data_4CBS
# 
_entry.id   4CBS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CBS         
PDBE  EBI-58751    
WWPDB D_1290058751 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4CBR 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'X-RAY STRUCTURE OF THE MORE STABLE HUMAN AGXT TRIPLE MUTANT (AGXT_HEM)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CBS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yunta, C.'  1 
'Albert, A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The Consensus-Based Approach for Gene/Enzyme Replacement Therapies and Crystallization Strategies: The Case of Human Alanine:Glyoxylate Aminotransferase.
;
_citation.journal_abbrev            Biochem.J. 
_citation.journal_volume            462 
_citation.page_first                453 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0264-6021 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24957194 
_citation.pdbx_database_id_DOI      10.1042/BJ20140250 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mesa-Torres, N.'      1 ? 
primary 'Yunta, C.'            2 ? 
primary 'Fabelo-Rosa, I.'      3 ? 
primary 'Gonzalez-Rubio, J.M.' 4 ? 
primary 'Sanchez-Ruiz, J.M.'   5 ? 
primary 'Salido, E.'           6 ? 
primary 'Albert, A.'           7 ? 
primary 'Pey, A.L.'            8 ? 
# 
_cell.entry_id           4CBS 
_cell.length_a           89.610 
_cell.length_b           89.610 
_cell.length_c           142.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CBS 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE--PYRUVATE AMINOTRANSFERASE' 43146.984 1  2.6.1.44 YES ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"            247.142   1  ?        ?   ? ? 
3 water       nat water                               18.015    82 ?        ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SPT, ALANINE--GLYOXYLATE AMINOTRANSFERASE, AGT, ALANINE GLYOXYLATE AMINOTRANSFERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASHKLLVTPPKALLKPLSIPNRLLLGPGPSNLPPRIMAAGGLQMIGHMSKEMYQIMDEIKEGIQYVFQTRNPLTLVISG
SGHCALEAALVNVLEPGDSFLVGANGIWGQRAADIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESST
GVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSF
YLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPT
VTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASHKLLVTPPKALLKPLSIPNRLLLGPGPSNLPPRIMAAGGLQMIGHMSKEMYQIMDEIKEGIQYVFQTRNPLTLVISG
SGHCALEAALVNVLEPGDSFLVGANGIWGQRAADIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESST
GVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSF
YLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPT
VTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   HIS n 
1 5   LYS n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   THR n 
1 10  PRO n 
1 11  PRO n 
1 12  LYS n 
1 13  ALA n 
1 14  LEU n 
1 15  LEU n 
1 16  LYS n 
1 17  PRO n 
1 18  LEU n 
1 19  SER n 
1 20  ILE n 
1 21  PRO n 
1 22  ASN n 
1 23  ARG n 
1 24  LEU n 
1 25  LEU n 
1 26  LEU n 
1 27  GLY n 
1 28  PRO n 
1 29  GLY n 
1 30  PRO n 
1 31  SER n 
1 32  ASN n 
1 33  LEU n 
1 34  PRO n 
1 35  PRO n 
1 36  ARG n 
1 37  ILE n 
1 38  MET n 
1 39  ALA n 
1 40  ALA n 
1 41  GLY n 
1 42  GLY n 
1 43  LEU n 
1 44  GLN n 
1 45  MET n 
1 46  ILE n 
1 47  GLY n 
1 48  HIS n 
1 49  MET n 
1 50  SER n 
1 51  LYS n 
1 52  GLU n 
1 53  MET n 
1 54  TYR n 
1 55  GLN n 
1 56  ILE n 
1 57  MET n 
1 58  ASP n 
1 59  GLU n 
1 60  ILE n 
1 61  LYS n 
1 62  GLU n 
1 63  GLY n 
1 64  ILE n 
1 65  GLN n 
1 66  TYR n 
1 67  VAL n 
1 68  PHE n 
1 69  GLN n 
1 70  THR n 
1 71  ARG n 
1 72  ASN n 
1 73  PRO n 
1 74  LEU n 
1 75  THR n 
1 76  LEU n 
1 77  VAL n 
1 78  ILE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLY n 
1 83  HIS n 
1 84  CYS n 
1 85  ALA n 
1 86  LEU n 
1 87  GLU n 
1 88  ALA n 
1 89  ALA n 
1 90  LEU n 
1 91  VAL n 
1 92  ASN n 
1 93  VAL n 
1 94  LEU n 
1 95  GLU n 
1 96  PRO n 
1 97  GLY n 
1 98  ASP n 
1 99  SER n 
1 100 PHE n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 ALA n 
1 105 ASN n 
1 106 GLY n 
1 107 ILE n 
1 108 TRP n 
1 109 GLY n 
1 110 GLN n 
1 111 ARG n 
1 112 ALA n 
1 113 ALA n 
1 114 ASP n 
1 115 ILE n 
1 116 GLY n 
1 117 GLU n 
1 118 ARG n 
1 119 ILE n 
1 120 GLY n 
1 121 ALA n 
1 122 ARG n 
1 123 VAL n 
1 124 HIS n 
1 125 PRO n 
1 126 MET n 
1 127 THR n 
1 128 LYS n 
1 129 ASP n 
1 130 PRO n 
1 131 GLY n 
1 132 GLY n 
1 133 HIS n 
1 134 TYR n 
1 135 THR n 
1 136 LEU n 
1 137 GLN n 
1 138 GLU n 
1 139 VAL n 
1 140 GLU n 
1 141 GLU n 
1 142 GLY n 
1 143 LEU n 
1 144 ALA n 
1 145 GLN n 
1 146 HIS n 
1 147 LYS n 
1 148 PRO n 
1 149 VAL n 
1 150 LEU n 
1 151 LEU n 
1 152 PHE n 
1 153 LEU n 
1 154 THR n 
1 155 HIS n 
1 156 GLY n 
1 157 GLU n 
1 158 SER n 
1 159 SER n 
1 160 THR n 
1 161 GLY n 
1 162 VAL n 
1 163 LEU n 
1 164 GLN n 
1 165 PRO n 
1 166 LEU n 
1 167 ASP n 
1 168 GLY n 
1 169 PHE n 
1 170 GLY n 
1 171 GLU n 
1 172 LEU n 
1 173 CYS n 
1 174 HIS n 
1 175 ARG n 
1 176 TYR n 
1 177 LYS n 
1 178 CYS n 
1 179 LEU n 
1 180 LEU n 
1 181 LEU n 
1 182 VAL n 
1 183 ASP n 
1 184 SER n 
1 185 VAL n 
1 186 ALA n 
1 187 SER n 
1 188 LEU n 
1 189 GLY n 
1 190 GLY n 
1 191 THR n 
1 192 PRO n 
1 193 LEU n 
1 194 TYR n 
1 195 MET n 
1 196 ASP n 
1 197 ARG n 
1 198 GLN n 
1 199 GLY n 
1 200 ILE n 
1 201 ASP n 
1 202 ILE n 
1 203 LEU n 
1 204 TYR n 
1 205 SER n 
1 206 GLY n 
1 207 SER n 
1 208 GLN n 
1 209 LYS n 
1 210 ALA n 
1 211 LEU n 
1 212 ASN n 
1 213 ALA n 
1 214 PRO n 
1 215 PRO n 
1 216 GLY n 
1 217 THR n 
1 218 SER n 
1 219 LEU n 
1 220 ILE n 
1 221 SER n 
1 222 PHE n 
1 223 SER n 
1 224 ASP n 
1 225 LYS n 
1 226 ALA n 
1 227 LYS n 
1 228 LYS n 
1 229 LYS n 
1 230 MET n 
1 231 TYR n 
1 232 SER n 
1 233 ARG n 
1 234 LYS n 
1 235 THR n 
1 236 LYS n 
1 237 PRO n 
1 238 PHE n 
1 239 SER n 
1 240 PHE n 
1 241 TYR n 
1 242 LEU n 
1 243 ASP n 
1 244 ILE n 
1 245 LYS n 
1 246 TRP n 
1 247 LEU n 
1 248 ALA n 
1 249 ASN n 
1 250 PHE n 
1 251 TRP n 
1 252 GLY n 
1 253 CYS n 
1 254 ASP n 
1 255 ASP n 
1 256 GLN n 
1 257 PRO n 
1 258 ARG n 
1 259 MET n 
1 260 TYR n 
1 261 HIS n 
1 262 HIS n 
1 263 THR n 
1 264 ILE n 
1 265 PRO n 
1 266 VAL n 
1 267 ILE n 
1 268 SER n 
1 269 LEU n 
1 270 TYR n 
1 271 SER n 
1 272 LEU n 
1 273 ARG n 
1 274 GLU n 
1 275 SER n 
1 276 LEU n 
1 277 ALA n 
1 278 LEU n 
1 279 ILE n 
1 280 ALA n 
1 281 GLU n 
1 282 GLN n 
1 283 GLY n 
1 284 LEU n 
1 285 GLU n 
1 286 ASN n 
1 287 SER n 
1 288 TRP n 
1 289 ARG n 
1 290 GLN n 
1 291 HIS n 
1 292 ARG n 
1 293 GLU n 
1 294 ALA n 
1 295 ALA n 
1 296 ALA n 
1 297 TYR n 
1 298 LEU n 
1 299 HIS n 
1 300 GLY n 
1 301 ARG n 
1 302 LEU n 
1 303 GLN n 
1 304 ALA n 
1 305 LEU n 
1 306 GLY n 
1 307 LEU n 
1 308 GLN n 
1 309 LEU n 
1 310 PHE n 
1 311 VAL n 
1 312 LYS n 
1 313 ASP n 
1 314 PRO n 
1 315 ALA n 
1 316 LEU n 
1 317 ARG n 
1 318 LEU n 
1 319 PRO n 
1 320 THR n 
1 321 VAL n 
1 322 THR n 
1 323 THR n 
1 324 VAL n 
1 325 ALA n 
1 326 VAL n 
1 327 PRO n 
1 328 ALA n 
1 329 GLY n 
1 330 TYR n 
1 331 ASP n 
1 332 TRP n 
1 333 ARG n 
1 334 ASP n 
1 335 ILE n 
1 336 VAL n 
1 337 SER n 
1 338 TYR n 
1 339 VAL n 
1 340 MET n 
1 341 ASP n 
1 342 HIS n 
1 343 PHE n 
1 344 ASP n 
1 345 ILE n 
1 346 GLU n 
1 347 ILE n 
1 348 MET n 
1 349 GLY n 
1 350 GLY n 
1 351 LEU n 
1 352 GLY n 
1 353 PRO n 
1 354 SER n 
1 355 THR n 
1 356 GLY n 
1 357 LYS n 
1 358 VAL n 
1 359 LEU n 
1 360 ARG n 
1 361 ILE n 
1 362 GLY n 
1 363 LEU n 
1 364 LEU n 
1 365 GLY n 
1 366 CYS n 
1 367 ASN n 
1 368 ALA n 
1 369 THR n 
1 370 ARG n 
1 371 GLU n 
1 372 ASN n 
1 373 VAL n 
1 374 ASP n 
1 375 ARG n 
1 376 VAL n 
1 377 THR n 
1 378 GLU n 
1 379 ALA n 
1 380 LEU n 
1 381 ARG n 
1 382 ALA n 
1 383 ALA n 
1 384 LEU n 
1 385 GLN n 
1 386 HIS n 
1 387 CYS n 
1 388 PRO n 
1 389 LYS n 
1 390 LYS n 
1 391 LYS n 
1 392 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              PLYSS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPYA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21549 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4CBS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 392 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P21549 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  392 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       392 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CBS ARG A 23  ? UNP P21549 GLN 23  'engineered mutation' 23  1 
1 4CBS HIS A 48  ? UNP P21549 SER 48  'engineered mutation' 48  2 
1 4CBS GLU A 52  ? UNP P21549 ASP 52  'engineered mutation' 52  3 
1 4CBS ALA A 113 ? UNP P21549 VAL 113 'engineered mutation' 113 4 
1 4CBS MET A 340 ? UNP P21549 ILE 340 'engineered mutation' 340 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CBS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.24 
_exptl_crystal.density_percent_sol   62.07 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 10K; 0.1 M HEPES PH 7.5, 2.5% V/V ISOPROPANOL AND 5% GLYCEROL AS ADDITIVE.' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.94 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.94 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CBS 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             55.74 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   26518 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.5 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.35 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    8.20 
_reflns_shell.pdbx_redundancy        14.5 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CBS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26451 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.50 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             55.741 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    99.93 
_refine.ls_R_factor_obs                          0.2226 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2207 
_refine.ls_R_factor_R_free                       0.2568 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  2552 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               57 
_refine.aniso_B[1][1]                            -0.0363 
_refine.aniso_B[2][2]                            -0.0363 
_refine.aniso_B[3][3]                            0.0726 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.337 
_refine.solvent_model_param_bsol                 35.089 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.11 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2YOB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.63 
_refine.pdbx_overall_phase_error                 27.93 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2975 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             82 
_refine_hist.number_atoms_total               3072 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        55.741 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 3062 'X-RAY DIFFRACTION' ? 
f_angle_d          1.208  ? ? 4155 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.499 ? ? 1139 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.078  ? ? 460  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 534  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.3000 2.3443  2594 0.3256 100.00 0.3448 . . 125 . . . . 
'X-RAY DIFFRACTION' . 2.3443 2.3921  2586 0.3143 100.00 0.3524 . . 135 . . . . 
'X-RAY DIFFRACTION' . 2.3921 2.4441  2621 0.2994 100.00 0.3479 . . 144 . . . . 
'X-RAY DIFFRACTION' . 2.4441 2.5010  2585 0.2955 100.00 0.3271 . . 120 . . . . 
'X-RAY DIFFRACTION' . 2.5010 2.5635  2623 0.2989 100.00 0.3442 . . 134 . . . . 
'X-RAY DIFFRACTION' . 2.5635 2.6329  2603 0.2938 100.00 0.3737 . . 127 . . . . 
'X-RAY DIFFRACTION' . 2.6329 2.7103  2579 0.2640 100.00 0.3021 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.7103 2.7978  2579 0.2658 100.00 0.3029 . . 163 . . . . 
'X-RAY DIFFRACTION' . 2.7978 2.8978  2591 0.2481 100.00 0.3518 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.8978 3.0138  2555 0.2611 100.00 0.2682 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.0138 3.1510  2585 0.2690 100.00 0.2973 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.1510 3.3171  2590 0.2460 100.00 0.3075 . . 172 . . . . 
'X-RAY DIFFRACTION' . 3.3171 3.5249  2581 0.2468 100.00 0.2643 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.5249 3.7970  2584 0.2144 100.00 0.2232 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.7970 4.1790  2580 0.1788 100.00 0.2268 . . 152 . . . . 
'X-RAY DIFFRACTION' . 4.1790 4.7834  2603 0.1599 100.00 0.1944 . . 138 . . . . 
'X-RAY DIFFRACTION' . 4.7834 6.0254  2600 0.1699 100.00 0.2073 . . 139 . . . . 
'X-RAY DIFFRACTION' . 6.0254 55.7572 2574 0.1722 99.00  0.1749 . . 124 . . . . 
# 
_struct.entry_id                  4CBS 
_struct.title                     'X-ray structure of quintuple mutant of human alanine glyoxylate aminotransferase, AGXT_RHEAM' 
_struct.pdbx_descriptor           'SERINE--PYRUVATE AMINOTRANSFERASE (E.C.2.6.1.44)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CBS 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, PRIMARY HIPEROXALURIA TYPE I, PROTEIN STABILIZATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 11  ? LYS A 16  ? PRO A 11  LYS A 16  5 ? 6  
HELX_P HELX_P2  2  PRO A 34  ? GLY A 42  ? PRO A 34  GLY A 42  1 ? 9  
HELX_P HELX_P3  3  SER A 50  ? GLN A 69  ? SER A 50  GLN A 69  1 ? 20 
HELX_P HELX_P4  4  SER A 81  ? LEU A 94  ? SER A 81  LEU A 94  1 ? 14 
HELX_P HELX_P5  5  GLY A 106 ? ILE A 119 ? GLY A 106 ILE A 119 1 ? 14 
HELX_P HELX_P6  6  THR A 135 ? LYS A 147 ? THR A 135 LYS A 147 1 ? 13 
HELX_P HELX_P7  7  GLY A 168 ? ARG A 175 ? GLY A 168 ARG A 175 1 ? 8  
HELX_P HELX_P8  8  TYR A 176 ? CYS A 178 ? TYR A 176 CYS A 178 5 ? 3  
HELX_P HELX_P9  9  SER A 223 ? SER A 232 ? SER A 223 SER A 232 1 ? 10 
HELX_P HELX_P10 10 ASP A 243 ? TRP A 251 ? ASP A 243 TRP A 251 1 ? 9  
HELX_P HELX_P11 11 PRO A 265 ? GLY A 283 ? PRO A 265 GLY A 283 1 ? 19 
HELX_P HELX_P12 12 GLY A 283 ? LEU A 305 ? GLY A 283 LEU A 305 1 ? 23 
HELX_P HELX_P13 13 ASP A 313 ? LEU A 316 ? ASP A 313 LEU A 316 5 ? 4  
HELX_P HELX_P14 14 ASP A 331 ? ASP A 344 ? ASP A 331 ASP A 344 1 ? 14 
HELX_P HELX_P15 15 LEU A 351 ? THR A 355 ? LEU A 351 THR A 355 5 ? 5  
HELX_P HELX_P16 16 LEU A 364 ? ALA A 368 ? LEU A 364 ALA A 368 5 ? 5  
HELX_P HELX_P17 17 THR A 369 ? CYS A 387 ? THR A 369 CYS A 387 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           LYS 
_struct_conn.ptnr1_label_seq_id            209 
_struct_conn.ptnr1_label_atom_id           NZ 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           PLP 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C4A 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            LYS 
_struct_conn.ptnr1_auth_seq_id             209 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            PLP 
_struct_conn.ptnr2_auth_seq_id             1389 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.386 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           29 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            29 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    30 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     30 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 7 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AB 4 5 ? parallel      
AB 5 6 ? parallel      
AB 6 7 ? parallel      
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 24  ? LEU A 25  ? LEU A 24  LEU A 25  
AA 2 ILE A 345 ? GLU A 346 ? ILE A 345 GLU A 346 
AB 1 LEU A 74  ? ILE A 78  ? LEU A 74  ILE A 78  
AB 2 SER A 218 ? PHE A 222 ? SER A 218 PHE A 222 
AB 3 ILE A 202 ? GLY A 206 ? ILE A 202 GLY A 206 
AB 4 LEU A 179 ? ASP A 183 ? LEU A 179 ASP A 183 
AB 5 LEU A 150 ? THR A 154 ? LEU A 150 THR A 154 
AB 6 SER A 99  ? ALA A 104 ? SER A 99  ALA A 104 
AB 7 ARG A 122 ? THR A 127 ? ARG A 122 THR A 127 
AC 1 VAL A 321 ? ALA A 325 ? VAL A 321 ALA A 325 
AC 2 VAL A 358 ? GLY A 362 ? VAL A 358 GLY A 362 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O LEU A 24  ? O LEU A 24  N GLU A 346 ? N GLU A 346 
AB 1 2 N ILE A 78  ? N ILE A 78  O SER A 218 ? O SER A 218 
AB 2 3 N SER A 221 ? N SER A 221 O LEU A 203 ? O LEU A 203 
AB 3 4 N ILE A 202 ? N ILE A 202 O LEU A 180 ? O LEU A 180 
AB 4 5 N LEU A 181 ? N LEU A 181 O LEU A 151 ? O LEU A 151 
AB 5 6 N PHE A 152 ? N PHE A 152 O LEU A 101 ? O LEU A 101 
AB 6 7 N PHE A 100 ? N PHE A 100 O ARG A 122 ? O ARG A 122 
AC 1 2 N VAL A 324 ? N VAL A 324 O LEU A 359 ? O LEU A 359 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    14 
_struct_site.details              'BINDING SITE FOR RESIDUE PLP A 1389' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 SER A 81  ? SER A 81  . ? 1_555 ? 
2  AC1 14 GLY A 82  ? GLY A 82  . ? 1_555 ? 
3  AC1 14 HIS A 83  ? HIS A 83  . ? 1_555 ? 
4  AC1 14 TRP A 108 ? TRP A 108 . ? 1_555 ? 
5  AC1 14 GLY A 156 ? GLY A 156 . ? 1_555 ? 
6  AC1 14 SER A 158 ? SER A 158 . ? 1_555 ? 
7  AC1 14 ASP A 183 ? ASP A 183 . ? 1_555 ? 
8  AC1 14 VAL A 185 ? VAL A 185 . ? 1_555 ? 
9  AC1 14 ALA A 186 ? ALA A 186 . ? 1_555 ? 
10 AC1 14 GLN A 208 ? GLN A 208 . ? 1_555 ? 
11 AC1 14 LYS A 209 ? LYS A 209 . ? 1_555 ? 
12 AC1 14 TYR A 260 ? TYR A 260 . ? 8_554 ? 
13 AC1 14 HIS A 262 ? HIS A 262 . ? 8_554 ? 
14 AC1 14 THR A 263 ? THR A 263 . ? 8_554 ? 
# 
_database_PDB_matrix.entry_id          4CBS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CBS 
_atom_sites.fract_transf_matrix[1][1]   0.011159 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011159 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007023 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 4   ? -25.968 3.856   -67.723 1.00 117.70 ? 4    HIS A N   1 
ATOM   2    C CA  . HIS A 1 4   ? -26.728 4.830   -66.948 1.00 124.28 ? 4    HIS A CA  1 
ATOM   3    C C   . HIS A 1 4   ? -28.039 4.248   -66.414 1.00 123.80 ? 4    HIS A C   1 
ATOM   4    O O   . HIS A 1 4   ? -29.098 4.434   -67.018 1.00 134.55 ? 4    HIS A O   1 
ATOM   5    C CB  . HIS A 1 4   ? -27.006 6.092   -67.781 1.00 133.09 ? 4    HIS A CB  1 
ATOM   6    C CG  . HIS A 1 4   ? -26.058 7.227   -67.514 1.00 143.51 ? 4    HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 4   ? -25.408 7.906   -68.522 1.00 141.22 ? 4    HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 4   ? -25.677 7.820   -66.355 1.00 140.59 ? 4    HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 4   ? -24.653 8.857   -67.996 1.00 139.08 ? 4    HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 4   ? -24.799 8.827   -66.684 1.00 137.85 ? 4    HIS A NE2 1 
ATOM   11   N N   . LYS A 1 5   ? -27.956 3.534   -65.291 1.00 110.64 ? 5    LYS A N   1 
ATOM   12   C CA  . LYS A 1 5   ? -29.139 3.114   -64.531 1.00 90.62  ? 5    LYS A CA  1 
ATOM   13   C C   . LYS A 1 5   ? -28.791 2.751   -63.094 1.00 93.77  ? 5    LYS A C   1 
ATOM   14   O O   . LYS A 1 5   ? -27.811 2.047   -62.834 1.00 93.91  ? 5    LYS A O   1 
ATOM   15   C CB  . LYS A 1 5   ? -29.889 1.971   -65.209 1.00 76.81  ? 5    LYS A CB  1 
ATOM   16   C CG  . LYS A 1 5   ? -31.160 2.438   -65.893 1.00 78.03  ? 5    LYS A CG  1 
ATOM   17   C CD  . LYS A 1 5   ? -31.831 3.558   -65.103 1.00 74.75  ? 5    LYS A CD  1 
ATOM   18   C CE  . LYS A 1 5   ? -32.926 3.034   -64.183 1.00 70.75  ? 5    LYS A CE  1 
ATOM   19   N NZ  . LYS A 1 5   ? -32.466 1.936   -63.286 1.00 69.62  ? 5    LYS A NZ  1 
ATOM   20   N N   . LEU A 1 6   ? -29.613 3.226   -62.164 1.00 89.93  ? 6    LEU A N   1 
ATOM   21   C CA  . LEU A 1 6   ? -29.223 3.252   -60.760 1.00 77.49  ? 6    LEU A CA  1 
ATOM   22   C C   . LEU A 1 6   ? -29.733 2.094   -59.914 1.00 68.31  ? 6    LEU A C   1 
ATOM   23   O O   . LEU A 1 6   ? -30.937 1.865   -59.823 1.00 73.30  ? 6    LEU A O   1 
ATOM   24   C CB  . LEU A 1 6   ? -29.639 4.584   -60.126 1.00 76.10  ? 6    LEU A CB  1 
ATOM   25   C CG  . LEU A 1 6   ? -29.053 5.857   -60.749 1.00 67.97  ? 6    LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 6   ? -29.259 7.026   -59.803 1.00 79.78  ? 6    LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 6   ? -27.575 5.714   -61.121 1.00 51.57  ? 6    LEU A CD2 1 
ATOM   28   N N   . LEU A 1 7   ? -28.810 1.379   -59.277 1.00 69.85  ? 7    LEU A N   1 
ATOM   29   C CA  . LEU A 1 7   ? -29.192 0.347   -58.322 1.00 67.94  ? 7    LEU A CA  1 
ATOM   30   C C   . LEU A 1 7   ? -30.057 0.948   -57.219 1.00 81.05  ? 7    LEU A C   1 
ATOM   31   O O   . LEU A 1 7   ? -31.168 0.483   -56.962 1.00 77.11  ? 7    LEU A O   1 
ATOM   32   C CB  . LEU A 1 7   ? -27.950 -0.297  -57.704 1.00 81.80  ? 7    LEU A CB  1 
ATOM   33   C CG  . LEU A 1 7   ? -26.931 -0.939  -58.645 1.00 85.43  ? 7    LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 7   ? -25.640 -0.119  -58.678 1.00 88.70  ? 7    LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 7   ? -26.667 -2.384  -58.226 1.00 86.37  ? 7    LEU A CD2 1 
ATOM   36   N N   . VAL A 1 8   ? -29.544 2.002   -56.585 1.00 86.43  ? 8    VAL A N   1 
ATOM   37   C CA  . VAL A 1 8   ? -30.205 2.603   -55.426 1.00 75.07  ? 8    VAL A CA  1 
ATOM   38   C C   . VAL A 1 8   ? -30.967 3.876   -55.774 1.00 63.03  ? 8    VAL A C   1 
ATOM   39   O O   . VAL A 1 8   ? -30.455 4.758   -56.455 1.00 56.14  ? 8    VAL A O   1 
ATOM   40   C CB  . VAL A 1 8   ? -29.198 2.925   -54.284 1.00 57.44  ? 8    VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 8   ? -29.941 3.316   -53.010 1.00 58.26  ? 8    VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 8   ? -28.279 1.739   -54.021 1.00 58.15  ? 8    VAL A CG2 1 
ATOM   43   N N   . THR A 1 9   ? -32.194 3.962   -55.281 1.00 51.04  ? 9    THR A N   1 
ATOM   44   C CA  . THR A 1 9   ? -33.003 5.147   -55.429 1.00 61.84  ? 9    THR A CA  1 
ATOM   45   C C   . THR A 1 9   ? -32.950 5.971   -54.149 1.00 77.71  ? 9    THR A C   1 
ATOM   46   O O   . THR A 1 9   ? -32.732 5.422   -53.069 1.00 88.15  ? 9    THR A O   1 
ATOM   47   C CB  . THR A 1 9   ? -34.427 4.743   -55.626 1.00 62.98  ? 9    THR A CB  1 
ATOM   48   O OG1 . THR A 1 9   ? -34.909 4.149   -54.407 1.00 63.93  ? 9    THR A OG1 1 
ATOM   49   C CG2 . THR A 1 9   ? -34.504 3.756   -56.791 1.00 57.48  ? 9    THR A CG2 1 
ATOM   50   N N   . PRO A 1 10  ? -33.150 7.292   -54.267 1.00 70.32  ? 10   PRO A N   1 
ATOM   51   C CA  . PRO A 1 10  ? -33.216 8.203   -53.123 1.00 67.59  ? 10   PRO A CA  1 
ATOM   52   C C   . PRO A 1 10  ? -34.063 7.663   -51.980 1.00 57.59  ? 10   PRO A C   1 
ATOM   53   O O   . PRO A 1 10  ? -35.234 7.355   -52.169 1.00 55.35  ? 10   PRO A O   1 
ATOM   54   C CB  . PRO A 1 10  ? -33.879 9.445   -53.718 1.00 63.67  ? 10   PRO A CB  1 
ATOM   55   C CG  . PRO A 1 10  ? -33.371 9.471   -55.109 1.00 69.27  ? 10   PRO A CG  1 
ATOM   56   C CD  . PRO A 1 10  ? -33.214 8.027   -55.543 1.00 66.82  ? 10   PRO A CD  1 
ATOM   57   N N   . PRO A 1 11  ? -33.452 7.547   -50.796 1.00 51.54  ? 11   PRO A N   1 
ATOM   58   C CA  . PRO A 1 11  ? -34.071 7.005   -49.587 1.00 52.18  ? 11   PRO A CA  1 
ATOM   59   C C   . PRO A 1 11  ? -35.222 7.867   -49.081 1.00 49.85  ? 11   PRO A C   1 
ATOM   60   O O   . PRO A 1 11  ? -35.048 9.038   -48.743 1.00 52.42  ? 11   PRO A O   1 
ATOM   61   C CB  . PRO A 1 11  ? -32.907 6.984   -48.588 1.00 48.34  ? 11   PRO A CB  1 
ATOM   62   C CG  . PRO A 1 11  ? -31.680 6.875   -49.456 1.00 46.93  ? 11   PRO A CG  1 
ATOM   63   C CD  . PRO A 1 11  ? -32.002 7.751   -50.628 1.00 43.92  ? 11   PRO A CD  1 
ATOM   64   N N   . LYS A 1 12  ? -36.401 7.268   -49.014 1.00 46.39  ? 12   LYS A N   1 
ATOM   65   C CA  . LYS A 1 12  ? -37.600 8.011   -48.669 1.00 56.04  ? 12   LYS A CA  1 
ATOM   66   C C   . LYS A 1 12  ? -37.471 8.701   -47.306 1.00 58.80  ? 12   LYS A C   1 
ATOM   67   O O   . LYS A 1 12  ? -38.053 9.765   -47.082 1.00 52.58  ? 12   LYS A O   1 
ATOM   68   C CB  . LYS A 1 12  ? -38.834 7.102   -48.752 1.00 66.02  ? 12   LYS A CB  1 
ATOM   69   C CG  . LYS A 1 12  ? -39.576 6.893   -47.447 1.00 72.31  ? 12   LYS A CG  1 
ATOM   70   C CD  . LYS A 1 12  ? -40.984 7.461   -47.522 1.00 80.19  ? 12   LYS A CD  1 
ATOM   71   C CE  . LYS A 1 12  ? -41.955 6.665   -46.641 1.00 85.75  ? 12   LYS A CE  1 
ATOM   72   N NZ  . LYS A 1 12  ? -42.514 5.430   -47.270 1.00 84.09  ? 12   LYS A NZ  1 
ATOM   73   N N   . ALA A 1 13  ? -36.672 8.114   -46.419 1.00 56.66  ? 13   ALA A N   1 
ATOM   74   C CA  . ALA A 1 13  ? -36.453 8.677   -45.086 1.00 43.16  ? 13   ALA A CA  1 
ATOM   75   C C   . ALA A 1 13  ? -35.765 10.046  -45.150 1.00 36.28  ? 13   ALA A C   1 
ATOM   76   O O   . ALA A 1 13  ? -36.154 10.966  -44.431 1.00 35.42  ? 13   ALA A O   1 
ATOM   77   C CB  . ALA A 1 13  ? -35.656 7.714   -44.232 1.00 45.16  ? 13   ALA A CB  1 
ATOM   78   N N   . LEU A 1 14  ? -34.763 10.164  -46.021 1.00 32.02  ? 14   LEU A N   1 
ATOM   79   C CA  . LEU A 1 14  ? -34.051 11.417  -46.234 1.00 28.79  ? 14   LEU A CA  1 
ATOM   80   C C   . LEU A 1 14  ? -34.947 12.520  -46.765 1.00 38.36  ? 14   LEU A C   1 
ATOM   81   O O   . LEU A 1 14  ? -34.623 13.686  -46.612 1.00 48.71  ? 14   LEU A O   1 
ATOM   82   C CB  . LEU A 1 14  ? -32.837 11.247  -47.169 1.00 22.04  ? 14   LEU A CB  1 
ATOM   83   C CG  . LEU A 1 14  ? -31.697 10.464  -46.517 1.00 41.08  ? 14   LEU A CG  1 
ATOM   84   C CD1 . LEU A 1 14  ? -30.428 10.500  -47.333 1.00 35.88  ? 14   LEU A CD1 1 
ATOM   85   C CD2 . LEU A 1 14  ? -31.459 11.033  -45.128 1.00 40.37  ? 14   LEU A CD2 1 
ATOM   86   N N   . LEU A 1 15  ? -36.073 12.158  -47.373 1.00 42.42  ? 15   LEU A N   1 
ATOM   87   C CA  . LEU A 1 15  ? -36.959 13.163  -47.959 1.00 40.98  ? 15   LEU A CA  1 
ATOM   88   C C   . LEU A 1 15  ? -37.838 13.824  -46.910 1.00 43.22  ? 15   LEU A C   1 
ATOM   89   O O   . LEU A 1 15  ? -38.487 14.842  -47.169 1.00 45.59  ? 15   LEU A O   1 
ATOM   90   C CB  . LEU A 1 15  ? -37.804 12.559  -49.083 1.00 41.12  ? 15   LEU A CB  1 
ATOM   91   C CG  . LEU A 1 15  ? -36.984 11.915  -50.203 1.00 44.05  ? 15   LEU A CG  1 
ATOM   92   C CD1 . LEU A 1 15  ? -37.896 11.380  -51.316 1.00 51.66  ? 15   LEU A CD1 1 
ATOM   93   C CD2 . LEU A 1 15  ? -35.939 12.873  -50.764 1.00 29.83  ? 15   LEU A CD2 1 
ATOM   94   N N   . LYS A 1 16  ? -37.865 13.248  -45.720 1.00 43.56  ? 16   LYS A N   1 
ATOM   95   C CA  . LYS A 1 16  ? -38.526 13.925  -44.620 1.00 52.50  ? 16   LYS A CA  1 
ATOM   96   C C   . LYS A 1 16  ? -37.559 14.929  -44.011 1.00 50.49  ? 16   LYS A C   1 
ATOM   97   O O   . LYS A 1 16  ? -36.344 14.828  -44.208 1.00 47.68  ? 16   LYS A O   1 
ATOM   98   C CB  . LYS A 1 16  ? -39.018 12.925  -43.578 1.00 67.94  ? 16   LYS A CB  1 
ATOM   99   C CG  . LYS A 1 16  ? -40.462 12.505  -43.785 1.00 74.88  ? 16   LYS A CG  1 
ATOM   100  C CD  . LYS A 1 16  ? -40.622 11.667  -45.033 1.00 83.74  ? 16   LYS A CD  1 
ATOM   101  C CE  . LYS A 1 16  ? -40.125 10.262  -44.796 1.00 88.62  ? 16   LYS A CE  1 
ATOM   102  N NZ  . LYS A 1 16  ? -41.231 9.287   -44.967 1.00 88.18  ? 16   LYS A NZ  1 
ATOM   103  N N   . PRO A 1 17  ? -38.096 15.936  -43.307 1.00 53.96  ? 17   PRO A N   1 
ATOM   104  C CA  . PRO A 1 17  ? -37.255 16.902  -42.589 1.00 47.72  ? 17   PRO A CA  1 
ATOM   105  C C   . PRO A 1 17  ? -36.626 16.289  -41.342 1.00 50.49  ? 17   PRO A C   1 
ATOM   106  O O   . PRO A 1 17  ? -37.228 15.417  -40.723 1.00 46.36  ? 17   PRO A O   1 
ATOM   107  C CB  . PRO A 1 17  ? -38.245 17.986  -42.154 1.00 41.41  ? 17   PRO A CB  1 
ATOM   108  C CG  . PRO A 1 17  ? -39.459 17.775  -42.979 1.00 55.82  ? 17   PRO A CG  1 
ATOM   109  C CD  . PRO A 1 17  ? -39.520 16.302  -43.244 1.00 48.39  ? 17   PRO A CD  1 
ATOM   110  N N   . LEU A 1 18  ? -35.441 16.769  -40.973 1.00 51.08  ? 18   LEU A N   1 
ATOM   111  C CA  . LEU A 1 18  ? -34.778 16.367  -39.741 1.00 41.68  ? 18   LEU A CA  1 
ATOM   112  C C   . LEU A 1 18  ? -35.598 16.791  -38.522 1.00 45.29  ? 18   LEU A C   1 
ATOM   113  O O   . LEU A 1 18  ? -35.915 17.962  -38.360 1.00 39.47  ? 18   LEU A O   1 
ATOM   114  C CB  . LEU A 1 18  ? -33.413 17.032  -39.680 1.00 45.57  ? 18   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 18  ? -32.219 16.284  -39.080 1.00 53.92  ? 18   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 18  ? -31.266 17.308  -38.510 1.00 36.56  ? 18   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 18  ? -32.602 15.236  -38.031 1.00 48.51  ? 18   LEU A CD2 1 
ATOM   118  N N   . SER A 1 19  ? -35.944 15.833  -37.674 1.00 47.68  ? 19   SER A N   1 
ATOM   119  C CA  . SER A 1 19  ? -36.647 16.128  -36.435 1.00 54.02  ? 19   SER A CA  1 
ATOM   120  C C   . SER A 1 19  ? -35.895 15.514  -35.255 1.00 37.88  ? 19   SER A C   1 
ATOM   121  O O   . SER A 1 19  ? -35.525 14.337  -35.285 1.00 51.81  ? 19   SER A O   1 
ATOM   122  C CB  . SER A 1 19  ? -38.082 15.580  -36.470 1.00 64.71  ? 19   SER A CB  1 
ATOM   123  O OG  . SER A 1 19  ? -38.214 14.397  -35.687 1.00 80.47  ? 19   SER A OG  1 
ATOM   124  N N   . ILE A 1 20  ? -35.683 16.306  -34.209 1.00 34.74  ? 20   ILE A N   1 
ATOM   125  C CA  . ILE A 1 20  ? -35.064 15.785  -32.994 1.00 48.94  ? 20   ILE A CA  1 
ATOM   126  C C   . ILE A 1 20  ? -35.879 16.161  -31.775 1.00 50.27  ? 20   ILE A C   1 
ATOM   127  O O   . ILE A 1 20  ? -36.244 17.322  -31.602 1.00 48.01  ? 20   ILE A O   1 
ATOM   128  C CB  . ILE A 1 20  ? -33.570 16.227  -32.822 1.00 55.05  ? 20   ILE A CB  1 
ATOM   129  C CG1 . ILE A 1 20  ? -33.447 17.738  -32.671 1.00 47.60  ? 20   ILE A CG1 1 
ATOM   130  C CG2 . ILE A 1 20  ? -32.699 15.729  -33.990 1.00 33.56  ? 20   ILE A CG2 1 
ATOM   131  C CD1 . ILE A 1 20  ? -32.272 18.140  -31.847 1.00 61.07  ? 20   ILE A CD1 1 
ATOM   132  N N   . PRO A 1 21  ? -36.177 15.167  -30.926 1.00 49.54  ? 21   PRO A N   1 
ATOM   133  C CA  . PRO A 1 21  ? -36.916 15.374  -29.677 1.00 52.54  ? 21   PRO A CA  1 
ATOM   134  C C   . PRO A 1 21  ? -36.113 16.213  -28.681 1.00 53.01  ? 21   PRO A C   1 
ATOM   135  O O   . PRO A 1 21  ? -34.915 16.371  -28.868 1.00 50.42  ? 21   PRO A O   1 
ATOM   136  C CB  . PRO A 1 21  ? -37.088 13.948  -29.139 1.00 41.01  ? 21   PRO A CB  1 
ATOM   137  C CG  . PRO A 1 21  ? -35.917 13.222  -29.671 1.00 45.02  ? 21   PRO A CG  1 
ATOM   138  C CD  . PRO A 1 21  ? -35.697 13.784  -31.050 1.00 41.43  ? 21   PRO A CD  1 
ATOM   139  N N   . ASN A 1 22  ? -36.782 16.750  -27.663 1.00 51.79  ? 22   ASN A N   1 
ATOM   140  C CA  . ASN A 1 22  ? -36.124 17.473  -26.582 1.00 60.04  ? 22   ASN A CA  1 
ATOM   141  C C   . ASN A 1 22  ? -35.789 16.536  -25.448 1.00 49.36  ? 22   ASN A C   1 
ATOM   142  O O   . ASN A 1 22  ? -36.653 15.813  -24.950 1.00 43.46  ? 22   ASN A O   1 
ATOM   143  C CB  . ASN A 1 22  ? -37.005 18.601  -26.046 1.00 76.55  ? 22   ASN A CB  1 
ATOM   144  C CG  . ASN A 1 22  ? -36.882 19.864  -26.862 1.00 94.71  ? 22   ASN A CG  1 
ATOM   145  O OD1 . ASN A 1 22  ? -36.542 19.825  -28.050 1.00 103.76 ? 22   ASN A OD1 1 
ATOM   146  N ND2 . ASN A 1 22  ? -37.153 21.000  -26.231 1.00 97.61  ? 22   ASN A ND2 1 
ATOM   147  N N   . ARG A 1 23  ? -34.525 16.510  -25.053 1.00 39.64  ? 23   ARG A N   1 
ATOM   148  C CA  . ARG A 1 23  ? -34.182 15.700  -23.902 1.00 41.86  ? 23   ARG A CA  1 
ATOM   149  C C   . ARG A 1 23  ? -33.264 16.415  -22.926 1.00 49.14  ? 23   ARG A C   1 
ATOM   150  O O   . ARG A 1 23  ? -32.422 17.223  -23.312 1.00 47.26  ? 23   ARG A O   1 
ATOM   151  C CB  . ARG A 1 23  ? -33.567 14.367  -24.309 1.00 35.15  ? 23   ARG A CB  1 
ATOM   152  C CG  . ARG A 1 23  ? -33.782 13.988  -25.733 1.00 43.59  ? 23   ARG A CG  1 
ATOM   153  C CD  . ARG A 1 23  ? -34.637 12.762  -25.834 1.00 57.94  ? 23   ARG A CD  1 
ATOM   154  N NE  . ARG A 1 23  ? -36.019 13.079  -25.536 1.00 82.17  ? 23   ARG A NE  1 
ATOM   155  C CZ  . ARG A 1 23  ? -37.036 12.364  -25.984 1.00 89.50  ? 23   ARG A CZ  1 
ATOM   156  N NH1 . ARG A 1 23  ? -36.792 11.306  -26.750 1.00 79.54  ? 23   ARG A NH1 1 
ATOM   157  N NH2 . ARG A 1 23  ? -38.281 12.706  -25.664 1.00 101.45 ? 23   ARG A NH2 1 
ATOM   158  N N   . LEU A 1 24  ? -33.451 16.093  -21.654 1.00 49.89  ? 24   LEU A N   1 
ATOM   159  C CA  . LEU A 1 24  ? -32.574 16.544  -20.604 1.00 42.75  ? 24   LEU A CA  1 
ATOM   160  C C   . LEU A 1 24  ? -31.585 15.422  -20.365 1.00 46.81  ? 24   LEU A C   1 
ATOM   161  O O   . LEU A 1 24  ? -31.939 14.387  -19.815 1.00 48.37  ? 24   LEU A O   1 
ATOM   162  C CB  . LEU A 1 24  ? -33.378 16.841  -19.348 1.00 40.10  ? 24   LEU A CB  1 
ATOM   163  C CG  . LEU A 1 24  ? -32.648 17.494  -18.172 1.00 54.01  ? 24   LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 24  ? -31.898 18.772  -18.553 1.00 48.52  ? 24   LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 24  ? -33.636 17.783  -17.058 1.00 59.12  ? 24   LEU A CD2 1 
ATOM   166  N N   . LEU A 1 25  ? -30.350 15.619  -20.814 1.00 42.11  ? 25   LEU A N   1 
ATOM   167  C CA  . LEU A 1 25  ? -29.324 14.584  -20.721 1.00 45.65  ? 25   LEU A CA  1 
ATOM   168  C C   . LEU A 1 25  ? -28.588 14.702  -19.398 1.00 44.39  ? 25   LEU A C   1 
ATOM   169  O O   . LEU A 1 25  ? -27.797 15.632  -19.192 1.00 45.31  ? 25   LEU A O   1 
ATOM   170  C CB  . LEU A 1 25  ? -28.352 14.683  -21.903 1.00 44.34  ? 25   LEU A CB  1 
ATOM   171  C CG  . LEU A 1 25  ? -29.083 14.690  -23.240 1.00 46.20  ? 25   LEU A CG  1 
ATOM   172  C CD1 . LEU A 1 25  ? -28.189 15.118  -24.384 1.00 41.47  ? 25   LEU A CD1 1 
ATOM   173  C CD2 . LEU A 1 25  ? -29.657 13.320  -23.530 1.00 45.33  ? 25   LEU A CD2 1 
ATOM   174  N N   . LEU A 1 26  ? -28.891 13.777  -18.491 1.00 47.27  ? 26   LEU A N   1 
ATOM   175  C CA  . LEU A 1 26  ? -28.300 13.777  -17.163 1.00 38.84  ? 26   LEU A CA  1 
ATOM   176  C C   . LEU A 1 26  ? -27.636 12.433  -16.903 1.00 44.36  ? 26   LEU A C   1 
ATOM   177  O O   . LEU A 1 26  ? -27.533 11.983  -15.760 1.00 46.51  ? 26   LEU A O   1 
ATOM   178  C CB  . LEU A 1 26  ? -29.346 14.069  -16.097 1.00 49.67  ? 26   LEU A CB  1 
ATOM   179  C CG  . LEU A 1 26  ? -30.044 15.416  -16.203 1.00 52.00  ? 26   LEU A CG  1 
ATOM   180  C CD1 . LEU A 1 26  ? -31.101 15.515  -15.102 1.00 50.28  ? 26   LEU A CD1 1 
ATOM   181  C CD2 . LEU A 1 26  ? -29.047 16.569  -16.124 1.00 33.35  ? 26   LEU A CD2 1 
ATOM   182  N N   . GLY A 1 27  ? -27.194 11.792  -17.981 1.00 35.42  ? 27   GLY A N   1 
ATOM   183  C CA  . GLY A 1 27  ? -26.275 10.674  -17.878 1.00 44.70  ? 27   GLY A CA  1 
ATOM   184  C C   . GLY A 1 27  ? -24.854 11.200  -17.775 1.00 40.08  ? 27   GLY A C   1 
ATOM   185  O O   . GLY A 1 27  ? -24.655 12.389  -17.550 1.00 45.99  ? 27   GLY A O   1 
ATOM   186  N N   . PRO A 1 28  ? -23.860 10.316  -17.954 1.00 47.75  ? 28   PRO A N   1 
ATOM   187  C CA  . PRO A 1 28  ? -22.414 10.583  -17.883 1.00 50.99  ? 28   PRO A CA  1 
ATOM   188  C C   . PRO A 1 28  ? -21.863 11.351  -19.076 1.00 55.53  ? 28   PRO A C   1 
ATOM   189  O O   . PRO A 1 28  ? -20.649 11.495  -19.195 1.00 63.21  ? 28   PRO A O   1 
ATOM   190  C CB  . PRO A 1 28  ? -21.798 9.177   -17.874 1.00 42.82  ? 28   PRO A CB  1 
ATOM   191  C CG  . PRO A 1 28  ? -22.832 8.306   -18.513 1.00 46.67  ? 28   PRO A CG  1 
ATOM   192  C CD  . PRO A 1 28  ? -24.151 8.883   -18.120 1.00 47.33  ? 28   PRO A CD  1 
ATOM   193  N N   . GLY A 1 29  ? -22.735 11.830  -19.950 1.00 56.47  ? 29   GLY A N   1 
ATOM   194  C CA  . GLY A 1 29  ? -22.285 12.480  -21.160 1.00 41.82  ? 29   GLY A CA  1 
ATOM   195  C C   . GLY A 1 29  ? -22.677 11.728  -22.415 1.00 51.57  ? 29   GLY A C   1 
ATOM   196  O O   . GLY A 1 29  ? -22.951 10.526  -22.377 1.00 61.15  ? 29   GLY A O   1 
ATOM   197  N N   . PRO A 1 30  ? -22.738 12.445  -23.543 1.00 50.97  ? 30   PRO A N   1 
ATOM   198  C CA  . PRO A 1 30  ? -22.609 13.902  -23.664 1.00 51.97  ? 30   PRO A CA  1 
ATOM   199  C C   . PRO A 1 30  ? -23.690 14.675  -22.905 1.00 45.81  ? 30   PRO A C   1 
ATOM   200  O O   . PRO A 1 30  ? -24.707 14.103  -22.491 1.00 41.24  ? 30   PRO A O   1 
ATOM   201  C CB  . PRO A 1 30  ? -22.754 14.136  -25.170 1.00 52.71  ? 30   PRO A CB  1 
ATOM   202  C CG  . PRO A 1 30  ? -23.393 12.898  -25.675 1.00 59.77  ? 30   PRO A CG  1 
ATOM   203  C CD  . PRO A 1 30  ? -22.815 11.813  -24.859 1.00 50.12  ? 30   PRO A CD  1 
ATOM   204  N N   . SER A 1 31  ? -23.436 15.958  -22.687 1.00 37.02  ? 31   SER A N   1 
ATOM   205  C CA  . SER A 1 31  ? -24.357 16.806  -21.951 1.00 43.03  ? 31   SER A CA  1 
ATOM   206  C C   . SER A 1 31  ? -25.090 17.709  -22.923 1.00 37.35  ? 31   SER A C   1 
ATOM   207  O O   . SER A 1 31  ? -24.756 17.759  -24.110 1.00 32.04  ? 31   SER A O   1 
ATOM   208  C CB  . SER A 1 31  ? -23.588 17.658  -20.942 1.00 41.42  ? 31   SER A CB  1 
ATOM   209  O OG  . SER A 1 31  ? -22.419 18.186  -21.545 1.00 46.82  ? 31   SER A OG  1 
ATOM   210  N N   . ASN A 1 32  ? -26.086 18.420  -22.415 1.00 34.12  ? 32   ASN A N   1 
ATOM   211  C CA  . ASN A 1 32  ? -26.795 19.412  -23.208 1.00 42.79  ? 32   ASN A CA  1 
ATOM   212  C C   . ASN A 1 32  ? -25.947 20.634  -23.514 1.00 37.87  ? 32   ASN A C   1 
ATOM   213  O O   . ASN A 1 32  ? -25.127 21.037  -22.696 1.00 36.91  ? 32   ASN A O   1 
ATOM   214  C CB  . ASN A 1 32  ? -28.063 19.837  -22.475 1.00 44.48  ? 32   ASN A CB  1 
ATOM   215  C CG  . ASN A 1 32  ? -29.210 18.888  -22.722 1.00 40.41  ? 32   ASN A CG  1 
ATOM   216  O OD1 . ASN A 1 32  ? -29.701 18.216  -21.808 1.00 44.01  ? 32   ASN A OD1 1 
ATOM   217  N ND2 . ASN A 1 32  ? -29.643 18.819  -23.974 1.00 36.14  ? 32   ASN A ND2 1 
ATOM   218  N N   . LEU A 1 33  ? -26.152 21.211  -24.690 1.00 35.36  ? 33   LEU A N   1 
ATOM   219  C CA  . LEU A 1 33  ? -25.426 22.396  -25.105 1.00 39.10  ? 33   LEU A CA  1 
ATOM   220  C C   . LEU A 1 33  ? -26.176 23.677  -24.741 1.00 42.60  ? 33   LEU A C   1 
ATOM   221  O O   . LEU A 1 33  ? -27.373 23.786  -24.999 1.00 42.18  ? 33   LEU A O   1 
ATOM   222  C CB  . LEU A 1 33  ? -25.209 22.379  -26.614 1.00 32.35  ? 33   LEU A CB  1 
ATOM   223  C CG  . LEU A 1 33  ? -24.892 21.018  -27.221 1.00 39.10  ? 33   LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 33  ? -24.945 21.087  -28.744 1.00 35.83  ? 33   LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 33  ? -23.528 20.527  -26.723 1.00 30.45  ? 33   LEU A CD2 1 
ATOM   226  N N   . PRO A 1 34  ? -25.453 24.665  -24.173 1.00 37.43  ? 34   PRO A N   1 
ATOM   227  C CA  . PRO A 1 34  ? -25.998 25.996  -23.898 1.00 39.93  ? 34   PRO A CA  1 
ATOM   228  C C   . PRO A 1 34  ? -26.153 26.789  -25.198 1.00 44.59  ? 34   PRO A C   1 
ATOM   229  O O   . PRO A 1 34  ? -25.579 26.388  -26.220 1.00 38.83  ? 34   PRO A O   1 
ATOM   230  C CB  . PRO A 1 34  ? -24.936 26.633  -22.977 1.00 39.81  ? 34   PRO A CB  1 
ATOM   231  C CG  . PRO A 1 34  ? -23.686 25.953  -23.288 1.00 41.83  ? 34   PRO A CG  1 
ATOM   232  C CD  . PRO A 1 34  ? -24.041 24.548  -23.757 1.00 29.34  ? 34   PRO A CD  1 
ATOM   233  N N   . PRO A 1 35  ? -26.922 27.893  -25.161 1.00 36.06  ? 35   PRO A N   1 
ATOM   234  C CA  . PRO A 1 35  ? -27.221 28.666  -26.364 1.00 45.23  ? 35   PRO A CA  1 
ATOM   235  C C   . PRO A 1 35  ? -25.991 29.092  -27.137 1.00 40.91  ? 35   PRO A C   1 
ATOM   236  O O   . PRO A 1 35  ? -26.028 29.001  -28.365 1.00 48.49  ? 35   PRO A O   1 
ATOM   237  C CB  . PRO A 1 35  ? -27.924 29.914  -25.808 1.00 49.92  ? 35   PRO A CB  1 
ATOM   238  C CG  . PRO A 1 35  ? -28.589 29.445  -24.570 1.00 41.07  ? 35   PRO A CG  1 
ATOM   239  C CD  . PRO A 1 35  ? -27.583 28.469  -23.974 1.00 44.88  ? 35   PRO A CD  1 
ATOM   240  N N   . ARG A 1 36  ? -24.937 29.553  -26.459 1.00 44.48  ? 36   ARG A N   1 
ATOM   241  C CA  . ARG A 1 36  ? -23.777 30.081  -27.162 1.00 40.52  ? 36   ARG A CA  1 
ATOM   242  C C   . ARG A 1 36  ? -23.106 29.022  -28.016 1.00 42.31  ? 36   ARG A C   1 
ATOM   243  O O   . ARG A 1 36  ? -22.700 29.277  -29.151 1.00 34.58  ? 36   ARG A O   1 
ATOM   244  C CB  . ARG A 1 36  ? -22.774 30.653  -26.174 1.00 52.62  ? 36   ARG A CB  1 
ATOM   245  C CG  . ARG A 1 36  ? -22.374 32.063  -26.518 1.00 55.37  ? 36   ARG A CG  1 
ATOM   246  C CD  . ARG A 1 36  ? -21.444 32.616  -25.482 1.00 50.42  ? 36   ARG A CD  1 
ATOM   247  N NE  . ARG A 1 36  ? -20.103 32.815  -26.011 1.00 45.52  ? 36   ARG A NE  1 
ATOM   248  C CZ  . ARG A 1 36  ? -19.122 33.375  -25.315 1.00 50.85  ? 36   ARG A CZ  1 
ATOM   249  N NH1 . ARG A 1 36  ? -19.352 33.789  -24.075 1.00 42.75  ? 36   ARG A NH1 1 
ATOM   250  N NH2 . ARG A 1 36  ? -17.920 33.531  -25.857 1.00 35.82  ? 36   ARG A NH2 1 
ATOM   251  N N   . ILE A 1 37  ? -22.991 27.828  -27.453 1.00 32.63  ? 37   ILE A N   1 
ATOM   252  C CA  . ILE A 1 37  ? -22.350 26.731  -28.148 1.00 38.16  ? 37   ILE A CA  1 
ATOM   253  C C   . ILE A 1 37  ? -23.187 26.285  -29.367 1.00 40.83  ? 37   ILE A C   1 
ATOM   254  O O   . ILE A 1 37  ? -22.642 26.036  -30.452 1.00 42.78  ? 37   ILE A O   1 
ATOM   255  C CB  . ILE A 1 37  ? -22.068 25.596  -27.158 1.00 39.03  ? 37   ILE A CB  1 
ATOM   256  C CG1 . ILE A 1 37  ? -21.089 26.120  -26.100 1.00 43.08  ? 37   ILE A CG1 1 
ATOM   257  C CG2 . ILE A 1 37  ? -21.557 24.370  -27.881 1.00 36.47  ? 37   ILE A CG2 1 
ATOM   258  C CD1 . ILE A 1 37  ? -20.523 25.094  -25.164 1.00 55.78  ? 37   ILE A CD1 1 
ATOM   259  N N   . MET A 1 38  ? -24.505 26.222  -29.199 1.00 37.21  ? 38   MET A N   1 
ATOM   260  C CA  . MET A 1 38  ? -25.393 25.948  -30.333 1.00 42.37  ? 38   MET A CA  1 
ATOM   261  C C   . MET A 1 38  ? -25.241 27.007  -31.424 1.00 46.32  ? 38   MET A C   1 
ATOM   262  O O   . MET A 1 38  ? -25.222 26.685  -32.616 1.00 46.26  ? 38   MET A O   1 
ATOM   263  C CB  . MET A 1 38  ? -26.851 25.879  -29.883 1.00 37.86  ? 38   MET A CB  1 
ATOM   264  C CG  . MET A 1 38  ? -27.248 24.593  -29.180 1.00 39.16  ? 38   MET A CG  1 
ATOM   265  S SD  . MET A 1 38  ? -28.870 24.755  -28.373 1.00 55.44  ? 38   MET A SD  1 
ATOM   266  C CE  . MET A 1 38  ? -29.949 25.004  -29.779 1.00 118.85 ? 38   MET A CE  1 
ATOM   267  N N   . ALA A 1 39  ? -25.108 28.266  -31.011 1.00 40.00  ? 39   ALA A N   1 
ATOM   268  C CA  . ALA A 1 39  ? -24.994 29.377  -31.957 1.00 51.79  ? 39   ALA A CA  1 
ATOM   269  C C   . ALA A 1 39  ? -23.729 29.264  -32.800 1.00 42.29  ? 39   ALA A C   1 
ATOM   270  O O   . ALA A 1 39  ? -23.747 29.470  -34.017 1.00 32.63  ? 39   ALA A O   1 
ATOM   271  C CB  . ALA A 1 39  ? -25.016 30.726  -31.221 1.00 26.01  ? 39   ALA A CB  1 
ATOM   272  N N   . ALA A 1 40  ? -22.625 28.965  -32.127 1.00 27.58  ? 40   ALA A N   1 
ATOM   273  C CA  . ALA A 1 40  ? -21.350 28.760  -32.794 1.00 34.03  ? 40   ALA A CA  1 
ATOM   274  C C   . ALA A 1 40  ? -21.502 27.609  -33.768 1.00 35.26  ? 40   ALA A C   1 
ATOM   275  O O   . ALA A 1 40  ? -20.924 27.637  -34.856 1.00 31.86  ? 40   ALA A O   1 
ATOM   276  C CB  . ALA A 1 40  ? -20.257 28.453  -31.783 1.00 26.97  ? 40   ALA A CB  1 
ATOM   277  N N   . GLY A 1 41  ? -22.306 26.618  -33.376 1.00 27.07  ? 41   GLY A N   1 
ATOM   278  C CA  . GLY A 1 41  ? -22.497 25.405  -34.166 1.00 25.36  ? 41   GLY A CA  1 
ATOM   279  C C   . GLY A 1 41  ? -23.179 25.673  -35.485 1.00 34.63  ? 41   GLY A C   1 
ATOM   280  O O   . GLY A 1 41  ? -23.016 24.911  -36.453 1.00 35.59  ? 41   GLY A O   1 
ATOM   281  N N   . GLY A 1 42  ? -23.926 26.778  -35.534 1.00 33.75  ? 42   GLY A N   1 
ATOM   282  C CA  . GLY A 1 42  ? -24.725 27.075  -36.705 1.00 26.06  ? 42   GLY A CA  1 
ATOM   283  C C   . GLY A 1 42  ? -24.068 28.033  -37.673 1.00 28.80  ? 42   GLY A C   1 
ATOM   284  O O   . GLY A 1 42  ? -24.713 28.480  -38.606 1.00 34.99  ? 42   GLY A O   1 
ATOM   285  N N   . LEU A 1 43  ? -22.789 28.339  -37.465 1.00 33.59  ? 43   LEU A N   1 
ATOM   286  C CA  . LEU A 1 43  ? -22.127 29.389  -38.237 1.00 32.43  ? 43   LEU A CA  1 
ATOM   287  C C   . LEU A 1 43  ? -21.593 28.905  -39.572 1.00 37.95  ? 43   LEU A C   1 
ATOM   288  O O   . LEU A 1 43  ? -21.520 27.707  -39.830 1.00 40.56  ? 43   LEU A O   1 
ATOM   289  C CB  . LEU A 1 43  ? -20.981 30.012  -37.436 1.00 29.10  ? 43   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 43  ? -21.319 30.811  -36.174 1.00 43.20  ? 43   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 43  ? -20.060 31.022  -35.352 1.00 39.61  ? 43   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 43  ? -21.948 32.153  -36.519 1.00 40.46  ? 43   LEU A CD2 1 
ATOM   293  N N   . GLN A 1 44  ? -21.182 29.855  -40.403 1.00 36.19  ? 44   GLN A N   1 
ATOM   294  C CA  . GLN A 1 44  ? -20.625 29.560  -41.711 1.00 31.70  ? 44   GLN A CA  1 
ATOM   295  C C   . GLN A 1 44  ? -19.151 29.161  -41.639 1.00 37.16  ? 44   GLN A C   1 
ATOM   296  O O   . GLN A 1 44  ? -18.485 29.393  -40.624 1.00 45.08  ? 44   GLN A O   1 
ATOM   297  C CB  . GLN A 1 44  ? -20.860 30.765  -42.643 1.00 27.09  ? 44   GLN A CB  1 
ATOM   298  C CG  . GLN A 1 44  ? -20.398 30.608  -44.107 1.00 25.61  ? 44   GLN A CG  1 
ATOM   299  C CD  . GLN A 1 44  ? -20.991 29.368  -44.817 1.00 45.04  ? 44   GLN A CD  1 
ATOM   300  O OE1 . GLN A 1 44  ? -20.326 28.344  -44.948 1.00 47.88  ? 44   GLN A OE1 1 
ATOM   301  N NE2 . GLN A 1 44  ? -22.232 29.478  -45.287 1.00 39.67  ? 44   GLN A NE2 1 
ATOM   302  N N   . MET A 1 45  ? -18.655 28.543  -42.709 1.00 30.76  ? 45   MET A N   1 
ATOM   303  C CA  . MET A 1 45  ? -17.270 28.070  -42.801 1.00 31.77  ? 45   MET A CA  1 
ATOM   304  C C   . MET A 1 45  ? -16.304 29.185  -43.149 1.00 40.66  ? 45   MET A C   1 
ATOM   305  O O   . MET A 1 45  ? -16.638 30.075  -43.925 1.00 36.15  ? 45   MET A O   1 
ATOM   306  C CB  . MET A 1 45  ? -17.135 27.008  -43.915 1.00 32.88  ? 45   MET A CB  1 
ATOM   307  C CG  . MET A 1 45  ? -17.509 25.601  -43.549 1.00 32.75  ? 45   MET A CG  1 
ATOM   308  S SD  . MET A 1 45  ? -16.310 24.832  -42.441 1.00 33.45  ? 45   MET A SD  1 
ATOM   309  C CE  . MET A 1 45  ? -14.778 25.092  -43.299 1.00 38.31  ? 45   MET A CE  1 
ATOM   310  N N   . ILE A 1 46  ? -15.088 29.100  -42.617 1.00 40.21  ? 46   ILE A N   1 
ATOM   311  C CA  . ILE A 1 46  ? -13.965 29.867  -43.142 1.00 38.68  ? 46   ILE A CA  1 
ATOM   312  C C   . ILE A 1 46  ? -12.923 28.873  -43.631 1.00 43.44  ? 46   ILE A C   1 
ATOM   313  O O   . ILE A 1 46  ? -13.126 27.675  -43.519 1.00 35.21  ? 46   ILE A O   1 
ATOM   314  C CB  . ILE A 1 46  ? -13.338 30.764  -42.067 1.00 34.55  ? 46   ILE A CB  1 
ATOM   315  C CG1 . ILE A 1 46  ? -12.852 29.935  -40.879 1.00 23.97  ? 46   ILE A CG1 1 
ATOM   316  C CG2 . ILE A 1 46  ? -14.344 31.796  -41.578 1.00 31.04  ? 46   ILE A CG2 1 
ATOM   317  C CD1 . ILE A 1 46  ? -12.154 30.775  -39.787 1.00 35.50  ? 46   ILE A CD1 1 
ATOM   318  N N   . GLY A 1 47  ? -11.800 29.359  -44.149 1.00 42.32  ? 47   GLY A N   1 
ATOM   319  C CA  . GLY A 1 47  ? -10.764 28.485  -44.681 1.00 29.30  ? 47   GLY A CA  1 
ATOM   320  C C   . GLY A 1 47  ? -9.975  27.738  -43.614 1.00 46.28  ? 47   GLY A C   1 
ATOM   321  O O   . GLY A 1 47  ? -9.500  28.335  -42.648 1.00 42.90  ? 47   GLY A O   1 
ATOM   322  N N   . HIS A 1 48  ? -9.821  26.429  -43.781 1.00 44.31  ? 48   HIS A N   1 
ATOM   323  C CA  . HIS A 1 48  ? -9.225  25.614  -42.720 1.00 49.00  ? 48   HIS A CA  1 
ATOM   324  C C   . HIS A 1 48  ? -7.778  25.972  -42.471 1.00 50.52  ? 48   HIS A C   1 
ATOM   325  O O   . HIS A 1 48  ? -7.225  25.614  -41.437 1.00 47.19  ? 48   HIS A O   1 
ATOM   326  C CB  . HIS A 1 48  ? -9.337  24.112  -43.009 1.00 35.42  ? 48   HIS A CB  1 
ATOM   327  C CG  . HIS A 1 48  ? -8.653  23.698  -44.263 1.00 35.51  ? 48   HIS A CG  1 
ATOM   328  N ND1 . HIS A 1 48  ? -7.550  22.873  -44.272 1.00 48.64  ? 48   HIS A ND1 1 
ATOM   329  C CD2 . HIS A 1 48  ? -8.894  24.023  -45.555 1.00 38.27  ? 48   HIS A CD2 1 
ATOM   330  C CE1 . HIS A 1 48  ? -7.155  22.686  -45.520 1.00 61.49  ? 48   HIS A CE1 1 
ATOM   331  N NE2 . HIS A 1 48  ? -7.954  23.374  -46.318 1.00 49.99  ? 48   HIS A NE2 1 
ATOM   332  N N   . MET A 1 49  ? -7.155  26.666  -43.415 1.00 44.30  ? 49   MET A N   1 
ATOM   333  C CA  . MET A 1 49  ? -5.807  27.164  -43.174 1.00 45.77  ? 49   MET A CA  1 
ATOM   334  C C   . MET A 1 49  ? -5.725  28.685  -43.254 1.00 46.91  ? 49   MET A C   1 
ATOM   335  O O   . MET A 1 49  ? -4.657  29.250  -43.434 1.00 42.19  ? 49   MET A O   1 
ATOM   336  C CB  . MET A 1 49  ? -4.815  26.479  -44.097 1.00 46.99  ? 49   MET A CB  1 
ATOM   337  C CG  . MET A 1 49  ? -4.810  24.980  -43.840 1.00 53.69  ? 49   MET A CG  1 
ATOM   338  S SD  . MET A 1 49  ? -3.722  24.062  -44.901 1.00 59.00  ? 49   MET A SD  1 
ATOM   339  C CE  . MET A 1 49  ? -2.193  24.921  -44.599 1.00 32.84  ? 49   MET A CE  1 
ATOM   340  N N   . SER A 1 50  ? -6.873  29.330  -43.091 1.00 44.25  ? 50   SER A N   1 
ATOM   341  C CA  . SER A 1 50  ? -6.953  30.783  -43.112 1.00 54.27  ? 50   SER A CA  1 
ATOM   342  C C   . SER A 1 50  ? -6.343  31.351  -41.847 1.00 50.57  ? 50   SER A C   1 
ATOM   343  O O   . SER A 1 50  ? -6.351  30.699  -40.806 1.00 44.73  ? 50   SER A O   1 
ATOM   344  C CB  . SER A 1 50  ? -8.409  31.236  -43.215 1.00 43.39  ? 50   SER A CB  1 
ATOM   345  O OG  . SER A 1 50  ? -9.164  30.774  -42.109 1.00 52.90  ? 50   SER A OG  1 
ATOM   346  N N   . LYS A 1 51  ? -5.834  32.572  -41.946 1.00 44.83  ? 51   LYS A N   1 
ATOM   347  C CA  . LYS A 1 51  ? -5.218  33.249  -40.812 1.00 50.73  ? 51   LYS A CA  1 
ATOM   348  C C   . LYS A 1 51  ? -6.189  33.378  -39.631 1.00 39.88  ? 51   LYS A C   1 
ATOM   349  O O   . LYS A 1 51  ? -5.783  33.295  -38.468 1.00 42.18  ? 51   LYS A O   1 
ATOM   350  C CB  . LYS A 1 51  ? -4.669  34.608  -41.261 1.00 72.60  ? 51   LYS A CB  1 
ATOM   351  C CG  . LYS A 1 51  ? -5.106  35.781  -40.425 1.00 89.79  ? 51   LYS A CG  1 
ATOM   352  C CD  . LYS A 1 51  ? -3.938  36.352  -39.639 1.00 100.51 ? 51   LYS A CD  1 
ATOM   353  C CE  . LYS A 1 51  ? -4.436  37.119  -38.418 1.00 104.36 ? 51   LYS A CE  1 
ATOM   354  N NZ  . LYS A 1 51  ? -3.434  38.087  -37.892 1.00 105.31 ? 51   LYS A NZ  1 
ATOM   355  N N   . GLU A 1 52  ? -7.477  33.531  -39.933 1.00 43.50  ? 52   GLU A N   1 
ATOM   356  C CA  . GLU A 1 52  ? -8.505  33.575  -38.894 1.00 44.10  ? 52   GLU A CA  1 
ATOM   357  C C   . GLU A 1 52  ? -8.663  32.244  -38.151 1.00 48.66  ? 52   GLU A C   1 
ATOM   358  O O   . GLU A 1 52  ? -8.798  32.223  -36.920 1.00 53.92  ? 52   GLU A O   1 
ATOM   359  C CB  . GLU A 1 52  ? -9.847  34.009  -39.478 1.00 48.85  ? 52   GLU A CB  1 
ATOM   360  C CG  . GLU A 1 52  ? -9.864  35.448  -39.980 1.00 54.51  ? 52   GLU A CG  1 
ATOM   361  C CD  . GLU A 1 52  ? -9.372  35.564  -41.411 1.00 65.95  ? 52   GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 52  ? -9.077  34.510  -42.030 1.00 60.05  ? 52   GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 52  ? -9.289  36.708  -41.920 1.00 65.16  ? 52   GLU A OE2 1 
ATOM   364  N N   . MET A 1 53  ? -8.634  31.139  -38.898 1.00 44.47  ? 53   MET A N   1 
ATOM   365  C CA  . MET A 1 53  ? -8.719  29.800  -38.308 1.00 37.80  ? 53   MET A CA  1 
ATOM   366  C C   . MET A 1 53  ? -7.585  29.552  -37.330 1.00 36.17  ? 53   MET A C   1 
ATOM   367  O O   . MET A 1 53  ? -7.813  29.016  -36.246 1.00 33.92  ? 53   MET A O   1 
ATOM   368  C CB  . MET A 1 53  ? -8.682  28.721  -39.387 1.00 32.48  ? 53   MET A CB  1 
ATOM   369  C CG  . MET A 1 53  ? -8.921  27.338  -38.853 1.00 30.70  ? 53   MET A CG  1 
ATOM   370  S SD  . MET A 1 53  ? -10.659 27.158  -38.463 1.00 45.89  ? 53   MET A SD  1 
ATOM   371  C CE  . MET A 1 53  ? -10.556 26.882  -36.694 1.00 35.93  ? 53   MET A CE  1 
ATOM   372  N N   . TYR A 1 54  ? -6.368  29.937  -37.724 1.00 32.28  ? 54   TYR A N   1 
ATOM   373  C CA  . TYR A 1 54  ? -5.198  29.815  -36.853 1.00 41.48  ? 54   TYR A CA  1 
ATOM   374  C C   . TYR A 1 54  ? -5.368  30.661  -35.600 1.00 45.43  ? 54   TYR A C   1 
ATOM   375  O O   . TYR A 1 54  ? -4.953  30.263  -34.511 1.00 40.83  ? 54   TYR A O   1 
ATOM   376  C CB  . TYR A 1 54  ? -3.931  30.255  -37.572 1.00 36.84  ? 54   TYR A CB  1 
ATOM   377  C CG  . TYR A 1 54  ? -3.532  29.406  -38.754 1.00 41.17  ? 54   TYR A CG  1 
ATOM   378  C CD1 . TYR A 1 54  ? -3.926  28.080  -38.859 1.00 51.66  ? 54   TYR A CD1 1 
ATOM   379  C CD2 . TYR A 1 54  ? -2.743  29.936  -39.770 1.00 42.73  ? 54   TYR A CD2 1 
ATOM   380  C CE1 . TYR A 1 54  ? -3.555  27.310  -39.959 1.00 52.77  ? 54   TYR A CE1 1 
ATOM   381  C CE2 . TYR A 1 54  ? -2.370  29.182  -40.861 1.00 50.44  ? 54   TYR A CE2 1 
ATOM   382  C CZ  . TYR A 1 54  ? -2.775  27.873  -40.954 1.00 52.32  ? 54   TYR A CZ  1 
ATOM   383  O OH  . TYR A 1 54  ? -2.388  27.138  -42.048 1.00 49.57  ? 54   TYR A OH  1 
ATOM   384  N N   . GLN A 1 55  ? -5.968  31.837  -35.750 1.00 45.84  ? 55   GLN A N   1 
ATOM   385  C CA  . GLN A 1 55  ? -6.219  32.677  -34.589 1.00 40.99  ? 55   GLN A CA  1 
ATOM   386  C C   . GLN A 1 55  ? -7.166  31.944  -33.647 1.00 44.26  ? 55   GLN A C   1 
ATOM   387  O O   . GLN A 1 55  ? -6.885  31.803  -32.459 1.00 41.61  ? 55   GLN A O   1 
ATOM   388  C CB  . GLN A 1 55  ? -6.790  34.034  -35.002 1.00 40.37  ? 55   GLN A CB  1 
ATOM   389  C CG  . GLN A 1 55  ? -7.337  34.860  -33.839 1.00 59.79  ? 55   GLN A CG  1 
ATOM   390  C CD  . GLN A 1 55  ? -6.265  35.224  -32.816 1.00 85.77  ? 55   GLN A CD  1 
ATOM   391  O OE1 . GLN A 1 55  ? -6.469  35.103  -31.603 1.00 88.14  ? 55   GLN A OE1 1 
ATOM   392  N NE2 . GLN A 1 55  ? -5.117  35.678  -33.304 1.00 91.57  ? 55   GLN A NE2 1 
ATOM   393  N N   . ILE A 1 56  ? -8.262  31.425  -34.196 1.00 44.95  ? 56   ILE A N   1 
ATOM   394  C CA  . ILE A 1 56  ? -9.224  30.684  -33.392 1.00 42.50  ? 56   ILE A CA  1 
ATOM   395  C C   . ILE A 1 56  ? -8.537  29.515  -32.706 1.00 38.45  ? 56   ILE A C   1 
ATOM   396  O O   . ILE A 1 56  ? -8.781  29.242  -31.522 1.00 39.34  ? 56   ILE A O   1 
ATOM   397  C CB  . ILE A 1 56  ? -10.412 30.187  -34.252 1.00 45.31  ? 56   ILE A CB  1 
ATOM   398  C CG1 . ILE A 1 56  ? -11.286 31.380  -34.665 1.00 35.24  ? 56   ILE A CG1 1 
ATOM   399  C CG2 . ILE A 1 56  ? -11.239 29.137  -33.490 1.00 36.22  ? 56   ILE A CG2 1 
ATOM   400  C CD1 . ILE A 1 56  ? -12.174 31.133  -35.864 1.00 36.71  ? 56   ILE A CD1 1 
ATOM   401  N N   . MET A 1 57  ? -7.663  28.839  -33.454 1.00 39.72  ? 57   MET A N   1 
ATOM   402  C CA  . MET A 1 57  ? -6.936  27.679  -32.946 1.00 30.88  ? 57   MET A CA  1 
ATOM   403  C C   . MET A 1 57  ? -5.977  28.104  -31.839 1.00 27.32  ? 57   MET A C   1 
ATOM   404  O O   . MET A 1 57  ? -5.785  27.384  -30.850 1.00 34.06  ? 57   MET A O   1 
ATOM   405  C CB  . MET A 1 57  ? -6.131  26.979  -34.071 1.00 29.00  ? 57   MET A CB  1 
ATOM   406  C CG  . MET A 1 57  ? -6.953  26.184  -35.080 1.00 36.83  ? 57   MET A CG  1 
ATOM   407  S SD  . MET A 1 57  ? -5.999  25.803  -36.576 1.00 39.93  ? 57   MET A SD  1 
ATOM   408  C CE  . MET A 1 57  ? -4.806  24.638  -35.910 1.00 43.48  ? 57   MET A CE  1 
ATOM   409  N N   . ASP A 1 58  ? -5.352  29.263  -32.016 1.00 49.46  ? 58   ASP A N   1 
ATOM   410  C CA  . ASP A 1 58  ? -4.427  29.765  -31.003 1.00 45.72  ? 58   ASP A CA  1 
ATOM   411  C C   . ASP A 1 58  ? -5.157  30.053  -29.702 1.00 48.73  ? 58   ASP A C   1 
ATOM   412  O O   . ASP A 1 58  ? -4.623  29.832  -28.615 1.00 51.61  ? 58   ASP A O   1 
ATOM   413  C CB  . ASP A 1 58  ? -3.697  31.011  -31.506 1.00 46.90  ? 58   ASP A CB  1 
ATOM   414  C CG  . ASP A 1 58  ? -2.633  30.675  -32.532 1.00 48.91  ? 58   ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 58  ? -2.249  29.489  -32.608 1.00 42.93  ? 58   ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 58  ? -2.182  31.586  -33.257 1.00 48.57  ? 58   ASP A OD2 1 
ATOM   417  N N   . GLU A 1 59  ? -6.392  30.535  -29.811 1.00 43.33  ? 59   GLU A N   1 
ATOM   418  C CA  . GLU A 1 59  ? -7.164  30.874  -28.620 1.00 43.35  ? 59   GLU A CA  1 
ATOM   419  C C   . GLU A 1 59  ? -7.561  29.593  -27.897 1.00 33.36  ? 59   GLU A C   1 
ATOM   420  O O   . GLU A 1 59  ? -7.545  29.516  -26.671 1.00 41.95  ? 59   GLU A O   1 
ATOM   421  C CB  . GLU A 1 59  ? -8.384  31.708  -28.993 1.00 48.23  ? 59   GLU A CB  1 
ATOM   422  C CG  . GLU A 1 59  ? -8.025  33.066  -29.566 1.00 48.17  ? 59   GLU A CG  1 
ATOM   423  C CD  . GLU A 1 59  ? -9.240  33.951  -29.736 1.00 55.48  ? 59   GLU A CD  1 
ATOM   424  O OE1 . GLU A 1 59  ? -10.318 33.583  -29.223 1.00 54.67  ? 59   GLU A OE1 1 
ATOM   425  O OE2 . GLU A 1 59  ? -9.115  35.011  -30.380 1.00 58.05  ? 59   GLU A OE2 1 
ATOM   426  N N   . ILE A 1 60  ? -7.861  28.566  -28.676 1.00 32.84  ? 60   ILE A N   1 
ATOM   427  C CA  . ILE A 1 60  ? -8.282  27.312  -28.096 1.00 35.42  ? 60   ILE A CA  1 
ATOM   428  C C   . ILE A 1 60  ? -7.131  26.731  -27.308 1.00 39.70  ? 60   ILE A C   1 
ATOM   429  O O   . ILE A 1 60  ? -7.324  26.223  -26.205 1.00 42.58  ? 60   ILE A O   1 
ATOM   430  C CB  . ILE A 1 60  ? -8.808  26.346  -29.183 1.00 36.62  ? 60   ILE A CB  1 
ATOM   431  C CG1 . ILE A 1 60  ? -10.222 26.765  -29.578 1.00 35.04  ? 60   ILE A CG1 1 
ATOM   432  C CG2 . ILE A 1 60  ? -8.815  24.925  -28.684 1.00 28.39  ? 60   ILE A CG2 1 
ATOM   433  C CD1 . ILE A 1 60  ? -10.737 26.132  -30.854 1.00 41.22  ? 60   ILE A CD1 1 
ATOM   434  N N   . LYS A 1 61  ? -5.932  26.835  -27.878 1.00 37.57  ? 61   LYS A N   1 
ATOM   435  C CA  . LYS A 1 61  ? -4.719  26.401  -27.211 1.00 47.28  ? 61   LYS A CA  1 
ATOM   436  C C   . LYS A 1 61  ? -4.578  27.090  -25.849 1.00 45.54  ? 61   LYS A C   1 
ATOM   437  O O   . LYS A 1 61  ? -4.433  26.407  -24.825 1.00 40.31  ? 61   LYS A O   1 
ATOM   438  C CB  . LYS A 1 61  ? -3.508  26.670  -28.111 1.00 55.76  ? 61   LYS A CB  1 
ATOM   439  C CG  . LYS A 1 61  ? -2.514  25.533  -28.146 1.00 69.32  ? 61   LYS A CG  1 
ATOM   440  C CD  . LYS A 1 61  ? -1.651  25.537  -29.416 1.00 71.93  ? 61   LYS A CD  1 
ATOM   441  C CE  . LYS A 1 61  ? -0.870  26.835  -29.592 1.00 61.46  ? 61   LYS A CE  1 
ATOM   442  N NZ  . LYS A 1 61  ? 0.263   26.652  -30.533 1.00 56.54  ? 61   LYS A NZ  1 
ATOM   443  N N   . GLU A 1 62  ? -4.652  28.426  -25.832 1.00 31.32  ? 62   GLU A N   1 
ATOM   444  C CA  . GLU A 1 62  ? -4.637  29.179  -24.564 1.00 44.15  ? 62   GLU A CA  1 
ATOM   445  C C   . GLU A 1 62  ? -5.738  28.666  -23.638 1.00 41.95  ? 62   GLU A C   1 
ATOM   446  O O   . GLU A 1 62  ? -5.528  28.480  -22.440 1.00 43.43  ? 62   GLU A O   1 
ATOM   447  C CB  . GLU A 1 62  ? -4.850  30.681  -24.789 1.00 47.86  ? 62   GLU A CB  1 
ATOM   448  C CG  . GLU A 1 62  ? -3.746  31.405  -25.541 1.00 54.89  ? 62   GLU A CG  1 
ATOM   449  C CD  . GLU A 1 62  ? -4.040  32.883  -25.695 1.00 67.47  ? 62   GLU A CD  1 
ATOM   450  O OE1 . GLU A 1 62  ? -4.590  33.473  -24.742 1.00 82.07  ? 62   GLU A OE1 1 
ATOM   451  O OE2 . GLU A 1 62  ? -3.738  33.460  -26.763 1.00 74.45  ? 62   GLU A OE2 1 
ATOM   452  N N   . GLY A 1 63  ? -6.908  28.404  -24.209 1.00 40.44  ? 63   GLY A N   1 
ATOM   453  C CA  . GLY A 1 63  ? -8.009  27.872  -23.429 1.00 41.08  ? 63   GLY A CA  1 
ATOM   454  C C   . GLY A 1 63  ? -7.700  26.547  -22.774 1.00 32.54  ? 63   GLY A C   1 
ATOM   455  O O   . GLY A 1 63  ? -8.065  26.322  -21.623 1.00 36.27  ? 63   GLY A O   1 
ATOM   456  N N   . ILE A 1 64  ? -7.056  25.649  -23.517 1.00 37.54  ? 64   ILE A N   1 
ATOM   457  C CA  . ILE A 1 64  ? -6.719  24.340  -22.980 1.00 36.54  ? 64   ILE A CA  1 
ATOM   458  C C   . ILE A 1 64  ? -5.611  24.508  -21.934 1.00 50.78  ? 64   ILE A C   1 
ATOM   459  O O   . ILE A 1 64  ? -5.518  23.734  -20.970 1.00 42.27  ? 64   ILE A O   1 
ATOM   460  C CB  . ILE A 1 64  ? -6.201  23.364  -24.073 1.00 54.20  ? 64   ILE A CB  1 
ATOM   461  C CG1 . ILE A 1 64  ? -7.170  23.272  -25.256 1.00 48.45  ? 64   ILE A CG1 1 
ATOM   462  C CG2 . ILE A 1 64  ? -5.937  21.984  -23.465 1.00 32.25  ? 64   ILE A CG2 1 
ATOM   463  C CD1 . ILE A 1 64  ? -6.617  22.557  -26.502 1.00 39.13  ? 64   ILE A CD1 1 
ATOM   464  N N   . GLN A 1 65  ? -4.755  25.507  -22.140 1.00 50.75  ? 65   GLN A N   1 
ATOM   465  C CA  . GLN A 1 65  ? -3.674  25.744  -21.197 1.00 48.94  ? 65   GLN A CA  1 
ATOM   466  C C   . GLN A 1 65  ? -4.289  26.240  -19.894 1.00 54.21  ? 65   GLN A C   1 
ATOM   467  O O   . GLN A 1 65  ? -3.890  25.802  -18.813 1.00 47.34  ? 65   GLN A O   1 
ATOM   468  C CB  . GLN A 1 65  ? -2.619  26.702  -21.767 1.00 41.07  ? 65   GLN A CB  1 
ATOM   469  C CG  . GLN A 1 65  ? -1.636  26.009  -22.707 1.00 47.94  ? 65   GLN A CG  1 
ATOM   470  C CD  . GLN A 1 65  ? -0.728  26.979  -23.423 1.00 59.14  ? 65   GLN A CD  1 
ATOM   471  O OE1 . GLN A 1 65  ? -1.127  28.094  -23.748 1.00 61.89  ? 65   GLN A OE1 1 
ATOM   472  N NE2 . GLN A 1 65  ? 0.513   26.559  -23.668 1.00 56.97  ? 65   GLN A NE2 1 
ATOM   473  N N   . TYR A 1 66  ? -5.306  27.095  -19.999 1.00 52.42  ? 66   TYR A N   1 
ATOM   474  C CA  . TYR A 1 66  ? -6.047  27.500  -18.807 1.00 47.34  ? 66   TYR A CA  1 
ATOM   475  C C   . TYR A 1 66  ? -6.743  26.336  -18.098 1.00 54.27  ? 66   TYR A C   1 
ATOM   476  O O   . TYR A 1 66  ? -6.484  26.092  -16.921 1.00 51.03  ? 66   TYR A O   1 
ATOM   477  C CB  . TYR A 1 66  ? -7.033  28.635  -19.084 1.00 41.23  ? 66   TYR A CB  1 
ATOM   478  C CG  . TYR A 1 66  ? -7.918  28.934  -17.886 1.00 55.34  ? 66   TYR A CG  1 
ATOM   479  C CD1 . TYR A 1 66  ? -7.381  29.438  -16.708 1.00 56.04  ? 66   TYR A CD1 1 
ATOM   480  C CD2 . TYR A 1 66  ? -9.293  28.702  -17.930 1.00 46.35  ? 66   TYR A CD2 1 
ATOM   481  C CE1 . TYR A 1 66  ? -8.187  29.711  -15.605 1.00 55.69  ? 66   TYR A CE1 1 
ATOM   482  C CE2 . TYR A 1 66  ? -10.101 28.964  -16.841 1.00 46.94  ? 66   TYR A CE2 1 
ATOM   483  C CZ  . TYR A 1 66  ? -9.548  29.470  -15.679 1.00 60.18  ? 66   TYR A CZ  1 
ATOM   484  O OH  . TYR A 1 66  ? -10.359 29.726  -14.594 1.00 51.20  ? 66   TYR A OH  1 
ATOM   485  N N   . VAL A 1 67  ? -7.610  25.605  -18.796 1.00 52.58  ? 67   VAL A N   1 
ATOM   486  C CA  . VAL A 1 67  ? -8.356  24.545  -18.118 1.00 46.58  ? 67   VAL A CA  1 
ATOM   487  C C   . VAL A 1 67  ? -7.479  23.410  -17.621 1.00 41.56  ? 67   VAL A C   1 
ATOM   488  O O   . VAL A 1 67  ? -7.770  22.816  -16.580 1.00 39.47  ? 67   VAL A O   1 
ATOM   489  C CB  . VAL A 1 67  ? -9.539  23.989  -18.952 1.00 42.89  ? 67   VAL A CB  1 
ATOM   490  C CG1 . VAL A 1 67  ? -10.475 25.125  -19.345 1.00 39.05  ? 67   VAL A CG1 1 
ATOM   491  C CG2 . VAL A 1 67  ? -9.049  23.202  -20.175 1.00 33.85  ? 67   VAL A CG2 1 
ATOM   492  N N   . PHE A 1 68  ? -6.411  23.106  -18.354 1.00 39.58  ? 68   PHE A N   1 
ATOM   493  C CA  . PHE A 1 68  ? -5.430  22.136  -17.865 1.00 41.27  ? 68   PHE A CA  1 
ATOM   494  C C   . PHE A 1 68  ? -4.524  22.689  -16.753 1.00 46.34  ? 68   PHE A C   1 
ATOM   495  O O   . PHE A 1 68  ? -4.026  21.926  -15.920 1.00 42.05  ? 68   PHE A O   1 
ATOM   496  C CB  . PHE A 1 68  ? -4.575  21.595  -19.003 1.00 46.28  ? 68   PHE A CB  1 
ATOM   497  C CG  . PHE A 1 68  ? -5.241  20.507  -19.794 1.00 55.32  ? 68   PHE A CG  1 
ATOM   498  C CD1 . PHE A 1 68  ? -6.527  20.084  -19.470 1.00 47.58  ? 68   PHE A CD1 1 
ATOM   499  C CD2 . PHE A 1 68  ? -4.579  19.899  -20.858 1.00 52.32  ? 68   PHE A CD2 1 
ATOM   500  C CE1 . PHE A 1 68  ? -7.136  19.085  -20.200 1.00 41.68  ? 68   PHE A CE1 1 
ATOM   501  C CE2 . PHE A 1 68  ? -5.181  18.895  -21.591 1.00 46.49  ? 68   PHE A CE2 1 
ATOM   502  C CZ  . PHE A 1 68  ? -6.454  18.484  -21.266 1.00 50.13  ? 68   PHE A CZ  1 
ATOM   503  N N   . GLN A 1 69  ? -4.332  24.006  -16.745 1.00 46.14  ? 69   GLN A N   1 
ATOM   504  C CA  . GLN A 1 69  ? -3.344  24.645  -15.875 1.00 49.37  ? 69   GLN A CA  1 
ATOM   505  C C   . GLN A 1 69  ? -1.931  24.170  -16.255 1.00 54.79  ? 69   GLN A C   1 
ATOM   506  O O   . GLN A 1 69  ? -1.242  23.500  -15.479 1.00 61.71  ? 69   GLN A O   1 
ATOM   507  C CB  . GLN A 1 69  ? -3.650  24.402  -14.388 1.00 39.45  ? 69   GLN A CB  1 
ATOM   508  C CG  . GLN A 1 69  ? -4.748  25.304  -13.813 1.00 54.89  ? 69   GLN A CG  1 
ATOM   509  C CD  . GLN A 1 69  ? -4.416  26.783  -13.925 1.00 64.42  ? 69   GLN A CD  1 
ATOM   510  O OE1 . GLN A 1 69  ? -3.399  27.250  -13.404 1.00 68.18  ? 69   GLN A OE1 1 
ATOM   511  N NE2 . GLN A 1 69  ? -5.269  27.527  -14.618 1.00 56.38  ? 69   GLN A NE2 1 
ATOM   512  N N   . THR A 1 70  ? -1.518  24.510  -17.469 1.00 49.10  ? 70   THR A N   1 
ATOM   513  C CA  . THR A 1 70  ? -0.191  24.153  -17.955 1.00 46.20  ? 70   THR A CA  1 
ATOM   514  C C   . THR A 1 70  ? 0.353   25.206  -18.889 1.00 53.84  ? 70   THR A C   1 
ATOM   515  O O   . THR A 1 70  ? -0.398  26.018  -19.437 1.00 49.16  ? 70   THR A O   1 
ATOM   516  C CB  . THR A 1 70  ? -0.144  22.814  -18.708 1.00 47.20  ? 70   THR A CB  1 
ATOM   517  O OG1 . THR A 1 70  ? 1.220   22.526  -19.020 1.00 41.45  ? 70   THR A OG1 1 
ATOM   518  C CG2 . THR A 1 70  ? -0.938  22.879  -20.034 1.00 35.94  ? 70   THR A CG2 1 
ATOM   519  N N   . ARG A 1 71  ? 1.664   25.181  -19.076 1.00 50.11  ? 71   ARG A N   1 
ATOM   520  C CA  . ARG A 1 71  ? 2.306   26.137  -19.953 1.00 51.18  ? 71   ARG A CA  1 
ATOM   521  C C   . ARG A 1 71  ? 3.025   25.365  -21.072 1.00 50.87  ? 71   ARG A C   1 
ATOM   522  O O   . ARG A 1 71  ? 3.576   25.972  -22.002 1.00 53.18  ? 71   ARG A O   1 
ATOM   523  C CB  . ARG A 1 71  ? 3.162   27.123  -19.113 1.00 117.45 ? 71   ARG A CB  1 
ATOM   524  C CG  . ARG A 1 71  ? 4.502   27.636  -19.664 1.00 127.25 ? 71   ARG A CG  1 
ATOM   525  C CD  . ARG A 1 71  ? 5.660   26.736  -19.202 1.00 130.42 ? 71   ARG A CD  1 
ATOM   526  N NE  . ARG A 1 71  ? 6.645   27.342  -18.300 1.00 123.56 ? 71   ARG A NE  1 
ATOM   527  C CZ  . ARG A 1 71  ? 6.640   27.220  -16.971 1.00 110.49 ? 71   ARG A CZ  1 
ATOM   528  N NH1 . ARG A 1 71  ? 5.687   26.538  -16.349 1.00 104.94 ? 71   ARG A NH1 1 
ATOM   529  N NH2 . ARG A 1 71  ? 7.590   27.795  -16.255 1.00 104.68 ? 71   ARG A NH2 1 
ATOM   530  N N   . ASN A 1 72  ? 2.961   24.024  -20.990 1.00 45.53  ? 72   ASN A N   1 
ATOM   531  C CA  . ASN A 1 72  ? 3.400   23.129  -22.084 1.00 56.26  ? 72   ASN A CA  1 
ATOM   532  C C   . ASN A 1 72  ? 3.003   23.678  -23.444 1.00 53.90  ? 72   ASN A C   1 
ATOM   533  O O   . ASN A 1 72  ? 1.821   23.901  -23.703 1.00 58.48  ? 72   ASN A O   1 
ATOM   534  C CB  . ASN A 1 72  ? 2.760   21.734  -22.006 1.00 35.63  ? 72   ASN A CB  1 
ATOM   535  C CG  . ASN A 1 72  ? 3.222   20.919  -20.826 1.00 62.55  ? 72   ASN A CG  1 
ATOM   536  O OD1 . ASN A 1 72  ? 4.180   21.268  -20.120 1.00 61.85  ? 72   ASN A OD1 1 
ATOM   537  N ND2 . ASN A 1 72  ? 2.543   19.796  -20.609 1.00 52.38  ? 72   ASN A ND2 1 
ATOM   538  N N   . PRO A 1 73  ? 3.992   23.899  -24.312 1.00 54.16  ? 73   PRO A N   1 
ATOM   539  C CA  . PRO A 1 73  ? 3.781   24.365  -25.682 1.00 46.00  ? 73   PRO A CA  1 
ATOM   540  C C   . PRO A 1 73  ? 3.153   23.251  -26.505 1.00 49.83  ? 73   PRO A C   1 
ATOM   541  O O   . PRO A 1 73  ? 2.461   23.510  -27.499 1.00 40.05  ? 73   PRO A O   1 
ATOM   542  C CB  . PRO A 1 73  ? 5.210   24.617  -26.192 1.00 56.01  ? 73   PRO A CB  1 
ATOM   543  C CG  . PRO A 1 73  ? 6.054   24.718  -24.975 1.00 40.74  ? 73   PRO A CG  1 
ATOM   544  C CD  . PRO A 1 73  ? 5.419   23.804  -23.971 1.00 48.71  ? 73   PRO A CD  1 
ATOM   545  N N   . LEU A 1 74  ? 3.413   22.010  -26.116 1.00 40.91  ? 74   LEU A N   1 
ATOM   546  C CA  . LEU A 1 74  ? 2.850   20.902  -26.873 1.00 51.45  ? 74   LEU A CA  1 
ATOM   547  C C   . LEU A 1 74  ? 1.455   20.549  -26.337 1.00 46.49  ? 74   LEU A C   1 
ATOM   548  O O   . LEU A 1 74  ? 1.253   19.556  -25.621 1.00 36.05  ? 74   LEU A O   1 
ATOM   549  C CB  . LEU A 1 74  ? 3.789   19.691  -26.931 1.00 40.09  ? 74   LEU A CB  1 
ATOM   550  C CG  . LEU A 1 74  ? 3.276   18.652  -27.923 1.00 44.04  ? 74   LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 74  ? 2.997   19.306  -29.277 1.00 33.81  ? 74   LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 74  ? 4.246   17.491  -28.057 1.00 47.33  ? 74   LEU A CD2 1 
ATOM   553  N N   . THR A 1 75  ? 0.503   21.400  -26.709 1.00 37.87  ? 75   THR A N   1 
ATOM   554  C CA  . THR A 1 75  ? -0.875  21.298  -26.258 1.00 33.92  ? 75   THR A CA  1 
ATOM   555  C C   . THR A 1 75  ? -1.790  21.598  -27.435 1.00 41.61  ? 75   THR A C   1 
ATOM   556  O O   . THR A 1 75  ? -1.588  22.578  -28.143 1.00 44.34  ? 75   THR A O   1 
ATOM   557  C CB  . THR A 1 75  ? -1.120  22.278  -25.112 1.00 33.98  ? 75   THR A CB  1 
ATOM   558  O OG1 . THR A 1 75  ? -0.393  21.822  -23.955 1.00 45.95  ? 75   THR A OG1 1 
ATOM   559  C CG2 . THR A 1 75  ? -2.588  22.336  -24.767 1.00 45.62  ? 75   THR A CG2 1 
ATOM   560  N N   . LEU A 1 76  ? -2.780  20.741  -27.667 1.00 38.52  ? 76   LEU A N   1 
ATOM   561  C CA  . LEU A 1 76  ? -3.596  20.877  -28.865 1.00 36.76  ? 76   LEU A CA  1 
ATOM   562  C C   . LEU A 1 76  ? -4.880  20.075  -28.830 1.00 35.10  ? 76   LEU A C   1 
ATOM   563  O O   . LEU A 1 76  ? -5.147  19.337  -27.882 1.00 35.30  ? 76   LEU A O   1 
ATOM   564  C CB  . LEU A 1 76  ? -2.796  20.505  -30.118 1.00 29.49  ? 76   LEU A CB  1 
ATOM   565  C CG  . LEU A 1 76  ? -1.982  19.212  -30.101 1.00 49.66  ? 76   LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 76  ? -2.841  18.002  -30.274 1.00 50.94  ? 76   LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 76  ? -0.973  19.281  -31.218 1.00 54.14  ? 76   LEU A CD2 1 
ATOM   568  N N   . VAL A 1 77  ? -5.660  20.222  -29.896 1.00 31.26  ? 77   VAL A N   1 
ATOM   569  C CA  . VAL A 1 77  ? -6.928  19.503  -30.037 1.00 32.87  ? 77   VAL A CA  1 
ATOM   570  C C   . VAL A 1 77  ? -6.729  18.305  -30.929 1.00 34.00  ? 77   VAL A C   1 
ATOM   571  O O   . VAL A 1 77  ? -6.093  18.409  -31.984 1.00 34.15  ? 77   VAL A O   1 
ATOM   572  C CB  . VAL A 1 77  ? -7.994  20.381  -30.690 1.00 34.27  ? 77   VAL A CB  1 
ATOM   573  C CG1 . VAL A 1 77  ? -9.321  19.607  -30.868 1.00 27.72  ? 77   VAL A CG1 1 
ATOM   574  C CG2 . VAL A 1 77  ? -8.197  21.647  -29.873 1.00 28.44  ? 77   VAL A CG2 1 
ATOM   575  N N   . ILE A 1 78  ? -7.252  17.159  -30.499 1.00 34.60  ? 78   ILE A N   1 
ATOM   576  C CA  . ILE A 1 78  ? -7.279  15.967  -31.350 1.00 35.50  ? 78   ILE A CA  1 
ATOM   577  C C   . ILE A 1 78  ? -8.604  15.989  -32.099 1.00 33.83  ? 78   ILE A C   1 
ATOM   578  O O   . ILE A 1 78  ? -9.647  16.227  -31.491 1.00 33.56  ? 78   ILE A O   1 
ATOM   579  C CB  . ILE A 1 78  ? -7.142  14.651  -30.521 1.00 28.14  ? 78   ILE A CB  1 
ATOM   580  C CG1 . ILE A 1 78  ? -5.802  14.623  -29.770 1.00 34.28  ? 78   ILE A CG1 1 
ATOM   581  C CG2 . ILE A 1 78  ? -7.298  13.432  -31.401 1.00 27.33  ? 78   ILE A CG2 1 
ATOM   582  C CD1 . ILE A 1 78  ? -4.604  14.855  -30.647 1.00 33.00  ? 78   ILE A CD1 1 
ATOM   583  N N   . SER A 1 79  ? -8.562  15.769  -33.411 1.00 36.74  ? 79   SER A N   1 
ATOM   584  C CA  . SER A 1 79  ? -9.770  15.826  -34.247 1.00 33.11  ? 79   SER A CA  1 
ATOM   585  C C   . SER A 1 79  ? -10.522 14.514  -34.152 1.00 28.45  ? 79   SER A C   1 
ATOM   586  O O   . SER A 1 79  ? -10.691 13.835  -35.154 1.00 31.19  ? 79   SER A O   1 
ATOM   587  C CB  . SER A 1 79  ? -9.399  16.064  -35.714 1.00 28.52  ? 79   SER A CB  1 
ATOM   588  O OG  . SER A 1 79  ? -8.699  17.278  -35.881 1.00 31.39  ? 79   SER A OG  1 
ATOM   589  N N   . GLY A 1 80  ? -10.936 14.142  -32.942 1.00 40.84  ? 80   GLY A N   1 
ATOM   590  C CA  . GLY A 1 80  ? -11.624 12.878  -32.698 1.00 40.00  ? 80   GLY A CA  1 
ATOM   591  C C   . GLY A 1 80  ? -12.166 12.883  -31.274 1.00 42.98  ? 80   GLY A C   1 
ATOM   592  O O   . GLY A 1 80  ? -11.831 13.769  -30.488 1.00 34.87  ? 80   GLY A O   1 
ATOM   593  N N   . SER A 1 81  ? -13.008 11.911  -30.940 1.00 41.28  ? 81   SER A N   1 
ATOM   594  C CA  . SER A 1 81  ? -13.593 11.833  -29.601 1.00 42.89  ? 81   SER A CA  1 
ATOM   595  C C   . SER A 1 81  ? -12.550 11.480  -28.519 1.00 37.73  ? 81   SER A C   1 
ATOM   596  O O   . SER A 1 81  ? -11.383 11.258  -28.833 1.00 39.53  ? 81   SER A O   1 
ATOM   597  C CB  . SER A 1 81  ? -14.717 10.801  -29.591 1.00 56.27  ? 81   SER A CB  1 
ATOM   598  O OG  . SER A 1 81  ? -14.189 9.494   -29.405 1.00 57.55  ? 81   SER A OG  1 
ATOM   599  N N   . GLY A 1 82  ? -12.959 11.459  -27.250 1.00 37.26  ? 82   GLY A N   1 
ATOM   600  C CA  . GLY A 1 82  ? -12.047 11.133  -26.151 1.00 40.16  ? 82   GLY A CA  1 
ATOM   601  C C   . GLY A 1 82  ? -11.080 9.984   -26.400 1.00 44.33  ? 82   GLY A C   1 
ATOM   602  O O   . GLY A 1 82  ? -9.865  10.186  -26.399 1.00 54.06  ? 82   GLY A O   1 
ATOM   603  N N   . HIS A 1 83  ? -11.629 8.788   -26.609 1.00 47.07  ? 83   HIS A N   1 
ATOM   604  C CA  . HIS A 1 83  ? -10.904 7.604   -27.088 1.00 51.45  ? 83   HIS A CA  1 
ATOM   605  C C   . HIS A 1 83  ? -9.744  7.914   -28.013 1.00 46.89  ? 83   HIS A C   1 
ATOM   606  O O   . HIS A 1 83  ? -8.661  7.318   -27.920 1.00 46.62  ? 83   HIS A O   1 
ATOM   607  C CB  . HIS A 1 83  ? -11.853 6.706   -27.900 1.00 50.18  ? 83   HIS A CB  1 
ATOM   608  C CG  . HIS A 1 83  ? -12.557 5.661   -27.090 1.00 59.31  ? 83   HIS A CG  1 
ATOM   609  N ND1 . HIS A 1 83  ? -13.699 5.922   -26.361 1.00 59.66  ? 83   HIS A ND1 1 
ATOM   610  C CD2 . HIS A 1 83  ? -12.293 4.344   -26.912 1.00 55.29  ? 83   HIS A CD2 1 
ATOM   611  C CE1 . HIS A 1 83  ? -14.106 4.814   -25.769 1.00 60.49  ? 83   HIS A CE1 1 
ATOM   612  N NE2 . HIS A 1 83  ? -13.266 3.843   -26.083 1.00 57.12  ? 83   HIS A NE2 1 
ATOM   613  N N   . CYS A 1 84  ? -10.006 8.819   -28.944 1.00 37.84  ? 84   CYS A N   1 
ATOM   614  C CA  . CYS A 1 84  ? -9.049  9.175   -29.970 1.00 42.12  ? 84   CYS A CA  1 
ATOM   615  C C   . CYS A 1 84  ? -7.856  9.899   -29.374 1.00 46.26  ? 84   CYS A C   1 
ATOM   616  O O   . CYS A 1 84  ? -6.727  9.743   -29.829 1.00 34.91  ? 84   CYS A O   1 
ATOM   617  C CB  . CYS A 1 84  ? -9.720  10.066  -31.000 1.00 33.24  ? 84   CYS A CB  1 
ATOM   618  S SG  . CYS A 1 84  ? -8.931  10.054  -32.580 1.00 46.71  ? 84   CYS A SG  1 
ATOM   619  N N   . ALA A 1 85  ? -8.113  10.713  -28.364 1.00 29.36  ? 85   ALA A N   1 
ATOM   620  C CA  . ALA A 1 85  ? -7.046  11.424  -27.708 1.00 29.95  ? 85   ALA A CA  1 
ATOM   621  C C   . ALA A 1 85  ? -6.190  10.427  -26.911 1.00 46.61  ? 85   ALA A C   1 
ATOM   622  O O   . ALA A 1 85  ? -4.969  10.575  -26.821 1.00 37.50  ? 85   ALA A O   1 
ATOM   623  C CB  . ALA A 1 85  ? -7.612  12.503  -26.819 1.00 30.21  ? 85   ALA A CB  1 
ATOM   624  N N   . LEU A 1 86  ? -6.833  9.403   -26.353 1.00 37.45  ? 86   LEU A N   1 
ATOM   625  C CA  . LEU A 1 86  ? -6.104  8.372   -25.629 1.00 40.19  ? 86   LEU A CA  1 
ATOM   626  C C   . LEU A 1 86  ? -5.257  7.601   -26.628 1.00 41.86  ? 86   LEU A C   1 
ATOM   627  O O   . LEU A 1 86  ? -4.059  7.395   -26.415 1.00 41.14  ? 86   LEU A O   1 
ATOM   628  C CB  . LEU A 1 86  ? -7.061  7.434   -24.885 1.00 37.88  ? 86   LEU A CB  1 
ATOM   629  C CG  . LEU A 1 86  ? -6.492  6.134   -24.294 1.00 47.16  ? 86   LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 86  ? -5.456  6.430   -23.217 1.00 36.29  ? 86   LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 86  ? -7.596  5.226   -23.736 1.00 44.14  ? 86   LEU A CD2 1 
ATOM   632  N N   . GLU A 1 87  ? -5.876  7.193   -27.726 1.00 33.01  ? 87   GLU A N   1 
ATOM   633  C CA  . GLU A 1 87  ? -5.145  6.477   -28.759 1.00 37.34  ? 87   GLU A CA  1 
ATOM   634  C C   . GLU A 1 87  ? -3.957  7.311   -29.269 1.00 45.65  ? 87   GLU A C   1 
ATOM   635  O O   . GLU A 1 87  ? -2.854  6.797   -29.436 1.00 50.44  ? 87   GLU A O   1 
ATOM   636  C CB  . GLU A 1 87  ? -6.092  6.038   -29.891 1.00 31.29  ? 87   GLU A CB  1 
ATOM   637  C CG  . GLU A 1 87  ? -5.412  5.194   -30.970 1.00 30.13  ? 87   GLU A CG  1 
ATOM   638  C CD  . GLU A 1 87  ? -6.343  4.176   -31.615 1.00 43.65  ? 87   GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 87  ? -7.160  3.563   -30.897 1.00 46.64  ? 87   GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 87  ? -6.256  3.984   -32.846 1.00 56.22  ? 87   GLU A OE2 1 
ATOM   641  N N   . ALA A 1 88  ? -4.172  8.604   -29.478 1.00 45.79  ? 88   ALA A N   1 
ATOM   642  C CA  . ALA A 1 88  ? -3.105  9.494   -29.929 1.00 36.39  ? 88   ALA A CA  1 
ATOM   643  C C   . ALA A 1 88  ? -1.937  9.424   -28.972 1.00 42.31  ? 88   ALA A C   1 
ATOM   644  O O   . ALA A 1 88  ? -0.797  9.225   -29.384 1.00 47.31  ? 88   ALA A O   1 
ATOM   645  C CB  . ALA A 1 88  ? -3.613  10.935  -30.032 1.00 39.41  ? 88   ALA A CB  1 
ATOM   646  N N   . ALA A 1 89  ? -2.243  9.594   -27.692 1.00 31.70  ? 89   ALA A N   1 
ATOM   647  C CA  . ALA A 1 89  ? -1.241  9.538   -26.638 1.00 54.78  ? 89   ALA A CA  1 
ATOM   648  C C   . ALA A 1 89  ? -0.461  8.225   -26.687 1.00 53.38  ? 89   ALA A C   1 
ATOM   649  O O   . ALA A 1 89  ? 0.763   8.230   -26.790 1.00 48.39  ? 89   ALA A O   1 
ATOM   650  C CB  . ALA A 1 89  ? -1.898  9.718   -25.279 1.00 33.37  ? 89   ALA A CB  1 
ATOM   651  N N   . LEU A 1 90  ? -1.176  7.108   -26.627 1.00 49.24  ? 90   LEU A N   1 
ATOM   652  C CA  . LEU A 1 90  ? -0.534  5.802   -26.579 1.00 52.98  ? 90   LEU A CA  1 
ATOM   653  C C   . LEU A 1 90  ? 0.265   5.501   -27.841 1.00 51.52  ? 90   LEU A C   1 
ATOM   654  O O   . LEU A 1 90  ? 1.320   4.875   -27.773 1.00 53.57  ? 90   LEU A O   1 
ATOM   655  C CB  . LEU A 1 90  ? -1.557  4.691   -26.327 1.00 34.07  ? 90   LEU A CB  1 
ATOM   656  C CG  . LEU A 1 90  ? -2.230  4.767   -24.964 1.00 42.51  ? 90   LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 90  ? -3.070  3.545   -24.680 1.00 35.00  ? 90   LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 90  ? -1.177  4.960   -23.899 1.00 47.14  ? 90   LEU A CD2 1 
ATOM   659  N N   . VAL A 1 91  ? -0.220  5.955   -28.989 1.00 40.07  ? 91   VAL A N   1 
ATOM   660  C CA  . VAL A 1 91  ? 0.434   5.602   -30.235 1.00 33.79  ? 91   VAL A CA  1 
ATOM   661  C C   . VAL A 1 91  ? 1.710   6.418   -30.486 1.00 45.59  ? 91   VAL A C   1 
ATOM   662  O O   . VAL A 1 91  ? 2.619   5.971   -31.198 1.00 40.28  ? 91   VAL A O   1 
ATOM   663  C CB  . VAL A 1 91  ? -0.534  5.643   -31.446 1.00 47.95  ? 91   VAL A CB  1 
ATOM   664  C CG1 . VAL A 1 91  ? -0.739  7.068   -31.924 1.00 43.36  ? 91   VAL A CG1 1 
ATOM   665  C CG2 . VAL A 1 91  ? -0.009  4.758   -32.571 1.00 39.19  ? 91   VAL A CG2 1 
ATOM   666  N N   . ASN A 1 92  ? 1.808   7.596   -29.885 1.00 36.88  ? 92   ASN A N   1 
ATOM   667  C CA  . ASN A 1 92  ? 3.027   8.367   -30.065 1.00 35.63  ? 92   ASN A CA  1 
ATOM   668  C C   . ASN A 1 92  ? 4.071   8.089   -28.990 1.00 44.70  ? 92   ASN A C   1 
ATOM   669  O O   . ASN A 1 92  ? 5.267   8.164   -29.251 1.00 48.82  ? 92   ASN A O   1 
ATOM   670  C CB  . ASN A 1 92  ? 2.734   9.846   -30.137 1.00 34.96  ? 92   ASN A CB  1 
ATOM   671  C CG  . ASN A 1 92  ? 2.014   10.224  -31.397 1.00 37.42  ? 92   ASN A CG  1 
ATOM   672  O OD1 . ASN A 1 92  ? 2.644   10.501  -32.409 1.00 33.63  ? 92   ASN A OD1 1 
ATOM   673  N ND2 . ASN A 1 92  ? 0.687   10.265  -31.338 1.00 33.30  ? 92   ASN A ND2 1 
ATOM   674  N N   . VAL A 1 93  ? 3.603   7.751   -27.792 1.00 51.69  ? 93   VAL A N   1 
ATOM   675  C CA  . VAL A 1 93  ? 4.464   7.560   -26.624 1.00 53.48  ? 93   VAL A CA  1 
ATOM   676  C C   . VAL A 1 93  ? 5.071   6.151   -26.543 1.00 58.68  ? 93   VAL A C   1 
ATOM   677  O O   . VAL A 1 93  ? 6.229   5.994   -26.171 1.00 55.18  ? 93   VAL A O   1 
ATOM   678  C CB  . VAL A 1 93  ? 3.698   7.895   -25.320 1.00 50.60  ? 93   VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 93  ? 4.271   7.162   -24.123 1.00 41.45  ? 93   VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 93  ? 3.705   9.386   -25.083 1.00 51.56  ? 93   VAL A CG2 1 
ATOM   681  N N   . LEU A 1 94  ? 4.297   5.134   -26.902 1.00 51.38  ? 94   LEU A N   1 
ATOM   682  C CA  . LEU A 1 94  ? 4.759   3.761   -26.780 1.00 52.68  ? 94   LEU A CA  1 
ATOM   683  C C   . LEU A 1 94  ? 5.276   3.165   -28.093 1.00 58.22  ? 94   LEU A C   1 
ATOM   684  O O   . LEU A 1 94  ? 4.549   3.094   -29.087 1.00 48.89  ? 94   LEU A O   1 
ATOM   685  C CB  . LEU A 1 94  ? 3.651   2.875   -26.221 1.00 47.10  ? 94   LEU A CB  1 
ATOM   686  C CG  . LEU A 1 94  ? 3.050   3.288   -24.887 1.00 50.35  ? 94   LEU A CG  1 
ATOM   687  C CD1 . LEU A 1 94  ? 1.882   2.387   -24.556 1.00 41.55  ? 94   LEU A CD1 1 
ATOM   688  C CD2 . LEU A 1 94  ? 4.102   3.209   -23.813 1.00 63.40  ? 94   LEU A CD2 1 
ATOM   689  N N   . GLU A 1 95  ? 6.537   2.729   -28.082 1.00 68.36  ? 95   GLU A N   1 
ATOM   690  C CA  . GLU A 1 95  ? 7.088   1.918   -29.166 1.00 60.95  ? 95   GLU A CA  1 
ATOM   691  C C   . GLU A 1 95  ? 6.796   0.474   -28.817 1.00 53.99  ? 95   GLU A C   1 
ATOM   692  O O   . GLU A 1 95  ? 6.683   0.151   -27.637 1.00 52.02  ? 95   GLU A O   1 
ATOM   693  C CB  . GLU A 1 95  ? 8.593   2.133   -29.283 1.00 57.94  ? 95   GLU A CB  1 
ATOM   694  C CG  . GLU A 1 95  ? 8.969   3.574   -29.516 1.00 68.93  ? 95   GLU A CG  1 
ATOM   695  C CD  . GLU A 1 95  ? 10.358  3.735   -30.088 1.00 72.82  ? 95   GLU A CD  1 
ATOM   696  O OE1 . GLU A 1 95  ? 10.551  3.433   -31.285 1.00 70.19  ? 95   GLU A OE1 1 
ATOM   697  O OE2 . GLU A 1 95  ? 11.257  4.173   -29.340 1.00 84.49  ? 95   GLU A OE2 1 
ATOM   698  N N   . PRO A 1 96  ? 6.640   -0.396  -29.831 1.00 52.91  ? 96   PRO A N   1 
ATOM   699  C CA  . PRO A 1 96  ? 6.350   -1.805  -29.528 1.00 59.58  ? 96   PRO A CA  1 
ATOM   700  C C   . PRO A 1 96  ? 7.423   -2.410  -28.622 1.00 66.34  ? 96   PRO A C   1 
ATOM   701  O O   . PRO A 1 96  ? 8.616   -2.153  -28.815 1.00 56.61  ? 96   PRO A O   1 
ATOM   702  C CB  . PRO A 1 96  ? 6.378   -2.480  -30.903 1.00 56.24  ? 96   PRO A CB  1 
ATOM   703  C CG  . PRO A 1 96  ? 6.093   -1.386  -31.869 1.00 49.43  ? 96   PRO A CG  1 
ATOM   704  C CD  . PRO A 1 96  ? 6.687   -0.136  -31.280 1.00 51.45  ? 96   PRO A CD  1 
ATOM   705  N N   . GLY A 1 97  ? 6.997   -3.184  -27.628 1.00 70.05  ? 97   GLY A N   1 
ATOM   706  C CA  . GLY A 1 97  ? 7.911   -3.738  -26.644 1.00 70.43  ? 97   GLY A CA  1 
ATOM   707  C C   . GLY A 1 97  ? 8.088   -2.886  -25.393 1.00 70.30  ? 97   GLY A C   1 
ATOM   708  O O   . GLY A 1 97  ? 8.625   -3.370  -24.391 1.00 64.88  ? 97   GLY A O   1 
ATOM   709  N N   . ASP A 1 98  ? 7.657   -1.622  -25.452 1.00 65.90  ? 98   ASP A N   1 
ATOM   710  C CA  . ASP A 1 98  ? 7.698   -0.735  -24.288 1.00 50.04  ? 98   ASP A CA  1 
ATOM   711  C C   . ASP A 1 98  ? 6.785   -1.270  -23.207 1.00 60.36  ? 98   ASP A C   1 
ATOM   712  O O   . ASP A 1 98  ? 5.713   -1.805  -23.499 1.00 63.37  ? 98   ASP A O   1 
ATOM   713  C CB  . ASP A 1 98  ? 7.252   0.682   -24.629 1.00 55.14  ? 98   ASP A CB  1 
ATOM   714  C CG  . ASP A 1 98  ? 8.338   1.503   -25.285 1.00 66.86  ? 98   ASP A CG  1 
ATOM   715  O OD1 . ASP A 1 98  ? 9.512   1.058   -25.291 1.00 59.93  ? 98   ASP A OD1 1 
ATOM   716  O OD2 . ASP A 1 98  ? 8.008   2.606   -25.793 1.00 58.86  ? 98   ASP A OD2 1 
ATOM   717  N N   . SER A 1 99  ? 7.218   -1.111  -21.960 1.00 60.64  ? 99   SER A N   1 
ATOM   718  C CA  . SER A 1 99  ? 6.486   -1.586  -20.792 1.00 63.62  ? 99   SER A CA  1 
ATOM   719  C C   . SER A 1 99  ? 5.485   -0.528  -20.326 1.00 51.36  ? 99   SER A C   1 
ATOM   720  O O   . SER A 1 99  ? 5.851   0.618   -20.095 1.00 56.81  ? 99   SER A O   1 
ATOM   721  C CB  . SER A 1 99  ? 7.480   -1.915  -19.673 1.00 53.70  ? 99   SER A CB  1 
ATOM   722  O OG  . SER A 1 99  ? 6.832   -2.044  -18.423 1.00 53.73  ? 99   SER A OG  1 
ATOM   723  N N   . PHE A 1 100 ? 4.233   -0.931  -20.155 1.00 55.61  ? 100  PHE A N   1 
ATOM   724  C CA  . PHE A 1 100 ? 3.126   0.018   -19.966 1.00 62.84  ? 100  PHE A CA  1 
ATOM   725  C C   . PHE A 1 100 ? 2.282   -0.396  -18.760 1.00 57.99  ? 100  PHE A C   1 
ATOM   726  O O   . PHE A 1 100 ? 1.682   -1.482  -18.758 1.00 50.11  ? 100  PHE A O   1 
ATOM   727  C CB  . PHE A 1 100 ? 2.289   0.058   -21.261 1.00 65.60  ? 100  PHE A CB  1 
ATOM   728  C CG  . PHE A 1 100 ? 1.067   0.950   -21.211 1.00 70.30  ? 100  PHE A CG  1 
ATOM   729  C CD1 . PHE A 1 100 ? 1.082   2.164   -20.540 1.00 61.19  ? 100  PHE A CD1 1 
ATOM   730  C CD2 . PHE A 1 100 ? -0.093  0.583   -21.895 1.00 70.31  ? 100  PHE A CD2 1 
ATOM   731  C CE1 . PHE A 1 100 ? -0.047  2.980   -20.524 1.00 60.68  ? 100  PHE A CE1 1 
ATOM   732  C CE2 . PHE A 1 100 ? -1.225  1.396   -21.885 1.00 64.25  ? 100  PHE A CE2 1 
ATOM   733  C CZ  . PHE A 1 100 ? -1.200  2.591   -21.197 1.00 63.17  ? 100  PHE A CZ  1 
ATOM   734  N N   . LEU A 1 101 ? 2.251   0.445   -17.723 1.00 49.81  ? 101  LEU A N   1 
ATOM   735  C CA  . LEU A 1 101 ? 1.464   0.118   -16.535 1.00 55.97  ? 101  LEU A CA  1 
ATOM   736  C C   . LEU A 1 101 ? 0.099   0.799   -16.546 1.00 65.55  ? 101  LEU A C   1 
ATOM   737  O O   . LEU A 1 101 ? 0.000   2.019   -16.641 1.00 65.13  ? 101  LEU A O   1 
ATOM   738  C CB  . LEU A 1 101 ? 2.215   0.468   -15.248 1.00 70.38  ? 101  LEU A CB  1 
ATOM   739  C CG  . LEU A 1 101 ? 1.704   -0.285  -14.020 1.00 69.39  ? 101  LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 101 ? 2.019   -1.749  -14.164 1.00 72.69  ? 101  LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 101 ? 2.313   0.274   -12.752 1.00 73.67  ? 101  LEU A CD2 1 
ATOM   742  N N   . VAL A 1 102 ? -0.952  0.000   -16.417 1.00 64.51  ? 102  VAL A N   1 
ATOM   743  C CA  . VAL A 1 102 ? -2.296  0.493   -16.617 1.00 60.97  ? 102  VAL A CA  1 
ATOM   744  C C   . VAL A 1 102 ? -3.170  0.321   -15.387 1.00 67.60  ? 102  VAL A C   1 
ATOM   745  O O   . VAL A 1 102 ? -3.421  -0.802  -14.953 1.00 77.94  ? 102  VAL A O   1 
ATOM   746  C CB  . VAL A 1 102 ? -2.975  -0.263  -17.759 1.00 53.69  ? 102  VAL A CB  1 
ATOM   747  C CG1 . VAL A 1 102 ? -4.345  0.312   -17.998 1.00 42.61  ? 102  VAL A CG1 1 
ATOM   748  C CG2 . VAL A 1 102 ? -2.124  -0.214  -19.019 1.00 45.42  ? 102  VAL A CG2 1 
ATOM   749  N N   . GLY A 1 103 ? -3.656  1.434   -14.849 1.00 56.50  ? 103  GLY A N   1 
ATOM   750  C CA  . GLY A 1 103 ? -4.614  1.393   -13.761 1.00 59.21  ? 103  GLY A CA  1 
ATOM   751  C C   . GLY A 1 103 ? -6.011  1.013   -14.224 1.00 71.25  ? 103  GLY A C   1 
ATOM   752  O O   . GLY A 1 103 ? -6.811  1.873   -14.591 1.00 78.08  ? 103  GLY A O   1 
ATOM   753  N N   . ALA A 1 104 ? -6.313  -0.279  -14.176 1.00 64.19  ? 104  ALA A N   1 
ATOM   754  C CA  . ALA A 1 104 ? -7.546  -0.812  -14.752 1.00 54.43  ? 104  ALA A CA  1 
ATOM   755  C C   . ALA A 1 104 ? -8.734  -0.914  -13.780 1.00 65.86  ? 104  ALA A C   1 
ATOM   756  O O   . ALA A 1 104 ? -9.265  -2.007  -13.553 1.00 66.39  ? 104  ALA A O   1 
ATOM   757  C CB  . ALA A 1 104 ? -7.264  -2.172  -15.380 1.00 45.46  ? 104  ALA A CB  1 
ATOM   758  N N   . ASN A 1 105 ? -9.162  0.219   -13.229 1.00 64.58  ? 105  ASN A N   1 
ATOM   759  C CA  . ASN A 1 105 ? -10.298 0.251   -12.304 1.00 59.84  ? 105  ASN A CA  1 
ATOM   760  C C   . ASN A 1 105 ? -11.668 0.472   -12.957 1.00 65.87  ? 105  ASN A C   1 
ATOM   761  O O   . ASN A 1 105 ? -12.652 0.732   -12.267 1.00 59.16  ? 105  ASN A O   1 
ATOM   762  C CB  . ASN A 1 105 ? -10.083 1.319   -11.236 1.00 59.95  ? 105  ASN A CB  1 
ATOM   763  C CG  . ASN A 1 105 ? -9.508  2.599   -11.805 1.00 68.13  ? 105  ASN A CG  1 
ATOM   764  O OD1 . ASN A 1 105 ? -8.883  2.592   -12.867 1.00 76.06  ? 105  ASN A OD1 1 
ATOM   765  N ND2 . ASN A 1 105 ? -9.688  3.702   -11.087 1.00 59.42  ? 105  ASN A ND2 1 
ATOM   766  N N   . GLY A 1 106 ? -11.745 0.379   -14.279 1.00 69.98  ? 106  GLY A N   1 
ATOM   767  C CA  . GLY A 1 106 ? -13.020 0.550   -14.959 1.00 65.18  ? 106  GLY A CA  1 
ATOM   768  C C   . GLY A 1 106 ? -12.854 0.395   -16.452 1.00 62.71  ? 106  GLY A C   1 
ATOM   769  O O   . GLY A 1 106 ? -11.828 -0.110  -16.898 1.00 64.30  ? 106  GLY A O   1 
ATOM   770  N N   . ILE A 1 107 ? -13.830 0.836   -17.241 1.00 63.61  ? 107  ILE A N   1 
ATOM   771  C CA  . ILE A 1 107 ? -13.714 0.596   -18.675 1.00 55.97  ? 107  ILE A CA  1 
ATOM   772  C C   . ILE A 1 107 ? -12.497 1.302   -19.266 1.00 53.18  ? 107  ILE A C   1 
ATOM   773  O O   . ILE A 1 107 ? -11.848 0.788   -20.172 1.00 59.91  ? 107  ILE A O   1 
ATOM   774  C CB  . ILE A 1 107 ? -15.020 0.901   -19.463 1.00 51.77  ? 107  ILE A CB  1 
ATOM   775  C CG1 . ILE A 1 107 ? -14.827 0.552   -20.938 1.00 54.27  ? 107  ILE A CG1 1 
ATOM   776  C CG2 . ILE A 1 107 ? -15.446 2.337   -19.295 1.00 35.16  ? 107  ILE A CG2 1 
ATOM   777  C CD1 . ILE A 1 107 ? -15.895 -0.343  -21.499 1.00 60.12  ? 107  ILE A CD1 1 
ATOM   778  N N   . TRP A 1 108 ? -12.136 2.438   -18.692 1.00 42.56  ? 108  TRP A N   1 
ATOM   779  C CA  . TRP A 1 108 ? -11.123 3.268   -19.320 1.00 48.92  ? 108  TRP A CA  1 
ATOM   780  C C   . TRP A 1 108 ? -9.730  2.665   -19.326 1.00 51.66  ? 108  TRP A C   1 
ATOM   781  O O   . TRP A 1 108 ? -9.030  2.704   -20.350 1.00 47.66  ? 108  TRP A O   1 
ATOM   782  C CB  . TRP A 1 108 ? -11.192 4.673   -18.740 1.00 47.78  ? 108  TRP A CB  1 
ATOM   783  C CG  . TRP A 1 108 ? -12.610 5.121   -18.826 1.00 57.92  ? 108  TRP A CG  1 
ATOM   784  C CD1 . TRP A 1 108 ? -13.466 5.336   -17.792 1.00 63.11  ? 108  TRP A CD1 1 
ATOM   785  C CD2 . TRP A 1 108 ? -13.381 5.291   -20.027 1.00 43.74  ? 108  TRP A CD2 1 
ATOM   786  N NE1 . TRP A 1 108 ? -14.704 5.684   -18.270 1.00 55.41  ? 108  TRP A NE1 1 
ATOM   787  C CE2 . TRP A 1 108 ? -14.680 5.662   -19.639 1.00 50.39  ? 108  TRP A CE2 1 
ATOM   788  C CE3 . TRP A 1 108 ? -13.085 5.200   -21.389 1.00 43.81  ? 108  TRP A CE3 1 
ATOM   789  C CZ2 . TRP A 1 108 ? -15.694 5.945   -20.568 1.00 39.85  ? 108  TRP A CZ2 1 
ATOM   790  C CZ3 . TRP A 1 108 ? -14.089 5.470   -22.313 1.00 44.89  ? 108  TRP A CZ3 1 
ATOM   791  C CH2 . TRP A 1 108 ? -15.376 5.840   -21.896 1.00 47.00  ? 108  TRP A CH2 1 
ATOM   792  N N   . GLY A 1 109 ? -9.345  2.079   -18.196 1.00 43.17  ? 109  GLY A N   1 
ATOM   793  C CA  . GLY A 1 109 ? -8.059  1.437   -18.093 1.00 38.58  ? 109  GLY A CA  1 
ATOM   794  C C   . GLY A 1 109 ? -8.091  0.218   -18.977 1.00 46.05  ? 109  GLY A C   1 
ATOM   795  O O   . GLY A 1 109 ? -7.080  -0.156  -19.576 1.00 40.99  ? 109  GLY A O   1 
ATOM   796  N N   . GLN A 1 110 ? -9.264  -0.396  -19.075 1.00 50.88  ? 110  GLN A N   1 
ATOM   797  C CA  . GLN A 1 110 ? -9.422  -1.502  -19.996 1.00 50.16  ? 110  GLN A CA  1 
ATOM   798  C C   . GLN A 1 110 ? -9.096  -1.016  -21.400 1.00 47.49  ? 110  GLN A C   1 
ATOM   799  O O   . GLN A 1 110 ? -8.328  -1.655  -22.128 1.00 45.89  ? 110  GLN A O   1 
ATOM   800  C CB  . GLN A 1 110 ? -10.838 -2.078  -19.937 1.00 51.34  ? 110  GLN A CB  1 
ATOM   801  C CG  . GLN A 1 110 ? -11.162 -2.825  -18.660 1.00 64.74  ? 110  GLN A CG  1 
ATOM   802  C CD  . GLN A 1 110 ? -12.555 -3.426  -18.676 1.00 72.58  ? 110  GLN A CD  1 
ATOM   803  O OE1 . GLN A 1 110 ? -13.458 -2.909  -19.332 1.00 68.61  ? 110  GLN A OE1 1 
ATOM   804  N NE2 . GLN A 1 110 ? -12.733 -4.528  -17.956 1.00 77.14  ? 110  GLN A NE2 1 
ATOM   805  N N   . ARG A 1 111 ? -9.657  0.131   -21.767 1.00 42.14  ? 111  ARG A N   1 
ATOM   806  C CA  . ARG A 1 111 ? -9.497  0.621   -23.127 1.00 40.62  ? 111  ARG A CA  1 
ATOM   807  C C   . ARG A 1 111 ? -8.032  0.974   -23.387 1.00 37.75  ? 111  ARG A C   1 
ATOM   808  O O   . ARG A 1 111 ? -7.503  0.695   -24.464 1.00 36.34  ? 111  ARG A O   1 
ATOM   809  C CB  . ARG A 1 111 ? -10.422 1.818   -23.400 1.00 42.59  ? 111  ARG A CB  1 
ATOM   810  C CG  . ARG A 1 111 ? -11.927 1.482   -23.399 1.00 39.82  ? 111  ARG A CG  1 
ATOM   811  C CD  . ARG A 1 111 ? -12.347 0.689   -24.639 1.00 44.68  ? 111  ARG A CD  1 
ATOM   812  N NE  . ARG A 1 111 ? -13.608 -0.031  -24.444 1.00 45.65  ? 111  ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 111 ? -14.772 0.358   -24.949 1.00 52.94  ? 111  ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 111 ? -14.822 1.464   -25.667 1.00 46.59  ? 111  ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 111 ? -15.879 -0.354  -24.742 1.00 55.29  ? 111  ARG A NH2 1 
ATOM   816  N N   . ALA A 1 112 ? -7.373  1.575   -22.401 1.00 41.82  ? 112  ALA A N   1 
ATOM   817  C CA  . ALA A 1 112 ? -5.940  1.859   -22.525 1.00 52.21  ? 112  ALA A CA  1 
ATOM   818  C C   . ALA A 1 112 ? -5.157  0.565   -22.743 1.00 53.48  ? 112  ALA A C   1 
ATOM   819  O O   . ALA A 1 112 ? -4.220  0.511   -23.546 1.00 53.41  ? 112  ALA A O   1 
ATOM   820  C CB  . ALA A 1 112 ? -5.416  2.596   -21.300 1.00 48.55  ? 112  ALA A CB  1 
ATOM   821  N N   . ALA A 1 113 ? -5.554  -0.479  -22.030 1.00 46.90  ? 113  ALA A N   1 
ATOM   822  C CA  . ALA A 1 113 ? -4.851  -1.744  -22.133 1.00 60.36  ? 113  ALA A CA  1 
ATOM   823  C C   . ALA A 1 113 ? -5.068  -2.337  -23.513 1.00 61.72  ? 113  ALA A C   1 
ATOM   824  O O   . ALA A 1 113 ? -4.119  -2.802  -24.153 1.00 61.41  ? 113  ALA A O   1 
ATOM   825  C CB  . ALA A 1 113 ? -5.311  -2.717  -21.040 1.00 50.26  ? 113  ALA A CB  1 
ATOM   826  N N   . ASP A 1 114 ? -6.322  -2.318  -23.962 1.00 61.50  ? 114  ASP A N   1 
ATOM   827  C CA  . ASP A 1 114 ? -6.676  -2.837  -25.275 1.00 51.56  ? 114  ASP A CA  1 
ATOM   828  C C   . ASP A 1 114 ? -5.796  -2.146  -26.326 1.00 47.35  ? 114  ASP A C   1 
ATOM   829  O O   . ASP A 1 114 ? -5.058  -2.793  -27.072 1.00 40.67  ? 114  ASP A O   1 
ATOM   830  C CB  . ASP A 1 114 ? -8.171  -2.616  -25.542 1.00 50.05  ? 114  ASP A CB  1 
ATOM   831  C CG  . ASP A 1 114 ? -8.670  -3.370  -26.768 1.00 49.53  ? 114  ASP A CG  1 
ATOM   832  O OD1 . ASP A 1 114 ? -7.899  -3.500  -27.730 1.00 54.76  ? 114  ASP A OD1 1 
ATOM   833  O OD2 . ASP A 1 114 ? -9.831  -3.829  -26.789 1.00 52.90  ? 114  ASP A OD2 1 
ATOM   834  N N   . ILE A 1 115 ? -5.849  -0.824  -26.356 1.00 48.81  ? 115  ILE A N   1 
ATOM   835  C CA  . ILE A 1 115 ? -4.992  -0.063  -27.254 1.00 47.91  ? 115  ILE A CA  1 
ATOM   836  C C   . ILE A 1 115 ? -3.521  -0.467  -27.104 1.00 47.94  ? 115  ILE A C   1 
ATOM   837  O O   . ILE A 1 115 ? -2.820  -0.682  -28.097 1.00 48.06  ? 115  ILE A O   1 
ATOM   838  C CB  . ILE A 1 115 ? -5.165  1.438   -27.009 1.00 49.27  ? 115  ILE A CB  1 
ATOM   839  C CG1 . ILE A 1 115 ? -6.568  1.876   -27.454 1.00 49.54  ? 115  ILE A CG1 1 
ATOM   840  C CG2 . ILE A 1 115 ? -4.095  2.215   -27.734 1.00 48.93  ? 115  ILE A CG2 1 
ATOM   841  C CD1 . ILE A 1 115 ? -6.963  3.274   -27.004 1.00 45.01  ? 115  ILE A CD1 1 
ATOM   842  N N   . GLY A 1 116 ? -3.080  -0.603  -25.855 1.00 55.51  ? 116  GLY A N   1 
ATOM   843  C CA  . GLY A 1 116 ? -1.712  -0.985  -25.542 1.00 57.14  ? 116  GLY A CA  1 
ATOM   844  C C   . GLY A 1 116 ? -1.288  -2.283  -26.204 1.00 56.70  ? 116  GLY A C   1 
ATOM   845  O O   . GLY A 1 116 ? -0.219  -2.360  -26.815 1.00 41.15  ? 116  GLY A O   1 
ATOM   846  N N   . GLU A 1 117 ? -2.129  -3.307  -26.088 1.00 60.06  ? 117  GLU A N   1 
ATOM   847  C CA  . GLU A 1 117 ? -1.844  -4.582  -26.734 1.00 63.85  ? 117  GLU A CA  1 
ATOM   848  C C   . GLU A 1 117 ? -1.758  -4.404  -28.242 1.00 55.27  ? 117  GLU A C   1 
ATOM   849  O O   . GLU A 1 117 ? -0.804  -4.877  -28.882 1.00 40.28  ? 117  GLU A O   1 
ATOM   850  C CB  . GLU A 1 117 ? -2.898  -5.632  -26.371 1.00 71.06  ? 117  GLU A CB  1 
ATOM   851  C CG  . GLU A 1 117 ? -2.634  -6.331  -25.046 1.00 87.69  ? 117  GLU A CG  1 
ATOM   852  C CD  . GLU A 1 117 ? -3.909  -6.786  -24.350 1.00 101.65 ? 117  GLU A CD  1 
ATOM   853  O OE1 . GLU A 1 117 ? -5.016  -6.429  -24.822 1.00 105.55 ? 117  GLU A OE1 1 
ATOM   854  O OE2 . GLU A 1 117 ? -3.805  -7.497  -23.324 1.00 103.43 ? 117  GLU A OE2 1 
ATOM   855  N N   . ARG A 1 118 ? -2.741  -3.689  -28.792 1.00 51.59  ? 118  ARG A N   1 
ATOM   856  C CA  . ARG A 1 118 ? -2.858  -3.511  -30.236 1.00 46.59  ? 118  ARG A CA  1 
ATOM   857  C C   . ARG A 1 118 ? -1.612  -2.890  -30.838 1.00 45.18  ? 118  ARG A C   1 
ATOM   858  O O   . ARG A 1 118 ? -1.214  -3.252  -31.938 1.00 46.28  ? 118  ARG A O   1 
ATOM   859  C CB  . ARG A 1 118 ? -4.077  -2.658  -30.591 1.00 48.56  ? 118  ARG A CB  1 
ATOM   860  C CG  . ARG A 1 118 ? -5.400  -3.387  -30.530 1.00 46.34  ? 118  ARG A CG  1 
ATOM   861  C CD  . ARG A 1 118 ? -6.521  -2.456  -30.921 1.00 48.99  ? 118  ARG A CD  1 
ATOM   862  N NE  . ARG A 1 118 ? -7.832  -3.050  -30.701 1.00 43.19  ? 118  ARG A NE  1 
ATOM   863  C CZ  . ARG A 1 118 ? -8.518  -3.688  -31.640 1.00 45.17  ? 118  ARG A CZ  1 
ATOM   864  N NH1 . ARG A 1 118 ? -8.013  -3.809  -32.858 1.00 38.25  ? 118  ARG A NH1 1 
ATOM   865  N NH2 . ARG A 1 118 ? -9.707  -4.200  -31.363 1.00 57.22  ? 118  ARG A NH2 1 
ATOM   866  N N   . ILE A 1 119 ? -0.995  -1.957  -30.122 1.00 46.84  ? 119  ILE A N   1 
ATOM   867  C CA  . ILE A 1 119 ? 0.203   -1.310  -30.640 1.00 43.07  ? 119  ILE A CA  1 
ATOM   868  C C   . ILE A 1 119 ? 1.486   -1.973  -30.139 1.00 52.23  ? 119  ILE A C   1 
ATOM   869  O O   . ILE A 1 119 ? 2.590   -1.425  -30.288 1.00 47.72  ? 119  ILE A O   1 
ATOM   870  C CB  . ILE A 1 119 ? 0.225   0.185   -30.342 1.00 51.23  ? 119  ILE A CB  1 
ATOM   871  C CG1 . ILE A 1 119 ? 0.216   0.429   -28.836 1.00 47.47  ? 119  ILE A CG1 1 
ATOM   872  C CG2 . ILE A 1 119 ? -0.968  0.874   -30.984 1.00 44.34  ? 119  ILE A CG2 1 
ATOM   873  C CD1 . ILE A 1 119 ? 0.569   1.847   -28.477 1.00 46.29  ? 119  ILE A CD1 1 
ATOM   874  N N   . GLY A 1 120 ? 1.316   -3.149  -29.539 1.00 49.59  ? 120  GLY A N   1 
ATOM   875  C CA  . GLY A 1 120 ? 2.418   -4.049  -29.246 1.00 56.88  ? 120  GLY A CA  1 
ATOM   876  C C   . GLY A 1 120 ? 3.274   -3.659  -28.063 1.00 59.64  ? 120  GLY A C   1 
ATOM   877  O O   . GLY A 1 120 ? 4.482   -3.905  -28.049 1.00 60.33  ? 120  GLY A O   1 
ATOM   878  N N   . ALA A 1 121 ? 2.657   -3.038  -27.068 1.00 55.29  ? 121  ALA A N   1 
ATOM   879  C CA  . ALA A 1 121 ? 3.372   -2.719  -25.845 1.00 63.75  ? 121  ALA A CA  1 
ATOM   880  C C   . ALA A 1 121 ? 3.275   -3.940  -24.948 1.00 71.44  ? 121  ALA A C   1 
ATOM   881  O O   . ALA A 1 121 ? 2.423   -4.802  -25.177 1.00 83.91  ? 121  ALA A O   1 
ATOM   882  C CB  . ALA A 1 121 ? 2.756   -1.503  -25.160 1.00 61.68  ? 121  ALA A CB  1 
ATOM   883  N N   . ARG A 1 122 ? 4.143   -4.012  -23.940 1.00 56.15  ? 122  ARG A N   1 
ATOM   884  C CA  . ARG A 1 122 ? 4.056   -5.041  -22.905 1.00 67.84  ? 122  ARG A CA  1 
ATOM   885  C C   . ARG A 1 122 ? 3.184   -4.501  -21.780 1.00 62.25  ? 122  ARG A C   1 
ATOM   886  O O   . ARG A 1 122 ? 3.644   -3.747  -20.908 1.00 55.59  ? 122  ARG A O   1 
ATOM   887  C CB  . ARG A 1 122 ? 5.449   -5.432  -22.374 1.00 75.24  ? 122  ARG A CB  1 
ATOM   888  C CG  . ARG A 1 122 ? 6.429   -6.026  -23.417 1.00 96.31  ? 122  ARG A CG  1 
ATOM   889  C CD  . ARG A 1 122 ? 6.144   -7.501  -23.778 1.00 109.62 ? 122  ARG A CD  1 
ATOM   890  N NE  . ARG A 1 122 ? 6.215   -8.416  -22.636 1.00 120.47 ? 122  ARG A NE  1 
ATOM   891  C CZ  . ARG A 1 122 ? 5.263   -9.292  -22.306 1.00 123.45 ? 122  ARG A CZ  1 
ATOM   892  N NH1 . ARG A 1 122 ? 4.150   -9.381  -23.032 1.00 125.10 ? 122  ARG A NH1 1 
ATOM   893  N NH2 . ARG A 1 122 ? 5.426   -10.081 -21.246 1.00 115.80 ? 122  ARG A NH2 1 
ATOM   894  N N   . VAL A 1 123 ? 1.919   -4.902  -21.809 1.00 61.62  ? 123  VAL A N   1 
ATOM   895  C CA  . VAL A 1 123 ? 0.890   -4.249  -21.011 1.00 66.82  ? 123  VAL A CA  1 
ATOM   896  C C   . VAL A 1 123 ? 0.729   -4.901  -19.656 1.00 65.52  ? 123  VAL A C   1 
ATOM   897  O O   . VAL A 1 123 ? 0.407   -6.084  -19.574 1.00 76.02  ? 123  VAL A O   1 
ATOM   898  C CB  . VAL A 1 123 ? -0.477  -4.285  -21.754 1.00 65.70  ? 123  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 123 ? -1.584  -3.623  -20.916 1.00 50.80  ? 123  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 123 ? -0.346  -3.642  -23.135 1.00 49.76  ? 123  VAL A CG2 1 
ATOM   901  N N   . HIS A 1 124 ? 0.941   -4.136  -18.591 1.00 58.79  ? 124  HIS A N   1 
ATOM   902  C CA  . HIS A 1 124 ? 0.783   -4.684  -17.247 1.00 69.04  ? 124  HIS A CA  1 
ATOM   903  C C   . HIS A 1 124 ? -0.370  -4.014  -16.498 1.00 73.38  ? 124  HIS A C   1 
ATOM   904  O O   . HIS A 1 124 ? -0.250  -2.885  -16.011 1.00 76.01  ? 124  HIS A O   1 
ATOM   905  C CB  . HIS A 1 124 ? 2.083   -4.593  -16.424 1.00 67.67  ? 124  HIS A CB  1 
ATOM   906  C CG  . HIS A 1 124 ? 3.304   -5.042  -17.160 1.00 64.42  ? 124  HIS A CG  1 
ATOM   907  N ND1 . HIS A 1 124 ? 4.298   -4.170  -17.553 1.00 73.16  ? 124  HIS A ND1 1 
ATOM   908  C CD2 . HIS A 1 124 ? 3.691   -6.269  -17.584 1.00 68.47  ? 124  HIS A CD2 1 
ATOM   909  C CE1 . HIS A 1 124 ? 5.249   -4.841  -18.179 1.00 71.99  ? 124  HIS A CE1 1 
ATOM   910  N NE2 . HIS A 1 124 ? 4.905   -6.117  -18.213 1.00 70.45  ? 124  HIS A NE2 1 
ATOM   911  N N   . PRO A 1 125 ? -1.496  -4.720  -16.398 1.00 66.60  ? 125  PRO A N   1 
ATOM   912  C CA  . PRO A 1 125 ? -2.702  -4.149  -15.800 1.00 67.14  ? 125  PRO A CA  1 
ATOM   913  C C   . PRO A 1 125 ? -2.809  -4.315  -14.294 1.00 74.40  ? 125  PRO A C   1 
ATOM   914  O O   . PRO A 1 125 ? -2.929  -5.444  -13.811 1.00 83.63  ? 125  PRO A O   1 
ATOM   915  C CB  . PRO A 1 125 ? -3.828  -4.920  -16.493 1.00 60.89  ? 125  PRO A CB  1 
ATOM   916  C CG  . PRO A 1 125 ? -3.228  -6.214  -16.872 1.00 60.95  ? 125  PRO A CG  1 
ATOM   917  C CD  . PRO A 1 125 ? -1.764  -5.975  -17.120 1.00 64.60  ? 125  PRO A CD  1 
ATOM   918  N N   . MET A 1 126 ? -2.781  -3.195  -13.571 1.00 67.82  ? 126  MET A N   1 
ATOM   919  C CA  . MET A 1 126 ? -3.112  -3.185  -12.150 1.00 67.95  ? 126  MET A CA  1 
ATOM   920  C C   . MET A 1 126 ? -4.617  -3.210  -12.035 1.00 76.62  ? 126  MET A C   1 
ATOM   921  O O   . MET A 1 126 ? -5.269  -2.158  -12.046 1.00 83.70  ? 126  MET A O   1 
ATOM   922  C CB  . MET A 1 126 ? -2.616  -1.910  -11.461 1.00 71.46  ? 126  MET A CB  1 
ATOM   923  C CG  . MET A 1 126 ? -1.148  -1.817  -11.199 1.00 47.69  ? 126  MET A CG  1 
ATOM   924  S SD  . MET A 1 126 ? -0.754  -0.292  -10.332 1.00 88.41  ? 126  MET A SD  1 
ATOM   925  C CE  . MET A 1 126 ? -1.414  0.965   -11.423 1.00 79.30  ? 126  MET A CE  1 
ATOM   926  N N   . THR A 1 127 ? -5.187  -4.397  -11.923 1.00 69.06  ? 127  THR A N   1 
ATOM   927  C CA  . THR A 1 127 ? -6.635  -4.484  -11.952 1.00 60.71  ? 127  THR A CA  1 
ATOM   928  C C   . THR A 1 127 ? -7.284  -4.311  -10.572 1.00 77.38  ? 127  THR A C   1 
ATOM   929  O O   . THR A 1 127 ? -6.851  -4.903  -9.573  1.00 85.68  ? 127  THR A O   1 
ATOM   930  C CB  . THR A 1 127 ? -7.077  -5.849  -12.532 1.00 66.10  ? 127  THR A CB  1 
ATOM   931  O OG1 . THR A 1 127 ? -6.197  -6.223  -13.595 1.00 72.88  ? 127  THR A OG1 1 
ATOM   932  C CG2 . THR A 1 127 ? -8.513  -5.780  -13.046 1.00 70.98  ? 127  THR A CG2 1 
ATOM   933  N N   . LYS A 1 128 ? -8.357  -3.528  -10.531 1.00 80.21  ? 128  LYS A N   1 
ATOM   934  C CA  . LYS A 1 128 ? -9.163  -3.377  -9.326  1.00 74.46  ? 128  LYS A CA  1 
ATOM   935  C C   . LYS A 1 128 ? -10.639 -3.531  -9.652  1.00 78.40  ? 128  LYS A C   1 
ATOM   936  O O   . LYS A 1 128 ? -11.081 -3.223  -10.757 1.00 86.54  ? 128  LYS A O   1 
ATOM   937  C CB  . LYS A 1 128 ? -8.916  -2.019  -8.658  1.00 72.24  ? 128  LYS A CB  1 
ATOM   938  C CG  . LYS A 1 128 ? -7.765  -2.043  -7.664  1.00 82.42  ? 128  LYS A CG  1 
ATOM   939  C CD  . LYS A 1 128 ? -7.833  -0.893  -6.657  1.00 91.34  ? 128  LYS A CD  1 
ATOM   940  C CE  . LYS A 1 128 ? -6.613  -0.902  -5.728  1.00 101.54 ? 128  LYS A CE  1 
ATOM   941  N NZ  . LYS A 1 128 ? -6.557  -2.115  -4.860  1.00 105.68 ? 128  LYS A NZ  1 
ATOM   942  N N   . ASP A 1 129 ? -11.390 -4.019  -8.676  1.00 82.65  ? 129  ASP A N   1 
ATOM   943  C CA  . ASP A 1 129 ? -12.833 -4.106  -8.767  1.00 86.88  ? 129  ASP A CA  1 
ATOM   944  C C   . ASP A 1 129 ? -13.412 -2.719  -9.005  1.00 82.60  ? 129  ASP A C   1 
ATOM   945  O O   . ASP A 1 129 ? -12.829 -1.719  -8.576  1.00 82.01  ? 129  ASP A O   1 
ATOM   946  C CB  . ASP A 1 129 ? -13.389 -4.702  -7.476  1.00 90.91  ? 129  ASP A CB  1 
ATOM   947  C CG  . ASP A 1 129 ? -13.515 -6.205  -7.544  1.00 91.77  ? 129  ASP A CG  1 
ATOM   948  O OD1 . ASP A 1 129 ? -12.969 -6.804  -8.496  1.00 90.59  ? 129  ASP A OD1 1 
ATOM   949  O OD2 . ASP A 1 129 ? -14.166 -6.787  -6.654  1.00 87.29  ? 129  ASP A OD2 1 
ATOM   950  N N   . PRO A 1 130 ? -14.549 -2.651  -9.713  1.00 77.31  ? 130  PRO A N   1 
ATOM   951  C CA  . PRO A 1 130 ? -15.174 -1.350  -9.968  1.00 75.89  ? 130  PRO A CA  1 
ATOM   952  C C   . PRO A 1 130 ? -15.556 -0.685  -8.660  1.00 72.64  ? 130  PRO A C   1 
ATOM   953  O O   . PRO A 1 130 ? -16.285 -1.264  -7.856  1.00 74.32  ? 130  PRO A O   1 
ATOM   954  C CB  . PRO A 1 130 ? -16.425 -1.708  -10.770 1.00 79.29  ? 130  PRO A CB  1 
ATOM   955  C CG  . PRO A 1 130 ? -16.676 -3.147  -10.476 1.00 81.18  ? 130  PRO A CG  1 
ATOM   956  C CD  . PRO A 1 130 ? -15.325 -3.761  -10.288 1.00 78.00  ? 130  PRO A CD  1 
ATOM   957  N N   . GLY A 1 131 ? -15.055 0.525   -8.455  1.00 73.32  ? 131  GLY A N   1 
ATOM   958  C CA  . GLY A 1 131 ? -15.197 1.201   -7.182  1.00 67.81  ? 131  GLY A CA  1 
ATOM   959  C C   . GLY A 1 131 ? -13.821 1.448   -6.603  1.00 63.85  ? 131  GLY A C   1 
ATOM   960  O O   . GLY A 1 131 ? -13.651 2.284   -5.724  1.00 55.63  ? 131  GLY A O   1 
ATOM   961  N N   . GLY A 1 132 ? -12.826 0.736   -7.123  1.00 68.47  ? 132  GLY A N   1 
ATOM   962  C CA  . GLY A 1 132 ? -11.484 0.812   -6.574  1.00 68.54  ? 132  GLY A CA  1 
ATOM   963  C C   . GLY A 1 132 ? -10.734 2.051   -7.019  1.00 75.23  ? 132  GLY A C   1 
ATOM   964  O O   . GLY A 1 132 ? -11.025 2.617   -8.069  1.00 85.28  ? 132  GLY A O   1 
ATOM   965  N N   . HIS A 1 133 ? -9.768  2.481   -6.217  1.00 81.27  ? 133  HIS A N   1 
ATOM   966  C CA  . HIS A 1 133 ? -8.855  3.536   -6.643  1.00 89.74  ? 133  HIS A CA  1 
ATOM   967  C C   . HIS A 1 133 ? -7.400  3.131   -6.363  1.00 94.59  ? 133  HIS A C   1 
ATOM   968  O O   . HIS A 1 133 ? -7.150  2.090   -5.764  1.00 95.20  ? 133  HIS A O   1 
ATOM   969  C CB  . HIS A 1 133 ? -9.222  4.882   -6.010  1.00 82.52  ? 133  HIS A CB  1 
ATOM   970  C CG  . HIS A 1 133 ? -8.697  5.071   -4.623  1.00 81.54  ? 133  HIS A CG  1 
ATOM   971  N ND1 . HIS A 1 133 ? -9.408  4.704   -3.501  1.00 79.89  ? 133  HIS A ND1 1 
ATOM   972  C CD2 . HIS A 1 133 ? -7.540  5.614   -4.176  1.00 85.24  ? 133  HIS A CD2 1 
ATOM   973  C CE1 . HIS A 1 133 ? -8.708  5.006   -2.423  1.00 88.35  ? 133  HIS A CE1 1 
ATOM   974  N NE2 . HIS A 1 133 ? -7.569  5.556   -2.805  1.00 94.87  ? 133  HIS A NE2 1 
ATOM   975  N N   . TYR A 1 134 ? -6.438  3.932   -6.802  1.00 84.39  ? 134  TYR A N   1 
ATOM   976  C CA  . TYR A 1 134 ? -5.046  3.525   -6.657  1.00 79.95  ? 134  TYR A CA  1 
ATOM   977  C C   . TYR A 1 134 ? -4.230  4.376   -5.685  1.00 89.24  ? 134  TYR A C   1 
ATOM   978  O O   . TYR A 1 134 ? -4.232  5.610   -5.748  1.00 87.21  ? 134  TYR A O   1 
ATOM   979  C CB  . TYR A 1 134 ? -4.367  3.435   -8.024  1.00 73.32  ? 134  TYR A CB  1 
ATOM   980  C CG  . TYR A 1 134 ? -4.984  2.381   -8.921  1.00 81.58  ? 134  TYR A CG  1 
ATOM   981  C CD1 . TYR A 1 134 ? -4.711  1.030   -8.723  1.00 78.50  ? 134  TYR A CD1 1 
ATOM   982  C CD2 . TYR A 1 134 ? -5.858  2.732   -9.954  1.00 76.51  ? 134  TYR A CD2 1 
ATOM   983  C CE1 . TYR A 1 134 ? -5.273  0.055   -9.541  1.00 72.19  ? 134  TYR A CE1 1 
ATOM   984  C CE2 . TYR A 1 134 ? -6.433  1.766   -10.767 1.00 67.96  ? 134  TYR A CE2 1 
ATOM   985  C CZ  . TYR A 1 134 ? -6.135  0.430   -10.556 1.00 74.69  ? 134  TYR A CZ  1 
ATOM   986  O OH  . TYR A 1 134 ? -6.707  -0.528  -11.360 1.00 72.19  ? 134  TYR A OH  1 
ATOM   987  N N   . THR A 1 135 ? -3.525  3.699   -4.785  1.00 96.93  ? 135  THR A N   1 
ATOM   988  C CA  . THR A 1 135 ? -2.679  4.382   -3.814  1.00 93.82  ? 135  THR A CA  1 
ATOM   989  C C   . THR A 1 135 ? -1.282  4.603   -4.370  1.00 88.51  ? 135  THR A C   1 
ATOM   990  O O   . THR A 1 135 ? -0.817  3.848   -5.228  1.00 90.68  ? 135  THR A O   1 
ATOM   991  C CB  . THR A 1 135 ? -2.557  3.576   -2.521  1.00 85.71  ? 135  THR A CB  1 
ATOM   992  O OG1 . THR A 1 135 ? -2.136  2.251   -2.850  1.00 83.36  ? 135  THR A OG1 1 
ATOM   993  C CG2 . THR A 1 135 ? -3.910  3.494   -1.806  1.00 79.48  ? 135  THR A CG2 1 
ATOM   994  N N   . LEU A 1 136 ? -0.622  5.642   -3.864  1.00 88.09  ? 136  LEU A N   1 
ATOM   995  C CA  . LEU A 1 136 ? 0.766   5.948   -4.197  1.00 91.22  ? 136  LEU A CA  1 
ATOM   996  C C   . LEU A 1 136 ? 1.643   4.687   -4.198  1.00 97.76  ? 136  LEU A C   1 
ATOM   997  O O   . LEU A 1 136 ? 2.515   4.520   -5.043  1.00 93.42  ? 136  LEU A O   1 
ATOM   998  C CB  . LEU A 1 136 ? 1.325   6.936   -3.175  1.00 89.34  ? 136  LEU A CB  1 
ATOM   999  C CG  . LEU A 1 136 ? 1.646   8.387   -3.558  1.00 80.29  ? 136  LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 136 ? 1.450   8.695   -5.036  1.00 73.10  ? 136  LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 136 ? 0.843   9.336   -2.677  1.00 76.22  ? 136  LEU A CD2 1 
ATOM   1002 N N   . GLN A 1 137 ? 1.374   3.788   -3.258  1.00 98.62  ? 137  GLN A N   1 
ATOM   1003 C CA  . GLN A 1 137 ? 2.174   2.583   -3.079  1.00 102.65 ? 137  GLN A CA  1 
ATOM   1004 C C   . GLN A 1 137 ? 1.963   1.509   -4.154  1.00 90.39  ? 137  GLN A C   1 
ATOM   1005 O O   . GLN A 1 137 ? 2.935   0.941   -4.677  1.00 86.44  ? 137  GLN A O   1 
ATOM   1006 C CB  . GLN A 1 137 ? 1.938   2.012   -1.686  1.00 123.01 ? 137  GLN A CB  1 
ATOM   1007 C CG  . GLN A 1 137 ? 0.483   1.710   -1.384  1.00 134.71 ? 137  GLN A CG  1 
ATOM   1008 C CD  . GLN A 1 137 ? 0.136   0.245   -1.585  1.00 140.29 ? 137  GLN A CD  1 
ATOM   1009 O OE1 . GLN A 1 137 ? 0.984   -0.632  -1.517  1.00 135.39 ? 137  GLN A OE1 1 
ATOM   1010 N NE2 . GLN A 1 137 ? -1.119  -0.020  -1.808  1.00 146.78 ? 137  GLN A NE2 1 
ATOM   1011 N N   . GLU A 1 138 ? 0.703   1.207   -4.459  1.00 84.73  ? 138  GLU A N   1 
ATOM   1012 C CA  . GLU A 1 138 ? 0.365   0.209   -5.481  1.00 84.07  ? 138  GLU A CA  1 
ATOM   1013 C C   . GLU A 1 138 ? 1.059   0.554   -6.779  1.00 88.73  ? 138  GLU A C   1 
ATOM   1014 O O   . GLU A 1 138 ? 1.471   -0.334  -7.529  1.00 85.20  ? 138  GLU A O   1 
ATOM   1015 C CB  . GLU A 1 138 ? -1.153  0.119   -5.707  1.00 81.47  ? 138  GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 138 ? -1.767  -1.093  -5.046  1.00 80.96  ? 138  GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 138 ? -3.028  -0.735  -4.285  1.00 92.91  ? 138  GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 138 ? -3.117  0.425   -3.823  1.00 103.33 ? 138  GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 138 ? -3.934  -1.588  -4.143  1.00 88.76  ? 138  GLU A OE2 1 
ATOM   1020 N N   . VAL A 1 139 ? 1.195   1.856   -7.017  1.00 96.64  ? 139  VAL A N   1 
ATOM   1021 C CA  . VAL A 1 139 ? 1.870   2.372   -8.186  1.00 89.48  ? 139  VAL A CA  1 
ATOM   1022 C C   . VAL A 1 139 ? 3.386   2.250   -8.057  1.00 82.86  ? 139  VAL A C   1 
ATOM   1023 O O   . VAL A 1 139 ? 4.041   1.759   -8.978  1.00 71.40  ? 139  VAL A O   1 
ATOM   1024 C CB  . VAL A 1 139 ? 1.423   3.820   -8.492  1.00 85.82  ? 139  VAL A CB  1 
ATOM   1025 C CG1 . VAL A 1 139 ? 2.320   4.444   -9.572  1.00 89.78  ? 139  VAL A CG1 1 
ATOM   1026 C CG2 . VAL A 1 139 ? -0.035  3.843   -8.907  1.00 80.32  ? 139  VAL A CG2 1 
ATOM   1027 N N   . GLU A 1 140 ? 3.939   2.659   -6.916  1.00 82.26  ? 140  GLU A N   1 
ATOM   1028 C CA  . GLU A 1 140 ? 5.366   2.435   -6.658  1.00 84.97  ? 140  GLU A CA  1 
ATOM   1029 C C   . GLU A 1 140 ? 5.674   0.942   -6.851  1.00 81.09  ? 140  GLU A C   1 
ATOM   1030 O O   . GLU A 1 140 ? 6.613   0.583   -7.571  1.00 76.67  ? 140  GLU A O   1 
ATOM   1031 C CB  . GLU A 1 140 ? 5.800   2.933   -5.261  1.00 80.39  ? 140  GLU A CB  1 
ATOM   1032 C CG  . GLU A 1 140 ? 7.233   2.528   -4.855  1.00 74.18  ? 140  GLU A CG  1 
ATOM   1033 C CD  . GLU A 1 140 ? 8.017   3.639   -4.133  1.00 78.05  ? 140  GLU A CD  1 
ATOM   1034 O OE1 . GLU A 1 140 ? 7.499   4.214   -3.151  1.00 78.02  ? 140  GLU A OE1 1 
ATOM   1035 O OE2 . GLU A 1 140 ? 9.162   3.936   -4.543  1.00 75.01  ? 140  GLU A OE2 1 
ATOM   1036 N N   . GLU A 1 141 ? 4.832   0.084   -6.272  1.00 72.23  ? 141  GLU A N   1 
ATOM   1037 C CA  . GLU A 1 141 ? 4.975   -1.374  -6.401  1.00 72.77  ? 141  GLU A CA  1 
ATOM   1038 C C   . GLU A 1 141 ? 4.962   -1.867  -7.847  1.00 77.00  ? 141  GLU A C   1 
ATOM   1039 O O   . GLU A 1 141 ? 5.887   -2.552  -8.296  1.00 76.81  ? 141  GLU A O   1 
ATOM   1040 C CB  . GLU A 1 141 ? 3.871   -2.074  -5.608  1.00 92.28  ? 141  GLU A CB  1 
ATOM   1041 C CG  . GLU A 1 141 ? 3.773   -3.574  -5.826  1.00 105.60 ? 141  GLU A CG  1 
ATOM   1042 C CD  . GLU A 1 141 ? 2.867   -4.251  -4.809  1.00 114.02 ? 141  GLU A CD  1 
ATOM   1043 O OE1 . GLU A 1 141 ? 3.062   -4.044  -3.592  1.00 115.11 ? 141  GLU A OE1 1 
ATOM   1044 O OE2 . GLU A 1 141 ? 1.950   -4.986  -5.226  1.00 115.50 ? 141  GLU A OE2 1 
ATOM   1045 N N   . GLY A 1 142 ? 3.909   -1.514  -8.579  1.00 81.61  ? 142  GLY A N   1 
ATOM   1046 C CA  . GLY A 1 142 ? 3.824   -1.855  -9.986  1.00 64.15  ? 142  GLY A CA  1 
ATOM   1047 C C   . GLY A 1 142 ? 4.953   -1.227  -10.777 1.00 55.36  ? 142  GLY A C   1 
ATOM   1048 O O   . GLY A 1 142 ? 5.469   -1.832  -11.718 1.00 59.58  ? 142  GLY A O   1 
ATOM   1049 N N   . LEU A 1 143 ? 5.334   -0.008  -10.397 1.00 63.54  ? 143  LEU A N   1 
ATOM   1050 C CA  . LEU A 1 143 ? 6.453   0.675   -11.043 1.00 80.51  ? 143  LEU A CA  1 
ATOM   1051 C C   . LEU A 1 143 ? 7.780   -0.036  -10.798 1.00 88.35  ? 143  LEU A C   1 
ATOM   1052 O O   . LEU A 1 143 ? 8.586   -0.206  -11.719 1.00 90.38  ? 143  LEU A O   1 
ATOM   1053 C CB  . LEU A 1 143 ? 6.562   2.143   -10.594 1.00 90.20  ? 143  LEU A CB  1 
ATOM   1054 C CG  . LEU A 1 143 ? 5.743   3.215   -11.334 1.00 87.12  ? 143  LEU A CG  1 
ATOM   1055 C CD1 . LEU A 1 143 ? 6.491   4.538   -11.374 1.00 87.37  ? 143  LEU A CD1 1 
ATOM   1056 C CD2 . LEU A 1 143 ? 5.395   2.765   -12.750 1.00 79.38  ? 143  LEU A CD2 1 
ATOM   1057 N N   . ALA A 1 144 ? 8.009   -0.441  -9.554  1.00 86.26  ? 144  ALA A N   1 
ATOM   1058 C CA  . ALA A 1 144 ? 9.246   -1.123  -9.195  1.00 82.66  ? 144  ALA A CA  1 
ATOM   1059 C C   . ALA A 1 144 ? 9.338   -2.478  -9.901  1.00 86.85  ? 144  ALA A C   1 
ATOM   1060 O O   . ALA A 1 144 ? 10.393  -2.846  -10.430 1.00 81.96  ? 144  ALA A O   1 
ATOM   1061 C CB  . ALA A 1 144 ? 9.332   -1.296  -7.686  1.00 73.50  ? 144  ALA A CB  1 
ATOM   1062 N N   . GLN A 1 145 ? 8.227   -3.208  -9.927  1.00 85.13  ? 145  GLN A N   1 
ATOM   1063 C CA  . GLN A 1 145 ? 8.211   -4.523  -10.562 1.00 78.93  ? 145  GLN A CA  1 
ATOM   1064 C C   . GLN A 1 145 ? 8.416   -4.494  -12.084 1.00 79.70  ? 145  GLN A C   1 
ATOM   1065 O O   . GLN A 1 145 ? 9.272   -5.209  -12.600 1.00 79.24  ? 145  GLN A O   1 
ATOM   1066 C CB  . GLN A 1 145 ? 6.927   -5.277  -10.222 1.00 81.33  ? 145  GLN A CB  1 
ATOM   1067 C CG  . GLN A 1 145 ? 6.808   -6.618  -10.933 1.00 83.88  ? 145  GLN A CG  1 
ATOM   1068 C CD  . GLN A 1 145 ? 5.472   -7.302  -10.668 1.00 87.58  ? 145  GLN A CD  1 
ATOM   1069 O OE1 . GLN A 1 145 ? 4.620   -6.774  -9.944  1.00 81.98  ? 145  GLN A OE1 1 
ATOM   1070 N NE2 . GLN A 1 145 ? 5.283   -8.482  -11.260 1.00 81.01  ? 145  GLN A NE2 1 
ATOM   1071 N N   . HIS A 1 146 ? 7.650   -3.673  -12.807 1.00 67.67  ? 146  HIS A N   1 
ATOM   1072 C CA  . HIS A 1 146 ? 7.674   -3.746  -14.278 1.00 52.76  ? 146  HIS A CA  1 
ATOM   1073 C C   . HIS A 1 146 ? 8.480   -2.666  -15.002 1.00 57.42  ? 146  HIS A C   1 
ATOM   1074 O O   . HIS A 1 146 ? 8.574   -2.696  -16.236 1.00 51.97  ? 146  HIS A O   1 
ATOM   1075 C CB  . HIS A 1 146 ? 6.266   -3.733  -14.847 1.00 67.12  ? 146  HIS A CB  1 
ATOM   1076 C CG  . HIS A 1 146 ? 5.343   -4.721  -14.215 1.00 69.87  ? 146  HIS A CG  1 
ATOM   1077 N ND1 . HIS A 1 146 ? 5.266   -6.033  -14.629 1.00 66.24  ? 146  HIS A ND1 1 
ATOM   1078 C CD2 . HIS A 1 146 ? 4.429   -4.582  -13.226 1.00 73.00  ? 146  HIS A CD2 1 
ATOM   1079 C CE1 . HIS A 1 146 ? 4.354   -6.663  -13.911 1.00 72.10  ? 146  HIS A CE1 1 
ATOM   1080 N NE2 . HIS A 1 146 ? 3.828   -5.805  -13.055 1.00 72.82  ? 146  HIS A NE2 1 
ATOM   1081 N N   . LYS A 1 147 ? 9.051   -1.726  -14.247 1.00 73.91  ? 147  LYS A N   1 
ATOM   1082 C CA  . LYS A 1 147 ? 9.846   -0.627  -14.816 1.00 88.65  ? 147  LYS A CA  1 
ATOM   1083 C C   . LYS A 1 147 ? 9.230   -0.009  -16.084 1.00 81.81  ? 147  LYS A C   1 
ATOM   1084 O O   . LYS A 1 147 ? 9.889   0.046   -17.138 1.00 72.99  ? 147  LYS A O   1 
ATOM   1085 C CB  . LYS A 1 147 ? 11.267  -1.117  -15.144 1.00 93.03  ? 147  LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 147 ? 11.835  -2.125  -14.160 1.00 99.35  ? 147  LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 147 ? 13.139  -2.736  -14.677 1.00 97.58  ? 147  LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 147 ? 13.679  -3.772  -13.704 1.00 85.10  ? 147  LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 147 ? 13.730  -3.204  -12.325 1.00 92.38  ? 147  LYS A NZ  1 
ATOM   1090 N N   . PRO A 1 148 ? 7.971   0.443   -15.997 1.00 75.60  ? 148  PRO A N   1 
ATOM   1091 C CA  . PRO A 1 148 ? 7.291   0.940   -17.194 1.00 63.78  ? 148  PRO A CA  1 
ATOM   1092 C C   . PRO A 1 148 ? 7.862   2.249   -17.717 1.00 52.51  ? 148  PRO A C   1 
ATOM   1093 O O   . PRO A 1 148 ? 8.368   3.068   -16.954 1.00 59.32  ? 148  PRO A O   1 
ATOM   1094 C CB  . PRO A 1 148 ? 5.867   1.183   -16.695 1.00 77.51  ? 148  PRO A CB  1 
ATOM   1095 C CG  . PRO A 1 148 ? 5.748   0.359   -15.462 1.00 85.22  ? 148  PRO A CG  1 
ATOM   1096 C CD  . PRO A 1 148 ? 7.077   0.463   -14.830 1.00 78.81  ? 148  PRO A CD  1 
ATOM   1097 N N   . VAL A 1 149 ? 7.763   2.438   -19.025 1.00 57.81  ? 149  VAL A N   1 
ATOM   1098 C CA  . VAL A 1 149 ? 8.033   3.728   -19.639 1.00 67.06  ? 149  VAL A CA  1 
ATOM   1099 C C   . VAL A 1 149 ? 6.867   4.685   -19.357 1.00 62.76  ? 149  VAL A C   1 
ATOM   1100 O O   . VAL A 1 149 ? 7.056   5.892   -19.201 1.00 71.07  ? 149  VAL A O   1 
ATOM   1101 C CB  . VAL A 1 149 ? 8.264   3.570   -21.160 1.00 73.30  ? 149  VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 149 ? 7.193   2.692   -21.768 1.00 69.84  ? 149  VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 149 ? 8.303   4.926   -21.861 1.00 74.97  ? 149  VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 150 ? 5.662   4.135   -19.251 1.00 60.86  ? 150  LEU A N   1 
ATOM   1105 C CA  . LEU A 1 150 ? 4.461   4.950   -19.069 1.00 56.17  ? 150  LEU A CA  1 
ATOM   1106 C C   . LEU A 1 150 ? 3.498   4.314   -18.068 1.00 51.23  ? 150  LEU A C   1 
ATOM   1107 O O   . LEU A 1 150 ? 3.356   3.086   -18.022 1.00 59.12  ? 150  LEU A O   1 
ATOM   1108 C CB  . LEU A 1 150 ? 3.754   5.143   -20.416 1.00 49.30  ? 150  LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 150 ? 2.384   5.837   -20.441 1.00 52.32  ? 150  LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 150 ? 2.510   7.315   -20.161 1.00 45.69  ? 150  LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 150 ? 1.726   5.619   -21.784 1.00 50.69  ? 150  LEU A CD2 1 
ATOM   1112 N N   . LEU A 1 151 ? 2.855   5.156   -17.261 1.00 43.84  ? 151  LEU A N   1 
ATOM   1113 C CA  . LEU A 1 151 ? 1.687   4.751   -16.476 1.00 45.81  ? 151  LEU A CA  1 
ATOM   1114 C C   . LEU A 1 151 ? 0.418   5.515   -16.912 1.00 50.91  ? 151  LEU A C   1 
ATOM   1115 O O   . LEU A 1 151 ? 0.448   6.741   -17.067 1.00 49.29  ? 151  LEU A O   1 
ATOM   1116 C CB  . LEU A 1 151 ? 1.919   4.981   -14.975 1.00 43.44  ? 151  LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 151 ? 0.667   4.808   -14.091 1.00 54.15  ? 151  LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 151 ? 0.338   3.344   -13.844 1.00 54.71  ? 151  LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 151 ? 0.769   5.575   -12.769 1.00 56.71  ? 151  LEU A CD2 1 
ATOM   1120 N N   . PHE A 1 152 ? -0.692  4.794   -17.070 1.00 52.23  ? 152  PHE A N   1 
ATOM   1121 C CA  . PHE A 1 152 ? -1.997  5.426   -17.325 1.00 60.92  ? 152  PHE A CA  1 
ATOM   1122 C C   . PHE A 1 152 ? -2.859  5.452   -16.071 1.00 61.46  ? 152  PHE A C   1 
ATOM   1123 O O   . PHE A 1 152 ? -3.033  4.432   -15.409 1.00 65.90  ? 152  PHE A O   1 
ATOM   1124 C CB  . PHE A 1 152 ? -2.769  4.709   -18.450 1.00 55.26  ? 152  PHE A CB  1 
ATOM   1125 C CG  . PHE A 1 152 ? -4.257  5.031   -18.482 1.00 60.39  ? 152  PHE A CG  1 
ATOM   1126 C CD1 . PHE A 1 152 ? -5.168  4.290   -17.726 1.00 62.47  ? 152  PHE A CD1 1 
ATOM   1127 C CD2 . PHE A 1 152 ? -4.743  6.069   -19.268 1.00 48.39  ? 152  PHE A CD2 1 
ATOM   1128 C CE1 . PHE A 1 152 ? -6.526  4.584   -17.746 1.00 61.10  ? 152  PHE A CE1 1 
ATOM   1129 C CE2 . PHE A 1 152 ? -6.102  6.360   -19.297 1.00 49.43  ? 152  PHE A CE2 1 
ATOM   1130 C CZ  . PHE A 1 152 ? -6.992  5.617   -18.532 1.00 53.86  ? 152  PHE A CZ  1 
ATOM   1131 N N   . LEU A 1 153 ? -3.426  6.612   -15.764 1.00 57.70  ? 153  LEU A N   1 
ATOM   1132 C CA  . LEU A 1 153 ? -4.425  6.706   -14.695 1.00 55.10  ? 153  LEU A CA  1 
ATOM   1133 C C   . LEU A 1 153 ? -5.683  7.428   -15.157 1.00 46.07  ? 153  LEU A C   1 
ATOM   1134 O O   . LEU A 1 153 ? -5.608  8.455   -15.832 1.00 45.87  ? 153  LEU A O   1 
ATOM   1135 C CB  . LEU A 1 153 ? -3.847  7.406   -13.463 1.00 55.80  ? 153  LEU A CB  1 
ATOM   1136 C CG  . LEU A 1 153 ? -2.958  6.514   -12.588 1.00 66.31  ? 153  LEU A CG  1 
ATOM   1137 C CD1 . LEU A 1 153 ? -2.251  7.341   -11.529 1.00 55.56  ? 153  LEU A CD1 1 
ATOM   1138 C CD2 . LEU A 1 153 ? -3.794  5.415   -11.949 1.00 67.08  ? 153  LEU A CD2 1 
ATOM   1139 N N   . THR A 1 154 ? -6.835  6.872   -14.796 1.00 57.38  ? 154  THR A N   1 
ATOM   1140 C CA  . THR A 1 154 ? -8.119  7.548   -14.984 1.00 56.14  ? 154  THR A CA  1 
ATOM   1141 C C   . THR A 1 154 ? -8.390  8.472   -13.818 1.00 57.72  ? 154  THR A C   1 
ATOM   1142 O O   . THR A 1 154 ? -8.612  8.005   -12.701 1.00 56.99  ? 154  THR A O   1 
ATOM   1143 C CB  . THR A 1 154 ? -9.292  6.557   -15.020 1.00 51.81  ? 154  THR A CB  1 
ATOM   1144 O OG1 . THR A 1 154 ? -9.006  5.498   -15.939 1.00 51.97  ? 154  THR A OG1 1 
ATOM   1145 C CG2 . THR A 1 154 ? -10.587 7.274   -15.447 1.00 47.13  ? 154  THR A CG2 1 
ATOM   1146 N N   . HIS A 1 155 ? -8.376  9.780   -14.055 1.00 60.80  ? 155  HIS A N   1 
ATOM   1147 C CA  . HIS A 1 155 ? -8.769  10.710  -12.997 1.00 48.07  ? 155  HIS A CA  1 
ATOM   1148 C C   . HIS A 1 155 ? -10.226 10.478  -12.633 1.00 54.11  ? 155  HIS A C   1 
ATOM   1149 O O   . HIS A 1 155 ? -10.530 9.901   -11.586 1.00 61.72  ? 155  HIS A O   1 
ATOM   1150 C CB  . HIS A 1 155 ? -8.577  12.158  -13.428 1.00 39.48  ? 155  HIS A CB  1 
ATOM   1151 C CG  . HIS A 1 155 ? -8.798  13.146  -12.325 1.00 51.30  ? 155  HIS A CG  1 
ATOM   1152 N ND1 . HIS A 1 155 ? -8.947  14.499  -12.553 1.00 39.80  ? 155  HIS A ND1 1 
ATOM   1153 C CD2 . HIS A 1 155 ? -8.881  12.983  -10.980 1.00 41.23  ? 155  HIS A CD2 1 
ATOM   1154 C CE1 . HIS A 1 155 ? -9.111  15.124  -11.401 1.00 51.17  ? 155  HIS A CE1 1 
ATOM   1155 N NE2 . HIS A 1 155 ? -9.076  14.224  -10.430 1.00 41.48  ? 155  HIS A NE2 1 
ATOM   1156 N N   . GLY A 1 156 ? -11.126 10.928  -13.504 1.00 50.85  ? 156  GLY A N   1 
ATOM   1157 C CA  . GLY A 1 156 ? -12.551 10.763  -13.284 1.00 53.91  ? 156  GLY A CA  1 
ATOM   1158 C C   . GLY A 1 156 ? -13.040 9.478   -13.916 1.00 50.24  ? 156  GLY A C   1 
ATOM   1159 O O   . GLY A 1 156 ? -13.295 9.424   -15.118 1.00 47.37  ? 156  GLY A O   1 
ATOM   1160 N N   . GLU A 1 157 ? -13.156 8.431   -13.114 1.00 46.51  ? 157  GLU A N   1 
ATOM   1161 C CA  . GLU A 1 157 ? -13.669 7.182   -13.632 1.00 54.91  ? 157  GLU A CA  1 
ATOM   1162 C C   . GLU A 1 157 ? -15.175 7.257   -13.850 1.00 64.19  ? 157  GLU A C   1 
ATOM   1163 O O   . GLU A 1 157 ? -15.969 6.956   -12.954 1.00 57.25  ? 157  GLU A O   1 
ATOM   1164 C CB  . GLU A 1 157 ? -13.320 6.025   -12.714 1.00 57.66  ? 157  GLU A CB  1 
ATOM   1165 C CG  . GLU A 1 157 ? -12.595 4.912   -13.429 1.00 60.89  ? 157  GLU A CG  1 
ATOM   1166 C CD  . GLU A 1 157 ? -13.421 4.278   -14.533 1.00 58.10  ? 157  GLU A CD  1 
ATOM   1167 O OE1 . GLU A 1 157 ? -14.660 4.476   -14.577 1.00 54.69  ? 157  GLU A OE1 1 
ATOM   1168 O OE2 . GLU A 1 157 ? -12.818 3.560   -15.355 1.00 54.50  ? 157  GLU A OE2 1 
ATOM   1169 N N   . SER A 1 158 ? -15.572 7.657   -15.050 1.00 62.24  ? 158  SER A N   1 
ATOM   1170 C CA  . SER A 1 158 ? -16.992 7.842   -15.318 1.00 54.22  ? 158  SER A CA  1 
ATOM   1171 C C   . SER A 1 158 ? -17.758 6.530   -15.308 1.00 41.84  ? 158  SER A C   1 
ATOM   1172 O O   . SER A 1 158 ? -18.969 6.543   -15.254 1.00 44.37  ? 158  SER A O   1 
ATOM   1173 C CB  . SER A 1 158 ? -17.217 8.569   -16.649 1.00 47.62  ? 158  SER A CB  1 
ATOM   1174 O OG  . SER A 1 158 ? -16.784 7.774   -17.744 1.00 51.49  ? 158  SER A OG  1 
ATOM   1175 N N   . SER A 1 159 ? -17.069 5.395   -15.370 1.00 46.91  ? 159  SER A N   1 
ATOM   1176 C CA  . SER A 1 159 ? -17.793 4.127   -15.378 1.00 42.58  ? 159  SER A CA  1 
ATOM   1177 C C   . SER A 1 159 ? -18.160 3.673   -13.959 1.00 52.73  ? 159  SER A C   1 
ATOM   1178 O O   . SER A 1 159 ? -19.079 2.874   -13.774 1.00 53.05  ? 159  SER A O   1 
ATOM   1179 C CB  . SER A 1 159 ? -17.045 3.030   -16.161 1.00 50.73  ? 159  SER A CB  1 
ATOM   1180 O OG  . SER A 1 159 ? -15.870 2.575   -15.493 1.00 50.15  ? 159  SER A OG  1 
ATOM   1181 N N   . THR A 1 160 ? -17.460 4.207   -12.960 1.00 63.25  ? 160  THR A N   1 
ATOM   1182 C CA  . THR A 1 160 ? -17.686 3.792   -11.573 1.00 59.44  ? 160  THR A CA  1 
ATOM   1183 C C   . THR A 1 160 ? -18.078 4.920   -10.630 1.00 60.82  ? 160  THR A C   1 
ATOM   1184 O O   . THR A 1 160 ? -18.594 4.665   -9.543  1.00 63.23  ? 160  THR A O   1 
ATOM   1185 C CB  . THR A 1 160 ? -16.450 3.109   -10.990 1.00 52.14  ? 160  THR A CB  1 
ATOM   1186 O OG1 . THR A 1 160 ? -15.352 4.031   -10.987 1.00 53.70  ? 160  THR A OG1 1 
ATOM   1187 C CG2 . THR A 1 160 ? -16.085 1.884   -11.815 1.00 48.33  ? 160  THR A CG2 1 
ATOM   1188 N N   . GLY A 1 161 ? -17.827 6.158   -11.046 1.00 59.59  ? 161  GLY A N   1 
ATOM   1189 C CA  . GLY A 1 161 ? -18.110 7.324   -10.222 1.00 52.32  ? 161  GLY A CA  1 
ATOM   1190 C C   . GLY A 1 161 ? -16.964 7.632   -9.273  1.00 55.29  ? 161  GLY A C   1 
ATOM   1191 O O   . GLY A 1 161 ? -17.081 8.493   -8.396  1.00 58.73  ? 161  GLY A O   1 
ATOM   1192 N N   . VAL A 1 162 ? -15.847 6.931   -9.453  1.00 48.42  ? 162  VAL A N   1 
ATOM   1193 C CA  . VAL A 1 162 ? -14.684 7.120   -8.594  1.00 49.67  ? 162  VAL A CA  1 
ATOM   1194 C C   . VAL A 1 162 ? -13.856 8.320   -9.015  1.00 53.64  ? 162  VAL A C   1 
ATOM   1195 O O   . VAL A 1 162 ? -13.522 8.471   -10.191 1.00 57.67  ? 162  VAL A O   1 
ATOM   1196 C CB  . VAL A 1 162 ? -13.756 5.902   -8.624  1.00 60.73  ? 162  VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 162 ? -12.464 6.194   -7.843  1.00 62.22  ? 162  VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 162 ? -14.459 4.676   -8.083  1.00 64.44  ? 162  VAL A CG2 1 
ATOM   1199 N N   . LEU A 1 163 ? -13.527 9.172   -8.048  1.00 57.15  ? 163  LEU A N   1 
ATOM   1200 C CA  . LEU A 1 163 ? -12.524 10.210  -8.243  1.00 62.23  ? 163  LEU A CA  1 
ATOM   1201 C C   . LEU A 1 163 ? -11.150 9.739   -7.732  1.00 70.27  ? 163  LEU A C   1 
ATOM   1202 O O   . LEU A 1 163 ? -10.970 9.521   -6.537  1.00 74.78  ? 163  LEU A O   1 
ATOM   1203 C CB  . LEU A 1 163 ? -12.941 11.478  -7.513  1.00 56.24  ? 163  LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 163 ? -11.969 12.652  -7.559  1.00 54.71  ? 163  LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 163 ? -11.910 13.219  -8.975  1.00 55.37  ? 163  LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 163 ? -12.411 13.717  -6.547  1.00 44.45  ? 163  LEU A CD2 1 
ATOM   1207 N N   . GLN A 1 164 ? -10.194 9.601   -8.651  1.00 74.73  ? 164  GLN A N   1 
ATOM   1208 C CA  . GLN A 1 164 ? -8.814  9.188   -8.363  1.00 64.31  ? 164  GLN A CA  1 
ATOM   1209 C C   . GLN A 1 164 ? -7.931  10.333  -7.841  1.00 77.45  ? 164  GLN A C   1 
ATOM   1210 O O   . GLN A 1 164 ? -7.862  11.404  -8.450  1.00 80.32  ? 164  GLN A O   1 
ATOM   1211 C CB  . GLN A 1 164 ? -8.202  8.588   -9.627  1.00 58.95  ? 164  GLN A CB  1 
ATOM   1212 C CG  . GLN A 1 164 ? -6.701  8.423   -9.602  1.00 67.99  ? 164  GLN A CG  1 
ATOM   1213 C CD  . GLN A 1 164 ? -6.245  7.441   -8.552  1.00 69.41  ? 164  GLN A CD  1 
ATOM   1214 O OE1 . GLN A 1 164 ? -6.614  6.251   -8.583  1.00 53.99  ? 164  GLN A OE1 1 
ATOM   1215 N NE2 . GLN A 1 164 ? -5.436  7.932   -7.600  1.00 63.00  ? 164  GLN A NE2 1 
ATOM   1216 N N   . PRO A 1 165 ? -7.265  10.105  -6.696  1.00 78.66  ? 165  PRO A N   1 
ATOM   1217 C CA  . PRO A 1 165 ? -6.378  11.029  -5.974  1.00 81.69  ? 165  PRO A CA  1 
ATOM   1218 C C   . PRO A 1 165 ? -5.307  11.836  -6.741  1.00 73.99  ? 165  PRO A C   1 
ATOM   1219 O O   . PRO A 1 165 ? -5.177  13.024  -6.435  1.00 87.64  ? 165  PRO A O   1 
ATOM   1220 C CB  . PRO A 1 165 ? -5.738  10.119  -4.929  1.00 85.02  ? 165  PRO A CB  1 
ATOM   1221 C CG  . PRO A 1 165 ? -6.864  9.199   -4.564  1.00 71.40  ? 165  PRO A CG  1 
ATOM   1222 C CD  . PRO A 1 165 ? -7.666  8.978   -5.832  1.00 73.51  ? 165  PRO A CD  1 
ATOM   1223 N N   . LEU A 1 166 ? -4.542  11.233  -7.646  1.00 45.56  ? 166  LEU A N   1 
ATOM   1224 C CA  . LEU A 1 166 ? -3.530  11.980  -8.428  1.00 66.28  ? 166  LEU A CA  1 
ATOM   1225 C C   . LEU A 1 166 ? -2.295  12.587  -7.711  1.00 66.26  ? 166  LEU A C   1 
ATOM   1226 O O   . LEU A 1 166 ? -1.197  12.583  -8.271  1.00 77.48  ? 166  LEU A O   1 
ATOM   1227 C CB  . LEU A 1 166 ? -4.179  13.092  -9.265  1.00 65.40  ? 166  LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 166 ? -5.150  12.689  -10.369 1.00 67.95  ? 166  LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 166 ? -5.462  13.882  -11.258 1.00 63.50  ? 166  LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 166 ? -4.574  11.535  -11.180 1.00 77.27  ? 166  LEU A CD2 1 
ATOM   1231 N N   . ASP A 1 167 ? -2.471  13.132  -6.509  1.00 57.20  ? 167  ASP A N   1 
ATOM   1232 C CA  . ASP A 1 167 ? -1.417  13.911  -5.834  1.00 74.55  ? 167  ASP A CA  1 
ATOM   1233 C C   . ASP A 1 167 ? -0.078  13.199  -5.650  1.00 67.54  ? 167  ASP A C   1 
ATOM   1234 O O   . ASP A 1 167 ? -0.021  12.106  -5.090  1.00 62.75  ? 167  ASP A O   1 
ATOM   1235 C CB  . ASP A 1 167 ? -1.899  14.398  -4.471  1.00 71.44  ? 167  ASP A CB  1 
ATOM   1236 C CG  . ASP A 1 167 ? -2.306  15.842  -4.488  1.00 65.40  ? 167  ASP A CG  1 
ATOM   1237 O OD1 . ASP A 1 167 ? -1.973  16.553  -5.465  1.00 59.84  ? 167  ASP A OD1 1 
ATOM   1238 O OD2 . ASP A 1 167 ? -2.950  16.266  -3.511  1.00 59.33  ? 167  ASP A OD2 1 
ATOM   1239 N N   . GLY A 1 168 ? 0.988   13.838  -6.128  1.00 68.59  ? 168  GLY A N   1 
ATOM   1240 C CA  . GLY A 1 168 ? 2.341   13.314  -6.003  1.00 74.73  ? 168  GLY A CA  1 
ATOM   1241 C C   . GLY A 1 168 ? 2.712   12.149  -6.905  1.00 81.92  ? 168  GLY A C   1 
ATOM   1242 O O   . GLY A 1 168 ? 3.896   11.827  -7.043  1.00 88.33  ? 168  GLY A O   1 
ATOM   1243 N N   . PHE A 1 169 ? 1.711   11.509  -7.509  1.00 81.83  ? 169  PHE A N   1 
ATOM   1244 C CA  . PHE A 1 169 ? 1.943   10.351  -8.385  1.00 80.04  ? 169  PHE A CA  1 
ATOM   1245 C C   . PHE A 1 169 ? 2.955   10.636  -9.482  1.00 67.24  ? 169  PHE A C   1 
ATOM   1246 O O   . PHE A 1 169 ? 3.735   9.762   -9.853  1.00 71.76  ? 169  PHE A O   1 
ATOM   1247 C CB  . PHE A 1 169 ? 0.643   9.878   -9.044  1.00 78.21  ? 169  PHE A CB  1 
ATOM   1248 C CG  . PHE A 1 169 ? -0.274  9.110   -8.132  1.00 70.96  ? 169  PHE A CG  1 
ATOM   1249 C CD1 . PHE A 1 169 ? -1.095  9.778   -7.230  1.00 66.59  ? 169  PHE A CD1 1 
ATOM   1250 C CD2 . PHE A 1 169 ? -0.341  7.726   -8.198  1.00 60.39  ? 169  PHE A CD2 1 
ATOM   1251 C CE1 . PHE A 1 169 ? -1.970  9.092   -6.397  1.00 57.99  ? 169  PHE A CE1 1 
ATOM   1252 C CE2 . PHE A 1 169 ? -1.205  7.025   -7.376  1.00 54.48  ? 169  PHE A CE2 1 
ATOM   1253 C CZ  . PHE A 1 169 ? -2.032  7.715   -6.468  1.00 58.35  ? 169  PHE A CZ  1 
ATOM   1254 N N   . GLY A 1 170 ? 2.932   11.858  -10.005 1.00 62.89  ? 170  GLY A N   1 
ATOM   1255 C CA  . GLY A 1 170 ? 3.855   12.249  -11.053 1.00 72.11  ? 170  GLY A CA  1 
ATOM   1256 C C   . GLY A 1 170 ? 5.276   12.340  -10.534 1.00 85.60  ? 170  GLY A C   1 
ATOM   1257 O O   . GLY A 1 170 ? 6.225   11.969  -11.227 1.00 82.08  ? 170  GLY A O   1 
ATOM   1258 N N   . GLU A 1 171 ? 5.416   12.852  -9.314  1.00 92.00  ? 171  GLU A N   1 
ATOM   1259 C CA  . GLU A 1 171 ? 6.699   12.873  -8.632  1.00 93.21  ? 171  GLU A CA  1 
ATOM   1260 C C   . GLU A 1 171 ? 7.187   11.447  -8.462  1.00 84.02  ? 171  GLU A C   1 
ATOM   1261 O O   . GLU A 1 171 ? 8.353   11.144  -8.736  1.00 88.03  ? 171  GLU A O   1 
ATOM   1262 C CB  . GLU A 1 171 ? 6.576   13.543  -7.262  1.00 102.02 ? 171  GLU A CB  1 
ATOM   1263 C CG  . GLU A 1 171 ? 7.687   13.155  -6.279  1.00 117.46 ? 171  GLU A CG  1 
ATOM   1264 C CD  . GLU A 1 171 ? 7.244   12.123  -5.239  1.00 116.68 ? 171  GLU A CD  1 
ATOM   1265 O OE1 . GLU A 1 171 ? 6.102   12.229  -4.735  1.00 115.41 ? 171  GLU A OE1 1 
ATOM   1266 O OE2 . GLU A 1 171 ? 8.039   11.207  -4.924  1.00 108.57 ? 171  GLU A OE2 1 
ATOM   1267 N N   . LEU A 1 172 ? 6.289   10.577  -8.002  1.00 71.42  ? 172  LEU A N   1 
ATOM   1268 C CA  . LEU A 1 172 ? 6.614   9.166   -7.844  1.00 65.48  ? 172  LEU A CA  1 
ATOM   1269 C C   . LEU A 1 172 ? 7.104   8.612   -9.153  1.00 76.23  ? 172  LEU A C   1 
ATOM   1270 O O   . LEU A 1 172 ? 8.098   7.895   -9.193  1.00 82.00  ? 172  LEU A O   1 
ATOM   1271 C CB  . LEU A 1 172 ? 5.396   8.353   -7.398  1.00 70.03  ? 172  LEU A CB  1 
ATOM   1272 C CG  . LEU A 1 172 ? 5.585   6.832   -7.257  1.00 73.05  ? 172  LEU A CG  1 
ATOM   1273 C CD1 . LEU A 1 172 ? 4.592   6.297   -6.284  1.00 75.59  ? 172  LEU A CD1 1 
ATOM   1274 C CD2 . LEU A 1 172 ? 5.426   6.073   -8.557  1.00 76.99  ? 172  LEU A CD2 1 
ATOM   1275 N N   . CYS A 1 173 ? 6.367   8.923   -10.216 1.00 71.28  ? 173  CYS A N   1 
ATOM   1276 C CA  . CYS A 1 173 ? 6.619   8.359   -11.536 1.00 77.39  ? 173  CYS A CA  1 
ATOM   1277 C C   . CYS A 1 173 ? 7.892   8.903   -12.161 1.00 71.36  ? 173  CYS A C   1 
ATOM   1278 O O   . CYS A 1 173 ? 8.497   8.248   -13.013 1.00 69.72  ? 173  CYS A O   1 
ATOM   1279 C CB  . CYS A 1 173 ? 5.427   8.621   -12.476 1.00 90.05  ? 173  CYS A CB  1 
ATOM   1280 S SG  . CYS A 1 173 ? 4.212   7.253   -12.603 1.00 81.68  ? 173  CYS A SG  1 
ATOM   1281 N N   . HIS A 1 174 ? 8.308   10.091  -11.735 1.00 63.58  ? 174  HIS A N   1 
ATOM   1282 C CA  . HIS A 1 174 ? 9.499   10.713  -12.307 1.00 78.02  ? 174  HIS A CA  1 
ATOM   1283 C C   . HIS A 1 174 ? 10.793  10.103  -11.746 1.00 84.70  ? 174  HIS A C   1 
ATOM   1284 O O   . HIS A 1 174 ? 11.744  9.859   -12.496 1.00 74.42  ? 174  HIS A O   1 
ATOM   1285 C CB  . HIS A 1 174 ? 9.436   12.237  -12.195 1.00 84.47  ? 174  HIS A CB  1 
ATOM   1286 C CG  . HIS A 1 174 ? 8.447   12.863  -13.135 1.00 86.80  ? 174  HIS A CG  1 
ATOM   1287 N ND1 . HIS A 1 174 ? 8.098   14.196  -13.074 1.00 82.06  ? 174  HIS A ND1 1 
ATOM   1288 C CD2 . HIS A 1 174 ? 7.731   12.335  -14.157 1.00 76.40  ? 174  HIS A CD2 1 
ATOM   1289 C CE1 . HIS A 1 174 ? 7.220   14.464  -14.022 1.00 75.00  ? 174  HIS A CE1 1 
ATOM   1290 N NE2 . HIS A 1 174 ? 6.980   13.353  -14.694 1.00 77.06  ? 174  HIS A NE2 1 
ATOM   1291 N N   . ARG A 1 175 ? 10.813  9.841   -10.439 1.00 85.15  ? 175  ARG A N   1 
ATOM   1292 C CA  . ARG A 1 175 ? 11.674  8.801   -9.898  1.00 87.46  ? 175  ARG A CA  1 
ATOM   1293 C C   . ARG A 1 175 ? 11.121  7.558   -10.570 1.00 99.93  ? 175  ARG A C   1 
ATOM   1294 O O   . ARG A 1 175 ? 9.939   7.507   -10.848 1.00 109.87 ? 175  ARG A O   1 
ATOM   1295 C CB  . ARG A 1 175 ? 11.508  8.708   -8.384  1.00 86.17  ? 175  ARG A CB  1 
ATOM   1296 C CG  . ARG A 1 175 ? 11.464  10.070  -7.686  1.00 92.30  ? 175  ARG A CG  1 
ATOM   1297 C CD  . ARG A 1 175 ? 11.164  9.951   -6.197  1.00 93.50  ? 175  ARG A CD  1 
ATOM   1298 N NE  . ARG A 1 175 ? 10.759  8.604   -5.803  1.00 101.23 ? 175  ARG A NE  1 
ATOM   1299 C CZ  . ARG A 1 175 ? 9.884   8.347   -4.835  1.00 102.73 ? 175  ARG A CZ  1 
ATOM   1300 N NH1 . ARG A 1 175 ? 9.317   9.352   -4.184  1.00 101.04 ? 175  ARG A NH1 1 
ATOM   1301 N NH2 . ARG A 1 175 ? 9.568   7.095   -4.524  1.00 102.15 ? 175  ARG A NH2 1 
ATOM   1302 N N   . TYR A 1 176 ? 11.959  6.567   -10.842 1.00 98.86  ? 176  TYR A N   1 
ATOM   1303 C CA  . TYR A 1 176 ? 11.576  5.451   -11.712 1.00 83.55  ? 176  TYR A CA  1 
ATOM   1304 C C   . TYR A 1 176 ? 11.463  5.875   -13.161 1.00 70.94  ? 176  TYR A C   1 
ATOM   1305 O O   . TYR A 1 176 ? 11.068  5.060   -13.993 1.00 67.78  ? 176  TYR A O   1 
ATOM   1306 C CB  . TYR A 1 176 ? 10.270  4.752   -11.282 1.00 78.07  ? 176  TYR A CB  1 
ATOM   1307 C CG  . TYR A 1 176 ? 10.253  4.128   -9.900  1.00 90.20  ? 176  TYR A CG  1 
ATOM   1308 C CD1 . TYR A 1 176 ? 10.813  2.871   -9.670  1.00 99.69  ? 176  TYR A CD1 1 
ATOM   1309 C CD2 . TYR A 1 176 ? 9.648   4.779   -8.834  1.00 90.28  ? 176  TYR A CD2 1 
ATOM   1310 C CE1 . TYR A 1 176 ? 10.786  2.294   -8.409  1.00 98.97  ? 176  TYR A CE1 1 
ATOM   1311 C CE2 . TYR A 1 176 ? 9.614   4.213   -7.572  1.00 90.97  ? 176  TYR A CE2 1 
ATOM   1312 C CZ  . TYR A 1 176 ? 10.182  2.970   -7.360  1.00 98.05  ? 176  TYR A CZ  1 
ATOM   1313 O OH  . TYR A 1 176 ? 10.148  2.409   -6.097  1.00 96.11  ? 176  TYR A OH  1 
ATOM   1314 N N   . LYS A 1 177 ? 11.838  7.132   -13.431 1.00 78.69  ? 177  LYS A N   1 
ATOM   1315 C CA  . LYS A 1 177 ? 11.897  7.728   -14.774 1.00 89.09  ? 177  LYS A CA  1 
ATOM   1316 C C   . LYS A 1 177 ? 10.725  7.304   -15.679 1.00 86.14  ? 177  LYS A C   1 
ATOM   1317 O O   . LYS A 1 177 ? 10.914  6.991   -16.858 1.00 72.17  ? 177  LYS A O   1 
ATOM   1318 C CB  . LYS A 1 177 ? 13.226  7.447   -15.490 1.00 93.08  ? 177  LYS A CB  1 
ATOM   1319 C CG  . LYS A 1 177 ? 14.283  6.792   -14.693 1.00 89.49  ? 177  LYS A CG  1 
ATOM   1320 C CD  . LYS A 1 177 ? 15.565  6.654   -15.513 1.00 84.86  ? 177  LYS A CD  1 
ATOM   1321 C CE  . LYS A 1 177 ? 16.745  7.285   -14.775 1.00 80.68  ? 177  LYS A CE  1 
ATOM   1322 N NZ  . LYS A 1 177 ? 16.866  7.087   -13.300 1.00 75.66  ? 177  LYS A NZ  1 
ATOM   1323 N N   . CYS A 1 178 ? 9.517   7.268   -15.119 1.00 88.71  ? 178  CYS A N   1 
ATOM   1324 C CA  . CYS A 1 178 ? 8.328   6.846   -15.871 1.00 89.63  ? 178  CYS A CA  1 
ATOM   1325 C C   . CYS A 1 178 ? 7.388   8.021   -16.140 1.00 76.64  ? 178  CYS A C   1 
ATOM   1326 O O   . CYS A 1 178 ? 7.290   8.924   -15.318 1.00 72.34  ? 178  CYS A O   1 
ATOM   1327 C CB  . CYS A 1 178 ? 7.578   5.756   -15.105 1.00 89.11  ? 178  CYS A CB  1 
ATOM   1328 S SG  . CYS A 1 178 ? 5.999   5.310   -15.834 1.00 69.82  ? 178  CYS A SG  1 
ATOM   1329 N N   . LEU A 1 179 ? 6.689   8.002   -17.276 1.00 65.10  ? 179  LEU A N   1 
ATOM   1330 C CA  . LEU A 1 179 ? 5.766   9.082   -17.616 1.00 59.54  ? 179  LEU A CA  1 
ATOM   1331 C C   . LEU A 1 179 ? 4.378   8.866   -17.010 1.00 61.51  ? 179  LEU A C   1 
ATOM   1332 O O   . LEU A 1 179 ? 3.890   7.737   -16.937 1.00 63.82  ? 179  LEU A O   1 
ATOM   1333 C CB  . LEU A 1 179 ? 5.627   9.214   -19.128 1.00 55.88  ? 179  LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 179 ? 6.869   9.595   -19.919 1.00 54.37  ? 179  LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 179 ? 6.564   9.556   -21.403 1.00 53.00  ? 179  LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 179 ? 7.307   10.970  -19.515 1.00 59.75  ? 179  LEU A CD2 1 
ATOM   1337 N N   . LEU A 1 180 ? 3.728   9.945   -16.588 1.00 62.67  ? 180  LEU A N   1 
ATOM   1338 C CA  . LEU A 1 180 ? 2.362   9.828   -16.079 1.00 63.58  ? 180  LEU A CA  1 
ATOM   1339 C C   . LEU A 1 180 ? 1.324   10.277  -17.107 1.00 56.30  ? 180  LEU A C   1 
ATOM   1340 O O   . LEU A 1 180 ? 1.319   11.433  -17.521 1.00 47.66  ? 180  LEU A O   1 
ATOM   1341 C CB  . LEU A 1 180 ? 2.192   10.628  -14.786 1.00 63.40  ? 180  LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 180 ? 0.788   10.605  -14.173 1.00 62.69  ? 180  LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 180 ? 0.275   9.175   -13.947 1.00 59.46  ? 180  LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 180 ? 0.777   11.394  -12.876 1.00 55.72  ? 180  LEU A CD2 1 
ATOM   1345 N N   . LEU A 1 181 ? 0.454   9.354   -17.508 1.00 55.57  ? 181  LEU A N   1 
ATOM   1346 C CA  . LEU A 1 181 ? -0.657  9.660   -18.417 1.00 52.80  ? 181  LEU A CA  1 
ATOM   1347 C C   . LEU A 1 181 ? -1.989  9.634   -17.694 1.00 50.70  ? 181  LEU A C   1 
ATOM   1348 O O   . LEU A 1 181 ? -2.368  8.601   -17.124 1.00 39.25  ? 181  LEU A O   1 
ATOM   1349 C CB  . LEU A 1 181 ? -0.714  8.649   -19.563 1.00 47.98  ? 181  LEU A CB  1 
ATOM   1350 C CG  . LEU A 1 181 ? -2.046  8.514   -20.316 1.00 60.79  ? 181  LEU A CG  1 
ATOM   1351 C CD1 . LEU A 1 181 ? -2.376  9.780   -21.109 1.00 36.08  ? 181  LEU A CD1 1 
ATOM   1352 C CD2 . LEU A 1 181 ? -2.024  7.288   -21.216 1.00 55.69  ? 181  LEU A CD2 1 
ATOM   1353 N N   . VAL A 1 182 ? -2.714  10.749  -17.750 1.00 46.01  ? 182  VAL A N   1 
ATOM   1354 C CA  . VAL A 1 182 ? -3.993  10.850  -17.052 1.00 49.30  ? 182  VAL A CA  1 
ATOM   1355 C C   . VAL A 1 182 ? -5.199  11.112  -17.964 1.00 48.27  ? 182  VAL A C   1 
ATOM   1356 O O   . VAL A 1 182 ? -5.149  11.972  -18.840 1.00 37.53  ? 182  VAL A O   1 
ATOM   1357 C CB  . VAL A 1 182 ? -3.929  11.915  -15.939 1.00 45.62  ? 182  VAL A CB  1 
ATOM   1358 C CG1 . VAL A 1 182 ? -5.323  12.168  -15.335 1.00 38.98  ? 182  VAL A CG1 1 
ATOM   1359 C CG2 . VAL A 1 182 ? -2.953  11.468  -14.858 1.00 53.20  ? 182  VAL A CG2 1 
ATOM   1360 N N   . ASP A 1 183 ? -6.268  10.348  -17.743 1.00 50.32  ? 183  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 183 ? -7.561  10.567  -18.390 1.00 50.93  ? 183  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 183 ? -8.405  11.512  -17.548 1.00 50.50  ? 183  ASP A C   1 
ATOM   1363 O O   . ASP A 1 183 ? -8.851  11.145  -16.463 1.00 46.10  ? 183  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 183 ? -8.310  9.240   -18.527 1.00 45.89  ? 183  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 183 ? -9.662  9.373   -19.257 1.00 45.31  ? 183  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 183 ? -10.395 10.366  -19.069 1.00 40.88  ? 183  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 183 ? -9.994  8.444   -20.029 1.00 47.92  ? 183  ASP A OD2 1 
ATOM   1368 N N   . SER A 1 184 ? -8.652  12.711  -18.063 1.00 35.90  ? 184  SER A N   1 
ATOM   1369 C CA  . SER A 1 184 ? -9.557  13.642  -17.400 1.00 51.02  ? 184  SER A CA  1 
ATOM   1370 C C   . SER A 1 184 ? -10.751 14.011  -18.294 1.00 39.76  ? 184  SER A C   1 
ATOM   1371 O O   . SER A 1 184 ? -11.229 15.127  -18.244 1.00 45.34  ? 184  SER A O   1 
ATOM   1372 C CB  . SER A 1 184 ? -8.814  14.913  -17.023 1.00 36.38  ? 184  SER A CB  1 
ATOM   1373 O OG  . SER A 1 184 ? -8.419  15.602  -18.194 1.00 45.27  ? 184  SER A OG  1 
ATOM   1374 N N   . VAL A 1 185 ? -11.226 13.086  -19.117 1.00 41.51  ? 185  VAL A N   1 
ATOM   1375 C CA  . VAL A 1 185 ? -12.376 13.397  -19.967 1.00 42.75  ? 185  VAL A CA  1 
ATOM   1376 C C   . VAL A 1 185 ? -13.596 13.725  -19.114 1.00 45.76  ? 185  VAL A C   1 
ATOM   1377 O O   . VAL A 1 185 ? -14.225 14.754  -19.312 1.00 41.77  ? 185  VAL A O   1 
ATOM   1378 C CB  . VAL A 1 185 ? -12.693 12.270  -20.957 1.00 46.00  ? 185  VAL A CB  1 
ATOM   1379 C CG1 . VAL A 1 185 ? -14.021 12.527  -21.662 1.00 33.64  ? 185  VAL A CG1 1 
ATOM   1380 C CG2 . VAL A 1 185 ? -11.554 12.131  -21.989 1.00 41.90  ? 185  VAL A CG2 1 
ATOM   1381 N N   . ALA A 1 186 ? -13.890 12.870  -18.139 1.00 43.35  ? 186  ALA A N   1 
ATOM   1382 C CA  . ALA A 1 186 ? -15.005 13.087  -17.225 1.00 42.71  ? 186  ALA A CA  1 
ATOM   1383 C C   . ALA A 1 186 ? -14.723 14.068  -16.088 1.00 44.54  ? 186  ALA A C   1 
ATOM   1384 O O   . ALA A 1 186 ? -15.628 14.730  -15.606 1.00 41.81  ? 186  ALA A O   1 
ATOM   1385 C CB  . ALA A 1 186 ? -15.506 11.762  -16.666 1.00 37.28  ? 186  ALA A CB  1 
ATOM   1386 N N   . SER A 1 187 ? -13.476 14.169  -15.653 1.00 37.60  ? 187  SER A N   1 
ATOM   1387 C CA  . SER A 1 187 ? -13.168 14.996  -14.480 1.00 43.87  ? 187  SER A CA  1 
ATOM   1388 C C   . SER A 1 187 ? -12.930 16.476  -14.772 1.00 46.07  ? 187  SER A C   1 
ATOM   1389 O O   . SER A 1 187 ? -13.126 17.319  -13.896 1.00 44.67  ? 187  SER A O   1 
ATOM   1390 C CB  . SER A 1 187 ? -11.939 14.447  -13.761 1.00 45.51  ? 187  SER A CB  1 
ATOM   1391 O OG  . SER A 1 187 ? -10.770 14.678  -14.539 1.00 44.83  ? 187  SER A OG  1 
ATOM   1392 N N   . LEU A 1 188 ? -12.476 16.790  -15.984 1.00 49.09  ? 188  LEU A N   1 
ATOM   1393 C CA  . LEU A 1 188 ? -12.061 18.159  -16.302 1.00 35.95  ? 188  LEU A CA  1 
ATOM   1394 C C   . LEU A 1 188 ? -13.169 19.192  -16.091 1.00 41.54  ? 188  LEU A C   1 
ATOM   1395 O O   . LEU A 1 188 ? -14.274 19.049  -16.608 1.00 42.62  ? 188  LEU A O   1 
ATOM   1396 C CB  . LEU A 1 188 ? -11.498 18.241  -17.725 1.00 35.03  ? 188  LEU A CB  1 
ATOM   1397 C CG  . LEU A 1 188 ? -11.076 19.654  -18.115 1.00 50.08  ? 188  LEU A CG  1 
ATOM   1398 C CD1 . LEU A 1 188 ? -9.740  20.022  -17.433 1.00 42.59  ? 188  LEU A CD1 1 
ATOM   1399 C CD2 . LEU A 1 188 ? -10.979 19.797  -19.604 1.00 33.77  ? 188  LEU A CD2 1 
ATOM   1400 N N   . GLY A 1 189 ? -12.880 20.224  -15.307 1.00 50.08  ? 189  GLY A N   1 
ATOM   1401 C CA  . GLY A 1 189 ? -13.827 21.316  -15.120 1.00 36.47  ? 189  GLY A CA  1 
ATOM   1402 C C   . GLY A 1 189 ? -14.766 21.178  -13.935 1.00 45.70  ? 189  GLY A C   1 
ATOM   1403 O O   . GLY A 1 189 ? -15.378 22.154  -13.495 1.00 48.98  ? 189  GLY A O   1 
ATOM   1404 N N   . GLY A 1 190 ? -14.891 19.967  -13.409 1.00 37.52  ? 190  GLY A N   1 
ATOM   1405 C CA  . GLY A 1 190 ? -15.822 19.746  -12.318 1.00 44.00  ? 190  GLY A CA  1 
ATOM   1406 C C   . GLY A 1 190 ? -15.188 19.249  -11.032 1.00 56.71  ? 190  GLY A C   1 
ATOM   1407 O O   . GLY A 1 190 ? -15.892 18.819  -10.117 1.00 50.49  ? 190  GLY A O   1 
ATOM   1408 N N   . THR A 1 191 ? -13.859 19.316  -10.968 1.00 56.62  ? 191  THR A N   1 
ATOM   1409 C CA  . THR A 1 191 ? -13.097 18.837  -9.821  1.00 52.97  ? 191  THR A CA  1 
ATOM   1410 C C   . THR A 1 191 ? -11.654 19.254  -10.080 1.00 60.38  ? 191  THR A C   1 
ATOM   1411 O O   . THR A 1 191 ? -11.232 19.321  -11.228 1.00 63.43  ? 191  THR A O   1 
ATOM   1412 C CB  . THR A 1 191 ? -13.248 17.304  -9.634  1.00 55.01  ? 191  THR A CB  1 
ATOM   1413 O OG1 . THR A 1 191 ? -12.712 16.891  -8.370  1.00 61.73  ? 191  THR A OG1 1 
ATOM   1414 C CG2 . THR A 1 191 ? -12.578 16.532  -10.769 1.00 49.62  ? 191  THR A CG2 1 
ATOM   1415 N N   . PRO A 1 192 ? -10.908 19.592  -9.018  1.00 65.85  ? 192  PRO A N   1 
ATOM   1416 C CA  . PRO A 1 192 ? -9.571  20.190  -9.145  1.00 60.15  ? 192  PRO A CA  1 
ATOM   1417 C C   . PRO A 1 192 ? -8.535  19.342  -9.885  1.00 54.28  ? 192  PRO A C   1 
ATOM   1418 O O   . PRO A 1 192 ? -8.427  18.130  -9.682  1.00 48.75  ? 192  PRO A O   1 
ATOM   1419 C CB  . PRO A 1 192 ? -9.149  20.402  -7.694  1.00 60.05  ? 192  PRO A CB  1 
ATOM   1420 C CG  . PRO A 1 192 ? -10.430 20.611  -6.983  1.00 61.33  ? 192  PRO A CG  1 
ATOM   1421 C CD  . PRO A 1 192 ? -11.399 19.666  -7.633  1.00 64.39  ? 192  PRO A CD  1 
ATOM   1422 N N   . LEU A 1 193 ? -7.754  20.012  -10.724 1.00 50.93  ? 193  LEU A N   1 
ATOM   1423 C CA  . LEU A 1 193 ? -6.794  19.349  -11.585 1.00 51.01  ? 193  LEU A CA  1 
ATOM   1424 C C   . LEU A 1 193 ? -5.747  20.364  -11.997 1.00 54.39  ? 193  LEU A C   1 
ATOM   1425 O O   . LEU A 1 193 ? -6.087  21.434  -12.488 1.00 64.57  ? 193  LEU A O   1 
ATOM   1426 C CB  . LEU A 1 193 ? -7.522  18.786  -12.817 1.00 41.81  ? 193  LEU A CB  1 
ATOM   1427 C CG  . LEU A 1 193 ? -6.728  18.106  -13.933 1.00 55.18  ? 193  LEU A CG  1 
ATOM   1428 C CD1 . LEU A 1 193 ? -5.993  16.857  -13.434 1.00 39.72  ? 193  LEU A CD1 1 
ATOM   1429 C CD2 . LEU A 1 193 ? -7.653  17.764  -15.096 1.00 37.94  ? 193  LEU A CD2 1 
ATOM   1430 N N   . TYR A 1 194 ? -4.475  20.043  -11.783 1.00 58.63  ? 194  TYR A N   1 
ATOM   1431 C CA  . TYR A 1 194 ? -3.394  20.945  -12.172 1.00 59.28  ? 194  TYR A CA  1 
ATOM   1432 C C   . TYR A 1 194 ? -2.276  20.146  -12.845 1.00 67.33  ? 194  TYR A C   1 
ATOM   1433 O O   . TYR A 1 194 ? -1.478  19.491  -12.164 1.00 57.17  ? 194  TYR A O   1 
ATOM   1434 C CB  . TYR A 1 194 ? -2.814  21.656  -10.953 1.00 60.25  ? 194  TYR A CB  1 
ATOM   1435 C CG  . TYR A 1 194 ? -3.810  22.072  -9.890  1.00 48.00  ? 194  TYR A CG  1 
ATOM   1436 C CD1 . TYR A 1 194 ? -4.318  21.147  -8.982  1.00 45.30  ? 194  TYR A CD1 1 
ATOM   1437 C CD2 . TYR A 1 194 ? -4.204  23.401  -9.766  1.00 50.17  ? 194  TYR A CD2 1 
ATOM   1438 C CE1 . TYR A 1 194 ? -5.217  21.540  -7.985  1.00 51.22  ? 194  TYR A CE1 1 
ATOM   1439 C CE2 . TYR A 1 194 ? -5.092  23.805  -8.786  1.00 50.70  ? 194  TYR A CE2 1 
ATOM   1440 C CZ  . TYR A 1 194 ? -5.598  22.873  -7.898  1.00 52.43  ? 194  TYR A CZ  1 
ATOM   1441 O OH  . TYR A 1 194 ? -6.481  23.282  -6.922  1.00 56.97  ? 194  TYR A OH  1 
ATOM   1442 N N   . MET A 1 195 ? -2.205  20.215  -14.174 1.00 63.69  ? 195  MET A N   1 
ATOM   1443 C CA  . MET A 1 195 ? -1.271  19.381  -14.927 1.00 53.13  ? 195  MET A CA  1 
ATOM   1444 C C   . MET A 1 195 ? 0.173   19.531  -14.452 1.00 55.98  ? 195  MET A C   1 
ATOM   1445 O O   . MET A 1 195 ? 0.752   18.581  -13.918 1.00 53.12  ? 195  MET A O   1 
ATOM   1446 C CB  . MET A 1 195 ? -1.354  19.679  -16.411 1.00 38.59  ? 195  MET A CB  1 
ATOM   1447 C CG  . MET A 1 195 ? -0.650  18.634  -17.222 1.00 44.40  ? 195  MET A CG  1 
ATOM   1448 S SD  . MET A 1 195 ? -0.551  19.073  -18.962 1.00 47.03  ? 195  MET A SD  1 
ATOM   1449 C CE  . MET A 1 195 ? 0.418   17.670  -19.583 1.00 42.76  ? 195  MET A CE  1 
ATOM   1450 N N   . ASP A 1 196 ? 0.743   20.719  -14.651 1.00 60.61  ? 196  ASP A N   1 
ATOM   1451 C CA  . ASP A 1 196 ? 2.118   20.997  -14.228 1.00 55.63  ? 196  ASP A CA  1 
ATOM   1452 C C   . ASP A 1 196 ? 2.355   20.769  -12.730 1.00 53.79  ? 196  ASP A C   1 
ATOM   1453 O O   . ASP A 1 196 ? 3.198   19.956  -12.352 1.00 59.46  ? 196  ASP A O   1 
ATOM   1454 C CB  . ASP A 1 196 ? 2.537   22.412  -14.629 1.00 50.77  ? 196  ASP A CB  1 
ATOM   1455 C CG  . ASP A 1 196 ? 2.552   22.603  -16.131 1.00 48.72  ? 196  ASP A CG  1 
ATOM   1456 O OD1 . ASP A 1 196 ? 2.396   21.604  -16.857 1.00 55.82  ? 196  ASP A OD1 1 
ATOM   1457 O OD2 . ASP A 1 196 ? 2.738   23.745  -16.600 1.00 56.44  ? 196  ASP A OD2 1 
ATOM   1458 N N   . ARG A 1 197 ? 1.608   21.462  -11.878 1.00 54.74  ? 197  ARG A N   1 
ATOM   1459 C CA  . ARG A 1 197 ? 1.795   21.327  -10.431 1.00 61.42  ? 197  ARG A CA  1 
ATOM   1460 C C   . ARG A 1 197 ? 1.746   19.869  -9.936  1.00 66.50  ? 197  ARG A C   1 
ATOM   1461 O O   . ARG A 1 197 ? 2.424   19.514  -8.973  1.00 75.65  ? 197  ARG A O   1 
ATOM   1462 C CB  . ARG A 1 197 ? 0.816   22.230  -9.660  1.00 60.13  ? 197  ARG A CB  1 
ATOM   1463 C CG  . ARG A 1 197 ? 0.609   21.887  -8.175  1.00 80.47  ? 197  ARG A CG  1 
ATOM   1464 C CD  . ARG A 1 197 ? -0.850  21.493  -7.918  1.00 93.34  ? 197  ARG A CD  1 
ATOM   1465 N NE  . ARG A 1 197 ? -1.369  21.934  -6.623  1.00 87.30  ? 197  ARG A NE  1 
ATOM   1466 C CZ  . ARG A 1 197 ? -1.874  21.115  -5.704  1.00 94.19  ? 197  ARG A CZ  1 
ATOM   1467 N NH1 . ARG A 1 197 ? -1.926  19.806  -5.932  1.00 87.63  ? 197  ARG A NH1 1 
ATOM   1468 N NH2 . ARG A 1 197 ? -2.327  21.606  -4.556  1.00 97.29  ? 197  ARG A NH2 1 
ATOM   1469 N N   . GLN A 1 198 ? 0.987   19.015  -10.614 1.00 53.94  ? 198  GLN A N   1 
ATOM   1470 C CA  . GLN A 1 198 ? 0.894   17.617  -10.199 1.00 48.68  ? 198  GLN A CA  1 
ATOM   1471 C C   . GLN A 1 198 ? 1.838   16.755  -11.034 1.00 52.43  ? 198  GLN A C   1 
ATOM   1472 O O   . GLN A 1 198 ? 1.786   15.525  -11.010 1.00 47.09  ? 198  GLN A O   1 
ATOM   1473 C CB  . GLN A 1 198 ? -0.553  17.125  -10.297 1.00 53.87  ? 198  GLN A CB  1 
ATOM   1474 C CG  . GLN A 1 198 ? -1.522  17.954  -9.450  1.00 63.41  ? 198  GLN A CG  1 
ATOM   1475 C CD  . GLN A 1 198 ? -2.990  17.595  -9.657  1.00 66.28  ? 198  GLN A CD  1 
ATOM   1476 O OE1 . GLN A 1 198 ? -3.656  18.134  -10.551 1.00 66.35  ? 198  GLN A OE1 1 
ATOM   1477 N NE2 . GLN A 1 198 ? -3.507  16.691  -8.817  1.00 49.64  ? 198  GLN A NE2 1 
ATOM   1478 N N   . GLY A 1 199 ? 2.714   17.422  -11.772 1.00 50.18  ? 199  GLY A N   1 
ATOM   1479 C CA  . GLY A 1 199 ? 3.683   16.735  -12.605 1.00 69.35  ? 199  GLY A CA  1 
ATOM   1480 C C   . GLY A 1 199 ? 3.077   15.674  -13.509 1.00 77.99  ? 199  GLY A C   1 
ATOM   1481 O O   . GLY A 1 199 ? 3.511   14.523  -13.501 1.00 81.29  ? 199  GLY A O   1 
ATOM   1482 N N   . ILE A 1 200 ? 2.060   16.058  -14.276 1.00 65.28  ? 200  ILE A N   1 
ATOM   1483 C CA  . ILE A 1 200 ? 1.447   15.157  -15.248 1.00 51.42  ? 200  ILE A CA  1 
ATOM   1484 C C   . ILE A 1 200 ? 2.129   15.296  -16.597 1.00 48.32  ? 200  ILE A C   1 
ATOM   1485 O O   . ILE A 1 200 ? 2.317   16.418  -17.095 1.00 47.99  ? 200  ILE A O   1 
ATOM   1486 C CB  . ILE A 1 200 ? -0.071  15.438  -15.399 1.00 69.28  ? 200  ILE A CB  1 
ATOM   1487 C CG1 . ILE A 1 200 ? -0.810  15.039  -14.115 1.00 63.19  ? 200  ILE A CG1 1 
ATOM   1488 C CG2 . ILE A 1 200 ? -0.650  14.712  -16.630 1.00 55.48  ? 200  ILE A CG2 1 
ATOM   1489 C CD1 . ILE A 1 200 ? -2.134  15.736  -13.927 1.00 63.56  ? 200  ILE A CD1 1 
ATOM   1490 N N   . ASP A 1 201 ? 2.496   14.155  -17.181 1.00 42.50  ? 201  ASP A N   1 
ATOM   1491 C CA  . ASP A 1 201 ? 3.197   14.140  -18.463 1.00 46.40  ? 201  ASP A CA  1 
ATOM   1492 C C   . ASP A 1 201 ? 2.283   14.154  -19.683 1.00 48.74  ? 201  ASP A C   1 
ATOM   1493 O O   . ASP A 1 201 ? 2.560   14.844  -20.666 1.00 54.61  ? 201  ASP A O   1 
ATOM   1494 C CB  . ASP A 1 201 ? 4.129   12.935  -18.553 1.00 56.86  ? 201  ASP A CB  1 
ATOM   1495 C CG  . ASP A 1 201 ? 5.217   12.967  -17.504 1.00 59.13  ? 201  ASP A CG  1 
ATOM   1496 O OD1 . ASP A 1 201 ? 6.090   13.851  -17.598 1.00 61.09  ? 201  ASP A OD1 1 
ATOM   1497 O OD2 . ASP A 1 201 ? 5.196   12.115  -16.591 1.00 52.57  ? 201  ASP A OD2 1 
ATOM   1498 N N   . ILE A 1 202 ? 1.227   13.352  -19.652 1.00 49.00  ? 202  ILE A N   1 
ATOM   1499 C CA  . ILE A 1 202 ? 0.228   13.407  -20.717 1.00 47.16  ? 202  ILE A CA  1 
ATOM   1500 C C   . ILE A 1 202 ? -1.174  13.492  -20.125 1.00 51.51  ? 202  ILE A C   1 
ATOM   1501 O O   . ILE A 1 202 ? -1.626  12.592  -19.416 1.00 46.74  ? 202  ILE A O   1 
ATOM   1502 C CB  . ILE A 1 202 ? 0.308   12.225  -21.689 1.00 43.52  ? 202  ILE A CB  1 
ATOM   1503 C CG1 . ILE A 1 202 ? 1.741   12.012  -22.178 1.00 46.58  ? 202  ILE A CG1 1 
ATOM   1504 C CG2 . ILE A 1 202 ? -0.603  12.473  -22.886 1.00 41.81  ? 202  ILE A CG2 1 
ATOM   1505 C CD1 . ILE A 1 202 ? 2.340   10.705  -21.706 1.00 47.53  ? 202  ILE A CD1 1 
ATOM   1506 N N   . LEU A 1 203 ? -1.845  14.598  -20.409 1.00 46.71  ? 203  LEU A N   1 
ATOM   1507 C CA  . LEU A 1 203 ? -3.207  14.807  -19.950 1.00 40.96  ? 203  LEU A CA  1 
ATOM   1508 C C   . LEU A 1 203 ? -4.130  14.960  -21.158 1.00 36.72  ? 203  LEU A C   1 
ATOM   1509 O O   . LEU A 1 203 ? -3.848  15.721  -22.090 1.00 41.12  ? 203  LEU A O   1 
ATOM   1510 C CB  . LEU A 1 203 ? -3.271  16.049  -19.058 1.00 37.75  ? 203  LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 203 ? -4.599  16.403  -18.385 1.00 45.45  ? 203  LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 203 ? -5.183  15.238  -17.596 1.00 38.36  ? 203  LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 203 ? -4.419  17.618  -17.490 1.00 37.02  ? 203  LEU A CD2 1 
ATOM   1514 N N   . TYR A 1 204 ? -5.226  14.221  -21.160 1.00 38.46  ? 204  TYR A N   1 
ATOM   1515 C CA  . TYR A 1 204 ? -6.256  14.476  -22.159 1.00 39.80  ? 204  TYR A CA  1 
ATOM   1516 C C   . TYR A 1 204 ? -7.628  14.578  -21.529 1.00 40.02  ? 204  TYR A C   1 
ATOM   1517 O O   . TYR A 1 204 ? -7.863  14.123  -20.401 1.00 41.41  ? 204  TYR A O   1 
ATOM   1518 C CB  . TYR A 1 204 ? -6.247  13.429  -23.283 1.00 37.75  ? 204  TYR A CB  1 
ATOM   1519 C CG  . TYR A 1 204 ? -6.659  12.045  -22.832 1.00 46.27  ? 204  TYR A CG  1 
ATOM   1520 C CD1 . TYR A 1 204 ? -5.771  11.216  -22.159 1.00 44.69  ? 204  TYR A CD1 1 
ATOM   1521 C CD2 . TYR A 1 204 ? -7.936  11.572  -23.070 1.00 39.57  ? 204  TYR A CD2 1 
ATOM   1522 C CE1 . TYR A 1 204 ? -6.147  9.954   -21.748 1.00 38.62  ? 204  TYR A CE1 1 
ATOM   1523 C CE2 . TYR A 1 204 ? -8.317  10.321  -22.658 1.00 37.59  ? 204  TYR A CE2 1 
ATOM   1524 C CZ  . TYR A 1 204 ? -7.421  9.522   -21.996 1.00 41.78  ? 204  TYR A CZ  1 
ATOM   1525 O OH  . TYR A 1 204 ? -7.812  8.277   -21.588 1.00 44.16  ? 204  TYR A OH  1 
ATOM   1526 N N   . SER A 1 205 ? -8.521  15.221  -22.262 1.00 36.87  ? 205  SER A N   1 
ATOM   1527 C CA  . SER A 1 205 ? -9.913  15.280  -21.886 1.00 37.40  ? 205  SER A CA  1 
ATOM   1528 C C   . SER A 1 205 ? -10.762 15.311  -23.159 1.00 37.63  ? 205  SER A C   1 
ATOM   1529 O O   . SER A 1 205 ? -10.232 15.205  -24.276 1.00 32.21  ? 205  SER A O   1 
ATOM   1530 C CB  . SER A 1 205 ? -10.188 16.486  -20.982 1.00 35.85  ? 205  SER A CB  1 
ATOM   1531 O OG  . SER A 1 205 ? -11.565 16.539  -20.617 1.00 43.20  ? 205  SER A OG  1 
ATOM   1532 N N   . GLY A 1 206 ? -12.076 15.441  -22.989 1.00 40.48  ? 206  GLY A N   1 
ATOM   1533 C CA  . GLY A 1 206 ? -13.002 15.372  -24.109 1.00 38.72  ? 206  GLY A CA  1 
ATOM   1534 C C   . GLY A 1 206 ? -13.825 16.638  -24.192 1.00 42.71  ? 206  GLY A C   1 
ATOM   1535 O O   . GLY A 1 206 ? -13.887 17.417  -23.236 1.00 39.18  ? 206  GLY A O   1 
ATOM   1536 N N   . SER A 1 207 ? -14.462 16.845  -25.338 1.00 29.23  ? 207  SER A N   1 
ATOM   1537 C CA  . SER A 1 207 ? -15.285 18.030  -25.549 1.00 39.59  ? 207  SER A CA  1 
ATOM   1538 C C   . SER A 1 207 ? -16.692 17.955  -24.924 1.00 32.76  ? 207  SER A C   1 
ATOM   1539 O O   . SER A 1 207 ? -17.277 18.984  -24.606 1.00 36.26  ? 207  SER A O   1 
ATOM   1540 C CB  . SER A 1 207 ? -15.441 18.275  -27.049 1.00 36.56  ? 207  SER A CB  1 
ATOM   1541 O OG  . SER A 1 207 ? -16.136 17.194  -27.648 1.00 37.02  ? 207  SER A OG  1 
ATOM   1542 N N   . GLN A 1 208 ? -17.235 16.751  -24.771 1.00 42.24  ? 208  GLN A N   1 
ATOM   1543 C CA  . GLN A 1 208 ? -18.676 16.604  -24.551 1.00 41.03  ? 208  GLN A CA  1 
ATOM   1544 C C   . GLN A 1 208 ? -19.089 16.430  -23.108 1.00 43.04  ? 208  GLN A C   1 
ATOM   1545 O O   . GLN A 1 208 ? -20.254 16.140  -22.834 1.00 31.87  ? 208  GLN A O   1 
ATOM   1546 C CB  . GLN A 1 208 ? -19.246 15.431  -25.359 1.00 42.69  ? 208  GLN A CB  1 
ATOM   1547 C CG  . GLN A 1 208 ? -18.925 14.053  -24.803 1.00 37.07  ? 208  GLN A CG  1 
ATOM   1548 C CD  . GLN A 1 208 ? -17.548 13.562  -25.198 1.00 45.53  ? 208  GLN A CD  1 
ATOM   1549 O OE1 . GLN A 1 208 ? -16.609 14.348  -25.358 1.00 44.34  ? 208  GLN A OE1 1 
ATOM   1550 N NE2 . GLN A 1 208 ? -17.419 12.249  -25.355 1.00 44.82  ? 208  GLN A NE2 1 
ATOM   1551 N N   . LYS A 1 209 ? -18.144 16.589  -22.186 1.00 46.06  ? 209  LYS A N   1 
ATOM   1552 C CA  . LYS A 1 209 ? -18.460 16.439  -20.769 1.00 42.00  ? 209  LYS A CA  1 
ATOM   1553 C C   . LYS A 1 209 ? -18.710 17.787  -20.077 1.00 37.07  ? 209  LYS A C   1 
ATOM   1554 O O   . LYS A 1 209 ? -19.626 18.495  -20.455 1.00 37.34  ? 209  LYS A O   1 
ATOM   1555 C CB  . LYS A 1 209 ? -17.430 15.564  -20.053 1.00 42.41  ? 209  LYS A CB  1 
ATOM   1556 C CG  . LYS A 1 209 ? -17.879 14.101  -19.862 1.00 35.05  ? 209  LYS A CG  1 
ATOM   1557 C CD  . LYS A 1 209 ? -17.744 13.236  -21.113 1.00 39.61  ? 209  LYS A CD  1 
ATOM   1558 C CE  . LYS A 1 209 ? -18.084 11.759  -20.827 1.00 41.19  ? 209  LYS A CE  1 
ATOM   1559 N NZ  . LYS A 1 209 ? -17.392 10.789  -21.725 1.00 71.18  ? 209  LYS A NZ  1 
ATOM   1560 N N   . ALA A 1 210 ? -17.926 18.160  -19.076 1.00 38.11  ? 210  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 210 ? -18.302 19.342  -18.302 1.00 35.90  ? 210  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 210 ? -18.186 20.629  -19.109 1.00 36.61  ? 210  ALA A C   1 
ATOM   1563 O O   . ALA A 1 210 ? -18.714 21.670  -18.725 1.00 35.69  ? 210  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 210 ? -17.498 19.432  -17.053 1.00 34.32  ? 210  ALA A CB  1 
ATOM   1565 N N   . LEU A 1 211 ? -17.487 20.538  -20.231 1.00 34.10  ? 211  LEU A N   1 
ATOM   1566 C CA  . LEU A 1 211 ? -17.317 21.648  -21.166 1.00 37.63  ? 211  LEU A CA  1 
ATOM   1567 C C   . LEU A 1 211 ? -18.601 21.966  -21.966 1.00 40.97  ? 211  LEU A C   1 
ATOM   1568 O O   . LEU A 1 211 ? -18.708 23.021  -22.580 1.00 44.73  ? 211  LEU A O   1 
ATOM   1569 C CB  . LEU A 1 211 ? -16.203 21.277  -22.146 1.00 39.51  ? 211  LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 211 ? -14.902 22.069  -22.314 1.00 46.03  ? 211  LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 211 ? -14.650 23.109  -21.212 1.00 32.05  ? 211  LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 211 ? -13.756 21.090  -22.423 1.00 35.05  ? 211  LEU A CD2 1 
ATOM   1573 N N   . ASN A 1 212 ? -19.538 21.021  -21.989 1.00 37.97  ? 212  ASN A N   1 
ATOM   1574 C CA  . ASN A 1 212 ? -20.795 21.138  -22.750 1.00 44.17  ? 212  ASN A CA  1 
ATOM   1575 C C   . ASN A 1 212 ? -20.680 21.434  -24.251 1.00 38.77  ? 212  ASN A C   1 
ATOM   1576 O O   . ASN A 1 212 ? -21.542 22.095  -24.809 1.00 42.34  ? 212  ASN A O   1 
ATOM   1577 C CB  . ASN A 1 212 ? -21.727 22.187  -22.121 1.00 30.36  ? 212  ASN A CB  1 
ATOM   1578 C CG  . ASN A 1 212 ? -21.802 22.071  -20.634 1.00 37.65  ? 212  ASN A CG  1 
ATOM   1579 O OD1 . ASN A 1 212 ? -21.713 23.069  -19.928 1.00 43.09  ? 212  ASN A OD1 1 
ATOM   1580 N ND2 . ASN A 1 212 ? -21.955 20.848  -20.139 1.00 31.56  ? 212  ASN A ND2 1 
ATOM   1581 N N   . ALA A 1 213 ? -19.622 20.974  -24.901 1.00 38.11  ? 213  ALA A N   1 
ATOM   1582 C CA  . ALA A 1 213 ? -19.521 21.107  -26.351 1.00 35.86  ? 213  ALA A CA  1 
ATOM   1583 C C   . ALA A 1 213 ? -20.004 19.795  -26.979 1.00 31.46  ? 213  ALA A C   1 
ATOM   1584 O O   . ALA A 1 213 ? -20.217 18.821  -26.263 1.00 33.57  ? 213  ALA A O   1 
ATOM   1585 C CB  . ALA A 1 213 ? -18.090 21.445  -26.756 1.00 29.07  ? 213  ALA A CB  1 
ATOM   1586 N N   . PRO A 1 214 ? -20.237 19.768  -28.303 1.00 30.63  ? 214  PRO A N   1 
ATOM   1587 C CA  . PRO A 1 214 ? -20.654 18.486  -28.891 1.00 33.77  ? 214  PRO A CA  1 
ATOM   1588 C C   . PRO A 1 214 ? -19.517 17.483  -28.904 1.00 30.99  ? 214  PRO A C   1 
ATOM   1589 O O   . PRO A 1 214 ? -18.372 17.885  -29.061 1.00 37.72  ? 214  PRO A O   1 
ATOM   1590 C CB  . PRO A 1 214 ? -20.999 18.860  -30.342 1.00 29.19  ? 214  PRO A CB  1 
ATOM   1591 C CG  . PRO A 1 214 ? -21.339 20.292  -30.302 1.00 39.19  ? 214  PRO A CG  1 
ATOM   1592 C CD  . PRO A 1 214 ? -20.392 20.876  -29.264 1.00 33.08  ? 214  PRO A CD  1 
ATOM   1593 N N   . PRO A 1 215 ? -19.838 16.191  -28.780 1.00 31.32  ? 215  PRO A N   1 
ATOM   1594 C CA  . PRO A 1 215 ? -18.806 15.154  -28.847 1.00 30.70  ? 215  PRO A CA  1 
ATOM   1595 C C   . PRO A 1 215 ? -18.143 15.178  -30.211 1.00 36.09  ? 215  PRO A C   1 
ATOM   1596 O O   . PRO A 1 215 ? -18.788 15.570  -31.173 1.00 32.04  ? 215  PRO A O   1 
ATOM   1597 C CB  . PRO A 1 215 ? -19.600 13.860  -28.670 1.00 33.63  ? 215  PRO A CB  1 
ATOM   1598 C CG  . PRO A 1 215 ? -21.001 14.198  -29.199 1.00 29.93  ? 215  PRO A CG  1 
ATOM   1599 C CD  . PRO A 1 215 ? -21.210 15.636  -28.804 1.00 35.50  ? 215  PRO A CD  1 
ATOM   1600 N N   . GLY A 1 216 ? -16.868 14.802  -30.281 1.00 33.95  ? 216  GLY A N   1 
ATOM   1601 C CA  . GLY A 1 216 ? -16.172 14.724  -31.553 1.00 29.13  ? 216  GLY A CA  1 
ATOM   1602 C C   . GLY A 1 216 ? -14.787 15.345  -31.564 1.00 35.03  ? 216  GLY A C   1 
ATOM   1603 O O   . GLY A 1 216 ? -13.980 14.996  -32.415 1.00 28.56  ? 216  GLY A O   1 
ATOM   1604 N N   . THR A 1 217 ? -14.501 16.292  -30.668 1.00 31.90  ? 217  THR A N   1 
ATOM   1605 C CA  . THR A 1 217 ? -13.109 16.710  -30.500 1.00 30.59  ? 217  THR A CA  1 
ATOM   1606 C C   . THR A 1 217 ? -12.620 16.324  -29.116 1.00 34.96  ? 217  THR A C   1 
ATOM   1607 O O   . THR A 1 217 ? -13.408 15.979  -28.247 1.00 43.16  ? 217  THR A O   1 
ATOM   1608 C CB  . THR A 1 217 ? -12.897 18.212  -30.724 1.00 34.82  ? 217  THR A CB  1 
ATOM   1609 O OG1 . THR A 1 217 ? -13.715 18.958  -29.811 1.00 33.33  ? 217  THR A OG1 1 
ATOM   1610 C CG2 . THR A 1 217 ? -13.247 18.585  -32.140 1.00 27.33  ? 217  THR A CG2 1 
ATOM   1611 N N   . SER A 1 218 ? -11.310 16.367  -28.929 1.00 32.91  ? 218  SER A N   1 
ATOM   1612 C CA  . SER A 1 218 ? -10.710 16.104  -27.634 1.00 33.15  ? 218  SER A CA  1 
ATOM   1613 C C   . SER A 1 218 ? -9.470  16.972  -27.402 1.00 39.38  ? 218  SER A C   1 
ATOM   1614 O O   . SER A 1 218 ? -8.914  17.551  -28.338 1.00 37.08  ? 218  SER A O   1 
ATOM   1615 C CB  . SER A 1 218 ? -10.406 14.614  -27.453 1.00 28.88  ? 218  SER A CB  1 
ATOM   1616 O OG  . SER A 1 218 ? -9.780  14.067  -28.595 1.00 34.37  ? 218  SER A OG  1 
ATOM   1617 N N   . LEU A 1 219 ? -9.069  17.070  -26.138 1.00 34.51  ? 219  LEU A N   1 
ATOM   1618 C CA  . LEU A 1 219 ? -8.015  17.978  -25.715 1.00 41.66  ? 219  LEU A CA  1 
ATOM   1619 C C   . LEU A 1 219 ? -6.808  17.182  -25.234 1.00 45.78  ? 219  LEU A C   1 
ATOM   1620 O O   . LEU A 1 219 ? -6.970  16.178  -24.540 1.00 38.72  ? 219  LEU A O   1 
ATOM   1621 C CB  . LEU A 1 219 ? -8.511  18.837  -24.553 1.00 42.38  ? 219  LEU A CB  1 
ATOM   1622 C CG  . LEU A 1 219 ? -9.797  19.641  -24.717 1.00 48.95  ? 219  LEU A CG  1 
ATOM   1623 C CD1 . LEU A 1 219 ? -9.915  20.712  -23.639 1.00 31.23  ? 219  LEU A CD1 1 
ATOM   1624 C CD2 . LEU A 1 219 ? -9.828  20.271  -26.094 1.00 55.94  ? 219  LEU A CD2 1 
ATOM   1625 N N   . ILE A 1 220 ? -5.603  17.626  -25.582 1.00 40.98  ? 220  ILE A N   1 
ATOM   1626 C CA  . ILE A 1 220 ? -4.402  16.935  -25.112 1.00 45.95  ? 220  ILE A CA  1 
ATOM   1627 C C   . ILE A 1 220 ? -3.201  17.865  -24.890 1.00 49.48  ? 220  ILE A C   1 
ATOM   1628 O O   . ILE A 1 220 ? -3.027  18.859  -25.608 1.00 39.30  ? 220  ILE A O   1 
ATOM   1629 C CB  . ILE A 1 220 ? -4.015  15.782  -26.066 1.00 45.87  ? 220  ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 220 ? -3.163  14.738  -25.347 1.00 44.47  ? 220  ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 220 ? -3.330  16.317  -27.318 1.00 33.11  ? 220  ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 220 ? -3.076  13.421  -26.099 1.00 39.47  ? 220  ILE A CD1 1 
ATOM   1633 N N   . SER A 1 221 ? -2.385  17.529  -23.887 1.00 38.32  ? 221  SER A N   1 
ATOM   1634 C CA  . SER A 1 221 ? -1.146  18.254  -23.596 1.00 42.58  ? 221  SER A CA  1 
ATOM   1635 C C   . SER A 1 221 ? 0.000   17.310  -23.274 1.00 40.89  ? 221  SER A C   1 
ATOM   1636 O O   . SER A 1 221 ? -0.204  16.283  -22.625 1.00 41.93  ? 221  SER A O   1 
ATOM   1637 C CB  . SER A 1 221 ? -1.329  19.191  -22.411 1.00 49.97  ? 221  SER A CB  1 
ATOM   1638 O OG  . SER A 1 221 ? -0.287  20.149  -22.386 1.00 53.39  ? 221  SER A OG  1 
ATOM   1639 N N   . PHE A 1 222 ? 1.209   17.666  -23.704 1.00 41.62  ? 222  PHE A N   1 
ATOM   1640 C CA  . PHE A 1 222 ? 2.395   16.863  -23.379 1.00 40.37  ? 222  PHE A CA  1 
ATOM   1641 C C   . PHE A 1 222 ? 3.512   17.630  -22.638 1.00 38.63  ? 222  PHE A C   1 
ATOM   1642 O O   . PHE A 1 222 ? 3.940   18.707  -23.068 1.00 43.10  ? 222  PHE A O   1 
ATOM   1643 C CB  . PHE A 1 222 ? 2.985   16.247  -24.652 1.00 41.68  ? 222  PHE A CB  1 
ATOM   1644 C CG  . PHE A 1 222 ? 2.016   15.398  -25.443 1.00 53.86  ? 222  PHE A CG  1 
ATOM   1645 C CD1 . PHE A 1 222 ? 1.145   15.983  -26.357 1.00 42.15  ? 222  PHE A CD1 1 
ATOM   1646 C CD2 . PHE A 1 222 ? 1.992   14.014  -25.291 1.00 57.64  ? 222  PHE A CD2 1 
ATOM   1647 C CE1 . PHE A 1 222 ? 0.265   15.208  -27.108 1.00 48.90  ? 222  PHE A CE1 1 
ATOM   1648 C CE2 . PHE A 1 222 ? 1.109   13.229  -26.046 1.00 52.02  ? 222  PHE A CE2 1 
ATOM   1649 C CZ  . PHE A 1 222 ? 0.245   13.834  -26.954 1.00 42.78  ? 222  PHE A CZ  1 
ATOM   1650 N N   . SER A 1 223 ? 4.006   17.046  -21.547 1.00 41.80  ? 223  SER A N   1 
ATOM   1651 C CA  . SER A 1 223 ? 5.169   17.599  -20.828 1.00 58.53  ? 223  SER A CA  1 
ATOM   1652 C C   . SER A 1 223 ? 6.470   17.563  -21.653 1.00 52.41  ? 223  SER A C   1 
ATOM   1653 O O   . SER A 1 223 ? 6.541   16.935  -22.704 1.00 47.56  ? 223  SER A O   1 
ATOM   1654 C CB  . SER A 1 223 ? 5.425   16.825  -19.537 1.00 55.29  ? 223  SER A CB  1 
ATOM   1655 O OG  . SER A 1 223 ? 6.109   15.620  -19.840 1.00 52.45  ? 223  SER A OG  1 
ATOM   1656 N N   . ASP A 1 224 ? 7.483   18.274  -21.167 1.00 62.08  ? 224  ASP A N   1 
ATOM   1657 C CA  . ASP A 1 224 ? 8.861   18.186  -21.659 1.00 50.57  ? 224  ASP A CA  1 
ATOM   1658 C C   . ASP A 1 224 ? 9.284   16.736  -21.898 1.00 39.99  ? 224  ASP A C   1 
ATOM   1659 O O   . ASP A 1 224 ? 9.746   16.357  -22.995 1.00 54.15  ? 224  ASP A O   1 
ATOM   1660 C CB  . ASP A 1 224 ? 9.797   18.755  -20.609 1.00 74.02  ? 224  ASP A CB  1 
ATOM   1661 C CG  . ASP A 1 224 ? 10.316  20.112  -20.962 1.00 86.74  ? 224  ASP A CG  1 
ATOM   1662 O OD1 . ASP A 1 224 ? 9.531   20.957  -21.460 1.00 61.08  ? 224  ASP A OD1 1 
ATOM   1663 O OD2 . ASP A 1 224 ? 11.514  20.380  -20.668 1.00 102.55 ? 224  ASP A OD2 1 
ATOM   1664 N N   . LYS A 1 225 ? 9.106   15.912  -20.872 1.00 40.97  ? 225  LYS A N   1 
ATOM   1665 C CA  . LYS A 1 225 ? 9.531   14.517  -20.939 1.00 54.59  ? 225  LYS A CA  1 
ATOM   1666 C C   . LYS A 1 225 ? 8.823   13.734  -22.045 1.00 54.28  ? 225  LYS A C   1 
ATOM   1667 O O   . LYS A 1 225 ? 9.472   13.063  -22.851 1.00 66.98  ? 225  LYS A O   1 
ATOM   1668 C CB  . LYS A 1 225 ? 9.359   13.843  -19.566 1.00 60.50  ? 225  LYS A CB  1 
ATOM   1669 C CG  . LYS A 1 225 ? 10.209  14.484  -18.479 1.00 64.69  ? 225  LYS A CG  1 
ATOM   1670 C CD  . LYS A 1 225 ? 9.835   14.080  -17.047 1.00 64.27  ? 225  LYS A CD  1 
ATOM   1671 C CE  . LYS A 1 225 ? 10.552  15.000  -16.034 1.00 70.97  ? 225  LYS A CE  1 
ATOM   1672 N NZ  . LYS A 1 225 ? 12.004  15.195  -16.359 1.00 73.55  ? 225  LYS A NZ  1 
ATOM   1673 N N   . ALA A 1 226 ? 7.496   13.824  -22.072 1.00 49.62  ? 226  ALA A N   1 
ATOM   1674 C CA  . ALA A 1 226 ? 6.708   13.234  -23.142 1.00 44.30  ? 226  ALA A CA  1 
ATOM   1675 C C   . ALA A 1 226 ? 7.200   13.697  -24.503 1.00 42.45  ? 226  ALA A C   1 
ATOM   1676 O O   . ALA A 1 226 ? 7.440   12.878  -25.399 1.00 46.52  ? 226  ALA A O   1 
ATOM   1677 C CB  . ALA A 1 226 ? 5.224   13.583  -22.968 1.00 42.13  ? 226  ALA A CB  1 
ATOM   1678 N N   . LYS A 1 227 ? 7.358   15.007  -24.661 1.00 38.00  ? 227  LYS A N   1 
ATOM   1679 C CA  . LYS A 1 227 ? 7.779   15.546  -25.950 1.00 42.77  ? 227  LYS A CA  1 
ATOM   1680 C C   . LYS A 1 227 ? 9.098   14.910  -26.416 1.00 48.55  ? 227  LYS A C   1 
ATOM   1681 O O   . LYS A 1 227 ? 9.231   14.541  -27.582 1.00 49.37  ? 227  LYS A O   1 
ATOM   1682 C CB  . LYS A 1 227 ? 7.878   17.074  -25.889 1.00 45.73  ? 227  LYS A CB  1 
ATOM   1683 C CG  . LYS A 1 227 ? 8.267   17.756  -27.212 1.00 55.42  ? 227  LYS A CG  1 
ATOM   1684 C CD  . LYS A 1 227 ? 7.933   19.249  -27.144 1.00 65.64  ? 227  LYS A CD  1 
ATOM   1685 C CE  . LYS A 1 227 ? 8.850   20.137  -27.996 1.00 69.03  ? 227  LYS A CE  1 
ATOM   1686 N NZ  . LYS A 1 227 ? 8.648   21.616  -27.753 1.00 49.25  ? 227  LYS A NZ  1 
ATOM   1687 N N   . LYS A 1 228 ? 10.045  14.758  -25.486 1.00 53.67  ? 228  LYS A N   1 
ATOM   1688 C CA  . LYS A 1 228 ? 11.338  14.136  -25.759 1.00 54.33  ? 228  LYS A CA  1 
ATOM   1689 C C   . LYS A 1 228 ? 11.163  12.696  -26.245 1.00 54.90  ? 228  LYS A C   1 
ATOM   1690 O O   . LYS A 1 228 ? 11.608  12.342  -27.343 1.00 55.10  ? 228  LYS A O   1 
ATOM   1691 C CB  . LYS A 1 228 ? 12.223  14.182  -24.502 1.00 60.27  ? 228  LYS A CB  1 
ATOM   1692 C CG  . LYS A 1 228 ? 13.624  13.604  -24.675 1.00 68.93  ? 228  LYS A CG  1 
ATOM   1693 C CD  . LYS A 1 228 ? 14.485  14.471  -25.590 1.00 80.76  ? 228  LYS A CD  1 
ATOM   1694 C CE  . LYS A 1 228 ? 15.812  13.789  -25.936 1.00 84.15  ? 228  LYS A CE  1 
ATOM   1695 N NZ  . LYS A 1 228 ? 16.412  14.345  -27.186 1.00 78.50  ? 228  LYS A NZ  1 
ATOM   1696 N N   . LYS A 1 229 ? 10.494  11.877  -25.439 1.00 51.57  ? 229  LYS A N   1 
ATOM   1697 C CA  . LYS A 1 229 ? 10.289  10.477  -25.796 1.00 48.71  ? 229  LYS A CA  1 
ATOM   1698 C C   . LYS A 1 229 ? 9.652   10.330  -27.184 1.00 55.95  ? 229  LYS A C   1 
ATOM   1699 O O   . LYS A 1 229 ? 10.088  9.501   -27.981 1.00 59.27  ? 229  LYS A O   1 
ATOM   1700 C CB  . LYS A 1 229 ? 9.488   9.754   -24.701 1.00 54.85  ? 229  LYS A CB  1 
ATOM   1701 C CG  . LYS A 1 229 ? 8.940   8.384   -25.094 1.00 62.75  ? 229  LYS A CG  1 
ATOM   1702 C CD  . LYS A 1 229 ? 9.845   7.253   -24.680 1.00 66.74  ? 229  LYS A CD  1 
ATOM   1703 C CE  . LYS A 1 229 ? 9.696   6.063   -25.631 1.00 74.54  ? 229  LYS A CE  1 
ATOM   1704 N NZ  . LYS A 1 229 ? 8.613   5.112   -25.234 1.00 75.18  ? 229  LYS A NZ  1 
ATOM   1705 N N   . MET A 1 230 ? 8.663   11.171  -27.494 1.00 55.92  ? 230  MET A N   1 
ATOM   1706 C CA  . MET A 1 230 ? 7.943   11.073  -28.767 1.00 49.57  ? 230  MET A CA  1 
ATOM   1707 C C   . MET A 1 230 ? 8.775   11.511  -29.958 1.00 48.35  ? 230  MET A C   1 
ATOM   1708 O O   . MET A 1 230 ? 8.706   10.912  -31.031 1.00 46.29  ? 230  MET A O   1 
ATOM   1709 C CB  . MET A 1 230 ? 6.625   11.868  -28.728 1.00 50.74  ? 230  MET A CB  1 
ATOM   1710 C CG  . MET A 1 230 ? 5.518   11.204  -27.910 1.00 46.83  ? 230  MET A CG  1 
ATOM   1711 S SD  . MET A 1 230 ? 3.996   12.176  -27.895 1.00 46.65  ? 230  MET A SD  1 
ATOM   1712 C CE  . MET A 1 230 ? 4.672   13.741  -27.364 1.00 54.25  ? 230  MET A CE  1 
ATOM   1713 N N   . TYR A 1 231 ? 9.560   12.561  -29.769 1.00 50.37  ? 231  TYR A N   1 
ATOM   1714 C CA  . TYR A 1 231 ? 10.392  13.076  -30.853 1.00 56.48  ? 231  TYR A CA  1 
ATOM   1715 C C   . TYR A 1 231 ? 11.694  12.293  -31.075 1.00 58.89  ? 231  TYR A C   1 
ATOM   1716 O O   . TYR A 1 231 ? 12.423  12.556  -32.027 1.00 55.57  ? 231  TYR A O   1 
ATOM   1717 C CB  . TYR A 1 231 ? 10.708  14.555  -30.618 1.00 56.44  ? 231  TYR A CB  1 
ATOM   1718 C CG  . TYR A 1 231 ? 9.637   15.460  -31.155 1.00 52.61  ? 231  TYR A CG  1 
ATOM   1719 C CD1 . TYR A 1 231 ? 8.495   15.721  -30.420 1.00 47.97  ? 231  TYR A CD1 1 
ATOM   1720 C CD2 . TYR A 1 231 ? 9.760   16.039  -32.403 1.00 50.13  ? 231  TYR A CD2 1 
ATOM   1721 C CE1 . TYR A 1 231 ? 7.506   16.535  -30.914 1.00 59.44  ? 231  TYR A CE1 1 
ATOM   1722 C CE2 . TYR A 1 231 ? 8.772   16.858  -32.908 1.00 53.22  ? 231  TYR A CE2 1 
ATOM   1723 C CZ  . TYR A 1 231 ? 7.648   17.103  -32.156 1.00 53.47  ? 231  TYR A CZ  1 
ATOM   1724 O OH  . TYR A 1 231 ? 6.661   17.917  -32.648 1.00 54.45  ? 231  TYR A OH  1 
ATOM   1725 N N   . SER A 1 232 ? 11.991  11.343  -30.199 1.00 52.71  ? 232  SER A N   1 
ATOM   1726 C CA  . SER A 1 232 ? 13.241  10.618  -30.309 1.00 58.92  ? 232  SER A CA  1 
ATOM   1727 C C   . SER A 1 232 ? 13.018  9.115   -30.483 1.00 68.13  ? 232  SER A C   1 
ATOM   1728 O O   . SER A 1 232 ? 13.953  8.329   -30.374 1.00 65.68  ? 232  SER A O   1 
ATOM   1729 C CB  . SER A 1 232 ? 14.109  10.896  -29.088 1.00 49.63  ? 232  SER A CB  1 
ATOM   1730 O OG  . SER A 1 232 ? 13.599  10.208  -27.970 1.00 55.38  ? 232  SER A OG  1 
ATOM   1731 N N   . ARG A 1 233 ? 11.781  8.708   -30.756 1.00 72.21  ? 233  ARG A N   1 
ATOM   1732 C CA  . ARG A 1 233 ? 11.533  7.292   -30.988 1.00 58.28  ? 233  ARG A CA  1 
ATOM   1733 C C   . ARG A 1 233 ? 12.200  6.860   -32.283 1.00 53.04  ? 233  ARG A C   1 
ATOM   1734 O O   . ARG A 1 233 ? 12.422  7.672   -33.179 1.00 58.69  ? 233  ARG A O   1 
ATOM   1735 C CB  . ARG A 1 233 ? 10.037  6.925   -30.946 1.00 66.12  ? 233  ARG A CB  1 
ATOM   1736 C CG  . ARG A 1 233 ? 9.087   7.769   -31.775 1.00 59.08  ? 233  ARG A CG  1 
ATOM   1737 C CD  . ARG A 1 233 ? 7.644   7.327   -31.531 1.00 62.51  ? 233  ARG A CD  1 
ATOM   1738 N NE  . ARG A 1 233 ? 7.348   6.024   -32.130 1.00 67.65  ? 233  ARG A NE  1 
ATOM   1739 C CZ  . ARG A 1 233 ? 6.401   5.188   -31.708 1.00 60.51  ? 233  ARG A CZ  1 
ATOM   1740 N NH1 . ARG A 1 233 ? 5.639   5.497   -30.660 1.00 44.58  ? 233  ARG A NH1 1 
ATOM   1741 N NH2 . ARG A 1 233 ? 6.218   4.030   -32.334 1.00 53.30  ? 233  ARG A NH2 1 
ATOM   1742 N N   . LYS A 1 234 ? 12.559  5.588   -32.362 1.00 51.65  ? 234  LYS A N   1 
ATOM   1743 C CA  . LYS A 1 234 ? 13.246  5.093   -33.544 1.00 72.73  ? 234  LYS A CA  1 
ATOM   1744 C C   . LYS A 1 234 ? 12.218  4.773   -34.607 1.00 65.78  ? 234  LYS A C   1 
ATOM   1745 O O   . LYS A 1 234 ? 12.442  4.997   -35.792 1.00 67.43  ? 234  LYS A O   1 
ATOM   1746 C CB  . LYS A 1 234 ? 14.068  3.842   -33.220 1.00 82.39  ? 234  LYS A CB  1 
ATOM   1747 C CG  . LYS A 1 234 ? 15.290  4.090   -32.352 1.00 81.76  ? 234  LYS A CG  1 
ATOM   1748 C CD  . LYS A 1 234 ? 16.187  5.165   -32.948 1.00 74.02  ? 234  LYS A CD  1 
ATOM   1749 C CE  . LYS A 1 234 ? 17.580  5.129   -32.327 1.00 76.50  ? 234  LYS A CE  1 
ATOM   1750 N NZ  . LYS A 1 234 ? 18.493  4.204   -33.058 1.00 80.37  ? 234  LYS A NZ  1 
ATOM   1751 N N   . THR A 1 235 ? 11.075  4.266   -34.162 1.00 62.72  ? 235  THR A N   1 
ATOM   1752 C CA  . THR A 1 235 ? 10.045  3.793   -35.069 1.00 64.90  ? 235  THR A CA  1 
ATOM   1753 C C   . THR A 1 235 ? 8.984   4.846   -35.329 1.00 65.53  ? 235  THR A C   1 
ATOM   1754 O O   . THR A 1 235 ? 8.783   5.751   -34.524 1.00 69.19  ? 235  THR A O   1 
ATOM   1755 C CB  . THR A 1 235 ? 9.377   2.558   -34.488 1.00 64.34  ? 235  THR A CB  1 
ATOM   1756 O OG1 . THR A 1 235 ? 9.213   2.743   -33.074 1.00 48.56  ? 235  THR A OG1 1 
ATOM   1757 C CG2 . THR A 1 235 ? 10.254  1.333   -34.726 1.00 62.90  ? 235  THR A CG2 1 
ATOM   1758 N N   . LYS A 1 236 ? 8.309   4.729   -36.461 1.00 56.01  ? 236  LYS A N   1 
ATOM   1759 C CA  . LYS A 1 236 ? 7.190   5.605   -36.741 1.00 60.08  ? 236  LYS A CA  1 
ATOM   1760 C C   . LYS A 1 236 ? 5.968   5.054   -36.031 1.00 62.45  ? 236  LYS A C   1 
ATOM   1761 O O   . LYS A 1 236 ? 5.769   3.845   -36.007 1.00 55.42  ? 236  LYS A O   1 
ATOM   1762 C CB  . LYS A 1 236 ? 6.929   5.687   -38.245 1.00 63.72  ? 236  LYS A CB  1 
ATOM   1763 C CG  . LYS A 1 236 ? 7.866   6.631   -38.987 1.00 73.02  ? 236  LYS A CG  1 
ATOM   1764 C CD  . LYS A 1 236 ? 7.382   6.864   -40.411 1.00 78.20  ? 236  LYS A CD  1 
ATOM   1765 C CE  . LYS A 1 236 ? 7.954   8.148   -41.004 1.00 81.93  ? 236  LYS A CE  1 
ATOM   1766 N NZ  . LYS A 1 236 ? 7.171   8.619   -42.198 1.00 79.64  ? 236  LYS A NZ  1 
ATOM   1767 N N   . PRO A 1 237 ? 5.153   5.938   -35.432 1.00 66.54  ? 237  PRO A N   1 
ATOM   1768 C CA  . PRO A 1 237 ? 3.867   5.494   -34.884 1.00 59.42  ? 237  PRO A CA  1 
ATOM   1769 C C   . PRO A 1 237 ? 2.986   4.855   -35.963 1.00 49.69  ? 237  PRO A C   1 
ATOM   1770 O O   . PRO A 1 237 ? 3.017   5.249   -37.131 1.00 37.36  ? 237  PRO A O   1 
ATOM   1771 C CB  . PRO A 1 237 ? 3.230   6.800   -34.393 1.00 62.32  ? 237  PRO A CB  1 
ATOM   1772 C CG  . PRO A 1 237 ? 4.377   7.687   -34.100 1.00 60.32  ? 237  PRO A CG  1 
ATOM   1773 C CD  . PRO A 1 237 ? 5.413   7.361   -35.143 1.00 61.99  ? 237  PRO A CD  1 
ATOM   1774 N N   . PHE A 1 238 ? 2.199   3.871   -35.559 1.00 37.97  ? 238  PHE A N   1 
ATOM   1775 C CA  . PHE A 1 238 ? 1.318   3.182   -36.478 1.00 42.85  ? 238  PHE A CA  1 
ATOM   1776 C C   . PHE A 1 238 ? 0.240   4.061   -37.093 1.00 43.67  ? 238  PHE A C   1 
ATOM   1777 O O   . PHE A 1 238 ? -0.462  3.621   -37.994 1.00 48.98  ? 238  PHE A O   1 
ATOM   1778 C CB  . PHE A 1 238 ? 0.654   2.011   -35.764 1.00 46.62  ? 238  PHE A CB  1 
ATOM   1779 C CG  . PHE A 1 238 ? 1.615   0.957   -35.329 1.00 54.62  ? 238  PHE A CG  1 
ATOM   1780 C CD1 . PHE A 1 238 ? 2.528   0.418   -36.226 1.00 40.93  ? 238  PHE A CD1 1 
ATOM   1781 C CD2 . PHE A 1 238 ? 1.611   0.498   -34.023 1.00 64.05  ? 238  PHE A CD2 1 
ATOM   1782 C CE1 . PHE A 1 238 ? 3.420   -0.557  -35.824 1.00 46.52  ? 238  PHE A CE1 1 
ATOM   1783 C CE2 . PHE A 1 238 ? 2.513   -0.480  -33.612 1.00 64.91  ? 238  PHE A CE2 1 
ATOM   1784 C CZ  . PHE A 1 238 ? 3.413   -1.005  -34.513 1.00 52.07  ? 238  PHE A CZ  1 
ATOM   1785 N N   . SER A 1 239 ? 0.075   5.284   -36.606 1.00 34.07  ? 239  SER A N   1 
ATOM   1786 C CA  . SER A 1 239 ? -1.014  6.113   -37.119 1.00 38.47  ? 239  SER A CA  1 
ATOM   1787 C C   . SER A 1 239 ? -0.487  7.382   -37.798 1.00 44.61  ? 239  SER A C   1 
ATOM   1788 O O   . SER A 1 239 ? 0.342   8.097   -37.241 1.00 54.87  ? 239  SER A O   1 
ATOM   1789 C CB  . SER A 1 239 ? -1.966  6.495   -35.983 1.00 33.31  ? 239  SER A CB  1 
ATOM   1790 O OG  . SER A 1 239 ? -2.815  7.560   -36.377 1.00 35.96  ? 239  SER A OG  1 
ATOM   1791 N N   . PHE A 1 240 ? -0.960  7.663   -39.001 1.00 39.18  ? 240  PHE A N   1 
ATOM   1792 C CA  . PHE A 1 240 ? -0.648  8.942   -39.638 1.00 42.64  ? 240  PHE A CA  1 
ATOM   1793 C C   . PHE A 1 240 ? -1.560  10.039  -39.075 1.00 41.84  ? 240  PHE A C   1 
ATOM   1794 O O   . PHE A 1 240 ? -1.096  11.095  -38.664 1.00 38.75  ? 240  PHE A O   1 
ATOM   1795 C CB  . PHE A 1 240 ? -0.803  8.866   -41.169 1.00 40.41  ? 240  PHE A CB  1 
ATOM   1796 C CG  . PHE A 1 240 ? -0.517  10.173  -41.864 1.00 44.82  ? 240  PHE A CG  1 
ATOM   1797 C CD1 . PHE A 1 240 ? 0.777   10.535  -42.156 1.00 47.13  ? 240  PHE A CD1 1 
ATOM   1798 C CD2 . PHE A 1 240 ? -1.539  11.052  -42.193 1.00 47.94  ? 240  PHE A CD2 1 
ATOM   1799 C CE1 . PHE A 1 240 ? 1.063   11.733  -42.771 1.00 42.62  ? 240  PHE A CE1 1 
ATOM   1800 C CE2 . PHE A 1 240 ? -1.257  12.266  -42.815 1.00 48.80  ? 240  PHE A CE2 1 
ATOM   1801 C CZ  . PHE A 1 240 ? 0.050   12.602  -43.099 1.00 42.58  ? 240  PHE A CZ  1 
ATOM   1802 N N   . TYR A 1 241 ? -2.861  9.767   -39.077 1.00 34.73  ? 241  TYR A N   1 
ATOM   1803 C CA  . TYR A 1 241 ? -3.877  10.714  -38.628 1.00 40.58  ? 241  TYR A CA  1 
ATOM   1804 C C   . TYR A 1 241 ? -3.584  11.295  -37.249 1.00 38.04  ? 241  TYR A C   1 
ATOM   1805 O O   . TYR A 1 241 ? -3.965  12.416  -36.956 1.00 38.66  ? 241  TYR A O   1 
ATOM   1806 C CB  . TYR A 1 241 ? -5.240  10.018  -38.615 1.00 32.95  ? 241  TYR A CB  1 
ATOM   1807 C CG  . TYR A 1 241 ? -6.427  10.924  -38.404 1.00 45.17  ? 241  TYR A CG  1 
ATOM   1808 C CD1 . TYR A 1 241 ? -6.888  11.750  -39.423 1.00 46.46  ? 241  TYR A CD1 1 
ATOM   1809 C CD2 . TYR A 1 241 ? -7.116  10.925  -37.199 1.00 43.75  ? 241  TYR A CD2 1 
ATOM   1810 C CE1 . TYR A 1 241 ? -7.995  12.580  -39.240 1.00 40.05  ? 241  TYR A CE1 1 
ATOM   1811 C CE2 . TYR A 1 241 ? -8.222  11.743  -37.004 1.00 48.02  ? 241  TYR A CE2 1 
ATOM   1812 C CZ  . TYR A 1 241 ? -8.660  12.570  -38.027 1.00 44.08  ? 241  TYR A CZ  1 
ATOM   1813 O OH  . TYR A 1 241 ? -9.755  13.382  -37.819 1.00 35.31  ? 241  TYR A OH  1 
ATOM   1814 N N   . LEU A 1 242 ? -2.886  10.531  -36.415 1.00 39.11  ? 242  LEU A N   1 
ATOM   1815 C CA  . LEU A 1 242 ? -2.694  10.912  -35.026 1.00 39.50  ? 242  LEU A CA  1 
ATOM   1816 C C   . LEU A 1 242 ? -1.234  11.185  -34.709 1.00 37.54  ? 242  LEU A C   1 
ATOM   1817 O O   . LEU A 1 242 ? -0.849  11.251  -33.536 1.00 39.74  ? 242  LEU A O   1 
ATOM   1818 C CB  . LEU A 1 242 ? -3.235  9.818   -34.100 1.00 42.49  ? 242  LEU A CB  1 
ATOM   1819 C CG  . LEU A 1 242 ? -4.735  9.504   -34.197 1.00 34.79  ? 242  LEU A CG  1 
ATOM   1820 C CD1 . LEU A 1 242 ? -5.161  8.393   -33.225 1.00 28.22  ? 242  LEU A CD1 1 
ATOM   1821 C CD2 . LEU A 1 242 ? -5.589  10.766  -33.971 1.00 26.66  ? 242  LEU A CD2 1 
ATOM   1822 N N   . ASP A 1 243 ? -0.424  11.352  -35.752 1.00 40.02  ? 243  ASP A N   1 
ATOM   1823 C CA  . ASP A 1 243 ? 1.022   11.471  -35.567 1.00 40.63  ? 243  ASP A CA  1 
ATOM   1824 C C   . ASP A 1 243 ? 1.345   12.823  -34.943 1.00 37.25  ? 243  ASP A C   1 
ATOM   1825 O O   . ASP A 1 243 ? 0.962   13.865  -35.475 1.00 37.24  ? 243  ASP A O   1 
ATOM   1826 C CB  . ASP A 1 243 ? 1.774   11.276  -36.895 1.00 41.94  ? 243  ASP A CB  1 
ATOM   1827 C CG  . ASP A 1 243 ? 3.280   11.471  -36.745 1.00 49.14  ? 243  ASP A CG  1 
ATOM   1828 O OD1 . ASP A 1 243 ? 3.724   12.644  -36.772 1.00 38.09  ? 243  ASP A OD1 1 
ATOM   1829 O OD2 . ASP A 1 243 ? 4.008   10.456  -36.596 1.00 49.83  ? 243  ASP A OD2 1 
ATOM   1830 N N   . ILE A 1 244 ? 2.050   12.810  -33.815 1.00 32.86  ? 244  ILE A N   1 
ATOM   1831 C CA  . ILE A 1 244 ? 2.168   14.025  -33.027 1.00 34.15  ? 244  ILE A CA  1 
ATOM   1832 C C   . ILE A 1 244 ? 3.008   15.087  -33.720 1.00 43.16  ? 244  ILE A C   1 
ATOM   1833 O O   . ILE A 1 244 ? 2.739   16.280  -33.587 1.00 49.19  ? 244  ILE A O   1 
ATOM   1834 C CB  . ILE A 1 244 ? 2.649   13.759  -31.581 1.00 51.76  ? 244  ILE A CB  1 
ATOM   1835 C CG1 . ILE A 1 244 ? 2.252   14.925  -30.677 1.00 46.59  ? 244  ILE A CG1 1 
ATOM   1836 C CG2 . ILE A 1 244 ? 4.144   13.506  -31.528 1.00 52.22  ? 244  ILE A CG2 1 
ATOM   1837 C CD1 . ILE A 1 244 ? 0.789   15.240  -30.761 1.00 47.44  ? 244  ILE A CD1 1 
ATOM   1838 N N   . LYS A 1 245 ? 3.998   14.655  -34.492 1.00 36.65  ? 245  LYS A N   1 
ATOM   1839 C CA  . LYS A 1 245 ? 4.892   15.593  -35.144 1.00 40.48  ? 245  LYS A CA  1 
ATOM   1840 C C   . LYS A 1 245 ? 4.118   16.427  -36.147 1.00 41.12  ? 245  LYS A C   1 
ATOM   1841 O O   . LYS A 1 245 ? 4.273   17.643  -36.223 1.00 44.89  ? 245  LYS A O   1 
ATOM   1842 C CB  . LYS A 1 245 ? 6.026   14.843  -35.831 1.00 47.40  ? 245  LYS A CB  1 
ATOM   1843 C CG  . LYS A 1 245 ? 7.045   14.270  -34.861 1.00 51.50  ? 245  LYS A CG  1 
ATOM   1844 C CD  . LYS A 1 245 ? 8.164   13.531  -35.598 1.00 57.80  ? 245  LYS A CD  1 
ATOM   1845 C CE  . LYS A 1 245 ? 9.163   12.931  -34.615 1.00 58.45  ? 245  LYS A CE  1 
ATOM   1846 N NZ  . LYS A 1 245 ? 10.272  12.215  -35.304 1.00 60.37  ? 245  LYS A NZ  1 
ATOM   1847 N N   . TRP A 1 246 ? 3.255   15.770  -36.904 1.00 38.59  ? 246  TRP A N   1 
ATOM   1848 C CA  . TRP A 1 246 ? 2.433   16.480  -37.876 1.00 35.06  ? 246  TRP A CA  1 
ATOM   1849 C C   . TRP A 1 246 ? 1.415   17.377  -37.184 1.00 36.04  ? 246  TRP A C   1 
ATOM   1850 O O   . TRP A 1 246 ? 1.171   18.502  -37.620 1.00 37.92  ? 246  TRP A O   1 
ATOM   1851 C CB  . TRP A 1 246 ? 1.677   15.475  -38.741 1.00 42.99  ? 246  TRP A CB  1 
ATOM   1852 C CG  . TRP A 1 246 ? 2.464   14.840  -39.846 1.00 55.92  ? 246  TRP A CG  1 
ATOM   1853 C CD1 . TRP A 1 246 ? 3.251   13.725  -39.760 1.00 55.37  ? 246  TRP A CD1 1 
ATOM   1854 C CD2 . TRP A 1 246 ? 2.502   15.251  -41.219 1.00 53.06  ? 246  TRP A CD2 1 
ATOM   1855 N NE1 . TRP A 1 246 ? 3.791   13.435  -40.988 1.00 50.56  ? 246  TRP A NE1 1 
ATOM   1856 C CE2 . TRP A 1 246 ? 3.345   14.355  -41.903 1.00 50.66  ? 246  TRP A CE2 1 
ATOM   1857 C CE3 . TRP A 1 246 ? 1.910   16.299  -41.936 1.00 53.07  ? 246  TRP A CE3 1 
ATOM   1858 C CZ2 . TRP A 1 246 ? 3.614   14.471  -43.263 1.00 51.81  ? 246  TRP A CZ2 1 
ATOM   1859 C CZ3 . TRP A 1 246 ? 2.177   16.414  -43.282 1.00 55.01  ? 246  TRP A CZ3 1 
ATOM   1860 C CH2 . TRP A 1 246 ? 3.021   15.506  -43.935 1.00 60.19  ? 246  TRP A CH2 1 
ATOM   1861 N N   . LEU A 1 247 ? 0.796   16.854  -36.129 1.00 34.07  ? 247  LEU A N   1 
ATOM   1862 C CA  . LEU A 1 247 ? -0.278  17.559  -35.438 1.00 34.51  ? 247  LEU A CA  1 
ATOM   1863 C C   . LEU A 1 247 ? 0.287   18.817  -34.801 1.00 38.76  ? 247  LEU A C   1 
ATOM   1864 O O   . LEU A 1 247 ? -0.248  19.922  -34.973 1.00 35.10  ? 247  LEU A O   1 
ATOM   1865 C CB  . LEU A 1 247 ? -0.932  16.653  -34.388 1.00 32.74  ? 247  LEU A CB  1 
ATOM   1866 C CG  . LEU A 1 247 ? -2.297  16.025  -34.731 1.00 47.67  ? 247  LEU A CG  1 
ATOM   1867 C CD1 . LEU A 1 247 ? -2.817  16.404  -36.109 1.00 40.57  ? 247  LEU A CD1 1 
ATOM   1868 C CD2 . LEU A 1 247 ? -2.307  14.529  -34.580 1.00 37.05  ? 247  LEU A CD2 1 
ATOM   1869 N N   . ALA A 1 248 ? 1.396   18.632  -34.093 1.00 40.76  ? 248  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 248 ? 2.092   19.717  -33.421 1.00 31.05  ? 248  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 248 ? 2.405   20.834  -34.403 1.00 42.27  ? 248  ALA A C   1 
ATOM   1872 O O   . ALA A 1 248 ? 2.182   22.010  -34.093 1.00 44.65  ? 248  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 248 ? 3.368   19.200  -32.784 1.00 40.69  ? 248  ALA A CB  1 
ATOM   1874 N N   . ASN A 1 249 ? 2.919   20.476  -35.581 1.00 38.99  ? 249  ASN A N   1 
ATOM   1875 C CA  . ASN A 1 249 ? 3.258   21.493  -36.571 1.00 42.29  ? 249  ASN A CA  1 
ATOM   1876 C C   . ASN A 1 249 ? 2.036   22.275  -37.014 1.00 37.12  ? 249  ASN A C   1 
ATOM   1877 O O   . ASN A 1 249 ? 2.040   23.499  -37.024 1.00 50.64  ? 249  ASN A O   1 
ATOM   1878 C CB  . ASN A 1 249 ? 3.974   20.915  -37.803 1.00 27.85  ? 249  ASN A CB  1 
ATOM   1879 C CG  . ASN A 1 249 ? 4.020   21.913  -38.949 1.00 39.60  ? 249  ASN A CG  1 
ATOM   1880 O OD1 . ASN A 1 249 ? 3.188   21.888  -39.868 1.00 38.25  ? 249  ASN A OD1 1 
ATOM   1881 N ND2 . ASN A 1 249 ? 4.961   22.832  -38.874 1.00 43.49  ? 249  ASN A ND2 1 
ATOM   1882 N N   . PHE A 1 250 ? 0.987   21.571  -37.404 1.00 37.81  ? 250  PHE A N   1 
ATOM   1883 C CA  . PHE A 1 250 ? -0.190  22.272  -37.884 1.00 39.71  ? 250  PHE A CA  1 
ATOM   1884 C C   . PHE A 1 250 ? -0.840  23.148  -36.795 1.00 42.49  ? 250  PHE A C   1 
ATOM   1885 O O   . PHE A 1 250 ? -1.421  24.173  -37.105 1.00 38.12  ? 250  PHE A O   1 
ATOM   1886 C CB  . PHE A 1 250 ? -1.216  21.315  -38.482 1.00 35.02  ? 250  PHE A CB  1 
ATOM   1887 C CG  . PHE A 1 250 ? -2.386  22.020  -39.083 1.00 39.58  ? 250  PHE A CG  1 
ATOM   1888 C CD1 . PHE A 1 250 ? -2.223  22.808  -40.213 1.00 35.90  ? 250  PHE A CD1 1 
ATOM   1889 C CD2 . PHE A 1 250 ? -3.636  21.933  -38.502 1.00 36.26  ? 250  PHE A CD2 1 
ATOM   1890 C CE1 . PHE A 1 250 ? -3.286  23.488  -40.764 1.00 38.54  ? 250  PHE A CE1 1 
ATOM   1891 C CE2 . PHE A 1 250 ? -4.711  22.605  -39.052 1.00 37.61  ? 250  PHE A CE2 1 
ATOM   1892 C CZ  . PHE A 1 250 ? -4.536  23.387  -40.188 1.00 40.24  ? 250  PHE A CZ  1 
ATOM   1893 N N   . TRP A 1 251 ? -0.719  22.748  -35.532 1.00 41.15  ? 251  TRP A N   1 
ATOM   1894 C CA  . TRP A 1 251 ? -1.221  23.554  -34.412 1.00 43.02  ? 251  TRP A CA  1 
ATOM   1895 C C   . TRP A 1 251 ? -0.267  24.648  -33.911 1.00 51.33  ? 251  TRP A C   1 
ATOM   1896 O O   . TRP A 1 251 ? -0.543  25.318  -32.912 1.00 41.62  ? 251  TRP A O   1 
ATOM   1897 C CB  . TRP A 1 251 ? -1.688  22.650  -33.261 1.00 39.13  ? 251  TRP A CB  1 
ATOM   1898 C CG  . TRP A 1 251 ? -3.038  22.058  -33.579 1.00 48.80  ? 251  TRP A CG  1 
ATOM   1899 C CD1 . TRP A 1 251 ? -3.293  20.944  -34.335 1.00 38.25  ? 251  TRP A CD1 1 
ATOM   1900 C CD2 . TRP A 1 251 ? -4.314  22.592  -33.212 1.00 38.72  ? 251  TRP A CD2 1 
ATOM   1901 N NE1 . TRP A 1 251 ? -4.649  20.740  -34.433 1.00 34.35  ? 251  TRP A NE1 1 
ATOM   1902 C CE2 . TRP A 1 251 ? -5.298  21.751  -33.758 1.00 40.82  ? 251  TRP A CE2 1 
ATOM   1903 C CE3 . TRP A 1 251 ? -4.722  23.705  -32.468 1.00 37.29  ? 251  TRP A CE3 1 
ATOM   1904 C CZ2 . TRP A 1 251 ? -6.664  21.974  -33.577 1.00 39.63  ? 251  TRP A CZ2 1 
ATOM   1905 C CZ3 . TRP A 1 251 ? -6.070  23.931  -32.297 1.00 44.88  ? 251  TRP A CZ3 1 
ATOM   1906 C CH2 . TRP A 1 251 ? -7.025  23.068  -32.845 1.00 48.32  ? 251  TRP A CH2 1 
ATOM   1907 N N   . GLY A 1 252 ? 0.843   24.842  -34.615 1.00 44.29  ? 252  GLY A N   1 
ATOM   1908 C CA  . GLY A 1 252 ? 1.717   25.962  -34.325 1.00 27.42  ? 252  GLY A CA  1 
ATOM   1909 C C   . GLY A 1 252 ? 2.611   25.750  -33.121 1.00 35.77  ? 252  GLY A C   1 
ATOM   1910 O O   . GLY A 1 252 ? 3.102   26.712  -32.521 1.00 39.75  ? 252  GLY A O   1 
ATOM   1911 N N   . CYS A 1 253 ? 2.837   24.493  -32.773 1.00 39.98  ? 253  CYS A N   1 
ATOM   1912 C CA  . CYS A 1 253 ? 3.698   24.177  -31.645 1.00 47.86  ? 253  CYS A CA  1 
ATOM   1913 C C   . CYS A 1 253 ? 5.184   24.108  -32.069 1.00 57.73  ? 253  CYS A C   1 
ATOM   1914 O O   . CYS A 1 253 ? 6.058   23.942  -31.225 1.00 54.22  ? 253  CYS A O   1 
ATOM   1915 C CB  . CYS A 1 253 ? 3.231   22.878  -30.984 1.00 35.67  ? 253  CYS A CB  1 
ATOM   1916 S SG  . CYS A 1 253 ? 1.426   22.826  -30.649 1.00 42.07  ? 253  CYS A SG  1 
ATOM   1917 N N   . ASP A 1 254 ? 5.447   24.292  -33.369 1.00 53.03  ? 254  ASP A N   1 
ATOM   1918 C CA  . ASP A 1 254 ? 6.791   24.198  -33.973 1.00 58.45  ? 254  ASP A CA  1 
ATOM   1919 C C   . ASP A 1 254 ? 7.414   25.531  -34.312 1.00 62.20  ? 254  ASP A C   1 
ATOM   1920 O O   . ASP A 1 254 ? 6.770   26.578  -34.205 1.00 66.61  ? 254  ASP A O   1 
ATOM   1921 C CB  . ASP A 1 254 ? 6.731   23.408  -35.288 1.00 54.10  ? 254  ASP A CB  1 
ATOM   1922 C CG  . ASP A 1 254 ? 6.778   21.940  -35.057 1.00 65.88  ? 254  ASP A CG  1 
ATOM   1923 O OD1 . ASP A 1 254 ? 6.708   21.559  -33.865 1.00 90.45  ? 254  ASP A OD1 1 
ATOM   1924 O OD2 . ASP A 1 254 ? 6.881   21.173  -36.037 1.00 45.34  ? 254  ASP A OD2 1 
ATOM   1925 N N   . ASP A 1 255 ? 8.665   25.474  -34.763 1.00 53.41  ? 255  ASP A N   1 
ATOM   1926 C CA  . ASP A 1 255 ? 9.333   26.652  -35.307 1.00 61.48  ? 255  ASP A CA  1 
ATOM   1927 C C   . ASP A 1 255 ? 8.984   26.793  -36.785 1.00 62.68  ? 255  ASP A C   1 
ATOM   1928 O O   . ASP A 1 255 ? 9.137   27.865  -37.387 1.00 55.23  ? 255  ASP A O   1 
ATOM   1929 C CB  . ASP A 1 255 ? 10.858  26.590  -35.107 1.00 67.63  ? 255  ASP A CB  1 
ATOM   1930 C CG  . ASP A 1 255 ? 11.485  25.341  -35.698 1.00 71.63  ? 255  ASP A CG  1 
ATOM   1931 O OD1 . ASP A 1 255 ? 10.957  24.235  -35.458 1.00 72.05  ? 255  ASP A OD1 1 
ATOM   1932 O OD2 . ASP A 1 255 ? 12.518  25.471  -36.391 1.00 75.49  ? 255  ASP A OD2 1 
ATOM   1933 N N   . GLN A 1 256 ? 8.497   25.702  -37.363 1.00 57.10  ? 256  GLN A N   1 
ATOM   1934 C CA  . GLN A 1 256 ? 8.201   25.680  -38.785 1.00 50.81  ? 256  GLN A CA  1 
ATOM   1935 C C   . GLN A 1 256 ? 6.812   26.213  -39.058 1.00 60.69  ? 256  GLN A C   1 
ATOM   1936 O O   . GLN A 1 256 ? 5.925   26.107  -38.213 1.00 63.98  ? 256  GLN A O   1 
ATOM   1937 C CB  . GLN A 1 256 ? 8.308   24.255  -39.321 1.00 45.54  ? 256  GLN A CB  1 
ATOM   1938 C CG  . GLN A 1 256 ? 9.719   23.695  -39.252 1.00 57.18  ? 256  GLN A CG  1 
ATOM   1939 C CD  . GLN A 1 256 ? 10.714  24.583  -39.963 1.00 62.77  ? 256  GLN A CD  1 
ATOM   1940 O OE1 . GLN A 1 256 ? 10.532  24.926  -41.136 1.00 61.07  ? 256  GLN A OE1 1 
ATOM   1941 N NE2 . GLN A 1 256 ? 11.772  24.970  -39.256 1.00 64.53  ? 256  GLN A NE2 1 
ATOM   1942 N N   . PRO A 1 257 ? 6.622   26.788  -40.247 1.00 57.97  ? 257  PRO A N   1 
ATOM   1943 C CA  . PRO A 1 257 ? 5.303   27.222  -40.702 1.00 52.52  ? 257  PRO A CA  1 
ATOM   1944 C C   . PRO A 1 257 ? 4.345   26.043  -40.699 1.00 56.14  ? 257  PRO A C   1 
ATOM   1945 O O   . PRO A 1 257 ? 4.785   24.914  -40.901 1.00 61.24  ? 257  PRO A O   1 
ATOM   1946 C CB  . PRO A 1 257 ? 5.562   27.659  -42.143 1.00 60.58  ? 257  PRO A CB  1 
ATOM   1947 C CG  . PRO A 1 257 ? 7.011   28.007  -42.174 1.00 66.83  ? 257  PRO A CG  1 
ATOM   1948 C CD  . PRO A 1 257 ? 7.673   27.056  -41.242 1.00 62.70  ? 257  PRO A CD  1 
ATOM   1949 N N   . ARG A 1 258 ? 3.061   26.294  -40.471 1.00 50.24  ? 258  ARG A N   1 
ATOM   1950 C CA  . ARG A 1 258 ? 2.079   25.218  -40.454 1.00 50.06  ? 258  ARG A CA  1 
ATOM   1951 C C   . ARG A 1 258 ? 1.903   24.576  -41.835 1.00 50.13  ? 258  ARG A C   1 
ATOM   1952 O O   . ARG A 1 258 ? 1.699   25.256  -42.840 1.00 48.59  ? 258  ARG A O   1 
ATOM   1953 C CB  . ARG A 1 258 ? 0.732   25.716  -39.938 1.00 45.67  ? 258  ARG A CB  1 
ATOM   1954 C CG  . ARG A 1 258 ? 0.796   26.529  -38.650 1.00 47.79  ? 258  ARG A CG  1 
ATOM   1955 C CD  . ARG A 1 258 ? -0.540  27.249  -38.453 1.00 40.65  ? 258  ARG A CD  1 
ATOM   1956 N NE  . ARG A 1 258 ? -0.548  28.168  -37.323 1.00 49.16  ? 258  ARG A NE  1 
ATOM   1957 C CZ  . ARG A 1 258 ? -1.153  27.936  -36.161 1.00 48.92  ? 258  ARG A CZ  1 
ATOM   1958 N NH1 . ARG A 1 258 ? -1.808  26.801  -35.953 1.00 43.61  ? 258  ARG A NH1 1 
ATOM   1959 N NH2 . ARG A 1 258 ? -1.099  28.847  -35.200 1.00 39.11  ? 258  ARG A NH2 1 
ATOM   1960 N N   . MET A 1 259 ? 1.972   23.251  -41.853 1.00 42.31  ? 259  MET A N   1 
ATOM   1961 C CA  . MET A 1 259 ? 1.928   22.459  -43.069 1.00 49.47  ? 259  MET A CA  1 
ATOM   1962 C C   . MET A 1 259 ? 0.641   21.655  -42.991 1.00 50.06  ? 259  MET A C   1 
ATOM   1963 O O   . MET A 1 259 ? 0.309   21.124  -41.927 1.00 48.31  ? 259  MET A O   1 
ATOM   1964 C CB  . MET A 1 259 ? 3.143   21.516  -43.099 1.00 51.95  ? 259  MET A CB  1 
ATOM   1965 C CG  . MET A 1 259 ? 3.337   20.729  -44.389 1.00 73.61  ? 259  MET A CG  1 
ATOM   1966 S SD  . MET A 1 259 ? 4.561   19.384  -44.259 1.00 83.48  ? 259  MET A SD  1 
ATOM   1967 C CE  . MET A 1 259 ? 6.109   20.281  -44.097 1.00 58.17  ? 259  MET A CE  1 
ATOM   1968 N N   . TYR A 1 260 ? -0.094  21.571  -44.097 1.00 38.68  ? 260  TYR A N   1 
ATOM   1969 C CA  . TYR A 1 260 ? -1.334  20.798  -44.102 1.00 43.84  ? 260  TYR A CA  1 
ATOM   1970 C C   . TYR A 1 260 ? -1.124  19.338  -43.694 1.00 43.16  ? 260  TYR A C   1 
ATOM   1971 O O   . TYR A 1 260 ? -0.174  18.700  -44.112 1.00 38.21  ? 260  TYR A O   1 
ATOM   1972 C CB  . TYR A 1 260 ? -2.018  20.872  -45.460 1.00 33.42  ? 260  TYR A CB  1 
ATOM   1973 C CG  . TYR A 1 260 ? -3.146  19.891  -45.624 1.00 33.77  ? 260  TYR A CG  1 
ATOM   1974 C CD1 . TYR A 1 260 ? -4.391  20.129  -45.055 1.00 34.25  ? 260  TYR A CD1 1 
ATOM   1975 C CD2 . TYR A 1 260 ? -2.974  18.726  -46.367 1.00 41.85  ? 260  TYR A CD2 1 
ATOM   1976 C CE1 . TYR A 1 260 ? -5.446  19.221  -45.217 1.00 34.83  ? 260  TYR A CE1 1 
ATOM   1977 C CE2 . TYR A 1 260 ? -4.006  17.821  -46.535 1.00 38.93  ? 260  TYR A CE2 1 
ATOM   1978 C CZ  . TYR A 1 260 ? -5.237  18.072  -45.965 1.00 47.39  ? 260  TYR A CZ  1 
ATOM   1979 O OH  . TYR A 1 260 ? -6.254  17.167  -46.142 1.00 44.43  ? 260  TYR A OH  1 
ATOM   1980 N N   . HIS A 1 261 ? -2.008  18.822  -42.853 1.00 38.16  ? 261  HIS A N   1 
ATOM   1981 C CA  . HIS A 1 261 ? -1.886  17.451  -42.401 1.00 34.83  ? 261  HIS A CA  1 
ATOM   1982 C C   . HIS A 1 261 ? -3.204  16.765  -42.673 1.00 40.28  ? 261  HIS A C   1 
ATOM   1983 O O   . HIS A 1 261 ? -3.275  15.867  -43.509 1.00 36.79  ? 261  HIS A O   1 
ATOM   1984 C CB  . HIS A 1 261 ? -1.489  17.389  -40.920 1.00 32.01  ? 261  HIS A CB  1 
ATOM   1985 C CG  . HIS A 1 261 ? -1.689  16.043  -40.294 1.00 45.69  ? 261  HIS A CG  1 
ATOM   1986 N ND1 . HIS A 1 261 ? -2.664  15.799  -39.349 1.00 40.72  ? 261  HIS A ND1 1 
ATOM   1987 C CD2 . HIS A 1 261 ? -1.057  14.861  -40.496 1.00 43.81  ? 261  HIS A CD2 1 
ATOM   1988 C CE1 . HIS A 1 261 ? -2.616  14.528  -38.988 1.00 39.78  ? 261  HIS A CE1 1 
ATOM   1989 N NE2 . HIS A 1 261 ? -1.648  13.936  -39.669 1.00 40.42  ? 261  HIS A NE2 1 
ATOM   1990 N N   . HIS A 1 262 ? -4.253  17.206  -41.980 1.00 39.15  ? 262  HIS A N   1 
ATOM   1991 C CA  . HIS A 1 262 ? -5.622  16.802  -42.294 1.00 34.01  ? 262  HIS A CA  1 
ATOM   1992 C C   . HIS A 1 262 ? -6.477  18.048  -42.129 1.00 40.56  ? 262  HIS A C   1 
ATOM   1993 O O   . HIS A 1 262 ? -6.039  19.029  -41.523 1.00 36.94  ? 262  HIS A O   1 
ATOM   1994 C CB  . HIS A 1 262 ? -6.119  15.726  -41.329 1.00 35.47  ? 262  HIS A CB  1 
ATOM   1995 C CG  . HIS A 1 262 ? -6.470  16.264  -39.979 1.00 41.22  ? 262  HIS A CG  1 
ATOM   1996 N ND1 . HIS A 1 262 ? -5.513  16.585  -39.038 1.00 43.23  ? 262  HIS A ND1 1 
ATOM   1997 C CD2 . HIS A 1 262 ? -7.668  16.580  -39.423 1.00 39.25  ? 262  HIS A CD2 1 
ATOM   1998 C CE1 . HIS A 1 262 ? -6.106  17.075  -37.960 1.00 41.28  ? 262  HIS A CE1 1 
ATOM   1999 N NE2 . HIS A 1 262 ? -7.413  17.080  -38.166 1.00 38.55  ? 262  HIS A NE2 1 
ATOM   2000 N N   . THR A 1 263 ? -7.700  18.014  -42.642 1.00 28.46  ? 263  THR A N   1 
ATOM   2001 C CA  . THR A 1 263 ? -8.600  19.144  -42.513 1.00 26.07  ? 263  THR A CA  1 
ATOM   2002 C C   . THR A 1 263 ? -9.281  19.139  -41.147 1.00 33.90  ? 263  THR A C   1 
ATOM   2003 O O   . THR A 1 263 ? -10.121 18.268  -40.886 1.00 31.42  ? 263  THR A O   1 
ATOM   2004 C CB  . THR A 1 263 ? -9.689  19.094  -43.618 1.00 37.88  ? 263  THR A CB  1 
ATOM   2005 O OG1 . THR A 1 263 ? -9.051  19.008  -44.898 1.00 41.70  ? 263  THR A OG1 1 
ATOM   2006 C CG2 . THR A 1 263 ? -10.582 20.326  -43.589 1.00 35.70  ? 263  THR A CG2 1 
ATOM   2007 N N   . ILE A 1 264 ? -8.921  20.094  -40.285 1.00 31.83  ? 264  ILE A N   1 
ATOM   2008 C CA  . ILE A 1 264 ? -9.510  20.195  -38.938 1.00 32.14  ? 264  ILE A CA  1 
ATOM   2009 C C   . ILE A 1 264 ? -11.028 20.419  -39.001 1.00 36.33  ? 264  ILE A C   1 
ATOM   2010 O O   . ILE A 1 264 ? -11.544 20.924  -40.007 1.00 34.73  ? 264  ILE A O   1 
ATOM   2011 C CB  . ILE A 1 264 ? -8.793  21.270  -38.060 1.00 47.51  ? 264  ILE A CB  1 
ATOM   2012 C CG1 . ILE A 1 264 ? -8.266  22.432  -38.902 1.00 52.26  ? 264  ILE A CG1 1 
ATOM   2013 C CG2 . ILE A 1 264 ? -7.612  20.653  -37.298 1.00 31.81  ? 264  ILE A CG2 1 
ATOM   2014 C CD1 . ILE A 1 264 ? -9.110  23.635  -38.879 1.00 53.88  ? 264  ILE A CD1 1 
ATOM   2015 N N   . PRO A 1 265 ? -11.762 19.995  -37.955 1.00 31.46  ? 265  PRO A N   1 
ATOM   2016 C CA  . PRO A 1 265 ? -13.224 20.165  -37.971 1.00 31.86  ? 265  PRO A CA  1 
ATOM   2017 C C   . PRO A 1 265 ? -13.635 21.585  -37.551 1.00 29.56  ? 265  PRO A C   1 
ATOM   2018 O O   . PRO A 1 265 ? -14.163 21.809  -36.442 1.00 29.30  ? 265  PRO A O   1 
ATOM   2019 C CB  . PRO A 1 265 ? -13.712 19.142  -36.944 1.00 22.60  ? 265  PRO A CB  1 
ATOM   2020 C CG  . PRO A 1 265 ? -12.584 19.054  -35.953 1.00 29.04  ? 265  PRO A CG  1 
ATOM   2021 C CD  . PRO A 1 265 ? -11.305 19.275  -36.754 1.00 24.72  ? 265  PRO A CD  1 
ATOM   2022 N N   . VAL A 1 266 ? -13.402 22.512  -38.482 1.00 33.06  ? 266  VAL A N   1 
ATOM   2023 C CA  . VAL A 1 266 ? -13.616 23.947  -38.334 1.00 39.18  ? 266  VAL A CA  1 
ATOM   2024 C C   . VAL A 1 266 ? -14.789 24.322  -37.442 1.00 38.98  ? 266  VAL A C   1 
ATOM   2025 O O   . VAL A 1 266 ? -14.627 25.079  -36.485 1.00 33.48  ? 266  VAL A O   1 
ATOM   2026 C CB  . VAL A 1 266 ? -13.817 24.580  -39.712 1.00 40.36  ? 266  VAL A CB  1 
ATOM   2027 C CG1 . VAL A 1 266 ? -14.240 26.029  -39.568 1.00 25.70  ? 266  VAL A CG1 1 
ATOM   2028 C CG2 . VAL A 1 266 ? -12.532 24.464  -40.537 1.00 31.78  ? 266  VAL A CG2 1 
ATOM   2029 N N   . ILE A 1 267 ? -15.962 23.781  -37.749 1.00 26.92  ? 267  ILE A N   1 
ATOM   2030 C CA  . ILE A 1 267 ? -17.162 24.136  -37.016 1.00 28.41  ? 267  ILE A CA  1 
ATOM   2031 C C   . ILE A 1 267 ? -17.137 23.607  -35.583 1.00 41.98  ? 267  ILE A C   1 
ATOM   2032 O O   . ILE A 1 267 ? -17.575 24.300  -34.651 1.00 33.31  ? 267  ILE A O   1 
ATOM   2033 C CB  . ILE A 1 267 ? -18.414 23.656  -37.745 1.00 29.14  ? 267  ILE A CB  1 
ATOM   2034 C CG1 . ILE A 1 267 ? -18.429 24.225  -39.160 1.00 30.82  ? 267  ILE A CG1 1 
ATOM   2035 C CG2 . ILE A 1 267 ? -19.687 24.045  -36.985 1.00 33.07  ? 267  ILE A CG2 1 
ATOM   2036 C CD1 . ILE A 1 267 ? -18.667 25.731  -39.215 1.00 25.70  ? 267  ILE A CD1 1 
ATOM   2037 N N   . SER A 1 268 ? -16.613 22.396  -35.394 1.00 33.77  ? 268  SER A N   1 
ATOM   2038 C CA  . SER A 1 268 ? -16.529 21.830  -34.050 1.00 37.20  ? 268  SER A CA  1 
ATOM   2039 C C   . SER A 1 268 ? -15.608 22.714  -33.190 1.00 36.57  ? 268  SER A C   1 
ATOM   2040 O O   . SER A 1 268 ? -15.823 22.886  -31.991 1.00 40.68  ? 268  SER A O   1 
ATOM   2041 C CB  . SER A 1 268 ? -16.030 20.385  -34.085 1.00 31.87  ? 268  SER A CB  1 
ATOM   2042 O OG  . SER A 1 268 ? -16.836 19.572  -34.929 1.00 41.31  ? 268  SER A OG  1 
ATOM   2043 N N   . LEU A 1 269 ? -14.618 23.295  -33.851 1.00 24.31  ? 269  LEU A N   1 
ATOM   2044 C CA  . LEU A 1 269 ? -13.663 24.192  -33.238 1.00 30.31  ? 269  LEU A CA  1 
ATOM   2045 C C   . LEU A 1 269 ? -14.281 25.527  -32.781 1.00 31.51  ? 269  LEU A C   1 
ATOM   2046 O O   . LEU A 1 269 ? -13.954 25.998  -31.688 1.00 33.46  ? 269  LEU A O   1 
ATOM   2047 C CB  . LEU A 1 269 ? -12.445 24.390  -34.164 1.00 29.03  ? 269  LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 269 ? -11.504 23.187  -34.328 1.00 38.01  ? 269  LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 269 ? -10.262 23.538  -35.140 1.00 33.70  ? 269  LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 269 ? -11.070 22.591  -32.987 1.00 30.95  ? 269  LEU A CD2 1 
ATOM   2051 N N   . TYR A 1 270 ? -15.152 26.122  -33.602 1.00 24.66  ? 270  TYR A N   1 
ATOM   2052 C CA  . TYR A 1 270 ? -15.944 27.296  -33.203 1.00 32.50  ? 270  TYR A CA  1 
ATOM   2053 C C   . TYR A 1 270 ? -16.596 26.996  -31.850 1.00 38.49  ? 270  TYR A C   1 
ATOM   2054 O O   . TYR A 1 270 ? -16.434 27.738  -30.886 1.00 40.63  ? 270  TYR A O   1 
ATOM   2055 C CB  . TYR A 1 270 ? -17.089 27.586  -34.191 1.00 27.27  ? 270  TYR A CB  1 
ATOM   2056 C CG  . TYR A 1 270 ? -16.754 28.032  -35.608 1.00 26.23  ? 270  TYR A CG  1 
ATOM   2057 C CD1 . TYR A 1 270 ? -15.463 28.342  -36.008 1.00 36.79  ? 270  TYR A CD1 1 
ATOM   2058 C CD2 . TYR A 1 270 ? -17.762 28.162  -36.551 1.00 35.78  ? 270  TYR A CD2 1 
ATOM   2059 C CE1 . TYR A 1 270 ? -15.188 28.766  -37.337 1.00 30.06  ? 270  TYR A CE1 1 
ATOM   2060 C CE2 . TYR A 1 270 ? -17.497 28.591  -37.863 1.00 28.68  ? 270  TYR A CE2 1 
ATOM   2061 C CZ  . TYR A 1 270 ? -16.222 28.884  -38.246 1.00 29.29  ? 270  TYR A CZ  1 
ATOM   2062 O OH  . TYR A 1 270 ? -15.985 29.285  -39.540 1.00 38.87  ? 270  TYR A OH  1 
ATOM   2063 N N   . SER A 1 271 ? -17.334 25.891  -31.802 1.00 36.49  ? 271  SER A N   1 
ATOM   2064 C CA  . SER A 1 271 ? -18.035 25.455  -30.603 1.00 40.00  ? 271  SER A CA  1 
ATOM   2065 C C   . SER A 1 271 ? -17.080 25.210  -29.439 1.00 40.95  ? 271  SER A C   1 
ATOM   2066 O O   . SER A 1 271 ? -17.375 25.588  -28.303 1.00 36.18  ? 271  SER A O   1 
ATOM   2067 C CB  . SER A 1 271 ? -18.829 24.176  -30.894 1.00 38.42  ? 271  SER A CB  1 
ATOM   2068 O OG  . SER A 1 271 ? -19.863 24.435  -31.811 1.00 53.74  ? 271  SER A OG  1 
ATOM   2069 N N   . LEU A 1 272 ? -15.957 24.550  -29.725 1.00 31.86  ? 272  LEU A N   1 
ATOM   2070 C CA  . LEU A 1 272 ? -14.995 24.203  -28.682 1.00 36.97  ? 272  LEU A CA  1 
ATOM   2071 C C   . LEU A 1 272 ? -14.454 25.469  -28.049 1.00 35.49  ? 272  LEU A C   1 
ATOM   2072 O O   . LEU A 1 272 ? -14.408 25.571  -26.830 1.00 33.78  ? 272  LEU A O   1 
ATOM   2073 C CB  . LEU A 1 272 ? -13.832 23.390  -29.238 1.00 27.07  ? 272  LEU A CB  1 
ATOM   2074 C CG  . LEU A 1 272 ? -12.850 22.931  -28.155 1.00 43.82  ? 272  LEU A CG  1 
ATOM   2075 C CD1 . LEU A 1 272 ? -13.567 22.134  -27.083 1.00 28.35  ? 272  LEU A CD1 1 
ATOM   2076 C CD2 . LEU A 1 272 ? -11.743 22.099  -28.753 1.00 42.28  ? 272  LEU A CD2 1 
ATOM   2077 N N   . ARG A 1 273 ? -14.052 26.412  -28.905 1.00 35.72  ? 273  ARG A N   1 
ATOM   2078 C CA  . ARG A 1 273 ? -13.608 27.743  -28.521 1.00 41.86  ? 273  ARG A CA  1 
ATOM   2079 C C   . ARG A 1 273 ? -14.613 28.403  -27.565 1.00 39.48  ? 273  ARG A C   1 
ATOM   2080 O O   . ARG A 1 273 ? -14.248 28.866  -26.479 1.00 42.03  ? 273  ARG A O   1 
ATOM   2081 C CB  . ARG A 1 273 ? -13.417 28.595  -29.785 1.00 38.13  ? 273  ARG A CB  1 
ATOM   2082 C CG  . ARG A 1 273 ? -12.747 29.962  -29.576 1.00 39.54  ? 273  ARG A CG  1 
ATOM   2083 C CD  . ARG A 1 273 ? -13.721 31.062  -29.130 1.00 36.66  ? 273  ARG A CD  1 
ATOM   2084 N NE  . ARG A 1 273 ? -13.115 32.384  -29.235 1.00 45.64  ? 273  ARG A NE  1 
ATOM   2085 C CZ  . ARG A 1 273 ? -13.573 33.479  -28.631 1.00 53.03  ? 273  ARG A CZ  1 
ATOM   2086 N NH1 . ARG A 1 273 ? -14.666 33.427  -27.871 1.00 47.76  ? 273  ARG A NH1 1 
ATOM   2087 N NH2 . ARG A 1 273 ? -12.929 34.631  -28.788 1.00 41.45  ? 273  ARG A NH2 1 
ATOM   2088 N N   . GLU A 1 274 ? -15.871 28.450  -27.972 1.00 38.45  ? 274  GLU A N   1 
ATOM   2089 C CA  . GLU A 1 274 ? -16.921 28.995  -27.111 1.00 38.42  ? 274  GLU A CA  1 
ATOM   2090 C C   . GLU A 1 274 ? -17.047 28.280  -25.760 1.00 33.11  ? 274  GLU A C   1 
ATOM   2091 O O   . GLU A 1 274 ? -17.300 28.910  -24.734 1.00 32.80  ? 274  GLU A O   1 
ATOM   2092 C CB  . GLU A 1 274 ? -18.266 28.954  -27.840 1.00 39.60  ? 274  GLU A CB  1 
ATOM   2093 C CG  . GLU A 1 274 ? -18.373 29.942  -28.976 1.00 32.67  ? 274  GLU A CG  1 
ATOM   2094 C CD  . GLU A 1 274 ? -18.317 31.376  -28.501 1.00 42.49  ? 274  GLU A CD  1 
ATOM   2095 O OE1 . GLU A 1 274 ? -17.231 31.878  -28.131 1.00 38.42  ? 274  GLU A OE1 1 
ATOM   2096 O OE2 . GLU A 1 274 ? -19.369 32.011  -28.505 1.00 45.22  ? 274  GLU A OE2 1 
ATOM   2097 N N   . SER A 1 275 ? -16.895 26.961  -25.762 1.00 29.12  ? 275  SER A N   1 
ATOM   2098 C CA  . SER A 1 275 ? -17.013 26.214  -24.529 1.00 33.47  ? 275  SER A CA  1 
ATOM   2099 C C   . SER A 1 275 ? -15.879 26.606  -23.586 1.00 38.53  ? 275  SER A C   1 
ATOM   2100 O O   . SER A 1 275 ? -16.064 26.652  -22.382 1.00 49.56  ? 275  SER A O   1 
ATOM   2101 C CB  . SER A 1 275 ? -16.986 24.711  -24.809 1.00 29.45  ? 275  SER A CB  1 
ATOM   2102 O OG  . SER A 1 275 ? -15.662 24.209  -24.818 1.00 46.48  ? 275  SER A OG  1 
ATOM   2103 N N   . LEU A 1 276 ? -14.710 26.898  -24.149 1.00 36.92  ? 276  LEU A N   1 
ATOM   2104 C CA  . LEU A 1 276 ? -13.562 27.329  -23.358 1.00 37.29  ? 276  LEU A CA  1 
ATOM   2105 C C   . LEU A 1 276 ? -13.704 28.781  -22.907 1.00 31.64  ? 276  LEU A C   1 
ATOM   2106 O O   . LEU A 1 276 ? -13.317 29.145  -21.805 1.00 36.53  ? 276  LEU A O   1 
ATOM   2107 C CB  . LEU A 1 276 ? -12.292 27.162  -24.161 1.00 30.83  ? 276  LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 276 ? -11.973 25.694  -24.388 1.00 45.72  ? 276  LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 276 ? -10.954 25.565  -25.520 1.00 35.19  ? 276  LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 276 ? -11.478 25.051  -23.090 1.00 43.77  ? 276  LEU A CD2 1 
ATOM   2111 N N   . ALA A 1 277 ? -14.247 29.604  -23.789 1.00 36.27  ? 277  ALA A N   1 
ATOM   2112 C CA  . ALA A 1 277 ? -14.614 30.964  -23.453 1.00 38.79  ? 277  ALA A CA  1 
ATOM   2113 C C   . ALA A 1 277 ? -15.563 30.995  -22.237 1.00 45.73  ? 277  ALA A C   1 
ATOM   2114 O O   . ALA A 1 277 ? -15.358 31.752  -21.287 1.00 47.35  ? 277  ALA A O   1 
ATOM   2115 C CB  . ALA A 1 277 ? -15.243 31.613  -24.647 1.00 30.77  ? 277  ALA A CB  1 
ATOM   2116 N N   . LEU A 1 278 ? -16.594 30.163  -22.268 1.00 42.34  ? 278  LEU A N   1 
ATOM   2117 C CA  . LEU A 1 278 ? -17.570 30.128  -21.190 1.00 45.91  ? 278  LEU A CA  1 
ATOM   2118 C C   . LEU A 1 278 ? -16.923 29.845  -19.836 1.00 44.74  ? 278  LEU A C   1 
ATOM   2119 O O   . LEU A 1 278 ? -17.194 30.530  -18.854 1.00 50.97  ? 278  LEU A O   1 
ATOM   2120 C CB  . LEU A 1 278 ? -18.634 29.071  -21.475 1.00 32.00  ? 278  LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 278 ? -20.095 29.431  -21.787 1.00 52.49  ? 278  LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 278 ? -20.364 30.890  -22.230 1.00 37.58  ? 278  LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 278 ? -20.606 28.436  -22.827 1.00 30.81  ? 278  LEU A CD2 1 
ATOM   2124 N N   . ILE A 1 279 ? -16.075 28.832  -19.781 1.00 44.42  ? 279  ILE A N   1 
ATOM   2125 C CA  . ILE A 1 279 ? -15.536 28.396  -18.498 1.00 45.69  ? 279  ILE A CA  1 
ATOM   2126 C C   . ILE A 1 279 ? -14.392 29.306  -18.064 1.00 48.73  ? 279  ILE A C   1 
ATOM   2127 O O   . ILE A 1 279 ? -14.079 29.417  -16.883 1.00 47.41  ? 279  ILE A O   1 
ATOM   2128 C CB  . ILE A 1 279 ? -15.091 26.924  -18.543 1.00 37.89  ? 279  ILE A CB  1 
ATOM   2129 C CG1 . ILE A 1 279 ? -14.777 26.420  -17.136 1.00 38.82  ? 279  ILE A CG1 1 
ATOM   2130 C CG2 . ILE A 1 279 ? -13.909 26.753  -19.490 1.00 38.80  ? 279  ILE A CG2 1 
ATOM   2131 C CD1 . ILE A 1 279 ? -14.449 24.968  -17.082 1.00 38.25  ? 279  ILE A CD1 1 
ATOM   2132 N N   . ALA A 1 280 ? -13.774 29.968  -19.031 1.00 47.42  ? 280  ALA A N   1 
ATOM   2133 C CA  . ALA A 1 280 ? -12.829 31.012  -18.708 1.00 49.97  ? 280  ALA A CA  1 
ATOM   2134 C C   . ALA A 1 280 ? -13.557 32.162  -18.004 1.00 49.17  ? 280  ALA A C   1 
ATOM   2135 O O   . ALA A 1 280 ? -13.015 32.753  -17.074 1.00 50.96  ? 280  ALA A O   1 
ATOM   2136 C CB  . ALA A 1 280 ? -12.137 31.505  -19.952 1.00 44.63  ? 280  ALA A CB  1 
ATOM   2137 N N   . GLU A 1 281 ? -14.777 32.472  -18.448 1.00 38.95  ? 281  GLU A N   1 
ATOM   2138 C CA  . GLU A 1 281 ? -15.561 33.561  -17.852 1.00 39.24  ? 281  GLU A CA  1 
ATOM   2139 C C   . GLU A 1 281 ? -16.058 33.208  -16.462 1.00 48.37  ? 281  GLU A C   1 
ATOM   2140 O O   . GLU A 1 281 ? -16.051 34.048  -15.568 1.00 58.31  ? 281  GLU A O   1 
ATOM   2141 C CB  . GLU A 1 281 ? -16.751 33.928  -18.722 1.00 39.22  ? 281  GLU A CB  1 
ATOM   2142 C CG  . GLU A 1 281 ? -16.396 34.637  -20.030 1.00 61.17  ? 281  GLU A CG  1 
ATOM   2143 C CD  . GLU A 1 281 ? -17.631 34.953  -20.880 1.00 68.64  ? 281  GLU A CD  1 
ATOM   2144 O OE1 . GLU A 1 281 ? -18.760 34.874  -20.351 1.00 66.66  ? 281  GLU A OE1 1 
ATOM   2145 O OE2 . GLU A 1 281 ? -17.479 35.273  -22.077 1.00 65.64  ? 281  GLU A OE2 1 
ATOM   2146 N N   . GLN A 1 282 ? -16.502 31.969  -16.286 1.00 49.38  ? 282  GLN A N   1 
ATOM   2147 C CA  . GLN A 1 282 ? -16.942 31.502  -14.983 1.00 48.60  ? 282  GLN A CA  1 
ATOM   2148 C C   . GLN A 1 282 ? -15.722 31.459  -14.090 1.00 47.04  ? 282  GLN A C   1 
ATOM   2149 O O   . GLN A 1 282 ? -15.672 32.105  -13.046 1.00 44.66  ? 282  GLN A O   1 
ATOM   2150 C CB  . GLN A 1 282 ? -17.576 30.111  -15.103 1.00 44.44  ? 282  GLN A CB  1 
ATOM   2151 C CG  . GLN A 1 282 ? -18.062 29.468  -13.798 1.00 46.34  ? 282  GLN A CG  1 
ATOM   2152 C CD  . GLN A 1 282 ? -18.561 28.044  -14.016 1.00 51.99  ? 282  GLN A CD  1 
ATOM   2153 O OE1 . GLN A 1 282 ? -18.329 27.469  -15.075 1.00 49.01  ? 282  GLN A OE1 1 
ATOM   2154 N NE2 . GLN A 1 282 ? -19.258 27.478  -13.027 1.00 50.06  ? 282  GLN A NE2 1 
ATOM   2155 N N   . GLY A 1 283 ? -14.718 30.713  -14.526 1.00 49.90  ? 283  GLY A N   1 
ATOM   2156 C CA  . GLY A 1 283 ? -13.508 30.562  -13.750 1.00 40.72  ? 283  GLY A CA  1 
ATOM   2157 C C   . GLY A 1 283 ? -13.456 29.172  -13.166 1.00 46.64  ? 283  GLY A C   1 
ATOM   2158 O O   . GLY A 1 283 ? -14.462 28.647  -12.663 1.00 51.26  ? 283  GLY A O   1 
ATOM   2159 N N   . LEU A 1 284 ? -12.265 28.591  -13.215 1.00 38.78  ? 284  LEU A N   1 
ATOM   2160 C CA  . LEU A 1 284 ? -12.079 27.182  -12.936 1.00 49.20  ? 284  LEU A CA  1 
ATOM   2161 C C   . LEU A 1 284 ? -12.547 26.790  -11.547 1.00 56.34  ? 284  LEU A C   1 
ATOM   2162 O O   . LEU A 1 284 ? -13.295 25.824  -11.387 1.00 71.06  ? 284  LEU A O   1 
ATOM   2163 C CB  . LEU A 1 284 ? -10.613 26.812  -13.106 1.00 38.98  ? 284  LEU A CB  1 
ATOM   2164 C CG  . LEU A 1 284 ? -10.215 25.849  -14.207 1.00 51.72  ? 284  LEU A CG  1 
ATOM   2165 C CD1 . LEU A 1 284 ? -8.752  25.407  -13.963 1.00 40.94  ? 284  LEU A CD1 1 
ATOM   2166 C CD2 . LEU A 1 284 ? -11.157 24.656  -14.257 1.00 47.71  ? 284  LEU A CD2 1 
ATOM   2167 N N   . GLU A 1 285 ? -12.091 27.528  -10.543 1.00 45.47  ? 285  GLU A N   1 
ATOM   2168 C CA  . GLU A 1 285 ? -12.447 27.211  -9.170  1.00 51.81  ? 285  GLU A CA  1 
ATOM   2169 C C   . GLU A 1 285 ? -13.951 27.350  -8.924  1.00 53.01  ? 285  GLU A C   1 
ATOM   2170 O O   . GLU A 1 285 ? -14.567 26.526  -8.241  1.00 56.19  ? 285  GLU A O   1 
ATOM   2171 C CB  . GLU A 1 285 ? -11.662 28.107  -8.219  1.00 65.50  ? 285  GLU A CB  1 
ATOM   2172 C CG  . GLU A 1 285 ? -10.178 27.791  -8.187  1.00 69.55  ? 285  GLU A CG  1 
ATOM   2173 C CD  . GLU A 1 285 ? -9.423  28.717  -7.265  1.00 76.03  ? 285  GLU A CD  1 
ATOM   2174 O OE1 . GLU A 1 285 ? -9.032  29.808  -7.734  1.00 69.69  ? 285  GLU A OE1 1 
ATOM   2175 O OE2 . GLU A 1 285 ? -9.235  28.358  -6.078  1.00 78.55  ? 285  GLU A OE2 1 
ATOM   2176 N N   . ASN A 1 286 ? -14.539 28.403  -9.476  1.00 47.16  ? 286  ASN A N   1 
ATOM   2177 C CA  . ASN A 1 286 ? -15.984 28.539  -9.449  1.00 59.04  ? 286  ASN A CA  1 
ATOM   2178 C C   . ASN A 1 286 ? -16.658 27.288  -9.995  1.00 58.77  ? 286  ASN A C   1 
ATOM   2179 O O   . ASN A 1 286 ? -17.502 26.686  -9.337  1.00 55.76  ? 286  ASN A O   1 
ATOM   2180 C CB  . ASN A 1 286 ? -16.409 29.785  -10.222 1.00 55.83  ? 286  ASN A CB  1 
ATOM   2181 C CG  . ASN A 1 286 ? -16.246 31.038  -9.397  1.00 56.91  ? 286  ASN A CG  1 
ATOM   2182 O OD1 . ASN A 1 286 ? -16.292 30.980  -8.167  1.00 57.92  ? 286  ASN A OD1 1 
ATOM   2183 N ND2 . ASN A 1 286 ? -16.062 32.174  -10.055 1.00 54.83  ? 286  ASN A ND2 1 
ATOM   2184 N N   . SER A 1 287 ? -16.236 26.871  -11.179 1.00 49.43  ? 287  SER A N   1 
ATOM   2185 C CA  . SER A 1 287 ? -16.790 25.677  -11.789 1.00 56.59  ? 287  SER A CA  1 
ATOM   2186 C C   . SER A 1 287 ? -16.662 24.476  -10.858 1.00 56.44  ? 287  SER A C   1 
ATOM   2187 O O   . SER A 1 287 ? -17.588 23.676  -10.750 1.00 57.20  ? 287  SER A O   1 
ATOM   2188 C CB  . SER A 1 287 ? -16.128 25.408  -13.148 1.00 47.09  ? 287  SER A CB  1 
ATOM   2189 O OG  . SER A 1 287 ? -16.482 24.138  -13.649 1.00 44.08  ? 287  SER A OG  1 
ATOM   2190 N N   . TRP A 1 288 ? -15.526 24.368  -10.171 1.00 51.75  ? 288  TRP A N   1 
ATOM   2191 C CA  . TRP A 1 288 ? -15.289 23.260  -9.247  1.00 51.13  ? 288  TRP A CA  1 
ATOM   2192 C C   . TRP A 1 288 ? -16.261 23.243  -8.065  1.00 54.48  ? 288  TRP A C   1 
ATOM   2193 O O   . TRP A 1 288 ? -16.721 22.173  -7.642  1.00 51.50  ? 288  TRP A O   1 
ATOM   2194 C CB  . TRP A 1 288 ? -13.865 23.317  -8.704  1.00 51.96  ? 288  TRP A CB  1 
ATOM   2195 C CG  . TRP A 1 288 ? -12.838 23.069  -9.730  1.00 66.83  ? 288  TRP A CG  1 
ATOM   2196 C CD1 . TRP A 1 288 ? -13.042 22.567  -10.984 1.00 66.15  ? 288  TRP A CD1 1 
ATOM   2197 C CD2 . TRP A 1 288 ? -11.431 23.304  -9.615  1.00 61.88  ? 288  TRP A CD2 1 
ATOM   2198 N NE1 . TRP A 1 288 ? -11.852 22.479  -11.655 1.00 65.33  ? 288  TRP A NE1 1 
ATOM   2199 C CE2 . TRP A 1 288 ? -10.835 22.927  -10.831 1.00 63.04  ? 288  TRP A CE2 1 
ATOM   2200 C CE3 . TRP A 1 288 ? -10.604 23.801  -8.594  1.00 65.07  ? 288  TRP A CE3 1 
ATOM   2201 C CZ2 . TRP A 1 288 ? -9.466  23.020  -11.071 1.00 60.39  ? 288  TRP A CZ2 1 
ATOM   2202 C CZ3 . TRP A 1 288 ? -9.238  23.900  -8.827  1.00 64.02  ? 288  TRP A CZ3 1 
ATOM   2203 C CH2 . TRP A 1 288 ? -8.684  23.510  -10.054 1.00 60.28  ? 288  TRP A CH2 1 
ATOM   2204 N N   . ARG A 1 289 ? -16.530 24.424  -7.511  1.00 54.12  ? 289  ARG A N   1 
ATOM   2205 C CA  . ARG A 1 289 ? -17.429 24.545  -6.372  1.00 61.45  ? 289  ARG A CA  1 
ATOM   2206 C C   . ARG A 1 289 ? -18.808 24.069  -6.797  1.00 60.68  ? 289  ARG A C   1 
ATOM   2207 O O   . ARG A 1 289 ? -19.424 23.231  -6.132  1.00 56.56  ? 289  ARG A O   1 
ATOM   2208 C CB  . ARG A 1 289 ? -17.524 26.000  -5.912  1.00 78.83  ? 289  ARG A CB  1 
ATOM   2209 C CG  . ARG A 1 289 ? -16.237 26.590  -5.352  1.00 99.99  ? 289  ARG A CG  1 
ATOM   2210 C CD  . ARG A 1 289 ? -16.449 28.035  -4.913  1.00 102.74 ? 289  ARG A CD  1 
ATOM   2211 N NE  . ARG A 1 289 ? -17.835 28.269  -4.512  1.00 107.77 ? 289  ARG A NE  1 
ATOM   2212 C CZ  . ARG A 1 289 ? -18.691 29.043  -5.175  1.00 112.39 ? 289  ARG A CZ  1 
ATOM   2213 N NH1 . ARG A 1 289 ? -18.304 29.676  -6.276  1.00 106.91 ? 289  ARG A NH1 1 
ATOM   2214 N NH2 . ARG A 1 289 ? -19.934 29.192  -4.730  1.00 117.64 ? 289  ARG A NH2 1 
ATOM   2215 N N   . GLN A 1 290 ? -19.268 24.608  -7.924  1.00 51.42  ? 290  GLN A N   1 
ATOM   2216 C CA  . GLN A 1 290 ? -20.576 24.282  -8.473  1.00 57.89  ? 290  GLN A CA  1 
ATOM   2217 C C   . GLN A 1 290 ? -20.771 22.790  -8.659  1.00 52.15  ? 290  GLN A C   1 
ATOM   2218 O O   . GLN A 1 290 ? -21.783 22.237  -8.229  1.00 49.15  ? 290  GLN A O   1 
ATOM   2219 C CB  . GLN A 1 290 ? -20.808 24.989  -9.798  1.00 56.21  ? 290  GLN A CB  1 
ATOM   2220 C CG  . GLN A 1 290 ? -22.220 24.786  -10.314 1.00 57.63  ? 290  GLN A CG  1 
ATOM   2221 C CD  . GLN A 1 290 ? -22.398 25.305  -11.712 1.00 62.77  ? 290  GLN A CD  1 
ATOM   2222 O OE1 . GLN A 1 290 ? -21.934 26.393  -12.044 1.00 68.01  ? 290  GLN A OE1 1 
ATOM   2223 N NE2 . GLN A 1 290 ? -23.065 24.523  -12.550 1.00 65.01  ? 290  GLN A NE2 1 
ATOM   2224 N N   . HIS A 1 291 ? -19.800 22.128  -9.276  1.00 44.30  ? 291  HIS A N   1 
ATOM   2225 C CA  . HIS A 1 291 ? -19.920 20.688  -9.429  1.00 45.97  ? 291  HIS A CA  1 
ATOM   2226 C C   . HIS A 1 291 ? -19.917 19.987  -8.077  1.00 58.58  ? 291  HIS A C   1 
ATOM   2227 O O   . HIS A 1 291 ? -20.713 19.077  -7.853  1.00 55.19  ? 291  HIS A O   1 
ATOM   2228 C CB  . HIS A 1 291 ? -18.853 20.118  -10.368 1.00 45.63  ? 291  HIS A CB  1 
ATOM   2229 C CG  . HIS A 1 291 ? -19.039 20.516  -11.803 1.00 44.25  ? 291  HIS A CG  1 
ATOM   2230 N ND1 . HIS A 1 291 ? -18.681 21.758  -12.286 1.00 45.43  ? 291  HIS A ND1 1 
ATOM   2231 C CD2 . HIS A 1 291 ? -19.560 19.841  -12.854 1.00 39.25  ? 291  HIS A CD2 1 
ATOM   2232 C CE1 . HIS A 1 291 ? -18.970 21.830  -13.574 1.00 39.87  ? 291  HIS A CE1 1 
ATOM   2233 N NE2 . HIS A 1 291 ? -19.503 20.679  -13.943 1.00 38.52  ? 291  HIS A NE2 1 
ATOM   2234 N N   . ARG A 1 292 ? -19.054 20.427  -7.165  1.00 41.72  ? 292  ARG A N   1 
ATOM   2235 C CA  . ARG A 1 292 ? -18.981 19.794  -5.850  1.00 56.08  ? 292  ARG A CA  1 
ATOM   2236 C C   . ARG A 1 292 ? -20.276 19.978  -5.043  1.00 53.64  ? 292  ARG A C   1 
ATOM   2237 O O   . ARG A 1 292 ? -20.763 19.041  -4.405  1.00 54.32  ? 292  ARG A O   1 
ATOM   2238 C CB  . ARG A 1 292 ? -17.781 20.335  -5.071  1.00 59.67  ? 292  ARG A CB  1 
ATOM   2239 C CG  . ARG A 1 292 ? -17.682 19.830  -3.651  1.00 67.61  ? 292  ARG A CG  1 
ATOM   2240 C CD  . ARG A 1 292 ? -16.445 20.393  -2.962  1.00 90.88  ? 292  ARG A CD  1 
ATOM   2241 N NE  . ARG A 1 292 ? -16.330 21.839  -3.143  1.00 102.25 ? 292  ARG A NE  1 
ATOM   2242 C CZ  . ARG A 1 292 ? -15.342 22.443  -3.803  1.00 106.58 ? 292  ARG A CZ  1 
ATOM   2243 N NH1 . ARG A 1 292 ? -14.357 21.732  -4.345  1.00 103.99 ? 292  ARG A NH1 1 
ATOM   2244 N NH2 . ARG A 1 292 ? -15.334 23.764  -3.911  1.00 105.55 ? 292  ARG A NH2 1 
ATOM   2245 N N   . GLU A 1 293 ? -20.818 21.193  -5.079  1.00 57.34  ? 293  GLU A N   1 
ATOM   2246 C CA  . GLU A 1 293 ? -22.070 21.529  -4.393  1.00 61.98  ? 293  GLU A CA  1 
ATOM   2247 C C   . GLU A 1 293 ? -23.292 20.832  -5.024  1.00 66.27  ? 293  GLU A C   1 
ATOM   2248 O O   . GLU A 1 293 ? -24.131 20.251  -4.322  1.00 68.79  ? 293  GLU A O   1 
ATOM   2249 C CB  . GLU A 1 293 ? -22.300 23.036  -4.437  1.00 54.58  ? 293  GLU A CB  1 
ATOM   2250 C CG  . GLU A 1 293 ? -21.457 23.866  -3.493  1.00 64.21  ? 293  GLU A CG  1 
ATOM   2251 C CD  . GLU A 1 293 ? -21.629 25.356  -3.760  1.00 77.51  ? 293  GLU A CD  1 
ATOM   2252 O OE1 . GLU A 1 293 ? -22.436 25.720  -4.650  1.00 84.50  ? 293  GLU A OE1 1 
ATOM   2253 O OE2 . GLU A 1 293 ? -20.957 26.163  -3.088  1.00 75.79  ? 293  GLU A OE2 1 
ATOM   2254 N N   . ALA A 1 294 ? -23.405 20.922  -6.345  1.00 51.08  ? 294  ALA A N   1 
ATOM   2255 C CA  . ALA A 1 294 ? -24.449 20.200  -7.063  1.00 63.27  ? 294  ALA A CA  1 
ATOM   2256 C C   . ALA A 1 294 ? -24.406 18.716  -6.670  1.00 54.84  ? 294  ALA A C   1 
ATOM   2257 O O   . ALA A 1 294 ? -25.417 18.138  -6.260  1.00 63.16  ? 294  ALA A O   1 
ATOM   2258 C CB  . ALA A 1 294 ? -24.279 20.366  -8.566  1.00 39.79  ? 294  ALA A CB  1 
ATOM   2259 N N   . ALA A 1 295 ? -23.225 18.117  -6.767  1.00 46.51  ? 295  ALA A N   1 
ATOM   2260 C CA  . ALA A 1 295 ? -23.012 16.733  -6.354  1.00 56.78  ? 295  ALA A CA  1 
ATOM   2261 C C   . ALA A 1 295 ? -23.402 16.478  -4.906  1.00 63.53  ? 295  ALA A C   1 
ATOM   2262 O O   . ALA A 1 295 ? -23.988 15.428  -4.597  1.00 64.27  ? 295  ALA A O   1 
ATOM   2263 C CB  . ALA A 1 295 ? -21.558 16.350  -6.557  1.00 58.65  ? 295  ALA A CB  1 
ATOM   2264 N N   . ALA A 1 296 ? -23.066 17.417  -4.026  1.00 64.55  ? 296  ALA A N   1 
ATOM   2265 C CA  . ALA A 1 296 ? -23.447 17.302  -2.635  1.00 68.34  ? 296  ALA A CA  1 
ATOM   2266 C C   . ALA A 1 296 ? -24.967 17.231  -2.531  1.00 58.64  ? 296  ALA A C   1 
ATOM   2267 O O   . ALA A 1 296 ? -25.512 16.296  -1.945  1.00 60.58  ? 296  ALA A O   1 
ATOM   2268 C CB  . ALA A 1 296 ? -22.897 18.520  -1.838  1.00 53.30  ? 296  ALA A CB  1 
ATOM   2269 N N   . TYR A 1 297 ? -25.649 18.210  -3.107  1.00 58.65  ? 297  TYR A N   1 
ATOM   2270 C CA  . TYR A 1 297 ? -27.106 18.204  -3.121  1.00 61.14  ? 297  TYR A CA  1 
ATOM   2271 C C   . TYR A 1 297 ? -27.679 16.892  -3.669  1.00 66.06  ? 297  TYR A C   1 
ATOM   2272 O O   . TYR A 1 297 ? -28.557 16.290  -3.049  1.00 62.87  ? 297  TYR A O   1 
ATOM   2273 C CB  . TYR A 1 297 ? -27.603 19.387  -3.927  1.00 56.38  ? 297  TYR A CB  1 
ATOM   2274 C CG  . TYR A 1 297 ? -29.099 19.558  -3.898  1.00 72.59  ? 297  TYR A CG  1 
ATOM   2275 C CD1 . TYR A 1 297 ? -29.812 19.430  -2.712  1.00 79.88  ? 297  TYR A CD1 1 
ATOM   2276 C CD2 . TYR A 1 297 ? -29.799 19.878  -5.051  1.00 68.33  ? 297  TYR A CD2 1 
ATOM   2277 C CE1 . TYR A 1 297 ? -31.183 19.595  -2.687  1.00 77.08  ? 297  TYR A CE1 1 
ATOM   2278 C CE2 . TYR A 1 297 ? -31.161 20.047  -5.035  1.00 76.92  ? 297  TYR A CE2 1 
ATOM   2279 C CZ  . TYR A 1 297 ? -31.852 19.905  -3.855  1.00 75.57  ? 297  TYR A CZ  1 
ATOM   2280 O OH  . TYR A 1 297 ? -33.217 20.078  -3.851  1.00 78.71  ? 297  TYR A OH  1 
ATOM   2281 N N   . LEU A 1 298 ? -27.148 16.431  -4.800  1.00 60.35  ? 298  LEU A N   1 
ATOM   2282 C CA  . LEU A 1 298 ? -27.683 15.234  -5.457  1.00 50.67  ? 298  LEU A CA  1 
ATOM   2283 C C   . LEU A 1 298 ? -27.627 13.958  -4.609  1.00 53.24  ? 298  LEU A C   1 
ATOM   2284 O O   . LEU A 1 298 ? -28.579 13.177  -4.590  1.00 69.16  ? 298  LEU A O   1 
ATOM   2285 C CB  . LEU A 1 298 ? -27.044 15.008  -6.839  1.00 52.27  ? 298  LEU A CB  1 
ATOM   2286 C CG  . LEU A 1 298 ? -27.167 13.597  -7.438  1.00 53.73  ? 298  LEU A CG  1 
ATOM   2287 C CD1 . LEU A 1 298 ? -28.593 13.267  -7.830  1.00 54.51  ? 298  LEU A CD1 1 
ATOM   2288 C CD2 . LEU A 1 298 ? -26.214 13.407  -8.619  1.00 52.91  ? 298  LEU A CD2 1 
ATOM   2289 N N   . HIS A 1 299 ? -26.525 13.754  -3.902  1.00 51.80  ? 299  HIS A N   1 
ATOM   2290 C CA  . HIS A 1 299 ? -26.360 12.552  -3.095  1.00 65.58  ? 299  HIS A CA  1 
ATOM   2291 C C   . HIS A 1 299 ? -27.371 12.501  -1.954  1.00 66.32  ? 299  HIS A C   1 
ATOM   2292 O O   . HIS A 1 299 ? -27.937 11.443  -1.651  1.00 71.82  ? 299  HIS A O   1 
ATOM   2293 C CB  . HIS A 1 299 ? -24.940 12.480  -2.536  1.00 67.86  ? 299  HIS A CB  1 
ATOM   2294 C CG  . HIS A 1 299 ? -23.884 12.432  -3.588  1.00 86.49  ? 299  HIS A CG  1 
ATOM   2295 N ND1 . HIS A 1 299 ? -22.544 12.260  -3.294  1.00 91.17  ? 299  HIS A ND1 1 
ATOM   2296 C CD2 . HIS A 1 299 ? -23.961 12.511  -4.938  1.00 86.02  ? 299  HIS A CD2 1 
ATOM   2297 C CE1 . HIS A 1 299 ? -21.849 12.256  -4.414  1.00 84.00  ? 299  HIS A CE1 1 
ATOM   2298 N NE2 . HIS A 1 299 ? -22.686 12.398  -5.428  1.00 85.28  ? 299  HIS A NE2 1 
ATOM   2299 N N   . GLY A 1 300 ? -27.581 13.653  -1.327  1.00 59.56  ? 300  GLY A N   1 
ATOM   2300 C CA  . GLY A 1 300 ? -28.553 13.780  -0.261  1.00 73.52  ? 300  GLY A CA  1 
ATOM   2301 C C   . GLY A 1 300 ? -29.935 13.355  -0.711  1.00 70.91  ? 300  GLY A C   1 
ATOM   2302 O O   . GLY A 1 300 ? -30.601 12.571  -0.039  1.00 77.59  ? 300  GLY A O   1 
ATOM   2303 N N   . ARG A 1 301 ? -30.358 13.851  -1.865  1.00 68.23  ? 301  ARG A N   1 
ATOM   2304 C CA  . ARG A 1 301 ? -31.676 13.509  -2.399  1.00 70.55  ? 301  ARG A CA  1 
ATOM   2305 C C   . ARG A 1 301 ? -31.819 12.028  -2.711  1.00 69.06  ? 301  ARG A C   1 
ATOM   2306 O O   . ARG A 1 301 ? -32.875 11.435  -2.496  1.00 70.71  ? 301  ARG A O   1 
ATOM   2307 C CB  . ARG A 1 301 ? -31.951 14.312  -3.658  1.00 64.48  ? 301  ARG A CB  1 
ATOM   2308 C CG  . ARG A 1 301 ? -31.882 15.813  -3.444  1.00 68.23  ? 301  ARG A CG  1 
ATOM   2309 C CD  . ARG A 1 301 ? -33.060 16.496  -4.120  1.00 66.80  ? 301  ARG A CD  1 
ATOM   2310 N NE  . ARG A 1 301 ? -34.329 16.089  -3.525  1.00 64.61  ? 301  ARG A NE  1 
ATOM   2311 C CZ  . ARG A 1 301 ? -35.498 16.620  -3.855  1.00 63.58  ? 301  ARG A CZ  1 
ATOM   2312 N NH1 . ARG A 1 301 ? -35.545 17.572  -4.770  1.00 51.64  ? 301  ARG A NH1 1 
ATOM   2313 N NH2 . ARG A 1 301 ? -36.616 16.206  -3.273  1.00 70.77  ? 301  ARG A NH2 1 
ATOM   2314 N N   . LEU A 1 302 ? -30.748 11.436  -3.217  1.00 64.47  ? 302  LEU A N   1 
ATOM   2315 C CA  . LEU A 1 302 ? -30.790 10.051  -3.650  1.00 66.74  ? 302  LEU A CA  1 
ATOM   2316 C C   . LEU A 1 302 ? -30.968 9.109   -2.474  1.00 76.83  ? 302  LEU A C   1 
ATOM   2317 O O   . LEU A 1 302 ? -31.778 8.182   -2.520  1.00 81.83  ? 302  LEU A O   1 
ATOM   2318 C CB  . LEU A 1 302 ? -29.524 9.700   -4.443  1.00 62.88  ? 302  LEU A CB  1 
ATOM   2319 C CG  . LEU A 1 302 ? -29.484 10.252  -5.870  1.00 62.74  ? 302  LEU A CG  1 
ATOM   2320 C CD1 . LEU A 1 302 ? -28.282 9.716   -6.612  1.00 65.77  ? 302  LEU A CD1 1 
ATOM   2321 C CD2 . LEU A 1 302 ? -30.771 9.880   -6.597  1.00 63.31  ? 302  LEU A CD2 1 
ATOM   2322 N N   . GLN A 1 303 ? -30.208 9.355   -1.416  1.00 78.53  ? 303  GLN A N   1 
ATOM   2323 C CA  . GLN A 1 303 ? -30.280 8.527   -0.224  1.00 80.58  ? 303  GLN A CA  1 
ATOM   2324 C C   . GLN A 1 303 ? -31.640 8.643   0.444   1.00 81.25  ? 303  GLN A C   1 
ATOM   2325 O O   . GLN A 1 303 ? -32.142 7.668   1.008   1.00 89.11  ? 303  GLN A O   1 
ATOM   2326 C CB  . GLN A 1 303 ? -29.162 8.906   0.742   1.00 89.33  ? 303  GLN A CB  1 
ATOM   2327 C CG  . GLN A 1 303 ? -27.785 8.658   0.157   1.00 84.85  ? 303  GLN A CG  1 
ATOM   2328 C CD  . GLN A 1 303 ? -26.672 9.106   1.066   1.00 79.20  ? 303  GLN A CD  1 
ATOM   2329 O OE1 . GLN A 1 303 ? -26.652 10.253  1.522   1.00 77.85  ? 303  GLN A OE1 1 
ATOM   2330 N NE2 . GLN A 1 303 ? -25.730 8.203   1.338   1.00 79.01  ? 303  GLN A NE2 1 
ATOM   2331 N N   . ALA A 1 304 ? -32.236 9.833   0.366   1.00 67.87  ? 304  ALA A N   1 
ATOM   2332 C CA  . ALA A 1 304 ? -33.594 10.052  0.863   1.00 72.94  ? 304  ALA A CA  1 
ATOM   2333 C C   . ALA A 1 304 ? -34.606 9.159   0.145   1.00 79.30  ? 304  ALA A C   1 
ATOM   2334 O O   . ALA A 1 304 ? -35.638 8.791   0.705   1.00 89.23  ? 304  ALA A O   1 
ATOM   2335 C CB  . ALA A 1 304 ? -33.994 11.524  0.730   1.00 62.19  ? 304  ALA A CB  1 
ATOM   2336 N N   . LEU A 1 305 ? -34.304 8.802   -1.096  1.00 74.91  ? 305  LEU A N   1 
ATOM   2337 C CA  . LEU A 1 305 ? -35.186 7.941   -1.868  1.00 68.53  ? 305  LEU A CA  1 
ATOM   2338 C C   . LEU A 1 305 ? -35.015 6.481   -1.476  1.00 69.59  ? 305  LEU A C   1 
ATOM   2339 O O   . LEU A 1 305 ? -35.764 5.612   -1.937  1.00 73.32  ? 305  LEU A O   1 
ATOM   2340 C CB  . LEU A 1 305 ? -34.908 8.110   -3.354  1.00 68.27  ? 305  LEU A CB  1 
ATOM   2341 C CG  . LEU A 1 305 ? -35.582 9.339   -3.947  1.00 76.71  ? 305  LEU A CG  1 
ATOM   2342 C CD1 . LEU A 1 305 ? -35.218 9.497   -5.418  1.00 75.94  ? 305  LEU A CD1 1 
ATOM   2343 C CD2 . LEU A 1 305 ? -37.094 9.230   -3.761  1.00 79.08  ? 305  LEU A CD2 1 
ATOM   2344 N N   . GLY A 1 306 ? -34.024 6.224   -0.628  1.00 66.26  ? 306  GLY A N   1 
ATOM   2345 C CA  . GLY A 1 306 ? -33.714 4.882   -0.176  1.00 68.94  ? 306  GLY A CA  1 
ATOM   2346 C C   . GLY A 1 306 ? -32.693 4.228   -1.077  1.00 76.95  ? 306  GLY A C   1 
ATOM   2347 O O   . GLY A 1 306 ? -32.484 3.014   -1.050  1.00 83.42  ? 306  GLY A O   1 
ATOM   2348 N N   . LEU A 1 307 ? -32.055 5.040   -1.906  1.00 76.68  ? 307  LEU A N   1 
ATOM   2349 C CA  . LEU A 1 307 ? -31.037 4.526   -2.803  1.00 72.59  ? 307  LEU A CA  1 
ATOM   2350 C C   . LEU A 1 307 ? -29.721 4.641   -2.089  1.00 81.35  ? 307  LEU A C   1 
ATOM   2351 O O   . LEU A 1 307 ? -29.548 5.500   -1.226  1.00 90.13  ? 307  LEU A O   1 
ATOM   2352 C CB  . LEU A 1 307 ? -30.989 5.337   -4.098  1.00 68.35  ? 307  LEU A CB  1 
ATOM   2353 C CG  . LEU A 1 307 ? -32.240 5.234   -4.974  1.00 64.03  ? 307  LEU A CG  1 
ATOM   2354 C CD1 . LEU A 1 307 ? -32.208 6.266   -6.087  1.00 53.35  ? 307  LEU A CD1 1 
ATOM   2355 C CD2 . LEU A 1 307 ? -32.357 3.832   -5.528  1.00 68.24  ? 307  LEU A CD2 1 
ATOM   2356 N N   . GLN A 1 308 ? -28.791 3.770   -2.445  1.00 88.14  ? 308  GLN A N   1 
ATOM   2357 C CA  . GLN A 1 308 ? -27.472 3.805   -1.843  1.00 92.38  ? 308  GLN A CA  1 
ATOM   2358 C C   . GLN A 1 308 ? -26.425 4.152   -2.905  1.00 90.93  ? 308  GLN A C   1 
ATOM   2359 O O   . GLN A 1 308 ? -26.523 3.729   -4.059  1.00 91.04  ? 308  GLN A O   1 
ATOM   2360 C CB  . GLN A 1 308 ? -27.154 2.475   -1.133  1.00 99.22  ? 308  GLN A CB  1 
ATOM   2361 C CG  . GLN A 1 308 ? -26.310 1.491   -1.923  1.00 110.03 ? 308  GLN A CG  1 
ATOM   2362 C CD  . GLN A 1 308 ? -25.740 0.376   -1.059  1.00 116.98 ? 308  GLN A CD  1 
ATOM   2363 O OE1 . GLN A 1 308 ? -25.500 0.565   0.135   1.00 125.51 ? 308  GLN A OE1 1 
ATOM   2364 N NE2 . GLN A 1 308 ? -25.529 -0.796  -1.659  1.00 110.40 ? 308  GLN A NE2 1 
ATOM   2365 N N   . LEU A 1 309 ? -25.443 4.958   -2.522  1.00 81.95  ? 309  LEU A N   1 
ATOM   2366 C CA  . LEU A 1 309 ? -24.412 5.377   -3.454  1.00 73.06  ? 309  LEU A CA  1 
ATOM   2367 C C   . LEU A 1 309 ? -23.375 4.285   -3.616  1.00 74.53  ? 309  LEU A C   1 
ATOM   2368 O O   . LEU A 1 309 ? -22.938 3.688   -2.632  1.00 80.60  ? 309  LEU A O   1 
ATOM   2369 C CB  . LEU A 1 309 ? -23.757 6.663   -2.975  1.00 70.44  ? 309  LEU A CB  1 
ATOM   2370 C CG  . LEU A 1 309 ? -24.782 7.733   -2.623  1.00 73.24  ? 309  LEU A CG  1 
ATOM   2371 C CD1 . LEU A 1 309 ? -24.091 9.059   -2.399  1.00 76.52  ? 309  LEU A CD1 1 
ATOM   2372 C CD2 . LEU A 1 309 ? -25.824 7.852   -3.721  1.00 72.76  ? 309  LEU A CD2 1 
ATOM   2373 N N   . PHE A 1 310 ? -22.985 4.023   -4.861  1.00 70.22  ? 310  PHE A N   1 
ATOM   2374 C CA  . PHE A 1 310 ? -22.075 2.923   -5.147  1.00 71.48  ? 310  PHE A CA  1 
ATOM   2375 C C   . PHE A 1 310 ? -20.729 3.092   -4.437  1.00 70.67  ? 310  PHE A C   1 
ATOM   2376 O O   . PHE A 1 310 ? -20.133 2.122   -3.960  1.00 70.42  ? 310  PHE A O   1 
ATOM   2377 C CB  . PHE A 1 310 ? -21.869 2.782   -6.649  1.00 59.38  ? 310  PHE A CB  1 
ATOM   2378 C CG  . PHE A 1 310 ? -21.155 1.531   -7.037  1.00 60.47  ? 310  PHE A CG  1 
ATOM   2379 C CD1 . PHE A 1 310 ? -21.778 0.302   -6.908  1.00 56.01  ? 310  PHE A CD1 1 
ATOM   2380 C CD2 . PHE A 1 310 ? -19.863 1.577   -7.528  1.00 64.89  ? 310  PHE A CD2 1 
ATOM   2381 C CE1 . PHE A 1 310 ? -21.133 -0.853  -7.262  1.00 59.26  ? 310  PHE A CE1 1 
ATOM   2382 C CE2 . PHE A 1 310 ? -19.208 0.423   -7.884  1.00 62.95  ? 310  PHE A CE2 1 
ATOM   2383 C CZ  . PHE A 1 310 ? -19.843 -0.796  -7.749  1.00 64.89  ? 310  PHE A CZ  1 
ATOM   2384 N N   . VAL A 1 311 ? -20.269 4.335   -4.369  1.00 73.79  ? 311  VAL A N   1 
ATOM   2385 C CA  . VAL A 1 311 ? -18.986 4.663   -3.761  1.00 74.88  ? 311  VAL A CA  1 
ATOM   2386 C C   . VAL A 1 311 ? -19.220 5.185   -2.356  1.00 79.64  ? 311  VAL A C   1 
ATOM   2387 O O   . VAL A 1 311 ? -19.833 6.238   -2.170  1.00 81.28  ? 311  VAL A O   1 
ATOM   2388 C CB  . VAL A 1 311 ? -18.256 5.743   -4.568  1.00 69.29  ? 311  VAL A CB  1 
ATOM   2389 C CG1 . VAL A 1 311 ? -16.874 5.992   -3.981  1.00 70.91  ? 311  VAL A CG1 1 
ATOM   2390 C CG2 . VAL A 1 311 ? -18.156 5.333   -6.033  1.00 71.25  ? 311  VAL A CG2 1 
ATOM   2391 N N   . LYS A 1 312 ? -18.717 4.457   -1.368  1.00 83.12  ? 312  LYS A N   1 
ATOM   2392 C CA  . LYS A 1 312 ? -19.073 4.725   0.022   1.00 86.18  ? 312  LYS A CA  1 
ATOM   2393 C C   . LYS A 1 312 ? -18.373 5.951   0.615   1.00 80.38  ? 312  LYS A C   1 
ATOM   2394 O O   . LYS A 1 312 ? -19.006 6.769   1.272   1.00 76.45  ? 312  LYS A O   1 
ATOM   2395 C CB  . LYS A 1 312 ? -18.868 3.466   0.862   1.00 86.69  ? 312  LYS A CB  1 
ATOM   2396 C CG  . LYS A 1 312 ? -19.689 2.292   0.327   1.00 92.14  ? 312  LYS A CG  1 
ATOM   2397 C CD  . LYS A 1 312 ? -19.127 0.949   0.761   1.00 99.66  ? 312  LYS A CD  1 
ATOM   2398 C CE  . LYS A 1 312 ? -19.360 -0.112  -0.309  1.00 99.38  ? 312  LYS A CE  1 
ATOM   2399 N NZ  . LYS A 1 312 ? -18.621 0.202   -1.569  1.00 91.67  ? 312  LYS A NZ  1 
ATOM   2400 N N   . ASP A 1 313 ? -17.082 6.083   0.345   1.00 77.42  ? 313  ASP A N   1 
ATOM   2401 C CA  . ASP A 1 313 ? -16.277 7.215   0.804   1.00 82.35  ? 313  ASP A CA  1 
ATOM   2402 C C   . ASP A 1 313 ? -16.480 8.446   -0.093  1.00 90.45  ? 313  ASP A C   1 
ATOM   2403 O O   . ASP A 1 313 ? -15.954 8.501   -1.204  1.00 103.76 ? 313  ASP A O   1 
ATOM   2404 C CB  . ASP A 1 313 ? -14.804 6.784   0.805   1.00 78.97  ? 313  ASP A CB  1 
ATOM   2405 C CG  . ASP A 1 313 ? -13.859 7.843   1.357   1.00 78.46  ? 313  ASP A CG  1 
ATOM   2406 O OD1 . ASP A 1 313 ? -14.244 9.031   1.476   1.00 76.72  ? 313  ASP A OD1 1 
ATOM   2407 O OD2 . ASP A 1 313 ? -12.697 7.467   1.653   1.00 78.32  ? 313  ASP A OD2 1 
ATOM   2408 N N   . PRO A 1 314 ? -17.223 9.449   0.404   1.00 83.62  ? 314  PRO A N   1 
ATOM   2409 C CA  . PRO A 1 314 ? -17.594 10.666  -0.332  1.00 81.40  ? 314  PRO A CA  1 
ATOM   2410 C C   . PRO A 1 314 ? -16.411 11.436  -0.914  1.00 86.23  ? 314  PRO A C   1 
ATOM   2411 O O   . PRO A 1 314 ? -16.571 12.160  -1.905  1.00 90.91  ? 314  PRO A O   1 
ATOM   2412 C CB  . PRO A 1 314 ? -18.291 11.507  0.734   1.00 76.98  ? 314  PRO A CB  1 
ATOM   2413 C CG  . PRO A 1 314 ? -18.836 10.501  1.682   1.00 71.22  ? 314  PRO A CG  1 
ATOM   2414 C CD  . PRO A 1 314 ? -17.788 9.450   1.762   1.00 73.96  ? 314  PRO A CD  1 
ATOM   2415 N N   . ALA A 1 315 ? -15.240 11.275  -0.308  1.00 77.48  ? 315  ALA A N   1 
ATOM   2416 C CA  . ALA A 1 315 ? -14.035 11.919  -0.805  1.00 72.93  ? 315  ALA A CA  1 
ATOM   2417 C C   . ALA A 1 315 ? -13.550 11.275  -2.116  1.00 76.54  ? 315  ALA A C   1 
ATOM   2418 O O   . ALA A 1 315 ? -12.767 11.874  -2.863  1.00 74.22  ? 315  ALA A O   1 
ATOM   2419 C CB  . ALA A 1 315 ? -12.948 11.857  0.251   1.00 67.90  ? 315  ALA A CB  1 
ATOM   2420 N N   . LEU A 1 316 ? -14.006 10.049  -2.373  1.00 65.33  ? 316  LEU A N   1 
ATOM   2421 C CA  . LEU A 1 316 ? -13.663 9.320   -3.589  1.00 63.86  ? 316  LEU A CA  1 
ATOM   2422 C C   . LEU A 1 316 ? -14.753 9.424   -4.666  1.00 62.18  ? 316  LEU A C   1 
ATOM   2423 O O   . LEU A 1 316 ? -14.627 8.831   -5.736  1.00 52.65  ? 316  LEU A O   1 
ATOM   2424 C CB  . LEU A 1 316 ? -13.410 7.844   -3.270  1.00 63.94  ? 316  LEU A CB  1 
ATOM   2425 C CG  . LEU A 1 316 ? -12.105 7.442   -2.570  1.00 71.95  ? 316  LEU A CG  1 
ATOM   2426 C CD1 . LEU A 1 316 ? -12.158 5.969   -2.155  1.00 65.30  ? 316  LEU A CD1 1 
ATOM   2427 C CD2 . LEU A 1 316 ? -10.893 7.711   -3.460  1.00 65.51  ? 316  LEU A CD2 1 
ATOM   2428 N N   . ARG A 1 317 ? -15.819 10.168  -4.382  1.00 62.84  ? 317  ARG A N   1 
ATOM   2429 C CA  . ARG A 1 317 ? -16.947 10.277  -5.312  1.00 67.23  ? 317  ARG A CA  1 
ATOM   2430 C C   . ARG A 1 317 ? -16.746 11.347  -6.380  1.00 59.88  ? 317  ARG A C   1 
ATOM   2431 O O   . ARG A 1 317 ? -16.642 12.536  -6.071  1.00 66.25  ? 317  ARG A O   1 
ATOM   2432 C CB  . ARG A 1 317 ? -18.245 10.576  -4.563  1.00 62.46  ? 317  ARG A CB  1 
ATOM   2433 C CG  . ARG A 1 317 ? -18.799 9.429   -3.765  1.00 57.20  ? 317  ARG A CG  1 
ATOM   2434 C CD  . ARG A 1 317 ? -20.107 9.858   -3.143  1.00 58.48  ? 317  ARG A CD  1 
ATOM   2435 N NE  . ARG A 1 317 ? -20.510 9.016   -2.026  1.00 69.26  ? 317  ARG A NE  1 
ATOM   2436 C CZ  . ARG A 1 317 ? -21.083 9.482   -0.921  1.00 80.59  ? 317  ARG A CZ  1 
ATOM   2437 N NH1 . ARG A 1 317 ? -21.313 10.782  -0.797  1.00 78.79  ? 317  ARG A NH1 1 
ATOM   2438 N NH2 . ARG A 1 317 ? -21.426 8.652   0.057   1.00 81.86  ? 317  ARG A NH2 1 
ATOM   2439 N N   . LEU A 1 318 ? -16.710 10.928  -7.639  1.00 54.71  ? 318  LEU A N   1 
ATOM   2440 C CA  . LEU A 1 318 ? -16.592 11.880  -8.744  1.00 56.86  ? 318  LEU A CA  1 
ATOM   2441 C C   . LEU A 1 318 ? -17.863 12.719  -8.799  1.00 55.06  ? 318  LEU A C   1 
ATOM   2442 O O   . LEU A 1 318 ? -18.957 12.171  -8.889  1.00 59.50  ? 318  LEU A O   1 
ATOM   2443 C CB  . LEU A 1 318 ? -16.372 11.137  -10.067 1.00 51.65  ? 318  LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 318 ? -16.350 11.960  -11.358 1.00 49.17  ? 318  LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 318 ? -15.104 12.835  -11.455 1.00 45.17  ? 318  LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 318 ? -16.450 11.026  -12.552 1.00 49.44  ? 318  LEU A CD2 1 
ATOM   2447 N N   . PRO A 1 319 ? -17.725 14.052  -8.718  1.00 56.00  ? 319  PRO A N   1 
ATOM   2448 C CA  . PRO A 1 319 ? -18.895 14.931  -8.674  1.00 47.82  ? 319  PRO A CA  1 
ATOM   2449 C C   . PRO A 1 319 ? -19.646 14.920  -9.985  1.00 60.23  ? 319  PRO A C   1 
ATOM   2450 O O   . PRO A 1 319 ? -20.870 14.984  -9.975  1.00 70.45  ? 319  PRO A O   1 
ATOM   2451 C CB  . PRO A 1 319 ? -18.291 16.318  -8.462  1.00 50.63  ? 319  PRO A CB  1 
ATOM   2452 C CG  . PRO A 1 319 ? -16.917 16.067  -7.902  1.00 51.30  ? 319  PRO A CG  1 
ATOM   2453 C CD  . PRO A 1 319 ? -16.469 14.804  -8.572  1.00 57.71  ? 319  PRO A CD  1 
ATOM   2454 N N   . THR A 1 320 ? -18.923 14.842  -11.098 1.00 62.62  ? 320  THR A N   1 
ATOM   2455 C CA  . THR A 1 320 ? -19.546 14.967  -12.415 1.00 50.41  ? 320  THR A CA  1 
ATOM   2456 C C   . THR A 1 320 ? -20.391 13.758  -12.810 1.00 44.55  ? 320  THR A C   1 
ATOM   2457 O O   . THR A 1 320 ? -21.354 13.882  -13.544 1.00 43.34  ? 320  THR A O   1 
ATOM   2458 C CB  . THR A 1 320 ? -18.499 15.223  -13.508 1.00 45.63  ? 320  THR A CB  1 
ATOM   2459 O OG1 . THR A 1 320 ? -17.481 14.221  -13.431 1.00 54.89  ? 320  THR A OG1 1 
ATOM   2460 C CG2 . THR A 1 320 ? -17.877 16.598  -13.339 1.00 39.48  ? 320  THR A CG2 1 
ATOM   2461 N N   . VAL A 1 321 ? -20.017 12.585  -12.331 1.00 50.64  ? 321  VAL A N   1 
ATOM   2462 C CA  . VAL A 1 321 ? -20.769 11.379  -12.635 1.00 49.82  ? 321  VAL A CA  1 
ATOM   2463 C C   . VAL A 1 321 ? -21.008 10.617  -11.349 1.00 51.32  ? 321  VAL A C   1 
ATOM   2464 O O   . VAL A 1 321 ? -20.064 10.230  -10.673 1.00 53.92  ? 321  VAL A O   1 
ATOM   2465 C CB  . VAL A 1 321 ? -19.995 10.455  -13.605 1.00 52.27  ? 321  VAL A CB  1 
ATOM   2466 C CG1 . VAL A 1 321 ? -20.758 9.169   -13.837 1.00 50.95  ? 321  VAL A CG1 1 
ATOM   2467 C CG2 . VAL A 1 321 ? -19.723 11.168  -14.927 1.00 43.00  ? 321  VAL A CG2 1 
ATOM   2468 N N   . THR A 1 322 ? -22.271 10.384  -11.019 1.00 68.51  ? 322  THR A N   1 
ATOM   2469 C CA  . THR A 1 322 ? -22.603 9.685   -9.784  1.00 65.32  ? 322  THR A CA  1 
ATOM   2470 C C   . THR A 1 322 ? -23.146 8.285   -10.012 1.00 58.40  ? 322  THR A C   1 
ATOM   2471 O O   . THR A 1 322 ? -24.109 8.100   -10.750 1.00 55.84  ? 322  THR A O   1 
ATOM   2472 C CB  . THR A 1 322 ? -23.643 10.461  -8.974  1.00 61.29  ? 322  THR A CB  1 
ATOM   2473 O OG1 . THR A 1 322 ? -23.116 11.749  -8.631  1.00 60.07  ? 322  THR A OG1 1 
ATOM   2474 C CG2 . THR A 1 322 ? -23.986 9.703   -7.706  1.00 56.94  ? 322  THR A CG2 1 
ATOM   2475 N N   . THR A 1 323 ? -22.547 7.307   -9.345  1.00 61.04  ? 323  THR A N   1 
ATOM   2476 C CA  . THR A 1 323 ? -23.031 5.939   -9.418  1.00 61.00  ? 323  THR A CA  1 
ATOM   2477 C C   . THR A 1 323 ? -23.940 5.574   -8.256  1.00 66.68  ? 323  THR A C   1 
ATOM   2478 O O   . THR A 1 323 ? -23.776 6.061   -7.140  1.00 76.73  ? 323  THR A O   1 
ATOM   2479 C CB  . THR A 1 323 ? -21.872 4.959   -9.490  1.00 68.06  ? 323  THR A CB  1 
ATOM   2480 O OG1 . THR A 1 323 ? -20.797 5.450   -8.676  1.00 65.23  ? 323  THR A OG1 1 
ATOM   2481 C CG2 . THR A 1 323 ? -21.406 4.847   -10.930 1.00 66.45  ? 323  THR A CG2 1 
ATOM   2482 N N   . VAL A 1 324 ? -24.901 4.704   -8.541  1.00 68.31  ? 324  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 324 ? -25.944 4.336   -7.597  1.00 64.12  ? 324  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 324 ? -26.216 2.851   -7.744  1.00 66.35  ? 324  VAL A C   1 
ATOM   2485 O O   . VAL A 1 324 ? -26.473 2.386   -8.848  1.00 63.14  ? 324  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 324 ? -27.250 5.051   -7.951  1.00 63.75  ? 324  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 324 ? -28.367 4.621   -7.024  1.00 62.25  ? 324  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 324 ? -27.065 6.550   -7.897  1.00 71.08  ? 324  VAL A CG2 1 
ATOM   2489 N N   . ALA A 1 325 ? -26.173 2.105   -6.645  1.00 66.23  ? 325  ALA A N   1 
ATOM   2490 C CA  . ALA A 1 325 ? -26.432 0.671   -6.711  1.00 62.81  ? 325  ALA A CA  1 
ATOM   2491 C C   . ALA A 1 325 ? -27.848 0.416   -7.196  1.00 66.01  ? 325  ALA A C   1 
ATOM   2492 O O   . ALA A 1 325 ? -28.767 1.131   -6.821  1.00 68.87  ? 325  ALA A O   1 
ATOM   2493 C CB  . ALA A 1 325 ? -26.218 0.037   -5.361  1.00 67.18  ? 325  ALA A CB  1 
ATOM   2494 N N   . VAL A 1 326 ? -28.026 -0.592  -8.043  1.00 70.61  ? 326  VAL A N   1 
ATOM   2495 C CA  . VAL A 1 326 ? -29.363 -0.928  -8.517  1.00 81.22  ? 326  VAL A CA  1 
ATOM   2496 C C   . VAL A 1 326 ? -30.197 -1.403  -7.338  1.00 91.33  ? 326  VAL A C   1 
ATOM   2497 O O   . VAL A 1 326 ? -29.840 -2.382  -6.684  1.00 101.54 ? 326  VAL A O   1 
ATOM   2498 C CB  . VAL A 1 326 ? -29.341 -2.045  -9.581  1.00 80.49  ? 326  VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 326 ? -30.767 -2.448  -9.955  1.00 80.88  ? 326  VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 326 ? -28.557 -1.608  -10.815 1.00 74.41  ? 326  VAL A CG2 1 
ATOM   2501 N N   . PRO A 1 327 ? -31.311 -0.708  -7.060  1.00 87.58  ? 327  PRO A N   1 
ATOM   2502 C CA  . PRO A 1 327 ? -32.214 -1.071  -5.959  1.00 89.08  ? 327  PRO A CA  1 
ATOM   2503 C C   . PRO A 1 327 ? -32.753 -2.477  -6.152  1.00 92.12  ? 327  PRO A C   1 
ATOM   2504 O O   . PRO A 1 327 ? -33.286 -2.763  -7.223  1.00 91.17  ? 327  PRO A O   1 
ATOM   2505 C CB  . PRO A 1 327 ? -33.354 -0.063  -6.098  1.00 84.41  ? 327  PRO A CB  1 
ATOM   2506 C CG  . PRO A 1 327 ? -33.291 0.392   -7.521  1.00 78.25  ? 327  PRO A CG  1 
ATOM   2507 C CD  . PRO A 1 327 ? -31.835 0.413   -7.854  1.00 75.54  ? 327  PRO A CD  1 
ATOM   2508 N N   . ALA A 1 328 ? -32.607 -3.336  -5.147  1.00 93.09  ? 328  ALA A N   1 
ATOM   2509 C CA  . ALA A 1 328 ? -33.010 -4.733  -5.279  1.00 90.74  ? 328  ALA A CA  1 
ATOM   2510 C C   . ALA A 1 328 ? -34.489 -4.822  -5.616  1.00 93.39  ? 328  ALA A C   1 
ATOM   2511 O O   . ALA A 1 328 ? -35.271 -3.960  -5.214  1.00 95.14  ? 328  ALA A O   1 
ATOM   2512 C CB  . ALA A 1 328 ? -32.703 -5.504  -4.005  1.00 86.00  ? 328  ALA A CB  1 
ATOM   2513 N N   . GLY A 1 329 ? -34.864 -5.850  -6.373  1.00 90.33  ? 329  GLY A N   1 
ATOM   2514 C CA  . GLY A 1 329 ? -36.248 -6.043  -6.769  1.00 81.36  ? 329  GLY A CA  1 
ATOM   2515 C C   . GLY A 1 329 ? -36.635 -5.293  -8.031  1.00 83.04  ? 329  GLY A C   1 
ATOM   2516 O O   . GLY A 1 329 ? -37.607 -5.638  -8.707  1.00 78.14  ? 329  GLY A O   1 
ATOM   2517 N N   . TYR A 1 330 ? -35.868 -4.260  -8.351  1.00 88.18  ? 330  TYR A N   1 
ATOM   2518 C CA  . TYR A 1 330 ? -36.139 -3.429  -9.515  1.00 87.95  ? 330  TYR A CA  1 
ATOM   2519 C C   . TYR A 1 330 ? -35.290 -3.826  -10.721 1.00 80.92  ? 330  TYR A C   1 
ATOM   2520 O O   . TYR A 1 330 ? -34.079 -4.046  -10.595 1.00 78.40  ? 330  TYR A O   1 
ATOM   2521 C CB  . TYR A 1 330 ? -35.828 -1.973  -9.188  1.00 88.69  ? 330  TYR A CB  1 
ATOM   2522 C CG  . TYR A 1 330 ? -36.820 -1.268  -8.298  1.00 84.26  ? 330  TYR A CG  1 
ATOM   2523 C CD1 . TYR A 1 330 ? -37.945 -0.666  -8.833  1.00 75.95  ? 330  TYR A CD1 1 
ATOM   2524 C CD2 . TYR A 1 330 ? -36.605 -1.163  -6.930  1.00 88.54  ? 330  TYR A CD2 1 
ATOM   2525 C CE1 . TYR A 1 330 ? -38.841 0.004   -8.030  1.00 86.13  ? 330  TYR A CE1 1 
ATOM   2526 C CE2 . TYR A 1 330 ? -37.500 -0.494  -6.116  1.00 89.19  ? 330  TYR A CE2 1 
ATOM   2527 C CZ  . TYR A 1 330 ? -38.614 0.089   -6.671  1.00 87.69  ? 330  TYR A CZ  1 
ATOM   2528 O OH  . TYR A 1 330 ? -39.511 0.756   -5.868  1.00 84.08  ? 330  TYR A OH  1 
ATOM   2529 N N   . ASP A 1 331 ? -35.920 -3.891  -11.892 1.00 70.28  ? 331  ASP A N   1 
ATOM   2530 C CA  . ASP A 1 331 ? -35.183 -4.038  -13.145 1.00 69.73  ? 331  ASP A CA  1 
ATOM   2531 C C   . ASP A 1 331 ? -34.637 -2.684  -13.584 1.00 75.41  ? 331  ASP A C   1 
ATOM   2532 O O   . ASP A 1 331 ? -35.396 -1.819  -14.026 1.00 78.91  ? 331  ASP A O   1 
ATOM   2533 C CB  . ASP A 1 331 ? -36.087 -4.585  -14.241 1.00 69.33  ? 331  ASP A CB  1 
ATOM   2534 C CG  . ASP A 1 331 ? -35.320 -4.980  -15.494 1.00 66.66  ? 331  ASP A CG  1 
ATOM   2535 O OD1 . ASP A 1 331 ? -34.164 -4.536  -15.672 1.00 59.65  ? 331  ASP A OD1 1 
ATOM   2536 O OD2 . ASP A 1 331 ? -35.884 -5.745  -16.305 1.00 61.25  ? 331  ASP A OD2 1 
ATOM   2537 N N   . TRP A 1 332 ? -33.321 -2.512  -13.478 1.00 78.83  ? 332  TRP A N   1 
ATOM   2538 C CA  . TRP A 1 332 ? -32.688 -1.222  -13.759 1.00 75.78  ? 332  TRP A CA  1 
ATOM   2539 C C   . TRP A 1 332 ? -33.078 -0.691  -15.139 1.00 69.19  ? 332  TRP A C   1 
ATOM   2540 O O   . TRP A 1 332 ? -33.164 0.522   -15.351 1.00 69.00  ? 332  TRP A O   1 
ATOM   2541 C CB  . TRP A 1 332 ? -31.167 -1.313  -13.616 1.00 72.02  ? 332  TRP A CB  1 
ATOM   2542 C CG  . TRP A 1 332 ? -30.499 -2.130  -14.682 1.00 90.38  ? 332  TRP A CG  1 
ATOM   2543 C CD1 . TRP A 1 332 ? -30.196 -3.461  -14.628 1.00 97.79  ? 332  TRP A CD1 1 
ATOM   2544 C CD2 . TRP A 1 332 ? -30.045 -1.669  -15.961 1.00 84.33  ? 332  TRP A CD2 1 
ATOM   2545 N NE1 . TRP A 1 332 ? -29.584 -3.858  -15.795 1.00 89.84  ? 332  TRP A NE1 1 
ATOM   2546 C CE2 . TRP A 1 332 ? -29.483 -2.775  -16.633 1.00 83.52  ? 332  TRP A CE2 1 
ATOM   2547 C CE3 . TRP A 1 332 ? -30.064 -0.428  -16.607 1.00 75.53  ? 332  TRP A CE3 1 
ATOM   2548 C CZ2 . TRP A 1 332 ? -28.947 -2.683  -17.909 1.00 80.53  ? 332  TRP A CZ2 1 
ATOM   2549 C CZ3 . TRP A 1 332 ? -29.529 -0.336  -17.874 1.00 81.43  ? 332  TRP A CZ3 1 
ATOM   2550 C CH2 . TRP A 1 332 ? -28.975 -1.458  -18.513 1.00 81.44  ? 332  TRP A CH2 1 
ATOM   2551 N N   . ARG A 1 333 ? -33.336 -1.613  -16.060 1.00 63.99  ? 333  ARG A N   1 
ATOM   2552 C CA  . ARG A 1 333 ? -33.722 -1.264  -17.416 1.00 64.54  ? 333  ARG A CA  1 
ATOM   2553 C C   . ARG A 1 333 ? -35.057 -0.530  -17.411 1.00 67.33  ? 333  ARG A C   1 
ATOM   2554 O O   . ARG A 1 333 ? -35.257 0.433   -18.157 1.00 68.78  ? 333  ARG A O   1 
ATOM   2555 C CB  . ARG A 1 333 ? -33.800 -2.518  -18.294 1.00 67.98  ? 333  ARG A CB  1 
ATOM   2556 C CG  . ARG A 1 333 ? -32.448 -3.086  -18.722 1.00 69.71  ? 333  ARG A CG  1 
ATOM   2557 C CD  . ARG A 1 333 ? -32.604 -4.391  -19.508 1.00 74.47  ? 333  ARG A CD  1 
ATOM   2558 N NE  . ARG A 1 333 ? -32.593 -5.573  -18.644 1.00 85.93  ? 333  ARG A NE  1 
ATOM   2559 C CZ  . ARG A 1 333 ? -33.660 -6.319  -18.358 1.00 90.57  ? 333  ARG A CZ  1 
ATOM   2560 N NH1 . ARG A 1 333 ? -34.846 -6.022  -18.868 1.00 79.94  ? 333  ARG A NH1 1 
ATOM   2561 N NH2 . ARG A 1 333 ? -33.536 -7.371  -17.558 1.00 99.55  ? 333  ARG A NH2 1 
ATOM   2562 N N   . ASP A 1 334 ? -35.965 -0.983  -16.557 1.00 69.88  ? 334  ASP A N   1 
ATOM   2563 C CA  . ASP A 1 334 ? -37.282 -0.372  -16.454 1.00 75.00  ? 334  ASP A CA  1 
ATOM   2564 C C   . ASP A 1 334 ? -37.168 1.064   -15.958 1.00 66.92  ? 334  ASP A C   1 
ATOM   2565 O O   . ASP A 1 334 ? -37.752 1.987   -16.529 1.00 67.68  ? 334  ASP A O   1 
ATOM   2566 C CB  . ASP A 1 334 ? -38.176 -1.188  -15.517 1.00 80.76  ? 334  ASP A CB  1 
ATOM   2567 C CG  . ASP A 1 334 ? -38.560 -2.532  -16.104 1.00 86.29  ? 334  ASP A CG  1 
ATOM   2568 O OD1 . ASP A 1 334 ? -38.590 -2.653  -17.348 1.00 84.28  ? 334  ASP A OD1 1 
ATOM   2569 O OD2 . ASP A 1 334 ? -38.839 -3.465  -15.322 1.00 87.76  ? 334  ASP A OD2 1 
ATOM   2570 N N   . ILE A 1 335 ? -36.409 1.238   -14.887 1.00 60.32  ? 335  ILE A N   1 
ATOM   2571 C CA  . ILE A 1 335 ? -36.220 2.542   -14.284 1.00 65.83  ? 335  ILE A CA  1 
ATOM   2572 C C   . ILE A 1 335 ? -35.754 3.559   -15.321 1.00 64.50  ? 335  ILE A C   1 
ATOM   2573 O O   . ILE A 1 335 ? -36.381 4.616   -15.494 1.00 60.64  ? 335  ILE A O   1 
ATOM   2574 C CB  . ILE A 1 335 ? -35.226 2.452   -13.117 1.00 65.66  ? 335  ILE A CB  1 
ATOM   2575 C CG1 . ILE A 1 335 ? -35.824 1.584   -12.006 1.00 65.25  ? 335  ILE A CG1 1 
ATOM   2576 C CG2 . ILE A 1 335 ? -34.881 3.836   -12.601 1.00 64.66  ? 335  ILE A CG2 1 
ATOM   2577 C CD1 . ILE A 1 335 ? -34.888 1.330   -10.864 1.00 70.41  ? 335  ILE A CD1 1 
ATOM   2578 N N   . VAL A 1 336 ? -34.677 3.210   -16.024 1.00 67.25  ? 336  VAL A N   1 
ATOM   2579 C CA  . VAL A 1 336 ? -34.110 4.064   -17.068 1.00 58.26  ? 336  VAL A CA  1 
ATOM   2580 C C   . VAL A 1 336 ? -35.127 4.408   -18.157 1.00 47.02  ? 336  VAL A C   1 
ATOM   2581 O O   . VAL A 1 336 ? -35.253 5.574   -18.537 1.00 62.80  ? 336  VAL A O   1 
ATOM   2582 C CB  . VAL A 1 336 ? -32.853 3.442   -17.728 1.00 46.27  ? 336  VAL A CB  1 
ATOM   2583 C CG1 . VAL A 1 336 ? -32.385 4.316   -18.900 1.00 41.14  ? 336  VAL A CG1 1 
ATOM   2584 C CG2 . VAL A 1 336 ? -31.721 3.247   -16.701 1.00 40.29  ? 336  VAL A CG2 1 
ATOM   2585 N N   . SER A 1 337 ? -35.846 3.405   -18.660 1.00 35.92  ? 337  SER A N   1 
ATOM   2586 C CA  . SER A 1 337 ? -36.878 3.661   -19.673 1.00 42.37  ? 337  SER A CA  1 
ATOM   2587 C C   . SER A 1 337 ? -37.965 4.568   -19.115 1.00 56.78  ? 337  SER A C   1 
ATOM   2588 O O   . SER A 1 337 ? -38.456 5.477   -19.810 1.00 58.13  ? 337  SER A O   1 
ATOM   2589 C CB  . SER A 1 337 ? -37.510 2.365   -20.198 1.00 56.33  ? 337  SER A CB  1 
ATOM   2590 O OG  . SER A 1 337 ? -36.566 1.555   -20.878 1.00 68.20  ? 337  SER A OG  1 
ATOM   2591 N N   . TYR A 1 338 ? -38.330 4.324   -17.857 1.00 61.15  ? 338  TYR A N   1 
ATOM   2592 C CA  . TYR A 1 338 ? -39.403 5.083   -17.215 1.00 62.91  ? 338  TYR A CA  1 
ATOM   2593 C C   . TYR A 1 338 ? -39.041 6.554   -17.136 1.00 57.70  ? 338  TYR A C   1 
ATOM   2594 O O   . TYR A 1 338 ? -39.867 7.429   -17.424 1.00 53.41  ? 338  TYR A O   1 
ATOM   2595 C CB  . TYR A 1 338 ? -39.711 4.559   -15.805 1.00 66.12  ? 338  TYR A CB  1 
ATOM   2596 C CG  . TYR A 1 338 ? -41.016 5.101   -15.269 1.00 69.15  ? 338  TYR A CG  1 
ATOM   2597 C CD1 . TYR A 1 338 ? -41.069 6.323   -14.606 1.00 71.64  ? 338  TYR A CD1 1 
ATOM   2598 C CD2 . TYR A 1 338 ? -42.204 4.411   -15.463 1.00 62.65  ? 338  TYR A CD2 1 
ATOM   2599 C CE1 . TYR A 1 338 ? -42.265 6.833   -14.138 1.00 70.18  ? 338  TYR A CE1 1 
ATOM   2600 C CE2 . TYR A 1 338 ? -43.407 4.910   -14.995 1.00 66.25  ? 338  TYR A CE2 1 
ATOM   2601 C CZ  . TYR A 1 338 ? -43.433 6.120   -14.334 1.00 69.30  ? 338  TYR A CZ  1 
ATOM   2602 O OH  . TYR A 1 338 ? -44.627 6.620   -13.868 1.00 64.14  ? 338  TYR A OH  1 
ATOM   2603 N N   . VAL A 1 339 ? -37.799 6.814   -16.738 1.00 60.27  ? 339  VAL A N   1 
ATOM   2604 C CA  . VAL A 1 339 ? -37.332 8.179   -16.600 1.00 56.44  ? 339  VAL A CA  1 
ATOM   2605 C C   . VAL A 1 339 ? -37.401 8.881   -17.951 1.00 58.09  ? 339  VAL A C   1 
ATOM   2606 O O   . VAL A 1 339 ? -37.775 10.055  -18.037 1.00 63.12  ? 339  VAL A O   1 
ATOM   2607 C CB  . VAL A 1 339 ? -35.912 8.233   -16.033 1.00 48.29  ? 339  VAL A CB  1 
ATOM   2608 C CG1 . VAL A 1 339 ? -35.425 9.651   -16.012 1.00 39.75  ? 339  VAL A CG1 1 
ATOM   2609 C CG2 . VAL A 1 339 ? -35.893 7.674   -14.627 1.00 51.28  ? 339  VAL A CG2 1 
ATOM   2610 N N   . MET A 1 340 ? -37.083 8.146   -19.012 1.00 46.91  ? 340  MET A N   1 
ATOM   2611 C CA  . MET A 1 340 ? -37.092 8.744   -20.336 1.00 49.62  ? 340  MET A CA  1 
ATOM   2612 C C   . MET A 1 340 ? -38.512 8.931   -20.849 1.00 51.41  ? 340  MET A C   1 
ATOM   2613 O O   . MET A 1 340 ? -38.874 10.013  -21.326 1.00 57.66  ? 340  MET A O   1 
ATOM   2614 C CB  . MET A 1 340 ? -36.277 7.902   -21.314 1.00 56.70  ? 340  MET A CB  1 
ATOM   2615 C CG  . MET A 1 340 ? -36.419 8.366   -22.742 1.00 55.40  ? 340  MET A CG  1 
ATOM   2616 S SD  . MET A 1 340 ? -35.857 10.063  -22.991 1.00 57.01  ? 340  MET A SD  1 
ATOM   2617 C CE  . MET A 1 340 ? -34.097 9.859   -22.643 1.00 39.33  ? 340  MET A CE  1 
ATOM   2618 N N   . ASP A 1 341 ? -39.318 7.880   -20.731 1.00 53.45  ? 341  ASP A N   1 
ATOM   2619 C CA  . ASP A 1 341 ? -40.682 7.896   -21.259 1.00 53.89  ? 341  ASP A CA  1 
ATOM   2620 C C   . ASP A 1 341 ? -41.552 8.969   -20.614 1.00 56.24  ? 341  ASP A C   1 
ATOM   2621 O O   . ASP A 1 341 ? -42.323 9.647   -21.296 1.00 51.00  ? 341  ASP A O   1 
ATOM   2622 C CB  . ASP A 1 341 ? -41.353 6.535   -21.072 1.00 53.17  ? 341  ASP A CB  1 
ATOM   2623 C CG  . ASP A 1 341 ? -40.652 5.442   -21.825 1.00 55.53  ? 341  ASP A CG  1 
ATOM   2624 O OD1 . ASP A 1 341 ? -39.954 5.763   -22.806 1.00 62.14  ? 341  ASP A OD1 1 
ATOM   2625 O OD2 . ASP A 1 341 ? -40.789 4.264   -21.437 1.00 56.22  ? 341  ASP A OD2 1 
ATOM   2626 N N   . HIS A 1 342 ? -41.435 9.120   -19.301 1.00 49.64  ? 342  HIS A N   1 
ATOM   2627 C CA  . HIS A 1 342 ? -42.336 10.020  -18.607 1.00 53.52  ? 342  HIS A CA  1 
ATOM   2628 C C   . HIS A 1 342 ? -41.754 11.393  -18.368 1.00 57.26  ? 342  HIS A C   1 
ATOM   2629 O O   . HIS A 1 342 ? -42.497 12.328  -18.049 1.00 45.13  ? 342  HIS A O   1 
ATOM   2630 C CB  . HIS A 1 342 ? -42.827 9.392   -17.305 1.00 47.00  ? 342  HIS A CB  1 
ATOM   2631 C CG  . HIS A 1 342 ? -43.612 8.143   -17.527 1.00 57.00  ? 342  HIS A CG  1 
ATOM   2632 N ND1 . HIS A 1 342 ? -44.983 8.141   -17.665 1.00 57.67  ? 342  HIS A ND1 1 
ATOM   2633 C CD2 . HIS A 1 342 ? -43.213 6.861   -17.695 1.00 74.34  ? 342  HIS A CD2 1 
ATOM   2634 C CE1 . HIS A 1 342 ? -45.397 6.906   -17.884 1.00 63.37  ? 342  HIS A CE1 1 
ATOM   2635 N NE2 . HIS A 1 342 ? -44.343 6.109   -17.906 1.00 71.45  ? 342  HIS A NE2 1 
ATOM   2636 N N   . PHE A 1 343 ? -40.441 11.531  -18.542 1.00 49.76  ? 343  PHE A N   1 
ATOM   2637 C CA  . PHE A 1 343 ? -39.796 12.785  -18.164 1.00 48.47  ? 343  PHE A CA  1 
ATOM   2638 C C   . PHE A 1 343 ? -38.871 13.405  -19.214 1.00 55.90  ? 343  PHE A C   1 
ATOM   2639 O O   . PHE A 1 343 ? -38.405 14.531  -19.040 1.00 55.81  ? 343  PHE A O   1 
ATOM   2640 C CB  . PHE A 1 343 ? -39.042 12.608  -16.845 1.00 48.43  ? 343  PHE A CB  1 
ATOM   2641 C CG  . PHE A 1 343 ? -39.936 12.321  -15.662 1.00 52.88  ? 343  PHE A CG  1 
ATOM   2642 C CD1 . PHE A 1 343 ? -40.448 13.351  -14.899 1.00 59.72  ? 343  PHE A CD1 1 
ATOM   2643 C CD2 . PHE A 1 343 ? -40.242 11.022  -15.301 1.00 48.57  ? 343  PHE A CD2 1 
ATOM   2644 C CE1 . PHE A 1 343 ? -41.256 13.089  -13.798 1.00 61.28  ? 343  PHE A CE1 1 
ATOM   2645 C CE2 . PHE A 1 343 ? -41.054 10.754  -14.206 1.00 51.42  ? 343  PHE A CE2 1 
ATOM   2646 C CZ  . PHE A 1 343 ? -41.558 11.792  -13.451 1.00 57.87  ? 343  PHE A CZ  1 
ATOM   2647 N N   . ASP A 1 344 ? -38.617 12.675  -20.297 1.00 54.09  ? 344  ASP A N   1 
ATOM   2648 C CA  . ASP A 1 344 ? -37.674 13.106  -21.330 1.00 54.12  ? 344  ASP A CA  1 
ATOM   2649 C C   . ASP A 1 344 ? -36.253 13.288  -20.775 1.00 48.72  ? 344  ASP A C   1 
ATOM   2650 O O   . ASP A 1 344 ? -35.456 14.037  -21.325 1.00 43.98  ? 344  ASP A O   1 
ATOM   2651 C CB  . ASP A 1 344 ? -38.149 14.385  -22.037 1.00 54.54  ? 344  ASP A CB  1 
ATOM   2652 C CG  . ASP A 1 344 ? -39.324 14.140  -22.982 1.00 52.17  ? 344  ASP A CG  1 
ATOM   2653 O OD1 . ASP A 1 344 ? -39.573 12.966  -23.338 1.00 52.84  ? 344  ASP A OD1 1 
ATOM   2654 O OD2 . ASP A 1 344 ? -39.994 15.121  -23.373 1.00 45.37  ? 344  ASP A OD2 1 
ATOM   2655 N N   . ILE A 1 345 ? -35.947 12.589  -19.689 1.00 44.38  ? 345  ILE A N   1 
ATOM   2656 C CA  . ILE A 1 345 ? -34.626 12.652  -19.067 1.00 47.26  ? 345  ILE A CA  1 
ATOM   2657 C C   . ILE A 1 345 ? -33.813 11.390  -19.355 1.00 50.72  ? 345  ILE A C   1 
ATOM   2658 O O   . ILE A 1 345 ? -34.302 10.265  -19.196 1.00 39.50  ? 345  ILE A O   1 
ATOM   2659 C CB  . ILE A 1 345 ? -34.717 12.865  -17.539 1.00 38.24  ? 345  ILE A CB  1 
ATOM   2660 C CG1 . ILE A 1 345 ? -35.326 14.234  -17.224 1.00 41.99  ? 345  ILE A CG1 1 
ATOM   2661 C CG2 . ILE A 1 345 ? -33.344 12.760  -16.895 1.00 37.80  ? 345  ILE A CG2 1 
ATOM   2662 C CD1 . ILE A 1 345 ? -35.565 14.485  -15.710 1.00 33.11  ? 345  ILE A CD1 1 
ATOM   2663 N N   . GLU A 1 346 ? -32.573 11.586  -19.796 1.00 46.27  ? 346  GLU A N   1 
ATOM   2664 C CA  . GLU A 1 346 ? -31.654 10.468  -19.977 1.00 46.40  ? 346  GLU A CA  1 
ATOM   2665 C C   . GLU A 1 346 ? -30.781 10.245  -18.735 1.00 46.39  ? 346  GLU A C   1 
ATOM   2666 O O   . GLU A 1 346 ? -30.065 11.145  -18.299 1.00 47.14  ? 346  GLU A O   1 
ATOM   2667 C CB  . GLU A 1 346 ? -30.766 10.667  -21.216 1.00 37.37  ? 346  GLU A CB  1 
ATOM   2668 C CG  . GLU A 1 346 ? -29.797 9.491   -21.453 1.00 60.55  ? 346  GLU A CG  1 
ATOM   2669 C CD  . GLU A 1 346 ? -28.676 9.772   -22.475 1.00 63.73  ? 346  GLU A CD  1 
ATOM   2670 O OE1 . GLU A 1 346 ? -27.646 10.372  -22.096 1.00 59.32  ? 346  GLU A OE1 1 
ATOM   2671 O OE2 . GLU A 1 346 ? -28.815 9.366   -23.649 1.00 69.41  ? 346  GLU A OE2 1 
ATOM   2672 N N   . ILE A 1 347 ? -30.872 9.049   -18.160 1.00 47.39  ? 347  ILE A N   1 
ATOM   2673 C CA  . ILE A 1 347 ? -29.845 8.549   -17.251 1.00 44.35  ? 347  ILE A CA  1 
ATOM   2674 C C   . ILE A 1 347 ? -29.363 7.211   -17.821 1.00 48.48  ? 347  ILE A C   1 
ATOM   2675 O O   . ILE A 1 347 ? -29.965 6.681   -18.747 1.00 49.41  ? 347  ILE A O   1 
ATOM   2676 C CB  . ILE A 1 347 ? -30.373 8.334   -15.829 1.00 46.10  ? 347  ILE A CB  1 
ATOM   2677 C CG1 . ILE A 1 347 ? -31.469 7.268   -15.833 1.00 44.36  ? 347  ILE A CG1 1 
ATOM   2678 C CG2 . ILE A 1 347 ? -30.858 9.648   -15.230 1.00 43.98  ? 347  ILE A CG2 1 
ATOM   2679 C CD1 . ILE A 1 347 ? -31.963 6.901   -14.467 1.00 52.68  ? 347  ILE A CD1 1 
ATOM   2680 N N   . MET A 1 348 ? -28.295 6.652   -17.268 1.00 49.51  ? 348  MET A N   1 
ATOM   2681 C CA  . MET A 1 348 ? -27.701 5.470   -17.868 1.00 50.87  ? 348  MET A CA  1 
ATOM   2682 C C   . MET A 1 348 ? -27.531 4.328   -16.885 1.00 56.61  ? 348  MET A C   1 
ATOM   2683 O O   . MET A 1 348 ? -27.778 4.474   -15.693 1.00 50.44  ? 348  MET A O   1 
ATOM   2684 C CB  . MET A 1 348 ? -26.350 5.830   -18.472 1.00 51.88  ? 348  MET A CB  1 
ATOM   2685 C CG  . MET A 1 348 ? -26.446 6.861   -19.574 1.00 49.51  ? 348  MET A CG  1 
ATOM   2686 S SD  . MET A 1 348 ? -26.580 6.103   -21.188 1.00 85.91  ? 348  MET A SD  1 
ATOM   2687 C CE  . MET A 1 348 ? -24.937 6.445   -21.824 1.00 113.75 ? 348  MET A CE  1 
ATOM   2688 N N   . GLY A 1 349 ? -27.111 3.181   -17.402 1.00 66.88  ? 349  GLY A N   1 
ATOM   2689 C CA  . GLY A 1 349 ? -26.779 2.050   -16.563 1.00 69.03  ? 349  GLY A CA  1 
ATOM   2690 C C   . GLY A 1 349 ? -25.287 2.047   -16.318 1.00 58.36  ? 349  GLY A C   1 
ATOM   2691 O O   . GLY A 1 349 ? -24.652 3.102   -16.281 1.00 61.97  ? 349  GLY A O   1 
ATOM   2692 N N   . GLY A 1 350 ? -24.721 0.860   -16.159 1.00 66.14  ? 350  GLY A N   1 
ATOM   2693 C CA  . GLY A 1 350 ? -23.283 0.734   -16.022 1.00 67.47  ? 350  GLY A CA  1 
ATOM   2694 C C   . GLY A 1 350 ? -22.601 0.720   -17.376 1.00 61.61  ? 350  GLY A C   1 
ATOM   2695 O O   . GLY A 1 350 ? -23.247 0.864   -18.418 1.00 49.04  ? 350  GLY A O   1 
ATOM   2696 N N   . LEU A 1 351 ? -21.286 0.540   -17.359 1.00 61.02  ? 351  LEU A N   1 
ATOM   2697 C CA  . LEU A 1 351 ? -20.492 0.491   -18.578 1.00 55.94  ? 351  LEU A CA  1 
ATOM   2698 C C   . LEU A 1 351 ? -19.255 -0.327  -18.262 1.00 55.69  ? 351  LEU A C   1 
ATOM   2699 O O   . LEU A 1 351 ? -18.480 0.048   -17.386 1.00 53.42  ? 351  LEU A O   1 
ATOM   2700 C CB  . LEU A 1 351 ? -20.071 1.903   -18.985 1.00 55.47  ? 351  LEU A CB  1 
ATOM   2701 C CG  . LEU A 1 351 ? -19.732 2.235   -20.438 1.00 56.83  ? 351  LEU A CG  1 
ATOM   2702 C CD1 . LEU A 1 351 ? -18.618 3.258   -20.466 1.00 50.83  ? 351  LEU A CD1 1 
ATOM   2703 C CD2 . LEU A 1 351 ? -19.376 1.012   -21.268 1.00 64.79  ? 351  LEU A CD2 1 
ATOM   2704 N N   . GLY A 1 352 ? -19.064 -1.434  -18.974 1.00 58.62  ? 352  GLY A N   1 
ATOM   2705 C CA  . GLY A 1 352 ? -17.921 -2.297  -18.723 1.00 62.35  ? 352  GLY A CA  1 
ATOM   2706 C C   . GLY A 1 352 ? -18.137 -3.135  -17.475 1.00 67.26  ? 352  GLY A C   1 
ATOM   2707 O O   . GLY A 1 352 ? -19.167 -3.802  -17.348 1.00 62.83  ? 352  GLY A O   1 
ATOM   2708 N N   . PRO A 1 353 ? -17.166 -3.109  -16.547 1.00 62.67  ? 353  PRO A N   1 
ATOM   2709 C CA  . PRO A 1 353 ? -17.300 -3.850  -15.288 1.00 66.77  ? 353  PRO A CA  1 
ATOM   2710 C C   . PRO A 1 353 ? -18.520 -3.416  -14.488 1.00 72.00  ? 353  PRO A C   1 
ATOM   2711 O O   . PRO A 1 353 ? -19.129 -4.265  -13.844 1.00 76.67  ? 353  PRO A O   1 
ATOM   2712 C CB  . PRO A 1 353 ? -16.014 -3.501  -14.529 1.00 56.60  ? 353  PRO A CB  1 
ATOM   2713 C CG  . PRO A 1 353 ? -15.039 -3.143  -15.594 1.00 51.51  ? 353  PRO A CG  1 
ATOM   2714 C CD  . PRO A 1 353 ? -15.840 -2.485  -16.685 1.00 61.32  ? 353  PRO A CD  1 
ATOM   2715 N N   . SER A 1 354 ? -18.879 -2.135  -14.535 1.00 67.54  ? 354  SER A N   1 
ATOM   2716 C CA  . SER A 1 354 ? -20.024 -1.650  -13.757 1.00 61.43  ? 354  SER A CA  1 
ATOM   2717 C C   . SER A 1 354 ? -21.382 -1.943  -14.403 1.00 58.81  ? 354  SER A C   1 
ATOM   2718 O O   . SER A 1 354 ? -22.419 -1.594  -13.842 1.00 67.45  ? 354  SER A O   1 
ATOM   2719 C CB  . SER A 1 354 ? -19.890 -0.158  -13.412 1.00 55.32  ? 354  SER A CB  1 
ATOM   2720 O OG  . SER A 1 354 ? -20.248 0.685   -14.495 1.00 52.72  ? 354  SER A OG  1 
ATOM   2721 N N   . THR A 1 355 ? -21.366 -2.589  -15.567 1.00 57.98  ? 355  THR A N   1 
ATOM   2722 C CA  . THR A 1 355 ? -22.592 -2.987  -16.259 1.00 55.87  ? 355  THR A CA  1 
ATOM   2723 C C   . THR A 1 355 ? -23.510 -3.773  -15.338 1.00 59.05  ? 355  THR A C   1 
ATOM   2724 O O   . THR A 1 355 ? -23.056 -4.605  -14.551 1.00 64.81  ? 355  THR A O   1 
ATOM   2725 C CB  . THR A 1 355 ? -22.274 -3.846  -17.502 1.00 62.43  ? 355  THR A CB  1 
ATOM   2726 O OG1 . THR A 1 355 ? -21.421 -3.110  -18.391 1.00 65.46  ? 355  THR A OG1 1 
ATOM   2727 C CG2 . THR A 1 355 ? -23.546 -4.268  -18.230 1.00 48.72  ? 355  THR A CG2 1 
ATOM   2728 N N   . GLY A 1 356 ? -24.802 -3.476  -15.418 1.00 61.62  ? 356  GLY A N   1 
ATOM   2729 C CA  . GLY A 1 356 ? -25.806 -4.166  -14.631 1.00 70.83  ? 356  GLY A CA  1 
ATOM   2730 C C   . GLY A 1 356 ? -25.724 -3.895  -13.140 1.00 73.75  ? 356  GLY A C   1 
ATOM   2731 O O   . GLY A 1 356 ? -26.609 -4.288  -12.385 1.00 73.28  ? 356  GLY A O   1 
ATOM   2732 N N   . LYS A 1 357 ? -24.669 -3.212  -12.715 1.00 66.89  ? 357  LYS A N   1 
ATOM   2733 C CA  . LYS A 1 357 ? -24.395 -3.067  -11.301 1.00 64.70  ? 357  LYS A CA  1 
ATOM   2734 C C   . LYS A 1 357 ? -24.803 -1.710  -10.747 1.00 72.81  ? 357  LYS A C   1 
ATOM   2735 O O   . LYS A 1 357 ? -24.892 -1.532  -9.531  1.00 84.32  ? 357  LYS A O   1 
ATOM   2736 C CB  . LYS A 1 357 ? -22.915 -3.341  -11.024 1.00 66.63  ? 357  LYS A CB  1 
ATOM   2737 C CG  . LYS A 1 357 ? -22.654 -4.673  -10.315 1.00 78.34  ? 357  LYS A CG  1 
ATOM   2738 C CD  . LYS A 1 357 ? -21.258 -5.228  -10.598 1.00 80.58  ? 357  LYS A CD  1 
ATOM   2739 C CE  . LYS A 1 357 ? -20.163 -4.429  -9.900  1.00 92.62  ? 357  LYS A CE  1 
ATOM   2740 N NZ  . LYS A 1 357 ? -20.153 -4.631  -8.420  1.00 101.10 ? 357  LYS A NZ  1 
ATOM   2741 N N   . VAL A 1 358 ? -25.047 -0.749  -11.630 1.00 67.56  ? 358  VAL A N   1 
ATOM   2742 C CA  . VAL A 1 358 ? -25.298 0.625   -11.200 1.00 66.44  ? 358  VAL A CA  1 
ATOM   2743 C C   . VAL A 1 358 ? -26.227 1.417   -12.111 1.00 67.18  ? 358  VAL A C   1 
ATOM   2744 O O   . VAL A 1 358 ? -26.611 0.969   -13.193 1.00 67.22  ? 358  VAL A O   1 
ATOM   2745 C CB  . VAL A 1 358 ? -23.987 1.447   -11.117 1.00 64.05  ? 358  VAL A CB  1 
ATOM   2746 C CG1 . VAL A 1 358 ? -23.142 1.010   -9.954  1.00 63.03  ? 358  VAL A CG1 1 
ATOM   2747 C CG2 . VAL A 1 358 ? -23.202 1.335   -12.420 1.00 59.98  ? 358  VAL A CG2 1 
ATOM   2748 N N   . LEU A 1 359 ? -26.592 2.600   -11.632 1.00 62.12  ? 359  LEU A N   1 
ATOM   2749 C CA  . LEU A 1 359 ? -27.153 3.644   -12.459 1.00 64.27  ? 359  LEU A CA  1 
ATOM   2750 C C   . LEU A 1 359 ? -26.152 4.784   -12.402 1.00 68.66  ? 359  LEU A C   1 
ATOM   2751 O O   . LEU A 1 359 ? -25.438 4.946   -11.407 1.00 63.85  ? 359  LEU A O   1 
ATOM   2752 C CB  . LEU A 1 359 ? -28.496 4.132   -11.920 1.00 57.42  ? 359  LEU A CB  1 
ATOM   2753 C CG  . LEU A 1 359 ? -29.681 3.175   -11.837 1.00 58.05  ? 359  LEU A CG  1 
ATOM   2754 C CD1 . LEU A 1 359 ? -30.928 3.980   -11.561 1.00 55.63  ? 359  LEU A CD1 1 
ATOM   2755 C CD2 . LEU A 1 359 ? -29.851 2.361   -13.102 1.00 60.30  ? 359  LEU A CD2 1 
ATOM   2756 N N   . ARG A 1 360 ? -26.107 5.581   -13.462 1.00 61.23  ? 360  ARG A N   1 
ATOM   2757 C CA  . ARG A 1 360 ? -25.150 6.669   -13.543 1.00 51.59  ? 360  ARG A CA  1 
ATOM   2758 C C   . ARG A 1 360 ? -25.891 7.948   -13.861 1.00 49.30  ? 360  ARG A C   1 
ATOM   2759 O O   . ARG A 1 360 ? -26.596 8.027   -14.874 1.00 59.58  ? 360  ARG A O   1 
ATOM   2760 C CB  . ARG A 1 360 ? -24.094 6.370   -14.612 1.00 44.51  ? 360  ARG A CB  1 
ATOM   2761 C CG  . ARG A 1 360 ? -23.169 5.200   -14.259 1.00 54.65  ? 360  ARG A CG  1 
ATOM   2762 C CD  . ARG A 1 360 ? -21.986 5.083   -15.234 1.00 55.42  ? 360  ARG A CD  1 
ATOM   2763 N NE  . ARG A 1 360 ? -22.414 4.731   -16.590 1.00 60.61  ? 360  ARG A NE  1 
ATOM   2764 C CZ  . ARG A 1 360 ? -21.742 5.031   -17.699 1.00 53.77  ? 360  ARG A CZ  1 
ATOM   2765 N NH1 . ARG A 1 360 ? -20.599 5.703   -17.634 1.00 48.19  ? 360  ARG A NH1 1 
ATOM   2766 N NH2 . ARG A 1 360 ? -22.217 4.662   -18.880 1.00 57.76  ? 360  ARG A NH2 1 
ATOM   2767 N N   . ILE A 1 361 ? -25.754 8.937   -12.980 1.00 48.20  ? 361  ILE A N   1 
ATOM   2768 C CA  . ILE A 1 361 ? -26.367 10.243  -13.181 1.00 52.65  ? 361  ILE A CA  1 
ATOM   2769 C C   . ILE A 1 361 ? -25.274 11.274  -13.298 1.00 47.45  ? 361  ILE A C   1 
ATOM   2770 O O   . ILE A 1 361 ? -24.331 11.264  -12.512 1.00 59.93  ? 361  ILE A O   1 
ATOM   2771 C CB  . ILE A 1 361 ? -27.305 10.632  -12.008 1.00 51.53  ? 361  ILE A CB  1 
ATOM   2772 C CG1 . ILE A 1 361 ? -28.509 9.702   -11.970 1.00 57.27  ? 361  ILE A CG1 1 
ATOM   2773 C CG2 . ILE A 1 361 ? -27.790 12.050  -12.157 1.00 38.98  ? 361  ILE A CG2 1 
ATOM   2774 C CD1 . ILE A 1 361 ? -28.509 8.796   -10.789 1.00 64.21  ? 361  ILE A CD1 1 
ATOM   2775 N N   . GLY A 1 362 ? -25.394 12.174  -14.265 1.00 52.52  ? 362  GLY A N   1 
ATOM   2776 C CA  . GLY A 1 362 ? -24.337 13.143  -14.489 1.00 53.33  ? 362  GLY A CA  1 
ATOM   2777 C C   . GLY A 1 362 ? -24.672 14.605  -14.258 1.00 53.72  ? 362  GLY A C   1 
ATOM   2778 O O   . GLY A 1 362 ? -25.748 15.084  -14.623 1.00 45.40  ? 362  GLY A O   1 
ATOM   2779 N N   . LEU A 1 363 ? -23.713 15.321  -13.681 1.00 42.18  ? 363  LEU A N   1 
ATOM   2780 C CA  . LEU A 1 363 ? -23.799 16.761  -13.494 1.00 45.52  ? 363  LEU A CA  1 
ATOM   2781 C C   . LEU A 1 363 ? -22.615 17.425  -14.221 1.00 56.19  ? 363  LEU A C   1 
ATOM   2782 O O   . LEU A 1 363 ? -21.458 17.361  -13.766 1.00 39.82  ? 363  LEU A O   1 
ATOM   2783 C CB  . LEU A 1 363 ? -23.789 17.089  -11.998 1.00 46.38  ? 363  LEU A CB  1 
ATOM   2784 C CG  . LEU A 1 363 ? -24.885 16.390  -11.193 1.00 51.10  ? 363  LEU A CG  1 
ATOM   2785 C CD1 . LEU A 1 363 ? -24.789 16.732  -9.714  1.00 52.87  ? 363  LEU A CD1 1 
ATOM   2786 C CD2 . LEU A 1 363 ? -26.253 16.772  -11.738 1.00 48.82  ? 363  LEU A CD2 1 
ATOM   2787 N N   . LEU A 1 364 ? -22.920 18.067  -15.346 1.00 34.67  ? 364  LEU A N   1 
ATOM   2788 C CA  . LEU A 1 364 ? -21.901 18.497  -16.291 1.00 34.14  ? 364  LEU A CA  1 
ATOM   2789 C C   . LEU A 1 364 ? -22.035 19.942  -16.755 1.00 48.25  ? 364  LEU A C   1 
ATOM   2790 O O   . LEU A 1 364 ? -22.975 20.291  -17.488 1.00 38.50  ? 364  LEU A O   1 
ATOM   2791 C CB  . LEU A 1 364 ? -21.942 17.583  -17.510 1.00 34.22  ? 364  LEU A CB  1 
ATOM   2792 C CG  . LEU A 1 364 ? -21.659 16.117  -17.215 1.00 36.43  ? 364  LEU A CG  1 
ATOM   2793 C CD1 . LEU A 1 364 ? -21.754 15.312  -18.475 1.00 40.46  ? 364  LEU A CD1 1 
ATOM   2794 C CD2 . LEU A 1 364 ? -20.282 15.968  -16.569 1.00 44.00  ? 364  LEU A CD2 1 
ATOM   2795 N N   . GLY A 1 365 ? -21.071 20.771  -16.353 1.00 39.79  ? 365  GLY A N   1 
ATOM   2796 C CA  . GLY A 1 365 ? -21.029 22.165  -16.766 1.00 34.12  ? 365  GLY A CA  1 
ATOM   2797 C C   . GLY A 1 365 ? -22.295 22.912  -16.410 1.00 44.56  ? 365  GLY A C   1 
ATOM   2798 O O   . GLY A 1 365 ? -22.768 22.839  -15.283 1.00 41.80  ? 365  GLY A O   1 
ATOM   2799 N N   . CYS A 1 366 ? -22.860 23.622  -17.376 1.00 42.90  ? 366  CYS A N   1 
ATOM   2800 C CA  . CYS A 1 366 ? -24.035 24.433  -17.105 1.00 47.76  ? 366  CYS A CA  1 
ATOM   2801 C C   . CYS A 1 366 ? -25.244 23.567  -16.752 1.00 56.03  ? 366  CYS A C   1 
ATOM   2802 O O   . CYS A 1 366 ? -26.271 24.076  -16.324 1.00 68.78  ? 366  CYS A O   1 
ATOM   2803 C CB  . CYS A 1 366 ? -24.349 25.325  -18.298 1.00 50.94  ? 366  CYS A CB  1 
ATOM   2804 S SG  . CYS A 1 366 ? -24.691 24.420  -19.821 1.00 54.78  ? 366  CYS A SG  1 
ATOM   2805 N N   . ASN A 1 367 ? -25.112 22.257  -16.927 1.00 52.00  ? 367  ASN A N   1 
ATOM   2806 C CA  . ASN A 1 367 ? -26.142 21.317  -16.517 1.00 43.83  ? 367  ASN A CA  1 
ATOM   2807 C C   . ASN A 1 367 ? -25.976 20.853  -15.073 1.00 48.45  ? 367  ASN A C   1 
ATOM   2808 O O   . ASN A 1 367 ? -26.868 20.222  -14.509 1.00 52.02  ? 367  ASN A O   1 
ATOM   2809 C CB  . ASN A 1 367 ? -26.155 20.112  -17.452 1.00 48.90  ? 367  ASN A CB  1 
ATOM   2810 C CG  . ASN A 1 367 ? -26.376 20.511  -18.890 1.00 58.03  ? 367  ASN A CG  1 
ATOM   2811 O OD1 . ASN A 1 367 ? -27.368 21.169  -19.214 1.00 48.47  ? 367  ASN A OD1 1 
ATOM   2812 N ND2 . ASN A 1 367 ? -25.434 20.154  -19.760 1.00 57.97  ? 367  ASN A ND2 1 
ATOM   2813 N N   . ALA A 1 368 ? -24.839 21.165  -14.463 1.00 46.23  ? 368  ALA A N   1 
ATOM   2814 C CA  . ALA A 1 368 ? -24.632 20.820  -13.062 1.00 37.87  ? 368  ALA A CA  1 
ATOM   2815 C C   . ALA A 1 368 ? -25.316 21.848  -12.161 1.00 44.28  ? 368  ALA A C   1 
ATOM   2816 O O   . ALA A 1 368 ? -24.665 22.714  -11.592 1.00 54.40  ? 368  ALA A O   1 
ATOM   2817 C CB  . ALA A 1 368 ? -23.144 20.716  -12.749 1.00 40.01  ? 368  ALA A CB  1 
ATOM   2818 N N   . THR A 1 369 ? -26.637 21.740  -12.054 1.00 49.16  ? 369  THR A N   1 
ATOM   2819 C CA  . THR A 1 369 ? -27.465 22.690  -11.310 1.00 50.72  ? 369  THR A CA  1 
ATOM   2820 C C   . THR A 1 369 ? -28.364 21.969  -10.332 1.00 58.58  ? 369  THR A C   1 
ATOM   2821 O O   . THR A 1 369 ? -28.792 20.842  -10.591 1.00 54.24  ? 369  THR A O   1 
ATOM   2822 C CB  . THR A 1 369 ? -28.392 23.495  -12.222 1.00 50.20  ? 369  THR A CB  1 
ATOM   2823 O OG1 . THR A 1 369 ? -29.415 22.634  -12.750 1.00 54.57  ? 369  THR A OG1 1 
ATOM   2824 C CG2 . THR A 1 369 ? -27.602 24.145  -13.358 1.00 47.79  ? 369  THR A CG2 1 
ATOM   2825 N N   . ARG A 1 370 ? -28.640 22.637  -9.214  1.00 59.93  ? 370  ARG A N   1 
ATOM   2826 C CA  . ARG A 1 370 ? -29.584 22.157  -8.221  1.00 51.23  ? 370  ARG A CA  1 
ATOM   2827 C C   . ARG A 1 370 ? -30.884 21.774  -8.892  1.00 53.10  ? 370  ARG A C   1 
ATOM   2828 O O   . ARG A 1 370 ? -31.420 20.697  -8.645  1.00 57.77  ? 370  ARG A O   1 
ATOM   2829 C CB  . ARG A 1 370 ? -29.869 23.238  -7.177  1.00 51.34  ? 370  ARG A CB  1 
ATOM   2830 C CG  . ARG A 1 370 ? -28.664 23.687  -6.373  1.00 59.41  ? 370  ARG A CG  1 
ATOM   2831 C CD  . ARG A 1 370 ? -29.092 24.603  -5.237  1.00 63.09  ? 370  ARG A CD  1 
ATOM   2832 N NE  . ARG A 1 370 ? -28.694 24.053  -3.945  1.00 71.73  ? 370  ARG A NE  1 
ATOM   2833 C CZ  . ARG A 1 370 ? -29.539 23.667  -2.995  1.00 78.09  ? 370  ARG A CZ  1 
ATOM   2834 N NH1 . ARG A 1 370 ? -30.845 23.789  -3.176  1.00 78.81  ? 370  ARG A NH1 1 
ATOM   2835 N NH2 . ARG A 1 370 ? -29.071 23.175  -1.855  1.00 85.77  ? 370  ARG A NH2 1 
ATOM   2836 N N   . GLU A 1 371 ? -31.388 22.654  -9.753  1.00 53.47  ? 371  GLU A N   1 
ATOM   2837 C CA  . GLU A 1 371 ? -32.692 22.400  -10.349 1.00 55.73  ? 371  GLU A CA  1 
ATOM   2838 C C   . GLU A 1 371 ? -32.754 21.115  -11.184 1.00 68.64  ? 371  GLU A C   1 
ATOM   2839 O O   . GLU A 1 371 ? -33.805 20.471  -11.258 1.00 73.84  ? 371  GLU A O   1 
ATOM   2840 C CB  . GLU A 1 371 ? -33.257 23.590  -11.120 1.00 63.30  ? 371  GLU A CB  1 
ATOM   2841 C CG  . GLU A 1 371 ? -34.751 23.372  -11.340 1.00 110.43 ? 371  GLU A CG  1 
ATOM   2842 C CD  . GLU A 1 371 ? -35.558 24.666  -11.324 1.00 141.18 ? 371  GLU A CD  1 
ATOM   2843 O OE1 . GLU A 1 371 ? -34.959 25.738  -11.087 1.00 158.52 ? 371  GLU A OE1 1 
ATOM   2844 O OE2 . GLU A 1 371 ? -36.763 24.581  -11.628 1.00 144.22 ? 371  GLU A OE2 1 
ATOM   2845 N N   . ASN A 1 372 ? -31.637 20.731  -11.798 1.00 61.74  ? 372  ASN A N   1 
ATOM   2846 C CA  . ASN A 1 372 ? -31.618 19.497  -12.561 1.00 45.25  ? 372  ASN A CA  1 
ATOM   2847 C C   . ASN A 1 372 ? -31.568 18.323  -11.613 1.00 47.78  ? 372  ASN A C   1 
ATOM   2848 O O   . ASN A 1 372 ? -32.056 17.240  -11.920 1.00 60.24  ? 372  ASN A O   1 
ATOM   2849 C CB  . ASN A 1 372 ? -30.453 19.461  -13.540 1.00 52.38  ? 372  ASN A CB  1 
ATOM   2850 C CG  . ASN A 1 372 ? -30.757 20.187  -14.820 1.00 51.63  ? 372  ASN A CG  1 
ATOM   2851 O OD1 . ASN A 1 372 ? -31.908 20.539  -15.093 1.00 65.75  ? 372  ASN A OD1 1 
ATOM   2852 N ND2 . ASN A 1 372 ? -29.729 20.400  -15.633 1.00 42.88  ? 372  ASN A ND2 1 
ATOM   2853 N N   . VAL A 1 373 ? -30.999 18.552  -10.441 1.00 41.33  ? 373  VAL A N   1 
ATOM   2854 C CA  . VAL A 1 373 ? -30.980 17.534  -9.401  1.00 53.28  ? 373  VAL A CA  1 
ATOM   2855 C C   . VAL A 1 373 ? -32.394 17.250  -8.896  1.00 53.73  ? 373  VAL A C   1 
ATOM   2856 O O   . VAL A 1 373 ? -32.742 16.116  -8.527  1.00 48.39  ? 373  VAL A O   1 
ATOM   2857 C CB  . VAL A 1 373 ? -30.109 17.974  -8.207  1.00 56.88  ? 373  VAL A CB  1 
ATOM   2858 C CG1 . VAL A 1 373 ? -30.185 16.950  -7.089  1.00 40.13  ? 373  VAL A CG1 1 
ATOM   2859 C CG2 . VAL A 1 373 ? -28.663 18.193  -8.658  1.00 64.05  ? 373  VAL A CG2 1 
ATOM   2860 N N   . ASP A 1 374 ? -33.217 18.285  -8.878  1.00 40.19  ? 374  ASP A N   1 
ATOM   2861 C CA  . ASP A 1 374 ? -34.569 18.108  -8.374  1.00 59.10  ? 374  ASP A CA  1 
ATOM   2862 C C   . ASP A 1 374 ? -35.356 17.317  -9.395  1.00 60.56  ? 374  ASP A C   1 
ATOM   2863 O O   . ASP A 1 374 ? -36.123 16.420  -9.044  1.00 66.01  ? 374  ASP A O   1 
ATOM   2864 C CB  . ASP A 1 374 ? -35.237 19.453  -8.089  1.00 48.01  ? 374  ASP A CB  1 
ATOM   2865 C CG  . ASP A 1 374 ? -34.630 20.159  -6.897  1.00 45.71  ? 374  ASP A CG  1 
ATOM   2866 O OD1 . ASP A 1 374 ? -34.119 19.466  -5.998  1.00 47.62  ? 374  ASP A OD1 1 
ATOM   2867 O OD2 . ASP A 1 374 ? -34.657 21.403  -6.862  1.00 53.77  ? 374  ASP A OD2 1 
ATOM   2868 N N   . ARG A 1 375 ? -35.132 17.644  -10.664 1.00 50.17  ? 375  ARG A N   1 
ATOM   2869 C CA  . ARG A 1 375 ? -35.811 16.972  -11.756 1.00 50.18  ? 375  ARG A CA  1 
ATOM   2870 C C   . ARG A 1 375 ? -35.474 15.485  -11.797 1.00 58.14  ? 375  ARG A C   1 
ATOM   2871 O O   . ARG A 1 375 ? -36.364 14.651  -11.931 1.00 64.52  ? 375  ARG A O   1 
ATOM   2872 C CB  . ARG A 1 375 ? -35.491 17.651  -13.079 1.00 47.39  ? 375  ARG A CB  1 
ATOM   2873 C CG  . ARG A 1 375 ? -35.967 19.082  -13.132 1.00 35.31  ? 375  ARG A CG  1 
ATOM   2874 C CD  . ARG A 1 375 ? -35.842 19.661  -14.527 1.00 35.92  ? 375  ARG A CD  1 
ATOM   2875 N NE  . ARG A 1 375 ? -36.258 21.061  -14.548 1.00 50.58  ? 375  ARG A NE  1 
ATOM   2876 C CZ  . ARG A 1 375 ? -37.499 21.478  -14.804 1.00 59.65  ? 375  ARG A CZ  1 
ATOM   2877 N NH1 . ARG A 1 375 ? -38.451 20.607  -15.078 1.00 56.45  ? 375  ARG A NH1 1 
ATOM   2878 N NH2 . ARG A 1 375 ? -37.797 22.772  -14.794 1.00 53.04  ? 375  ARG A NH2 1 
ATOM   2879 N N   . VAL A 1 376 ? -34.202 15.144  -11.647 1.00 50.30  ? 376  VAL A N   1 
ATOM   2880 C CA  . VAL A 1 376 ? -33.817 13.742  -11.742 1.00 53.37  ? 376  VAL A CA  1 
ATOM   2881 C C   . VAL A 1 376 ? -34.288 12.995  -10.503 1.00 61.68  ? 376  VAL A C   1 
ATOM   2882 O O   . VAL A 1 376 ? -34.658 11.818  -10.575 1.00 62.13  ? 376  VAL A O   1 
ATOM   2883 C CB  . VAL A 1 376 ? -32.287 13.532  -12.018 1.00 46.98  ? 376  VAL A CB  1 
ATOM   2884 C CG1 . VAL A 1 376 ? -31.503 13.292  -10.731 1.00 43.36  ? 376  VAL A CG1 1 
ATOM   2885 C CG2 . VAL A 1 376 ? -32.078 12.362  -12.938 1.00 45.00  ? 376  VAL A CG2 1 
ATOM   2886 N N   . THR A 1 377 ? -34.304 13.691  -9.369  1.00 66.19  ? 377  THR A N   1 
ATOM   2887 C CA  . THR A 1 377 ? -34.749 13.076  -8.127  1.00 67.26  ? 377  THR A CA  1 
ATOM   2888 C C   . THR A 1 377 ? -36.213 12.704  -8.233  1.00 54.81  ? 377  THR A C   1 
ATOM   2889 O O   . THR A 1 377 ? -36.612 11.600  -7.869  1.00 67.49  ? 377  THR A O   1 
ATOM   2890 C CB  . THR A 1 377 ? -34.565 14.010  -6.931  1.00 77.89  ? 377  THR A CB  1 
ATOM   2891 O OG1 . THR A 1 377 ? -33.186 14.382  -6.844  1.00 84.95  ? 377  THR A OG1 1 
ATOM   2892 C CG2 . THR A 1 377 ? -34.979 13.306  -5.645  1.00 73.86  ? 377  THR A CG2 1 
ATOM   2893 N N   . GLU A 1 378 ? -37.011 13.617  -8.760  1.00 42.45  ? 378  GLU A N   1 
ATOM   2894 C CA  . GLU A 1 378 ? -38.438 13.359  -8.854  1.00 53.93  ? 378  GLU A CA  1 
ATOM   2895 C C   . GLU A 1 378 ? -38.756 12.318  -9.927  1.00 58.92  ? 378  GLU A C   1 
ATOM   2896 O O   . GLU A 1 378 ? -39.627 11.470  -9.735  1.00 56.70  ? 378  GLU A O   1 
ATOM   2897 C CB  . GLU A 1 378 ? -39.207 14.659  -9.065  1.00 51.72  ? 378  GLU A CB  1 
ATOM   2898 C CG  . GLU A 1 378 ? -39.132 15.567  -7.841  1.00 57.55  ? 378  GLU A CG  1 
ATOM   2899 C CD  . GLU A 1 378 ? -40.045 16.775  -7.920  1.00 47.35  ? 378  GLU A CD  1 
ATOM   2900 O OE1 . GLU A 1 378 ? -40.610 17.047  -8.998  1.00 42.44  ? 378  GLU A OE1 1 
ATOM   2901 O OE2 . GLU A 1 378 ? -40.189 17.457  -6.886  1.00 53.62  ? 378  GLU A OE2 1 
ATOM   2902 N N   . ALA A 1 379 ? -38.026 12.368  -11.038 1.00 51.82  ? 379  ALA A N   1 
ATOM   2903 C CA  . ALA A 1 379 ? -38.193 11.385  -12.098 1.00 52.22  ? 379  ALA A CA  1 
ATOM   2904 C C   . ALA A 1 379 ? -37.890 9.984   -11.575 1.00 57.00  ? 379  ALA A C   1 
ATOM   2905 O O   . ALA A 1 379 ? -38.638 9.047   -11.835 1.00 67.25  ? 379  ALA A O   1 
ATOM   2906 C CB  . ALA A 1 379 ? -37.301 11.720  -13.287 1.00 60.68  ? 379  ALA A CB  1 
ATOM   2907 N N   . LEU A 1 380 ? -36.806 9.849   -10.819 1.00 56.18  ? 380  LEU A N   1 
ATOM   2908 C CA  . LEU A 1 380 ? -36.449 8.555   -10.247 1.00 61.28  ? 380  LEU A CA  1 
ATOM   2909 C C   . LEU A 1 380 ? -37.483 8.100   -9.220  1.00 66.14  ? 380  LEU A C   1 
ATOM   2910 O O   . LEU A 1 380 ? -37.839 6.920   -9.154  1.00 67.63  ? 380  LEU A O   1 
ATOM   2911 C CB  . LEU A 1 380 ? -35.060 8.610   -9.609  1.00 60.70  ? 380  LEU A CB  1 
ATOM   2912 C CG  . LEU A 1 380 ? -33.854 8.552   -10.541 1.00 57.34  ? 380  LEU A CG  1 
ATOM   2913 C CD1 . LEU A 1 380 ? -32.619 9.081   -9.822  1.00 65.93  ? 380  LEU A CD1 1 
ATOM   2914 C CD2 . LEU A 1 380 ? -33.620 7.132   -11.017 1.00 47.80  ? 380  LEU A CD2 1 
ATOM   2915 N N   . ARG A 1 381 ? -37.964 9.043   -8.420  1.00 67.23  ? 381  ARG A N   1 
ATOM   2916 C CA  . ARG A 1 381 ? -38.941 8.721   -7.391  1.00 68.13  ? 381  ARG A CA  1 
ATOM   2917 C C   . ARG A 1 381 ? -40.176 8.086   -8.007  1.00 67.13  ? 381  ARG A C   1 
ATOM   2918 O O   . ARG A 1 381 ? -40.640 7.028   -7.560  1.00 62.84  ? 381  ARG A O   1 
ATOM   2919 C CB  . ARG A 1 381 ? -39.351 9.971   -6.620  1.00 63.38  ? 381  ARG A CB  1 
ATOM   2920 C CG  . ARG A 1 381 ? -40.367 9.689   -5.528  1.00 64.54  ? 381  ARG A CG  1 
ATOM   2921 C CD  . ARG A 1 381 ? -41.145 10.940  -5.160  1.00 65.93  ? 381  ARG A CD  1 
ATOM   2922 N NE  . ARG A 1 381 ? -40.357 11.869  -4.355  1.00 72.19  ? 381  ARG A NE  1 
ATOM   2923 C CZ  . ARG A 1 381 ? -40.312 13.178  -4.575  1.00 72.52  ? 381  ARG A CZ  1 
ATOM   2924 N NH1 . ARG A 1 381 ? -41.011 13.698  -5.580  1.00 76.30  ? 381  ARG A NH1 1 
ATOM   2925 N NH2 . ARG A 1 381 ? -39.577 13.963  -3.795  1.00 59.21  ? 381  ARG A NH2 1 
ATOM   2926 N N   . ALA A 1 382 ? -40.705 8.752   -9.030  1.00 67.43  ? 382  ALA A N   1 
ATOM   2927 C CA  . ALA A 1 382 ? -41.864 8.256   -9.763  1.00 62.99  ? 382  ALA A CA  1 
ATOM   2928 C C   . ALA A 1 382 ? -41.560 6.876   -10.336 1.00 62.36  ? 382  ALA A C   1 
ATOM   2929 O O   . ALA A 1 382 ? -42.390 5.963   -10.272 1.00 58.24  ? 382  ALA A O   1 
ATOM   2930 C CB  . ALA A 1 382 ? -42.252 9.229   -10.868 1.00 49.02  ? 382  ALA A CB  1 
ATOM   2931 N N   . ALA A 1 383 ? -40.353 6.731   -10.874 1.00 60.56  ? 383  ALA A N   1 
ATOM   2932 C CA  . ALA A 1 383 ? -39.905 5.454   -11.412 1.00 61.25  ? 383  ALA A CA  1 
ATOM   2933 C C   . ALA A 1 383 ? -39.976 4.380   -10.345 1.00 56.09  ? 383  ALA A C   1 
ATOM   2934 O O   . ALA A 1 383 ? -40.579 3.327   -10.557 1.00 76.27  ? 383  ALA A O   1 
ATOM   2935 C CB  . ALA A 1 383 ? -38.496 5.560   -11.970 1.00 61.56  ? 383  ALA A CB  1 
ATOM   2936 N N   . LEU A 1 384 ? -39.373 4.661   -9.195  1.00 57.40  ? 384  LEU A N   1 
ATOM   2937 C CA  . LEU A 1 384 ? -39.413 3.751   -8.052  1.00 64.09  ? 384  LEU A CA  1 
ATOM   2938 C C   . LEU A 1 384 ? -40.846 3.363   -7.665  1.00 76.23  ? 384  LEU A C   1 
ATOM   2939 O O   . LEU A 1 384 ? -41.115 2.215   -7.308  1.00 76.70  ? 384  LEU A O   1 
ATOM   2940 C CB  . LEU A 1 384 ? -38.739 4.403   -6.850  1.00 54.83  ? 384  LEU A CB  1 
ATOM   2941 C CG  . LEU A 1 384 ? -37.286 4.042   -6.565  1.00 63.09  ? 384  LEU A CG  1 
ATOM   2942 C CD1 . LEU A 1 384 ? -36.818 2.942   -7.497  1.00 61.58  ? 384  LEU A CD1 1 
ATOM   2943 C CD2 . LEU A 1 384 ? -36.399 5.279   -6.658  1.00 67.23  ? 384  LEU A CD2 1 
ATOM   2944 N N   . GLN A 1 385 ? -41.757 4.329   -7.738  1.00 75.89  ? 385  GLN A N   1 
ATOM   2945 C CA  . GLN A 1 385 ? -43.137 4.106   -7.334  1.00 77.05  ? 385  GLN A CA  1 
ATOM   2946 C C   . GLN A 1 385 ? -43.858 3.157   -8.256  1.00 74.94  ? 385  GLN A C   1 
ATOM   2947 O O   . GLN A 1 385 ? -44.576 2.272   -7.803  1.00 82.30  ? 385  GLN A O   1 
ATOM   2948 C CB  . GLN A 1 385 ? -43.914 5.413   -7.314  1.00 84.46  ? 385  GLN A CB  1 
ATOM   2949 C CG  . GLN A 1 385 ? -43.834 6.172   -6.021  1.00 93.60  ? 385  GLN A CG  1 
ATOM   2950 C CD  . GLN A 1 385 ? -44.238 7.633   -6.184  1.00 93.48  ? 385  GLN A CD  1 
ATOM   2951 O OE1 . GLN A 1 385 ? -45.054 7.983   -7.050  1.00 82.15  ? 385  GLN A OE1 1 
ATOM   2952 N NE2 . GLN A 1 385 ? -43.647 8.500   -5.361  1.00 95.34  ? 385  GLN A NE2 1 
ATOM   2953 N N   . HIS A 1 386 ? -43.676 3.345   -9.554  1.00 71.64  ? 386  HIS A N   1 
ATOM   2954 C CA  . HIS A 1 386 ? -44.523 2.652   -10.518 1.00 74.25  ? 386  HIS A CA  1 
ATOM   2955 C C   . HIS A 1 386 ? -43.930 1.376   -11.151 1.00 78.60  ? 386  HIS A C   1 
ATOM   2956 O O   . HIS A 1 386 ? -44.671 0.465   -11.520 1.00 81.38  ? 386  HIS A O   1 
ATOM   2957 C CB  . HIS A 1 386 ? -45.021 3.637   -11.583 1.00 65.11  ? 386  HIS A CB  1 
ATOM   2958 C CG  . HIS A 1 386 ? -45.767 4.810   -11.020 1.00 77.99  ? 386  HIS A CG  1 
ATOM   2959 N ND1 . HIS A 1 386 ? -45.511 6.106   -11.410 1.00 88.41  ? 386  HIS A ND1 1 
ATOM   2960 C CD2 . HIS A 1 386 ? -46.766 4.883   -10.108 1.00 78.93  ? 386  HIS A CD2 1 
ATOM   2961 C CE1 . HIS A 1 386 ? -46.313 6.929   -10.754 1.00 81.36  ? 386  HIS A CE1 1 
ATOM   2962 N NE2 . HIS A 1 386 ? -47.077 6.213   -9.951  1.00 82.30  ? 386  HIS A NE2 1 
ATOM   2963 N N   . CYS A 1 387 ? -42.607 1.307   -11.265 1.00 69.84  ? 387  CYS A N   1 
ATOM   2964 C CA  . CYS A 1 387 ? -41.950 0.116   -11.806 1.00 82.85  ? 387  CYS A CA  1 
ATOM   2965 C C   . CYS A 1 387 ? -42.103 -1.110  -10.898 1.00 85.76  ? 387  CYS A C   1 
ATOM   2966 O O   . CYS A 1 387 ? -41.868 -1.023  -9.697  1.00 83.47  ? 387  CYS A O   1 
ATOM   2967 C CB  . CYS A 1 387 ? -40.465 0.386   -12.056 1.00 83.88  ? 387  CYS A CB  1 
ATOM   2968 S SG  . CYS A 1 387 ? -40.146 1.569   -13.384 1.00 81.90  ? 387  CYS A SG  1 
ATOM   2969 N N   . PRO A 1 388 ? -42.459 -2.266  -11.484 1.00 84.82  ? 388  PRO A N   1 
ATOM   2970 C CA  . PRO A 1 388 ? -42.810 -3.490  -10.751 1.00 80.06  ? 388  PRO A CA  1 
ATOM   2971 C C   . PRO A 1 388 ? -41.631 -4.128  -10.021 1.00 74.75  ? 388  PRO A C   1 
ATOM   2972 O O   . PRO A 1 388 ? -40.486 -3.801  -10.321 1.00 69.91  ? 388  PRO A O   1 
ATOM   2973 C CB  . PRO A 1 388 ? -43.299 -4.420  -11.861 1.00 82.65  ? 388  PRO A CB  1 
ATOM   2974 C CG  . PRO A 1 388 ? -42.542 -3.983  -13.057 1.00 83.11  ? 388  PRO A CG  1 
ATOM   2975 C CD  . PRO A 1 388 ? -42.444 -2.487  -12.941 1.00 83.22  ? 388  PRO A CD  1 
HETATM 2976 N N1  . PLP B 2 .   ? -12.525 8.522   -20.919 1.00 87.43  ? 1389 PLP A N1  1 
HETATM 2977 C C2  . PLP B 2 .   ? -13.488 8.728   -19.996 1.00 81.78  ? 1389 PLP A C2  1 
HETATM 2978 C C2A . PLP B 2 .   ? -13.143 8.481   -18.569 1.00 55.40  ? 1389 PLP A C2A 1 
HETATM 2979 C C3  . PLP B 2 .   ? -14.760 9.174   -20.357 1.00 88.98  ? 1389 PLP A C3  1 
HETATM 2980 O O3  . PLP B 2 .   ? -15.729 9.371   -19.411 1.00 71.74  ? 1389 PLP A O3  1 
HETATM 2981 C C4  . PLP B 2 .   ? -15.035 9.409   -21.695 1.00 95.47  ? 1389 PLP A C4  1 
HETATM 2982 C C4A . PLP B 2 .   ? -16.406 9.892   -22.106 1.00 82.45  ? 1389 PLP A C4A 1 
HETATM 2983 C C5  . PLP B 2 .   ? -14.016 9.189   -22.620 1.00 99.87  ? 1389 PLP A C5  1 
HETATM 2984 C C6  . PLP B 2 .   ? -12.763 8.747   -22.223 1.00 92.41  ? 1389 PLP A C6  1 
HETATM 2985 C C5A . PLP B 2 .   ? -14.234 9.448   -24.059 1.00 98.66  ? 1389 PLP A C5A 1 
HETATM 2986 O O4P . PLP B 2 .   ? -14.760 8.482   -24.863 1.00 103.87 ? 1389 PLP A O4P 1 
HETATM 2987 P P   . PLP B 2 .   ? -15.371 9.054   -26.173 1.00 78.03  ? 1389 PLP A P   1 
HETATM 2988 O O1P . PLP B 2 .   ? -16.768 8.472   -26.264 1.00 86.24  ? 1389 PLP A O1P 1 
HETATM 2989 O O2P . PLP B 2 .   ? -15.368 10.561  -26.046 1.00 73.46  ? 1389 PLP A O2P 1 
HETATM 2990 O O3P . PLP B 2 .   ? -14.497 8.621   -27.344 1.00 73.28  ? 1389 PLP A O3P 1 
HETATM 2991 O O   . HOH C 3 .   ? -34.059 3.734   -50.363 1.00 45.53  ? 2001 HOH A O   1 
HETATM 2992 O O   . HOH C 3 .   ? -36.805 4.001   -49.237 1.00 41.29  ? 2002 HOH A O   1 
HETATM 2993 O O   . HOH C 3 .   ? -34.835 19.347  -42.121 1.00 46.32  ? 2003 HOH A O   1 
HETATM 2994 O O   . HOH C 3 .   ? -30.984 28.215  -28.196 1.00 42.37  ? 2004 HOH A O   1 
HETATM 2995 O O   . HOH C 3 .   ? -21.562 33.086  -32.712 1.00 43.36  ? 2005 HOH A O   1 
HETATM 2996 O O   . HOH C 3 .   ? -36.269 12.372  -37.541 1.00 52.58  ? 2006 HOH A O   1 
HETATM 2997 O O   . HOH C 3 .   ? -32.994 17.493  -27.197 1.00 45.99  ? 2007 HOH A O   1 
HETATM 2998 O O   . HOH C 3 .   ? -34.245 20.004  -28.183 1.00 45.64  ? 2008 HOH A O   1 
HETATM 2999 O O   . HOH C 3 .   ? -25.166 14.943  -18.689 1.00 40.44  ? 2009 HOH A O   1 
HETATM 3000 O O   . HOH C 3 .   ? -25.752 12.276  -20.751 1.00 51.46  ? 2010 HOH A O   1 
HETATM 3001 O O   . HOH C 3 .   ? -22.202 17.164  -25.586 1.00 36.17  ? 2011 HOH A O   1 
HETATM 3002 O O   . HOH C 3 .   ? -27.175 22.999  -20.727 1.00 60.00  ? 2012 HOH A O   1 
HETATM 3003 O O   . HOH C 3 .   ? -28.600 29.300  -29.821 1.00 58.90  ? 2013 HOH A O   1 
HETATM 3004 O O   . HOH C 3 .   ? -21.842 31.364  -30.033 1.00 48.91  ? 2014 HOH A O   1 
HETATM 3005 O O   . HOH C 3 .   ? -16.414 35.262  -24.107 1.00 43.20  ? 2015 HOH A O   1 
HETATM 3006 O O   . HOH C 3 .   ? -18.068 37.007  -24.889 1.00 56.51  ? 2016 HOH A O   1 
HETATM 3007 O O   . HOH C 3 .   ? -31.463 26.906  -25.862 1.00 50.64  ? 2017 HOH A O   1 
HETATM 3008 O O   . HOH C 3 .   ? -24.204 33.573  -33.804 1.00 50.65  ? 2018 HOH A O   1 
HETATM 3009 O O   . HOH C 3 .   ? -22.346 22.346  -35.595 0.50 28.48  ? 2019 HOH A O   1 
HETATM 3010 O O   . HOH C 3 .   ? -22.920 25.191  -39.099 1.00 32.50  ? 2020 HOH A O   1 
HETATM 3011 O O   . HOH C 3 .   ? -27.784 28.525  -38.101 1.00 45.76  ? 2021 HOH A O   1 
HETATM 3012 O O   . HOH C 3 .   ? -11.272 31.878  -45.464 1.00 44.45  ? 2022 HOH A O   1 
HETATM 3013 O O   . HOH C 3 .   ? -7.107  22.083  -41.916 1.00 59.73  ? 2023 HOH A O   1 
HETATM 3014 O O   . HOH C 3 .   ? -3.081  31.724  -43.821 1.00 60.52  ? 2024 HOH A O   1 
HETATM 3015 O O   . HOH C 3 .   ? 0.103   28.069  -43.753 1.00 54.74  ? 2025 HOH A O   1 
HETATM 3016 O O   . HOH C 3 .   ? -3.007  26.916  -32.982 1.00 36.49  ? 2026 HOH A O   1 
HETATM 3017 O O   . HOH C 3 .   ? -1.808  30.132  -28.494 1.00 44.90  ? 2027 HOH A O   1 
HETATM 3018 O O   . HOH C 3 .   ? -11.499 34.712  -32.481 1.00 49.69  ? 2028 HOH A O   1 
HETATM 3019 O O   . HOH C 3 .   ? 2.556   25.349  -28.480 1.00 45.50  ? 2029 HOH A O   1 
HETATM 3020 O O   . HOH C 3 .   ? -5.088  36.405  -25.043 1.00 50.88  ? 2030 HOH A O   1 
HETATM 3021 O O   . HOH C 3 .   ? -3.784  35.381  -28.595 1.00 54.48  ? 2031 HOH A O   1 
HETATM 3022 O O   . HOH C 3 .   ? -0.621  30.568  -21.800 1.00 56.77  ? 2032 HOH A O   1 
HETATM 3023 O O   . HOH C 3 .   ? -10.070 30.378  -11.690 1.00 53.63  ? 2033 HOH A O   1 
HETATM 3024 O O   . HOH C 3 .   ? -8.304  22.156  -14.568 1.00 47.72  ? 2034 HOH A O   1 
HETATM 3025 O O   . HOH C 3 .   ? -0.566  22.466  -12.353 1.00 57.98  ? 2035 HOH A O   1 
HETATM 3026 O O   . HOH C 3 .   ? 5.253   20.235  -23.941 1.00 47.79  ? 2036 HOH A O   1 
HETATM 3027 O O   . HOH C 3 .   ? -6.353  18.160  -34.660 1.00 35.19  ? 2037 HOH A O   1 
HETATM 3028 O O   . HOH C 3 .   ? -6.115  15.409  -34.591 1.00 32.65  ? 2038 HOH A O   1 
HETATM 3029 O O   . HOH C 3 .   ? -13.441 15.682  -35.039 1.00 42.31  ? 2039 HOH A O   1 
HETATM 3030 O O   . HOH C 3 .   ? -15.082 14.051  -27.986 1.00 37.19  ? 2040 HOH A O   1 
HETATM 3031 O O   . HOH C 3 .   ? 3.214   3.241   -32.686 1.00 43.70  ? 2041 HOH A O   1 
HETATM 3032 O O   . HOH C 3 .   ? 3.730   1.452   -30.536 1.00 46.16  ? 2042 HOH A O   1 
HETATM 3033 O O   . HOH C 3 .   ? 11.354  3.096   -26.085 1.00 42.45  ? 2043 HOH A O   1 
HETATM 3034 O O   . HOH C 3 .   ? -6.869  4.660   -13.740 1.00 62.14  ? 2044 HOH A O   1 
HETATM 3035 O O   . HOH C 3 .   ? -10.073 3.449   -15.754 1.00 63.51  ? 2045 HOH A O   1 
HETATM 3036 O O   . HOH C 3 .   ? -8.234  5.797   -11.577 1.00 54.45  ? 2046 HOH A O   1 
HETATM 3037 O O   . HOH C 3 .   ? -7.581  -6.949  -24.260 1.00 57.45  ? 2047 HOH A O   1 
HETATM 3038 O O   . HOH C 3 .   ? -0.095  -6.293  -5.725  1.00 47.31  ? 2048 HOH A O   1 
HETATM 3039 O O   . HOH C 3 .   ? -9.778  16.562  -8.661  1.00 48.71  ? 2049 HOH A O   1 
HETATM 3040 O O   . HOH C 3 .   ? -7.321  14.775  -7.869  1.00 38.99  ? 2050 HOH A O   1 
HETATM 3041 O O   . HOH C 3 .   ? -10.076 11.843  -4.814  1.00 51.32  ? 2051 HOH A O   1 
HETATM 3042 O O   . HOH C 3 .   ? 1.176   13.955  -9.766  1.00 60.06  ? 2052 HOH A O   1 
HETATM 3043 O O   . HOH C 3 .   ? -15.137 16.940  -18.337 1.00 41.47  ? 2053 HOH A O   1 
HETATM 3044 O O   . HOH C 3 .   ? -15.519 18.447  -21.383 1.00 39.96  ? 2054 HOH A O   1 
HETATM 3045 O O   . HOH C 3 .   ? -16.786 18.622  -30.706 1.00 57.21  ? 2055 HOH A O   1 
HETATM 3046 O O   . HOH C 3 .   ? -21.250 25.069  -20.664 1.00 39.20  ? 2056 HOH A O   1 
HETATM 3047 O O   . HOH C 3 .   ? -15.059 12.826  -34.205 1.00 34.19  ? 2057 HOH A O   1 
HETATM 3048 O O   . HOH C 3 .   ? 6.000   22.501  -29.381 1.00 42.40  ? 2058 HOH A O   1 
HETATM 3049 O O   . HOH C 3 .   ? 12.890  7.867   -27.765 1.00 53.48  ? 2059 HOH A O   1 
HETATM 3050 O O   . HOH C 3 .   ? 6.720   19.056  -35.035 1.00 43.25  ? 2060 HOH A O   1 
HETATM 3051 O O   . HOH C 3 .   ? 6.584   20.440  -30.879 1.00 44.95  ? 2061 HOH A O   1 
HETATM 3052 O O   . HOH C 3 .   ? 6.464   11.279  -42.162 1.00 52.28  ? 2062 HOH A O   1 
HETATM 3053 O O   . HOH C 3 .   ? -5.888  14.274  -37.042 1.00 28.43  ? 2063 HOH A O   1 
HETATM 3054 O O   . HOH C 3 .   ? 4.217   25.021  -35.790 1.00 50.28  ? 2064 HOH A O   1 
HETATM 3055 O O   . HOH C 3 .   ? -3.823  20.355  -41.437 1.00 33.84  ? 2065 HOH A O   1 
HETATM 3056 O O   . HOH C 3 .   ? -10.563 19.679  -47.424 1.00 33.81  ? 2066 HOH A O   1 
HETATM 3057 O O   . HOH C 3 .   ? -16.272 16.272  -35.595 0.50 58.25  ? 2067 HOH A O   1 
HETATM 3058 O O   . HOH C 3 .   ? -20.779 22.055  -33.146 1.00 37.63  ? 2068 HOH A O   1 
HETATM 3059 O O   . HOH C 3 .   ? -12.900 35.754  -16.197 1.00 44.51  ? 2069 HOH A O   1 
HETATM 3060 O O   . HOH C 3 .   ? -21.780 26.772  -15.796 1.00 47.87  ? 2070 HOH A O   1 
HETATM 3061 O O   . HOH C 3 .   ? -20.788 25.256  -14.609 1.00 45.67  ? 2071 HOH A O   1 
HETATM 3062 O O   . HOH C 3 .   ? -18.652 26.473  -17.196 1.00 48.15  ? 2072 HOH A O   1 
HETATM 3063 O O   . HOH C 3 .   ? -13.104 30.901  -10.433 1.00 51.69  ? 2073 HOH A O   1 
HETATM 3064 O O   . HOH C 3 .   ? -37.840 18.602  -5.736  1.00 58.44  ? 2074 HOH A O   1 
HETATM 3065 O O   . HOH C 3 .   ? -20.491 10.051  -7.333  1.00 47.83  ? 2075 HOH A O   1 
HETATM 3066 O O   . HOH C 3 .   ? -22.811 13.303  -10.073 1.00 47.36  ? 2076 HOH A O   1 
HETATM 3067 O O   . HOH C 3 .   ? -33.433 7.670   -19.242 1.00 53.49  ? 2077 HOH A O   1 
HETATM 3068 O O   . HOH C 3 .   ? -37.751 4.665   -23.674 1.00 50.89  ? 2078 HOH A O   1 
HETATM 3069 O O   . HOH C 3 .   ? -31.031 9.713   -24.551 1.00 56.13  ? 2079 HOH A O   1 
HETATM 3070 O O   . HOH C 3 .   ? -24.478 2.986   -19.613 1.00 57.57  ? 2080 HOH A O   1 
HETATM 3071 O O   . HOH C 3 .   ? -25.508 16.566  -16.423 1.00 36.54  ? 2081 HOH A O   1 
HETATM 3072 O O   . HOH C 3 .   ? -42.422 12.405  -8.889  1.00 52.63  ? 2082 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 4   ? 1.4726 1.4040 1.5953 0.0260 -0.1011 -0.0461 4    HIS A N   
2    C CA  . HIS A 4   ? 1.5375 1.5089 1.6756 0.0241 -0.1108 -0.0433 4    HIS A CA  
3    C C   . HIS A 4   ? 1.5475 1.4803 1.6761 0.0256 -0.1008 -0.0467 4    HIS A C   
4    O O   . HIS A 4   ? 1.6647 1.6022 1.8452 0.0311 -0.1388 -0.0573 4    HIS A O   
5    C CB  . HIS A 4   ? 1.6483 1.6198 1.7888 0.0240 -0.1116 -0.0435 4    HIS A CB  
6    C CG  . HIS A 4   ? 1.7804 1.7187 1.9538 0.0340 -0.1386 -0.0613 4    HIS A CG  
7    N ND1 . HIS A 4   ? 1.7692 1.7016 1.8950 0.0272 -0.1017 -0.0489 4    HIS A ND1 
8    C CD2 . HIS A 4   ? 1.7431 1.7167 1.8819 0.0259 -0.1105 -0.0468 4    HIS A CD2 
9    C CE1 . HIS A 4   ? 1.7248 1.6972 1.8624 0.0259 -0.1114 -0.0464 4    HIS A CE1 
10   N NE2 . HIS A 4   ? 1.7086 1.6825 1.8465 0.0265 -0.1106 -0.0477 4    HIS A NE2 
11   N N   . LYS A 5   ? 1.3809 1.3144 1.5085 0.0258 -0.1001 -0.0470 5    LYS A N   
12   C CA  . LYS A 5   ? 1.1262 1.0603 1.2568 0.0253 -0.0999 -0.0468 5    LYS A CA  
13   C C   . LYS A 5   ? 1.1662 1.1014 1.2951 0.0260 -0.0990 -0.0479 5    LYS A C   
14   O O   . LYS A 5   ? 1.1524 1.1256 1.2902 0.0241 -0.1087 -0.0438 5    LYS A O   
15   C CB  . LYS A 5   ? 0.9331 0.8713 1.1140 0.0302 -0.1375 -0.0560 5    LYS A CB  
16   C CG  . LYS A 5   ? 0.9466 0.8849 1.1331 0.0294 -0.1383 -0.0553 5    LYS A CG  
17   C CD  . LYS A 5   ? 0.9044 0.8787 1.0570 0.0221 -0.1106 -0.0420 5    LYS A CD  
18   C CE  . LYS A 5   ? 0.8705 0.8052 1.0123 0.0237 -0.1003 -0.0458 5    LYS A CE  
19   N NZ  . LYS A 5   ? 0.8376 0.7790 1.0288 0.0295 -0.1363 -0.0568 5    LYS A NZ  
20   N N   . LEU A 6   ? 1.1163 1.0528 1.2478 0.0262 -0.0986 -0.0489 6    LEU A N   
21   C CA  . LEU A 6   ? 0.9589 0.8968 1.0887 0.0271 -0.0977 -0.0505 6    LEU A CA  
22   C C   . LEU A 6   ? 0.8424 0.7803 0.9727 0.0265 -0.0974 -0.0497 6    LEU A C   
23   O O   . LEU A 6   ? 0.8869 0.8639 1.0343 0.0236 -0.1071 -0.0449 6    LEU A O   
24   C CB  . LEU A 6   ? 0.9225 0.9010 1.0680 0.0256 -0.1072 -0.0483 6    LEU A CB  
25   C CG  . LEU A 6   ? 0.8370 0.7767 0.9689 0.0286 -0.0977 -0.0539 6    LEU A CG  
26   C CD1 . LEU A 6   ? 0.9677 0.9486 1.1150 0.0273 -0.1072 -0.0518 6    LEU A CD1 
27   C CD2 . LEU A 6   ? 0.6130 0.5589 0.7876 0.0365 -0.1338 -0.0674 6    LEU A CD2 
28   N N   . LEU A 7   ? 0.8463 0.8221 0.9855 0.0248 -0.1069 -0.0457 7    LEU A N   
29   C CA  . LEU A 7   ? 0.8389 0.7767 0.9656 0.0266 -0.0968 -0.0492 7    LEU A CA  
30   C C   . LEU A 7   ? 0.9854 0.9315 1.1626 0.0337 -0.1317 -0.0633 7    LEU A C   
31   O O   . LEU A 7   ? 0.9351 0.9133 1.0813 0.0239 -0.1056 -0.0455 7    LEU A O   
32   C CB  . LEU A 7   ? 1.0163 0.9538 1.1380 0.0274 -0.0967 -0.0496 7    LEU A CB  
33   C CG  . LEU A 7   ? 1.0552 1.0132 1.1775 0.0170 -0.1050 -0.0510 7    LEU A CG  
34   C CD1 . LEU A 7   ? 1.1065 1.0429 1.2208 0.0290 -0.0972 -0.0506 7    LEU A CD1 
35   C CD2 . LEU A 7   ? 1.0655 1.0180 1.1983 0.0218 -0.1141 -0.0523 7    LEU A CD2 
36   N N   . VAL A 8   ? 1.0547 1.0338 1.1955 0.0261 -0.1054 -0.0488 8    VAL A N   
37   C CA  . VAL A 8   ? 0.9266 0.8696 1.0564 0.0291 -0.0950 -0.0552 8    VAL A CA  
38   C C   . VAL A 8   ? 0.7530 0.7052 0.9364 0.0366 -0.1303 -0.0706 8    VAL A C   
39   O O   . VAL A 8   ? 0.6678 0.6505 0.8148 0.0273 -0.1052 -0.0524 8    VAL A O   
40   C CB  . VAL A 8   ? 0.7041 0.6487 0.8297 0.0310 -0.0943 -0.0578 8    VAL A CB  
41   C CG1 . VAL A 8   ? 0.6960 0.6806 0.8370 0.0290 -0.1035 -0.0549 8    VAL A CG1 
42   C CG2 . VAL A 8   ? 0.7109 0.6642 0.8343 0.0225 -0.1010 -0.0607 8    VAL A CG2 
43   N N   . THR A 9   ? 0.6190 0.5637 0.7567 0.0289 -0.0948 -0.0567 9    THR A N   
44   C CA  . THR A 9   ? 0.7541 0.6999 0.8958 0.0292 -0.0949 -0.0583 9    THR A CA  
45   C C   . THR A 9   ? 0.9360 0.9241 1.0925 0.0282 -0.1039 -0.0565 9    THR A C   
46   O O   . THR A 9   ? 1.0688 1.0574 1.2231 0.0286 -0.1033 -0.0572 9    THR A O   
47   C CB  . THR A 9   ? 0.7488 0.7344 0.9098 0.0257 -0.1047 -0.0522 9    THR A CB  
48   O OG1 . THR A 9   ? 0.7602 0.7469 0.9220 0.0257 -0.1039 -0.0526 9    THR A OG1 
49   C CG2 . THR A 9   ? 0.6800 0.6634 0.8406 0.0244 -0.1054 -0.0493 9    THR A CG2 
50   N N   . PRO A 10  ? 0.8595 0.8089 1.0035 0.0315 -0.0943 -0.0637 10   PRO A N   
51   C CA  . PRO A 10  ? 0.8051 0.7976 0.9655 0.0303 -0.1036 -0.0617 10   PRO A CA  
52   C C   . PRO A 10  ? 0.6775 0.6713 0.8395 0.0303 -0.1028 -0.0624 10   PRO A C   
53   O O   . PRO A 10  ? 0.6478 0.6415 0.8138 0.0293 -0.1029 -0.0613 10   PRO A O   
54   C CB  . PRO A 10  ? 0.7535 0.7469 0.9187 0.0303 -0.1043 -0.0627 10   PRO A CB  
55   C CG  . PRO A 10  ? 0.8223 0.7839 1.0259 0.0404 -0.1307 -0.0827 10   PRO A CG  
56   C CD  . PRO A 10  ? 0.8150 0.7632 0.9608 0.0311 -0.0952 -0.0629 10   PRO A CD  
57   N N   . PRO A 11  ? 0.6013 0.5967 0.7601 0.0315 -0.1020 -0.0644 11   PRO A N   
58   C CA  . PRO A 11  ? 0.6088 0.6056 0.7683 0.0317 -0.1012 -0.0654 11   PRO A CA  
59   C C   . PRO A 11  ? 0.5765 0.5761 0.7415 0.0321 -0.1009 -0.0678 11   PRO A C   
60   O O   . PRO A 11  ? 0.6077 0.6099 0.7740 0.0334 -0.1009 -0.0709 11   PRO A O   
61   C CB  . PRO A 11  ? 0.5787 0.5390 0.7191 0.0333 -0.0941 -0.0765 11   PRO A CB  
62   C CG  . PRO A 11  ? 0.5636 0.5219 0.6977 0.0322 -0.0934 -0.0745 11   PRO A CG  
63   C CD  . PRO A 11  ? 0.5066 0.5020 0.6601 0.0327 -0.1020 -0.0656 11   PRO A CD  
64   N N   . LYS A 12  ? 0.5270 0.4995 0.7362 0.0423 -0.1248 -0.0907 12   LYS A N   
65   C CA  . LYS A 12  ? 0.6706 0.6308 0.8278 0.0341 -0.0905 -0.0748 12   LYS A CA  
66   C C   . LYS A 12  ? 0.7043 0.6685 0.8613 0.0358 -0.0899 -0.0797 12   LYS A C   
67   O O   . LYS A 12  ? 0.6238 0.5900 0.7840 0.0369 -0.0895 -0.0825 12   LYS A O   
68   C CB  . LYS A 12  ? 0.7713 0.7451 0.9921 0.0407 -0.1243 -0.0906 12   LYS A CB  
69   C CG  . LYS A 12  ? 0.8740 0.8359 1.0376 0.0339 -0.0897 -0.0747 12   LYS A CG  
70   C CD  . LYS A 12  ? 0.9517 0.9569 1.1382 0.0301 -0.0990 -0.0697 12   LYS A CD  
71   C CE  . LYS A 12  ? 1.0383 1.0041 1.2158 0.0352 -0.0909 -0.0768 12   LYS A CE  
72   N NZ  . LYS A 12  ? 1.0182 0.9812 1.1956 0.0337 -0.0900 -0.0715 12   LYS A NZ  
73   N N   . ALA A 13  ? 0.6753 0.6427 0.8348 0.0369 -0.0941 -0.0836 13   ALA A N   
74   C CA  . ALA A 13  ? 0.4999 0.4742 0.6657 0.0405 -0.0975 -0.0914 13   ALA A CA  
75   C C   . ALA A 13  ? 0.4133 0.3893 0.5761 0.0419 -0.0961 -0.0939 13   ALA A C   
76   O O   . ALA A 13  ? 0.3993 0.3799 0.5665 0.0440 -0.0964 -0.0989 13   ALA A O   
77   C CB  . ALA A 13  ? 0.5230 0.5009 0.6919 0.0427 -0.1029 -0.0951 13   ALA A CB  
78   N N   . LEU A 14  ? 0.3629 0.3353 0.5185 0.0406 -0.0945 -0.0906 14   LEU A N   
79   C CA  . LEU A 14  ? 0.3226 0.2958 0.4753 0.0416 -0.0929 -0.0920 14   LEU A CA  
80   C C   . LEU A 14  ? 0.4440 0.4156 0.5978 0.0414 -0.0896 -0.0901 14   LEU A C   
81   O O   . LEU A 14  ? 0.5477 0.5411 0.7620 0.0534 -0.1241 -0.1167 14   LEU A O   
82   C CB  . LEU A 14  ? 0.2409 0.2105 0.3861 0.0402 -0.0918 -0.0884 14   LEU A CB  
83   C CG  . LEU A 14  ? 0.4807 0.4537 0.6265 0.0423 -0.0963 -0.0920 14   LEU A CG  
84   C CD1 . LEU A 14  ? 0.4177 0.3883 0.5571 0.0415 -0.0954 -0.0897 14   LEU A CD1 
85   C CD2 . LEU A 14  ? 0.4672 0.4484 0.6184 0.0468 -0.0996 -0.1004 14   LEU A CD2 
86   N N   . LEU A 15  ? 0.4690 0.4563 0.6866 0.0497 -0.1244 -0.1095 15   LEU A N   
87   C CA  . LEU A 15  ? 0.4542 0.4662 0.6364 0.0361 -0.1014 -0.0810 15   LEU A CA  
88   C C   . LEU A 15  ? 0.4797 0.4960 0.6664 0.0371 -0.1008 -0.0850 15   LEU A C   
89   O O   . LEU A 15  ? 0.5075 0.5252 0.6996 0.0373 -0.1015 -0.0867 15   LEU A O   
90   C CB  . LEU A 15  ? 0.4772 0.4423 0.6430 0.0374 -0.0918 -0.0843 15   LEU A CB  
91   C CG  . LEU A 15  ? 0.5165 0.4783 0.6788 0.0363 -0.0925 -0.0802 15   LEU A CG  
92   C CD1 . LEU A 15  ? 0.5927 0.5947 0.7756 0.0317 -0.1034 -0.0703 15   LEU A CD1 
93   C CD2 . LEU A 15  ? 0.3369 0.2986 0.4978 0.0371 -0.0931 -0.0810 15   LEU A CD2 
94   N N   . LYS A 16  ? 0.5039 0.4800 0.6711 0.0426 -0.0896 -0.0947 16   LYS A N   
95   C CA  . LYS A 16  ? 0.6125 0.5948 0.7874 0.0448 -0.0912 -0.1014 16   LYS A CA  
96   C C   . LYS A 16  ? 0.5856 0.5725 0.7604 0.0469 -0.0920 -0.1069 16   LYS A C   
97   O O   . LYS A 16  ? 0.5518 0.5380 0.7216 0.0470 -0.0923 -0.1062 16   LYS A O   
98   C CB  . LYS A 16  ? 0.8046 0.7913 0.9857 0.0457 -0.0941 -0.1053 16   LYS A CB  
99   C CG  . LYS A 16  ? 0.8915 0.8765 1.0770 0.0446 -0.0934 -0.1029 16   LYS A CG  
100  C CD  . LYS A 16  ? 1.0080 0.9857 1.1879 0.0419 -0.0913 -0.0946 16   LYS A CD  
101  C CE  . LYS A 16  ? 1.0704 1.0474 1.2493 0.0410 -0.0933 -0.0933 16   LYS A CE  
102  N NZ  . LYS A 16  ? 1.0643 1.0395 1.2468 0.0397 -0.0932 -0.0903 16   LYS A NZ  
103  N N   . PRO A 17  ? 0.6259 0.6179 0.8064 0.0487 -0.0923 -0.1124 17   PRO A N   
104  C CA  . PRO A 17  ? 0.5447 0.5426 0.7260 0.0511 -0.0932 -0.1186 17   PRO A CA  
105  C C   . PRO A 17  ? 0.5762 0.5824 0.7598 0.0539 -0.0964 -0.1255 17   PRO A C   
106  O O   . PRO A 17  ? 0.5215 0.5308 0.7092 0.0546 -0.0982 -0.1277 17   PRO A O   
107  C CB  . PRO A 17  ? 0.4615 0.4629 0.6491 0.0521 -0.0926 -0.1227 17   PRO A CB  
108  C CG  . PRO A 17  ? 0.6455 0.6412 0.8341 0.0501 -0.0911 -0.1172 17   PRO A CG  
109  C CD  . PRO A 17  ? 0.5532 0.5458 0.7396 0.0486 -0.0916 -0.1131 17   PRO A CD  
110  N N   . LEU A 18  ? 0.5831 0.5936 0.7642 0.0560 -0.0972 -0.1293 18   LEU A N   
111  C CA  . LEU A 18  ? 0.4599 0.4808 0.6428 0.0599 -0.1003 -0.1372 18   LEU A CA  
112  C C   . LEU A 18  ? 0.4999 0.5309 0.6899 0.0625 -0.1011 -0.1455 18   LEU A C   
113  O O   . LEU A 18  ? 0.4246 0.4579 0.6172 0.0627 -0.0996 -0.1482 18   LEU A O   
114  C CB  . LEU A 18  ? 0.5096 0.5336 0.6882 0.0618 -0.1004 -0.1397 18   LEU A CB  
115  C CG  . LEU A 18  ? 0.6142 0.6450 0.7896 0.0655 -0.1034 -0.1438 18   LEU A CG  
116  C CD1 . LEU A 18  ? 0.3920 0.4312 0.5661 0.0686 -0.1032 -0.1499 18   LEU A CD1 
117  C CD2 . LEU A 18  ? 0.5417 0.5810 0.7206 0.0688 -0.1065 -0.1494 18   LEU A CD2 
118  N N   . SER A 19  ? 0.5269 0.5645 0.7203 0.0646 -0.1035 -0.1498 19   SER A N   
119  C CA  . SER A 19  ? 0.6011 0.6507 0.8009 0.0674 -0.1042 -0.1587 19   SER A CA  
120  C C   . SER A 19  ? 0.3924 0.4559 0.5911 0.0726 -0.1070 -0.1670 19   SER A C   
121  O O   . SER A 19  ? 0.5698 0.6325 0.7664 0.0738 -0.1094 -0.1656 19   SER A O   
122  C CB  . SER A 19  ? 0.7354 0.7821 0.9412 0.0653 -0.1040 -0.1569 19   SER A CB  
123  O OG  . SER A 19  ? 0.9319 0.9854 1.1402 0.0677 -0.1068 -0.1609 19   SER A OG  
124  N N   . ILE A 20  ? 0.3476 0.4250 0.5474 0.0761 -0.1066 -0.1759 20   ILE A N   
125  C CA  . ILE A 20  ? 0.5217 0.6204 0.7174 0.0791 -0.1070 -0.1764 20   ILE A CA  
126  C C   . ILE A 20  ? 0.5315 0.6473 0.7313 0.0796 -0.1055 -0.1805 20   ILE A C   
127  O O   . ILE A 20  ? 0.5020 0.6162 0.7062 0.0810 -0.1047 -0.1907 20   ILE A O   
128  C CB  . ILE A 20  ? 0.5993 0.7046 0.7878 0.0822 -0.1069 -0.1780 20   ILE A CB  
129  C CG1 . ILE A 20  ? 0.5045 0.6084 0.6957 0.0845 -0.1061 -0.1899 20   ILE A CG1 
130  C CG2 . ILE A 20  ? 0.3338 0.4240 0.5176 0.0814 -0.1084 -0.1730 20   ILE A CG2 
131  C CD1 . ILE A 20  ? 0.6715 0.7923 0.8567 0.0878 -0.1054 -0.1922 20   ILE A CD1 
132  N N   . PRO A 21  ? 0.5168 0.6496 0.7158 0.0787 -0.1051 -0.1724 21   PRO A N   
133  C CA  . PRO A 21  ? 0.5475 0.6990 0.7499 0.0789 -0.1036 -0.1750 21   PRO A CA  
134  C C   . PRO A 21  ? 0.5489 0.7174 0.7477 0.0824 -0.1025 -0.1812 21   PRO A C   
135  O O   . PRO A 21  ? 0.5182 0.6866 0.7110 0.0847 -0.1028 -0.1807 21   PRO A O   
136  C CB  . PRO A 21  ? 0.3973 0.5622 0.5986 0.0777 -0.1036 -0.1622 21   PRO A CB  
137  C CG  . PRO A 21  ? 0.4514 0.6128 0.6463 0.0790 -0.1045 -0.1538 21   PRO A CG  
138  C CD  . PRO A 21  ? 0.4143 0.5508 0.6090 0.0780 -0.1058 -0.1595 21   PRO A CD  
139  N N   . ASN A 22  ? 0.5276 0.7102 0.7299 0.0828 -0.1011 -0.1872 22   ASN A N   
140  C CA  . ASN A 22  ? 0.6270 0.8282 0.8260 0.0860 -0.0997 -0.1932 22   ASN A CA  
141  C C   . ASN A 22  ? 0.4853 0.7100 0.6801 0.0872 -0.0990 -0.1838 22   ASN A C   
142  O O   . ASN A 22  ? 0.4066 0.6397 0.6048 0.0853 -0.0986 -0.1782 22   ASN A O   
143  C CB  . ASN A 22  ? 0.8328 1.0376 1.0380 0.0861 -0.0984 -0.2055 22   ASN A CB  
144  C CG  . ASN A 22  ? 1.0677 1.2547 1.2761 0.0875 -0.0986 -0.2165 22   ASN A CG  
145  O OD1 . ASN A 22  ? 1.1890 1.3564 1.3970 0.0872 -0.1000 -0.2147 22   ASN A OD1 
146  N ND2 . ASN A 22  ? 1.1008 1.2949 1.3129 0.0893 -0.0973 -0.2280 22   ASN A ND2 
147  N N   . ARG A 23  ? 0.3610 0.5963 0.5487 0.0906 -0.0986 -0.1815 23   ARG A N   
148  C CA  . ARG A 23  ? 0.3827 0.6411 0.5668 0.0929 -0.0975 -0.1728 23   ARG A CA  
149  C C   . ARG A 23  ? 0.4707 0.7469 0.6493 0.0969 -0.0961 -0.1788 23   ARG A C   
150  O O   . ARG A 23  ? 0.4501 0.7201 0.6253 0.0986 -0.0962 -0.1857 23   ARG A O   
151  C CB  . ARG A 23  ? 0.2994 0.5560 0.4801 0.0937 -0.0983 -0.1581 23   ARG A CB  
152  C CG  . ARG A 23  ? 0.4136 0.6463 0.5964 0.0907 -0.1001 -0.1550 23   ARG A CG  
153  C CD  . ARG A 23  ? 0.5941 0.8260 0.7813 0.0883 -0.1004 -0.1441 23   ARG A CD  
154  N NE  . ARG A 23  ? 0.8984 1.1309 1.0926 0.0850 -0.1001 -0.1496 23   ARG A NE  
155  C CZ  . ARG A 23  ? 0.9922 1.2165 1.1918 0.0815 -0.1006 -0.1446 23   ARG A CZ  
156  N NH1 . ARG A 23  ? 0.8695 1.0845 1.0683 0.0809 -0.1015 -0.1341 23   ARG A NH1 
157  N NH2 . ARG A 23  ? 1.1410 1.3669 1.3469 0.0787 -0.1001 -0.1503 23   ARG A NH2 
158  N N   . LEU A 24  ? 0.4732 0.7717 0.6508 0.0984 -0.0945 -0.1762 24   LEU A N   
159  C CA  . LEU A 24  ? 0.3781 0.6966 0.5495 0.1025 -0.0929 -0.1800 24   LEU A CA  
160  C C   . LEU A 24  ? 0.4285 0.7563 0.5938 0.1061 -0.0926 -0.1665 24   LEU A C   
161  O O   . LEU A 24  ? 0.4444 0.7826 0.6107 0.1066 -0.0921 -0.1560 24   LEU A O   
162  C CB  . LEU A 24  ? 0.3373 0.6751 0.5112 0.1022 -0.0912 -0.1852 24   LEU A CB  
163  C CG  . LEU A 24  ? 0.5082 0.8679 0.6761 0.1061 -0.0891 -0.1921 24   LEU A CG  
164  C CD1 . LEU A 24  ? 0.4418 0.7943 0.6074 0.1075 -0.0891 -0.2046 24   LEU A CD1 
165  C CD2 . LEU A 24  ? 0.5663 0.9427 0.7375 0.1049 -0.0875 -0.1979 24   LEU A CD2 
166  N N   . LEU A 25  ? 0.3725 0.6959 0.5316 0.1089 -0.0929 -0.1666 25   LEU A N   
167  C CA  . LEU A 25  ? 0.4171 0.7470 0.5703 0.1128 -0.0926 -0.1540 25   LEU A CA  
168  C C   . LEU A 25  ? 0.3951 0.7500 0.5415 0.1177 -0.0903 -0.1547 25   LEU A C   
169  O O   . LEU A 25  ? 0.4067 0.7666 0.5482 0.1198 -0.0896 -0.1639 25   LEU A O   
170  C CB  . LEU A 25  ? 0.4076 0.7200 0.5573 0.1133 -0.0939 -0.1535 25   LEU A CB  
171  C CG  . LEU A 25  ? 0.4374 0.7248 0.5931 0.1084 -0.0960 -0.1544 25   LEU A CG  
172  C CD1 . LEU A 25  ? 0.3844 0.6546 0.5368 0.1083 -0.0972 -0.1576 25   LEU A CD1 
173  C CD2 . LEU A 25  ? 0.4266 0.7098 0.5859 0.1070 -0.0966 -0.1408 25   LEU A CD2 
174  N N   . LEU A 26  ? 0.4263 0.7971 0.5727 0.1196 -0.0890 -0.1454 26   LEU A N   
175  C CA  . LEU A 26  ? 0.3133 0.7093 0.4530 0.1244 -0.0865 -0.1452 26   LEU A CA  
176  C C   . LEU A 26  ? 0.3822 0.7855 0.5177 0.1293 -0.0855 -0.1295 26   LEU A C   
177  O O   . LEU A 26  ? 0.4038 0.8279 0.5356 0.1330 -0.0833 -0.1248 26   LEU A O   
178  C CB  . LEU A 26  ? 0.4441 0.8558 0.5872 0.1227 -0.0853 -0.1504 26   LEU A CB  
179  C CG  . LEU A 26  ? 0.4740 0.8803 0.6214 0.1187 -0.0858 -0.1665 26   LEU A CG  
180  C CD1 . LEU A 26  ? 0.4455 0.8686 0.5963 0.1172 -0.0843 -0.1700 26   LEU A CD1 
181  C CD2 . LEU A 26  ? 0.2387 0.6482 0.3802 0.1211 -0.0851 -0.1781 26   LEU A CD2 
182  N N   . GLY A 27  ? 0.2746 0.6605 0.4106 0.1295 -0.0869 -0.1216 27   GLY A N   
183  C CA  . GLY A 27  ? 0.3923 0.7828 0.5232 0.1351 -0.0857 -0.1083 27   GLY A CA  
184  C C   . GLY A 27  ? 0.3351 0.7317 0.4562 0.1394 -0.0847 -0.1125 27   GLY A C   
185  O O   . GLY A 27  ? 0.4092 0.8105 0.5279 0.1384 -0.0846 -0.1253 27   GLY A O   
186  N N   . PRO A 28  ? 0.4340 0.8304 0.5498 0.1445 -0.0838 -0.1019 28   PRO A N   
187  C CA  . PRO A 28  ? 0.4763 0.8788 0.5823 0.1494 -0.0825 -0.1033 28   PRO A CA  
188  C C   . PRO A 28  ? 0.5400 0.9242 0.6458 0.1466 -0.0846 -0.1110 28   PRO A C   
189  O O   . PRO A 28  ? 0.6389 1.0255 0.7373 0.1503 -0.0838 -0.1114 28   PRO A O   
190  C CB  . PRO A 28  ? 0.3736 0.7771 0.4762 0.1551 -0.0810 -0.0877 28   PRO A CB  
191  C CG  . PRO A 28  ? 0.4244 0.8126 0.5365 0.1518 -0.0826 -0.0794 28   PRO A CG  
192  C CD  . PRO A 28  ? 0.4292 0.8206 0.5484 0.1464 -0.0835 -0.0868 28   PRO A CD  
193  N N   . GLY A 29  ? 0.5553 0.9216 0.6688 0.1403 -0.0870 -0.1168 29   GLY A N   
194  C CA  . GLY A 29  ? 0.3760 0.7234 0.4895 0.1375 -0.0889 -0.1232 29   GLY A CA  
195  C C   . GLY A 29  ? 0.5051 0.8304 0.6239 0.1343 -0.0910 -0.1157 29   GLY A C   
196  O O   . GLY A 29  ? 0.6258 0.9509 0.7468 0.1357 -0.0906 -0.1034 29   GLY A O   
197  N N   . PRO A 30  ? 0.5031 0.8095 0.6242 0.1299 -0.0930 -0.1233 30   PRO A N   
198  C CA  . PRO A 30  ? 0.5168 0.8206 0.6374 0.1279 -0.0935 -0.1383 30   PRO A CA  
199  C C   . PRO A 30  ? 0.4346 0.7462 0.5600 0.1254 -0.0931 -0.1476 30   PRO A C   
200  O O   . PRO A 30  ? 0.3738 0.6892 0.5040 0.1239 -0.0930 -0.1427 30   PRO A O   
201  C CB  . PRO A 30  ? 0.5336 0.8118 0.6574 0.1234 -0.0958 -0.1410 30   PRO A CB  
202  C CG  . PRO A 30  ? 0.6246 0.8938 0.7525 0.1217 -0.0966 -0.1291 30   PRO A CG  
203  C CD  . PRO A 30  ? 0.4985 0.7837 0.6224 0.1273 -0.0947 -0.1172 30   PRO A CD  
204  N N   . SER A 31  ? 0.3226 0.6372 0.4467 0.1253 -0.0927 -0.1608 31   SER A N   
205  C CA  . SER A 31  ? 0.3947 0.7171 0.5231 0.1234 -0.0921 -0.1710 31   SER A CA  
206  C C   . SER A 31  ? 0.3275 0.6289 0.4628 0.1187 -0.0938 -0.1808 31   SER A C   
207  O O   . SER A 31  ? 0.2665 0.5488 0.4022 0.1171 -0.0953 -0.1804 31   SER A O   
208  C CB  . SER A 31  ? 0.3697 0.7115 0.4925 0.1272 -0.0901 -0.1797 31   SER A CB  
209  O OG  . SER A 31  ? 0.4418 0.7770 0.5600 0.1289 -0.0904 -0.1836 31   SER A OG  
210  N N   . ASN A 32  ? 0.2836 0.5886 0.4243 0.1167 -0.0933 -0.1897 32   ASN A N   
211  C CA  . ASN A 32  ? 0.3973 0.6837 0.5448 0.1132 -0.0943 -0.2003 32   ASN A CA  
212  C C   . ASN A 32  ? 0.3371 0.6188 0.4829 0.1148 -0.0941 -0.2115 32   ASN A C   
213  O O   . ASN A 32  ? 0.3211 0.6197 0.4617 0.1182 -0.0926 -0.2154 32   ASN A O   
214  C CB  . ASN A 32  ? 0.4142 0.7077 0.5680 0.1113 -0.0935 -0.2069 32   ASN A CB  
215  C CG  . ASN A 32  ? 0.3631 0.6502 0.5221 0.1079 -0.0944 -0.1985 32   ASN A CG  
216  O OD1 . ASN A 32  ? 0.4034 0.7063 0.5625 0.1082 -0.0935 -0.1928 32   ASN A OD1 
217  N ND2 . ASN A 32  ? 0.3154 0.5793 0.4787 0.1048 -0.0962 -0.1976 32   ASN A ND2 
218  N N   . LEU A 33  ? 0.3114 0.5704 0.4619 0.1124 -0.0956 -0.2164 33   LEU A N   
219  C CA  . LEU A 33  ? 0.3610 0.6130 0.5114 0.1138 -0.0955 -0.2268 33   LEU A CA  
220  C C   . LEU A 33  ? 0.4030 0.6550 0.5605 0.1135 -0.0946 -0.2406 33   LEU A C   
221  O O   . LEU A 33  ? 0.3986 0.6407 0.5635 0.1109 -0.0950 -0.2427 33   LEU A O   
222  C CB  . LEU A 33  ? 0.2834 0.5103 0.4355 0.1118 -0.0974 -0.2248 33   LEU A CB  
223  C CG  . LEU A 33  ? 0.3722 0.5935 0.5200 0.1108 -0.0986 -0.2110 33   LEU A CG  
224  C CD1 . LEU A 33  ? 0.3386 0.5335 0.4892 0.1081 -0.1004 -0.2107 33   LEU A CD1 
225  C CD2 . LEU A 33  ? 0.2605 0.4974 0.3990 0.1146 -0.0977 -0.2052 33   LEU A CD2 
226  N N   . PRO A 34  ? 0.3345 0.5970 0.4907 0.1155 -0.0932 -0.2478 34   PRO A N   
227  C CA  . PRO A 34  ? 0.3638 0.6248 0.5286 0.1124 -0.0921 -0.2525 34   PRO A CA  
228  C C   . PRO A 34  ? 0.4288 0.6646 0.6010 0.1077 -0.0930 -0.2481 34   PRO A C   
229  O O   . PRO A 34  ? 0.3612 0.5833 0.5307 0.1069 -0.0942 -0.2418 34   PRO A O   
230  C CB  . PRO A 34  ? 0.3576 0.6374 0.5176 0.1153 -0.0905 -0.2573 34   PRO A CB  
231  C CG  . PRO A 34  ? 0.3855 0.6675 0.5363 0.1185 -0.0910 -0.2531 34   PRO A CG  
232  C CD  . PRO A 34  ? 0.2305 0.5071 0.3772 0.1198 -0.0924 -0.2480 34   PRO A CD  
233  N N   . PRO A 35  ? 0.3195 0.5502 0.5004 0.1047 -0.0923 -0.2509 35   PRO A N   
234  C CA  . PRO A 35  ? 0.4408 0.6493 0.6283 0.1005 -0.0928 -0.2459 35   PRO A CA  
235  C C   . PRO A 35  ? 0.3899 0.5901 0.5743 0.1002 -0.0931 -0.2422 35   PRO A C   
236  O O   . PRO A 35  ? 0.4918 0.6733 0.6772 0.0974 -0.0939 -0.2349 35   PRO A O   
237  C CB  . PRO A 35  ? 0.4964 0.7086 0.6918 0.0991 -0.0916 -0.2518 35   PRO A CB  
238  C CG  . PRO A 35  ? 0.3783 0.6089 0.5732 0.1012 -0.0909 -0.2581 35   PRO A CG  
239  C CD  . PRO A 35  ? 0.4246 0.6711 0.6093 0.1053 -0.0909 -0.2587 35   PRO A CD  
240  N N   . ARG A 36  ? 0.4317 0.6458 0.6125 0.1028 -0.0923 -0.2468 36   ARG A N   
241  C CA  . ARG A 36  ? 0.3847 0.5915 0.5635 0.1024 -0.0924 -0.2439 36   ARG A CA  
242  C C   . ARG A 36  ? 0.4124 0.6107 0.5845 0.1029 -0.0936 -0.2371 36   ARG A C   
243  O O   . ARG A 36  ? 0.3196 0.5021 0.4922 0.1005 -0.0941 -0.2313 36   ARG A O   
244  C CB  . ARG A 36  ? 0.5328 0.7580 0.7084 0.1055 -0.0913 -0.2505 36   ARG A CB  
245  C CG  . ARG A 36  ? 0.5680 0.7867 0.7489 0.1036 -0.0908 -0.2518 36   ARG A CG  
246  C CD  . ARG A 36  ? 0.4999 0.7375 0.6782 0.1065 -0.0897 -0.2586 36   ARG A CD  
247  N NE  . ARG A 36  ? 0.4402 0.6750 0.6143 0.1072 -0.0898 -0.2562 36   ARG A NE  
248  C CZ  . ARG A 36  ? 0.5038 0.7528 0.6756 0.1094 -0.0889 -0.2611 36   ARG A CZ  
249  N NH1 . ARG A 36  ? 0.3949 0.6615 0.5680 0.1109 -0.0877 -0.2684 36   ARG A NH1 
250  N NH2 . ARG A 36  ? 0.3157 0.5615 0.4839 0.1099 -0.0891 -0.2587 36   ARG A NH2 
251  N N   . ILE A 37  ? 0.2882 0.4981 0.4537 0.1063 -0.0940 -0.2377 37   ILE A N   
252  C CA  . ILE A 37  ? 0.3624 0.5663 0.5211 0.1074 -0.0953 -0.2319 37   ILE A CA  
253  C C   . ILE A 37  ? 0.4022 0.5843 0.5648 0.1033 -0.0965 -0.2246 37   ILE A C   
254  O O   . ILE A 37  ? 0.4322 0.6005 0.5927 0.1016 -0.0973 -0.2183 37   ILE A O   
255  C CB  . ILE A 37  ? 0.3696 0.5934 0.5198 0.1128 -0.0952 -0.2345 37   ILE A CB  
256  C CG1 . ILE A 37  ? 0.4156 0.6603 0.5609 0.1165 -0.0936 -0.2400 37   ILE A CG1 
257  C CG2 . ILE A 37  ? 0.3416 0.5588 0.4851 0.1144 -0.0967 -0.2285 37   ILE A CG2 
258  C CD1 . ILE A 37  ? 0.5727 0.8393 0.7075 0.1224 -0.0929 -0.2409 37   ILE A CD1 
259  N N   . MET A 38  ? 0.3554 0.5346 0.5237 0.1014 -0.0965 -0.2253 38   MET A N   
260  C CA  . MET A 38  ? 0.4261 0.5852 0.5987 0.0971 -0.0973 -0.2181 38   MET A CA  
261  C C   . MET A 38  ? 0.4803 0.6230 0.6566 0.0930 -0.0967 -0.2132 38   MET A C   
262  O O   . MET A 38  ? 0.4851 0.6119 0.6605 0.0901 -0.0971 -0.2054 38   MET A O   
263  C CB  . MET A 38  ? 0.3665 0.5269 0.5452 0.0958 -0.0971 -0.2204 38   MET A CB  
264  C CG  . MET A 38  ? 0.3804 0.5517 0.5557 0.0988 -0.0979 -0.2225 38   MET A CG  
265  S SD  . MET A 38  ? 0.5820 0.7596 0.7649 0.0978 -0.0972 -0.2276 38   MET A SD  
266  C CE  . MET A 38  ? 1.3912 1.5434 1.5813 0.0919 -0.0975 -0.2192 38   MET A CE  
267  N N   . ALA A 39  ? 0.3973 0.5450 0.5775 0.0931 -0.0955 -0.2179 39   ALA A N   
268  C CA  . ALA A 39  ? 0.5499 0.6841 0.7337 0.0898 -0.0949 -0.2139 39   ALA A CA  
269  C C   . ALA A 39  ? 0.4335 0.5612 0.6119 0.0896 -0.0952 -0.2092 39   ALA A C   
270  O O   . ALA A 39  ? 0.3162 0.4284 0.4951 0.0864 -0.0950 -0.2019 39   ALA A O   
271  C CB  . ALA A 39  ? 0.2188 0.3616 0.4078 0.0905 -0.0939 -0.2208 39   ALA A CB  
272  N N   . ALA A 40  ? 0.2447 0.3857 0.4176 0.0933 -0.0954 -0.2135 40   ALA A N   
273  C CA  . ALA A 40  ? 0.3294 0.4667 0.4967 0.0938 -0.0957 -0.2099 40   ALA A CA  
274  C C   . ALA A 40  ? 0.3504 0.4752 0.5143 0.0921 -0.0967 -0.2022 40   ALA A C   
275  O O   . ALA A 40  ? 0.3118 0.4249 0.4736 0.0899 -0.0967 -0.1962 40   ALA A O   
276  C CB  . ALA A 40  ? 0.2359 0.3919 0.3970 0.0988 -0.0957 -0.2159 40   ALA A CB  
277  N N   . GLY A 41  ? 0.2459 0.3735 0.4093 0.0929 -0.0975 -0.2025 41   GLY A N   
278  C CA  . GLY A 41  ? 0.2287 0.3460 0.3890 0.0916 -0.0987 -0.1959 41   GLY A CA  
279  C C   . GLY A 41  ? 0.3513 0.4492 0.5151 0.0862 -0.0981 -0.1876 41   GLY A C   
280  O O   . GLY A 41  ? 0.3682 0.4553 0.5287 0.0842 -0.0985 -0.1808 41   GLY A O   
281  N N   . GLY A 42  ? 0.3394 0.4337 0.5092 0.0839 -0.0968 -0.1882 42   GLY A N   
282  C CA  . GLY A 42  ? 0.2464 0.3246 0.4190 0.0793 -0.0959 -0.1805 42   GLY A CA  
283  C C   . GLY A 42  ? 0.2842 0.3539 0.4563 0.0772 -0.0948 -0.1764 42   GLY A C   
284  O O   . GLY A 42  ? 0.3657 0.4240 0.5397 0.0738 -0.0937 -0.1705 42   GLY A O   
285  N N   . LEU A 43  ? 0.3438 0.4195 0.5129 0.0793 -0.0950 -0.1794 43   LEU A N   
286  C CA  . LEU A 43  ? 0.3311 0.4007 0.5006 0.0777 -0.0940 -0.1769 43   LEU A CA  
287  C C   . LEU A 43  ? 0.4066 0.4643 0.5711 0.0751 -0.0936 -0.1685 43   LEU A C   
288  O O   . LEU A 43  ? 0.4418 0.4971 0.6021 0.0749 -0.0943 -0.1653 43   LEU A O   
289  C CB  . LEU A 43  ? 0.2851 0.3668 0.4540 0.0811 -0.0942 -0.1840 43   LEU A CB  
290  C CG  . LEU A 43  ? 0.4578 0.5521 0.6316 0.0834 -0.0941 -0.1928 43   LEU A CG  
291  C CD1 . LEU A 43  ? 0.4086 0.5169 0.5795 0.0871 -0.0943 -0.1994 43   LEU A CD1 
292  C CD2 . LEU A 43  ? 0.4230 0.5110 0.6034 0.0812 -0.0931 -0.1923 43   LEU A CD2 
293  N N   . GLN A 44  ? 0.3863 0.4373 0.5513 0.0733 -0.0926 -0.1654 44   GLN A N   
294  C CA  . GLN A 44  ? 0.3345 0.3752 0.4949 0.0708 -0.0918 -0.1578 44   GLN A CA  
295  C C   . GLN A 44  ? 0.4035 0.4492 0.5591 0.0729 -0.0926 -0.1596 44   GLN A C   
296  O O   . GLN A 44  ? 0.4999 0.5573 0.6558 0.0764 -0.0935 -0.1669 44   GLN A O   
297  C CB  . GLN A 44  ? 0.2780 0.3103 0.4411 0.0682 -0.0904 -0.1538 44   GLN A CB  
298  C CG  . GLN A 44  ? 0.2627 0.2862 0.4243 0.0662 -0.0909 -0.1473 44   GLN A CG  
299  C CD  . GLN A 44  ? 0.5118 0.5289 0.6707 0.0642 -0.0911 -0.1413 44   GLN A CD  
300  O OE1 . GLN A 44  ? 0.5501 0.5665 0.7025 0.0644 -0.0903 -0.1386 44   GLN A OE1 
301  N NE2 . GLN A 44  ? 0.4436 0.4562 0.6076 0.0625 -0.0922 -0.1392 44   GLN A NE2 
302  N N   . MET A 45  ? 0.3268 0.3643 0.4775 0.0709 -0.0922 -0.1531 45   MET A N   
303  C CA  . MET A 45  ? 0.3400 0.3811 0.4857 0.0727 -0.0930 -0.1540 45   MET A CA  
304  C C   . MET A 45  ? 0.4524 0.4938 0.5988 0.0728 -0.0923 -0.1550 45   MET A C   
305  O O   . MET A 45  ? 0.3970 0.4307 0.5458 0.0702 -0.0910 -0.1513 45   MET A O   
306  C CB  . MET A 45  ? 0.3590 0.3907 0.4996 0.0702 -0.0927 -0.1465 45   MET A CB  
307  C CG  . MET A 45  ? 0.3576 0.3910 0.4957 0.0712 -0.0941 -0.1463 45   MET A CG  
308  S SD  . MET A 45  ? 0.3632 0.4107 0.4972 0.0771 -0.0965 -0.1537 45   MET A SD  
309  C CE  . MET A 45  ? 0.4269 0.4721 0.5567 0.0771 -0.0961 -0.1517 45   MET A CE  
310  N N   . ILE A 46  ? 0.4445 0.4949 0.5883 0.0762 -0.0933 -0.1599 46   ILE A N   
311  C CA  . ILE A 46  ? 0.4256 0.4753 0.5686 0.0761 -0.0928 -0.1598 46   ILE A CA  
312  C C   . ILE A 46  ? 0.4883 0.5375 0.6249 0.0769 -0.0934 -0.1574 46   ILE A C   
313  O O   . ILE A 46  ? 0.3851 0.4346 0.5183 0.0776 -0.0942 -0.1562 46   ILE A O   
314  C CB  . ILE A 46  ? 0.3683 0.4305 0.5140 0.0796 -0.0932 -0.1681 46   ILE A CB  
315  C CG1 . ILE A 46  ? 0.2308 0.3070 0.3728 0.0842 -0.0944 -0.1743 46   ILE A CG1 
316  C CG2 . ILE A 46  ? 0.3214 0.3842 0.4738 0.0789 -0.0926 -0.1709 46   ILE A CG2 
317  C CD1 . ILE A 46  ? 0.3715 0.4620 0.5151 0.0879 -0.0943 -0.1827 46   ILE A CD1 
318  N N   . GLY A 47  ? 0.4747 0.5236 0.6098 0.0771 -0.0930 -0.1572 47   GLY A N   
319  C CA  . GLY A 47  ? 0.3120 0.3602 0.4411 0.0779 -0.0936 -0.1550 47   GLY A CA  
320  C C   . GLY A 47  ? 0.5239 0.5856 0.6490 0.0832 -0.0951 -0.1612 47   GLY A C   
321  O O   . GLY A 47  ? 0.4768 0.5501 0.6029 0.0866 -0.0953 -0.1679 47   GLY A O   
322  N N   . HIS A 48  ? 0.5008 0.5618 0.6208 0.0842 -0.0961 -0.1591 48   HIS A N   
323  C CA  . HIS A 48  ? 0.5572 0.6321 0.6725 0.0900 -0.0976 -0.1647 48   HIS A CA  
324  C C   . HIS A 48  ? 0.5743 0.6590 0.6862 0.0937 -0.0975 -0.1687 48   HIS A C   
325  O O   . HIS A 48  ? 0.5286 0.6279 0.6364 0.0991 -0.0981 -0.1742 48   HIS A O   
326  C CB  . HIS A 48  ? 0.3878 0.4596 0.4982 0.0909 -0.0990 -0.1615 48   HIS A CB  
327  C CG  . HIS A 48  ? 0.3932 0.4556 0.5004 0.0886 -0.0988 -0.1559 48   HIS A CG  
328  N ND1 . HIS A 48  ? 0.5598 0.6278 0.6605 0.0926 -0.1000 -0.1571 48   HIS A ND1 
329  C CD2 . HIS A 48  ? 0.4320 0.4807 0.5412 0.0829 -0.0974 -0.1492 48   HIS A CD2 
330  C CE1 . HIS A 48  ? 0.7264 0.7839 0.8259 0.0892 -0.0995 -0.1516 48   HIS A CE1 
331  N NE2 . HIS A 48  ? 0.5830 0.6290 0.6874 0.0833 -0.0978 -0.1467 48   HIS A NE2 
332  N N   . MET A 49  ? 0.4975 0.5750 0.6106 0.0910 -0.0966 -0.1659 49   MET A N   
333  C CA  . MET A 49  ? 0.5139 0.6006 0.6246 0.0941 -0.0964 -0.1699 49   MET A CA  
334  C C   . MET A 49  ? 0.5268 0.6123 0.6434 0.0921 -0.0953 -0.1717 49   MET A C   
335  O O   . MET A 49  ? 0.4660 0.5551 0.5820 0.0931 -0.0949 -0.1734 49   MET A O   
336  C CB  . MET A 49  ? 0.5325 0.6151 0.6379 0.0943 -0.0967 -0.1663 49   MET A CB  
337  C CG  . MET A 49  ? 0.6182 0.7044 0.7174 0.0976 -0.0981 -0.1658 49   MET A CG  
338  S SD  . MET A 49  ? 0.6891 0.7706 0.7820 0.0982 -0.0987 -0.1618 49   MET A SD  
339  C CE  . MET A 49  ? 0.3546 0.4476 0.4456 0.1017 -0.0978 -0.1666 49   MET A CE  
340  N N   . SER A 50  ? 0.4926 0.5737 0.6151 0.0895 -0.0948 -0.1714 50   SER A N   
341  C CA  . SER A 50  ? 0.6178 0.6977 0.7464 0.0878 -0.0939 -0.1732 50   SER A CA  
342  C C   . SER A 50  ? 0.5655 0.6614 0.6947 0.0921 -0.0940 -0.1816 50   SER A C   
343  O O   . SER A 50  ? 0.4887 0.5963 0.6147 0.0958 -0.0945 -0.1858 50   SER A O   
344  C CB  . SER A 50  ? 0.4808 0.5527 0.6151 0.0845 -0.0934 -0.1708 50   SER A CB  
345  O OG  . SER A 50  ? 0.5986 0.6782 0.7333 0.0866 -0.0940 -0.1747 50   SER A OG  
346  N N   . LYS A 51  ? 0.4912 0.5881 0.6243 0.0916 -0.0934 -0.1839 51   LYS A N   
347  C CA  . LYS A 51  ? 0.5604 0.6725 0.6945 0.0951 -0.0932 -0.1918 51   LYS A CA  
348  C C   . LYS A 51  ? 0.4194 0.5394 0.5565 0.0964 -0.0932 -0.1966 51   LYS A C   
349  O O   . LYS A 51  ? 0.4440 0.5799 0.5789 0.1003 -0.0931 -0.2028 51   LYS A O   
350  C CB  . LYS A 51  ? 0.8367 0.9460 0.9758 0.0936 -0.0928 -0.1929 51   LYS A CB  
351  C CG  . LYS A 51  ? 1.0501 1.1656 1.1958 0.0940 -0.0924 -0.1988 51   LYS A CG  
352  C CD  . LYS A 51  ? 1.1812 1.3114 1.3263 0.0974 -0.0921 -0.2058 51   LYS A CD  
353  C CE  . LYS A 51  ? 1.2248 1.3657 1.3747 0.0988 -0.0918 -0.2129 51   LYS A CE  
354  N NZ  . LYS A 51  ? 1.2325 1.3845 1.3843 0.1007 -0.0913 -0.2192 51   LYS A NZ  
355  N N   . GLU A 52  ? 0.4670 0.5769 0.6087 0.0931 -0.0932 -0.1934 52   GLU A N   
356  C CA  . GLU A 52  ? 0.4715 0.5878 0.6162 0.0941 -0.0932 -0.1975 52   GLU A CA  
357  C C   . GLU A 52  ? 0.5283 0.6534 0.6671 0.0971 -0.0938 -0.1987 52   GLU A C   
358  O O   . GLU A 52  ? 0.5904 0.7296 0.7289 0.1002 -0.0937 -0.2048 52   GLU A O   
359  C CB  . GLU A 52  ? 0.5342 0.6373 0.6848 0.0900 -0.0930 -0.1932 52   GLU A CB  
360  C CG  . GLU A 52  ? 0.6057 0.7027 0.7627 0.0878 -0.0925 -0.1931 52   GLU A CG  
361  C CD  . GLU A 52  ? 0.7553 0.8397 0.9110 0.0850 -0.0922 -0.1861 52   GLU A CD  
362  O OE1 . GLU A 52  ? 0.6840 0.7638 0.8340 0.0845 -0.0924 -0.1813 52   GLU A OE1 
363  O OE2 . GLU A 52  ? 0.7453 0.8248 0.9057 0.0835 -0.0919 -0.1856 52   GLU A OE2 
364  N N   . MET A 53  ? 0.4794 0.5966 0.6135 0.0963 -0.0944 -0.1930 53   MET A N   
365  C CA  . MET A 53  ? 0.3944 0.5193 0.5225 0.0996 -0.0952 -0.1936 53   MET A CA  
366  C C   . MET A 53  ? 0.3696 0.5131 0.4918 0.1051 -0.0950 -0.1992 53   MET A C   
367  O O   . MET A 53  ? 0.3377 0.4945 0.4568 0.1088 -0.0950 -0.2030 53   MET A O   
368  C CB  . MET A 53  ? 0.3323 0.4454 0.4564 0.0979 -0.0959 -0.1865 53   MET A CB  
369  C CG  . MET A 53  ? 0.3095 0.4289 0.4281 0.1011 -0.0969 -0.1868 53   MET A CG  
370  S SD  . MET A 53  ? 0.5016 0.6168 0.6254 0.0989 -0.0972 -0.1864 53   MET A SD  
371  C CE  . MET A 53  ? 0.3689 0.5072 0.4893 0.1054 -0.0973 -0.1948 53   MET A CE  
372  N N   . TYR A 54  ? 0.3205 0.4654 0.4406 0.1058 -0.0946 -0.1993 54   TYR A N   
373  C CA  . TYR A 54  ? 0.4330 0.5960 0.5471 0.1110 -0.0941 -0.2042 54   TYR A CA  
374  C C   . TYR A 54  ? 0.4772 0.6545 0.5944 0.1128 -0.0932 -0.2112 54   TYR A C   
375  O O   . TYR A 54  ? 0.4147 0.6099 0.5266 0.1174 -0.0926 -0.2152 54   TYR A O   
376  C CB  . TYR A 54  ? 0.3754 0.5361 0.4881 0.1108 -0.0938 -0.2031 54   TYR A CB  
377  C CG  . TYR A 54  ? 0.4355 0.5847 0.5442 0.1096 -0.0945 -0.1968 54   TYR A CG  
378  C CD1 . TYR A 54  ? 0.5706 0.7177 0.6744 0.1109 -0.0954 -0.1935 54   TYR A CD1 
379  C CD2 . TYR A 54  ? 0.4576 0.5985 0.5674 0.1073 -0.0943 -0.1943 54   TYR A CD2 
380  C CE1 . TYR A 54  ? 0.5894 0.7259 0.6897 0.1097 -0.0960 -0.1879 54   TYR A CE1 
381  C CE2 . TYR A 54  ? 0.5598 0.6906 0.6661 0.1061 -0.0948 -0.1886 54   TYR A CE2 
382  C CZ  . TYR A 54  ? 0.5859 0.7144 0.6875 0.1072 -0.0957 -0.1855 54   TYR A CZ  
383  O OH  . TYR A 54  ? 0.5556 0.6742 0.6538 0.1059 -0.0962 -0.1802 54   TYR A OH  
384  N N   . GLN A 55  ? 0.4820 0.6522 0.6076 0.1092 -0.0929 -0.2126 55   GLN A N   
385  C CA  . GLN A 55  ? 0.4150 0.5980 0.5444 0.1105 -0.0921 -0.2195 55   GLN A CA  
386  C C   . GLN A 55  ? 0.4542 0.6455 0.5820 0.1124 -0.0922 -0.2214 55   GLN A C   
387  O O   . GLN A 55  ? 0.4157 0.6253 0.5399 0.1162 -0.0915 -0.2263 55   GLN A O   
388  C CB  . GLN A 55  ? 0.4075 0.5801 0.5464 0.1065 -0.0920 -0.2201 55   GLN A CB  
389  C CG  . GLN A 55  ? 0.6480 0.8317 0.7920 0.1073 -0.0913 -0.2272 55   GLN A CG  
390  C CD  . GLN A 55  ? 0.9717 1.1747 1.1127 0.1110 -0.0904 -0.2338 55   GLN A CD  
391  O OE1 . GLN A 55  ? 0.9969 1.2156 1.1364 0.1136 -0.0898 -0.2388 55   GLN A OE1 
392  N NE2 . GLN A 55  ? 1.0456 1.2481 1.1857 0.1112 -0.0902 -0.2336 55   GLN A NE2 
393  N N   . ILE A 56  ? 0.4665 0.6449 0.5965 0.1097 -0.0930 -0.2169 56   ILE A N   
394  C CA  . ILE A 56  ? 0.4336 0.6187 0.5625 0.1113 -0.0933 -0.2184 56   ILE A CA  
395  C C   . ILE A 56  ? 0.3805 0.5810 0.4995 0.1167 -0.0932 -0.2191 56   ILE A C   
396  O O   . ILE A 56  ? 0.3872 0.6041 0.5036 0.1200 -0.0926 -0.2233 56   ILE A O   
397  C CB  . ILE A 56  ? 0.4740 0.6415 0.6061 0.1074 -0.0942 -0.2125 56   ILE A CB  
398  C CG1 . ILE A 56  ? 0.3472 0.5030 0.4887 0.1029 -0.0939 -0.2121 56   ILE A CG1 
399  C CG2 . ILE A 56  ? 0.3573 0.5323 0.4866 0.1098 -0.0947 -0.2135 56   ILE A CG2 
400  C CD1 . ILE A 56  ? 0.3714 0.5076 0.5157 0.0984 -0.0944 -0.2046 56   ILE A CD1 
401  N N   . MET A 57  ? 0.3999 0.5961 0.5132 0.1177 -0.0937 -0.2149 57   MET A N   
402  C CA  . MET A 57  ? 0.2867 0.4967 0.3897 0.1233 -0.0935 -0.2144 57   MET A CA  
403  C C   . MET A 57  ? 0.2359 0.4672 0.3349 0.1275 -0.0919 -0.2195 57   MET A C   
404  O O   . MET A 57  ? 0.3179 0.5669 0.4096 0.1325 -0.0911 -0.2207 57   MET A O   
405  C CB  . MET A 57  ? 0.2679 0.4678 0.3661 0.1233 -0.0943 -0.2088 57   MET A CB  
406  C CG  . MET A 57  ? 0.3725 0.5545 0.4722 0.1202 -0.0959 -0.2030 57   MET A CG  
407  S SD  . MET A 57  ? 0.4176 0.5852 0.5143 0.1184 -0.0966 -0.1970 57   MET A SD  
408  C CE  . MET A 57  ? 0.4606 0.6469 0.5446 0.1265 -0.0962 -0.1976 57   MET A CE  
409  N N   . ASP A 58  ? 0.5153 0.7454 0.6186 0.1256 -0.0914 -0.2220 58   ASP A N   
410  C CA  . ASP A 58  ? 0.4625 0.7121 0.5626 0.1290 -0.0898 -0.2269 58   ASP A CA  
411  C C   . ASP A 58  ? 0.4952 0.7592 0.5972 0.1303 -0.0889 -0.2322 58   ASP A C   
412  O O   . ASP A 58  ? 0.5268 0.8113 0.6229 0.1346 -0.0876 -0.2347 58   ASP A O   
413  C CB  . ASP A 58  ? 0.4774 0.7216 0.5829 0.1264 -0.0896 -0.2289 58   ASP A CB  
414  C CG  . ASP A 58  ? 0.5067 0.7434 0.6081 0.1266 -0.0899 -0.2245 58   ASP A CG  
415  O OD1 . ASP A 58  ? 0.4326 0.6730 0.5258 0.1299 -0.0901 -0.2210 58   ASP A OD1 
416  O OD2 . ASP A 58  ? 0.5038 0.7314 0.6101 0.1236 -0.0901 -0.2246 58   ASP A OD2 
417  N N   . GLU A 59  ? 0.4275 0.6813 0.5377 0.1265 -0.0896 -0.2334 59   GLU A N   
418  C CA  . GLU A 59  ? 0.4225 0.6891 0.5354 0.1272 -0.0888 -0.2387 59   GLU A CA  
419  C C   . GLU A 59  ? 0.2946 0.5731 0.4000 0.1311 -0.0885 -0.2372 59   GLU A C   
420  O O   . GLU A 59  ? 0.3979 0.6961 0.4999 0.1343 -0.0872 -0.2407 59   GLU A O   
421  C CB  . GLU A 59  ? 0.4857 0.7375 0.6092 0.1222 -0.0894 -0.2398 59   GLU A CB  
422  C CG  . GLU A 59  ? 0.4856 0.7282 0.6165 0.1190 -0.0894 -0.2414 59   GLU A CG  
423  C CD  . GLU A 59  ? 0.5785 0.8099 0.7194 0.1150 -0.0897 -0.2428 59   GLU A CD  
424  O OE1 . GLU A 59  ? 0.5671 0.8008 0.7094 0.1149 -0.0898 -0.2438 59   GLU A OE1 
425  O OE2 . GLU A 59  ? 0.6124 0.8335 0.7596 0.1121 -0.0898 -0.2428 59   GLU A OE2 
426  N N   . ILE A 60  ? 0.2927 0.5599 0.3952 0.1310 -0.0898 -0.2316 60   ILE A N   
427  C CA  . ILE A 60  ? 0.3244 0.6016 0.4199 0.1349 -0.0897 -0.2296 60   ILE A CA  
428  C C   . ILE A 60  ? 0.3750 0.6734 0.4598 0.1410 -0.0881 -0.2291 60   ILE A C   
429  O O   . ILE A 60  ? 0.4071 0.7240 0.4866 0.1449 -0.0868 -0.2299 60   ILE A O   
430  C CB  . ILE A 60  ? 0.3457 0.6050 0.4406 0.1335 -0.0915 -0.2237 60   ILE A CB  
431  C CG1 . ILE A 60  ? 0.3275 0.5713 0.4324 0.1282 -0.0926 -0.2242 60   ILE A CG1 
432  C CG2 . ILE A 60  ? 0.2407 0.5120 0.3259 0.1389 -0.0913 -0.2208 60   ILE A CG2 
433  C CD1 . ILE A 60  ? 0.4123 0.6346 0.5190 0.1249 -0.0944 -0.2182 60   ILE A CD1 
434  N N   . LYS A 61  ? 0.3499 0.6460 0.4315 0.1418 -0.0879 -0.2271 61   LYS A N   
435  C CA  . LYS A 61  ? 0.4697 0.7852 0.5414 0.1474 -0.0862 -0.2261 61   LYS A CA  
436  C C   . LYS A 61  ? 0.4408 0.7770 0.5127 0.1489 -0.0844 -0.2314 61   LYS A C   
437  O O   . LYS A 61  ? 0.3705 0.7265 0.4346 0.1538 -0.0828 -0.2301 61   LYS A O   
438  C CB  . LYS A 61  ? 0.5801 0.8878 0.6507 0.1468 -0.0865 -0.2242 61   LYS A CB  
439  C CG  . LYS A 61  ? 0.7527 1.0693 0.8119 0.1525 -0.0857 -0.2189 61   LYS A CG  
440  C CD  . LYS A 61  ? 0.7907 1.0927 0.8496 0.1510 -0.0866 -0.2159 61   LYS A CD  
441  C CE  . LYS A 61  ? 0.6567 0.9574 0.7210 0.1481 -0.0863 -0.2198 61   LYS A CE  
442  N NZ  . LYS A 61  ? 0.5977 0.8918 0.6586 0.1486 -0.0865 -0.2166 61   LYS A NZ  
443  N N   . GLU A 62  ? 0.2590 0.5911 0.3397 0.1449 -0.0845 -0.2369 62   GLU A N   
444  C CA  . GLU A 62  ? 0.4149 0.7653 0.4972 0.1457 -0.0830 -0.2428 62   GLU A CA  
445  C C   . GLU A 62  ? 0.3840 0.7447 0.4653 0.1470 -0.0824 -0.2437 62   GLU A C   
446  O O   . GLU A 62  ? 0.3972 0.7795 0.4733 0.1505 -0.0807 -0.2450 62   GLU A O   
447  C CB  . GLU A 62  ? 0.4614 0.8025 0.5547 0.1408 -0.0834 -0.2486 62   GLU A CB  
448  C CG  . GLU A 62  ? 0.5522 0.8859 0.6473 0.1394 -0.0836 -0.2488 62   GLU A CG  
449  C CD  . GLU A 62  ? 0.7107 1.0363 0.8167 0.1350 -0.0839 -0.2542 62   GLU A CD  
450  O OE1 . GLU A 62  ? 0.8909 1.2266 1.0007 0.1347 -0.0832 -0.2597 62   GLU A OE1 
451  O OE2 . GLU A 62  ? 0.8029 1.1124 0.9135 0.1321 -0.0848 -0.2529 62   GLU A OE2 
452  N N   . GLY A 63  ? 0.3684 0.7137 0.4546 0.1441 -0.0839 -0.2425 63   GLY A N   
453  C CA  . GLY A 63  ? 0.3738 0.7275 0.4594 0.1452 -0.0836 -0.2432 63   GLY A CA  
454  C C   . GLY A 63  ? 0.2638 0.6348 0.3376 0.1512 -0.0823 -0.2383 63   GLY A C   
455  O O   . GLY A 63  ? 0.3060 0.6954 0.3767 0.1536 -0.0808 -0.2396 63   GLY A O   
456  N N   . ILE A 64  ? 0.3314 0.6966 0.3984 0.1537 -0.0828 -0.2321 64   ILE A N   
457  C CA  . ILE A 64  ? 0.3174 0.6982 0.3728 0.1601 -0.0813 -0.2261 64   ILE A CA  
458  C C   . ILE A 64  ? 0.4922 0.8964 0.5409 0.1642 -0.0788 -0.2262 64   ILE A C   
459  O O   . ILE A 64  ? 0.3805 0.8044 0.4210 0.1692 -0.0768 -0.2225 64   ILE A O   
460  C CB  . ILE A 64  ? 0.5470 0.9157 0.5966 0.1622 -0.0823 -0.2194 64   ILE A CB  
461  C CG1 . ILE A 64  ? 0.4802 0.8236 0.5370 0.1574 -0.0850 -0.2192 64   ILE A CG1 
462  C CG2 . ILE A 64  ? 0.2674 0.6514 0.3067 0.1682 -0.0806 -0.2099 64   ILE A CG2 
463  C CD1 . ILE A 64  ? 0.3684 0.6960 0.4223 0.1576 -0.0864 -0.2129 64   ILE A CD1 
464  N N   . GLN A 65  ? 0.4914 0.8933 0.5437 0.1621 -0.0789 -0.2298 65   GLN A N   
465  C CA  . GLN A 65  ? 0.4632 0.8862 0.5102 0.1655 -0.0768 -0.2304 65   GLN A CA  
466  C C   . GLN A 65  ? 0.5234 0.9633 0.5729 0.1651 -0.0755 -0.2353 65   GLN A C   
467  O O   . GLN A 65  ? 0.4315 0.8934 0.4737 0.1695 -0.0734 -0.2330 65   GLN A O   
468  C CB  . GLN A 65  ? 0.3646 0.7807 0.4151 0.1633 -0.0772 -0.2333 65   GLN A CB  
469  C CG  . GLN A 65  ? 0.4561 0.8647 0.5006 0.1656 -0.0775 -0.2273 65   GLN A CG  
470  C CD  . GLN A 65  ? 0.5997 0.9988 0.6487 0.1627 -0.0782 -0.2303 65   GLN A CD  
471  O OE1 . GLN A 65  ? 0.6349 1.0229 0.6937 0.1576 -0.0793 -0.2358 65   GLN A OE1 
472  N NE2 . GLN A 65  ? 0.5729 0.9767 0.6149 0.1661 -0.0773 -0.2262 65   GLN A NE2 
473  N N   . TYR A 66  ? 0.5009 0.9303 0.5605 0.1600 -0.0768 -0.2415 66   TYR A N   
474  C CA  . TYR A 66  ? 0.4307 0.8750 0.4930 0.1595 -0.0757 -0.2464 66   TYR A CA  
475  C C   . TYR A 66  ? 0.5164 0.9736 0.5720 0.1631 -0.0747 -0.2417 66   TYR A C   
476  O O   . TYR A 66  ? 0.4697 0.9496 0.5196 0.1666 -0.0726 -0.2408 66   TYR A O   
477  C CB  . TYR A 66  ? 0.3539 0.7840 0.4287 0.1536 -0.0771 -0.2536 66   TYR A CB  
478  C CG  . TYR A 66  ? 0.5267 0.9717 0.6042 0.1531 -0.0761 -0.2585 66   TYR A CG  
479  C CD1 . TYR A 66  ? 0.5292 0.9955 0.6047 0.1546 -0.0743 -0.2623 66   TYR A CD1 
480  C CD2 . TYR A 66  ? 0.4137 0.8516 0.4956 0.1510 -0.0769 -0.2593 66   TYR A CD2 
481  C CE1 . TYR A 66  ? 0.5193 0.9996 0.5972 0.1541 -0.0733 -0.2669 66   TYR A CE1 
482  C CE2 . TYR A 66  ? 0.4159 0.8676 0.5002 0.1505 -0.0759 -0.2639 66   TYR A CE2 
483  C CZ  . TYR A 66  ? 0.5771 1.0501 0.6593 0.1520 -0.0741 -0.2676 66   TYR A CZ  
484  O OH  . TYR A 66  ? 0.4579 0.9451 0.5425 0.1514 -0.0731 -0.2723 66   TYR A OH  
485  N N   . VAL A 67  ? 0.4994 0.9428 0.5556 0.1625 -0.0760 -0.2384 67   VAL A N   
486  C CA  . VAL A 67  ? 0.4213 0.8769 0.4717 0.1658 -0.0749 -0.2342 67   VAL A CA  
487  C C   . VAL A 67  ? 0.3561 0.8294 0.3938 0.1727 -0.0727 -0.2256 67   VAL A C   
488  O O   . VAL A 67  ? 0.3250 0.8176 0.3571 0.1761 -0.0708 -0.2225 67   VAL A O   
489  C CB  . VAL A 67  ? 0.3794 0.8166 0.4335 0.1637 -0.0768 -0.2328 67   VAL A CB  
490  C CG1 . VAL A 67  ? 0.3318 0.7528 0.3990 0.1570 -0.0786 -0.2405 67   VAL A CG1 
491  C CG2 . VAL A 67  ? 0.2716 0.6929 0.3216 0.1651 -0.0781 -0.2266 67   VAL A CG2 
492  N N   . PHE A 68  ? 0.3347 0.8015 0.3677 0.1748 -0.0729 -0.2213 68   PHE A N   
493  C CA  . PHE A 68  ? 0.3543 0.8382 0.3755 0.1816 -0.0705 -0.2129 68   PHE A CA  
494  C C   . PHE A 68  ? 0.4122 0.9176 0.4309 0.1834 -0.0684 -0.2147 68   PHE A C   
495  O O   . PHE A 68  ? 0.3543 0.8794 0.3642 0.1890 -0.0659 -0.2080 68   PHE A O   
496  C CB  . PHE A 68  ? 0.4237 0.8942 0.4407 0.1835 -0.0712 -0.2077 68   PHE A CB  
497  C CG  . PHE A 68  ? 0.5431 0.9971 0.5618 0.1826 -0.0727 -0.1978 68   PHE A CG  
498  C CD1 . PHE A 68  ? 0.4440 0.8960 0.4680 0.1801 -0.0734 -0.1940 68   PHE A CD1 
499  C CD2 . PHE A 68  ? 0.5105 0.9499 0.5277 0.1830 -0.0737 -0.1903 68   PHE A CD2 
500  C CE1 . PHE A 68  ? 0.3735 0.8089 0.4013 0.1781 -0.0751 -0.1832 68   PHE A CE1 
501  C CE2 . PHE A 68  ? 0.4409 0.8638 0.4618 0.1811 -0.0754 -0.1796 68   PHE A CE2 
502  C CZ  . PHE A 68  ? 0.4859 0.9067 0.5122 0.1786 -0.0761 -0.1760 68   PHE A CZ  
503  N N   . GLN A 69  ? 0.4082 0.9098 0.4350 0.1788 -0.0694 -0.2233 69   GLN A N   
504  C CA  . GLN A 69  ? 0.4438 0.9630 0.4691 0.1800 -0.0678 -0.2259 69   GLN A CA  
505  C C   . GLN A 69  ? 0.5141 1.0356 0.5319 0.1841 -0.0669 -0.2198 69   GLN A C   
506  O O   . GLN A 69  ? 0.5983 1.1387 0.6075 0.1895 -0.0646 -0.2138 69   GLN A O   
507  C CB  . GLN A 69  ? 0.3112 0.8554 0.3325 0.1827 -0.0656 -0.2250 69   GLN A CB  
508  C CG  . GLN A 69  ? 0.5033 1.0489 0.5334 0.1779 -0.0663 -0.2338 69   GLN A CG  
509  C CD  . GLN A 69  ? 0.6230 1.1628 0.6620 0.1733 -0.0673 -0.2434 69   GLN A CD  
510  O OE1 . GLN A 69  ? 0.6671 1.2194 0.7042 0.1746 -0.0662 -0.2450 69   GLN A OE1 
511  N NE2 . GLN A 69  ? 0.5242 1.0449 0.5731 0.1680 -0.0693 -0.2495 69   GLN A NE2 
512  N N   . THR A 70  ? 0.4474 0.9492 0.4687 0.1816 -0.0687 -0.2212 70   THR A N   
513  C CA  . THR A 70  ? 0.4128 0.9146 0.4280 0.1848 -0.0681 -0.2163 70   THR A CA  
514  C C   . THR A 70  ? 0.5126 0.9982 0.5349 0.1803 -0.0699 -0.2220 70   THR A C   
515  O O   . THR A 70  ? 0.4555 0.9252 0.4872 0.1747 -0.0718 -0.2281 70   THR A O   
516  C CB  . THR A 70  ? 0.4306 0.9244 0.4384 0.1888 -0.0680 -0.2072 70   THR A CB  
517  O OG1 . THR A 70  ? 0.3587 0.8555 0.3606 0.1923 -0.0670 -0.2028 70   THR A OG1 
518  C CG2 . THR A 70  ? 0.2947 0.7619 0.3089 0.1843 -0.0708 -0.2091 70   THR A CG2 
519  N N   . ARG A 71  ? 0.4655 0.9553 0.4833 0.1827 -0.0691 -0.2197 71   ARG A N   
520  C CA  . ARG A 71  ? 0.4815 0.9576 0.5054 0.1788 -0.0705 -0.2243 71   ARG A CA  
521  C C   . ARG A 71  ? 0.4833 0.9476 0.5020 0.1809 -0.0710 -0.2179 71   ARG A C   
522  O O   . ARG A 71  ? 0.5156 0.9663 0.5385 0.1779 -0.0722 -0.2202 71   ARG A O   
523  C CB  . ARG A 71  ? 1.3152 1.8069 1.3406 0.1786 -0.0694 -0.2297 71   ARG A CB  
524  C CG  . ARG A 71  ? 1.4402 1.9292 1.4656 0.1784 -0.0695 -0.2306 71   ARG A CG  
525  C CD  . ARG A 71  ? 1.4782 1.9842 1.4929 0.1848 -0.0674 -0.2236 71   ARG A CD  
526  N NE  . ARG A 71  ? 1.3855 1.9101 1.3990 0.1862 -0.0660 -0.2267 71   ARG A NE  
527  C CZ  . ARG A 71  ? 1.2139 1.7604 1.2240 0.1890 -0.0642 -0.2266 71   ARG A CZ  
528  N NH1 . ARG A 71  ? 1.1422 1.6954 1.1498 0.1907 -0.0635 -0.2235 71   ARG A NH1 
529  N NH2 . ARG A 71  ? 1.1352 1.6975 1.1447 0.1900 -0.0631 -0.2296 71   ARG A NH2 
530  N N   . ASN A 72  ? 0.4168 0.8861 0.4268 0.1861 -0.0699 -0.2097 72   ASN A N   
531  C CA  . ASN A 72  ? 0.5586 1.0154 0.5636 0.1883 -0.0704 -0.2033 72   ASN A CA  
532  C C   . ASN A 72  ? 0.5346 0.9656 0.5477 0.1823 -0.0732 -0.2070 72   ASN A C   
533  O O   . ASN A 72  ? 0.5944 1.0136 0.6139 0.1784 -0.0748 -0.2100 72   ASN A O   
534  C CB  . ASN A 72  ? 0.2991 0.7577 0.2969 0.1928 -0.0695 -0.1955 72   ASN A CB  
535  C CG  . ASN A 72  ? 0.6352 1.1179 0.6236 0.1998 -0.0663 -0.1888 72   ASN A CG  
536  O OD1 . ASN A 72  ? 0.6218 1.1202 0.6079 0.2018 -0.0648 -0.1893 72   ASN A OD1 
537  N ND2 . ASN A 72  ? 0.5072 0.9931 0.4900 0.2037 -0.0653 -0.1821 72   ASN A ND2 
538  N N   . PRO A 73  ? 0.5408 0.9632 0.5539 0.1816 -0.0737 -0.2065 73   PRO A N   
539  C CA  . PRO A 73  ? 0.4433 0.8414 0.4633 0.1762 -0.0762 -0.2088 73   PRO A CA  
540  C C   . PRO A 73  ? 0.4973 0.8818 0.5144 0.1772 -0.0773 -0.2033 73   PRO A C   
541  O O   . PRO A 73  ? 0.3780 0.7418 0.4019 0.1722 -0.0796 -0.2050 73   PRO A O   
542  C CB  . PRO A 73  ? 0.5707 0.9690 0.5885 0.1771 -0.0758 -0.2080 73   PRO A CB  
543  C CG  . PRO A 73  ? 0.3711 0.7933 0.3838 0.1813 -0.0734 -0.2081 73   PRO A CG  
544  C CD  . PRO A 73  ? 0.4692 0.9058 0.4758 0.1858 -0.0719 -0.2041 73   PRO A CD  
545  N N   . LEU A 74  ? 0.3839 0.7796 0.3907 0.1837 -0.0756 -0.1963 74   LEU A N   
546  C CA  . LEU A 74  ? 0.5226 0.9062 0.5259 0.1852 -0.0766 -0.1910 74   LEU A CA  
547  C C   . LEU A 74  ? 0.4589 0.8438 0.4637 0.1850 -0.0769 -0.1913 74   LEU A C   
548  O O   . LEU A 74  ? 0.3246 0.7208 0.3243 0.1891 -0.0753 -0.1831 74   LEU A O   
549  C CB  . LEU A 74  ? 0.3799 0.7716 0.3717 0.1925 -0.0746 -0.1827 74   LEU A CB  
550  C CG  . LEU A 74  ? 0.4357 0.8084 0.4293 0.1908 -0.0763 -0.1736 74   LEU A CG  
551  C CD1 . LEU A 74  ? 0.3115 0.6606 0.3126 0.1843 -0.0795 -0.1792 74   LEU A CD1 
552  C CD2 . LEU A 74  ? 0.4784 0.8558 0.4643 0.1964 -0.0746 -0.1627 74   LEU A CD2 
553  N N   . THR A 75  ? 0.3509 0.7216 0.3662 0.1783 -0.0791 -0.1974 75   THR A N   
554  C CA  . THR A 75  ? 0.3000 0.6700 0.3189 0.1768 -0.0798 -0.1992 75   THR A CA  
555  C C   . THR A 75  ? 0.4028 0.7473 0.4308 0.1704 -0.0828 -0.2016 75   THR A C   
556  O O   . THR A 75  ? 0.4392 0.7704 0.4750 0.1651 -0.0842 -0.2054 75   THR A O   
557  C CB  . THR A 75  ? 0.2945 0.6787 0.3180 0.1751 -0.0787 -0.2051 75   THR A CB  
558  O OG1 . THR A 75  ? 0.4409 0.8497 0.4554 0.1813 -0.0758 -0.2016 75   THR A OG1 
559  C CG2 . THR A 75  ? 0.4411 0.8223 0.4701 0.1724 -0.0796 -0.2079 75   THR A CG2 
560  N N   . LEU A 76  ? 0.3659 0.7007 0.3972 0.1681 -0.0841 -0.1937 76   LEU A N   
561  C CA  . LEU A 76  ? 0.3491 0.6591 0.3886 0.1621 -0.0870 -0.1943 76   LEU A CA  
562  C C   . LEU A 76  ? 0.3289 0.6320 0.3728 0.1595 -0.0880 -0.1872 76   LEU A C   
563  O O   . LEU A 76  ? 0.3277 0.6449 0.3687 0.1625 -0.0866 -0.1807 76   LEU A O   
564  C CB  . LEU A 76  ? 0.2625 0.5581 0.3000 0.1615 -0.0880 -0.1900 76   LEU A CB  
565  C CG  . LEU A 76  ? 0.5182 0.8205 0.5480 0.1660 -0.0868 -0.1781 76   LEU A CG  
566  C CD1 . LEU A 76  ? 0.5363 0.8311 0.5681 0.1649 -0.0876 -0.1671 76   LEU A CD1 
567  C CD2 . LEU A 76  ? 0.5793 0.8708 0.6069 0.1657 -0.0875 -0.1783 76   LEU A CD2 
568  N N   . VAL A 77  ? 0.2852 0.5663 0.3363 0.1540 -0.0905 -0.1882 77   VAL A N   
569  C CA  . VAL A 77  ? 0.3069 0.5788 0.3632 0.1508 -0.0918 -0.1819 77   VAL A CA  
570  C C   . VAL A 77  ? 0.3256 0.5861 0.3801 0.1505 -0.0927 -0.1706 77   VAL A C   
571  O O   . VAL A 77  ? 0.3320 0.5800 0.3857 0.1492 -0.0937 -0.1712 77   VAL A O   
572  C CB  . VAL A 77  ? 0.3275 0.5816 0.3930 0.1450 -0.0939 -0.1900 77   VAL A CB  
573  C CG1 . VAL A 77  ? 0.2460 0.4905 0.3167 0.1415 -0.0952 -0.1835 77   VAL A CG1 
574  C CG2 . VAL A 77  ? 0.2495 0.5134 0.3177 0.1454 -0.0929 -0.2021 77   VAL A CG2 
575  N N   . ILE A 78  ? 0.3319 0.5970 0.3858 0.1519 -0.0922 -0.1603 78   ILE A N   
576  C CA  . ILE A 78  ? 0.3474 0.6004 0.4012 0.1512 -0.0931 -0.1494 78   ILE A CA  
577  C C   . ILE A 78  ? 0.3298 0.5639 0.3919 0.1447 -0.0956 -0.1502 78   ILE A C   
578  O O   . ILE A 78  ? 0.3236 0.5609 0.3904 0.1430 -0.0957 -0.1527 78   ILE A O   
579  C CB  . ILE A 78  ? 0.2510 0.5179 0.3004 0.1566 -0.0911 -0.1371 78   ILE A CB  
580  C CG1 . ILE A 78  ? 0.3254 0.6113 0.3658 0.1634 -0.0884 -0.1363 78   ILE A CG1 
581  C CG2 . ILE A 78  ? 0.2449 0.4982 0.2955 0.1557 -0.0919 -0.1262 78   ILE A CG2 
582  C CD1 . ILE A 78  ? 0.3127 0.5921 0.3489 0.1641 -0.0886 -0.1384 78   ILE A CD1 
583  N N   . SER A 79  ? 0.3724 0.5875 0.4362 0.1412 -0.0974 -0.1486 79   SER A N   
584  C CA  . SER A 79  ? 0.3303 0.5263 0.4016 0.1349 -0.0997 -0.1500 79   SER A CA  
585  C C   . SER A 79  ? 0.2710 0.4660 0.3439 0.1348 -0.0997 -0.1387 79   SER A C   
586  O O   . SER A 79  ? 0.3101 0.4907 0.3844 0.1322 -0.1010 -0.1334 79   SER A O   
587  C CB  . SER A 79  ? 0.2784 0.4548 0.3504 0.1313 -0.1015 -0.1525 79   SER A CB  
588  O OG  . SER A 79  ? 0.3152 0.4911 0.3864 0.1315 -0.1014 -0.1626 79   SER A OG  
589  N N   . GLY A 80  ? 0.4226 0.6335 0.4955 0.1378 -0.0982 -0.1348 80   GLY A N   
590  C CA  . GLY A 80  ? 0.4109 0.6230 0.4859 0.1386 -0.0978 -0.1235 80   GLY A CA  
591  C C   . GLY A 80  ? 0.4424 0.6727 0.5181 0.1412 -0.0962 -0.1229 80   GLY A C   
592  O O   . GLY A 80  ? 0.3361 0.5792 0.4095 0.1431 -0.0952 -0.1306 80   GLY A O   
593  N N   . SER A 81  ? 0.4192 0.6510 0.4984 0.1414 -0.0959 -0.1140 81   SER A N   
594  C CA  . SER A 81  ? 0.4336 0.6824 0.5138 0.1438 -0.0944 -0.1127 81   SER A CA  
595  C C   . SER A 81  ? 0.3637 0.6336 0.4362 0.1514 -0.0915 -0.1082 81   SER A C   
596  O O   . SER A 81  ? 0.3884 0.6590 0.4548 0.1549 -0.0907 -0.1058 81   SER A O   
597  C CB  . SER A 81  ? 0.6026 0.8468 0.6888 0.1422 -0.0947 -0.1034 81   SER A CB  
598  O OG  . SER A 81  ? 0.6181 0.8671 0.7013 0.1475 -0.0930 -0.0904 81   SER A OG  
599  N N   . GLY A 82  ? 0.3521 0.6394 0.4242 0.1540 -0.0899 -0.1076 82   GLY A N   
600  C CA  . GLY A 82  ? 0.3844 0.6928 0.4487 0.1613 -0.0869 -0.1036 82   GLY A CA  
601  C C   . GLY A 82  ? 0.4391 0.7473 0.4980 0.1668 -0.0852 -0.0922 82   GLY A C   
602  O O   . GLY A 82  ? 0.5628 0.8769 0.6144 0.1707 -0.0840 -0.0938 82   GLY A O   
603  N N   . HIS A 83  ? 0.4750 0.7760 0.5375 0.1674 -0.0851 -0.0809 83   HIS A N   
604  C CA  . HIS A 83  ? 0.5335 0.8288 0.5928 0.1718 -0.0838 -0.0697 83   HIS A CA  
605  C C   . HIS A 83  ? 0.4800 0.7673 0.5344 0.1721 -0.0843 -0.0731 83   HIS A C   
606  O O   . HIS A 83  ? 0.4771 0.7698 0.5246 0.1782 -0.0821 -0.0672 83   HIS A O   
607  C CB  . HIS A 83  ? 0.5207 0.7981 0.5879 0.1683 -0.0853 -0.0621 83   HIS A CB  
608  C CG  . HIS A 83  ? 0.6331 0.9173 0.7031 0.1716 -0.0835 -0.0517 83   HIS A CG  
609  N ND1 . HIS A 83  ? 0.6335 0.9244 0.7088 0.1690 -0.0840 -0.0539 83   HIS A ND1 
610  C CD2 . HIS A 83  ? 0.5826 0.8671 0.6509 0.1775 -0.0812 -0.0392 83   HIS A CD2 
611  C CE1 . HIS A 83  ? 0.6420 0.9375 0.7189 0.1729 -0.0821 -0.0430 83   HIS A CE1 
612  N NE2 . HIS A 83  ? 0.6022 0.8935 0.6748 0.1783 -0.0803 -0.0340 83   HIS A NE2 
613  N N   . CYS A 84  ? 0.3686 0.6422 0.4268 0.1655 -0.0872 -0.0823 84   CYS A N   
614  C CA  . CYS A 84  ? 0.4273 0.6909 0.4822 0.1645 -0.0881 -0.0862 84   CYS A CA  
615  C C   . CYS A 84  ? 0.4773 0.7562 0.5242 0.1688 -0.0865 -0.0923 84   CYS A C   
616  O O   . CYS A 84  ? 0.3358 0.6136 0.3771 0.1717 -0.0857 -0.0910 84   CYS A O   
617  C CB  . CYS A 84  ? 0.3186 0.5649 0.3795 0.1564 -0.0914 -0.0955 84   CYS A CB  
618  S SG  . CYS A 84  ? 0.4959 0.7236 0.5552 0.1539 -0.0930 -0.0964 84   CYS A SG  
619  N N   . ALA A 85  ? 0.2586 0.5519 0.3049 0.1691 -0.0858 -0.0994 85   ALA A N   
620  C CA  . ALA A 85  ? 0.2631 0.5726 0.3021 0.1732 -0.0840 -0.1056 85   ALA A CA  
621  C C   . ALA A 85  ? 0.4715 0.7968 0.5026 0.1816 -0.0805 -0.0956 85   ALA A C   
622  O O   . ALA A 85  ? 0.3559 0.6894 0.3795 0.1860 -0.0789 -0.0968 85   ALA A O   
623  C CB  . ALA A 85  ? 0.2620 0.5829 0.3028 0.1714 -0.0840 -0.1158 85   ALA A CB  
624  N N   . LEU A 86  ? 0.3536 0.6828 0.3864 0.1841 -0.0793 -0.0855 86   LEU A N   
625  C CA  . LEU A 86  ? 0.3864 0.7289 0.4119 0.1923 -0.0757 -0.0750 86   LEU A CA  
626  C C   . LEU A 86  ? 0.4125 0.7426 0.4354 0.1946 -0.0755 -0.0684 86   LEU A C   
627  O O   . LEU A 86  ? 0.4030 0.7424 0.4178 0.2006 -0.0730 -0.0661 86   LEU A O   
628  C CB  . LEU A 86  ? 0.3544 0.7017 0.3832 0.1942 -0.0744 -0.0656 86   LEU A CB  
629  C CG  . LEU A 86  ? 0.4709 0.8274 0.4937 0.2028 -0.0706 -0.0524 86   LEU A CG  
630  C CD1 . LEU A 86  ? 0.3286 0.7088 0.3413 0.2095 -0.0672 -0.0540 86   LEU A CD1 
631  C CD2 . LEU A 86  ? 0.4307 0.7880 0.4585 0.2035 -0.0697 -0.0433 86   LEU A CD2 
632  N N   . GLU A 87  ? 0.3051 0.6144 0.3349 0.1897 -0.0779 -0.0655 87   GLU A N   
633  C CA  . GLU A 87  ? 0.3649 0.6611 0.3928 0.1912 -0.0779 -0.0599 87   GLU A CA  
634  C C   . GLU A 87  ? 0.4718 0.7687 0.4941 0.1912 -0.0783 -0.0680 87   GLU A C   
635  O O   . GLU A 87  ? 0.5337 0.8331 0.5496 0.1964 -0.0764 -0.0635 87   GLU A O   
636  C CB  . GLU A 87  ? 0.2927 0.5668 0.3293 0.1850 -0.0806 -0.0571 87   GLU A CB  
637  C CG  . GLU A 87  ? 0.2831 0.5434 0.3182 0.1864 -0.0805 -0.0507 87   GLU A CG  
638  C CD  . GLU A 87  ? 0.4573 0.7015 0.4997 0.1839 -0.0813 -0.0424 87   GLU A CD  
639  O OE1 . GLU A 87  ? 0.4927 0.7411 0.5385 0.1855 -0.0802 -0.0361 87   GLU A OE1 
640  O OE2 . GLU A 87  ? 0.6212 0.8490 0.6659 0.1804 -0.0829 -0.0423 87   GLU A OE2 
641  N N   . ALA A 88  ? 0.4734 0.7684 0.4982 0.1856 -0.0806 -0.0800 88   ALA A N   
642  C CA  . ALA A 88  ? 0.3556 0.6512 0.3759 0.1853 -0.0810 -0.0886 88   ALA A CA  
643  C C   . ALA A 88  ? 0.4268 0.7432 0.4376 0.1932 -0.0775 -0.0872 88   ALA A C   
644  O O   . ALA A 88  ? 0.4920 0.8086 0.4970 0.1967 -0.0765 -0.0857 88   ALA A O   
645  C CB  . ALA A 88  ? 0.3933 0.6862 0.4180 0.1790 -0.0833 -0.1019 88   ALA A CB  
646  N N   . ALA A 89  ? 0.2871 0.6213 0.2962 0.1960 -0.0757 -0.0878 89   ALA A N   
647  C CA  . ALA A 89  ? 0.5751 0.9315 0.5749 0.2036 -0.0721 -0.0865 89   ALA A CA  
648  C C   . ALA A 89  ? 0.5587 0.9165 0.5528 0.2107 -0.0693 -0.0741 89   ALA A C   
649  O O   . ALA A 89  ? 0.4960 0.8597 0.4830 0.2150 -0.0677 -0.0742 89   ALA A O   
650  C CB  . ALA A 89  ? 0.2980 0.6723 0.2977 0.2052 -0.0706 -0.0873 89   ALA A CB  
651  N N   . LEU A 90  ? 0.5072 0.8591 0.5046 0.2119 -0.0687 -0.0635 90   LEU A N   
652  C CA  . LEU A 90  ? 0.5558 0.9090 0.5483 0.2192 -0.0656 -0.0512 90   LEU A CA  
653  C C   . LEU A 90  ? 0.5429 0.8807 0.5342 0.2189 -0.0665 -0.0499 90   LEU A C   
654  O O   . LEU A 90  ? 0.5693 0.9127 0.5535 0.2257 -0.0636 -0.0441 90   LEU A O   
655  C CB  . LEU A 90  ? 0.3165 0.6643 0.3139 0.2201 -0.0649 -0.0405 90   LEU A CB  
656  C CG  . LEU A 90  ? 0.4175 0.7829 0.4147 0.2221 -0.0631 -0.0395 90   LEU A CG  
657  C CD1 . LEU A 90  ? 0.3226 0.6837 0.3236 0.2243 -0.0617 -0.0276 90   LEU A CD1 
658  C CD2 . LEU A 90  ? 0.4716 0.8608 0.4586 0.2294 -0.0594 -0.0398 90   LEU A CD2 
659  N N   . VAL A 91  ? 0.4018 0.7207 0.3998 0.2112 -0.0703 -0.0554 91   VAL A N   
660  C CA  . VAL A 91  ? 0.3275 0.6313 0.3251 0.2104 -0.0713 -0.0538 91   VAL A CA  
661  C C   . VAL A 91  ? 0.4771 0.7869 0.4682 0.2116 -0.0711 -0.0616 91   VAL A C   
662  O O   . VAL A 91  ? 0.4129 0.7171 0.4003 0.2141 -0.0705 -0.0586 91   VAL A O   
663  C CB  . VAL A 91  ? 0.5113 0.7923 0.5182 0.2020 -0.0752 -0.0556 91   VAL A CB  
664  C CG1 . VAL A 91  ? 0.4537 0.7301 0.4637 0.1946 -0.0784 -0.0687 91   VAL A CG1 
665  C CG2 . VAL A 91  ? 0.4055 0.6717 0.4118 0.2029 -0.0752 -0.0493 91   VAL A CG2 
666  N N   . ASN A 92  ? 0.3632 0.6851 0.3528 0.2101 -0.0715 -0.0716 92   ASN A N   
667  C CA  . ASN A 92  ? 0.3471 0.6757 0.3308 0.2116 -0.0711 -0.0789 92   ASN A CA  
668  C C   . ASN A 92  ? 0.4579 0.8087 0.4319 0.2205 -0.0669 -0.0754 92   ASN A C   
669  O O   . ASN A 92  ? 0.5108 0.8657 0.4786 0.2240 -0.0657 -0.0766 92   ASN A O   
670  C CB  . ASN A 92  ? 0.3377 0.6659 0.3249 0.2054 -0.0736 -0.0924 92   ASN A CB  
671  C CG  . ASN A 92  ? 0.3736 0.6793 0.3689 0.1970 -0.0775 -0.0967 92   ASN A CG  
672  O OD1 . ASN A 92  ? 0.3292 0.6247 0.3240 0.1949 -0.0788 -0.1001 92   ASN A OD1 
673  N ND2 . ASN A 92  ? 0.3213 0.6197 0.3241 0.1921 -0.0793 -0.0968 92   ASN A ND2 
674  N N   . VAL A 93  ? 0.5420 0.9073 0.5148 0.2242 -0.0646 -0.0710 93   VAL A N   
675  C CA  . VAL A 93  ? 0.5599 0.9485 0.5235 0.2325 -0.0604 -0.0680 93   VAL A CA  
676  C C   . VAL A 93  ? 0.6269 1.0173 0.5853 0.2405 -0.0570 -0.0547 93   VAL A C   
677  O O   . VAL A 93  ? 0.5810 0.9847 0.5311 0.2472 -0.0539 -0.0529 93   VAL A O   
678  C CB  . VAL A 93  ? 0.5177 0.9229 0.4819 0.2330 -0.0593 -0.0697 93   VAL A CB  
679  C CG1 . VAL A 93  ? 0.3975 0.8241 0.3534 0.2422 -0.0545 -0.0613 93   VAL A CG1 
680  C CG2 . VAL A 93  ? 0.5272 0.9396 0.4922 0.2285 -0.0610 -0.0839 93   VAL A CG2 
681  N N   . LEU A 94  ? 0.5374 0.9139 0.5008 0.2399 -0.0573 -0.0456 94   LEU A N   
682  C CA  . LEU A 94  ? 0.5551 0.9321 0.5143 0.2477 -0.0537 -0.0326 94   LEU A CA  
683  C C   . LEU A 94  ? 0.6314 0.9896 0.5913 0.2472 -0.0547 -0.0293 94   LEU A C   
684  O O   . LEU A 94  ? 0.5172 0.8555 0.4847 0.2407 -0.0580 -0.0302 94   LEU A O   
685  C CB  . LEU A 94  ? 0.4835 0.8589 0.4471 0.2487 -0.0526 -0.0234 94   LEU A CB  
686  C CG  . LEU A 94  ? 0.5187 0.9128 0.4817 0.2496 -0.0513 -0.0251 94   LEU A CG  
687  C CD1 . LEU A 94  ? 0.4072 0.7958 0.3758 0.2496 -0.0508 -0.0160 94   LEU A CD1 
688  C CD2 . LEU A 94  ? 0.6793 1.0975 0.6322 0.2582 -0.0468 -0.0226 94   LEU A CD2 
689  N N   . GLU A 95  ? 0.7600 1.1253 0.7120 0.2543 -0.0517 -0.0255 95   GLU A N   
690  C CA  . GLU A 95  ? 0.6715 1.0212 0.6231 0.2558 -0.0516 -0.0202 95   GLU A CA  
691  C C   . GLU A 95  ? 0.5843 0.9314 0.5358 0.2620 -0.0482 -0.0065 95   GLU A C   
692  O O   . GLU A 95  ? 0.5552 0.9179 0.5034 0.2675 -0.0449 -0.0012 95   GLU A O   
693  C CB  . GLU A 95  ? 0.6330 0.9922 0.5762 0.2608 -0.0497 -0.0226 95   GLU A CB  
694  C CG  . GLU A 95  ? 0.7710 1.1346 0.7136 0.2555 -0.0525 -0.0360 95   GLU A CG  
695  C CD  . GLU A 95  ? 0.8217 1.1873 0.7581 0.2584 -0.0518 -0.0388 95   GLU A CD  
696  O OE1 . GLU A 95  ? 0.7933 1.1417 0.7321 0.2558 -0.0536 -0.0382 95   GLU A OE1 
697  O OE2 . GLU A 95  ? 0.9654 1.3503 0.8946 0.2633 -0.0494 -0.0417 95   GLU A OE2 
698  N N   . PRO A 96  ? 0.5759 0.9032 0.5311 0.2611 -0.0489 -0.0009 96   PRO A N   
699  C CA  . PRO A 96  ? 0.6617 0.9849 0.6171 0.2672 -0.0454 0.0122  96   PRO A CA  
700  C C   . PRO A 96  ? 0.7447 1.0856 0.6905 0.2781 -0.0400 0.0195  96   PRO A C   
701  O O   . PRO A 96  ? 0.6214 0.9690 0.5607 0.2814 -0.0390 0.0167  96   PRO A O   
702  C CB  . PRO A 96  ? 0.6258 0.9261 0.5850 0.2648 -0.0470 0.0149  96   PRO A CB  
703  C CG  . PRO A 96  ? 0.5412 0.8313 0.5055 0.2549 -0.0522 0.0034  96   PRO A CG  
704  C CD  . PRO A 96  ? 0.5624 0.8704 0.5220 0.2544 -0.0527 -0.0061 96   PRO A CD  
705  N N   . GLY A 97  ? 0.7893 1.1382 0.7341 0.2837 -0.0364 0.0288  97   GLY A N   
706  C CA  . GLY A 97  ? 0.7908 1.1583 0.7268 0.2942 -0.0309 0.0363  97   GLY A CA  
707  C C   . GLY A 97  ? 0.7822 1.1752 0.7135 0.2960 -0.0296 0.0317  97   GLY A C   
708  O O   . GLY A 97  ? 0.7100 1.1205 0.6348 0.3045 -0.0248 0.0388  97   GLY A O   
709  N N   . ASP A 98  ? 0.7247 1.1201 0.6592 0.2880 -0.0337 0.0198  98   ASP A N   
710  C CA  . ASP A 98  ? 0.5172 0.9360 0.4480 0.2887 -0.0328 0.0142  98   ASP A CA  
711  C C   . ASP A 98  ? 0.6445 1.0720 0.5769 0.2913 -0.0304 0.0217  98   ASP A C   
712  O O   . ASP A 98  ? 0.6852 1.0977 0.6247 0.2880 -0.0318 0.0261  98   ASP A O   
713  C CB  . ASP A 98  ? 0.5811 0.9976 0.5163 0.2792 -0.0378 0.0000  98   ASP A CB  
714  C CG  . ASP A 98  ? 0.7307 1.1477 0.6621 0.2778 -0.0393 -0.0092 98   ASP A CG  
715  O OD1 . ASP A 98  ? 0.6431 1.0666 0.5673 0.2847 -0.0363 -0.0051 98   ASP A OD1 
716  O OD2 . ASP A 98  ? 0.6300 1.0408 0.5656 0.2697 -0.0435 -0.0205 98   ASP A OD2 
717  N N   . SER A 99  ? 0.6420 1.0944 0.5678 0.2973 -0.0268 0.0231  99   SER A N   
718  C CA  . SER A 99  ? 0.6754 1.1403 0.6014 0.3007 -0.0239 0.0305  99   SER A CA  
719  C C   . SER A 99  ? 0.5166 0.9877 0.4473 0.2932 -0.0272 0.0210  99   SER A C   
720  O O   . SER A 99  ? 0.5825 1.0654 0.5106 0.2905 -0.0286 0.0100  99   SER A O   
721  C CB  . SER A 99  ? 0.5445 1.0347 0.4610 0.3108 -0.0182 0.0365  99   SER A CB  
722  O OG  . SER A 99  ? 0.5394 1.0466 0.4554 0.3132 -0.0157 0.0409  99   SER A OG  
723  N N   . PHE A 100 ? 0.5707 1.0342 0.5081 0.2902 -0.0281 0.0252  100  PHE A N   
724  C CA  . PHE A 100 ? 0.6601 1.1238 0.6039 0.2819 -0.0319 0.0160  100  PHE A CA  
725  C C   . PHE A 100 ? 0.5938 1.0712 0.5383 0.2845 -0.0294 0.0226  100  PHE A C   
726  O O   . PHE A 100 ? 0.4959 0.9642 0.4437 0.2868 -0.0278 0.0335  100  PHE A O   
727  C CB  . PHE A 100 ? 0.7011 1.1370 0.6545 0.2734 -0.0369 0.0128  100  PHE A CB  
728  C CG  . PHE A 100 ? 0.7590 1.1918 0.7202 0.2645 -0.0411 0.0039  100  PHE A CG  
729  C CD1 . PHE A 100 ? 0.6387 1.0882 0.5980 0.2618 -0.0420 -0.0069 100  PHE A CD1 
730  C CD2 . PHE A 100 ? 0.7628 1.1752 0.7335 0.2587 -0.0441 0.0060  100  PHE A CD2 
731  C CE1 . PHE A 100 ? 0.6310 1.0768 0.5978 0.2538 -0.0457 -0.0152 100  PHE A CE1 
732  C CE2 . PHE A 100 ? 0.6846 1.0937 0.6628 0.2506 -0.0479 -0.0022 100  PHE A CE2 
733  C CZ  . PHE A 100 ? 0.6661 1.0918 0.6423 0.2482 -0.0487 -0.0127 100  PHE A CZ  
734  N N   . LEU A 101 ? 0.4838 0.9836 0.4250 0.2843 -0.0287 0.0162  101  LEU A N   
735  C CA  . LEU A 101 ? 0.5568 1.0716 0.4983 0.2866 -0.0263 0.0219  101  LEU A CA  
736  C C   . LEU A 101 ? 0.6772 1.1860 0.6274 0.2777 -0.0306 0.0144  101  LEU A C   
737  O O   . LEU A 101 ? 0.6705 1.1821 0.6221 0.2716 -0.0338 0.0014  101  LEU A O   
738  C CB  . LEU A 101 ? 0.7321 1.2776 0.6646 0.2928 -0.0222 0.0212  101  LEU A CB  
739  C CG  . LEU A 101 ? 0.7145 1.2766 0.6454 0.2982 -0.0180 0.0318  101  LEU A CG  
740  C CD1 . LEU A 101 ? 0.7593 1.3137 0.6888 0.3059 -0.0140 0.0473  101  LEU A CD1 
741  C CD2 . LEU A 101 ? 0.7610 1.3546 0.6837 0.3027 -0.0146 0.0287  101  LEU A CD2 
742  N N   . VAL A 102 ? 0.6647 1.1656 0.6206 0.2771 -0.0303 0.0227  102  VAL A N   
743  C CA  . VAL A 102 ? 0.6201 1.1113 0.5853 0.2685 -0.0346 0.0167  102  VAL A CA  
744  C C   . VAL A 102 ? 0.6983 1.2061 0.6642 0.2697 -0.0326 0.0206  102  VAL A C   
745  O O   . VAL A 102 ? 0.8289 1.3381 0.7944 0.2751 -0.0293 0.0333  102  VAL A O   
746  C CB  . VAL A 102 ? 0.5346 0.9974 0.5080 0.2649 -0.0371 0.0219  102  VAL A CB  
747  C CG1 . VAL A 102 ? 0.3941 0.8474 0.3775 0.2558 -0.0416 0.0150  102  VAL A CG1 
748  C CG2 . VAL A 102 ? 0.4358 0.8816 0.4086 0.2639 -0.0388 0.0191  102  VAL A CG2 
749  N N   . GLY A 103 ? 0.5532 1.0731 0.5206 0.2647 -0.0347 0.0096  103  GLY A N   
750  C CA  . GLY A 103 ? 0.5820 1.1167 0.5511 0.2643 -0.0336 0.0116  103  GLY A CA  
751  C C   . GLY A 103 ? 0.7371 1.2533 0.7168 0.2585 -0.0366 0.0141  103  GLY A C   
752  O O   . GLY A 103 ? 0.8238 1.3323 0.8106 0.2503 -0.0409 0.0038  103  GLY A O   
753  N N   . ALA A 104 ? 0.6495 1.1591 0.6305 0.2629 -0.0341 0.0279  104  ALA A N   
754  C CA  . ALA A 104 ? 0.5292 1.0187 0.5203 0.2581 -0.0367 0.0317  104  ALA A CA  
755  C C   . ALA A 104 ? 0.6688 1.1698 0.6639 0.2567 -0.0362 0.0341  104  ALA A C   
756  O O   . ALA A 104 ? 0.6761 1.1732 0.6733 0.2599 -0.0340 0.0459  104  ALA A O   
757  C CB  . ALA A 104 ? 0.4212 0.8936 0.4123 0.2632 -0.0345 0.0448  104  ALA A CB  
758  N N   . ASN A 105 ? 0.6477 1.1623 0.6438 0.2517 -0.0382 0.0226  105  ASN A N   
759  C CA  . ASN A 105 ? 0.5824 1.1092 0.5822 0.2496 -0.0380 0.0233  105  ASN A CA  
760  C C   . ASN A 105 ? 0.6607 1.1692 0.6727 0.2408 -0.0427 0.0185  105  ASN A C   
761  O O   . ASN A 105 ? 0.5712 1.0895 0.5872 0.2376 -0.0433 0.0161  105  ASN A O   
762  C CB  . ASN A 105 ? 0.5767 1.1301 0.5710 0.2492 -0.0371 0.0135  105  ASN A CB  
763  C CG  . ASN A 105 ? 0.6817 1.2319 0.6750 0.2446 -0.0402 -0.0013 105  ASN A CG  
764  O OD1 . ASN A 105 ? 0.7878 1.3208 0.7815 0.2440 -0.0418 -0.0025 105  ASN A OD1 
765  N ND2 . ASN A 105 ? 0.5662 1.1336 0.5580 0.2415 -0.0409 -0.0128 105  ASN A ND2 
766  N N   . GLY A 106 ? 0.7193 1.2021 0.7374 0.2368 -0.0461 0.0171  106  GLY A N   
767  C CA  . GLY A 106 ? 0.6606 1.1256 0.6905 0.2286 -0.0504 0.0131  106  GLY A CA  
768  C C   . GLY A 106 ? 0.6366 1.0746 0.6714 0.2252 -0.0535 0.0123  106  GLY A C   
769  O O   . GLY A 106 ? 0.6606 1.0928 0.6897 0.2301 -0.0517 0.0174  106  GLY A O   
770  N N   . ILE A 107 ? 0.6501 1.0716 0.6952 0.2168 -0.0579 0.0057  107  ILE A N   
771  C CA  . ILE A 107 ? 0.5602 0.9561 0.6101 0.2136 -0.0606 0.0060  107  ILE A CA  
772  C C   . ILE A 107 ? 0.5275 0.9216 0.5713 0.2138 -0.0612 -0.0012 107  ILE A C   
773  O O   . ILE A 107 ? 0.6181 0.9975 0.6606 0.2154 -0.0612 0.0028  107  ILE A O   
774  C CB  . ILE A 107 ? 0.5087 0.8872 0.5712 0.2045 -0.0651 0.0009  107  ILE A CB  
775  C CG1 . ILE A 107 ? 0.5474 0.9006 0.6141 0.2018 -0.0673 0.0023  107  ILE A CG1 
776  C CG2 . ILE A 107 ? 0.2951 0.6806 0.3604 0.1978 -0.0678 -0.0134 107  ILE A CG2 
777  C CD1 . ILE A 107 ? 0.6241 0.9598 0.7004 0.1992 -0.0686 0.0093  107  ILE A CD1 
778  N N   . TRP A 108 ? 0.3891 0.7992 0.4286 0.2127 -0.0614 -0.0116 108  TRP A N   
779  C CA  . TRP A 108 ? 0.4723 0.8792 0.5073 0.2116 -0.0626 -0.0202 108  TRP A CA  
780  C C   . TRP A 108 ? 0.5087 0.9200 0.5341 0.2195 -0.0592 -0.0134 108  TRP A C   
781  O O   . TRP A 108 ? 0.4630 0.8604 0.4875 0.2187 -0.0605 -0.0149 108  TRP A O   
782  C CB  . TRP A 108 ? 0.4535 0.8748 0.4873 0.2080 -0.0637 -0.0338 108  TRP A CB  
783  C CG  . TRP A 108 ? 0.5808 0.9954 0.6247 0.2004 -0.0668 -0.0393 108  TRP A CG  
784  C CD1 . TRP A 108 ? 0.6408 1.0703 0.6867 0.1995 -0.0661 -0.0410 108  TRP A CD1 
785  C CD2 . TRP A 108 ? 0.4056 0.7969 0.4593 0.1930 -0.0708 -0.0425 108  TRP A CD2 
786  N NE1 . TRP A 108 ? 0.5441 0.9608 0.6004 0.1919 -0.0695 -0.0458 108  TRP A NE1 
787  C CE2 . TRP A 108 ? 0.4866 0.8799 0.5478 0.1878 -0.0723 -0.0467 108  TRP A CE2 
788  C CE3 . TRP A 108 ? 0.4128 0.7824 0.4693 0.1901 -0.0730 -0.0426 108  TRP A CE3 
789  C CZ2 . TRP A 108 ? 0.3561 0.7304 0.4275 0.1800 -0.0759 -0.0508 108  TRP A CZ2 
790  C CZ3 . TRP A 108 ? 0.4294 0.7804 0.4957 0.1823 -0.0766 -0.0465 108  TRP A CZ3 
791  C CH2 . TRP A 108 ? 0.4528 0.8064 0.5265 0.1774 -0.0780 -0.0505 108  TRP A CH2 
792  N N   . GLY A 109 ? 0.3972 0.8277 0.4153 0.2271 -0.0548 -0.0057 109  GLY A N   
793  C CA  . GLY A 109 ? 0.3403 0.7765 0.3490 0.2353 -0.0510 0.0017  109  GLY A CA  
794  C C   . GLY A 109 ? 0.4408 0.8561 0.4526 0.2372 -0.0507 0.0125  109  GLY A C   
795  O O   . GLY A 109 ? 0.3807 0.7891 0.3878 0.2409 -0.0495 0.0155  109  GLY A O   
796  N N   . GLN A 110 ? 0.5029 0.9077 0.5227 0.2346 -0.0517 0.0178  110  GLN A N   
797  C CA  . GLN A 110 ? 0.4997 0.8826 0.5236 0.2354 -0.0518 0.0268  110  GLN A CA  
798  C C   . GLN A 110 ? 0.4713 0.8347 0.4985 0.2298 -0.0556 0.0195  110  GLN A C   
799  O O   . GLN A 110 ? 0.4559 0.8078 0.4801 0.2331 -0.0545 0.0245  110  GLN A O   
800  C CB  . GLN A 110 ? 0.5145 0.8885 0.5475 0.2323 -0.0529 0.0318  110  GLN A CB  
801  C CG  . GLN A 110 ? 0.6799 1.0702 0.7096 0.2385 -0.0487 0.0416  110  GLN A CG  
802  C CD  . GLN A 110 ? 0.7795 1.1597 0.8186 0.2353 -0.0499 0.0465  110  GLN A CD  
803  O OE1 . GLN A 110 ? 0.7301 1.0981 0.7786 0.2271 -0.0543 0.0394  110  GLN A OE1 
804  N NE2 . GLN A 110 ? 0.8364 1.2216 0.8728 0.2419 -0.0457 0.0590  110  GLN A NE2 
805  N N   . ARG A 111 ? 0.4027 0.7628 0.4357 0.2215 -0.0598 0.0077  111  ARG A N   
806  C CA  . ARG A 111 ? 0.3884 0.7295 0.4254 0.2154 -0.0635 0.0008  111  ARG A CA  
807  C C   . ARG A 111 ? 0.3536 0.6992 0.3817 0.2190 -0.0623 -0.0024 111  ARG A C   
808  O O   . ARG A 111 ? 0.3409 0.6709 0.3691 0.2184 -0.0632 -0.0014 111  ARG A O   
809  C CB  . ARG A 111 ? 0.4119 0.7494 0.4567 0.2060 -0.0678 -0.0112 111  ARG A CB  
810  C CG  . ARG A 111 ? 0.3762 0.7056 0.4313 0.2013 -0.0696 -0.0085 111  ARG A CG  
811  C CD  . ARG A 111 ? 0.4435 0.7486 0.5057 0.1984 -0.0713 -0.0030 111  ARG A CD  
812  N NE  . ARG A 111 ? 0.4548 0.7545 0.5252 0.1969 -0.0716 0.0033  111  ARG A NE  
813  C CZ  . ARG A 111 ? 0.5472 0.8366 0.6277 0.1890 -0.0749 -0.0013 111  ARG A CZ  
814  N NH1 . ARG A 111 ? 0.4681 0.7513 0.5510 0.1821 -0.0781 -0.0121 111  ARG A NH1 
815  N NH2 . ARG A 111 ? 0.5759 0.8610 0.6637 0.1881 -0.0749 0.0050  111  ARG A NH2 
816  N N   . ALA A 112 ? 0.4004 0.7677 0.4208 0.2228 -0.0602 -0.0064 112  ALA A N   
817  C CA  . ALA A 112 ? 0.5329 0.9067 0.5443 0.2270 -0.0586 -0.0088 112  ALA A CA  
818  C C   . ALA A 112 ? 0.5523 0.9213 0.5586 0.2346 -0.0551 0.0034  112  ALA A C   
819  O O   . ALA A 112 ? 0.5552 0.9161 0.5582 0.2358 -0.0552 0.0027  112  ALA A O   
820  C CB  . ALA A 112 ? 0.4803 0.8801 0.4842 0.2305 -0.0563 -0.0140 112  ALA A CB  
821  N N   . ALA A 113 ? 0.4674 0.8412 0.4733 0.2399 -0.0519 0.0146  113  ALA A N   
822  C CA  . ALA A 113 ? 0.6409 1.0105 0.6419 0.2478 -0.0480 0.0267  113  ALA A CA  
823  C C   . ALA A 113 ? 0.6650 1.0079 0.6720 0.2444 -0.0503 0.0292  113  ALA A C   
824  O O   . ALA A 113 ? 0.6651 1.0006 0.6678 0.2480 -0.0489 0.0323  113  ALA A O   
825  C CB  . ALA A 113 ? 0.5100 0.8901 0.5094 0.2541 -0.0438 0.0382  113  ALA A CB  
826  N N   . ASP A 114 ? 0.6635 0.9928 0.6804 0.2375 -0.0536 0.0276  114  ASP A N   
827  C CA  . ASP A 114 ? 0.5438 0.8480 0.5674 0.2333 -0.0560 0.0294  114  ASP A CA  
828  C C   . ASP A 114 ? 0.4935 0.7900 0.5154 0.2300 -0.0584 0.0213  114  ASP A C   
829  O O   . ASP A 114 ? 0.4134 0.6992 0.4325 0.2330 -0.0572 0.0256  114  ASP A O   
830  C CB  . ASP A 114 ? 0.5242 0.8181 0.5592 0.2253 -0.0597 0.0265  114  ASP A CB  
831  C CG  . ASP A 114 ? 0.5235 0.7925 0.5657 0.2218 -0.0614 0.0304  114  ASP A CG  
832  O OD1 . ASP A 114 ? 0.5943 0.8521 0.6344 0.2218 -0.0618 0.0297  114  ASP A OD1 
833  O OD2 . ASP A 114 ? 0.5665 0.8269 0.6165 0.2190 -0.0623 0.0339  114  ASP A OD2 
834  N N   . ILE A 115 ? 0.5098 0.8122 0.5327 0.2242 -0.0614 0.0095  115  ILE A N   
835  C CA  . ILE A 115 ? 0.5010 0.7980 0.5215 0.2213 -0.0635 0.0012  115  ILE A CA  
836  C C   . ILE A 115 ? 0.5021 0.8073 0.5123 0.2295 -0.0599 0.0053  115  ILE A C   
837  O O   . ILE A 115 ? 0.5079 0.8014 0.5168 0.2294 -0.0604 0.0054  115  ILE A O   
838  C CB  . ILE A 115 ? 0.5148 0.8210 0.5362 0.2155 -0.0662 -0.0118 115  ILE A CB  
839  C CG1 . ILE A 115 ? 0.5187 0.8129 0.5509 0.2066 -0.0702 -0.0166 115  ILE A CG1 
840  C CG2 . ILE A 115 ? 0.5127 0.8167 0.5297 0.2141 -0.0675 -0.0198 115  ILE A CG2 
841  C CD1 . ILE A 115 ? 0.4575 0.7615 0.4912 0.2015 -0.0723 -0.0287 115  ILE A CD1 
842  N N   . GLY A 116 ? 0.5934 0.9193 0.5964 0.2365 -0.0561 0.0089  116  GLY A N   
843  C CA  . GLY A 116 ? 0.6138 0.9505 0.6068 0.2450 -0.0521 0.0132  116  GLY A CA  
844  C C   . GLY A 116 ? 0.6134 0.9359 0.6052 0.2498 -0.0499 0.0236  116  GLY A C   
845  O O   . GLY A 116 ? 0.4191 0.7382 0.4061 0.2523 -0.0492 0.0231  116  GLY A O   
846  N N   . GLU A 117 ? 0.6573 0.9712 0.6535 0.2511 -0.0486 0.0329  117  GLU A N   
847  C CA  . GLU A 117 ? 0.7106 1.0090 0.7064 0.2554 -0.0464 0.0427  117  GLU A CA  
848  C C   . GLU A 117 ? 0.6073 0.8849 0.6077 0.2491 -0.0501 0.0375  117  GLU A C   
849  O O   . GLU A 117 ? 0.4210 0.6922 0.4172 0.2527 -0.0487 0.0401  117  GLU A O   
850  C CB  . GLU A 117 ? 0.8027 1.0941 0.8033 0.2571 -0.0446 0.0526  117  GLU A CB  
851  C CG  . GLU A 117 ? 1.0097 1.3185 1.0035 0.2665 -0.0391 0.0625  117  GLU A CG  
852  C CD  . GLU A 117 ? 1.1847 1.4939 1.1837 0.2658 -0.0385 0.0681  117  GLU A CD  
853  O OE1 . GLU A 117 ? 1.2347 1.5327 1.2428 0.2577 -0.0427 0.0631  117  GLU A OE1 
854  O OE2 . GLU A 117 ? 1.2049 1.5261 1.1990 0.2735 -0.0337 0.0775  117  GLU A OE2 
855  N N   . ARG A 118 ? 0.5609 0.8293 0.5700 0.2397 -0.0548 0.0300  118  ARG A N   
856  C CA  . ARG A 118 ? 0.5024 0.7508 0.5171 0.2328 -0.0585 0.0252  118  ARG A CA  
857  C C   . ARG A 118 ? 0.4859 0.7362 0.4947 0.2330 -0.0592 0.0188  118  ARG A C   
858  O O   . ARG A 118 ? 0.5044 0.7402 0.5140 0.2318 -0.0600 0.0195  118  ARG A O   
859  C CB  . ARG A 118 ? 0.5264 0.7681 0.5507 0.2228 -0.0632 0.0173  118  ARG A CB  
860  C CG  . ARG A 118 ? 0.4988 0.7306 0.5314 0.2207 -0.0636 0.0234  118  ARG A CG  
861  C CD  . ARG A 118 ? 0.5312 0.7573 0.5730 0.2107 -0.0681 0.0150  118  ARG A CD  
862  N NE  . ARG A 118 ? 0.4573 0.6768 0.5070 0.2088 -0.0684 0.0202  118  ARG A NE  
863  C CZ  . ARG A 118 ? 0.4862 0.6867 0.5434 0.2050 -0.0697 0.0235  118  ARG A CZ  
864  N NH1 . ARG A 118 ? 0.4031 0.5896 0.4605 0.2027 -0.0707 0.0222  118  ARG A NH1 
865  N NH2 . ARG A 118 ? 0.6380 0.8337 0.7024 0.2034 -0.0698 0.0280  118  ARG A NH2 
866  N N   . ILE A 119 ? 0.5027 0.7712 0.5057 0.2344 -0.0588 0.0125  119  ILE A N   
867  C CA  . ILE A 119 ? 0.4560 0.7272 0.4532 0.2347 -0.0594 0.0059  119  ILE A CA  
868  C C   . ILE A 119 ? 0.5716 0.8542 0.5588 0.2448 -0.0547 0.0126  119  ILE A C   
869  O O   . ILE A 119 ? 0.5141 0.8040 0.4951 0.2465 -0.0544 0.0075  119  ILE A O   
870  C CB  . ILE A 119 ? 0.5557 0.8381 0.5525 0.2298 -0.0620 -0.0063 119  ILE A CB  
871  C CG1 . ILE A 119 ? 0.5022 0.8071 0.4944 0.2345 -0.0593 -0.0057 119  ILE A CG1 
872  C CG2 . ILE A 119 ? 0.4695 0.7390 0.4761 0.2197 -0.0666 -0.0133 119  ILE A CG2 
873  C CD1 . ILE A 119 ? 0.4838 0.8018 0.4733 0.2317 -0.0608 -0.0177 119  ILE A CD1 
874  N N   . GLY A 120 ? 0.5381 0.8222 0.5239 0.2515 -0.0508 0.0239  120  GLY A N   
875  C CA  . GLY A 120 ? 0.6311 0.9213 0.6086 0.2613 -0.0460 0.0324  120  GLY A CA  
876  C C   . GLY A 120 ? 0.6609 0.9759 0.6294 0.2680 -0.0428 0.0319  120  GLY A C   
877  O O   . GLY A 120 ? 0.6698 0.9916 0.6308 0.2743 -0.0400 0.0342  120  GLY A O   
878  N N   . ALA A 121 ? 0.6006 0.9301 0.5701 0.2665 -0.0431 0.0288  121  ALA A N   
879  C CA  . ALA A 121 ? 0.7021 1.0567 0.6633 0.2729 -0.0396 0.0289  121  ALA A CA  
880  C C   . ALA A 121 ? 0.7982 1.1596 0.7564 0.2815 -0.0345 0.0423  121  ALA A C   
881  O O   . ALA A 121 ? 0.9590 1.3063 0.9228 0.2808 -0.0343 0.0495  121  ALA A O   
882  C CB  . ALA A 121 ? 0.6710 1.0385 0.6342 0.2675 -0.0421 0.0193  121  ALA A CB  
883  N N   . ARG A 122 ? 0.6003 0.9833 0.5499 0.2895 -0.0301 0.0457  122  ARG A N   
884  C CA  . ARG A 122 ? 0.7459 1.1393 0.6923 0.2979 -0.0248 0.0581  122  ARG A CA  
885  C C   . ARG A 122 ? 0.6692 1.0787 0.6172 0.2959 -0.0250 0.0559  122  ARG A C   
886  O O   . ARG A 122 ? 0.5792 1.0110 0.5218 0.2977 -0.0239 0.0510  122  ARG A O   
887  C CB  . ARG A 122 ? 0.8377 1.2472 0.7740 0.3080 -0.0198 0.0635  122  ARG A CB  
888  C CG  . ARG A 122 ? 1.1100 1.5054 1.0438 0.3111 -0.0190 0.0662  122  ARG A CG  
889  C CD  . ARG A 122 ? 1.2835 1.6617 1.2197 0.3155 -0.0162 0.0788  122  ARG A CD  
890  N NE  . ARG A 122 ? 1.4180 1.8094 1.3500 0.3248 -0.0103 0.0910  122  ARG A NE  
891  C CZ  . ARG A 122 ? 1.4568 1.8409 1.3930 0.3261 -0.0085 0.1001  122  ARG A CZ  
892  N NH1 . ARG A 122 ? 1.4816 1.8452 1.4263 0.3186 -0.0122 0.0983  122  ARG A NH1 
893  N NH2 . ARG A 122 ? 1.3568 1.7544 1.2888 0.3349 -0.0029 0.1112  122  ARG A NH2 
894  N N   . VAL A 123 ? 0.6625 1.0608 0.6181 0.2921 -0.0264 0.0594  123  VAL A N   
895  C CA  . VAL A 123 ? 0.7236 1.1325 0.6829 0.2876 -0.0281 0.0550  123  VAL A CA  
896  C C   . VAL A 123 ? 0.7021 1.1296 0.6576 0.2950 -0.0230 0.0650  123  VAL A C   
897  O O   . VAL A 123 ? 0.8374 1.2569 0.7941 0.2995 -0.0201 0.0768  123  VAL A O   
898  C CB  . VAL A 123 ? 0.7129 1.1004 0.6831 0.2791 -0.0325 0.0531  123  VAL A CB  
899  C CG1 . VAL A 123 ? 0.5190 0.9177 0.4935 0.2744 -0.0342 0.0485  123  VAL A CG1 
900  C CG2 . VAL A 123 ? 0.5156 0.8848 0.4902 0.2715 -0.0374 0.0435  123  VAL A CG2 
901  N N   . HIS A 124 ? 0.6103 1.0624 0.5611 0.2963 -0.0219 0.0604  124  HIS A N   
902  C CA  . HIS A 124 ? 0.7347 1.2068 0.6817 0.3032 -0.0170 0.0695  124  HIS A CA  
903  C C   . HIS A 124 ? 0.7848 1.2671 0.7363 0.2976 -0.0191 0.0643  124  HIS A C   
904  O O   . HIS A 124 ? 0.8134 1.3119 0.7628 0.2946 -0.0206 0.0540  124  HIS A O   
905  C CB  . HIS A 124 ? 0.7127 1.2092 0.6494 0.3115 -0.0125 0.0713  124  HIS A CB  
906  C CG  . HIS A 124 ? 0.6757 1.1644 0.6077 0.3164 -0.0108 0.0741  124  HIS A CG  
907  N ND1 . HIS A 124 ? 0.7862 1.2796 0.7138 0.3152 -0.0124 0.0644  124  HIS A ND1 
908  C CD2 . HIS A 124 ? 0.7315 1.2076 0.6625 0.3225 -0.0077 0.0854  124  HIS A CD2 
909  C CE1 . HIS A 124 ? 0.7755 1.2603 0.6996 0.3204 -0.0105 0.0696  124  HIS A CE1 
910  N NE2 . HIS A 124 ? 0.7588 1.2329 0.6849 0.3249 -0.0076 0.0823  124  HIS A NE2 
911  N N   . PRO A 125 ? 0.6999 1.1728 0.6576 0.2963 -0.0191 0.0715  125  PRO A N   
912  C CA  . PRO A 125 ? 0.7027 1.1826 0.6658 0.2905 -0.0215 0.0667  125  PRO A CA  
913  C C   . PRO A 125 ? 0.7873 1.2939 0.7456 0.2961 -0.0171 0.0724  125  PRO A C   
914  O O   . PRO A 125 ? 0.9041 1.4124 0.8612 0.3026 -0.0128 0.0857  125  PRO A O   
915  C CB  . PRO A 125 ? 0.6285 1.0842 0.6007 0.2867 -0.0235 0.0722  125  PRO A CB  
916  C CG  . PRO A 125 ? 0.6342 1.0784 0.6034 0.2940 -0.0196 0.0846  125  PRO A CG  
917  C CD  . PRO A 125 ? 0.6810 1.1312 0.6423 0.2985 -0.0181 0.0821  125  PRO A CD  
918  N N   . MET A 126 ? 0.6980 1.2250 0.6538 0.2935 -0.0181 0.0624  126  MET A N   
919  C CA  . MET A 126 ? 0.6922 1.2449 0.6448 0.2968 -0.0148 0.0658  126  MET A CA  
920  C C   . MET A 126 ? 0.8014 1.3472 0.7627 0.2906 -0.0175 0.0656  126  MET A C   
921  O O   . MET A 126 ? 0.8891 1.4364 0.8547 0.2828 -0.0216 0.0537  126  MET A O   
922  C CB  . MET A 126 ? 0.7306 1.3069 0.6778 0.2953 -0.0152 0.0537  126  MET A CB  
923  C CG  . MET A 126 ? 0.4278 1.0191 0.3653 0.3023 -0.0118 0.0540  126  MET A CG  
924  S SD  . MET A 126 ? 0.9361 1.5550 0.8680 0.2998 -0.0124 0.0391  126  MET A SD  
925  C CE  . MET A 126 ? 0.8249 1.4231 0.7649 0.2877 -0.0200 0.0224  126  MET A CE  
926  N N   . THR A 127 ? 0.7074 1.2452 0.6715 0.2940 -0.0151 0.0785  127  THR A N   
927  C CA  . THR A 127 ? 0.6017 1.1301 0.5748 0.2879 -0.0179 0.0785  127  THR A CA  
928  C C   . THR A 127 ? 0.8050 1.3582 0.7770 0.2887 -0.0159 0.0799  127  THR A C   
929  O O   . THR A 127 ? 0.9058 1.4782 0.8714 0.2966 -0.0105 0.0896  127  THR A O   
930  C CB  . THR A 127 ? 0.6760 1.1820 0.6534 0.2904 -0.0166 0.0914  127  THR A CB  
931  O OG1 . THR A 127 ? 0.7684 1.2564 0.7441 0.2925 -0.0167 0.0928  127  THR A OG1 
932  C CG2 . THR A 127 ? 0.7400 1.2286 0.7284 0.2821 -0.0212 0.0882  127  THR A CG2 
933  N N   . LYS A 128 ? 0.8388 1.3915 0.8175 0.2804 -0.0201 0.0705  128  LYS A N   
934  C CA  . LYS A 128 ? 0.7588 1.3323 0.7379 0.2799 -0.0188 0.0713  128  LYS A CA  
935  C C   . LYS A 128 ? 0.8102 1.3686 0.8001 0.2731 -0.0223 0.0710  128  LYS A C   
936  O O   . LYS A 128 ? 0.9184 1.4541 0.9157 0.2664 -0.0270 0.0644  128  LYS A O   
937  C CB  . LYS A 128 ? 0.7246 1.3205 0.6998 0.2768 -0.0199 0.0576  128  LYS A CB  
938  C CG  . LYS A 128 ? 0.8483 1.4710 0.8122 0.2850 -0.0146 0.0612  128  LYS A CG  
939  C CD  . LYS A 128 ? 0.9537 1.6030 0.9139 0.2825 -0.0148 0.0499  128  LYS A CD  
940  C CE  . LYS A 128 ? 1.0776 1.7537 1.0266 0.2907 -0.0096 0.0531  128  LYS A CE  
941  N NZ  . LYS A 128 ? 1.1268 1.8162 1.0724 0.2992 -0.0037 0.0697  128  LYS A NZ  
942  N N   . ASP A 129 ? 0.8593 1.4310 0.8499 0.2750 -0.0198 0.0784  129  ASP A N   
943  C CA  . ASP A 129 ? 0.9128 1.4751 0.9132 0.2687 -0.0228 0.0778  129  ASP A CA  
944  C C   . ASP A 129 ? 0.8567 1.4193 0.8625 0.2591 -0.0282 0.0608  129  ASP A C   
945  O O   . ASP A 129 ? 0.8454 1.4247 0.8458 0.2584 -0.0283 0.0509  129  ASP A O   
946  C CB  . ASP A 129 ? 0.9576 1.5405 0.9560 0.2728 -0.0188 0.0876  129  ASP A CB  
947  C CG  . ASP A 129 ? 0.9723 1.5436 0.9711 0.2791 -0.0151 0.1047  129  ASP A CG  
948  O OD1 . ASP A 129 ? 0.9643 1.5144 0.9631 0.2816 -0.0149 0.1093  129  ASP A OD1 
949  O OD2 . ASP A 129 ? 0.9114 1.4945 0.9106 0.2815 -0.0123 0.1134  129  ASP A OD2 
950  N N   . PRO A 130 ? 0.7924 1.3360 0.8091 0.2517 -0.0325 0.0572  130  PRO A N   
951  C CA  . PRO A 130 ? 0.7727 1.3152 0.7955 0.2425 -0.0374 0.0413  130  PRO A CA  
952  C C   . PRO A 130 ? 0.7233 1.2936 0.7431 0.2416 -0.0362 0.0360  130  PRO A C   
953  O O   . PRO A 130 ? 0.7405 1.3215 0.7617 0.2432 -0.0341 0.0435  130  PRO A O   
954  C CB  . PRO A 130 ? 0.8193 1.3389 0.8543 0.2363 -0.0411 0.0423  130  PRO A CB  
955  C CG  . PRO A 130 ? 0.8443 1.3611 0.8790 0.2425 -0.0375 0.0587  130  PRO A CG  
956  C CD  . PRO A 130 ? 0.8057 1.3282 0.8296 0.2517 -0.0328 0.0675  130  PRO A CD  
957  N N   . GLY A 131 ? 0.7292 1.3114 0.7450 0.2392 -0.0373 0.0230  131  GLY A N   
958  C CA  . GLY A 131 ? 0.6516 1.2620 0.6627 0.2392 -0.0356 0.0172  131  GLY A CA  
959  C C   . GLY A 131 ? 0.5991 1.2288 0.5980 0.2457 -0.0320 0.0167  131  GLY A C   
960  O O   . GLY A 131 ? 0.4892 1.1415 0.4830 0.2453 -0.0311 0.0084  131  GLY A O   
961  N N   . GLY A 132 ? 0.6621 1.2828 0.6566 0.2517 -0.0300 0.0253  132  GLY A N   
962  C CA  . GLY A 132 ? 0.6607 1.2998 0.6438 0.2589 -0.0261 0.0267  132  GLY A CA  
963  C C   . GLY A 132 ? 0.7465 1.3851 0.7268 0.2556 -0.0286 0.0119  132  GLY A C   
964  O O   . GLY A 132 ? 0.8786 1.4961 0.8656 0.2490 -0.0332 0.0032  132  GLY A O   
965  N N   . HIS A 133 ? 0.8184 1.4806 0.7888 0.2603 -0.0254 0.0090  133  HIS A N   
966  C CA  . HIS A 133 ? 0.9270 1.5890 0.8936 0.2586 -0.0271 -0.0036 133  HIS A CA  
967  C C   . HIS A 133 ? 0.9878 1.6625 0.9438 0.2675 -0.0226 0.0029  133  HIS A C   
968  O O   . HIS A 133 ? 0.9934 1.6784 0.9453 0.2748 -0.0181 0.0166  133  HIS A O   
969  C CB  . HIS A 133 ? 0.8305 1.5083 0.7967 0.2532 -0.0289 -0.0192 133  HIS A CB  
970  C CG  . HIS A 133 ? 0.8103 1.5213 0.7667 0.2585 -0.0244 -0.0193 133  HIS A CG  
971  N ND1 . HIS A 133 ? 0.7831 1.5135 0.7388 0.2599 -0.0219 -0.0138 133  HIS A ND1 
972  C CD2 . HIS A 133 ? 0.8542 1.5833 0.8013 0.2625 -0.0221 -0.0244 133  HIS A CD2 
973  C CE1 . HIS A 133 ? 0.8839 1.6430 0.8300 0.2645 -0.0181 -0.0155 133  HIS A CE1 
974  N NE2 . HIS A 133 ? 0.9683 1.7273 0.9092 0.2663 -0.0182 -0.0220 133  HIS A NE2 
975  N N   . TYR A 134 ? 0.8602 1.5340 0.8122 0.2670 -0.0237 -0.0067 134  TYR A N   
976  C CA  . TYR A 134 ? 0.8037 1.4876 0.7465 0.2753 -0.0197 -0.0006 134  TYR A CA  
977  C C   . TYR A 134 ? 0.9149 1.6275 0.8485 0.2780 -0.0172 -0.0088 134  TYR A C   
978  O O   . TYR A 134 ? 0.8881 1.6034 0.8221 0.2726 -0.0201 -0.0240 134  TYR A O   
979  C CB  . TYR A 134 ? 0.7275 1.3864 0.6720 0.2746 -0.0220 -0.0014 134  TYR A CB  
980  C CG  . TYR A 134 ? 0.8384 1.4710 0.7903 0.2737 -0.0234 0.0091  134  TYR A CG  
981  C CD1 . TYR A 134 ? 0.8001 1.4329 0.7495 0.2815 -0.0191 0.0253  134  TYR A CD1 
982  C CD2 . TYR A 134 ? 0.7792 1.3869 0.7410 0.2653 -0.0287 0.0027  134  TYR A CD2 
983  C CE1 . TYR A 134 ? 0.7262 1.3345 0.6822 0.2808 -0.0202 0.0345  134  TYR A CE1 
984  C CE2 . TYR A 134 ? 0.6765 1.2607 0.6451 0.2644 -0.0299 0.0119  134  TYR A CE2 
985  C CZ  . TYR A 134 ? 0.7626 1.3470 0.7282 0.2722 -0.0256 0.0276  134  TYR A CZ  
986  O OH  . TYR A 134 ? 0.7366 1.2974 0.7089 0.2714 -0.0267 0.0363  134  TYR A OH  
987  N N   . THR A 135 ? 1.0077 1.7421 0.9332 0.2866 -0.0117 0.0013  135  THR A N   
988  C CA  . THR A 135 ? 0.9616 1.7253 0.8778 0.2902 -0.0087 -0.0050 135  THR A CA  
989  C C   . THR A 135 ? 0.8971 1.6585 0.8075 0.2938 -0.0080 -0.0078 135  THR A C   
990  O O   . THR A 135 ? 0.9303 1.6735 0.8418 0.2967 -0.0078 0.0004  135  THR A O   
991  C CB  . THR A 135 ? 0.8520 1.6426 0.7622 0.2979 -0.0027 0.0072  135  THR A CB  
992  O OG1 . THR A 135 ? 0.8254 1.6066 0.7352 0.3049 0.0005  0.0235  135  THR A OG1 
993  C CG2 . THR A 135 ? 0.7691 1.5667 0.6840 0.2942 -0.0032 0.0086  135  THR A CG2 
994  N N   . LEU A 136 ? 0.8873 1.6678 0.7916 0.2936 -0.0075 -0.0196 136  LEU A N   
995  C CA  . LEU A 136 ? 0.9282 1.7093 0.8285 0.2964 -0.0073 -0.0226 136  LEU A CA  
996  C C   . LEU A 136 ? 1.0119 1.7965 0.9062 0.3064 -0.0022 -0.0068 136  LEU A C   
997  O O   . LEU A 136 ? 0.9616 1.7347 0.8533 0.3090 -0.0021 -0.0060 136  LEU A O   
998  C CB  . LEU A 136 ? 0.8973 1.6977 0.7996 0.2935 -0.0090 -0.0314 136  LEU A CB  
999  C CG  . LEU A 136 ? 0.7835 1.5771 0.6902 0.2858 -0.0139 -0.0486 136  LEU A CG  
1000 C CD1 . LEU A 136 ? 0.7008 1.4674 0.6094 0.2819 -0.0170 -0.0552 136  LEU A CD1 
1001 C CD2 . LEU A 136 ? 0.7263 1.5315 0.6381 0.2793 -0.0162 -0.0588 136  LEU A CD2 
1002 N N   . GLN A 137 ? 1.0180 1.8185 0.9105 0.3120 0.0021  0.0057  137  GLN A N   
1003 C CA  . GLN A 137 ? 1.0687 1.8752 0.9563 0.3219 0.0076  0.0214  137  GLN A CA  
1004 C C   . GLN A 137 ? 0.9214 1.6990 0.8140 0.3232 0.0070  0.0323  137  GLN A C   
1005 O O   . GLN A 137 ? 0.8747 1.6454 0.7643 0.3287 0.0089  0.0385  137  GLN A O   
1006 C CB  . GLN A 137 ? 1.3187 2.1492 1.2060 0.3262 0.0114  0.0314  137  GLN A CB  
1007 C CG  . GLN A 137 ? 1.4659 2.2966 1.3560 0.3236 0.0119  0.0347  137  GLN A CG  
1008 C CD  . GLN A 137 ? 1.5395 2.3572 1.4335 0.3285 0.0145  0.0525  137  GLN A CD  
1009 O OE1 . GLN A 137 ? 1.4775 2.2990 1.3676 0.3370 0.0190  0.0641  137  GLN A OE1 
1010 N NE2 . GLN A 137 ? 1.6242 2.4268 1.5259 0.3233 0.0118  0.0546  137  GLN A NE2 
1011 N N   . GLU A 138 ? 0.8527 1.6132 0.7535 0.3179 0.0042  0.0348  138  GLU A N   
1012 C CA  . GLU A 138 ? 0.8519 1.5833 0.7591 0.3180 0.0029  0.0445  138  GLU A CA  
1013 C C   . GLU A 138 ? 0.9179 1.6274 0.8258 0.3154 -0.0004 0.0379  138  GLU A C   
1014 O O   . GLU A 138 ? 0.8787 1.5710 0.7874 0.3191 0.0005  0.0469  138  GLU A O   
1015 C CB  . GLU A 138 ? 0.8211 1.5367 0.7376 0.3108 -0.0007 0.0443  138  GLU A CB  
1016 C CG  . GLU A 138 ? 0.8125 1.5329 0.7307 0.3157 0.0032  0.0600  138  GLU A CG  
1017 C CD  . GLU A 138 ? 0.9591 1.6897 0.8813 0.3106 0.0019  0.0567  138  GLU A CD  
1018 O OE1 . GLU A 138 ? 1.0867 1.8322 1.0070 0.3061 0.0001  0.0435  138  GLU A OE1 
1019 O OE2 . GLU A 138 ? 0.9070 1.6309 0.8344 0.3109 0.0027  0.0669  138  GLU A OE2 
1020 N N   . VAL A 139 ? 1.0179 1.7287 0.9255 0.3092 -0.0042 0.0220  139  VAL A N   
1021 C CA  . VAL A 139 ? 0.9330 1.6257 0.8411 0.3062 -0.0075 0.0140  139  VAL A CA  
1022 C C   . VAL A 139 ? 0.8478 1.5536 0.7468 0.3139 -0.0038 0.0162  139  VAL A C   
1023 O O   . VAL A 139 ? 0.7083 1.3975 0.6072 0.3161 -0.0039 0.0203  139  VAL A O   
1024 C CB  . VAL A 139 ? 0.8868 1.5754 0.7986 0.2968 -0.0127 -0.0037 139  VAL A CB  
1025 C CG1 . VAL A 139 ? 0.9419 1.6165 0.8528 0.2945 -0.0155 -0.0125 139  VAL A CG1 
1026 C CG2 . VAL A 139 ? 0.8200 1.4900 0.7420 0.2890 -0.0169 -0.0053 139  VAL A CG2 
1027 N N   . GLU A 140 ? 0.8327 1.5686 0.7242 0.3182 -0.0003 0.0137  140  GLU A N   
1028 C CA  . GLU A 140 ? 0.8648 1.6162 0.7476 0.3264 0.0040  0.0174  140  GLU A CA  
1029 C C   . GLU A 140 ? 0.8183 1.5617 0.7008 0.3343 0.0079  0.0348  140  GLU A C   
1030 O O   . GLU A 140 ? 0.7665 1.5000 0.6467 0.3380 0.0085  0.0377  140  GLU A O   
1031 C CB  . GLU A 140 ? 0.7976 1.5798 0.6773 0.3284 0.0059  0.0147  140  GLU A CB  
1032 C CG  . GLU A 140 ? 0.7158 1.5114 0.5915 0.3359 0.0090  0.0213  140  GLU A CG  
1033 C CD  . GLU A 140 ? 0.7588 1.5707 0.6363 0.3323 0.0061  0.0107  140  GLU A CD  
1034 O OE1 . GLU A 140 ? 0.7523 1.5793 0.6329 0.3284 0.0048  0.0059  140  GLU A OE1 
1035 O OE2 . GLU A 140 ? 0.7214 1.5313 0.5973 0.3334 0.0051  0.0071  140  GLU A OE2 
1036 N N   . GLU A 141 ? 0.7043 1.4502 0.5899 0.3365 0.0102  0.0460  141  GLU A N   
1037 C CA  . GLU A 141 ? 0.7137 1.4511 0.6000 0.3439 0.0140  0.0630  141  GLU A CA  
1038 C C   . GLU A 141 ? 0.7769 1.4804 0.6684 0.3415 0.0108  0.0652  141  GLU A C   
1039 O O   . GLU A 141 ? 0.7776 1.4750 0.6660 0.3476 0.0133  0.0722  141  GLU A O   
1040 C CB  . GLU A 141 ? 0.9577 1.7007 0.8478 0.3448 0.0161  0.0729  141  GLU A CB  
1041 C CG  . GLU A 141 ? 1.1300 1.8597 1.0227 0.3511 0.0194  0.0900  141  GLU A CG  
1042 C CD  . GLU A 141 ? 1.2318 1.9737 1.1268 0.3536 0.0227  0.1005  141  GLU A CD  
1043 O OE1 . GLU A 141 ? 1.2372 2.0092 1.1273 0.3574 0.0264  0.1016  141  GLU A OE1 
1044 O OE2 . GLU A 141 ? 1.2551 1.9768 1.1568 0.3517 0.0215  0.1077  141  GLU A OE2 
1045 N N   . GLY A 142 ? 0.8399 1.5217 0.7393 0.3324 0.0055  0.0589  142  GLY A N   
1046 C CA  . GLY A 142 ? 0.6276 1.2777 0.5324 0.3289 0.0020  0.0593  142  GLY A CA  
1047 C C   . GLY A 142 ? 0.5191 1.1642 0.4200 0.3283 0.0003  0.0506  142  GLY A C   
1048 O O   . GLY A 142 ? 0.5785 1.2053 0.4799 0.3303 0.0002  0.0551  142  GLY A O   
1049 N N   . LEU A 143 ? 0.6186 1.2801 0.5157 0.3255 -0.0010 0.0379  143  LEU A N   
1050 C CA  . LEU A 143 ? 0.8354 1.4951 0.7284 0.3251 -0.0025 0.0289  143  LEU A CA  
1051 C C   . LEU A 143 ? 0.9333 1.6051 0.8183 0.3354 0.0027  0.0378  143  LEU A C   
1052 O O   . LEU A 143 ? 0.9639 1.6223 0.8477 0.3366 0.0021  0.0377  143  LEU A O   
1053 C CB  . LEU A 143 ? 0.9536 1.6296 0.8441 0.3202 -0.0046 0.0133  143  LEU A CB  
1054 C CG  . LEU A 143 ? 0.9178 1.5767 0.8156 0.3092 -0.0109 -0.0005 143  LEU A CG  
1055 C CD1 . LEU A 143 ? 0.9190 1.5876 0.8129 0.3064 -0.0126 -0.0154 143  LEU A CD1 
1056 C CD2 . LEU A 143 ? 0.8282 1.4544 0.7333 0.3049 -0.0146 0.0019  143  LEU A CD2 
1057 N N   . ALA A 144 ? 0.9000 1.5976 0.7799 0.3427 0.0080  0.0453  144  ALA A N   
1058 C CA  . ALA A 144 ? 0.8522 1.5639 0.7247 0.3530 0.0134  0.0542  144  ALA A CA  
1059 C C   . ALA A 144 ? 0.9113 1.6021 0.7864 0.3577 0.0151  0.0678  144  ALA A C   
1060 O O   . ALA A 144 ? 0.8521 1.5385 0.7235 0.3626 0.0166  0.0707  144  ALA A O   
1061 C CB  . ALA A 144 ? 0.7271 1.4710 0.5945 0.3594 0.0187  0.0599  144  ALA A CB  
1062 N N   . GLN A 145 ? 0.8918 1.5694 0.7733 0.3561 0.0148  0.0758  145  GLN A N   
1063 C CA  . GLN A 145 ? 0.8192 1.4762 0.7036 0.3604 0.0166  0.0887  145  GLN A CA  
1064 C C   . GLN A 145 ? 0.8376 1.4652 0.7254 0.3557 0.0123  0.0840  145  GLN A C   
1065 O O   . GLN A 145 ? 0.8353 1.4550 0.7204 0.3615 0.0145  0.0904  145  GLN A O   
1066 C CB  . GLN A 145 ? 0.8500 1.4997 0.7406 0.3595 0.0172  0.0978  145  GLN A CB  
1067 C CG  . GLN A 145 ? 0.8890 1.5149 0.7832 0.3632 0.0187  0.1104  145  GLN A CG  
1068 C CD  . GLN A 145 ? 0.9366 1.5534 0.8374 0.3614 0.0189  0.1185  145  GLN A CD  
1069 O OE1 . GLN A 145 ? 0.8610 1.4899 0.7640 0.3572 0.0178  0.1147  145  GLN A OE1 
1070 N NE2 . GLN A 145 ? 0.8594 1.4548 0.7636 0.3644 0.0203  0.1293  145  GLN A NE2 
1071 N N   . HIS A 146 ? 0.6886 1.3003 0.5822 0.3455 0.0063  0.0729  146  HIS A N   
1072 C CA  . HIS A 146 ? 0.5081 1.0905 0.4062 0.3406 0.0023  0.0696  146  HIS A CA  
1073 C C   . HIS A 146 ? 0.5686 1.1489 0.4642 0.3363 -0.0012 0.0563  146  HIS A C   
1074 O O   . HIS A 146 ? 0.5061 1.0634 0.4052 0.3323 -0.0045 0.0534  146  HIS A O   
1075 C CB  . HIS A 146 ? 0.6939 1.2548 0.6016 0.3320 -0.0022 0.0677  146  HIS A CB  
1076 C CG  . HIS A 146 ? 0.7276 1.2884 0.6386 0.3349 0.0006  0.0797  146  HIS A CG  
1077 N ND1 . HIS A 146 ? 0.6865 1.2307 0.5994 0.3395 0.0030  0.0923  146  HIS A ND1 
1078 C CD2 . HIS A 146 ? 0.7622 1.3365 0.6751 0.3336 0.0013  0.0808  146  HIS A CD2 
1079 C CE1 . HIS A 146 ? 0.7586 1.3063 0.6746 0.3411 0.0052  0.1010  146  HIS A CE1 
1080 N NE2 . HIS A 146 ? 0.7615 1.3276 0.6776 0.3375 0.0041  0.0943  146  HIS A NE2 
1081 N N   . LYS A 147 ? 0.7714 1.3756 0.6613 0.3371 -0.0005 0.0482  147  LYS A N   
1082 C CA  . LYS A 147 ? 0.9588 1.5635 0.8459 0.3333 -0.0034 0.0351  147  LYS A CA  
1083 C C   . LYS A 147 ? 0.8784 1.4569 0.7731 0.3229 -0.0098 0.0255  147  LYS A C   
1084 O O   . LYS A 147 ? 0.7716 1.3355 0.6661 0.3218 -0.0116 0.0226  147  LYS A O   
1085 C CB  . LYS A 147 ? 1.0156 1.6229 0.8961 0.3409 -0.0004 0.0396  147  LYS A CB  
1086 C CG  . LYS A 147 ? 1.0914 1.7176 0.9660 0.3521 0.0062  0.0530  147  LYS A CG  
1087 C CD  . LYS A 147 ? 1.0716 1.6951 0.9409 0.3593 0.0088  0.0582  147  LYS A CD  
1088 C CE  . LYS A 147 ? 0.9091 1.5509 0.7733 0.3707 0.0156  0.0720  147  LYS A CE  
1089 N NZ  . LYS A 147 ? 0.9924 1.6655 0.8521 0.3732 0.0183  0.0697  147  LYS A NZ  
1090 N N   . PRO A 148 ? 0.7994 1.3720 0.7010 0.3155 -0.0131 0.0208  148  PRO A N   
1091 C CA  . PRO A 148 ? 0.6555 1.2027 0.5652 0.3059 -0.0189 0.0129  148  PRO A CA  
1092 C C   . PRO A 148 ? 0.5131 1.0604 0.4216 0.3006 -0.0223 -0.0018 148  PRO A C   
1093 O O   . PRO A 148 ? 0.5940 1.1625 0.4972 0.3019 -0.0212 -0.0089 148  PRO A O   
1094 C CB  . PRO A 148 ? 0.8272 1.3744 0.7435 0.3004 -0.0208 0.0113  148  PRO A CB  
1095 C CG  . PRO A 148 ? 0.9198 1.4857 0.8323 0.3080 -0.0157 0.0226  148  PRO A CG  
1096 C CD  . PRO A 148 ? 0.8345 1.4227 0.7371 0.3157 -0.0116 0.0231  148  PRO A CD  
1097 N N   . VAL A 149 ? 0.5864 1.1099 0.5003 0.2946 -0.0264 -0.0062 149  VAL A N   
1098 C CA  . VAL A 149 ? 0.7046 1.2240 0.6196 0.2879 -0.0304 -0.0206 149  VAL A CA  
1099 C C   . VAL A 149 ? 0.6479 1.1672 0.5694 0.2798 -0.0338 -0.0300 149  VAL A C   
1100 O O   . VAL A 149 ? 0.7507 1.2782 0.6713 0.2761 -0.0355 -0.0422 149  VAL A O   
1101 C CB  . VAL A 149 ? 0.7909 1.2845 0.7098 0.2840 -0.0335 -0.0216 149  VAL A CB  
1102 C CG1 . VAL A 149 ? 0.7516 1.2237 0.6785 0.2810 -0.0351 -0.0139 149  VAL A CG1 
1103 C CG2 . VAL A 149 ? 0.8133 1.2999 0.7354 0.2758 -0.0380 -0.0364 149  VAL A CG2 
1104 N N   . LEU A 150 ? 0.6246 1.1352 0.5525 0.2774 -0.0346 -0.0242 150  LEU A N   
1105 C CA  . LEU A 150 ? 0.5637 1.0718 0.4986 0.2696 -0.0380 -0.0324 150  LEU A CA  
1106 C C   . LEU A 150 ? 0.4975 1.0149 0.4342 0.2717 -0.0359 -0.0243 150  LEU A C   
1107 O O   . LEU A 150 ? 0.5990 1.1117 0.5357 0.2765 -0.0334 -0.0115 150  LEU A O   
1108 C CB  . LEU A 150 ? 0.4830 0.9630 0.4272 0.2612 -0.0430 -0.0364 150  LEU A CB  
1109 C CG  . LEU A 150 ? 0.5208 0.9933 0.4739 0.2527 -0.0468 -0.0436 150  LEU A CG  
1110 C CD1 . LEU A 150 ? 0.4336 0.9161 0.3861 0.2484 -0.0485 -0.0583 150  LEU A CD1 
1111 C CD2 . LEU A 150 ? 0.5065 0.9510 0.4684 0.2461 -0.0507 -0.0433 150  LEU A CD2 
1112 N N   . LEU A 151 ? 0.3991 0.9296 0.3371 0.2684 -0.0367 -0.0321 151  LEU A N   
1113 C CA  . LEU A 151 ? 0.4209 0.9567 0.3628 0.2678 -0.0360 -0.0268 151  LEU A CA  
1114 C C   . LEU A 151 ? 0.4869 1.0088 0.4387 0.2580 -0.0409 -0.0359 151  LEU A C   
1115 O O   . LEU A 151 ? 0.4657 0.9886 0.4186 0.2527 -0.0436 -0.0491 151  LEU A O   
1116 C CB  . LEU A 151 ? 0.3831 0.9494 0.3179 0.2729 -0.0321 -0.0270 151  LEU A CB  
1117 C CG  . LEU A 151 ? 0.5147 1.0890 0.4535 0.2713 -0.0318 -0.0242 151  LEU A CG  
1118 C CD1 . LEU A 151 ? 0.5226 1.0942 0.4618 0.2769 -0.0286 -0.0078 151  LEU A CD1 
1119 C CD2 . LEU A 151 ? 0.5394 1.1426 0.4727 0.2728 -0.0297 -0.0307 151  LEU A CD2 
1120 N N   . PHE A 152 ? 0.5054 1.0149 0.4642 0.2557 -0.0420 -0.0287 152  PHE A N   
1121 C CA  . PHE A 152 ? 0.6159 1.1146 0.5842 0.2470 -0.0461 -0.0361 152  PHE A CA  
1122 C C   . PHE A 152 ? 0.6166 1.1331 0.5855 0.2475 -0.0446 -0.0351 152  PHE A C   
1123 O O   . PHE A 152 ? 0.6709 1.1953 0.6377 0.2530 -0.0413 -0.0233 152  PHE A O   
1124 C CB  . PHE A 152 ? 0.5503 1.0218 0.5274 0.2428 -0.0489 -0.0304 152  PHE A CB  
1125 C CG  . PHE A 152 ? 0.6148 1.0781 0.6018 0.2354 -0.0522 -0.0342 152  PHE A CG  
1126 C CD1 . PHE A 152 ? 0.6383 1.1074 0.6279 0.2371 -0.0506 -0.0259 152  PHE A CD1 
1127 C CD2 . PHE A 152 ? 0.4651 0.9149 0.4588 0.2269 -0.0567 -0.0460 152  PHE A CD2 
1128 C CE1 . PHE A 152 ? 0.6203 1.0824 0.6189 0.2303 -0.0535 -0.0295 152  PHE A CE1 
1129 C CE2 . PHE A 152 ? 0.4776 0.9201 0.4804 0.2203 -0.0594 -0.0495 152  PHE A CE2 
1130 C CZ  . PHE A 152 ? 0.5308 0.9798 0.5361 0.2220 -0.0579 -0.0413 152  PHE A CZ  
1131 N N   . LEU A 153 ? 0.5660 1.0883 0.5380 0.2417 -0.0469 -0.0474 153  LEU A N   
1132 C CA  . LEU A 153 ? 0.5277 1.0642 0.5017 0.2406 -0.0462 -0.0476 153  LEU A CA  
1133 C C   . LEU A 153 ? 0.4145 0.9370 0.3990 0.2314 -0.0507 -0.0566 153  LEU A C   
1134 O O   . LEU A 153 ? 0.4142 0.9271 0.4016 0.2259 -0.0538 -0.0683 153  LEU A O   
1135 C CB  . LEU A 153 ? 0.5296 1.0951 0.4954 0.2442 -0.0433 -0.0538 153  LEU A CB  
1136 C CG  . LEU A 153 ? 0.6593 1.2448 0.6153 0.2540 -0.0379 -0.0425 153  LEU A CG  
1137 C CD1 . LEU A 153 ? 0.5167 1.1299 0.4643 0.2570 -0.0354 -0.0503 153  LEU A CD1 
1138 C CD2 . LEU A 153 ? 0.6671 1.2566 0.6251 0.2569 -0.0357 -0.0297 153  LEU A CD2 
1139 N N   . THR A 154 ? 0.5563 1.0776 0.5464 0.2299 -0.0509 -0.0507 154  THR A N   
1140 C CA  . THR A 154 ? 0.5403 1.0528 0.5400 0.2217 -0.0545 -0.0589 154  THR A CA  
1141 C C   . THR A 154 ? 0.5536 1.0887 0.5507 0.2209 -0.0536 -0.0684 154  THR A C   
1142 O O   . THR A 154 ? 0.5392 1.0934 0.5327 0.2249 -0.0506 -0.0624 154  THR A O   
1143 C CB  . THR A 154 ? 0.4861 0.9891 0.4931 0.2204 -0.0550 -0.0488 154  THR A CB  
1144 O OG1 . THR A 154 ? 0.4939 0.9785 0.5023 0.2226 -0.0550 -0.0382 154  THR A OG1 
1145 C CG2 . THR A 154 ? 0.4276 0.9179 0.4453 0.2114 -0.0592 -0.0578 154  THR A CG2 
1146 N N   . HIS A 155 ? 0.5926 1.1260 0.5915 0.2158 -0.0559 -0.0831 155  HIS A N   
1147 C CA  . HIS A 155 ? 0.4253 0.9784 0.4230 0.2142 -0.0553 -0.0933 155  HIS A CA  
1148 C C   . HIS A 155 ? 0.4995 1.0514 0.5049 0.2103 -0.0563 -0.0914 155  HIS A C   
1149 O O   . HIS A 155 ? 0.5910 1.1606 0.5935 0.2139 -0.0536 -0.0846 155  HIS A O   
1150 C CB  . HIS A 155 ? 0.3175 0.8656 0.3171 0.2092 -0.0577 -0.1097 155  HIS A CB  
1151 C CG  . HIS A 155 ? 0.4608 1.0303 0.4582 0.2084 -0.0565 -0.1209 155  HIS A CG  
1152 N ND1 . HIS A 155 ? 0.3151 0.8808 0.3161 0.2033 -0.0586 -0.1366 155  HIS A ND1 
1153 C CD2 . HIS A 155 ? 0.3264 0.9218 0.3182 0.2122 -0.0534 -0.1190 155  HIS A CD2 
1154 C CE1 . HIS A 155 ? 0.4529 1.0407 0.4507 0.2040 -0.0568 -0.1442 155  HIS A CE1 
1155 N NE2 . HIS A 155 ? 0.3258 0.9324 0.3178 0.2092 -0.0537 -0.1337 155  HIS A NE2 
1156 N N   . GLY A 156 ? 0.4618 0.9930 0.4772 0.2029 -0.0602 -0.0974 156  GLY A N   
1157 C CA  . GLY A 156 ? 0.4989 1.0268 0.5225 0.1985 -0.0616 -0.0965 156  GLY A CA  
1158 C C   . GLY A 156 ? 0.4562 0.9676 0.4850 0.1988 -0.0622 -0.0827 156  GLY A C   
1159 O O   . GLY A 156 ? 0.4256 0.9133 0.4610 0.1946 -0.0652 -0.0828 156  GLY A O   
1160 N N   . GLU A 157 ? 0.4058 0.9298 0.4315 0.2040 -0.0593 -0.0707 157  GLU A N   
1161 C CA  . GLU A 157 ? 0.5155 1.0245 0.5464 0.2047 -0.0596 -0.0575 157  GLU A CA  
1162 C C   . GLU A 157 ? 0.6328 1.1311 0.6750 0.1978 -0.0625 -0.0597 157  GLU A C   
1163 O O   . GLU A 157 ? 0.5401 1.0512 0.5839 0.1981 -0.0612 -0.0565 157  GLU A O   
1164 C CB  . GLU A 157 ? 0.5472 1.0724 0.5714 0.2128 -0.0552 -0.0436 157  GLU A CB  
1165 C CG  . GLU A 157 ? 0.5933 1.1051 0.6153 0.2178 -0.0540 -0.0315 157  GLU A CG  
1166 C CD  . GLU A 157 ? 0.5633 1.0486 0.5955 0.2135 -0.0569 -0.0264 157  GLU A CD  
1167 O OE1 . GLU A 157 ? 0.5190 0.9987 0.5601 0.2075 -0.0594 -0.0296 157  GLU A OE1 
1168 O OE2 . GLU A 157 ? 0.5230 0.9935 0.5542 0.2162 -0.0567 -0.0193 157  GLU A OE2 
1169 N N   . SER A 158 ? 0.6132 1.0885 0.6632 0.1915 -0.0662 -0.0652 158  SER A N   
1170 C CA  . SER A 158 ? 0.5115 0.9763 0.5724 0.1845 -0.0690 -0.0685 158  SER A CA  
1171 C C   . SER A 158 ? 0.3548 0.8139 0.4209 0.1857 -0.0684 -0.0549 158  SER A C   
1172 O O   . SER A 158 ? 0.3853 0.8409 0.4598 0.1810 -0.0700 -0.0561 158  SER A O   
1173 C CB  . SER A 158 ? 0.4336 0.8748 0.5011 0.1777 -0.0729 -0.0770 158  SER A CB  
1174 O OG  . SER A 158 ? 0.4886 0.9108 0.5573 0.1786 -0.0737 -0.0687 158  SER A OG  
1175 N N   . SER A 159 ? 0.4210 0.8788 0.4825 0.1921 -0.0662 -0.0422 159  SER A N   
1176 C CA  . SER A 159 ? 0.3667 0.8179 0.4334 0.1937 -0.0654 -0.0293 159  SER A CA  
1177 C C   . SER A 159 ? 0.4885 0.9629 0.5519 0.1979 -0.0621 -0.0234 159  SER A C   
1178 O O   . SER A 159 ? 0.4915 0.9633 0.5608 0.1976 -0.0618 -0.0155 159  SER A O   
1179 C CB  . SER A 159 ? 0.4755 0.9119 0.5400 0.1984 -0.0644 -0.0180 159  SER A CB  
1180 O OG  . SER A 159 ? 0.4670 0.9184 0.5201 0.2070 -0.0603 -0.0114 159  SER A OG  
1181 N N   . THR A 160 ? 0.6172 1.1146 0.6712 0.2017 -0.0595 -0.0275 160  THR A N   
1182 C CA  . THR A 160 ? 0.5624 1.0841 0.6119 0.2062 -0.0559 -0.0216 160  THR A CA  
1183 C C   . THR A 160 ? 0.5736 1.1154 0.6218 0.2029 -0.0559 -0.0338 160  THR A C   
1184 O O   . THR A 160 ? 0.5984 1.1589 0.6453 0.2045 -0.0537 -0.0304 160  THR A O   
1185 C CB  . THR A 160 ? 0.4692 1.0049 0.5070 0.2156 -0.0513 -0.0120 160  THR A CB  
1186 O OG1 . THR A 160 ? 0.4888 1.0323 0.5190 0.2167 -0.0511 -0.0213 160  THR A OG1 
1187 C CG2 . THR A 160 ? 0.4270 0.9437 0.4656 0.2197 -0.0505 0.0009  160  THR A CG2 
1188 N N   . GLY A 161 ? 0.5592 1.0972 0.6076 0.1984 -0.0584 -0.0479 161  GLY A N   
1189 C CA  . GLY A 161 ? 0.4618 1.0174 0.5086 0.1955 -0.0584 -0.0610 161  GLY A CA  
1190 C C   . GLY A 161 ? 0.4955 1.0754 0.5299 0.2016 -0.0549 -0.0628 161  GLY A C   
1191 O O   . GLY A 161 ? 0.5338 1.1325 0.5651 0.2005 -0.0540 -0.0726 161  GLY A O   
1192 N N   . VAL A 162 ? 0.4110 0.9906 0.4383 0.2082 -0.0526 -0.0536 162  VAL A N   
1193 C CA  . VAL A 162 ? 0.4231 1.0257 0.4385 0.2146 -0.0490 -0.0539 162  VAL A CA  
1194 C C   . VAL A 162 ? 0.4751 1.0758 0.4872 0.2127 -0.0505 -0.0676 162  VAL A C   
1195 O O   . VAL A 162 ? 0.5322 1.1113 0.5475 0.2104 -0.0530 -0.0697 162  VAL A O   
1196 C CB  . VAL A 162 ? 0.5651 1.1684 0.5739 0.2228 -0.0456 -0.0387 162  VAL A CB  
1197 C CG1 . VAL A 162 ? 0.5804 1.2067 0.5769 0.2293 -0.0420 -0.0401 162  VAL A CG1 
1198 C CG2 . VAL A 162 ? 0.6101 1.2175 0.6209 0.2259 -0.0434 -0.0244 162  VAL A CG2 
1199 N N   . LEU A 163 ? 0.5140 1.1376 0.5197 0.2137 -0.0488 -0.0768 163  LEU A N   
1200 C CA  . LEU A 163 ? 0.5791 1.2057 0.5797 0.2138 -0.0491 -0.0884 163  LEU A CA  
1201 C C   . LEU A 163 ? 0.6792 1.3227 0.6680 0.2223 -0.0450 -0.0813 163  LEU A C   
1202 O O   . LEU A 163 ? 0.7302 1.3991 0.7120 0.2269 -0.0414 -0.0778 163  LEU A O   
1203 C CB  . LEU A 163 ? 0.4982 1.1396 0.4989 0.2099 -0.0495 -0.1039 163  LEU A CB  
1204 C CG  . LEU A 163 ? 0.4786 1.1259 0.4742 0.2100 -0.0495 -0.1172 163  LEU A CG  
1205 C CD1 . LEU A 163 ? 0.4941 1.1133 0.4965 0.2050 -0.0534 -0.1241 163  LEU A CD1 
1206 C CD2 . LEU A 163 ? 0.3424 1.0095 0.3370 0.2075 -0.0489 -0.1308 163  LEU A CD2 
1207 N N   . GLN A 164 ? 0.7411 1.3706 0.7279 0.2242 -0.0455 -0.0793 164  GLN A N   
1208 C CA  . GLN A 164 ? 0.6084 1.2506 0.5846 0.2321 -0.0419 -0.0731 164  GLN A CA  
1209 C C   . GLN A 164 ? 0.7712 1.4315 0.7401 0.2331 -0.0409 -0.0859 164  GLN A C   
1210 O O   . GLN A 164 ? 0.8098 1.4599 0.7820 0.2280 -0.0438 -0.0990 164  GLN A O   
1211 C CB  . GLN A 164 ? 0.5478 1.1664 0.5255 0.2333 -0.0432 -0.0665 164  GLN A CB  
1212 C CG  . GLN A 164 ? 0.6628 1.2901 0.6306 0.2401 -0.0402 -0.0635 164  GLN A CG  
1213 C CD  . GLN A 164 ? 0.6762 1.3252 0.6358 0.2487 -0.0350 -0.0506 164  GLN A CD  
1214 O OE1 . GLN A 164 ? 0.4823 1.1253 0.4439 0.2517 -0.0336 -0.0368 164  GLN A OE1 
1215 N NE2 . GLN A 164 ? 0.5894 1.2643 0.5399 0.2529 -0.0319 -0.0550 164  GLN A NE2 
1216 N N   . PRO A 165 ? 0.7806 1.4684 0.7397 0.2397 -0.0365 -0.0820 165  PRO A N   
1217 C CA  . PRO A 165 ? 0.8143 1.5245 0.7650 0.2419 -0.0345 -0.0923 165  PRO A CA  
1218 C C   . PRO A 165 ? 0.7203 1.4223 0.6687 0.2414 -0.0358 -0.1018 165  PRO A C   
1219 O O   . PRO A 165 ? 0.8904 1.6016 0.8378 0.2386 -0.0365 -0.1163 165  PRO A O   
1220 C CB  . PRO A 165 ? 0.8515 1.5864 0.7926 0.2506 -0.0292 -0.0799 165  PRO A CB  
1221 C CG  . PRO A 165 ? 0.6777 1.4116 0.6235 0.2503 -0.0286 -0.0690 165  PRO A CG  
1222 C CD  . PRO A 165 ? 0.7116 1.4130 0.6685 0.2444 -0.0331 -0.0679 165  PRO A CD  
1223 N N   . LEU A 166 ? 0.3656 1.0524 0.3130 0.2442 -0.0360 -0.0944 166  LEU A N   
1224 C CA  . LEU A 166 ? 0.6316 1.3098 0.5770 0.2435 -0.0373 -0.1031 166  LEU A CA  
1225 C C   . LEU A 166 ? 0.6266 1.3280 0.5628 0.2479 -0.0346 -0.1091 166  LEU A C   
1226 O O   . LEU A 166 ? 0.7714 1.4670 0.7053 0.2501 -0.0346 -0.1081 166  LEU A O   
1227 C CB  . LEU A 166 ? 0.6239 1.2825 0.5785 0.2348 -0.0421 -0.1171 166  LEU A CB  
1228 C CG  . LEU A 166 ? 0.6625 1.2918 0.6276 0.2293 -0.0458 -0.1131 166  LEU A CG  
1229 C CD1 . LEU A 166 ? 0.6097 1.2209 0.5822 0.2218 -0.0499 -0.1274 166  LEU A CD1 
1230 C CD2 . LEU A 166 ? 0.7857 1.4005 0.7496 0.2332 -0.0453 -0.0996 166  LEU A CD2 
1231 N N   . ASP A 167 ? 0.5048 1.2253 0.4432 0.2460 -0.0342 -0.1132 167  ASP A N   
1232 C CA  . ASP A 167 ? 0.7199 1.4540 0.6587 0.2457 -0.0343 -0.1184 167  ASP A CA  
1233 C C   . ASP A 167 ? 0.6303 1.3739 0.5622 0.2530 -0.0314 -0.1082 167  ASP A C   
1234 O O   . ASP A 167 ? 0.5674 1.3230 0.4937 0.2594 -0.0278 -0.0954 167  ASP A O   
1235 C CB  . ASP A 167 ? 0.6726 1.4280 0.6138 0.2435 -0.0339 -0.1224 167  ASP A CB  
1236 C CG  . ASP A 167 ? 0.5951 1.3453 0.5445 0.2355 -0.0373 -0.1384 167  ASP A CG  
1237 O OD1 . ASP A 167 ? 0.5294 1.2617 0.4826 0.2319 -0.0399 -0.1464 167  ASP A OD1 
1238 O OD2 . ASP A 167 ? 0.5126 1.2768 0.4648 0.2329 -0.0372 -0.1429 167  ASP A OD2 
1239 N N   . GLY A 168 ? 0.6452 1.3831 0.5778 0.2520 -0.0328 -0.1139 168  GLY A N   
1240 C CA  . GLY A 168 ? 0.7220 1.4684 0.6488 0.2583 -0.0304 -0.1060 168  GLY A CA  
1241 C C   . GLY A 168 ? 0.8190 1.5533 0.7402 0.2642 -0.0285 -0.0947 168  GLY A C   
1242 O O   . GLY A 168 ? 0.9007 1.6378 0.8178 0.2689 -0.0270 -0.0898 168  GLY A O   
1243 N N   . PHE A 169 ? 0.8224 1.5435 0.7434 0.2642 -0.0284 -0.0905 169  PHE A N   
1244 C CA  . PHE A 169 ? 0.8056 1.5143 0.7213 0.2700 -0.0263 -0.0794 169  PHE A CA  
1245 C C   . PHE A 169 ? 0.6488 1.3422 0.5639 0.2696 -0.0280 -0.0831 169  PHE A C   
1246 O O   . PHE A 169 ? 0.7086 1.3999 0.6181 0.2759 -0.0254 -0.0736 169  PHE A O   
1247 C CB  . PHE A 169 ? 0.7871 1.4764 0.7081 0.2665 -0.0281 -0.0763 169  PHE A CB  
1248 C CG  . PHE A 169 ? 0.6913 1.3916 0.6133 0.2684 -0.0260 -0.0668 169  PHE A CG  
1249 C CD1 . PHE A 169 ? 0.6306 1.3458 0.5539 0.2650 -0.0263 -0.0745 169  PHE A CD1 
1250 C CD2 . PHE A 169 ? 0.5592 1.2541 0.4811 0.2735 -0.0237 -0.0503 169  PHE A CD2 
1251 C CE1 . PHE A 169 ? 0.5178 1.2433 0.4422 0.2663 -0.0244 -0.0659 169  PHE A CE1 
1252 C CE2 . PHE A 169 ? 0.4808 1.1852 0.4040 0.2751 -0.0217 -0.0414 169  PHE A CE2 
1253 C CZ  . PHE A 169 ? 0.5242 1.2443 0.4486 0.2714 -0.0221 -0.0492 169  PHE A CZ  
1254 N N   . GLY A 170 ? 0.5952 1.2779 0.5165 0.2622 -0.0321 -0.0968 170  GLY A N   
1255 C CA  . GLY A 170 ? 0.7167 1.3847 0.6384 0.2609 -0.0340 -0.1013 170  GLY A CA  
1256 C C   . GLY A 170 ? 0.8838 1.5663 0.8022 0.2648 -0.0323 -0.0992 170  GLY A C   
1257 O O   . GLY A 170 ? 0.8427 1.5182 0.7576 0.2681 -0.0317 -0.0954 170  GLY A O   
1258 N N   . GLU A 171 ? 0.9576 1.6605 0.8774 0.2642 -0.0317 -0.1021 171  GLU A N   
1259 C CA  . GLU A 171 ? 0.9683 1.6884 0.8847 0.2684 -0.0299 -0.0994 171  GLU A CA  
1260 C C   . GLU A 171 ? 0.8522 1.5795 0.7609 0.2776 -0.0256 -0.0840 171  GLU A C   
1261 O O   . GLU A 171 ? 0.9039 1.6322 0.8088 0.2820 -0.0243 -0.0800 171  GLU A O   
1262 C CB  . GLU A 171 ? 1.0719 1.8138 0.9908 0.2665 -0.0297 -0.1042 171  GLU A CB  
1263 C CG  . GLU A 171 ? 1.2615 2.0261 1.1755 0.2728 -0.0267 -0.0974 171  GLU A CG  
1264 C CD  . GLU A 171 ? 1.2470 2.0293 1.1568 0.2787 -0.0229 -0.0856 171  GLU A CD  
1265 O OE1 . GLU A 171 ? 1.2289 2.0147 1.1414 0.2757 -0.0233 -0.0874 171  GLU A OE1 
1266 O OE2 . GLU A 171 ? 1.1428 1.9354 1.0469 0.2864 -0.0195 -0.0746 171  GLU A OE2 
1267 N N   . LEU A 172 ? 0.6916 1.4239 0.5982 0.2808 -0.0232 -0.0753 172  LEU A N   
1268 C CA  . LEU A 172 ? 0.6167 1.3548 0.5166 0.2899 -0.0186 -0.0597 172  LEU A CA  
1269 C C   . LEU A 172 ? 0.7604 1.4788 0.6572 0.2925 -0.0184 -0.0559 172  LEU A C   
1270 O O   . LEU A 172 ? 0.8338 1.5565 0.7255 0.2993 -0.0155 -0.0474 172  LEU A O   
1271 C CB  . LEU A 172 ? 0.6735 1.4148 0.5726 0.2918 -0.0164 -0.0514 172  LEU A CB  
1272 C CG  . LEU A 172 ? 0.7124 1.4581 0.6052 0.3014 -0.0111 -0.0342 172  LEU A CG  
1273 C CD1 . LEU A 172 ? 0.7401 1.4988 0.6330 0.3030 -0.0086 -0.0272 172  LEU A CD1 
1274 C CD2 . LEU A 172 ? 0.7707 1.4938 0.6609 0.3037 -0.0104 -0.0289 172  LEU A CD2 
1275 N N   . CYS A 173 ? 0.7038 1.4008 0.6038 0.2871 -0.0215 -0.0622 173  CYS A N   
1276 C CA  . CYS A 173 ? 0.7889 1.4654 0.6863 0.2890 -0.0215 -0.0588 173  CYS A CA  
1277 C C   . CYS A 173 ? 0.7143 1.3854 0.6115 0.2882 -0.0232 -0.0643 173  CYS A C   
1278 O O   . CYS A 173 ? 0.6985 1.3589 0.5917 0.2923 -0.0220 -0.0588 173  CYS A O   
1279 C CB  . CYS A 173 ? 0.9547 1.6057 0.8610 0.2808 -0.0262 -0.0636 173  CYS A CB  
1280 S SG  . CYS A 173 ? 0.8516 1.4874 0.7646 0.2809 -0.0261 -0.0485 173  CYS A SG  
1281 N N   . HIS A 174 ? 0.6118 1.2907 0.5134 0.2831 -0.0257 -0.0750 174  HIS A N   
1282 C CA  . HIS A 174 ? 0.7960 1.4702 0.6982 0.2817 -0.0275 -0.0809 174  HIS A CA  
1283 C C   . HIS A 174 ? 0.8771 1.5676 0.7735 0.2895 -0.0240 -0.0725 174  HIS A C   
1284 O O   . HIS A 174 ? 0.7503 1.4333 0.6439 0.2921 -0.0237 -0.0705 174  HIS A O   
1285 C CB  . HIS A 174 ? 0.8754 1.5492 0.7850 0.2732 -0.0314 -0.0956 174  HIS A CB  
1286 C CG  . HIS A 174 ? 0.9099 1.5625 0.8255 0.2657 -0.0351 -0.1044 174  HIS A CG  
1287 N ND1 . HIS A 174 ? 0.8483 1.4981 0.7716 0.2578 -0.0384 -0.1173 174  HIS A ND1 
1288 C CD2 . HIS A 174 ? 0.7847 1.4180 0.7001 0.2651 -0.0359 -0.1022 174  HIS A CD2 
1289 C CE1 . HIS A 174 ? 0.7641 1.3936 0.6918 0.2526 -0.0412 -0.1225 174  HIS A CE1 
1290 N NE2 . HIS A 174 ? 0.7952 1.4146 0.7182 0.2568 -0.0398 -0.1137 174  HIS A NE2 
1291 N N   . ARG A 175 ? 0.8760 1.5887 0.7707 0.2932 -0.0213 -0.0673 175  ARG A N   
1292 C CA  . ARG A 175 ? 0.9027 1.6296 0.7909 0.3026 -0.0169 -0.0550 175  ARG A CA  
1293 C C   . ARG A 175 ? 1.0662 1.7800 0.9505 0.3074 -0.0143 -0.0440 175  ARG A C   
1294 O O   . ARG A 175 ? 1.1949 1.8984 1.0814 0.3041 -0.0154 -0.0451 175  ARG A O   
1295 C CB  . ARG A 175 ? 0.8782 1.6300 0.7660 0.3051 -0.0146 -0.0512 175  ARG A CB  
1296 C CG  . ARG A 175 ? 0.9504 1.7127 0.8437 0.2981 -0.0177 -0.0640 175  ARG A CG  
1297 C CD  . ARG A 175 ? 0.9576 1.7443 0.8506 0.3003 -0.0156 -0.0604 175  ARG A CD  
1298 N NE  . ARG A 175 ? 1.0549 1.8478 0.9434 0.3077 -0.0113 -0.0458 175  ARG A NE  
1299 C CZ  . ARG A 175 ? 1.0695 1.8753 0.9586 0.3081 -0.0098 -0.0420 175  ARG A CZ  
1300 N NH1 . ARG A 175 ? 1.0438 1.8575 0.9378 0.3015 -0.0124 -0.0522 175  ARG A NH1 
1301 N NH2 . ARG A 175 ? 1.0617 1.8725 0.9471 0.3151 -0.0056 -0.0280 175  ARG A NH2 
1302 N N   . TYR A 176 ? 1.0546 1.7685 0.9331 0.3153 -0.0109 -0.0337 176  TYR A N   
1303 C CA  . TYR A 176 ? 0.8673 1.5651 0.7420 0.3198 -0.0086 -0.0243 176  TYR A CA  
1304 C C   . TYR A 176 ? 0.7153 1.3884 0.5919 0.3143 -0.0123 -0.0322 176  TYR A C   
1305 O O   . TYR A 176 ? 0.6811 1.3350 0.5591 0.3150 -0.0124 -0.0252 176  TYR A O   
1306 C CB  . TYR A 176 ? 0.7976 1.4964 0.6723 0.3212 -0.0063 -0.0168 176  TYR A CB  
1307 C CG  . TYR A 176 ? 0.9442 1.6663 0.8168 0.3274 -0.0020 -0.0068 176  TYR A CG  
1308 C CD1 . TYR A 176 ? 1.0641 1.7926 0.9312 0.3374 0.0034  0.0078  176  TYR A CD1 
1309 C CD2 . TYR A 176 ? 0.9387 1.6760 0.8153 0.3232 -0.0033 -0.0118 176  TYR A CD2 
1310 C CE1 . TYR A 176 ? 1.0482 1.7982 0.9140 0.3431 0.0074  0.0173  176  TYR A CE1 
1311 C CE2 . TYR A 176 ? 0.9409 1.6998 0.8158 0.3286 0.0004  -0.0027 176  TYR A CE2 
1312 C CZ  . TYR A 176 ? 1.0302 1.7955 0.8999 0.3385 0.0058  0.0120  176  TYR A CZ  
1313 O OH  . TYR A 176 ? 0.9986 1.7858 0.8672 0.3440 0.0096  0.0214  176  TYR A OH  
1314 N N   . LYS A 177 ? 0.8128 1.4828 0.6941 0.3071 -0.0167 -0.0453 177  LYS A N   
1315 C CA  . LYS A 177 ? 0.9510 1.5991 0.8351 0.3012 -0.0206 -0.0542 177  LYS A CA  
1316 C C   . LYS A 177 ? 0.9200 1.5455 0.8073 0.2979 -0.0223 -0.0524 177  LYS A C   
1317 O O   . LYS A 177 ? 0.7494 1.3530 0.6398 0.2959 -0.0245 -0.0506 177  LYS A O   
1318 C CB  . LYS A 177 ? 1.0044 1.6478 0.8847 0.3050 -0.0199 -0.0519 177  LYS A CB  
1319 C CG  . LYS A 177 ? 0.9543 1.6164 0.8294 0.3134 -0.0158 -0.0428 177  LYS A CG  
1320 C CD  . LYS A 177 ? 0.8988 1.5546 0.7709 0.3161 -0.0158 -0.0424 177  LYS A CD  
1321 C CE  . LYS A 177 ? 0.8397 1.5137 0.7123 0.3168 -0.0159 -0.0461 177  LYS A CE  
1322 N NZ  . LYS A 177 ? 0.7682 1.4670 0.6395 0.3212 -0.0130 -0.0409 177  LYS A NZ  
1323 N N   . CYS A 178 ? 0.9505 1.5772 0.8426 0.2948 -0.0230 -0.0512 178  CYS A N   
1324 C CA  . CYS A 178 ? 0.9674 1.5691 0.8689 0.2890 -0.0264 -0.0477 178  CYS A CA  
1325 C C   . CYS A 178 ? 0.8034 1.3962 0.7122 0.2793 -0.0311 -0.0608 178  CYS A C   
1326 O O   . CYS A 178 ? 0.7438 1.3540 0.6509 0.2780 -0.0308 -0.0698 178  CYS A O   
1327 C CB  . CYS A 178 ? 0.9587 1.5659 0.8610 0.2931 -0.0235 -0.0348 178  CYS A CB  
1328 S SG  . CYS A 178 ? 0.7196 1.2996 0.6335 0.2858 -0.0275 -0.0312 178  CYS A SG  
1329 N N   . LEU A 179 ? 0.6634 1.2296 0.5807 0.2727 -0.0352 -0.0620 179  LEU A N   
1330 C CA  . LEU A 179 ? 0.5937 1.1496 0.5188 0.2635 -0.0396 -0.0739 179  LEU A CA  
1331 C C   . LEU A 179 ? 0.6166 1.1731 0.5473 0.2607 -0.0402 -0.0711 179  LEU A C   
1332 O O   . LEU A 179 ? 0.6470 1.1985 0.5794 0.2634 -0.0389 -0.0590 179  LEU A O   
1333 C CB  . LEU A 179 ? 0.5547 1.0822 0.4865 0.2573 -0.0438 -0.0768 179  LEU A CB  
1334 C CG  . LEU A 179 ? 0.5382 1.0615 0.4661 0.2582 -0.0442 -0.0815 179  LEU A CG  
1335 C CD1 . LEU A 179 ? 0.5279 1.0227 0.4631 0.2520 -0.0482 -0.0825 179  LEU A CD1 
1336 C CD2 . LEU A 179 ? 0.6026 1.1396 0.5282 0.2562 -0.0446 -0.0955 179  LEU A CD2 
1337 N N   . LEU A 180 ? 0.6282 1.1906 0.5623 0.2554 -0.0421 -0.0824 180  LEU A N   
1338 C CA  . LEU A 180 ? 0.6379 1.1999 0.5780 0.2520 -0.0430 -0.0810 180  LEU A CA  
1339 C C   . LEU A 180 ? 0.5504 1.0872 0.5014 0.2429 -0.0480 -0.0868 180  LEU A C   
1340 O O   . LEU A 180 ? 0.4418 0.9732 0.3959 0.2375 -0.0507 -0.0995 180  LEU A O   
1341 C CB  . LEU A 180 ? 0.6283 1.2155 0.5651 0.2525 -0.0414 -0.0888 180  LEU A CB  
1342 C CG  . LEU A 180 ? 0.6167 1.2059 0.5594 0.2489 -0.0423 -0.0885 180  LEU A CG  
1343 C CD1 . LEU A 180 ? 0.5762 1.1632 0.5198 0.2528 -0.0403 -0.0725 180  LEU A CD1 
1344 C CD2 . LEU A 180 ? 0.5210 1.1370 0.4592 0.2499 -0.0403 -0.0966 180  LEU A CD2 
1345 N N   . LEU A 181 ? 0.5443 1.0659 0.5013 0.2415 -0.0490 -0.0774 181  LEU A N   
1346 C CA  . LEU A 181 ? 0.5134 1.0119 0.4810 0.2330 -0.0535 -0.0816 181  LEU A CA  
1347 C C   . LEU A 181 ? 0.4834 0.9865 0.4564 0.2302 -0.0540 -0.0811 181  LEU A C   
1348 O O   . LEU A 181 ? 0.3368 0.8456 0.3089 0.2342 -0.0517 -0.0697 181  LEU A O   
1349 C CB  . LEU A 181 ? 0.4587 0.9342 0.4300 0.2326 -0.0547 -0.0720 181  LEU A CB  
1350 C CG  . LEU A 181 ? 0.6246 1.0783 0.6069 0.2254 -0.0584 -0.0715 181  LEU A CG  
1351 C CD1 . LEU A 181 ? 0.3140 0.7546 0.3023 0.2171 -0.0625 -0.0851 181  LEU A CD1 
1352 C CD2 . LEU A 181 ? 0.5654 1.0008 0.5498 0.2268 -0.0586 -0.0598 181  LEU A CD2 
1353 N N   . VAL A 182 ? 0.4232 0.9230 0.4020 0.2234 -0.0568 -0.0932 182  VAL A N   
1354 C CA  . VAL A 182 ? 0.4614 0.9662 0.4455 0.2203 -0.0574 -0.0944 182  VAL A CA  
1355 C C   . VAL A 182 ? 0.4524 0.9339 0.4479 0.2120 -0.0616 -0.0980 182  VAL A C   
1356 O O   . VAL A 182 ? 0.3197 0.7871 0.3192 0.2069 -0.0645 -0.1074 182  VAL A O   
1357 C CB  . VAL A 182 ? 0.4084 0.9360 0.3889 0.2205 -0.0561 -0.1054 182  VAL A CB  
1358 C CG1 . VAL A 182 ? 0.3210 0.8519 0.3081 0.2161 -0.0571 -0.1086 182  VAL A CG1 
1359 C CG2 . VAL A 182 ? 0.4996 1.0528 0.4691 0.2290 -0.0514 -0.0997 182  VAL A CG2 
1360 N N   . ASP A 183 ? 0.4777 0.9558 0.4784 0.2110 -0.0618 -0.0901 183  ASP A N   
1361 C CA  . ASP A 183 ? 0.4880 0.9476 0.4995 0.2034 -0.0654 -0.0933 183  ASP A CA  
1362 C C   . ASP A 183 ? 0.4776 0.9491 0.4921 0.1999 -0.0659 -0.1035 183  ASP A C   
1363 O O   . ASP A 183 ? 0.4169 0.9051 0.4297 0.2025 -0.0638 -0.0994 183  ASP A O   
1364 C CB  . ASP A 183 ? 0.4256 0.8764 0.4415 0.2043 -0.0653 -0.0797 183  ASP A CB  
1365 C CG  . ASP A 183 ? 0.4210 0.8522 0.4484 0.1964 -0.0690 -0.0821 183  ASP A CG  
1366 O OD1 . ASP A 183 ? 0.3629 0.7953 0.3949 0.1912 -0.0707 -0.0927 183  ASP A OD1 
1367 O OD2 . ASP A 183 ? 0.4581 0.8725 0.4899 0.1957 -0.0700 -0.0730 183  ASP A OD2 
1368 N N   . SER A 184 ? 0.2942 0.7565 0.3134 0.1940 -0.0685 -0.1165 184  SER A N   
1369 C CA  . SER A 184 ? 0.4816 0.9519 0.5050 0.1901 -0.0692 -0.1270 184  SER A CA  
1370 C C   . SER A 184 ? 0.3427 0.7909 0.3773 0.1823 -0.0728 -0.1315 184  SER A C   
1371 O O   . SER A 184 ? 0.4123 0.8594 0.4509 0.1780 -0.0741 -0.1438 184  SER A O   
1372 C CB  . SER A 184 ? 0.2938 0.7760 0.3127 0.1905 -0.0684 -0.1405 184  SER A CB  
1373 O OG  . SER A 184 ? 0.4116 0.8751 0.4334 0.1869 -0.0708 -0.1475 184  SER A OG  
1374 N N   . VAL A 185 ? 0.3691 0.7995 0.4086 0.1805 -0.0744 -0.1219 185  VAL A N   
1375 C CA  . VAL A 185 ? 0.3881 0.7981 0.4379 0.1732 -0.0776 -0.1257 185  VAL A CA  
1376 C C   . VAL A 185 ? 0.4216 0.8407 0.4764 0.1705 -0.0776 -0.1300 185  VAL A C   
1377 O O   . VAL A 185 ? 0.3713 0.7842 0.4315 0.1655 -0.0793 -0.1413 185  VAL A O   
1378 C CB  . VAL A 185 ? 0.4343 0.8250 0.4885 0.1720 -0.0791 -0.1142 185  VAL A CB  
1379 C CG1 . VAL A 185 ? 0.2803 0.6530 0.3450 0.1646 -0.0821 -0.1176 185  VAL A CG1 
1380 C CG2 . VAL A 185 ? 0.3877 0.7664 0.4380 0.1733 -0.0796 -0.1123 185  VAL A CG2 
1381 N N   . ALA A 186 ? 0.3867 0.8212 0.4394 0.1742 -0.0755 -0.1211 186  ALA A N   
1382 C CA  . ALA A 186 ? 0.3735 0.8192 0.4301 0.1722 -0.0751 -0.1243 186  ALA A CA  
1383 C C   . ALA A 186 ? 0.3909 0.8591 0.4423 0.1739 -0.0732 -0.1350 186  ALA A C   
1384 O O   . ALA A 186 ? 0.3532 0.8263 0.4092 0.1704 -0.0736 -0.1432 186  ALA A O   
1385 C CB  . ALA A 186 ? 0.3024 0.7548 0.3594 0.1752 -0.0736 -0.1103 186  ALA A CB  
1386 N N   . SER A 187 ? 0.3015 0.7838 0.3434 0.1793 -0.0709 -0.1354 187  SER A N   
1387 C CA  . SER A 187 ? 0.3748 0.8811 0.4111 0.1815 -0.0686 -0.1447 187  SER A CA  
1388 C C   . SER A 187 ? 0.4034 0.9058 0.4412 0.1782 -0.0698 -0.1611 187  SER A C   
1389 O O   . SER A 187 ? 0.3807 0.8989 0.4176 0.1778 -0.0687 -0.1713 187  SER A O   
1390 C CB  . SER A 187 ? 0.3928 0.9187 0.4177 0.1892 -0.0652 -0.1378 187  SER A CB  
1391 O OG  . SER A 187 ? 0.3882 0.9057 0.4092 0.1908 -0.0655 -0.1395 187  SER A OG  
1392 N N   . LEU A 188 ? 0.4476 0.9298 0.4878 0.1760 -0.0719 -0.1637 188  LEU A N   
1393 C CA  . LEU A 188 ? 0.2821 0.7605 0.3232 0.1738 -0.0727 -0.1784 188  LEU A CA  
1394 C C   . LEU A 188 ? 0.3511 0.8273 0.4000 0.1687 -0.0738 -0.1908 188  LEU A C   
1395 O O   . LEU A 188 ? 0.3671 0.8279 0.4243 0.1641 -0.0758 -0.1896 188  LEU A O   
1396 C CB  . LEU A 188 ? 0.2775 0.7328 0.3206 0.1719 -0.0749 -0.1780 188  LEU A CB  
1397 C CG  . LEU A 188 ? 0.4693 0.9193 0.5141 0.1697 -0.0756 -0.1928 188  LEU A CG  
1398 C CD1 . LEU A 188 ? 0.3710 0.8410 0.4061 0.1751 -0.0731 -0.1966 188  LEU A CD1 
1399 C CD2 . LEU A 188 ? 0.2700 0.6935 0.3197 0.1661 -0.0783 -0.1930 188  LEU A CD2 
1400 N N   . GLY A 189 ? 0.4549 0.9469 0.5012 0.1697 -0.0722 -0.2029 189  GLY A N   
1401 C CA  . GLY A 189 ? 0.2807 0.7705 0.3344 0.1654 -0.0730 -0.2161 189  GLY A CA  
1402 C C   . GLY A 189 ? 0.3915 0.8990 0.4460 0.1653 -0.0716 -0.2167 189  GLY A C   
1403 O O   . GLY A 189 ? 0.4301 0.9421 0.4888 0.1629 -0.0713 -0.2290 189  GLY A O   
1404 N N   . GLY A 190 ? 0.2858 0.8035 0.3363 0.1680 -0.0704 -0.2035 190  GLY A N   
1405 C CA  . GLY A 190 ? 0.3621 0.8963 0.4135 0.1677 -0.0691 -0.2029 190  GLY A CA  
1406 C C   . GLY A 190 ? 0.5168 1.0798 0.5579 0.1735 -0.0658 -0.1978 190  GLY A C   
1407 O O   . GLY A 190 ? 0.4333 1.0110 0.4740 0.1739 -0.0644 -0.1942 190  GLY A O   
1408 N N   . THR A 191 ? 0.5158 1.0871 0.5485 0.1781 -0.0643 -0.1975 191  THR A N   
1409 C CA  . THR A 191 ? 0.4640 1.0626 0.4859 0.1842 -0.0608 -0.1921 191  THR A CA  
1410 C C   . THR A 191 ? 0.5593 1.1606 0.5742 0.1878 -0.0599 -0.1957 191  THR A C   
1411 O O   . THR A 191 ? 0.6040 1.1847 0.6215 0.1865 -0.0619 -0.1951 191  THR A O   
1412 C CB  . THR A 191 ? 0.4898 1.0911 0.5091 0.1876 -0.0598 -0.1740 191  THR A CB  
1413 O OG1 . THR A 191 ? 0.5687 1.1986 0.5781 0.1934 -0.0561 -0.1693 191  THR A OG1 
1414 C CG2 . THR A 191 ? 0.4281 1.0101 0.4471 0.1892 -0.0610 -0.1636 191  THR A CG2 
1415 N N   . PRO A 192 ? 0.6229 1.2502 0.6290 0.1920 -0.0569 -0.2001 192  PRO A N   
1416 C CA  . PRO A 192 ? 0.5511 1.1792 0.5553 0.1931 -0.0568 -0.2028 192  PRO A CA  
1417 C C   . PRO A 192 ? 0.4812 1.1032 0.4779 0.1982 -0.0562 -0.1933 192  PRO A C   
1418 O O   . PRO A 192 ? 0.4112 1.0393 0.4019 0.2028 -0.0544 -0.1801 192  PRO A O   
1419 C CB  . PRO A 192 ? 0.5419 1.1968 0.5431 0.1949 -0.0545 -0.2024 192  PRO A CB  
1420 C CG  . PRO A 192 ? 0.5541 1.2165 0.5597 0.1918 -0.0545 -0.2071 192  PRO A CG  
1421 C CD  . PRO A 192 ? 0.5970 1.2482 0.6015 0.1925 -0.0549 -0.2015 192  PRO A CD  
1422 N N   . LEU A 193 ? 0.4426 1.0500 0.4424 0.1962 -0.0579 -0.1980 193  LEU A N   
1423 C CA  . LEU A 193 ? 0.4486 1.0469 0.4425 0.2001 -0.0577 -0.1907 193  LEU A CA  
1424 C C   . LEU A 193 ? 0.4925 1.0840 0.4900 0.1976 -0.0590 -0.1973 193  LEU A C   
1425 O O   . LEU A 193 ? 0.6231 1.2006 0.6298 0.1918 -0.0614 -0.2072 193  LEU A O   
1426 C CB  . LEU A 193 ? 0.3389 0.9101 0.3394 0.1967 -0.0605 -0.1851 193  LEU A CB  
1427 C CG  . LEU A 193 ? 0.5144 1.0686 0.5135 0.1983 -0.0615 -0.1762 193  LEU A CG  
1428 C CD1 . LEU A 193 ? 0.3172 0.8850 0.3072 0.2054 -0.0585 -0.1618 193  LEU A CD1 
1429 C CD2 . LEU A 193 ? 0.3021 0.8283 0.3110 0.1928 -0.0649 -0.1721 193  LEU A CD2 
1430 N N   . TYR A 194 ? 0.5451 1.1467 0.5358 0.2022 -0.0572 -0.1915 194  TYR A N   
1431 C CA  . TYR A 194 ? 0.5543 1.1505 0.5477 0.2003 -0.0582 -0.1970 194  TYR A CA  
1432 C C   . TYR A 194 ? 0.6600 1.2521 0.6460 0.2052 -0.0573 -0.1884 194  TYR A C   
1433 O O   . TYR A 194 ? 0.5283 1.1376 0.5064 0.2109 -0.0547 -0.1806 194  TYR A O   
1434 C CB  . TYR A 194 ? 0.5594 1.1768 0.5530 0.2004 -0.0569 -0.2010 194  TYR A CB  
1435 C CG  . TYR A 194 ? 0.3986 1.0290 0.3962 0.1979 -0.0565 -0.2061 194  TYR A CG  
1436 C CD1 . TYR A 194 ? 0.3607 1.0081 0.3525 0.2017 -0.0543 -0.1987 194  TYR A CD1 
1437 C CD2 . TYR A 194 ? 0.4243 1.0505 0.4313 0.1920 -0.0581 -0.2180 194  TYR A CD2 
1438 C CE1 . TYR A 194 ? 0.4303 1.0904 0.4256 0.1993 -0.0539 -0.2035 194  TYR A CE1 
1439 C CE2 . TYR A 194 ? 0.4258 1.0640 0.4364 0.1897 -0.0577 -0.2231 194  TYR A CE2 
1440 C CZ  . TYR A 194 ? 0.4440 1.0993 0.4487 0.1932 -0.0557 -0.2161 194  TYR A CZ  
1441 O OH  . TYR A 194 ? 0.4962 1.1638 0.5045 0.1908 -0.0553 -0.2213 194  TYR A OH  
1442 N N   . MET A 195 ? 0.6206 1.1900 0.6093 0.2030 -0.0595 -0.1899 195  MET A N   
1443 C CA  . MET A 195 ? 0.4912 1.0546 0.4729 0.2076 -0.0588 -0.1818 195  MET A CA  
1444 C C   . MET A 195 ? 0.5240 1.1016 0.5012 0.2110 -0.0570 -0.1797 195  MET A C   
1445 O O   . MET A 195 ? 0.4859 1.0779 0.4546 0.2174 -0.0542 -0.1700 195  MET A O   
1446 C CB  . MET A 195 ? 0.3142 0.8511 0.3010 0.2036 -0.0617 -0.1856 195  MET A CB  
1447 C CG  . MET A 195 ? 0.3927 0.9225 0.3719 0.2084 -0.0610 -0.1767 195  MET A CG  
1448 S SD  . MET A 195 ? 0.4341 0.9338 0.4192 0.2034 -0.0645 -0.1815 195  MET A SD  
1449 C CE  . MET A 195 ? 0.3838 0.8787 0.3621 0.2087 -0.0634 -0.1665 195  MET A CE  
1450 N N   . ASP A 196 ? 0.5822 1.1554 0.5653 0.2067 -0.0586 -0.1883 196  ASP A N   
1451 C CA  . ASP A 196 ? 0.5159 1.1019 0.4957 0.2092 -0.0572 -0.1877 196  ASP A CA  
1452 C C   . ASP A 196 ? 0.4852 1.0983 0.4604 0.2131 -0.0545 -0.1845 196  ASP A C   
1453 O O   . ASP A 196 ? 0.5554 1.1811 0.5226 0.2192 -0.0521 -0.1758 196  ASP A O   
1454 C CB  . ASP A 196 ? 0.4547 1.0318 0.4427 0.2034 -0.0593 -0.1984 196  ASP A CB  
1455 C CG  . ASP A 196 ? 0.4358 0.9873 0.4279 0.2001 -0.0617 -0.2003 196  ASP A CG  
1456 O OD1 . ASP A 196 ? 0.5306 1.0722 0.5182 0.2027 -0.0617 -0.1934 196  ASP A OD1 
1457 O OD2 . ASP A 196 ? 0.5346 1.0757 0.5342 0.1950 -0.0634 -0.2084 196  ASP A OD2 
1458 N N   . ARG A 197 ? 0.4925 1.1146 0.4727 0.2098 -0.0548 -0.1911 197  ARG A N   
1459 C CA  . ARG A 197 ? 0.5698 1.2179 0.5461 0.2129 -0.0524 -0.1888 197  ARG A CA  
1460 C C   . ARG A 197 ? 0.6330 1.2935 0.6002 0.2199 -0.0496 -0.1757 197  ARG A C   
1461 O O   . ARG A 197 ? 0.7438 1.4249 0.7057 0.2245 -0.0471 -0.1705 197  ARG A O   
1462 C CB  . ARG A 197 ? 0.5490 1.2032 0.5324 0.2080 -0.0532 -0.1980 197  ARG A CB  
1463 C CG  . ARG A 197 ? 0.7993 1.4795 0.7788 0.2110 -0.0509 -0.1947 197  ARG A CG  
1464 C CD  . ARG A 197 ? 0.9619 1.6414 0.9430 0.2096 -0.0509 -0.1938 197  ARG A CD  
1465 N NE  . ARG A 197 ? 0.8784 1.5770 0.8615 0.2082 -0.0501 -0.1982 197  ARG A NE  
1466 C CZ  . ARG A 197 ? 0.9617 1.6771 0.9401 0.2116 -0.0480 -0.1911 197  ARG A CZ  
1467 N NH1 . ARG A 197 ? 0.8811 1.5962 0.8525 0.2168 -0.0463 -0.1789 197  ARG A NH1 
1468 N NH2 . ARG A 197 ? 0.9945 1.7270 0.9752 0.2098 -0.0474 -0.1959 197  ARG A NH2 
1469 N N   . GLN A 198 ? 0.4788 1.1267 0.4442 0.2210 -0.0497 -0.1701 198  GLN A N   
1470 C CA  . GLN A 198 ? 0.4113 1.0698 0.3684 0.2279 -0.0467 -0.1570 198  GLN A CA  
1471 C C   . GLN A 198 ? 0.4636 1.1141 0.4144 0.2330 -0.0457 -0.1483 198  GLN A C   
1472 O O   . GLN A 198 ? 0.3972 1.0508 0.3413 0.2389 -0.0432 -0.1367 198  GLN A O   
1473 C CB  . GLN A 198 ? 0.4787 1.1310 0.4373 0.2266 -0.0471 -0.1553 198  GLN A CB  
1474 C CG  . GLN A 198 ? 0.5946 1.2552 0.5594 0.2216 -0.0480 -0.1640 198  GLN A CG  
1475 C CD  . GLN A 198 ? 0.6328 1.2852 0.6003 0.2194 -0.0488 -0.1640 198  GLN A CD  
1476 O OE1 . GLN A 198 ? 0.6381 1.2708 0.6122 0.2142 -0.0517 -0.1715 198  GLN A OE1 
1477 N NE2 . GLN A 198 ? 0.4185 1.0863 0.3812 0.2234 -0.0462 -0.1553 198  GLN A NE2 
1478 N N   . GLY A 199 ? 0.4378 1.0778 0.3908 0.2308 -0.0473 -0.1537 199  GLY A N   
1479 C CA  . GLY A 199 ? 0.6852 1.3172 0.6328 0.2351 -0.0465 -0.1468 199  GLY A CA  
1480 C C   . GLY A 199 ? 0.8008 1.4175 0.7452 0.2374 -0.0463 -0.1395 199  GLY A C   
1481 O O   . GLY A 199 ? 0.8435 1.4648 0.7802 0.2443 -0.0435 -0.1281 199  GLY A O   
1482 N N   . ILE A 200 ? 0.6438 1.2424 0.5942 0.2319 -0.0492 -0.1459 200  ILE A N   
1483 C CA  . ILE A 200 ? 0.4746 1.0551 0.4242 0.2326 -0.0499 -0.1396 200  ILE A CA  
1484 C C   . ILE A 200 ? 0.4416 1.0015 0.3930 0.2307 -0.0520 -0.1410 200  ILE A C   
1485 O O   . ILE A 200 ? 0.4385 0.9905 0.3943 0.2259 -0.0543 -0.1525 200  ILE A O   
1486 C CB  . ILE A 200 ? 0.7017 1.2691 0.6615 0.2256 -0.0529 -0.1431 200  ILE A CB  
1487 C CG1 . ILE A 200 ? 0.6187 1.2053 0.5769 0.2278 -0.0507 -0.1388 200  ILE A CG1 
1488 C CG2 . ILE A 200 ? 0.5338 1.0732 0.5009 0.2221 -0.0558 -0.1352 200  ILE A CG2 
1489 C CD1 . ILE A 200 ? 0.6220 1.2042 0.5887 0.2213 -0.0530 -0.1472 200  ILE A CD1 
1490 N N   . ASP A 201 ? 0.3717 0.9219 0.3214 0.2340 -0.0515 -0.1286 201  ASP A N   
1491 C CA  . ASP A 201 ? 0.4270 0.9584 0.3775 0.2327 -0.0533 -0.1286 201  ASP A CA  
1492 C C   . ASP A 201 ? 0.4628 0.9657 0.4235 0.2254 -0.0574 -0.1291 201  ASP A C   
1493 O O   . ASP A 201 ? 0.5410 1.0291 0.5050 0.2212 -0.0599 -0.1365 201  ASP A O   
1494 C CB  . ASP A 201 ? 0.5608 1.0955 0.5042 0.2399 -0.0505 -0.1158 201  ASP A CB  
1495 C CG  . ASP A 201 ? 0.5840 1.1460 0.5169 0.2474 -0.0463 -0.1156 201  ASP A CG  
1496 O OD1 . ASP A 201 ? 0.6077 1.1748 0.5385 0.2468 -0.0465 -0.1245 201  ASP A OD1 
1497 O OD2 . ASP A 201 ? 0.4973 1.0747 0.4254 0.2532 -0.0429 -0.1059 201  ASP A OD2 
1498 N N   . ILE A 202 ? 0.4670 0.9622 0.4326 0.2240 -0.0581 -0.1208 202  ILE A N   
1499 C CA  . ILE A 202 ? 0.4488 0.9185 0.4244 0.2167 -0.0620 -0.1218 202  ILE A CA  
1500 C C   . ILE A 202 ? 0.5014 0.9724 0.4833 0.2131 -0.0630 -0.1228 202  ILE A C   
1501 O O   . ILE A 202 ? 0.4385 0.9181 0.4193 0.2164 -0.0611 -0.1132 202  ILE A O   
1502 C CB  . ILE A 202 ? 0.4083 0.8601 0.3853 0.2176 -0.0627 -0.1100 202  ILE A CB  
1503 C CG1 . ILE A 202 ? 0.4492 0.9017 0.4190 0.2221 -0.0613 -0.1079 202  ILE A CG1 
1504 C CG2 . ILE A 202 ? 0.3919 0.8177 0.3789 0.2095 -0.0669 -0.1131 202  ILE A CG2 
1505 C CD1 . ILE A 202 ? 0.4602 0.9226 0.4231 0.2303 -0.0576 -0.0944 202  ILE A CD1 
1506 N N   . LEU A 203 ? 0.4411 0.9040 0.4298 0.2066 -0.0657 -0.1345 203  LEU A N   
1507 C CA  . LEU A 203 ? 0.3661 0.8287 0.3616 0.2024 -0.0668 -0.1369 203  LEU A CA  
1508 C C   . LEU A 203 ? 0.3179 0.7538 0.3236 0.1951 -0.0707 -0.1387 203  LEU A C   
1509 O O   . LEU A 203 ? 0.3773 0.7992 0.3858 0.1913 -0.0728 -0.1464 203  LEU A O   
1510 C CB  . LEU A 203 ? 0.3201 0.7992 0.3149 0.2015 -0.0661 -0.1502 203  LEU A CB  
1511 C CG  . LEU A 203 ? 0.4144 0.8975 0.4152 0.1978 -0.0668 -0.1545 203  LEU A CG  
1512 C CD1 . LEU A 203 ? 0.3216 0.8148 0.3210 0.2011 -0.0650 -0.1423 203  LEU A CD1 
1513 C CD2 . LEU A 203 ? 0.3023 0.8035 0.3009 0.1980 -0.0656 -0.1679 203  LEU A CD2 
1514 N N   . TYR A 204 ? 0.3405 0.7692 0.3517 0.1931 -0.0716 -0.1314 204  TYR A N   
1515 C CA  . TYR A 204 ? 0.3618 0.7675 0.3829 0.1858 -0.0751 -0.1343 204  TYR A CA  
1516 C C   . TYR A 204 ? 0.3615 0.7703 0.3889 0.1826 -0.0757 -0.1358 204  TYR A C   
1517 O O   . TYR A 204 ? 0.3741 0.8007 0.3984 0.1862 -0.0735 -0.1312 204  TYR A O   
1518 C CB  . TYR A 204 ? 0.3416 0.7277 0.3650 0.1850 -0.0765 -0.1238 204  TYR A CB  
1519 C CG  . TYR A 204 ? 0.4483 0.8384 0.4712 0.1886 -0.0749 -0.1098 204  TYR A CG  
1520 C CD1 . TYR A 204 ? 0.4261 0.8315 0.4406 0.1964 -0.0715 -0.1010 204  TYR A CD1 
1521 C CD2 . TYR A 204 ? 0.3645 0.7432 0.3956 0.1845 -0.0766 -0.1055 204  TYR A CD2 
1522 C CE1 . TYR A 204 ? 0.3482 0.7565 0.3625 0.2001 -0.0698 -0.0881 204  TYR A CE1 
1523 C CE2 . TYR A 204 ? 0.3384 0.7204 0.3696 0.1880 -0.0751 -0.0929 204  TYR A CE2 
1524 C CZ  . TYR A 204 ? 0.3895 0.7859 0.4123 0.1958 -0.0717 -0.0842 204  TYR A CZ  
1525 O OH  . TYR A 204 ? 0.4186 0.8174 0.4418 0.1996 -0.0699 -0.0715 204  TYR A OH  
1526 N N   . SER A 205 ? 0.3245 0.7160 0.3605 0.1758 -0.0786 -0.1427 205  SER A N   
1527 C CA  . SER A 205 ? 0.3292 0.7196 0.3723 0.1720 -0.0796 -0.1440 205  SER A CA  
1528 C C   . SER A 205 ? 0.3379 0.7022 0.3899 0.1654 -0.0829 -0.1444 205  SER A C   
1529 O O   . SER A 205 ? 0.2744 0.6230 0.3264 0.1642 -0.0842 -0.1430 205  SER A O   
1530 C CB  . SER A 205 ? 0.3047 0.7093 0.3482 0.1711 -0.0789 -0.1568 205  SER A CB  
1531 O OG  . SER A 205 ? 0.3958 0.7993 0.4464 0.1674 -0.0797 -0.1582 205  SER A OG  
1532 N N   . GLY A 206 ? 0.3728 0.7332 0.4321 0.1612 -0.0840 -0.1464 206  GLY A N   
1533 C CA  . GLY A 206 ? 0.3555 0.6926 0.4232 0.1552 -0.0869 -0.1460 206  GLY A CA  
1534 C C   . GLY A 206 ? 0.4058 0.7369 0.4800 0.1502 -0.0882 -0.1593 206  GLY A C   
1535 O O   . GLY A 206 ? 0.3565 0.7027 0.4296 0.1513 -0.0869 -0.1676 206  GLY A O   
1536 N N   . SER A 207 ? 0.2404 0.5491 0.3211 0.1448 -0.0907 -0.1615 207  SER A N   
1537 C CA  . SER A 207 ? 0.3723 0.6722 0.4598 0.1403 -0.0919 -0.1737 207  SER A CA  
1538 C C   . SER A 207 ? 0.2825 0.5861 0.3762 0.1378 -0.0919 -0.1743 207  SER A C   
1539 O O   . SER A 207 ? 0.3250 0.6297 0.4229 0.1359 -0.0919 -0.1852 207  SER A O   
1540 C CB  . SER A 207 ? 0.3410 0.6152 0.4330 0.1357 -0.0943 -0.1757 207  SER A CB  
1541 O OG  . SER A 207 ? 0.3497 0.6122 0.4448 0.1333 -0.0955 -0.1656 207  SER A OG  
1542 N N   . GLN A 208 ? 0.4018 0.7068 0.4965 0.1380 -0.0920 -0.1626 208  GLN A N   
1543 C CA  . GLN A 208 ? 0.3849 0.6872 0.4870 0.1344 -0.0926 -0.1623 208  GLN A CA  
1544 C C   . GLN A 208 ? 0.4031 0.7279 0.5041 0.1369 -0.0907 -0.1613 208  GLN A C   
1545 O O   . GLN A 208 ? 0.2598 0.5845 0.3665 0.1344 -0.0910 -0.1595 208  GLN A O   
1546 C CB  . GLN A 208 ? 0.4095 0.6973 0.5152 0.1320 -0.0941 -0.1508 208  GLN A CB  
1547 C CG  . GLN A 208 ? 0.3356 0.6351 0.4376 0.1364 -0.0927 -0.1366 208  GLN A CG  
1548 C CD  . GLN A 208 ? 0.4453 0.7445 0.5401 0.1405 -0.0920 -0.1306 208  GLN A CD  
1549 O OE1 . GLN A 208 ? 0.4314 0.7316 0.5217 0.1418 -0.0918 -0.1378 208  GLN A OE1 
1550 N NE2 . GLN A 208 ? 0.4371 0.7347 0.5312 0.1429 -0.0916 -0.1173 208  GLN A NE2 
1551 N N   . LYS A 209 ? 0.4374 0.7818 0.5310 0.1419 -0.0885 -0.1625 209  LYS A N   
1552 C CA  . LYS A 209 ? 0.3789 0.7465 0.4705 0.1447 -0.0864 -0.1618 209  LYS A CA  
1553 C C   . LYS A 209 ? 0.3127 0.6902 0.4054 0.1437 -0.0856 -0.1768 209  LYS A C   
1554 O O   . LYS A 209 ? 0.3176 0.6836 0.4176 0.1392 -0.0869 -0.1849 209  LYS A O   
1555 C CB  . LYS A 209 ? 0.3813 0.7663 0.4639 0.1512 -0.0841 -0.1520 209  LYS A CB  
1556 C CG  . LYS A 209 ? 0.2871 0.6738 0.3708 0.1529 -0.0836 -0.1368 209  LYS A CG  
1557 C CD  . LYS A 209 ? 0.3511 0.7169 0.4372 0.1517 -0.0853 -0.1274 209  LYS A CD  
1558 C CE  . LYS A 209 ? 0.3697 0.7385 0.4567 0.1544 -0.0844 -0.1122 209  LYS A CE  
1559 N NZ  . LYS A 209 ? 0.7544 1.1104 0.8396 0.1566 -0.0847 -0.1017 209  LYS A NZ  
1560 N N   . ALA A 210 ? 0.3212 0.7197 0.4069 0.1480 -0.0833 -0.1808 210  ALA A N   
1561 C CA  . ALA A 210 ? 0.2890 0.6986 0.3763 0.1471 -0.0824 -0.1946 210  ALA A CA  
1562 C C   . ALA A 210 ? 0.3018 0.6959 0.3934 0.1443 -0.0837 -0.2076 210  ALA A C   
1563 O O   . ALA A 210 ? 0.2877 0.6849 0.3834 0.1427 -0.0833 -0.2197 210  ALA A O   
1564 C CB  . ALA A 210 ? 0.2630 0.6992 0.3417 0.1523 -0.0795 -0.1960 210  ALA A CB  
1565 N N   . LEU A 211 ? 0.2758 0.6533 0.3665 0.1439 -0.0850 -0.2049 211  LEU A N   
1566 C CA  . LEU A 211 ? 0.3248 0.6851 0.4198 0.1414 -0.0864 -0.2154 211  LEU A CA  
1567 C C   . LEU A 211 ? 0.3707 0.7100 0.4758 0.1360 -0.0884 -0.2190 211  LEU A C   
1568 O O   . LEU A 211 ? 0.4211 0.7472 0.5312 0.1341 -0.0892 -0.2292 211  LEU A O   
1569 C CB  . LEU A 211 ? 0.3538 0.7029 0.4443 0.1426 -0.0872 -0.2097 211  LEU A CB  
1570 C CG  . LEU A 211 ? 0.4371 0.7890 0.5229 0.1452 -0.0865 -0.2167 211  LEU A CG  
1571 C CD1 . LEU A 211 ? 0.2541 0.6254 0.3381 0.1475 -0.0845 -0.2286 211  LEU A CD1 
1572 C CD2 . LEU A 211 ? 0.2991 0.6564 0.3763 0.1491 -0.0859 -0.2057 211  LEU A CD2 
1573 N N   . ASN A 212 ? 0.3329 0.6688 0.4410 0.1340 -0.0891 -0.2100 212  ASN A N   
1574 C CA  . ASN A 212 ? 0.4148 0.7313 0.5320 0.1291 -0.0909 -0.2117 212  ASN A CA  
1575 C C   . ASN A 212 ? 0.3540 0.6443 0.4747 0.1262 -0.0930 -0.2131 212  ASN A C   
1576 O O   . ASN A 212 ? 0.4017 0.6770 0.5299 0.1230 -0.0940 -0.2200 212  ASN A O   
1577 C CB  . ASN A 212 ? 0.2363 0.5576 0.3596 0.1276 -0.0902 -0.2241 212  ASN A CB  
1578 C CG  . ASN A 212 ? 0.3211 0.6687 0.4407 0.1302 -0.0880 -0.2247 212  ASN A CG  
1579 O OD1 . ASN A 212 ? 0.3862 0.7451 0.5059 0.1315 -0.0865 -0.2361 212  ASN A OD1 
1580 N ND2 . ASN A 212 ? 0.2415 0.5994 0.3580 0.1313 -0.0876 -0.2125 212  ASN A ND2 
1581 N N   . ALA A 213 ? 0.3492 0.6343 0.4645 0.1277 -0.0935 -0.2070 213  ALA A N   
1582 C CA  . ALA A 213 ? 0.3279 0.5886 0.4460 0.1248 -0.0955 -0.2070 213  ALA A CA  
1583 C C   . ALA A 213 ? 0.2753 0.5258 0.3942 0.1227 -0.0968 -0.1943 213  ALA A C   
1584 O O   . ALA A 213 ? 0.2984 0.5618 0.4153 0.1241 -0.0961 -0.1854 213  ALA A O   
1585 C CB  . ALA A 213 ? 0.2441 0.5043 0.3563 0.1274 -0.0953 -0.2087 213  ALA A CB  
1586 N N   . PRO A 214 ? 0.2714 0.4987 0.3937 0.1192 -0.0987 -0.1937 214  PRO A N   
1587 C CA  . PRO A 214 ? 0.3140 0.5325 0.4368 0.1172 -0.0999 -0.1818 214  PRO A CA  
1588 C C   . PRO A 214 ? 0.2789 0.5046 0.3941 0.1205 -0.0994 -0.1711 214  PRO A C   
1589 O O   . PRO A 214 ? 0.3650 0.5928 0.4752 0.1230 -0.0990 -0.1739 214  PRO A O   
1590 C CB  . PRO A 214 ? 0.2632 0.4555 0.3905 0.1131 -0.1018 -0.1854 214  PRO A CB  
1591 C CG  . PRO A 214 ? 0.3897 0.5774 0.5221 0.1125 -0.1016 -0.1988 214  PRO A CG  
1592 C CD  . PRO A 214 ? 0.3072 0.5153 0.4346 0.1168 -0.0998 -0.2037 214  PRO A CD  
1593 N N   . PRO A 215 ? 0.2821 0.5108 0.3971 0.1209 -0.0994 -0.1591 215  PRO A N   
1594 C CA  . PRO A 215 ? 0.2746 0.5086 0.3833 0.1246 -0.0987 -0.1481 215  PRO A CA  
1595 C C   . PRO A 215 ? 0.3496 0.5651 0.4566 0.1228 -0.1002 -0.1482 215  PRO A C   
1596 O O   . PRO A 215 ? 0.3029 0.4996 0.4147 0.1181 -0.1019 -0.1529 215  PRO A O   
1597 C CB  . PRO A 215 ? 0.3104 0.5456 0.4220 0.1242 -0.0987 -0.1361 215  PRO A CB  
1598 C CG  . PRO A 215 ? 0.2657 0.4862 0.3854 0.1183 -0.1003 -0.1411 215  PRO A CG  
1599 C CD  . PRO A 215 ? 0.3346 0.5579 0.4561 0.1174 -0.1001 -0.1551 215  PRO A CD  
1600 N N   . GLY A 216 ? 0.3229 0.5438 0.4231 0.1268 -0.0993 -0.1436 216  GLY A N   
1601 C CA  . GLY A 216 ? 0.2679 0.4727 0.3661 0.1253 -0.1006 -0.1429 216  GLY A CA  
1602 C C   . GLY A 216 ? 0.3428 0.5533 0.4347 0.1286 -0.0998 -0.1476 216  GLY A C   
1603 O O   . GLY A 216 ? 0.2649 0.4670 0.3534 0.1290 -0.1003 -0.1442 216  GLY A O   
1604 N N   . THR A 217 ? 0.2991 0.5233 0.3895 0.1309 -0.0985 -0.1559 217  THR A N   
1605 C CA  . THR A 217 ? 0.2818 0.5152 0.3654 0.1349 -0.0973 -0.1589 217  THR A CA  
1606 C C   . THR A 217 ? 0.3308 0.5887 0.4088 0.1407 -0.0948 -0.1549 217  THR A C   
1607 O O   . THR A 217 ? 0.4306 0.6985 0.5106 0.1413 -0.0941 -0.1520 217  THR A O   
1608 C CB  . THR A 217 ? 0.3362 0.5649 0.4217 0.1333 -0.0977 -0.1727 217  THR A CB  
1609 O OG1 . THR A 217 ? 0.3131 0.5506 0.4027 0.1328 -0.0970 -0.1803 217  THR A OG1 
1610 C CG2 . THR A 217 ? 0.2480 0.4520 0.3385 0.1283 -0.0999 -0.1762 217  THR A CG2 
1611 N N   . SER A 218 ? 0.3040 0.5717 0.3747 0.1452 -0.0934 -0.1546 218  SER A N   
1612 C CA  . SER A 218 ? 0.3013 0.5928 0.3656 0.1512 -0.0907 -0.1518 218  SER A CA  
1613 C C   . SER A 218 ? 0.3789 0.6802 0.4372 0.1543 -0.0895 -0.1597 218  SER A C   
1614 O O   . SER A 218 ? 0.3538 0.6429 0.4124 0.1524 -0.0906 -0.1648 218  SER A O   
1615 C CB  . SER A 218 ? 0.2467 0.5434 0.3071 0.1554 -0.0895 -0.1372 218  SER A CB  
1616 O OG  . SER A 218 ? 0.3216 0.6038 0.3805 0.1550 -0.0904 -0.1319 218  SER A OG  
1617 N N   . LEU A 219 ? 0.3114 0.6352 0.3645 0.1591 -0.0870 -0.1607 219  LEU A N   
1618 C CA  . LEU A 219 ? 0.3996 0.7359 0.4474 0.1620 -0.0855 -0.1694 219  LEU A CA  
1619 C C   . LEU A 219 ? 0.4499 0.8014 0.4881 0.1687 -0.0831 -0.1613 219  LEU A C   
1620 O O   . LEU A 219 ? 0.3579 0.7200 0.3932 0.1723 -0.0816 -0.1515 219  LEU A O   
1621 C CB  . LEU A 219 ? 0.4030 0.7552 0.4520 0.1623 -0.0844 -0.1786 219  LEU A CB  
1622 C CG  . LEU A 219 ? 0.4867 0.8282 0.5451 0.1567 -0.0861 -0.1870 219  LEU A CG  
1623 C CD1 . LEU A 219 ? 0.2567 0.6148 0.3151 0.1577 -0.0846 -0.1986 219  LEU A CD1 
1624 C CD2 . LEU A 219 ? 0.5814 0.8990 0.6451 0.1521 -0.0885 -0.1924 219  LEU A CD2 
1625 N N   . ILE A 220 ? 0.3903 0.7431 0.4236 0.1708 -0.0826 -0.1652 220  ILE A N   
1626 C CA  . ILE A 220 ? 0.4515 0.8194 0.4752 0.1775 -0.0800 -0.1582 220  ILE A CA  
1627 C C   . ILE A 220 ? 0.4943 0.8733 0.5125 0.1802 -0.0786 -0.1672 220  ILE A C   
1628 O O   . ILE A 220 ? 0.3678 0.7358 0.3895 0.1766 -0.0802 -0.1767 220  ILE A O   
1629 C CB  . ILE A 220 ? 0.4554 0.8099 0.4777 0.1785 -0.0806 -0.1467 220  ILE A CB  
1630 C CG1 . ILE A 220 ? 0.4350 0.8061 0.4485 0.1861 -0.0774 -0.1364 220  ILE A CG1 
1631 C CG2 . ILE A 220 ? 0.2988 0.6374 0.3219 0.1757 -0.0823 -0.1517 220  ILE A CG2 
1632 C CD1 . ILE A 220 ? 0.3759 0.7345 0.3893 0.1874 -0.0777 -0.1237 220  ILE A CD1 
1633 N N   . SER A 221 ? 0.3485 0.7495 0.3581 0.1867 -0.0756 -0.1641 221  SER A N   
1634 C CA  . SER A 221 ? 0.4002 0.8143 0.4033 0.1900 -0.0739 -0.1713 221  SER A CA  
1635 C C   . SER A 221 ? 0.3778 0.8048 0.3712 0.1972 -0.0711 -0.1618 221  SER A C   
1636 O O   . SER A 221 ? 0.3890 0.8253 0.3791 0.2010 -0.0693 -0.1515 221  SER A O   
1637 C CB  . SER A 221 ? 0.4877 0.9210 0.4900 0.1908 -0.0724 -0.1813 221  SER A CB  
1638 O OG  . SER A 221 ? 0.5297 0.9704 0.5286 0.1922 -0.0715 -0.1908 221  SER A OG  
1639 N N   . PHE A 222 ? 0.3882 0.8162 0.3769 0.1991 -0.0706 -0.1651 222  PHE A N   
1640 C CA  . PHE A 222 ? 0.3711 0.8125 0.3501 0.2063 -0.0677 -0.1571 222  PHE A CA  
1641 C C   . PHE A 222 ? 0.3445 0.8071 0.3163 0.2105 -0.0652 -0.1650 222  PHE A C   
1642 O O   . PHE A 222 ? 0.4016 0.8583 0.3777 0.2065 -0.0666 -0.1738 222  PHE A O   
1643 C CB  . PHE A 222 ? 0.3937 0.8174 0.3724 0.2061 -0.0689 -0.1509 222  PHE A CB  
1644 C CG  . PHE A 222 ? 0.5526 0.9559 0.5378 0.2024 -0.0711 -0.1425 222  PHE A CG  
1645 C CD1 . PHE A 222 ? 0.4081 0.7909 0.4024 0.1948 -0.0745 -0.1483 222  PHE A CD1 
1646 C CD2 . PHE A 222 ? 0.6010 1.0055 0.5833 0.2067 -0.0696 -0.1290 222  PHE A CD2 
1647 C CE1 . PHE A 222 ? 0.4977 0.8622 0.4979 0.1913 -0.0766 -0.1408 222  PHE A CE1 
1648 C CE2 . PHE A 222 ? 0.5341 0.9196 0.5227 0.2032 -0.0716 -0.1216 222  PHE A CE2 
1649 C CZ  . PHE A 222 ? 0.4206 0.7866 0.4181 0.1954 -0.0752 -0.1277 222  PHE A CZ  
1650 N N   . SER A 223 ? 0.3800 0.8649 0.3435 0.2172 -0.0617 -0.1592 223  SER A N   
1651 C CA  . SER A 223 ? 0.5870 1.0891 0.5479 0.2193 -0.0600 -0.1615 223  SER A CA  
1652 C C   . SER A 223 ? 0.5124 1.0083 0.4706 0.2207 -0.0600 -0.1599 223  SER A C   
1653 O O   . SER A 223 ? 0.4567 0.9379 0.4125 0.2217 -0.0607 -0.1563 223  SER A O   
1654 C CB  . SER A 223 ? 0.5405 1.0666 0.4936 0.2263 -0.0563 -0.1535 223  SER A CB  
1655 O OG  . SER A 223 ? 0.5070 1.0345 0.4512 0.2333 -0.0539 -0.1431 223  SER A OG  
1656 N N   . ASP A 224 ? 0.6308 1.1382 0.5897 0.2205 -0.0593 -0.1630 224  ASP A N   
1657 C CA  . ASP A 224 ? 0.4862 0.9936 0.4416 0.2229 -0.0587 -0.1607 224  ASP A CA  
1658 C C   . ASP A 224 ? 0.3549 0.8640 0.3004 0.2305 -0.0563 -0.1495 224  ASP A C   
1659 O O   . ASP A 224 ? 0.5395 1.0349 0.4832 0.2311 -0.0570 -0.1473 224  ASP A O   
1660 C CB  . ASP A 224 ? 0.7768 1.3045 0.7313 0.2245 -0.0571 -0.1625 224  ASP A CB  
1661 C CG  . ASP A 224 ? 0.9372 1.4593 0.8993 0.2185 -0.0591 -0.1720 224  ASP A CG  
1662 O OD1 . ASP A 224 ? 0.6142 1.1219 0.5846 0.2119 -0.0616 -0.1794 224  ASP A OD1 
1663 O OD2 . ASP A 224 ? 1.1345 1.6674 1.0944 0.2205 -0.0580 -0.1721 224  ASP A OD2 
1664 N N   . LYS A 225 ? 0.3638 0.8897 0.3033 0.2365 -0.0534 -0.1421 225  LYS A N   
1665 C CA  . LYS A 225 ? 0.5381 1.0679 0.4682 0.2446 -0.0503 -0.1304 225  LYS A CA  
1666 C C   . LYS A 225 ? 0.5410 1.0494 0.4718 0.2438 -0.0518 -0.1257 225  LYS A C   
1667 O O   . LYS A 225 ? 0.7059 1.2043 0.6347 0.2459 -0.0517 -0.1194 225  LYS A O   
1668 C CB  . LYS A 225 ? 0.6073 1.1591 0.5322 0.2507 -0.0468 -0.1228 225  LYS A CB  
1669 C CG  . LYS A 225 ? 0.6534 1.2257 0.5788 0.2514 -0.0457 -0.1253 225  LYS A CG  
1670 C CD  . LYS A 225 ? 0.6419 1.2358 0.5644 0.2554 -0.0428 -0.1201 225  LYS A CD  
1671 C CE  . LYS A 225 ? 0.7198 1.3320 0.6446 0.2541 -0.0427 -0.1256 225  LYS A CE  
1672 N NZ  . LYS A 225 ? 0.7525 1.3667 0.6753 0.2559 -0.0424 -0.1259 225  LYS A NZ  
1673 N N   . ALA A 226 ? 0.4829 0.9809 0.4216 0.2383 -0.0541 -0.1265 226  ALA A N   
1674 C CA  . ALA A 226 ? 0.4214 0.8942 0.3675 0.2337 -0.0570 -0.1209 226  ALA A CA  
1675 C C   . ALA A 226 ? 0.4033 0.8572 0.3523 0.2295 -0.0597 -0.1261 226  ALA A C   
1676 O O   . ALA A 226 ? 0.4595 0.8992 0.4088 0.2300 -0.0603 -0.1185 226  ALA A O   
1677 C CB  . ALA A 226 ? 0.3936 0.8590 0.3483 0.2276 -0.0594 -0.1242 226  ALA A CB  
1678 N N   . LYS A 227 ? 0.3462 0.8003 0.2975 0.2255 -0.0612 -0.1391 227  LYS A N   
1679 C CA  . LYS A 227 ? 0.4114 0.8477 0.3659 0.2211 -0.0638 -0.1447 227  LYS A CA  
1680 C C   . LYS A 227 ? 0.4864 0.9244 0.4338 0.2263 -0.0621 -0.1389 227  LYS A C   
1681 O O   . LYS A 227 ? 0.5021 0.9218 0.4519 0.2240 -0.0639 -0.1358 227  LYS A O   
1682 C CB  . LYS A 227 ? 0.4468 0.8853 0.4053 0.2166 -0.0650 -0.1587 227  LYS A CB  
1683 C CG  . LYS A 227 ? 0.5741 0.9931 0.5385 0.2109 -0.0679 -0.1639 227  LYS A CG  
1684 C CD  . LYS A 227 ? 0.7015 1.1159 0.6767 0.2032 -0.0699 -0.1736 227  LYS A CD  
1685 C CE  . LYS A 227 ? 0.7459 1.1509 0.7260 0.1991 -0.0713 -0.1780 227  LYS A CE  
1686 N NZ  . LYS A 227 ? 0.4926 0.8964 0.4824 0.1928 -0.0725 -0.1867 227  LYS A NZ  
1687 N N   . LYS A 228 ? 0.5468 1.0073 0.4853 0.2335 -0.0585 -0.1374 228  LYS A N   
1688 C CA  . LYS A 228 ? 0.5561 1.0214 0.4869 0.2394 -0.0563 -0.1318 228  LYS A CA  
1689 C C   . LYS A 228 ? 0.5671 1.0209 0.4978 0.2420 -0.0559 -0.1180 228  LYS A C   
1690 O O   . LYS A 228 ? 0.5745 1.0133 0.5058 0.2411 -0.0571 -0.1155 228  LYS A O   
1691 C CB  . LYS A 228 ? 0.6246 1.1148 0.5506 0.2447 -0.0531 -0.1295 228  LYS A CB  
1692 C CG  . LYS A 228 ? 0.7344 1.2309 0.6538 0.2507 -0.0509 -0.1236 228  LYS A CG  
1693 C CD  . LYS A 228 ? 0.8861 1.3725 0.8100 0.2458 -0.0533 -0.1304 228  LYS A CD  
1694 C CE  . LYS A 228 ? 0.9300 1.4202 0.8470 0.2517 -0.0513 -0.1243 228  LYS A CE  
1695 N NZ  . LYS A 228 ? 0.8625 1.3371 0.7832 0.2470 -0.0538 -0.1295 228  LYS A NZ  
1696 N N   . LYS A 229 ? 0.5229 0.9834 0.4531 0.2451 -0.0542 -0.1094 229  LYS A N   
1697 C CA  . LYS A 229 ? 0.4901 0.9404 0.4204 0.2480 -0.0534 -0.0961 229  LYS A CA  
1698 C C   . LYS A 229 ? 0.5882 1.0109 0.5267 0.2411 -0.0573 -0.0957 229  LYS A C   
1699 O O   . LYS A 229 ? 0.6343 1.0460 0.5718 0.2429 -0.0571 -0.0888 229  LYS A O   
1700 C CB  . LYS A 229 ? 0.5644 1.0252 0.4945 0.2514 -0.0512 -0.0879 229  LYS A CB  
1701 C CG  . LYS A 229 ? 0.6681 1.1151 0.6010 0.2529 -0.0509 -0.0748 229  LYS A CG  
1702 C CD  . LYS A 229 ? 0.7178 1.1754 0.6427 0.2625 -0.0465 -0.0635 229  LYS A CD  
1703 C CE  . LYS A 229 ? 0.8222 1.2597 0.7501 0.2631 -0.0469 -0.0533 229  LYS A CE  
1704 N NZ  . LYS A 229 ? 0.8305 1.2635 0.7625 0.2639 -0.0460 -0.0434 229  LYS A NZ  
1705 N N   . MET A 230 ? 0.5887 1.0007 0.5352 0.2332 -0.0607 -0.1037 230  MET A N   
1706 C CA  . MET A 230 ? 0.5140 0.9006 0.4687 0.2262 -0.0644 -0.1036 230  MET A CA  
1707 C C   . MET A 230 ? 0.5025 0.8776 0.4569 0.2237 -0.0661 -0.1087 230  MET A C   
1708 O O   . MET A 230 ? 0.4813 0.8388 0.4385 0.2215 -0.0676 -0.1040 230  MET A O   
1709 C CB  . MET A 230 ? 0.5285 0.9075 0.4918 0.2187 -0.0673 -0.1106 230  MET A CB  
1710 C CG  . MET A 230 ? 0.4767 0.8597 0.4427 0.2195 -0.0665 -0.1037 230  MET A CG  
1711 S SD  . MET A 230 ? 0.4740 0.8482 0.4502 0.2107 -0.0699 -0.1126 230  MET A SD  
1712 C CE  . MET A 230 ? 0.5663 0.9553 0.5395 0.2103 -0.0695 -0.1272 230  MET A CE  
1713 N N   . TYR A 231 ? 0.5257 0.9111 0.4770 0.2239 -0.0657 -0.1184 231  TYR A N   
1714 C CA  . TYR A 231 ? 0.6065 0.9822 0.5575 0.2216 -0.0671 -0.1240 231  TYR A CA  
1715 C C   . TYR A 231 ? 0.6377 1.0190 0.5808 0.2283 -0.0647 -0.1175 231  TYR A C   
1716 O O   . TYR A 231 ? 0.5987 0.9716 0.5412 0.2268 -0.0658 -0.1208 231  TYR A O   
1717 C CB  . TYR A 231 ? 0.6032 0.9865 0.5548 0.2190 -0.0677 -0.1374 231  TYR A CB  
1718 C CG  . TYR A 231 ? 0.5566 0.9244 0.5179 0.2106 -0.0711 -0.1454 231  TYR A CG  
1719 C CD1 . TYR A 231 ? 0.4954 0.8660 0.4613 0.2082 -0.0716 -0.1472 231  TYR A CD1 
1720 C CD2 . TYR A 231 ? 0.5295 0.8797 0.4954 0.2051 -0.0738 -0.1508 231  TYR A CD2 
1721 C CE1 . TYR A 231 ? 0.6426 0.9986 0.6173 0.2008 -0.0746 -0.1544 231  TYR A CE1 
1722 C CE2 . TYR A 231 ? 0.5706 0.9062 0.5454 0.1978 -0.0767 -0.1578 231  TYR A CE2 
1723 C CZ  . TYR A 231 ? 0.5713 0.9098 0.5504 0.1958 -0.0771 -0.1596 231  TYR A CZ  
1724 O OH  . TYR A 231 ? 0.5856 0.9095 0.5736 0.1888 -0.0798 -0.1665 231  TYR A OH  
1725 N N   . SER A 232 ? 0.5569 0.9522 0.4937 0.2358 -0.0613 -0.1084 232  SER A N   
1726 C CA  . SER A 232 ? 0.6359 1.0380 0.5649 0.2429 -0.0586 -0.1023 232  SER A CA  
1727 C C   . SER A 232 ? 0.7553 1.1498 0.6836 0.2468 -0.0573 -0.0887 232  SER A C   
1728 O O   . SER A 232 ? 0.7240 1.1257 0.6456 0.2540 -0.0543 -0.0818 232  SER A O   
1729 C CB  . SER A 232 ? 0.5122 0.9406 0.4328 0.2497 -0.0550 -0.1041 232  SER A CB  
1730 O OG  . SER A 232 ? 0.5817 1.0222 0.5002 0.2543 -0.0524 -0.0965 232  SER A OG  
1731 N N   . ARG A 233 ? 0.8093 1.1893 0.7449 0.2423 -0.0592 -0.0849 233  ARG A N   
1732 C CA  . ARG A 233 ? 0.6356 1.0070 0.5716 0.2458 -0.0580 -0.0724 233  ARG A CA  
1733 C C   . ARG A 233 ? 0.5745 0.9308 0.5101 0.2452 -0.0590 -0.0705 233  ARG A C   
1734 O O   . ARG A 233 ? 0.6482 0.9953 0.5863 0.2397 -0.0618 -0.0788 233  ARG A O   
1735 C CB  . ARG A 233 ? 0.7361 1.0962 0.6801 0.2413 -0.0598 -0.0685 233  ARG A CB  
1736 C CG  . ARG A 233 ? 0.6495 0.9927 0.6025 0.2312 -0.0643 -0.0768 233  ARG A CG  
1737 C CD  . ARG A 233 ? 0.6931 1.0287 0.6532 0.2280 -0.0654 -0.0722 233  ARG A CD  
1738 N NE  . ARG A 233 ? 0.7621 1.0838 0.7244 0.2293 -0.0651 -0.0614 233  ARG A NE  
1739 C CZ  . ARG A 233 ? 0.6713 0.9904 0.6372 0.2302 -0.0644 -0.0532 233  ARG A CZ  
1740 N NH1 . ARG A 233 ? 0.4654 0.7954 0.4329 0.2299 -0.0639 -0.0543 233  ARG A NH1 
1741 N NH2 . ARG A 233 ? 0.5839 0.8894 0.5518 0.2315 -0.0640 -0.0439 233  ARG A NH2 
1742 N N   . LYS A 234 ? 0.5585 0.9129 0.4909 0.2514 -0.0566 -0.0595 234  LYS A N   
1743 C CA  . LYS A 234 ? 0.8302 1.1714 0.7617 0.2516 -0.0572 -0.0573 234  LYS A CA  
1744 C C   . LYS A 234 ? 0.7471 1.0650 0.6872 0.2445 -0.0606 -0.0558 234  LYS A C   
1745 O O   . LYS A 234 ? 0.7718 1.0760 0.7143 0.2399 -0.0631 -0.0596 234  LYS A O   
1746 C CB  . LYS A 234 ? 0.9526 1.3007 0.8772 0.2614 -0.0529 -0.0462 234  LYS A CB  
1747 C CG  . LYS A 234 ? 0.9402 1.3109 0.8555 0.2689 -0.0494 -0.0474 234  LYS A CG  
1748 C CD  . LYS A 234 ? 0.8422 1.2148 0.7553 0.2659 -0.0512 -0.0581 234  LYS A CD  
1749 C CE  . LYS A 234 ? 0.8703 1.2629 0.7736 0.2744 -0.0475 -0.0574 234  LYS A CE  
1750 N NZ  . LYS A 234 ? 0.9225 1.3090 0.8220 0.2793 -0.0460 -0.0509 234  LYS A NZ  
1751 N N   . THR A 235 ? 0.7080 1.0223 0.6530 0.2435 -0.0606 -0.0503 235  THR A N   
1752 C CA  . THR A 235 ? 0.7399 1.0332 0.6930 0.2375 -0.0633 -0.0474 235  THR A CA  
1753 C C   . THR A 235 ? 0.7478 1.0334 0.7086 0.2281 -0.0672 -0.0563 235  THR A C   
1754 O O   . THR A 235 ? 0.7903 1.0878 0.7509 0.2270 -0.0674 -0.0627 235  THR A O   
1755 C CB  . THR A 235 ? 0.7326 1.0250 0.6871 0.2419 -0.0608 -0.0358 235  THR A CB  
1756 O OG1 . THR A 235 ? 0.5274 0.8387 0.4789 0.2461 -0.0584 -0.0349 235  THR A OG1 
1757 C CG2 . THR A 235 ? 0.7166 1.0074 0.6659 0.2497 -0.0576 -0.0262 235  THR A CG2 
1758 N N   . LYS A 236 ? 0.6315 0.8974 0.5992 0.2214 -0.0703 -0.0568 236  LYS A N   
1759 C CA  . LYS A 236 ? 0.6834 0.9405 0.6589 0.2126 -0.0739 -0.0641 236  LYS A CA  
1760 C C   . LYS A 236 ? 0.7118 0.9688 0.6921 0.2124 -0.0735 -0.0581 236  LYS A C   
1761 O O   . LYS A 236 ? 0.6241 0.8769 0.6047 0.2161 -0.0718 -0.0479 236  LYS A O   
1762 C CB  . LYS A 236 ? 0.7346 0.9711 0.7153 0.2055 -0.0773 -0.0668 236  LYS A CB  
1763 C CG  . LYS A 236 ? 0.8537 1.0890 0.8317 0.2031 -0.0787 -0.0758 236  LYS A CG  
1764 C CD  . LYS A 236 ? 0.9240 1.1392 0.9081 0.1949 -0.0822 -0.0794 236  LYS A CD  
1765 C CE  . LYS A 236 ? 0.9720 1.1856 0.9555 0.1907 -0.0841 -0.0906 236  LYS A CE  
1766 N NZ  . LYS A 236 ? 0.9469 1.1417 0.9374 0.1818 -0.0877 -0.0956 236  LYS A NZ  
1767 N N   . PRO A 237 ? 0.7608 1.0227 0.7448 0.2083 -0.0749 -0.0644 237  PRO A N   
1768 C CA  . PRO A 237 ? 0.6693 0.9293 0.6590 0.2068 -0.0751 -0.0596 237  PRO A CA  
1769 C C   . PRO A 237 ? 0.5506 0.7896 0.5478 0.2015 -0.0774 -0.0554 237  PRO A C   
1770 O O   . PRO A 237 ? 0.3980 0.6233 0.3979 0.1958 -0.0800 -0.0604 237  PRO A O   
1771 C CB  . PRO A 237 ? 0.7030 0.9686 0.6961 0.2017 -0.0770 -0.0699 237  PRO A CB  
1772 C CG  . PRO A 237 ? 0.6756 0.9541 0.6621 0.2043 -0.0760 -0.0774 237  PRO A CG  
1773 C CD  . PRO A 237 ? 0.7006 0.9710 0.6836 0.2055 -0.0760 -0.0761 237  PRO A CD  
1774 N N   . PHE A 238 ? 0.4017 0.6387 0.4021 0.2034 -0.0761 -0.0464 238  PHE A N   
1775 C CA  . PHE A 238 ? 0.4674 0.6857 0.4750 0.1989 -0.0779 -0.0419 238  PHE A CA  
1776 C C   . PHE A 238 ? 0.4790 0.6861 0.4943 0.1892 -0.0818 -0.0498 238  PHE A C   
1777 O O   . PHE A 238 ? 0.5495 0.7408 0.5707 0.1845 -0.0835 -0.0474 238  PHE A O   
1778 C CB  . PHE A 238 ? 0.5139 0.7338 0.5236 0.2033 -0.0754 -0.0310 238  PHE A CB  
1779 C CG  . PHE A 238 ? 0.6153 0.8422 0.6179 0.2129 -0.0713 -0.0219 238  PHE A CG  
1780 C CD1 . PHE A 238 ? 0.4457 0.6645 0.4449 0.2152 -0.0706 -0.0193 238  PHE A CD1 
1781 C CD2 . PHE A 238 ? 0.7310 0.9728 0.7300 0.2198 -0.0679 -0.0158 238  PHE A CD2 
1782 C CE1 . PHE A 238 ? 0.5167 0.7417 0.5092 0.2244 -0.0665 -0.0109 238  PHE A CE1 
1783 C CE2 . PHE A 238 ? 0.7420 0.9904 0.7339 0.2291 -0.0637 -0.0071 238  PHE A CE2 
1784 C CZ  . PHE A 238 ? 0.5833 0.8230 0.5721 0.2314 -0.0630 -0.0047 238  PHE A CZ  
1785 N N   . SER A 239 ? 0.3547 0.5698 0.3702 0.1862 -0.0831 -0.0592 239  SER A N   
1786 C CA  . SER A 239 ? 0.4115 0.6159 0.4344 0.1774 -0.0866 -0.0667 239  SER A CA  
1787 C C   . SER A 239 ? 0.4910 0.6916 0.5126 0.1730 -0.0887 -0.0783 239  SER A C   
1788 O O   . SER A 239 ? 0.6183 0.8316 0.6348 0.1760 -0.0876 -0.0837 239  SER A O   
1789 C CB  . SER A 239 ? 0.3418 0.5560 0.3678 0.1769 -0.0864 -0.0683 239  SER A CB  
1790 O OG  . SER A 239 ? 0.3761 0.5823 0.4079 0.1690 -0.0894 -0.0778 239  SER A OG  
1791 N N   . PHE A 240 ? 0.4263 0.6097 0.4525 0.1659 -0.0915 -0.0821 240  PHE A N   
1792 C CA  . PHE A 240 ? 0.4719 0.6501 0.4981 0.1611 -0.0936 -0.0936 240  PHE A CA  
1793 C C   . PHE A 240 ? 0.4595 0.6399 0.4903 0.1570 -0.0949 -0.1020 240  PHE A C   
1794 O O   . PHE A 240 ? 0.4183 0.6067 0.4471 0.1575 -0.0947 -0.1103 240  PHE A O   
1795 C CB  . PHE A 240 ? 0.4492 0.6079 0.4782 0.1552 -0.0961 -0.0950 240  PHE A CB  
1796 C CG  . PHE A 240 ? 0.5072 0.6591 0.5367 0.1504 -0.0982 -0.1065 240  PHE A CG  
1797 C CD1 . PHE A 240 ? 0.5368 0.6928 0.5610 0.1530 -0.0975 -0.1097 240  PHE A CD1 
1798 C CD2 . PHE A 240 ? 0.5482 0.6895 0.5838 0.1435 -0.1005 -0.1141 240  PHE A CD2 
1799 C CE1 . PHE A 240 ? 0.4815 0.6312 0.5066 0.1490 -0.0990 -0.1198 240  PHE A CE1 
1800 C CE2 . PHE A 240 ? 0.5610 0.6954 0.5977 0.1397 -0.1020 -0.1244 240  PHE A CE2 
1801 C CZ  . PHE A 240 ? 0.4826 0.6213 0.5141 0.1425 -0.1012 -0.1271 240  PHE A CZ  
1802 N N   . TYR A 241 ? 0.3698 0.5428 0.4069 0.1531 -0.0961 -0.0998 241  TYR A N   
1803 C CA  . TYR A 241 ? 0.4422 0.6151 0.4844 0.1489 -0.0974 -0.1074 241  TYR A CA  
1804 C C   . TYR A 241 ? 0.4045 0.5970 0.4438 0.1534 -0.0955 -0.1107 241  TYR A C   
1805 O O   . TYR A 241 ? 0.4110 0.6050 0.4530 0.1506 -0.0963 -0.1201 241  TYR A O   
1806 C CB  . TYR A 241 ? 0.3459 0.5118 0.3943 0.1458 -0.0982 -0.1018 241  TYR A CB  
1807 C CG  . TYR A 241 ? 0.5000 0.6618 0.5545 0.1405 -0.0999 -0.1095 241  TYR A CG  
1808 C CD1 . TYR A 241 ? 0.5205 0.6657 0.5789 0.1338 -0.1024 -0.1180 241  TYR A CD1 
1809 C CD2 . TYR A 241 ? 0.4772 0.6512 0.5338 0.1423 -0.0988 -0.1083 241  TYR A CD2 
1810 C CE1 . TYR A 241 ? 0.4390 0.5793 0.5032 0.1293 -0.1037 -0.1252 241  TYR A CE1 
1811 C CE2 . TYR A 241 ? 0.5307 0.7009 0.5930 0.1377 -0.1002 -0.1156 241  TYR A CE2 
1812 C CZ  . TYR A 241 ? 0.4852 0.6382 0.5514 0.1313 -0.1026 -0.1241 241  TYR A CZ  
1813 O OH  . TYR A 241 ? 0.3736 0.5223 0.4456 0.1272 -0.1037 -0.1314 241  TYR A OH  
1814 N N   . LEU A 242 ? 0.4149 0.6223 0.4487 0.1605 -0.0927 -0.1033 242  LEU A N   
1815 C CA  . LEU A 242 ? 0.4143 0.6416 0.4449 0.1651 -0.0906 -0.1053 242  LEU A CA  
1816 C C   . LEU A 242 ? 0.3880 0.6282 0.4104 0.1707 -0.0886 -0.1074 242  LEU A C   
1817 O O   . LEU A 242 ? 0.4111 0.6699 0.4289 0.1760 -0.0862 -0.1071 242  LEU A O   
1818 C CB  . LEU A 242 ? 0.4491 0.6854 0.4800 0.1693 -0.0887 -0.0949 242  LEU A CB  
1819 C CG  . LEU A 242 ? 0.3520 0.5786 0.3911 0.1644 -0.0903 -0.0923 242  LEU A CG  
1820 C CD1 . LEU A 242 ? 0.2656 0.5020 0.3047 0.1694 -0.0881 -0.0815 242  LEU A CD1 
1821 C CD2 . LEU A 242 ? 0.2478 0.4735 0.2918 0.1590 -0.0921 -0.1034 242  LEU A CD2 
1822 N N   . ASP A 243 ? 0.4231 0.6540 0.4436 0.1695 -0.0895 -0.1098 243  ASP A N   
1823 C CA  . ASP A 243 ? 0.4296 0.6719 0.4421 0.1750 -0.0875 -0.1107 243  ASP A CA  
1824 C C   . ASP A 243 ? 0.3836 0.6370 0.3948 0.1749 -0.0872 -0.1220 243  ASP A C   
1825 O O   . ASP A 243 ? 0.3850 0.6288 0.4011 0.1692 -0.0893 -0.1312 243  ASP A O   
1826 C CB  . ASP A 243 ? 0.4512 0.6802 0.4623 0.1735 -0.0886 -0.1103 243  ASP A CB  
1827 C CG  . ASP A 243 ? 0.5411 0.7817 0.5442 0.1790 -0.0865 -0.1120 243  ASP A CG  
1828 O OD1 . ASP A 243 ? 0.4003 0.6440 0.4029 0.1774 -0.0870 -0.1219 243  ASP A OD1 
1829 O OD2 . ASP A 243 ? 0.5497 0.7962 0.5473 0.1851 -0.0843 -0.1035 243  ASP A OD2 
1830 N N   . ILE A 244 ? 0.3233 0.5971 0.3281 0.1813 -0.0843 -0.1213 244  ILE A N   
1831 C CA  . ILE A 244 ? 0.3356 0.6219 0.3398 0.1814 -0.0838 -0.1316 244  ILE A CA  
1832 C C   . ILE A 244 ? 0.4514 0.7336 0.4549 0.1794 -0.0847 -0.1412 244  ILE A C   
1833 O O   . ILE A 244 ? 0.5266 0.8088 0.5336 0.1762 -0.0855 -0.1515 244  ILE A O   
1834 C CB  . ILE A 244 ? 0.5529 0.8634 0.5502 0.1887 -0.0804 -0.1287 244  ILE A CB  
1835 C CG1 . ILE A 244 ? 0.4830 0.8050 0.4821 0.1873 -0.0802 -0.1389 244  ILE A CG1 
1836 C CG2 . ILE A 244 ? 0.5582 0.8793 0.5466 0.1949 -0.0780 -0.1266 244  ILE A CG2 
1837 C CD1 . ILE A 244 ? 0.4945 0.8057 0.5024 0.1812 -0.0825 -0.1417 244  ILE A CD1 
1838 N N   . LYS A 245 ? 0.3718 0.6495 0.3712 0.1812 -0.0844 -0.1379 245  LYS A N   
1839 C CA  . LYS A 245 ? 0.4217 0.6964 0.4200 0.1799 -0.0849 -0.1463 245  LYS A CA  
1840 C C   . LYS A 245 ? 0.4336 0.6886 0.4402 0.1720 -0.0881 -0.1534 245  LYS A C   
1841 O O   . LYS A 245 ? 0.4806 0.7352 0.4897 0.1698 -0.0886 -0.1636 245  LYS A O   
1842 C CB  . LYS A 245 ? 0.5118 0.7847 0.5043 0.1833 -0.0841 -0.1404 245  LYS A CB  
1843 C CG  . LYS A 245 ? 0.5599 0.8534 0.5433 0.1917 -0.0806 -0.1354 245  LYS A CG  
1844 C CD  . LYS A 245 ? 0.6425 0.9333 0.6205 0.1952 -0.0798 -0.1298 245  LYS A CD  
1845 C CE  . LYS A 245 ? 0.6470 0.9583 0.6157 0.2041 -0.0760 -0.1245 245  LYS A CE  
1846 N NZ  . LYS A 245 ? 0.6739 0.9829 0.6372 0.2079 -0.0750 -0.1192 245  LYS A NZ  
1847 N N   . TRP A 246 ? 0.4054 0.6442 0.4167 0.1680 -0.0900 -0.1481 246  TRP A N   
1848 C CA  . TRP A 246 ? 0.3646 0.5840 0.3837 0.1606 -0.0928 -0.1541 246  TRP A CA  
1849 C C   . TRP A 246 ? 0.3743 0.5957 0.3991 0.1579 -0.0933 -0.1613 246  TRP A C   
1850 O O   . TRP A 246 ? 0.3995 0.6120 0.4293 0.1539 -0.0946 -0.1705 246  TRP A O   
1851 C CB  . TRP A 246 ? 0.4693 0.6725 0.4916 0.1572 -0.0945 -0.1463 246  TRP A CB  
1852 C CG  . TRP A 246 ? 0.6371 0.8313 0.6563 0.1574 -0.0949 -0.1418 246  TRP A CG  
1853 C CD1 . TRP A 246 ? 0.6299 0.8309 0.6429 0.1627 -0.0932 -0.1328 246  TRP A CD1 
1854 C CD2 . TRP A 246 ? 0.6059 0.7820 0.6283 0.1521 -0.0971 -0.1458 246  TRP A CD2 
1855 N NE1 . TRP A 246 ? 0.5734 0.7623 0.5856 0.1610 -0.0943 -0.1315 246  TRP A NE1 
1856 C CE2 . TRP A 246 ? 0.5778 0.7516 0.5955 0.1543 -0.0967 -0.1393 246  TRP A CE2 
1857 C CE3 . TRP A 246 ? 0.6086 0.7703 0.6374 0.1459 -0.0992 -0.1543 246  TRP A CE3 
1858 C CZ2 . TRP A 246 ? 0.5970 0.7554 0.6161 0.1503 -0.0985 -0.1413 246  TRP A CZ2 
1859 C CZ3 . TRP A 246 ? 0.6380 0.7840 0.6682 0.1422 -0.1008 -0.1558 246  TRP A CZ3 
1860 C CH2 . TRP A 246 ? 0.7056 0.8504 0.7308 0.1442 -0.1005 -0.1495 246  TRP A CH2 
1861 N N   . LEU A 247 ? 0.3460 0.5784 0.3703 0.1603 -0.0922 -0.1568 247  LEU A N   
1862 C CA  . LEU A 247 ? 0.3490 0.5836 0.3788 0.1578 -0.0926 -0.1627 247  LEU A CA  
1863 C C   . LEU A 247 ? 0.3991 0.6458 0.4279 0.1595 -0.0915 -0.1733 247  LEU A C   
1864 O O   . LEU A 247 ? 0.3531 0.5924 0.3880 0.1556 -0.0926 -0.1827 247  LEU A O   
1865 C CB  . LEU A 247 ? 0.3230 0.5691 0.3517 0.1607 -0.0914 -0.1548 247  LEU A CB  
1866 C CG  . LEU A 247 ? 0.5144 0.7474 0.5495 0.1563 -0.0931 -0.1496 247  LEU A CG  
1867 C CD1 . LEU A 247 ? 0.4302 0.6400 0.4714 0.1496 -0.0959 -0.1533 247  LEU A CD1 
1868 C CD2 . LEU A 247 ? 0.3800 0.6158 0.4122 0.1597 -0.0921 -0.1365 247  LEU A CD2 
1869 N N   . ALA A 248 ? 0.4210 0.6857 0.4420 0.1655 -0.0891 -0.1718 248  ALA A N   
1870 C CA  . ALA A 248 ? 0.2941 0.5728 0.3129 0.1678 -0.0876 -0.1814 248  ALA A CA  
1871 C C   . ALA A 248 ? 0.4388 0.7034 0.4639 0.1627 -0.0890 -0.1880 248  ALA A C   
1872 O O   . ALA A 248 ? 0.4663 0.7312 0.4992 0.1585 -0.0890 -0.1927 248  ALA A O   
1873 C CB  . ALA A 248 ? 0.4131 0.7107 0.4222 0.1748 -0.0849 -0.1771 248  ALA A CB  
1874 N N   . ASN A 249 ? 0.4020 0.6535 0.4260 0.1615 -0.0901 -0.1850 249  ASN A N   
1875 C CA  . ASN A 249 ? 0.4458 0.6831 0.4779 0.1550 -0.0911 -0.1869 249  ASN A CA  
1876 C C   . ASN A 249 ? 0.3821 0.6028 0.4255 0.1475 -0.0928 -0.1889 249  ASN A C   
1877 O O   . ASN A 249 ? 0.5516 0.7698 0.6026 0.1433 -0.0926 -0.1923 249  ASN A O   
1878 C CB  . ASN A 249 ? 0.2678 0.4937 0.2967 0.1548 -0.0920 -0.1829 249  ASN A CB  
1879 C CG  . ASN A 249 ? 0.4194 0.6278 0.4576 0.1472 -0.0931 -0.1838 249  ASN A CG  
1880 O OD1 . ASN A 249 ? 0.4064 0.5965 0.4505 0.1418 -0.0949 -0.1819 249  ASN A OD1 
1881 N ND2 . ASN A 249 ? 0.4661 0.6805 0.5058 0.1468 -0.0920 -0.1863 249  ASN A ND2 
1882 N N   . PHE A 250 ? 0.3942 0.6035 0.4389 0.1459 -0.0944 -0.1865 250  PHE A N   
1883 C CA  . PHE A 250 ? 0.4200 0.6132 0.4755 0.1386 -0.0958 -0.1873 250  PHE A CA  
1884 C C   . PHE A 250 ? 0.4505 0.6530 0.5110 0.1379 -0.0949 -0.1922 250  PHE A C   
1885 O O   . PHE A 250 ? 0.3955 0.5878 0.4652 0.1322 -0.0952 -0.1937 250  PHE A O   
1886 C CB  . PHE A 250 ? 0.3650 0.5446 0.4211 0.1367 -0.0977 -0.1836 250  PHE A CB  
1887 C CG  . PHE A 250 ? 0.4248 0.5871 0.4918 0.1289 -0.0987 -0.1830 250  PHE A CG  
1888 C CD1 . PHE A 250 ? 0.3812 0.5283 0.4544 0.1228 -0.0987 -0.1808 250  PHE A CD1 
1889 C CD2 . PHE A 250 ? 0.3817 0.5438 0.4523 0.1280 -0.0992 -0.1842 250  PHE A CD2 
1890 C CE1 . PHE A 250 ? 0.4165 0.5490 0.4988 0.1160 -0.0990 -0.1790 250  PHE A CE1 
1891 C CE2 . PHE A 250 ? 0.4006 0.5474 0.4809 0.1210 -0.0996 -0.1829 250  PHE A CE2 
1892 C CZ  . PHE A 250 ? 0.4370 0.5691 0.5228 0.1151 -0.0994 -0.1799 250  PHE A CZ  
1893 N N   . TRP A 251 ? 0.4290 0.6513 0.4831 0.1438 -0.0936 -0.1941 251  TRP A N   
1894 C CA  . TRP A 251 ? 0.4476 0.6813 0.5058 0.1436 -0.0926 -0.1990 251  TRP A CA  
1895 C C   . TRP A 251 ? 0.5486 0.7935 0.6080 0.1440 -0.0910 -0.2030 251  TRP A C   
1896 O O   . TRP A 251 ? 0.4210 0.6774 0.4831 0.1442 -0.0900 -0.2074 251  TRP A O   
1897 C CB  . TRP A 251 ? 0.3951 0.6451 0.4465 0.1493 -0.0917 -0.1988 251  TRP A CB  
1898 C CG  . TRP A 251 ? 0.5205 0.7582 0.5752 0.1469 -0.0935 -0.1972 251  TRP A CG  
1899 C CD1 . TRP A 251 ? 0.3916 0.6186 0.4432 0.1474 -0.0949 -0.1919 251  TRP A CD1 
1900 C CD2 . TRP A 251 ? 0.3915 0.6253 0.4544 0.1431 -0.0940 -0.2002 251  TRP A CD2 
1901 N NE1 . TRP A 251 ? 0.3435 0.5604 0.4013 0.1435 -0.0963 -0.1905 251  TRP A NE1 
1902 C CE2 . TRP A 251 ? 0.4220 0.6430 0.4860 0.1416 -0.0958 -0.1971 251  TRP A CE2 
1903 C CE3 . TRP A 251 ? 0.3692 0.6090 0.4385 0.1408 -0.0932 -0.2053 251  TRP A CE3 
1904 C CZ2 . TRP A 251 ? 0.4067 0.6211 0.4780 0.1379 -0.0967 -0.1986 251  TRP A CZ2 
1905 C CZ3 . TRP A 251 ? 0.4652 0.6986 0.5416 0.1374 -0.0939 -0.2069 251  TRP A CZ3 
1906 C CH2 . TRP A 251 ? 0.5125 0.7335 0.5898 0.1360 -0.0956 -0.2035 251  TRP A CH2 
1907 N N   . GLY A 252 ? 0.4612 0.7028 0.5189 0.1438 -0.0908 -0.2017 252  GLY A N   
1908 C CA  . GLY A 252 ? 0.2442 0.4935 0.3044 0.1432 -0.0896 -0.2055 252  GLY A CA  
1909 C C   . GLY A 252 ? 0.3445 0.6179 0.3968 0.1495 -0.0875 -0.2070 252  GLY A C   
1910 O O   . GLY A 252 ? 0.3908 0.6740 0.4456 0.1492 -0.0865 -0.2113 252  GLY A O   
1911 N N   . CYS A 253 ? 0.3978 0.6808 0.4403 0.1552 -0.0868 -0.2030 253  CYS A N   
1912 C CA  . CYS A 253 ? 0.4927 0.7990 0.5268 0.1615 -0.0845 -0.2028 253  CYS A CA  
1913 C C   . CYS A 253 ? 0.6181 0.9283 0.6471 0.1639 -0.0836 -0.2007 253  CYS A C   
1914 O O   . CYS A 253 ? 0.5695 0.8986 0.5920 0.1688 -0.0815 -0.2001 253  CYS A O   
1915 C CB  . CYS A 253 ? 0.3377 0.6543 0.3634 0.1671 -0.0837 -0.1985 253  CYS A CB  
1916 S SG  . CYS A 253 ? 0.4189 0.7290 0.4507 0.1640 -0.0850 -0.2005 253  CYS A SG  
1917 N N   . ASP A 254 ? 0.5633 0.8558 0.5958 0.1601 -0.0851 -0.1997 254  ASP A N   
1918 C CA  . ASP A 254 ? 0.6332 0.9264 0.6615 0.1618 -0.0845 -0.1976 254  ASP A CA  
1919 C C   . ASP A 254 ? 0.6794 0.9692 0.7147 0.1576 -0.0845 -0.2019 254  ASP A C   
1920 O O   . ASP A 254 ? 0.7341 1.0187 0.7781 0.1531 -0.0852 -0.2062 254  ASP A O   
1921 C CB  . ASP A 254 ? 0.5843 0.8601 0.6112 0.1606 -0.0860 -0.1931 254  ASP A CB  
1922 C CG  . ASP A 254 ? 0.7346 1.0172 0.7512 0.1670 -0.0853 -0.1878 254  ASP A CG  
1923 O OD1 . ASP A 254 ? 1.0418 1.3420 1.0530 0.1720 -0.0836 -0.1872 254  ASP A OD1 
1924 O OD2 . ASP A 254 ? 0.4793 0.7503 0.4931 0.1672 -0.0864 -0.1840 254  ASP A OD2 
1925 N N   . ASP A 255 ? 0.5684 0.8609 0.5999 0.1594 -0.0839 -0.2004 255  ASP A N   
1926 C CA  . ASP A 255 ? 0.6703 0.9575 0.7080 0.1555 -0.0841 -0.2037 255  ASP A CA  
1927 C C   . ASP A 255 ? 0.6913 0.9556 0.7347 0.1501 -0.0859 -0.2017 255  ASP A C   
1928 O O   . ASP A 255 ? 0.5974 0.8527 0.6482 0.1456 -0.0864 -0.2040 255  ASP A O   
1929 C CB  . ASP A 255 ? 0.7456 1.0467 0.7771 0.1596 -0.0824 -0.2032 255  ASP A CB  
1930 C CG  . ASP A 255 ? 0.7996 1.0996 0.8225 0.1636 -0.0822 -0.1973 255  ASP A CG  
1931 O OD1 . ASP A 255 ? 0.8063 1.1079 0.8234 0.1670 -0.0821 -0.1935 255  ASP A OD1 
1932 O OD2 . ASP A 255 ? 0.8496 1.1474 0.8713 0.1635 -0.0820 -0.1965 255  ASP A OD2 
1933 N N   . GLN A 256 ? 0.6249 0.8798 0.6647 0.1508 -0.0869 -0.1972 256  GLN A N   
1934 C CA  . GLN A 256 ? 0.5508 0.7846 0.5950 0.1459 -0.0886 -0.1944 256  GLN A CA  
1935 C C   . GLN A 256 ? 0.6779 0.8971 0.7311 0.1401 -0.0900 -0.1952 256  GLN A C   
1936 O O   . GLN A 256 ? 0.7175 0.9418 0.7715 0.1409 -0.0900 -0.1968 256  GLN A O   
1937 C CB  . GLN A 256 ? 0.4879 0.7179 0.5244 0.1490 -0.0891 -0.1892 256  GLN A CB  
1938 C CG  . GLN A 256 ? 0.6343 0.8765 0.6619 0.1546 -0.0876 -0.1874 256  GLN A CG  
1939 C CD  . GLN A 256 ? 0.7049 0.9437 0.7361 0.1518 -0.0874 -0.1889 256  GLN A CD  
1940 O OE1 . GLN A 256 ? 0.6873 0.9091 0.7240 0.1467 -0.0887 -0.1878 256  GLN A OE1 
1941 N NE2 . GLN A 256 ? 0.7228 0.9780 0.7509 0.1552 -0.0857 -0.1911 256  GLN A NE2 
1942 N N   . PRO A 257 ? 0.6470 0.8485 0.7070 0.1344 -0.0910 -0.1938 257  PRO A N   
1943 C CA  . PRO A 257 ? 0.5805 0.7662 0.6489 0.1287 -0.0921 -0.1929 257  PRO A CA  
1944 C C   . PRO A 257 ? 0.6290 0.8097 0.6944 0.1294 -0.0932 -0.1896 257  PRO A C   
1945 O O   . PRO A 257 ? 0.6954 0.8783 0.7532 0.1329 -0.0934 -0.1868 257  PRO A O   
1946 C CB  . PRO A 257 ? 0.6867 0.8557 0.7595 0.1237 -0.0927 -0.1896 257  PRO A CB  
1947 C CG  . PRO A 257 ? 0.7637 0.9423 0.8333 0.1263 -0.0917 -0.1915 257  PRO A CG  
1948 C CD  . PRO A 257 ? 0.7087 0.9048 0.7686 0.1332 -0.0909 -0.1923 257  PRO A CD  
1949 N N   . ARG A 258 ? 0.5545 0.7288 0.6257 0.1263 -0.0938 -0.1901 258  ARG A N   
1950 C CA  . ARG A 258 ? 0.5545 0.7238 0.6236 0.1267 -0.0948 -0.1873 258  ARG A CA  
1951 C C   . ARG A 258 ? 0.5613 0.7128 0.6306 0.1231 -0.0961 -0.1815 258  ARG A C   
1952 O O   . ARG A 258 ? 0.5444 0.6816 0.6201 0.1174 -0.0962 -0.1791 258  ARG A O   
1953 C CB  . ARG A 258 ? 0.4977 0.6639 0.5737 0.1237 -0.0951 -0.1890 258  ARG A CB  
1954 C CG  . ARG A 258 ? 0.5188 0.7009 0.5961 0.1260 -0.0939 -0.1950 258  ARG A CG  
1955 C CD  . ARG A 258 ? 0.4279 0.6026 0.5139 0.1217 -0.0942 -0.1964 258  ARG A CD  
1956 N NE  . ARG A 258 ? 0.5303 0.7185 0.6191 0.1231 -0.0931 -0.2023 258  ARG A NE  
1957 C CZ  . ARG A 258 ? 0.5236 0.7240 0.6111 0.1258 -0.0928 -0.2055 258  ARG A CZ  
1958 N NH1 . ARG A 258 ? 0.4575 0.6585 0.5409 0.1278 -0.0934 -0.2032 258  ARG A NH1 
1959 N NH2 . ARG A 258 ? 0.3945 0.6068 0.4848 0.1266 -0.0917 -0.2110 258  ARG A NH2 
1960 N N   . MET A 259 ? 0.4640 0.6175 0.5260 0.1269 -0.0968 -0.1791 259  MET A N   
1961 C CA  . MET A 259 ? 0.5599 0.6991 0.6208 0.1245 -0.0980 -0.1740 259  MET A CA  
1962 C C   . MET A 259 ? 0.5693 0.7017 0.6311 0.1235 -0.0993 -0.1719 259  MET A C   
1963 O O   . MET A 259 ? 0.5446 0.6888 0.6023 0.1283 -0.0994 -0.1742 259  MET A O   
1964 C CB  . MET A 259 ? 0.5915 0.7399 0.6423 0.1308 -0.0978 -0.1732 259  MET A CB  
1965 C CG  . MET A 259 ? 0.8709 1.0058 0.9199 0.1288 -0.0989 -0.1684 259  MET A CG  
1966 S SD  . MET A 259 ? 0.9964 1.1432 1.0323 0.1376 -0.0987 -0.1672 259  MET A SD  
1967 C CE  . MET A 259 ? 0.6724 0.8312 0.7065 0.1398 -0.0967 -0.1698 259  MET A CE  
1968 N N   . TYR A 260 ? 0.4294 0.5437 0.4963 0.1171 -0.1002 -0.1674 260  TYR A N   
1969 C CA  . TYR A 260 ? 0.4969 0.6038 0.5651 0.1155 -0.1015 -0.1650 260  TYR A CA  
1970 C C   . TYR A 260 ? 0.4888 0.6032 0.5478 0.1223 -0.1028 -0.1649 260  TYR A C   
1971 O O   . TYR A 260 ? 0.4276 0.5439 0.4802 0.1256 -0.1030 -0.1636 260  TYR A O   
1972 C CB  . TYR A 260 ? 0.3695 0.4567 0.4436 0.1077 -0.1017 -0.1590 260  TYR A CB  
1973 C CG  . TYR A 260 ? 0.3765 0.4557 0.4510 0.1060 -0.1031 -0.1558 260  TYR A CG  
1974 C CD1 . TYR A 260 ? 0.3813 0.4593 0.4608 0.1040 -0.1031 -0.1564 260  TYR A CD1 
1975 C CD2 . TYR A 260 ? 0.4823 0.5551 0.5526 0.1063 -0.1044 -0.1522 260  TYR A CD2 
1976 C CE1 . TYR A 260 ? 0.3908 0.4614 0.4711 0.1022 -0.1044 -0.1534 260  TYR A CE1 
1977 C CE2 . TYR A 260 ? 0.4476 0.5129 0.5186 0.1046 -0.1058 -0.1492 260  TYR A CE2 
1978 C CZ  . TYR A 260 ? 0.5535 0.6177 0.6296 0.1024 -0.1058 -0.1497 260  TYR A CZ  
1979 O OH  . TYR A 260 ? 0.5181 0.5750 0.5952 0.1006 -0.1071 -0.1467 260  TYR A OH  
1980 N N   . HIS A 261 ? 0.4241 0.5437 0.4823 0.1248 -0.1035 -0.1663 261  HIS A N   
1981 C CA  . HIS A 261 ? 0.3820 0.5098 0.4317 0.1311 -0.1041 -0.1638 261  HIS A CA  
1982 C C   . HIS A 261 ? 0.4533 0.5699 0.5074 0.1271 -0.1055 -0.1593 261  HIS A C   
1983 O O   . HIS A 261 ? 0.4126 0.5195 0.4659 0.1252 -0.1065 -0.1532 261  HIS A O   
1984 C CB  . HIS A 261 ? 0.3401 0.4906 0.3856 0.1370 -0.1017 -0.1627 261  HIS A CB  
1985 C CG  . HIS A 261 ? 0.5114 0.6710 0.5535 0.1403 -0.1007 -0.1519 261  HIS A CG  
1986 N ND1 . HIS A 261 ? 0.4453 0.6118 0.4900 0.1406 -0.1002 -0.1497 261  HIS A ND1 
1987 C CD2 . HIS A 261 ? 0.4884 0.6509 0.5254 0.1435 -0.0998 -0.1426 261  HIS A CD2 
1988 C CE1 . HIS A 261 ? 0.4323 0.6054 0.4738 0.1441 -0.0991 -0.1391 261  HIS A CE1 
1989 N NE2 . HIS A 261 ? 0.4428 0.6134 0.4797 0.1460 -0.0988 -0.1346 261  HIS A NE2 
1990 N N   . HIS A 262 ? 0.4368 0.5548 0.4958 0.1258 -0.1057 -0.1626 262  HIS A N   
1991 C CA  . HIS A 262 ? 0.3741 0.4797 0.4385 0.1212 -0.1072 -0.1603 262  HIS A CA  
1992 C C   . HIS A 262 ? 0.4557 0.5565 0.5290 0.1161 -0.1065 -0.1639 262  HIS A C   
1993 O O   . HIS A 262 ? 0.4062 0.5166 0.4806 0.1173 -0.1049 -0.1678 262  HIS A O   
1994 C CB  . HIS A 262 ? 0.3889 0.5067 0.4519 0.1239 -0.1062 -0.1517 262  HIS A CB  
1995 C CG  . HIS A 262 ? 0.4564 0.5894 0.5205 0.1265 -0.1048 -0.1551 262  HIS A CG  
1996 N ND1 . HIS A 262 ? 0.4773 0.6288 0.5365 0.1319 -0.1028 -0.1567 262  HIS A ND1 
1997 C CD2 . HIS A 262 ? 0.4297 0.5624 0.4993 0.1245 -0.1052 -0.1579 262  HIS A CD2 
1998 C CE1 . HIS A 262 ? 0.4483 0.6104 0.5098 0.1329 -0.1019 -0.1605 262  HIS A CE1 
1999 N NE2 . HIS A 262 ? 0.4152 0.5663 0.4831 0.1285 -0.1034 -0.1612 262  HIS A NE2 
2000 N N   . THR A 263 ? 0.3046 0.3919 0.3847 0.1099 -0.1070 -0.1604 263  THR A N   
2001 C CA  . THR A 263 ? 0.2729 0.3561 0.3614 0.1046 -0.1055 -0.1607 263  THR A CA  
2002 C C   . THR A 263 ? 0.3677 0.4635 0.4567 0.1086 -0.1058 -0.1659 263  THR A C   
2003 O O   . THR A 263 ? 0.3368 0.4316 0.4254 0.1096 -0.1072 -0.1653 263  THR A O   
2004 C CB  . THR A 263 ? 0.4265 0.4916 0.5211 0.0966 -0.1052 -0.1537 263  THR A CB  
2005 O OG1 . THR A 263 ? 0.4788 0.5337 0.5720 0.0931 -0.1046 -0.1485 263  THR A OG1 
2006 C CG2 . THR A 263 ? 0.3979 0.4586 0.5000 0.0917 -0.1032 -0.1532 263  THR A CG2 
2007 N N   . ILE A 264 ? 0.3372 0.4452 0.4269 0.1109 -0.1044 -0.1711 264  ILE A N   
2008 C CA  . ILE A 264 ? 0.3363 0.4583 0.4263 0.1147 -0.1042 -0.1764 264  ILE A CA  
2009 C C   . ILE A 264 ? 0.3900 0.5022 0.4881 0.1095 -0.1043 -0.1750 264  ILE A C   
2010 O O   . ILE A 264 ? 0.3730 0.4694 0.4772 0.1027 -0.1038 -0.1702 264  ILE A O   
2011 C CB  . ILE A 264 ? 0.5262 0.6631 0.6159 0.1173 -0.1023 -0.1819 264  ILE A CB  
2012 C CG1 . ILE A 264 ? 0.5879 0.7153 0.6825 0.1124 -0.1013 -0.1804 264  ILE A CG1 
2013 C CG2 . ILE A 264 ? 0.3246 0.4802 0.4037 0.1255 -0.1019 -0.1845 264  ILE A CG2 
2014 C CD1 . ILE A 264 ? 0.6073 0.7289 0.7108 0.1075 -0.1003 -0.1813 264  ILE A CD1 
2015 N N   . PRO A 265 ? 0.3250 0.4475 0.4226 0.1129 -0.1049 -0.1785 265  PRO A N   
2016 C CA  . PRO A 265 ? 0.3304 0.4445 0.4357 0.1083 -0.1050 -0.1774 265  PRO A CA  
2017 C C   . PRO A 265 ? 0.2983 0.4144 0.4104 0.1056 -0.1032 -0.1806 265  PRO A C   
2018 O O   . PRO A 265 ? 0.2905 0.4186 0.4040 0.1081 -0.1028 -0.1858 265  PRO A O   
2019 C CB  . PRO A 265 ? 0.2104 0.3368 0.3114 0.1140 -0.1062 -0.1806 265  PRO A CB  
2020 C CG  . PRO A 265 ? 0.2871 0.4353 0.3811 0.1196 -0.1045 -0.1798 265  PRO A CG  
2021 C CD  . PRO A 265 ? 0.2354 0.3786 0.3250 0.1206 -0.1046 -0.1808 265  PRO A CD  
2022 N N   . VAL A 266 ? 0.3452 0.4498 0.4612 0.1006 -0.1020 -0.1772 266  VAL A N   
2023 C CA  . VAL A 266 ? 0.4208 0.5251 0.5429 0.0980 -0.1004 -0.1793 266  VAL A CA  
2024 C C   . VAL A 266 ? 0.4148 0.5243 0.5422 0.0979 -0.1001 -0.1832 266  VAL A C   
2025 O O   . VAL A 266 ? 0.3404 0.4624 0.4692 0.1003 -0.0993 -0.1893 266  VAL A O   
2026 C CB  . VAL A 266 ? 0.4402 0.5268 0.5663 0.0917 -0.0993 -0.1725 266  VAL A CB  
2027 C CG1 . VAL A 266 ? 0.2528 0.3385 0.3853 0.0894 -0.0978 -0.1744 266  VAL A CG1 
2028 C CG2 . VAL A 266 ? 0.3342 0.4175 0.4557 0.0918 -0.0993 -0.1697 266  VAL A CG2 
2029 N N   . ILE A 267 ? 0.2640 0.3645 0.3943 0.0951 -0.1006 -0.1795 267  ILE A N   
2030 C CA  . ILE A 267 ? 0.2799 0.3839 0.4157 0.0945 -0.1002 -0.1827 267  ILE A CA  
2031 C C   . ILE A 267 ? 0.4464 0.5695 0.5790 0.1005 -0.1009 -0.1899 267  ILE A C   
2032 O O   . ILE A 267 ? 0.3322 0.4652 0.4683 0.1015 -0.1001 -0.1954 267  ILE A O   
2033 C CB  . ILE A 267 ? 0.2927 0.3825 0.4320 0.0900 -0.1004 -0.1766 267  ILE A CB  
2034 C CG1 . ILE A 267 ? 0.3189 0.3922 0.4599 0.0845 -0.0990 -0.1689 267  ILE A CG1 
2035 C CG2 . ILE A 267 ? 0.3393 0.4328 0.4846 0.0895 -0.1000 -0.1800 267  ILE A CG2 
2036 C CD1 . ILE A 267 ? 0.2529 0.3244 0.3992 0.0824 -0.0973 -0.1701 267  ILE A CD1 
2037 N N   . SER A 268 ? 0.3427 0.4722 0.4681 0.1047 -0.1023 -0.1898 268  SER A N   
2038 C CA  . SER A 268 ? 0.3811 0.5310 0.5014 0.1112 -0.1024 -0.1958 268  SER A CA  
2039 C C   . SER A 268 ? 0.3685 0.5347 0.4865 0.1145 -0.1008 -0.2014 268  SER A C   
2040 O O   . SER A 268 ? 0.4151 0.5982 0.5322 0.1177 -0.0998 -0.2070 268  SER A O   
2041 C CB  . SER A 268 ? 0.3151 0.4691 0.4266 0.1159 -0.1040 -0.1936 268  SER A CB  
2042 O OG  . SER A 268 ? 0.4390 0.5774 0.5534 0.1121 -0.1055 -0.1873 268  SER A OG  
2043 N N   . LEU A 269 ? 0.2152 0.3759 0.3325 0.1131 -0.1003 -0.1997 269  LEU A N   
2044 C CA  . LEU A 269 ? 0.2874 0.4609 0.4031 0.1154 -0.0988 -0.2043 269  LEU A CA  
2045 C C   . LEU A 269 ? 0.2995 0.4742 0.4235 0.1125 -0.0976 -0.2085 269  LEU A C   
2046 O O   . LEU A 269 ? 0.3189 0.5108 0.4416 0.1157 -0.0965 -0.2144 269  LEU A O   
2047 C CB  . LEU A 269 ? 0.2746 0.4409 0.3876 0.1146 -0.0988 -0.2011 269  LEU A CB  
2048 C CG  . LEU A 269 ? 0.3899 0.5611 0.4930 0.1193 -0.0996 -0.1987 269  LEU A CG  
2049 C CD1 . LEU A 269 ? 0.3378 0.5038 0.4387 0.1186 -0.0993 -0.1964 269  LEU A CD1 
2050 C CD2 . LEU A 269 ? 0.2954 0.4906 0.3900 0.1268 -0.0987 -0.2027 269  LEU A CD2 
2051 N N   . TYR A 270 ? 0.2159 0.3733 0.3477 0.1069 -0.0978 -0.2052 270  TYR A N   
2052 C CA  . TYR A 270 ? 0.3126 0.4700 0.4524 0.1044 -0.0968 -0.2087 270  TYR A CA  
2053 C C   . TYR A 270 ? 0.3830 0.5570 0.5224 0.1077 -0.0965 -0.2147 270  TYR A C   
2054 O O   . TYR A 270 ? 0.4051 0.5929 0.5457 0.1095 -0.0954 -0.2209 270  TYR A O   
2055 C CB  . TYR A 270 ? 0.2505 0.3885 0.3971 0.0988 -0.0969 -0.2031 270  TYR A CB  
2056 C CG  . TYR A 270 ? 0.2427 0.3634 0.3905 0.0946 -0.0966 -0.1963 270  TYR A CG  
2057 C CD1 . TYR A 270 ? 0.3774 0.4986 0.5219 0.0954 -0.0964 -0.1958 270  TYR A CD1 
2058 C CD2 . TYR A 270 ? 0.3675 0.4722 0.5197 0.0899 -0.0964 -0.1900 270  TYR A CD2 
2059 C CE1 . TYR A 270 ? 0.2969 0.4029 0.4425 0.0915 -0.0960 -0.1893 270  TYR A CE1 
2060 C CE2 . TYR A 270 ? 0.2824 0.3726 0.4349 0.0861 -0.0957 -0.1833 270  TYR A CE2 
2061 C CZ  . TYR A 270 ? 0.2908 0.3817 0.4401 0.0869 -0.0956 -0.1831 270  TYR A CZ  
2062 O OH  . TYR A 270 ? 0.4166 0.4942 0.5660 0.0833 -0.0948 -0.1765 270  TYR A OH  
2063 N N   . SER A 271 ? 0.3586 0.5315 0.4963 0.1084 -0.0975 -0.2127 271  SER A N   
2064 C CA  . SER A 271 ? 0.3983 0.5866 0.5351 0.1114 -0.0973 -0.2176 271  SER A CA  
2065 C C   . SER A 271 ? 0.4051 0.6171 0.5338 0.1175 -0.0963 -0.2224 271  SER A C   
2066 O O   . SER A 271 ? 0.3392 0.5671 0.4686 0.1193 -0.0950 -0.2280 271  SER A O   
2067 C CB  . SER A 271 ? 0.3807 0.5630 0.5162 0.1115 -0.0987 -0.2138 271  SER A CB  
2068 O OG  . SER A 271 ? 0.5787 0.7415 0.7218 0.1058 -0.0992 -0.2094 271  SER A OG  
2069 N N   . LEU A 272 ? 0.2917 0.5065 0.4123 0.1207 -0.0966 -0.2196 272  LEU A N   
2070 C CA  . LEU A 272 ? 0.3519 0.5898 0.4631 0.1270 -0.0953 -0.2224 272  LEU A CA  
2071 C C   . LEU A 272 ? 0.3290 0.5769 0.4427 0.1267 -0.0936 -0.2276 272  LEU A C   
2072 O O   . LEU A 272 ? 0.3015 0.5696 0.4123 0.1299 -0.0921 -0.2320 272  LEU A O   
2073 C CB  . LEU A 272 ? 0.2296 0.4670 0.3320 0.1302 -0.0957 -0.2180 272  LEU A CB  
2074 C CG  . LEU A 272 ? 0.4368 0.6990 0.5290 0.1367 -0.0939 -0.2178 272  LEU A CG  
2075 C CD1 . LEU A 272 ? 0.2363 0.5137 0.3273 0.1377 -0.0929 -0.2117 272  LEU A CD1 
2076 C CD2 . LEU A 272 ? 0.4203 0.6806 0.5056 0.1385 -0.0941 -0.2088 272  LEU A CD2 
2077 N N   . ARG A 273 ? 0.3347 0.5685 0.4538 0.1228 -0.0939 -0.2267 273  ARG A N   
2078 C CA  . ARG A 273 ? 0.4094 0.6484 0.5327 0.1217 -0.0927 -0.2314 273  ARG A CA  
2079 C C   . ARG A 273 ? 0.3745 0.6217 0.5038 0.1207 -0.0918 -0.2371 273  ARG A C   
2080 O O   . ARG A 273 ? 0.4012 0.6667 0.5290 0.1232 -0.0904 -0.2425 273  ARG A O   
2081 C CB  . ARG A 273 ? 0.3669 0.5853 0.4964 0.1168 -0.0933 -0.2283 273  ARG A CB  
2082 C CG  . ARG A 273 ? 0.3822 0.6046 0.5156 0.1160 -0.0922 -0.2325 273  ARG A CG  
2083 C CD  . ARG A 273 ? 0.3429 0.5646 0.4854 0.1134 -0.0917 -0.2370 273  ARG A CD  
2084 N NE  . ARG A 273 ? 0.4554 0.6762 0.6026 0.1120 -0.0910 -0.2399 273  ARG A NE  
2085 C CZ  . ARG A 273 ? 0.5452 0.7705 0.6991 0.1110 -0.0903 -0.2455 273  ARG A CZ  
2086 N NH1 . ARG A 273 ? 0.4755 0.7067 0.6325 0.1110 -0.0900 -0.2488 273  ARG A NH1 
2087 N NH2 . ARG A 273 ? 0.3977 0.6219 0.5554 0.1100 -0.0898 -0.2479 273  ARG A NH2 
2088 N N   . GLU A 274 ? 0.3635 0.5976 0.4998 0.1171 -0.0926 -0.2358 274  GLU A N   
2089 C CA  . GLU A 274 ? 0.3588 0.5999 0.5010 0.1162 -0.0919 -0.2411 274  GLU A CA  
2090 C C   . GLU A 274 ? 0.2859 0.5502 0.4219 0.1208 -0.0909 -0.2449 274  GLU A C   
2091 O O   . GLU A 274 ? 0.2765 0.5549 0.4148 0.1214 -0.0896 -0.2509 274  GLU A O   
2092 C CB  . GLU A 274 ? 0.3773 0.6004 0.5268 0.1120 -0.0929 -0.2378 274  GLU A CB  
2093 C CG  . GLU A 274 ? 0.2939 0.4970 0.4505 0.1073 -0.0932 -0.2344 274  GLU A CG  
2094 C CD  . GLU A 274 ? 0.4146 0.6225 0.5772 0.1065 -0.0921 -0.2400 274  GLU A CD  
2095 O OE1 . GLU A 274 ? 0.3607 0.5783 0.5207 0.1084 -0.0914 -0.2433 274  GLU A OE1 
2096 O OE2 . GLU A 274 ? 0.4486 0.6506 0.6188 0.1039 -0.0919 -0.2412 274  GLU A OE2 
2097 N N   . SER A 275 ? 0.2365 0.5054 0.3646 0.1240 -0.0914 -0.2412 275  SER A N   
2098 C CA  . SER A 275 ? 0.2863 0.5779 0.4075 0.1286 -0.0902 -0.2434 275  SER A CA  
2099 C C   . SER A 275 ? 0.3455 0.6580 0.4606 0.1322 -0.0883 -0.2465 275  SER A C   
2100 O O   . SER A 275 ? 0.4793 0.8117 0.5922 0.1344 -0.0868 -0.2503 275  SER A O   
2101 C CB  . SER A 275 ? 0.2380 0.5299 0.3511 0.1319 -0.0911 -0.2379 275  SER A CB  
2102 O OG  . SER A 275 ? 0.4542 0.7546 0.5575 0.1363 -0.0905 -0.2348 275  SER A OG  
2103 N N   . LEU A 276 ? 0.3274 0.6353 0.4401 0.1325 -0.0884 -0.2447 276  LEU A N   
2104 C CA  . LEU A 276 ? 0.3277 0.6538 0.4353 0.1356 -0.0867 -0.2473 276  LEU A CA  
2105 C C   . LEU A 276 ? 0.2526 0.5809 0.3686 0.1326 -0.0860 -0.2540 276  LEU A C   
2106 O O   . LEU A 276 ? 0.3089 0.6568 0.4223 0.1347 -0.0844 -0.2582 276  LEU A O   
2107 C CB  . LEU A 276 ? 0.2496 0.5695 0.3524 0.1368 -0.0871 -0.2432 276  LEU A CB  
2108 C CG  . LEU A 276 ? 0.4405 0.7632 0.5333 0.1411 -0.0874 -0.2369 276  LEU A CG  
2109 C CD1 . LEU A 276 ? 0.3124 0.6219 0.4027 0.1408 -0.0884 -0.2327 276  LEU A CD1 
2110 C CD2 . LEU A 276 ? 0.4102 0.7604 0.4926 0.1472 -0.0852 -0.2364 276  LEU A CD2 
2111 N N   . ALA A 277 ? 0.3149 0.6227 0.4405 0.1277 -0.0872 -0.2545 277  ALA A N   
2112 C CA  . ALA A 277 ? 0.3440 0.6514 0.4786 0.1248 -0.0866 -0.2605 277  ALA A CA  
2113 C C   . ALA A 277 ? 0.4262 0.7490 0.5625 0.1255 -0.0855 -0.2657 277  ALA A C   
2114 O O   . ALA A 277 ? 0.4413 0.7789 0.5790 0.1262 -0.0842 -0.2716 277  ALA A O   
2115 C CB  . ALA A 277 ? 0.2475 0.5302 0.3913 0.1200 -0.0879 -0.2582 277  ALA A CB  
2116 N N   . LEU A 278 ? 0.3842 0.7039 0.5204 0.1253 -0.0861 -0.2635 278  LEU A N   
2117 C CA  . LEU A 278 ? 0.4243 0.7578 0.5623 0.1257 -0.0851 -0.2681 278  LEU A CA  
2118 C C   . LEU A 278 ? 0.4030 0.7643 0.5326 0.1301 -0.0832 -0.2708 278  LEU A C   
2119 O O   . LEU A 278 ? 0.4764 0.8512 0.6090 0.1298 -0.0820 -0.2769 278  LEU A O   
2120 C CB  . LEU A 278 ? 0.2504 0.5774 0.3880 0.1255 -0.0861 -0.2645 278  LEU A CB  
2121 C CG  . LEU A 278 ? 0.5111 0.8245 0.6587 0.1214 -0.0868 -0.2659 278  LEU A CG  
2122 C CD1 . LEU A 278 ? 0.3232 0.6232 0.4814 0.1173 -0.0870 -0.2689 278  LEU A CD1 
2123 C CD2 . LEU A 278 ? 0.2424 0.5386 0.3895 0.1203 -0.0886 -0.2593 278  LEU A CD2 
2124 N N   . ILE A 279 ? 0.3995 0.7698 0.5186 0.1341 -0.0829 -0.2658 279  ILE A N   
2125 C CA  . ILE A 279 ? 0.4096 0.8070 0.5196 0.1386 -0.0809 -0.2664 279  ILE A CA  
2126 C C   . ILE A 279 ? 0.4450 0.8522 0.5543 0.1393 -0.0798 -0.2699 279  ILE A C   
2127 O O   . ILE A 279 ? 0.4222 0.8515 0.5275 0.1415 -0.0780 -0.2726 279  ILE A O   
2128 C CB  . ILE A 279 ? 0.3122 0.7169 0.4106 0.1434 -0.0806 -0.2589 279  ILE A CB  
2129 C CG1 . ILE A 279 ? 0.3173 0.7511 0.4067 0.1480 -0.0782 -0.2582 279  ILE A CG1 
2130 C CG2 . ILE A 279 ? 0.3285 0.7228 0.4230 0.1445 -0.0814 -0.2543 279  ILE A CG2 
2131 C CD1 . ILE A 279 ? 0.3108 0.7536 0.3888 0.1532 -0.0775 -0.2499 279  ILE A CD1 
2132 N N   . ALA A 280 ? 0.4326 0.8233 0.5460 0.1371 -0.0809 -0.2696 280  ALA A N   
2133 C CA  . ALA A 280 ? 0.4620 0.8594 0.5770 0.1369 -0.0800 -0.2739 280  ALA A CA  
2134 C C   . ALA A 280 ? 0.4475 0.8493 0.5714 0.1341 -0.0794 -0.2819 280  ALA A C   
2135 O O   . ALA A 280 ? 0.4649 0.8835 0.5879 0.1352 -0.0781 -0.2866 280  ALA A O   
2136 C CB  . ALA A 280 ? 0.3999 0.7777 0.5181 0.1348 -0.0813 -0.2718 280  ALA A CB  
2137 N N   . GLU A 281 ? 0.3202 0.7070 0.4527 0.1306 -0.0805 -0.2833 281  GLU A N   
2138 C CA  . GLU A 281 ? 0.3200 0.7095 0.4616 0.1280 -0.0799 -0.2908 281  GLU A CA  
2139 C C   . GLU A 281 ? 0.4290 0.8416 0.5671 0.1299 -0.0783 -0.2943 281  GLU A C   
2140 O O   . GLU A 281 ? 0.5496 0.9750 0.6910 0.1295 -0.0772 -0.3009 281  GLU A O   
2141 C CB  . GLU A 281 ? 0.3238 0.6913 0.4752 0.1240 -0.0813 -0.2904 281  GLU A CB  
2142 C CG  . GLU A 281 ? 0.6074 0.9521 0.7645 0.1213 -0.0826 -0.2877 281  GLU A CG  
2143 C CD  . GLU A 281 ? 0.7060 1.0297 0.8724 0.1175 -0.0838 -0.2861 281  GLU A CD  
2144 O OE1 . GLU A 281 ? 0.6786 1.0059 0.8484 0.1167 -0.0835 -0.2888 281  GLU A OE1 
2145 O OE2 . GLU A 281 ? 0.6734 0.9773 0.8432 0.1152 -0.0850 -0.2818 281  GLU A OE2 
2146 N N   . GLN A 282 ? 0.4421 0.8604 0.5738 0.1320 -0.0783 -0.2898 282  GLN A N   
2147 C CA  . GLN A 282 ? 0.4260 0.8673 0.5532 0.1341 -0.0766 -0.2919 282  GLN A CA  
2148 C C   . GLN A 282 ? 0.4017 0.8650 0.5205 0.1376 -0.0750 -0.2919 282  GLN A C   
2149 O O   . GLN A 282 ? 0.3656 0.8454 0.4857 0.1375 -0.0736 -0.2977 282  GLN A O   
2150 C CB  . GLN A 282 ? 0.3751 0.8170 0.4964 0.1359 -0.0769 -0.2858 282  GLN A CB  
2151 C CG  . GLN A 282 ? 0.3929 0.8593 0.5084 0.1383 -0.0751 -0.2863 282  GLN A CG  
2152 C CD  . GLN A 282 ? 0.4665 0.9331 0.5757 0.1406 -0.0754 -0.2794 282  GLN A CD  
2153 O OE1 . GLN A 282 ? 0.4347 0.8853 0.5421 0.1410 -0.0768 -0.2740 282  GLN A OE1 
2154 N NE2 . GLN A 282 ? 0.4373 0.9219 0.5430 0.1420 -0.0740 -0.2794 282  GLN A NE2 
2155 N N   . GLY A 283 ? 0.4408 0.9040 0.5512 0.1406 -0.0751 -0.2853 283  GLY A N   
2156 C CA  . GLY A 283 ? 0.3206 0.8042 0.4224 0.1443 -0.0735 -0.2840 283  GLY A CA  
2157 C C   . GLY A 283 ? 0.3938 0.8940 0.4843 0.1489 -0.0723 -0.2770 283  GLY A C   
2158 O O   . GLY A 283 ? 0.4502 0.9572 0.5403 0.1490 -0.0718 -0.2766 283  GLY A O   
2159 N N   . LEU A 284 ? 0.2949 0.8022 0.3763 0.1528 -0.0716 -0.2711 284  LEU A N   
2160 C CA  . LEU A 284 ? 0.4266 0.9459 0.4969 0.1577 -0.0705 -0.2622 284  LEU A CA  
2161 C C   . LEU A 284 ? 0.5102 1.0544 0.5761 0.1598 -0.0685 -0.2619 284  LEU A C   
2162 O O   . LEU A 284 ? 0.6966 1.2448 0.7587 0.1614 -0.0680 -0.2571 284  LEU A O   
2163 C CB  . LEU A 284 ? 0.2982 0.8227 0.3602 0.1617 -0.0698 -0.2566 284  LEU A CB  
2164 C CG  . LEU A 284 ? 0.4659 0.9765 0.5225 0.1640 -0.0707 -0.2487 284  LEU A CG  
2165 C CD1 . LEU A 284 ? 0.3284 0.8520 0.3753 0.1689 -0.0692 -0.2427 284  LEU A CD1 
2166 C CD2 . LEU A 284 ? 0.4165 0.9271 0.4692 0.1659 -0.0706 -0.2428 284  LEU A CD2 
2167 N N   . GLU A 285 ? 0.3667 0.9279 0.4330 0.1597 -0.0671 -0.2667 285  GLU A N   
2168 C CA  . GLU A 285 ? 0.4401 1.0263 0.5022 0.1616 -0.0651 -0.2664 285  GLU A CA  
2169 C C   . GLU A 285 ? 0.4538 1.0377 0.5225 0.1583 -0.0655 -0.2711 285  GLU A C   
2170 O O   . GLU A 285 ? 0.4911 1.0889 0.5550 0.1602 -0.0643 -0.2670 285  GLU A O   
2171 C CB  . GLU A 285 ? 0.6077 1.2108 0.6702 0.1615 -0.0639 -0.2718 285  GLU A CB  
2172 C CG  . GLU A 285 ? 0.6590 1.2704 0.7133 0.1656 -0.0630 -0.2661 285  GLU A CG  
2173 C CD  . GLU A 285 ? 0.7353 1.3629 0.7906 0.1654 -0.0620 -0.2721 285  GLU A CD  
2174 O OE1 . GLU A 285 ? 0.6564 1.2728 0.7188 0.1624 -0.0631 -0.2790 285  GLU A OE1 
2175 O OE2 . GLU A 285 ? 0.7611 1.4127 0.8105 0.1681 -0.0600 -0.2698 285  GLU A OE2 
2176 N N   . ASN A 286 ? 0.3819 0.9483 0.4618 0.1534 -0.0671 -0.2792 286  ASN A N   
2177 C CA  . ASN A 286 ? 0.5320 1.0922 0.6192 0.1501 -0.0676 -0.2835 286  ASN A CA  
2178 C C   . ASN A 286 ? 0.5323 1.0854 0.6154 0.1515 -0.0682 -0.2761 286  ASN A C   
2179 O O   . ASN A 286 ? 0.4909 1.0559 0.5718 0.1522 -0.0672 -0.2747 286  ASN A O   
2180 C CB  . ASN A 286 ? 0.4944 1.0327 0.5942 0.1451 -0.0694 -0.2913 286  ASN A CB  
2181 C CG  . ASN A 286 ? 0.5027 1.0514 0.6081 0.1431 -0.0685 -0.3002 286  ASN A CG  
2182 O OD1 . ASN A 286 ? 0.5090 1.0806 0.6108 0.1444 -0.0668 -0.3020 286  ASN A OD1 
2183 N ND2 . ASN A 286 ? 0.4790 1.0113 0.5931 0.1401 -0.0697 -0.3055 286  ASN A ND2 
2184 N N   . SER A 287 ? 0.4205 0.9553 0.5023 0.1523 -0.0697 -0.2712 287  SER A N   
2185 C CA  . SER A 287 ? 0.5151 1.0420 0.5930 0.1538 -0.0703 -0.2642 287  SER A CA  
2186 C C   . SER A 287 ? 0.5092 1.0599 0.5755 0.1590 -0.0681 -0.2563 287  SER A C   
2187 O O   . SER A 287 ? 0.5185 1.0716 0.5833 0.1596 -0.0678 -0.2531 287  SER A O   
2188 C CB  . SER A 287 ? 0.4022 0.9078 0.4792 0.1543 -0.0721 -0.2599 287  SER A CB  
2189 O OG  . SER A 287 ? 0.3674 0.8684 0.4389 0.1568 -0.0725 -0.2523 287  SER A OG  
2190 N N   . TRP A 288 ? 0.4464 1.0148 0.5050 0.1627 -0.0663 -0.2528 288  TRP A N   
2191 C CA  . TRP A 288 ? 0.4345 1.0264 0.4820 0.1680 -0.0638 -0.2438 288  TRP A CA  
2192 C C   . TRP A 288 ? 0.4703 1.0808 0.5187 0.1671 -0.0624 -0.2462 288  TRP A C   
2193 O O   . TRP A 288 ? 0.4309 1.0530 0.4729 0.1700 -0.0609 -0.2386 288  TRP A O   
2194 C CB  . TRP A 288 ? 0.4423 1.0492 0.4827 0.1717 -0.0622 -0.2404 288  TRP A CB  
2195 C CG  . TRP A 288 ? 0.6364 1.2294 0.6735 0.1738 -0.0631 -0.2359 288  TRP A CG  
2196 C CD1 . TRP A 288 ? 0.6347 1.2063 0.6725 0.1736 -0.0648 -0.2327 288  TRP A CD1 
2197 C CD2 . TRP A 288 ? 0.5730 1.1725 0.6057 0.1763 -0.0623 -0.2341 288  TRP A CD2 
2198 N NE1 . TRP A 288 ? 0.6279 1.1923 0.6619 0.1758 -0.0651 -0.2291 288  TRP A NE1 
2199 C CE2 . TRP A 288 ? 0.5943 1.1758 0.6252 0.1775 -0.0635 -0.2299 288  TRP A CE2 
2200 C CE3 . TRP A 288 ? 0.6076 1.2268 0.6380 0.1776 -0.0607 -0.2359 288  TRP A CE3 
2201 C CZ2 . TRP A 288 ? 0.5619 1.1441 0.5885 0.1800 -0.0631 -0.2273 288  TRP A CZ2 
2202 C CZ3 . TRP A 288 ? 0.5954 1.2153 0.6217 0.1800 -0.0604 -0.2334 288  TRP A CZ3 
2203 C CH2 . TRP A 288 ? 0.5547 1.1564 0.5792 0.1812 -0.0615 -0.2291 288  TRP A CH2 
2204 N N   . ARG A 289 ? 0.4621 1.0762 0.5181 0.1631 -0.0625 -0.2563 289  ARG A N   
2205 C CA  . ARG A 289 ? 0.5485 1.1802 0.6061 0.1617 -0.0612 -0.2599 289  ARG A CA  
2206 C C   . ARG A 289 ? 0.5409 1.1623 0.6025 0.1596 -0.0621 -0.2600 289  ARG A C   
2207 O O   . ARG A 289 ? 0.4853 1.1216 0.5420 0.1613 -0.0606 -0.2549 289  ARG A O   
2208 C CB  . ARG A 289 ? 0.7653 1.3981 0.8319 0.1574 -0.0616 -0.2718 289  ARG A CB  
2209 C CG  . ARG A 289 ? 1.0301 1.6752 1.0938 0.1590 -0.0606 -0.2732 289  ARG A CG  
2210 C CD  . ARG A 289 ? 1.0616 1.7073 1.1349 0.1548 -0.0610 -0.2854 289  ARG A CD  
2211 N NE  . ARG A 289 ? 1.1227 1.7697 1.2023 0.1514 -0.0609 -0.2911 289  ARG A NE  
2212 C CZ  . ARG A 289 ? 1.1841 1.8116 1.2748 0.1470 -0.0625 -0.2984 289  ARG A CZ  
2213 N NH1 . ARG A 289 ? 1.1203 1.7252 1.2167 0.1454 -0.0642 -0.3006 289  ARG A NH1 
2214 N NH2 . ARG A 289 ? 1.2477 1.8783 1.3436 0.1444 -0.0622 -0.3032 289  ARG A NH2 
2215 N N   . GLN A 290 ? 0.4292 1.0248 0.4998 0.1558 -0.0645 -0.2653 290  GLN A N   
2216 C CA  . GLN A 290 ? 0.5137 1.0960 0.5898 0.1532 -0.0657 -0.2664 290  GLN A CA  
2217 C C   . GLN A 290 ? 0.4427 1.0232 0.5157 0.1545 -0.0661 -0.2495 290  GLN A C   
2218 O O   . GLN A 290 ? 0.4021 0.9871 0.4782 0.1527 -0.0660 -0.2447 290  GLN A O   
2219 C CB  . GLN A 290 ? 0.4990 1.0514 0.5852 0.1493 -0.0683 -0.2714 290  GLN A CB  
2220 C CG  . GLN A 290 ? 0.5194 1.0569 0.6136 0.1456 -0.0698 -0.2724 290  GLN A CG  
2221 C CD  . GLN A 290 ? 0.5915 1.0994 0.6940 0.1427 -0.0723 -0.2760 290  GLN A CD  
2222 O OE1 . GLN A 290 ? 0.6593 1.1570 0.7678 0.1404 -0.0730 -0.2809 290  GLN A OE1 
2223 N NE2 . GLN A 290 ? 0.6244 1.1139 0.7318 0.1399 -0.0744 -0.2660 290  GLN A NE2 
2224 N N   . HIS A 291 ? 0.3473 0.9205 0.4154 0.1573 -0.0667 -0.2393 291  HIS A N   
2225 C CA  . HIS A 291 ? 0.3699 0.9406 0.4363 0.1586 -0.0671 -0.2218 291  HIS A CA  
2226 C C   . HIS A 291 ? 0.5226 1.1213 0.5817 0.1622 -0.0643 -0.2150 291  HIS A C   
2227 O O   . HIS A 291 ? 0.4785 1.0785 0.5401 0.1614 -0.0643 -0.2050 291  HIS A O   
2228 C CB  . HIS A 291 ? 0.3712 0.9286 0.4339 0.1611 -0.0680 -0.2125 291  HIS A CB  
2229 C CG  . HIS A 291 ? 0.3610 0.8888 0.4316 0.1571 -0.0710 -0.2157 291  HIS A CG  
2230 N ND1 . HIS A 291 ? 0.3780 0.8971 0.4510 0.1556 -0.0717 -0.2292 291  HIS A ND1 
2231 C CD2 . HIS A 291 ? 0.3031 0.8085 0.3798 0.1542 -0.0734 -0.2071 291  HIS A CD2 
2232 C CE1 . HIS A 291 ? 0.3142 0.8067 0.3941 0.1521 -0.0743 -0.2285 291  HIS A CE1 
2233 N NE2 . HIS A 291 ? 0.2993 0.7832 0.3813 0.1511 -0.0754 -0.2154 291  HIS A NE2 
2234 N N   . ARG A 292 ? 0.3045 0.9259 0.3548 0.1661 -0.0617 -0.2205 292  ARG A N   
2235 C CA  . ARG A 292 ? 0.4796 1.1292 0.5220 0.1699 -0.0588 -0.2142 292  ARG A CA  
2236 C C   . ARG A 292 ? 0.4436 1.1039 0.4907 0.1665 -0.0583 -0.2192 292  ARG A C   
2237 O O   . ARG A 292 ? 0.4489 1.1207 0.4943 0.1676 -0.0571 -0.2086 292  ARG A O   
2238 C CB  . ARG A 292 ? 0.5212 1.1931 0.5531 0.1745 -0.0561 -0.2205 292  ARG A CB  
2239 C CG  . ARG A 292 ? 0.6143 1.3173 0.6374 0.1785 -0.0528 -0.2157 292  ARG A CG  
2240 C CD  . ARG A 292 ? 0.9055 1.6242 0.9235 0.1810 -0.0513 -0.2184 292  ARG A CD  
2241 N NE  . ARG A 292 ? 1.0496 1.7586 1.0768 0.1760 -0.0533 -0.2322 292  ARG A NE  
2242 C CZ  . ARG A 292 ? 1.1080 1.8048 1.1366 0.1758 -0.0545 -0.2353 292  ARG A CZ  
2243 N NH1 . ARG A 292 ? 1.0788 1.7719 1.1004 0.1804 -0.0540 -0.2262 292  ARG A NH1 
2244 N NH2 . ARG A 292 ? 1.0948 1.7835 1.1322 0.1713 -0.0559 -0.2472 292  ARG A NH2 
2245 N N   . GLU A 293 ? 0.4899 1.1460 0.5429 0.1626 -0.0590 -0.2353 293  GLU A N   
2246 C CA  . GLU A 293 ? 0.5440 1.2085 0.6024 0.1590 -0.0585 -0.2423 293  GLU A CA  
2247 C C   . GLU A 293 ? 0.6014 1.2474 0.6693 0.1548 -0.0607 -0.2341 293  GLU A C   
2248 O O   . GLU A 293 ? 0.6291 1.2867 0.6978 0.1538 -0.0598 -0.2290 293  GLU A O   
2249 C CB  . GLU A 293 ? 0.4497 1.1108 0.5132 0.1561 -0.0587 -0.2618 293  GLU A CB  
2250 C CG  . GLU A 293 ? 0.5666 1.2437 0.6293 0.1563 -0.0576 -0.2661 293  GLU A CG  
2251 C CD  . GLU A 293 ? 0.7358 1.3992 0.8101 0.1514 -0.0591 -0.2791 293  GLU A CD  
2252 O OE1 . GLU A 293 ? 0.8285 1.4703 0.9116 0.1479 -0.0609 -0.2841 293  GLU A OE1 
2253 O OE2 . GLU A 293 ? 0.7102 1.3843 0.7851 0.1512 -0.0585 -0.2839 293  GLU A OE2 
2254 N N   . ALA A 294 ? 0.4160 1.0337 0.4910 0.1521 -0.0635 -0.2335 294  ALA A N   
2255 C CA  . ALA A 294 ? 0.5738 1.1727 0.6574 0.1484 -0.0656 -0.2249 294  ALA A CA  
2256 C C   . ALA A 294 ? 0.4653 1.0736 0.5446 0.1513 -0.0648 -0.2069 294  ALA A C   
2257 O O   . ALA A 294 ? 0.5679 1.1809 0.6511 0.1493 -0.0646 -0.2017 294  ALA A O   
2258 C CB  . ALA A 294 ? 0.2846 0.8534 0.3740 0.1462 -0.0685 -0.2246 294  ALA A CB  
2259 N N   . ALA A 295 ? 0.3614 0.9730 0.4327 0.1562 -0.0640 -0.1977 295  ALA A N   
2260 C CA  . ALA A 295 ? 0.4897 1.1113 0.5562 0.1602 -0.0626 -0.1806 295  ALA A CA  
2261 C C   . ALA A 295 ? 0.5673 1.2174 0.6291 0.1619 -0.0598 -0.1792 295  ALA A C   
2262 O O   . ALA A 295 ? 0.5748 1.2291 0.6381 0.1624 -0.0593 -0.1671 295  ALA A O   
2263 C CB  . ALA A 295 ? 0.5158 1.1394 0.5733 0.1659 -0.0616 -0.1737 295  ALA A CB  
2264 N N   . ALA A 296 ? 0.5754 1.2454 0.6316 0.1629 -0.0579 -0.1915 296  ALA A N   
2265 C CA  . ALA A 296 ? 0.6157 1.3138 0.6672 0.1641 -0.0552 -0.1920 296  ALA A CA  
2266 C C   . ALA A 296 ? 0.4911 1.1851 0.5520 0.1587 -0.0563 -0.1935 296  ALA A C   
2267 O O   . ALA A 296 ? 0.5121 1.2168 0.5728 0.1594 -0.0552 -0.1828 296  ALA A O   
2268 C CB  . ALA A 296 ? 0.4208 1.1383 0.4660 0.1652 -0.0534 -0.2079 296  ALA A CB  
2269 N N   . TYR A 297 ? 0.4935 1.1719 0.5631 0.1535 -0.0582 -0.2067 297  TYR A N   
2270 C CA  . TYR A 297 ? 0.5239 1.1961 0.6031 0.1482 -0.0593 -0.2089 297  TYR A CA  
2271 C C   . TYR A 297 ? 0.5888 1.2479 0.6732 0.1473 -0.0606 -0.1924 297  TYR A C   
2272 O O   . TYR A 297 ? 0.5442 1.2135 0.6310 0.1460 -0.0598 -0.1868 297  TYR A O   
2273 C CB  . TYR A 297 ? 0.4674 1.1196 0.5553 0.1435 -0.0613 -0.2239 297  TYR A CB  
2274 C CG  . TYR A 297 ? 0.6711 1.3181 0.7688 0.1381 -0.0620 -0.2287 297  TYR A CG  
2275 C CD1 . TYR A 297 ? 0.7564 1.4260 0.8528 0.1374 -0.0600 -0.2300 297  TYR A CD1 
2276 C CD2 . TYR A 297 ? 0.6228 1.2426 0.7309 0.1337 -0.0646 -0.2322 297  TYR A CD2 
2277 C CE1 . TYR A 297 ? 0.7195 1.3845 0.8249 0.1324 -0.0606 -0.2347 297  TYR A CE1 
2278 C CE2 . TYR A 297 ? 0.7303 1.3453 0.8472 0.1290 -0.0651 -0.2367 297  TYR A CE2 
2279 C CZ  . TYR A 297 ? 0.7060 1.3435 0.8217 0.1283 -0.0631 -0.2381 297  TYR A CZ  
2280 O OH  . TYR A 297 ? 0.7444 1.3771 0.8691 0.1235 -0.0635 -0.2428 297  TYR A OH  
2281 N N   . LEU A 298 ? 0.5232 1.1607 0.6093 0.1482 -0.0625 -0.1845 298  LEU A N   
2282 C CA  . LEU A 298 ? 0.4036 1.0258 0.4957 0.1472 -0.0640 -0.1697 298  LEU A CA  
2283 C C   . LEU A 298 ? 0.4318 1.0720 0.5190 0.1513 -0.0618 -0.1543 298  LEU A C   
2284 O O   . LEU A 298 ? 0.6322 1.2696 0.7258 0.1492 -0.0621 -0.1461 298  LEU A O   
2285 C CB  . LEU A 298 ? 0.4319 1.0281 0.5260 0.1475 -0.0664 -0.1648 298  LEU A CB  
2286 C CG  . LEU A 298 ? 0.4534 1.0372 0.5508 0.1486 -0.0673 -0.1473 298  LEU A CG  
2287 C CD1 . LEU A 298 ? 0.4637 1.0349 0.5725 0.1430 -0.0690 -0.1452 298  LEU A CD1 
2288 C CD2 . LEU A 298 ? 0.4502 1.0137 0.5464 0.1503 -0.0689 -0.1429 298  LEU A CD2 
2289 N N   . HIS A 299 ? 0.4110 1.0700 0.4871 0.1573 -0.0592 -0.1503 299  HIS A N   
2290 C CA  . HIS A 299 ? 0.5817 1.2580 0.6522 0.1622 -0.0566 -0.1352 299  HIS A CA  
2291 C C   . HIS A 299 ? 0.5837 1.2809 0.6553 0.1602 -0.0550 -0.1367 299  HIS A C   
2292 O O   . HIS A 299 ? 0.6513 1.3525 0.7252 0.1609 -0.0541 -0.1242 299  HIS A O   
2293 C CB  . HIS A 299 ? 0.6090 1.3026 0.6667 0.1692 -0.0540 -0.1321 299  HIS A CB  
2294 C CG  . HIS A 299 ? 0.8517 1.5268 0.9076 0.1717 -0.0552 -0.1295 299  HIS A CG  
2295 N ND1 . HIS A 299 ? 0.9109 1.5974 0.9558 0.1781 -0.0530 -0.1253 299  HIS A ND1 
2296 C CD2 . HIS A 299 ? 0.8528 1.4993 0.9161 0.1685 -0.0584 -0.1302 299  HIS A CD2 
2297 C CE1 . HIS A 299 ? 0.8267 1.4923 0.8727 0.1787 -0.0547 -0.1240 299  HIS A CE1 
2298 N NE2 . HIS A 299 ? 0.8474 1.4885 0.9043 0.1729 -0.0581 -0.1268 299  HIS A NE2 
2299 N N   . GLY A 300 ? 0.4943 1.2045 0.5642 0.1577 -0.0544 -0.1523 300  GLY A N   
2300 C CA  . GLY A 300 ? 0.6642 1.3941 0.7351 0.1552 -0.0529 -0.1564 300  GLY A CA  
2301 C C   . GLY A 300 ? 0.6320 1.3474 0.7149 0.1497 -0.0548 -0.1532 300  GLY A C   
2302 O O   . GLY A 300 ? 0.7121 1.4399 0.7960 0.1496 -0.0534 -0.1446 300  GLY A O   
2303 N N   . ARG A 301 ? 0.6038 1.2928 0.6959 0.1452 -0.0578 -0.1596 301  ARG A N   
2304 C CA  . ARG A 301 ? 0.6343 1.3078 0.7383 0.1397 -0.0597 -0.1574 301  ARG A CA  
2305 C C   . ARG A 301 ? 0.6168 1.2834 0.7237 0.1415 -0.0599 -0.1385 301  ARG A C   
2306 O O   . ARG A 301 ? 0.6350 1.3030 0.7486 0.1387 -0.0598 -0.1332 301  ARG A O   
2307 C CB  . ARG A 301 ? 0.5640 1.2098 0.6761 0.1352 -0.0628 -0.1671 301  ARG A CB  
2308 C CG  . ARG A 301 ? 0.6105 1.2604 0.7213 0.1334 -0.0625 -0.1863 301  ARG A CG  
2309 C CD  . ARG A 301 ? 0.5949 1.2264 0.7170 0.1271 -0.0645 -0.1965 301  ARG A CD  
2310 N NE  . ARG A 301 ? 0.5623 1.2027 0.6898 0.1237 -0.0638 -0.1945 301  ARG A NE  
2311 C CZ  . ARG A 301 ? 0.5498 1.1794 0.6867 0.1183 -0.0648 -0.2032 301  ARG A CZ  
2312 N NH1 . ARG A 301 ? 0.4037 1.0131 0.5453 0.1161 -0.0665 -0.2141 301  ARG A NH1 
2313 N NH2 . ARG A 301 ? 0.6361 1.2752 0.7776 0.1152 -0.0640 -0.2009 301  ARG A NH2 
2314 N N   . LEU A 302 ? 0.5629 1.2218 0.6650 0.1464 -0.0599 -0.1287 302  LEU A N   
2315 C CA  . LEU A 302 ? 0.5937 1.2429 0.6991 0.1488 -0.0601 -0.1113 302  LEU A CA  
2316 C C   . LEU A 302 ? 0.7151 1.3879 0.8161 0.1524 -0.0569 -0.1000 302  LEU A C   
2317 O O   . LEU A 302 ? 0.7774 1.4463 0.8854 0.1512 -0.0568 -0.0899 302  LEU A O   
2318 C CB  . LEU A 302 ? 0.5509 1.1870 0.6514 0.1536 -0.0606 -0.1045 302  LEU A CB  
2319 C CG  . LEU A 302 ? 0.5565 1.1637 0.6634 0.1497 -0.0641 -0.1109 302  LEU A CG  
2320 C CD1 . LEU A 302 ? 0.6005 1.1959 0.7027 0.1546 -0.0643 -0.1023 302  LEU A CD1 
2321 C CD2 . LEU A 302 ? 0.5657 1.1544 0.6855 0.1439 -0.0664 -0.1085 302  LEU A CD2 
2322 N N   . GLN A 303 ? 0.7322 1.4300 0.8218 0.1569 -0.0540 -0.1016 303  GLN A N   
2323 C CA  . GLN A 303 ? 0.7517 1.4744 0.8357 0.1609 -0.0506 -0.0911 303  GLN A CA  
2324 C C   . GLN A 303 ? 0.7545 1.4880 0.8446 0.1555 -0.0503 -0.0953 303  GLN A C   
2325 O O   . GLN A 303 ? 0.8502 1.5940 0.9415 0.1568 -0.0485 -0.0836 303  GLN A O   
2326 C CB  . GLN A 303 ? 0.8589 1.6065 0.9288 0.1664 -0.0476 -0.0936 303  GLN A CB  
2327 C CG  . GLN A 303 ? 0.8072 1.5461 0.8705 0.1723 -0.0474 -0.0877 303  GLN A CG  
2328 C CD  . GLN A 303 ? 0.7321 1.4954 0.7819 0.1775 -0.0445 -0.0913 303  GLN A CD  
2329 O OE1 . GLN A 303 ? 0.7122 1.4868 0.7590 0.1750 -0.0445 -0.1065 303  GLN A OE1 
2330 N NE2 . GLN A 303 ? 0.7297 1.5013 0.7712 0.1850 -0.0417 -0.0775 303  GLN A NE2 
2331 N N   . ALA A 304 ? 0.5845 1.3154 0.6788 0.1496 -0.0520 -0.1121 304  ALA A N   
2332 C CA  . ALA A 304 ? 0.6440 1.3821 0.7453 0.1438 -0.0520 -0.1180 304  ALA A CA  
2333 C C   . ALA A 304 ? 0.7266 1.4461 0.8402 0.1403 -0.0536 -0.1085 304  ALA A C   
2334 O O   . ALA A 304 ? 0.8476 1.5768 0.9661 0.1373 -0.0526 -0.1062 304  ALA A O   
2335 C CB  . ALA A 304 ? 0.5082 1.2426 0.6123 0.1385 -0.0534 -0.1382 304  ALA A CB  
2336 N N   . LEU A 305 ? 0.6781 1.3715 0.7967 0.1407 -0.0559 -0.1031 305  LEU A N   
2337 C CA  . LEU A 305 ? 0.5997 1.2742 0.7301 0.1376 -0.0575 -0.0941 305  LEU A CA  
2338 C C   . LEU A 305 ? 0.6111 1.2932 0.7399 0.1429 -0.0551 -0.0753 305  LEU A C   
2339 O O   . LEU A 305 ? 0.6591 1.3292 0.7976 0.1410 -0.0558 -0.0663 305  LEU A O   
2340 C CB  . LEU A 305 ? 0.6047 1.2487 0.7406 0.1360 -0.0608 -0.0954 305  LEU A CB  
2341 C CG  . LEU A 305 ? 0.7138 1.3446 0.8561 0.1292 -0.0633 -0.1119 305  LEU A CG  
2342 C CD1 . LEU A 305 ? 0.7123 1.3139 0.8590 0.1280 -0.0664 -0.1126 305  LEU A CD1 
2343 C CD2 . LEU A 305 ? 0.7403 1.3717 0.8928 0.1231 -0.0636 -0.1139 305  LEU A CD2 
2344 N N   . GLY A 306 ? 0.5663 1.2684 0.6829 0.1496 -0.0522 -0.0696 306  GLY A N   
2345 C CA  . GLY A 306 ? 0.5984 1.3093 0.7116 0.1559 -0.0494 -0.0516 306  GLY A CA  
2346 C C   . GLY A 306 ? 0.7068 1.3994 0.8177 0.1614 -0.0499 -0.0416 306  GLY A C   
2347 O O   . GLY A 306 ? 0.7880 1.4855 0.8960 0.1681 -0.0475 -0.0265 306  GLY A O   
2348 N N   . LEU A 307 ? 0.7087 1.3863 0.8184 0.1603 -0.0523 -0.0510 307  LEU A N   
2349 C CA  . LEU A 307 ? 0.6636 1.3237 0.7707 0.1651 -0.0529 -0.0430 307  LEU A CA  
2350 C C   . LEU A 307 ? 0.7732 1.4517 0.8659 0.1722 -0.0501 -0.0412 307  LEU A C   
2351 O O   . LEU A 307 ? 0.8798 1.5789 0.9657 0.1717 -0.0489 -0.0511 307  LEU A O   
2352 C CB  . LEU A 307 ? 0.6166 1.2510 0.7296 0.1603 -0.0570 -0.0536 307  LEU A CB  
2353 C CG  . LEU A 307 ? 0.5639 1.1773 0.6914 0.1532 -0.0600 -0.0553 307  LEU A CG  
2354 C CD1 . LEU A 307 ? 0.4344 1.0267 0.5661 0.1481 -0.0636 -0.0679 307  LEU A CD1 
2355 C CD2 . LEU A 307 ? 0.6201 1.2195 0.7530 0.1561 -0.0598 -0.0391 307  LEU A CD2 
2356 N N   . GLN A 308 ? 0.8632 1.5347 0.9511 0.1789 -0.0487 -0.0288 308  GLN A N   
2357 C CA  . GLN A 308 ? 0.9159 1.6039 0.9901 0.1860 -0.0457 -0.0261 308  GLN A CA  
2358 C C   . GLN A 308 ? 0.9046 1.5737 0.9765 0.1875 -0.0476 -0.0295 308  GLN A C   
2359 O O   . GLN A 308 ? 0.9123 1.5556 0.9913 0.1862 -0.0499 -0.0255 308  GLN A O   
2360 C CB  . GLN A 308 ? 1.0001 1.7011 1.0685 0.1939 -0.0414 -0.0078 308  GLN A CB  
2361 C CG  . GLN A 308 ? 1.1437 1.8269 1.2102 0.2001 -0.0407 0.0052  308  GLN A CG  
2362 C CD  . GLN A 308 ? 1.2273 1.9357 1.2816 0.2116 -0.0346 0.0217  308  GLN A CD  
2363 O OE1 . GLN A 308 ? 1.3286 2.0661 1.3740 0.2147 -0.0313 0.0217  308  GLN A OE1 
2364 N NE2 . GLN A 308 ? 1.1477 1.8457 1.2012 0.2185 -0.0327 0.0362  308  GLN A NE2 
2365 N N   . LEU A 309 ? 0.7899 1.4720 0.8519 0.1899 -0.0465 -0.0374 309  LEU A N   
2366 C CA  . LEU A 309 ? 0.6835 1.3499 0.7426 0.1911 -0.0481 -0.0417 309  LEU A CA  
2367 C C   . LEU A 309 ? 0.7052 1.3691 0.7577 0.1993 -0.0455 -0.0265 309  LEU A C   
2368 O O   . LEU A 309 ? 0.7779 1.4627 0.8220 0.2057 -0.0414 -0.0173 309  LEU A O   
2369 C CB  . LEU A 309 ? 0.6478 1.3293 0.6993 0.1906 -0.0478 -0.0563 309  LEU A CB  
2370 C CG  . LEU A 309 ? 0.6795 1.3668 0.7364 0.1833 -0.0496 -0.0713 309  LEU A CG  
2371 C CD1 . LEU A 309 ? 0.7201 1.4166 0.7707 0.1826 -0.0497 -0.0869 309  LEU A CD1 
2372 C CD2 . LEU A 309 ? 0.6778 1.3385 0.7482 0.1761 -0.0535 -0.0750 309  LEU A CD2 
2373 N N   . PHE A 310 ? 0.6579 1.2960 0.7140 0.1993 -0.0476 -0.0240 310  PHE A N   
2374 C CA  . PHE A 310 ? 0.6776 1.3097 0.7285 0.2069 -0.0452 -0.0095 310  PHE A CA  
2375 C C   . PHE A 310 ? 0.6651 1.3174 0.7024 0.2139 -0.0416 -0.0086 310  PHE A C   
2376 O O   . PHE A 310 ? 0.6611 1.3227 0.6917 0.2215 -0.0376 0.0048  310  PHE A O   
2377 C CB  . PHE A 310 ? 0.5326 1.1338 0.5896 0.2048 -0.0485 -0.0094 310  PHE A CB  
2378 C CG  . PHE A 310 ? 0.5509 1.1422 0.6044 0.2119 -0.0462 0.0059  310  PHE A CG  
2379 C CD1 . PHE A 310 ? 0.4945 1.0817 0.5520 0.2146 -0.0445 0.0196  310  PHE A CD1 
2380 C CD2 . PHE A 310 ? 0.6111 1.1972 0.6574 0.2162 -0.0454 0.0064  310  PHE A CD2 
2381 C CE1 . PHE A 310 ? 0.5402 1.1172 0.5942 0.2214 -0.0421 0.0335  310  PHE A CE1 
2382 C CE2 . PHE A 310 ? 0.5908 1.1674 0.6337 0.2230 -0.0430 0.0202  310  PHE A CE2 
2383 C CZ  . PHE A 310 ? 0.6157 1.1875 0.6624 0.2257 -0.0413 0.0337  310  PHE A CZ  
2384 N N   . VAL A 311 ? 0.7036 1.3628 0.7372 0.2113 -0.0428 -0.0232 311  VAL A N   
2385 C CA  . VAL A 311 ? 0.7153 1.3934 0.7365 0.2171 -0.0397 -0.0247 311  VAL A CA  
2386 C C   . VAL A 311 ? 0.7671 1.4761 0.7827 0.2173 -0.0373 -0.0301 311  VAL A C   
2387 O O   . VAL A 311 ? 0.7855 1.4985 0.8044 0.2111 -0.0395 -0.0442 311  VAL A O   
2388 C CB  . VAL A 311 ? 0.6485 1.3153 0.6687 0.2144 -0.0424 -0.0380 311  VAL A CB  
2389 C CG1 . VAL A 311 ? 0.6669 1.3529 0.6746 0.2209 -0.0391 -0.0387 311  VAL A CG1 
2390 C CG2 . VAL A 311 ? 0.6816 1.3170 0.7085 0.2128 -0.0453 -0.0342 311  VAL A CG2 
2391 N N   . LYS A 312 ? 0.8068 1.5376 0.8137 0.2246 -0.0326 -0.0190 312  LYS A N   
2392 C CA  . LYS A 312 ? 0.8372 1.5982 0.8390 0.2249 -0.0300 -0.0214 312  LYS A CA  
2393 C C   . LYS A 312 ? 0.7600 1.5405 0.7536 0.2247 -0.0294 -0.0357 312  LYS A C   
2394 O O   . LYS A 312 ? 0.7054 1.4998 0.6997 0.2201 -0.0301 -0.0469 312  LYS A O   
2395 C CB  . LYS A 312 ? 0.8402 1.6175 0.8362 0.2327 -0.0250 -0.0035 312  LYS A CB  
2396 C CG  . LYS A 312 ? 0.9126 1.6707 0.9175 0.2325 -0.0256 0.0099  312  LYS A CG  
2397 C CD  . LYS A 312 ? 1.0073 1.7730 1.0064 0.2417 -0.0206 0.0290  312  LYS A CD  
2398 C CE  . LYS A 312 ? 1.0110 1.7474 1.0175 0.2429 -0.0217 0.0404  312  LYS A CE  
2399 N NZ  . LYS A 312 ? 0.9210 1.6334 0.9287 0.2421 -0.0245 0.0351  312  LYS A NZ  
2400 N N   . ASP A 313 ? 0.7249 1.5055 0.7112 0.2294 -0.0282 -0.0359 313  ASP A N   
2401 C CA  . ASP A 313 ? 0.7843 1.5817 0.7627 0.2297 -0.0275 -0.0493 313  ASP A CA  
2402 C C   . ASP A 313 ? 0.8911 1.6698 0.8760 0.2224 -0.0322 -0.0665 313  ASP A C   
2403 O O   . ASP A 313 ? 1.0662 1.8226 1.0535 0.2221 -0.0343 -0.0672 313  ASP A O   
2404 C CB  . ASP A 313 ? 0.7427 1.5465 0.7114 0.2380 -0.0242 -0.0416 313  ASP A CB  
2405 C CG  . ASP A 313 ? 0.7326 1.5564 0.6922 0.2393 -0.0228 -0.0540 313  ASP A CG  
2406 O OD1 . ASP A 313 ? 0.7088 1.5356 0.6705 0.2335 -0.0252 -0.0703 313  ASP A OD1 
2407 O OD2 . ASP A 313 ? 0.7298 1.5658 0.6803 0.2466 -0.0192 -0.0473 313  ASP A OD2 
2408 N N   . PRO A 314 ? 0.8005 1.5886 0.7879 0.2167 -0.0336 -0.0805 314  PRO A N   
2409 C CA  . PRO A 314 ? 0.7757 1.5472 0.7700 0.2095 -0.0377 -0.0974 314  PRO A CA  
2410 C C   . PRO A 314 ? 0.8403 1.6057 0.8303 0.2108 -0.0384 -0.1061 314  PRO A C   
2411 O O   . PRO A 314 ? 0.9046 1.6482 0.9015 0.2058 -0.0419 -0.1158 314  PRO A O   
2412 C CB  . PRO A 314 ? 0.7127 1.5060 0.7062 0.2060 -0.0371 -0.1094 314  PRO A CB  
2413 C CG  . PRO A 314 ? 0.6345 1.4455 0.6259 0.2087 -0.0343 -0.0965 314  PRO A CG  
2414 C CD  . PRO A 314 ? 0.6701 1.4863 0.6537 0.2170 -0.0310 -0.0807 314  PRO A CD  
2415 N N   . ALA A 315 ? 0.7267 1.5114 0.7056 0.2176 -0.0349 -0.1023 315  ALA A N   
2416 C CA  . ALA A 315 ? 0.6721 1.4528 0.6462 0.2195 -0.0351 -0.1094 315  ALA A CA  
2417 C C   . ALA A 315 ? 0.7258 1.4790 0.7032 0.2208 -0.0368 -0.1007 315  ALA A C   
2418 O O   . ALA A 315 ? 0.7005 1.4423 0.6771 0.2203 -0.0382 -0.1077 315  ALA A O   
2419 C CB  . ALA A 315 ? 0.6028 1.4132 0.5640 0.2265 -0.0306 -0.1071 315  ALA A CB  
2420 N N   . LEU A 316 ? 0.5860 1.3292 0.5671 0.2224 -0.0365 -0.0855 316  LEU A N   
2421 C CA  . LEU A 316 ? 0.5748 1.2919 0.5596 0.2236 -0.0380 -0.0764 316  LEU A CA  
2422 C C   . LEU A 316 ? 0.5588 1.2475 0.5564 0.2161 -0.0426 -0.0795 316  LEU A C   
2423 O O   . LEU A 316 ? 0.4443 1.1099 0.4461 0.2161 -0.0443 -0.0726 316  LEU A O   
2424 C CB  . LEU A 316 ? 0.5754 1.2978 0.5564 0.2307 -0.0345 -0.0572 316  LEU A CB  
2425 C CG  . LEU A 316 ? 0.6739 1.4175 0.6426 0.2395 -0.0296 -0.0501 316  LEU A CG  
2426 C CD1 . LEU A 316 ? 0.5885 1.3373 0.5552 0.2460 -0.0259 -0.0309 316  LEU A CD1 
2427 C CD2 . LEU A 316 ? 0.5975 1.3287 0.5629 0.2416 -0.0303 -0.0530 316  LEU A CD2 
2428 N N   . ARG A 317 ? 0.5644 1.2552 0.5680 0.2098 -0.0445 -0.0899 317  ARG A N   
2429 C CA  . ARG A 317 ? 0.6241 1.2901 0.6402 0.2026 -0.0486 -0.0929 317  ARG A CA  
2430 C C   . ARG A 317 ? 0.5361 1.1821 0.5567 0.1977 -0.0521 -0.1061 317  ARG A C   
2431 O O   . ARG A 317 ? 0.6145 1.2688 0.6336 0.1953 -0.0524 -0.1206 317  ARG A O   
2432 C CB  . ARG A 317 ? 0.5585 1.2348 0.5798 0.1980 -0.0489 -0.0981 317  ARG A CB  
2433 C CG  . ARG A 317 ? 0.4879 1.1769 0.5084 0.2011 -0.0464 -0.0842 317  ARG A CG  
2434 C CD  . ARG A 317 ? 0.4993 1.1967 0.5258 0.1956 -0.0472 -0.0912 317  ARG A CD  
2435 N NE  . ARG A 317 ? 0.6299 1.3485 0.6530 0.1989 -0.0440 -0.0807 317  ARG A NE  
2436 C CZ  . ARG A 317 ? 0.7666 1.5078 0.7878 0.1972 -0.0427 -0.0872 317  ARG A CZ  
2437 N NH1 . ARG A 317 ? 0.7422 1.4868 0.7647 0.1924 -0.0442 -0.1045 317  ARG A NH1 
2438 N NH2 . ARG A 317 ? 0.7774 1.5376 0.7954 0.2003 -0.0397 -0.0765 317  ARG A NH2 
2439 N N   . LEU A 318 ? 0.4776 1.0972 0.5038 0.1961 -0.0545 -0.1011 318  LEU A N   
2440 C CA  . LEU A 318 ? 0.5101 1.1090 0.5412 0.1911 -0.0579 -0.1125 318  LEU A CA  
2441 C C   . LEU A 318 ? 0.4862 1.0791 0.5267 0.1837 -0.0604 -0.1239 318  LEU A C   
2442 O O   . LEU A 318 ? 0.5424 1.1281 0.5903 0.1807 -0.0614 -0.1186 318  LEU A O   
2443 C CB  . LEU A 318 ? 0.4515 1.0242 0.4869 0.1909 -0.0599 -0.1036 318  LEU A CB  
2444 C CG  . LEU A 318 ? 0.4262 0.9746 0.4676 0.1854 -0.0635 -0.1132 318  LEU A CG  
2445 C CD1 . LEU A 318 ? 0.3763 0.9295 0.4104 0.1876 -0.0629 -0.1222 318  LEU A CD1 
2446 C CD2 . LEU A 318 ? 0.4360 0.9598 0.4826 0.1846 -0.0655 -0.1026 318  LEU A CD2 
2447 N N   . PRO A 319 ? 0.4971 1.0932 0.5373 0.1810 -0.0610 -0.1398 319  PRO A N   
2448 C CA  . PRO A 319 ? 0.3922 0.9842 0.4406 0.1745 -0.0628 -0.1517 319  PRO A CA  
2449 C C   . PRO A 319 ? 0.5556 1.1181 0.6148 0.1689 -0.0664 -0.1518 319  PRO A C   
2450 O O   . PRO A 319 ? 0.6841 1.2414 0.7513 0.1643 -0.0676 -0.1539 319  PRO A O   
2451 C CB  . PRO A 319 ? 0.4265 1.0259 0.4715 0.1741 -0.0624 -0.1679 319  PRO A CB  
2452 C CG  . PRO A 319 ? 0.4328 1.0502 0.4660 0.1809 -0.0596 -0.1637 319  PRO A CG  
2453 C CD  . PRO A 319 ? 0.5185 1.1239 0.5504 0.1842 -0.0597 -0.1476 319  PRO A CD  
2454 N N   . THR A 320 ? 0.5921 1.1358 0.6513 0.1692 -0.0679 -0.1495 320  THR A N   
2455 C CA  . THR A 320 ? 0.4436 0.9591 0.5124 0.1636 -0.0713 -0.1509 320  THR A CA  
2456 C C   . THR A 320 ? 0.3712 0.8753 0.4463 0.1623 -0.0724 -0.1377 320  THR A C   
2457 O O   . THR A 320 ? 0.3588 0.8451 0.4430 0.1568 -0.0749 -0.1398 320  THR A O   
2458 C CB  . THR A 320 ? 0.3893 0.8885 0.4559 0.1643 -0.0726 -0.1522 320  THR A CB  
2459 O OG1 . THR A 320 ? 0.5072 1.0123 0.5662 0.1703 -0.0709 -0.1399 320  THR A OG1 
2460 C CG2 . THR A 320 ? 0.3105 0.8158 0.3739 0.1641 -0.0722 -0.1675 320  THR A CG2 
2461 N N   . VAL A 321 ? 0.4465 0.9607 0.5167 0.1675 -0.0704 -0.1240 321  VAL A N   
2462 C CA  . VAL A 321 ? 0.4374 0.9419 0.5135 0.1669 -0.0710 -0.1109 321  VAL A CA  
2463 C C   . VAL A 321 ? 0.4501 0.9775 0.5224 0.1711 -0.0680 -0.1025 321  VAL A C   
2464 O O   . VAL A 321 ? 0.4807 1.0245 0.5435 0.1775 -0.0651 -0.0970 321  VAL A O   
2465 C CB  . VAL A 321 ? 0.4743 0.9627 0.5490 0.1698 -0.0715 -0.0996 321  VAL A CB  
2466 C CG1 . VAL A 321 ? 0.4584 0.9380 0.5393 0.1698 -0.0718 -0.0861 321  VAL A CG1 
2467 C CG2 . VAL A 321 ? 0.3633 0.8290 0.4414 0.1656 -0.0745 -0.1073 321  VAL A CG2 
2468 N N   . THR A 322 ? 0.6649 1.1937 0.7445 0.1675 -0.0685 -0.1013 322  THR A N   
2469 C CA  . THR A 322 ? 0.6182 1.1690 0.6947 0.1710 -0.0656 -0.0936 322  THR A CA  
2470 C C   . THR A 322 ? 0.5316 1.0741 0.6132 0.1723 -0.0654 -0.0780 322  THR A C   
2471 O O   . THR A 322 ? 0.5017 1.0265 0.5935 0.1672 -0.0680 -0.0773 322  THR A O   
2472 C CB  . THR A 322 ? 0.5615 1.1254 0.6416 0.1666 -0.0656 -0.1040 322  THR A CB  
2473 O OG1 . THR A 322 ? 0.5446 1.1183 0.6195 0.1661 -0.0652 -0.1187 322  THR A OG1 
2474 C CG2 . THR A 322 ? 0.4999 1.0871 0.5766 0.1701 -0.0625 -0.0955 322  THR A CG2 
2475 N N   . THR A 323 ? 0.5629 1.1189 0.6373 0.1794 -0.0622 -0.0657 323  THR A N   
2476 C CA  . THR A 323 ? 0.5629 1.1131 0.6416 0.1816 -0.0614 -0.0505 323  THR A CA  
2477 C C   . THR A 323 ? 0.6280 1.1974 0.7080 0.1818 -0.0594 -0.0468 323  THR A C   
2478 O O   . THR A 323 ? 0.7496 1.3430 0.8228 0.1834 -0.0571 -0.0516 323  THR A O   
2479 C CB  . THR A 323 ? 0.6550 1.2053 0.7256 0.1897 -0.0588 -0.0378 323  THR A CB  
2480 O OG1 . THR A 323 ? 0.6161 1.1875 0.6749 0.1946 -0.0560 -0.0414 323  THR A OG1 
2481 C CG2 . THR A 323 ? 0.6425 1.1660 0.7163 0.1884 -0.0614 -0.0371 323  THR A CG2 
2482 N N   . VAL A 324 ? 0.6493 1.2080 0.7381 0.1799 -0.0601 -0.0383 324  VAL A N   
2483 C CA  . VAL A 324 ? 0.5900 1.1637 0.6824 0.1789 -0.0587 -0.0349 324  VAL A CA  
2484 C C   . VAL A 324 ? 0.6197 1.1858 0.7156 0.1827 -0.0573 -0.0183 324  VAL A C   
2485 O O   . VAL A 324 ? 0.5844 1.1265 0.6880 0.1807 -0.0596 -0.0145 324  VAL A O   
2486 C CB  . VAL A 324 ? 0.5846 1.1493 0.6884 0.1699 -0.0619 -0.0456 324  VAL A CB  
2487 C CG1 . VAL A 324 ? 0.5592 1.1386 0.6673 0.1685 -0.0605 -0.0419 324  VAL A CG1 
2488 C CG2 . VAL A 324 ? 0.6768 1.2460 0.7780 0.1660 -0.0633 -0.0628 324  VAL A CG2 
2489 N N   . ALA A 325 ? 0.6133 1.1995 0.7036 0.1882 -0.0534 -0.0083 325  ALA A N   
2490 C CA  . ALA A 325 ? 0.5713 1.1507 0.6644 0.1926 -0.0516 0.0080  325  ALA A CA  
2491 C C   . ALA A 325 ? 0.6118 1.1771 0.7189 0.1860 -0.0542 0.0077  325  ALA A C   
2492 O O   . ALA A 325 ? 0.6436 1.2169 0.7561 0.1798 -0.0556 -0.0018 325  ALA A O   
2493 C CB  . ALA A 325 ? 0.6207 1.2271 0.7047 0.1995 -0.0467 0.0179  325  ALA A CB  
2494 N N   . VAL A 326 ? 0.6744 1.2229 0.7855 0.1890 -0.0544 0.0175  326  VAL A N   
2495 C CA  . VAL A 326 ? 0.8076 1.3483 0.9301 0.1850 -0.0561 0.0179  326  VAL A CA  
2496 C C   . VAL A 326 ? 0.9266 1.4967 1.0467 0.1886 -0.0522 0.0236  326  VAL A C   
2497 O O   . VAL A 326 ? 1.0533 1.6410 1.1637 0.1986 -0.0472 0.0376  326  VAL A O   
2498 C CB  . VAL A 326 ? 0.8043 1.3246 0.9294 0.1895 -0.0560 0.0288  326  VAL A CB  
2499 C CG1 . VAL A 326 ? 0.8069 1.3226 0.9435 0.1862 -0.0571 0.0298  326  VAL A CG1 
2500 C CG2 . VAL A 326 ? 0.7360 1.2271 0.8641 0.1853 -0.0599 0.0234  326  VAL A CG2 
2501 N N   . PRO A 327 ? 0.8744 1.4500 1.0031 0.1805 -0.0542 0.0133  327  PRO A N   
2502 C CA  . PRO A 327 ? 0.8843 1.4883 1.0120 0.1823 -0.0509 0.0173  327  PRO A CA  
2503 C C   . PRO A 327 ? 0.9216 1.5280 1.0506 0.1892 -0.0477 0.0334  327  PRO A C   
2504 O O   . PRO A 327 ? 0.9138 1.4978 1.0526 0.1863 -0.0502 0.0335  327  PRO A O   
2505 C CB  . PRO A 327 ? 0.8231 1.4210 0.9630 0.1707 -0.0547 0.0022  327  PRO A CB  
2506 C CG  . PRO A 327 ? 0.7536 1.3168 0.9029 0.1642 -0.0596 -0.0045 327  PRO A CG  
2507 C CD  . PRO A 327 ? 0.7255 1.2789 0.8659 0.1689 -0.0595 -0.0016 327  PRO A CD  
2508 N N   . ALA A 328 ? 0.9284 1.5612 1.0475 0.1983 -0.0418 0.0475  328  ALA A N   
2509 C CA  . ALA A 328 ? 0.8980 1.5328 1.0167 0.2064 -0.0375 0.0658  328  ALA A CA  
2510 C C   . ALA A 328 ? 0.9280 1.5598 1.0606 0.1998 -0.0391 0.0626  328  ALA A C   
2511 O O   . ALA A 328 ? 0.9449 1.5859 1.0840 0.1910 -0.0415 0.0492  328  ALA A O   
2512 C CB  . ALA A 328 ? 0.8317 1.4981 0.9378 0.2164 -0.0304 0.0816  328  ALA A CB  
2513 N N   . GLY A 329 ? 0.8925 1.5100 1.0295 0.2041 -0.0374 0.0746  329  GLY A N   
2514 C CA  . GLY A 329 ? 0.7755 1.3896 0.9262 0.1985 -0.0384 0.0729  329  GLY A CA  
2515 C C   . GLY A 329 ? 0.8022 1.3867 0.9660 0.1883 -0.0454 0.0571  329  GLY A C   
2516 O O   . GLY A 329 ? 0.7399 1.3140 0.9152 0.1850 -0.0463 0.0575  329  GLY A O   
2517 N N   . TYR A 330 ? 0.8723 1.4435 1.0345 0.1833 -0.0499 0.0439  330  TYR A N   
2518 C CA  . TYR A 330 ? 0.8749 1.4180 1.0488 0.1733 -0.0563 0.0296  330  TYR A CA  
2519 C C   . TYR A 330 ? 0.7957 1.3106 0.9682 0.1768 -0.0580 0.0342  330  TYR A C   
2520 O O   . TYR A 330 ? 0.7680 1.2821 0.9289 0.1835 -0.0562 0.0403  330  TYR A O   
2521 C CB  . TYR A 330 ? 0.8845 1.4278 1.0578 0.1652 -0.0596 0.0134  330  TYR A CB  
2522 C CG  . TYR A 330 ? 0.8205 1.3826 0.9983 0.1583 -0.0595 0.0038  330  TYR A CG  
2523 C CD1 . TYR A 330 ? 0.7148 1.2647 0.9062 0.1481 -0.0630 -0.0069 330  TYR A CD1 
2524 C CD2 . TYR A 330 ? 0.8682 1.4599 1.0362 0.1618 -0.0559 0.0053  330  TYR A CD2 
2525 C CE1 . TYR A 330 ? 0.8374 1.4028 1.0323 0.1417 -0.0627 -0.0160 330  TYR A CE1 
2526 C CE2 . TYR A 330 ? 0.8696 1.4779 1.0412 0.1553 -0.0558 -0.0041 330  TYR A CE2 
2527 C CZ  . TYR A 330 ? 0.8507 1.4452 1.0358 0.1453 -0.0592 -0.0149 330  TYR A CZ  
2528 O OH  . TYR A 330 ? 0.7989 1.4086 0.9872 0.1389 -0.0588 -0.0243 330  TYR A OH  
2529 N N   . ASP A 331 ? 0.6649 1.1566 0.8490 0.1717 -0.0614 0.0308  331  ASP A N   
2530 C CA  . ASP A 331 ? 0.6675 1.1302 0.8519 0.1723 -0.0641 0.0318  331  ASP A CA  
2531 C C   . ASP A 331 ? 0.7435 1.1918 0.9301 0.1631 -0.0690 0.0173  331  ASP A C   
2532 O O   . ASP A 331 ? 0.7874 1.2260 0.9847 0.1527 -0.0727 0.0062  331  ASP A O   
2533 C CB  . ASP A 331 ? 0.6647 1.1087 0.8607 0.1701 -0.0659 0.0335  331  ASP A CB  
2534 C CG  . ASP A 331 ? 0.6409 1.0563 0.8356 0.1726 -0.0676 0.0372  331  ASP A CG  
2535 O OD1 . ASP A 331 ? 0.5571 0.9644 0.7448 0.1726 -0.0689 0.0346  331  ASP A OD1 
2536 O OD2 . ASP A 331 ? 0.5751 0.9765 0.7758 0.1744 -0.0675 0.0429  331  ASP A OD2 
2537 N N   . TRP A 332 ? 0.7909 1.2373 0.9670 0.1669 -0.0684 0.0188  332  TRP A N   
2538 C CA  . TRP A 332 ? 0.7558 1.1914 0.9323 0.1591 -0.0717 0.0071  332  TRP A CA  
2539 C C   . TRP A 332 ? 0.6780 1.0851 0.8659 0.1496 -0.0762 0.0005  332  TRP A C   
2540 O O   . TRP A 332 ? 0.6762 1.0797 0.8659 0.1422 -0.0785 -0.0107 332  TRP A O   
2541 C CB  . TRP A 332 ? 0.7122 1.1479 0.8762 0.1654 -0.0701 0.0113  332  TRP A CB  
2542 C CG  . TRP A 332 ? 0.9524 1.3669 1.1147 0.1698 -0.0703 0.0193  332  TRP A CG  
2543 C CD1 . TRP A 332 ? 1.0479 1.4647 1.2030 0.1807 -0.0665 0.0334  332  TRP A CD1 
2544 C CD2 . TRP A 332 ? 0.8830 1.2706 1.0504 0.1635 -0.0741 0.0145  332  TRP A CD2 
2545 N NE1 . TRP A 332 ? 0.9554 1.3475 1.1108 0.1815 -0.0680 0.0364  332  TRP A NE1 
2546 C CE2 . TRP A 332 ? 0.8784 1.2532 1.0417 0.1708 -0.0728 0.0247  332  TRP A CE2 
2547 C CE3 . TRP A 332 ? 0.7728 1.1542 0.9426 0.1563 -0.0772 0.0021  332  TRP A CE3 
2548 C CZ2 . TRP A 332 ? 0.8480 1.1974 1.0145 0.1670 -0.0755 0.0234  332  TRP A CZ2 
2549 C CZ3 . TRP A 332 ? 0.8543 1.2152 1.0245 0.1547 -0.0793 0.0010  332  TRP A CZ3 
2550 C CH2 . TRP A 332 ? 0.8599 1.2055 1.0288 0.1598 -0.0785 0.0116  332  TRP A CH2 
2551 N N   . ARG A 333 ? 0.6155 1.0078 0.8080 0.1523 -0.0768 0.0073  333  ARG A N   
2552 C CA  . ARG A 333 ? 0.6276 0.9942 0.8304 0.1440 -0.0805 0.0031  333  ARG A CA  
2553 C C   . ARG A 333 ? 0.6589 1.0268 0.8724 0.1344 -0.0823 -0.0053 333  ARG A C   
2554 O O   . ARG A 333 ? 0.6804 1.0356 0.8972 0.1261 -0.0847 -0.0131 333  ARG A O   
2555 C CB  . ARG A 333 ? 0.6751 1.0278 0.8800 0.1499 -0.0802 0.0126  333  ARG A CB  
2556 C CG  . ARG A 333 ? 0.7040 1.0456 0.8991 0.1569 -0.0791 0.0197  333  ARG A CG  
2557 C CD  . ARG A 333 ? 0.7690 1.0960 0.9645 0.1638 -0.0780 0.0298  333  ARG A CD  
2558 N NE  . ARG A 333 ? 0.9123 1.2545 1.0982 0.1762 -0.0725 0.0426  333  ARG A NE  
2559 C CZ  . ARG A 333 ? 0.9672 1.3174 1.1567 0.1801 -0.0698 0.0492  333  ARG A CZ  
2560 N NH1 . ARG A 333 ? 0.8296 1.1747 1.0330 0.1725 -0.0729 0.0422  333  ARG A NH1 
2561 N NH2 . ARG A 333 ? 1.0800 1.4435 1.2591 0.1915 -0.0633 0.0641  333  ARG A NH2 
2562 N N   . ASP A 334 ? 0.6839 1.0714 0.8998 0.1370 -0.0805 -0.0040 334  ASP A N   
2563 C CA  . ASP A 334 ? 0.7443 1.1351 0.9702 0.1283 -0.0817 -0.0119 334  ASP A CA  
2564 C C   . ASP A 334 ? 0.6420 1.0356 0.8651 0.1209 -0.0824 -0.0222 334  ASP A C   
2565 O O   . ASP A 334 ? 0.6533 1.0388 0.8794 0.1136 -0.0844 -0.0317 334  ASP A O   
2566 C CB  . ASP A 334 ? 0.8087 1.2233 1.0367 0.1331 -0.0788 -0.0077 334  ASP A CB  
2567 C CG  . ASP A 334 ? 0.8788 1.2887 1.1110 0.1396 -0.0776 0.0025  334  ASP A CG  
2568 O OD1 . ASP A 334 ? 0.8593 1.2456 1.0973 0.1368 -0.0803 0.0026  334  ASP A OD1 
2569 O OD2 . ASP A 334 ? 0.8920 1.3218 1.1208 0.1475 -0.0734 0.0116  334  ASP A OD2 
2570 N N   . ILE A 335 ? 0.5557 0.9675 0.7688 0.1260 -0.0803 -0.0226 335  ILE A N   
2571 C CA  . ILE A 335 ? 0.6233 1.0488 0.8290 0.1240 -0.0803 -0.0353 335  ILE A CA  
2572 C C   . ILE A 335 ? 0.6128 1.0226 0.8152 0.1206 -0.0829 -0.0449 335  ILE A C   
2573 O O   . ILE A 335 ? 0.5640 0.9719 0.7681 0.1145 -0.0843 -0.0569 335  ILE A O   
2574 C CB  . ILE A 335 ? 0.6182 1.0649 0.8118 0.1315 -0.0773 -0.0326 335  ILE A CB  
2575 C CG1 . ILE A 335 ? 0.6061 1.0713 0.8018 0.1344 -0.0744 -0.0246 335  ILE A CG1 
2576 C CG2 . ILE A 335 ? 0.6040 1.0632 0.7896 0.1298 -0.0774 -0.0465 335  ILE A CG2 
2577 C CD1 . ILE A 335 ? 0.6681 1.1566 0.8506 0.1428 -0.0708 -0.0201 335  ILE A CD1 
2578 N N   . VAL A 336 ? 0.6532 1.0513 0.8508 0.1247 -0.0833 -0.0397 336  VAL A N   
2579 C CA  . VAL A 336 ? 0.5457 0.9284 0.7395 0.1221 -0.0855 -0.0476 336  VAL A CA  
2580 C C   . VAL A 336 ? 0.4066 0.7711 0.6089 0.1143 -0.0880 -0.0524 336  VAL A C   
2581 O O   . VAL A 336 ? 0.6089 0.9683 0.8089 0.1100 -0.0893 -0.0648 336  VAL A O   
2582 C CB  . VAL A 336 ? 0.3993 0.7712 0.5875 0.1276 -0.0854 -0.0395 336  VAL A CB  
2583 C CG1 . VAL A 336 ? 0.3409 0.6959 0.5262 0.1241 -0.0877 -0.0479 336  VAL A CG1 
2584 C CG2 . VAL A 336 ? 0.3212 0.7111 0.4985 0.1356 -0.0828 -0.0361 336  VAL A CG2 
2585 N N   . SER A 337 ? 0.2662 0.6207 0.4778 0.1128 -0.0882 -0.0429 337  SER A N   
2586 C CA  . SER A 337 ? 0.3509 0.6895 0.5696 0.1053 -0.0901 -0.0468 337  SER A CA  
2587 C C   . SER A 337 ? 0.5294 0.8771 0.7508 0.0998 -0.0903 -0.0581 337  SER A C   
2588 O O   . SER A 337 ? 0.5503 0.8869 0.7715 0.0943 -0.0918 -0.0689 337  SER A O   
2589 C CB  . SER A 337 ? 0.5276 0.8564 0.7563 0.1049 -0.0898 -0.0341 337  SER A CB  
2590 O OG  . SER A 337 ? 0.6826 0.9996 0.9093 0.1098 -0.0895 -0.0246 337  SER A OG  
2591 N N   . TYR A 338 ? 0.5776 0.9449 0.8009 0.1015 -0.0885 -0.0563 338  TYR A N   
2592 C CA  . TYR A 338 ? 0.5955 0.9732 0.8217 0.0966 -0.0882 -0.0663 338  TYR A CA  
2593 C C   . TYR A 338 ? 0.5317 0.9108 0.7500 0.0954 -0.0888 -0.0818 338  TYR A C   
2594 O O   . TYR A 338 ? 0.4786 0.8517 0.6992 0.0901 -0.0897 -0.0929 338  TYR A O   
2595 C CB  . TYR A 338 ? 0.6279 1.0284 0.8559 0.0994 -0.0857 -0.0616 338  TYR A CB  
2596 C CG  . TYR A 338 ? 0.6617 1.0708 0.8949 0.0935 -0.0854 -0.0700 338  TYR A CG  
2597 C CD1 . TYR A 338 ? 0.6914 1.1118 0.9189 0.0922 -0.0849 -0.0837 338  TYR A CD1 
2598 C CD2 . TYR A 338 ? 0.5769 0.9824 0.8212 0.0891 -0.0854 -0.0647 338  TYR A CD2 
2599 C CE1 . TYR A 338 ? 0.6690 1.0965 0.9012 0.0871 -0.0845 -0.0919 338  TYR A CE1 
2600 C CE2 . TYR A 338 ? 0.6185 1.0315 0.8673 0.0836 -0.0849 -0.0726 338  TYR A CE2 
2601 C CZ  . TYR A 338 ? 0.6556 1.0794 0.8981 0.0827 -0.0845 -0.0863 338  TYR A CZ  
2602 O OH  . TYR A 338 ? 0.5863 1.0172 0.8333 0.0775 -0.0839 -0.0947 338  TYR A OH  
2603 N N   . VAL A 339 ? 0.5647 0.9515 0.7738 0.1009 -0.0880 -0.0825 339  VAL A N   
2604 C CA  . VAL A 339 ? 0.5177 0.9071 0.7196 0.1007 -0.0882 -0.0968 339  VAL A CA  
2605 C C   . VAL A 339 ? 0.5463 0.9122 0.7488 0.0967 -0.0905 -0.1045 339  VAL A C   
2606 O O   . VAL A 339 ? 0.6112 0.9738 0.8132 0.0938 -0.0908 -0.1183 339  VAL A O   
2607 C CB  . VAL A 339 ? 0.4140 0.8150 0.6057 0.1074 -0.0869 -0.0952 339  VAL A CB  
2608 C CG1 . VAL A 339 ? 0.3077 0.7095 0.4931 0.1070 -0.0871 -0.1102 339  VAL A CG1 
2609 C CG2 . VAL A 339 ? 0.4443 0.8699 0.6340 0.1114 -0.0843 -0.0894 339  VAL A CG2 
2610 N N   . MET A 340 ? 0.4097 0.7590 0.6136 0.0969 -0.0917 -0.0958 340  MET A N   
2611 C CA  . MET A 340 ? 0.4517 0.7785 0.6551 0.0934 -0.0937 -0.1026 340  MET A CA  
2612 C C   . MET A 340 ? 0.4755 0.7916 0.6864 0.0870 -0.0945 -0.1076 340  MET A C   
2613 O O   . MET A 340 ? 0.5583 0.8638 0.7689 0.0840 -0.0953 -0.1204 340  MET A O   
2614 C CB  . MET A 340 ? 0.5465 0.8596 0.7481 0.0955 -0.0945 -0.0923 340  MET A CB  
2615 C CG  . MET A 340 ? 0.5381 0.8273 0.7395 0.0915 -0.0964 -0.0984 340  MET A CG  
2616 S SD  . MET A 340 ? 0.5626 0.8456 0.7577 0.0911 -0.0971 -0.1160 340  MET A SD  
2617 C CE  . MET A 340 ? 0.3386 0.6311 0.5246 0.0980 -0.0963 -0.1105 340  MET A CE  
2618 N N   . ASP A 341 ? 0.4981 0.8169 0.7161 0.0854 -0.0942 -0.0975 341  ASP A N   
2619 C CA  . ASP A 341 ? 0.5046 0.8132 0.7297 0.0793 -0.0949 -0.1008 341  ASP A CA  
2620 C C   . ASP A 341 ? 0.5313 0.8473 0.7581 0.0764 -0.0943 -0.1142 341  ASP A C   
2621 O O   . ASP A 341 ? 0.4689 0.7707 0.6981 0.0723 -0.0951 -0.1238 341  ASP A O   
2622 C CB  . ASP A 341 ? 0.4912 0.8049 0.7240 0.0785 -0.0942 -0.0870 341  ASP A CB  
2623 C CG  . ASP A 341 ? 0.5244 0.8284 0.7570 0.0815 -0.0944 -0.0738 341  ASP A CG  
2624 O OD1 . ASP A 341 ? 0.6152 0.9037 0.8423 0.0819 -0.0956 -0.0769 341  ASP A OD1 
2625 O OD2 . ASP A 341 ? 0.5288 0.8402 0.7673 0.0837 -0.0931 -0.0606 341  ASP A OD2 
2626 N N   . HIS A 342 ? 0.4409 0.7786 0.6664 0.0789 -0.0927 -0.1152 342  HIS A N   
2627 C CA  . HIS A 342 ? 0.4863 0.8329 0.7141 0.0762 -0.0917 -0.1271 342  HIS A CA  
2628 C C   . HIS A 342 ? 0.5351 0.8836 0.7568 0.0782 -0.0914 -0.1412 342  HIS A C   
2629 O O   . HIS A 342 ? 0.3800 0.7308 0.6040 0.0761 -0.0906 -0.1533 342  HIS A O   
2630 C CB  . HIS A 342 ? 0.3950 0.7645 0.6261 0.0767 -0.0899 -0.1211 342  HIS A CB  
2631 C CG  . HIS A 342 ? 0.5197 0.8870 0.7590 0.0741 -0.0900 -0.1088 342  HIS A CG  
2632 N ND1 . HIS A 342 ? 0.5269 0.8908 0.7735 0.0684 -0.0900 -0.1119 342  HIS A ND1 
2633 C CD2 . HIS A 342 ? 0.7386 1.1054 0.9804 0.0766 -0.0900 -0.0934 342  HIS A CD2 
2634 C CE1 . HIS A 342 ? 0.5973 0.9597 0.8506 0.0672 -0.0900 -0.0989 342  HIS A CE1 
2635 N NE2 . HIS A 342 ? 0.7000 1.0639 0.9510 0.0723 -0.0899 -0.0875 342  HIS A NE2 
2636 N N   . PHE A 343 ? 0.4429 0.7902 0.6575 0.0825 -0.0917 -0.1400 343  PHE A N   
2637 C CA  . PHE A 343 ? 0.4268 0.7791 0.6357 0.0849 -0.0910 -0.1527 343  PHE A CA  
2638 C C   . PHE A 343 ? 0.5284 0.8627 0.7329 0.0863 -0.0923 -0.1575 343  PHE A C   
2639 O O   . PHE A 343 ? 0.5280 0.8637 0.7290 0.0880 -0.0917 -0.1690 343  PHE A O   
2640 C CB  . PHE A 343 ? 0.4199 0.7971 0.6230 0.0895 -0.0891 -0.1497 343  PHE A CB  
2641 C CG  . PHE A 343 ? 0.4686 0.8657 0.6751 0.0883 -0.0874 -0.1488 343  PHE A CG  
2642 C CD1 . PHE A 343 ? 0.5514 0.9595 0.7580 0.0873 -0.0860 -0.1620 343  PHE A CD1 
2643 C CD2 . PHE A 343 ? 0.4101 0.8152 0.6201 0.0886 -0.0870 -0.1348 343  PHE A CD2 
2644 C CE1 . PHE A 343 ? 0.5640 0.9912 0.7734 0.0861 -0.0843 -0.1615 343  PHE A CE1 
2645 C CE2 . PHE A 343 ? 0.4389 0.8627 0.6522 0.0875 -0.0853 -0.1339 343  PHE A CE2 
2646 C CZ  . PHE A 343 ? 0.5171 0.9522 0.7296 0.0861 -0.0840 -0.1474 343  PHE A CZ  
2647 N N   . ASP A 344 ? 0.5109 0.8285 0.7158 0.0855 -0.0938 -0.1489 344  ASP A N   
2648 C CA  . ASP A 344 ? 0.5184 0.8191 0.7188 0.0868 -0.0951 -0.1517 344  ASP A CA  
2649 C C   . ASP A 344 ? 0.4487 0.7617 0.6408 0.0920 -0.0943 -0.1511 344  ASP A C   
2650 O O   . ASP A 344 ? 0.3932 0.6968 0.5812 0.0934 -0.0948 -0.1577 344  ASP A O   
2651 C CB  . ASP A 344 ? 0.5284 0.8125 0.7314 0.0845 -0.0956 -0.1663 344  ASP A CB  
2652 C CG  . ASP A 344 ? 0.5022 0.7679 0.7121 0.0800 -0.0966 -0.1661 344  ASP A CG  
2653 O OD1 . ASP A 344 ? 0.5112 0.7735 0.7228 0.0783 -0.0974 -0.1544 344  ASP A OD1 
2654 O OD2 . ASP A 344 ? 0.4184 0.6729 0.6324 0.0784 -0.0966 -0.1775 344  ASP A OD2 
2655 N N   . ILE A 345 ? 0.3876 0.7213 0.5774 0.0951 -0.0929 -0.1430 345  ILE A N   
2656 C CA  . ILE A 345 ? 0.4223 0.7696 0.6038 0.1006 -0.0918 -0.1415 345  ILE A CA  
2657 C C   . ILE A 345 ? 0.4675 0.8134 0.6463 0.1039 -0.0920 -0.1261 345  ILE A C   
2658 O O   . ILE A 345 ? 0.3230 0.6718 0.5061 0.1038 -0.0918 -0.1145 345  ILE A O   
2659 C CB  . ILE A 345 ? 0.3001 0.6735 0.4793 0.1029 -0.0896 -0.1445 345  ILE A CB  
2660 C CG1 . ILE A 345 ? 0.3463 0.7217 0.5273 0.1005 -0.0890 -0.1610 345  ILE A CG1 
2661 C CG2 . ILE A 345 ? 0.2927 0.6808 0.4627 0.1089 -0.0882 -0.1413 345  ILE A CG2 
2662 C CD1 . ILE A 345 ? 0.2257 0.6274 0.4048 0.1021 -0.0867 -0.1651 345  ILE A CD1 
2663 N N   . GLU A 346 ? 0.4151 0.7560 0.5871 0.1071 -0.0923 -0.1263 346  GLU A N   
2664 C CA  . GLU A 346 ? 0.4178 0.7588 0.5863 0.1113 -0.0920 -0.1127 346  GLU A CA  
2665 C C   . GLU A 346 ? 0.4124 0.7764 0.5739 0.1175 -0.0897 -0.1091 346  GLU A C   
2666 O O   . GLU A 346 ? 0.4211 0.7940 0.5761 0.1196 -0.0889 -0.1181 346  GLU A O   
2667 C CB  . GLU A 346 ? 0.3109 0.6331 0.4758 0.1114 -0.0935 -0.1137 346  GLU A CB  
2668 C CG  . GLU A 346 ? 0.6060 0.9274 0.7674 0.1160 -0.0930 -0.0997 346  GLU A CG  
2669 C CD  . GLU A 346 ? 0.6528 0.9602 0.8086 0.1170 -0.0940 -0.1016 346  GLU A CD  
2670 O OE1 . GLU A 346 ? 0.5965 0.9123 0.7450 0.1205 -0.0931 -0.1066 346  GLU A OE1 
2671 O OE2 . GLU A 346 ? 0.7301 1.0185 0.8886 0.1144 -0.0955 -0.0979 346  GLU A OE2 
2672 N N   . ILE A 347 ? 0.4214 0.7951 0.5841 0.1206 -0.0884 -0.0963 347  ILE A N   
2673 C CA  . ILE A 347 ? 0.3796 0.7709 0.5344 0.1277 -0.0861 -0.0896 347  ILE A CA  
2674 C C   . ILE A 347 ? 0.4350 0.8167 0.5904 0.1313 -0.0860 -0.0746 347  ILE A C   
2675 O O   . ILE A 347 ? 0.4501 0.8145 0.6128 0.1279 -0.0876 -0.0697 347  ILE A O   
2676 C CB  . ILE A 347 ? 0.3940 0.8087 0.5488 0.1295 -0.0839 -0.0882 347  ILE A CB  
2677 C CG1 . ILE A 347 ? 0.3700 0.7816 0.5340 0.1276 -0.0840 -0.0780 347  ILE A CG1 
2678 C CG2 . ILE A 347 ? 0.3640 0.7887 0.5182 0.1262 -0.0837 -0.1034 347  ILE A CG2 
2679 C CD1 . ILE A 347 ? 0.4677 0.9021 0.6317 0.1296 -0.0816 -0.0749 347  ILE A CD1 
2680 N N   . MET A 348 ? 0.4470 0.8396 0.5945 0.1383 -0.0839 -0.0674 348  MET A N   
2681 C CA  . MET A 348 ? 0.4679 0.8498 0.6150 0.1424 -0.0836 -0.0544 348  MET A CA  
2682 C C   . MET A 348 ? 0.5366 0.9331 0.6811 0.1491 -0.0807 -0.0422 348  MET A C   
2683 O O   . MET A 348 ? 0.4525 0.8695 0.5943 0.1508 -0.0787 -0.0436 348  MET A O   
2684 C CB  . MET A 348 ? 0.4856 0.8611 0.6245 0.1451 -0.0838 -0.0569 348  MET A CB  
2685 C CG  . MET A 348 ? 0.4605 0.8190 0.6015 0.1389 -0.0866 -0.0679 348  MET A CG  
2686 S SD  . MET A 348 ? 0.9288 1.2598 1.0758 0.1360 -0.0887 -0.0605 348  MET A SD  
2687 C CE  . MET A 348 ? 1.2866 1.6118 1.4236 0.1396 -0.0886 -0.0627 348  MET A CE  
2688 N N   . GLY A 349 ? 0.6702 1.0558 0.8149 0.1532 -0.0801 -0.0303 349  GLY A N   
2689 C CA  . GLY A 349 ? 0.6952 1.0923 0.8355 0.1609 -0.0768 -0.0181 349  GLY A CA  
2690 C C   . GLY A 349 ? 0.5617 0.9663 0.6893 0.1678 -0.0746 -0.0162 349  GLY A C   
2691 O O   . GLY A 349 ? 0.6075 1.0177 0.7293 0.1667 -0.0751 -0.0262 349  GLY A O   
2692 N N   . GLY A 350 ? 0.6619 1.0662 0.7850 0.1751 -0.0720 -0.0034 350  GLY A N   
2693 C CA  . GLY A 350 ? 0.6808 1.0907 0.7920 0.1820 -0.0696 -0.0003 350  GLY A CA  
2694 C C   . GLY A 350 ? 0.6139 1.0018 0.7252 0.1809 -0.0716 -0.0010 350  GLY A C   
2695 O O   . GLY A 350 ? 0.4579 0.8269 0.5784 0.1746 -0.0748 -0.0041 350  GLY A O   
2696 N N   . LEU A 351 ? 0.6087 0.9999 0.7098 0.1870 -0.0694 0.0022  351  LEU A N   
2697 C CA  . LEU A 351 ? 0.5510 0.9235 0.6509 0.1867 -0.0708 0.0019  351  LEU A CA  
2698 C C   . LEU A 351 ? 0.5496 0.9277 0.6386 0.1961 -0.0669 0.0114  351  LEU A C   
2699 O O   . LEU A 351 ? 0.5175 0.9150 0.5971 0.2004 -0.0644 0.0097  351  LEU A O   
2700 C CB  . LEU A 351 ? 0.5456 0.9183 0.6437 0.1818 -0.0732 -0.0121 351  LEU A CB  
2701 C CG  . LEU A 351 ? 0.5693 0.9201 0.6700 0.1774 -0.0761 -0.0165 351  LEU A CG  
2702 C CD1 . LEU A 351 ? 0.4937 0.8513 0.5861 0.1780 -0.0761 -0.0257 351  LEU A CD1 
2703 C CD2 . LEU A 351 ? 0.6755 1.0092 0.7770 0.1807 -0.0755 -0.0053 351  LEU A CD2 
2704 N N   . GLY A 352 ? 0.5921 0.9531 0.6820 0.1991 -0.0661 0.0213  352  GLY A N   
2705 C CA  . GLY A 352 ? 0.6416 1.0061 0.7213 0.2083 -0.0620 0.0311  352  GLY A CA  
2706 C C   . GLY A 352 ? 0.6998 1.0804 0.7752 0.2150 -0.0577 0.0415  352  GLY A C   
2707 O O   . GLY A 352 ? 0.6434 1.0186 0.7254 0.2141 -0.0578 0.0473  352  GLY A O   
2708 N N   . PRO A 353 ? 0.6388 1.0394 0.7030 0.2219 -0.0539 0.0441  353  PRO A N   
2709 C CA  . PRO A 353 ? 0.6864 1.1049 0.7456 0.2286 -0.0493 0.0544  353  PRO A CA  
2710 C C   . PRO A 353 ? 0.7463 1.1777 0.8117 0.2240 -0.0505 0.0503  353  PRO A C   
2711 O O   . PRO A 353 ? 0.8035 1.2397 0.8699 0.2271 -0.0481 0.0600  353  PRO A O   
2712 C CB  . PRO A 353 ? 0.5547 0.9943 0.6016 0.2348 -0.0459 0.0538  353  PRO A CB  
2713 C CG  . PRO A 353 ? 0.4955 0.9215 0.5401 0.2339 -0.0476 0.0486  353  PRO A CG  
2714 C CD  . PRO A 353 ? 0.6225 1.0293 0.6780 0.2242 -0.0532 0.0388  353  PRO A CD  
2715 N N   . SER A 354 ? 0.6868 1.1233 0.7562 0.2167 -0.0541 0.0365  354  SER A N   
2716 C CA  . SER A 354 ? 0.6031 1.0527 0.6782 0.2120 -0.0551 0.0316  354  SER A CA  
2717 C C   . SER A 354 ? 0.5714 1.0033 0.6598 0.2057 -0.0583 0.0318  354  SER A C   
2718 O O   . SER A 354 ? 0.6757 1.1168 0.7701 0.2014 -0.0593 0.0278  354  SER A O   
2719 C CB  . SER A 354 ? 0.5216 0.9853 0.5949 0.2073 -0.0570 0.0165  354  SER A CB  
2720 O OG  . SER A 354 ? 0.4920 0.9382 0.5730 0.1992 -0.0616 0.0056  354  SER A OG  
2721 N N   . THR A 355 ? 0.5676 0.9749 0.6605 0.2051 -0.0598 0.0363  355  THR A N   
2722 C CA  . THR A 355 ? 0.5427 0.9319 0.6481 0.1997 -0.0626 0.0374  355  THR A CA  
2723 C C   . THR A 355 ? 0.5789 0.9776 0.6870 0.2021 -0.0603 0.0459  355  THR A C   
2724 O O   . THR A 355 ? 0.6511 1.0602 0.7510 0.2101 -0.0559 0.0567  355  THR A O   
2725 C CB  . THR A 355 ? 0.6340 0.9969 0.7412 0.2011 -0.0632 0.0438  355  THR A CB  
2726 O OG1 . THR A 355 ? 0.6759 1.0303 0.7808 0.1985 -0.0654 0.0360  355  THR A OG1 
2727 C CG2 . THR A 355 ? 0.4622 0.8065 0.5825 0.1955 -0.0660 0.0448  355  THR A CG2 
2728 N N   . GLY A 356 ? 0.6086 1.0046 0.7281 0.1951 -0.0631 0.0409  356  GLY A N   
2729 C CA  . GLY A 356 ? 0.7203 1.1299 0.8410 0.1988 -0.0604 0.0481  356  GLY A CA  
2730 C C   . GLY A 356 ? 0.7496 1.1901 0.8626 0.2025 -0.0570 0.0487  356  GLY A C   
2731 O O   . GLY A 356 ? 0.7377 1.1954 0.8510 0.2054 -0.0545 0.0535  356  GLY A O   
2732 N N   . LYS A 357 ? 0.6623 1.1106 0.7684 0.2023 -0.0568 0.0437  357  LYS A N   
2733 C CA  . LYS A 357 ? 0.6278 1.1059 0.7246 0.2072 -0.0530 0.0456  357  LYS A CA  
2734 C C   . LYS A 357 ? 0.7247 1.2177 0.8240 0.2000 -0.0552 0.0311  357  LYS A C   
2735 O O   . LYS A 357 ? 0.8640 1.3814 0.9583 0.2019 -0.0526 0.0312  357  LYS A O   
2736 C CB  . LYS A 357 ? 0.6544 1.1383 0.7387 0.2148 -0.0496 0.0514  357  LYS A CB  
2737 C CG  . LYS A 357 ? 0.8013 1.3000 0.8751 0.2273 -0.0429 0.0689  357  LYS A CG  
2738 C CD  . LYS A 357 ? 0.8352 1.3267 0.8998 0.2343 -0.0402 0.0763  357  LYS A CD  
2739 C CE  . LYS A 357 ? 0.9848 1.4928 1.0416 0.2348 -0.0394 0.0701  357  LYS A CE  
2740 N NZ  . LYS A 357 ? 1.0842 1.6249 1.1322 0.2414 -0.0342 0.0765  357  LYS A NZ  
2741 N N   . VAL A 358 ? 0.6604 1.1402 0.7661 0.1926 -0.0594 0.0188  358  VAL A N   
2742 C CA  . VAL A 358 ? 0.6418 1.1350 0.7476 0.1869 -0.0611 0.0042  358  VAL A CA  
2743 C C   . VAL A 358 ? 0.6529 1.1294 0.7702 0.1774 -0.0656 -0.0069 358  VAL A C   
2744 O O   . VAL A 358 ? 0.6582 1.1122 0.7838 0.1747 -0.0679 -0.0039 358  VAL A O   
2745 C CB  . VAL A 358 ? 0.6124 1.1137 0.7073 0.1896 -0.0604 -0.0028 358  VAL A CB  
2746 C CG1 . VAL A 358 ? 0.5958 1.1204 0.6786 0.1980 -0.0556 0.0048  358  VAL A CG1 
2747 C CG2 . VAL A 358 ? 0.5686 1.0469 0.6633 0.1900 -0.0622 -0.0022 358  VAL A CG2 
2748 N N   . LEU A 359 ? 0.5847 1.0734 0.7022 0.1726 -0.0666 -0.0197 359  LEU A N   
2749 C CA  . LEU A 359 ? 0.6141 1.0889 0.7389 0.1644 -0.0704 -0.0325 359  LEU A CA  
2750 C C   . LEU A 359 ? 0.6706 1.1518 0.7866 0.1650 -0.0705 -0.0435 359  LEU A C   
2751 O O   . LEU A 359 ? 0.6058 1.1080 0.7120 0.1699 -0.0677 -0.0438 359  LEU A O   
2752 C CB  . LEU A 359 ? 0.5221 1.0051 0.6546 0.1584 -0.0712 -0.0394 359  LEU A CB  
2753 C CG  . LEU A 359 ? 0.5277 1.0075 0.6703 0.1567 -0.0711 -0.0308 359  LEU A CG  
2754 C CD1 . LEU A 359 ? 0.4930 0.9775 0.6431 0.1492 -0.0725 -0.0413 359  LEU A CD1 
2755 C CD2 . LEU A 359 ? 0.5623 1.0161 0.7126 0.1557 -0.0731 -0.0231 359  LEU A CD2 
2756 N N   . ARG A 360 ? 0.5812 1.0447 0.7007 0.1599 -0.0736 -0.0526 360  ARG A N   
2757 C CA  . ARG A 360 ? 0.4606 0.9273 0.5725 0.1603 -0.0738 -0.0633 360  ARG A CA  
2758 C C   . ARG A 360 ? 0.4317 0.8925 0.5492 0.1529 -0.0763 -0.0783 360  ARG A C   
2759 O O   . ARG A 360 ? 0.5658 1.0063 0.6918 0.1474 -0.0790 -0.0801 360  ARG A O   
2760 C CB  . ARG A 360 ? 0.3776 0.8273 0.4863 0.1627 -0.0746 -0.0591 360  ARG A CB  
2761 C CG  . ARG A 360 ? 0.5063 0.9626 0.6075 0.1712 -0.0716 -0.0453 360  ARG A CG  
2762 C CD  . ARG A 360 ? 0.5224 0.9645 0.6190 0.1737 -0.0721 -0.0434 360  ARG A CD  
2763 N NE  . ARG A 360 ? 0.5940 1.0097 0.6992 0.1694 -0.0750 -0.0409 360  ARG A NE  
2764 C CZ  . ARG A 360 ? 0.5132 0.9125 0.6174 0.1679 -0.0768 -0.0440 360  ARG A CZ  
2765 N NH1 . ARG A 360 ? 0.4433 0.8490 0.5387 0.1705 -0.0760 -0.0500 360  ARG A NH1 
2766 N NH2 . ARG A 360 ? 0.5686 0.9454 0.6806 0.1638 -0.0793 -0.0413 360  ARG A NH2 
2767 N N   . ILE A 361 ? 0.4135 0.8920 0.5258 0.1529 -0.0751 -0.0891 361  ILE A N   
2768 C CA  . ILE A 361 ? 0.4699 0.9441 0.5865 0.1468 -0.0768 -0.1045 361  ILE A CA  
2769 C C   . ILE A 361 ? 0.4060 0.8819 0.5150 0.1484 -0.0767 -0.1148 361  ILE A C   
2770 O O   . ILE A 361 ? 0.5612 1.0550 0.6609 0.1538 -0.0743 -0.1137 361  ILE A O   
2771 C CB  . ILE A 361 ? 0.4488 0.9422 0.5670 0.1450 -0.0755 -0.1105 361  ILE A CB  
2772 C CG1 . ILE A 361 ? 0.5196 1.0098 0.6466 0.1424 -0.0759 -0.1015 361  ILE A CG1 
2773 C CG2 . ILE A 361 ? 0.2901 0.7797 0.4114 0.1398 -0.0768 -0.1274 361  ILE A CG2 
2774 C CD1 . ILE A 361 ? 0.6016 1.1134 0.7247 0.1472 -0.0729 -0.0914 361  ILE A CD1 
2775 N N   . GLY A 362 ? 0.4749 0.9328 0.5879 0.1438 -0.0791 -0.1248 362  GLY A N   
2776 C CA  . GLY A 362 ? 0.4873 0.9448 0.5941 0.1453 -0.0790 -0.1344 362  GLY A CA  
2777 C C   . GLY A 362 ? 0.4908 0.9512 0.5991 0.1420 -0.0792 -0.1515 362  GLY A C   
2778 O O   . GLY A 362 ? 0.3863 0.8359 0.5027 0.1367 -0.0807 -0.1580 362  GLY A O   
2779 N N   . LEU A 363 ? 0.3425 0.8170 0.4430 0.1454 -0.0776 -0.1589 363  LEU A N   
2780 C CA  . LEU A 363 ? 0.3837 0.8607 0.4850 0.1433 -0.0775 -0.1756 363  LEU A CA  
2781 C C   . LEU A 363 ? 0.5234 0.9911 0.6206 0.1448 -0.0781 -0.1812 363  LEU A C   
2782 O O   . LEU A 363 ? 0.3145 0.7956 0.4028 0.1497 -0.0764 -0.1796 363  LEU A O   
2783 C CB  . LEU A 363 ? 0.3869 0.8923 0.4829 0.1459 -0.0747 -0.1808 363  LEU A CB  
2784 C CG  . LEU A 363 ? 0.4418 0.9589 0.5410 0.1447 -0.0739 -0.1747 363  LEU A CG  
2785 C CD1 . LEU A 363 ? 0.4565 1.0029 0.5495 0.1474 -0.0709 -0.1799 363  LEU A CD1 
2786 C CD2 . LEU A 363 ? 0.4144 0.9157 0.5247 0.1384 -0.0758 -0.1805 363  LEU A CD2 
2787 N N   . LEU A 364 ? 0.2564 0.7012 0.3599 0.1406 -0.0804 -0.1878 364  LEU A N   
2788 C CA  . LEU A 364 ? 0.2550 0.6862 0.3561 0.1413 -0.0814 -0.1907 364  LEU A CA  
2789 C C   . LEU A 364 ? 0.4358 0.8562 0.5412 0.1385 -0.0822 -0.2064 364  LEU A C   
2790 O O   . LEU A 364 ? 0.3155 0.7179 0.4293 0.1340 -0.0839 -0.2105 364  LEU A O   
2791 C CB  . LEU A 364 ? 0.2622 0.6717 0.3662 0.1397 -0.0835 -0.1795 364  LEU A CB  
2792 C CG  . LEU A 364 ? 0.2890 0.7061 0.3891 0.1432 -0.0827 -0.1633 364  LEU A CG  
2793 C CD1 . LEU A 364 ? 0.3463 0.7409 0.4502 0.1412 -0.0848 -0.1538 364  LEU A CD1 
2794 C CD2 . LEU A 364 ? 0.3825 0.8171 0.4720 0.1495 -0.0804 -0.1606 364  LEU A CD2 
2795 N N   . GLY A 365 ? 0.3269 0.7580 0.4269 0.1414 -0.0808 -0.2151 365  GLY A N   
2796 C CA  . GLY A 365 ? 0.2569 0.6787 0.3610 0.1396 -0.0813 -0.2300 365  GLY A CA  
2797 C C   . GLY A 365 ? 0.3865 0.8080 0.4986 0.1363 -0.0812 -0.2402 365  GLY A C   
2798 O O   . GLY A 365 ? 0.3455 0.7862 0.4564 0.1371 -0.0795 -0.2416 365  GLY A O   
2799 N N   . CYS A 366 ? 0.3700 0.7696 0.4902 0.1329 -0.0828 -0.2471 366  CYS A N   
2800 C CA  . CYS A 366 ? 0.4294 0.8274 0.5578 0.1302 -0.0825 -0.2578 366  CYS A CA  
2801 C C   . CYS A 366 ? 0.5320 0.9329 0.6639 0.1278 -0.0827 -0.2503 366  CYS A C   
2802 O O   . CYS A 366 ? 0.6905 1.0943 0.8284 0.1258 -0.0822 -0.2580 366  CYS A O   
2803 C CB  . CYS A 366 ? 0.4755 0.8480 0.6120 0.1276 -0.0841 -0.2657 366  CYS A CB  
2804 S SG  . CYS A 366 ? 0.5322 0.8771 0.6722 0.1244 -0.0870 -0.2538 366  CYS A SG  
2805 N N   . ASN A 367 ? 0.4823 0.8829 0.6107 0.1281 -0.0835 -0.2354 367  ASN A N   
2806 C CA  . ASN A 367 ? 0.3761 0.7818 0.5073 0.1262 -0.0835 -0.2269 367  ASN A CA  
2807 C C   . ASN A 367 ? 0.4273 0.8614 0.5522 0.1294 -0.0812 -0.2234 367  ASN A C   
2808 O O   . ASN A 367 ? 0.4689 0.9112 0.5963 0.1281 -0.0808 -0.2182 367  ASN A O   
2809 C CB  . ASN A 367 ? 0.4453 0.8356 0.5771 0.1251 -0.0854 -0.2124 367  ASN A CB  
2810 C CG  . ASN A 367 ? 0.5683 0.9309 0.7059 0.1218 -0.0876 -0.2154 367  ASN A CG  
2811 O OD1 . ASN A 367 ? 0.4482 0.7998 0.5935 0.1185 -0.0882 -0.2234 367  ASN A OD1 
2812 N ND2 . ASN A 367 ? 0.5725 0.9238 0.7064 0.1229 -0.0887 -0.2094 367  ASN A ND2 
2813 N N   . ALA A 368 ? 0.3966 0.8464 0.5134 0.1336 -0.0795 -0.2264 368  ALA A N   
2814 C CA  . ALA A 368 ? 0.2836 0.7616 0.3936 0.1369 -0.0770 -0.2241 368  ALA A CA  
2815 C C   . ALA A 368 ? 0.3594 0.8506 0.4723 0.1356 -0.0755 -0.2383 368  ALA A C   
2816 O O   . ALA A 368 ? 0.4847 0.9887 0.5934 0.1379 -0.0740 -0.2485 368  ALA A O   
2817 C CB  . ALA A 368 ? 0.3100 0.8004 0.4097 0.1421 -0.0757 -0.2215 368  ALA A CB  
2818 N N   . THR A 369 ? 0.4198 0.9079 0.5401 0.1319 -0.0760 -0.2390 369  THR A N   
2819 C CA  . THR A 369 ? 0.4349 0.9329 0.5594 0.1302 -0.0746 -0.2526 369  THR A CA  
2820 C C   . THR A 369 ? 0.5287 1.0436 0.6535 0.1293 -0.0735 -0.2470 369  THR A C   
2821 O O   . THR A 369 ? 0.4749 0.9847 0.6012 0.1282 -0.0745 -0.2338 369  THR A O   
2822 C CB  . THR A 369 ? 0.4324 0.9074 0.5676 0.1261 -0.0762 -0.2617 369  THR A CB  
2823 O OG1 . THR A 369 ? 0.4899 0.9523 0.6311 0.1226 -0.0778 -0.2522 369  THR A OG1 
2824 C CG2 . THR A 369 ? 0.4083 0.8632 0.5445 0.1266 -0.0776 -0.2660 369  THR A CG2 
2825 N N   . ARG A 370 ? 0.5395 1.0746 0.6629 0.1297 -0.0713 -0.2574 370  ARG A N   
2826 C CA  . ARG A 370 ? 0.4233 0.9757 0.5476 0.1284 -0.0700 -0.2549 370  ARG A CA  
2827 C C   . ARG A 370 ? 0.4495 0.9841 0.5837 0.1238 -0.0718 -0.2511 370  ARG A C   
2828 O O   . ARG A 370 ? 0.5070 1.0463 0.6418 0.1229 -0.0718 -0.2393 370  ARG A O   
2829 C CB  . ARG A 370 ? 0.4187 0.9896 0.5426 0.1284 -0.0677 -0.2706 370  ARG A CB  
2830 C CG  . ARG A 370 ? 0.5172 1.1088 0.6312 0.1329 -0.0656 -0.2759 370  ARG A CG  
2831 C CD  . ARG A 370 ? 0.5570 1.1691 0.6709 0.1325 -0.0633 -0.2905 370  ARG A CD  
2832 N NE  . ARG A 370 ? 0.6599 1.3019 0.7638 0.1355 -0.0609 -0.2856 370  ARG A NE  
2833 C CZ  . ARG A 370 ? 0.7346 1.3940 0.8383 0.1342 -0.0595 -0.2841 370  ARG A CZ  
2834 N NH1 . ARG A 370 ? 0.7437 1.3940 0.8569 0.1298 -0.0602 -0.2876 370  ARG A NH1 
2835 N NH2 . ARG A 370 ? 0.8260 1.5127 0.9200 0.1373 -0.0572 -0.2792 370  ARG A NH2 
2836 N N   . GLU A 371 ? 0.4584 0.9725 0.6007 0.1209 -0.0730 -0.2610 371  GLU A N   
2837 C CA  . GLU A 371 ? 0.4891 0.9873 0.6410 0.1165 -0.0745 -0.2590 371  GLU A CA  
2838 C C   . GLU A 371 ? 0.6571 1.1410 0.8100 0.1154 -0.0765 -0.2424 371  GLU A C   
2839 O O   . GLU A 371 ? 0.7223 1.2025 0.8808 0.1122 -0.0771 -0.2365 371  GLU A O   
2840 C CB  . GLU A 371 ? 0.5886 1.0673 0.7491 0.1142 -0.0752 -0.2726 371  GLU A CB  
2841 C CG  . GLU A 371 ? 1.1854 1.6554 1.3551 0.1099 -0.0758 -0.2722 371  GLU A CG  
2842 C CD  . GLU A 371 ? 1.5739 2.0388 1.7515 0.1085 -0.0749 -0.2888 371  GLU A CD  
2843 O OE1 . GLU A 371 ? 1.7926 2.2617 1.9689 0.1109 -0.0739 -0.3009 371  GLU A OE1 
2844 O OE2 . GLU A 371 ? 1.6130 2.0683 1.7985 0.1052 -0.0754 -0.2893 371  GLU A OE2 
2845 N N   . ASN A 372 ? 0.5739 1.0502 0.7216 0.1179 -0.0775 -0.2350 372  ASN A N   
2846 C CA  . ASN A 372 ? 0.3691 0.8327 0.5176 0.1173 -0.0793 -0.2194 372  ASN A CA  
2847 C C   . ASN A 372 ? 0.3959 0.8797 0.5399 0.1194 -0.0779 -0.2068 372  ASN A C   
2848 O O   . ASN A 372 ? 0.5546 1.0324 0.7019 0.1181 -0.0789 -0.1945 372  ASN A O   
2849 C CB  . ASN A 372 ? 0.4656 0.9145 0.6102 0.1193 -0.0806 -0.2159 372  ASN A CB  
2850 C CG  . ASN A 372 ? 0.4627 0.8851 0.6140 0.1163 -0.0826 -0.2229 372  ASN A CG  
2851 O OD1 . ASN A 372 ? 0.6421 1.0548 0.8014 0.1126 -0.0831 -0.2283 372  ASN A OD1 
2852 N ND2 . ASN A 372 ? 0.3570 0.7674 0.5050 0.1179 -0.0835 -0.2227 372  ASN A ND2 
2853 N N   . VAL A 373 ? 0.3086 0.8168 0.4451 0.1229 -0.0756 -0.2101 373  VAL A N   
2854 C CA  . VAL A 373 ? 0.4542 0.9841 0.5860 0.1255 -0.0739 -0.1992 373  VAL A CA  
2855 C C   . VAL A 373 ? 0.4557 0.9914 0.5943 0.1217 -0.0735 -0.1988 373  VAL A C   
2856 O O   . VAL A 373 ? 0.3855 0.9286 0.5244 0.1221 -0.0731 -0.1861 373  VAL A O   
2857 C CB  . VAL A 373 ? 0.4945 1.0506 0.6163 0.1299 -0.0712 -0.2046 373  VAL A CB  
2858 C CG1 . VAL A 373 ? 0.2761 0.8554 0.3930 0.1326 -0.0691 -0.1935 373  VAL A CG1 
2859 C CG2 . VAL A 373 ? 0.5891 1.1410 0.7037 0.1339 -0.0713 -0.2044 373  VAL A CG2 
2860 N N   . ASP A 374 ? 0.2836 0.8158 0.4278 0.1181 -0.0735 -0.2128 374  ASP A N   
2861 C CA  . ASP A 374 ? 0.5188 1.0573 0.6694 0.1144 -0.0730 -0.2138 374  ASP A CA  
2862 C C   . ASP A 374 ? 0.5417 1.0588 0.7006 0.1108 -0.0752 -0.2043 374  ASP A C   
2863 O O   . ASP A 374 ? 0.6075 1.1307 0.7698 0.1092 -0.0750 -0.1953 374  ASP A O   
2864 C CB  . ASP A 374 ? 0.3765 0.9167 0.5312 0.1120 -0.0721 -0.2318 374  ASP A CB  
2865 C CG  . ASP A 374 ? 0.3416 0.9066 0.4886 0.1151 -0.0696 -0.2414 374  ASP A CG  
2866 O OD1 . ASP A 374 ? 0.3614 0.9473 0.5006 0.1182 -0.0680 -0.2333 374  ASP A OD1 
2867 O OD2 . ASP A 374 ? 0.4436 1.0072 0.5923 0.1147 -0.0690 -0.2569 374  ASP A OD2 
2868 N N   . ARG A 375 ? 0.4172 0.9097 0.5792 0.1096 -0.0774 -0.2061 375  ARG A N   
2869 C CA  . ARG A 375 ? 0.4221 0.8928 0.5916 0.1062 -0.0796 -0.1980 375  ARG A CA  
2870 C C   . ARG A 375 ? 0.5228 0.9957 0.6904 0.1080 -0.0800 -0.1799 375  ARG A C   
2871 O O   . ARG A 375 ? 0.6028 1.0721 0.7767 0.1053 -0.0805 -0.1716 375  ARG A O   
2872 C CB  . ARG A 375 ? 0.3945 0.8398 0.5662 0.1051 -0.0815 -0.2038 375  ARG A CB  
2873 C CG  . ARG A 375 ? 0.2418 0.6822 0.4175 0.1035 -0.0811 -0.2212 375  ARG A CG  
2874 C CD  . ARG A 375 ? 0.2575 0.6706 0.4368 0.1022 -0.0830 -0.2257 375  ARG A CD  
2875 N NE  . ARG A 375 ? 0.4432 0.8517 0.6270 0.1016 -0.0823 -0.2424 375  ARG A NE  
2876 C CZ  . ARG A 375 ? 0.5582 0.9575 0.7506 0.0984 -0.0823 -0.2489 375  ARG A CZ  
2877 N NH1 . ARG A 375 ? 0.5180 0.9117 0.7151 0.0950 -0.0832 -0.2404 375  ARG A NH1 
2878 N NH2 . ARG A 375 ? 0.4744 0.8700 0.6711 0.0987 -0.0815 -0.2640 375  ARG A NH2 
2879 N N   . VAL A 376 ? 0.4240 0.9035 0.5835 0.1129 -0.0794 -0.1738 376  VAL A N   
2880 C CA  . VAL A 376 ? 0.4632 0.9433 0.6212 0.1156 -0.0795 -0.1566 376  VAL A CA  
2881 C C   . VAL A 376 ? 0.5611 1.0641 0.7185 0.1169 -0.0774 -0.1496 376  VAL A C   
2882 O O   . VAL A 376 ? 0.5660 1.0675 0.7272 0.1170 -0.0775 -0.1364 376  VAL A O   
2883 C CB  . VAL A 376 ? 0.3855 0.8645 0.5348 0.1209 -0.0794 -0.1514 376  VAL A CB  
2884 C CG1 . VAL A 376 ? 0.3340 0.8397 0.4739 0.1265 -0.0766 -0.1482 376  VAL A CG1 
2885 C CG2 . VAL A 376 ? 0.3650 0.8280 0.5169 0.1216 -0.0809 -0.1369 376  VAL A CG2 
2886 N N   . THR A 377 ? 0.6126 1.1370 0.7654 0.1179 -0.0753 -0.1588 377  THR A N   
2887 C CA  . THR A 377 ? 0.6188 1.1667 0.7701 0.1191 -0.0730 -0.1533 377  THR A CA  
2888 C C   . THR A 377 ? 0.4594 1.0020 0.6212 0.1137 -0.0737 -0.1515 377  THR A C   
2889 O O   . THR A 377 ? 0.6169 1.1664 0.7811 0.1143 -0.0729 -0.1393 377  THR A O   
2890 C CB  . THR A 377 ? 0.7477 1.3192 0.8924 0.1204 -0.0706 -0.1654 377  THR A CB  
2891 O OG1 . THR A 377 ? 0.8387 1.4155 0.9737 0.1253 -0.0699 -0.1674 377  THR A OG1 
2892 C CG2 . THR A 377 ? 0.6891 1.2859 0.8313 0.1218 -0.0681 -0.1586 377  THR A CG2 
2893 N N   . GLU A 378 ? 0.3050 0.8348 0.4731 0.1088 -0.0750 -0.1636 378  GLU A N   
2894 C CA  . GLU A 378 ? 0.4487 0.9738 0.6265 0.1035 -0.0754 -0.1632 378  GLU A CA  
2895 C C   . GLU A 378 ? 0.5163 1.0212 0.7011 0.1016 -0.0775 -0.1505 378  GLU A C   
2896 O O   . GLU A 378 ? 0.4852 0.9928 0.6762 0.0994 -0.0773 -0.1424 378  GLU A O   
2897 C CB  . GLU A 378 ? 0.4217 0.9395 0.6039 0.0993 -0.0758 -0.1802 378  GLU A CB  
2898 C CG  . GLU A 378 ? 0.4897 1.0304 0.6666 0.1007 -0.0734 -0.1924 378  GLU A CG  
2899 C CD  . GLU A 378 ? 0.3605 0.8958 0.5430 0.0969 -0.0732 -0.2090 378  GLU A CD  
2900 O OE1 . GLU A 378 ? 0.3035 0.8158 0.4931 0.0937 -0.0750 -0.2120 378  GLU A OE1 
2901 O OE2 . GLU A 378 ? 0.4344 0.9888 0.6140 0.0974 -0.0711 -0.2192 378  GLU A OE2 
2902 N N   . ALA A 379 ? 0.4333 0.9185 0.6170 0.1026 -0.0794 -0.1487 379  ALA A N   
2903 C CA  . ALA A 379 ? 0.4428 0.9088 0.6323 0.1013 -0.0813 -0.1368 379  ALA A CA  
2904 C C   . ALA A 379 ? 0.5000 0.9771 0.6886 0.1052 -0.0801 -0.1204 379  ALA A C   
2905 O O   . ALA A 379 ? 0.6290 1.1006 0.8254 0.1031 -0.0806 -0.1109 379  ALA A O   
2906 C CB  . ALA A 379 ? 0.5579 1.0034 0.7445 0.1023 -0.0833 -0.1382 379  ALA A CB  
2907 N N   . LEU A 380 ? 0.4874 0.9806 0.6667 0.1112 -0.0783 -0.1172 380  LEU A N   
2908 C CA  . LEU A 380 ? 0.5488 1.0535 0.7262 0.1161 -0.0766 -0.1019 380  LEU A CA  
2909 C C   . LEU A 380 ? 0.6030 1.1253 0.7847 0.1145 -0.0747 -0.0991 380  LEU A C   
2910 O O   . LEU A 380 ? 0.6201 1.1428 0.8068 0.1156 -0.0740 -0.0862 380  LEU A O   
2911 C CB  . LEU A 380 ? 0.5407 1.0599 0.7058 0.1230 -0.0747 -0.1002 380  LEU A CB  
2912 C CG  . LEU A 380 ? 0.5048 1.0087 0.6652 0.1264 -0.0760 -0.0971 380  LEU A CG  
2913 C CD1 . LEU A 380 ? 0.6123 1.1327 0.7602 0.1317 -0.0741 -0.1013 380  LEU A CD1 
2914 C CD2 . LEU A 380 ? 0.3863 0.8807 0.5493 0.1297 -0.0760 -0.0805 380  LEU A CD2 
2915 N N   . ARG A 381 ? 0.6126 1.1495 0.7924 0.1120 -0.0737 -0.1113 381  ARG A N   
2916 C CA  . ARG A 381 ? 0.6167 1.1720 0.7999 0.1101 -0.0717 -0.1101 381  ARG A CA  
2917 C C   . ARG A 381 ? 0.6043 1.1460 0.8002 0.1049 -0.0730 -0.1049 381  ARG A C   
2918 O O   . ARG A 381 ? 0.5460 1.0957 0.7461 0.1056 -0.0715 -0.0938 381  ARG A O   
2919 C CB  . ARG A 381 ? 0.5528 1.1223 0.7332 0.1075 -0.0707 -0.1262 381  ARG A CB  
2920 C CG  . ARG A 381 ? 0.5598 1.1493 0.7430 0.1052 -0.0686 -0.1258 381  ARG A CG  
2921 C CD  . ARG A 381 ? 0.5752 1.1701 0.7598 0.1006 -0.0683 -0.1430 381  ARG A CD  
2922 N NE  . ARG A 381 ? 0.6522 1.2642 0.8265 0.1038 -0.0668 -0.1533 381  ARG A NE  
2923 C CZ  . ARG A 381 ? 0.6586 1.2650 0.8318 0.1022 -0.0674 -0.1693 381  ARG A CZ  
2924 N NH1 . ARG A 381 ? 0.7112 1.2954 0.8927 0.0977 -0.0694 -0.1762 381  ARG A NH1 
2925 N NH2 . ARG A 381 ? 0.4875 1.1107 0.6517 0.1053 -0.0657 -0.1783 381  ARG A NH2 
2926 N N   . ALA A 382 ? 0.6131 1.1342 0.8147 0.0997 -0.0755 -0.1132 382  ALA A N   
2927 C CA  . ALA A 382 ? 0.5580 1.0641 0.7713 0.0943 -0.0769 -0.1095 382  ALA A CA  
2928 C C   . ALA A 382 ? 0.5519 1.0481 0.7693 0.0969 -0.0773 -0.0928 382  ALA A C   
2929 O O   . ALA A 382 ? 0.4968 0.9934 0.7228 0.0950 -0.0767 -0.0843 382  ALA A O   
2930 C CB  . ALA A 382 ? 0.3872 0.8717 0.6036 0.0895 -0.0793 -0.1209 382  ALA A CB  
2931 N N   . ALA A 383 ? 0.5341 1.0215 0.7454 0.1016 -0.0781 -0.0885 383  ALA A N   
2932 C CA  . ALA A 383 ? 0.5452 1.0228 0.7593 0.1053 -0.0783 -0.0732 383  ALA A CA  
2933 C C   . ALA A 383 ? 0.4734 0.9699 0.6877 0.1097 -0.0753 -0.0619 383  ALA A C   
2934 O O   . ALA A 383 ? 0.7278 1.2192 0.9510 0.1092 -0.0749 -0.0518 383  ALA A O   
2935 C CB  . ALA A 383 ? 0.5549 1.0237 0.7604 0.1103 -0.0791 -0.0715 383  ALA A CB  
2936 N N   . LEU A 384 ? 0.4860 1.0047 0.6903 0.1139 -0.0729 -0.0639 384  LEU A N   
2937 C CA  . LEU A 384 ? 0.5644 1.1040 0.7666 0.1183 -0.0695 -0.0539 384  LEU A CA  
2938 C C   . LEU A 384 ? 0.7112 1.2632 0.9219 0.1148 -0.0684 -0.0546 384  LEU A C   
2939 O O   . LEU A 384 ? 0.7114 1.2808 0.9220 0.1202 -0.0657 -0.0449 384  LEU A O   
2940 C CB  . LEU A 384 ? 0.4432 1.0075 0.6328 0.1219 -0.0672 -0.0597 384  LEU A CB  
2941 C CG  . LEU A 384 ? 0.5495 1.1207 0.7270 0.1304 -0.0656 -0.0524 384  LEU A CG  
2942 C CD1 . LEU A 384 ? 0.5354 1.0888 0.7155 0.1347 -0.0662 -0.0396 384  LEU A CD1 
2943 C CD2 . LEU A 384 ? 0.6046 1.1766 0.7730 0.1308 -0.0667 -0.0647 384  LEU A CD2 
2944 N N   . GLN A 385 ? 0.7072 1.2515 0.9246 0.1061 -0.0699 -0.0656 385  GLN A N   
2945 C CA  . GLN A 385 ? 0.7155 1.2715 0.9408 0.1017 -0.0688 -0.0679 385  GLN A CA  
2946 C C   . GLN A 385 ? 0.6887 1.2343 0.9244 0.1006 -0.0697 -0.0615 385  GLN A C   
2947 O O   . GLN A 385 ? 0.7745 1.3387 1.0138 0.1022 -0.0671 -0.0563 385  GLN A O   
2948 C CB  . GLN A 385 ? 0.8100 1.3612 1.0378 0.0939 -0.0701 -0.0828 385  GLN A CB  
2949 C CG  . GLN A 385 ? 0.9203 1.4966 1.1395 0.0948 -0.0679 -0.0918 385  GLN A CG  
2950 C CD  . GLN A 385 ? 0.9205 1.4928 1.1385 0.0902 -0.0693 -0.1098 385  GLN A CD  
2951 O OE1 . GLN A 385 ? 0.7804 1.3348 1.0062 0.0847 -0.0713 -0.1153 385  GLN A OE1 
2952 N NE2 . GLN A 385 ? 0.9419 1.5306 1.1499 0.0927 -0.0680 -0.1192 385  GLN A NE2 
2953 N N   . HIS A 386 ? 0.6550 1.1716 0.8954 0.0978 -0.0729 -0.0616 386  HIS A N   
2954 C CA  . HIS A 386 ? 0.6885 1.1925 0.9401 0.0949 -0.0742 -0.0581 386  HIS A CA  
2955 C C   . HIS A 386 ? 0.7447 1.2452 0.9964 0.1027 -0.0739 -0.0459 386  HIS A C   
2956 O O   . HIS A 386 ? 0.7766 1.2789 1.0366 0.1030 -0.0732 -0.0407 386  HIS A O   
2957 C CB  . HIS A 386 ? 0.5805 1.0558 0.8376 0.0858 -0.0776 -0.0656 386  HIS A CB  
2958 C CG  . HIS A 386 ? 0.7419 1.2235 0.9979 0.0799 -0.0774 -0.0786 386  HIS A CG  
2959 N ND1 . HIS A 386 ? 0.8786 1.3527 1.1281 0.0784 -0.0791 -0.0922 386  HIS A ND1 
2960 C CD2 . HIS A 386 ? 0.7472 1.2450 1.0069 0.0765 -0.0754 -0.0822 386  HIS A CD2 
2961 C CE1 . HIS A 386 ? 0.7856 1.2705 1.0351 0.0747 -0.0781 -0.1037 386  HIS A CE1 
2962 N NE2 . HIS A 386 ? 0.7907 1.2904 1.0458 0.0733 -0.0760 -0.0979 386  HIS A NE2 
2963 N N   . CYS A 387 ? 0.6385 1.1343 0.8810 0.1091 -0.0741 -0.0411 387  CYS A N   
2964 C CA  . CYS A 387 ? 0.8052 1.2972 1.0456 0.1177 -0.0733 -0.0289 387  CYS A CA  
2965 C C   . CYS A 387 ? 0.8339 1.3541 1.0705 0.1266 -0.0683 -0.0173 387  CYS A C   
2966 O O   . CYS A 387 ? 0.7996 1.3440 1.0277 0.1299 -0.0652 -0.0163 387  CYS A O   
2967 C CB  . CYS A 387 ? 0.8252 1.3064 1.0553 0.1223 -0.0742 -0.0268 387  CYS A CB  
2968 S SG  . CYS A 387 ? 0.8106 1.2569 1.0443 0.1133 -0.0788 -0.0352 387  CYS A SG  
2969 N N   . PRO A 388 ? 0.8212 1.3384 1.0631 0.1310 -0.0669 -0.0072 388  PRO A N   
2970 C CA  . PRO A 388 ? 0.7534 1.2956 0.9929 0.1390 -0.0609 0.0068  388  PRO A CA  
2971 C C   . PRO A 388 ? 0.6866 1.2433 0.9101 0.1512 -0.0565 0.0206  388  PRO A C   
2972 O O   . PRO A 388 ? 0.6324 1.1759 0.8479 0.1541 -0.0586 0.0196  388  PRO A O   
2973 C CB  . PRO A 388 ? 0.7883 1.3148 1.0372 0.1408 -0.0608 0.0143  388  PRO A CB  
2974 C CG  . PRO A 388 ? 0.8046 1.2997 1.0536 0.1393 -0.0660 0.0092  388  PRO A CG  
2975 C CD  . PRO A 388 ? 0.8082 1.2964 1.0576 0.1294 -0.0703 -0.0067 388  PRO A CD  
2976 N N1  . PLP B .   ? 0.9610 1.3484 1.0124 0.1830 -0.0754 -0.0755 1389 PLP A N1  
2977 C C2  . PLP B .   ? 0.8846 1.2836 0.9393 0.1816 -0.0750 -0.0776 1389 PLP A C2  
2978 C C2A . PLP B .   ? 0.5443 0.9690 0.5916 0.1880 -0.0714 -0.0742 1389 PLP A C2A 
2979 C C3  . PLP B .   ? 0.9761 1.3642 1.0404 0.1744 -0.0778 -0.0831 1389 PLP A C3  
2980 O O3  . PLP B .   ? 0.7527 1.1530 0.8202 0.1730 -0.0774 -0.0854 1389 PLP A O3  
2981 C C4  . PLP B .   ? 1.0641 1.4290 1.1344 0.1687 -0.0809 -0.0861 1389 PLP A C4  
2982 C C4A . PLP B .   ? 0.8998 1.2528 0.9800 0.1612 -0.0836 -0.0920 1389 PLP A C4A 
2983 C C5  . PLP B .   ? 1.1247 1.4785 1.1913 0.1703 -0.0812 -0.0837 1389 PLP A C5  
2984 C C6  . PLP B .   ? 1.0296 1.3948 1.0869 0.1774 -0.0785 -0.0785 1389 PLP A C6  
2985 C C5A . PLP B .   ? 1.1156 1.4456 1.1875 0.1643 -0.0843 -0.0870 1389 PLP A C5A 
2986 O O4P . PLP B .   ? 1.1851 1.4991 1.2625 0.1625 -0.0854 -0.0781 1389 PLP A O4P 
2987 P P   . PLP B .   ? 0.8629 1.1548 0.9470 0.1547 -0.0888 -0.0847 1389 PLP A P   
2988 O O1P . PLP B .   ? 0.9663 1.2509 1.0593 0.1509 -0.0898 -0.0797 1389 PLP A O1P 
2989 O O2P . PLP B .   ? 0.8043 1.0993 0.8878 0.1514 -0.0897 -0.0994 1389 PLP A O2P 
2990 O O3P . PLP B .   ? 0.8085 1.0859 0.8900 0.1552 -0.0893 -0.0808 1389 PLP A O3P 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   HIS 4   4   4   HIS HIS A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 TRP 108 108 108 TRP TRP A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 HIS 124 124 124 HIS HIS A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 HIS 133 133 133 HIS HIS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 CYS 173 173 173 CYS CYS A . n 
A 1 174 HIS 174 174 174 HIS HIS A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 TYR 231 231 231 TYR TYR A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 LYS 236 236 236 LYS LYS A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 TRP 246 246 246 TRP TRP A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 TRP 251 251 251 TRP TRP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 CYS 253 253 253 CYS CYS A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 ASP 255 255 255 ASP ASP A . n 
A 1 256 GLN 256 256 256 GLN GLN A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 HIS 261 261 261 HIS HIS A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 ASN 286 286 286 ASN ASN A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 TRP 288 288 288 TRP TRP A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 GLN 290 290 290 GLN GLN A . n 
A 1 291 HIS 291 291 291 HIS HIS A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 TYR 297 297 297 TYR TYR A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLY 306 306 306 GLY GLY A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 PHE 310 310 310 PHE PHE A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LYS 312 312 312 LYS LYS A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 THR 320 320 320 THR THR A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 THR 322 322 322 THR THR A . n 
A 1 323 THR 323 323 323 THR THR A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 PRO 327 327 327 PRO PRO A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 TYR 330 330 330 TYR TYR A . n 
A 1 331 ASP 331 331 331 ASP ASP A . n 
A 1 332 TRP 332 332 332 TRP TRP A . n 
A 1 333 ARG 333 333 333 ARG ARG A . n 
A 1 334 ASP 334 334 334 ASP ASP A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 TYR 338 338 338 TYR TYR A . n 
A 1 339 VAL 339 339 339 VAL VAL A . n 
A 1 340 MET 340 340 340 MET MET A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 HIS 342 342 342 HIS HIS A . n 
A 1 343 PHE 343 343 343 PHE PHE A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 MET 348 348 348 MET MET A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 GLY 356 356 356 GLY GLY A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 ARG 360 360 360 ARG ARG A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 CYS 366 366 366 CYS CYS A . n 
A 1 367 ASN 367 367 367 ASN ASN A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 ARG 370 370 370 ARG ARG A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 ASN 372 372 372 ASN ASN A . n 
A 1 373 VAL 373 373 373 VAL VAL A . n 
A 1 374 ASP 374 374 374 ASP ASP A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 VAL 376 376 376 VAL VAL A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 ALA 379 379 379 ALA ALA A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 ALA 382 382 382 ALA ALA A . n 
A 1 383 ALA 383 383 383 ALA ALA A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 HIS 386 386 386 HIS HIS A . n 
A 1 387 CYS 387 387 387 CYS CYS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 LYS 389 389 ?   ?   ?   A . n 
A 1 390 LYS 390 390 ?   ?   ?   A . n 
A 1 391 LYS 391 391 ?   ?   ?   A . n 
A 1 392 LEU 392 392 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PLP 1  1389 1389 PLP PLP A . 
C 3 HOH 1  2001 2001 HOH HOH A . 
C 3 HOH 2  2002 2002 HOH HOH A . 
C 3 HOH 3  2003 2003 HOH HOH A . 
C 3 HOH 4  2004 2004 HOH HOH A . 
C 3 HOH 5  2005 2005 HOH HOH A . 
C 3 HOH 6  2006 2006 HOH HOH A . 
C 3 HOH 7  2007 2007 HOH HOH A . 
C 3 HOH 8  2008 2008 HOH HOH A . 
C 3 HOH 9  2009 2009 HOH HOH A . 
C 3 HOH 10 2010 2010 HOH HOH A . 
C 3 HOH 11 2011 2011 HOH HOH A . 
C 3 HOH 12 2012 2012 HOH HOH A . 
C 3 HOH 13 2013 2013 HOH HOH A . 
C 3 HOH 14 2014 2014 HOH HOH A . 
C 3 HOH 15 2015 2015 HOH HOH A . 
C 3 HOH 16 2016 2016 HOH HOH A . 
C 3 HOH 17 2017 2017 HOH HOH A . 
C 3 HOH 18 2018 2018 HOH HOH A . 
C 3 HOH 19 2019 2019 HOH HOH A . 
C 3 HOH 20 2020 2020 HOH HOH A . 
C 3 HOH 21 2021 2021 HOH HOH A . 
C 3 HOH 22 2022 2022 HOH HOH A . 
C 3 HOH 23 2023 2023 HOH HOH A . 
C 3 HOH 24 2024 2024 HOH HOH A . 
C 3 HOH 25 2025 2025 HOH HOH A . 
C 3 HOH 26 2026 2026 HOH HOH A . 
C 3 HOH 27 2027 2027 HOH HOH A . 
C 3 HOH 28 2028 2028 HOH HOH A . 
C 3 HOH 29 2029 2029 HOH HOH A . 
C 3 HOH 30 2030 2030 HOH HOH A . 
C 3 HOH 31 2031 2031 HOH HOH A . 
C 3 HOH 32 2032 2032 HOH HOH A . 
C 3 HOH 33 2033 2033 HOH HOH A . 
C 3 HOH 34 2034 2034 HOH HOH A . 
C 3 HOH 35 2035 2035 HOH HOH A . 
C 3 HOH 36 2036 2036 HOH HOH A . 
C 3 HOH 37 2037 2037 HOH HOH A . 
C 3 HOH 38 2038 2038 HOH HOH A . 
C 3 HOH 39 2039 2039 HOH HOH A . 
C 3 HOH 40 2040 2040 HOH HOH A . 
C 3 HOH 41 2041 2041 HOH HOH A . 
C 3 HOH 42 2042 2042 HOH HOH A . 
C 3 HOH 43 2043 2043 HOH HOH A . 
C 3 HOH 44 2044 2044 HOH HOH A . 
C 3 HOH 45 2045 2045 HOH HOH A . 
C 3 HOH 46 2046 2046 HOH HOH A . 
C 3 HOH 47 2047 2047 HOH HOH A . 
C 3 HOH 48 2048 2048 HOH HOH A . 
C 3 HOH 49 2049 2049 HOH HOH A . 
C 3 HOH 50 2050 2050 HOH HOH A . 
C 3 HOH 51 2051 2051 HOH HOH A . 
C 3 HOH 52 2052 2052 HOH HOH A . 
C 3 HOH 53 2053 2053 HOH HOH A . 
C 3 HOH 54 2054 2054 HOH HOH A . 
C 3 HOH 55 2055 2055 HOH HOH A . 
C 3 HOH 56 2056 2056 HOH HOH A . 
C 3 HOH 57 2057 2057 HOH HOH A . 
C 3 HOH 58 2058 2058 HOH HOH A . 
C 3 HOH 59 2059 2059 HOH HOH A . 
C 3 HOH 60 2060 2060 HOH HOH A . 
C 3 HOH 61 2061 2061 HOH HOH A . 
C 3 HOH 62 2062 2062 HOH HOH A . 
C 3 HOH 63 2063 2063 HOH HOH A . 
C 3 HOH 64 2064 2064 HOH HOH A . 
C 3 HOH 65 2065 2065 HOH HOH A . 
C 3 HOH 66 2066 2066 HOH HOH A . 
C 3 HOH 67 2067 2067 HOH HOH A . 
C 3 HOH 68 2068 2068 HOH HOH A . 
C 3 HOH 69 2069 2069 HOH HOH A . 
C 3 HOH 70 2070 2070 HOH HOH A . 
C 3 HOH 71 2071 2071 HOH HOH A . 
C 3 HOH 72 2072 2072 HOH HOH A . 
C 3 HOH 73 2073 2073 HOH HOH A . 
C 3 HOH 74 2074 2074 HOH HOH A . 
C 3 HOH 75 2075 2075 HOH HOH A . 
C 3 HOH 76 2076 2076 HOH HOH A . 
C 3 HOH 77 2077 2077 HOH HOH A . 
C 3 HOH 78 2078 2078 HOH HOH A . 
C 3 HOH 79 2079 2079 HOH HOH A . 
C 3 HOH 80 2080 2080 HOH HOH A . 
C 3 HOH 81 2081 2081 HOH HOH A . 
C 3 HOH 82 2082 2082 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9220  ? 
1 MORE         -57.9 ? 
1 'SSA (A^2)'  26150 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -71.1900000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2019 ? C HOH . 
2 1 A HOH 2067 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-07-09 
2 'Structure model' 1 1 2014-09-03 
3 'Structure model' 1 2 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Derived calculations'     
4 3 'Structure model' 'Experimental preparation' 
5 3 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow   
2 3 'Structure model' pdbx_database_status 
3 3 'Structure model' reflns_shell         
4 3 'Structure model' struct_conn          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'           
2 3 'Structure model' '_exptl_crystal_grow.temp'             
3 3 'Structure model' '_pdbx_database_status.status_code_sf' 
4 3 'Structure model' '_reflns_shell.Rmerge_I_obs'           
5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -12.9660 
_pdbx_refine_tls.origin_y         12.7945 
_pdbx_refine_tls.origin_z         -21.2275 
_pdbx_refine_tls.T[1][1]          -0.1058 
_pdbx_refine_tls.T[2][2]          0.7688 
_pdbx_refine_tls.T[3][3]          0.2887 
_pdbx_refine_tls.T[1][2]          0.3358 
_pdbx_refine_tls.T[1][3]          -0.2427 
_pdbx_refine_tls.T[2][3]          -0.1325 
_pdbx_refine_tls.L[1][1]          0.6710 
_pdbx_refine_tls.L[2][2]          0.1132 
_pdbx_refine_tls.L[3][3]          0.3430 
_pdbx_refine_tls.L[1][2]          0.0914 
_pdbx_refine_tls.L[1][3]          -0.1038 
_pdbx_refine_tls.L[2][3]          0.0829 
_pdbx_refine_tls.S[1][1]          -0.1702 
_pdbx_refine_tls.S[1][2]          -0.7873 
_pdbx_refine_tls.S[1][3]          -0.0124 
_pdbx_refine_tls.S[2][1]          0.0425 
_pdbx_refine_tls.S[2][2]          0.0150 
_pdbx_refine_tls.S[2][3]          0.1310 
_pdbx_refine_tls.S[3][1]          0.4137 
_pdbx_refine_tls.S[3][2]          0.2724 
_pdbx_refine_tls.S[3][3]          -0.1335 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ALL 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 ? ? ? ? 
XDS    'data reduction' .                 ? 2 ? ? ? ? 
SCALA  'data scaling'   .                 ? 3 ? ? ? ? 
PHASER phasing          .                 ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             4CBS 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;PYRIDOXAL-5'-PHOSPHATE (PLP): SCHIFF BASE WITH K209
;
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A PRO 73   ? ? O A HOH 2029 ? ? 2.09 
2 1 O   A GLN 198  ? ? O A HOH 2052 ? ? 2.09 
3 1 OG1 A THR 322  ? ? O A HOH 2076 ? ? 2.14 
4 1 O   A HOH 2070 ? ? O A HOH 2071 ? ? 2.17 
5 1 OD1 A ASN 212  ? ? O A HOH 2056 ? ? 2.18 
6 1 O   A VAL 67   ? ? O A HOH 2034 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 2022 ? ? 1_555 O A HOH 2079 ? ? 8_554 2.13 
2 1 O A HOH 2006 ? ? 1_555 O A HOH 2028 ? ? 8_554 2.13 
3 1 O A HOH 2039 ? ? 1_555 O A HOH 2057 ? ? 8_554 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 69  ? ? 63.52   64.26   
2 1 ASN A 72  ? ? -39.68  121.65  
3 1 HIS A 155 ? ? -63.33  -74.68  
4 1 LEU A 166 ? ? 66.53   -38.91  
5 1 LYS A 177 ? ? 39.45   42.06   
6 1 THR A 191 ? ? -173.23 145.73  
7 1 LYS A 209 ? ? -97.78  -118.86 
8 1 HIS A 261 ? ? -126.82 -65.83  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A ALA 2   ? A ALA 2   
3 1 Y 1 A SER 3   ? A SER 3   
4 1 Y 1 A LYS 389 ? A LYS 389 
5 1 Y 1 A LYS 390 ? A LYS 390 
6 1 Y 1 A LYS 391 ? A LYS 391 
7 1 Y 1 A LEU 392 ? A LEU 392 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 water                    HOH 
#