data_4CYM
# 
_entry.id   4CYM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4CYM         
PDBE  EBI-60304    
WWPDB D_1290060304 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4CZ2 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'COMPLEX OF HUMAN VARP-ANKRD1 WITH RAB32-GPPCP. SELENOMET DERIVATIVE.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CYM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Perez-Dorado, I.' 1 
'Schaefer, I.B.'   2 
'McCoy, A.J.'      3 
'Owen, D.J.'       4 
'Evans, P.R.'      5 
# 
_citation.id                        primary 
_citation.title                     
'Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.' 
_citation.journal_abbrev            Dev.Cell 
_citation.journal_volume            29 
_citation.page_first                591 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1534-5807 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24856514 
_citation.pdbx_database_id_DOI      10.1016/J.DEVCEL.2014.04.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hesketh, G.G.'    1  
primary 'Perez-Dorado, I.' 2  
primary 'Jackson, L.P.'    3  
primary 'Wartosch, L.'     4  
primary 'Schefer, I.B.'    5  
primary 'Gray, S.R.'       6  
primary 'Mccoy, A.J.'      7  
primary 'Zeldin, O.B.'     8  
primary 'Garman, E.F.'     9  
primary 'Harbour, M.E.'    10 
primary 'Evans, P.R.'      11 
primary 'Seaman, M.N.'     12 
primary 'Luzio, J.P.'      13 
primary 'Owen, D.J.'       14 
# 
_cell.entry_id           4CYM 
_cell.length_a           144.445 
_cell.length_b           144.445 
_cell.length_c           135.680 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CYM 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RAS-RELATED PROTEIN RAB-32'                   25425.762 3   3.6.5.2 YES ? ? 
2 polymer     man 'ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27'  22312.137 3   ?       ?   
'FIRST ANKYRIN REPEAT-CONTAINING DOMAIN, RESIDUES 450-640' ? 
3 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' 521.208   3   ?       ?   ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                24.305    3   ?       ?   ? ? 
5 water       nat water                                          18.015    131 ?       ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 RAB32                                                          
2 'VPS9-DOMAIN ANKYRIN REPEAT PROTEIN, VPS9 DOMAIN-CONTAINING P' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPLGSMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLV
RLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSP
SQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
;
;GPLGSMAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLV
RLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSP
SQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
;
A,B,C ? 
2 'polypeptide(L)' no no 
;GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAE
VQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLK
CALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDHHHHHH
;
;GPLGSMDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAE
VQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLK
CALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDHHHHHH
;
D,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ALA n 
1 8   GLY n 
1 9   GLY n 
1 10  GLY n 
1 11  ALA n 
1 12  GLY n 
1 13  ASP n 
1 14  PRO n 
1 15  GLY n 
1 16  LEU n 
1 17  GLY n 
1 18  ALA n 
1 19  ALA n 
1 20  ALA n 
1 21  ALA n 
1 22  PRO n 
1 23  ALA n 
1 24  PRO n 
1 25  GLU n 
1 26  THR n 
1 27  ARG n 
1 28  GLU n 
1 29  HIS n 
1 30  LEU n 
1 31  PHE n 
1 32  LYS n 
1 33  VAL n 
1 34  LEU n 
1 35  VAL n 
1 36  ILE n 
1 37  GLY n 
1 38  GLU n 
1 39  LEU n 
1 40  GLY n 
1 41  VAL n 
1 42  GLY n 
1 43  LYS n 
1 44  THR n 
1 45  SER n 
1 46  ILE n 
1 47  ILE n 
1 48  LYS n 
1 49  ARG n 
1 50  TYR n 
1 51  VAL n 
1 52  HIS n 
1 53  GLN n 
1 54  LEU n 
1 55  PHE n 
1 56  SER n 
1 57  GLN n 
1 58  HIS n 
1 59  TYR n 
1 60  ARG n 
1 61  ALA n 
1 62  THR n 
1 63  ILE n 
1 64  GLY n 
1 65  VAL n 
1 66  ASP n 
1 67  PHE n 
1 68  ALA n 
1 69  LEU n 
1 70  LYS n 
1 71  VAL n 
1 72  LEU n 
1 73  ASN n 
1 74  TRP n 
1 75  ASP n 
1 76  SER n 
1 77  ARG n 
1 78  THR n 
1 79  LEU n 
1 80  VAL n 
1 81  ARG n 
1 82  LEU n 
1 83  GLN n 
1 84  LEU n 
1 85  TRP n 
1 86  ASP n 
1 87  ILE n 
1 88  ALA n 
1 89  GLY n 
1 90  LEU n 
1 91  GLU n 
1 92  ARG n 
1 93  PHE n 
1 94  GLY n 
1 95  ASN n 
1 96  MET n 
1 97  THR n 
1 98  ARG n 
1 99  VAL n 
1 100 TYR n 
1 101 TYR n 
1 102 LYS n 
1 103 GLU n 
1 104 ALA n 
1 105 VAL n 
1 106 GLY n 
1 107 ALA n 
1 108 PHE n 
1 109 VAL n 
1 110 VAL n 
1 111 PHE n 
1 112 ASP n 
1 113 ILE n 
1 114 SER n 
1 115 ARG n 
1 116 SER n 
1 117 SER n 
1 118 THR n 
1 119 PHE n 
1 120 GLU n 
1 121 ALA n 
1 122 VAL n 
1 123 LEU n 
1 124 LYS n 
1 125 TRP n 
1 126 LYS n 
1 127 SER n 
1 128 ASP n 
1 129 LEU n 
1 130 ASP n 
1 131 SER n 
1 132 LYS n 
1 133 VAL n 
1 134 HIS n 
1 135 LEU n 
1 136 PRO n 
1 137 ASN n 
1 138 GLY n 
1 139 SER n 
1 140 PRO n 
1 141 ILE n 
1 142 PRO n 
1 143 ALA n 
1 144 VAL n 
1 145 LEU n 
1 146 LEU n 
1 147 ALA n 
1 148 ASN n 
1 149 LYS n 
1 150 CYS n 
1 151 ASP n 
1 152 GLN n 
1 153 ASN n 
1 154 LYS n 
1 155 ASP n 
1 156 SER n 
1 157 SER n 
1 158 GLN n 
1 159 SER n 
1 160 PRO n 
1 161 SER n 
1 162 GLN n 
1 163 VAL n 
1 164 ASP n 
1 165 GLN n 
1 166 PHE n 
1 167 CYS n 
1 168 LYS n 
1 169 GLU n 
1 170 HIS n 
1 171 GLY n 
1 172 PHE n 
1 173 ALA n 
1 174 GLY n 
1 175 TRP n 
1 176 PHE n 
1 177 GLU n 
1 178 THR n 
1 179 SER n 
1 180 ALA n 
1 181 LYS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 ASN n 
1 186 ILE n 
1 187 GLU n 
1 188 GLU n 
1 189 ALA n 
1 190 ALA n 
1 191 ARG n 
1 192 PHE n 
1 193 LEU n 
1 194 VAL n 
1 195 GLU n 
1 196 LYS n 
1 197 ILE n 
1 198 LEU n 
1 199 VAL n 
1 200 ASN n 
1 201 HIS n 
1 202 GLN n 
1 203 SER n 
1 204 PHE n 
1 205 PRO n 
1 206 ASN n 
1 207 GLU n 
1 208 GLU n 
1 209 ASN n 
1 210 ASP n 
1 211 VAL n 
1 212 ASP n 
1 213 LYS n 
1 214 ILE n 
1 215 LYS n 
1 216 LEU n 
1 217 ASP n 
1 218 GLN n 
1 219 GLU n 
1 220 THR n 
1 221 LEU n 
1 222 ARG n 
1 223 ALA n 
1 224 GLU n 
1 225 ASN n 
1 226 LYS n 
1 227 SER n 
1 228 GLN n 
1 229 CYS n 
1 230 CYS n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   MET n 
2 7   ASP n 
2 8   PRO n 
2 9   SER n 
2 10  VAL n 
2 11  VAL n 
2 12  THR n 
2 13  PRO n 
2 14  PHE n 
2 15  SER n 
2 16  ARG n 
2 17  ASP n 
2 18  ASP n 
2 19  ARG n 
2 20  GLY n 
2 21  HIS n 
2 22  THR n 
2 23  PRO n 
2 24  LEU n 
2 25  HIS n 
2 26  VAL n 
2 27  ALA n 
2 28  ALA n 
2 29  VAL n 
2 30  CYS n 
2 31  GLY n 
2 32  GLN n 
2 33  ALA n 
2 34  SER n 
2 35  LEU n 
2 36  ILE n 
2 37  ASP n 
2 38  LEU n 
2 39  LEU n 
2 40  VAL n 
2 41  SER n 
2 42  LYS n 
2 43  GLY n 
2 44  ALA n 
2 45  MET n 
2 46  VAL n 
2 47  ASN n 
2 48  ALA n 
2 49  THR n 
2 50  ASP n 
2 51  TYR n 
2 52  HIS n 
2 53  GLY n 
2 54  ALA n 
2 55  THR n 
2 56  PRO n 
2 57  LEU n 
2 58  HIS n 
2 59  LEU n 
2 60  ALA n 
2 61  CYS n 
2 62  GLN n 
2 63  LYS n 
2 64  GLY n 
2 65  TYR n 
2 66  GLN n 
2 67  SER n 
2 68  VAL n 
2 69  THR n 
2 70  LEU n 
2 71  LEU n 
2 72  LEU n 
2 73  LEU n 
2 74  HIS n 
2 75  TYR n 
2 76  LYS n 
2 77  ALA n 
2 78  SER n 
2 79  ALA n 
2 80  GLU n 
2 81  VAL n 
2 82  GLN n 
2 83  ASP n 
2 84  ASN n 
2 85  ASN n 
2 86  GLY n 
2 87  ASN n 
2 88  THR n 
2 89  PRO n 
2 90  LEU n 
2 91  HIS n 
2 92  LEU n 
2 93  ALA n 
2 94  CYS n 
2 95  THR n 
2 96  TYR n 
2 97  GLY n 
2 98  HIS n 
2 99  GLU n 
2 100 ASP n 
2 101 CYS n 
2 102 VAL n 
2 103 LYS n 
2 104 ALA n 
2 105 LEU n 
2 106 VAL n 
2 107 TYR n 
2 108 TYR n 
2 109 ASP n 
2 110 VAL n 
2 111 GLU n 
2 112 SER n 
2 113 CYS n 
2 114 ARG n 
2 115 LEU n 
2 116 ASP n 
2 117 ILE n 
2 118 GLY n 
2 119 ASN n 
2 120 GLU n 
2 121 LYS n 
2 122 GLY n 
2 123 ASP n 
2 124 THR n 
2 125 PRO n 
2 126 LEU n 
2 127 HIS n 
2 128 ILE n 
2 129 ALA n 
2 130 ALA n 
2 131 ARG n 
2 132 TRP n 
2 133 GLY n 
2 134 TYR n 
2 135 GLN n 
2 136 GLY n 
2 137 VAL n 
2 138 ILE n 
2 139 GLU n 
2 140 THR n 
2 141 LEU n 
2 142 LEU n 
2 143 GLN n 
2 144 ASN n 
2 145 GLY n 
2 146 ALA n 
2 147 SER n 
2 148 THR n 
2 149 GLU n 
2 150 ILE n 
2 151 GLN n 
2 152 ASN n 
2 153 ARG n 
2 154 LEU n 
2 155 LYS n 
2 156 GLU n 
2 157 THR n 
2 158 PRO n 
2 159 LEU n 
2 160 LYS n 
2 161 CYS n 
2 162 ALA n 
2 163 LEU n 
2 164 ASN n 
2 165 SER n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 SER n 
2 170 VAL n 
2 171 MET n 
2 172 GLU n 
2 173 ALA n 
2 174 TYR n 
2 175 HIS n 
2 176 LEU n 
2 177 SER n 
2 178 PHE n 
2 179 GLU n 
2 180 ARG n 
2 181 ARG n 
2 182 GLN n 
2 183 LYS n 
2 184 SER n 
2 185 SER n 
2 186 GLU n 
2 187 ALA n 
2 188 PRO n 
2 189 VAL n 
2 190 GLN n 
2 191 SER n 
2 192 PRO n 
2 193 GLN n 
2 194 ARG n 
2 195 SER n 
2 196 VAL n 
2 197 ASP n 
2 198 HIS n 
2 199 HIS n 
2 200 HIS n 
2 201 HIS n 
2 202 HIS n 
2 203 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' 
'ROSETTA 2' ? ? ? ? ? ? PLASMID ? ? ? PGEX-6P-1 ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' 
'ROSETTA 2' ? ? ? ? ? ? PLASMID ? ? ? PGEX-6P-1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RAB32_HUMAN 1 ? ? Q13637 ? 
2 UNP ANR27_HUMAN 2 ? ? Q96NW4 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4CYM A 6 ? 230 ? Q13637 1   ? 225 ? 1   225 
2 1 4CYM B 6 ? 230 ? Q13637 1   ? 225 ? 1   225 
3 1 4CYM C 6 ? 230 ? Q13637 1   ? 225 ? 1   225 
4 2 4CYM D 7 ? 197 ? Q96NW4 450 ? 640 ? 450 640 
5 2 4CYM E 7 ? 197 ? Q96NW4 450 ? 640 ? 450 640 
6 2 4CYM F 7 ? 197 ? Q96NW4 450 ? 640 ? 450 640 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CYM GLY A 1   ? UNP Q13637 ?   ?  'expression tag'      -4  1  
1 4CYM PRO A 2   ? UNP Q13637 ?   ?  'expression tag'      -3  2  
1 4CYM LEU A 3   ? UNP Q13637 ?   ?  'expression tag'      -2  3  
1 4CYM GLY A 4   ? UNP Q13637 ?   ?  'expression tag'      -1  4  
1 4CYM SER A 5   ? UNP Q13637 ?   ?  'expression tag'      0   5  
1 4CYM LEU A 90  ? UNP Q13637 GLN 85 'engineered mutation' 85  6  
2 4CYM GLY B 1   ? UNP Q13637 ?   ?  'expression tag'      -4  7  
2 4CYM PRO B 2   ? UNP Q13637 ?   ?  'expression tag'      -3  8  
2 4CYM LEU B 3   ? UNP Q13637 ?   ?  'expression tag'      -2  9  
2 4CYM GLY B 4   ? UNP Q13637 ?   ?  'expression tag'      -1  10 
2 4CYM SER B 5   ? UNP Q13637 ?   ?  'expression tag'      0   11 
2 4CYM LEU B 90  ? UNP Q13637 GLN 85 'engineered mutation' 85  12 
3 4CYM GLY C 1   ? UNP Q13637 ?   ?  'expression tag'      -4  13 
3 4CYM PRO C 2   ? UNP Q13637 ?   ?  'expression tag'      -3  14 
3 4CYM LEU C 3   ? UNP Q13637 ?   ?  'expression tag'      -2  15 
3 4CYM GLY C 4   ? UNP Q13637 ?   ?  'expression tag'      -1  16 
3 4CYM SER C 5   ? UNP Q13637 ?   ?  'expression tag'      0   17 
3 4CYM LEU C 90  ? UNP Q13637 GLN 85 'engineered mutation' 85  18 
4 4CYM GLY D 1   ? UNP Q96NW4 ?   ?  'expression tag'      444 19 
4 4CYM PRO D 2   ? UNP Q96NW4 ?   ?  'expression tag'      445 20 
4 4CYM LEU D 3   ? UNP Q96NW4 ?   ?  'expression tag'      446 21 
4 4CYM GLY D 4   ? UNP Q96NW4 ?   ?  'expression tag'      447 22 
4 4CYM SER D 5   ? UNP Q96NW4 ?   ?  'expression tag'      448 23 
4 4CYM MET D 6   ? UNP Q96NW4 ?   ?  'expression tag'      449 24 
4 4CYM HIS D 198 ? UNP Q96NW4 ?   ?  'expression tag'      641 25 
4 4CYM HIS D 199 ? UNP Q96NW4 ?   ?  'expression tag'      642 26 
4 4CYM HIS D 200 ? UNP Q96NW4 ?   ?  'expression tag'      643 27 
4 4CYM HIS D 201 ? UNP Q96NW4 ?   ?  'expression tag'      644 28 
4 4CYM HIS D 202 ? UNP Q96NW4 ?   ?  'expression tag'      645 29 
4 4CYM HIS D 203 ? UNP Q96NW4 ?   ?  'expression tag'      646 30 
5 4CYM GLY E 1   ? UNP Q96NW4 ?   ?  'expression tag'      444 31 
5 4CYM PRO E 2   ? UNP Q96NW4 ?   ?  'expression tag'      445 32 
5 4CYM LEU E 3   ? UNP Q96NW4 ?   ?  'expression tag'      446 33 
5 4CYM GLY E 4   ? UNP Q96NW4 ?   ?  'expression tag'      447 34 
5 4CYM SER E 5   ? UNP Q96NW4 ?   ?  'expression tag'      448 35 
5 4CYM MET E 6   ? UNP Q96NW4 ?   ?  'expression tag'      449 36 
5 4CYM HIS E 198 ? UNP Q96NW4 ?   ?  'expression tag'      641 37 
5 4CYM HIS E 199 ? UNP Q96NW4 ?   ?  'expression tag'      642 38 
5 4CYM HIS E 200 ? UNP Q96NW4 ?   ?  'expression tag'      643 39 
5 4CYM HIS E 201 ? UNP Q96NW4 ?   ?  'expression tag'      644 40 
5 4CYM HIS E 202 ? UNP Q96NW4 ?   ?  'expression tag'      645 41 
5 4CYM HIS E 203 ? UNP Q96NW4 ?   ?  'expression tag'      646 42 
6 4CYM GLY F 1   ? UNP Q96NW4 ?   ?  'expression tag'      444 43 
6 4CYM PRO F 2   ? UNP Q96NW4 ?   ?  'expression tag'      445 44 
6 4CYM LEU F 3   ? UNP Q96NW4 ?   ?  'expression tag'      446 45 
6 4CYM GLY F 4   ? UNP Q96NW4 ?   ?  'expression tag'      447 46 
6 4CYM SER F 5   ? UNP Q96NW4 ?   ?  'expression tag'      448 47 
6 4CYM MET F 6   ? UNP Q96NW4 ?   ?  'expression tag'      449 48 
6 4CYM HIS F 198 ? UNP Q96NW4 ?   ?  'expression tag'      641 49 
6 4CYM HIS F 199 ? UNP Q96NW4 ?   ?  'expression tag'      642 50 
6 4CYM HIS F 200 ? UNP Q96NW4 ?   ?  'expression tag'      643 51 
6 4CYM HIS F 201 ? UNP Q96NW4 ?   ?  'expression tag'      644 52 
6 4CYM HIS F 202 ? UNP Q96NW4 ?   ?  'expression tag'      645 53 
6 4CYM HIS F 203 ? UNP Q96NW4 ?   ?  'expression tag'      646 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ? 'C3 H7 N O2 S'      121.158 
GCP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' ? 'C11 H18 N5 O13 P3' 521.208 
GLN 'L-peptide linking' y GLUTAMINE                                      ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4CYM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.82 
_exptl_crystal.density_percent_sol   56.3 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-02-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             0.9763 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CYM 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             72.22 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   40077 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.24 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.91 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           1.50 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.90 
_reflns_shell.pdbx_redundancy        5.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CYM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     38004 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             125.09 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.33 
_refine.ls_R_factor_obs                          0.19466 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19205 
_refine.ls_R_factor_R_free                       0.24565 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2011 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               74.856 
_refine.aniso_B[1][1]                            1.40 
_refine.aniso_B[2][2]                            1.40 
_refine.aniso_B[3][3]                            -4.53 
_refine.aniso_B[1][2]                            0.70 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY MISSING RESIDUES. RESIDUES 1-21 AND 199-225 OF BOTH CHAINS A AND C. RESIDUES 1-22 AND 198-225 OF CHAIN B. RESIDUES 450-451 AND 619-640 OF CHAIN D. RESIDUES 450-452 AND 618- 640 OF CHAIN E. RESIDUES 450-452 AND 619-640 OF CHAIN F. RESIDUES FROM -5 TO 0. CTERMINAL 6HIS TAGS IN CHAINS D, E, AND F.
;
_refine.pdbx_starting_model                      'PDB ENTRIES 1YHN AND 4B93' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.717 
_refine.pdbx_overall_ESU_R_Free                  0.329 
_refine.overall_SU_ML                            0.291 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             16.544 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8052 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         99 
_refine_hist.number_atoms_solvent             131 
_refine_hist.number_atoms_total               8282 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        125.09 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.019  ? 8340  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 7915  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.539  1.958  ? 11311 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.076  3.000  ? 18165 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.075  0.200  ? 1276  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 9380  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.004  0.020  ? 1949  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  5.212  7.226  ? 4102  'X-RAY DIFFRACTION' ? 
r_mcbond_other               5.200  7.226  ? 4101  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 8.083  10.823 ? 5117  'X-RAY DIFFRACTION' ? 
r_mcangle_other              8.083  10.824 ? 5118  'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.522  7.792  ? 4237  'X-RAY DIFFRACTION' ? 
r_scbond_other               5.522  7.794  ? 4238  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              8.749  11.466 ? 6195  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       11.743 73.273 ? 7167  'X-RAY DIFFRACTION' ? 
r_long_range_B_other         11.745 73.290 ? 7165  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 10324 0.10 0.05 'interatomic distance' 1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 10324 0.10 0.05 'interatomic distance' 1 2  'X-RAY DIFFRACTION' ? ? ? 
1 A 10711 0.09 0.05 'interatomic distance' 2 3  'X-RAY DIFFRACTION' ? ? ? 
2 C 10711 0.09 0.05 'interatomic distance' 2 4  'X-RAY DIFFRACTION' ? ? ? 
1 B 10442 0.10 0.05 'interatomic distance' 3 5  'X-RAY DIFFRACTION' ? ? ? 
2 C 10442 0.10 0.05 'interatomic distance' 3 6  'X-RAY DIFFRACTION' ? ? ? 
1 D 9375  0.10 0.05 'interatomic distance' 4 7  'X-RAY DIFFRACTION' ? ? ? 
2 E 9375  0.10 0.05 'interatomic distance' 4 8  'X-RAY DIFFRACTION' ? ? ? 
1 D 9415  0.11 0.05 'interatomic distance' 5 9  'X-RAY DIFFRACTION' ? ? ? 
2 F 9415  0.11 0.05 'interatomic distance' 5 10 'X-RAY DIFFRACTION' ? ? ? 
1 E 9417  0.11 0.05 'interatomic distance' 6 11 'X-RAY DIFFRACTION' ? ? ? 
2 F 9417  0.11 0.05 'interatomic distance' 6 12 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             2628 
_refine_ls_shell.R_factor_R_work                  0.380 
_refine_ls_shell.percent_reflns_obs               91.61 
_refine_ls_shell.R_factor_R_free                  0.437 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             136 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
1 A 2 
2 C 2 
1 B 3 
2 C 3 
1 D 4 
2 E 4 
1 D 5 
2 F 5 
1 E 6 
2 F 6 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 23  A 196 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 23  B 196 0 0 ? ? ? ? ? ? ? ? 1 ? 
1 A 22  A 198 0 0 ? ? ? ? ? ? ? ? 2 ? 
2 C 22  C 198 0 0 ? ? ? ? ? ? ? ? 2 ? 
1 B 23  B 196 0 0 ? ? ? ? ? ? ? ? 3 ? 
2 C 23  C 196 0 0 ? ? ? ? ? ? ? ? 3 ? 
1 D 453 D 616 0 0 ? ? ? ? ? ? ? ? 4 ? 
2 E 453 E 616 0 0 ? ? ? ? ? ? ? ? 4 ? 
1 D 453 D 617 0 0 ? ? ? ? ? ? ? ? 5 ? 
2 F 453 F 617 0 0 ? ? ? ? ? ? ? ? 5 ? 
1 E 453 E 616 0 0 ? ? ? ? ? ? ? ? 6 ? 
2 F 453 F 616 0 0 ? ? ? ? ? ? ? ? 6 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
# 
_struct.entry_id                  4CYM 
_struct.title                     'Complex of human VARP-ANKRD1 with Rab32-GppCp' 
_struct.pdbx_descriptor           'RAS-RELATED PROTEIN RAB-32 (E.C.3.6.5.2), ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 27' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CYM 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'TRANSPORT PROTEIN, VARP, RAB-EFFECTOR, RAB, ENDOSOME, VESICLE TRAFFICKING, MELANOSOME BIOGENESIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 42  ? GLN A 53  ? GLY A 37  GLN A 48  1 ? 12 
HELX_P HELX_P2  2  GLY A 89  ? GLY A 94  ? GLY A 84  GLY A 89  5 ? 6  
HELX_P HELX_P3  3  MET A 96  ? LYS A 102 ? MET A 91  LYS A 97  1 ? 7  
HELX_P HELX_P4  4  ARG A 115 ? ALA A 121 ? ARG A 110 ALA A 116 1 ? 7  
HELX_P HELX_P5  5  ALA A 121 ? VAL A 133 ? ALA A 116 VAL A 128 1 ? 13 
HELX_P HELX_P6  6  SER A 159 ? HIS A 170 ? SER A 154 HIS A 165 1 ? 12 
HELX_P HELX_P7  7  ASN A 185 ? HIS A 201 ? ASN A 180 HIS A 196 1 ? 17 
HELX_P HELX_P8  8  GLY B 42  ? GLN B 53  ? GLY B 37  GLN B 48  1 ? 12 
HELX_P HELX_P9  9  GLY B 89  ? GLY B 94  ? GLY B 84  GLY B 89  5 ? 6  
HELX_P HELX_P10 10 MET B 96  ? LYS B 102 ? MET B 91  LYS B 97  1 ? 7  
HELX_P HELX_P11 11 ARG B 115 ? ALA B 121 ? ARG B 110 ALA B 116 1 ? 7  
HELX_P HELX_P12 12 ALA B 121 ? VAL B 133 ? ALA B 116 VAL B 128 1 ? 13 
HELX_P HELX_P13 13 SER B 159 ? HIS B 170 ? SER B 154 HIS B 165 1 ? 12 
HELX_P HELX_P14 14 ASN B 185 ? HIS B 201 ? ASN B 180 HIS B 196 1 ? 17 
HELX_P HELX_P15 15 GLY C 42  ? GLN C 53  ? GLY C 37  GLN C 48  1 ? 12 
HELX_P HELX_P16 16 GLY C 89  ? GLY C 94  ? GLY C 84  GLY C 89  5 ? 6  
HELX_P HELX_P17 17 MET C 96  ? LYS C 102 ? MET C 91  LYS C 97  1 ? 7  
HELX_P HELX_P18 18 ARG C 115 ? ALA C 121 ? ARG C 110 ALA C 116 1 ? 7  
HELX_P HELX_P19 19 ALA C 121 ? VAL C 133 ? ALA C 116 VAL C 128 1 ? 13 
HELX_P HELX_P20 20 SER C 159 ? HIS C 170 ? SER C 154 HIS C 165 1 ? 12 
HELX_P HELX_P21 21 ASN C 185 ? HIS C 201 ? ASN C 180 HIS C 196 1 ? 17 
HELX_P HELX_P22 22 THR D 22  ? GLY D 31  ? THR D 465 GLY D 474 1 ? 10 
HELX_P HELX_P23 23 GLN D 32  ? LYS D 42  ? GLN D 475 LYS D 485 1 ? 11 
HELX_P HELX_P24 24 THR D 55  ? GLY D 64  ? THR D 498 GLY D 507 1 ? 10 
HELX_P HELX_P25 25 TYR D 65  ? TYR D 75  ? TYR D 508 TYR D 518 1 ? 11 
HELX_P HELX_P26 26 THR D 88  ? TYR D 96  ? THR D 531 TYR D 539 1 ? 9  
HELX_P HELX_P27 27 HIS D 98  ? ASP D 109 ? HIS D 541 ASP D 552 1 ? 12 
HELX_P HELX_P28 28 THR D 124 ? TRP D 132 ? THR D 567 TRP D 575 1 ? 9  
HELX_P HELX_P29 29 TYR D 134 ? ASN D 144 ? TYR D 577 ASN D 587 1 ? 11 
HELX_P HELX_P30 30 THR D 157 ? ALA D 162 ? THR D 600 ALA D 605 1 ? 6  
HELX_P HELX_P31 31 ASN D 164 ? ALA D 173 ? ASN D 607 ALA D 616 1 ? 10 
HELX_P HELX_P32 32 THR E 22  ? GLY E 31  ? THR E 465 GLY E 474 1 ? 10 
HELX_P HELX_P33 33 GLN E 32  ? LYS E 42  ? GLN E 475 LYS E 485 1 ? 11 
HELX_P HELX_P34 34 THR E 55  ? GLY E 64  ? THR E 498 GLY E 507 1 ? 10 
HELX_P HELX_P35 35 TYR E 65  ? TYR E 75  ? TYR E 508 TYR E 518 1 ? 11 
HELX_P HELX_P36 36 THR E 88  ? TYR E 96  ? THR E 531 TYR E 539 1 ? 9  
HELX_P HELX_P37 37 HIS E 98  ? ASP E 109 ? HIS E 541 ASP E 552 1 ? 12 
HELX_P HELX_P38 38 THR E 124 ? TRP E 132 ? THR E 567 TRP E 575 1 ? 9  
HELX_P HELX_P39 39 TYR E 134 ? ASN E 144 ? TYR E 577 ASN E 587 1 ? 11 
HELX_P HELX_P40 40 PRO E 158 ? ALA E 162 ? PRO E 601 ALA E 605 5 ? 5  
HELX_P HELX_P41 41 ASN E 164 ? ALA E 173 ? ASN E 607 ALA E 616 1 ? 10 
HELX_P HELX_P42 42 ASP F 17  ? HIS F 21  ? ASP F 460 HIS F 464 5 ? 5  
HELX_P HELX_P43 43 THR F 22  ? GLY F 31  ? THR F 465 GLY F 474 1 ? 10 
HELX_P HELX_P44 44 GLN F 32  ? LYS F 42  ? GLN F 475 LYS F 485 1 ? 11 
HELX_P HELX_P45 45 THR F 55  ? GLY F 64  ? THR F 498 GLY F 507 1 ? 10 
HELX_P HELX_P46 46 TYR F 65  ? TYR F 75  ? TYR F 508 TYR F 518 1 ? 11 
HELX_P HELX_P47 47 THR F 88  ? TYR F 96  ? THR F 531 TYR F 539 1 ? 9  
HELX_P HELX_P48 48 HIS F 98  ? ASP F 109 ? HIS F 541 ASP F 552 1 ? 12 
HELX_P HELX_P49 49 THR F 124 ? TRP F 132 ? THR F 567 TRP F 575 1 ? 9  
HELX_P HELX_P50 50 TYR F 134 ? ASN F 144 ? TYR F 577 ASN F 587 1 ? 11 
HELX_P HELX_P51 51 PRO F 158 ? ALA F 162 ? PRO F 601 ALA F 605 5 ? 5  
HELX_P HELX_P52 52 ASN F 164 ? ALA F 173 ? ASN F 607 ALA F 616 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G GCP . O3G ? ? ? 1_555 H MG  .  MG  ? ? A GCP 1198 A MG  1199 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc2  metalc ? ? G GCP . O2B ? ? ? 1_555 H MG  .  MG  ? ? A GCP 1198 A MG  1199 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc3  metalc ? ? H MG  . MG  ? ? ? 1_555 A THR 44 OG1 ? ? A MG  1199 A THR 39   1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc4  metalc ? ? H MG  . MG  ? ? ? 1_555 A THR 62 OG1 ? ? A MG  1199 A THR 57   1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc5  metalc ? ? H MG  . MG  ? ? ? 1_555 M HOH .  O   ? ? A MG  1199 A HOH 2003 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc6  metalc ? ? H MG  . MG  ? ? ? 1_555 M HOH .  O   ? ? A MG  1199 A HOH 2004 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc7  metalc ? ? I GCP . O3G ? ? ? 1_555 J MG  .  MG  ? ? B GCP 1198 B MG  1199 1_555 ? ? ? ? ? ? ? 1.896 ? 
metalc8  metalc ? ? I GCP . O2B ? ? ? 1_555 J MG  .  MG  ? ? B GCP 1198 B MG  1199 1_555 ? ? ? ? ? ? ? 1.964 ? 
metalc9  metalc ? ? J MG  . MG  ? ? ? 1_555 N HOH .  O   ? ? B MG  1199 B HOH 2003 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc10 metalc ? ? J MG  . MG  ? ? ? 1_555 B THR 62 OG1 ? ? B MG  1199 B THR 57   1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc11 metalc ? ? J MG  . MG  ? ? ? 1_555 B THR 44 OG1 ? ? B MG  1199 B THR 39   1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc12 metalc ? ? J MG  . MG  ? ? ? 1_555 N HOH .  O   ? ? B MG  1199 B HOH 2004 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc13 metalc ? ? K GCP . O2B ? ? ? 1_555 L MG  .  MG  ? ? C GCP 1198 C MG  1199 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc14 metalc ? ? K GCP . O3G ? ? ? 1_555 L MG  .  MG  ? ? C GCP 1198 C MG  1199 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc15 metalc ? ? L MG  . MG  ? ? ? 1_555 O HOH .  O   ? ? C MG  1199 C HOH 2003 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc16 metalc ? ? L MG  . MG  ? ? ? 1_555 O HOH .  O   ? ? C MG  1199 C HOH 2004 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc17 metalc ? ? L MG  . MG  ? ? ? 1_555 C THR 44 OG1 ? ? C MG  1199 C THR 39   1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc18 metalc ? ? L MG  . MG  ? ? ? 1_555 C THR 62 OG1 ? ? C MG  1199 C THR 57   1_555 ? ? ? ? ? ? ? 2.140 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
BA ? 6 ? 
CA ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
CA 1 2 ? anti-parallel 
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? parallel      
CA 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 65  ? ASN A 73  ? VAL A 60  ASN A 68  
AA 2 LEU A 79  ? ILE A 87  ? LEU A 74  ILE A 82  
AA 3 GLU A 28  ? ILE A 36  ? GLU A 23  ILE A 31  
AA 4 GLY A 106 ? ASP A 112 ? GLY A 101 ASP A 107 
AA 5 ALA A 143 ? ASN A 148 ? ALA A 138 ASN A 143 
AA 6 PHE A 172 ? THR A 178 ? PHE A 167 THR A 173 
BA 1 VAL B 65  ? ASN B 73  ? VAL B 60  ASN B 68  
BA 2 LEU B 79  ? ILE B 87  ? LEU B 74  ILE B 82  
BA 3 HIS B 29  ? ILE B 36  ? HIS B 24  ILE B 31  
BA 4 GLY B 106 ? ASP B 112 ? GLY B 101 ASP B 107 
BA 5 ALA B 143 ? ASN B 148 ? ALA B 138 ASN B 143 
BA 6 GLY B 174 ? THR B 178 ? GLY B 169 THR B 173 
CA 1 VAL C 65  ? ASN C 73  ? VAL C 60  ASN C 68  
CA 2 LEU C 79  ? ILE C 87  ? LEU C 74  ILE C 82  
CA 3 GLU C 28  ? ILE C 36  ? GLU C 23  ILE C 31  
CA 4 GLY C 106 ? ASP C 112 ? GLY C 101 ASP C 107 
CA 5 ALA C 143 ? ASN C 148 ? ALA C 138 ASN C 143 
CA 6 PHE C 172 ? THR C 178 ? PHE C 167 THR C 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 72  ? N LEU A 67  O VAL A 80  ? O VAL A 75  
AA 2 3 N ARG A 81  ? N ARG A 76  O HIS A 29  ? O HIS A 24  
AA 3 4 N LEU A 34  ? N LEU A 29  O GLY A 106 ? O GLY A 101 
AA 4 5 N VAL A 109 ? N VAL A 104 O VAL A 144 ? O VAL A 139 
AA 5 6 O ALA A 143 ? O ALA A 138 N ALA A 173 ? N ALA A 168 
BA 1 2 N LEU B 72  ? N LEU B 67  O VAL B 80  ? O VAL B 75  
BA 2 3 N ARG B 81  ? N ARG B 76  O HIS B 29  ? O HIS B 24  
BA 3 4 N LEU B 34  ? N LEU B 29  O GLY B 106 ? O GLY B 101 
BA 4 5 N VAL B 109 ? N VAL B 104 O VAL B 144 ? O VAL B 139 
BA 5 6 N LEU B 145 ? N LEU B 140 O GLY B 174 ? O GLY B 169 
CA 1 2 N LEU C 72  ? N LEU C 67  O VAL C 80  ? O VAL C 75  
CA 2 3 N ARG C 81  ? N ARG C 76  O HIS C 29  ? O HIS C 24  
CA 3 4 N LEU C 34  ? N LEU C 29  O GLY C 106 ? O GLY C 101 
CA 4 5 N VAL C 109 ? N VAL C 104 O VAL C 144 ? O VAL C 139 
CA 5 6 O ALA C 143 ? O ALA C 138 N ALA C 173 ? N ALA C 168 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE GCP A 1198' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 1199'  
AC3 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE GCP B 1198' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 1199'  
AC5 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE GCP C 1198' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG C 1199'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 LEU A 39  ? LEU A 34   . ? 1_555 ? 
2  AC1 26 GLY A 40  ? GLY A 35   . ? 1_555 ? 
3  AC1 26 VAL A 41  ? VAL A 36   . ? 1_555 ? 
4  AC1 26 GLY A 42  ? GLY A 37   . ? 1_555 ? 
5  AC1 26 LYS A 43  ? LYS A 38   . ? 1_555 ? 
6  AC1 26 THR A 44  ? THR A 39   . ? 1_555 ? 
7  AC1 26 SER A 45  ? SER A 40   . ? 1_555 ? 
8  AC1 26 PHE A 55  ? PHE A 50   . ? 1_555 ? 
9  AC1 26 SER A 56  ? SER A 51   . ? 1_555 ? 
10 AC1 26 GLN A 57  ? GLN A 52   . ? 1_555 ? 
11 AC1 26 TYR A 59  ? TYR A 54   . ? 1_555 ? 
12 AC1 26 ALA A 61  ? ALA A 56   . ? 1_555 ? 
13 AC1 26 THR A 62  ? THR A 57   . ? 1_555 ? 
14 AC1 26 GLY A 89  ? GLY A 84   . ? 1_555 ? 
15 AC1 26 ASN A 148 ? ASN A 143  . ? 1_555 ? 
16 AC1 26 LYS A 149 ? LYS A 144  . ? 1_555 ? 
17 AC1 26 ASP A 151 ? ASP A 146  . ? 1_555 ? 
18 AC1 26 GLN A 152 ? GLN A 147  . ? 1_555 ? 
19 AC1 26 SER A 179 ? SER A 174  . ? 1_555 ? 
20 AC1 26 ALA A 180 ? ALA A 175  . ? 1_555 ? 
21 AC1 26 LYS A 181 ? LYS A 176  . ? 1_555 ? 
22 AC1 26 MG  H .   ? MG  A 1199 . ? 1_555 ? 
23 AC1 26 HOH M .   ? HOH A 2003 . ? 1_555 ? 
24 AC1 26 HOH M .   ? HOH A 2004 . ? 1_555 ? 
25 AC1 26 HOH M .   ? HOH A 2012 . ? 1_555 ? 
26 AC1 26 HOH M .   ? HOH A 2013 . ? 1_555 ? 
27 AC2 5  THR A 44  ? THR A 39   . ? 1_555 ? 
28 AC2 5  THR A 62  ? THR A 57   . ? 1_555 ? 
29 AC2 5  GCP G .   ? GCP A 1198 . ? 1_555 ? 
30 AC2 5  HOH M .   ? HOH A 2003 . ? 1_555 ? 
31 AC2 5  HOH M .   ? HOH A 2004 . ? 1_555 ? 
32 AC3 24 LEU B 39  ? LEU B 34   . ? 1_555 ? 
33 AC3 24 GLY B 40  ? GLY B 35   . ? 1_555 ? 
34 AC3 24 VAL B 41  ? VAL B 36   . ? 1_555 ? 
35 AC3 24 GLY B 42  ? GLY B 37   . ? 1_555 ? 
36 AC3 24 LYS B 43  ? LYS B 38   . ? 1_555 ? 
37 AC3 24 THR B 44  ? THR B 39   . ? 1_555 ? 
38 AC3 24 SER B 45  ? SER B 40   . ? 1_555 ? 
39 AC3 24 PHE B 55  ? PHE B 50   . ? 1_555 ? 
40 AC3 24 SER B 56  ? SER B 51   . ? 1_555 ? 
41 AC3 24 GLN B 57  ? GLN B 52   . ? 1_555 ? 
42 AC3 24 TYR B 59  ? TYR B 54   . ? 1_555 ? 
43 AC3 24 ALA B 61  ? ALA B 56   . ? 1_555 ? 
44 AC3 24 THR B 62  ? THR B 57   . ? 1_555 ? 
45 AC3 24 GLY B 89  ? GLY B 84   . ? 1_555 ? 
46 AC3 24 ASN B 148 ? ASN B 143  . ? 1_555 ? 
47 AC3 24 LYS B 149 ? LYS B 144  . ? 1_555 ? 
48 AC3 24 ASP B 151 ? ASP B 146  . ? 1_555 ? 
49 AC3 24 SER B 179 ? SER B 174  . ? 1_555 ? 
50 AC3 24 ALA B 180 ? ALA B 175  . ? 1_555 ? 
51 AC3 24 LYS B 181 ? LYS B 176  . ? 1_555 ? 
52 AC3 24 MG  J .   ? MG  B 1199 . ? 1_555 ? 
53 AC3 24 HOH N .   ? HOH B 2003 . ? 1_555 ? 
54 AC3 24 HOH N .   ? HOH B 2004 . ? 1_555 ? 
55 AC3 24 HOH N .   ? HOH B 2008 . ? 1_555 ? 
56 AC4 5  THR B 44  ? THR B 39   . ? 1_555 ? 
57 AC4 5  THR B 62  ? THR B 57   . ? 1_555 ? 
58 AC4 5  GCP I .   ? GCP B 1198 . ? 1_555 ? 
59 AC4 5  HOH N .   ? HOH B 2003 . ? 1_555 ? 
60 AC4 5  HOH N .   ? HOH B 2004 . ? 1_555 ? 
61 AC5 27 GLU C 38  ? GLU C 33   . ? 1_555 ? 
62 AC5 27 LEU C 39  ? LEU C 34   . ? 1_555 ? 
63 AC5 27 GLY C 40  ? GLY C 35   . ? 1_555 ? 
64 AC5 27 VAL C 41  ? VAL C 36   . ? 1_555 ? 
65 AC5 27 GLY C 42  ? GLY C 37   . ? 1_555 ? 
66 AC5 27 LYS C 43  ? LYS C 38   . ? 1_555 ? 
67 AC5 27 THR C 44  ? THR C 39   . ? 1_555 ? 
68 AC5 27 SER C 45  ? SER C 40   . ? 1_555 ? 
69 AC5 27 PHE C 55  ? PHE C 50   . ? 1_555 ? 
70 AC5 27 SER C 56  ? SER C 51   . ? 1_555 ? 
71 AC5 27 GLN C 57  ? GLN C 52   . ? 1_555 ? 
72 AC5 27 HIS C 58  ? HIS C 53   . ? 1_555 ? 
73 AC5 27 TYR C 59  ? TYR C 54   . ? 1_555 ? 
74 AC5 27 ALA C 61  ? ALA C 56   . ? 1_555 ? 
75 AC5 27 THR C 62  ? THR C 57   . ? 1_555 ? 
76 AC5 27 GLY C 89  ? GLY C 84   . ? 1_555 ? 
77 AC5 27 ASN C 148 ? ASN C 143  . ? 1_555 ? 
78 AC5 27 LYS C 149 ? LYS C 144  . ? 1_555 ? 
79 AC5 27 ASP C 151 ? ASP C 146  . ? 1_555 ? 
80 AC5 27 GLN C 152 ? GLN C 147  . ? 1_555 ? 
81 AC5 27 SER C 179 ? SER C 174  . ? 1_555 ? 
82 AC5 27 ALA C 180 ? ALA C 175  . ? 1_555 ? 
83 AC5 27 LYS C 181 ? LYS C 176  . ? 1_555 ? 
84 AC5 27 MG  L .   ? MG  C 1199 . ? 1_555 ? 
85 AC5 27 HOH O .   ? HOH C 2003 . ? 1_555 ? 
86 AC5 27 HOH O .   ? HOH C 2004 . ? 1_555 ? 
87 AC5 27 HOH O .   ? HOH C 2006 . ? 1_555 ? 
88 AC6 5  THR C 44  ? THR C 39   . ? 1_555 ? 
89 AC6 5  THR C 62  ? THR C 57   . ? 1_555 ? 
90 AC6 5  GCP K .   ? GCP C 1198 . ? 1_555 ? 
91 AC6 5  HOH O .   ? HOH C 2003 . ? 1_555 ? 
92 AC6 5  HOH O .   ? HOH C 2004 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4CYM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CYM 
_atom_sites.fract_transf_matrix[1][1]   0.006923 
_atom_sites.fract_transf_matrix[1][2]   0.003997 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007994 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007370 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 27  ? 33.947  -22.329 -11.268 1.00 120.74 ? 22   ARG A N     1 
ATOM   2    C  CA    . ARG A 1 27  ? 32.448  -22.413 -11.233 1.00 124.56 ? 22   ARG A CA    1 
ATOM   3    C  C     . ARG A 1 27  ? 31.864  -21.762 -9.983  1.00 128.37 ? 22   ARG A C     1 
ATOM   4    O  O     . ARG A 1 27  ? 32.337  -22.033 -8.883  1.00 131.37 ? 22   ARG A O     1 
ATOM   5    C  CB    . ARG A 1 27  ? 31.978  -23.869 -11.272 1.00 122.30 ? 22   ARG A CB    1 
ATOM   6    C  CG    . ARG A 1 27  ? 30.503  -24.043 -10.908 1.00 121.27 ? 22   ARG A CG    1 
ATOM   7    C  CD    . ARG A 1 27  ? 29.883  -25.196 -11.656 1.00 121.68 ? 22   ARG A CD    1 
ATOM   8    N  NE    . ARG A 1 27  ? 30.911  -26.190 -11.943 1.00 129.85 ? 22   ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1 27  ? 31.083  -27.354 -11.311 1.00 134.59 ? 22   ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1 27  ? 30.264  -27.761 -10.347 1.00 124.79 ? 22   ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1 27  ? 32.090  -28.143 -11.677 1.00 140.73 ? 22   ARG A NH2   1 
ATOM   12   N  N     . GLU A 1 28  ? 30.806  -20.959 -10.150 1.00 131.07 ? 23   GLU A N     1 
ATOM   13   C  CA    . GLU A 1 28  ? 30.043  -20.398 -9.010  1.00 125.76 ? 23   GLU A CA    1 
ATOM   14   C  C     . GLU A 1 28  ? 28.540  -20.766 -8.992  1.00 114.70 ? 23   GLU A C     1 
ATOM   15   O  O     . GLU A 1 28  ? 27.933  -20.965 -10.047 1.00 104.79 ? 23   GLU A O     1 
ATOM   16   C  CB    . GLU A 1 28  ? 30.203  -18.875 -8.964  1.00 125.35 ? 23   GLU A CB    1 
ATOM   17   C  CG    . GLU A 1 28  ? 29.688  -18.113 -10.176 1.00 127.04 ? 23   GLU A CG    1 
ATOM   18   C  CD    . GLU A 1 28  ? 29.481  -16.634 -9.881  1.00 133.94 ? 23   GLU A CD    1 
ATOM   19   O  OE1   . GLU A 1 28  ? 30.165  -16.094 -8.982  1.00 137.78 ? 23   GLU A OE1   1 
ATOM   20   O  OE2   . GLU A 1 28  ? 28.626  -16.008 -10.538 1.00 129.04 ? 23   GLU A OE2   1 
ATOM   21   N  N     . HIS A 1 29  ? 27.959  -20.855 -7.786  1.00 109.17 ? 24   HIS A N     1 
ATOM   22   C  CA    . HIS A 1 29  ? 26.525  -21.175 -7.610  1.00 111.58 ? 24   HIS A CA    1 
ATOM   23   C  C     . HIS A 1 29  ? 25.711  -20.099 -6.916  1.00 104.98 ? 24   HIS A C     1 
ATOM   24   O  O     . HIS A 1 29  ? 26.222  -19.350 -6.073  1.00 104.45 ? 24   HIS A O     1 
ATOM   25   C  CB    . HIS A 1 29  ? 26.332  -22.434 -6.795  1.00 106.15 ? 24   HIS A CB    1 
ATOM   26   C  CG    . HIS A 1 29  ? 27.009  -23.622 -7.370  1.00 106.99 ? 24   HIS A CG    1 
ATOM   27   N  ND1   . HIS A 1 29  ? 28.283  -23.993 -7.001  1.00 105.00 ? 24   HIS A ND1   1 
ATOM   28   C  CD2   . HIS A 1 29  ? 26.597  -24.525 -8.287  1.00 101.59 ? 24   HIS A CD2   1 
ATOM   29   C  CE1   . HIS A 1 29  ? 28.628  -25.077 -7.668  1.00 102.29 ? 24   HIS A CE1   1 
ATOM   30   N  NE2   . HIS A 1 29  ? 27.623  -25.419 -8.453  1.00 103.89 ? 24   HIS A NE2   1 
ATOM   31   N  N     . LEU A 1 30  ? 24.432  -20.054 -7.278  1.00 90.77  ? 25   LEU A N     1 
ATOM   32   C  CA    . LEU A 1 30  ? 23.452  -19.292 -6.543  1.00 83.09  ? 25   LEU A CA    1 
ATOM   33   C  C     . LEU A 1 30  ? 22.357  -20.223 -6.027  1.00 76.33  ? 25   LEU A C     1 
ATOM   34   O  O     . LEU A 1 30  ? 21.680  -20.891 -6.803  1.00 76.85  ? 25   LEU A O     1 
ATOM   35   C  CB    . LEU A 1 30  ? 22.887  -18.193 -7.431  1.00 84.64  ? 25   LEU A CB    1 
ATOM   36   C  CG    . LEU A 1 30  ? 22.120  -17.121 -6.647  1.00 99.15  ? 25   LEU A CG    1 
ATOM   37   C  CD1   . LEU A 1 30  ? 22.863  -15.797 -6.539  1.00 97.10  ? 25   LEU A CD1   1 
ATOM   38   C  CD2   . LEU A 1 30  ? 20.758  -16.908 -7.274  1.00 105.97 ? 25   LEU A CD2   1 
ATOM   39   N  N     . PHE A 1 31  ? 22.212  -20.289 -4.704  1.00 74.01  ? 26   PHE A N     1 
ATOM   40   C  CA    . PHE A 1 31  ? 21.176  -21.120 -4.062  1.00 71.52  ? 26   PHE A CA    1 
ATOM   41   C  C     . PHE A 1 31  ? 20.137  -20.303 -3.277  1.00 65.41  ? 26   PHE A C     1 
ATOM   42   O  O     . PHE A 1 31  ? 20.498  -19.492 -2.395  1.00 58.03  ? 26   PHE A O     1 
ATOM   43   C  CB    . PHE A 1 31  ? 21.817  -22.120 -3.103  1.00 70.22  ? 26   PHE A CB    1 
ATOM   44   C  CG    . PHE A 1 31  ? 22.772  -23.073 -3.749  1.00 73.34  ? 26   PHE A CG    1 
ATOM   45   C  CD1   . PHE A 1 31  ? 22.458  -23.699 -4.940  1.00 72.30  ? 26   PHE A CD1   1 
ATOM   46   C  CD2   . PHE A 1 31  ? 23.987  -23.362 -3.135  1.00 75.69  ? 26   PHE A CD2   1 
ATOM   47   C  CE1   . PHE A 1 31  ? 23.342  -24.583 -5.510  1.00 76.52  ? 26   PHE A CE1   1 
ATOM   48   C  CE2   . PHE A 1 31  ? 24.874  -24.254 -3.697  1.00 78.13  ? 26   PHE A CE2   1 
ATOM   49   C  CZ    . PHE A 1 31  ? 24.549  -24.865 -4.888  1.00 78.73  ? 26   PHE A CZ    1 
ATOM   50   N  N     . LYS A 1 32  ? 18.857  -20.559 -3.578  1.00 55.53  ? 27   LYS A N     1 
ATOM   51   C  CA    . LYS A 1 32  ? 17.752  -20.039 -2.788  1.00 49.34  ? 27   LYS A CA    1 
ATOM   52   C  C     . LYS A 1 32  ? 17.508  -20.938 -1.614  1.00 47.56  ? 27   LYS A C     1 
ATOM   53   O  O     . LYS A 1 32  ? 17.076  -22.091 -1.773  1.00 47.25  ? 27   LYS A O     1 
ATOM   54   C  CB    . LYS A 1 32  ? 16.467  -19.965 -3.598  1.00 50.06  ? 27   LYS A CB    1 
ATOM   55   C  CG    . LYS A 1 32  ? 15.311  -19.239 -2.907  1.00 49.77  ? 27   LYS A CG    1 
ATOM   56   C  CD    . LYS A 1 32  ? 13.955  -19.590 -3.513  1.00 49.52  ? 27   LYS A CD    1 
ATOM   57   C  CE    . LYS A 1 32  ? 12.971  -18.462 -3.332  1.00 49.41  ? 27   LYS A CE    1 
ATOM   58   N  NZ    . LYS A 1 32  ? 11.711  -18.681 -4.076  1.00 57.06  ? 27   LYS A NZ    1 
ATOM   59   N  N     . VAL A 1 33  ? 17.735  -20.381 -0.425  1.00 44.48  ? 28   VAL A N     1 
ATOM   60   C  CA    . VAL A 1 33  ? 17.509  -21.104 0.814   1.00 46.01  ? 28   VAL A CA    1 
ATOM   61   C  C     . VAL A 1 33  ? 16.518  -20.395 1.710   1.00 44.23  ? 28   VAL A C     1 
ATOM   62   O  O     . VAL A 1 33  ? 16.685  -19.221 2.024   1.00 44.79  ? 28   VAL A O     1 
ATOM   63   C  CB    . VAL A 1 33  ? 18.815  -21.309 1.595   1.00 45.27  ? 28   VAL A CB    1 
ATOM   64   C  CG1   . VAL A 1 33  ? 18.563  -22.151 2.821   1.00 44.67  ? 28   VAL A CG1   1 
ATOM   65   C  CG2   . VAL A 1 33  ? 19.838  -21.995 0.714   1.00 46.33  ? 28   VAL A CG2   1 
ATOM   66   N  N     . LEU A 1 34  ? 15.518  -21.150 2.161   1.00 44.49  ? 29   LEU A N     1 
ATOM   67   C  CA    . LEU A 1 34  ? 14.483  -20.629 3.022   1.00 43.48  ? 29   LEU A CA    1 
ATOM   68   C  C     . LEU A 1 34  ? 14.854  -20.736 4.487   1.00 43.83  ? 29   LEU A C     1 
ATOM   69   O  O     . LEU A 1 34  ? 15.514  -21.674 4.893   1.00 46.20  ? 29   LEU A O     1 
ATOM   70   C  CB    . LEU A 1 34  ? 13.231  -21.430 2.814   1.00 44.30  ? 29   LEU A CB    1 
ATOM   71   C  CG    . LEU A 1 34  ? 12.691  -21.425 1.406   1.00 45.06  ? 29   LEU A CG    1 
ATOM   72   C  CD1   . LEU A 1 34  ? 11.579  -22.456 1.326   1.00 48.71  ? 29   LEU A CD1   1 
ATOM   73   C  CD2   . LEU A 1 34  ? 12.169  -20.047 1.028   1.00 45.36  ? 29   LEU A CD2   1 
ATOM   74   N  N     . VAL A 1 35  ? 14.403  -19.778 5.287   1.00 44.03  ? 30   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 35  ? 14.476  -19.895 6.741   1.00 43.51  ? 30   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 35  ? 13.088  -19.689 7.328   1.00 45.09  ? 30   VAL A C     1 
ATOM   77   O  O     . VAL A 1 35  ? 12.526  -18.608 7.223   1.00 49.44  ? 30   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 35  ? 15.424  -18.849 7.327   1.00 41.72  ? 30   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 35  ? 15.576  -19.029 8.825   1.00 42.30  ? 30   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 35  ? 16.760  -18.939 6.639   1.00 41.15  ? 30   VAL A CG2   1 
ATOM   81   N  N     . ILE A 1 36  ? 12.530  -20.729 7.926   1.00 43.82  ? 31   ILE A N     1 
ATOM   82   C  CA    . ILE A 1 36  ? 11.139  -20.712 8.298   1.00 44.60  ? 31   ILE A CA    1 
ATOM   83   C  C     . ILE A 1 36  ? 10.935  -21.228 9.710   1.00 48.40  ? 31   ILE A C     1 
ATOM   84   O  O     . ILE A 1 36  ? 11.828  -21.846 10.289  1.00 48.11  ? 31   ILE A O     1 
ATOM   85   C  CB    . ILE A 1 36  ? 10.291  -21.515 7.317   1.00 42.29  ? 31   ILE A CB    1 
ATOM   86   C  CG1   . ILE A 1 36  ? 10.668  -22.987 7.328   1.00 45.11  ? 31   ILE A CG1   1 
ATOM   87   C  CG2   . ILE A 1 36  ? 10.498  -20.971 5.931   1.00 42.72  ? 31   ILE A CG2   1 
ATOM   88   C  CD1   . ILE A 1 36  ? 9.806   -23.839 6.402   1.00 46.21  ? 31   ILE A CD1   1 
ATOM   89   N  N     . GLY A 1 37  ? 9.760   -20.937 10.267  1.00 48.27  ? 32   GLY A N     1 
ATOM   90   C  CA    . GLY A 1 37  ? 9.452   -21.267 11.652  1.00 48.09  ? 32   GLY A CA    1 
ATOM   91   C  C     . GLY A 1 37  ? 8.693   -20.169 12.368  1.00 50.11  ? 32   GLY A C     1 
ATOM   92   O  O     . GLY A 1 37  ? 8.588   -19.049 11.870  1.00 45.67  ? 32   GLY A O     1 
ATOM   93   N  N     . GLU A 1 38  ? 8.171   -20.503 13.550  1.00 53.58  ? 33   GLU A N     1 
ATOM   94   C  CA    . GLU A 1 38  ? 7.227   -19.649 14.253  1.00 55.57  ? 33   GLU A CA    1 
ATOM   95   C  C     . GLU A 1 38  ? 7.810   -18.292 14.585  1.00 53.79  ? 33   GLU A C     1 
ATOM   96   O  O     . GLU A 1 38  ? 9.011   -18.088 14.478  1.00 58.31  ? 33   GLU A O     1 
ATOM   97   C  CB    . GLU A 1 38  ? 6.740   -20.332 15.541  1.00 59.21  ? 33   GLU A CB    1 
ATOM   98   C  CG    . GLU A 1 38  ? 5.619   -21.346 15.341  1.00 62.25  ? 33   GLU A CG    1 
ATOM   99   C  CD    . GLU A 1 38  ? 4.368   -20.763 14.687  1.00 69.88  ? 33   GLU A CD    1 
ATOM   100  O  OE1   . GLU A 1 38  ? 4.179   -19.505 14.612  1.00 78.64  ? 33   GLU A OE1   1 
ATOM   101  O  OE2   . GLU A 1 38  ? 3.583   -21.586 14.212  1.00 66.76  ? 33   GLU A OE2   1 
ATOM   102  N  N     . LEU A 1 39  ? 6.953   -17.357 14.986  1.00 54.30  ? 34   LEU A N     1 
ATOM   103  C  CA    . LEU A 1 39  ? 7.426   -16.050 15.449  1.00 53.80  ? 34   LEU A CA    1 
ATOM   104  C  C     . LEU A 1 39  ? 8.418   -16.137 16.608  1.00 51.77  ? 34   LEU A C     1 
ATOM   105  O  O     . LEU A 1 39  ? 8.540   -17.166 17.263  1.00 49.12  ? 34   LEU A O     1 
ATOM   106  C  CB    . LEU A 1 39  ? 6.267   -15.195 15.884  1.00 55.87  ? 34   LEU A CB    1 
ATOM   107  C  CG    . LEU A 1 39  ? 5.519   -15.716 17.115  1.00 63.14  ? 34   LEU A CG    1 
ATOM   108  C  CD1   . LEU A 1 39  ? 5.389   -14.619 18.149  1.00 66.20  ? 34   LEU A CD1   1 
ATOM   109  C  CD2   . LEU A 1 39  ? 4.135   -16.245 16.733  1.00 68.01  ? 34   LEU A CD2   1 
ATOM   110  N  N     . GLY A 1 40  ? 9.099   -15.020 16.850  1.00 51.08  ? 35   GLY A N     1 
ATOM   111  C  CA    . GLY A 1 40  ? 10.190  -14.897 17.834  1.00 49.81  ? 35   GLY A CA    1 
ATOM   112  C  C     . GLY A 1 40  ? 11.193  -16.019 18.042  1.00 47.24  ? 35   GLY A C     1 
ATOM   113  O  O     . GLY A 1 40  ? 11.829  -16.116 19.083  1.00 50.35  ? 35   GLY A O     1 
ATOM   114  N  N     . VAL A 1 41  ? 11.373  -16.849 17.044  1.00 45.89  ? 36   VAL A N     1 
ATOM   115  C  CA    . VAL A 1 41  ? 12.142  -18.064 17.201  1.00 43.65  ? 36   VAL A CA    1 
ATOM   116  C  C     . VAL A 1 41  ? 13.636  -17.789 16.988  1.00 42.44  ? 36   VAL A C     1 
ATOM   117  O  O     . VAL A 1 41  ? 14.472  -18.568 17.436  1.00 41.05  ? 36   VAL A O     1 
ATOM   118  C  CB    . VAL A 1 41  ? 11.586  -19.113 16.210  1.00 45.98  ? 36   VAL A CB    1 
ATOM   119  C  CG1   . VAL A 1 41  ? 12.672  -19.793 15.391  1.00 47.34  ? 36   VAL A CG1   1 
ATOM   120  C  CG2   . VAL A 1 41  ? 10.748  -20.121 16.965  1.00 47.88  ? 36   VAL A CG2   1 
ATOM   121  N  N     . GLY A 1 42  ? 13.952  -16.717 16.251  1.00 40.48  ? 37   GLY A N     1 
ATOM   122  C  CA    . GLY A 1 42  ? 15.324  -16.319 15.967  1.00 40.99  ? 37   GLY A CA    1 
ATOM   123  C  C     . GLY A 1 42  ? 15.756  -16.317 14.511  1.00 41.79  ? 37   GLY A C     1 
ATOM   124  O  O     . GLY A 1 42  ? 16.932  -16.113 14.196  1.00 41.89  ? 37   GLY A O     1 
ATOM   125  N  N     . LYS A 1 43  ? 14.811  -16.517 13.611  1.00 43.28  ? 38   LYS A N     1 
ATOM   126  C  CA    . LYS A 1 43  ? 15.149  -16.713 12.209  1.00 43.57  ? 38   LYS A CA    1 
ATOM   127  C  C     . LYS A 1 43  ? 15.972  -15.522 11.743  1.00 42.19  ? 38   LYS A C     1 
ATOM   128  O  O     . LYS A 1 43  ? 17.057  -15.674 11.188  1.00 42.41  ? 38   LYS A O     1 
ATOM   129  C  CB    . LYS A 1 43  ? 13.880  -16.869 11.376  1.00 42.91  ? 38   LYS A CB    1 
ATOM   130  C  CG    . LYS A 1 43  ? 13.038  -18.070 11.790  1.00 44.54  ? 38   LYS A CG    1 
ATOM   131  C  CD    . LYS A 1 43  ? 11.757  -18.277 10.964  1.00 45.52  ? 38   LYS A CD    1 
ATOM   132  C  CE    . LYS A 1 43  ? 10.791  -17.095 11.009  1.00 44.32  ? 38   LYS A CE    1 
ATOM   133  N  NZ    . LYS A 1 43  ? 10.309  -16.734 12.375  1.00 44.71  ? 38   LYS A NZ    1 
ATOM   134  N  N     . THR A 1 44  ? 15.440  -14.331 11.956  1.00 40.16  ? 39   THR A N     1 
ATOM   135  C  CA    . THR A 1 44  ? 16.130  -13.123 11.506  1.00 39.81  ? 39   THR A CA    1 
ATOM   136  C  C     . THR A 1 44  ? 17.497  -13.005 12.161  1.00 38.48  ? 39   THR A C     1 
ATOM   137  O  O     . THR A 1 44  ? 18.468  -12.693 11.497  1.00 42.00  ? 39   THR A O     1 
ATOM   138  C  CB    . THR A 1 44  ? 15.283  -11.846 11.750  1.00 36.20  ? 39   THR A CB    1 
ATOM   139  O  OG1   . THR A 1 44  ? 14.093  -11.910 10.947  1.00 35.00  ? 39   THR A OG1   1 
ATOM   140  C  CG2   . THR A 1 44  ? 16.045  -10.617 11.378  1.00 34.23  ? 39   THR A CG2   1 
ATOM   141  N  N     . SER A 1 45  ? 17.552  -13.271 13.451  1.00 39.68  ? 40   SER A N     1 
ATOM   142  C  CA    . SER A 1 45  ? 18.764  -13.120 14.228  1.00 40.67  ? 40   SER A CA    1 
ATOM   143  C  C     . SER A 1 45  ? 19.871  -14.060 13.785  1.00 41.81  ? 40   SER A C     1 
ATOM   144  O  O     . SER A 1 45  ? 21.058  -13.684 13.737  1.00 44.42  ? 40   SER A O     1 
ATOM   145  C  CB    . SER A 1 45  ? 18.467  -13.401 15.695  1.00 42.04  ? 40   SER A CB    1 
ATOM   146  O  OG    . SER A 1 45  ? 17.572  -12.410 16.210  1.00 48.14  ? 40   SER A OG    1 
ATOM   147  N  N     . ILE A 1 46  ? 19.501  -15.299 13.504  1.00 41.32  ? 41   ILE A N     1 
ATOM   148  C  CA    . ILE A 1 46  ? 20.448  -16.247 12.944  1.00 41.66  ? 41   ILE A CA    1 
ATOM   149  C  C     . ILE A 1 46  ? 21.084  -15.641 11.701  1.00 41.98  ? 41   ILE A C     1 
ATOM   150  O  O     . ILE A 1 46  ? 22.310  -15.481 11.634  1.00 45.89  ? 41   ILE A O     1 
ATOM   151  C  CB    . ILE A 1 46  ? 19.770  -17.576 12.580  1.00 40.23  ? 41   ILE A CB    1 
ATOM   152  C  CG1   . ILE A 1 46  ? 19.491  -18.392 13.841  1.00 42.99  ? 41   ILE A CG1   1 
ATOM   153  C  CG2   . ILE A 1 46  ? 20.643  -18.383 11.646  1.00 36.33  ? 41   ILE A CG2   1 
ATOM   154  C  CD1   . ILE A 1 46  ? 18.443  -19.464 13.659  1.00 43.24  ? 41   ILE A CD1   1 
ATOM   155  N  N     . ILE A 1 47  ? 20.237  -15.297 10.740  1.00 40.38  ? 42   ILE A N     1 
ATOM   156  C  CA    . ILE A 1 47  ? 20.695  -14.791 9.469   1.00 41.13  ? 42   ILE A CA    1 
ATOM   157  C  C     . ILE A 1 47  ? 21.597  -13.595 9.719   1.00 42.70  ? 42   ILE A C     1 
ATOM   158  O  O     . ILE A 1 47  ? 22.655  -13.466 9.102   1.00 44.01  ? 42   ILE A O     1 
ATOM   159  C  CB    . ILE A 1 47  ? 19.522  -14.402 8.564   1.00 42.44  ? 42   ILE A CB    1 
ATOM   160  C  CG1   . ILE A 1 47  ? 18.775  -15.655 8.104   1.00 43.65  ? 42   ILE A CG1   1 
ATOM   161  C  CG2   . ILE A 1 47  ? 20.017  -13.664 7.327   1.00 44.41  ? 42   ILE A CG2   1 
ATOM   162  C  CD1   . ILE A 1 47  ? 17.415  -15.369 7.500   1.00 43.91  ? 42   ILE A CD1   1 
ATOM   163  N  N     . LYS A 1 48  ? 21.198  -12.728 10.634  1.00 43.59  ? 43   LYS A N     1 
ATOM   164  C  CA    . LYS A 1 48  ? 21.920  -11.501 10.841  1.00 46.91  ? 43   LYS A CA    1 
ATOM   165  C  C     . LYS A 1 48  ? 23.296  -11.772 11.396  1.00 47.87  ? 43   LYS A C     1 
ATOM   166  O  O     . LYS A 1 48  ? 24.282  -11.164 10.982  1.00 46.43  ? 43   LYS A O     1 
ATOM   167  C  CB    . LYS A 1 48  ? 21.180  -10.582 11.790  1.00 49.28  ? 43   LYS A CB    1 
ATOM   168  C  CG    . LYS A 1 48  ? 21.756  -9.170  11.795  1.00 57.13  ? 43   LYS A CG    1 
ATOM   169  C  CD    . LYS A 1 48  ? 21.514  -8.499  13.125  1.00 66.95  ? 43   LYS A CD    1 
ATOM   170  C  CE    . LYS A 1 48  ? 21.390  -7.000  12.976  1.00 72.13  ? 43   LYS A CE    1 
ATOM   171  N  NZ    . LYS A 1 48  ? 20.795  -6.462  14.227  1.00 82.15  ? 43   LYS A NZ    1 
ATOM   172  N  N     . ARG A 1 49  ? 23.371  -12.677 12.350  1.00 53.01  ? 44   ARG A N     1 
ATOM   173  C  CA    . ARG A 1 49  ? 24.671  -13.114 12.818  1.00 55.33  ? 44   ARG A CA    1 
ATOM   174  C  C     . ARG A 1 49  ? 25.520  -13.776 11.708  1.00 53.11  ? 44   ARG A C     1 
ATOM   175  O  O     . ARG A 1 49  ? 26.689  -13.432 11.511  1.00 47.03  ? 44   ARG A O     1 
ATOM   176  C  CB    . ARG A 1 49  ? 24.510  -14.072 13.983  1.00 59.57  ? 44   ARG A CB    1 
ATOM   177  C  CG    . ARG A 1 49  ? 25.797  -14.820 14.230  1.00 67.70  ? 44   ARG A CG    1 
ATOM   178  C  CD    . ARG A 1 49  ? 25.932  -15.326 15.646  1.00 71.88  ? 44   ARG A CD    1 
ATOM   179  N  NE    . ARG A 1 49  ? 26.012  -14.321 16.725  1.00 69.03  ? 44   ARG A NE    1 
ATOM   180  C  CZ    . ARG A 1 49  ? 26.885  -13.330 16.838  1.00 57.58  ? 44   ARG A CZ    1 
ATOM   181  N  NH1   . ARG A 1 49  ? 27.797  -13.090 15.905  1.00 60.35  ? 44   ARG A NH1   1 
ATOM   182  N  NH2   . ARG A 1 49  ? 26.821  -12.562 17.910  1.00 53.25  ? 44   ARG A NH2   1 
ATOM   183  N  N     . TYR A 1 50  ? 24.945  -14.763 11.023  1.00 51.61  ? 45   TYR A N     1 
ATOM   184  C  CA    . TYR A 1 50  ? 25.685  -15.522 10.027  1.00 48.90  ? 45   TYR A CA    1 
ATOM   185  C  C     . TYR A 1 50  ? 26.232  -14.668 8.912   1.00 50.00  ? 45   TYR A C     1 
ATOM   186  O  O     . TYR A 1 50  ? 27.155  -15.050 8.254   1.00 56.48  ? 45   TYR A O     1 
ATOM   187  C  CB    . TYR A 1 50  ? 24.798  -16.576 9.403   1.00 50.95  ? 45   TYR A CB    1 
ATOM   188  C  CG    . TYR A 1 50  ? 25.498  -17.458 8.375   1.00 54.32  ? 45   TYR A CG    1 
ATOM   189  C  CD1   . TYR A 1 50  ? 26.783  -17.937 8.586   1.00 53.81  ? 45   TYR A CD1   1 
ATOM   190  C  CD2   . TYR A 1 50  ? 24.861  -17.823 7.193   1.00 55.96  ? 45   TYR A CD2   1 
ATOM   191  C  CE1   . TYR A 1 50  ? 27.403  -18.747 7.652   1.00 56.38  ? 45   TYR A CE1   1 
ATOM   192  C  CE2   . TYR A 1 50  ? 25.475  -18.644 6.256   1.00 54.83  ? 45   TYR A CE2   1 
ATOM   193  C  CZ    . TYR A 1 50  ? 26.745  -19.098 6.488   1.00 56.71  ? 45   TYR A CZ    1 
ATOM   194  O  OH    . TYR A 1 50  ? 27.362  -19.911 5.575   1.00 56.24  ? 45   TYR A OH    1 
ATOM   195  N  N     . VAL A 1 51  ? 25.646  -13.515 8.692   1.00 55.53  ? 46   VAL A N     1 
ATOM   196  C  CA    . VAL A 1 51  ? 25.986  -12.697 7.552   1.00 56.54  ? 46   VAL A CA    1 
ATOM   197  C  C     . VAL A 1 51  ? 26.741  -11.437 7.976   1.00 62.46  ? 46   VAL A C     1 
ATOM   198  O  O     . VAL A 1 51  ? 27.591  -10.980 7.237   1.00 80.01  ? 46   VAL A O     1 
ATOM   199  C  CB    . VAL A 1 51  ? 24.696  -12.320 6.786   1.00 57.57  ? 46   VAL A CB    1 
ATOM   200  C  CG1   . VAL A 1 51  ? 24.927  -11.220 5.755   1.00 54.15  ? 46   VAL A CG1   1 
ATOM   201  C  CG2   . VAL A 1 51  ? 24.114  -13.566 6.132   1.00 61.07  ? 46   VAL A CG2   1 
ATOM   202  N  N     . HIS A 1 52  ? 26.415  -10.844 9.126   1.00 63.83  ? 47   HIS A N     1 
ATOM   203  C  CA    . HIS A 1 52  ? 27.066  -9.605  9.553   1.00 63.33  ? 47   HIS A CA    1 
ATOM   204  C  C     . HIS A 1 52  ? 27.692  -9.718  10.947  1.00 65.29  ? 47   HIS A C     1 
ATOM   205  O  O     . HIS A 1 52  ? 28.153  -8.740  11.500  1.00 65.01  ? 47   HIS A O     1 
ATOM   206  C  CB    . HIS A 1 52  ? 26.088  -8.436  9.554   1.00 62.62  ? 47   HIS A CB    1 
ATOM   207  C  CG    . HIS A 1 52  ? 25.385  -8.215  8.251   1.00 63.62  ? 47   HIS A CG    1 
ATOM   208  N  ND1   . HIS A 1 52  ? 24.157  -8.768  7.956   1.00 66.70  ? 47   HIS A ND1   1 
ATOM   209  C  CD2   . HIS A 1 52  ? 25.717  -7.462  7.182   1.00 68.39  ? 47   HIS A CD2   1 
ATOM   210  C  CE1   . HIS A 1 52  ? 23.769  -8.385  6.755   1.00 63.48  ? 47   HIS A CE1   1 
ATOM   211  N  NE2   . HIS A 1 52  ? 24.697  -7.587  6.266   1.00 66.63  ? 47   HIS A NE2   1 
ATOM   212  N  N     . GLN A 1 53  ? 27.760  -10.919 11.493  1.00 73.24  ? 48   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 53  ? 28.241  -11.124 12.867  1.00 75.93  ? 48   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 53  ? 27.728  -10.062 13.836  1.00 67.35  ? 48   GLN A C     1 
ATOM   215  O  O     . GLN A 1 53  ? 28.480  -9.507  14.612  1.00 71.55  ? 48   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 53  ? 29.761  -11.211 12.906  1.00 74.93  ? 48   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 53  ? 30.330  -12.257 12.008  1.00 80.72  ? 48   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 53  ? 30.880  -11.680 10.692  1.00 93.64  ? 48   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 53  ? 30.372  -10.677 10.157  1.00 89.03  ? 48   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 53  ? 31.944  -12.304 10.175  1.00 104.36 ? 48   GLN A NE2   1 
ATOM   221  N  N     . LEU A 1 54  ? 26.426  -9.815  13.794  1.00 65.19  ? 49   LEU A N     1 
ATOM   222  C  CA    . LEU A 1 54  ? 25.763  -9.020  14.808  1.00 56.80  ? 49   LEU A CA    1 
ATOM   223  C  C     . LEU A 1 54  ? 24.604  -9.778  15.466  1.00 51.93  ? 49   LEU A C     1 
ATOM   224  O  O     . LEU A 1 54  ? 24.016  -10.744 14.911  1.00 54.59  ? 49   LEU A O     1 
ATOM   225  C  CB    . LEU A 1 54  ? 25.235  -7.734  14.187  1.00 61.64  ? 49   LEU A CB    1 
ATOM   226  C  CG    . LEU A 1 54  ? 26.101  -6.522  13.910  1.00 63.79  ? 49   LEU A CG    1 
ATOM   227  C  CD1   . LEU A 1 54  ? 27.188  -6.846  12.933  1.00 62.72  ? 49   LEU A CD1   1 
ATOM   228  C  CD2   . LEU A 1 54  ? 25.297  -5.293  13.435  1.00 67.21  ? 49   LEU A CD2   1 
ATOM   229  N  N     . PHE A 1 55  ? 24.265  -9.305  16.652  1.00 47.10  ? 50   PHE A N     1 
ATOM   230  C  CA    . PHE A 1 55  ? 23.085  -9.758  17.359  1.00 49.00  ? 50   PHE A CA    1 
ATOM   231  C  C     . PHE A 1 55  ? 22.446  -8.636  18.128  1.00 49.67  ? 50   PHE A C     1 
ATOM   232  O  O     . PHE A 1 55  ? 23.130  -7.827  18.723  1.00 53.08  ? 50   PHE A O     1 
ATOM   233  C  CB    . PHE A 1 55  ? 23.453  -10.873 18.314  1.00 47.69  ? 50   PHE A CB    1 
ATOM   234  C  CG    . PHE A 1 55  ? 22.325  -11.321 19.172  1.00 47.22  ? 50   PHE A CG    1 
ATOM   235  C  CD1   . PHE A 1 55  ? 21.473  -12.333 18.737  1.00 52.51  ? 50   PHE A CD1   1 
ATOM   236  C  CD2   . PHE A 1 55  ? 22.102  -10.736 20.388  1.00 44.65  ? 50   PHE A CD2   1 
ATOM   237  C  CE1   . PHE A 1 55  ? 20.415  -12.756 19.522  1.00 56.84  ? 50   PHE A CE1   1 
ATOM   238  C  CE2   . PHE A 1 55  ? 21.048  -11.144 21.186  1.00 50.64  ? 50   PHE A CE2   1 
ATOM   239  C  CZ    . PHE A 1 55  ? 20.199  -12.157 20.757  1.00 57.05  ? 50   PHE A CZ    1 
ATOM   240  N  N     . SER A 1 56  ? 21.126  -8.591  18.132  1.00 53.65  ? 51   SER A N     1 
ATOM   241  C  CA    . SER A 1 56  ? 20.453  -7.677  19.023  1.00 53.25  ? 51   SER A CA    1 
ATOM   242  C  C     . SER A 1 56  ? 19.421  -8.401  19.891  1.00 52.89  ? 51   SER A C     1 
ATOM   243  O  O     . SER A 1 56  ? 18.726  -9.292  19.424  1.00 49.75  ? 51   SER A O     1 
ATOM   244  C  CB    . SER A 1 56  ? 19.805  -6.576  18.209  1.00 52.97  ? 51   SER A CB    1 
ATOM   245  O  OG    . SER A 1 56  ? 19.109  -5.685  19.062  1.00 52.92  ? 51   SER A OG    1 
ATOM   246  N  N     . GLN A 1 57  ? 19.319  -7.992  21.153  1.00 55.39  ? 52   GLN A N     1 
ATOM   247  C  CA    . GLN A 1 57  ? 18.289  -8.509  22.041  1.00 59.95  ? 52   GLN A CA    1 
ATOM   248  C  C     . GLN A 1 57  ? 16.906  -7.954  21.662  1.00 57.77  ? 52   GLN A C     1 
ATOM   249  O  O     . GLN A 1 57  ? 15.905  -8.536  22.002  1.00 58.80  ? 52   GLN A O     1 
ATOM   250  C  CB    . GLN A 1 57  ? 18.642  -8.231  23.513  1.00 67.01  ? 52   GLN A CB    1 
ATOM   251  C  CG    . GLN A 1 57  ? 17.936  -9.152  24.508  1.00 85.07  ? 52   GLN A CG    1 
ATOM   252  C  CD    . GLN A 1 57  ? 18.230  -10.655 24.327  1.00 93.64  ? 52   GLN A CD    1 
ATOM   253  O  OE1   . GLN A 1 57  ? 19.305  -11.139 24.701  1.00 102.87 ? 52   GLN A OE1   1 
ATOM   254  N  NE2   . GLN A 1 57  ? 17.255  -11.400 23.793  1.00 87.95  ? 52   GLN A NE2   1 
ATOM   255  N  N     . HIS A 1 58  ? 16.876  -6.836  20.946  1.00 61.02  ? 53   HIS A N     1 
ATOM   256  C  CA    . HIS A 1 58  ? 15.658  -6.109  20.605  1.00 65.69  ? 53   HIS A CA    1 
ATOM   257  C  C     . HIS A 1 58  ? 14.938  -6.876  19.500  1.00 63.32  ? 53   HIS A C     1 
ATOM   258  O  O     . HIS A 1 58  ? 15.561  -7.294  18.524  1.00 75.00  ? 53   HIS A O     1 
ATOM   259  C  CB    . HIS A 1 58  ? 16.083  -4.698  20.169  1.00 75.89  ? 53   HIS A CB    1 
ATOM   260  C  CG    . HIS A 1 58  ? 14.967  -3.740  19.869  1.00 96.44  ? 53   HIS A CG    1 
ATOM   261  N  ND1   . HIS A 1 58  ? 14.629  -3.368  18.581  1.00 112.17 ? 53   HIS A ND1   1 
ATOM   262  C  CD2   . HIS A 1 58  ? 14.185  -2.995  20.686  1.00 102.02 ? 53   HIS A CD2   1 
ATOM   263  C  CE1   . HIS A 1 58  ? 13.650  -2.478  18.616  1.00 98.48  ? 53   HIS A CE1   1 
ATOM   264  N  NE2   . HIS A 1 58  ? 13.364  -2.233  19.881  1.00 95.62  ? 53   HIS A NE2   1 
ATOM   265  N  N     . TYR A 1 59  ? 13.633  -7.085  19.668  1.00 55.43  ? 54   TYR A N     1 
ATOM   266  C  CA    . TYR A 1 59  ? 12.814  -7.815  18.685  1.00 51.04  ? 54   TYR A CA    1 
ATOM   267  C  C     . TYR A 1 59  ? 12.086  -6.867  17.736  1.00 53.69  ? 54   TYR A C     1 
ATOM   268  O  O     . TYR A 1 59  ? 11.295  -6.027  18.140  1.00 59.55  ? 54   TYR A O     1 
ATOM   269  C  CB    . TYR A 1 59  ? 11.791  -8.696  19.399  1.00 48.10  ? 54   TYR A CB    1 
ATOM   270  C  CG    . TYR A 1 59  ? 10.843  -9.539  18.538  1.00 45.23  ? 54   TYR A CG    1 
ATOM   271  C  CD1   . TYR A 1 59  ? 11.142  -9.899  17.258  1.00 47.64  ? 54   TYR A CD1   1 
ATOM   272  C  CD2   . TYR A 1 59  ? 9.654   -10.003 19.062  1.00 44.54  ? 54   TYR A CD2   1 
ATOM   273  C  CE1   . TYR A 1 59  ? 10.265  -10.689 16.520  1.00 48.49  ? 54   TYR A CE1   1 
ATOM   274  C  CE2   . TYR A 1 59  ? 8.782   -10.801 18.346  1.00 42.77  ? 54   TYR A CE2   1 
ATOM   275  C  CZ    . TYR A 1 59  ? 9.079   -11.146 17.075  1.00 43.27  ? 54   TYR A CZ    1 
ATOM   276  O  OH    . TYR A 1 59  ? 8.200   -11.949 16.408  1.00 32.47  ? 54   TYR A OH    1 
ATOM   277  N  N     . ARG A 1 60  ? 12.311  -7.045  16.454  1.00 57.89  ? 55   ARG A N     1 
ATOM   278  C  CA    . ARG A 1 60  ? 11.496  -6.378  15.480  1.00 56.90  ? 55   ARG A CA    1 
ATOM   279  C  C     . ARG A 1 60  ? 10.936  -7.430  14.546  1.00 56.53  ? 55   ARG A C     1 
ATOM   280  O  O     . ARG A 1 60  ? 11.665  -8.043  13.784  1.00 65.01  ? 55   ARG A O     1 
ATOM   281  C  CB    . ARG A 1 60  ? 12.294  -5.321  14.747  1.00 55.69  ? 55   ARG A CB    1 
ATOM   282  C  CG    . ARG A 1 60  ? 11.693  -3.985  15.018  1.00 69.69  ? 55   ARG A CG    1 
ATOM   283  C  CD    . ARG A 1 60  ? 12.612  -2.824  14.802  1.00 80.36  ? 55   ARG A CD    1 
ATOM   284  N  NE    . ARG A 1 60  ? 12.067  -1.925  13.788  1.00 91.91  ? 55   ARG A NE    1 
ATOM   285  C  CZ    . ARG A 1 60  ? 12.737  -0.876  13.337  1.00 115.28 ? 55   ARG A CZ    1 
ATOM   286  N  NH1   . ARG A 1 60  ? 13.941  -0.598  13.836  1.00 129.27 ? 55   ARG A NH1   1 
ATOM   287  N  NH2   . ARG A 1 60  ? 12.209  -0.096  12.408  1.00 121.36 ? 55   ARG A NH2   1 
ATOM   288  N  N     . ALA A 1 61  ? 9.631   -7.653  14.632  1.00 56.46  ? 56   ALA A N     1 
ATOM   289  C  CA    . ALA A 1 61  ? 8.993   -8.712  13.882  1.00 53.71  ? 56   ALA A CA    1 
ATOM   290  C  C     . ALA A 1 61  ? 9.137   -8.402  12.419  1.00 50.56  ? 56   ALA A C     1 
ATOM   291  O  O     . ALA A 1 61  ? 9.000   -7.242  11.991  1.00 48.53  ? 56   ALA A O     1 
ATOM   292  C  CB    . ALA A 1 61  ? 7.528   -8.838  14.248  1.00 53.14  ? 56   ALA A CB    1 
ATOM   293  N  N     . THR A 1 62  ? 9.420   -9.452  11.668  1.00 46.21  ? 57   THR A N     1 
ATOM   294  C  CA    . THR A 1 62  ? 9.637   -9.341  10.253  1.00 45.63  ? 57   THR A CA    1 
ATOM   295  C  C     . THR A 1 62  ? 8.318   -9.075  9.553   1.00 43.92  ? 57   THR A C     1 
ATOM   296  O  O     . THR A 1 62  ? 7.315   -9.714  9.861   1.00 44.69  ? 57   THR A O     1 
ATOM   297  C  CB    . THR A 1 62  ? 10.368  -10.592 9.772   1.00 44.36  ? 57   THR A CB    1 
ATOM   298  O  OG1   . THR A 1 62  ? 11.680  -10.533 10.321  1.00 39.34  ? 57   THR A OG1   1 
ATOM   299  C  CG2   . THR A 1 62  ? 10.464  -10.653 8.264   1.00 45.45  ? 57   THR A CG2   1 
ATOM   300  N  N     . ILE A 1 63  ? 8.326   -8.091  8.648   1.00 44.29  ? 58   ILE A N     1 
ATOM   301  C  CA    . ILE A 1 63  ? 7.159   -7.741  7.808   1.00 43.23  ? 58   ILE A CA    1 
ATOM   302  C  C     . ILE A 1 63  ? 7.202   -8.541  6.504   1.00 41.36  ? 58   ILE A C     1 
ATOM   303  O  O     . ILE A 1 63  ? 7.951   -8.207  5.589   1.00 35.80  ? 58   ILE A O     1 
ATOM   304  C  CB    . ILE A 1 63  ? 7.117   -6.242  7.390   1.00 43.23  ? 58   ILE A CB    1 
ATOM   305  C  CG1   . ILE A 1 63  ? 7.412   -5.301  8.535   1.00 45.25  ? 58   ILE A CG1   1 
ATOM   306  C  CG2   . ILE A 1 63  ? 5.744   -5.890  6.861   1.00 45.65  ? 58   ILE A CG2   1 
ATOM   307  C  CD1   . ILE A 1 63  ? 6.519   -5.480  9.749   1.00 46.91  ? 58   ILE A CD1   1 
ATOM   308  N  N     . GLY A 1 64  ? 6.402   -9.600  6.438   1.00 44.82  ? 59   GLY A N     1 
ATOM   309  C  CA    . GLY A 1 64  ? 6.356   -10.470 5.259   1.00 45.92  ? 59   GLY A CA    1 
ATOM   310  C  C     . GLY A 1 64  ? 7.632   -11.270 5.008   1.00 44.67  ? 59   GLY A C     1 
ATOM   311  O  O     . GLY A 1 64  ? 7.793   -12.351 5.557   1.00 41.98  ? 59   GLY A O     1 
ATOM   312  N  N     . VAL A 1 65  ? 8.531   -10.745 4.175   1.00 41.59  ? 60   VAL A N     1 
ATOM   313  C  CA    . VAL A 1 65  ? 9.744   -11.453 3.853   1.00 42.21  ? 60   VAL A CA    1 
ATOM   314  C  C     . VAL A 1 65  ? 10.943  -10.536 3.844   1.00 42.64  ? 60   VAL A C     1 
ATOM   315  O  O     . VAL A 1 65  ? 10.932  -9.479  3.236   1.00 43.40  ? 60   VAL A O     1 
ATOM   316  C  CB    . VAL A 1 65  ? 9.716   -12.073 2.458   1.00 43.52  ? 60   VAL A CB    1 
ATOM   317  C  CG1   . VAL A 1 65  ? 11.011  -12.801 2.199   1.00 45.96  ? 60   VAL A CG1   1 
ATOM   318  C  CG2   . VAL A 1 65  ? 8.577   -13.051 2.301   1.00 47.63  ? 60   VAL A CG2   1 
ATOM   319  N  N     . ASP A 1 66  ? 12.010  -11.023 4.448   1.00 41.27  ? 61   ASP A N     1 
ATOM   320  C  CA    . ASP A 1 66  ? 13.298  -10.386 4.393   1.00 41.79  ? 61   ASP A CA    1 
ATOM   321  C  C     . ASP A 1 66  ? 14.334  -11.284 3.692   1.00 45.12  ? 61   ASP A C     1 
ATOM   322  O  O     . ASP A 1 66  ? 14.167  -12.499 3.592   1.00 41.57  ? 61   ASP A O     1 
ATOM   323  C  CB    . ASP A 1 66  ? 13.750  -10.069 5.818   1.00 42.04  ? 61   ASP A CB    1 
ATOM   324  C  CG    . ASP A 1 66  ? 14.712  -8.927  5.883   1.00 43.14  ? 61   ASP A CG    1 
ATOM   325  O  OD1   . ASP A 1 66  ? 15.070  -8.401  4.812   1.00 46.42  ? 61   ASP A OD1   1 
ATOM   326  O  OD2   . ASP A 1 66  ? 15.095  -8.535  6.990   1.00 42.64  ? 61   ASP A OD2   1 
ATOM   327  N  N     . PHE A 1 67  ? 15.398  -10.653 3.197   1.00 46.62  ? 62   PHE A N     1 
ATOM   328  C  CA    . PHE A 1 67  ? 16.390  -11.310 2.377   1.00 43.53  ? 62   PHE A CA    1 
ATOM   329  C  C     . PHE A 1 67  ? 17.766  -10.970 2.888   1.00 46.09  ? 62   PHE A C     1 
ATOM   330  O  O     . PHE A 1 67  ? 17.992  -9.858  3.389   1.00 47.93  ? 62   PHE A O     1 
ATOM   331  C  CB    . PHE A 1 67  ? 16.287  -10.829 0.941   1.00 44.70  ? 62   PHE A CB    1 
ATOM   332  C  CG    . PHE A 1 67  ? 14.944  -11.045 0.318   1.00 44.01  ? 62   PHE A CG    1 
ATOM   333  C  CD1   . PHE A 1 67  ? 13.976  -10.091 0.425   1.00 43.98  ? 62   PHE A CD1   1 
ATOM   334  C  CD2   . PHE A 1 67  ? 14.660  -12.207 -0.393  1.00 45.67  ? 62   PHE A CD2   1 
ATOM   335  C  CE1   . PHE A 1 67  ? 12.739  -10.276 -0.161  1.00 47.25  ? 62   PHE A CE1   1 
ATOM   336  C  CE2   . PHE A 1 67  ? 13.416  -12.405 -0.983  1.00 44.71  ? 62   PHE A CE2   1 
ATOM   337  C  CZ    . PHE A 1 67  ? 12.454  -11.435 -0.871  1.00 44.21  ? 62   PHE A CZ    1 
ATOM   338  N  N     . ALA A 1 68  ? 18.705  -11.905 2.736   1.00 47.33  ? 63   ALA A N     1 
ATOM   339  C  CA    . ALA A 1 68  ? 20.136  -11.578 2.873   1.00 45.87  ? 63   ALA A CA    1 
ATOM   340  C  C     . ALA A 1 68  ? 20.991  -12.509 2.054   1.00 46.56  ? 63   ALA A C     1 
ATOM   341  O  O     . ALA A 1 68  ? 20.552  -13.608 1.722   1.00 43.12  ? 63   ALA A O     1 
ATOM   342  C  CB    . ALA A 1 68  ? 20.555  -11.619 4.317   1.00 43.92  ? 63   ALA A CB    1 
ATOM   343  N  N     . LEU A 1 69  ? 22.181  -12.014 1.676   1.00 52.55  ? 64   LEU A N     1 
ATOM   344  C  CA    . LEU A 1 69  ? 23.094  -12.682 0.724   1.00 53.06  ? 64   LEU A CA    1 
ATOM   345  C  C     . LEU A 1 69  ? 24.328  -13.091 1.452   1.00 57.55  ? 64   LEU A C     1 
ATOM   346  O  O     . LEU A 1 69  ? 24.938  -12.280 2.152   1.00 61.74  ? 64   LEU A O     1 
ATOM   347  C  CB    . LEU A 1 69  ? 23.525  -11.760 -0.407  1.00 54.09  ? 64   LEU A CB    1 
ATOM   348  C  CG    . LEU A 1 69  ? 24.457  -12.407 -1.448  1.00 60.63  ? 64   LEU A CG    1 
ATOM   349  C  CD1   . LEU A 1 69  ? 23.760  -13.459 -2.307  1.00 62.23  ? 64   LEU A CD1   1 
ATOM   350  C  CD2   . LEU A 1 69  ? 25.064  -11.333 -2.342  1.00 61.31  ? 64   LEU A CD2   1 
ATOM   351  N  N     . LYS A 1 70  ? 24.698  -14.349 1.297   1.00 61.56  ? 65   LYS A N     1 
ATOM   352  C  CA    . LYS A 1 70  ? 25.918  -14.848 1.889   1.00 63.36  ? 65   LYS A CA    1 
ATOM   353  C  C     . LYS A 1 70  ? 26.828  -15.396 0.806   1.00 68.36  ? 65   LYS A C     1 
ATOM   354  O  O     . LYS A 1 70  ? 26.396  -16.179 -0.047  1.00 75.83  ? 65   LYS A O     1 
ATOM   355  C  CB    . LYS A 1 70  ? 25.581  -15.937 2.875   1.00 61.92  ? 65   LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 70  ? 26.785  -16.608 3.496   1.00 66.02  ? 65   LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 70  ? 27.389  -15.770 4.598   1.00 69.13  ? 65   LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 70  ? 28.637  -16.426 5.133   1.00 68.11  ? 65   LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 70  ? 29.287  -15.553 6.141   1.00 71.67  ? 65   LYS A NZ    1 
ATOM   360  N  N     . VAL A 1 71  ? 28.089  -14.984 0.840   1.00 70.23  ? 66   VAL A N     1 
ATOM   361  C  CA    . VAL A 1 71  ? 29.059  -15.434 -0.143  1.00 76.52  ? 66   VAL A CA    1 
ATOM   362  C  C     . VAL A 1 71  ? 30.108  -16.342 0.498   1.00 77.97  ? 66   VAL A C     1 
ATOM   363  O  O     . VAL A 1 71  ? 30.622  -16.041 1.558   1.00 76.12  ? 66   VAL A O     1 
ATOM   364  C  CB    . VAL A 1 71  ? 29.742  -14.239 -0.823  1.00 73.58  ? 66   VAL A CB    1 
ATOM   365  C  CG1   . VAL A 1 71  ? 30.660  -14.736 -1.912  1.00 76.91  ? 66   VAL A CG1   1 
ATOM   366  C  CG2   . VAL A 1 71  ? 28.711  -13.312 -1.451  1.00 76.12  ? 66   VAL A CG2   1 
ATOM   367  N  N     . LEU A 1 72  ? 30.410  -17.456 -0.158  1.00 84.14  ? 67   LEU A N     1 
ATOM   368  C  CA    . LEU A 1 72  ? 31.246  -18.511 0.421   1.00 91.95  ? 67   LEU A CA    1 
ATOM   369  C  C     . LEU A 1 72  ? 32.378  -18.899 -0.527  1.00 107.30 ? 67   LEU A C     1 
ATOM   370  O  O     . LEU A 1 72  ? 32.131  -19.263 -1.687  1.00 120.95 ? 67   LEU A O     1 
ATOM   371  C  CB    . LEU A 1 72  ? 30.415  -19.763 0.680   1.00 85.85  ? 67   LEU A CB    1 
ATOM   372  C  CG    . LEU A 1 72  ? 29.740  -19.787 2.051   1.00 79.74  ? 67   LEU A CG    1 
ATOM   373  C  CD1   . LEU A 1 72  ? 28.583  -18.822 1.991   1.00 88.63  ? 67   LEU A CD1   1 
ATOM   374  C  CD2   . LEU A 1 72  ? 29.280  -21.172 2.511   1.00 73.75  ? 67   LEU A CD2   1 
ATOM   375  N  N     . ASN A 1 73  ? 33.609  -18.877 -0.025  1.00 108.20 ? 68   ASN A N     1 
ATOM   376  C  CA    . ASN A 1 73  ? 34.709  -19.554 -0.707  1.00 103.98 ? 68   ASN A CA    1 
ATOM   377  C  C     . ASN A 1 73  ? 34.775  -21.013 -0.312  1.00 92.85  ? 68   ASN A C     1 
ATOM   378  O  O     . ASN A 1 73  ? 35.291  -21.357 0.749   1.00 94.14  ? 68   ASN A O     1 
ATOM   379  C  CB    . ASN A 1 73  ? 36.032  -18.844 -0.421  1.00 106.41 ? 68   ASN A CB    1 
ATOM   380  C  CG    . ASN A 1 73  ? 36.105  -17.478 -1.082  1.00 108.95 ? 68   ASN A CG    1 
ATOM   381  O  OD1   . ASN A 1 73  ? 35.658  -17.302 -2.212  1.00 101.51 ? 68   ASN A OD1   1 
ATOM   382  N  ND2   . ASN A 1 73  ? 36.660  -16.502 -0.375  1.00 119.59 ? 68   ASN A ND2   1 
ATOM   383  N  N     . TRP A 1 74  ? 34.243  -21.871 -1.173  1.00 85.18  ? 69   TRP A N     1 
ATOM   384  C  CA    . TRP A 1 74  ? 33.977  -23.251 -0.798  1.00 90.35  ? 69   TRP A CA    1 
ATOM   385  C  C     . TRP A 1 74  ? 35.181  -24.177 -1.096  1.00 95.53  ? 69   TRP A C     1 
ATOM   386  O  O     . TRP A 1 74  ? 35.773  -24.711 -0.159  1.00 83.41  ? 69   TRP A O     1 
ATOM   387  C  CB    . TRP A 1 74  ? 32.707  -23.732 -1.487  1.00 84.61  ? 69   TRP A CB    1 
ATOM   388  C  CG    . TRP A 1 74  ? 32.256  -25.124 -1.071  1.00 86.35  ? 69   TRP A CG    1 
ATOM   389  C  CD1   . TRP A 1 74  ? 32.379  -26.256 -1.798  1.00 93.55  ? 69   TRP A CD1   1 
ATOM   390  C  CD2   . TRP A 1 74  ? 31.589  -25.502 0.142   1.00 92.11  ? 69   TRP A CD2   1 
ATOM   391  N  NE1   . TRP A 1 74  ? 31.839  -27.331 -1.117  1.00 94.70  ? 69   TRP A NE1   1 
ATOM   392  C  CE2   . TRP A 1 74  ? 31.340  -26.896 0.076   1.00 91.65  ? 69   TRP A CE2   1 
ATOM   393  C  CE3   . TRP A 1 74  ? 31.173  -24.799 1.267   1.00 99.82  ? 69   TRP A CE3   1 
ATOM   394  C  CZ2   . TRP A 1 74  ? 30.685  -27.600 1.098   1.00 90.78  ? 69   TRP A CZ2   1 
ATOM   395  C  CZ3   . TRP A 1 74  ? 30.526  -25.496 2.284   1.00 99.81  ? 69   TRP A CZ3   1 
ATOM   396  C  CH2   . TRP A 1 74  ? 30.290  -26.879 2.191   1.00 95.61  ? 69   TRP A CH2   1 
ATOM   397  N  N     . ASP A 1 75  ? 35.521  -24.363 -2.384  1.00 100.48 ? 70   ASP A N     1 
ATOM   398  C  CA    . ASP A 1 75  ? 36.872  -24.766 -2.811  1.00 93.24  ? 70   ASP A CA    1 
ATOM   399  C  C     . ASP A 1 75  ? 37.684  -23.516 -3.087  1.00 104.29 ? 70   ASP A C     1 
ATOM   400  O  O     . ASP A 1 75  ? 37.312  -22.422 -2.675  1.00 104.49 ? 70   ASP A O     1 
ATOM   401  C  CB    . ASP A 1 75  ? 36.864  -25.621 -4.093  1.00 91.79  ? 70   ASP A CB    1 
ATOM   402  C  CG    . ASP A 1 75  ? 35.822  -26.714 -4.086  1.00 97.10  ? 70   ASP A CG    1 
ATOM   403  O  OD1   . ASP A 1 75  ? 35.693  -27.393 -3.042  1.00 102.33 ? 70   ASP A OD1   1 
ATOM   404  O  OD2   . ASP A 1 75  ? 35.132  -26.897 -5.124  1.00 91.32  ? 70   ASP A OD2   1 
ATOM   405  N  N     . SER A 1 76  ? 38.784  -23.676 -3.816  1.00 121.40 ? 71   SER A N     1 
ATOM   406  C  CA    . SER A 1 76  ? 39.247  -22.662 -4.776  1.00 118.46 ? 71   SER A CA    1 
ATOM   407  C  C     . SER A 1 76  ? 38.664  -22.861 -6.165  1.00 119.60 ? 71   SER A C     1 
ATOM   408  O  O     . SER A 1 76  ? 38.506  -21.901 -6.906  1.00 121.03 ? 71   SER A O     1 
ATOM   409  C  CB    . SER A 1 76  ? 40.771  -22.677 -4.872  1.00 113.48 ? 71   SER A CB    1 
ATOM   410  O  OG    . SER A 1 76  ? 41.311  -23.494 -3.844  1.00 111.99 ? 71   SER A OG    1 
ATOM   411  N  N     . ARG A 1 77  ? 38.354  -24.105 -6.519  1.00 119.79 ? 72   ARG A N     1 
ATOM   412  C  CA    . ARG A 1 77  ? 37.517  -24.386 -7.691  1.00 120.63 ? 72   ARG A CA    1 
ATOM   413  C  C     . ARG A 1 77  ? 36.234  -23.544 -7.692  1.00 111.51 ? 72   ARG A C     1 
ATOM   414  O  O     . ARG A 1 77  ? 35.867  -22.956 -8.722  1.00 108.94 ? 72   ARG A O     1 
ATOM   415  C  CB    . ARG A 1 77  ? 37.166  -25.875 -7.757  1.00 129.13 ? 72   ARG A CB    1 
ATOM   416  C  CG    . ARG A 1 77  ? 38.357  -26.811 -7.804  1.00 130.96 ? 72   ARG A CG    1 
ATOM   417  C  CD    . ARG A 1 77  ? 38.195  -27.840 -6.698  1.00 133.64 ? 72   ARG A CD    1 
ATOM   418  N  NE    . ARG A 1 77  ? 39.189  -28.905 -6.698  1.00 135.65 ? 72   ARG A NE    1 
ATOM   419  C  CZ    . ARG A 1 77  ? 39.172  -29.947 -5.860  1.00 141.03 ? 72   ARG A CZ    1 
ATOM   420  N  NH1   . ARG A 1 77  ? 38.194  -30.101 -4.970  1.00 142.60 ? 72   ARG A NH1   1 
ATOM   421  N  NH2   . ARG A 1 77  ? 40.132  -30.861 -5.921  1.00 141.03 ? 72   ARG A NH2   1 
ATOM   422  N  N     . THR A 1 78  ? 35.565  -23.476 -6.540  1.00 105.84 ? 73   THR A N     1 
ATOM   423  C  CA    . THR A 1 78  ? 34.121  -23.169 -6.507  1.00 101.91 ? 73   THR A CA    1 
ATOM   424  C  C     . THR A 1 78  ? 33.767  -22.185 -5.378  1.00 99.77  ? 73   THR A C     1 
ATOM   425  O  O     . THR A 1 78  ? 34.435  -22.102 -4.330  1.00 100.86 ? 73   THR A O     1 
ATOM   426  C  CB    . THR A 1 78  ? 33.166  -24.406 -6.539  1.00 96.74  ? 73   THR A CB    1 
ATOM   427  O  OG1   . THR A 1 78  ? 33.294  -25.175 -5.350  1.00 88.57  ? 73   THR A OG1   1 
ATOM   428  C  CG2   . THR A 1 78  ? 33.409  -25.315 -7.780  1.00 95.51  ? 73   THR A CG2   1 
ATOM   429  N  N     . LEU A 1 79  ? 32.738  -21.394 -5.652  1.00 97.69  ? 74   LEU A N     1 
ATOM   430  C  CA    . LEU A 1 79  ? 32.239  -20.393 -4.725  1.00 94.77  ? 74   LEU A CA    1 
ATOM   431  C  C     . LEU A 1 79  ? 30.700  -20.415 -4.761  1.00 96.05  ? 74   LEU A C     1 
ATOM   432  O  O     . LEU A 1 79  ? 30.104  -20.694 -5.811  1.00 97.25  ? 74   LEU A O     1 
ATOM   433  C  CB    . LEU A 1 79  ? 32.834  -19.029 -5.095  1.00 89.77  ? 74   LEU A CB    1 
ATOM   434  C  CG    . LEU A 1 79  ? 32.041  -17.727 -4.924  1.00 91.72  ? 74   LEU A CG    1 
ATOM   435  C  CD1   . LEU A 1 79  ? 32.964  -16.557 -4.579  1.00 90.89  ? 74   LEU A CD1   1 
ATOM   436  C  CD2   . LEU A 1 79  ? 31.244  -17.405 -6.177  1.00 88.79  ? 74   LEU A CD2   1 
ATOM   437  N  N     . VAL A 1 80  ? 30.063  -20.144 -3.614  1.00 93.16  ? 75   VAL A N     1 
ATOM   438  C  CA    . VAL A 1 80  ? 28.579  -20.225 -3.500  1.00 86.92  ? 75   VAL A CA    1 
ATOM   439  C  C     . VAL A 1 80  ? 27.954  -18.931 -2.954  1.00 80.81  ? 75   VAL A C     1 
ATOM   440  O  O     . VAL A 1 80  ? 28.291  -18.441 -1.864  1.00 73.49  ? 75   VAL A O     1 
ATOM   441  C  CB    . VAL A 1 80  ? 28.026  -21.497 -2.807  1.00 87.43  ? 75   VAL A CB    1 
ATOM   442  C  CG1   . VAL A 1 80  ? 29.016  -22.663 -2.814  1.00 84.16  ? 75   VAL A CG1   1 
ATOM   443  C  CG2   . VAL A 1 80  ? 27.538  -21.204 -1.411  1.00 86.28  ? 75   VAL A CG2   1 
ATOM   444  N  N     . ARG A 1 81  ? 27.071  -18.363 -3.765  1.00 83.70  ? 76   ARG A N     1 
ATOM   445  C  CA    . ARG A 1 81  ? 26.147  -17.333 -3.314  1.00 85.67  ? 76   ARG A CA    1 
ATOM   446  C  C     . ARG A 1 81  ? 24.918  -17.966 -2.676  1.00 77.50  ? 76   ARG A C     1 
ATOM   447  O  O     . ARG A 1 81  ? 24.255  -18.823 -3.263  1.00 76.21  ? 76   ARG A O     1 
ATOM   448  C  CB    . ARG A 1 81  ? 25.722  -16.451 -4.476  1.00 91.92  ? 76   ARG A CB    1 
ATOM   449  C  CG    . ARG A 1 81  ? 26.873  -15.662 -5.056  1.00 102.92 ? 76   ARG A CG    1 
ATOM   450  C  CD    . ARG A 1 81  ? 26.438  -14.490 -5.929  1.00 106.36 ? 76   ARG A CD    1 
ATOM   451  N  NE    . ARG A 1 81  ? 27.374  -13.384 -5.742  1.00 107.14 ? 76   ARG A NE    1 
ATOM   452  C  CZ    . ARG A 1 81  ? 28.666  -13.416 -6.083  1.00 115.80 ? 76   ARG A CZ    1 
ATOM   453  N  NH1   . ARG A 1 81  ? 29.202  -14.481 -6.683  1.00 118.47 ? 76   ARG A NH1   1 
ATOM   454  N  NH2   . ARG A 1 81  ? 29.433  -12.363 -5.840  1.00 118.97 ? 76   ARG A NH2   1 
ATOM   455  N  N     . LEU A 1 82  ? 24.627  -17.523 -1.463  1.00 70.00  ? 77   LEU A N     1 
ATOM   456  C  CA    . LEU A 1 82  ? 23.506  -18.013 -0.696  1.00 60.27  ? 77   LEU A CA    1 
ATOM   457  C  C     . LEU A 1 82  ? 22.462  -16.924 -0.531  1.00 58.33  ? 77   LEU A C     1 
ATOM   458  O  O     . LEU A 1 82  ? 22.702  -15.926 0.175   1.00 52.97  ? 77   LEU A O     1 
ATOM   459  C  CB    . LEU A 1 82  ? 24.006  -18.444 0.653   1.00 58.76  ? 77   LEU A CB    1 
ATOM   460  C  CG    . LEU A 1 82  ? 23.496  -19.791 1.106   1.00 59.66  ? 77   LEU A CG    1 
ATOM   461  C  CD1   . LEU A 1 82  ? 23.684  -20.836 0.047   1.00 60.47  ? 77   LEU A CD1   1 
ATOM   462  C  CD2   . LEU A 1 82  ? 24.262  -20.191 2.344   1.00 59.51  ? 77   LEU A CD2   1 
ATOM   463  N  N     . GLN A 1 83  ? 21.330  -17.094 -1.221  1.00 56.50  ? 78   GLN A N     1 
ATOM   464  C  CA    . GLN A 1 83  ? 20.174  -16.199 -1.077  1.00 58.32  ? 78   GLN A CA    1 
ATOM   465  C  C     . GLN A 1 83  ? 19.327  -16.685 0.080   1.00 53.35  ? 78   GLN A C     1 
ATOM   466  O  O     . GLN A 1 83  ? 18.701  -17.743 -0.014  1.00 50.14  ? 78   GLN A O     1 
ATOM   467  C  CB    . GLN A 1 83  ? 19.299  -16.246 -2.310  1.00 64.63  ? 78   GLN A CB    1 
ATOM   468  C  CG    . GLN A 1 83  ? 19.801  -15.467 -3.499  1.00 70.08  ? 78   GLN A CG    1 
ATOM   469  C  CD    . GLN A 1 83  ? 18.681  -15.096 -4.457  1.00 73.58  ? 78   GLN A CD    1 
ATOM   470  O  OE1   . GLN A 1 83  ? 18.789  -14.077 -5.125  1.00 92.92  ? 78   GLN A OE1   1 
ATOM   471  N  NE2   . GLN A 1 83  ? 17.618  -15.922 -4.557  1.00 70.31  ? 78   GLN A NE2   1 
ATOM   472  N  N     . LEU A 1 84  ? 19.328  -15.933 1.170   1.00 49.41  ? 79   LEU A N     1 
ATOM   473  C  CA    . LEU A 1 84  ? 18.618  -16.342 2.364   1.00 49.46  ? 79   LEU A CA    1 
ATOM   474  C  C     . LEU A 1 84  ? 17.256  -15.632 2.483   1.00 48.69  ? 79   LEU A C     1 
ATOM   475  O  O     . LEU A 1 84  ? 17.193  -14.407 2.575   1.00 44.80  ? 79   LEU A O     1 
ATOM   476  C  CB    . LEU A 1 84  ? 19.472  -16.086 3.605   1.00 50.52  ? 79   LEU A CB    1 
ATOM   477  C  CG    . LEU A 1 84  ? 20.685  -17.017 3.774   1.00 52.72  ? 79   LEU A CG    1 
ATOM   478  C  CD1   . LEU A 1 84  ? 21.511  -16.569 4.962   1.00 54.04  ? 79   LEU A CD1   1 
ATOM   479  C  CD2   . LEU A 1 84  ? 20.276  -18.473 3.959   1.00 57.64  ? 79   LEU A CD2   1 
ATOM   480  N  N     . TRP A 1 85  ? 16.191  -16.429 2.456   1.00 45.80  ? 80   TRP A N     1 
ATOM   481  C  CA    . TRP A 1 85  ? 14.833  -15.930 2.417   1.00 47.12  ? 80   TRP A CA    1 
ATOM   482  C  C     . TRP A 1 85  ? 14.224  -16.074 3.783   1.00 45.72  ? 80   TRP A C     1 
ATOM   483  O  O     . TRP A 1 85  ? 13.699  -17.136 4.159   1.00 48.88  ? 80   TRP A O     1 
ATOM   484  C  CB    . TRP A 1 85  ? 13.988  -16.681 1.386   1.00 50.84  ? 80   TRP A CB    1 
ATOM   485  C  CG    . TRP A 1 85  ? 14.256  -16.286 -0.058  1.00 53.41  ? 80   TRP A CG    1 
ATOM   486  C  CD1   . TRP A 1 85  ? 15.458  -16.262 -0.689  1.00 54.93  ? 80   TRP A CD1   1 
ATOM   487  C  CD2   . TRP A 1 85  ? 13.291  -15.903 -1.032  1.00 54.17  ? 80   TRP A CD2   1 
ATOM   488  N  NE1   . TRP A 1 85  ? 15.306  -15.883 -2.001  1.00 57.57  ? 80   TRP A NE1   1 
ATOM   489  C  CE2   . TRP A 1 85  ? 13.985  -15.643 -2.234  1.00 54.34  ? 80   TRP A CE2   1 
ATOM   490  C  CE3   . TRP A 1 85  ? 11.909  -15.749 -1.008  1.00 56.11  ? 80   TRP A CE3   1 
ATOM   491  C  CZ2   . TRP A 1 85  ? 13.348  -15.238 -3.400  1.00 56.32  ? 80   TRP A CZ2   1 
ATOM   492  C  CZ3   . TRP A 1 85  ? 11.275  -15.348 -2.170  1.00 61.25  ? 80   TRP A CZ3   1 
ATOM   493  C  CH2   . TRP A 1 85  ? 11.998  -15.102 -3.355  1.00 56.87  ? 80   TRP A CH2   1 
ATOM   494  N  N     . ASP A 1 86  ? 14.313  -14.985 4.529   1.00 44.47  ? 81   ASP A N     1 
ATOM   495  C  CA    . ASP A 1 86  ? 13.831  -14.914 5.891   1.00 44.14  ? 81   ASP A CA    1 
ATOM   496  C  C     . ASP A 1 86  ? 12.322  -14.710 5.843   1.00 45.91  ? 81   ASP A C     1 
ATOM   497  O  O     . ASP A 1 86  ? 11.835  -13.647 5.509   1.00 53.15  ? 81   ASP A O     1 
ATOM   498  C  CB    . ASP A 1 86  ? 14.533  -13.751 6.587   1.00 42.85  ? 81   ASP A CB    1 
ATOM   499  C  CG    . ASP A 1 86  ? 14.143  -13.591 8.013   1.00 43.90  ? 81   ASP A CG    1 
ATOM   500  O  OD1   . ASP A 1 86  ? 13.341  -14.412 8.508   1.00 47.67  ? 81   ASP A OD1   1 
ATOM   501  O  OD2   . ASP A 1 86  ? 14.646  -12.624 8.641   1.00 41.83  ? 81   ASP A OD2   1 
ATOM   502  N  N     . ILE A 1 87  ? 11.581  -15.729 6.217   1.00 45.60  ? 82   ILE A N     1 
ATOM   503  C  CA    . ILE A 1 87  ? 10.138  -15.662 6.158   1.00 45.14  ? 82   ILE A CA    1 
ATOM   504  C  C     . ILE A 1 87  ? 9.472   -15.500 7.521   1.00 43.34  ? 82   ILE A C     1 
ATOM   505  O  O     . ILE A 1 87  ? 9.723   -16.254 8.444   1.00 43.06  ? 82   ILE A O     1 
ATOM   506  C  CB    . ILE A 1 87  ? 9.615   -16.915 5.505   1.00 45.74  ? 82   ILE A CB    1 
ATOM   507  C  CG1   . ILE A 1 87  ? 10.066  -16.895 4.061   1.00 46.01  ? 82   ILE A CG1   1 
ATOM   508  C  CG2   . ILE A 1 87  ? 8.097   -16.994 5.621   1.00 45.44  ? 82   ILE A CG2   1 
ATOM   509  C  CD1   . ILE A 1 87  ? 9.747   -18.179 3.353   1.00 51.35  ? 82   ILE A CD1   1 
ATOM   510  N  N     . ALA A 1 88  ? 8.605   -14.508 7.623   1.00 45.00  ? 83   ALA A N     1 
ATOM   511  C  CA    . ALA A 1 88  ? 8.093   -14.064 8.909   1.00 45.64  ? 83   ALA A CA    1 
ATOM   512  C  C     . ALA A 1 88  ? 7.181   -15.159 9.451   1.00 45.37  ? 83   ALA A C     1 
ATOM   513  O  O     . ALA A 1 88  ? 6.565   -15.875 8.673   1.00 48.04  ? 83   ALA A O     1 
ATOM   514  C  CB    . ALA A 1 88  ? 7.332   -12.767 8.732   1.00 44.24  ? 83   ALA A CB    1 
ATOM   515  N  N     . GLY A 1 89  ? 7.133   -15.344 10.762  1.00 43.94  ? 84   GLY A N     1 
ATOM   516  C  CA    . GLY A 1 89  ? 6.495   -16.546 11.284  1.00 43.93  ? 84   GLY A CA    1 
ATOM   517  C  C     . GLY A 1 89  ? 4.994   -16.528 11.057  1.00 43.16  ? 84   GLY A C     1 
ATOM   518  O  O     . GLY A 1 89  ? 4.317   -17.565 11.054  1.00 44.83  ? 84   GLY A O     1 
ATOM   519  N  N     . LEU A 1 90  ? 4.485   -15.319 10.930  1.00 41.34  ? 85   LEU A N     1 
ATOM   520  C  CA    . LEU A 1 90  ? 3.084   -15.076 10.720  1.00 42.99  ? 85   LEU A CA    1 
ATOM   521  C  C     . LEU A 1 90  ? 2.631   -15.570 9.363   1.00 45.88  ? 85   LEU A C     1 
ATOM   522  O  O     . LEU A 1 90  ? 1.452   -15.771 9.140   1.00 47.83  ? 85   LEU A O     1 
ATOM   523  C  CB    . LEU A 1 90  ? 2.856   -13.565 10.775  1.00 43.05  ? 85   LEU A CB    1 
ATOM   524  C  CG    . LEU A 1 90  ? 1.460   -13.034 10.548  1.00 42.16  ? 85   LEU A CG    1 
ATOM   525  C  CD1   . LEU A 1 90  ? 0.487   -13.662 11.530  1.00 40.88  ? 85   LEU A CD1   1 
ATOM   526  C  CD2   . LEU A 1 90  ? 1.447   -11.523 10.690  1.00 44.87  ? 85   LEU A CD2   1 
ATOM   527  N  N     . GLU A 1 91  ? 3.559   -15.719 8.429   1.00 49.35  ? 86   GLU A N     1 
ATOM   528  C  CA    . GLU A 1 91  ? 3.189   -15.857 7.033   1.00 47.76  ? 86   GLU A CA    1 
ATOM   529  C  C     . GLU A 1 91  ? 2.584   -17.215 6.722   1.00 43.31  ? 86   GLU A C     1 
ATOM   530  O  O     . GLU A 1 91  ? 2.023   -17.388 5.661   1.00 40.28  ? 86   GLU A O     1 
ATOM   531  C  CB    . GLU A 1 91  ? 4.378   -15.588 6.117   1.00 48.32  ? 86   GLU A CB    1 
ATOM   532  C  CG    . GLU A 1 91  ? 4.702   -14.107 5.993   1.00 54.69  ? 86   GLU A CG    1 
ATOM   533  C  CD    . GLU A 1 91  ? 3.606   -13.307 5.325   1.00 60.52  ? 86   GLU A CD    1 
ATOM   534  O  OE1   . GLU A 1 91  ? 3.167   -13.729 4.223   1.00 60.72  ? 86   GLU A OE1   1 
ATOM   535  O  OE2   . GLU A 1 91  ? 3.178   -12.261 5.900   1.00 73.92  ? 86   GLU A OE2   1 
ATOM   536  N  N     . ARG A 1 92  ? 2.633   -18.163 7.642   1.00 42.08  ? 87   ARG A N     1 
ATOM   537  C  CA    . ARG A 1 92  ? 2.001   -19.441 7.348   1.00 48.36  ? 87   ARG A CA    1 
ATOM   538  C  C     . ARG A 1 92  ? 0.502   -19.417 7.505   1.00 47.11  ? 87   ARG A C     1 
ATOM   539  O  O     . ARG A 1 92  ? -0.160  -20.382 7.124   1.00 48.91  ? 87   ARG A O     1 
ATOM   540  C  CB    . ARG A 1 92  ? 2.612   -20.592 8.158   1.00 55.07  ? 87   ARG A CB    1 
ATOM   541  C  CG    . ARG A 1 92  ? 2.042   -20.853 9.536   1.00 60.27  ? 87   ARG A CG    1 
ATOM   542  C  CD    . ARG A 1 92  ? 2.843   -21.943 10.233  1.00 64.74  ? 87   ARG A CD    1 
ATOM   543  N  NE    . ARG A 1 92  ? 2.552   -21.997 11.669  1.00 70.77  ? 87   ARG A NE    1 
ATOM   544  C  CZ    . ARG A 1 92  ? 1.500   -22.617 12.210  1.00 68.32  ? 87   ARG A CZ    1 
ATOM   545  N  NH1   . ARG A 1 92  ? 0.619   -23.264 11.457  1.00 73.44  ? 87   ARG A NH1   1 
ATOM   546  N  NH2   . ARG A 1 92  ? 1.324   -22.599 13.515  1.00 68.93  ? 87   ARG A NH2   1 
ATOM   547  N  N     . PHE A 1 93  ? -0.033  -18.342 8.069   1.00 44.07  ? 88   PHE A N     1 
ATOM   548  C  CA    . PHE A 1 93  ? -1.469  -18.168 8.133   1.00 45.25  ? 88   PHE A CA    1 
ATOM   549  C  C     . PHE A 1 93  ? -1.995  -17.370 6.960   1.00 48.07  ? 88   PHE A C     1 
ATOM   550  O  O     . PHE A 1 93  ? -3.217  -17.236 6.808   1.00 51.60  ? 88   PHE A O     1 
ATOM   551  C  CB    . PHE A 1 93  ? -1.864  -17.506 9.455   1.00 46.76  ? 88   PHE A CB    1 
ATOM   552  C  CG    . PHE A 1 93  ? -1.370  -18.246 10.654  1.00 47.52  ? 88   PHE A CG    1 
ATOM   553  C  CD1   . PHE A 1 93  ? -1.993  -19.421 11.055  1.00 48.57  ? 88   PHE A CD1   1 
ATOM   554  C  CD2   . PHE A 1 93  ? -0.253  -17.817 11.334  1.00 50.04  ? 88   PHE A CD2   1 
ATOM   555  C  CE1   . PHE A 1 93  ? -1.522  -20.157 12.128  1.00 50.59  ? 88   PHE A CE1   1 
ATOM   556  C  CE2   . PHE A 1 93  ? 0.237   -18.556 12.400  1.00 55.76  ? 88   PHE A CE2   1 
ATOM   557  C  CZ    . PHE A 1 93  ? -0.400  -19.734 12.802  1.00 53.54  ? 88   PHE A CZ    1 
ATOM   558  N  N     . GLY A 1 94  ? -1.086  -16.839 6.138   1.00 47.88  ? 89   GLY A N     1 
ATOM   559  C  CA    . GLY A 1 94  ? -1.452  -16.143 4.904   1.00 50.41  ? 89   GLY A CA    1 
ATOM   560  C  C     . GLY A 1 94  ? -1.427  -17.097 3.727   1.00 54.59  ? 89   GLY A C     1 
ATOM   561  O  O     . GLY A 1 94  ? -1.477  -18.298 3.931   1.00 53.25  ? 89   GLY A O     1 
ATOM   562  N  N     . ASN A 1 95  ? -1.333  -16.573 2.503   1.00 61.59  ? 90   ASN A N     1 
ATOM   563  C  CA    . ASN A 1 95  ? -1.496  -17.395 1.293   1.00 70.01  ? 90   ASN A CA    1 
ATOM   564  C  C     . ASN A 1 95  ? -0.316  -17.346 0.374   1.00 68.51  ? 90   ASN A C     1 
ATOM   565  O  O     . ASN A 1 95  ? -0.420  -17.729 -0.783  1.00 72.13  ? 90   ASN A O     1 
ATOM   566  C  CB    . ASN A 1 95  ? -2.723  -16.951 0.517   1.00 81.90  ? 90   ASN A CB    1 
ATOM   567  C  CG    . ASN A 1 95  ? -3.977  -16.981 1.366   1.00 99.10  ? 90   ASN A CG    1 
ATOM   568  O  OD1   . ASN A 1 95  ? -4.136  -17.841 2.253   1.00 102.25 ? 90   ASN A OD1   1 
ATOM   569  N  ND2   . ASN A 1 95  ? -4.879  -16.036 1.109   1.00 101.56 ? 90   ASN A ND2   1 
ATOM   570  N  N     . MET A 1 96  ? 0.805   -16.872 0.887   1.00 66.48  ? 91   MET A N     1 
ATOM   571  C  CA    . MET A 1 96  ? 1.876   -16.399 0.036   1.00 64.55  ? 91   MET A CA    1 
ATOM   572  C  C     . MET A 1 96  ? 3.026   -17.382 -0.006  1.00 61.44  ? 91   MET A C     1 
ATOM   573  O  O     . MET A 1 96  ? 4.040   -17.119 -0.659  1.00 59.19  ? 91   MET A O     1 
ATOM   574  C  CB    . MET A 1 96  ? 2.378   -15.033 0.515   1.00 68.04  ? 91   MET A CB    1 
ATOM   575  C  CG    . MET A 1 96  ? 1.486   -13.878 0.088   1.00 71.32  ? 91   MET A CG    1 
ATOM   576  S  SD    . MET A 1 96  ? 1.269   -13.814 -1.699  1.00 72.00  ? 91   MET A SD    1 
ATOM   577  C  CE    . MET A 1 96  ? 2.842   -13.097 -2.135  1.00 70.33  ? 91   MET A CE    1 
ATOM   578  N  N     . THR A 1 97  ? 2.896   -18.507 0.688   1.00 60.69  ? 92   THR A N     1 
ATOM   579  C  CA    . THR A 1 97  ? 4.083   -19.299 0.954   1.00 57.55  ? 92   THR A CA    1 
ATOM   580  C  C     . THR A 1 97  ? 4.426   -20.042 -0.315  1.00 59.19  ? 92   THR A C     1 
ATOM   581  O  O     . THR A 1 97  ? 5.609   -20.159 -0.643  1.00 62.91  ? 92   THR A O     1 
ATOM   582  C  CB    . THR A 1 97  ? 3.930   -20.283 2.119   1.00 55.16  ? 92   THR A CB    1 
ATOM   583  O  OG1   . THR A 1 97  ? 2.649   -20.909 2.050   1.00 60.48  ? 92   THR A OG1   1 
ATOM   584  C  CG2   . THR A 1 97  ? 4.070   -19.547 3.406   1.00 52.35  ? 92   THR A CG2   1 
ATOM   585  N  N     . ARG A 1 98  ? 3.406   -20.535 -1.030  1.00 59.64  ? 93   ARG A N     1 
ATOM   586  C  CA    . ARG A 1 98  ? 3.594   -21.088 -2.389  1.00 62.02  ? 93   ARG A CA    1 
ATOM   587  C  C     . ARG A 1 98  ? 4.494   -20.197 -3.237  1.00 57.79  ? 93   ARG A C     1 
ATOM   588  O  O     . ARG A 1 98  ? 5.359   -20.684 -3.951  1.00 62.32  ? 93   ARG A O     1 
ATOM   589  C  CB    . ARG A 1 98  ? 2.265   -21.277 -3.115  1.00 70.78  ? 93   ARG A CB    1 
ATOM   590  C  CG    . ARG A 1 98  ? 1.252   -20.153 -2.835  1.00 83.82  ? 93   ARG A CG    1 
ATOM   591  C  CD    . ARG A 1 98  ? 0.417   -19.699 -4.047  1.00 81.64  ? 93   ARG A CD    1 
ATOM   592  N  NE    . ARG A 1 98  ? -0.443  -18.557 -3.697  1.00 72.57  ? 93   ARG A NE    1 
ATOM   593  C  CZ    . ARG A 1 98  ? -1.100  -17.795 -4.569  1.00 70.21  ? 93   ARG A CZ    1 
ATOM   594  N  NH1   . ARG A 1 98  ? -1.006  -18.026 -5.876  1.00 77.72  ? 93   ARG A NH1   1 
ATOM   595  N  NH2   . ARG A 1 98  ? -1.848  -16.786 -4.134  1.00 59.13  ? 93   ARG A NH2   1 
ATOM   596  N  N     . VAL A 1 99  ? 4.323   -18.893 -3.135  1.00 48.70  ? 94   VAL A N     1 
ATOM   597  C  CA    . VAL A 1 99  ? 5.118   -17.986 -3.932  1.00 50.66  ? 94   VAL A CA    1 
ATOM   598  C  C     . VAL A 1 99  ? 6.538   -17.901 -3.428  1.00 48.09  ? 94   VAL A C     1 
ATOM   599  O  O     . VAL A 1 99  ? 7.480   -17.927 -4.208  1.00 47.15  ? 94   VAL A O     1 
ATOM   600  C  CB    . VAL A 1 99  ? 4.506   -16.585 -3.925  1.00 56.69  ? 94   VAL A CB    1 
ATOM   601  C  CG1   . VAL A 1 99  ? 5.443   -15.576 -4.574  1.00 60.49  ? 94   VAL A CG1   1 
ATOM   602  C  CG2   . VAL A 1 99  ? 3.157   -16.620 -4.642  1.00 58.40  ? 94   VAL A CG2   1 
ATOM   603  N  N     . TYR A 1 100 ? 6.672   -17.787 -2.112  1.00 51.48  ? 95   TYR A N     1 
ATOM   604  C  CA    . TYR A 1 100 ? 7.971   -17.685 -1.442  1.00 50.71  ? 95   TYR A CA    1 
ATOM   605  C  C     . TYR A 1 100 ? 8.841   -18.929 -1.616  1.00 51.53  ? 95   TYR A C     1 
ATOM   606  O  O     . TYR A 1 100 ? 10.067  -18.835 -1.779  1.00 52.18  ? 95   TYR A O     1 
ATOM   607  C  CB    . TYR A 1 100 ? 7.783   -17.504 0.055   1.00 49.04  ? 95   TYR A CB    1 
ATOM   608  C  CG    . TYR A 1 100 ? 6.996   -16.304 0.508   1.00 50.49  ? 95   TYR A CG    1 
ATOM   609  C  CD1   . TYR A 1 100 ? 6.962   -15.143 -0.229  1.00 52.99  ? 95   TYR A CD1   1 
ATOM   610  C  CD2   . TYR A 1 100 ? 6.307   -16.336 1.721   1.00 53.49  ? 95   TYR A CD2   1 
ATOM   611  C  CE1   . TYR A 1 100 ? 6.252   -14.044 0.219   1.00 56.02  ? 95   TYR A CE1   1 
ATOM   612  C  CE2   . TYR A 1 100 ? 5.592   -15.252 2.173   1.00 54.98  ? 95   TYR A CE2   1 
ATOM   613  C  CZ    . TYR A 1 100 ? 5.570   -14.109 1.419   1.00 57.11  ? 95   TYR A CZ    1 
ATOM   614  O  OH    . TYR A 1 100 ? 4.873   -13.022 1.869   1.00 61.70  ? 95   TYR A OH    1 
ATOM   615  N  N     . TYR A 1 101 ? 8.214   -20.095 -1.549  1.00 50.24  ? 96   TYR A N     1 
ATOM   616  C  CA    . TYR A 1 101 ? 8.971   -21.332 -1.575  1.00 52.35  ? 96   TYR A CA    1 
ATOM   617  C  C     . TYR A 1 101 ? 9.506   -21.689 -2.983  1.00 52.95  ? 96   TYR A C     1 
ATOM   618  O  O     . TYR A 1 101 ? 10.396  -22.513 -3.110  1.00 54.20  ? 96   TYR A O     1 
ATOM   619  C  CB    . TYR A 1 101 ? 8.127   -22.491 -1.028  1.00 49.83  ? 96   TYR A CB    1 
ATOM   620  C  CG    . TYR A 1 101 ? 7.707   -22.429 0.418   1.00 44.93  ? 96   TYR A CG    1 
ATOM   621  C  CD1   . TYR A 1 101 ? 8.238   -21.499 1.310   1.00 44.68  ? 96   TYR A CD1   1 
ATOM   622  C  CD2   . TYR A 1 101 ? 6.748   -23.316 0.892   1.00 46.17  ? 96   TYR A CD2   1 
ATOM   623  C  CE1   . TYR A 1 101 ? 7.810   -21.458 2.640   1.00 46.37  ? 96   TYR A CE1   1 
ATOM   624  C  CE2   . TYR A 1 101 ? 6.309   -23.281 2.213   1.00 47.57  ? 96   TYR A CE2   1 
ATOM   625  C  CZ    . TYR A 1 101 ? 6.835   -22.353 3.085   1.00 46.68  ? 96   TYR A CZ    1 
ATOM   626  O  OH    . TYR A 1 101 ? 6.398   -22.345 4.388   1.00 46.12  ? 96   TYR A OH    1 
ATOM   627  N  N     . LYS A 1 102 ? 8.947   -21.105 -4.032  1.00 56.71  ? 97   LYS A N     1 
ATOM   628  C  CA    . LYS A 1 102 ? 9.173   -21.615 -5.375  1.00 59.34  ? 97   LYS A CA    1 
ATOM   629  C  C     . LYS A 1 102 ? 10.664  -21.706 -5.669  1.00 60.26  ? 97   LYS A C     1 
ATOM   630  O  O     . LYS A 1 102 ? 11.433  -20.810 -5.283  1.00 58.75  ? 97   LYS A O     1 
ATOM   631  C  CB    . LYS A 1 102 ? 8.508   -20.718 -6.406  1.00 61.88  ? 97   LYS A CB    1 
ATOM   632  C  CG    . LYS A 1 102 ? 8.163   -21.429 -7.702  1.00 65.10  ? 97   LYS A CG    1 
ATOM   633  C  CD    . LYS A 1 102 ? 7.999   -20.436 -8.847  1.00 73.65  ? 97   LYS A CD    1 
ATOM   634  C  CE    . LYS A 1 102 ? 7.424   -21.095 -10.091 1.00 80.39  ? 97   LYS A CE    1 
ATOM   635  N  NZ    . LYS A 1 102 ? 6.744   -20.097 -10.974 1.00 84.57  ? 97   LYS A NZ    1 
ATOM   636  N  N     . GLU A 1 103 ? 11.054  -22.807 -6.325  1.00 57.97  ? 98   GLU A N     1 
ATOM   637  C  CA    . GLU A 1 103 ? 12.449  -23.080 -6.764  1.00 61.22  ? 98   GLU A CA    1 
ATOM   638  C  C     . GLU A 1 103 ? 13.537  -22.894 -5.681  1.00 58.30  ? 98   GLU A C     1 
ATOM   639  O  O     . GLU A 1 103 ? 14.710  -22.647 -5.981  1.00 54.79  ? 98   GLU A O     1 
ATOM   640  C  CB    . GLU A 1 103 ? 12.791  -22.298 -8.047  1.00 67.92  ? 98   GLU A CB    1 
ATOM   641  C  CG    . GLU A 1 103 ? 11.648  -22.282 -9.055  1.00 74.50  ? 98   GLU A CG    1 
ATOM   642  C  CD    . GLU A 1 103 ? 12.053  -22.065 -10.500 1.00 75.78  ? 98   GLU A CD    1 
ATOM   643  O  OE1   . GLU A 1 103 ? 12.711  -21.048 -10.807 1.00 91.52  ? 98   GLU A OE1   1 
ATOM   644  O  OE2   . GLU A 1 103 ? 11.654  -22.888 -11.348 1.00 80.64  ? 98   GLU A OE2   1 
ATOM   645  N  N     . ALA A 1 104 ? 13.141  -23.089 -4.429  1.00 56.74  ? 99   ALA A N     1 
ATOM   646  C  CA    . ALA A 1 104 ? 14.077  -23.205 -3.332  1.00 52.94  ? 99   ALA A CA    1 
ATOM   647  C  C     . ALA A 1 104 ? 14.760  -24.547 -3.382  1.00 52.55  ? 99   ALA A C     1 
ATOM   648  O  O     . ALA A 1 104 ? 14.142  -25.552 -3.737  1.00 51.66  ? 99   ALA A O     1 
ATOM   649  C  CB    . ALA A 1 104 ? 13.347  -23.058 -2.023  1.00 52.80  ? 99   ALA A CB    1 
ATOM   650  N  N     . VAL A 1 105 ? 16.040  -24.553 -3.028  1.00 56.60  ? 100  VAL A N     1 
ATOM   651  C  CA    . VAL A 1 105 ? 16.878  -25.761 -3.143  1.00 57.74  ? 100  VAL A CA    1 
ATOM   652  C  C     . VAL A 1 105 ? 17.304  -26.320 -1.794  1.00 54.83  ? 100  VAL A C     1 
ATOM   653  O  O     . VAL A 1 105 ? 17.947  -27.366 -1.744  1.00 60.11  ? 100  VAL A O     1 
ATOM   654  C  CB    . VAL A 1 105 ? 18.143  -25.521 -4.001  1.00 57.69  ? 100  VAL A CB    1 
ATOM   655  C  CG1   . VAL A 1 105 ? 17.755  -24.993 -5.366  1.00 60.26  ? 100  VAL A CG1   1 
ATOM   656  C  CG2   . VAL A 1 105 ? 19.106  -24.549 -3.337  1.00 58.83  ? 100  VAL A CG2   1 
ATOM   657  N  N     . GLY A 1 106 ? 16.926  -25.625 -0.723  1.00 53.41  ? 101  GLY A N     1 
ATOM   658  C  CA    . GLY A 1 106 ? 17.183  -26.045 0.653   1.00 52.39  ? 101  GLY A CA    1 
ATOM   659  C  C     . GLY A 1 106 ? 16.504  -25.127 1.675   1.00 52.66  ? 101  GLY A C     1 
ATOM   660  O  O     . GLY A 1 106 ? 16.139  -23.987 1.367   1.00 55.93  ? 101  GLY A O     1 
ATOM   661  N  N     . ALA A 1 107 ? 16.349  -25.617 2.898   1.00 49.07  ? 102  ALA A N     1 
ATOM   662  C  CA    . ALA A 1 107 ? 15.619  -24.898 3.949   1.00 49.84  ? 102  ALA A CA    1 
ATOM   663  C  C     . ALA A 1 107 ? 16.207  -25.116 5.357   1.00 48.40  ? 102  ALA A C     1 
ATOM   664  O  O     . ALA A 1 107 ? 16.531  -26.231 5.726   1.00 52.75  ? 102  ALA A O     1 
ATOM   665  C  CB    . ALA A 1 107 ? 14.165  -25.338 3.942   1.00 52.14  ? 102  ALA A CB    1 
ATOM   666  N  N     . PHE A 1 108 ? 16.303  -24.058 6.146   1.00 44.98  ? 103  PHE A N     1 
ATOM   667  C  CA    . PHE A 1 108 ? 16.262  -24.181 7.576   1.00 43.84  ? 103  PHE A CA    1 
ATOM   668  C  C     . PHE A 1 108 ? 14.866  -24.038 8.119   1.00 44.00  ? 103  PHE A C     1 
ATOM   669  O  O     . PHE A 1 108 ? 14.182  -23.099 7.787   1.00 48.48  ? 103  PHE A O     1 
ATOM   670  C  CB    . PHE A 1 108 ? 17.105  -23.099 8.210   1.00 46.64  ? 103  PHE A CB    1 
ATOM   671  C  CG    . PHE A 1 108 ? 18.555  -23.202 7.884   1.00 47.06  ? 103  PHE A CG    1 
ATOM   672  C  CD1   . PHE A 1 108 ? 19.296  -24.269 8.342   1.00 49.95  ? 103  PHE A CD1   1 
ATOM   673  C  CD2   . PHE A 1 108 ? 19.184  -22.234 7.127   1.00 46.47  ? 103  PHE A CD2   1 
ATOM   674  C  CE1   . PHE A 1 108 ? 20.642  -24.386 8.025   1.00 50.79  ? 103  PHE A CE1   1 
ATOM   675  C  CE2   . PHE A 1 108 ? 20.524  -22.329 6.823   1.00 46.53  ? 103  PHE A CE2   1 
ATOM   676  C  CZ    . PHE A 1 108 ? 21.257  -23.412 7.267   1.00 48.23  ? 103  PHE A CZ    1 
ATOM   677  N  N     . VAL A 1 109 ? 14.482  -24.960 8.995   1.00 46.25  ? 104  VAL A N     1 
ATOM   678  C  CA    . VAL A 1 109 ? 13.329  -24.812 9.872   1.00 47.41  ? 104  VAL A CA    1 
ATOM   679  C  C     . VAL A 1 109 ? 13.742  -24.681 11.340  1.00 49.91  ? 104  VAL A C     1 
ATOM   680  O  O     . VAL A 1 109 ? 14.541  -25.452 11.820  1.00 56.81  ? 104  VAL A O     1 
ATOM   681  C  CB    . VAL A 1 109 ? 12.440  -26.052 9.779   1.00 48.77  ? 104  VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 109 ? 11.115  -25.820 10.489  1.00 45.95  ? 104  VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 109 ? 12.225  -26.432 8.324   1.00 49.35  ? 104  VAL A CG2   1 
ATOM   684  N  N     . VAL A 1 110 ? 13.182  -23.719 12.057  1.00 46.65  ? 105  VAL A N     1 
ATOM   685  C  CA    . VAL A 1 110 ? 13.780  -23.231 13.277  1.00 43.24  ? 105  VAL A CA    1 
ATOM   686  C  C     . VAL A 1 110 ? 12.758  -23.190 14.369  1.00 45.51  ? 105  VAL A C     1 
ATOM   687  O  O     . VAL A 1 110 ? 11.565  -22.876 14.148  1.00 54.19  ? 105  VAL A O     1 
ATOM   688  C  CB    . VAL A 1 110 ? 14.319  -21.811 13.086  1.00 47.25  ? 105  VAL A CB    1 
ATOM   689  C  CG1   . VAL A 1 110 ? 15.129  -21.375 14.276  1.00 47.81  ? 105  VAL A CG1   1 
ATOM   690  C  CG2   . VAL A 1 110 ? 15.195  -21.728 11.846  1.00 49.04  ? 105  VAL A CG2   1 
ATOM   691  N  N     . PHE A 1 111 ? 13.201  -23.538 15.569  1.00 48.39  ? 106  PHE A N     1 
ATOM   692  C  CA    . PHE A 1 111 ? 12.338  -23.437 16.735  1.00 51.05  ? 106  PHE A CA    1 
ATOM   693  C  C     . PHE A 1 111 ? 13.118  -22.941 17.931  1.00 49.00  ? 106  PHE A C     1 
ATOM   694  O  O     . PHE A 1 111 ? 14.328  -23.031 17.975  1.00 46.04  ? 106  PHE A O     1 
ATOM   695  C  CB    . PHE A 1 111 ? 11.577  -24.766 17.012  1.00 52.94  ? 106  PHE A CB    1 
ATOM   696  C  CG    . PHE A 1 111 ? 12.427  -25.846 17.596  1.00 57.37  ? 106  PHE A CG    1 
ATOM   697  C  CD1   . PHE A 1 111 ? 13.210  -26.658 16.777  1.00 59.28  ? 106  PHE A CD1   1 
ATOM   698  C  CD2   . PHE A 1 111 ? 12.454  -26.060 18.969  1.00 60.44  ? 106  PHE A CD2   1 
ATOM   699  C  CE1   . PHE A 1 111 ? 14.014  -27.652 17.313  1.00 53.14  ? 106  PHE A CE1   1 
ATOM   700  C  CE2   . PHE A 1 111 ? 13.262  -27.046 19.512  1.00 55.68  ? 106  PHE A CE2   1 
ATOM   701  C  CZ    . PHE A 1 111 ? 14.041  -27.841 18.680  1.00 52.74  ? 106  PHE A CZ    1 
ATOM   702  N  N     . ASP A 1 112 ? 12.375  -22.374 18.873  1.00 55.01  ? 107  ASP A N     1 
ATOM   703  C  CA    . ASP A 1 112 ? 12.905  -21.867 20.115  1.00 57.71  ? 107  ASP A CA    1 
ATOM   704  C  C     . ASP A 1 112 ? 13.006  -23.054 21.057  1.00 66.16  ? 107  ASP A C     1 
ATOM   705  O  O     . ASP A 1 112 ? 12.019  -23.709 21.353  1.00 73.82  ? 107  ASP A O     1 
ATOM   706  C  CB    . ASP A 1 112 ? 11.958  -20.817 20.685  1.00 56.13  ? 107  ASP A CB    1 
ATOM   707  C  CG    . ASP A 1 112 ? 12.567  -20.044 21.826  1.00 59.32  ? 107  ASP A CG    1 
ATOM   708  O  OD1   . ASP A 1 112 ? 13.356  -20.677 22.568  1.00 61.86  ? 107  ASP A OD1   1 
ATOM   709  O  OD2   . ASP A 1 112 ? 12.280  -18.822 21.972  1.00 47.67  ? 107  ASP A OD2   1 
ATOM   710  N  N     . ILE A 1 113 ? 14.218  -23.347 21.495  1.00 81.52  ? 108  ILE A N     1 
ATOM   711  C  CA    . ILE A 1 113 ? 14.474  -24.451 22.419  1.00 72.00  ? 108  ILE A CA    1 
ATOM   712  C  C     . ILE A 1 113 ? 13.835  -24.179 23.772  1.00 63.80  ? 108  ILE A C     1 
ATOM   713  O  O     . ILE A 1 113 ? 13.590  -25.103 24.521  1.00 64.47  ? 108  ILE A O     1 
ATOM   714  C  CB    . ILE A 1 113 ? 15.994  -24.702 22.579  1.00 78.62  ? 108  ILE A CB    1 
ATOM   715  C  CG1   . ILE A 1 113 ? 16.253  -26.193 22.776  1.00 97.53  ? 108  ILE A CG1   1 
ATOM   716  C  CG2   . ILE A 1 113 ? 16.592  -23.852 23.706  1.00 72.82  ? 108  ILE A CG2   1 
ATOM   717  C  CD1   . ILE A 1 113 ? 17.708  -26.614 22.635  1.00 114.22 ? 108  ILE A CD1   1 
ATOM   718  N  N     . SER A 1 114 ? 13.552  -22.917 24.072  1.00 63.43  ? 109  SER A N     1 
ATOM   719  C  CA    . SER A 1 114 ? 12.878  -22.550 25.305  1.00 68.30  ? 109  SER A CA    1 
ATOM   720  C  C     . SER A 1 114 ? 11.386  -22.214 25.117  1.00 70.96  ? 109  SER A C     1 
ATOM   721  O  O     . SER A 1 114 ? 10.816  -21.434 25.883  1.00 70.37  ? 109  SER A O     1 
ATOM   722  C  CB    . SER A 1 114 ? 13.628  -21.389 25.980  1.00 72.47  ? 109  SER A CB    1 
ATOM   723  O  OG    . SER A 1 114 ? 13.589  -20.210 25.199  1.00 80.46  ? 109  SER A OG    1 
ATOM   724  N  N     . ARG A 1 115 ? 10.737  -22.851 24.144  1.00 73.85  ? 110  ARG A N     1 
ATOM   725  C  CA    . ARG A 1 115 ? 9.291   -22.700 23.943  1.00 74.34  ? 110  ARG A CA    1 
ATOM   726  C  C     . ARG A 1 115 ? 8.771   -23.868 23.119  1.00 80.66  ? 110  ARG A C     1 
ATOM   727  O  O     . ARG A 1 115 ? 8.957   -23.907 21.920  1.00 83.74  ? 110  ARG A O     1 
ATOM   728  C  CB    . ARG A 1 115 ? 8.981   -21.397 23.224  1.00 69.90  ? 110  ARG A CB    1 
ATOM   729  C  CG    . ARG A 1 115 ? 8.337   -20.325 24.077  1.00 73.53  ? 110  ARG A CG    1 
ATOM   730  C  CD    . ARG A 1 115 ? 8.622   -18.938 23.505  1.00 74.93  ? 110  ARG A CD    1 
ATOM   731  N  NE    . ARG A 1 115 ? 7.999   -18.726 22.190  1.00 71.25  ? 110  ARG A NE    1 
ATOM   732  C  CZ    . ARG A 1 115 ? 8.599   -18.198 21.121  1.00 65.70  ? 110  ARG A CZ    1 
ATOM   733  N  NH1   . ARG A 1 115 ? 9.864   -17.807 21.162  1.00 65.04  ? 110  ARG A NH1   1 
ATOM   734  N  NH2   . ARG A 1 115 ? 7.923   -18.059 19.989  1.00 63.14  ? 110  ARG A NH2   1 
ATOM   735  N  N     . SER A 1 116 ? 8.135   -24.832 23.771  1.00 88.13  ? 111  SER A N     1 
ATOM   736  C  CA    . SER A 1 116 ? 7.823   -26.099 23.126  1.00 84.27  ? 111  SER A CA    1 
ATOM   737  C  C     . SER A 1 116 ? 6.727   -25.927 22.095  1.00 78.27  ? 111  SER A C     1 
ATOM   738  O  O     . SER A 1 116 ? 6.738   -26.631 21.092  1.00 76.08  ? 111  SER A O     1 
ATOM   739  C  CB    . SER A 1 116 ? 7.412   -27.136 24.163  1.00 92.61  ? 111  SER A CB    1 
ATOM   740  O  OG    . SER A 1 116 ? 8.303   -27.067 25.265  1.00 111.57 ? 111  SER A OG    1 
ATOM   741  N  N     . SER A 1 117 ? 5.800   -24.990 22.337  1.00 71.06  ? 112  SER A N     1 
ATOM   742  C  CA    . SER A 1 117 ? 4.825   -24.551 21.324  1.00 70.07  ? 112  SER A CA    1 
ATOM   743  C  C     . SER A 1 117 ? 5.434   -24.478 19.925  1.00 73.14  ? 112  SER A C     1 
ATOM   744  O  O     . SER A 1 117 ? 4.885   -25.032 18.952  1.00 67.36  ? 112  SER A O     1 
ATOM   745  C  CB    . SER A 1 117 ? 4.263   -23.178 21.687  1.00 72.11  ? 112  SER A CB    1 
ATOM   746  O  OG    . SER A 1 117 ? 5.244   -22.390 22.353  1.00 76.22  ? 112  SER A OG    1 
ATOM   747  N  N     . THR A 1 118 ? 6.593   -23.820 19.853  1.00 69.94  ? 113  THR A N     1 
ATOM   748  C  CA    . THR A 1 118 ? 7.314   -23.633 18.599  1.00 62.36  ? 113  THR A CA    1 
ATOM   749  C  C     . THR A 1 118 ? 7.829   -24.947 18.006  1.00 58.20  ? 113  THR A C     1 
ATOM   750  O  O     . THR A 1 118 ? 8.006   -25.041 16.796  1.00 61.95  ? 113  THR A O     1 
ATOM   751  C  CB    . THR A 1 118 ? 8.520   -22.663 18.719  1.00 56.68  ? 113  THR A CB    1 
ATOM   752  O  OG1   . THR A 1 118 ? 9.589   -23.297 19.420  1.00 53.90  ? 113  THR A OG1   1 
ATOM   753  C  CG2   . THR A 1 118 ? 8.147   -21.360 19.417  1.00 56.99  ? 113  THR A CG2   1 
ATOM   754  N  N     . PHE A 1 119 ? 8.097   -25.947 18.832  1.00 59.96  ? 114  PHE A N     1 
ATOM   755  C  CA    . PHE A 1 119 ? 8.497   -27.250 18.298  1.00 65.72  ? 114  PHE A CA    1 
ATOM   756  C  C     . PHE A 1 119 ? 7.321   -28.031 17.694  1.00 66.93  ? 114  PHE A C     1 
ATOM   757  O  O     . PHE A 1 119 ? 7.445   -28.645 16.624  1.00 54.11  ? 114  PHE A O     1 
ATOM   758  C  CB    . PHE A 1 119 ? 9.206   -28.112 19.344  1.00 64.26  ? 114  PHE A CB    1 
ATOM   759  C  CG    . PHE A 1 119 ? 9.673   -29.432 18.801  1.00 63.53  ? 114  PHE A CG    1 
ATOM   760  C  CD1   . PHE A 1 119 ? 8.827   -30.531 18.765  1.00 60.95  ? 114  PHE A CD1   1 
ATOM   761  C  CD2   . PHE A 1 119 ? 10.956  -29.569 18.283  1.00 63.75  ? 114  PHE A CD2   1 
ATOM   762  C  CE1   . PHE A 1 119 ? 9.259   -31.746 18.246  1.00 63.73  ? 114  PHE A CE1   1 
ATOM   763  C  CE2   . PHE A 1 119 ? 11.390  -30.786 17.761  1.00 67.93  ? 114  PHE A CE2   1 
ATOM   764  C  CZ    . PHE A 1 119 ? 10.535  -31.878 17.740  1.00 63.47  ? 114  PHE A CZ    1 
ATOM   765  N  N     . GLU A 1 120 ? 6.181   -27.997 18.373  1.00 73.26  ? 115  GLU A N     1 
ATOM   766  C  CA    . GLU A 1 120 ? 4.968   -28.611 17.837  1.00 76.35  ? 115  GLU A CA    1 
ATOM   767  C  C     . GLU A 1 120 ? 4.713   -28.064 16.439  1.00 69.99  ? 115  GLU A C     1 
ATOM   768  O  O     . GLU A 1 120 ? 4.365   -28.822 15.515  1.00 78.94  ? 115  GLU A O     1 
ATOM   769  C  CB    . GLU A 1 120 ? 3.756   -28.370 18.754  1.00 89.30  ? 115  GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 120 ? 3.837   -29.040 20.133  1.00 99.53  ? 115  GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 120 ? 3.214   -28.189 21.244  1.00 121.40 ? 115  GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 120 ? 2.165   -27.526 20.991  1.00 119.73 ? 115  GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 120 ? 3.786   -28.178 22.377  1.00 138.60 ? 115  GLU A OE2   1 
ATOM   774  N  N     . ALA A 1 121 ? 4.951   -26.763 16.280  1.00 67.25  ? 116  ALA A N     1 
ATOM   775  C  CA    . ALA A 1 121 ? 4.730   -26.057 15.011  1.00 61.45  ? 116  ALA A CA    1 
ATOM   776  C  C     . ALA A 1 121 ? 5.677   -26.392 13.859  1.00 54.29  ? 116  ALA A C     1 
ATOM   777  O  O     . ALA A 1 121 ? 5.333   -26.105 12.714  1.00 58.85  ? 116  ALA A O     1 
ATOM   778  C  CB    . ALA A 1 121 ? 4.746   -24.562 15.234  1.00 64.50  ? 116  ALA A CB    1 
ATOM   779  N  N     . VAL A 1 122 ? 6.828   -27.009 14.102  1.00 49.01  ? 117  VAL A N     1 
ATOM   780  C  CA    . VAL A 1 122 ? 7.742   -27.241 12.974  1.00 53.99  ? 117  VAL A CA    1 
ATOM   781  C  C     . VAL A 1 122 ? 7.176   -28.215 11.959  1.00 57.19  ? 117  VAL A C     1 
ATOM   782  O  O     . VAL A 1 122 ? 7.527   -28.165 10.786  1.00 60.50  ? 117  VAL A O     1 
ATOM   783  C  CB    . VAL A 1 122 ? 9.172   -27.712 13.339  1.00 56.41  ? 117  VAL A CB    1 
ATOM   784  C  CG1   . VAL A 1 122 ? 9.615   -27.200 14.704  1.00 60.85  ? 117  VAL A CG1   1 
ATOM   785  C  CG2   . VAL A 1 122 ? 9.320   -29.213 13.231  1.00 54.61  ? 117  VAL A CG2   1 
ATOM   786  N  N     . LEU A 1 123 ? 6.293   -29.102 12.391  1.00 64.51  ? 118  LEU A N     1 
ATOM   787  C  CA    . LEU A 1 123 ? 5.704   -30.032 11.447  1.00 69.47  ? 118  LEU A CA    1 
ATOM   788  C  C     . LEU A 1 123 ? 4.746   -29.316 10.491  1.00 65.02  ? 118  LEU A C     1 
ATOM   789  O  O     . LEU A 1 123 ? 4.605   -29.715 9.343   1.00 60.09  ? 118  LEU A O     1 
ATOM   790  C  CB    . LEU A 1 123 ? 5.017   -31.181 12.179  1.00 76.06  ? 118  LEU A CB    1 
ATOM   791  C  CG    . LEU A 1 123 ? 5.978   -32.309 12.590  1.00 76.38  ? 118  LEU A CG    1 
ATOM   792  C  CD1   . LEU A 1 123 ? 5.428   -33.065 13.787  1.00 79.16  ? 118  LEU A CD1   1 
ATOM   793  C  CD2   . LEU A 1 123 ? 6.251   -33.259 11.434  1.00 75.73  ? 118  LEU A CD2   1 
ATOM   794  N  N     . LYS A 1 124 ? 4.115   -28.250 10.959  1.00 61.80  ? 119  LYS A N     1 
ATOM   795  C  CA    . LYS A 1 124 ? 3.179   -27.509 10.122  1.00 63.97  ? 119  LYS A CA    1 
ATOM   796  C  C     . LYS A 1 124 ? 3.920   -26.789 9.002   1.00 60.17  ? 119  LYS A C     1 
ATOM   797  O  O     . LYS A 1 124 ? 3.498   -26.813 7.840   1.00 53.47  ? 119  LYS A O     1 
ATOM   798  C  CB    . LYS A 1 124 ? 2.373   -26.546 10.971  1.00 64.48  ? 119  LYS A CB    1 
ATOM   799  C  CG    . LYS A 1 124 ? 1.579   -27.284 12.028  1.00 77.16  ? 119  LYS A CG    1 
ATOM   800  C  CD    . LYS A 1 124 ? 0.370   -26.486 12.495  1.00 100.23 ? 119  LYS A CD    1 
ATOM   801  C  CE    . LYS A 1 124 ? -0.554  -27.327 13.363  1.00 111.42 ? 119  LYS A CE    1 
ATOM   802  N  NZ    . LYS A 1 124 ? -1.189  -28.425 12.580  1.00 112.51 ? 119  LYS A NZ    1 
ATOM   803  N  N     . TRP A 1 125 ? 5.053   -26.193 9.360   1.00 55.35  ? 120  TRP A N     1 
ATOM   804  C  CA    . TRP A 1 125 ? 5.960   -25.624 8.374   1.00 52.63  ? 120  TRP A CA    1 
ATOM   805  C  C     . TRP A 1 125 ? 6.512   -26.698 7.444   1.00 51.37  ? 120  TRP A C     1 
ATOM   806  O  O     . TRP A 1 125 ? 6.485   -26.542 6.224   1.00 50.14  ? 120  TRP A O     1 
ATOM   807  C  CB    . TRP A 1 125 ? 7.122   -24.887 9.050   1.00 49.88  ? 120  TRP A CB    1 
ATOM   808  C  CG    . TRP A 1 125 ? 6.743   -23.596 9.710   1.00 48.98  ? 120  TRP A CG    1 
ATOM   809  C  CD1   . TRP A 1 125 ? 6.565   -23.386 11.040  1.00 51.09  ? 120  TRP A CD1   1 
ATOM   810  C  CD2   . TRP A 1 125 ? 6.487   -22.348 9.070   1.00 48.09  ? 120  TRP A CD2   1 
ATOM   811  N  NE1   . TRP A 1 125 ? 6.208   -22.080 11.276  1.00 53.75  ? 120  TRP A NE1   1 
ATOM   812  C  CE2   . TRP A 1 125 ? 6.158   -21.422 10.076  1.00 50.80  ? 120  TRP A CE2   1 
ATOM   813  C  CE3   . TRP A 1 125 ? 6.485   -21.929 7.747   1.00 48.14  ? 120  TRP A CE3   1 
ATOM   814  C  CZ2   . TRP A 1 125 ? 5.839   -20.106 9.798   1.00 50.16  ? 120  TRP A CZ2   1 
ATOM   815  C  CZ3   . TRP A 1 125 ? 6.178   -20.627 7.474   1.00 48.31  ? 120  TRP A CZ3   1 
ATOM   816  C  CH2   . TRP A 1 125 ? 5.863   -19.726 8.494   1.00 49.25  ? 120  TRP A CH2   1 
ATOM   817  N  N     . LYS A 1 126 ? 7.021   -27.777 8.015   1.00 49.13  ? 121  LYS A N     1 
ATOM   818  C  CA    . LYS A 1 126 ? 7.543   -28.841 7.195   1.00 50.84  ? 121  LYS A CA    1 
ATOM   819  C  C     . LYS A 1 126 ? 6.505   -29.402 6.210   1.00 50.02  ? 121  LYS A C     1 
ATOM   820  O  O     . LYS A 1 126 ? 6.845   -29.658 5.057   1.00 50.68  ? 121  LYS A O     1 
ATOM   821  C  CB    . LYS A 1 126 ? 8.120   -29.952 8.054   1.00 52.43  ? 121  LYS A CB    1 
ATOM   822  C  CG    . LYS A 1 126 ? 8.858   -31.034 7.258   1.00 54.68  ? 121  LYS A CG    1 
ATOM   823  C  CD    . LYS A 1 126 ? 10.165  -30.552 6.664   1.00 54.22  ? 121  LYS A CD    1 
ATOM   824  C  CE    . LYS A 1 126 ? 11.116  -31.706 6.365   1.00 58.00  ? 121  LYS A CE    1 
ATOM   825  N  NZ    . LYS A 1 126 ? 10.863  -32.352 5.043   1.00 59.93  ? 121  LYS A NZ    1 
ATOM   826  N  N     . SER A 1 127 ? 5.260   -29.592 6.648   1.00 51.21  ? 122  SER A N     1 
ATOM   827  C  CA    . SER A 1 127 ? 4.165   -29.981 5.729   1.00 52.39  ? 122  SER A CA    1 
ATOM   828  C  C     . SER A 1 127 ? 3.960   -28.972 4.645   1.00 49.80  ? 122  SER A C     1 
ATOM   829  O  O     . SER A 1 127 ? 3.849   -29.315 3.478   1.00 50.03  ? 122  SER A O     1 
ATOM   830  C  CB    . SER A 1 127 ? 2.845   -30.087 6.452   1.00 52.49  ? 122  SER A CB    1 
ATOM   831  O  OG    . SER A 1 127 ? 2.732   -31.367 7.040   1.00 58.88  ? 122  SER A OG    1 
ATOM   832  N  N     . ASP A 1 128 ? 3.899   -27.720 5.062   1.00 50.78  ? 123  ASP A N     1 
ATOM   833  C  CA    . ASP A 1 128 ? 3.708   -26.618 4.143   1.00 55.05  ? 123  ASP A CA    1 
ATOM   834  C  C     . ASP A 1 128 ? 4.780   -26.663 3.073   1.00 52.48  ? 123  ASP A C     1 
ATOM   835  O  O     . ASP A 1 128 ? 4.480   -26.681 1.889   1.00 48.78  ? 123  ASP A O     1 
ATOM   836  C  CB    . ASP A 1 128 ? 3.767   -25.289 4.905   1.00 54.20  ? 123  ASP A CB    1 
ATOM   837  C  CG    . ASP A 1 128 ? 3.316   -24.132 4.079   1.00 55.20  ? 123  ASP A CG    1 
ATOM   838  O  OD1   . ASP A 1 128 ? 2.329   -24.282 3.342   1.00 57.43  ? 123  ASP A OD1   1 
ATOM   839  O  OD2   . ASP A 1 128 ? 3.933   -23.059 4.183   1.00 63.91  ? 123  ASP A OD2   1 
ATOM   840  N  N     . LEU A 1 129 ? 6.026   -26.715 3.520   1.00 50.46  ? 124  LEU A N     1 
ATOM   841  C  CA    . LEU A 1 129 ? 7.154   -26.810 2.628   1.00 49.44  ? 124  LEU A CA    1 
ATOM   842  C  C     . LEU A 1 129 ? 6.962   -27.931 1.622   1.00 52.16  ? 124  LEU A C     1 
ATOM   843  O  O     . LEU A 1 129 ? 6.980   -27.702 0.423   1.00 51.09  ? 124  LEU A O     1 
ATOM   844  C  CB    . LEU A 1 129 ? 8.438   -27.016 3.430   1.00 49.54  ? 124  LEU A CB    1 
ATOM   845  C  CG    . LEU A 1 129 ? 9.745   -26.852 2.661   1.00 47.09  ? 124  LEU A CG    1 
ATOM   846  C  CD1   . LEU A 1 129 ? 9.856   -25.438 2.142   1.00 49.68  ? 124  LEU A CD1   1 
ATOM   847  C  CD2   . LEU A 1 129 ? 10.948  -27.137 3.541   1.00 47.11  ? 124  LEU A CD2   1 
ATOM   848  N  N     . ASP A 1 130 ? 6.798   -29.155 2.104   1.00 57.67  ? 125  ASP A N     1 
ATOM   849  C  CA    . ASP A 1 130 ? 6.883   -30.324 1.224   1.00 58.98  ? 125  ASP A CA    1 
ATOM   850  C  C     . ASP A 1 130 ? 5.644   -30.427 0.368   1.00 55.84  ? 125  ASP A C     1 
ATOM   851  O  O     . ASP A 1 130 ? 5.678   -30.967 -0.745  1.00 69.43  ? 125  ASP A O     1 
ATOM   852  C  CB    . ASP A 1 130 ? 7.052   -31.607 2.045   1.00 59.65  ? 125  ASP A CB    1 
ATOM   853  C  CG    . ASP A 1 130 ? 8.344   -31.633 2.867   1.00 55.99  ? 125  ASP A CG    1 
ATOM   854  O  OD1   . ASP A 1 130 ? 9.358   -30.983 2.473   1.00 50.87  ? 125  ASP A OD1   1 
ATOM   855  O  OD2   . ASP A 1 130 ? 8.335   -32.364 3.891   1.00 56.35  ? 125  ASP A OD2   1 
ATOM   856  N  N     . SER A 1 131 ? 4.543   -29.942 0.919   1.00 53.64  ? 126  SER A N     1 
ATOM   857  C  CA    . SER A 1 131 ? 3.350   -29.622 0.153   1.00 55.29  ? 126  SER A CA    1 
ATOM   858  C  C     . SER A 1 131 ? 3.656   -28.876 -1.136  1.00 51.83  ? 126  SER A C     1 
ATOM   859  O  O     . SER A 1 131 ? 2.950   -29.043 -2.102  1.00 59.15  ? 126  SER A O     1 
ATOM   860  C  CB    . SER A 1 131 ? 2.351   -28.843 1.038   1.00 57.86  ? 126  SER A CB    1 
ATOM   861  O  OG    . SER A 1 131 ? 1.328   -28.256 0.286   1.00 63.15  ? 126  SER A OG    1 
ATOM   862  N  N     . LYS A 1 132 ? 4.671   -28.030 -1.142  1.00 50.46  ? 127  LYS A N     1 
ATOM   863  C  CA    . LYS A 1 132 ? 4.771   -26.963 -2.137  1.00 49.21  ? 127  LYS A CA    1 
ATOM   864  C  C     . LYS A 1 132 ? 6.111   -26.833 -2.832  1.00 52.69  ? 127  LYS A C     1 
ATOM   865  O  O     . LYS A 1 132 ? 6.232   -25.988 -3.691  1.00 57.05  ? 127  LYS A O     1 
ATOM   866  C  CB    . LYS A 1 132 ? 4.485   -25.620 -1.490  1.00 49.47  ? 127  LYS A CB    1 
ATOM   867  C  CG    . LYS A 1 132 ? 3.096   -25.588 -0.925  1.00 51.52  ? 127  LYS A CG    1 
ATOM   868  C  CD    . LYS A 1 132 ? 2.728   -24.264 -0.292  1.00 51.83  ? 127  LYS A CD    1 
ATOM   869  C  CE    . LYS A 1 132 ? 1.371   -24.449 0.364   1.00 54.71  ? 127  LYS A CE    1 
ATOM   870  N  NZ    . LYS A 1 132 ? 0.889   -23.203 0.995   1.00 60.12  ? 127  LYS A NZ    1 
ATOM   871  N  N     . VAL A 1 133 ? 7.120   -27.632 -2.501  1.00 56.99  ? 128  VAL A N     1 
ATOM   872  C  CA    . VAL A 1 133 ? 8.335   -27.630 -3.298  1.00 56.21  ? 128  VAL A CA    1 
ATOM   873  C  C     . VAL A 1 133 ? 8.999   -28.973 -3.292  1.00 62.33  ? 128  VAL A C     1 
ATOM   874  O  O     . VAL A 1 133 ? 9.156   -29.587 -2.221  1.00 70.88  ? 128  VAL A O     1 
ATOM   875  C  CB    . VAL A 1 133 ? 9.372   -26.646 -2.774  1.00 57.74  ? 128  VAL A CB    1 
ATOM   876  C  CG1   . VAL A 1 133 ? 10.366  -26.300 -3.867  1.00 59.23  ? 128  VAL A CG1   1 
ATOM   877  C  CG2   . VAL A 1 133 ? 8.720   -25.383 -2.302  1.00 59.06  ? 128  VAL A CG2   1 
ATOM   878  N  N     . HIS A 1 134 ? 9.426   -29.381 -4.489  1.00 63.63  ? 129  HIS A N     1 
ATOM   879  C  CA    . HIS A 1 134 ? 10.265  -30.550 -4.708  1.00 66.39  ? 129  HIS A CA    1 
ATOM   880  C  C     . HIS A 1 134 ? 11.450  -30.073 -5.484  1.00 67.82  ? 129  HIS A C     1 
ATOM   881  O  O     . HIS A 1 134 ? 11.380  -29.091 -6.232  1.00 60.26  ? 129  HIS A O     1 
ATOM   882  C  CB    . HIS A 1 134 ? 9.521   -31.606 -5.519  1.00 75.41  ? 129  HIS A CB    1 
ATOM   883  C  CG    . HIS A 1 134 ? 8.049   -31.517 -5.347  1.00 91.90  ? 129  HIS A CG    1 
ATOM   884  N  ND1   . HIS A 1 134 ? 7.459   -31.712 -4.116  1.00 102.85 ? 129  HIS A ND1   1 
ATOM   885  C  CD2   . HIS A 1 134 ? 7.052   -31.187 -6.203  1.00 93.90  ? 129  HIS A CD2   1 
ATOM   886  C  CE1   . HIS A 1 134 ? 6.157   -31.530 -4.220  1.00 106.51 ? 129  HIS A CE1   1 
ATOM   887  N  NE2   . HIS A 1 134 ? 5.884   -31.214 -5.476  1.00 112.09 ? 129  HIS A NE2   1 
ATOM   888  N  N     . LEU A 1 135 ? 12.547  -30.786 -5.315  1.00 78.18  ? 130  LEU A N     1 
ATOM   889  C  CA    . LEU A 1 135 ? 13.628  -30.714 -6.278  1.00 90.30  ? 130  LEU A CA    1 
ATOM   890  C  C     . LEU A 1 135 ? 13.091  -31.201 -7.617  1.00 90.34  ? 130  LEU A C     1 
ATOM   891  O  O     . LEU A 1 135 ? 12.122  -31.975 -7.648  1.00 86.02  ? 130  LEU A O     1 
ATOM   892  C  CB    . LEU A 1 135 ? 14.807  -31.577 -5.825  1.00 90.12  ? 130  LEU A CB    1 
ATOM   893  C  CG    . LEU A 1 135 ? 15.470  -31.146 -4.504  1.00 89.26  ? 130  LEU A CG    1 
ATOM   894  C  CD1   . LEU A 1 135 ? 16.121  -32.341 -3.816  1.00 86.82  ? 130  LEU A CD1   1 
ATOM   895  C  CD2   . LEU A 1 135 ? 16.471  -30.009 -4.699  1.00 88.28  ? 130  LEU A CD2   1 
ATOM   896  N  N     . PRO A 1 136 ? 13.701  -30.739 -8.725  1.00 92.54  ? 131  PRO A N     1 
ATOM   897  C  CA    . PRO A 1 136 ? 13.227  -31.107 -10.061 1.00 93.18  ? 131  PRO A CA    1 
ATOM   898  C  C     . PRO A 1 136 ? 12.857  -32.590 -10.251 1.00 88.58  ? 131  PRO A C     1 
ATOM   899  O  O     . PRO A 1 136 ? 11.876  -32.889 -10.929 1.00 90.54  ? 131  PRO A O     1 
ATOM   900  C  CB    . PRO A 1 136 ? 14.398  -30.701 -10.958 1.00 93.96  ? 131  PRO A CB    1 
ATOM   901  C  CG    . PRO A 1 136 ? 14.962  -29.498 -10.277 1.00 95.02  ? 131  PRO A CG    1 
ATOM   902  C  CD    . PRO A 1 136 ? 14.825  -29.779 -8.799  1.00 96.96  ? 131  PRO A CD    1 
ATOM   903  N  N     . ASN A 1 137 ? 13.588  -33.502 -9.623  1.00 81.02  ? 132  ASN A N     1 
ATOM   904  C  CA    . ASN A 1 137 ? 13.248  -34.931 -9.709  1.00 73.75  ? 132  ASN A CA    1 
ATOM   905  C  C     . ASN A 1 137 ? 12.084  -35.398 -8.822  1.00 74.59  ? 132  ASN A C     1 
ATOM   906  O  O     . ASN A 1 137 ? 11.997  -36.583 -8.510  1.00 68.24  ? 132  ASN A O     1 
ATOM   907  C  CB    . ASN A 1 137 ? 14.488  -35.750 -9.399  1.00 70.44  ? 132  ASN A CB    1 
ATOM   908  C  CG    . ASN A 1 137 ? 15.154  -35.317 -8.114  1.00 75.11  ? 132  ASN A CG    1 
ATOM   909  O  OD1   . ASN A 1 137 ? 16.170  -34.613 -8.131  1.00 71.46  ? 132  ASN A OD1   1 
ATOM   910  N  ND2   . ASN A 1 137 ? 14.575  -35.711 -6.984  1.00 80.59  ? 132  ASN A ND2   1 
ATOM   911  N  N     . GLY A 1 138 ? 11.226  -34.481 -8.376  1.00 77.17  ? 133  GLY A N     1 
ATOM   912  C  CA    . GLY A 1 138 ? 10.057  -34.841 -7.571  1.00 84.11  ? 133  GLY A CA    1 
ATOM   913  C  C     . GLY A 1 138 ? 10.274  -35.128 -6.085  1.00 90.73  ? 133  GLY A C     1 
ATOM   914  O  O     . GLY A 1 138 ? 9.328   -35.489 -5.380  1.00 111.12 ? 133  GLY A O     1 
ATOM   915  N  N     . SER A 1 139 ? 11.498  -34.978 -5.588  1.00 91.06  ? 134  SER A N     1 
ATOM   916  C  CA    . SER A 1 139 ? 11.804  -35.333 -4.190  1.00 85.06  ? 134  SER A CA    1 
ATOM   917  C  C     . SER A 1 139 ? 11.953  -34.083 -3.307  1.00 79.21  ? 134  SER A C     1 
ATOM   918  O  O     . SER A 1 139 ? 12.450  -33.044 -3.770  1.00 72.79  ? 134  SER A O     1 
ATOM   919  C  CB    . SER A 1 139 ? 13.091  -36.146 -4.136  1.00 87.93  ? 134  SER A CB    1 
ATOM   920  O  OG    . SER A 1 139 ? 14.202  -35.267 -4.075  1.00 92.46  ? 134  SER A OG    1 
ATOM   921  N  N     . PRO A 1 140 ? 11.533  -34.179 -2.028  1.00 75.74  ? 135  PRO A N     1 
ATOM   922  C  CA    . PRO A 1 140 ? 11.444  -33.007 -1.155  1.00 75.46  ? 135  PRO A CA    1 
ATOM   923  C  C     . PRO A 1 140 ? 12.801  -32.433 -0.869  1.00 72.02  ? 135  PRO A C     1 
ATOM   924  O  O     . PRO A 1 140 ? 13.772  -33.166 -0.823  1.00 74.33  ? 135  PRO A O     1 
ATOM   925  C  CB    . PRO A 1 140 ? 10.855  -33.564 0.141   1.00 72.56  ? 135  PRO A CB    1 
ATOM   926  C  CG    . PRO A 1 140 ? 11.219  -34.984 0.118   1.00 72.99  ? 135  PRO A CG    1 
ATOM   927  C  CD    . PRO A 1 140 ? 11.098  -35.388 -1.321  1.00 76.58  ? 135  PRO A CD    1 
ATOM   928  N  N     . ILE A 1 141 ? 12.871  -31.116 -0.717  1.00 72.15  ? 136  ILE A N     1 
ATOM   929  C  CA    . ILE A 1 141 ? 14.161  -30.444 -0.717  1.00 67.39  ? 136  ILE A CA    1 
ATOM   930  C  C     . ILE A 1 141 ? 14.848  -30.757 0.614   1.00 62.63  ? 136  ILE A C     1 
ATOM   931  O  O     . ILE A 1 141 ? 14.179  -31.063 1.599   1.00 61.53  ? 136  ILE A O     1 
ATOM   932  C  CB    . ILE A 1 141 ? 14.032  -28.920 -0.972  1.00 65.85  ? 136  ILE A CB    1 
ATOM   933  C  CG1   . ILE A 1 141 ? 13.252  -28.214 0.132   1.00 65.49  ? 136  ILE A CG1   1 
ATOM   934  C  CG2   . ILE A 1 141 ? 13.334  -28.644 -2.290  1.00 65.54  ? 136  ILE A CG2   1 
ATOM   935  C  CD1   . ILE A 1 141 ? 13.687  -26.777 0.308   1.00 65.04  ? 136  ILE A CD1   1 
ATOM   936  N  N     . PRO A 1 142 ? 16.177  -30.674 0.651   1.00 58.40  ? 137  PRO A N     1 
ATOM   937  C  CA    . PRO A 1 142 ? 16.889  -30.847 1.913   1.00 57.52  ? 137  PRO A CA    1 
ATOM   938  C  C     . PRO A 1 142 ? 16.504  -29.836 2.990   1.00 61.82  ? 137  PRO A C     1 
ATOM   939  O  O     . PRO A 1 142 ? 16.630  -28.622 2.791   1.00 57.95  ? 137  PRO A O     1 
ATOM   940  C  CB    . PRO A 1 142 ? 18.347  -30.631 1.526   1.00 59.06  ? 137  PRO A CB    1 
ATOM   941  C  CG    . PRO A 1 142 ? 18.309  -29.865 0.239   1.00 61.13  ? 137  PRO A CG    1 
ATOM   942  C  CD    . PRO A 1 142 ? 17.085  -30.364 -0.465  1.00 59.65  ? 137  PRO A CD    1 
ATOM   943  N  N     . ALA A 1 143 ? 16.059  -30.345 4.134   1.00 63.24  ? 138  ALA A N     1 
ATOM   944  C  CA    . ALA A 1 143 ? 15.717  -29.508 5.283   1.00 58.51  ? 138  ALA A CA    1 
ATOM   945  C  C     . ALA A 1 143 ? 16.634  -29.775 6.499   1.00 56.26  ? 138  ALA A C     1 
ATOM   946  O  O     . ALA A 1 143 ? 16.916  -30.915 6.829   1.00 67.50  ? 138  ALA A O     1 
ATOM   947  C  CB    . ALA A 1 143 ? 14.260  -29.745 5.651   1.00 55.60  ? 138  ALA A CB    1 
ATOM   948  N  N     . VAL A 1 144 ? 17.037  -28.724 7.193   1.00 51.59  ? 139  VAL A N     1 
ATOM   949  C  CA    . VAL A 1 144 ? 17.846  -28.853 8.376   1.00 52.52  ? 139  VAL A CA    1 
ATOM   950  C  C     . VAL A 1 144 ? 17.165  -28.146 9.540   1.00 56.99  ? 139  VAL A C     1 
ATOM   951  O  O     . VAL A 1 144 ? 16.856  -26.980 9.461   1.00 57.58  ? 139  VAL A O     1 
ATOM   952  C  CB    . VAL A 1 144 ? 19.208  -28.207 8.149   1.00 52.22  ? 139  VAL A CB    1 
ATOM   953  C  CG1   . VAL A 1 144 ? 20.036  -28.209 9.412   1.00 55.65  ? 139  VAL A CG1   1 
ATOM   954  C  CG2   . VAL A 1 144 ? 19.943  -28.948 7.065   1.00 56.02  ? 139  VAL A CG2   1 
ATOM   955  N  N     . LEU A 1 145 ? 16.978  -28.859 10.641  1.00 61.14  ? 140  LEU A N     1 
ATOM   956  C  CA    . LEU A 1 145 ? 16.277  -28.337 11.819  1.00 56.26  ? 140  LEU A CA    1 
ATOM   957  C  C     . LEU A 1 145 ? 17.217  -27.577 12.760  1.00 52.25  ? 140  LEU A C     1 
ATOM   958  O  O     . LEU A 1 145 ? 18.373  -27.917 12.869  1.00 49.39  ? 140  LEU A O     1 
ATOM   959  C  CB    . LEU A 1 145 ? 15.655  -29.507 12.570  1.00 53.92  ? 140  LEU A CB    1 
ATOM   960  C  CG    . LEU A 1 145 ? 14.787  -29.205 13.770  1.00 55.41  ? 140  LEU A CG    1 
ATOM   961  C  CD1   . LEU A 1 145 ? 13.600  -28.340 13.390  1.00 58.65  ? 140  LEU A CD1   1 
ATOM   962  C  CD2   . LEU A 1 145 ? 14.306  -30.527 14.350  1.00 58.43  ? 140  LEU A CD2   1 
ATOM   963  N  N     . LEU A 1 146 ? 16.730  -26.537 13.423  1.00 48.37  ? 141  LEU A N     1 
ATOM   964  C  CA    . LEU A 1 146 ? 17.598  -25.679 14.221  1.00 46.67  ? 141  LEU A CA    1 
ATOM   965  C  C     . LEU A 1 146 ? 16.947  -25.426 15.559  1.00 55.04  ? 141  LEU A C     1 
ATOM   966  O  O     . LEU A 1 146 ? 15.927  -24.748 15.652  1.00 60.74  ? 141  LEU A O     1 
ATOM   967  C  CB    . LEU A 1 146 ? 17.891  -24.346 13.521  1.00 41.08  ? 141  LEU A CB    1 
ATOM   968  C  CG    . LEU A 1 146 ? 18.709  -24.298 12.208  1.00 39.65  ? 141  LEU A CG    1 
ATOM   969  C  CD1   . LEU A 1 146 ? 19.118  -22.879 11.898  1.00 38.02  ? 141  LEU A CD1   1 
ATOM   970  C  CD2   . LEU A 1 146 ? 19.964  -25.145 12.233  1.00 40.57  ? 141  LEU A CD2   1 
ATOM   971  N  N     . ALA A 1 147 ? 17.551  -25.972 16.601  1.00 60.66  ? 142  ALA A N     1 
ATOM   972  C  CA    . ALA A 1 147 ? 17.105  -25.718 17.939  1.00 59.71  ? 142  ALA A CA    1 
ATOM   973  C  C     . ALA A 1 147 ? 17.802  -24.474 18.440  1.00 57.72  ? 142  ALA A C     1 
ATOM   974  O  O     . ALA A 1 147 ? 18.954  -24.530 18.846  1.00 56.97  ? 142  ALA A O     1 
ATOM   975  C  CB    . ALA A 1 147 ? 17.432  -26.906 18.808  1.00 60.31  ? 142  ALA A CB    1 
ATOM   976  N  N     . ASN A 1 148 ? 17.117  -23.341 18.377  1.00 56.84  ? 143  ASN A N     1 
ATOM   977  C  CA    . ASN A 1 148 ? 17.788  -22.068 18.576  1.00 54.70  ? 143  ASN A CA    1 
ATOM   978  C  C     . ASN A 1 148 ? 17.629  -21.549 19.989  1.00 54.24  ? 143  ASN A C     1 
ATOM   979  O  O     . ASN A 1 148 ? 16.720  -21.955 20.688  1.00 48.62  ? 143  ASN A O     1 
ATOM   980  C  CB    . ASN A 1 148 ? 17.298  -21.006 17.603  1.00 51.17  ? 143  ASN A CB    1 
ATOM   981  C  CG    . ASN A 1 148 ? 18.206  -19.802 17.588  1.00 47.54  ? 143  ASN A CG    1 
ATOM   982  O  OD1   . ASN A 1 148 ? 19.404  -19.948 17.383  1.00 40.36  ? 143  ASN A OD1   1 
ATOM   983  N  ND2   . ASN A 1 148 ? 17.656  -18.617 17.884  1.00 45.39  ? 143  ASN A ND2   1 
ATOM   984  N  N     . LYS A 1 149 ? 18.550  -20.665 20.386  1.00 56.09  ? 144  LYS A N     1 
ATOM   985  C  CA    . LYS A 1 149 ? 18.615  -20.080 21.726  1.00 56.11  ? 144  LYS A CA    1 
ATOM   986  C  C     . LYS A 1 149 ? 19.093  -21.097 22.752  1.00 58.58  ? 144  LYS A C     1 
ATOM   987  O  O     . LYS A 1 149 ? 18.582  -21.152 23.876  1.00 64.72  ? 144  LYS A O     1 
ATOM   988  C  CB    . LYS A 1 149 ? 17.266  -19.484 22.170  1.00 54.28  ? 144  LYS A CB    1 
ATOM   989  C  CG    . LYS A 1 149 ? 16.760  -18.311 21.369  1.00 50.57  ? 144  LYS A CG    1 
ATOM   990  C  CD    . LYS A 1 149 ? 15.253  -18.339 21.360  1.00 49.78  ? 144  LYS A CD    1 
ATOM   991  C  CE    . LYS A 1 149 ? 14.664  -17.188 20.574  1.00 51.99  ? 144  LYS A CE    1 
ATOM   992  N  NZ    . LYS A 1 149 ? 14.043  -16.178 21.459  1.00 54.64  ? 144  LYS A NZ    1 
ATOM   993  N  N     . CYS A 1 150 ? 20.071  -21.908 22.367  1.00 61.66  ? 145  CYS A N     1 
ATOM   994  C  CA    . CYS A 1 150 ? 20.580  -22.975 23.243  1.00 68.00  ? 145  CYS A CA    1 
ATOM   995  C  C     . CYS A 1 150 ? 21.410  -22.423 24.414  1.00 70.99  ? 145  CYS A C     1 
ATOM   996  O  O     . CYS A 1 150 ? 21.572  -23.081 25.442  1.00 90.31  ? 145  CYS A O     1 
ATOM   997  C  CB    . CYS A 1 150 ? 21.430  -23.958 22.437  1.00 66.52  ? 145  CYS A CB    1 
ATOM   998  S  SG    . CYS A 1 150 ? 22.953  -23.188 21.845  1.00 69.50  ? 145  CYS A SG    1 
ATOM   999  N  N     . ASP A 1 151 ? 21.922  -21.214 24.266  1.00 71.87  ? 146  ASP A N     1 
ATOM   1000 C  CA    . ASP A 1 151 ? 22.363  -20.433 25.409  1.00 73.94  ? 146  ASP A CA    1 
ATOM   1001 C  C     . ASP A 1 151 ? 21.331  -20.235 26.534  1.00 80.51  ? 146  ASP A C     1 
ATOM   1002 O  O     . ASP A 1 151 ? 21.678  -19.711 27.579  1.00 98.29  ? 146  ASP A O     1 
ATOM   1003 C  CB    . ASP A 1 151 ? 22.841  -19.064 24.929  1.00 73.66  ? 146  ASP A CB    1 
ATOM   1004 C  CG    . ASP A 1 151 ? 21.722  -18.231 24.349  1.00 68.93  ? 146  ASP A CG    1 
ATOM   1005 O  OD1   . ASP A 1 151 ? 21.347  -18.495 23.188  1.00 66.30  ? 146  ASP A OD1   1 
ATOM   1006 O  OD2   . ASP A 1 151 ? 21.214  -17.328 25.052  1.00 61.59  ? 146  ASP A OD2   1 
ATOM   1007 N  N     . GLN A 1 152 ? 20.085  -20.643 26.338  1.00 87.73  ? 147  GLN A N     1 
ATOM   1008 C  CA    . GLN A 1 152 ? 19.068  -20.553 27.386  1.00 97.02  ? 147  GLN A CA    1 
ATOM   1009 C  C     . GLN A 1 152 ? 18.714  -21.920 28.028  1.00 100.98 ? 147  GLN A C     1 
ATOM   1010 O  O     . GLN A 1 152 ? 19.273  -22.957 27.661  1.00 108.70 ? 147  GLN A O     1 
ATOM   1011 C  CB    . GLN A 1 152 ? 17.813  -19.911 26.799  1.00 101.40 ? 147  GLN A CB    1 
ATOM   1012 C  CG    . GLN A 1 152 ? 17.969  -18.450 26.420  1.00 100.29 ? 147  GLN A CG    1 
ATOM   1013 C  CD    . GLN A 1 152 ? 16.615  -17.823 26.063  1.00 105.31 ? 147  GLN A CD    1 
ATOM   1014 O  OE1   . GLN A 1 152 ? 15.623  -18.531 25.870  1.00 97.51  ? 147  GLN A OE1   1 
ATOM   1015 N  NE2   . GLN A 1 152 ? 16.568  -16.498 25.985  1.00 98.95  ? 147  GLN A NE2   1 
ATOM   1016 N  N     . ASN A 1 153 ? 17.781  -21.900 28.983  1.00 101.88 ? 148  ASN A N     1 
ATOM   1017 C  CA    . ASN A 1 153 ? 17.300  -23.103 29.679  1.00 101.03 ? 148  ASN A CA    1 
ATOM   1018 C  C     . ASN A 1 153 ? 16.179  -23.828 28.938  1.00 98.26  ? 148  ASN A C     1 
ATOM   1019 O  O     . ASN A 1 153 ? 15.139  -23.223 28.680  1.00 83.84  ? 148  ASN A O     1 
ATOM   1020 C  CB    . ASN A 1 153 ? 16.742  -22.701 31.054  1.00 103.84 ? 148  ASN A CB    1 
ATOM   1021 C  CG    . ASN A 1 153 ? 17.805  -22.170 32.000  1.00 99.35  ? 148  ASN A CG    1 
ATOM   1022 O  OD1   . ASN A 1 153 ? 18.992  -22.153 31.679  1.00 103.35 ? 148  ASN A OD1   1 
ATOM   1023 N  ND2   . ASN A 1 153 ? 17.378  -21.730 33.176  1.00 98.49  ? 148  ASN A ND2   1 
ATOM   1024 N  N     . LYS A 1 154 ? 16.374  -25.129 28.675  1.00 102.61 ? 149  LYS A N     1 
ATOM   1025 C  CA    . LYS A 1 154 ? 15.350  -26.021 28.083  1.00 104.57 ? 149  LYS A CA    1 
ATOM   1026 C  C     . LYS A 1 154 ? 13.956  -25.921 28.743  1.00 105.91 ? 149  LYS A C     1 
ATOM   1027 O  O     . LYS A 1 154 ? 13.775  -26.296 29.893  1.00 123.13 ? 149  LYS A O     1 
ATOM   1028 C  CB    . LYS A 1 154 ? 15.825  -27.488 28.112  1.00 105.74 ? 149  LYS A CB    1 
ATOM   1029 C  CG    . LYS A 1 154 ? 16.932  -27.821 27.115  1.00 111.58 ? 149  LYS A CG    1 
ATOM   1030 C  CD    . LYS A 1 154 ? 16.709  -29.142 26.376  1.00 118.21 ? 149  LYS A CD    1 
ATOM   1031 C  CE    . LYS A 1 154 ? 17.777  -29.368 25.306  1.00 129.47 ? 149  LYS A CE    1 
ATOM   1032 N  NZ    . LYS A 1 154 ? 17.368  -30.296 24.208  1.00 131.46 ? 149  LYS A NZ    1 
ATOM   1033 N  N     . ASP A 1 155 ? 12.991  -25.396 27.991  1.00 106.37 ? 150  ASP A N     1 
ATOM   1034 C  CA    . ASP A 1 155 ? 11.552  -25.453 28.301  1.00 106.60 ? 150  ASP A CA    1 
ATOM   1035 C  C     . ASP A 1 155 ? 11.052  -26.898 28.295  1.00 112.52 ? 150  ASP A C     1 
ATOM   1036 O  O     . ASP A 1 155 ? 10.197  -27.277 29.094  1.00 109.34 ? 150  ASP A O     1 
ATOM   1037 C  CB    . ASP A 1 155 ? 10.790  -24.614 27.246  1.00 108.99 ? 150  ASP A CB    1 
ATOM   1038 C  CG    . ASP A 1 155 ? 9.314   -24.382 27.583  1.00 115.45 ? 150  ASP A CG    1 
ATOM   1039 O  OD1   . ASP A 1 155 ? 9.003   -23.964 28.719  1.00 130.09 ? 150  ASP A OD1   1 
ATOM   1040 O  OD2   . ASP A 1 155 ? 8.463   -24.579 26.687  1.00 106.53 ? 150  ASP A OD2   1 
ATOM   1041 N  N     . SER A 1 156 ? 11.582  -27.684 27.365  1.00 120.09 ? 151  SER A N     1 
ATOM   1042 C  CA    . SER A 1 156 ? 11.324  -29.113 27.297  1.00 117.62 ? 151  SER A CA    1 
ATOM   1043 C  C     . SER A 1 156 ? 12.634  -29.851 27.510  1.00 121.75 ? 151  SER A C     1 
ATOM   1044 O  O     . SER A 1 156 ? 13.675  -29.482 26.946  1.00 124.69 ? 151  SER A O     1 
ATOM   1045 C  CB    . SER A 1 156 ? 10.731  -29.470 25.935  1.00 117.82 ? 151  SER A CB    1 
ATOM   1046 O  OG    . SER A 1 156 ? 10.472  -30.858 25.836  1.00 116.46 ? 151  SER A OG    1 
ATOM   1047 N  N     . SER A 1 157 ? 12.585  -30.891 28.333  1.00 124.05 ? 152  SER A N     1 
ATOM   1048 C  CA    . SER A 1 157 ? 13.601  -31.936 28.294  1.00 130.88 ? 152  SER A CA    1 
ATOM   1049 C  C     . SER A 1 157 ? 13.185  -32.991 27.269  1.00 121.23 ? 152  SER A C     1 
ATOM   1050 O  O     . SER A 1 157 ? 12.628  -34.031 27.617  1.00 114.39 ? 152  SER A O     1 
ATOM   1051 C  CB    . SER A 1 157 ? 13.788  -32.561 29.678  1.00 128.76 ? 152  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 157 ? 12.568  -33.108 30.133  1.00 129.13 ? 152  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 158 ? 13.478  -32.694 26.009  1.00 105.09 ? 153  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 158 ? 13.653  -33.711 24.989  1.00 90.33  ? 153  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 158 ? 15.139  -33.929 24.728  1.00 85.82  ? 153  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 158 ? 15.959  -32.988 24.734  1.00 82.45  ? 153  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 158 ? 12.948  -33.312 23.701  1.00 94.57  ? 153  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 158 ? 12.852  -31.802 23.488  1.00 97.57  ? 153  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 158 ? 12.431  -31.421 22.089  1.00 92.87  ? 153  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 158 ? 12.590  -32.206 21.148  1.00 85.29  ? 153  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 158 ? 11.873  -30.218 21.945  1.00 82.96  ? 153  GLN A NE2   1 
ATOM   1062 N  N     . SER A 1 159 ? 15.485  -35.184 24.510  1.00 79.06  ? 154  SER A N     1 
ATOM   1063 C  CA    . SER A 1 159 ? 16.875  -35.570 24.404  1.00 82.85  ? 154  SER A CA    1 
ATOM   1064 C  C     . SER A 1 159 ? 17.283  -35.314 22.981  1.00 73.83  ? 154  SER A C     1 
ATOM   1065 O  O     . SER A 1 159 ? 16.442  -35.385 22.090  1.00 72.86  ? 154  SER A O     1 
ATOM   1066 C  CB    . SER A 1 159 ? 17.059  -37.056 24.732  1.00 89.59  ? 154  SER A CB    1 
ATOM   1067 O  OG    . SER A 1 159 ? 16.372  -37.873 23.799  1.00 92.87  ? 154  SER A OG    1 
ATOM   1068 N  N     . PRO A 1 160 ? 18.576  -35.053 22.753  1.00 76.31  ? 155  PRO A N     1 
ATOM   1069 C  CA    . PRO A 1 160 ? 19.181  -35.204 21.426  1.00 78.47  ? 155  PRO A CA    1 
ATOM   1070 C  C     . PRO A 1 160 ? 18.764  -36.472 20.706  1.00 76.05  ? 155  PRO A C     1 
ATOM   1071 O  O     . PRO A 1 160 ? 18.424  -36.437 19.526  1.00 71.44  ? 155  PRO A O     1 
ATOM   1072 C  CB    . PRO A 1 160 ? 20.679  -35.218 21.733  1.00 77.55  ? 155  PRO A CB    1 
ATOM   1073 C  CG    . PRO A 1 160 ? 20.806  -34.294 22.897  1.00 82.06  ? 155  PRO A CG    1 
ATOM   1074 C  CD    . PRO A 1 160 ? 19.528  -34.449 23.707  1.00 82.47  ? 155  PRO A CD    1 
ATOM   1075 N  N     . SER A 1 161 ? 18.742  -37.574 21.434  1.00 81.84  ? 156  SER A N     1 
ATOM   1076 C  CA    . SER A 1 161 ? 18.342  -38.836 20.861  1.00 82.95  ? 156  SER A CA    1 
ATOM   1077 C  C     . SER A 1 161 ? 16.945  -38.813 20.242  1.00 78.33  ? 156  SER A C     1 
ATOM   1078 O  O     . SER A 1 161 ? 16.728  -39.419 19.193  1.00 81.69  ? 156  SER A O     1 
ATOM   1079 C  CB    . SER A 1 161 ? 18.398  -39.901 21.938  1.00 85.09  ? 156  SER A CB    1 
ATOM   1080 O  OG    . SER A 1 161 ? 18.212  -41.163 21.353  1.00 115.75 ? 156  SER A OG    1 
ATOM   1081 N  N     . GLN A 1 162 ? 15.999  -38.138 20.898  1.00 77.19  ? 157  GLN A N     1 
ATOM   1082 C  CA    . GLN A 1 162 ? 14.617  -38.041 20.405  1.00 77.47  ? 157  GLN A CA    1 
ATOM   1083 C  C     . GLN A 1 162 ? 14.511  -37.183 19.162  1.00 74.82  ? 157  GLN A C     1 
ATOM   1084 O  O     . GLN A 1 162 ? 13.750  -37.473 18.226  1.00 77.64  ? 157  GLN A O     1 
ATOM   1085 C  CB    . GLN A 1 162 ? 13.714  -37.422 21.461  1.00 76.50  ? 157  GLN A CB    1 
ATOM   1086 C  CG    . GLN A 1 162 ? 13.353  -38.353 22.582  1.00 85.99  ? 157  GLN A CG    1 
ATOM   1087 C  CD    . GLN A 1 162 ? 12.670  -37.609 23.703  1.00 99.78  ? 157  GLN A CD    1 
ATOM   1088 O  OE1   . GLN A 1 162 ? 11.646  -36.969 23.495  1.00 102.58 ? 157  GLN A OE1   1 
ATOM   1089 N  NE2   . GLN A 1 162 ? 13.248  -37.663 24.894  1.00 112.76 ? 157  GLN A NE2   1 
ATOM   1090 N  N     . VAL A 1 163 ? 15.239  -36.083 19.210  1.00 72.70  ? 158  VAL A N     1 
ATOM   1091 C  CA    . VAL A 1 163 ? 15.359  -35.165 18.104  1.00 70.15  ? 158  VAL A CA    1 
ATOM   1092 C  C     . VAL A 1 163 ? 16.001  -35.877 16.917  1.00 67.23  ? 158  VAL A C     1 
ATOM   1093 O  O     . VAL A 1 163 ? 15.550  -35.690 15.783  1.00 66.09  ? 158  VAL A O     1 
ATOM   1094 C  CB    . VAL A 1 163 ? 16.175  -33.918 18.526  1.00 71.43  ? 158  VAL A CB    1 
ATOM   1095 C  CG1   . VAL A 1 163 ? 16.517  -33.025 17.346  1.00 68.09  ? 158  VAL A CG1   1 
ATOM   1096 C  CG2   . VAL A 1 163 ? 15.406  -33.125 19.573  1.00 66.61  ? 158  VAL A CG2   1 
ATOM   1097 N  N     . ASP A 1 164 ? 17.021  -36.698 17.171  1.00 65.51  ? 159  ASP A N     1 
ATOM   1098 C  CA    . ASP A 1 164 ? 17.604  -37.551 16.114  1.00 70.11  ? 159  ASP A CA    1 
ATOM   1099 C  C     . ASP A 1 164 ? 16.543  -38.429 15.474  1.00 68.51  ? 159  ASP A C     1 
ATOM   1100 O  O     . ASP A 1 164 ? 16.498  -38.570 14.249  1.00 64.53  ? 159  ASP A O     1 
ATOM   1101 C  CB    . ASP A 1 164 ? 18.716  -38.462 16.659  1.00 76.85  ? 159  ASP A CB    1 
ATOM   1102 C  CG    . ASP A 1 164 ? 19.996  -37.717 16.961  1.00 81.72  ? 159  ASP A CG    1 
ATOM   1103 O  OD1   . ASP A 1 164 ? 20.378  -36.871 16.130  1.00 91.15  ? 159  ASP A OD1   1 
ATOM   1104 O  OD2   . ASP A 1 164 ? 20.604  -37.964 18.032  1.00 81.92  ? 159  ASP A OD2   1 
ATOM   1105 N  N     . GLN A 1 165 ? 15.692  -39.028 16.308  1.00 63.82  ? 160  GLN A N     1 
ATOM   1106 C  CA    . GLN A 1 165 ? 14.643  -39.884 15.798  1.00 65.84  ? 160  GLN A CA    1 
ATOM   1107 C  C     . GLN A 1 165 ? 13.689  -39.057 14.931  1.00 64.11  ? 160  GLN A C     1 
ATOM   1108 O  O     . GLN A 1 165 ? 13.473  -39.366 13.752  1.00 63.14  ? 160  GLN A O     1 
ATOM   1109 C  CB    . GLN A 1 165 ? 13.912  -40.617 16.931  1.00 66.62  ? 160  GLN A CB    1 
ATOM   1110 C  CG    . GLN A 1 165 ? 12.833  -41.600 16.501  1.00 66.68  ? 160  GLN A CG    1 
ATOM   1111 C  CD    . GLN A 1 165 ? 13.280  -42.525 15.352  1.00 76.30  ? 160  GLN A CD    1 
ATOM   1112 O  OE1   . GLN A 1 165 ? 14.424  -43.011 15.329  1.00 70.12  ? 160  GLN A OE1   1 
ATOM   1113 N  NE2   . GLN A 1 165 ? 12.377  -42.754 14.373  1.00 79.08  ? 160  GLN A NE2   1 
ATOM   1114 N  N     . PHE A 1 166 ? 13.131  -38.013 15.529  1.00 62.78  ? 161  PHE A N     1 
ATOM   1115 C  CA    . PHE A 1 166 ? 12.253  -37.053 14.847  1.00 64.27  ? 161  PHE A CA    1 
ATOM   1116 C  C     . PHE A 1 166 ? 12.723  -36.712 13.430  1.00 61.91  ? 161  PHE A C     1 
ATOM   1117 O  O     . PHE A 1 166 ? 11.966  -36.863 12.456  1.00 51.72  ? 161  PHE A O     1 
ATOM   1118 C  CB    . PHE A 1 166 ? 12.176  -35.786 15.697  1.00 69.44  ? 161  PHE A CB    1 
ATOM   1119 C  CG    . PHE A 1 166 ? 11.236  -34.747 15.175  1.00 71.18  ? 161  PHE A CG    1 
ATOM   1120 C  CD1   . PHE A 1 166 ? 9.886   -34.791 15.492  1.00 71.14  ? 161  PHE A CD1   1 
ATOM   1121 C  CD2   . PHE A 1 166 ? 11.706  -33.696 14.403  1.00 72.67  ? 161  PHE A CD2   1 
ATOM   1122 C  CE1   . PHE A 1 166 ? 9.008   -33.823 15.027  1.00 73.82  ? 161  PHE A CE1   1 
ATOM   1123 C  CE2   . PHE A 1 166 ? 10.831  -32.727 13.930  1.00 75.35  ? 161  PHE A CE2   1 
ATOM   1124 C  CZ    . PHE A 1 166 ? 9.480   -32.794 14.238  1.00 73.74  ? 161  PHE A CZ    1 
ATOM   1125 N  N     . CYS A 1 167 ? 13.979  -36.291 13.323  1.00 59.64  ? 162  CYS A N     1 
ATOM   1126 C  CA    . CYS A 1 167 ? 14.538  -35.922 12.035  1.00 64.99  ? 162  CYS A CA    1 
ATOM   1127 C  C     . CYS A 1 167 ? 14.426  -37.040 11.013  1.00 65.68  ? 162  CYS A C     1 
ATOM   1128 O  O     . CYS A 1 167 ? 14.007  -36.807 9.877   1.00 77.05  ? 162  CYS A O     1 
ATOM   1129 C  CB    . CYS A 1 167 ? 15.999  -35.473 12.164  1.00 67.57  ? 162  CYS A CB    1 
ATOM   1130 S  SG    . CYS A 1 167 ? 16.212  -33.884 13.015  1.00 67.45  ? 162  CYS A SG    1 
ATOM   1131 N  N     . LYS A 1 168 ? 14.799  -38.250 11.405  1.00 67.91  ? 163  LYS A N     1 
ATOM   1132 C  CA    . LYS A 1 168 ? 14.738  -39.408 10.496  1.00 66.90  ? 163  LYS A CA    1 
ATOM   1133 C  C     . LYS A 1 168 ? 13.295  -39.740 10.105  1.00 61.60  ? 163  LYS A C     1 
ATOM   1134 O  O     . LYS A 1 168 ? 12.985  -40.000 8.948   1.00 60.69  ? 163  LYS A O     1 
ATOM   1135 C  CB    . LYS A 1 168 ? 15.442  -40.595 11.145  1.00 71.08  ? 163  LYS A CB    1 
ATOM   1136 C  CG    . LYS A 1 168 ? 16.932  -40.328 11.340  1.00 83.54  ? 163  LYS A CG    1 
ATOM   1137 C  CD    . LYS A 1 168 ? 17.757  -41.539 11.781  1.00 92.70  ? 163  LYS A CD    1 
ATOM   1138 C  CE    . LYS A 1 168 ? 19.014  -41.111 12.555  1.00 99.96  ? 163  LYS A CE    1 
ATOM   1139 N  NZ    . LYS A 1 168 ? 19.954  -42.234 12.825  1.00 108.07 ? 163  LYS A NZ    1 
ATOM   1140 N  N     . GLU A 1 169 ? 12.397  -39.611 11.058  1.00 61.53  ? 164  GLU A N     1 
ATOM   1141 C  CA    . GLU A 1 169 ? 10.992  -39.842 10.797  1.00 67.53  ? 164  GLU A CA    1 
ATOM   1142 C  C     . GLU A 1 169 ? 10.294  -38.787 9.918   1.00 68.63  ? 164  GLU A C     1 
ATOM   1143 O  O     . GLU A 1 169 ? 9.277   -39.093 9.316   1.00 78.96  ? 164  GLU A O     1 
ATOM   1144 C  CB    . GLU A 1 169 ? 10.241  -39.956 12.120  1.00 74.46  ? 164  GLU A CB    1 
ATOM   1145 C  CG    . GLU A 1 169 ? 8.931   -40.710 12.000  1.00 75.99  ? 164  GLU A CG    1 
ATOM   1146 C  CD    . GLU A 1 169 ? 8.521   -41.379 13.290  1.00 76.92  ? 164  GLU A CD    1 
ATOM   1147 O  OE1   . GLU A 1 169 ? 9.371   -41.999 13.960  1.00 62.42  ? 164  GLU A OE1   1 
ATOM   1148 O  OE2   . GLU A 1 169 ? 7.335   -41.284 13.626  1.00 85.01  ? 164  GLU A OE2   1 
ATOM   1149 N  N     . HIS A 1 170 ? 10.811  -37.558 9.850   1.00 69.36  ? 165  HIS A N     1 
ATOM   1150 C  CA    . HIS A 1 170 ? 10.142  -36.448 9.116   1.00 61.46  ? 165  HIS A CA    1 
ATOM   1151 C  C     . HIS A 1 170 ? 11.022  -35.776 8.072   1.00 52.94  ? 165  HIS A C     1 
ATOM   1152 O  O     . HIS A 1 170 ? 10.865  -34.618 7.794   1.00 47.00  ? 165  HIS A O     1 
ATOM   1153 C  CB    . HIS A 1 170 ? 9.635   -35.410 10.105  1.00 58.14  ? 165  HIS A CB    1 
ATOM   1154 C  CG    . HIS A 1 170 ? 8.686   -35.980 11.091  1.00 64.01  ? 165  HIS A CG    1 
ATOM   1155 N  ND1   . HIS A 1 170 ? 7.423   -36.398 10.738  1.00 67.92  ? 165  HIS A ND1   1 
ATOM   1156 C  CD2   . HIS A 1 170 ? 8.823   -36.262 12.406  1.00 68.27  ? 165  HIS A CD2   1 
ATOM   1157 C  CE1   . HIS A 1 170 ? 6.808   -36.881 11.803  1.00 67.09  ? 165  HIS A CE1   1 
ATOM   1158 N  NE2   . HIS A 1 170 ? 7.638   -36.816 12.826  1.00 67.89  ? 165  HIS A NE2   1 
ATOM   1159 N  N     . GLY A 1 171 ? 11.961  -36.517 7.508   1.00 54.60  ? 166  GLY A N     1 
ATOM   1160 C  CA    . GLY A 1 171 ? 12.676  -36.060 6.331   1.00 55.80  ? 166  GLY A CA    1 
ATOM   1161 C  C     . GLY A 1 171 ? 13.570  -34.859 6.582   1.00 55.14  ? 166  GLY A C     1 
ATOM   1162 O  O     . GLY A 1 171 ? 13.794  -34.054 5.689   1.00 53.69  ? 166  GLY A O     1 
ATOM   1163 N  N     . PHE A 1 172 ? 14.118  -34.745 7.781   1.00 50.83  ? 167  PHE A N     1 
ATOM   1164 C  CA    . PHE A 1 172 ? 15.129  -33.741 8.001   1.00 52.91  ? 167  PHE A CA    1 
ATOM   1165 C  C     . PHE A 1 172 ? 16.495  -34.362 7.821   1.00 53.94  ? 167  PHE A C     1 
ATOM   1166 O  O     . PHE A 1 172 ? 16.830  -35.323 8.484   1.00 61.17  ? 167  PHE A O     1 
ATOM   1167 C  CB    . PHE A 1 172 ? 15.017  -33.147 9.397   1.00 54.20  ? 167  PHE A CB    1 
ATOM   1168 C  CG    . PHE A 1 172 ? 13.886  -32.186 9.562   1.00 53.71  ? 167  PHE A CG    1 
ATOM   1169 C  CD1   . PHE A 1 172 ? 14.056  -30.848 9.283   1.00 58.88  ? 167  PHE A CD1   1 
ATOM   1170 C  CD2   . PHE A 1 172 ? 12.650  -32.618 10.013  1.00 52.59  ? 167  PHE A CD2   1 
ATOM   1171 C  CE1   . PHE A 1 172 ? 13.000  -29.951 9.449   1.00 61.78  ? 167  PHE A CE1   1 
ATOM   1172 C  CE2   . PHE A 1 172 ? 11.596  -31.731 10.183  1.00 52.27  ? 167  PHE A CE2   1 
ATOM   1173 C  CZ    . PHE A 1 172 ? 11.770  -30.395 9.908   1.00 53.59  ? 167  PHE A CZ    1 
ATOM   1174 N  N     . ALA A 1 173 ? 17.309  -33.763 6.969   1.00 55.94  ? 168  ALA A N     1 
ATOM   1175 C  CA    . ALA A 1 173 ? 18.690  -34.201 6.803   1.00 58.52  ? 168  ALA A CA    1 
ATOM   1176 C  C     . ALA A 1 173 ? 19.555  -34.123 8.077   1.00 60.29  ? 168  ALA A C     1 
ATOM   1177 O  O     . ALA A 1 173 ? 20.599  -34.764 8.154   1.00 55.10  ? 168  ALA A O     1 
ATOM   1178 C  CB    . ALA A 1 173 ? 19.354  -33.415 5.674   1.00 59.05  ? 168  ALA A CB    1 
ATOM   1179 N  N     . GLY A 1 174 ? 19.173  -33.301 9.045   1.00 64.20  ? 169  GLY A N     1 
ATOM   1180 C  CA    . GLY A 1 174 ? 20.082  -32.999 10.149  1.00 70.81  ? 169  GLY A CA    1 
ATOM   1181 C  C     . GLY A 1 174 ? 19.446  -32.089 11.168  1.00 65.68  ? 169  GLY A C     1 
ATOM   1182 O  O     . GLY A 1 174 ? 18.266  -31.819 11.079  1.00 70.72  ? 169  GLY A O     1 
ATOM   1183 N  N     . TRP A 1 175 ? 20.228  -31.670 12.155  1.00 62.00  ? 170  TRP A N     1 
ATOM   1184 C  CA    . TRP A 1 175 ? 19.776  -30.730 13.176  1.00 64.31  ? 170  TRP A CA    1 
ATOM   1185 C  C     . TRP A 1 175 ? 20.942  -30.228 14.038  1.00 58.60  ? 170  TRP A C     1 
ATOM   1186 O  O     . TRP A 1 175 ? 21.984  -30.852 14.072  1.00 66.43  ? 170  TRP A O     1 
ATOM   1187 C  CB    . TRP A 1 175 ? 18.655  -31.329 14.053  1.00 66.67  ? 170  TRP A CB    1 
ATOM   1188 C  CG    . TRP A 1 175 ? 19.097  -32.251 15.115  1.00 70.98  ? 170  TRP A CG    1 
ATOM   1189 C  CD1   . TRP A 1 175 ? 19.364  -33.575 14.984  1.00 77.57  ? 170  TRP A CD1   1 
ATOM   1190 C  CD2   . TRP A 1 175 ? 19.322  -31.931 16.485  1.00 73.49  ? 170  TRP A CD2   1 
ATOM   1191 N  NE1   . TRP A 1 175 ? 19.746  -34.105 16.188  1.00 82.04  ? 170  TRP A NE1   1 
ATOM   1192 C  CE2   . TRP A 1 175 ? 19.733  -33.112 17.128  1.00 78.49  ? 170  TRP A CE2   1 
ATOM   1193 C  CE3   . TRP A 1 175 ? 19.219  -30.763 17.233  1.00 73.51  ? 170  TRP A CE3   1 
ATOM   1194 C  CZ2   . TRP A 1 175 ? 20.039  -33.158 18.479  1.00 77.96  ? 170  TRP A CZ2   1 
ATOM   1195 C  CZ3   . TRP A 1 175 ? 19.521  -30.814 18.578  1.00 75.87  ? 170  TRP A CZ3   1 
ATOM   1196 C  CH2   . TRP A 1 175 ? 19.922  -32.002 19.187  1.00 76.87  ? 170  TRP A CH2   1 
ATOM   1197 N  N     . PHE A 1 176 ? 20.772  -29.084 14.697  1.00 53.81  ? 171  PHE A N     1 
ATOM   1198 C  CA    . PHE A 1 176 ? 21.844  -28.443 15.459  1.00 51.69  ? 171  PHE A CA    1 
ATOM   1199 C  C     . PHE A 1 176 ? 21.243  -27.620 16.587  1.00 57.20  ? 171  PHE A C     1 
ATOM   1200 O  O     . PHE A 1 176 ? 20.281  -26.892 16.372  1.00 55.44  ? 171  PHE A O     1 
ATOM   1201 C  CB    . PHE A 1 176 ? 22.665  -27.510 14.587  1.00 49.61  ? 171  PHE A CB    1 
ATOM   1202 C  CG    . PHE A 1 176 ? 23.361  -28.178 13.438  1.00 49.03  ? 171  PHE A CG    1 
ATOM   1203 C  CD1   . PHE A 1 176 ? 22.655  -28.647 12.349  1.00 52.35  ? 171  PHE A CD1   1 
ATOM   1204 C  CD2   . PHE A 1 176 ? 24.749  -28.259 13.410  1.00 52.60  ? 171  PHE A CD2   1 
ATOM   1205 C  CE1   . PHE A 1 176 ? 23.315  -29.233 11.269  1.00 59.58  ? 171  PHE A CE1   1 
ATOM   1206 C  CE2   . PHE A 1 176 ? 25.418  -28.837 12.342  1.00 54.81  ? 171  PHE A CE2   1 
ATOM   1207 C  CZ    . PHE A 1 176 ? 24.701  -29.330 11.268  1.00 57.49  ? 171  PHE A CZ    1 
ATOM   1208 N  N     . GLU A 1 177 ? 21.812  -27.715 17.789  1.00 64.75  ? 172  GLU A N     1 
ATOM   1209 C  CA    . GLU A 1 177 ? 21.601  -26.682 18.803  1.00 67.10  ? 172  GLU A CA    1 
ATOM   1210 C  C     . GLU A 1 177 ? 22.347  -25.445 18.327  1.00 63.64  ? 172  GLU A C     1 
ATOM   1211 O  O     . GLU A 1 177 ? 23.536  -25.527 18.031  1.00 54.99  ? 172  GLU A O     1 
ATOM   1212 C  CB    . GLU A 1 177 ? 22.110  -27.130 20.183  1.00 80.29  ? 172  GLU A CB    1 
ATOM   1213 C  CG    . GLU A 1 177 ? 21.535  -28.463 20.693  1.00 91.18  ? 172  GLU A CG    1 
ATOM   1214 C  CD    . GLU A 1 177 ? 21.404  -28.546 22.217  1.00 94.35  ? 172  GLU A CD    1 
ATOM   1215 O  OE1   . GLU A 1 177 ? 22.392  -28.220 22.899  1.00 91.84  ? 172  GLU A OE1   1 
ATOM   1216 O  OE2   . GLU A 1 177 ? 20.318  -28.933 22.729  1.00 96.90  ? 172  GLU A OE2   1 
ATOM   1217 N  N     . THR A 1 178 ? 21.640  -24.315 18.198  1.00 62.89  ? 173  THR A N     1 
ATOM   1218 C  CA    . THR A 1 178 ? 22.246  -23.061 17.695  1.00 57.89  ? 173  THR A CA    1 
ATOM   1219 C  C     . THR A 1 178 ? 22.034  -21.940 18.658  1.00 53.07  ? 173  THR A C     1 
ATOM   1220 O  O     . THR A 1 178 ? 21.071  -21.961 19.435  1.00 51.37  ? 173  THR A O     1 
ATOM   1221 C  CB    . THR A 1 178 ? 21.641  -22.586 16.354  1.00 57.82  ? 173  THR A CB    1 
ATOM   1222 O  OG1   . THR A 1 178 ? 20.233  -22.347 16.498  1.00 52.82  ? 173  THR A OG1   1 
ATOM   1223 C  CG2   . THR A 1 178 ? 21.896  -23.620 15.269  1.00 58.86  ? 173  THR A CG2   1 
ATOM   1224 N  N     . SER A 1 179 ? 22.906  -20.943 18.590  1.00 47.94  ? 174  SER A N     1 
ATOM   1225 C  CA    . SER A 1 179 ? 22.615  -19.673 19.255  1.00 52.26  ? 174  SER A CA    1 
ATOM   1226 C  C     . SER A 1 179 ? 23.067  -18.498 18.427  1.00 52.23  ? 174  SER A C     1 
ATOM   1227 O  O     . SER A 1 179 ? 24.257  -18.294 18.215  1.00 48.35  ? 174  SER A O     1 
ATOM   1228 C  CB    . SER A 1 179 ? 23.280  -19.596 20.629  1.00 53.70  ? 174  SER A CB    1 
ATOM   1229 O  OG    . SER A 1 179 ? 23.125  -18.310 21.189  1.00 54.24  ? 174  SER A OG    1 
ATOM   1230 N  N     . ALA A 1 180 ? 22.098  -17.711 17.998  1.00 49.49  ? 175  ALA A N     1 
ATOM   1231 C  CA    . ALA A 1 180 ? 22.383  -16.434 17.429  1.00 50.44  ? 175  ALA A CA    1 
ATOM   1232 C  C     . ALA A 1 180 ? 23.100  -15.527 18.413  1.00 50.66  ? 175  ALA A C     1 
ATOM   1233 O  O     . ALA A 1 180 ? 23.892  -14.701 18.003  1.00 48.78  ? 175  ALA A O     1 
ATOM   1234 C  CB    . ALA A 1 180 ? 21.094  -15.776 16.966  1.00 54.54  ? 175  ALA A CB    1 
ATOM   1235 N  N     . LYS A 1 181 ? 22.803  -15.632 19.702  1.00 53.12  ? 176  LYS A N     1 
ATOM   1236 C  CA    . LYS A 1 181 ? 23.393  -14.702 20.675  1.00 53.15  ? 176  LYS A CA    1 
ATOM   1237 C  C     . LYS A 1 181 ? 24.875  -14.937 20.791  1.00 56.77  ? 176  LYS A C     1 
ATOM   1238 O  O     . LYS A 1 181 ? 25.667  -13.988 20.714  1.00 52.62  ? 176  LYS A O     1 
ATOM   1239 C  CB    . LYS A 1 181 ? 22.778  -14.876 22.041  1.00 53.91  ? 176  LYS A CB    1 
ATOM   1240 C  CG    . LYS A 1 181 ? 23.170  -13.776 22.992  1.00 60.20  ? 176  LYS A CG    1 
ATOM   1241 C  CD    . LYS A 1 181 ? 22.753  -14.054 24.415  1.00 65.42  ? 176  LYS A CD    1 
ATOM   1242 C  CE    . LYS A 1 181 ? 22.570  -12.761 25.174  1.00 71.62  ? 176  LYS A CE    1 
ATOM   1243 N  NZ    . LYS A 1 181 ? 22.207  -12.964 26.602  1.00 76.84  ? 176  LYS A NZ    1 
ATOM   1244 N  N     . ASP A 1 182 ? 25.235  -16.216 20.941  1.00 57.28  ? 177  ASP A N     1 
ATOM   1245 C  CA    . ASP A 1 182 ? 26.586  -16.627 21.309  1.00 59.30  ? 177  ASP A CA    1 
ATOM   1246 C  C     . ASP A 1 182 ? 27.270  -17.390 20.174  1.00 59.31  ? 177  ASP A C     1 
ATOM   1247 O  O     . ASP A 1 182 ? 27.989  -18.344 20.393  1.00 72.43  ? 177  ASP A O     1 
ATOM   1248 C  CB    . ASP A 1 182 ? 26.536  -17.492 22.577  1.00 59.79  ? 177  ASP A CB    1 
ATOM   1249 C  CG    . ASP A 1 182 ? 26.247  -16.681 23.834  1.00 62.15  ? 177  ASP A CG    1 
ATOM   1250 O  OD1   . ASP A 1 182 ? 26.650  -15.503 23.883  1.00 72.43  ? 177  ASP A OD1   1 
ATOM   1251 O  OD2   . ASP A 1 182 ? 25.627  -17.218 24.782  1.00 59.72  ? 177  ASP A OD2   1 
ATOM   1252 N  N     . ASN A 1 183 ? 27.060  -16.958 18.951  1.00 60.64  ? 178  ASN A N     1 
ATOM   1253 C  CA    . ASN A 1 183 ? 27.505  -17.691 17.757  1.00 61.29  ? 178  ASN A CA    1 
ATOM   1254 C  C     . ASN A 1 183 ? 27.751  -19.199 17.832  1.00 60.48  ? 178  ASN A C     1 
ATOM   1255 O  O     . ASN A 1 183 ? 28.861  -19.639 17.606  1.00 69.32  ? 178  ASN A O     1 
ATOM   1256 C  CB    . ASN A 1 183 ? 28.767  -17.039 17.192  1.00 57.86  ? 178  ASN A CB    1 
ATOM   1257 C  CG    . ASN A 1 183 ? 28.921  -17.305 15.706  1.00 64.69  ? 178  ASN A CG    1 
ATOM   1258 O  OD1   . ASN A 1 183 ? 28.390  -18.298 15.187  1.00 75.82  ? 178  ASN A OD1   1 
ATOM   1259 N  ND2   . ASN A 1 183 ? 29.611  -16.417 15.000  1.00 69.72  ? 178  ASN A ND2   1 
ATOM   1260 N  N     . ILE A 1 184 ? 26.739  -20.000 18.114  1.00 58.41  ? 179  ILE A N     1 
ATOM   1261 C  CA    . ILE A 1 184 ? 26.954  -21.440 18.196  1.00 60.68  ? 179  ILE A CA    1 
ATOM   1262 C  C     . ILE A 1 184 ? 26.339  -22.193 17.027  1.00 61.84  ? 179  ILE A C     1 
ATOM   1263 O  O     . ILE A 1 184 ? 25.141  -22.123 16.812  1.00 60.81  ? 179  ILE A O     1 
ATOM   1264 C  CB    . ILE A 1 184 ? 26.378  -22.017 19.496  1.00 64.06  ? 179  ILE A CB    1 
ATOM   1265 C  CG1   . ILE A 1 184 ? 27.216  -21.566 20.692  1.00 59.36  ? 179  ILE A CG1   1 
ATOM   1266 C  CG2   . ILE A 1 184 ? 26.326  -23.541 19.433  1.00 69.29  ? 179  ILE A CG2   1 
ATOM   1267 C  CD1   . ILE A 1 184 ? 26.442  -21.506 21.990  1.00 61.76  ? 179  ILE A CD1   1 
ATOM   1268 N  N     . ASN A 1 185 ? 27.181  -22.943 16.317  1.00 67.29  ? 180  ASN A N     1 
ATOM   1269 C  CA    . ASN A 1 185 ? 26.761  -23.947 15.343  1.00 68.74  ? 180  ASN A CA    1 
ATOM   1270 C  C     . ASN A 1 185 ? 26.069  -23.427 14.089  1.00 65.50  ? 180  ASN A C     1 
ATOM   1271 O  O     . ASN A 1 185 ? 25.521  -24.191 13.294  1.00 68.17  ? 180  ASN A O     1 
ATOM   1272 C  CB    . ASN A 1 185 ? 25.887  -24.985 16.020  1.00 72.05  ? 180  ASN A CB    1 
ATOM   1273 C  CG    . ASN A 1 185 ? 26.698  -26.077 16.646  1.00 75.48  ? 180  ASN A CG    1 
ATOM   1274 O  OD1   . ASN A 1 185 ? 27.869  -26.265 16.321  1.00 72.46  ? 180  ASN A OD1   1 
ATOM   1275 N  ND2   . ASN A 1 185 ? 26.073  -26.824 17.530  1.00 80.05  ? 180  ASN A ND2   1 
ATOM   1276 N  N     . ILE A 1 186 ? 26.108  -22.130 13.898  1.00 60.89  ? 181  ILE A N     1 
ATOM   1277 C  CA    . ILE A 1 186 ? 25.437  -21.568 12.774  1.00 58.85  ? 181  ILE A CA    1 
ATOM   1278 C  C     . ILE A 1 186 ? 26.308  -21.870 11.565  1.00 58.10  ? 181  ILE A C     1 
ATOM   1279 O  O     . ILE A 1 186 ? 25.854  -22.485 10.596  1.00 54.08  ? 181  ILE A O     1 
ATOM   1280 C  CB    . ILE A 1 186 ? 25.188  -20.068 13.009  1.00 61.61  ? 181  ILE A CB    1 
ATOM   1281 C  CG1   . ILE A 1 186 ? 24.106  -19.901 14.079  1.00 61.50  ? 181  ILE A CG1   1 
ATOM   1282 C  CG2   . ILE A 1 186 ? 24.786  -19.363 11.726  1.00 59.46  ? 181  ILE A CG2   1 
ATOM   1283 C  CD1   . ILE A 1 186 ? 23.929  -18.476 14.565  1.00 68.82  ? 181  ILE A CD1   1 
ATOM   1284 N  N     . GLU A 1 187 ? 27.568  -21.437 11.631  1.00 60.20  ? 182  GLU A N     1 
ATOM   1285 C  CA    . GLU A 1 187 ? 28.556  -21.739 10.587  1.00 60.50  ? 182  GLU A CA    1 
ATOM   1286 C  C     . GLU A 1 187 ? 28.479  -23.222 10.149  1.00 60.02  ? 182  GLU A C     1 
ATOM   1287 O  O     . GLU A 1 187 ? 28.512  -23.541 8.958   1.00 56.00  ? 182  GLU A O     1 
ATOM   1288 C  CB    . GLU A 1 187 ? 29.956  -21.372 11.091  1.00 62.50  ? 182  GLU A CB    1 
ATOM   1289 C  CG    . GLU A 1 187 ? 30.269  -19.885 11.108  1.00 64.79  ? 182  GLU A CG    1 
ATOM   1290 C  CD    . GLU A 1 187 ? 30.555  -19.338 9.710   1.00 80.76  ? 182  GLU A CD    1 
ATOM   1291 O  OE1   . GLU A 1 187 ? 30.544  -20.119 8.719   1.00 86.11  ? 182  GLU A OE1   1 
ATOM   1292 O  OE2   . GLU A 1 187 ? 30.775  -18.110 9.582   1.00 94.66  ? 182  GLU A OE2   1 
ATOM   1293 N  N     . GLU A 1 188 ? 28.333  -24.100 11.134  1.00 61.04  ? 183  GLU A N     1 
ATOM   1294 C  CA    . GLU A 1 188 ? 28.403  -25.534 10.932  1.00 64.62  ? 183  GLU A CA    1 
ATOM   1295 C  C     . GLU A 1 188 ? 27.166  -25.998 10.210  1.00 59.23  ? 183  GLU A C     1 
ATOM   1296 O  O     . GLU A 1 188 ? 27.254  -26.746 9.233   1.00 62.80  ? 183  GLU A O     1 
ATOM   1297 C  CB    . GLU A 1 188 ? 28.518  -26.267 12.280  1.00 76.74  ? 183  GLU A CB    1 
ATOM   1298 C  CG    . GLU A 1 188 ? 29.882  -26.151 12.964  1.00 81.42  ? 183  GLU A CG    1 
ATOM   1299 C  CD    . GLU A 1 188 ? 30.138  -24.806 13.653  1.00 87.43  ? 183  GLU A CD    1 
ATOM   1300 O  OE1   . GLU A 1 188 ? 29.415  -23.822 13.406  1.00 90.18  ? 183  GLU A OE1   1 
ATOM   1301 O  OE2   . GLU A 1 188 ? 31.082  -24.722 14.463  1.00 104.08 ? 183  GLU A OE2   1 
ATOM   1302 N  N     . ALA A 1 189 ? 26.012  -25.557 10.702  1.00 54.34  ? 184  ALA A N     1 
ATOM   1303 C  CA    . ALA A 1 189 ? 24.722  -25.909 10.086  1.00 52.94  ? 184  ALA A CA    1 
ATOM   1304 C  C     . ALA A 1 189 ? 24.590  -25.403 8.659   1.00 48.93  ? 184  ALA A C     1 
ATOM   1305 O  O     . ALA A 1 189 ? 24.102  -26.129 7.789   1.00 49.75  ? 184  ALA A O     1 
ATOM   1306 C  CB    . ALA A 1 189 ? 23.564  -25.395 10.929  1.00 50.52  ? 184  ALA A CB    1 
ATOM   1307 N  N     . ALA A 1 190 ? 25.030  -24.171 8.428   1.00 47.95  ? 185  ALA A N     1 
ATOM   1308 C  CA    . ALA A 1 190 ? 25.126  -23.627 7.077   1.00 52.68  ? 185  ALA A CA    1 
ATOM   1309 C  C     . ALA A 1 190 ? 25.905  -24.574 6.174   1.00 58.20  ? 185  ALA A C     1 
ATOM   1310 O  O     . ALA A 1 190 ? 25.424  -24.988 5.107   1.00 56.18  ? 185  ALA A O     1 
ATOM   1311 C  CB    . ALA A 1 190 ? 25.786  -22.259 7.094   1.00 53.49  ? 185  ALA A CB    1 
ATOM   1312 N  N     . ARG A 1 191 ? 27.116  -24.917 6.607   1.00 65.06  ? 186  ARG A N     1 
ATOM   1313 C  CA    . ARG A 1 191 ? 27.968  -25.828 5.836   1.00 64.35  ? 186  ARG A CA    1 
ATOM   1314 C  C     . ARG A 1 191 ? 27.270  -27.159 5.553   1.00 63.55  ? 186  ARG A C     1 
ATOM   1315 O  O     . ARG A 1 191 ? 27.216  -27.616 4.399   1.00 58.99  ? 186  ARG A O     1 
ATOM   1316 C  CB    . ARG A 1 191 ? 29.314  -26.085 6.536   1.00 65.26  ? 186  ARG A CB    1 
ATOM   1317 C  CG    . ARG A 1 191 ? 30.361  -25.111 6.044   1.00 65.57  ? 186  ARG A CG    1 
ATOM   1318 C  CD    . ARG A 1 191 ? 31.727  -25.352 6.637   1.00 67.27  ? 186  ARG A CD    1 
ATOM   1319 N  NE    . ARG A 1 191 ? 32.140  -24.341 7.601   1.00 68.00  ? 186  ARG A NE    1 
ATOM   1320 C  CZ    . ARG A 1 191 ? 32.133  -24.505 8.921   1.00 72.18  ? 186  ARG A CZ    1 
ATOM   1321 N  NH1   . ARG A 1 191 ? 31.685  -25.628 9.471   1.00 74.89  ? 186  ARG A NH1   1 
ATOM   1322 N  NH2   . ARG A 1 191 ? 32.563  -23.518 9.710   1.00 74.47  ? 186  ARG A NH2   1 
ATOM   1323 N  N     . PHE A 1 192 ? 26.727  -27.764 6.608   1.00 61.72  ? 187  PHE A N     1 
ATOM   1324 C  CA    . PHE A 1 192 ? 26.043  -29.046 6.479   1.00 64.58  ? 187  PHE A CA    1 
ATOM   1325 C  C     . PHE A 1 192 ? 24.981  -29.002 5.390   1.00 67.27  ? 187  PHE A C     1 
ATOM   1326 O  O     . PHE A 1 192 ? 24.879  -29.917 4.562   1.00 70.49  ? 187  PHE A O     1 
ATOM   1327 C  CB    . PHE A 1 192 ? 25.391  -29.437 7.795   1.00 68.71  ? 187  PHE A CB    1 
ATOM   1328 C  CG    . PHE A 1 192 ? 24.651  -30.732 7.725   1.00 73.39  ? 187  PHE A CG    1 
ATOM   1329 C  CD1   . PHE A 1 192 ? 25.291  -31.926 7.971   1.00 76.44  ? 187  PHE A CD1   1 
ATOM   1330 C  CD2   . PHE A 1 192 ? 23.320  -30.761 7.386   1.00 85.38  ? 187  PHE A CD2   1 
ATOM   1331 C  CE1   . PHE A 1 192 ? 24.607  -33.126 7.910   1.00 78.99  ? 187  PHE A CE1   1 
ATOM   1332 C  CE2   . PHE A 1 192 ? 22.629  -31.966 7.319   1.00 87.12  ? 187  PHE A CE2   1 
ATOM   1333 C  CZ    . PHE A 1 192 ? 23.273  -33.150 7.587   1.00 76.54  ? 187  PHE A CZ    1 
ATOM   1334 N  N     . LEU A 1 193 ? 24.214  -27.911 5.374   1.00 68.86  ? 188  LEU A N     1 
ATOM   1335 C  CA    . LEU A 1 193 ? 23.141  -27.764 4.414   1.00 62.76  ? 188  LEU A CA    1 
ATOM   1336 C  C     . LEU A 1 193 ? 23.710  -27.610 3.017   1.00 59.04  ? 188  LEU A C     1 
ATOM   1337 O  O     . LEU A 1 193 ? 23.364  -28.365 2.114   1.00 61.67  ? 188  LEU A O     1 
ATOM   1338 C  CB    . LEU A 1 193 ? 22.253  -26.573 4.761   1.00 66.28  ? 188  LEU A CB    1 
ATOM   1339 C  CG    . LEU A 1 193 ? 21.069  -26.315 3.808   1.00 68.30  ? 188  LEU A CG    1 
ATOM   1340 C  CD1   . LEU A 1 193 ? 20.287  -27.587 3.475   1.00 69.77  ? 188  LEU A CD1   1 
ATOM   1341 C  CD2   . LEU A 1 193 ? 20.134  -25.260 4.394   1.00 62.71  ? 188  LEU A CD2   1 
ATOM   1342 N  N     . VAL A 1 194 ? 24.606  -26.651 2.849   1.00 54.07  ? 189  VAL A N     1 
ATOM   1343 C  CA    . VAL A 1 194 ? 25.211  -26.420 1.538   1.00 60.55  ? 189  VAL A CA    1 
ATOM   1344 C  C     . VAL A 1 194 ? 25.771  -27.697 0.879   1.00 63.27  ? 189  VAL A C     1 
ATOM   1345 O  O     . VAL A 1 194 ? 25.589  -27.912 -0.320  1.00 66.88  ? 189  VAL A O     1 
ATOM   1346 C  CB    . VAL A 1 194 ? 26.358  -25.381 1.627   1.00 61.27  ? 189  VAL A CB    1 
ATOM   1347 C  CG1   . VAL A 1 194 ? 27.203  -25.361 0.361   1.00 62.44  ? 189  VAL A CG1   1 
ATOM   1348 C  CG2   . VAL A 1 194 ? 25.812  -23.991 1.884   1.00 59.31  ? 189  VAL A CG2   1 
ATOM   1349 N  N     . GLU A 1 195 ? 26.490  -28.503 1.652   1.00 67.04  ? 190  GLU A N     1 
ATOM   1350 C  CA    . GLU A 1 195 ? 26.905  -29.829 1.203   1.00 75.44  ? 190  GLU A CA    1 
ATOM   1351 C  C     . GLU A 1 195 ? 25.787  -30.623 0.596   1.00 69.93  ? 190  GLU A C     1 
ATOM   1352 O  O     . GLU A 1 195 ? 25.916  -31.084 -0.536  1.00 68.59  ? 190  GLU A O     1 
ATOM   1353 C  CB    . GLU A 1 195 ? 27.458  -30.666 2.337   1.00 90.59  ? 190  GLU A CB    1 
ATOM   1354 C  CG    . GLU A 1 195 ? 28.927  -30.996 2.110   1.00 107.49 ? 190  GLU A CG    1 
ATOM   1355 C  CD    . GLU A 1 195 ? 29.344  -32.286 2.806   1.00 123.50 ? 190  GLU A CD    1 
ATOM   1356 O  OE1   . GLU A 1 195 ? 28.475  -33.168 3.019   1.00 118.36 ? 190  GLU A OE1   1 
ATOM   1357 O  OE2   . GLU A 1 195 ? 30.540  -32.416 3.148   1.00 140.07 ? 190  GLU A OE2   1 
ATOM   1358 N  N     . LYS A 1 196 ? 24.705  -30.795 1.356   1.00 65.47  ? 191  LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 196 ? 23.565  -31.603 0.880   1.00 66.80  ? 191  LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 196 ? 23.062  -31.067 -0.437  1.00 63.29  ? 191  LYS A C     1 
ATOM   1361 O  O     . LYS A 1 196 ? 22.740  -31.826 -1.333  1.00 62.07  ? 191  LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 196 ? 22.393  -31.593 1.835   1.00 69.73  ? 191  LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 196 ? 22.683  -32.110 3.228   1.00 79.56  ? 191  LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 196 ? 22.280  -33.546 3.490   1.00 90.08  ? 191  LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 196 ? 23.319  -34.480 2.898   1.00 100.10 ? 191  LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 196 ? 24.596  -34.403 3.662   1.00 102.75 ? 191  LYS A NZ    1 
ATOM   1367 N  N     . ILE A 1 197 ? 23.010  -29.744 -0.525  1.00 64.41  ? 192  ILE A N     1 
ATOM   1368 C  CA    . ILE A 1 197 ? 22.553  -29.062 -1.719  1.00 68.41  ? 192  ILE A CA    1 
ATOM   1369 C  C     . ILE A 1 197 ? 23.477  -29.360 -2.884  1.00 69.79  ? 192  ILE A C     1 
ATOM   1370 O  O     . ILE A 1 197 ? 23.007  -29.660 -3.972  1.00 73.71  ? 192  ILE A O     1 
ATOM   1371 C  CB    . ILE A 1 197 ? 22.445  -27.532 -1.488  1.00 68.62  ? 192  ILE A CB    1 
ATOM   1372 C  CG1   . ILE A 1 197 ? 21.187  -27.245 -0.690  1.00 72.95  ? 192  ILE A CG1   1 
ATOM   1373 C  CG2   . ILE A 1 197 ? 22.418  -26.743 -2.794  1.00 62.88  ? 192  ILE A CG2   1 
ATOM   1374 C  CD1   . ILE A 1 197 ? 21.242  -25.945 0.078   1.00 75.57  ? 192  ILE A CD1   1 
ATOM   1375 N  N     . LEU A 1 198 ? 24.782  -29.226 -2.668  1.00 71.09  ? 193  LEU A N     1 
ATOM   1376 C  CA    . LEU A 1 198 ? 25.756  -29.450 -3.727  1.00 70.96  ? 193  LEU A CA    1 
ATOM   1377 C  C     . LEU A 1 198 ? 25.683  -30.877 -4.244  1.00 77.69  ? 193  LEU A C     1 
ATOM   1378 O  O     . LEU A 1 198 ? 25.810  -31.127 -5.449  1.00 85.95  ? 193  LEU A O     1 
ATOM   1379 C  CB    . LEU A 1 198 ? 27.158  -29.157 -3.226  1.00 67.75  ? 193  LEU A CB    1 
ATOM   1380 C  CG    . LEU A 1 198 ? 27.481  -27.668 -3.248  1.00 67.21  ? 193  LEU A CG    1 
ATOM   1381 C  CD1   . LEU A 1 198 ? 28.643  -27.366 -2.308  1.00 69.25  ? 193  LEU A CD1   1 
ATOM   1382 C  CD2   . LEU A 1 198 ? 27.798  -27.176 -4.653  1.00 62.16  ? 193  LEU A CD2   1 
ATOM   1383 N  N     . VAL A 1 199 ? 25.482  -31.808 -3.325  1.00 77.23  ? 194  VAL A N     1 
ATOM   1384 C  CA    . VAL A 1 199 ? 25.305  -33.205 -3.671  1.00 82.64  ? 194  VAL A CA    1 
ATOM   1385 C  C     . VAL A 1 199 ? 24.104  -33.450 -4.588  1.00 84.65  ? 194  VAL A C     1 
ATOM   1386 O  O     . VAL A 1 199 ? 24.166  -34.326 -5.443  1.00 96.51  ? 194  VAL A O     1 
ATOM   1387 C  CB    . VAL A 1 199 ? 25.242  -34.056 -2.381  1.00 85.98  ? 194  VAL A CB    1 
ATOM   1388 C  CG1   . VAL A 1 199 ? 24.584  -35.417 -2.614  1.00 80.53  ? 194  VAL A CG1   1 
ATOM   1389 C  CG2   . VAL A 1 199 ? 26.661  -34.186 -1.796  1.00 87.78  ? 194  VAL A CG2   1 
ATOM   1390 N  N     . ASN A 1 200 ? 23.030  -32.679 -4.433  1.00 87.16  ? 195  ASN A N     1 
ATOM   1391 C  CA    . ASN A 1 200 ? 21.867  -32.768 -5.346  1.00 86.80  ? 195  ASN A CA    1 
ATOM   1392 C  C     . ASN A 1 200 ? 22.153  -32.148 -6.716  1.00 85.93  ? 195  ASN A C     1 
ATOM   1393 O  O     . ASN A 1 200 ? 21.667  -32.647 -7.729  1.00 93.37  ? 195  ASN A O     1 
ATOM   1394 C  CB    . ASN A 1 200 ? 20.613  -32.089 -4.756  1.00 90.14  ? 195  ASN A CB    1 
ATOM   1395 C  CG    . ASN A 1 200 ? 20.191  -32.655 -3.398  1.00 90.40  ? 195  ASN A CG    1 
ATOM   1396 O  OD1   . ASN A 1 200 ? 20.302  -33.850 -3.143  1.00 85.92  ? 195  ASN A OD1   1 
ATOM   1397 N  ND2   . ASN A 1 200 ? 19.728  -31.776 -2.510  1.00 93.11  ? 195  ASN A ND2   1 
ATOM   1398 N  N     . HIS A 1 201 ? 22.947  -31.073 -6.730  1.00 95.13  ? 196  HIS A N     1 
ATOM   1399 C  CA    . HIS A 1 201 ? 23.271  -30.286 -7.949  1.00 105.08 ? 196  HIS A CA    1 
ATOM   1400 C  C     . HIS A 1 201 ? 24.545  -30.766 -8.647  1.00 112.35 ? 196  HIS A C     1 
ATOM   1401 O  O     . HIS A 1 201 ? 25.075  -30.087 -9.517  1.00 108.62 ? 196  HIS A O     1 
ATOM   1402 C  CB    . HIS A 1 201 ? 23.395  -28.794 -7.601  1.00 106.88 ? 196  HIS A CB    1 
ATOM   1403 C  CG    . HIS A 1 201 ? 22.080  -28.125 -7.311  1.00 123.32 ? 196  HIS A CG    1 
ATOM   1404 N  ND1   . HIS A 1 201 ? 21.158  -28.624 -6.407  1.00 128.26 ? 196  HIS A ND1   1 
ATOM   1405 C  CD2   . HIS A 1 201 ? 21.539  -26.986 -7.804  1.00 118.07 ? 196  HIS A CD2   1 
ATOM   1406 C  CE1   . HIS A 1 201 ? 20.105  -27.828 -6.365  1.00 117.18 ? 196  HIS A CE1   1 
ATOM   1407 N  NE2   . HIS A 1 201 ? 20.312  -26.827 -7.203  1.00 116.15 ? 196  HIS A NE2   1 
ATOM   1408 N  N     . GLN A 1 202 ? 25.022  -31.951 -8.271  1.00 134.60 ? 197  GLN A N     1 
ATOM   1409 C  CA    . GLN A 1 202 ? 25.942  -32.739 -9.088  1.00 138.15 ? 197  GLN A CA    1 
ATOM   1410 C  C     . GLN A 1 202 ? 25.477  -34.195 -9.142  1.00 140.95 ? 197  GLN A C     1 
ATOM   1411 O  O     . GLN A 1 202 ? 26.316  -35.092 -9.191  1.00 134.44 ? 197  GLN A O     1 
ATOM   1412 C  CB    . GLN A 1 202 ? 27.350  -32.709 -8.483  1.00 143.41 ? 197  GLN A CB    1 
ATOM   1413 C  CG    . GLN A 1 202 ? 27.924  -31.318 -8.245  1.00 148.94 ? 197  GLN A CG    1 
ATOM   1414 C  CD    . GLN A 1 202 ? 29.179  -31.345 -7.386  1.00 149.08 ? 197  GLN A CD    1 
ATOM   1415 O  OE1   . GLN A 1 202 ? 30.061  -32.180 -7.583  1.00 157.32 ? 197  GLN A OE1   1 
ATOM   1416 N  NE2   . GLN A 1 202 ? 29.269  -30.425 -6.434  1.00 143.88 ? 197  GLN A NE2   1 
ATOM   1417 N  N     . SER A 1 203 ? 24.156  -34.430 -9.113  1.00 144.34 ? 198  SER A N     1 
ATOM   1418 C  CA    . SER A 1 203 ? 23.593  -35.756 -9.444  1.00 139.49 ? 198  SER A CA    1 
ATOM   1419 C  C     . SER A 1 203 ? 22.058  -35.757 -9.397  1.00 128.03 ? 198  SER A C     1 
ATOM   1420 O  O     . SER A 1 203 ? 21.392  -34.958 -10.056 1.00 118.59 ? 198  SER A O     1 
ATOM   1421 C  CB    . SER A 1 203 ? 24.121  -36.835 -8.486  1.00 140.41 ? 198  SER A CB    1 
ATOM   1422 O  OG    . SER A 1 203 ? 23.317  -37.989 -8.594  1.00 147.39 ? 198  SER A OG    1 
ATOM   1423 N  N     . GLU B 1 28  ? 46.641  -14.699 37.867  1.00 120.24 ? 23   GLU B N     1 
ATOM   1424 C  CA    . GLU B 1 28  ? 47.371  -15.392 36.752  1.00 120.46 ? 23   GLU B CA    1 
ATOM   1425 C  C     . GLU B 1 28  ? 47.209  -16.926 36.737  1.00 112.79 ? 23   GLU B C     1 
ATOM   1426 O  O     . GLU B 1 28  ? 47.092  -17.551 37.788  1.00 101.07 ? 23   GLU B O     1 
ATOM   1427 C  CB    . GLU B 1 28  ? 48.863  -15.005 36.735  1.00 115.59 ? 23   GLU B CB    1 
ATOM   1428 C  CG    . GLU B 1 28  ? 49.694  -15.424 37.939  1.00 120.63 ? 23   GLU B CG    1 
ATOM   1429 C  CD    . GLU B 1 28  ? 51.188  -15.423 37.637  1.00 125.21 ? 23   GLU B CD    1 
ATOM   1430 O  OE1   . GLU B 1 28  ? 51.630  -14.646 36.766  1.00 113.11 ? 23   GLU B OE1   1 
ATOM   1431 O  OE2   . GLU B 1 28  ? 51.926  -16.204 38.277  1.00 137.87 ? 23   GLU B OE2   1 
ATOM   1432 N  N     . HIS B 1 29  ? 47.242  -17.519 35.541  1.00 112.16 ? 24   HIS B N     1 
ATOM   1433 C  CA    . HIS B 1 29  ? 47.177  -18.983 35.388  1.00 106.47 ? 24   HIS B CA    1 
ATOM   1434 C  C     . HIS B 1 29  ? 48.380  -19.605 34.715  1.00 100.90 ? 24   HIS B C     1 
ATOM   1435 O  O     . HIS B 1 29  ? 49.040  -18.991 33.861  1.00 86.98  ? 24   HIS B O     1 
ATOM   1436 C  CB    . HIS B 1 29  ? 45.966  -19.375 34.580  1.00 107.21 ? 24   HIS B CB    1 
ATOM   1437 C  CG    . HIS B 1 29  ? 44.686  -18.925 35.191  1.00 112.79 ? 24   HIS B CG    1 
ATOM   1438 N  ND1   . HIS B 1 29  ? 44.253  -19.383 36.416  1.00 114.52 ? 24   HIS B ND1   1 
ATOM   1439 C  CD2   . HIS B 1 29  ? 43.750  -18.051 34.757  1.00 110.78 ? 24   HIS B CD2   1 
ATOM   1440 C  CE1   . HIS B 1 29  ? 43.096  -18.816 36.708  1.00 114.80 ? 24   HIS B CE1   1 
ATOM   1441 N  NE2   . HIS B 1 29  ? 42.766  -18.009 35.715  1.00 110.59 ? 24   HIS B NE2   1 
ATOM   1442 N  N     . LEU B 1 30  ? 48.620  -20.865 35.071  1.00 102.48 ? 25   LEU B N     1 
ATOM   1443 C  CA    . LEU B 1 30  ? 49.519  -21.726 34.314  1.00 103.44 ? 25   LEU B CA    1 
ATOM   1444 C  C     . LEU B 1 30  ? 48.770  -22.956 33.776  1.00 97.58  ? 25   LEU B C     1 
ATOM   1445 O  O     . LEU B 1 30  ? 48.232  -23.746 34.553  1.00 86.81  ? 25   LEU B O     1 
ATOM   1446 C  CB    . LEU B 1 30  ? 50.700  -22.137 35.194  1.00 100.51 ? 25   LEU B CB    1 
ATOM   1447 C  CG    . LEU B 1 30  ? 51.884  -22.725 34.419  1.00 101.30 ? 25   LEU B CG    1 
ATOM   1448 C  CD1   . LEU B 1 30  ? 53.066  -21.769 34.330  1.00 100.07 ? 25   LEU B CD1   1 
ATOM   1449 C  CD2   . LEU B 1 30  ? 52.301  -24.046 35.031  1.00 101.09 ? 25   LEU B CD2   1 
ATOM   1450 N  N     . PHE B 1 31  ? 48.742  -23.102 32.446  1.00 95.32  ? 26   PHE B N     1 
ATOM   1451 C  CA    . PHE B 1 31  ? 48.117  -24.262 31.787  1.00 89.61  ? 26   PHE B CA    1 
ATOM   1452 C  C     . PHE B 1 31  ? 49.096  -25.140 30.983  1.00 77.60  ? 26   PHE B C     1 
ATOM   1453 O  O     . PHE B 1 31  ? 49.840  -24.641 30.136  1.00 71.04  ? 26   PHE B O     1 
ATOM   1454 C  CB    . PHE B 1 31  ? 47.035  -23.783 30.844  1.00 92.65  ? 26   PHE B CB    1 
ATOM   1455 C  CG    . PHE B 1 31  ? 45.939  -23.007 31.504  1.00 97.53  ? 26   PHE B CG    1 
ATOM   1456 C  CD1   . PHE B 1 31  ? 45.375  -23.434 32.703  1.00 107.82 ? 26   PHE B CD1   1 
ATOM   1457 C  CD2   . PHE B 1 31  ? 45.441  -21.865 30.902  1.00 100.59 ? 26   PHE B CD2   1 
ATOM   1458 C  CE1   . PHE B 1 31  ? 44.347  -22.726 33.295  1.00 106.61 ? 26   PHE B CE1   1 
ATOM   1459 C  CE2   . PHE B 1 31  ? 44.418  -21.150 31.487  1.00 106.11 ? 26   PHE B CE2   1 
ATOM   1460 C  CZ    . PHE B 1 31  ? 43.872  -21.581 32.685  1.00 112.23 ? 26   PHE B CZ    1 
ATOM   1461 N  N     . LYS B 1 32  ? 49.073  -26.441 31.270  1.00 73.23  ? 27   LYS B N     1 
ATOM   1462 C  CA    . LYS B 1 32  ? 49.783  -27.437 30.483  1.00 69.52  ? 27   LYS B CA    1 
ATOM   1463 C  C     . LYS B 1 32  ? 48.930  -27.811 29.309  1.00 72.19  ? 27   LYS B C     1 
ATOM   1464 O  O     . LYS B 1 32  ? 47.860  -28.444 29.466  1.00 67.12  ? 27   LYS B O     1 
ATOM   1465 C  CB    . LYS B 1 32  ? 50.061  -28.708 31.294  1.00 74.50  ? 27   LYS B CB    1 
ATOM   1466 C  CG    . LYS B 1 32  ? 50.967  -29.718 30.593  1.00 76.52  ? 27   LYS B CG    1 
ATOM   1467 C  CD    . LYS B 1 32  ? 50.852  -31.119 31.190  1.00 78.95  ? 27   LYS B CD    1 
ATOM   1468 C  CE    . LYS B 1 32  ? 52.137  -31.910 31.001  1.00 78.66  ? 27   LYS B CE    1 
ATOM   1469 N  NZ    . LYS B 1 32  ? 52.139  -33.208 31.725  1.00 80.78  ? 27   LYS B NZ    1 
ATOM   1470 N  N     . VAL B 1 33  ? 49.427  -27.469 28.126  1.00 72.91  ? 28   VAL B N     1 
ATOM   1471 C  CA    . VAL B 1 33  ? 48.739  -27.809 26.882  1.00 75.07  ? 28   VAL B CA    1 
ATOM   1472 C  C     . VAL B 1 33  ? 49.606  -28.653 25.961  1.00 68.90  ? 28   VAL B C     1 
ATOM   1473 O  O     . VAL B 1 33  ? 50.750  -28.296 25.661  1.00 66.90  ? 28   VAL B O     1 
ATOM   1474 C  CB    . VAL B 1 33  ? 48.319  -26.552 26.119  1.00 78.05  ? 28   VAL B CB    1 
ATOM   1475 C  CG1   . VAL B 1 33  ? 47.534  -26.921 24.880  1.00 77.27  ? 28   VAL B CG1   1 
ATOM   1476 C  CG2   . VAL B 1 33  ? 47.475  -25.675 27.013  1.00 81.85  ? 28   VAL B CG2   1 
ATOM   1477 N  N     . LEU B 1 34  ? 49.034  -29.760 25.507  1.00 59.40  ? 29   LEU B N     1 
ATOM   1478 C  CA    . LEU B 1 34  ? 49.738  -30.691 24.642  1.00 58.10  ? 29   LEU B CA    1 
ATOM   1479 C  C     . LEU B 1 34  ? 49.579  -30.309 23.187  1.00 58.96  ? 29   LEU B C     1 
ATOM   1480 O  O     . LEU B 1 34  ? 48.530  -29.820 22.784  1.00 63.13  ? 29   LEU B O     1 
ATOM   1481 C  CB    . LEU B 1 34  ? 49.159  -32.069 24.837  1.00 56.17  ? 29   LEU B CB    1 
ATOM   1482 C  CG    . LEU B 1 34  ? 49.251  -32.631 26.245  1.00 58.24  ? 29   LEU B CG    1 
ATOM   1483 C  CD1   . LEU B 1 34  ? 48.422  -33.902 26.320  1.00 59.40  ? 29   LEU B CD1   1 
ATOM   1484 C  CD2   . LEU B 1 34  ? 50.697  -32.910 26.618  1.00 58.72  ? 29   LEU B CD2   1 
ATOM   1485 N  N     . VAL B 1 35  ? 50.595  -30.588 22.390  1.00 56.12  ? 30   VAL B N     1 
ATOM   1486 C  CA    . VAL B 1 35  ? 50.456  -30.535 20.947  1.00 56.81  ? 30   VAL B CA    1 
ATOM   1487 C  C     . VAL B 1 35  ? 50.894  -31.862 20.342  1.00 57.73  ? 30   VAL B C     1 
ATOM   1488 O  O     . VAL B 1 35  ? 52.051  -32.234 20.428  1.00 56.36  ? 30   VAL B O     1 
ATOM   1489 C  CB    . VAL B 1 35  ? 51.327  -29.423 20.367  1.00 55.25  ? 30   VAL B CB    1 
ATOM   1490 C  CG1   . VAL B 1 35  ? 51.116  -29.287 18.863  1.00 55.52  ? 30   VAL B CG1   1 
ATOM   1491 C  CG2   . VAL B 1 35  ? 51.011  -28.128 21.063  1.00 54.74  ? 30   VAL B CG2   1 
ATOM   1492 N  N     . ILE B 1 36  ? 49.965  -32.570 19.722  1.00 54.53  ? 31   ILE B N     1 
ATOM   1493 C  CA    . ILE B 1 36  ? 50.213  -33.929 19.321  1.00 53.95  ? 31   ILE B CA    1 
ATOM   1494 C  C     . ILE B 1 36  ? 49.737  -34.190 17.915  1.00 58.65  ? 31   ILE B C     1 
ATOM   1495 O  O     . ILE B 1 36  ? 48.975  -33.411 17.352  1.00 63.56  ? 31   ILE B O     1 
ATOM   1496 C  CB    . ILE B 1 36  ? 49.559  -34.910 20.293  1.00 55.15  ? 31   ILE B CB    1 
ATOM   1497 C  CG1   . ILE B 1 36  ? 48.042  -34.795 20.288  1.00 55.56  ? 31   ILE B CG1   1 
ATOM   1498 C  CG2   . ILE B 1 36  ? 50.057  -34.640 21.696  1.00 55.73  ? 31   ILE B CG2   1 
ATOM   1499 C  CD1   . ILE B 1 36  ? 47.350  -35.805 21.203  1.00 55.01  ? 31   ILE B CD1   1 
ATOM   1500 N  N     . GLY B 1 37  ? 50.215  -35.290 17.344  1.00 64.52  ? 32   GLY B N     1 
ATOM   1501 C  CA    . GLY B 1 37  ? 49.939  -35.643 15.945  1.00 62.13  ? 32   GLY B CA    1 
ATOM   1502 C  C     . GLY B 1 37  ? 51.154  -36.215 15.237  1.00 59.26  ? 32   GLY B C     1 
ATOM   1503 O  O     . GLY B 1 37  ? 52.269  -36.114 15.715  1.00 59.07  ? 32   GLY B O     1 
ATOM   1504 N  N     . GLU B 1 38  ? 50.924  -36.785 14.069  1.00 61.07  ? 33   GLU B N     1 
ATOM   1505 C  CA    . GLU B 1 38  ? 51.937  -37.544 13.349  1.00 60.61  ? 33   GLU B CA    1 
ATOM   1506 C  C     . GLU B 1 38  ? 53.156  -36.718 13.004  1.00 61.53  ? 33   GLU B C     1 
ATOM   1507 O  O     . GLU B 1 38  ? 53.160  -35.502 13.134  1.00 68.08  ? 33   GLU B O     1 
ATOM   1508 C  CB    . GLU B 1 38  ? 51.353  -38.108 12.050  1.00 64.43  ? 33   GLU B CB    1 
ATOM   1509 C  CG    . GLU B 1 38  ? 50.539  -39.382 12.224  1.00 68.73  ? 33   GLU B CG    1 
ATOM   1510 C  CD    . GLU B 1 38  ? 51.315  -40.516 12.872  1.00 75.58  ? 33   GLU B CD    1 
ATOM   1511 O  OE1   . GLU B 1 38  ? 52.578  -40.495 12.946  1.00 79.41  ? 33   GLU B OE1   1 
ATOM   1512 O  OE2   . GLU B 1 38  ? 50.636  -41.446 13.328  1.00 76.98  ? 33   GLU B OE2   1 
ATOM   1513 N  N     . LEU B 1 39  ? 54.206  -37.391 12.567  1.00 63.09  ? 34   LEU B N     1 
ATOM   1514 C  CA    . LEU B 1 39  ? 55.414  -36.702 12.137  1.00 64.23  ? 34   LEU B CA    1 
ATOM   1515 C  C     . LEU B 1 39  ? 55.164  -35.719 11.012  1.00 62.13  ? 34   LEU B C     1 
ATOM   1516 O  O     . LEU B 1 39  ? 54.135  -35.760 10.358  1.00 69.05  ? 34   LEU B O     1 
ATOM   1517 C  CB    . LEU B 1 39  ? 56.453  -37.719 11.681  1.00 73.66  ? 34   LEU B CB    1 
ATOM   1518 C  CG    . LEU B 1 39  ? 56.070  -38.545 10.446  1.00 81.10  ? 34   LEU B CG    1 
ATOM   1519 C  CD1   . LEU B 1 39  ? 57.193  -38.479 9.426   1.00 81.61  ? 34   LEU B CD1   1 
ATOM   1520 C  CD2   . LEU B 1 39  ? 55.769  -39.989 10.808  1.00 85.70  ? 34   LEU B CD2   1 
ATOM   1521 N  N     . GLY B 1 40  ? 56.151  -34.866 10.769  1.00 63.11  ? 35   GLY B N     1 
ATOM   1522 C  CA    . GLY B 1 40  ? 56.078  -33.746 9.812   1.00 65.10  ? 35   GLY B CA    1 
ATOM   1523 C  C     . GLY B 1 40  ? 54.807  -32.921 9.623   1.00 65.30  ? 35   GLY B C     1 
ATOM   1524 O  O     . GLY B 1 40  ? 54.616  -32.291 8.591   1.00 66.96  ? 35   GLY B O     1 
ATOM   1525 N  N     . VAL B 1 41  ? 53.957  -32.895 10.628  1.00 66.58  ? 36   VAL B N     1 
ATOM   1526 C  CA    . VAL B 1 41  ? 52.625  -32.363 10.487  1.00 62.30  ? 36   VAL B CA    1 
ATOM   1527 C  C     . VAL B 1 41  ? 52.620  -30.848 10.753  1.00 64.96  ? 36   VAL B C     1 
ATOM   1528 O  O     . VAL B 1 41  ? 51.741  -30.133 10.261  1.00 66.05  ? 36   VAL B O     1 
ATOM   1529 C  CB    . VAL B 1 41  ? 51.689  -33.110 11.449  1.00 62.93  ? 36   VAL B CB    1 
ATOM   1530 C  CG1   . VAL B 1 41  ? 50.838  -32.161 12.274  1.00 65.08  ? 36   VAL B CG1   1 
ATOM   1531 C  CG2   . VAL B 1 41  ? 50.853  -34.096 10.678  1.00 60.55  ? 36   VAL B CG2   1 
ATOM   1532 N  N     . GLY B 1 42  ? 53.628  -30.368 11.477  1.00 63.24  ? 37   GLY B N     1 
ATOM   1533 C  CA    . GLY B 1 42  ? 53.803  -28.937 11.742  1.00 66.03  ? 37   GLY B CA    1 
ATOM   1534 C  C     . GLY B 1 42  ? 53.709  -28.524 13.206  1.00 62.67  ? 37   GLY B C     1 
ATOM   1535 O  O     . GLY B 1 42  ? 53.746  -27.340 13.522  1.00 58.00  ? 37   GLY B O     1 
ATOM   1536 N  N     . LYS B 1 43  ? 53.660  -29.503 14.099  1.00 59.17  ? 38   LYS B N     1 
ATOM   1537 C  CA    . LYS B 1 43  ? 53.441  -29.244 15.494  1.00 52.33  ? 38   LYS B CA    1 
ATOM   1538 C  C     . LYS B 1 43  ? 54.477  -28.254 15.981  1.00 52.19  ? 38   LYS B C     1 
ATOM   1539 O  O     . LYS B 1 43  ? 54.154  -27.200 16.525  1.00 51.01  ? 38   LYS B O     1 
ATOM   1540 C  CB    . LYS B 1 43  ? 53.522  -30.549 16.288  1.00 51.11  ? 38   LYS B CB    1 
ATOM   1541 C  CG    . LYS B 1 43  ? 52.478  -31.578 15.861  1.00 50.04  ? 38   LYS B CG    1 
ATOM   1542 C  CD    . LYS B 1 43  ? 52.479  -32.870 16.654  1.00 50.91  ? 38   LYS B CD    1 
ATOM   1543 C  CE    . LYS B 1 43  ? 53.810  -33.611 16.606  1.00 56.52  ? 38   LYS B CE    1 
ATOM   1544 N  NZ    . LYS B 1 43  ? 54.249  -34.017 15.243  1.00 61.43  ? 38   LYS B NZ    1 
ATOM   1545 N  N     . THR B 1 44  ? 55.738  -28.579 15.774  1.00 52.76  ? 39   THR B N     1 
ATOM   1546 C  CA    . THR B 1 44  ? 56.808  -27.693 16.218  1.00 55.33  ? 39   THR B CA    1 
ATOM   1547 C  C     . THR B 1 44  ? 56.708  -26.306 15.576  1.00 54.25  ? 39   THR B C     1 
ATOM   1548 O  O     . THR B 1 44  ? 56.866  -25.300 16.247  1.00 51.29  ? 39   THR B O     1 
ATOM   1549 C  CB    . THR B 1 44  ? 58.193  -28.312 15.940  1.00 57.99  ? 39   THR B CB    1 
ATOM   1550 O  OG1   . THR B 1 44  ? 58.349  -29.517 16.711  1.00 55.62  ? 39   THR B OG1   1 
ATOM   1551 C  CG2   . THR B 1 44  ? 59.301  -27.346 16.308  1.00 59.16  ? 39   THR B CG2   1 
ATOM   1552 N  N     . SER B 1 45  ? 56.432  -26.268 14.277  1.00 54.77  ? 40   SER B N     1 
ATOM   1553 C  CA    . SER B 1 45  ? 56.381  -25.020 13.517  1.00 51.60  ? 40   SER B CA    1 
ATOM   1554 C  C     . SER B 1 45  ? 55.266  -24.088 13.971  1.00 49.64  ? 40   SER B C     1 
ATOM   1555 O  O     . SER B 1 45  ? 55.443  -22.879 14.033  1.00 54.24  ? 40   SER B O     1 
ATOM   1556 C  CB    . SER B 1 45  ? 56.145  -25.330 12.048  1.00 53.92  ? 40   SER B CB    1 
ATOM   1557 O  OG    . SER B 1 45  ? 57.221  -26.030 11.495  1.00 56.67  ? 40   SER B OG    1 
ATOM   1558 N  N     . ILE B 1 46  ? 54.101  -24.655 14.239  1.00 46.93  ? 41   ILE B N     1 
ATOM   1559 C  CA    . ILE B 1 46  ? 53.013  -23.893 14.791  1.00 48.15  ? 41   ILE B CA    1 
ATOM   1560 C  C     . ILE B 1 46  ? 53.489  -23.197 16.050  1.00 51.53  ? 41   ILE B C     1 
ATOM   1561 O  O     . ILE B 1 46  ? 53.464  -21.966 16.139  1.00 54.70  ? 41   ILE B O     1 
ATOM   1562 C  CB    . ILE B 1 46  ? 51.836  -24.794 15.146  1.00 50.67  ? 41   ILE B CB    1 
ATOM   1563 C  CG1   . ILE B 1 46  ? 51.068  -25.193 13.890  1.00 55.45  ? 41   ILE B CG1   1 
ATOM   1564 C  CG2   . ILE B 1 46  ? 50.892  -24.092 16.097  1.00 49.39  ? 41   ILE B CG2   1 
ATOM   1565 C  CD1   . ILE B 1 46  ? 50.195  -26.427 14.063  1.00 60.74  ? 41   ILE B CD1   1 
ATOM   1566 N  N     . ILE B 1 47  ? 53.966  -23.991 17.005  1.00 51.11  ? 42   ILE B N     1 
ATOM   1567 C  CA    . ILE B 1 47  ? 54.419  -23.465 18.294  1.00 51.25  ? 42   ILE B CA    1 
ATOM   1568 C  C     . ILE B 1 47  ? 55.459  -22.373 18.068  1.00 54.37  ? 42   ILE B C     1 
ATOM   1569 O  O     . ILE B 1 47  ? 55.417  -21.334 18.688  1.00 52.09  ? 42   ILE B O     1 
ATOM   1570 C  CB    . ILE B 1 47  ? 55.002  -24.574 19.197  1.00 50.58  ? 42   ILE B CB    1 
ATOM   1571 C  CG1   . ILE B 1 47  ? 53.893  -25.533 19.630  1.00 55.36  ? 42   ILE B CG1   1 
ATOM   1572 C  CG2   . ILE B 1 47  ? 55.655  -23.989 20.435  1.00 46.89  ? 42   ILE B CG2   1 
ATOM   1573 C  CD1   . ILE B 1 47  ? 54.396  -26.836 20.209  1.00 60.20  ? 42   ILE B CD1   1 
ATOM   1574 N  N     . LYS B 1 48  ? 56.379  -22.608 17.149  1.00 63.96  ? 43   LYS B N     1 
ATOM   1575 C  CA    . LYS B 1 48  ? 57.480  -21.694 16.961  1.00 71.77  ? 43   LYS B CA    1 
ATOM   1576 C  C     . LYS B 1 48  ? 56.968  -20.378 16.416  1.00 74.66  ? 43   LYS B C     1 
ATOM   1577 O  O     . LYS B 1 48  ? 57.411  -19.320 16.838  1.00 76.93  ? 43   LYS B O     1 
ATOM   1578 C  CB    . LYS B 1 48  ? 58.503  -22.269 15.995  1.00 77.81  ? 43   LYS B CB    1 
ATOM   1579 C  CG    . LYS B 1 48  ? 59.793  -21.477 15.972  1.00 80.02  ? 43   LYS B CG    1 
ATOM   1580 C  CD    . LYS B 1 48  ? 60.462  -21.593 14.622  1.00 84.20  ? 43   LYS B CD    1 
ATOM   1581 C  CE    . LYS B 1 48  ? 61.962  -21.471 14.743  1.00 90.53  ? 43   LYS B CE    1 
ATOM   1582 N  NZ    . LYS B 1 48  ? 62.582  -21.925 13.473  1.00 98.91  ? 43   LYS B NZ    1 
ATOM   1583 N  N     . ARG B 1 49  ? 56.048  -20.441 15.460  1.00 74.60  ? 44   ARG B N     1 
ATOM   1584 C  CA    . ARG B 1 49  ? 55.397  -19.228 14.986  1.00 78.60  ? 44   ARG B CA    1 
ATOM   1585 C  C     . ARG B 1 49  ? 54.587  -18.520 16.090  1.00 78.72  ? 44   ARG B C     1 
ATOM   1586 O  O     . ARG B 1 49  ? 54.761  -17.323 16.332  1.00 73.75  ? 44   ARG B O     1 
ATOM   1587 C  CB    . ARG B 1 49  ? 54.478  -19.525 13.822  1.00 80.54  ? 44   ARG B CB    1 
ATOM   1588 C  CG    . ARG B 1 49  ? 53.527  -18.378 13.599  1.00 83.78  ? 44   ARG B CG    1 
ATOM   1589 C  CD    . ARG B 1 49  ? 53.001  -18.317 12.189  1.00 87.42  ? 44   ARG B CD    1 
ATOM   1590 N  NE    . ARG B 1 49  ? 53.974  -18.061 11.125  1.00 89.08  ? 44   ARG B NE    1 
ATOM   1591 C  CZ    . ARG B 1 49  ? 54.819  -17.041 11.034  1.00 80.13  ? 44   ARG B CZ    1 
ATOM   1592 N  NH1   . ARG B 1 49  ? 54.915  -16.124 11.980  1.00 83.69  ? 44   ARG B NH1   1 
ATOM   1593 N  NH2   . ARG B 1 49  ? 55.596  -16.964 9.961   1.00 77.17  ? 44   ARG B NH2   1 
ATOM   1594 N  N     . TYR B 1 50  ? 53.707  -19.260 16.753  1.00 70.14  ? 45   TYR B N     1 
ATOM   1595 C  CA    . TYR B 1 50  ? 52.859  -18.675 17.766  1.00 67.33  ? 45   TYR B CA    1 
ATOM   1596 C  C     . TYR B 1 50  ? 53.628  -18.010 18.880  1.00 69.80  ? 45   TYR B C     1 
ATOM   1597 O  O     . TYR B 1 50  ? 53.081  -17.176 19.566  1.00 82.88  ? 45   TYR B O     1 
ATOM   1598 C  CB    . TYR B 1 50  ? 51.978  -19.739 18.392  1.00 71.57  ? 45   TYR B CB    1 
ATOM   1599 C  CG    . TYR B 1 50  ? 50.985  -19.221 19.412  1.00 75.38  ? 45   TYR B CG    1 
ATOM   1600 C  CD1   . TYR B 1 50  ? 50.262  -18.044 19.198  1.00 74.75  ? 45   TYR B CD1   1 
ATOM   1601 C  CD2   . TYR B 1 50  ? 50.750  -19.925 20.586  1.00 80.06  ? 45   TYR B CD2   1 
ATOM   1602 C  CE1   . TYR B 1 50  ? 49.362  -17.582 20.132  1.00 77.17  ? 45   TYR B CE1   1 
ATOM   1603 C  CE2   . TYR B 1 50  ? 49.835  -19.473 21.520  1.00 85.34  ? 45   TYR B CE2   1 
ATOM   1604 C  CZ    . TYR B 1 50  ? 49.151  -18.303 21.285  1.00 80.21  ? 45   TYR B CZ    1 
ATOM   1605 O  OH    . TYR B 1 50  ? 48.266  -17.865 22.225  1.00 78.68  ? 45   TYR B OH    1 
ATOM   1606 N  N     . VAL B 1 51  ? 54.875  -18.400 19.099  1.00 70.31  ? 46   VAL B N     1 
ATOM   1607 C  CA    . VAL B 1 51  ? 55.622  -17.949 20.252  1.00 67.21  ? 46   VAL B CA    1 
ATOM   1608 C  C     . VAL B 1 51  ? 56.738  -16.993 19.857  1.00 72.11  ? 46   VAL B C     1 
ATOM   1609 O  O     . VAL B 1 51  ? 57.044  -16.075 20.613  1.00 90.19  ? 46   VAL B O     1 
ATOM   1610 C  CB    . VAL B 1 51  ? 56.199  -19.156 21.013  1.00 68.94  ? 46   VAL B CB    1 
ATOM   1611 C  CG1   . VAL B 1 51  ? 57.240  -18.744 22.056  1.00 66.80  ? 46   VAL B CG1   1 
ATOM   1612 C  CG2   . VAL B 1 51  ? 55.072  -19.948 21.665  1.00 69.02  ? 46   VAL B CG2   1 
ATOM   1613 N  N     . HIS B 1 52  ? 57.366  -17.191 18.704  1.00 69.70  ? 47   HIS B N     1 
ATOM   1614 C  CA    . HIS B 1 52  ? 58.480  -16.311 18.295  1.00 73.31  ? 47   HIS B CA    1 
ATOM   1615 C  C     . HIS B 1 52  ? 58.253  -15.673 16.930  1.00 75.04  ? 47   HIS B C     1 
ATOM   1616 O  O     . HIS B 1 52  ? 59.160  -15.092 16.368  1.00 65.15  ? 47   HIS B O     1 
ATOM   1617 C  CB    . HIS B 1 52  ? 59.806  -17.078 18.270  1.00 73.18  ? 47   HIS B CB    1 
ATOM   1618 C  CG    . HIS B 1 52  ? 60.158  -17.740 19.566  1.00 76.30  ? 47   HIS B CG    1 
ATOM   1619 N  ND1   . HIS B 1 52  ? 59.813  -19.043 19.853  1.00 79.27  ? 47   HIS B ND1   1 
ATOM   1620 C  CD2   . HIS B 1 52  ? 60.843  -17.288 20.641  1.00 78.08  ? 47   HIS B CD2   1 
ATOM   1621 C  CE1   . HIS B 1 52  ? 60.253  -19.361 21.056  1.00 76.77  ? 47   HIS B CE1   1 
ATOM   1622 N  NE2   . HIS B 1 52  ? 60.888  -18.316 21.552  1.00 78.47  ? 47   HIS B NE2   1 
ATOM   1623 N  N     . GLN B 1 53  ? 57.053  -15.813 16.385  1.00 83.54  ? 48   GLN B N     1 
ATOM   1624 C  CA    . GLN B 1 53  ? 56.772  -15.380 15.021  1.00 87.46  ? 48   GLN B CA    1 
ATOM   1625 C  C     . GLN B 1 53  ? 57.877  -15.725 14.030  1.00 85.42  ? 48   GLN B C     1 
ATOM   1626 O  O     . GLN B 1 53  ? 58.333  -14.877 13.272  1.00 83.04  ? 48   GLN B O     1 
ATOM   1627 C  CB    . GLN B 1 53  ? 56.456  -13.890 15.026  1.00 91.47  ? 48   GLN B CB    1 
ATOM   1628 C  CG    . GLN B 1 53  ? 55.278  -13.565 15.962  1.00 104.57 ? 48   GLN B CG    1 
ATOM   1629 C  CD    . GLN B 1 53  ? 53.989  -14.281 15.517  1.00 108.85 ? 48   GLN B CD    1 
ATOM   1630 O  OE1   . GLN B 1 53  ? 53.764  -14.491 14.315  1.00 85.27  ? 48   GLN B OE1   1 
ATOM   1631 N  NE2   . GLN B 1 53  ? 53.146  -14.666 16.483  1.00 114.55 ? 48   GLN B NE2   1 
ATOM   1632 N  N     . LEU B 1 54  ? 58.303  -16.983 14.047  1.00 84.86  ? 49   LEU B N     1 
ATOM   1633 C  CA    . LEU B 1 54  ? 59.195  -17.501 13.032  1.00 79.94  ? 49   LEU B CA    1 
ATOM   1634 C  C     . LEU B 1 54  ? 58.675  -18.760 12.361  1.00 74.30  ? 49   LEU B C     1 
ATOM   1635 O  O     . LEU B 1 54  ? 57.834  -19.490 12.899  1.00 71.47  ? 49   LEU B O     1 
ATOM   1636 C  CB    . LEU B 1 54  ? 60.560  -17.760 13.645  1.00 80.79  ? 49   LEU B CB    1 
ATOM   1637 C  CG    . LEU B 1 54  ? 61.248  -16.420 13.994  1.00 86.60  ? 49   LEU B CG    1 
ATOM   1638 C  CD1   . LEU B 1 54  ? 62.255  -16.513 15.131  1.00 86.89  ? 49   LEU B CD1   1 
ATOM   1639 C  CD2   . LEU B 1 54  ? 61.912  -15.867 12.738  1.00 89.41  ? 49   LEU B CD2   1 
ATOM   1640 N  N     . PHE B 1 55  ? 59.201  -18.986 11.166  1.00 66.02  ? 50   PHE B N     1 
ATOM   1641 C  CA    . PHE B 1 55  ? 58.939  -20.187 10.414  1.00 67.53  ? 50   PHE B CA    1 
ATOM   1642 C  C     . PHE B 1 55  ? 60.155  -20.588 9.576   1.00 69.12  ? 50   PHE B C     1 
ATOM   1643 O  O     . PHE B 1 55  ? 60.807  -19.760 8.975   1.00 72.95  ? 50   PHE B O     1 
ATOM   1644 C  CB    . PHE B 1 55  ? 57.752  -19.985 9.491   1.00 67.62  ? 50   PHE B CB    1 
ATOM   1645 C  CG    . PHE B 1 55  ? 57.493  -21.151 8.603   1.00 69.42  ? 50   PHE B CG    1 
ATOM   1646 C  CD1   . PHE B 1 55  ? 58.156  -21.273 7.402   1.00 65.52  ? 50   PHE B CD1   1 
ATOM   1647 C  CD2   . PHE B 1 55  ? 56.628  -22.161 9.002   1.00 75.73  ? 50   PHE B CD2   1 
ATOM   1648 C  CE1   . PHE B 1 55  ? 57.934  -22.360 6.590   1.00 72.43  ? 50   PHE B CE1   1 
ATOM   1649 C  CE2   . PHE B 1 55  ? 56.405  -23.266 8.197   1.00 79.39  ? 50   PHE B CE2   1 
ATOM   1650 C  CZ    . PHE B 1 55  ? 57.056  -23.366 6.983   1.00 78.02  ? 50   PHE B CZ    1 
ATOM   1651 N  N     . SER B 1 56  ? 60.450  -21.875 9.528   1.00 74.01  ? 51   SER B N     1 
ATOM   1652 C  CA    . SER B 1 56  ? 61.474  -22.366 8.635   1.00 70.88  ? 51   SER B CA    1 
ATOM   1653 C  C     . SER B 1 56  ? 60.921  -23.474 7.763   1.00 70.56  ? 51   SER B C     1 
ATOM   1654 O  O     . SER B 1 56  ? 60.154  -24.329 8.241   1.00 73.22  ? 51   SER B O     1 
ATOM   1655 C  CB    . SER B 1 56  ? 62.666  -22.848 9.454   1.00 71.70  ? 51   SER B CB    1 
ATOM   1656 O  OG    . SER B 1 56  ? 63.656  -23.395 8.600   1.00 76.74  ? 51   SER B OG    1 
ATOM   1657 N  N     . GLN B 1 57  ? 61.328  -23.489 6.496   1.00 67.37  ? 52   GLN B N     1 
ATOM   1658 C  CA    . GLN B 1 57  ? 60.965  -24.602 5.610   1.00 72.96  ? 52   GLN B CA    1 
ATOM   1659 C  C     . GLN B 1 57  ? 61.714  -25.900 5.974   1.00 63.69  ? 52   GLN B C     1 
ATOM   1660 O  O     . GLN B 1 57  ? 61.261  -26.979 5.665   1.00 60.18  ? 52   GLN B O     1 
ATOM   1661 C  CB    . GLN B 1 57  ? 61.177  -24.219 4.139   1.00 83.62  ? 52   GLN B CB    1 
ATOM   1662 C  CG    . GLN B 1 57  ? 60.386  -25.065 3.134   1.00 103.26 ? 52   GLN B CG    1 
ATOM   1663 C  CD    . GLN B 1 57  ? 58.857  -25.017 3.310   1.00 118.09 ? 52   GLN B CD    1 
ATOM   1664 O  OE1   . GLN B 1 57  ? 58.213  -24.020 2.966   1.00 125.88 ? 52   GLN B OE1   1 
ATOM   1665 N  NE2   . GLN B 1 57  ? 58.274  -26.099 3.843   1.00 117.90 ? 52   GLN B NE2   1 
ATOM   1666 N  N     . HIS B 1 58  ? 62.845  -25.770 6.655   1.00 63.83  ? 53   HIS B N     1 
ATOM   1667 C  CA    . HIS B 1 58  ? 63.726  -26.879 6.975   1.00 68.22  ? 53   HIS B CA    1 
ATOM   1668 C  C     . HIS B 1 58  ? 63.099  -27.726 8.085   1.00 72.47  ? 53   HIS B C     1 
ATOM   1669 O  O     . HIS B 1 58  ? 62.642  -27.177 9.103   1.00 85.41  ? 53   HIS B O     1 
ATOM   1670 C  CB    . HIS B 1 58  ? 65.064  -26.300 7.426   1.00 75.37  ? 53   HIS B CB    1 
ATOM   1671 C  CG    . HIS B 1 58  ? 66.078  -27.328 7.835   1.00 94.13  ? 53   HIS B CG    1 
ATOM   1672 N  ND1   . HIS B 1 58  ? 66.686  -28.189 6.944   1.00 100.12 ? 53   HIS B ND1   1 
ATOM   1673 C  CD2   . HIS B 1 58  ? 66.609  -27.615 9.052   1.00 102.03 ? 53   HIS B CD2   1 
ATOM   1674 C  CE1   . HIS B 1 58  ? 67.543  -28.962 7.591   1.00 97.76  ? 53   HIS B CE1   1 
ATOM   1675 N  NE2   . HIS B 1 58  ? 67.515  -28.635 8.871   1.00 97.76  ? 53   HIS B NE2   1 
ATOM   1676 N  N     . TYR B 1 59  ? 63.054  -29.047 7.887   1.00 65.85  ? 54   TYR B N     1 
ATOM   1677 C  CA    . TYR B 1 59  ? 62.439  -29.966 8.857   1.00 60.05  ? 54   TYR B CA    1 
ATOM   1678 C  C     . TYR B 1 59  ? 63.467  -30.627 9.776   1.00 61.60  ? 54   TYR B C     1 
ATOM   1679 O  O     . TYR B 1 59  ? 64.382  -31.295 9.323   1.00 58.63  ? 54   TYR B O     1 
ATOM   1680 C  CB    . TYR B 1 59  ? 61.666  -31.031 8.124   1.00 55.61  ? 54   TYR B CB    1 
ATOM   1681 C  CG    . TYR B 1 59  ? 61.044  -32.114 8.984   1.00 54.94  ? 54   TYR B CG    1 
ATOM   1682 C  CD1   . TYR B 1 59  ? 60.710  -31.918 10.322  1.00 57.06  ? 54   TYR B CD1   1 
ATOM   1683 C  CD2   . TYR B 1 59  ? 60.775  -33.350 8.429   1.00 51.92  ? 54   TYR B CD2   1 
ATOM   1684 C  CE1   . TYR B 1 59  ? 60.135  -32.951 11.065  1.00 62.33  ? 54   TYR B CE1   1 
ATOM   1685 C  CE2   . TYR B 1 59  ? 60.209  -34.380 9.153   1.00 50.99  ? 54   TYR B CE2   1 
ATOM   1686 C  CZ    . TYR B 1 59  ? 59.887  -34.196 10.464  1.00 55.53  ? 54   TYR B CZ    1 
ATOM   1687 O  OH    . TYR B 1 59  ? 59.328  -35.258 11.134  1.00 46.13  ? 54   TYR B OH    1 
ATOM   1688 N  N     . ARG B 1 60  ? 63.317  -30.431 11.078  1.00 64.21  ? 55   ARG B N     1 
ATOM   1689 C  CA    . ARG B 1 60  ? 64.170  -31.103 12.026  1.00 64.61  ? 55   ARG B CA    1 
ATOM   1690 C  C     . ARG B 1 60  ? 63.280  -31.823 13.004  1.00 61.74  ? 55   ARG B C     1 
ATOM   1691 O  O     . ARG B 1 60  ? 62.577  -31.213 13.789  1.00 62.89  ? 55   ARG B O     1 
ATOM   1692 C  CB    . ARG B 1 60  ? 65.099  -30.110 12.735  1.00 69.88  ? 55   ARG B CB    1 
ATOM   1693 C  CG    . ARG B 1 60  ? 66.571  -30.198 12.313  1.00 81.27  ? 55   ARG B CG    1 
ATOM   1694 C  CD    . ARG B 1 60  ? 67.550  -29.953 13.475  1.00 90.53  ? 55   ARG B CD    1 
ATOM   1695 N  NE    . ARG B 1 60  ? 68.219  -28.650 13.405  1.00 103.00 ? 55   ARG B NE    1 
ATOM   1696 C  CZ    . ARG B 1 60  ? 69.138  -28.246 14.286  1.00 117.78 ? 55   ARG B CZ    1 
ATOM   1697 N  NH1   . ARG B 1 60  ? 69.485  -29.035 15.302  1.00 119.95 ? 55   ARG B NH1   1 
ATOM   1698 N  NH2   . ARG B 1 60  ? 69.716  -27.051 14.158  1.00 119.33 ? 55   ARG B NH2   1 
ATOM   1699 N  N     . ALA B 1 61  ? 63.291  -33.142 12.927  1.00 63.03  ? 56   ALA B N     1 
ATOM   1700 C  CA    . ALA B 1 61  ? 62.359  -33.943 13.686  1.00 62.73  ? 56   ALA B CA    1 
ATOM   1701 C  C     . ALA B 1 61  ? 62.655  -33.777 15.145  1.00 63.15  ? 56   ALA B C     1 
ATOM   1702 O  O     . ALA B 1 61  ? 63.811  -33.739 15.576  1.00 63.78  ? 56   ALA B O     1 
ATOM   1703 C  CB    . ALA B 1 61  ? 62.469  -35.404 13.312  1.00 64.72  ? 56   ALA B CB    1 
ATOM   1704 N  N     . THR B 1 62  ? 61.583  -33.682 15.906  1.00 66.00  ? 57   THR B N     1 
ATOM   1705 C  CA    . THR B 1 62  ? 61.662  -33.476 17.340  1.00 59.92  ? 57   THR B CA    1 
ATOM   1706 C  C     . THR B 1 62  ? 62.140  -34.757 18.023  1.00 51.58  ? 57   THR B C     1 
ATOM   1707 O  O     . THR B 1 62  ? 61.670  -35.850 17.714  1.00 45.45  ? 57   THR B O     1 
ATOM   1708 C  CB    . THR B 1 62  ? 60.288  -32.978 17.835  1.00 61.28  ? 57   THR B CB    1 
ATOM   1709 O  OG1   . THR B 1 62  ? 60.077  -31.666 17.297  1.00 54.70  ? 57   THR B OG1   1 
ATOM   1710 C  CG2   . THR B 1 62  ? 60.215  -32.911 19.340  1.00 65.26  ? 57   THR B CG2   1 
ATOM   1711 N  N     . ILE B 1 63  ? 63.111  -34.605 18.915  1.00 50.78  ? 58   ILE B N     1 
ATOM   1712 C  CA    . ILE B 1 63  ? 63.640  -35.727 19.720  1.00 50.23  ? 58   ILE B CA    1 
ATOM   1713 C  C     . ILE B 1 63  ? 62.858  -35.830 21.006  1.00 47.45  ? 58   ILE B C     1 
ATOM   1714 O  O     . ILE B 1 63  ? 63.078  -35.050 21.936  1.00 48.60  ? 58   ILE B O     1 
ATOM   1715 C  CB    . ILE B 1 63  ? 65.127  -35.551 20.131  1.00 51.41  ? 58   ILE B CB    1 
ATOM   1716 C  CG1   . ILE B 1 63  ? 66.006  -35.080 18.981  1.00 54.72  ? 58   ILE B CG1   1 
ATOM   1717 C  CG2   . ILE B 1 63  ? 65.701  -36.863 20.635  1.00 54.66  ? 58   ILE B CG2   1 
ATOM   1718 C  CD1   . ILE B 1 63  ? 65.966  -35.964 17.761  1.00 58.91  ? 58   ILE B CD1   1 
ATOM   1719 N  N     . GLY B 1 64  ? 61.937  -36.779 21.063  1.00 47.90  ? 59   GLY B N     1 
ATOM   1720 C  CA    . GLY B 1 64  ? 61.100  -36.956 22.255  1.00 52.91  ? 59   GLY B CA    1 
ATOM   1721 C  C     . GLY B 1 64  ? 60.103  -35.837 22.513  1.00 53.28  ? 59   GLY B C     1 
ATOM   1722 O  O     . GLY B 1 64  ? 59.007  -35.867 22.006  1.00 66.07  ? 59   GLY B O     1 
ATOM   1723 N  N     . VAL B 1 65  ? 60.456  -34.869 23.333  1.00 54.47  ? 60   VAL B N     1 
ATOM   1724 C  CA    . VAL B 1 65  ? 59.497  -33.857 23.716  1.00 59.92  ? 60   VAL B CA    1 
ATOM   1725 C  C     . VAL B 1 65  ? 60.168  -32.484 23.821  1.00 62.11  ? 60   VAL B C     1 
ATOM   1726 O  O     . VAL B 1 65  ? 61.279  -32.340 24.343  1.00 68.74  ? 60   VAL B O     1 
ATOM   1727 C  CB    . VAL B 1 65  ? 58.657  -34.339 24.923  1.00 66.89  ? 60   VAL B CB    1 
ATOM   1728 C  CG1   . VAL B 1 65  ? 59.260  -33.973 26.241  1.00 75.58  ? 60   VAL B CG1   1 
ATOM   1729 C  CG2   . VAL B 1 65  ? 57.244  -33.804 24.852  1.00 73.84  ? 60   VAL B CG2   1 
ATOM   1730 N  N     . ASP B 1 66  ? 59.534  -31.501 23.198  1.00 60.35  ? 61   ASP B N     1 
ATOM   1731 C  CA    . ASP B 1 66  ? 59.993  -30.143 23.249  1.00 58.40  ? 61   ASP B CA    1 
ATOM   1732 C  C     . ASP B 1 66  ? 58.965  -29.277 23.962  1.00 58.72  ? 61   ASP B C     1 
ATOM   1733 O  O     . ASP B 1 66  ? 57.792  -29.631 24.062  1.00 57.73  ? 61   ASP B O     1 
ATOM   1734 C  CB    . ASP B 1 66  ? 60.236  -29.630 21.845  1.00 58.14  ? 61   ASP B CB    1 
ATOM   1735 C  CG    . ASP B 1 66  ? 61.181  -28.467 21.820  1.00 64.21  ? 61   ASP B CG    1 
ATOM   1736 O  OD1   . ASP B 1 66  ? 61.709  -28.106 22.890  1.00 67.53  ? 61   ASP B OD1   1 
ATOM   1737 O  OD2   . ASP B 1 66  ? 61.395  -27.895 20.731  1.00 70.31  ? 61   ASP B OD2   1 
ATOM   1738 N  N     . PHE B 1 67  ? 59.427  -28.145 24.476  1.00 58.26  ? 62   PHE B N     1 
ATOM   1739 C  CA    . PHE B 1 67  ? 58.620  -27.270 25.303  1.00 56.12  ? 62   PHE B CA    1 
ATOM   1740 C  C     . PHE B 1 67  ? 58.749  -25.831 24.840  1.00 57.62  ? 62   PHE B C     1 
ATOM   1741 O  O     . PHE B 1 67  ? 59.791  -25.419 24.328  1.00 55.27  ? 62   PHE B O     1 
ATOM   1742 C  CB    . PHE B 1 67  ? 59.097  -27.325 26.738  1.00 58.06  ? 62   PHE B CB    1 
ATOM   1743 C  CG    . PHE B 1 67  ? 59.106  -28.699 27.330  1.00 56.20  ? 62   PHE B CG    1 
ATOM   1744 C  CD1   . PHE B 1 67  ? 60.219  -29.500 27.204  1.00 56.22  ? 62   PHE B CD1   1 
ATOM   1745 C  CD2   . PHE B 1 67  ? 58.006  -29.178 28.038  1.00 56.26  ? 62   PHE B CD2   1 
ATOM   1746 C  CE1   . PHE B 1 67  ? 60.246  -30.758 27.766  1.00 56.45  ? 62   PHE B CE1   1 
ATOM   1747 C  CE2   . PHE B 1 67  ? 58.018  -30.443 28.598  1.00 55.69  ? 62   PHE B CE2   1 
ATOM   1748 C  CZ    . PHE B 1 67  ? 59.143  -31.233 28.461  1.00 56.13  ? 62   PHE B CZ    1 
ATOM   1749 N  N     . ALA B 1 68  ? 57.674  -25.065 25.004  1.00 66.20  ? 63   ALA B N     1 
ATOM   1750 C  CA    . ALA B 1 68  ? 57.752  -23.601 24.890  1.00 68.58  ? 63   ALA B CA    1 
ATOM   1751 C  C     . ALA B 1 68  ? 56.699  -22.943 25.752  1.00 70.01  ? 63   ALA B C     1 
ATOM   1752 O  O     . ALA B 1 68  ? 55.651  -23.556 26.038  1.00 65.10  ? 63   ALA B O     1 
ATOM   1753 C  CB    . ALA B 1 68  ? 57.605  -23.157 23.439  1.00 64.88  ? 63   ALA B CB    1 
ATOM   1754 N  N     . LEU B 1 69  ? 56.992  -21.698 26.141  1.00 70.88  ? 64   LEU B N     1 
ATOM   1755 C  CA    . LEU B 1 69  ? 56.162  -20.932 27.070  1.00 69.78  ? 64   LEU B CA    1 
ATOM   1756 C  C     . LEU B 1 69  ? 55.544  -19.765 26.330  1.00 69.38  ? 64   LEU B C     1 
ATOM   1757 O  O     . LEU B 1 69  ? 56.236  -19.013 25.658  1.00 58.20  ? 64   LEU B O     1 
ATOM   1758 C  CB    . LEU B 1 69  ? 56.985  -20.393 28.223  1.00 68.93  ? 64   LEU B CB    1 
ATOM   1759 C  CG    . LEU B 1 69  ? 56.191  -19.608 29.279  1.00 75.24  ? 64   LEU B CG    1 
ATOM   1760 C  CD1   . LEU B 1 69  ? 55.254  -20.479 30.111  1.00 68.83  ? 64   LEU B CD1   1 
ATOM   1761 C  CD2   . LEU B 1 69  ? 57.157  -18.858 30.192  1.00 79.82  ? 64   LEU B CD2   1 
ATOM   1762 N  N     . LYS B 1 70  ? 54.235  -19.619 26.471  1.00 75.99  ? 65   LYS B N     1 
ATOM   1763 C  CA    . LYS B 1 70  ? 53.530  -18.486 25.902  1.00 80.55  ? 65   LYS B CA    1 
ATOM   1764 C  C     . LYS B 1 70  ? 52.860  -17.694 27.012  1.00 91.99  ? 65   LYS B C     1 
ATOM   1765 O  O     . LYS B 1 70  ? 52.166  -18.261 27.866  1.00 94.71  ? 65   LYS B O     1 
ATOM   1766 C  CB    . LYS B 1 70  ? 52.490  -18.973 24.915  1.00 79.59  ? 65   LYS B CB    1 
ATOM   1767 C  CG    . LYS B 1 70  ? 51.618  -17.887 24.321  1.00 76.28  ? 65   LYS B CG    1 
ATOM   1768 C  CD    . LYS B 1 70  ? 52.330  -17.131 23.228  1.00 78.82  ? 65   LYS B CD    1 
ATOM   1769 C  CE    . LYS B 1 70  ? 51.457  -16.011 22.707  1.00 77.80  ? 65   LYS B CE    1 
ATOM   1770 N  NZ    . LYS B 1 70  ? 52.180  -15.206 21.696  1.00 78.41  ? 65   LYS B NZ    1 
ATOM   1771 N  N     . VAL B 1 71  ? 53.075  -16.382 26.995  1.00 96.43  ? 66   VAL B N     1 
ATOM   1772 C  CA    . VAL B 1 71  ? 52.504  -15.514 27.996  1.00 92.91  ? 66   VAL B CA    1 
ATOM   1773 C  C     . VAL B 1 71  ? 51.463  -14.617 27.334  1.00 92.30  ? 66   VAL B C     1 
ATOM   1774 O  O     . VAL B 1 71  ? 51.712  -14.009 26.295  1.00 88.94  ? 66   VAL B O     1 
ATOM   1775 C  CB    . VAL B 1 71  ? 53.589  -14.673 28.692  1.00 93.74  ? 66   VAL B CB    1 
ATOM   1776 C  CG1   . VAL B 1 71  ? 52.963  -13.845 29.783  1.00 100.11 ? 66   VAL B CG1   1 
ATOM   1777 C  CG2   . VAL B 1 71  ? 54.653  -15.560 29.314  1.00 92.65  ? 66   VAL B CG2   1 
ATOM   1778 N  N     . LEU B 1 72  ? 50.307  -14.512 27.972  1.00 95.93  ? 67   LEU B N     1 
ATOM   1779 C  CA    . LEU B 1 72  ? 49.146  -13.851 27.388  1.00 106.85 ? 67   LEU B CA    1 
ATOM   1780 C  C     . LEU B 1 72  ? 48.555  -12.792 28.321  1.00 135.49 ? 67   LEU B C     1 
ATOM   1781 O  O     . LEU B 1 72  ? 48.254  -13.091 29.483  1.00 159.52 ? 67   LEU B O     1 
ATOM   1782 C  CB    . LEU B 1 72  ? 48.072  -14.888 27.131  1.00 101.04 ? 67   LEU B CB    1 
ATOM   1783 C  CG    . LEU B 1 72  ? 48.222  -15.765 25.911  1.00 90.77  ? 67   LEU B CG    1 
ATOM   1784 C  CD1   . LEU B 1 72  ? 46.989  -16.656 25.808  1.00 81.04  ? 67   LEU B CD1   1 
ATOM   1785 C  CD2   . LEU B 1 72  ? 48.447  -14.941 24.655  1.00 85.51  ? 67   LEU B CD2   1 
ATOM   1786 N  N     . ASN B 1 73  ? 48.371  -11.569 27.817  1.00 141.37 ? 68   ASN B N     1 
ATOM   1787 C  CA    . ASN B 1 73  ? 47.537  -10.581 28.507  1.00 136.25 ? 68   ASN B CA    1 
ATOM   1788 C  C     . ASN B 1 73  ? 46.084  -10.735 28.111  1.00 123.34 ? 68   ASN B C     1 
ATOM   1789 O  O     . ASN B 1 73  ? 45.669  -10.278 27.048  1.00 127.73 ? 68   ASN B O     1 
ATOM   1790 C  CB    . ASN B 1 73  ? 48.032  -9.161  28.227  1.00 142.91 ? 68   ASN B CB    1 
ATOM   1791 C  CG    . ASN B 1 73  ? 49.380  -8.880  28.877  1.00 149.11 ? 68   ASN B CG    1 
ATOM   1792 O  OD1   . ASN B 1 73  ? 49.640  -9.304  30.011  1.00 151.96 ? 68   ASN B OD1   1 
ATOM   1793 N  ND2   . ASN B 1 73  ? 50.248  -8.172  28.164  1.00 148.63 ? 68   ASN B ND2   1 
ATOM   1794 N  N     . TRP B 1 74  ? 45.330  -11.420 28.961  1.00 112.43 ? 69   TRP B N     1 
ATOM   1795 C  CA    . TRP B 1 74  ? 44.035  -11.951 28.574  1.00 109.67 ? 69   TRP B CA    1 
ATOM   1796 C  C     . TRP B 1 74  ? 42.924  -10.941 28.872  1.00 119.77 ? 69   TRP B C     1 
ATOM   1797 O  O     . TRP B 1 74  ? 42.309  -10.430 27.936  1.00 120.35 ? 69   TRP B O     1 
ATOM   1798 C  CB    . TRP B 1 74  ? 43.797  -13.284 29.284  1.00 103.79 ? 69   TRP B CB    1 
ATOM   1799 C  CG    . TRP B 1 74  ? 42.549  -13.955 28.924  1.00 99.05  ? 69   TRP B CG    1 
ATOM   1800 C  CD1   . TRP B 1 74  ? 41.429  -14.050 29.687  1.00 95.01  ? 69   TRP B CD1   1 
ATOM   1801 C  CD2   . TRP B 1 74  ? 42.274  -14.666 27.714  1.00 107.99 ? 69   TRP B CD2   1 
ATOM   1802 N  NE1   . TRP B 1 74  ? 40.462  -14.760 29.027  1.00 97.97  ? 69   TRP B NE1   1 
ATOM   1803 C  CE2   . TRP B 1 74  ? 40.953  -15.153 27.811  1.00 107.92 ? 69   TRP B CE2   1 
ATOM   1804 C  CE3   . TRP B 1 74  ? 43.008  -14.932 26.552  1.00 113.06 ? 69   TRP B CE3   1 
ATOM   1805 C  CZ2   . TRP B 1 74  ? 40.344  -15.889 26.792  1.00 111.40 ? 69   TRP B CZ2   1 
ATOM   1806 C  CZ3   . TRP B 1 74  ? 42.397  -15.663 25.536  1.00 116.05 ? 69   TRP B CZ3   1 
ATOM   1807 C  CH2   . TRP B 1 74  ? 41.075  -16.135 25.666  1.00 111.16 ? 69   TRP B CH2   1 
ATOM   1808 N  N     . ASP B 1 75  ? 42.681  -10.652 30.160  1.00 122.72 ? 70   ASP B N     1 
ATOM   1809 C  CA    . ASP B 1 75  ? 42.050  -9.397  30.603  1.00 115.12 ? 70   ASP B CA    1 
ATOM   1810 C  C     . ASP B 1 75  ? 43.132  -8.381  30.919  1.00 124.26 ? 70   ASP B C     1 
ATOM   1811 O  O     . ASP B 1 75  ? 44.272  -8.523  30.488  1.00 133.50 ? 70   ASP B O     1 
ATOM   1812 C  CB    . ASP B 1 75  ? 41.190  -9.579  31.864  1.00 113.85 ? 70   ASP B CB    1 
ATOM   1813 C  CG    . ASP B 1 75  ? 40.301  -10.801 31.815  1.00 111.98 ? 70   ASP B CG    1 
ATOM   1814 O  OD1   . ASP B 1 75  ? 39.655  -11.014 30.774  1.00 102.77 ? 70   ASP B OD1   1 
ATOM   1815 O  OD2   . ASP B 1 75  ? 40.222  -11.522 32.838  1.00 106.53 ? 70   ASP B OD2   1 
ATOM   1816 N  N     . SER B 1 76  ? 42.764  -7.344  31.664  1.00 125.98 ? 71   SER B N     1 
ATOM   1817 C  CA    . SER B 1 76  ? 43.672  -6.716  32.618  1.00 126.10 ? 71   SER B CA    1 
ATOM   1818 C  C     . SER B 1 76  ? 43.570  -7.352  34.002  1.00 126.60 ? 71   SER B C     1 
ATOM   1819 O  O     . SER B 1 76  ? 44.551  -7.377  34.746  1.00 125.98 ? 71   SER B O     1 
ATOM   1820 C  CB    . SER B 1 76  ? 43.409  -5.209  32.671  1.00 125.90 ? 71   SER B CB    1 
ATOM   1821 O  OG    . SER B 1 76  ? 42.030  -4.947  32.546  1.00 125.59 ? 71   SER B OG    1 
ATOM   1822 N  N     . ARG B 1 77  ? 42.397  -7.883  34.341  1.00 131.49 ? 72   ARG B N     1 
ATOM   1823 C  CA    . ARG B 1 77  ? 42.268  -8.783  35.497  1.00 143.19 ? 72   ARG B CA    1 
ATOM   1824 C  C     . ARG B 1 77  ? 43.326  -9.893  35.474  1.00 149.55 ? 72   ARG B C     1 
ATOM   1825 O  O     . ARG B 1 77  ? 43.956  -10.189 36.498  1.00 148.86 ? 72   ARG B O     1 
ATOM   1826 C  CB    . ARG B 1 77  ? 40.874  -9.407  35.544  1.00 139.31 ? 72   ARG B CB    1 
ATOM   1827 C  CG    . ARG B 1 77  ? 39.735  -8.420  35.623  1.00 133.19 ? 72   ARG B CG    1 
ATOM   1828 C  CD    . ARG B 1 77  ? 38.739  -8.770  34.532  1.00 138.40 ? 72   ARG B CD    1 
ATOM   1829 N  NE    . ARG B 1 77  ? 37.392  -8.270  34.788  1.00 143.50 ? 72   ARG B NE    1 
ATOM   1830 C  CZ    . ARG B 1 77  ? 36.322  -8.565  34.044  1.00 139.14 ? 72   ARG B CZ    1 
ATOM   1831 N  NH1   . ARG B 1 77  ? 36.434  -9.325  32.959  1.00 145.49 ? 72   ARG B NH1   1 
ATOM   1832 N  NH2   . ARG B 1 77  ? 35.131  -8.082  34.372  1.00 130.04 ? 72   ARG B NH2   1 
ATOM   1833 N  N     . THR B 1 78  ? 43.520  -10.489 34.296  1.00 145.03 ? 73   THR B N     1 
ATOM   1834 C  CA    . THR B 1 78  ? 43.995  -11.855 34.179  1.00 133.28 ? 73   THR B CA    1 
ATOM   1835 C  C     . THR B 1 78  ? 45.087  -11.977 33.127  1.00 127.85 ? 73   THR B C     1 
ATOM   1836 O  O     . THR B 1 78  ? 45.084  -11.293 32.100  1.00 112.27 ? 73   THR B O     1 
ATOM   1837 C  CB    . THR B 1 78  ? 42.850  -12.819 33.816  1.00 125.11 ? 73   THR B CB    1 
ATOM   1838 O  OG1   . THR B 1 78  ? 41.696  -12.499 34.605  1.00 119.51 ? 73   THR B OG1   1 
ATOM   1839 C  CG2   . THR B 1 78  ? 43.261  -14.276 34.062  1.00 127.81 ? 73   THR B CG2   1 
ATOM   1840 N  N     . LEU B 1 79  ? 46.027  -12.864 33.418  1.00 124.98 ? 74   LEU B N     1 
ATOM   1841 C  CA    . LEU B 1 79  ? 47.108  -13.184 32.506  1.00 121.16 ? 74   LEU B CA    1 
ATOM   1842 C  C     . LEU B 1 79  ? 47.341  -14.703 32.544  1.00 119.48 ? 74   LEU B C     1 
ATOM   1843 O  O     . LEU B 1 79  ? 47.115  -15.352 33.573  1.00 116.60 ? 74   LEU B O     1 
ATOM   1844 C  CB    . LEU B 1 79  ? 48.354  -12.372 32.894  1.00 114.88 ? 74   LEU B CB    1 
ATOM   1845 C  CG    . LEU B 1 79  ? 49.763  -12.950 32.724  1.00 107.58 ? 74   LEU B CG    1 
ATOM   1846 C  CD1   . LEU B 1 79  ? 50.768  -11.856 32.398  1.00 99.14  ? 74   LEU B CD1   1 
ATOM   1847 C  CD2   . LEU B 1 79  ? 50.189  -13.709 33.974  1.00 109.30 ? 74   LEU B CD2   1 
ATOM   1848 N  N     . VAL B 1 80  ? 47.750  -15.266 31.407  1.00 114.51 ? 75   VAL B N     1 
ATOM   1849 C  CA    . VAL B 1 80  ? 47.854  -16.718 31.247  1.00 114.25 ? 75   VAL B CA    1 
ATOM   1850 C  C     . VAL B 1 80  ? 49.230  -17.142 30.735  1.00 102.12 ? 75   VAL B C     1 
ATOM   1851 O  O     . VAL B 1 80  ? 49.653  -16.752 29.647  1.00 82.56  ? 75   VAL B O     1 
ATOM   1852 C  CB    . VAL B 1 80  ? 46.787  -17.245 30.255  1.00 123.61 ? 75   VAL B CB    1 
ATOM   1853 C  CG1   . VAL B 1 80  ? 46.765  -18.763 30.248  1.00 127.90 ? 75   VAL B CG1   1 
ATOM   1854 C  CG2   . VAL B 1 80  ? 45.400  -16.696 30.567  1.00 131.46 ? 75   VAL B CG2   1 
ATOM   1855 N  N     . ARG B 1 81  ? 49.905  -17.961 31.542  1.00 101.14 ? 76   ARG B N     1 
ATOM   1856 C  CA    . ARG B 1 81  ? 51.056  -18.719 31.101  1.00 99.76  ? 76   ARG B CA    1 
ATOM   1857 C  C     . ARG B 1 81  ? 50.624  -20.018 30.456  1.00 98.46  ? 76   ARG B C     1 
ATOM   1858 O  O     . ARG B 1 81  ? 49.881  -20.828 31.040  1.00 96.67  ? 76   ARG B O     1 
ATOM   1859 C  CB    . ARG B 1 81  ? 51.981  -19.017 32.275  1.00 108.84 ? 76   ARG B CB    1 
ATOM   1860 C  CG    . ARG B 1 81  ? 52.583  -17.766 32.864  1.00 115.98 ? 76   ARG B CG    1 
ATOM   1861 C  CD    . ARG B 1 81  ? 53.797  -18.025 33.738  1.00 116.99 ? 76   ARG B CD    1 
ATOM   1862 N  NE    . ARG B 1 81  ? 54.756  -16.942 33.552  1.00 122.55 ? 76   ARG B NE    1 
ATOM   1863 C  CZ    . ARG B 1 81  ? 54.529  -15.668 33.882  1.00 128.32 ? 76   ARG B CZ    1 
ATOM   1864 N  NH1   . ARG B 1 81  ? 53.385  -15.290 34.461  1.00 128.96 ? 76   ARG B NH1   1 
ATOM   1865 N  NH2   . ARG B 1 81  ? 55.468  -14.757 33.653  1.00 127.12 ? 76   ARG B NH2   1 
ATOM   1866 N  N     . LEU B 1 82  ? 51.130  -20.226 29.251  1.00 96.51  ? 77   LEU B N     1 
ATOM   1867 C  CA    . LEU B 1 82  ? 50.837  -21.413 28.477  1.00 88.04  ? 77   LEU B CA    1 
ATOM   1868 C  C     . LEU B 1 82  ? 52.091  -22.248 28.316  1.00 82.95  ? 77   LEU B C     1 
ATOM   1869 O  O     . LEU B 1 82  ? 53.011  -21.859 27.590  1.00 76.61  ? 77   LEU B O     1 
ATOM   1870 C  CB    . LEU B 1 82  ? 50.319  -20.987 27.121  1.00 87.62  ? 77   LEU B CB    1 
ATOM   1871 C  CG    . LEU B 1 82  ? 49.073  -21.699 26.657  1.00 88.88  ? 77   LEU B CG    1 
ATOM   1872 C  CD1   . LEU B 1 82  ? 48.008  -21.708 27.724  1.00 90.11  ? 77   LEU B CD1   1 
ATOM   1873 C  CD2   . LEU B 1 82  ? 48.546  -20.989 25.425  1.00 89.74  ? 77   LEU B CD2   1 
ATOM   1874 N  N     . GLN B 1 83  ? 52.110  -23.388 29.003  1.00 77.69  ? 78   GLN B N     1 
ATOM   1875 C  CA    . GLN B 1 83  ? 53.159  -24.388 28.835  1.00 76.54  ? 78   GLN B CA    1 
ATOM   1876 C  C     . GLN B 1 83  ? 52.810  -25.277 27.662  1.00 69.20  ? 78   GLN B C     1 
ATOM   1877 O  O     . GLN B 1 83  ? 51.861  -26.085 27.747  1.00 58.78  ? 78   GLN B O     1 
ATOM   1878 C  CB    . GLN B 1 83  ? 53.244  -25.283 30.060  1.00 85.15  ? 78   GLN B CB    1 
ATOM   1879 C  CG    . GLN B 1 83  ? 53.922  -24.674 31.270  1.00 85.80  ? 78   GLN B CG    1 
ATOM   1880 C  CD    . GLN B 1 83  ? 54.471  -25.716 32.242  1.00 85.20  ? 78   GLN B CD    1 
ATOM   1881 O  OE1   . GLN B 1 83  ? 55.464  -25.444 32.903  1.00 88.29  ? 78   GLN B OE1   1 
ATOM   1882 N  NE2   . GLN B 1 83  ? 53.840  -26.911 32.328  1.00 76.90  ? 78   GLN B NE2   1 
ATOM   1883 N  N     . LEU B 1 84  ? 53.560  -25.141 26.572  1.00 63.16  ? 79   LEU B N     1 
ATOM   1884 C  CA    . LEU B 1 84  ? 53.253  -25.897 25.364  1.00 60.09  ? 79   LEU B CA    1 
ATOM   1885 C  C     . LEU B 1 84  ? 54.165  -27.100 25.242  1.00 59.25  ? 79   LEU B C     1 
ATOM   1886 O  O     . LEU B 1 84  ? 55.395  -26.965 25.130  1.00 55.96  ? 79   LEU B O     1 
ATOM   1887 C  CB    . LEU B 1 84  ? 53.366  -25.015 24.138  1.00 62.37  ? 79   LEU B CB    1 
ATOM   1888 C  CG    . LEU B 1 84  ? 52.247  -23.984 23.977  1.00 62.66  ? 79   LEU B CG    1 
ATOM   1889 C  CD1   . LEU B 1 84  ? 52.565  -23.064 22.800  1.00 65.59  ? 79   LEU B CD1   1 
ATOM   1890 C  CD2   . LEU B 1 84  ? 50.881  -24.623 23.785  1.00 60.63  ? 79   LEU B CD2   1 
ATOM   1891 N  N     . TRP B 1 85  ? 53.546  -28.281 25.277  1.00 59.72  ? 80   TRP B N     1 
ATOM   1892 C  CA    . TRP B 1 85  ? 54.266  -29.559 25.272  1.00 64.40  ? 80   TRP B CA    1 
ATOM   1893 C  C     . TRP B 1 85  ? 54.234  -30.176 23.871  1.00 60.12  ? 80   TRP B C     1 
ATOM   1894 O  O     . TRP B 1 85  ? 53.292  -30.883 23.492  1.00 60.18  ? 80   TRP B O     1 
ATOM   1895 C  CB    . TRP B 1 85  ? 53.676  -30.539 26.294  1.00 68.95  ? 80   TRP B CB    1 
ATOM   1896 C  CG    . TRP B 1 85  ? 54.018  -30.239 27.727  1.00 73.71  ? 80   TRP B CG    1 
ATOM   1897 C  CD1   . TRP B 1 85  ? 53.860  -29.051 28.377  1.00 79.78  ? 80   TRP B CD1   1 
ATOM   1898 C  CD2   . TRP B 1 85  ? 54.574  -31.147 28.685  1.00 73.21  ? 80   TRP B CD2   1 
ATOM   1899 N  NE1   . TRP B 1 85  ? 54.275  -29.160 29.682  1.00 80.91  ? 80   TRP B NE1   1 
ATOM   1900 C  CE2   . TRP B 1 85  ? 54.728  -30.434 29.893  1.00 77.20  ? 80   TRP B CE2   1 
ATOM   1901 C  CE3   . TRP B 1 85  ? 54.968  -32.484 28.637  1.00 67.25  ? 80   TRP B CE3   1 
ATOM   1902 C  CZ2   . TRP B 1 85  ? 55.234  -31.017 31.041  1.00 79.02  ? 80   TRP B CZ2   1 
ATOM   1903 C  CZ3   . TRP B 1 85  ? 55.471  -33.059 29.777  1.00 68.69  ? 80   TRP B CZ3   1 
ATOM   1904 C  CH2   . TRP B 1 85  ? 55.593  -32.330 30.967  1.00 74.52  ? 80   TRP B CH2   1 
ATOM   1905 N  N     . ASP B 1 86  ? 55.278  -29.863 23.117  1.00 58.90  ? 81   ASP B N     1 
ATOM   1906 C  CA    . ASP B 1 86  ? 55.442  -30.312 21.755  1.00 60.24  ? 81   ASP B CA    1 
ATOM   1907 C  C     . ASP B 1 86  ? 55.895  -31.779 21.767  1.00 57.53  ? 81   ASP B C     1 
ATOM   1908 O  O     . ASP B 1 86  ? 57.033  -32.090 22.089  1.00 62.63  ? 81   ASP B O     1 
ATOM   1909 C  CB    . ASP B 1 86  ? 56.481  -29.417 21.083  1.00 57.17  ? 81   ASP B CB    1 
ATOM   1910 C  CG    . ASP B 1 86  ? 56.700  -29.757 19.647  1.00 61.13  ? 81   ASP B CG    1 
ATOM   1911 O  OD1   . ASP B 1 86  ? 56.034  -30.685 19.146  1.00 62.68  ? 81   ASP B OD1   1 
ATOM   1912 O  OD2   . ASP B 1 86  ? 57.562  -29.096 19.025  1.00 65.82  ? 81   ASP B OD2   1 
ATOM   1913 N  N     . ILE B 1 87  ? 55.006  -32.678 21.416  1.00 52.73  ? 82   ILE B N     1 
ATOM   1914 C  CA    . ILE B 1 87  ? 55.328  -34.084 21.467  1.00 55.11  ? 82   ILE B CA    1 
ATOM   1915 C  C     . ILE B 1 87  ? 55.621  -34.694 20.083  1.00 57.44  ? 82   ILE B C     1 
ATOM   1916 O  O     . ILE B 1 87  ? 54.833  -34.571 19.164  1.00 56.15  ? 82   ILE B O     1 
ATOM   1917 C  CB    . ILE B 1 87  ? 54.185  -34.826 22.107  1.00 54.07  ? 82   ILE B CB    1 
ATOM   1918 C  CG1   . ILE B 1 87  ? 54.123  -34.404 23.555  1.00 54.65  ? 82   ILE B CG1   1 
ATOM   1919 C  CG2   . ILE B 1 87  ? 54.368  -36.333 21.965  1.00 52.26  ? 82   ILE B CG2   1 
ATOM   1920 C  CD1   . ILE B 1 87  ? 52.919  -34.960 24.262  1.00 56.18  ? 82   ILE B CD1   1 
ATOM   1921 N  N     . ALA B 1 88  ? 56.751  -35.382 19.964  1.00 52.49  ? 83   ALA B N     1 
ATOM   1922 C  CA    . ALA B 1 88  ? 57.255  -35.802 18.684  1.00 50.31  ? 83   ALA B CA    1 
ATOM   1923 C  C     . ALA B 1 88  ? 56.323  -36.878 18.149  1.00 51.66  ? 83   ALA B C     1 
ATOM   1924 O  O     . ALA B 1 88  ? 55.728  -37.634 18.910  1.00 47.39  ? 83   ALA B O     1 
ATOM   1925 C  CB    . ALA B 1 88  ? 58.650  -36.353 18.846  1.00 53.44  ? 83   ALA B CB    1 
ATOM   1926 N  N     . GLY B 1 89  ? 56.153  -36.939 16.841  1.00 52.18  ? 84   GLY B N     1 
ATOM   1927 C  CA    . GLY B 1 89  ? 55.089  -37.791 16.298  1.00 55.36  ? 84   GLY B CA    1 
ATOM   1928 C  C     . GLY B 1 89  ? 55.364  -39.278 16.481  1.00 54.68  ? 84   GLY B C     1 
ATOM   1929 O  O     . GLY B 1 89  ? 54.451  -40.111 16.480  1.00 54.25  ? 84   GLY B O     1 
ATOM   1930 N  N     . LEU B 1 90  ? 56.646  -39.591 16.627  1.00 54.86  ? 85   LEU B N     1 
ATOM   1931 C  CA    . LEU B 1 90  ? 57.112  -40.945 16.858  1.00 51.73  ? 85   LEU B CA    1 
ATOM   1932 C  C     . LEU B 1 90  ? 56.690  -41.471 18.193  1.00 49.68  ? 85   LEU B C     1 
ATOM   1933 O  O     . LEU B 1 90  ? 56.665  -42.671 18.399  1.00 48.77  ? 85   LEU B O     1 
ATOM   1934 C  CB    . LEU B 1 90  ? 58.633  -40.950 16.816  1.00 55.85  ? 85   LEU B CB    1 
ATOM   1935 C  CG    . LEU B 1 90  ? 59.385  -42.270 17.006  1.00 53.08  ? 85   LEU B CG    1 
ATOM   1936 C  CD1   . LEU B 1 90  ? 58.905  -43.303 16.020  1.00 51.89  ? 85   LEU B CD1   1 
ATOM   1937 C  CD2   . LEU B 1 90  ? 60.884  -42.061 16.833  1.00 53.02  ? 85   LEU B CD2   1 
ATOM   1938 N  N     . GLU B 1 91  ? 56.383  -40.578 19.125  1.00 53.31  ? 86   GLU B N     1 
ATOM   1939 C  CA    . GLU B 1 91  ? 56.305  -40.976 20.516  1.00 53.83  ? 86   GLU B CA    1 
ATOM   1940 C  C     . GLU B 1 91  ? 55.069  -41.789 20.822  1.00 52.74  ? 86   GLU B C     1 
ATOM   1941 O  O     . GLU B 1 91  ? 54.988  -42.390 21.889  1.00 53.53  ? 86   GLU B O     1 
ATOM   1942 C  CB    . GLU B 1 91  ? 56.380  -39.775 21.438  1.00 52.79  ? 86   GLU B CB    1 
ATOM   1943 C  CG    . GLU B 1 91  ? 57.785  -39.213 21.562  1.00 60.56  ? 86   GLU B CG    1 
ATOM   1944 C  CD    . GLU B 1 91  ? 58.756  -40.176 22.229  1.00 66.36  ? 86   GLU B CD    1 
ATOM   1945 O  OE1   . GLU B 1 91  ? 58.419  -40.685 23.323  1.00 64.81  ? 86   GLU B OE1   1 
ATOM   1946 O  OE2   . GLU B 1 91  ? 59.857  -40.416 21.657  1.00 82.09  ? 86   GLU B OE2   1 
ATOM   1947 N  N     . ARG B 1 92  ? 54.131  -41.886 19.893  1.00 53.01  ? 87   ARG B N     1 
ATOM   1948 C  CA    . ARG B 1 92  ? 52.975  -42.733 20.173  1.00 60.54  ? 87   ARG B CA    1 
ATOM   1949 C  C     . ARG B 1 92  ? 53.234  -44.209 20.008  1.00 62.33  ? 87   ARG B C     1 
ATOM   1950 O  O     . ARG B 1 92  ? 52.396  -45.016 20.387  1.00 72.79  ? 87   ARG B O     1 
ATOM   1951 C  CB    . ARG B 1 92  ? 51.748  -42.312 19.366  1.00 64.56  ? 87   ARG B CB    1 
ATOM   1952 C  CG    . ARG B 1 92  ? 51.587  -42.904 17.990  1.00 64.56  ? 87   ARG B CG    1 
ATOM   1953 C  CD    . ARG B 1 92  ? 50.369  -42.290 17.302  1.00 66.59  ? 87   ARG B CD    1 
ATOM   1954 N  NE    . ARG B 1 92  ? 50.361  -42.561 15.863  1.00 64.88  ? 87   ARG B NE    1 
ATOM   1955 C  CZ    . ARG B 1 92  ? 49.917  -43.687 15.313  1.00 62.99  ? 87   ARG B CZ    1 
ATOM   1956 N  NH1   . ARG B 1 92  ? 49.404  -44.668 16.051  1.00 66.46  ? 87   ARG B NH1   1 
ATOM   1957 N  NH2   . ARG B 1 92  ? 49.980  -43.837 14.010  1.00 65.72  ? 87   ARG B NH2   1 
ATOM   1958 N  N     . PHE B 1 93  ? 54.385  -44.571 19.462  1.00 60.60  ? 88   PHE B N     1 
ATOM   1959 C  CA    . PHE B 1 93  ? 54.783  -45.962 19.423  1.00 57.68  ? 88   PHE B CA    1 
ATOM   1960 C  C     . PHE B 1 93  ? 55.671  -46.355 20.586  1.00 59.22  ? 88   PHE B C     1 
ATOM   1961 O  O     . PHE B 1 93  ? 56.045  -47.531 20.714  1.00 60.60  ? 88   PHE B O     1 
ATOM   1962 C  CB    . PHE B 1 93  ? 55.475  -46.229 18.107  1.00 60.11  ? 88   PHE B CB    1 
ATOM   1963 C  CG    . PHE B 1 93  ? 54.647  -45.848 16.923  1.00 60.78  ? 88   PHE B CG    1 
ATOM   1964 C  CD1   . PHE B 1 93  ? 53.592  -46.653 16.513  1.00 56.65  ? 88   PHE B CD1   1 
ATOM   1965 C  CD2   . PHE B 1 93  ? 54.902  -44.671 16.229  1.00 62.29  ? 88   PHE B CD2   1 
ATOM   1966 C  CE1   . PHE B 1 93  ? 52.823  -46.300 15.419  1.00 57.08  ? 88   PHE B CE1   1 
ATOM   1967 C  CE2   . PHE B 1 93  ? 54.125  -44.308 15.135  1.00 60.47  ? 88   PHE B CE2   1 
ATOM   1968 C  CZ    . PHE B 1 93  ? 53.083  -45.127 14.727  1.00 56.43  ? 88   PHE B CZ    1 
ATOM   1969 N  N     . GLY B 1 94  ? 56.027  -45.375 21.414  1.00 56.79  ? 89   GLY B N     1 
ATOM   1970 C  CA    . GLY B 1 94  ? 56.792  -45.633 22.623  1.00 57.06  ? 89   GLY B CA    1 
ATOM   1971 C  C     . GLY B 1 94  ? 55.850  -45.778 23.781  1.00 56.75  ? 89   GLY B C     1 
ATOM   1972 O  O     . GLY B 1 94  ? 54.677  -45.993 23.575  1.00 51.38  ? 89   GLY B O     1 
ATOM   1973 N  N     . ASN B 1 95  ? 56.366  -45.631 24.999  1.00 69.53  ? 90   ASN B N     1 
ATOM   1974 C  CA    . ASN B 1 95  ? 55.609  -45.959 26.217  1.00 76.16  ? 90   ASN B CA    1 
ATOM   1975 C  C     . ASN B 1 95  ? 55.476  -44.786 27.146  1.00 72.04  ? 90   ASN B C     1 
ATOM   1976 O  O     . ASN B 1 95  ? 55.120  -44.959 28.307  1.00 77.92  ? 90   ASN B O     1 
ATOM   1977 C  CB    . ASN B 1 95  ? 56.285  -47.086 27.001  1.00 84.29  ? 90   ASN B CB    1 
ATOM   1978 C  CG    . ASN B 1 95  ? 56.566  -48.309 26.159  1.00 93.25  ? 90   ASN B CG    1 
ATOM   1979 O  OD1   . ASN B 1 95  ? 57.673  -48.827 26.221  1.00 104.20 ? 90   ASN B OD1   1 
ATOM   1980 N  ND2   . ASN B 1 95  ? 55.587  -48.782 25.372  1.00 91.78  ? 90   ASN B ND2   1 
ATOM   1981 N  N     . MET B 1 96  ? 55.758  -43.593 26.646  1.00 66.76  ? 91   MET B N     1 
ATOM   1982 C  CA    . MET B 1 96  ? 56.037  -42.458 27.513  1.00 67.26  ? 91   MET B CA    1 
ATOM   1983 C  C     . MET B 1 96  ? 54.868  -41.484 27.577  1.00 64.30  ? 91   MET B C     1 
ATOM   1984 O  O     . MET B 1 96  ? 54.934  -40.453 28.222  1.00 65.79  ? 91   MET B O     1 
ATOM   1985 C  CB    . MET B 1 96  ? 57.295  -41.722 27.033  1.00 73.46  ? 91   MET B CB    1 
ATOM   1986 C  CG    . MET B 1 96  ? 58.584  -42.406 27.461  1.00 79.78  ? 91   MET B CG    1 
ATOM   1987 S  SD    . MET B 1 96  ? 58.685  -42.627 29.264  1.00 79.45  ? 91   MET B SD    1 
ATOM   1988 C  CE    . MET B 1 96  ? 59.097  -40.950 29.708  1.00 77.61  ? 91   MET B CE    1 
ATOM   1989 N  N     . THR B 1 97  ? 53.798  -41.795 26.874  1.00 68.72  ? 92   THR B N     1 
ATOM   1990 C  CA    . THR B 1 97  ? 52.817  -40.806 26.546  1.00 62.34  ? 92   THR B CA    1 
ATOM   1991 C  C     . THR B 1 97  ? 51.951  -40.570 27.814  1.00 63.53  ? 92   THR B C     1 
ATOM   1992 O  O     . THR B 1 97  ? 51.679  -39.424 28.189  1.00 59.56  ? 92   THR B O     1 
ATOM   1993 C  CB    . THR B 1 97  ? 52.124  -41.335 25.271  1.00 60.34  ? 92   THR B CB    1 
ATOM   1994 O  OG1   . THR B 1 97  ? 52.066  -40.321 24.266  1.00 67.13  ? 92   THR B OG1   1 
ATOM   1995 C  CG2   . THR B 1 97  ? 50.778  -41.860 25.562  1.00 59.47  ? 92   THR B CG2   1 
ATOM   1996 N  N     . ARG B 1 98  ? 51.632  -41.649 28.538  1.00 72.98  ? 93   ARG B N     1 
ATOM   1997 C  CA    . ARG B 1 98  ? 51.094  -41.572 29.926  1.00 77.63  ? 93   ARG B CA    1 
ATOM   1998 C  C     . ARG B 1 98  ? 51.819  -40.545 30.783  1.00 70.42  ? 93   ARG B C     1 
ATOM   1999 O  O     . ARG B 1 98  ? 51.201  -39.800 31.505  1.00 80.63  ? 93   ARG B O     1 
ATOM   2000 C  CB    . ARG B 1 98  ? 51.147  -42.934 30.650  1.00 88.27  ? 93   ARG B CB    1 
ATOM   2001 C  CG    . ARG B 1 98  ? 52.433  -43.738 30.371  1.00 104.28 ? 93   ARG B CG    1 
ATOM   2002 C  CD    . ARG B 1 98  ? 53.046  -44.484 31.570  1.00 106.52 ? 93   ARG B CD    1 
ATOM   2003 N  NE    . ARG B 1 98  ? 54.343  -45.092 31.204  1.00 95.49  ? 93   ARG B NE    1 
ATOM   2004 C  CZ    . ARG B 1 98  ? 55.218  -45.616 32.057  1.00 84.50  ? 93   ARG B CZ    1 
ATOM   2005 N  NH1   . ARG B 1 98  ? 54.962  -45.619 33.363  1.00 85.86  ? 93   ARG B NH1   1 
ATOM   2006 N  NH2   . ARG B 1 98  ? 56.354  -46.140 31.602  1.00 76.16  ? 93   ARG B NH2   1 
ATOM   2007 N  N     . VAL B 1 99  ? 53.133  -40.496 30.694  1.00 64.26  ? 94   VAL B N     1 
ATOM   2008 C  CA    . VAL B 1 99  ? 53.893  -39.576 31.504  1.00 66.66  ? 94   VAL B CA    1 
ATOM   2009 C  C     . VAL B 1 99  ? 53.733  -38.161 30.993  1.00 66.96  ? 94   VAL B C     1 
ATOM   2010 O  O     . VAL B 1 99  ? 53.545  -37.238 31.785  1.00 74.99  ? 94   VAL B O     1 
ATOM   2011 C  CB    . VAL B 1 99  ? 55.381  -39.937 31.493  1.00 72.86  ? 94   VAL B CB    1 
ATOM   2012 C  CG1   . VAL B 1 99  ? 56.209  -38.849 32.158  1.00 77.80  ? 94   VAL B CG1   1 
ATOM   2013 C  CG2   . VAL B 1 99  ? 55.584  -41.273 32.188  1.00 75.55  ? 94   VAL B CG2   1 
ATOM   2014 N  N     . TYR B 1 100 ? 53.828  -37.998 29.677  1.00 64.72  ? 95   TYR B N     1 
ATOM   2015 C  CA    . TYR B 1 100 ? 53.709  -36.693 29.031  1.00 65.84  ? 95   TYR B CA    1 
ATOM   2016 C  C     . TYR B 1 100 ? 52.334  -36.044 29.225  1.00 64.05  ? 95   TYR B C     1 
ATOM   2017 O  O     . TYR B 1 100 ? 52.229  -34.818 29.399  1.00 61.05  ? 95   TYR B O     1 
ATOM   2018 C  CB    . TYR B 1 100 ? 53.921  -36.822 27.530  1.00 68.12  ? 95   TYR B CB    1 
ATOM   2019 C  CG    . TYR B 1 100 ? 55.238  -37.370 27.066  1.00 70.90  ? 95   TYR B CG    1 
ATOM   2020 C  CD1   . TYR B 1 100 ? 56.389  -37.205 27.791  1.00 74.20  ? 95   TYR B CD1   1 
ATOM   2021 C  CD2   . TYR B 1 100 ? 55.324  -38.052 25.854  1.00 79.00  ? 95   TYR B CD2   1 
ATOM   2022 C  CE1   . TYR B 1 100 ? 57.592  -37.713 27.330  1.00 83.75  ? 95   TYR B CE1   1 
ATOM   2023 C  CE2   . TYR B 1 100 ? 56.520  -38.564 25.386  1.00 77.87  ? 95   TYR B CE2   1 
ATOM   2024 C  CZ    . TYR B 1 100 ? 57.647  -38.396 26.129  1.00 79.27  ? 95   TYR B CZ    1 
ATOM   2025 O  OH    . TYR B 1 100 ? 58.829  -38.906 25.686  1.00 82.15  ? 95   TYR B OH    1 
ATOM   2026 N  N     . TYR B 1 101 ? 51.283  -36.859 29.152  1.00 60.89  ? 96   TYR B N     1 
ATOM   2027 C  CA    . TYR B 1 101 ? 49.930  -36.332 29.190  1.00 64.58  ? 96   TYR B CA    1 
ATOM   2028 C  C     . TYR B 1 101 ? 49.483  -35.892 30.601  1.00 72.33  ? 96   TYR B C     1 
ATOM   2029 O  O     . TYR B 1 101 ? 48.527  -35.127 30.738  1.00 81.01  ? 96   TYR B O     1 
ATOM   2030 C  CB    . TYR B 1 101 ? 48.936  -37.347 28.643  1.00 59.48  ? 96   TYR B CB    1 
ATOM   2031 C  CG    . TYR B 1 101 ? 49.078  -37.730 27.181  1.00 59.36  ? 96   TYR B CG    1 
ATOM   2032 C  CD1   . TYR B 1 101 ? 49.891  -37.016 26.277  1.00 58.10  ? 96   TYR B CD1   1 
ATOM   2033 C  CD2   . TYR B 1 101 ? 48.384  -38.825 26.693  1.00 58.26  ? 96   TYR B CD2   1 
ATOM   2034 C  CE1   . TYR B 1 101 ? 50.014  -37.413 24.945  1.00 53.58  ? 96   TYR B CE1   1 
ATOM   2035 C  CE2   . TYR B 1 101 ? 48.490  -39.218 25.365  1.00 54.26  ? 96   TYR B CE2   1 
ATOM   2036 C  CZ    . TYR B 1 101 ? 49.301  -38.520 24.493  1.00 53.69  ? 96   TYR B CZ    1 
ATOM   2037 O  OH    . TYR B 1 101 ? 49.387  -38.950 23.174  1.00 53.01  ? 96   TYR B OH    1 
ATOM   2038 N  N     . LYS B 1 102 ? 50.170  -36.343 31.646  1.00 75.72  ? 97   LYS B N     1 
ATOM   2039 C  CA    . LYS B 1 102 ? 49.649  -36.196 33.006  1.00 76.35  ? 97   LYS B CA    1 
ATOM   2040 C  C     . LYS B 1 102 ? 49.352  -34.735 33.311  1.00 78.83  ? 97   LYS B C     1 
ATOM   2041 O  O     . LYS B 1 102 ? 50.093  -33.852 32.887  1.00 77.56  ? 97   LYS B O     1 
ATOM   2042 C  CB    . LYS B 1 102 ? 50.645  -36.728 34.019  1.00 79.70  ? 97   LYS B CB    1 
ATOM   2043 C  CG    . LYS B 1 102 ? 50.001  -37.208 35.311  1.00 81.93  ? 97   LYS B CG    1 
ATOM   2044 C  CD    . LYS B 1 102 ? 51.031  -37.310 36.440  1.00 88.87  ? 97   LYS B CD    1 
ATOM   2045 C  CE    . LYS B 1 102 ? 50.465  -38.001 37.673  1.00 91.25  ? 97   LYS B CE    1 
ATOM   2046 N  NZ    . LYS B 1 102 ? 51.539  -38.556 38.547  1.00 92.60  ? 97   LYS B NZ    1 
ATOM   2047 N  N     . GLU B 1 103 ? 48.269  -34.481 34.046  1.00 84.77  ? 98   GLU B N     1 
ATOM   2048 C  CA    . GLU B 1 103 ? 47.950  -33.132 34.559  1.00 90.40  ? 98   GLU B CA    1 
ATOM   2049 C  C     . GLU B 1 103 ? 47.699  -32.112 33.404  1.00 77.95  ? 98   GLU B C     1 
ATOM   2050 O  O     . GLU B 1 103 ? 47.703  -30.922 33.649  1.00 81.43  ? 98   GLU B O     1 
ATOM   2051 C  CB    . GLU B 1 103 ? 49.070  -32.568 35.538  1.00 107.49 ? 98   GLU B CB    1 
ATOM   2052 C  CG    . GLU B 1 103 ? 50.202  -33.514 36.078  1.00 120.04 ? 98   GLU B CG    1 
ATOM   2053 C  CD    . GLU B 1 103 ? 51.646  -32.912 36.119  1.00 112.96 ? 98   GLU B CD    1 
ATOM   2054 O  OE1   . GLU B 1 103 ? 52.468  -32.950 35.147  1.00 91.24  ? 98   GLU B OE1   1 
ATOM   2055 O  OE2   . GLU B 1 103 ? 51.982  -32.417 37.197  1.00 110.14 ? 98   GLU B OE2   1 
ATOM   2056 N  N     . ALA B 1 104 ? 47.526  -32.550 32.154  1.00 75.05  ? 99   ALA B N     1 
ATOM   2057 C  CA    . ALA B 1 104 ? 47.266  -31.625 31.043  1.00 74.04  ? 99   ALA B CA    1 
ATOM   2058 C  C     . ALA B 1 104 ? 45.829  -31.166 31.096  1.00 75.27  ? 99   ALA B C     1 
ATOM   2059 O  O     . ALA B 1 104 ? 44.933  -31.946 31.410  1.00 73.57  ? 99   ALA B O     1 
ATOM   2060 C  CB    . ALA B 1 104 ? 47.535  -32.296 29.700  1.00 72.56  ? 99   ALA B CB    1 
ATOM   2061 N  N     . VAL B 1 105 ? 45.606  -29.903 30.743  1.00 78.58  ? 100  VAL B N     1 
ATOM   2062 C  CA    . VAL B 1 105 ? 44.266  -29.285 30.849  1.00 80.31  ? 100  VAL B CA    1 
ATOM   2063 C  C     . VAL B 1 105 ? 43.635  -28.953 29.488  1.00 80.72  ? 100  VAL B C     1 
ATOM   2064 O  O     . VAL B 1 105 ? 42.502  -28.461 29.435  1.00 91.19  ? 100  VAL B O     1 
ATOM   2065 C  CB    . VAL B 1 105 ? 44.299  -28.005 31.724  1.00 74.79  ? 100  VAL B CB    1 
ATOM   2066 C  CG1   . VAL B 1 105 ? 44.893  -28.315 33.080  1.00 70.99  ? 100  VAL B CG1   1 
ATOM   2067 C  CG2   . VAL B 1 105 ? 45.089  -26.877 31.063  1.00 74.91  ? 100  VAL B CG2   1 
ATOM   2068 N  N     . GLY B 1 106 ? 44.388  -29.193 28.412  1.00 79.79  ? 101  GLY B N     1 
ATOM   2069 C  CA    . GLY B 1 106 ? 43.944  -28.962 27.038  1.00 77.18  ? 101  GLY B CA    1 
ATOM   2070 C  C     . GLY B 1 106 ? 44.969  -29.442 26.002  1.00 75.38  ? 101  GLY B C     1 
ATOM   2071 O  O     . GLY B 1 106 ? 46.146  -29.637 26.318  1.00 68.07  ? 101  GLY B O     1 
ATOM   2072 N  N     . ALA B 1 107 ? 44.505  -29.659 24.767  1.00 73.59  ? 102  ALA B N     1 
ATOM   2073 C  CA    . ALA B 1 107 ? 45.319  -30.264 23.709  1.00 68.13  ? 102  ALA B CA    1 
ATOM   2074 C  C     . ALA B 1 107 ? 44.990  -29.703 22.331  1.00 64.10  ? 102  ALA B C     1 
ATOM   2075 O  O     . ALA B 1 107 ? 43.839  -29.590 21.957  1.00 63.19  ? 102  ALA B O     1 
ATOM   2076 C  CB    . ALA B 1 107 ? 45.131  -31.778 23.707  1.00 70.29  ? 102  ALA B CB    1 
ATOM   2077 N  N     . PHE B 1 108 ? 46.015  -29.403 21.555  1.00 64.35  ? 103  PHE B N     1 
ATOM   2078 C  CA    . PHE B 1 108 ? 45.905  -29.457 20.106  1.00 68.35  ? 103  PHE B CA    1 
ATOM   2079 C  C     . PHE B 1 108 ? 46.290  -30.818 19.545  1.00 68.66  ? 103  PHE B C     1 
ATOM   2080 O  O     . PHE B 1 108 ? 47.339  -31.345 19.884  1.00 79.89  ? 103  PHE B O     1 
ATOM   2081 C  CB    . PHE B 1 108 ? 46.823  -28.438 19.483  1.00 68.83  ? 103  PHE B CB    1 
ATOM   2082 C  CG    . PHE B 1 108 ? 46.466  -27.040 19.825  1.00 75.34  ? 103  PHE B CG    1 
ATOM   2083 C  CD1   . PHE B 1 108 ? 45.270  -26.498 19.402  1.00 79.87  ? 103  PHE B CD1   1 
ATOM   2084 C  CD2   . PHE B 1 108 ? 47.321  -26.262 20.593  1.00 78.11  ? 103  PHE B CD2   1 
ATOM   2085 C  CE1   . PHE B 1 108 ? 44.935  -25.192 19.725  1.00 79.39  ? 103  PHE B CE1   1 
ATOM   2086 C  CE2   . PHE B 1 108 ? 46.994  -24.959 20.918  1.00 74.14  ? 103  PHE B CE2   1 
ATOM   2087 C  CZ    . PHE B 1 108 ? 45.799  -24.421 20.484  1.00 71.64  ? 103  PHE B CZ    1 
ATOM   2088 N  N     . VAL B 1 109 ? 45.451  -31.344 18.659  1.00 60.19  ? 104  VAL B N     1 
ATOM   2089 C  CA    . VAL B 1 109 ? 45.793  -32.437 17.777  1.00 56.93  ? 104  VAL B CA    1 
ATOM   2090 C  C     . VAL B 1 109 ? 45.868  -31.976 16.331  1.00 53.95  ? 104  VAL B C     1 
ATOM   2091 O  O     . VAL B 1 109 ? 44.967  -31.336 15.847  1.00 60.70  ? 104  VAL B O     1 
ATOM   2092 C  CB    . VAL B 1 109 ? 44.715  -33.521 17.855  1.00 59.11  ? 104  VAL B CB    1 
ATOM   2093 C  CG1   . VAL B 1 109 ? 45.168  -34.784 17.138  1.00 60.39  ? 104  VAL B CG1   1 
ATOM   2094 C  CG2   . VAL B 1 109 ? 44.382  -33.819 19.308  1.00 61.16  ? 104  VAL B CG2   1 
ATOM   2095 N  N     . VAL B 1 110 ? 46.922  -32.344 15.623  1.00 49.99  ? 105  VAL B N     1 
ATOM   2096 C  CA    . VAL B 1 110 ? 47.288  -31.662 14.399  1.00 47.21  ? 105  VAL B CA    1 
ATOM   2097 C  C     . VAL B 1 110 ? 47.456  -32.671 13.291  1.00 50.98  ? 105  VAL B C     1 
ATOM   2098 O  O     . VAL B 1 110 ? 47.987  -33.773 13.498  1.00 65.02  ? 105  VAL B O     1 
ATOM   2099 C  CB    . VAL B 1 110 ? 48.594  -30.901 14.587  1.00 44.18  ? 105  VAL B CB    1 
ATOM   2100 C  CG1   . VAL B 1 110 ? 48.885  -30.015 13.418  1.00 45.57  ? 105  VAL B CG1   1 
ATOM   2101 C  CG2   . VAL B 1 110 ? 48.525  -30.053 15.826  1.00 44.16  ? 105  VAL B CG2   1 
ATOM   2102 N  N     . PHE B 1 111 ? 47.031  -32.294 12.099  1.00 52.32  ? 106  PHE B N     1 
ATOM   2103 C  CA    . PHE B 1 111 ? 47.311  -33.098 10.929  1.00 59.81  ? 106  PHE B CA    1 
ATOM   2104 C  C     . PHE B 1 111 ? 47.674  -32.234 9.729   1.00 61.38  ? 106  PHE B C     1 
ATOM   2105 O  O     . PHE B 1 111 ? 47.410  -31.041 9.699   1.00 66.08  ? 106  PHE B O     1 
ATOM   2106 C  CB    . PHE B 1 111 ? 46.156  -34.054 10.633  1.00 61.57  ? 106  PHE B CB    1 
ATOM   2107 C  CG    . PHE B 1 111 ? 44.963  -33.395 10.058  1.00 67.62  ? 106  PHE B CG    1 
ATOM   2108 C  CD1   . PHE B 1 111 ? 44.030  -32.784 10.887  1.00 72.80  ? 106  PHE B CD1   1 
ATOM   2109 C  CD2   . PHE B 1 111 ? 44.758  -33.385 8.685   1.00 68.31  ? 106  PHE B CD2   1 
ATOM   2110 C  CE1   . PHE B 1 111 ? 42.915  -32.165 10.357  1.00 68.79  ? 106  PHE B CE1   1 
ATOM   2111 C  CE2   . PHE B 1 111 ? 43.641  -32.776 8.151   1.00 65.81  ? 106  PHE B CE2   1 
ATOM   2112 C  CZ    . PHE B 1 111 ? 42.724  -32.169 8.988   1.00 66.33  ? 106  PHE B CZ    1 
ATOM   2113 N  N     . ASP B 1 112 ? 48.350  -32.857 8.774   1.00 64.54  ? 107  ASP B N     1 
ATOM   2114 C  CA    . ASP B 1 112 ? 48.771  -32.212 7.550   1.00 62.20  ? 107  ASP B CA    1 
ATOM   2115 C  C     . ASP B 1 112 ? 47.597  -32.305 6.606   1.00 63.90  ? 107  ASP B C     1 
ATOM   2116 O  O     . ASP B 1 112 ? 47.119  -33.392 6.287   1.00 69.72  ? 107  ASP B O     1 
ATOM   2117 C  CB    . ASP B 1 112 ? 49.967  -32.948 6.971   1.00 58.35  ? 107  ASP B CB    1 
ATOM   2118 C  CG    . ASP B 1 112 ? 50.614  -32.203 5.846   1.00 60.65  ? 107  ASP B CG    1 
ATOM   2119 O  OD1   . ASP B 1 112 ? 49.877  -31.535 5.098   1.00 64.34  ? 107  ASP B OD1   1 
ATOM   2120 O  OD2   . ASP B 1 112 ? 51.869  -32.268 5.701   1.00 63.60  ? 107  ASP B OD2   1 
ATOM   2121 N  N     . ILE B 1 113 ? 47.121  -31.157 6.168   1.00 70.39  ? 108  ILE B N     1 
ATOM   2122 C  CA    . ILE B 1 113 ? 45.992  -31.092 5.234   1.00 74.69  ? 108  ILE B CA    1 
ATOM   2123 C  C     . ILE B 1 113 ? 46.360  -31.675 3.866   1.00 73.36  ? 108  ILE B C     1 
ATOM   2124 O  O     . ILE B 1 113 ? 45.491  -32.067 3.107   1.00 68.85  ? 108  ILE B O     1 
ATOM   2125 C  CB    . ILE B 1 113 ? 45.473  -29.633 5.090   1.00 69.46  ? 108  ILE B CB    1 
ATOM   2126 C  CG1   . ILE B 1 113 ? 43.962  -29.654 4.898   1.00 76.98  ? 108  ILE B CG1   1 
ATOM   2127 C  CG2   . ILE B 1 113 ? 46.203  -28.883 3.972   1.00 60.27  ? 108  ILE B CG2   1 
ATOM   2128 C  CD1   . ILE B 1 113 ? 43.287  -28.304 5.053   1.00 86.48  ? 108  ILE B CD1   1 
ATOM   2129 N  N     . SER B 1 114 ? 47.655  -31.723 3.565   1.00 79.80  ? 109  SER B N     1 
ATOM   2130 C  CA    . SER B 1 114 ? 48.145  -32.296 2.316   1.00 83.66  ? 109  SER B CA    1 
ATOM   2131 C  C     . SER B 1 114 ? 48.732  -33.716 2.483   1.00 86.27  ? 109  SER B C     1 
ATOM   2132 O  O     . SER B 1 114 ? 49.622  -34.115 1.734   1.00 90.84  ? 109  SER B O     1 
ATOM   2133 C  CB    . SER B 1 114 ? 49.160  -31.335 1.665   1.00 82.23  ? 109  SER B CB    1 
ATOM   2134 O  OG    . SER B 1 114 ? 50.316  -31.167 2.473   1.00 78.19  ? 109  SER B OG    1 
ATOM   2135 N  N     . ARG B 1 115 ? 48.203  -34.484 3.431   1.00 87.40  ? 110  ARG B N     1 
ATOM   2136 C  CA    . ARG B 1 115 ? 48.611  -35.880 3.626   1.00 85.85  ? 110  ARG B CA    1 
ATOM   2137 C  C     . ARG B 1 115 ? 47.557  -36.597 4.436   1.00 84.06  ? 110  ARG B C     1 
ATOM   2138 O  O     . ARG B 1 115 ? 47.466  -36.426 5.650   1.00 83.59  ? 110  ARG B O     1 
ATOM   2139 C  CB    . ARG B 1 115 ? 49.944  -35.963 4.369   1.00 83.39  ? 110  ARG B CB    1 
ATOM   2140 C  CG    . ARG B 1 115 ? 51.121  -36.400 3.522   1.00 82.43  ? 110  ARG B CG    1 
ATOM   2141 C  CD    . ARG B 1 115 ? 52.425  -35.875 4.106   1.00 86.69  ? 110  ARG B CD    1 
ATOM   2142 N  NE    . ARG B 1 115 ? 52.722  -36.468 5.418   1.00 95.19  ? 110  ARG B NE    1 
ATOM   2143 C  CZ    . ARG B 1 115 ? 53.131  -35.806 6.504   1.00 91.61  ? 110  ARG B CZ    1 
ATOM   2144 N  NH1   . ARG B 1 115 ? 53.319  -34.495 6.485   1.00 100.16 ? 110  ARG B NH1   1 
ATOM   2145 N  NH2   . ARG B 1 115 ? 53.355  -36.466 7.629   1.00 89.93  ? 110  ARG B NH2   1 
ATOM   2146 N  N     . SER B 1 116 ? 46.735  -37.376 3.764   1.00 88.17  ? 111  SER B N     1 
ATOM   2147 C  CA    . SER B 1 116 ? 45.540  -37.896 4.399   1.00 96.89  ? 111  SER B CA    1 
ATOM   2148 C  C     . SER B 1 116 ? 45.881  -38.946 5.443   1.00 86.62  ? 111  SER B C     1 
ATOM   2149 O  O     . SER B 1 116 ? 45.165  -39.079 6.436   1.00 82.75  ? 111  SER B O     1 
ATOM   2150 C  CB    . SER B 1 116 ? 44.602  -38.473 3.345   1.00 110.31 ? 111  SER B CB    1 
ATOM   2151 O  OG    . SER B 1 116 ? 44.537  -37.589 2.244   1.00 121.02 ? 111  SER B OG    1 
ATOM   2152 N  N     . SER B 1 117 ? 46.963  -39.693 5.211   1.00 83.05  ? 112  SER B N     1 
ATOM   2153 C  CA    . SER B 1 117 ? 47.544  -40.598 6.223   1.00 80.37  ? 112  SER B CA    1 
ATOM   2154 C  C     . SER B 1 117 ? 47.482  -40.005 7.625   1.00 75.73  ? 112  SER B C     1 
ATOM   2155 O  O     . SER B 1 117 ? 47.026  -40.664 8.576   1.00 72.56  ? 112  SER B O     1 
ATOM   2156 C  CB    . SER B 1 117 ? 49.010  -40.920 5.880   1.00 82.71  ? 112  SER B CB    1 
ATOM   2157 O  OG    . SER B 1 117 ? 49.643  -39.823 5.247   1.00 84.60  ? 112  SER B OG    1 
ATOM   2158 N  N     . THR B 1 118 ? 47.936  -38.753 7.724   1.00 68.85  ? 113  THR B N     1 
ATOM   2159 C  CA    . THR B 1 118 ? 48.003  -38.029 8.991   1.00 60.33  ? 113  THR B CA    1 
ATOM   2160 C  C     . THR B 1 118 ? 46.622  -37.756 9.575   1.00 61.58  ? 113  THR B C     1 
ATOM   2161 O  O     . THR B 1 118 ? 46.493  -37.635 10.784  1.00 70.20  ? 113  THR B O     1 
ATOM   2162 C  CB    . THR B 1 118 ? 48.751  -36.676 8.890   1.00 55.93  ? 113  THR B CB    1 
ATOM   2163 O  OG1   . THR B 1 118 ? 47.942  -35.727 8.188   1.00 56.39  ? 113  THR B OG1   1 
ATOM   2164 C  CG2   . THR B 1 118 ? 50.108  -36.816 8.184   1.00 54.53  ? 113  THR B CG2   1 
ATOM   2165 N  N     . PHE B 1 119 ? 45.593  -37.645 8.744   1.00 64.70  ? 114  PHE B N     1 
ATOM   2166 C  CA    . PHE B 1 119 ? 44.248  -37.482 9.277   1.00 66.61  ? 114  PHE B CA    1 
ATOM   2167 C  C     . PHE B 1 119 ? 43.682  -38.782 9.845   1.00 65.51  ? 114  PHE B C     1 
ATOM   2168 O  O     . PHE B 1 119 ? 43.064  -38.795 10.916  1.00 58.15  ? 114  PHE B O     1 
ATOM   2169 C  CB    . PHE B 1 119 ? 43.294  -36.918 8.223   1.00 74.07  ? 114  PHE B CB    1 
ATOM   2170 C  CG    . PHE B 1 119 ? 41.900  -36.688 8.756   1.00 81.04  ? 114  PHE B CG    1 
ATOM   2171 C  CD1   . PHE B 1 119 ? 40.956  -37.728 8.771   1.00 79.62  ? 114  PHE B CD1   1 
ATOM   2172 C  CD2   . PHE B 1 119 ? 41.550  -35.469 9.304   1.00 77.42  ? 114  PHE B CD2   1 
ATOM   2173 C  CE1   . PHE B 1 119 ? 39.695  -37.546 9.306   1.00 74.14  ? 114  PHE B CE1   1 
ATOM   2174 C  CE2   . PHE B 1 119 ? 40.290  -35.289 9.846   1.00 78.51  ? 114  PHE B CE2   1 
ATOM   2175 C  CZ    . PHE B 1 119 ? 39.365  -36.325 9.851   1.00 75.73  ? 114  PHE B CZ    1 
ATOM   2176 N  N     . GLU B 1 120 ? 43.887  -39.884 9.136   1.00 74.96  ? 115  GLU B N     1 
ATOM   2177 C  CA    . GLU B 1 120 ? 43.480  -41.191 9.658   1.00 89.82  ? 115  GLU B CA    1 
ATOM   2178 C  C     . GLU B 1 120 ? 44.060  -41.381 11.081  1.00 85.07  ? 115  GLU B C     1 
ATOM   2179 O  O     . GLU B 1 120 ? 43.391  -41.899 11.986  1.00 78.90  ? 115  GLU B O     1 
ATOM   2180 C  CB    . GLU B 1 120 ? 43.920  -42.330 8.712   1.00 105.70 ? 115  GLU B CB    1 
ATOM   2181 C  CG    . GLU B 1 120 ? 43.269  -42.335 7.319   1.00 114.42 ? 115  GLU B CG    1 
ATOM   2182 C  CD    . GLU B 1 120 ? 44.226  -42.784 6.199   1.00 127.97 ? 115  GLU B CD    1 
ATOM   2183 O  OE1   . GLU B 1 120 ? 45.047  -43.707 6.416   1.00 133.85 ? 115  GLU B OE1   1 
ATOM   2184 O  OE2   . GLU B 1 120 ? 44.158  -42.223 5.086   1.00 131.18 ? 115  GLU B OE2   1 
ATOM   2185 N  N     . ALA B 1 121 ? 45.300  -40.924 11.262  1.00 77.86  ? 116  ALA B N     1 
ATOM   2186 C  CA    . ALA B 1 121 ? 46.030  -41.062 12.529  1.00 73.74  ? 116  ALA B CA    1 
ATOM   2187 C  C     . ALA B 1 121 ? 45.545  -40.226 13.704  1.00 70.07  ? 116  ALA B C     1 
ATOM   2188 O  O     . ALA B 1 121 ? 45.902  -40.524 14.838  1.00 76.01  ? 116  ALA B O     1 
ATOM   2189 C  CB    . ALA B 1 121 ? 47.508  -40.780 12.303  1.00 79.97  ? 116  ALA B CB    1 
ATOM   2190 N  N     . VAL B 1 122 ? 44.760  -39.180 13.477  1.00 67.88  ? 117  VAL B N     1 
ATOM   2191 C  CA    . VAL B 1 122 ? 44.398  -38.325 14.613  1.00 63.44  ? 117  VAL B CA    1 
ATOM   2192 C  C     . VAL B 1 122 ? 43.531  -39.074 15.616  1.00 59.40  ? 117  VAL B C     1 
ATOM   2193 O  O     . VAL B 1 122 ? 43.514  -38.739 16.796  1.00 62.64  ? 117  VAL B O     1 
ATOM   2194 C  CB    . VAL B 1 122 ? 43.689  -36.995 14.245  1.00 65.82  ? 117  VAL B CB    1 
ATOM   2195 C  CG1   . VAL B 1 122 ? 44.110  -36.451 12.884  1.00 65.24  ? 117  VAL B CG1   1 
ATOM   2196 C  CG2   . VAL B 1 122 ? 42.177  -37.126 14.351  1.00 68.69  ? 117  VAL B CG2   1 
ATOM   2197 N  N     . LEU B 1 123 ? 42.798  -40.079 15.164  1.00 58.82  ? 118  LEU B N     1 
ATOM   2198 C  CA    . LEU B 1 123 ? 41.982  -40.838 16.099  1.00 65.99  ? 118  LEU B CA    1 
ATOM   2199 C  C     . LEU B 1 123 ? 42.834  -41.665 17.052  1.00 67.19  ? 118  LEU B C     1 
ATOM   2200 O  O     . LEU B 1 123 ? 42.460  -41.906 18.204  1.00 69.45  ? 118  LEU B O     1 
ATOM   2201 C  CB    . LEU B 1 123 ? 41.000  -41.735 15.360  1.00 70.38  ? 118  LEU B CB    1 
ATOM   2202 C  CG    . LEU B 1 123 ? 39.739  -40.984 14.955  1.00 71.30  ? 118  LEU B CG    1 
ATOM   2203 C  CD1   . LEU B 1 123 ? 39.095  -41.652 13.754  1.00 74.25  ? 118  LEU B CD1   1 
ATOM   2204 C  CD2   . LEU B 1 123 ? 38.761  -40.903 16.118  1.00 71.84  ? 118  LEU B CD2   1 
ATOM   2205 N  N     . LYS B 1 124 ? 44.000  -42.083 16.581  1.00 66.99  ? 119  LYS B N     1 
ATOM   2206 C  CA    . LYS B 1 124 ? 44.873  -42.894 17.404  1.00 65.01  ? 119  LYS B CA    1 
ATOM   2207 C  C     . LYS B 1 124 ? 45.457  -42.053 18.527  1.00 57.84  ? 119  LYS B C     1 
ATOM   2208 O  O     . LYS B 1 124 ? 45.486  -42.497 19.689  1.00 61.20  ? 119  LYS B O     1 
ATOM   2209 C  CB    . LYS B 1 124 ? 45.956  -43.526 16.538  1.00 71.95  ? 119  LYS B CB    1 
ATOM   2210 C  CG    . LYS B 1 124 ? 45.372  -44.430 15.467  1.00 82.65  ? 119  LYS B CG    1 
ATOM   2211 C  CD    . LYS B 1 124 ? 46.350  -45.485 14.985  1.00 94.13  ? 119  LYS B CD    1 
ATOM   2212 C  CE    . LYS B 1 124 ? 45.672  -46.513 14.089  1.00 102.67 ? 119  LYS B CE    1 
ATOM   2213 N  NZ    . LYS B 1 124 ? 44.677  -47.322 14.853  1.00 107.29 ? 119  LYS B NZ    1 
ATOM   2214 N  N     . TRP B 1 125 ? 45.881  -40.839 18.189  1.00 50.55  ? 120  TRP B N     1 
ATOM   2215 C  CA    . TRP B 1 125 ? 46.282  -39.869 19.190  1.00 52.85  ? 120  TRP B CA    1 
ATOM   2216 C  C     . TRP B 1 125 ? 45.148  -39.509 20.126  1.00 55.91  ? 120  TRP B C     1 
ATOM   2217 O  O     . TRP B 1 125 ? 45.288  -39.540 21.352  1.00 59.32  ? 120  TRP B O     1 
ATOM   2218 C  CB    . TRP B 1 125 ? 46.780  -38.603 18.525  1.00 55.59  ? 120  TRP B CB    1 
ATOM   2219 C  CG    . TRP B 1 125 ? 48.096  -38.753 17.857  1.00 57.14  ? 120  TRP B CG    1 
ATOM   2220 C  CD1   . TRP B 1 125 ? 48.337  -38.846 16.515  1.00 59.09  ? 120  TRP B CD1   1 
ATOM   2221 C  CD2   . TRP B 1 125 ? 49.367  -38.799 18.496  1.00 56.13  ? 120  TRP B CD2   1 
ATOM   2222 N  NE1   . TRP B 1 125 ? 49.689  -38.948 16.276  1.00 58.72  ? 120  TRP B NE1   1 
ATOM   2223 C  CE2   . TRP B 1 125 ? 50.341  -38.908 17.481  1.00 57.47  ? 120  TRP B CE2   1 
ATOM   2224 C  CE3   . TRP B 1 125 ? 49.782  -38.741 19.829  1.00 57.49  ? 120  TRP B CE3   1 
ATOM   2225 C  CZ2   . TRP B 1 125 ? 51.695  -38.982 17.761  1.00 57.16  ? 120  TRP B CZ2   1 
ATOM   2226 C  CZ3   . TRP B 1 125 ? 51.127  -38.803 20.101  1.00 57.83  ? 120  TRP B CZ3   1 
ATOM   2227 C  CH2   . TRP B 1 125 ? 52.070  -38.930 19.072  1.00 55.21  ? 120  TRP B CH2   1 
ATOM   2228 N  N     . LYS B 1 126 ? 43.996  -39.187 19.563  1.00 61.25  ? 121  LYS B N     1 
ATOM   2229 C  CA    . LYS B 1 126 ? 42.835  -38.885 20.408  1.00 66.40  ? 121  LYS B CA    1 
ATOM   2230 C  C     . LYS B 1 126 ? 42.469  -40.006 21.393  1.00 59.22  ? 121  LYS B C     1 
ATOM   2231 O  O     . LYS B 1 126 ? 42.142  -39.721 22.535  1.00 56.28  ? 121  LYS B O     1 
ATOM   2232 C  CB    . LYS B 1 126 ? 41.623  -38.509 19.554  1.00 72.77  ? 121  LYS B CB    1 
ATOM   2233 C  CG    . LYS B 1 126 ? 40.426  -37.985 20.353  1.00 76.32  ? 121  LYS B CG    1 
ATOM   2234 C  CD    . LYS B 1 126 ? 40.671  -36.605 20.953  1.00 82.50  ? 121  LYS B CD    1 
ATOM   2235 C  CE    . LYS B 1 126 ? 39.371  -35.859 21.256  1.00 79.88  ? 121  LYS B CE    1 
ATOM   2236 N  NZ    . LYS B 1 126 ? 38.774  -36.232 22.564  1.00 75.58  ? 121  LYS B NZ    1 
ATOM   2237 N  N     . SER B 1 127 ? 42.490  -41.261 20.947  1.00 57.60  ? 122  SER B N     1 
ATOM   2238 C  CA    . SER B 1 127 ? 42.277  -42.403 21.852  1.00 62.72  ? 122  SER B CA    1 
ATOM   2239 C  C     . SER B 1 127 ? 43.294  -42.424 22.940  1.00 65.59  ? 122  SER B C     1 
ATOM   2240 O  O     . SER B 1 127 ? 42.973  -42.627 24.103  1.00 66.28  ? 122  SER B O     1 
ATOM   2241 C  CB    . SER B 1 127 ? 42.424  -43.717 21.116  1.00 64.44  ? 122  SER B CB    1 
ATOM   2242 O  OG    . SER B 1 127 ? 41.212  -44.071 20.533  1.00 80.11  ? 122  SER B OG    1 
ATOM   2243 N  N     . ASP B 1 128 ? 44.543  -42.282 22.522  1.00 62.71  ? 123  ASP B N     1 
ATOM   2244 C  CA    . ASP B 1 128 ? 45.654  -42.323 23.433  1.00 59.55  ? 123  ASP B CA    1 
ATOM   2245 C  C     . ASP B 1 128 ? 45.429  -41.284 24.493  1.00 56.89  ? 123  ASP B C     1 
ATOM   2246 O  O     . ASP B 1 128 ? 45.450  -41.591 25.673  1.00 57.56  ? 123  ASP B O     1 
ATOM   2247 C  CB    . ASP B 1 128 ? 46.944  -42.037 22.672  1.00 64.83  ? 123  ASP B CB    1 
ATOM   2248 C  CG    . ASP B 1 128 ? 48.167  -42.301 23.485  1.00 64.07  ? 123  ASP B CG    1 
ATOM   2249 O  OD1   . ASP B 1 128 ? 48.166  -43.312 24.218  1.00 58.99  ? 123  ASP B OD1   1 
ATOM   2250 O  OD2   . ASP B 1 128 ? 49.129  -41.508 23.357  1.00 64.83  ? 123  ASP B OD2   1 
ATOM   2251 N  N     . LEU B 1 129 ? 45.183  -40.054 24.053  1.00 56.31  ? 124  LEU B N     1 
ATOM   2252 C  CA    . LEU B 1 129 ? 44.876  -38.947 24.958  1.00 56.50  ? 124  LEU B CA    1 
ATOM   2253 C  C     . LEU B 1 129 ? 43.787  -39.297 25.964  1.00 59.18  ? 124  LEU B C     1 
ATOM   2254 O  O     . LEU B 1 129 ? 44.029  -39.298 27.157  1.00 64.83  ? 124  LEU B O     1 
ATOM   2255 C  CB    . LEU B 1 129 ? 44.463  -37.714 24.162  1.00 56.59  ? 124  LEU B CB    1 
ATOM   2256 C  CG    . LEU B 1 129 ? 44.401  -36.412 24.946  1.00 55.72  ? 124  LEU B CG    1 
ATOM   2257 C  CD1   . LEU B 1 129 ? 45.771  -36.073 25.474  1.00 60.45  ? 124  LEU B CD1   1 
ATOM   2258 C  CD2   . LEU B 1 129 ? 43.921  -35.264 24.080  1.00 57.34  ? 124  LEU B CD2   1 
ATOM   2259 N  N     . ASP B 1 130 ? 42.607  -39.658 25.485  1.00 64.87  ? 125  ASP B N     1 
ATOM   2260 C  CA    . ASP B 1 130 ? 41.451  -39.814 26.367  1.00 73.37  ? 125  ASP B CA    1 
ATOM   2261 C  C     . ASP B 1 130 ? 41.548  -41.086 27.208  1.00 78.39  ? 125  ASP B C     1 
ATOM   2262 O  O     . ASP B 1 130 ? 41.021  -41.137 28.322  1.00 78.63  ? 125  ASP B O     1 
ATOM   2263 C  CB    . ASP B 1 130 ? 40.157  -39.856 25.555  1.00 79.36  ? 125  ASP B CB    1 
ATOM   2264 C  CG    . ASP B 1 130 ? 39.911  -38.584 24.747  1.00 80.40  ? 125  ASP B CG    1 
ATOM   2265 O  OD1   . ASP B 1 130 ? 40.403  -37.486 25.126  1.00 88.38  ? 125  ASP B OD1   1 
ATOM   2266 O  OD2   . ASP B 1 130 ? 39.202  -38.700 23.723  1.00 77.66  ? 125  ASP B OD2   1 
ATOM   2267 N  N     . SER B 1 131 ? 42.230  -42.100 26.658  1.00 85.75  ? 126  SER B N     1 
ATOM   2268 C  CA    . SER B 1 131 ? 42.787  -43.231 27.436  1.00 80.75  ? 126  SER B CA    1 
ATOM   2269 C  C     . SER B 1 131 ? 43.444  -42.798 28.729  1.00 70.83  ? 126  SER B C     1 
ATOM   2270 O  O     . SER B 1 131 ? 43.394  -43.525 29.693  1.00 69.56  ? 126  SER B O     1 
ATOM   2271 C  CB    . SER B 1 131 ? 43.841  -44.041 26.634  1.00 80.71  ? 126  SER B CB    1 
ATOM   2272 O  OG    . SER B 1 131 ? 43.298  -44.782 25.562  1.00 108.80 ? 126  SER B OG    1 
ATOM   2273 N  N     . LYS B 1 132 ? 44.097  -41.644 28.737  1.00 66.39  ? 127  LYS B N     1 
ATOM   2274 C  CA    . LYS B 1 132 ? 45.134  -41.380 29.718  1.00 68.46  ? 127  LYS B CA    1 
ATOM   2275 C  C     . LYS B 1 132 ? 45.047  -40.058 30.427  1.00 71.75  ? 127  LYS B C     1 
ATOM   2276 O  O     . LYS B 1 132 ? 45.862  -39.800 31.283  1.00 73.10  ? 127  LYS B O     1 
ATOM   2277 C  CB    . LYS B 1 132 ? 46.501  -41.452 29.054  1.00 70.30  ? 127  LYS B CB    1 
ATOM   2278 C  CG    . LYS B 1 132 ? 46.761  -42.825 28.487  1.00 75.09  ? 127  LYS B CG    1 
ATOM   2279 C  CD    . LYS B 1 132 ? 48.116  -42.976 27.840  1.00 76.61  ? 127  LYS B CD    1 
ATOM   2280 C  CE    . LYS B 1 132 ? 48.160  -44.340 27.170  1.00 74.57  ? 127  LYS B CE    1 
ATOM   2281 N  NZ    . LYS B 1 132 ? 49.469  -44.603 26.529  1.00 72.87  ? 127  LYS B NZ    1 
ATOM   2282 N  N     . VAL B 1 133 ? 44.102  -39.198 30.101  1.00 75.99  ? 128  VAL B N     1 
ATOM   2283 C  CA    . VAL B 1 133 ? 43.972  -38.009 30.915  1.00 76.24  ? 128  VAL B CA    1 
ATOM   2284 C  C     . VAL B 1 133 ? 42.549  -37.462 30.860  1.00 91.42  ? 128  VAL B C     1 
ATOM   2285 O  O     . VAL B 1 133 ? 41.877  -37.457 29.803  1.00 96.16  ? 128  VAL B O     1 
ATOM   2286 C  CB    . VAL B 1 133 ? 45.084  -36.976 30.592  1.00 70.29  ? 128  VAL B CB    1 
ATOM   2287 C  CG1   . VAL B 1 133 ? 45.182  -36.712 29.118  1.00 69.57  ? 128  VAL B CG1   1 
ATOM   2288 C  CG2   . VAL B 1 133 ? 44.869  -35.662 31.305  1.00 77.82  ? 128  VAL B CG2   1 
ATOM   2289 N  N     . HIS B 1 134 ? 42.089  -37.083 32.054  1.00 98.13  ? 129  HIS B N     1 
ATOM   2290 C  CA    . HIS B 1 134 ? 40.748  -36.583 32.295  1.00 101.44 ? 129  HIS B CA    1 
ATOM   2291 C  C     . HIS B 1 134 ? 40.917  -35.324 33.127  1.00 104.38 ? 129  HIS B C     1 
ATOM   2292 O  O     . HIS B 1 134 ? 41.863  -35.212 33.897  1.00 103.97 ? 129  HIS B O     1 
ATOM   2293 C  CB    . HIS B 1 134 ? 39.900  -37.615 33.043  1.00 102.33 ? 129  HIS B CB    1 
ATOM   2294 C  CG    . HIS B 1 134 ? 39.929  -38.979 32.433  1.00 116.08 ? 129  HIS B CG    1 
ATOM   2295 N  ND1   . HIS B 1 134 ? 39.193  -39.311 31.309  1.00 120.58 ? 129  HIS B ND1   1 
ATOM   2296 C  CD2   . HIS B 1 134 ? 40.604  -40.098 32.786  1.00 123.09 ? 129  HIS B CD2   1 
ATOM   2297 C  CE1   . HIS B 1 134 ? 39.414  -40.576 30.999  1.00 122.93 ? 129  HIS B CE1   1 
ATOM   2298 N  NE2   . HIS B 1 134 ? 40.267  -41.076 31.878  1.00 130.56 ? 129  HIS B NE2   1 
ATOM   2299 N  N     . LEU B 1 135 ? 40.012  -34.367 32.962  1.00 109.78 ? 130  LEU B N     1 
ATOM   2300 C  CA    . LEU B 1 135 ? 39.868  -33.286 33.929  1.00 102.82 ? 130  LEU B CA    1 
ATOM   2301 C  C     . LEU B 1 135 ? 39.442  -33.900 35.254  1.00 108.91 ? 130  LEU B C     1 
ATOM   2302 O  O     . LEU B 1 135 ? 38.863  -34.998 35.275  1.00 115.46 ? 130  LEU B O     1 
ATOM   2303 C  CB    . LEU B 1 135 ? 38.825  -32.280 33.457  1.00 101.35 ? 130  LEU B CB    1 
ATOM   2304 C  CG    . LEU B 1 135 ? 39.147  -31.542 32.149  1.00 108.90 ? 130  LEU B CG    1 
ATOM   2305 C  CD1   . LEU B 1 135 ? 37.867  -31.094 31.447  1.00 106.91 ? 130  LEU B CD1   1 
ATOM   2306 C  CD2   . LEU B 1 135 ? 40.100  -30.365 32.358  1.00 110.63 ? 130  LEU B CD2   1 
ATOM   2307 N  N     . PRO B 1 136 ? 39.731  -33.211 36.372  1.00 104.85 ? 131  PRO B N     1 
ATOM   2308 C  CA    . PRO B 1 136 ? 39.407  -33.751 37.696  1.00 97.55  ? 131  PRO B CA    1 
ATOM   2309 C  C     . PRO B 1 136 ? 38.006  -34.385 37.816  1.00 95.17  ? 131  PRO B C     1 
ATOM   2310 O  O     . PRO B 1 136 ? 37.849  -35.392 38.506  1.00 92.77  ? 131  PRO B O     1 
ATOM   2311 C  CB    . PRO B 1 136 ? 39.553  -32.531 38.594  1.00 94.57  ? 131  PRO B CB    1 
ATOM   2312 C  CG    . PRO B 1 136 ? 40.664  -31.765 37.954  1.00 98.89  ? 131  PRO B CG    1 
ATOM   2313 C  CD    . PRO B 1 136 ? 40.478  -31.944 36.472  1.00 98.16  ? 131  PRO B CD    1 
ATOM   2314 N  N     . ASN B 1 137 ? 37.010  -33.837 37.127  1.00 94.57  ? 132  ASN B N     1 
ATOM   2315 C  CA    . ASN B 1 137 ? 35.658  -34.440 37.126  1.00 96.58  ? 132  ASN B CA    1 
ATOM   2316 C  C     . ASN B 1 137 ? 35.452  -35.722 36.306  1.00 98.24  ? 132  ASN B C     1 
ATOM   2317 O  O     . ASN B 1 137 ? 34.315  -36.085 35.999  1.00 98.89  ? 132  ASN B O     1 
ATOM   2318 C  CB    . ASN B 1 137 ? 34.612  -33.410 36.682  1.00 95.20  ? 132  ASN B CB    1 
ATOM   2319 C  CG    . ASN B 1 137 ? 34.923  -32.804 35.338  1.00 94.81  ? 132  ASN B CG    1 
ATOM   2320 O  OD1   . ASN B 1 137 ? 34.597  -33.365 34.297  1.00 94.60  ? 132  ASN B OD1   1 
ATOM   2321 N  ND2   . ASN B 1 137 ? 35.541  -31.636 35.359  1.00 95.54  ? 132  ASN B ND2   1 
ATOM   2322 N  N     . GLY B 1 138 ? 36.530  -36.388 35.917  1.00 104.68 ? 133  GLY B N     1 
ATOM   2323 C  CA    . GLY B 1 138 ? 36.416  -37.602 35.102  1.00 109.25 ? 133  GLY B CA    1 
ATOM   2324 C  C     . GLY B 1 138 ? 36.056  -37.388 33.628  1.00 104.81 ? 133  GLY B C     1 
ATOM   2325 O  O     . GLY B 1 138 ? 35.817  -38.348 32.905  1.00 95.66  ? 133  GLY B O     1 
ATOM   2326 N  N     . SER B 1 139 ? 36.043  -36.140 33.167  1.00 103.99 ? 134  SER B N     1 
ATOM   2327 C  CA    . SER B 1 139 ? 35.686  -35.818 31.787  1.00 105.83 ? 134  SER B CA    1 
ATOM   2328 C  C     . SER B 1 139 ? 36.901  -35.515 30.917  1.00 98.36  ? 134  SER B C     1 
ATOM   2329 O  O     . SER B 1 139 ? 37.826  -34.856 31.380  1.00 102.20 ? 134  SER B O     1 
ATOM   2330 C  CB    . SER B 1 139 ? 34.825  -34.575 31.802  1.00 109.53 ? 134  SER B CB    1 
ATOM   2331 O  OG    . SER B 1 139 ? 34.285  -34.308 30.542  1.00 124.81 ? 134  SER B OG    1 
ATOM   2332 N  N     . PRO B 1 140 ? 36.887  -35.954 29.641  1.00 89.25  ? 135  PRO B N     1 
ATOM   2333 C  CA    . PRO B 1 140 ? 38.063  -35.808 28.783  1.00 86.08  ? 135  PRO B CA    1 
ATOM   2334 C  C     . PRO B 1 140 ? 38.390  -34.355 28.532  1.00 82.89  ? 135  PRO B C     1 
ATOM   2335 O  O     . PRO B 1 140 ? 37.496  -33.526 28.446  1.00 78.63  ? 135  PRO B O     1 
ATOM   2336 C  CB    . PRO B 1 140 ? 37.626  -36.457 27.466  1.00 83.66  ? 135  PRO B CB    1 
ATOM   2337 C  CG    . PRO B 1 140 ? 36.154  -36.331 27.459  1.00 84.90  ? 135  PRO B CG    1 
ATOM   2338 C  CD    . PRO B 1 140 ? 35.757  -36.534 28.897  1.00 87.26  ? 135  PRO B CD    1 
ATOM   2339 N  N     . ILE B 1 141 ? 39.671  -34.058 28.386  1.00 82.06  ? 136  ILE B N     1 
ATOM   2340 C  CA    . ILE B 1 141 ? 40.107  -32.681 28.364  1.00 78.35  ? 136  ILE B CA    1 
ATOM   2341 C  C     . ILE B 1 141 ? 39.705  -32.049 27.033  1.00 75.43  ? 136  ILE B C     1 
ATOM   2342 O  O     . ILE B 1 141 ? 39.511  -32.742 26.049  1.00 80.93  ? 136  ILE B O     1 
ATOM   2343 C  CB    . ILE B 1 141 ? 41.626  -32.552 28.616  1.00 86.36  ? 136  ILE B CB    1 
ATOM   2344 C  CG1   . ILE B 1 141 ? 42.455  -33.188 27.500  1.00 87.53  ? 136  ILE B CG1   1 
ATOM   2345 C  CG2   . ILE B 1 141 ? 42.012  -33.201 29.941  1.00 88.90  ? 136  ILE B CG2   1 
ATOM   2346 C  CD1   . ILE B 1 141 ? 43.804  -32.528 27.343  1.00 87.71  ? 136  ILE B CD1   1 
ATOM   2347 N  N     . PRO B 1 142 ? 39.574  -30.732 26.999  1.00 77.30  ? 137  PRO B N     1 
ATOM   2348 C  CA    . PRO B 1 142 ? 39.278  -30.053 25.744  1.00 78.83  ? 137  PRO B CA    1 
ATOM   2349 C  C     . PRO B 1 142 ? 40.331  -30.234 24.661  1.00 76.32  ? 137  PRO B C     1 
ATOM   2350 O  O     . PRO B 1 142 ? 41.491  -29.916 24.870  1.00 77.34  ? 137  PRO B O     1 
ATOM   2351 C  CB    . PRO B 1 142 ? 39.234  -28.578 26.148  1.00 84.09  ? 137  PRO B CB    1 
ATOM   2352 C  CG    . PRO B 1 142 ? 39.978  -28.488 27.435  1.00 87.09  ? 137  PRO B CG    1 
ATOM   2353 C  CD    . PRO B 1 142 ? 39.685  -29.786 28.124  1.00 84.51  ? 137  PRO B CD    1 
ATOM   2354 N  N     . ALA B 1 143 ? 39.905  -30.743 23.515  1.00 77.19  ? 138  ALA B N     1 
ATOM   2355 C  CA    . ALA B 1 143 ? 40.780  -30.941 22.377  1.00 73.79  ? 138  ALA B CA    1 
ATOM   2356 C  C     . ALA B 1 143 ? 40.353  -30.090 21.184  1.00 75.18  ? 138  ALA B C     1 
ATOM   2357 O  O     . ALA B 1 143 ? 39.172  -30.007 20.846  1.00 80.07  ? 138  ALA B O     1 
ATOM   2358 C  CB    . ALA B 1 143 ? 40.776  -32.420 21.994  1.00 77.06  ? 138  ALA B CB    1 
ATOM   2359 N  N     . VAL B 1 144 ? 41.320  -29.506 20.498  1.00 73.79  ? 139  VAL B N     1 
ATOM   2360 C  CA    . VAL B 1 144 ? 41.037  -28.704 19.316  1.00 70.56  ? 139  VAL B CA    1 
ATOM   2361 C  C     . VAL B 1 144 ? 41.840  -29.224 18.141  1.00 69.45  ? 139  VAL B C     1 
ATOM   2362 O  O     . VAL B 1 144 ? 43.057  -29.324 18.223  1.00 71.67  ? 139  VAL B O     1 
ATOM   2363 C  CB    . VAL B 1 144 ? 41.439  -27.247 19.564  1.00 71.28  ? 139  VAL B CB    1 
ATOM   2364 C  CG1   . VAL B 1 144 ? 41.286  -26.417 18.301  1.00 74.56  ? 139  VAL B CG1   1 
ATOM   2365 C  CG2   . VAL B 1 144 ? 40.595  -26.661 20.668  1.00 69.04  ? 139  VAL B CG2   1 
ATOM   2366 N  N     . LEU B 1 145 ? 41.163  -29.529 17.041  1.00 65.33  ? 140  LEU B N     1 
ATOM   2367 C  CA    . LEU B 1 145 ? 41.802  -30.113 15.861  1.00 66.69  ? 140  LEU B CA    1 
ATOM   2368 C  C     . LEU B 1 145 ? 42.408  -29.045 14.940  1.00 64.30  ? 140  LEU B C     1 
ATOM   2369 O  O     . LEU B 1 145 ? 41.865  -27.973 14.820  1.00 69.89  ? 140  LEU B O     1 
ATOM   2370 C  CB    . LEU B 1 145 ? 40.779  -30.933 15.100  1.00 65.79  ? 140  LEU B CB    1 
ATOM   2371 C  CG    . LEU B 1 145 ? 41.236  -31.732 13.887  1.00 72.44  ? 140  LEU B CG    1 
ATOM   2372 C  CD1   . LEU B 1 145 ? 42.295  -32.746 14.269  1.00 75.24  ? 140  LEU B CD1   1 
ATOM   2373 C  CD2   . LEU B 1 145 ? 40.023  -32.440 13.293  1.00 72.80  ? 140  LEU B CD2   1 
ATOM   2374 N  N     . LEU B 1 146 ? 43.535  -29.334 14.296  1.00 64.02  ? 141  LEU B N     1 
ATOM   2375 C  CA    . LEU B 1 146 ? 44.228  -28.330 13.492  1.00 64.74  ? 141  LEU B CA    1 
ATOM   2376 C  C     . LEU B 1 146 ? 44.610  -28.897 12.142  1.00 66.05  ? 141  LEU B C     1 
ATOM   2377 O  O     . LEU B 1 146 ? 45.433  -29.791 12.044  1.00 70.05  ? 141  LEU B O     1 
ATOM   2378 C  CB    . LEU B 1 146 ? 45.480  -27.821 14.188  1.00 63.96  ? 141  LEU B CB    1 
ATOM   2379 C  CG    . LEU B 1 146 ? 45.364  -27.026 15.494  1.00 64.15  ? 141  LEU B CG    1 
ATOM   2380 C  CD1   . LEU B 1 146 ? 46.703  -26.372 15.808  1.00 62.49  ? 141  LEU B CD1   1 
ATOM   2381 C  CD2   . LEU B 1 146 ? 44.314  -25.942 15.470  1.00 65.14  ? 141  LEU B CD2   1 
ATOM   2382 N  N     . ALA B 1 147 ? 43.971  -28.392 11.097  1.00 64.70  ? 142  ALA B N     1 
ATOM   2383 C  CA    . ALA B 1 147 ? 44.289  -28.785 9.745   1.00 61.16  ? 142  ALA B CA    1 
ATOM   2384 C  C     . ALA B 1 147 ? 45.381  -27.881 9.240   1.00 61.29  ? 142  ALA B C     1 
ATOM   2385 O  O     . ALA B 1 147 ? 45.121  -26.753 8.849   1.00 67.26  ? 142  ALA B O     1 
ATOM   2386 C  CB    . ALA B 1 147 ? 43.060  -28.672 8.882   1.00 63.32  ? 142  ALA B CB    1 
ATOM   2387 N  N     . ASN B 1 148 ? 46.617  -28.347 9.314   1.00 63.65  ? 143  ASN B N     1 
ATOM   2388 C  CA    . ASN B 1 148 ? 47.744  -27.461 9.123   1.00 63.70  ? 143  ASN B CA    1 
ATOM   2389 C  C     . ASN B 1 148 ? 48.269  -27.507 7.706   1.00 63.86  ? 143  ASN B C     1 
ATOM   2390 O  O     . ASN B 1 148 ? 48.034  -28.465 6.995   1.00 55.84  ? 143  ASN B O     1 
ATOM   2391 C  CB    . ASN B 1 148 ? 48.876  -27.768 10.098  1.00 63.80  ? 143  ASN B CB    1 
ATOM   2392 C  CG    . ASN B 1 148 ? 49.906  -26.664 10.115  1.00 65.27  ? 143  ASN B CG    1 
ATOM   2393 O  OD1   . ASN B 1 148 ? 49.563  -25.509 10.334  1.00 69.99  ? 143  ASN B OD1   1 
ATOM   2394 N  ND2   . ASN B 1 148 ? 51.150  -26.996 9.824   1.00 70.40  ? 143  ASN B ND2   1 
ATOM   2395 N  N     . LYS B 1 149 ? 48.991  -26.453 7.328   1.00 70.60  ? 144  LYS B N     1 
ATOM   2396 C  CA    . LYS B 1 149 ? 49.553  -26.270 5.986   1.00 72.14  ? 144  LYS B CA    1 
ATOM   2397 C  C     . LYS B 1 149 ? 48.444  -25.977 4.960   1.00 77.38  ? 144  LYS B C     1 
ATOM   2398 O  O     . LYS B 1 149 ? 48.493  -26.457 3.828   1.00 80.29  ? 144  LYS B O     1 
ATOM   2399 C  CB    . LYS B 1 149 ? 50.380  -27.473 5.534   1.00 66.79  ? 144  LYS B CB    1 
ATOM   2400 C  CG    . LYS B 1 149 ? 51.616  -27.771 6.340   1.00 64.76  ? 144  LYS B CG    1 
ATOM   2401 C  CD    . LYS B 1 149 ? 51.856  -29.266 6.360   1.00 68.16  ? 144  LYS B CD    1 
ATOM   2402 C  CE    . LYS B 1 149 ? 53.102  -29.661 7.141   1.00 65.53  ? 144  LYS B CE    1 
ATOM   2403 N  NZ    . LYS B 1 149 ? 54.211  -30.089 6.249   1.00 64.78  ? 144  LYS B NZ    1 
ATOM   2404 N  N     . CYS B 1 150 ? 47.473  -25.156 5.351   1.00 81.95  ? 145  CYS B N     1 
ATOM   2405 C  CA    . CYS B 1 150 ? 46.334  -24.820 4.484   1.00 79.29  ? 145  CYS B CA    1 
ATOM   2406 C  C     . CYS B 1 150 ? 46.725  -23.882 3.342   1.00 76.22  ? 145  CYS B C     1 
ATOM   2407 O  O     . CYS B 1 150 ? 46.053  -23.831 2.313   1.00 81.47  ? 145  CYS B O     1 
ATOM   2408 C  CB    . CYS B 1 150 ? 45.232  -24.162 5.308   1.00 83.33  ? 145  CYS B CB    1 
ATOM   2409 S  SG    . CYS B 1 150 ? 45.732  -22.540 5.955   1.00 88.84  ? 145  CYS B SG    1 
ATOM   2410 N  N     . ASP B 1 151 ? 47.832  -23.164 3.503   1.00 75.21  ? 146  ASP B N     1 
ATOM   2411 C  CA    . ASP B 1 151 ? 48.533  -22.569 2.361   1.00 80.45  ? 146  ASP B CA    1 
ATOM   2412 C  C     . ASP B 1 151 ? 48.883  -23.518 1.204   1.00 83.83  ? 146  ASP B C     1 
ATOM   2413 O  O     . ASP B 1 151 ? 49.334  -23.062 0.174   1.00 85.48  ? 146  ASP B O     1 
ATOM   2414 C  CB    . ASP B 1 151 ? 49.807  -21.870 2.835   1.00 84.68  ? 146  ASP B CB    1 
ATOM   2415 C  CG    . ASP B 1 151 ? 50.829  -22.834 3.394   1.00 83.16  ? 146  ASP B CG    1 
ATOM   2416 O  OD1   . ASP B 1 151 ? 50.640  -23.278 4.554   1.00 86.82  ? 146  ASP B OD1   1 
ATOM   2417 O  OD2   . ASP B 1 151 ? 51.807  -23.139 2.676   1.00 76.86  ? 146  ASP B OD2   1 
ATOM   2418 N  N     . GLN B 1 152 ? 48.698  -24.823 1.372   1.00 103.51 ? 147  GLN B N     1 
ATOM   2419 C  CA    . GLN B 1 152 ? 48.973  -25.797 0.307   1.00 112.36 ? 147  GLN B CA    1 
ATOM   2420 C  C     . GLN B 1 152 ? 47.702  -26.372 -0.335  1.00 115.17 ? 147  GLN B C     1 
ATOM   2421 O  O     . GLN B 1 152 ? 46.588  -26.014 0.058   1.00 116.32 ? 147  GLN B O     1 
ATOM   2422 C  CB    . GLN B 1 152 ? 49.842  -26.927 0.873   1.00 116.45 ? 147  GLN B CB    1 
ATOM   2423 C  CG    . GLN B 1 152 ? 51.254  -26.480 1.225   1.00 121.41 ? 147  GLN B CG    1 
ATOM   2424 C  CD    . GLN B 1 152 ? 52.219  -27.628 1.392   1.00 128.46 ? 147  GLN B CD    1 
ATOM   2425 O  OE1   . GLN B 1 152 ? 53.291  -27.627 0.789   1.00 137.22 ? 147  GLN B OE1   1 
ATOM   2426 N  NE2   . GLN B 1 152 ? 51.852  -28.616 2.205   1.00 131.25 ? 147  GLN B NE2   1 
ATOM   2427 N  N     . ASN B 1 153 ? 47.890  -27.264 -1.315  1.00 117.56 ? 148  ASN B N     1 
ATOM   2428 C  CA    . ASN B 1 153 ? 46.783  -27.933 -2.030  1.00 114.15 ? 148  ASN B CA    1 
ATOM   2429 C  C     . ASN B 1 153 ? 46.303  -29.231 -1.343  1.00 108.56 ? 148  ASN B C     1 
ATOM   2430 O  O     . ASN B 1 153 ? 47.104  -30.139 -1.059  1.00 90.30  ? 148  ASN B O     1 
ATOM   2431 C  CB    . ASN B 1 153 ? 47.128  -28.159 -3.515  1.00 108.48 ? 148  ASN B CB    1 
ATOM   2432 C  CG    . ASN B 1 153 ? 46.607  -27.047 -4.405  1.00 109.71 ? 148  ASN B CG    1 
ATOM   2433 O  OD1   . ASN B 1 153 ? 45.830  -27.280 -5.342  1.00 111.37 ? 148  ASN B OD1   1 
ATOM   2434 N  ND2   . ASN B 1 153 ? 47.023  -25.828 -4.112  1.00 106.26 ? 148  ASN B ND2   1 
ATOM   2435 N  N     . LYS B 1 154 ? 44.993  -29.271 -1.060  1.00 110.54 ? 149  LYS B N     1 
ATOM   2436 C  CA    . LYS B 1 154 ? 44.311  -30.431 -0.464  1.00 114.93 ? 149  LYS B CA    1 
ATOM   2437 C  C     . LYS B 1 154 ? 44.671  -31.767 -1.154  1.00 131.65 ? 149  LYS B C     1 
ATOM   2438 O  O     . LYS B 1 154 ? 44.328  -31.993 -2.306  1.00 139.73 ? 149  LYS B O     1 
ATOM   2439 C  CB    . LYS B 1 154 ? 42.785  -30.225 -0.484  1.00 106.44 ? 149  LYS B CB    1 
ATOM   2440 C  CG    . LYS B 1 154 ? 42.266  -29.212 0.532   1.00 108.09 ? 149  LYS B CG    1 
ATOM   2441 C  CD    . LYS B 1 154 ? 41.007  -29.680 1.263   1.00 108.15 ? 149  LYS B CD    1 
ATOM   2442 C  CE    . LYS B 1 154 ? 40.587  -28.685 2.352   1.00 110.82 ? 149  LYS B CE    1 
ATOM   2443 N  NZ    . LYS B 1 154 ? 39.741  -29.274 3.436   1.00 105.06 ? 149  LYS B NZ    1 
ATOM   2444 N  N     . ASP B 1 155 ? 45.372  -32.634 -0.416  1.00 149.62 ? 150  ASP B N     1 
ATOM   2445 C  CA    . ASP B 1 155 ? 45.580  -34.065 -0.747  1.00 137.26 ? 150  ASP B CA    1 
ATOM   2446 C  C     . ASP B 1 155 ? 44.254  -34.820 -0.763  1.00 135.44 ? 150  ASP B C     1 
ATOM   2447 O  O     . ASP B 1 155 ? 44.031  -35.706 -1.581  1.00 112.61 ? 150  ASP B O     1 
ATOM   2448 C  CB    . ASP B 1 155 ? 46.518  -34.685 0.313   1.00 138.09 ? 150  ASP B CB    1 
ATOM   2449 C  CG    . ASP B 1 155 ? 46.995  -36.088 -0.036  1.00 139.49 ? 150  ASP B CG    1 
ATOM   2450 O  OD1   . ASP B 1 155 ? 47.473  -36.300 -1.169  1.00 141.30 ? 150  ASP B OD1   1 
ATOM   2451 O  OD2   . ASP B 1 155 ? 46.943  -36.968 0.854   1.00 136.72 ? 150  ASP B OD2   1 
ATOM   2452 N  N     . SER B 1 156 ? 43.377  -34.447 0.165   1.00 148.97 ? 151  SER B N     1 
ATOM   2453 C  CA    . SER B 1 156 ? 42.014  -34.938 0.217   1.00 139.21 ? 151  SER B CA    1 
ATOM   2454 C  C     . SER B 1 156 ? 41.057  -33.759 0.020   1.00 144.15 ? 151  SER B C     1 
ATOM   2455 O  O     . SER B 1 156 ? 41.217  -32.701 0.633   1.00 136.43 ? 151  SER B O     1 
ATOM   2456 C  CB    . SER B 1 156 ? 41.773  -35.609 1.571   1.00 133.59 ? 151  SER B CB    1 
ATOM   2457 O  OG    . SER B 1 156 ? 40.470  -36.130 1.661   1.00 130.94 ? 151  SER B OG    1 
ATOM   2458 N  N     . SER B 1 157 ? 40.048  -33.956 -0.820  1.00 142.82 ? 152  SER B N     1 
ATOM   2459 C  CA    . SER B 1 157 ? 38.837  -33.147 -0.757  1.00 147.07 ? 152  SER B CA    1 
ATOM   2460 C  C     . SER B 1 157 ? 37.868  -33.771 0.250   1.00 142.11 ? 152  SER B C     1 
ATOM   2461 O  O     . SER B 1 157 ? 36.939  -34.500 -0.112  1.00 131.65 ? 152  SER B O     1 
ATOM   2462 C  CB    . SER B 1 157 ? 38.195  -33.033 -2.136  1.00 152.21 ? 152  SER B CB    1 
ATOM   2463 O  OG    . SER B 1 157 ? 37.868  -34.313 -2.633  1.00 166.22 ? 152  SER B OG    1 
ATOM   2464 N  N     . GLN B 1 158 ? 38.112  -33.484 1.525   1.00 140.80 ? 153  GLN B N     1 
ATOM   2465 C  CA    . GLN B 1 158 ? 37.082  -33.567 2.567   1.00 124.70 ? 153  GLN B CA    1 
ATOM   2466 C  C     . GLN B 1 158 ? 36.584  -32.162 2.872   1.00 112.27 ? 153  GLN B C     1 
ATOM   2467 O  O     . GLN B 1 158 ? 37.358  -31.176 2.885   1.00 99.93  ? 153  GLN B O     1 
ATOM   2468 C  CB    . GLN B 1 158 ? 37.605  -34.220 3.851   1.00 121.12 ? 153  GLN B CB    1 
ATOM   2469 C  CG    . GLN B 1 158 ? 39.091  -34.019 4.087   1.00 120.68 ? 153  GLN B CG    1 
ATOM   2470 C  CD    . GLN B 1 158 ? 39.518  -34.389 5.484   1.00 118.49 ? 153  GLN B CD    1 
ATOM   2471 O  OE1   . GLN B 1 158 ? 38.711  -34.419 6.419   1.00 95.30  ? 153  GLN B OE1   1 
ATOM   2472 N  NE2   . GLN B 1 158 ? 40.805  -34.685 5.634   1.00 125.26 ? 153  GLN B NE2   1 
ATOM   2473 N  N     . SER B 1 159 ? 35.280  -32.078 3.094   1.00 93.28  ? 154  SER B N     1 
ATOM   2474 C  CA    . SER B 1 159 ? 34.636  -30.805 3.209   1.00 88.18  ? 154  SER B CA    1 
ATOM   2475 C  C     . SER B 1 159 ? 34.828  -30.386 4.641   1.00 82.55  ? 154  SER B C     1 
ATOM   2476 O  O     . SER B 1 159 ? 34.914  -31.234 5.530   1.00 71.54  ? 154  SER B O     1 
ATOM   2477 C  CB    . SER B 1 159 ? 33.154  -30.918 2.881   1.00 95.81  ? 154  SER B CB    1 
ATOM   2478 O  OG    . SER B 1 159 ? 32.500  -31.764 3.812   1.00 97.45  ? 154  SER B OG    1 
ATOM   2479 N  N     . PRO B 1 160 ? 34.891  -29.072 4.876   1.00 80.63  ? 155  PRO B N     1 
ATOM   2480 C  CA    . PRO B 1 160 ? 34.616  -28.544 6.199   1.00 76.66  ? 155  PRO B CA    1 
ATOM   2481 C  C     . PRO B 1 160 ? 33.455  -29.244 6.901   1.00 72.12  ? 155  PRO B C     1 
ATOM   2482 O  O     . PRO B 1 160 ? 33.527  -29.533 8.096   1.00 69.13  ? 155  PRO B O     1 
ATOM   2483 C  CB    . PRO B 1 160 ? 34.297  -27.081 5.911   1.00 77.65  ? 155  PRO B CB    1 
ATOM   2484 C  CG    . PRO B 1 160 ? 35.168  -26.745 4.748   1.00 79.74  ? 155  PRO B CG    1 
ATOM   2485 C  CD    . PRO B 1 160 ? 35.251  -28.004 3.924   1.00 80.65  ? 155  PRO B CD    1 
ATOM   2486 N  N     . SER B 1 161 ? 32.374  -29.474 6.178   1.00 74.83  ? 156  SER B N     1 
ATOM   2487 C  CA    . SER B 1 161 ? 31.207  -30.087 6.772   1.00 79.54  ? 156  SER B CA    1 
ATOM   2488 C  C     . SER B 1 161 ? 31.504  -31.459 7.385   1.00 82.03  ? 156  SER B C     1 
ATOM   2489 O  O     . SER B 1 161 ? 30.935  -31.811 8.424   1.00 85.48  ? 156  SER B O     1 
ATOM   2490 C  CB    . SER B 1 161 ? 30.111  -30.209 5.734   1.00 75.15  ? 156  SER B CB    1 
ATOM   2491 O  OG    . SER B 1 161 ? 28.925  -30.638 6.377   1.00 78.41  ? 156  SER B OG    1 
ATOM   2492 N  N     . GLN B 1 162 ? 32.356  -32.237 6.723   1.00 82.85  ? 157  GLN B N     1 
ATOM   2493 C  CA    . GLN B 1 162 ? 32.707  -33.589 7.195   1.00 83.82  ? 157  GLN B CA    1 
ATOM   2494 C  C     . GLN B 1 162 ? 33.596  -33.545 8.420   1.00 73.28  ? 157  GLN B C     1 
ATOM   2495 O  O     . GLN B 1 162 ? 33.447  -34.321 9.355   1.00 62.62  ? 157  GLN B O     1 
ATOM   2496 C  CB    . GLN B 1 162 ? 33.459  -34.334 6.117   1.00 90.40  ? 157  GLN B CB    1 
ATOM   2497 C  CG    . GLN B 1 162 ? 32.601  -34.843 4.984   1.00 102.62 ? 157  GLN B CG    1 
ATOM   2498 C  CD    . GLN B 1 162 ? 33.460  -35.334 3.846   1.00 110.34 ? 157  GLN B CD    1 
ATOM   2499 O  OE1   . GLN B 1 162 ? 34.290  -36.214 4.035   1.00 127.67 ? 157  GLN B OE1   1 
ATOM   2500 N  NE2   . GLN B 1 162 ? 33.290  -34.755 2.666   1.00 117.93 ? 157  GLN B NE2   1 
ATOM   2501 N  N     . VAL B 1 163 ? 34.523  -32.609 8.377   1.00 66.45  ? 158  VAL B N     1 
ATOM   2502 C  CA    . VAL B 1 163 ? 35.364  -32.289 9.507   1.00 66.68  ? 158  VAL B CA    1 
ATOM   2503 C  C     . VAL B 1 163 ? 34.520  -31.818 10.697  1.00 70.26  ? 158  VAL B C     1 
ATOM   2504 O  O     . VAL B 1 163 ? 34.790  -32.189 11.833  1.00 63.40  ? 158  VAL B O     1 
ATOM   2505 C  CB    . VAL B 1 163 ? 36.413  -31.213 9.094   1.00 66.87  ? 158  VAL B CB    1 
ATOM   2506 C  CG1   . VAL B 1 163 ? 37.218  -30.701 10.278  1.00 62.86  ? 158  VAL B CG1   1 
ATOM   2507 C  CG2   . VAL B 1 163 ? 37.343  -31.783 8.036   1.00 67.49  ? 158  VAL B CG2   1 
ATOM   2508 N  N     . ASP B 1 164 ? 33.507  -30.989 10.439  1.00 77.39  ? 159  ASP B N     1 
ATOM   2509 C  CA    . ASP B 1 164 ? 32.550  -30.592 11.490  1.00 77.89  ? 159  ASP B CA    1 
ATOM   2510 C  C     . ASP B 1 164 ? 31.888  -31.807 12.119  1.00 71.22  ? 159  ASP B C     1 
ATOM   2511 O  O     . ASP B 1 164 ? 31.727  -31.855 13.340  1.00 60.47  ? 159  ASP B O     1 
ATOM   2512 C  CB    . ASP B 1 164 ? 31.452  -29.667 10.943  1.00 83.56  ? 159  ASP B CB    1 
ATOM   2513 C  CG    . ASP B 1 164 ? 31.949  -28.269 10.652  1.00 83.12  ? 159  ASP B CG    1 
ATOM   2514 O  OD1   . ASP B 1 164 ? 32.697  -27.726 11.495  1.00 82.16  ? 159  ASP B OD1   1 
ATOM   2515 O  OD2   . ASP B 1 164 ? 31.580  -27.705 9.585   1.00 80.06  ? 159  ASP B OD2   1 
ATOM   2516 N  N     . GLN B 1 165 ? 31.486  -32.762 11.281  1.00 73.03  ? 160  GLN B N     1 
ATOM   2517 C  CA    . GLN B 1 165 ? 30.835  -33.979 11.770  1.00 83.11  ? 160  GLN B CA    1 
ATOM   2518 C  C     . GLN B 1 165 ? 31.795  -34.683 12.677  1.00 79.11  ? 160  GLN B C     1 
ATOM   2519 O  O     . GLN B 1 165 ? 31.511  -34.940 13.840  1.00 78.15  ? 160  GLN B O     1 
ATOM   2520 C  CB    . GLN B 1 165 ? 30.518  -34.985 10.625  1.00 94.48  ? 160  GLN B CB    1 
ATOM   2521 C  CG    . GLN B 1 165 ? 29.058  -35.044 10.149  1.00 103.03 ? 160  GLN B CG    1 
ATOM   2522 C  CD    . GLN B 1 165 ? 28.843  -34.200 8.902   1.00 112.06 ? 160  GLN B CD    1 
ATOM   2523 O  OE1   . GLN B 1 165 ? 29.083  -34.645 7.756   1.00 105.97 ? 160  GLN B OE1   1 
ATOM   2524 N  NE2   . GLN B 1 165 ? 28.411  -32.965 9.115   1.00 114.24 ? 160  GLN B NE2   1 
ATOM   2525 N  N     . PHE B 1 166 ? 32.930  -35.026 12.082  1.00 81.06  ? 161  PHE B N     1 
ATOM   2526 C  CA    . PHE B 1 166 ? 34.018  -35.692 12.757  1.00 77.98  ? 161  PHE B CA    1 
ATOM   2527 C  C     . PHE B 1 166 ? 34.227  -35.164 14.176  1.00 73.97  ? 161  PHE B C     1 
ATOM   2528 O  O     . PHE B 1 166 ? 34.210  -35.933 15.141  1.00 77.10  ? 161  PHE B O     1 
ATOM   2529 C  CB    . PHE B 1 166 ? 35.282  -35.501 11.912  1.00 81.54  ? 161  PHE B CB    1 
ATOM   2530 C  CG    . PHE B 1 166 ? 36.471  -36.233 12.425  1.00 84.48  ? 161  PHE B CG    1 
ATOM   2531 C  CD1   . PHE B 1 166 ? 36.660  -37.557 12.104  1.00 83.80  ? 161  PHE B CD1   1 
ATOM   2532 C  CD2   . PHE B 1 166 ? 37.409  -35.592 13.227  1.00 87.80  ? 161  PHE B CD2   1 
ATOM   2533 C  CE1   . PHE B 1 166 ? 37.754  -38.236 12.582  1.00 83.27  ? 161  PHE B CE1   1 
ATOM   2534 C  CE2   . PHE B 1 166 ? 38.501  -36.270 13.710  1.00 81.20  ? 161  PHE B CE2   1 
ATOM   2535 C  CZ    . PHE B 1 166 ? 38.673  -37.594 13.386  1.00 79.27  ? 161  PHE B CZ    1 
ATOM   2536 N  N     . CYS B 1 167 ? 34.428  -33.853 14.297  1.00 72.08  ? 162  CYS B N     1 
ATOM   2537 C  CA    . CYS B 1 167 ? 34.689  -33.222 15.597  1.00 71.86  ? 162  CYS B CA    1 
ATOM   2538 C  C     . CYS B 1 167 ? 33.595  -33.538 16.605  1.00 78.08  ? 162  CYS B C     1 
ATOM   2539 O  O     . CYS B 1 167 ? 33.894  -33.913 17.739  1.00 78.46  ? 162  CYS B O     1 
ATOM   2540 C  CB    . CYS B 1 167 ? 34.864  -31.707 15.463  1.00 73.49  ? 162  CYS B CB    1 
ATOM   2541 S  SG    . CYS B 1 167 ? 36.383  -31.186 14.605  1.00 77.87  ? 162  CYS B SG    1 
ATOM   2542 N  N     . LYS B 1 168 ? 32.332  -33.411 16.192  1.00 89.61  ? 163  LYS B N     1 
ATOM   2543 C  CA    . LYS B 1 168 ? 31.226  -33.718 17.101  1.00 93.43  ? 163  LYS B CA    1 
ATOM   2544 C  C     . LYS B 1 168 ? 31.259  -35.175 17.492  1.00 84.48  ? 163  LYS B C     1 
ATOM   2545 O  O     . LYS B 1 168 ? 30.956  -35.520 18.625  1.00 78.29  ? 163  LYS B O     1 
ATOM   2546 C  CB    . LYS B 1 168 ? 29.843  -33.452 16.503  1.00 103.44 ? 163  LYS B CB    1 
ATOM   2547 C  CG    . LYS B 1 168 ? 29.246  -32.069 16.763  1.00 118.57 ? 163  LYS B CG    1 
ATOM   2548 C  CD    . LYS B 1 168 ? 27.719  -32.028 16.603  1.00 123.52 ? 163  LYS B CD    1 
ATOM   2549 C  CE    . LYS B 1 168 ? 27.220  -30.617 16.266  1.00 123.21 ? 163  LYS B CE    1 
ATOM   2550 N  NZ    . LYS B 1 168 ? 25.735  -30.493 16.329  1.00 124.09 ? 163  LYS B NZ    1 
ATOM   2551 N  N     . GLU B 1 169 ? 31.541  -36.034 16.523  1.00 81.68  ? 164  GLU B N     1 
ATOM   2552 C  CA    . GLU B 1 169 ? 31.506  -37.460 16.765  1.00 84.80  ? 164  GLU B CA    1 
ATOM   2553 C  C     . GLU B 1 169 ? 32.625  -37.941 17.681  1.00 82.03  ? 164  GLU B C     1 
ATOM   2554 O  O     . GLU B 1 169 ? 32.489  -38.987 18.297  1.00 88.50  ? 164  GLU B O     1 
ATOM   2555 C  CB    . GLU B 1 169 ? 31.544  -38.214 15.443  1.00 91.65  ? 164  GLU B CB    1 
ATOM   2556 C  CG    . GLU B 1 169 ? 31.061  -39.649 15.560  1.00 107.75 ? 164  GLU B CG    1 
ATOM   2557 C  CD    . GLU B 1 169 ? 30.601  -40.210 14.228  1.00 122.93 ? 164  GLU B CD    1 
ATOM   2558 O  OE1   . GLU B 1 169 ? 29.659  -39.626 13.642  1.00 129.59 ? 164  GLU B OE1   1 
ATOM   2559 O  OE2   . GLU B 1 169 ? 31.184  -41.225 13.765  1.00 125.28 ? 164  GLU B OE2   1 
ATOM   2560 N  N     . HIS B 1 170 ? 33.726  -37.197 17.767  1.00 78.27  ? 165  HIS B N     1 
ATOM   2561 C  CA    . HIS B 1 170 ? 34.913  -37.668 18.488  1.00 75.02  ? 165  HIS B CA    1 
ATOM   2562 C  C     . HIS B 1 170 ? 35.401  -36.680 19.526  1.00 74.11  ? 165  HIS B C     1 
ATOM   2563 O  O     . HIS B 1 170 ? 36.577  -36.630 19.819  1.00 79.83  ? 165  HIS B O     1 
ATOM   2564 C  CB    . HIS B 1 170 ? 36.037  -37.975 17.486  1.00 76.46  ? 165  HIS B CB    1 
ATOM   2565 C  CG    . HIS B 1 170 ? 35.668  -39.015 16.477  1.00 78.86  ? 165  HIS B CG    1 
ATOM   2566 N  ND1   . HIS B 1 170 ? 35.476  -40.336 16.813  1.00 81.07  ? 165  HIS B ND1   1 
ATOM   2567 C  CD2   . HIS B 1 170 ? 35.427  -38.929 15.149  1.00 84.56  ? 165  HIS B CD2   1 
ATOM   2568 C  CE1   . HIS B 1 170 ? 35.147  -41.024 15.735  1.00 82.29  ? 165  HIS B CE1   1 
ATOM   2569 N  NE2   . HIS B 1 170 ? 35.112  -40.193 14.710  1.00 88.11  ? 165  HIS B NE2   1 
ATOM   2570 N  N     . GLY B 1 171 ? 34.503  -35.886 20.086  1.00 78.89  ? 166  GLY B N     1 
ATOM   2571 C  CA    . GLY B 1 171 ? 34.809  -35.099 21.278  1.00 80.03  ? 166  GLY B CA    1 
ATOM   2572 C  C     . GLY B 1 171 ? 35.821  -33.989 21.050  1.00 79.77  ? 166  GLY B C     1 
ATOM   2573 O  O     . GLY B 1 171 ? 36.589  -33.640 21.945  1.00 87.84  ? 166  GLY B O     1 
ATOM   2574 N  N     . PHE B 1 172 ? 35.860  -33.430 19.854  1.00 72.85  ? 167  PHE B N     1 
ATOM   2575 C  CA    . PHE B 1 172 ? 36.687  -32.253 19.654  1.00 79.12  ? 167  PHE B CA    1 
ATOM   2576 C  C     . PHE B 1 172 ? 35.849  -31.006 19.841  1.00 78.12  ? 167  PHE B C     1 
ATOM   2577 O  O     . PHE B 1 172 ? 34.834  -30.852 19.184  1.00 83.83  ? 167  PHE B O     1 
ATOM   2578 C  CB    . PHE B 1 172 ? 37.299  -32.251 18.263  1.00 81.97  ? 167  PHE B CB    1 
ATOM   2579 C  CG    . PHE B 1 172 ? 38.439  -33.206 18.100  1.00 82.81  ? 167  PHE B CG    1 
ATOM   2580 C  CD1   . PHE B 1 172 ? 38.214  -34.515 17.711  1.00 85.49  ? 167  PHE B CD1   1 
ATOM   2581 C  CD2   . PHE B 1 172 ? 39.746  -32.786 18.301  1.00 87.69  ? 167  PHE B CD2   1 
ATOM   2582 C  CE1   . PHE B 1 172 ? 39.273  -35.391 17.528  1.00 88.67  ? 167  PHE B CE1   1 
ATOM   2583 C  CE2   . PHE B 1 172 ? 40.806  -33.659 18.125  1.00 87.49  ? 167  PHE B CE2   1 
ATOM   2584 C  CZ    . PHE B 1 172 ? 40.574  -34.961 17.736  1.00 83.46  ? 167  PHE B CZ    1 
ATOM   2585 N  N     . ALA B 1 173 ? 36.305  -30.100 20.696  1.00 75.61  ? 168  ALA B N     1 
ATOM   2586 C  CA    . ALA B 1 173 ? 35.641  -28.816 20.893  1.00 73.47  ? 168  ALA B CA    1 
ATOM   2587 C  C     . ALA B 1 173 ? 35.597  -27.929 19.648  1.00 74.18  ? 168  ALA B C     1 
ATOM   2588 O  O     . ALA B 1 173 ? 34.769  -27.028 19.574  1.00 86.63  ? 168  ALA B O     1 
ATOM   2589 C  CB    . ALA B 1 173 ? 36.289  -28.052 22.036  1.00 71.76  ? 168  ALA B CB    1 
ATOM   2590 N  N     . GLY B 1 174 ? 36.458  -28.158 18.667  1.00 74.09  ? 169  GLY B N     1 
ATOM   2591 C  CA    . GLY B 1 174 ? 36.568  -27.218 17.555  1.00 73.25  ? 169  GLY B CA    1 
ATOM   2592 C  C     . GLY B 1 174 ? 37.550  -27.687 16.511  1.00 71.01  ? 169  GLY B C     1 
ATOM   2593 O  O     . GLY B 1 174 ? 38.025  -28.798 16.595  1.00 76.78  ? 169  GLY B O     1 
ATOM   2594 N  N     . TRP B 1 175 ? 37.830  -26.832 15.526  1.00 66.90  ? 170  TRP B N     1 
ATOM   2595 C  CA    . TRP B 1 175 ? 38.846  -27.083 14.510  1.00 63.35  ? 170  TRP B CA    1 
ATOM   2596 C  C     . TRP B 1 175 ? 39.129  -25.834 13.659  1.00 62.43  ? 170  TRP B C     1 
ATOM   2597 O  O     . TRP B 1 175 ? 38.341  -24.914 13.654  1.00 65.95  ? 170  TRP B O     1 
ATOM   2598 C  CB    . TRP B 1 175 ? 38.461  -28.277 13.630  1.00 65.59  ? 170  TRP B CB    1 
ATOM   2599 C  CG    . TRP B 1 175 ? 37.474  -28.017 12.564  1.00 68.30  ? 170  TRP B CG    1 
ATOM   2600 C  CD1   . TRP B 1 175 ? 36.112  -28.052 12.680  1.00 74.89  ? 170  TRP B CD1   1 
ATOM   2601 C  CD2   . TRP B 1 175 ? 37.754  -27.721 11.196  1.00 69.16  ? 170  TRP B CD2   1 
ATOM   2602 N  NE1   . TRP B 1 175 ? 35.528  -27.783 11.468  1.00 78.12  ? 170  TRP B NE1   1 
ATOM   2603 C  CE2   . TRP B 1 175 ? 36.517  -27.572 10.539  1.00 76.62  ? 170  TRP B CE2   1 
ATOM   2604 C  CE3   . TRP B 1 175 ? 38.927  -27.562 10.460  1.00 69.06  ? 170  TRP B CE3   1 
ATOM   2605 C  CZ2   . TRP B 1 175 ? 36.423  -27.274 9.175   1.00 75.66  ? 170  TRP B CZ2   1 
ATOM   2606 C  CZ3   . TRP B 1 175 ? 38.832  -27.267 9.110   1.00 72.23  ? 170  TRP B CZ3   1 
ATOM   2607 C  CH2   . TRP B 1 175 ? 37.590  -27.132 8.480   1.00 73.07  ? 170  TRP B CH2   1 
ATOM   2608 N  N     . PHE B 1 176 ? 40.288  -25.786 13.003  1.00 62.09  ? 171  PHE B N     1 
ATOM   2609 C  CA    . PHE B 1 176 ? 40.742  -24.608 12.256  1.00 64.27  ? 171  PHE B CA    1 
ATOM   2610 C  C     . PHE B 1 176 ? 41.667  -25.059 11.125  1.00 64.30  ? 171  PHE B C     1 
ATOM   2611 O  O     . PHE B 1 176 ? 42.561  -25.858 11.341  1.00 70.36  ? 171  PHE B O     1 
ATOM   2612 C  CB    . PHE B 1 176 ? 41.539  -23.645 13.147  1.00 71.60  ? 171  PHE B CB    1 
ATOM   2613 C  CG    . PHE B 1 176 ? 40.777  -23.073 14.316  1.00 80.27  ? 171  PHE B CG    1 
ATOM   2614 C  CD1   . PHE B 1 176 ? 40.427  -23.864 15.410  1.00 87.97  ? 171  PHE B CD1   1 
ATOM   2615 C  CD2   . PHE B 1 176 ? 40.467  -21.719 14.364  1.00 84.90  ? 171  PHE B CD2   1 
ATOM   2616 C  CE1   . PHE B 1 176 ? 39.743  -23.324 16.502  1.00 89.09  ? 171  PHE B CE1   1 
ATOM   2617 C  CE2   . PHE B 1 176 ? 39.787  -21.178 15.452  1.00 83.97  ? 171  PHE B CE2   1 
ATOM   2618 C  CZ    . PHE B 1 176 ? 39.427  -21.979 16.522  1.00 82.58  ? 171  PHE B CZ    1 
ATOM   2619 N  N     . GLU B 1 177 ? 41.486  -24.528 9.929   1.00 71.10  ? 172  GLU B N     1 
ATOM   2620 C  CA    . GLU B 1 177 ? 42.548  -24.531 8.928   1.00 71.74  ? 172  GLU B CA    1 
ATOM   2621 C  C     . GLU B 1 177 ? 43.637  -23.578 9.420   1.00 70.51  ? 172  GLU B C     1 
ATOM   2622 O  O     . GLU B 1 177 ? 43.356  -22.419 9.715   1.00 77.79  ? 172  GLU B O     1 
ATOM   2623 C  CB    . GLU B 1 177 ? 42.015  -24.093 7.551   1.00 82.75  ? 172  GLU B CB    1 
ATOM   2624 C  CG    . GLU B 1 177 ? 40.801  -24.889 7.035   1.00 99.53  ? 172  GLU B CG    1 
ATOM   2625 C  CD    . GLU B 1 177 ? 40.739  -25.014 5.506   1.00 113.77 ? 172  GLU B CD    1 
ATOM   2626 O  OE1   . GLU B 1 177 ? 40.888  -23.974 4.830   1.00 119.11 ? 172  GLU B OE1   1 
ATOM   2627 O  OE2   . GLU B 1 177 ? 40.538  -26.146 4.977   1.00 116.42 ? 172  GLU B OE2   1 
ATOM   2628 N  N     . THR B 1 178 ? 44.867  -24.068 9.545   1.00 69.78  ? 173  THR B N     1 
ATOM   2629 C  CA    . THR B 1 178 ? 45.985  -23.258 10.045  1.00 64.65  ? 173  THR B CA    1 
ATOM   2630 C  C     . THR B 1 178 ? 47.117  -23.262 9.081   1.00 59.85  ? 173  THR B C     1 
ATOM   2631 O  O     . THR B 1 178 ? 47.273  -24.205 8.305   1.00 57.74  ? 173  THR B O     1 
ATOM   2632 C  CB    . THR B 1 178 ? 46.553  -23.784 11.377  1.00 70.39  ? 173  THR B CB    1 
ATOM   2633 O  OG1   . THR B 1 178 ? 47.026  -25.131 11.226  1.00 74.74  ? 173  THR B OG1   1 
ATOM   2634 C  CG2   . THR B 1 178 ? 45.493  -23.730 12.471  1.00 73.71  ? 173  THR B CG2   1 
ATOM   2635 N  N     . SER B 1 179 ? 47.949  -22.234 9.157   1.00 59.76  ? 174  SER B N     1 
ATOM   2636 C  CA    . SER B 1 179 ? 49.252  -22.293 8.493   1.00 64.95  ? 174  SER B CA    1 
ATOM   2637 C  C     . SER B 1 179 ? 50.334  -21.662 9.340   1.00 66.97  ? 174  SER B C     1 
ATOM   2638 O  O     . SER B 1 179 ? 50.338  -20.453 9.566   1.00 72.16  ? 174  SER B O     1 
ATOM   2639 C  CB    . SER B 1 179 ? 49.213  -21.606 7.137   1.00 63.30  ? 174  SER B CB    1 
ATOM   2640 O  OG    . SER B 1 179 ? 50.511  -21.525 6.583   1.00 68.88  ? 174  SER B OG    1 
ATOM   2641 N  N     . ALA B 1 180 ? 51.270  -22.487 9.781   1.00 65.43  ? 175  ALA B N     1 
ATOM   2642 C  CA    . ALA B 1 180 ? 52.495  -21.987 10.353  1.00 71.30  ? 175  ALA B CA    1 
ATOM   2643 C  C     . ALA B 1 180 ? 53.261  -21.120 9.377   1.00 70.80  ? 175  ALA B C     1 
ATOM   2644 O  O     . ALA B 1 180 ? 53.942  -20.201 9.794   1.00 73.47  ? 175  ALA B O     1 
ATOM   2645 C  CB    . ALA B 1 180 ? 53.373  -23.138 10.806  1.00 81.50  ? 175  ALA B CB    1 
ATOM   2646 N  N     . LYS B 1 181 ? 53.198  -21.415 8.085   1.00 76.57  ? 176  LYS B N     1 
ATOM   2647 C  CA    . LYS B 1 181 ? 54.012  -20.661 7.133   1.00 84.34  ? 176  LYS B CA    1 
ATOM   2648 C  C     . LYS B 1 181 ? 53.533  -19.229 7.051   1.00 86.38  ? 176  LYS B C     1 
ATOM   2649 O  O     . LYS B 1 181 ? 54.332  -18.294 7.125   1.00 85.47  ? 176  LYS B O     1 
ATOM   2650 C  CB    . LYS B 1 181 ? 53.960  -21.277 5.743   1.00 92.86  ? 176  LYS B CB    1 
ATOM   2651 C  CG    . LYS B 1 181 ? 55.003  -20.672 4.815   1.00 98.50  ? 176  LYS B CG    1 
ATOM   2652 C  CD    . LYS B 1 181 ? 54.820  -21.075 3.372   1.00 103.22 ? 176  LYS B CD    1 
ATOM   2653 C  CE    . LYS B 1 181 ? 56.151  -20.985 2.651   1.00 104.20 ? 176  LYS B CE    1 
ATOM   2654 N  NZ    . LYS B 1 181 ? 56.041  -21.283 1.200   1.00 112.77 ? 176  LYS B NZ    1 
ATOM   2655 N  N     . ASP B 1 182 ? 52.215  -19.084 6.890   1.00 88.76  ? 177  ASP B N     1 
ATOM   2656 C  CA    . ASP B 1 182 ? 51.575  -17.818 6.531   1.00 81.25  ? 177  ASP B CA    1 
ATOM   2657 C  C     . ASP B 1 182 ? 50.700  -17.289 7.673   1.00 77.34  ? 177  ASP B C     1 
ATOM   2658 O  O     . ASP B 1 182 ? 49.637  -16.764 7.457   1.00 82.19  ? 177  ASP B O     1 
ATOM   2659 C  CB    . ASP B 1 182 ? 50.729  -18.011 5.264   1.00 78.25  ? 177  ASP B CB    1 
ATOM   2660 C  CG    . ASP B 1 182 ? 51.575  -18.138 4.005   1.00 77.52  ? 177  ASP B CG    1 
ATOM   2661 O  OD1   . ASP B 1 182 ? 52.670  -17.539 3.958   1.00 73.99  ? 177  ASP B OD1   1 
ATOM   2662 O  OD2   . ASP B 1 182 ? 51.137  -18.820 3.049   1.00 82.65  ? 177  ASP B OD2   1 
ATOM   2663 N  N     . ASN B 1 183 ? 51.174  -17.424 8.894   1.00 76.89  ? 178  ASN B N     1 
ATOM   2664 C  CA    . ASN B 1 183 ? 50.388  -17.133 10.084  1.00 71.04  ? 178  ASN B CA    1 
ATOM   2665 C  C     . ASN B 1 183 ? 48.855  -17.138 9.954   1.00 69.36  ? 178  ASN B C     1 
ATOM   2666 O  O     . ASN B 1 183 ? 48.234  -16.143 10.228  1.00 78.93  ? 178  ASN B O     1 
ATOM   2667 C  CB    . ASN B 1 183 ? 50.836  -15.784 10.645  1.00 66.16  ? 178  ASN B CB    1 
ATOM   2668 C  CG    . ASN B 1 183 ? 50.631  -15.669 12.142  1.00 70.96  ? 178  ASN B CG    1 
ATOM   2669 O  OD1   . ASN B 1 183 ? 51.377  -14.960 12.827  1.00 75.40  ? 178  ASN B OD1   1 
ATOM   2670 N  ND2   . ASN B 1 183 ? 49.615  -16.359 12.670  1.00 75.86  ? 178  ASN B ND2   1 
ATOM   2671 N  N     . ILE B 1 184 ? 48.230  -18.264 9.643   1.00 71.14  ? 179  ILE B N     1 
ATOM   2672 C  CA    . ILE B 1 184 ? 46.761  -18.304 9.592   1.00 70.62  ? 179  ILE B CA    1 
ATOM   2673 C  C     . ILE B 1 184 ? 46.138  -19.064 10.764  1.00 75.89  ? 179  ILE B C     1 
ATOM   2674 O  O     . ILE B 1 184 ? 46.421  -20.244 10.972  1.00 78.37  ? 179  ILE B O     1 
ATOM   2675 C  CB    . ILE B 1 184 ? 46.279  -18.956 8.300   1.00 71.95  ? 179  ILE B CB    1 
ATOM   2676 C  CG1   . ILE B 1 184 ? 46.598  -18.047 7.120   1.00 69.41  ? 179  ILE B CG1   1 
ATOM   2677 C  CG2   . ILE B 1 184 ? 44.789  -19.270 8.366   1.00 67.57  ? 179  ILE B CG2   1 
ATOM   2678 C  CD1   . ILE B 1 184 ? 46.797  -18.791 5.817   1.00 70.95  ? 179  ILE B CD1   1 
ATOM   2679 N  N     . ASN B 1 185 ? 45.258  -18.380 11.489  1.00 78.18  ? 180  ASN B N     1 
ATOM   2680 C  CA    . ASN B 1 185 ? 44.344  -18.988 12.455  1.00 78.31  ? 180  ASN B CA    1 
ATOM   2681 C  C     . ASN B 1 185 ? 44.979  -19.600 13.688  1.00 76.13  ? 180  ASN B C     1 
ATOM   2682 O  O     . ASN B 1 185 ? 44.316  -20.279 14.481  1.00 78.18  ? 180  ASN B O     1 
ATOM   2683 C  CB    . ASN B 1 185 ? 43.468  -20.023 11.769  1.00 85.31  ? 180  ASN B CB    1 
ATOM   2684 C  CG    . ASN B 1 185 ? 42.263  -19.411 11.140  1.00 86.80  ? 180  ASN B CG    1 
ATOM   2685 O  OD1   . ASN B 1 185 ? 41.874  -18.288 11.474  1.00 96.08  ? 180  ASN B OD1   1 
ATOM   2686 N  ND2   . ASN B 1 185 ? 41.640  -20.149 10.246  1.00 89.98  ? 180  ASN B ND2   1 
ATOM   2687 N  N     . ILE B 1 186 ? 46.255  -19.338 13.880  1.00 77.97  ? 181  ILE B N     1 
ATOM   2688 C  CA    . ILE B 1 186 ? 46.945  -19.904 15.011  1.00 82.16  ? 181  ILE B CA    1 
ATOM   2689 C  C     . ILE B 1 186 ? 46.524  -19.126 16.253  1.00 83.20  ? 181  ILE B C     1 
ATOM   2690 O  O     . ILE B 1 186 ? 45.969  -19.701 17.197  1.00 71.50  ? 181  ILE B O     1 
ATOM   2691 C  CB    . ILE B 1 186 ? 48.463  -19.878 14.773  1.00 86.24  ? 181  ILE B CB    1 
ATOM   2692 C  CG1   . ILE B 1 186 ? 48.804  -20.902 13.684  1.00 82.64  ? 181  ILE B CG1   1 
ATOM   2693 C  CG2   . ILE B 1 186 ? 49.228  -20.165 16.058  1.00 83.59  ? 181  ILE B CG2   1 
ATOM   2694 C  CD1   . ILE B 1 186 ? 50.235  -20.835 13.205  1.00 85.24  ? 181  ILE B CD1   1 
ATOM   2695 N  N     . GLU B 1 187 ? 46.722  -17.806 16.204  1.00 93.58  ? 182  GLU B N     1 
ATOM   2696 C  CA    . GLU B 1 187 ? 46.227  -16.884 17.238  1.00 86.52  ? 182  GLU B CA    1 
ATOM   2697 C  C     . GLU B 1 187 ? 44.780  -17.212 17.655  1.00 84.38  ? 182  GLU B C     1 
ATOM   2698 O  O     . GLU B 1 187 ? 44.461  -17.274 18.847  1.00 85.95  ? 182  GLU B O     1 
ATOM   2699 C  CB    . GLU B 1 187 ? 46.340  -15.440 16.740  1.00 81.75  ? 182  GLU B CB    1 
ATOM   2700 C  CG    . GLU B 1 187 ? 47.763  -14.890 16.743  1.00 80.77  ? 182  GLU B CG    1 
ATOM   2701 C  CD    . GLU B 1 187 ? 48.256  -14.549 18.144  1.00 86.69  ? 182  GLU B CD    1 
ATOM   2702 O  OE1   . GLU B 1 187 ? 47.486  -14.701 19.125  1.00 88.20  ? 182  GLU B OE1   1 
ATOM   2703 O  OE2   . GLU B 1 187 ? 49.419  -14.113 18.280  1.00 94.35  ? 182  GLU B OE2   1 
ATOM   2704 N  N     . GLU B 1 188 ? 43.939  -17.490 16.663  1.00 78.01  ? 183  GLU B N     1 
ATOM   2705 C  CA    . GLU B 1 188 ? 42.506  -17.689 16.865  1.00 79.61  ? 183  GLU B CA    1 
ATOM   2706 C  C     . GLU B 1 188 ? 42.244  -18.992 17.579  1.00 74.67  ? 183  GLU B C     1 
ATOM   2707 O  O     . GLU B 1 188 ? 41.502  -19.035 18.564  1.00 72.89  ? 183  GLU B O     1 
ATOM   2708 C  CB    . GLU B 1 188 ? 41.759  -17.691 15.513  1.00 88.36  ? 183  GLU B CB    1 
ATOM   2709 C  CG    . GLU B 1 188 ? 41.635  -16.323 14.834  1.00 89.96  ? 183  GLU B CG    1 
ATOM   2710 C  CD    . GLU B 1 188 ? 42.921  -15.835 14.158  1.00 95.67  ? 183  GLU B CD    1 
ATOM   2711 O  OE1   . GLU B 1 188 ? 44.021  -16.371 14.419  1.00 95.14  ? 183  GLU B OE1   1 
ATOM   2712 O  OE2   . GLU B 1 188 ? 42.841  -14.881 13.364  1.00 105.91 ? 183  GLU B OE2   1 
ATOM   2713 N  N     . ALA B 1 189 ? 42.872  -20.056 17.079  1.00 77.25  ? 184  ALA B N     1 
ATOM   2714 C  CA    . ALA B 1 189 ? 42.747  -21.391 17.681  1.00 78.41  ? 184  ALA B CA    1 
ATOM   2715 C  C     . ALA B 1 189 ? 43.280  -21.452 19.110  1.00 79.50  ? 184  ALA B C     1 
ATOM   2716 O  O     . ALA B 1 189 ? 42.652  -22.080 19.977  1.00 68.70  ? 184  ALA B O     1 
ATOM   2717 C  CB    . ALA B 1 189 ? 43.454  -22.429 16.831  1.00 79.30  ? 184  ALA B CB    1 
ATOM   2718 N  N     . ALA B 1 190 ? 44.428  -20.798 19.347  1.00 76.96  ? 185  ALA B N     1 
ATOM   2719 C  CA    . ALA B 1 190 ? 44.968  -20.625 20.701  1.00 77.41  ? 185  ALA B CA    1 
ATOM   2720 C  C     . ALA B 1 190 ? 43.919  -20.027 21.614  1.00 86.31  ? 185  ALA B C     1 
ATOM   2721 O  O     . ALA B 1 190 ? 43.580  -20.601 22.668  1.00 87.28  ? 185  ALA B O     1 
ATOM   2722 C  CB    . ALA B 1 190 ? 46.200  -19.749 20.683  1.00 71.97  ? 185  ALA B CB    1 
ATOM   2723 N  N     . ARG B 1 191 ? 43.371  -18.893 21.181  1.00 91.70  ? 186  ARG B N     1 
ATOM   2724 C  CA    . ARG B 1 191 ? 42.329  -18.218 21.951  1.00 93.89  ? 186  ARG B CA    1 
ATOM   2725 C  C     . ARG B 1 191 ? 41.143  -19.129 22.238  1.00 82.07  ? 186  ARG B C     1 
ATOM   2726 O  O     . ARG B 1 191 ? 40.728  -19.276 23.399  1.00 73.97  ? 186  ARG B O     1 
ATOM   2727 C  CB    . ARG B 1 191 ? 41.843  -16.915 21.282  1.00 111.74 ? 186  ARG B CB    1 
ATOM   2728 C  CG    . ARG B 1 191 ? 42.625  -15.697 21.775  1.00 123.40 ? 186  ARG B CG    1 
ATOM   2729 C  CD    . ARG B 1 191 ? 42.135  -14.369 21.215  1.00 129.02 ? 186  ARG B CD    1 
ATOM   2730 N  NE    . ARG B 1 191 ? 43.049  -13.768 20.236  1.00 138.37 ? 186  ARG B NE    1 
ATOM   2731 C  CZ    . ARG B 1 191 ? 42.903  -13.817 18.909  1.00 139.32 ? 186  ARG B CZ    1 
ATOM   2732 N  NH1   . ARG B 1 191 ? 41.875  -14.460 18.356  1.00 143.90 ? 186  ARG B NH1   1 
ATOM   2733 N  NH2   . ARG B 1 191 ? 43.798  -13.225 18.122  1.00 132.46 ? 186  ARG B NH2   1 
ATOM   2734 N  N     . PHE B 1 192 ? 40.623  -19.749 21.181  1.00 74.46  ? 187  PHE B N     1 
ATOM   2735 C  CA    . PHE B 1 192 ? 39.477  -20.648 21.313  1.00 78.73  ? 187  PHE B CA    1 
ATOM   2736 C  C     . PHE B 1 192 ? 39.709  -21.684 22.410  1.00 80.08  ? 187  PHE B C     1 
ATOM   2737 O  O     . PHE B 1 192 ? 38.824  -21.949 23.231  1.00 72.80  ? 187  PHE B O     1 
ATOM   2738 C  CB    . PHE B 1 192 ? 39.190  -21.359 19.989  1.00 79.72  ? 187  PHE B CB    1 
ATOM   2739 C  CG    . PHE B 1 192 ? 38.037  -22.329 20.061  1.00 78.15  ? 187  PHE B CG    1 
ATOM   2740 C  CD1   . PHE B 1 192 ? 36.752  -21.914 19.814  1.00 77.12  ? 187  PHE B CD1   1 
ATOM   2741 C  CD2   . PHE B 1 192 ? 38.241  -23.653 20.384  1.00 86.86  ? 187  PHE B CD2   1 
ATOM   2742 C  CE1   . PHE B 1 192 ? 35.680  -22.792 19.887  1.00 77.33  ? 187  PHE B CE1   1 
ATOM   2743 C  CE2   . PHE B 1 192 ? 37.175  -24.544 20.459  1.00 90.74  ? 187  PHE B CE2   1 
ATOM   2744 C  CZ    . PHE B 1 192 ? 35.890  -24.107 20.211  1.00 84.63  ? 187  PHE B CZ    1 
ATOM   2745 N  N     . LEU B 1 193 ? 40.909  -22.265 22.411  1.00 80.76  ? 188  LEU B N     1 
ATOM   2746 C  CA    . LEU B 1 193 ? 41.228  -23.318 23.355  1.00 75.77  ? 188  LEU B CA    1 
ATOM   2747 C  C     . LEU B 1 193 ? 41.289  -22.741 24.747  1.00 72.66  ? 188  LEU B C     1 
ATOM   2748 O  O     . LEU B 1 193 ? 40.612  -23.221 25.649  1.00 77.74  ? 188  LEU B O     1 
ATOM   2749 C  CB    . LEU B 1 193 ? 42.556  -24.001 23.004  1.00 77.57  ? 188  LEU B CB    1 
ATOM   2750 C  CG    . LEU B 1 193 ? 43.014  -25.144 23.944  1.00 73.77  ? 188  LEU B CG    1 
ATOM   2751 C  CD1   . LEU B 1 193 ? 41.895  -26.136 24.260  1.00 72.40  ? 188  LEU B CD1   1 
ATOM   2752 C  CD2   . LEU B 1 193 ? 44.204  -25.873 23.348  1.00 71.21  ? 188  LEU B CD2   1 
ATOM   2753 N  N     . VAL B 1 194 ? 42.102  -21.707 24.917  1.00 73.40  ? 189  VAL B N     1 
ATOM   2754 C  CA    . VAL B 1 194 ? 42.311  -21.103 26.239  1.00 79.02  ? 189  VAL B CA    1 
ATOM   2755 C  C     . VAL B 1 194 ? 40.966  -20.683 26.926  1.00 80.73  ? 189  VAL B C     1 
ATOM   2756 O  O     . VAL B 1 194 ? 40.747  -20.968 28.126  1.00 66.88  ? 189  VAL B O     1 
ATOM   2757 C  CB    . VAL B 1 194 ? 43.434  -20.026 26.170  1.00 75.61  ? 189  VAL B CB    1 
ATOM   2758 C  CG1   . VAL B 1 194 ? 43.045  -18.900 25.256  1.00 80.89  ? 189  VAL B CG1   1 
ATOM   2759 C  CG2   . VAL B 1 194 ? 43.796  -19.476 27.541  1.00 75.92  ? 189  VAL B CG2   1 
ATOM   2760 N  N     . GLU B 1 195 ? 40.051  -20.090 26.153  1.00 81.79  ? 190  GLU B N     1 
ATOM   2761 C  CA    . GLU B 1 195 ? 38.671  -19.873 26.594  1.00 93.76  ? 190  GLU B CA    1 
ATOM   2762 C  C     . GLU B 1 195 ? 38.045  -21.115 27.204  1.00 86.13  ? 190  GLU B C     1 
ATOM   2763 O  O     . GLU B 1 195 ? 37.549  -21.093 28.332  1.00 84.86  ? 190  GLU B O     1 
ATOM   2764 C  CB    . GLU B 1 195 ? 37.801  -19.454 25.406  1.00 106.01 ? 190  GLU B CB    1 
ATOM   2765 C  CG    . GLU B 1 195 ? 37.595  -17.957 25.205  1.00 114.35 ? 190  GLU B CG    1 
ATOM   2766 C  CD    . GLU B 1 195 ? 36.994  -17.646 23.840  1.00 121.41 ? 190  GLU B CD    1 
ATOM   2767 O  OE1   . GLU B 1 195 ? 36.145  -18.433 23.353  1.00 122.70 ? 190  GLU B OE1   1 
ATOM   2768 O  OE2   . GLU B 1 195 ? 37.381  -16.623 23.240  1.00 124.76 ? 190  GLU B OE2   1 
ATOM   2769 N  N     . LYS B 1 196 ? 38.049  -22.188 26.430  1.00 82.28  ? 191  LYS B N     1 
ATOM   2770 C  CA    . LYS B 1 196 ? 37.404  -23.417 26.837  1.00 89.20  ? 191  LYS B CA    1 
ATOM   2771 C  C     . LYS B 1 196 ? 38.005  -23.906 28.154  1.00 86.06  ? 191  LYS B C     1 
ATOM   2772 O  O     . LYS B 1 196 ? 37.293  -24.393 29.036  1.00 75.43  ? 191  LYS B O     1 
ATOM   2773 C  CB    . LYS B 1 196 ? 37.596  -24.486 25.755  1.00 99.02  ? 191  LYS B CB    1 
ATOM   2774 C  CG    . LYS B 1 196 ? 36.774  -25.748 25.987  1.00 107.87 ? 191  LYS B CG    1 
ATOM   2775 C  CD    . LYS B 1 196 ? 35.474  -25.847 25.154  1.00 108.61 ? 191  LYS B CD    1 
ATOM   2776 C  CE    . LYS B 1 196 ? 34.664  -24.554 24.981  1.00 107.14 ? 191  LYS B CE    1 
ATOM   2777 N  NZ    . LYS B 1 196 ? 34.987  -23.784 23.736  1.00 98.74  ? 191  LYS B NZ    1 
ATOM   2778 N  N     . ILE B 1 197 ? 39.324  -23.768 28.260  1.00 87.73  ? 192  ILE B N     1 
ATOM   2779 C  CA    . ILE B 1 197 ? 40.066  -24.162 29.447  1.00 94.60  ? 192  ILE B CA    1 
ATOM   2780 C  C     . ILE B 1 197 ? 39.640  -23.322 30.645  1.00 103.55 ? 192  ILE B C     1 
ATOM   2781 O  O     . ILE B 1 197 ? 39.394  -23.864 31.716  1.00 103.82 ? 192  ILE B O     1 
ATOM   2782 C  CB    . ILE B 1 197 ? 41.590  -24.042 29.222  1.00 97.73  ? 192  ILE B CB    1 
ATOM   2783 C  CG1   . ILE B 1 197 ? 42.078  -25.239 28.416  1.00 96.40  ? 192  ILE B CG1   1 
ATOM   2784 C  CG2   . ILE B 1 197 ? 42.364  -23.962 30.536  1.00 97.73  ? 192  ILE B CG2   1 
ATOM   2785 C  CD1   . ILE B 1 197 ? 43.359  -24.963 27.664  1.00 99.57  ? 192  ILE B CD1   1 
ATOM   2786 N  N     . LEU B 1 198 ? 39.560  -22.002 30.460  1.00 106.97 ? 193  LEU B N     1 
ATOM   2787 C  CA    . LEU B 1 198 ? 39.167  -21.091 31.547  1.00 92.90  ? 193  LEU B CA    1 
ATOM   2788 C  C     . LEU B 1 198 ? 37.773  -21.387 32.059  1.00 92.19  ? 193  LEU B C     1 
ATOM   2789 O  O     . LEU B 1 198 ? 37.512  -21.359 33.263  1.00 87.13  ? 193  LEU B O     1 
ATOM   2790 C  CB    . LEU B 1 198 ? 39.238  -19.652 31.072  1.00 84.16  ? 193  LEU B CB    1 
ATOM   2791 C  CG    . LEU B 1 198 ? 40.663  -19.105 31.106  1.00 90.14  ? 193  LEU B CG    1 
ATOM   2792 C  CD1   . LEU B 1 198 ? 40.808  -17.899 30.184  1.00 91.81  ? 193  LEU B CD1   1 
ATOM   2793 C  CD2   . LEU B 1 198 ? 41.093  -18.743 32.522  1.00 84.72  ? 193  LEU B CD2   1 
ATOM   2794 N  N     . VAL B 1 199 ? 36.884  -21.688 31.126  1.00 92.44  ? 194  VAL B N     1 
ATOM   2795 C  CA    . VAL B 1 199 ? 35.535  -22.102 31.455  1.00 94.65  ? 194  VAL B CA    1 
ATOM   2796 C  C     . VAL B 1 199 ? 35.479  -23.374 32.326  1.00 95.21  ? 194  VAL B C     1 
ATOM   2797 O  O     . VAL B 1 199 ? 34.614  -23.474 33.185  1.00 99.98  ? 194  VAL B O     1 
ATOM   2798 C  CB    . VAL B 1 199 ? 34.711  -22.247 30.157  1.00 95.52  ? 194  VAL B CB    1 
ATOM   2799 C  CG1   . VAL B 1 199 ? 33.464  -23.110 30.367  1.00 92.74  ? 194  VAL B CG1   1 
ATOM   2800 C  CG2   . VAL B 1 199 ? 34.371  -20.853 29.622  1.00 90.09  ? 194  VAL B CG2   1 
ATOM   2801 N  N     . ASN B 1 200 ? 36.396  -24.320 32.127  1.00 105.11 ? 195  ASN B N     1 
ATOM   2802 C  CA    . ASN B 1 200 ? 36.486  -25.508 33.004  1.00 111.77 ? 195  ASN B CA    1 
ATOM   2803 C  C     . ASN B 1 200 ? 37.065  -25.172 34.376  1.00 115.05 ? 195  ASN B C     1 
ATOM   2804 O  O     . ASN B 1 200 ? 36.677  -25.753 35.391  1.00 121.30 ? 195  ASN B O     1 
ATOM   2805 C  CB    . ASN B 1 200 ? 37.356  -26.610 32.393  1.00 120.32 ? 195  ASN B CB    1 
ATOM   2806 C  CG    . ASN B 1 200 ? 36.876  -27.069 31.022  1.00 124.14 ? 195  ASN B CG    1 
ATOM   2807 O  OD1   . ASN B 1 200 ? 35.681  -27.152 30.760  1.00 124.68 ? 195  ASN B OD1   1 
ATOM   2808 N  ND2   . ASN B 1 200 ? 37.822  -27.389 30.147  1.00 126.75 ? 195  ASN B ND2   1 
ATOM   2809 N  N     . HIS B 1 201 ? 37.966  -24.199 34.417  1.00 119.94 ? 196  HIS B N     1 
ATOM   2810 C  CA    . HIS B 1 201 ? 38.499  -23.707 35.671  1.00 126.47 ? 196  HIS B CA    1 
ATOM   2811 C  C     . HIS B 1 201 ? 37.408  -22.993 36.478  1.00 133.61 ? 196  HIS B C     1 
ATOM   2812 O  O     . HIS B 1 201 ? 37.727  -22.211 37.362  1.00 130.94 ? 196  HIS B O     1 
ATOM   2813 C  CB    . HIS B 1 201 ? 39.634  -22.717 35.373  1.00 132.76 ? 196  HIS B CB    1 
ATOM   2814 C  CG    . HIS B 1 201 ? 40.561  -22.498 36.525  1.00 144.30 ? 196  HIS B CG    1 
ATOM   2815 N  ND1   . HIS B 1 201 ? 40.235  -21.656 37.565  1.00 144.70 ? 196  HIS B ND1   1 
ATOM   2816 C  CD2   . HIS B 1 201 ? 41.789  -22.995 36.811  1.00 143.28 ? 196  HIS B CD2   1 
ATOM   2817 C  CE1   . HIS B 1 201 ? 41.218  -21.639 38.444  1.00 141.05 ? 196  HIS B CE1   1 
ATOM   2818 N  NE2   . HIS B 1 201 ? 42.175  -22.442 38.010  1.00 144.32 ? 196  HIS B NE2   1 
ATOM   2819 N  N     . GLN B 1 202 ? 36.135  -23.244 36.150  1.00 137.81 ? 197  GLN B N     1 
ATOM   2820 C  CA    . GLN B 1 202 ? 34.982  -22.806 36.936  1.00 123.95 ? 197  GLN B CA    1 
ATOM   2821 C  C     . GLN B 1 202 ? 33.862  -23.850 36.918  1.00 112.75 ? 197  GLN B C     1 
ATOM   2822 O  O     . GLN B 1 202 ? 34.027  -24.964 37.405  1.00 107.55 ? 197  GLN B O     1 
ATOM   2823 C  CB    . GLN B 1 202 ? 34.445  -21.512 36.346  1.00 120.96 ? 197  GLN B CB    1 
ATOM   2824 C  CG    . GLN B 1 202 ? 35.494  -20.424 36.205  1.00 118.79 ? 197  GLN B CG    1 
ATOM   2825 C  CD    . GLN B 1 202 ? 35.056  -19.322 35.278  1.00 124.83 ? 197  GLN B CD    1 
ATOM   2826 O  OE1   . GLN B 1 202 ? 34.013  -19.412 34.629  1.00 122.35 ? 197  GLN B OE1   1 
ATOM   2827 N  NE2   . GLN B 1 202 ? 35.860  -18.273 35.200  1.00 127.19 ? 197  GLN B NE2   1 
ATOM   2828 N  N     . ARG C 1 27  ? 25.081  -51.885 29.790  1.00 99.18  ? 22   ARG C N     1 
ATOM   2829 C  CA    . ARG C 1 27  ? 23.623  -52.245 29.751  1.00 106.08 ? 22   ARG C CA    1 
ATOM   2830 C  C     . ARG C 1 27  ? 23.264  -53.017 28.483  1.00 104.71 ? 22   ARG C C     1 
ATOM   2831 O  O     . ARG C 1 27  ? 23.651  -52.604 27.397  1.00 103.45 ? 22   ARG C O     1 
ATOM   2832 C  CB    . ARG C 1 27  ? 22.726  -50.998 29.839  1.00 104.36 ? 22   ARG C CB    1 
ATOM   2833 C  CG    . ARG C 1 27  ? 21.259  -51.284 29.468  1.00 110.96 ? 22   ARG C CG    1 
ATOM   2834 C  CD    . ARG C 1 27  ? 20.144  -50.593 30.285  1.00 122.74 ? 22   ARG C CD    1 
ATOM   2835 N  NE    . ARG C 1 27  ? 20.606  -49.722 31.376  1.00 140.11 ? 22   ARG C NE    1 
ATOM   2836 C  CZ    . ARG C 1 27  ? 20.811  -48.408 31.277  1.00 140.89 ? 22   ARG C CZ    1 
ATOM   2837 N  NH1   . ARG C 1 27  ? 20.597  -47.769 30.133  1.00 144.87 ? 22   ARG C NH1   1 
ATOM   2838 N  NH2   . ARG C 1 27  ? 21.234  -47.722 32.337  1.00 134.27 ? 22   ARG C NH2   1 
ATOM   2839 N  N     . GLU C 1 28  ? 22.501  -54.110 28.631  1.00 102.77 ? 23   GLU C N     1 
ATOM   2840 C  CA    . GLU C 1 28  ? 21.983  -54.882 27.483  1.00 97.95  ? 23   GLU C CA    1 
ATOM   2841 C  C     . GLU C 1 28  ? 20.452  -54.981 27.428  1.00 84.87  ? 23   GLU C C     1 
ATOM   2842 O  O     . GLU C 1 28  ? 19.773  -54.939 28.456  1.00 69.31  ? 23   GLU C O     1 
ATOM   2843 C  CB    . GLU C 1 28  ? 22.580  -56.292 27.458  1.00 102.77 ? 23   GLU C CB    1 
ATOM   2844 C  CG    . GLU C 1 28  ? 22.254  -57.171 28.658  1.00 107.19 ? 23   GLU C CG    1 
ATOM   2845 C  CD    . GLU C 1 28  ? 22.459  -58.640 28.357  1.00 113.05 ? 23   GLU C CD    1 
ATOM   2846 O  OE1   . GLU C 1 28  ? 23.315  -58.959 27.498  1.00 118.60 ? 23   GLU C OE1   1 
ATOM   2847 O  OE2   . GLU C 1 28  ? 21.761  -59.477 28.971  1.00 112.26 ? 23   GLU C OE2   1 
ATOM   2848 N  N     . HIS C 1 29  ? 19.921  -55.096 26.211  1.00 89.70  ? 24   HIS C N     1 
ATOM   2849 C  CA    . HIS C 1 29  ? 18.468  -55.225 26.005  1.00 96.51  ? 24   HIS C CA    1 
ATOM   2850 C  C     . HIS C 1 29  ? 18.038  -56.489 25.286  1.00 91.95  ? 24   HIS C C     1 
ATOM   2851 O  O     . HIS C 1 29  ? 18.755  -57.020 24.439  1.00 84.77  ? 24   HIS C O     1 
ATOM   2852 C  CB    . HIS C 1 29  ? 17.933  -54.057 25.203  1.00 94.33  ? 24   HIS C CB    1 
ATOM   2853 C  CG    . HIS C 1 29  ? 18.218  -52.730 25.818  1.00 93.40  ? 24   HIS C CG    1 
ATOM   2854 N  ND1   . HIS C 1 29  ? 19.335  -51.987 25.492  1.00 86.95  ? 24   HIS C ND1   1 
ATOM   2855 C  CD2   . HIS C 1 29  ? 17.526  -52.005 26.728  1.00 88.72  ? 24   HIS C CD2   1 
ATOM   2856 C  CE1   . HIS C 1 29  ? 19.311  -50.854 26.169  1.00 86.43  ? 24   HIS C CE1   1 
ATOM   2857 N  NE2   . HIS C 1 29  ? 18.222  -50.838 26.921  1.00 87.20  ? 24   HIS C NE2   1 
ATOM   2858 N  N     . LEU C 1 30  ? 16.826  -56.918 25.612  1.00 84.12  ? 25   LEU C N     1 
ATOM   2859 C  CA    . LEU C 1 30  ? 16.136  -57.901 24.832  1.00 82.35  ? 25   LEU C CA    1 
ATOM   2860 C  C     . LEU C 1 30  ? 14.832  -57.309 24.288  1.00 78.71  ? 25   LEU C C     1 
ATOM   2861 O  O     . LEU C 1 30  ? 13.959  -56.896 25.061  1.00 67.05  ? 25   LEU C O     1 
ATOM   2862 C  CB    . LEU C 1 30  ? 15.883  -59.134 25.689  1.00 84.51  ? 25   LEU C CB    1 
ATOM   2863 C  CG    . LEU C 1 30  ? 15.481  -60.372 24.876  1.00 93.37  ? 25   LEU C CG    1 
ATOM   2864 C  CD1   . LEU C 1 30  ? 16.590  -61.409 24.783  1.00 97.14  ? 25   LEU C CD1   1 
ATOM   2865 C  CD2   . LEU C 1 30  ? 14.219  -60.982 25.448  1.00 89.78  ? 25   LEU C CD2   1 
ATOM   2866 N  N     . PHE C 1 31  ? 14.707  -57.279 22.958  1.00 75.31  ? 26   PHE C N     1 
ATOM   2867 C  CA    . PHE C 1 31  ? 13.486  -56.808 22.305  1.00 75.01  ? 26   PHE C CA    1 
ATOM   2868 C  C     . PHE C 1 31  ? 12.774  -57.872 21.482  1.00 73.90  ? 26   PHE C C     1 
ATOM   2869 O  O     . PHE C 1 31  ? 13.371  -58.525 20.605  1.00 67.60  ? 26   PHE C O     1 
ATOM   2870 C  CB    . PHE C 1 31  ? 13.806  -55.656 21.374  1.00 77.33  ? 26   PHE C CB    1 
ATOM   2871 C  CG    . PHE C 1 31  ? 14.416  -54.470 22.051  1.00 76.66  ? 26   PHE C CG    1 
ATOM   2872 C  CD1   . PHE C 1 31  ? 13.888  -53.976 23.248  1.00 77.14  ? 26   PHE C CD1   1 
ATOM   2873 C  CD2   . PHE C 1 31  ? 15.495  -53.819 21.475  1.00 73.13  ? 26   PHE C CD2   1 
ATOM   2874 C  CE1   . PHE C 1 31  ? 14.433  -52.864 23.858  1.00 72.18  ? 26   PHE C CE1   1 
ATOM   2875 C  CE2   . PHE C 1 31  ? 16.047  -52.712 22.081  1.00 72.98  ? 26   PHE C CE2   1 
ATOM   2876 C  CZ    . PHE C 1 31  ? 15.516  -52.234 23.269  1.00 73.62  ? 26   PHE C CZ    1 
ATOM   2877 N  N     . LYS C 1 32  ? 11.478  -58.022 21.756  1.00 75.35  ? 27   LYS C N     1 
ATOM   2878 C  CA    . LYS C 1 32  ? 10.594  -58.866 20.938  1.00 73.24  ? 27   LYS C CA    1 
ATOM   2879 C  C     . LYS C 1 32  ? 10.082  -58.086 19.766  1.00 68.13  ? 27   LYS C C     1 
ATOM   2880 O  O     . LYS C 1 32  ? 9.323   -57.119 19.929  1.00 64.65  ? 27   LYS C O     1 
ATOM   2881 C  CB    . LYS C 1 32  ? 9.393   -59.364 21.741  1.00 75.17  ? 27   LYS C CB    1 
ATOM   2882 C  CG    . LYS C 1 32  ? 8.545   -60.406 21.015  1.00 74.21  ? 27   LYS C CG    1 
ATOM   2883 C  CD    . LYS C 1 32  ? 7.149   -60.504 21.609  1.00 77.73  ? 27   LYS C CD    1 
ATOM   2884 C  CE    . LYS C 1 32  ? 6.566   -61.892 21.399  1.00 77.03  ? 27   LYS C CE    1 
ATOM   2885 N  NZ    . LYS C 1 32  ? 5.288   -62.092 22.130  1.00 74.65  ? 27   LYS C NZ    1 
ATOM   2886 N  N     . VAL C 1 33  ? 10.494  -58.518 18.586  1.00 68.69  ? 28   VAL C N     1 
ATOM   2887 C  CA    . VAL C 1 33  ? 10.073  -57.866 17.360  1.00 71.10  ? 28   VAL C CA    1 
ATOM   2888 C  C     . VAL C 1 33  ? 9.366   -58.837 16.434  1.00 66.71  ? 28   VAL C C     1 
ATOM   2889 O  O     . VAL C 1 33  ? 9.903   -59.907 16.103  1.00 58.94  ? 28   VAL C O     1 
ATOM   2890 C  CB    . VAL C 1 33  ? 11.268  -57.263 16.609  1.00 74.81  ? 28   VAL C CB    1 
ATOM   2891 C  CG1   . VAL C 1 33  ? 10.785  -56.523 15.385  1.00 76.69  ? 28   VAL C CG1   1 
ATOM   2892 C  CG2   . VAL C 1 33  ? 12.019  -56.304 17.508  1.00 84.12  ? 28   VAL C CG2   1 
ATOM   2893 N  N     . LEU C 1 34  ? 8.187   -58.427 15.981  1.00 61.44  ? 29   LEU C N     1 
ATOM   2894 C  CA    . LEU C 1 34  ? 7.381   -59.240 15.097  1.00 61.13  ? 29   LEU C CA    1 
ATOM   2895 C  C     . LEU C 1 34  ? 7.738   -59.001 13.641  1.00 66.08  ? 29   LEU C C     1 
ATOM   2896 O  O     . LEU C 1 34  ? 8.069   -57.883 13.258  1.00 68.11  ? 29   LEU C O     1 
ATOM   2897 C  CB    . LEU C 1 34  ? 5.932   -58.879 15.287  1.00 60.43  ? 29   LEU C CB    1 
ATOM   2898 C  CG    . LEU C 1 34  ? 5.395   -59.070 16.693  1.00 61.96  ? 29   LEU C CG    1 
ATOM   2899 C  CD1   . LEU C 1 34  ? 4.015   -58.445 16.778  1.00 60.42  ? 29   LEU C CD1   1 
ATOM   2900 C  CD2   . LEU C 1 34  ? 5.346   -60.551 17.040  1.00 61.97  ? 29   LEU C CD2   1 
ATOM   2901 N  N     . VAL C 1 35  ? 7.620   -60.042 12.817  1.00 64.95  ? 30   VAL C N     1 
ATOM   2902 C  CA    . VAL C 1 35  ? 7.655   -59.875 11.370  1.00 59.60  ? 30   VAL C CA    1 
ATOM   2903 C  C     . VAL C 1 35  ? 6.418   -60.490 10.762  1.00 57.18  ? 30   VAL C C     1 
ATOM   2904 O  O     . VAL C 1 35  ? 6.218   -61.686 10.848  1.00 63.36  ? 30   VAL C O     1 
ATOM   2905 C  CB    . VAL C 1 35  ? 8.887   -60.556 10.788  1.00 59.99  ? 30   VAL C CB    1 
ATOM   2906 C  CG1   . VAL C 1 35  ? 8.996   -60.312 9.293   1.00 60.27  ? 30   VAL C CG1   1 
ATOM   2907 C  CG2   . VAL C 1 35  ? 10.124  -60.050 11.493  1.00 63.57  ? 30   VAL C CG2   1 
ATOM   2908 N  N     . ILE C 1 36  ? 5.578   -59.672 10.161  1.00 58.47  ? 31   ILE C N     1 
ATOM   2909 C  CA    . ILE C 1 36  ? 4.262   -60.120 9.758   1.00 61.72  ? 31   ILE C CA    1 
ATOM   2910 C  C     . ILE C 1 36  ? 3.922   -59.668 8.349   1.00 67.49  ? 31   ILE C C     1 
ATOM   2911 O  O     . ILE C 1 36  ? 4.575   -58.774 7.804   1.00 68.51  ? 31   ILE C O     1 
ATOM   2912 C  CB    . ILE C 1 36  ? 3.186   -59.628 10.739  1.00 61.93  ? 31   ILE C CB    1 
ATOM   2913 C  CG1   . ILE C 1 36  ? 3.074   -58.105 10.751  1.00 60.84  ? 31   ILE C CG1   1 
ATOM   2914 C  CG2   . ILE C 1 36  ? 3.528   -60.101 12.128  1.00 63.80  ? 31   ILE C CG2   1 
ATOM   2915 C  CD1   . ILE C 1 36  ? 1.973   -57.597 11.664  1.00 61.94  ? 31   ILE C CD1   1 
ATOM   2916 N  N     . GLY C 1 37  ? 2.898   -60.299 7.774   1.00 68.13  ? 32   GLY C N     1 
ATOM   2917 C  CA    . GLY C 1 37  ? 2.509   -60.055 6.395   1.00 65.82  ? 32   GLY C CA    1 
ATOM   2918 C  C     . GLY C 1 37  ? 2.148   -61.325 5.658   1.00 63.39  ? 32   GLY C C     1 
ATOM   2919 O  O     . GLY C 1 37  ? 2.407   -62.424 6.137   1.00 62.01  ? 32   GLY C O     1 
ATOM   2920 N  N     . GLU C 1 38  ? 1.564   -61.159 4.476   1.00 66.50  ? 33   GLU C N     1 
ATOM   2921 C  CA    . GLU C 1 38  ? 0.949   -62.256 3.748   1.00 69.22  ? 33   GLU C CA    1 
ATOM   2922 C  C     . GLU C 1 38  ? 1.945   -63.345 3.408   1.00 73.20  ? 33   GLU C C     1 
ATOM   2923 O  O     . GLU C 1 38  ? 3.149   -63.163 3.531   1.00 69.90  ? 33   GLU C O     1 
ATOM   2924 C  CB    . GLU C 1 38  ? 0.300   -61.738 2.458   1.00 73.08  ? 33   GLU C CB    1 
ATOM   2925 C  CG    . GLU C 1 38  ? -1.082  -61.133 2.649   1.00 78.06  ? 33   GLU C CG    1 
ATOM   2926 C  CD    . GLU C 1 38  ? -2.084  -62.083 3.293   1.00 78.84  ? 33   GLU C CD    1 
ATOM   2927 O  OE1   . GLU C 1 38  ? -1.869  -63.333 3.350   1.00 79.51  ? 33   GLU C OE1   1 
ATOM   2928 O  OE2   . GLU C 1 38  ? -3.099  -61.546 3.763   1.00 71.81  ? 33   GLU C OE2   1 
ATOM   2929 N  N     . LEU C 1 39  ? 1.434   -64.482 2.965   1.00 77.22  ? 34   LEU C N     1 
ATOM   2930 C  CA    . LEU C 1 39  ? 2.301   -65.555 2.498   1.00 75.79  ? 34   LEU C CA    1 
ATOM   2931 C  C     . LEU C 1 39  ? 3.230   -65.128 1.378   1.00 71.43  ? 34   LEU C C     1 
ATOM   2932 O  O     . LEU C 1 39  ? 3.024   -64.115 0.727   1.00 65.26  ? 34   LEU C O     1 
ATOM   2933 C  CB    . LEU C 1 39  ? 1.462   -66.728 2.017   1.00 79.87  ? 34   LEU C CB    1 
ATOM   2934 C  CG    . LEU C 1 39  ? 0.591   -66.444 0.793   1.00 80.21  ? 34   LEU C CG    1 
ATOM   2935 C  CD1   . LEU C 1 39  ? 0.822   -67.516 -0.252  1.00 86.63  ? 34   LEU C CD1   1 
ATOM   2936 C  CD2   . LEU C 1 39  ? -0.880  -66.387 1.165   1.00 86.98  ? 34   LEU C CD2   1 
ATOM   2937 N  N     . GLY C 1 40  ? 4.225   -65.968 1.136   1.00 76.48  ? 35   GLY C N     1 
ATOM   2938 C  CA    . GLY C 1 40  ? 5.305   -65.724 0.160   1.00 76.71  ? 35   GLY C CA    1 
ATOM   2939 C  C     . GLY C 1 40  ? 5.921   -64.349 -0.011  1.00 69.88  ? 35   GLY C C     1 
ATOM   2940 O  O     . GLY C 1 40  ? 6.509   -64.043 -1.046  1.00 71.79  ? 35   GLY C O     1 
ATOM   2941 N  N     . VAL C 1 41  ? 5.827   -63.528 1.013   1.00 67.28  ? 36   VAL C N     1 
ATOM   2942 C  CA    . VAL C 1 41  ? 6.171   -62.120 0.894   1.00 59.90  ? 36   VAL C CA    1 
ATOM   2943 C  C     . VAL C 1 41  ? 7.664   -61.908 1.140   1.00 63.24  ? 36   VAL C C     1 
ATOM   2944 O  O     . VAL C 1 41  ? 8.227   -60.912 0.687   1.00 65.11  ? 36   VAL C O     1 
ATOM   2945 C  CB    . VAL C 1 41  ? 5.298   -61.319 1.868   1.00 56.70  ? 36   VAL C CB    1 
ATOM   2946 C  CG1   . VAL C 1 41  ? 6.105   -60.355 2.707   1.00 55.58  ? 36   VAL C CG1   1 
ATOM   2947 C  CG2   . VAL C 1 41  ? 4.181   -60.619 1.103   1.00 56.03  ? 36   VAL C CG2   1 
ATOM   2948 N  N     . GLY C 1 42  ? 8.295   -62.861 1.840   1.00 67.67  ? 37   GLY C N     1 
ATOM   2949 C  CA    . GLY C 1 42  ? 9.740   -62.838 2.124   1.00 69.03  ? 37   GLY C CA    1 
ATOM   2950 C  C     . GLY C 1 42  ? 10.138  -62.757 3.597   1.00 69.13  ? 37   GLY C C     1 
ATOM   2951 O  O     . GLY C 1 42  ? 11.318  -62.565 3.921   1.00 60.25  ? 37   GLY C O     1 
ATOM   2952 N  N     . LYS C 1 43  ? 9.153   -62.856 4.494   1.00 66.24  ? 38   LYS C N     1 
ATOM   2953 C  CA    . LYS C 1 43  ? 9.372   -62.577 5.915   1.00 60.44  ? 38   LYS C CA    1 
ATOM   2954 C  C     . LYS C 1 43  ? 10.506  -63.467 6.437   1.00 57.67  ? 38   LYS C C     1 
ATOM   2955 O  O     . LYS C 1 43  ? 11.509  -62.981 6.939   1.00 56.18  ? 38   LYS C O     1 
ATOM   2956 C  CB    . LYS C 1 43  ? 8.102   -62.833 6.707   1.00 60.18  ? 38   LYS C CB    1 
ATOM   2957 C  CG    . LYS C 1 43  ? 6.941   -61.955 6.287   1.00 62.62  ? 38   LYS C CG    1 
ATOM   2958 C  CD    . LYS C 1 43  ? 5.655   -62.178 7.090   1.00 61.36  ? 38   LYS C CD    1 
ATOM   2959 C  CE    . LYS C 1 43  ? 5.122   -63.602 7.010   1.00 61.13  ? 38   LYS C CE    1 
ATOM   2960 N  NZ    . LYS C 1 43  ? 4.785   -64.071 5.639   1.00 65.60  ? 38   LYS C NZ    1 
ATOM   2961 N  N     . THR C 1 44  ? 10.379  -64.765 6.222   1.00 53.73  ? 39   THR C N     1 
ATOM   2962 C  CA    . THR C 1 44  ? 11.419  -65.678 6.616   1.00 51.83  ? 39   THR C CA    1 
ATOM   2963 C  C     . THR C 1 44  ? 12.763  -65.334 5.958   1.00 54.60  ? 39   THR C C     1 
ATOM   2964 O  O     . THR C 1 44  ? 13.793  -65.355 6.626   1.00 55.08  ? 39   THR C O     1 
ATOM   2965 C  CB    . THR C 1 44  ? 11.022  -67.128 6.300   1.00 52.44  ? 39   THR C CB    1 
ATOM   2966 O  OG1   . THR C 1 44  ? 9.863   -67.472 7.072   1.00 49.88  ? 39   THR C OG1   1 
ATOM   2967 C  CG2   . THR C 1 44  ? 12.143  -68.083 6.640   1.00 53.68  ? 39   THR C CG2   1 
ATOM   2968 N  N     . SER C 1 45  ? 12.751  -65.026 4.660   1.00 56.77  ? 40   SER C N     1 
ATOM   2969 C  CA    . SER C 1 45  ? 13.983  -64.785 3.895   1.00 60.46  ? 40   SER C CA    1 
ATOM   2970 C  C     . SER C 1 45  ? 14.750  -63.555 4.350   1.00 61.94  ? 40   SER C C     1 
ATOM   2971 O  O     . SER C 1 45  ? 15.981  -63.555 4.436   1.00 68.50  ? 40   SER C O     1 
ATOM   2972 C  CB    . SER C 1 45  ? 13.648  -64.585 2.425   1.00 63.57  ? 40   SER C CB    1 
ATOM   2973 O  OG    . SER C 1 45  ? 13.126  -65.758 1.864   1.00 65.66  ? 40   SER C OG    1 
ATOM   2974 N  N     . ILE C 1 46  ? 14.012  -62.497 4.624   1.00 57.85  ? 41   ILE C N     1 
ATOM   2975 C  CA    . ILE C 1 46  ? 14.605  -61.333 5.222   1.00 57.27  ? 41   ILE C CA    1 
ATOM   2976 C  C     . ILE C 1 46  ? 15.378  -61.738 6.473   1.00 63.86  ? 41   ILE C C     1 
ATOM   2977 O  O     . ILE C 1 46  ? 16.590  -61.507 6.575   1.00 71.97  ? 41   ILE C O     1 
ATOM   2978 C  CB    . ILE C 1 46  ? 13.531  -60.303 5.598   1.00 54.33  ? 41   ILE C CB    1 
ATOM   2979 C  CG1   . ILE C 1 46  ? 13.020  -59.585 4.346   1.00 54.28  ? 41   ILE C CG1   1 
ATOM   2980 C  CG2   . ILE C 1 46  ? 14.089  -59.281 6.574   1.00 51.73  ? 41   ILE C CG2   1 
ATOM   2981 C  CD1   . ILE C 1 46  ? 11.669  -58.911 4.531   1.00 53.91  ? 41   ILE C CD1   1 
ATOM   2982 N  N     . ILE C 1 47  ? 14.660  -62.324 7.428   1.00 62.61  ? 42   ILE C N     1 
ATOM   2983 C  CA    . ILE C 1 47  ? 15.242  -62.690 8.705   1.00 59.59  ? 42   ILE C CA    1 
ATOM   2984 C  C     . ILE C 1 47  ? 16.486  -63.541 8.449   1.00 60.10  ? 42   ILE C C     1 
ATOM   2985 O  O     . ILE C 1 47  ? 17.507  -63.363 9.098   1.00 56.11  ? 42   ILE C O     1 
ATOM   2986 C  CB    . ILE C 1 47  ? 14.232  -63.459 9.589   1.00 58.90  ? 42   ILE C CB    1 
ATOM   2987 C  CG1   . ILE C 1 47  ? 13.118  -62.517 10.053  1.00 58.92  ? 42   ILE C CG1   1 
ATOM   2988 C  CG2   . ILE C 1 47  ? 14.907  -64.044 10.822  1.00 59.46  ? 42   ILE C CG2   1 
ATOM   2989 C  CD1   . ILE C 1 47  ? 11.906  -63.213 10.641  1.00 55.24  ? 42   ILE C CD1   1 
ATOM   2990 N  N     . LYS C 1 48  ? 16.393  -64.473 7.516   1.00 60.49  ? 43   LYS C N     1 
ATOM   2991 C  CA    . LYS C 1 48  ? 17.458  -65.422 7.325   1.00 68.74  ? 43   LYS C CA    1 
ATOM   2992 C  C     . LYS C 1 48  ? 18.688  -64.729 6.791   1.00 75.60  ? 43   LYS C C     1 
ATOM   2993 O  O     . LYS C 1 48  ? 19.805  -65.008 7.224   1.00 81.61  ? 43   LYS C O     1 
ATOM   2994 C  CB    . LYS C 1 48  ? 17.047  -66.510 6.355   1.00 73.20  ? 43   LYS C CB    1 
ATOM   2995 C  CG    . LYS C 1 48  ? 18.025  -67.666 6.338   1.00 73.61  ? 43   LYS C CG    1 
ATOM   2996 C  CD    . LYS C 1 48  ? 18.001  -68.332 4.992   1.00 77.49  ? 43   LYS C CD    1 
ATOM   2997 C  CE    . LYS C 1 48  ? 18.344  -69.799 5.117   1.00 84.82  ? 43   LYS C CE    1 
ATOM   2998 N  NZ    . LYS C 1 48  ? 17.970  -70.477 3.848   1.00 94.22  ? 43   LYS C NZ    1 
ATOM   2999 N  N     . ARG C 1 49  ? 18.489  -63.812 5.856   1.00 82.23  ? 44   ARG C N     1 
ATOM   3000 C  CA    . ARG C 1 49  ? 19.597  -62.972 5.409   1.00 81.57  ? 44   ARG C CA    1 
ATOM   3001 C  C     . ARG C 1 49  ? 20.171  -62.088 6.527   1.00 77.77  ? 44   ARG C C     1 
ATOM   3002 O  O     . ARG C 1 49  ? 21.381  -62.084 6.776   1.00 75.65  ? 44   ARG C O     1 
ATOM   3003 C  CB    . ARG C 1 49  ? 19.169  -62.083 4.266   1.00 79.39  ? 44   ARG C CB    1 
ATOM   3004 C  CG    . ARG C 1 49  ? 20.160  -60.969 4.063   1.00 77.34  ? 44   ARG C CG    1 
ATOM   3005 C  CD    . ARG C 1 49  ? 20.136  -60.428 2.663   1.00 81.25  ? 44   ARG C CD    1 
ATOM   3006 N  NE    . ARG C 1 49  ? 20.530  -61.347 1.583   1.00 84.48  ? 44   ARG C NE    1 
ATOM   3007 C  CZ    . ARG C 1 49  ? 21.673  -62.018 1.476   1.00 83.15  ? 44   ARG C CZ    1 
ATOM   3008 N  NH1   . ARG C 1 49  ? 22.617  -61.969 2.410   1.00 82.77  ? 44   ARG C NH1   1 
ATOM   3009 N  NH2   . ARG C 1 49  ? 21.853  -62.771 0.402   1.00 87.38  ? 44   ARG C NH2   1 
ATOM   3010 N  N     . TYR C 1 50  ? 19.302  -61.344 7.202   1.00 67.66  ? 45   TYR C N     1 
ATOM   3011 C  CA    . TYR C 1 50  ? 19.756  -60.434 8.250   1.00 65.26  ? 45   TYR C CA    1 
ATOM   3012 C  C     . TYR C 1 50  ? 20.548  -61.105 9.357   1.00 64.94  ? 45   TYR C C     1 
ATOM   3013 O  O     . TYR C 1 50  ? 21.283  -60.450 10.070  1.00 66.59  ? 45   TYR C O     1 
ATOM   3014 C  CB    . TYR C 1 50  ? 18.573  -59.719 8.885   1.00 65.93  ? 45   TYR C CB    1 
ATOM   3015 C  CG    . TYR C 1 50  ? 18.950  -58.681 9.945   1.00 67.53  ? 45   TYR C CG    1 
ATOM   3016 C  CD1   . TYR C 1 50  ? 20.024  -57.824 9.777   1.00 67.56  ? 45   TYR C CD1   1 
ATOM   3017 C  CD2   . TYR C 1 50  ? 18.226  -58.574 11.120  1.00 72.00  ? 45   TYR C CD2   1 
ATOM   3018 C  CE1   . TYR C 1 50  ? 20.360  -56.894 10.743  1.00 71.68  ? 45   TYR C CE1   1 
ATOM   3019 C  CE2   . TYR C 1 50  ? 18.546  -57.637 12.084  1.00 73.75  ? 45   TYR C CE2   1 
ATOM   3020 C  CZ    . TYR C 1 50  ? 19.614  -56.804 11.891  1.00 73.96  ? 45   TYR C CZ    1 
ATOM   3021 O  OH    . TYR C 1 50  ? 19.924  -55.882 12.847  1.00 75.61  ? 45   TYR C OH    1 
ATOM   3022 N  N     . VAL C 1 51  ? 20.358  -62.401 9.536   1.00 65.69  ? 46   VAL C N     1 
ATOM   3023 C  CA    . VAL C 1 51  ? 20.902  -63.092 10.680  1.00 66.54  ? 46   VAL C CA    1 
ATOM   3024 C  C     . VAL C 1 51  ? 22.021  -64.026 10.263  1.00 64.09  ? 46   VAL C C     1 
ATOM   3025 O  O     . VAL C 1 51  ? 22.948  -64.210 11.028  1.00 73.47  ? 46   VAL C O     1 
ATOM   3026 C  CB    . VAL C 1 51  ? 19.778  -63.858 11.430  1.00 67.22  ? 46   VAL C CB    1 
ATOM   3027 C  CG1   . VAL C 1 51  ? 20.336  -64.844 12.452  1.00 65.90  ? 46   VAL C CG1   1 
ATOM   3028 C  CG2   . VAL C 1 51  ? 18.820  -62.878 12.102  1.00 61.20  ? 46   VAL C CG2   1 
ATOM   3029 N  N     . HIS C 1 52  ? 21.921  -64.656 9.099   1.00 66.35  ? 47   HIS C N     1 
ATOM   3030 C  CA    . HIS C 1 52  ? 22.943  -65.631 8.681   1.00 72.58  ? 47   HIS C CA    1 
ATOM   3031 C  C     . HIS C 1 52  ? 23.517  -65.307 7.323   1.00 76.95  ? 47   HIS C C     1 
ATOM   3032 O  O     . HIS C 1 52  ? 24.228  -66.111 6.750   1.00 76.17  ? 47   HIS C O     1 
ATOM   3033 C  CB    . HIS C 1 52  ? 22.383  -67.050 8.643   1.00 70.69  ? 47   HIS C CB    1 
ATOM   3034 C  CG    . HIS C 1 52  ? 21.780  -67.507 9.934   1.00 75.52  ? 47   HIS C CG    1 
ATOM   3035 N  ND1   . HIS C 1 52  ? 20.435  -67.375 10.218  1.00 80.34  ? 47   HIS C ND1   1 
ATOM   3036 C  CD2   . HIS C 1 52  ? 22.327  -68.136 10.999  1.00 81.38  ? 47   HIS C CD2   1 
ATOM   3037 C  CE1   . HIS C 1 52  ? 20.178  -67.898 11.403  1.00 82.21  ? 47   HIS C CE1   1 
ATOM   3038 N  NE2   . HIS C 1 52  ? 21.311  -68.360 11.901  1.00 87.94  ? 47   HIS C NE2   1 
ATOM   3039 N  N     . GLN C 1 53  ? 23.204  -64.133 6.798   1.00 85.89  ? 48   GLN C N     1 
ATOM   3040 C  CA    . GLN C 1 53  ? 23.600  -63.767 5.438   1.00 90.36  ? 48   GLN C CA    1 
ATOM   3041 C  C     . GLN C 1 53  ? 23.425  -64.903 4.436   1.00 80.38  ? 48   GLN C C     1 
ATOM   3042 O  O     . GLN C 1 53  ? 24.327  -65.207 3.665   1.00 74.00  ? 48   GLN C O     1 
ATOM   3043 C  CB    . GLN C 1 53  ? 25.036  -63.226 5.447   1.00 95.08  ? 48   GLN C CB    1 
ATOM   3044 C  CG    . GLN C 1 53  ? 25.190  -62.030 6.400   1.00 107.85 ? 48   GLN C CG    1 
ATOM   3045 C  CD    . GLN C 1 53  ? 24.292  -60.850 5.979   1.00 116.26 ? 48   GLN C CD    1 
ATOM   3046 O  OE1   . GLN C 1 53  ? 24.042  -60.639 4.781   1.00 92.21  ? 48   GLN C OE1   1 
ATOM   3047 N  NE2   . GLN C 1 53  ? 23.779  -60.097 6.967   1.00 118.61 ? 48   GLN C NE2   1 
ATOM   3048 N  N     . LEU C 1 54  ? 22.249  -65.518 4.449   1.00 75.94  ? 49   LEU C N     1 
ATOM   3049 C  CA    . LEU C 1 54  ? 21.877  -66.457 3.412   1.00 76.87  ? 49   LEU C CA    1 
ATOM   3050 C  C     . LEU C 1 54  ? 20.552  -66.124 2.752   1.00 79.33  ? 49   LEU C C     1 
ATOM   3051 O  O     . LEU C 1 54  ? 19.706  -65.404 3.306   1.00 77.30  ? 49   LEU C O     1 
ATOM   3052 C  CB    . LEU C 1 54  ? 21.826  -67.853 3.990   1.00 79.83  ? 49   LEU C CB    1 
ATOM   3053 C  CG    . LEU C 1 54  ? 23.253  -68.339 4.326   1.00 80.23  ? 49   LEU C CG    1 
ATOM   3054 C  CD1   . LEU C 1 54  ? 23.315  -69.363 5.453   1.00 76.14  ? 49   LEU C CD1   1 
ATOM   3055 C  CD2   . LEU C 1 54  ? 23.888  -68.894 3.061   1.00 79.98  ? 49   LEU C CD2   1 
ATOM   3056 N  N     . PHE C 1 55  ? 20.395  -66.665 1.546   1.00 71.50  ? 50   PHE C N     1 
ATOM   3057 C  CA    . PHE C 1 55  ? 19.141  -66.572 0.815   1.00 67.49  ? 50   PHE C CA    1 
ATOM   3058 C  C     . PHE C 1 55  ? 18.907  -67.833 0.006   1.00 71.18  ? 50   PHE C C     1 
ATOM   3059 O  O     . PHE C 1 55  ? 19.839  -68.382 -0.573  1.00 69.77  ? 50   PHE C O     1 
ATOM   3060 C  CB    . PHE C 1 55  ? 19.159  -65.375 -0.098  1.00 61.50  ? 50   PHE C CB    1 
ATOM   3061 C  CG    . PHE C 1 55  ? 17.965  -65.286 -0.976  1.00 64.97  ? 50   PHE C CG    1 
ATOM   3062 C  CD1   . PHE C 1 55  ? 17.961  -65.885 -2.215  1.00 66.18  ? 50   PHE C CD1   1 
ATOM   3063 C  CD2   . PHE C 1 55  ? 16.839  -64.607 -0.563  1.00 73.71  ? 50   PHE C CD2   1 
ATOM   3064 C  CE1   . PHE C 1 55  ? 16.852  -65.800 -3.040  1.00 70.26  ? 50   PHE C CE1   1 
ATOM   3065 C  CE2   . PHE C 1 55  ? 15.721  -64.506 -1.381  1.00 73.91  ? 50   PHE C CE2   1 
ATOM   3066 C  CZ    . PHE C 1 55  ? 15.727  -65.110 -2.624  1.00 72.60  ? 50   PHE C CZ    1 
ATOM   3067 N  N     . SER C 1 56  ? 17.664  -68.300 -0.036  1.00 70.81  ? 51   SER C N     1 
ATOM   3068 C  CA    . SER C 1 56  ? 17.319  -69.395 -0.939  1.00 68.30  ? 51   SER C CA    1 
ATOM   3069 C  C     . SER C 1 56  ? 16.116  -69.040 -1.816  1.00 67.70  ? 51   SER C C     1 
ATOM   3070 O  O     . SER C 1 56  ? 15.181  -68.382 -1.364  1.00 64.86  ? 51   SER C O     1 
ATOM   3071 C  CB    . SER C 1 56  ? 17.046  -70.657 -0.151  1.00 60.42  ? 51   SER C CB    1 
ATOM   3072 O  OG    . SER C 1 56  ? 16.671  -71.696 -1.030  1.00 60.01  ? 51   SER C OG    1 
ATOM   3073 N  N     . GLN C 1 57  ? 16.177  -69.428 -3.085  1.00 70.91  ? 52   GLN C N     1 
ATOM   3074 C  CA    . GLN C 1 57  ? 15.065  -69.197 -4.003  1.00 80.83  ? 52   GLN C CA    1 
ATOM   3075 C  C     . GLN C 1 57  ? 13.918  -70.155 -3.687  1.00 83.65  ? 52   GLN C C     1 
ATOM   3076 O  O     . GLN C 1 57  ? 12.782  -69.886 -4.025  1.00 88.71  ? 52   GLN C O     1 
ATOM   3077 C  CB    . GLN C 1 57  ? 15.521  -69.318 -5.467  1.00 89.01  ? 52   GLN C CB    1 
ATOM   3078 C  CG    . GLN C 1 57  ? 14.588  -68.652 -6.474  1.00 103.21 ? 52   GLN C CG    1 
ATOM   3079 C  CD    . GLN C 1 57  ? 14.409  -67.139 -6.270  1.00 112.46 ? 52   GLN C CD    1 
ATOM   3080 O  OE1   . GLN C 1 57  ? 15.293  -66.346 -6.610  1.00 117.27 ? 52   GLN C OE1   1 
ATOM   3081 N  NE2   . GLN C 1 57  ? 13.246  -66.733 -5.747  1.00 107.61 ? 52   GLN C NE2   1 
ATOM   3082 N  N     . HIS C 1 58  ? 14.228  -71.251 -3.001  1.00 84.01  ? 53   HIS C N     1 
ATOM   3083 C  CA    . HIS C 1 58  ? 13.281  -72.315 -2.715  1.00 82.64  ? 53   HIS C CA    1 
ATOM   3084 C  C     . HIS C 1 58  ? 12.336  -71.853 -1.608  1.00 82.44  ? 53   HIS C C     1 
ATOM   3085 O  O     . HIS C 1 58  ? 12.784  -71.309 -0.587  1.00 90.78  ? 53   HIS C O     1 
ATOM   3086 C  CB    . HIS C 1 58  ? 14.090  -73.533 -2.293  1.00 94.86  ? 53   HIS C CB    1 
ATOM   3087 C  CG    . HIS C 1 58  ? 13.295  -74.783 -2.133  1.00 113.82 ? 53   HIS C CG    1 
ATOM   3088 N  ND1   . HIS C 1 58  ? 12.969  -75.300 -0.899  1.00 131.11 ? 53   HIS C ND1   1 
ATOM   3089 C  CD2   . HIS C 1 58  ? 12.819  -75.661 -3.047  1.00 123.52 ? 53   HIS C CD2   1 
ATOM   3090 C  CE1   . HIS C 1 58  ? 12.297  -76.427 -1.058  1.00 130.08 ? 53   HIS C CE1   1 
ATOM   3091 N  NE2   . HIS C 1 58  ? 12.194  -76.670 -2.351  1.00 129.85 ? 53   HIS C NE2   1 
ATOM   3092 N  N     . TYR C 1 59  ? 11.028  -72.030 -1.821  1.00 75.59  ? 54   TYR C N     1 
ATOM   3093 C  CA    . TYR C 1 59  ? 9.995   -71.592 -0.852  1.00 67.71  ? 54   TYR C CA    1 
ATOM   3094 C  C     . TYR C 1 59  ? 9.489   -72.712 0.062   1.00 66.66  ? 54   TYR C C     1 
ATOM   3095 O  O     . TYR C 1 59  ? 8.960   -73.722 -0.391  1.00 62.61  ? 54   TYR C O     1 
ATOM   3096 C  CB    . TYR C 1 59  ? 8.812   -70.991 -1.579  1.00 59.36  ? 54   TYR C CB    1 
ATOM   3097 C  CG    . TYR C 1 59  ? 7.656   -70.509 -0.713  1.00 59.92  ? 54   TYR C CG    1 
ATOM   3098 C  CD1   . TYR C 1 59  ? 7.814   -70.122 0.608   1.00 63.90  ? 54   TYR C CD1   1 
ATOM   3099 C  CD2   . TYR C 1 59  ? 6.389   -70.431 -1.242  1.00 58.55  ? 54   TYR C CD2   1 
ATOM   3100 C  CE1   . TYR C 1 59  ? 6.719   -69.688 1.352   1.00 64.21  ? 54   TYR C CE1   1 
ATOM   3101 C  CE2   . TYR C 1 59  ? 5.303   -69.990 -0.509  1.00 53.72  ? 54   TYR C CE2   1 
ATOM   3102 C  CZ    . TYR C 1 59  ? 5.458   -69.614 0.775   1.00 53.90  ? 54   TYR C CZ    1 
ATOM   3103 O  OH    . TYR C 1 59  ? 4.332   -69.183 1.450   1.00 52.53  ? 54   TYR C OH    1 
ATOM   3104 N  N     . ARG C 1 60  ? 9.658   -72.525 1.363   1.00 68.93  ? 55   ARG C N     1 
ATOM   3105 C  CA    . ARG C 1 60  ? 9.106   -73.455 2.323   1.00 72.37  ? 55   ARG C CA    1 
ATOM   3106 C  C     . ARG C 1 60  ? 8.274   -72.654 3.294   1.00 68.47  ? 55   ARG C C     1 
ATOM   3107 O  O     . ARG C 1 60  ? 8.800   -71.870 4.076   1.00 69.57  ? 55   ARG C O     1 
ATOM   3108 C  CB    . ARG C 1 60  ? 10.233  -74.213 3.022   1.00 74.71  ? 55   ARG C CB    1 
ATOM   3109 C  CG    . ARG C 1 60  ? 11.206  -74.854 2.024   1.00 83.84  ? 55   ARG C CG    1 
ATOM   3110 C  CD    . ARG C 1 60  ? 11.230  -76.363 2.077   1.00 89.59  ? 55   ARG C CD    1 
ATOM   3111 N  NE    . ARG C 1 60  ? 10.929  -76.897 3.405   1.00 90.74  ? 55   ARG C NE    1 
ATOM   3112 C  CZ    . ARG C 1 60  ? 11.714  -77.663 4.160   1.00 91.56  ? 55   ARG C CZ    1 
ATOM   3113 N  NH1   . ARG C 1 60  ? 12.925  -78.045 3.758   1.00 97.98  ? 55   ARG C NH1   1 
ATOM   3114 N  NH2   . ARG C 1 60  ? 11.274  -78.053 5.358   1.00 91.53  ? 55   ARG C NH2   1 
ATOM   3115 N  N     . ALA C 1 61  ? 6.962   -72.827 3.207   1.00 63.71  ? 56   ALA C N     1 
ATOM   3116 C  CA    . ALA C 1 61  ? 6.049   -72.016 3.982   1.00 56.37  ? 56   ALA C CA    1 
ATOM   3117 C  C     . ALA C 1 61  ? 6.295   -72.317 5.445   1.00 55.47  ? 56   ALA C C     1 
ATOM   3118 O  O     . ALA C 1 61  ? 6.517   -73.471 5.850   1.00 51.35  ? 56   ALA C O     1 
ATOM   3119 C  CB    . ALA C 1 61  ? 4.615   -72.314 3.621   1.00 53.32  ? 56   ALA C CB    1 
ATOM   3120 N  N     . THR C 1 62  ? 6.248   -71.252 6.225   1.00 51.78  ? 57   THR C N     1 
ATOM   3121 C  CA    . THR C 1 62  ? 6.466   -71.325 7.639   1.00 53.72  ? 57   THR C CA    1 
ATOM   3122 C  C     . THR C 1 62  ? 5.279   -72.018 8.330   1.00 53.70  ? 57   THR C C     1 
ATOM   3123 O  O     . THR C 1 62  ? 4.126   -71.734 8.018   1.00 50.38  ? 57   THR C O     1 
ATOM   3124 C  CB    . THR C 1 62  ? 6.759   -69.910 8.158   1.00 55.24  ? 57   THR C CB    1 
ATOM   3125 O  OG1   . THR C 1 62  ? 8.027   -69.523 7.632   1.00 50.43  ? 57   THR C OG1   1 
ATOM   3126 C  CG2   . THR C 1 62  ? 6.799   -69.850 9.672   1.00 59.30  ? 57   THR C CG2   1 
ATOM   3127 N  N     . ILE C 1 63  ? 5.592   -72.957 9.233   1.00 55.68  ? 58   ILE C N     1 
ATOM   3128 C  CA    . ILE C 1 63  ? 4.589   -73.669 10.042  1.00 54.02  ? 58   ILE C CA    1 
ATOM   3129 C  C     . ILE C 1 63  ? 4.360   -72.913 11.337  1.00 55.21  ? 58   ILE C C     1 
ATOM   3130 O  O     . ILE C 1 63  ? 5.158   -73.012 12.257  1.00 60.46  ? 58   ILE C O     1 
ATOM   3131 C  CB    . ILE C 1 63  ? 5.025   -75.103 10.436  1.00 52.35  ? 58   ILE C CB    1 
ATOM   3132 C  CG1   . ILE C 1 63  ? 5.643   -75.886 9.278   1.00 53.13  ? 58   ILE C CG1   1 
ATOM   3133 C  CG2   . ILE C 1 63  ? 3.832   -75.884 10.940  1.00 55.14  ? 58   ILE C CG2   1 
ATOM   3134 C  CD1   . ILE C 1 63  ? 4.773   -75.999 8.058   1.00 55.91  ? 58   ILE C CD1   1 
ATOM   3135 N  N     . GLY C 1 64  ? 3.266   -72.175 11.411  1.00 58.11  ? 59   GLY C N     1 
ATOM   3136 C  CA    . GLY C 1 64  ? 2.926   -71.418 12.611  1.00 58.47  ? 59   GLY C CA    1 
ATOM   3137 C  C     . GLY C 1 64  ? 3.864   -70.270 12.893  1.00 63.11  ? 59   GLY C C     1 
ATOM   3138 O  O     . GLY C 1 64  ? 3.676   -69.173 12.358  1.00 80.82  ? 59   GLY C O     1 
ATOM   3139 N  N     . VAL C 1 65  ? 4.867   -70.492 13.742  1.00 62.62  ? 60   VAL C N     1 
ATOM   3140 C  CA    . VAL C 1 65  ? 5.782   -69.415 14.096  1.00 62.81  ? 60   VAL C CA    1 
ATOM   3141 C  C     . VAL C 1 65  ? 7.198   -69.883 14.101  1.00 62.63  ? 60   VAL C C     1 
ATOM   3142 O  O     . VAL C 1 65  ? 7.505   -70.922 14.663  1.00 66.73  ? 60   VAL C O     1 
ATOM   3143 C  CB    . VAL C 1 65  ? 5.549   -68.855 15.505  1.00 63.49  ? 60   VAL C CB    1 
ATOM   3144 C  CG1   . VAL C 1 65  ? 6.552   -67.766 15.789  1.00 64.93  ? 60   VAL C CG1   1 
ATOM   3145 C  CG2   . VAL C 1 65  ? 4.160   -68.299 15.651  1.00 64.51  ? 60   VAL C CG2   1 
ATOM   3146 N  N     . ASP C 1 66  ? 8.068   -69.068 13.523  1.00 61.83  ? 61   ASP C N     1 
ATOM   3147 C  CA    . ASP C 1 66  ? 9.493   -69.308 13.589  1.00 63.99  ? 61   ASP C CA    1 
ATOM   3148 C  C     . ASP C 1 66  ? 10.187  -68.174 14.317  1.00 66.46  ? 61   ASP C C     1 
ATOM   3149 O  O     . ASP C 1 66  ? 9.650   -67.057 14.434  1.00 67.49  ? 61   ASP C O     1 
ATOM   3150 C  CB    . ASP C 1 66  ? 10.058  -69.447 12.188  1.00 65.24  ? 61   ASP C CB    1 
ATOM   3151 C  CG    . ASP C 1 66  ? 11.331  -70.221 12.164  1.00 69.27  ? 61   ASP C CG    1 
ATOM   3152 O  OD1   . ASP C 1 66  ? 11.744  -70.686 13.224  1.00 67.35  ? 61   ASP C OD1   1 
ATOM   3153 O  OD2   . ASP C 1 66  ? 11.928  -70.374 11.083  1.00 87.14  ? 61   ASP C OD2   1 
ATOM   3154 N  N     . PHE C 1 67  ? 11.380  -68.466 14.812  1.00 59.51  ? 62   PHE C N     1 
ATOM   3155 C  CA    . PHE C 1 67  ? 12.113  -67.533 15.638  1.00 60.15  ? 62   PHE C CA    1 
ATOM   3156 C  C     . PHE C 1 67  ? 13.543  -67.424 15.130  1.00 61.21  ? 62   PHE C C     1 
ATOM   3157 O  O     . PHE C 1 67  ? 14.109  -68.397 14.630  1.00 56.60  ? 62   PHE C O     1 
ATOM   3158 C  CB    . PHE C 1 67  ? 12.140  -68.026 17.087  1.00 61.28  ? 62   PHE C CB    1 
ATOM   3159 C  CG    . PHE C 1 67  ? 10.783  -68.261 17.687  1.00 55.41  ? 62   PHE C CG    1 
ATOM   3160 C  CD1   . PHE C 1 67  ? 10.149  -69.467 17.540  1.00 53.91  ? 62   PHE C CD1   1 
ATOM   3161 C  CD2   . PHE C 1 67  ? 10.149  -67.271 18.411  1.00 57.72  ? 62   PHE C CD2   1 
ATOM   3162 C  CE1   . PHE C 1 67  ? 8.905   -69.690 18.099  1.00 52.06  ? 62   PHE C CE1   1 
ATOM   3163 C  CE2   . PHE C 1 67  ? 8.898   -67.486 18.981  1.00 55.96  ? 62   PHE C CE2   1 
ATOM   3164 C  CZ    . PHE C 1 67  ? 8.277   -68.702 18.822  1.00 51.18  ? 62   PHE C CZ    1 
ATOM   3165 N  N     . ALA C 1 68  ? 14.142  -66.254 15.314  1.00 63.30  ? 63   ALA C N     1 
ATOM   3166 C  CA    . ALA C 1 68  ? 15.597  -66.127 15.217  1.00 62.98  ? 63   ALA C CA    1 
ATOM   3167 C  C     . ALA C 1 68  ? 16.093  -65.001 16.089  1.00 62.24  ? 63   ALA C C     1 
ATOM   3168 O  O     . ALA C 1 68  ? 15.329  -64.076 16.415  1.00 60.40  ? 63   ALA C O     1 
ATOM   3169 C  CB    . ALA C 1 68  ? 16.020  -65.901 13.783  1.00 60.93  ? 63   ALA C CB    1 
ATOM   3170 N  N     . LEU C 1 69  ? 17.366  -65.113 16.489  1.00 64.13  ? 64   LEU C N     1 
ATOM   3171 C  CA    . LEU C 1 69  ? 17.983  -64.205 17.466  1.00 63.13  ? 64   LEU C CA    1 
ATOM   3172 C  C     . LEU C 1 69  ? 19.031  -63.423 16.768  1.00 64.34  ? 64   LEU C C     1 
ATOM   3173 O  O     . LEU C 1 69  ? 19.877  -63.993 16.084  1.00 64.52  ? 64   LEU C O     1 
ATOM   3174 C  CB    . LEU C 1 69  ? 18.651  -64.959 18.614  1.00 66.87  ? 64   LEU C CB    1 
ATOM   3175 C  CG    . LEU C 1 69  ? 19.310  -64.087 19.707  1.00 69.47  ? 64   LEU C CG    1 
ATOM   3176 C  CD1   . LEU C 1 69  ? 18.295  -63.312 20.552  1.00 72.13  ? 64   LEU C CD1   1 
ATOM   3177 C  CD2   . LEU C 1 69  ? 20.174  -64.941 20.617  1.00 70.46  ? 64   LEU C CD2   1 
ATOM   3178 N  N     . LYS C 1 70  ? 18.997  -62.115 16.959  1.00 68.79  ? 65   LYS C N     1 
ATOM   3179 C  CA    . LYS C 1 70  ? 20.031  -61.255 16.424  1.00 75.98  ? 65   LYS C CA    1 
ATOM   3180 C  C     . LYS C 1 70  ? 20.702  -60.514 17.564  1.00 77.61  ? 65   LYS C C     1 
ATOM   3181 O  O     . LYS C 1 70  ? 20.028  -59.905 18.409  1.00 69.38  ? 65   LYS C O     1 
ATOM   3182 C  CB    . LYS C 1 70  ? 19.409  -60.282 15.438  1.00 84.10  ? 65   LYS C CB    1 
ATOM   3183 C  CG    . LYS C 1 70  ? 20.373  -59.258 14.875  1.00 87.40  ? 65   LYS C CG    1 
ATOM   3184 C  CD    . LYS C 1 70  ? 21.227  -59.837 13.773  1.00 86.38  ? 65   LYS C CD    1 
ATOM   3185 C  CE    . LYS C 1 70  ? 22.214  -58.795 13.300  1.00 86.76  ? 65   LYS C CE    1 
ATOM   3186 N  NZ    . LYS C 1 70  ? 23.105  -59.378 12.268  1.00 93.98  ? 65   LYS C NZ    1 
ATOM   3187 N  N     . VAL C 1 71  ? 22.034  -60.557 17.584  1.00 84.27  ? 66   VAL C N     1 
ATOM   3188 C  CA    . VAL C 1 71  ? 22.811  -59.874 18.631  1.00 89.45  ? 66   VAL C CA    1 
ATOM   3189 C  C     . VAL C 1 71  ? 23.597  -58.719 18.039  1.00 91.70  ? 66   VAL C C     1 
ATOM   3190 O  O     . VAL C 1 71  ? 24.210  -58.858 16.975  1.00 101.86 ? 66   VAL C O     1 
ATOM   3191 C  CB    . VAL C 1 71  ? 23.789  -60.813 19.332  1.00 85.22  ? 66   VAL C CB    1 
ATOM   3192 C  CG1   . VAL C 1 71  ? 24.480  -60.086 20.456  1.00 89.15  ? 66   VAL C CG1   1 
ATOM   3193 C  CG2   . VAL C 1 71  ? 23.051  -62.002 19.903  1.00 84.24  ? 66   VAL C CG2   1 
ATOM   3194 N  N     . LEU C 1 72  ? 23.530  -57.571 18.707  1.00 89.81  ? 67   LEU C N     1 
ATOM   3195 C  CA    . LEU C 1 72  ? 24.007  -56.324 18.144  1.00 93.41  ? 67   LEU C CA    1 
ATOM   3196 C  C     . LEU C 1 72  ? 24.943  -55.615 19.109  1.00 97.21  ? 67   LEU C C     1 
ATOM   3197 O  O     . LEU C 1 72  ? 24.567  -55.348 20.247  1.00 103.17 ? 67   LEU C O     1 
ATOM   3198 C  CB    . LEU C 1 72  ? 22.817  -55.422 17.850  1.00 92.14  ? 67   LEU C CB    1 
ATOM   3199 C  CG    . LEU C 1 72  ? 21.992  -55.687 16.592  1.00 87.76  ? 67   LEU C CG    1 
ATOM   3200 C  CD1   . LEU C 1 72  ? 20.935  -54.598 16.478  1.00 89.25  ? 67   LEU C CD1   1 
ATOM   3201 C  CD2   . LEU C 1 72  ? 22.852  -55.766 15.340  1.00 85.70  ? 67   LEU C CD2   1 
ATOM   3202 N  N     . ASN C 1 73  ? 26.144  -55.276 18.644  1.00 99.07  ? 68   ASN C N     1 
ATOM   3203 C  CA    . ASN C 1 73  ? 26.982  -54.311 19.353  1.00 101.17 ? 68   ASN C CA    1 
ATOM   3204 C  C     . ASN C 1 73  ? 26.621  -52.899 18.940  1.00 96.48  ? 68   ASN C C     1 
ATOM   3205 O  O     . ASN C 1 73  ? 27.062  -52.413 17.898  1.00 100.30 ? 68   ASN C O     1 
ATOM   3206 C  CB    . ASN C 1 73  ? 28.462  -54.594 19.109  1.00 101.56 ? 68   ASN C CB    1 
ATOM   3207 C  CG    . ASN C 1 73  ? 28.908  -55.891 19.760  1.00 105.70 ? 68   ASN C CG    1 
ATOM   3208 O  OD1   . ASN C 1 73  ? 28.487  -56.221 20.873  1.00 103.81 ? 68   ASN C OD1   1 
ATOM   3209 N  ND2   . ASN C 1 73  ? 29.745  -56.645 19.063  1.00 104.11 ? 68   ASN C ND2   1 
ATOM   3210 N  N     . TRP C 1 74  ? 25.801  -52.252 19.762  1.00 90.98  ? 69   TRP C N     1 
ATOM   3211 C  CA    . TRP C 1 74  ? 25.106  -51.033 19.360  1.00 93.30  ? 69   TRP C CA    1 
ATOM   3212 C  C     . TRP C 1 74  ? 25.976  -49.790 19.677  1.00 99.38  ? 69   TRP C C     1 
ATOM   3213 O  O     . TRP C 1 74  ? 26.436  -49.122 18.752  1.00 95.72  ? 69   TRP C O     1 
ATOM   3214 C  CB    . TRP C 1 74  ? 23.737  -50.982 20.045  1.00 89.51  ? 69   TRP C CB    1 
ATOM   3215 C  CG    . TRP C 1 74  ? 22.889  -49.844 19.669  1.00 87.55  ? 69   TRP C CG    1 
ATOM   3216 C  CD1   . TRP C 1 74  ? 22.628  -48.750 20.430  1.00 88.55  ? 69   TRP C CD1   1 
ATOM   3217 C  CD2   . TRP C 1 74  ? 22.150  -49.674 18.450  1.00 94.32  ? 69   TRP C CD2   1 
ATOM   3218 N  NE1   . TRP C 1 74  ? 21.785  -47.893 19.765  1.00 93.66  ? 69   TRP C NE1   1 
ATOM   3219 C  CE2   . TRP C 1 74  ? 21.469  -48.435 18.548  1.00 93.41  ? 69   TRP C CE2   1 
ATOM   3220 C  CE3   . TRP C 1 74  ? 21.995  -50.440 17.287  1.00 89.45  ? 69   TRP C CE3   1 
ATOM   3221 C  CZ2   . TRP C 1 74  ? 20.651  -47.935 17.525  1.00 94.15  ? 69   TRP C CZ2   1 
ATOM   3222 C  CZ3   . TRP C 1 74  ? 21.170  -49.948 16.269  1.00 92.88  ? 69   TRP C CZ3   1 
ATOM   3223 C  CH2   . TRP C 1 74  ? 20.510  -48.703 16.398  1.00 98.99  ? 69   TRP C CH2   1 
ATOM   3224 N  N     . ASP C 1 75  ? 26.208  -49.504 20.969  1.00 106.70 ? 70   ASP C N     1 
ATOM   3225 C  CA    . ASP C 1 75  ? 27.354  -48.698 21.438  1.00 93.52  ? 70   ASP C CA    1 
ATOM   3226 C  C     . ASP C 1 75  ? 28.506  -49.614 21.793  1.00 99.64  ? 70   ASP C C     1 
ATOM   3227 O  O     . ASP C 1 75  ? 28.535  -50.770 21.376  1.00 109.01 ? 70   ASP C O     1 
ATOM   3228 C  CB    . ASP C 1 75  ? 27.007  -47.868 22.684  1.00 89.77  ? 70   ASP C CB    1 
ATOM   3229 C  CG    . ASP C 1 75  ? 25.665  -47.173 22.589  1.00 98.61  ? 70   ASP C CG    1 
ATOM   3230 O  OD1   . ASP C 1 75  ? 25.372  -46.580 21.530  1.00 94.83  ? 70   ASP C OD1   1 
ATOM   3231 O  OD2   . ASP C 1 75  ? 24.906  -47.183 23.589  1.00 103.27 ? 70   ASP C OD2   1 
ATOM   3232 N  N     . SER C 1 76  ? 29.451  -49.093 22.575  1.00 110.67 ? 71   SER C N     1 
ATOM   3233 C  CA    . SER C 1 76  ? 30.161  -49.880 23.592  1.00 108.10 ? 71   SER C CA    1 
ATOM   3234 C  C     . SER C 1 76  ? 29.473  -49.835 24.939  1.00 108.53 ? 71   SER C C     1 
ATOM   3235 O  O     . SER C 1 76  ? 29.604  -50.775 25.715  1.00 109.73 ? 71   SER C O     1 
ATOM   3236 C  CB    . SER C 1 76  ? 31.597  -49.383 23.768  1.00 104.46 ? 71   SER C CB    1 
ATOM   3237 O  OG    . SER C 1 76  ? 31.922  -48.465 22.753  1.00 112.10 ? 71   SER C OG    1 
ATOM   3238 N  N     . ARG C 1 77  ? 28.762  -48.746 25.226  1.00 114.20 ? 72   ARG C N     1 
ATOM   3239 C  CA    . ARG C 1 77  ? 27.809  -48.715 26.350  1.00 121.25 ? 72   ARG C CA    1 
ATOM   3240 C  C     . ARG C 1 77  ? 26.874  -49.934 26.308  1.00 114.17 ? 72   ARG C C     1 
ATOM   3241 O  O     . ARG C 1 77  ? 26.661  -50.599 27.326  1.00 104.13 ? 72   ARG C O     1 
ATOM   3242 C  CB    . ARG C 1 77  ? 26.995  -47.402 26.361  1.00 128.24 ? 72   ARG C CB    1 
ATOM   3243 C  CG    . ARG C 1 77  ? 27.804  -46.101 26.662  1.00 133.96 ? 72   ARG C CG    1 
ATOM   3244 C  CD    . ARG C 1 77  ? 28.428  -46.147 28.068  1.00 140.41 ? 72   ARG C CD    1 
ATOM   3245 N  NE    . ARG C 1 77  ? 29.519  -45.187 28.297  1.00 150.38 ? 72   ARG C NE    1 
ATOM   3246 C  CZ    . ARG C 1 77  ? 30.267  -45.126 29.407  1.00 146.96 ? 72   ARG C CZ    1 
ATOM   3247 N  NH1   . ARG C 1 77  ? 30.053  -45.959 30.422  1.00 138.16 ? 72   ARG C NH1   1 
ATOM   3248 N  NH2   . ARG C 1 77  ? 31.239  -44.220 29.512  1.00 148.60 ? 72   ARG C NH2   1 
ATOM   3249 N  N     . THR C 1 78  ? 26.365  -50.256 25.121  1.00 112.51 ? 73   THR C N     1 
ATOM   3250 C  CA    . THR C 1 78  ? 25.097  -50.958 24.983  1.00 117.73 ? 73   THR C CA    1 
ATOM   3251 C  C     . THR C 1 78  ? 25.167  -52.080 23.940  1.00 109.93 ? 73   THR C C     1 
ATOM   3252 O  O     . THR C 1 78  ? 25.856  -51.977 22.926  1.00 97.15  ? 73   THR C O     1 
ATOM   3253 C  CB    . THR C 1 78  ? 23.972  -49.974 24.590  1.00 119.80 ? 73   THR C CB    1 
ATOM   3254 O  OG1   . THR C 1 78  ? 24.095  -48.773 25.364  1.00 120.10 ? 73   THR C OG1   1 
ATOM   3255 C  CG2   . THR C 1 78  ? 22.586  -50.593 24.807  1.00 116.27 ? 73   THR C CG2   1 
ATOM   3256 N  N     . LEU C 1 79  ? 24.415  -53.145 24.212  1.00 113.64 ? 74   LEU C N     1 
ATOM   3257 C  CA    . LEU C 1 79  ? 24.250  -54.259 23.288  1.00 108.10 ? 74   LEU C CA    1 
ATOM   3258 C  C     . LEU C 1 79  ? 22.774  -54.714 23.281  1.00 102.31 ? 74   LEU C C     1 
ATOM   3259 O  O     . LEU C 1 79  ? 22.071  -54.581 24.291  1.00 87.87  ? 74   LEU C O     1 
ATOM   3260 C  CB    . LEU C 1 79  ? 25.207  -55.379 23.692  1.00 105.28 ? 74   LEU C CB    1 
ATOM   3261 C  CG    . LEU C 1 79  ? 24.833  -56.851 23.504  1.00 104.18 ? 74   LEU C CG    1 
ATOM   3262 C  CD1   . LEU C 1 79  ? 26.069  -57.695 23.202  1.00 100.78 ? 74   LEU C CD1   1 
ATOM   3263 C  CD2   . LEU C 1 79  ? 24.117  -57.386 24.733  1.00 105.29 ? 74   LEU C CD2   1 
ATOM   3264 N  N     . VAL C 1 80  ? 22.298  -55.178 22.120  1.00 99.71  ? 75   VAL C N     1 
ATOM   3265 C  CA    . VAL C 1 80  ? 20.878  -55.477 21.915  1.00 91.10  ? 75   VAL C CA    1 
ATOM   3266 C  C     . VAL C 1 80  ? 20.672  -56.889 21.377  1.00 83.45  ? 75   VAL C C     1 
ATOM   3267 O  O     . VAL C 1 80  ? 21.141  -57.241 20.293  1.00 70.24  ? 75   VAL C O     1 
ATOM   3268 C  CB    . VAL C 1 80  ? 20.232  -54.486 20.917  1.00 92.72  ? 75   VAL C CB    1 
ATOM   3269 C  CG1   . VAL C 1 80  ? 18.724  -54.675 20.870  1.00 95.56  ? 75   VAL C CG1   1 
ATOM   3270 C  CG2   . VAL C 1 80  ? 20.575  -53.043 21.248  1.00 92.42  ? 75   VAL C CG2   1 
ATOM   3271 N  N     . ARG C 1 81  ? 19.943  -57.682 22.155  1.00 85.84  ? 76   ARG C N     1 
ATOM   3272 C  CA    . ARG C 1 81  ? 19.360  -58.926 21.680  1.00 89.83  ? 76   ARG C CA    1 
ATOM   3273 C  C     . ARG C 1 81  ? 18.014  -58.681 21.009  1.00 82.63  ? 76   ARG C C     1 
ATOM   3274 O  O     . ARG C 1 81  ? 17.103  -58.069 21.579  1.00 71.13  ? 76   ARG C O     1 
ATOM   3275 C  CB    . ARG C 1 81  ? 19.183  -59.909 22.831  1.00 95.78  ? 76   ARG C CB    1 
ATOM   3276 C  CG    . ARG C 1 81  ? 20.499  -60.331 23.448  1.00 106.82 ? 76   ARG C CG    1 
ATOM   3277 C  CD    . ARG C 1 81  ? 20.388  -61.583 24.315  1.00 112.57 ? 76   ARG C CD    1 
ATOM   3278 N  NE    . ARG C 1 81  ? 21.605  -62.383 24.254  1.00 117.06 ? 76   ARG C NE    1 
ATOM   3279 C  CZ    . ARG C 1 81  ? 22.807  -61.978 24.670  1.00 119.22 ? 76   ARG C CZ    1 
ATOM   3280 N  NH1   . ARG C 1 81  ? 22.988  -60.777 25.208  1.00 112.64 ? 76   ARG C NH1   1 
ATOM   3281 N  NH2   . ARG C 1 81  ? 23.849  -62.793 24.551  1.00 134.23 ? 76   ARG C NH2   1 
ATOM   3282 N  N     . LEU C 1 82  ? 17.912  -59.180 19.783  1.00 75.86  ? 77   LEU C N     1 
ATOM   3283 C  CA    . LEU C 1 82  ? 16.716  -59.048 18.987  1.00 70.38  ? 77   LEU C CA    1 
ATOM   3284 C  C     . LEU C 1 82  ? 16.075  -60.393 18.785  1.00 66.22  ? 77   LEU C C     1 
ATOM   3285 O  O     . LEU C 1 82  ? 16.602  -61.244 18.059  1.00 62.26  ? 77   LEU C O     1 
ATOM   3286 C  CB    . LEU C 1 82  ? 17.071  -58.456 17.635  1.00 70.85  ? 77   LEU C CB    1 
ATOM   3287 C  CG    . LEU C 1 82  ? 16.173  -57.319 17.161  1.00 68.01  ? 77   LEU C CG    1 
ATOM   3288 C  CD1   . LEU C 1 82  ? 16.011  -56.281 18.245  1.00 75.17  ? 77   LEU C CD1   1 
ATOM   3289 C  CD2   . LEU C 1 82  ? 16.809  -56.681 15.959  1.00 66.49  ? 77   LEU C CD2   1 
ATOM   3290 N  N     . GLN C 1 83  ? 14.939  -60.574 19.442  1.00 64.58  ? 78   GLN C N     1 
ATOM   3291 C  CA    . GLN C 1 83  ? 14.120  -61.748 19.249  1.00 64.72  ? 78   GLN C CA    1 
ATOM   3292 C  C     . GLN C 1 83  ? 13.197  -61.502 18.076  1.00 62.68  ? 78   GLN C C     1 
ATOM   3293 O  O     . GLN C 1 83  ? 12.253  -60.701 18.178  1.00 55.23  ? 78   GLN C O     1 
ATOM   3294 C  CB    . GLN C 1 83  ? 13.246  -61.977 20.464  1.00 70.36  ? 78   GLN C CB    1 
ATOM   3295 C  CG    . GLN C 1 83  ? 13.913  -62.581 21.667  1.00 71.54  ? 78   GLN C CG    1 
ATOM   3296 C  CD    . GLN C 1 83  ? 12.849  -63.174 22.557  1.00 81.05  ? 78   GLN C CD    1 
ATOM   3297 O  OE1   . GLN C 1 83  ? 11.738  -62.614 22.710  1.00 71.07  ? 78   GLN C OE1   1 
ATOM   3298 N  NE2   . GLN C 1 83  ? 13.143  -64.340 23.105  1.00 92.96  ? 78   GLN C NE2   1 
ATOM   3299 N  N     . LEU C 1 84  ? 13.445  -62.211 16.978  1.00 60.66  ? 79   LEU C N     1 
ATOM   3300 C  CA    . LEU C 1 84  ? 12.656  -62.025 15.773  1.00 58.80  ? 79   LEU C CA    1 
ATOM   3301 C  C     . LEU C 1 84  ? 11.601  -63.111 15.651  1.00 55.20  ? 79   LEU C C     1 
ATOM   3302 O  O     . LEU C 1 84  ? 11.917  -64.303 15.530  1.00 55.42  ? 79   LEU C O     1 
ATOM   3303 C  CB    . LEU C 1 84  ? 13.557  -61.996 14.540  1.00 60.76  ? 79   LEU C CB    1 
ATOM   3304 C  CG    . LEU C 1 84  ? 14.413  -60.740 14.406  1.00 63.64  ? 79   LEU C CG    1 
ATOM   3305 C  CD1   . LEU C 1 84  ? 15.369  -60.896 13.243  1.00 62.94  ? 79   LEU C CD1   1 
ATOM   3306 C  CD2   . LEU C 1 84  ? 13.578  -59.474 14.238  1.00 61.85  ? 79   LEU C CD2   1 
ATOM   3307 N  N     . TRP C 1 85  ? 10.344  -62.681 15.679  1.00 53.68  ? 80   TRP C N     1 
ATOM   3308 C  CA    . TRP C 1 85  ? 9.199   -63.588 15.666  1.00 55.09  ? 80   TRP C CA    1 
ATOM   3309 C  C     . TRP C 1 85  ? 8.598   -63.611 14.258  1.00 53.15  ? 80   TRP C C     1 
ATOM   3310 O  O     . TRP C 1 85  ? 7.756   -62.769 13.887  1.00 46.58  ? 80   TRP C O     1 
ATOM   3311 C  CB    . TRP C 1 85  ? 8.142   -63.162 16.695  1.00 59.02  ? 80   TRP C CB    1 
ATOM   3312 C  CG    . TRP C 1 85  ? 8.500   -63.470 18.150  1.00 62.22  ? 80   TRP C CG    1 
ATOM   3313 C  CD1   . TRP C 1 85  ? 9.639   -63.135 18.792  1.00 63.38  ? 80   TRP C CD1   1 
ATOM   3314 C  CD2   . TRP C 1 85  ? 7.688   -64.143 19.107  1.00 66.18  ? 80   TRP C CD2   1 
ATOM   3315 N  NE1   . TRP C 1 85  ? 9.599   -63.558 20.087  1.00 66.73  ? 80   TRP C NE1   1 
ATOM   3316 C  CE2   . TRP C 1 85  ? 8.412   -64.193 20.302  1.00 69.07  ? 80   TRP C CE2   1 
ATOM   3317 C  CE3   . TRP C 1 85  ? 6.422   -64.726 19.061  1.00 70.18  ? 80   TRP C CE3   1 
ATOM   3318 C  CZ2   . TRP C 1 85  ? 7.916   -64.800 21.449  1.00 75.60  ? 80   TRP C CZ2   1 
ATOM   3319 C  CZ3   . TRP C 1 85  ? 5.936   -65.337 20.190  1.00 67.61  ? 80   TRP C CZ3   1 
ATOM   3320 C  CH2   . TRP C 1 85  ? 6.674   -65.357 21.374  1.00 73.15  ? 80   TRP C CH2   1 
ATOM   3321 N  N     . ASP C 1 86  ? 9.035   -64.608 13.499  1.00 52.69  ? 81   ASP C N     1 
ATOM   3322 C  CA    . ASP C 1 86  ? 8.611   -64.819 12.122  1.00 50.35  ? 81   ASP C CA    1 
ATOM   3323 C  C     . ASP C 1 86  ? 7.248   -65.503 12.097  1.00 51.53  ? 81   ASP C C     1 
ATOM   3324 O  O     . ASP C 1 86  ? 7.115   -66.658 12.466  1.00 54.46  ? 81   ASP C O     1 
ATOM   3325 C  CB    . ASP C 1 86  ? 9.655   -65.679 11.446  1.00 51.33  ? 81   ASP C CB    1 
ATOM   3326 C  CG    . ASP C 1 86  ? 9.364   -65.928 10.015  1.00 54.54  ? 81   ASP C CG    1 
ATOM   3327 O  OD1   . ASP C 1 86  ? 8.342   -65.394 9.527   1.00 57.58  ? 81   ASP C OD1   1 
ATOM   3328 O  OD2   . ASP C 1 86  ? 10.170  -66.675 9.397   1.00 54.91  ? 81   ASP C OD2   1 
ATOM   3329 N  N     . ILE C 1 87  ? 6.219   -64.752 11.741  1.00 52.44  ? 82   ILE C N     1 
ATOM   3330 C  CA    . ILE C 1 87  ? 4.867   -65.254 11.831  1.00 56.41  ? 82   ILE C CA    1 
ATOM   3331 C  C     . ILE C 1 87  ? 4.290   -65.593 10.475  1.00 58.80  ? 82   ILE C C     1 
ATOM   3332 O  O     . ILE C 1 87  ? 4.311   -64.780 9.561   1.00 62.62  ? 82   ILE C O     1 
ATOM   3333 C  CB    . ILE C 1 87  ? 3.966   -64.236 12.490  1.00 57.06  ? 82   ILE C CB    1 
ATOM   3334 C  CG1   . ILE C 1 87  ? 4.367   -64.147 13.935  1.00 62.10  ? 82   ILE C CG1   1 
ATOM   3335 C  CG2   . ILE C 1 87  ? 2.505   -64.644 12.364  1.00 57.50  ? 82   ILE C CG2   1 
ATOM   3336 C  CD1   . ILE C 1 87  ? 3.645   -63.043 14.655  1.00 67.12  ? 82   ILE C CD1   1 
ATOM   3337 N  N     . ALA C 1 88  ? 3.778   -66.813 10.351  1.00 57.63  ? 83   ALA C N     1 
ATOM   3338 C  CA    . ALA C 1 88  ? 3.457   -67.366 9.055   1.00 56.39  ? 83   ALA C CA    1 
ATOM   3339 C  C     . ALA C 1 88  ? 2.278   -66.573 8.503   1.00 54.72  ? 83   ALA C C     1 
ATOM   3340 O  O     . ALA C 1 88  ? 1.439   -66.137 9.274   1.00 55.45  ? 83   ALA C O     1 
ATOM   3341 C  CB    . ALA C 1 88  ? 3.134   -68.848 9.195   1.00 53.18  ? 83   ALA C CB    1 
ATOM   3342 N  N     . GLY C 1 89  ? 2.208   -66.380 7.190   1.00 50.50  ? 84   GLY C N     1 
ATOM   3343 C  CA    . GLY C 1 89  ? 1.200   -65.478 6.650   1.00 54.65  ? 84   GLY C CA    1 
ATOM   3344 C  C     . GLY C 1 89  ? -0.219  -65.993 6.827   1.00 56.65  ? 84   GLY C C     1 
ATOM   3345 O  O     . GLY C 1 89  ? -1.187  -65.216 6.867   1.00 65.27  ? 84   GLY C O     1 
ATOM   3346 N  N     . LEU C 1 90  ? -0.331  -67.315 6.943   1.00 53.55  ? 85   LEU C N     1 
ATOM   3347 C  CA    . LEU C 1 90  ? -1.587  -67.997 7.179   1.00 51.63  ? 85   LEU C CA    1 
ATOM   3348 C  C     . LEU C 1 90  ? -2.192  -67.674 8.520   1.00 55.07  ? 85   LEU C C     1 
ATOM   3349 O  O     . LEU C 1 90  ? -3.388  -67.838 8.714   1.00 58.79  ? 85   LEU C O     1 
ATOM   3350 C  CB    . LEU C 1 90  ? -1.366  -69.504 7.137   1.00 53.42  ? 85   LEU C CB    1 
ATOM   3351 C  CG    . LEU C 1 90  ? -2.563  -70.453 7.333   1.00 53.35  ? 85   LEU C CG    1 
ATOM   3352 C  CD1   . LEU C 1 90  ? -3.642  -70.139 6.312   1.00 55.72  ? 85   LEU C CD1   1 
ATOM   3353 C  CD2   . LEU C 1 90  ? -2.146  -71.905 7.208   1.00 51.83  ? 85   LEU C CD2   1 
ATOM   3354 N  N     . GLU C 1 91  ? -1.372  -67.264 9.470   1.00 57.69  ? 86   GLU C N     1 
ATOM   3355 C  CA    . GLU C 1 91  ? -1.790  -67.296 10.854  1.00 58.02  ? 86   GLU C CA    1 
ATOM   3356 C  C     . GLU C 1 91  ? -2.803  -66.223 11.157  1.00 57.30  ? 86   GLU C C     1 
ATOM   3357 O  O     . GLU C 1 91  ? -3.390  -66.240 12.230  1.00 60.06  ? 86   GLU C O     1 
ATOM   3358 C  CB    . GLU C 1 91  ? -0.592  -67.186 11.791  1.00 62.51  ? 86   GLU C CB    1 
ATOM   3359 C  CG    . GLU C 1 91  ? 0.198   -68.485 11.911  1.00 70.52  ? 86   GLU C CG    1 
ATOM   3360 C  CD    . GLU C 1 91  ? -0.589  -69.608 12.576  1.00 77.38  ? 86   GLU C CD    1 
ATOM   3361 O  OE1   . GLU C 1 91  ? -1.150  -69.362 13.660  1.00 77.49  ? 86   GLU C OE1   1 
ATOM   3362 O  OE2   . GLU C 1 91  ? -0.663  -70.721 12.005  1.00 87.01  ? 86   GLU C OE2   1 
ATOM   3363 N  N     . ARG C 1 92  ? -3.034  -65.285 10.242  1.00 57.24  ? 87   ARG C N     1 
ATOM   3364 C  CA    . ARG C 1 92  ? -4.040  -64.262 10.536  1.00 63.71  ? 87   ARG C CA    1 
ATOM   3365 C  C     . ARG C 1 92  ? -5.448  -64.744 10.355  1.00 58.18  ? 87   ARG C C     1 
ATOM   3366 O  O     . ARG C 1 92  ? -6.375  -64.064 10.758  1.00 63.75  ? 87   ARG C O     1 
ATOM   3367 C  CB    . ARG C 1 92  ? -3.811  -62.954 9.756   1.00 67.50  ? 87   ARG C CB    1 
ATOM   3368 C  CG    . ARG C 1 92  ? -4.420  -62.837 8.377   1.00 64.43  ? 87   ARG C CG    1 
ATOM   3369 C  CD    . ARG C 1 92  ? -3.992  -61.512 7.733   1.00 68.02  ? 87   ARG C CD    1 
ATOM   3370 N  NE    . ARG C 1 92  ? -4.250  -61.500 6.299   1.00 66.00  ? 87   ARG C NE    1 
ATOM   3371 C  CZ    . ARG C 1 92  ? -5.430  -61.223 5.754   1.00 62.23  ? 87   ARG C CZ    1 
ATOM   3372 N  NH1   . ARG C 1 92  ? -6.480  -60.900 6.493   1.00 62.74  ? 87   ARG C NH1   1 
ATOM   3373 N  NH2   . ARG C 1 92  ? -5.564  -61.276 4.444   1.00 67.85  ? 87   ARG C NH2   1 
ATOM   3374 N  N     . PHE C 1 93  ? -5.613  -65.921 9.782   1.00 57.71  ? 88   PHE C N     1 
ATOM   3375 C  CA    . PHE C 1 93  ? -6.925  -66.564 9.737   1.00 60.01  ? 88   PHE C CA    1 
ATOM   3376 C  C     . PHE C 1 93  ? -7.149  -67.560 10.896  1.00 60.83  ? 88   PHE C C     1 
ATOM   3377 O  O     . PHE C 1 93  ? -8.230  -68.137 11.014  1.00 59.06  ? 88   PHE C O     1 
ATOM   3378 C  CB    . PHE C 1 93  ? -7.101  -67.256 8.390   1.00 58.75  ? 88   PHE C CB    1 
ATOM   3379 C  CG    . PHE C 1 93  ? -6.841  -66.354 7.213   1.00 66.13  ? 88   PHE C CG    1 
ATOM   3380 C  CD1   . PHE C 1 93  ? -7.793  -65.429 6.812   1.00 66.27  ? 88   PHE C CD1   1 
ATOM   3381 C  CD2   . PHE C 1 93  ? -5.622  -66.409 6.512   1.00 68.35  ? 88   PHE C CD2   1 
ATOM   3382 C  CE1   . PHE C 1 93  ? -7.547  -64.579 5.739   1.00 70.10  ? 88   PHE C CE1   1 
ATOM   3383 C  CE2   . PHE C 1 93  ? -5.372  -65.562 5.430   1.00 65.31  ? 88   PHE C CE2   1 
ATOM   3384 C  CZ    . PHE C 1 93  ? -6.337  -64.645 5.043   1.00 67.09  ? 88   PHE C CZ    1 
ATOM   3385 N  N     . GLY C 1 94  ? -6.128  -67.755 11.734  1.00 59.60  ? 89   GLY C N     1 
ATOM   3386 C  CA    . GLY C 1 94  ? -6.253  -68.540 12.960  1.00 60.37  ? 89   GLY C CA    1 
ATOM   3387 C  C     . GLY C 1 94  ? -6.553  -67.637 14.137  1.00 61.31  ? 89   GLY C C     1 
ATOM   3388 O  O     . GLY C 1 94  ? -6.983  -66.515 13.930  1.00 60.39  ? 89   GLY C O     1 
ATOM   3389 N  N     . ASN C 1 95  ? -6.332  -68.123 15.361  1.00 63.14  ? 90   ASN C N     1 
ATOM   3390 C  CA    . ASN C 1 95  ? -6.750  -67.408 16.579  1.00 72.94  ? 90   ASN C CA    1 
ATOM   3391 C  C     . ASN C 1 95  ? -5.618  -67.097 17.521  1.00 72.98  ? 90   ASN C C     1 
ATOM   3392 O  O     . ASN C 1 95  ? -5.843  -66.788 18.681  1.00 72.47  ? 90   ASN C O     1 
ATOM   3393 C  CB    . ASN C 1 95  ? -7.783  -68.220 17.335  1.00 76.78  ? 90   ASN C CB    1 
ATOM   3394 C  CG    . ASN C 1 95  ? -8.983  -68.540 16.478  1.00 87.70  ? 90   ASN C CG    1 
ATOM   3395 O  OD1   . ASN C 1 95  ? -9.375  -67.756 15.593  1.00 86.32  ? 90   ASN C OD1   1 
ATOM   3396 N  ND2   . ASN C 1 95  ? -9.566  -69.708 16.711  1.00 93.91  ? 90   ASN C ND2   1 
ATOM   3397 N  N     . MET C 1 96  ? -4.401  -67.174 17.015  1.00 73.80  ? 91   MET C N     1 
ATOM   3398 C  CA    . MET C 1 96  ? -3.247  -67.294 17.877  1.00 76.41  ? 91   MET C CA    1 
ATOM   3399 C  C     . MET C 1 96  ? -2.465  -65.996 17.942  1.00 71.54  ? 91   MET C C     1 
ATOM   3400 O  O     . MET C 1 96  ? -1.433  -65.931 18.596  1.00 67.84  ? 91   MET C O     1 
ATOM   3401 C  CB    . MET C 1 96  ? -2.336  -68.437 17.389  1.00 83.05  ? 91   MET C CB    1 
ATOM   3402 C  CG    . MET C 1 96  ? -2.816  -69.828 17.785  1.00 82.56  ? 91   MET C CG    1 
ATOM   3403 S  SD    . MET C 1 96  ? -3.038  -70.000 19.555  1.00 78.25  ? 91   MET C SD    1 
ATOM   3404 C  CE    . MET C 1 96  ? -1.314  -70.151 20.024  1.00 83.39  ? 91   MET C CE    1 
ATOM   3405 N  N     . THR C 1 97  ? -2.928  -64.969 17.248  1.00 72.72  ? 92   THR C N     1 
ATOM   3406 C  CA    . THR C 1 97  ? -2.053  -63.843 17.009  1.00 67.98  ? 92   THR C CA    1 
ATOM   3407 C  C     . THR C 1 97  ? -1.971  -63.047 18.297  1.00 69.72  ? 92   THR C C     1 
ATOM   3408 O  O     . THR C 1 97  ? -0.906  -62.560 18.636  1.00 65.82  ? 92   THR C O     1 
ATOM   3409 C  CB    . THR C 1 97  ? -2.501  -62.940 15.847  1.00 67.75  ? 92   THR C CB    1 
ATOM   3410 O  OG1   . THR C 1 97  ? -3.911  -62.730 15.900  1.00 73.82  ? 92   THR C OG1   1 
ATOM   3411 C  CG2   . THR C 1 97  ? -2.135  -63.581 14.546  1.00 67.43  ? 92   THR C CG2   1 
ATOM   3412 N  N     . ARG C 1 98  ? -3.104  -62.896 18.992  1.00 73.14  ? 93   ARG C N     1 
ATOM   3413 C  CA    . ARG C 1 98  ? -3.122  -62.320 20.347  1.00 77.21  ? 93   ARG C CA    1 
ATOM   3414 C  C     . ARG C 1 98  ? -1.983  -62.886 21.180  1.00 73.82  ? 93   ARG C C     1 
ATOM   3415 O  O     . ARG C 1 98  ? -1.346  -62.170 21.927  1.00 78.73  ? 93   ARG C O     1 
ATOM   3416 C  CB    . ARG C 1 98  ? -4.461  -62.576 21.062  1.00 87.03  ? 93   ARG C CB    1 
ATOM   3417 C  CG    . ARG C 1 98  ? -5.063  -63.961 20.770  1.00 102.62 ? 93   ARG C CG    1 
ATOM   3418 C  CD    . ARG C 1 98  ? -5.720  -64.670 21.972  1.00 100.95 ? 93   ARG C CD    1 
ATOM   3419 N  NE    . ARG C 1 98  ? -6.175  -66.028 21.605  1.00 98.01  ? 93   ARG C NE    1 
ATOM   3420 C  CZ    . ARG C 1 98  ? -6.560  -66.976 22.460  1.00 82.95  ? 93   ARG C CZ    1 
ATOM   3421 N  NH1   . ARG C 1 98  ? -6.563  -66.739 23.761  1.00 85.15  ? 93   ARG C NH1   1 
ATOM   3422 N  NH2   . ARG C 1 98  ? -6.946  -68.161 22.005  1.00 72.16  ? 93   ARG C NH2   1 
ATOM   3423 N  N     . VAL C 1 99  ? -1.737  -64.179 21.073  1.00 69.35  ? 94   VAL C N     1 
ATOM   3424 C  CA    . VAL C 1 99  ? -0.724  -64.802 21.886  1.00 73.81  ? 94   VAL C CA    1 
ATOM   3425 C  C     . VAL C 1 99  ? 0.646   -64.400 21.383  1.00 70.46  ? 94   VAL C C     1 
ATOM   3426 O  O     . VAL C 1 99  ? 1.536   -64.122 22.180  1.00 79.72  ? 94   VAL C O     1 
ATOM   3427 C  CB    . VAL C 1 99  ? -0.857  -66.333 21.858  1.00 83.87  ? 94   VAL C CB    1 
ATOM   3428 C  CG1   . VAL C 1 99  ? 0.347   -67.005 22.511  1.00 85.71  ? 94   VAL C CG1   1 
ATOM   3429 C  CG2   . VAL C 1 99  ? -2.150  -66.738 22.550  1.00 90.54  ? 94   VAL C CG2   1 
ATOM   3430 N  N     . TYR C 1 100 ? 0.817   -64.438 20.066  1.00 64.32  ? 95   TYR C N     1 
ATOM   3431 C  CA    . TYR C 1 100 ? 2.097   -64.145 19.424  1.00 61.62  ? 95   TYR C CA    1 
ATOM   3432 C  C     . TYR C 1 100 ? 2.542   -62.708 19.634  1.00 61.53  ? 95   TYR C C     1 
ATOM   3433 O  O     . TYR C 1 100 ? 3.721   -62.417 19.802  1.00 54.29  ? 95   TYR C O     1 
ATOM   3434 C  CB    . TYR C 1 100 ? 1.992   -64.363 17.924  1.00 62.56  ? 95   TYR C CB    1 
ATOM   3435 C  CG    . TYR C 1 100 ? 1.632   -65.751 17.449  1.00 66.92  ? 95   TYR C CG    1 
ATOM   3436 C  CD1   . TYR C 1 100 ? 1.972   -66.883 18.168  1.00 72.62  ? 95   TYR C CD1   1 
ATOM   3437 C  CD2   . TYR C 1 100 ? 0.981   -65.927 16.235  1.00 73.72  ? 95   TYR C CD2   1 
ATOM   3438 C  CE1   . TYR C 1 100 ? 1.656   -68.154 17.702  1.00 77.20  ? 95   TYR C CE1   1 
ATOM   3439 C  CE2   . TYR C 1 100 ? 0.657   -67.188 15.759  1.00 76.16  ? 95   TYR C CE2   1 
ATOM   3440 C  CZ    . TYR C 1 100 ? 0.997   -68.300 16.497  1.00 76.19  ? 95   TYR C CZ    1 
ATOM   3441 O  OH    . TYR C 1 100 ? 0.675   -69.543 16.031  1.00 68.14  ? 95   TYR C OH    1 
ATOM   3442 N  N     . TYR C 1 101 ? 1.584   -61.798 19.572  1.00 65.70  ? 96   TYR C N     1 
ATOM   3443 C  CA    . TYR C 1 101 ? 1.894   -60.389 19.620  1.00 65.21  ? 96   TYR C CA    1 
ATOM   3444 C  C     . TYR C 1 101 ? 2.261   -59.908 21.037  1.00 67.73  ? 96   TYR C C     1 
ATOM   3445 O  O     . TYR C 1 101 ? 2.842   -58.840 21.186  1.00 75.77  ? 96   TYR C O     1 
ATOM   3446 C  CB    . TYR C 1 101 ? 0.724   -59.557 19.076  1.00 65.15  ? 96   TYR C CB    1 
ATOM   3447 C  CG    . TYR C 1 101 ? 0.348   -59.740 17.615  1.00 63.05  ? 96   TYR C CG    1 
ATOM   3448 C  CD1   . TYR C 1 101 ? 1.157   -60.437 16.713  1.00 62.20  ? 96   TYR C CD1   1 
ATOM   3449 C  CD2   . TYR C 1 101 ? -0.845  -59.193 17.132  1.00 65.67  ? 96   TYR C CD2   1 
ATOM   3450 C  CE1   . TYR C 1 101 ? 0.779   -60.588 15.370  1.00 59.12  ? 96   TYR C CE1   1 
ATOM   3451 C  CE2   . TYR C 1 101 ? -1.229  -59.339 15.800  1.00 66.80  ? 96   TYR C CE2   1 
ATOM   3452 C  CZ    . TYR C 1 101 ? -0.412  -60.035 14.920  1.00 61.86  ? 96   TYR C CZ    1 
ATOM   3453 O  OH    . TYR C 1 101 ? -0.818  -60.148 13.608  1.00 64.05  ? 96   TYR C OH    1 
ATOM   3454 N  N     . LYS C 1 102 ? 1.913   -60.659 22.073  1.00 68.84  ? 97   LYS C N     1 
ATOM   3455 C  CA    . LYS C 1 102 ? 1.974   -60.137 23.439  1.00 76.16  ? 97   LYS C CA    1 
ATOM   3456 C  C     . LYS C 1 102 ? 3.356   -59.564 23.734  1.00 76.63  ? 97   LYS C C     1 
ATOM   3457 O  O     . LYS C 1 102 ? 4.364   -60.165 23.343  1.00 72.26  ? 97   LYS C O     1 
ATOM   3458 C  CB    . LYS C 1 102 ? 1.653   -61.240 24.459  1.00 82.74  ? 97   LYS C CB    1 
ATOM   3459 C  CG    . LYS C 1 102 ? 1.141   -60.741 25.800  1.00 85.87  ? 97   LYS C CG    1 
ATOM   3460 C  CD    . LYS C 1 102 ? 1.362   -61.781 26.890  1.00 86.83  ? 97   LYS C CD    1 
ATOM   3461 C  CE    . LYS C 1 102 ? 0.646   -61.398 28.178  1.00 94.87  ? 97   LYS C CE    1 
ATOM   3462 N  NZ    . LYS C 1 102 ? 0.396   -62.590 29.041  1.00 100.76 ? 97   LYS C NZ    1 
ATOM   3463 N  N     . GLU C 1 103 ? 3.375   -58.407 24.413  1.00 74.58  ? 98   GLU C N     1 
ATOM   3464 C  CA    . GLU C 1 103 ? 4.604   -57.708 24.869  1.00 79.58  ? 98   GLU C CA    1 
ATOM   3465 C  C     . GLU C 1 103 ? 5.683   -57.520 23.800  1.00 73.98  ? 98   GLU C C     1 
ATOM   3466 O  O     . GLU C 1 103 ? 6.863   -57.386 24.102  1.00 76.48  ? 98   GLU C O     1 
ATOM   3467 C  CB    . GLU C 1 103 ? 5.203   -58.375 26.130  1.00 89.86  ? 98   GLU C CB    1 
ATOM   3468 C  CG    . GLU C 1 103 ? 4.156   -58.823 27.150  1.00 95.84  ? 98   GLU C CG    1 
ATOM   3469 C  CD    . GLU C 1 103 ? 4.657   -58.982 28.582  1.00 95.04  ? 98   GLU C CD    1 
ATOM   3470 O  OE1   . GLU C 1 103 ? 5.607   -59.762 28.815  1.00 98.70  ? 98   GLU C OE1   1 
ATOM   3471 O  OE2   . GLU C 1 103 ? 4.062   -58.353 29.488  1.00 98.48  ? 98   GLU C OE2   1 
ATOM   3472 N  N     . ALA C 1 104 ? 5.255   -57.454 22.553  1.00 74.85  ? 99   ALA C N     1 
ATOM   3473 C  CA    . ALA C 1 104 ? 6.122   -57.030 21.463  1.00 70.97  ? 99   ALA C CA    1 
ATOM   3474 C  C     . ALA C 1 104 ? 6.343   -55.533 21.529  1.00 69.23  ? 99   ALA C C     1 
ATOM   3475 O  O     . ALA C 1 104 ? 5.438   -54.777 21.893  1.00 65.20  ? 99   ALA C O     1 
ATOM   3476 C  CB    . ALA C 1 104 ? 5.491   -57.385 20.138  1.00 73.15  ? 99   ALA C CB    1 
ATOM   3477 N  N     . VAL C 1 105 ? 7.552   -55.115 21.188  1.00 72.00  ? 100  VAL C N     1 
ATOM   3478 C  CA    . VAL C 1 105 ? 7.964   -53.706 21.338  1.00 79.02  ? 100  VAL C CA    1 
ATOM   3479 C  C     . VAL C 1 105 ? 8.205   -53.012 20.002  1.00 76.32  ? 100  VAL C C     1 
ATOM   3480 O  O     . VAL C 1 105 ? 8.522   -51.825 19.981  1.00 80.55  ? 100  VAL C O     1 
ATOM   3481 C  CB    . VAL C 1 105 ? 9.234   -53.560 22.227  1.00 76.89  ? 100  VAL C CB    1 
ATOM   3482 C  CG1   . VAL C 1 105 ? 9.009   -54.206 23.589  1.00 80.93  ? 100  VAL C CG1   1 
ATOM   3483 C  CG2   . VAL C 1 105 ? 10.467  -54.167 21.569  1.00 76.13  ? 100  VAL C CG2   1 
ATOM   3484 N  N     . GLY C 1 106 ? 8.072   -53.774 18.917  1.00 73.67  ? 101  GLY C N     1 
ATOM   3485 C  CA    . GLY C 1 106 ? 8.219   -53.280 17.561  1.00 70.00  ? 101  GLY C CA    1 
ATOM   3486 C  C     . GLY C 1 106 ? 7.851   -54.338 16.523  1.00 72.67  ? 101  GLY C C     1 
ATOM   3487 O  O     . GLY C 1 106 ? 7.883   -55.549 16.806  1.00 85.79  ? 101  GLY C O     1 
ATOM   3488 N  N     . ALA C 1 107 ? 7.554   -53.894 15.304  1.00 66.51  ? 102  ALA C N     1 
ATOM   3489 C  CA    . ALA C 1 107 ? 7.107   -54.786 14.229  1.00 63.84  ? 102  ALA C CA    1 
ATOM   3490 C  C     . ALA C 1 107 ? 7.619   -54.366 12.849  1.00 63.50  ? 102  ALA C C     1 
ATOM   3491 O  O     . ALA C 1 107 ? 7.590   -53.204 12.493  1.00 70.21  ? 102  ALA C O     1 
ATOM   3492 C  CB    . ALA C 1 107 ? 5.596   -54.836 14.208  1.00 61.08  ? 102  ALA C CB    1 
ATOM   3493 N  N     . PHE C 1 108 ? 8.071   -55.325 12.060  1.00 61.21  ? 103  PHE C N     1 
ATOM   3494 C  CA    . PHE C 1 108 ? 8.017   -55.198 10.618  1.00 61.44  ? 103  PHE C CA    1 
ATOM   3495 C  C     . PHE C 1 108 ? 6.744   -55.765 10.045  1.00 62.63  ? 103  PHE C C     1 
ATOM   3496 O  O     . PHE C 1 108 ? 6.382   -56.892 10.358  1.00 67.81  ? 103  PHE C O     1 
ATOM   3497 C  CB    . PHE C 1 108 ? 9.170   -55.952 9.998   1.00 63.06  ? 103  PHE C CB    1 
ATOM   3498 C  CG    . PHE C 1 108 ? 10.500  -55.401 10.366  1.00 64.26  ? 103  PHE C CG    1 
ATOM   3499 C  CD1   . PHE C 1 108 ? 10.863  -54.135 9.964   1.00 67.29  ? 103  PHE C CD1   1 
ATOM   3500 C  CD2   . PHE C 1 108 ? 11.392  -56.148 11.114  1.00 64.17  ? 103  PHE C CD2   1 
ATOM   3501 C  CE1   . PHE C 1 108 ? 12.106  -53.627 10.293  1.00 72.86  ? 103  PHE C CE1   1 
ATOM   3502 C  CE2   . PHE C 1 108 ? 12.636  -55.648 11.447  1.00 63.18  ? 103  PHE C CE2   1 
ATOM   3503 C  CZ    . PHE C 1 108 ? 12.998  -54.387 11.037  1.00 67.42  ? 103  PHE C CZ    1 
ATOM   3504 N  N     . VAL C 1 109 ? 6.103   -54.996 9.173   1.00 61.45  ? 104  VAL C N     1 
ATOM   3505 C  CA    . VAL C 1 109 ? 5.061   -55.489 8.275   1.00 58.69  ? 104  VAL C CA    1 
ATOM   3506 C  C     . VAL C 1 109 ? 5.527   -55.463 6.831   1.00 57.51  ? 104  VAL C C     1 
ATOM   3507 O  O     . VAL C 1 109 ? 6.044   -54.472 6.359   1.00 62.56  ? 104  VAL C O     1 
ATOM   3508 C  CB    . VAL C 1 109 ? 3.833   -54.588 8.359   1.00 57.49  ? 104  VAL C CB    1 
ATOM   3509 C  CG1   . VAL C 1 109 ? 2.661   -55.214 7.632   1.00 57.63  ? 104  VAL C CG1   1 
ATOM   3510 C  CG2   . VAL C 1 109 ? 3.484   -54.327 9.818   1.00 60.83  ? 104  VAL C CG2   1 
ATOM   3511 N  N     . VAL C 1 110 ? 5.321   -56.551 6.122   1.00 54.71  ? 105  VAL C N     1 
ATOM   3512 C  CA    . VAL C 1 110 ? 6.046   -56.800 4.899   1.00 53.50  ? 105  VAL C CA    1 
ATOM   3513 C  C     . VAL C 1 110 ? 5.053   -57.113 3.777   1.00 58.85  ? 105  VAL C C     1 
ATOM   3514 O  O     . VAL C 1 110 ? 4.042   -57.796 3.967   1.00 50.14  ? 105  VAL C O     1 
ATOM   3515 C  CB    . VAL C 1 110 ? 7.007   -57.983 5.064   1.00 50.35  ? 105  VAL C CB    1 
ATOM   3516 C  CG1   . VAL C 1 110 ? 7.927   -58.116 3.881   1.00 49.28  ? 105  VAL C CG1   1 
ATOM   3517 C  CG2   . VAL C 1 110 ? 7.842   -57.808 6.308   1.00 52.52  ? 105  VAL C CG2   1 
ATOM   3518 N  N     . PHE C 1 111 ? 5.375   -56.623 2.586   1.00 69.77  ? 106  PHE C N     1 
ATOM   3519 C  CA    . PHE C 1 111 ? 4.623   -56.987 1.402   1.00 72.16  ? 106  PHE C CA    1 
ATOM   3520 C  C     . PHE C 1 111 ? 5.553   -57.219 0.217   1.00 74.79  ? 106  PHE C C     1 
ATOM   3521 O  O     . PHE C 1 111 ? 6.699   -56.750 0.197   1.00 78.85  ? 106  PHE C O     1 
ATOM   3522 C  CB    . PHE C 1 111 ? 3.516   -55.960 1.115   1.00 70.74  ? 106  PHE C CB    1 
ATOM   3523 C  CG    . PHE C 1 111 ? 4.010   -54.650 0.560   1.00 78.09  ? 106  PHE C CG    1 
ATOM   3524 C  CD1   . PHE C 1 111 ? 4.492   -53.645 1.408   1.00 79.37  ? 106  PHE C CD1   1 
ATOM   3525 C  CD2   . PHE C 1 111 ? 3.989   -54.413 -0.806  1.00 81.89  ? 106  PHE C CD2   1 
ATOM   3526 C  CE1   . PHE C 1 111 ? 4.949   -52.434 0.903   1.00 77.68  ? 106  PHE C CE1   1 
ATOM   3527 C  CE2   . PHE C 1 111 ? 4.453   -53.212 -1.317  1.00 81.07  ? 106  PHE C CE2   1 
ATOM   3528 C  CZ    . PHE C 1 111 ? 4.929   -52.219 -0.461  1.00 80.96  ? 106  PHE C CZ    1 
ATOM   3529 N  N     . ASP C 1 112 ? 5.034   -57.957 -0.752  1.00 74.71  ? 107  ASP C N     1 
ATOM   3530 C  CA    . ASP C 1 112 ? 5.725   -58.229 -1.971  1.00 77.72  ? 107  ASP C CA    1 
ATOM   3531 C  C     . ASP C 1 112 ? 5.471   -57.042 -2.890  1.00 84.13  ? 107  ASP C C     1 
ATOM   3532 O  O     . ASP C 1 112 ? 4.337   -56.734 -3.219  1.00 84.84  ? 107  ASP C O     1 
ATOM   3533 C  CB    . ASP C 1 112 ? 5.178   -59.509 -2.580  1.00 81.68  ? 107  ASP C CB    1 
ATOM   3534 C  CG    . ASP C 1 112 ? 6.036   -60.027 -3.718  1.00 88.19  ? 107  ASP C CG    1 
ATOM   3535 O  OD1   . ASP C 1 112 ? 6.598   -59.181 -4.446  1.00 86.94  ? 107  ASP C OD1   1 
ATOM   3536 O  OD2   . ASP C 1 112 ? 6.143   -61.269 -3.883  1.00 82.67  ? 107  ASP C OD2   1 
ATOM   3537 N  N     . ILE C 1 113 ? 6.544   -56.385 -3.313  1.00 97.24  ? 108  ILE C N     1 
ATOM   3538 C  CA    . ILE C 1 113 ? 6.456   -55.251 -4.234  1.00 96.80  ? 108  ILE C CA    1 
ATOM   3539 C  C     . ILE C 1 113 ? 5.956   -55.685 -5.613  1.00 94.82  ? 108  ILE C C     1 
ATOM   3540 O  O     . ILE C 1 113 ? 5.445   -54.872 -6.356  1.00 89.56  ? 108  ILE C O     1 
ATOM   3541 C  CB    . ILE C 1 113 ? 7.825   -54.525 -4.369  1.00 103.65 ? 108  ILE C CB    1 
ATOM   3542 C  CG1   . ILE C 1 113 ? 7.611   -53.017 -4.552  1.00 106.88 ? 108  ILE C CG1   1 
ATOM   3543 C  CG2   . ILE C 1 113 ? 8.683   -55.131 -5.495  1.00 102.39 ? 108  ILE C CG2   1 
ATOM   3544 C  CD1   . ILE C 1 113 ? 8.862   -52.173 -4.378  1.00 113.56 ? 108  ILE C CD1   1 
ATOM   3545 N  N     . SER C 1 114 ? 6.106   -56.969 -5.945  1.00 97.29  ? 109  SER C N     1 
ATOM   3546 C  CA    . SER C 1 114 ? 5.594   -57.520 -7.203  1.00 93.03  ? 109  SER C CA    1 
ATOM   3547 C  C     . SER C 1 114 ? 4.256   -58.298 -7.062  1.00 89.17  ? 109  SER C C     1 
ATOM   3548 O  O     . SER C 1 114 ? 3.996   -59.220 -7.815  1.00 90.00  ? 109  SER C O     1 
ATOM   3549 C  CB    . SER C 1 114 ? 6.685   -58.377 -7.859  1.00 90.09  ? 109  SER C CB    1 
ATOM   3550 O  OG    . SER C 1 114 ? 7.017   -59.501 -7.067  1.00 91.38  ? 109  SER C OG    1 
ATOM   3551 N  N     . ARG C 1 115 ? 3.417   -57.913 -6.099  1.00 87.74  ? 110  ARG C N     1 
ATOM   3552 C  CA    . ARG C 1 115 ? 2.100   -58.517 -5.913  1.00 82.01  ? 110  ARG C CA    1 
ATOM   3553 C  C     . ARG C 1 115 ? 1.244   -57.585 -5.087  1.00 88.39  ? 110  ARG C C     1 
ATOM   3554 O  O     . ARG C 1 115 ? 1.387   -57.509 -3.866  1.00 91.13  ? 110  ARG C O     1 
ATOM   3555 C  CB    . ARG C 1 115 ? 2.208   -59.850 -5.193  1.00 77.17  ? 110  ARG C CB    1 
ATOM   3556 C  CG    . ARG C 1 115 ? 1.938   -61.054 -6.064  1.00 80.02  ? 110  ARG C CG    1 
ATOM   3557 C  CD    . ARG C 1 115 ? 2.633   -62.284 -5.491  1.00 84.77  ? 110  ARG C CD    1 
ATOM   3558 N  NE    . ARG C 1 115 ? 2.084   -62.686 -4.179  1.00 85.01  ? 110  ARG C NE    1 
ATOM   3559 C  CZ    . ARG C 1 115 ? 2.805   -63.028 -3.103  1.00 80.95  ? 110  ARG C CZ    1 
ATOM   3560 N  NH1   . ARG C 1 115 ? 4.139   -63.021 -3.125  1.00 83.78  ? 110  ARG C NH1   1 
ATOM   3561 N  NH2   . ARG C 1 115 ? 2.190   -63.385 -1.988  1.00 77.21  ? 110  ARG C NH2   1 
ATOM   3562 N  N     . SER C 1 116 ? 0.358   -56.859 -5.749  1.00 93.60  ? 111  SER C N     1 
ATOM   3563 C  CA    . SER C 1 116 ? -0.348  -55.767 -5.094  1.00 92.35  ? 111  SER C CA    1 
ATOM   3564 C  C     . SER C 1 116 ? -1.371  -56.276 -4.077  1.00 88.99  ? 111  SER C C     1 
ATOM   3565 O  O     . SER C 1 116 ? -1.585  -55.624 -3.055  1.00 80.45  ? 111  SER C O     1 
ATOM   3566 C  CB    . SER C 1 116 ? -1.031  -54.887 -6.131  1.00 92.27  ? 111  SER C CB    1 
ATOM   3567 O  OG    . SER C 1 116 ? -0.139  -54.670 -7.205  1.00 100.68 ? 111  SER C OG    1 
ATOM   3568 N  N     . SER C 1 117 ? -1.961  -57.447 -4.342  1.00 83.23  ? 112  SER C N     1 
ATOM   3569 C  CA    . SER C 1 117 ? -2.761  -58.176 -3.352  1.00 74.28  ? 112  SER C CA    1 
ATOM   3570 C  C     . SER C 1 117 ? -2.162  -58.065 -1.939  1.00 80.56  ? 112  SER C C     1 
ATOM   3571 O  O     . SER C 1 117 ? -2.886  -57.757 -0.960  1.00 74.94  ? 112  SER C O     1 
ATOM   3572 C  CB    . SER C 1 117 ? -2.870  -59.655 -3.737  1.00 70.86  ? 112  SER C CB    1 
ATOM   3573 O  OG    . SER C 1 117 ? -1.675  -60.101 -4.361  1.00 75.86  ? 112  SER C OG    1 
ATOM   3574 N  N     . THR C 1 118 ? -0.848  -58.329 -1.844  1.00 74.94  ? 113  THR C N     1 
ATOM   3575 C  CA    . THR C 1 118 ? -0.130  -58.345 -0.565  1.00 68.69  ? 113  THR C CA    1 
ATOM   3576 C  C     . THR C 1 118 ? -0.057  -56.961 0.064   1.00 70.66  ? 113  THR C C     1 
ATOM   3577 O  O     . THR C 1 118 ? 0.034   -56.842 1.279   1.00 77.72  ? 113  THR C O     1 
ATOM   3578 C  CB    . THR C 1 118 ? 1.316   -58.883 -0.673  1.00 65.78  ? 113  THR C CB    1 
ATOM   3579 O  OG1   . THR C 1 118 ? 2.138   -57.933 -1.348  1.00 57.66  ? 113  THR C OG1   1 
ATOM   3580 C  CG2   . THR C 1 118 ? 1.376   -60.224 -1.390  1.00 67.86  ? 113  THR C CG2   1 
ATOM   3581 N  N     . PHE C 1 119 ? -0.093  -55.908 -0.743  1.00 72.45  ? 114  PHE C N     1 
ATOM   3582 C  CA    . PHE C 1 119 ? -0.138  -54.560 -0.184  1.00 72.87  ? 114  PHE C CA    1 
ATOM   3583 C  C     . PHE C 1 119 ? -1.516  -54.220 0.397   1.00 75.06  ? 114  PHE C C     1 
ATOM   3584 O  O     . PHE C 1 119 ? -1.616  -53.614 1.465   1.00 76.62  ? 114  PHE C O     1 
ATOM   3585 C  CB    . PHE C 1 119 ? 0.298   -53.488 -1.203  1.00 75.75  ? 114  PHE C CB    1 
ATOM   3586 C  CG    . PHE C 1 119 ? 0.336   -52.079 -0.625  1.00 77.97  ? 114  PHE C CG    1 
ATOM   3587 C  CD1   . PHE C 1 119 ? -0.819  -51.297 -0.586  1.00 80.29  ? 114  PHE C CD1   1 
ATOM   3588 C  CD2   . PHE C 1 119 ? 1.502   -51.550 -0.097  1.00 74.41  ? 114  PHE C CD2   1 
ATOM   3589 C  CE1   . PHE C 1 119 ? -0.805  -50.026 -0.050  1.00 74.59  ? 114  PHE C CE1   1 
ATOM   3590 C  CE2   . PHE C 1 119 ? 1.520   -50.272 0.440   1.00 73.24  ? 114  PHE C CE2   1 
ATOM   3591 C  CZ    . PHE C 1 119 ? 0.365   -49.512 0.462   1.00 73.81  ? 114  PHE C CZ    1 
ATOM   3592 N  N     . GLU C 1 120 ? -2.579  -54.563 -0.319  1.00 82.53  ? 115  GLU C N     1 
ATOM   3593 C  CA    . GLU C 1 120 ? -3.932  -54.339 0.197   1.00 89.61  ? 115  GLU C CA    1 
ATOM   3594 C  C     . GLU C 1 120 ? -4.042  -54.981 1.592   1.00 84.47  ? 115  GLU C C     1 
ATOM   3595 O  O     . GLU C 1 120 ? -4.642  -54.401 2.507   1.00 76.23  ? 115  GLU C O     1 
ATOM   3596 C  CB    . GLU C 1 120 ? -4.992  -54.901 -0.769  1.00 106.19 ? 115  GLU C CB    1 
ATOM   3597 C  CG    . GLU C 1 120 ? -5.078  -54.205 -2.137  1.00 116.81 ? 115  GLU C CG    1 
ATOM   3598 C  CD    . GLU C 1 120 ? -5.391  -55.169 -3.292  1.00 136.46 ? 115  GLU C CD    1 
ATOM   3599 O  OE1   . GLU C 1 120 ? -6.200  -56.112 -3.103  1.00 143.33 ? 115  GLU C OE1   1 
ATOM   3600 O  OE2   . GLU C 1 120 ? -4.820  -54.999 -4.396  1.00 142.44 ? 115  GLU C OE2   1 
ATOM   3601 N  N     . ALA C 1 121 ? -3.409  -56.151 1.746   1.00 83.17  ? 116  ALA C N     1 
ATOM   3602 C  CA    . ALA C 1 121 ? -3.431  -56.921 3.000   1.00 76.98  ? 116  ALA C CA    1 
ATOM   3603 C  C     . ALA C 1 121 ? -2.671  -56.319 4.184   1.00 75.63  ? 116  ALA C C     1 
ATOM   3604 O  O     . ALA C 1 121 ? -2.910  -56.722 5.309   1.00 76.37  ? 116  ALA C O     1 
ATOM   3605 C  CB    . ALA C 1 121 ? -2.928  -58.336 2.757   1.00 78.22  ? 116  ALA C CB    1 
ATOM   3606 N  N     . VAL C 1 122 ? -1.757  -55.373 3.975   1.00 76.65  ? 117  VAL C N     1 
ATOM   3607 C  CA    . VAL C 1 122 ? -0.960  -54.897 5.120   1.00 72.51  ? 117  VAL C CA    1 
ATOM   3608 C  C     . VAL C 1 122 ? -1.831  -54.195 6.137   1.00 69.09  ? 117  VAL C C     1 
ATOM   3609 O  O     . VAL C 1 122 ? -1.486  -54.131 7.297   1.00 76.18  ? 117  VAL C O     1 
ATOM   3610 C  CB    . VAL C 1 122 ? 0.256   -53.981 4.776   1.00 69.63  ? 117  VAL C CB    1 
ATOM   3611 C  CG1   . VAL C 1 122 ? 0.859   -54.297 3.420   1.00 71.15  ? 117  VAL C CG1   1 
ATOM   3612 C  CG2   . VAL C 1 122 ? -0.081  -52.508 4.894   1.00 69.73  ? 117  VAL C CG2   1 
ATOM   3613 N  N     . LEU C 1 123 ? -2.932  -53.619 5.696   1.00 69.14  ? 118  LEU C N     1 
ATOM   3614 C  CA    . LEU C 1 123 ? -3.791  -52.921 6.625   1.00 75.38  ? 118  LEU C CA    1 
ATOM   3615 C  C     . LEU C 1 123 ? -4.492  -53.906 7.539   1.00 70.51  ? 118  LEU C C     1 
ATOM   3616 O  O     . LEU C 1 123 ? -4.778  -53.592 8.690   1.00 71.85  ? 118  LEU C O     1 
ATOM   3617 C  CB    . LEU C 1 123 ? -4.794  -52.028 5.887   1.00 86.93  ? 118  LEU C CB    1 
ATOM   3618 C  CG    . LEU C 1 123 ? -4.224  -50.647 5.502   1.00 87.41  ? 118  LEU C CG    1 
ATOM   3619 C  CD1   . LEU C 1 123 ? -4.963  -50.083 4.299   1.00 90.99  ? 118  LEU C CD1   1 
ATOM   3620 C  CD2   . LEU C 1 123 ? -4.285  -49.678 6.668   1.00 84.80  ? 118  LEU C CD2   1 
ATOM   3621 N  N     . LYS C 1 124 ? -4.743  -55.107 7.044   1.00 69.60  ? 119  LYS C N     1 
ATOM   3622 C  CA    . LYS C 1 124 ? -5.407  -56.113 7.850   1.00 73.68  ? 119  LYS C CA    1 
ATOM   3623 C  C     . LYS C 1 124 ? -4.490  -56.579 8.981   1.00 72.81  ? 119  LYS C C     1 
ATOM   3624 O  O     . LYS C 1 124 ? -4.925  -56.718 10.142  1.00 68.02  ? 119  LYS C O     1 
ATOM   3625 C  CB    . LYS C 1 124 ? -5.856  -57.279 6.976   1.00 79.35  ? 119  LYS C CB    1 
ATOM   3626 C  CG    . LYS C 1 124 ? -6.842  -56.828 5.909   1.00 88.57  ? 119  LYS C CG    1 
ATOM   3627 C  CD    . LYS C 1 124 ? -7.734  -57.966 5.435   1.00 106.28 ? 119  LYS C CD    1 
ATOM   3628 C  CE    . LYS C 1 124 ? -8.862  -57.463 4.553   1.00 112.48 ? 119  LYS C CE    1 
ATOM   3629 N  NZ    . LYS C 1 124 ? -9.818  -56.625 5.328   1.00 119.73 ? 119  LYS C NZ    1 
ATOM   3630 N  N     . TRP C 1 125 ? -3.222  -56.800 8.642   1.00 65.93  ? 120  TRP C N     1 
ATOM   3631 C  CA    . TRP C 1 125 ? -2.209  -57.082 9.644   1.00 64.09  ? 120  TRP C CA    1 
ATOM   3632 C  C     . TRP C 1 125 ? -2.035  -55.916 10.597  1.00 64.60  ? 120  TRP C C     1 
ATOM   3633 O  O     . TRP C 1 125 ? -2.032  -56.100 11.812  1.00 72.20  ? 120  TRP C O     1 
ATOM   3634 C  CB    . TRP C 1 125 ? -0.878  -57.396 8.986   1.00 65.34  ? 120  TRP C CB    1 
ATOM   3635 C  CG    . TRP C 1 125 ? -0.836  -58.734 8.316   1.00 61.51  ? 120  TRP C CG    1 
ATOM   3636 C  CD1   . TRP C 1 125 ? -0.883  -58.966 6.985   1.00 63.08  ? 120  TRP C CD1   1 
ATOM   3637 C  CD2   . TRP C 1 125 ? -0.701  -60.015 8.943   1.00 57.15  ? 120  TRP C CD2   1 
ATOM   3638 N  NE1   . TRP C 1 125 ? -0.795  -60.307 6.737   1.00 63.11  ? 120  TRP C NE1   1 
ATOM   3639 C  CE2   . TRP C 1 125 ? -0.672  -60.975 7.924   1.00 58.24  ? 120  TRP C CE2   1 
ATOM   3640 C  CE3   . TRP C 1 125 ? -0.580  -60.437 10.265  1.00 54.38  ? 120  TRP C CE3   1 
ATOM   3641 C  CZ2   . TRP C 1 125 ? -0.565  -62.343 8.182   1.00 55.23  ? 120  TRP C CZ2   1 
ATOM   3642 C  CZ3   . TRP C 1 125 ? -0.457  -61.781 10.520  1.00 52.22  ? 120  TRP C CZ3   1 
ATOM   3643 C  CH2   . TRP C 1 125 ? -0.455  -62.724 9.478   1.00 53.43  ? 120  TRP C CH2   1 
ATOM   3644 N  N     . LYS C 1 126 ? -1.894  -54.715 10.053  1.00 66.14  ? 121  LYS C N     1 
ATOM   3645 C  CA    . LYS C 1 126 ? -1.755  -53.529 10.893  1.00 69.20  ? 121  LYS C CA    1 
ATOM   3646 C  C     . LYS C 1 126 ? -2.927  -53.329 11.858  1.00 70.53  ? 121  LYS C C     1 
ATOM   3647 O  O     . LYS C 1 126 ? -2.692  -53.031 13.020  1.00 83.09  ? 121  LYS C O     1 
ATOM   3648 C  CB    . LYS C 1 126 ? -1.548  -52.272 10.055  1.00 69.19  ? 121  LYS C CB    1 
ATOM   3649 C  CG    . LYS C 1 126 ? -1.213  -51.030 10.872  1.00 73.34  ? 121  LYS C CG    1 
ATOM   3650 C  CD    . LYS C 1 126 ? 0.186   -51.083 11.475  1.00 78.56  ? 121  LYS C CD    1 
ATOM   3651 C  CE    . LYS C 1 126 ? 0.738   -49.699 11.798  1.00 77.33  ? 121  LYS C CE    1 
ATOM   3652 N  NZ    . LYS C 1 126 ? 0.276   -49.194 13.122  1.00 80.36  ? 121  LYS C NZ    1 
ATOM   3653 N  N     . SER C 1 127 ? -4.158  -53.543 11.406  1.00 67.16  ? 122  SER C N     1 
ATOM   3654 C  CA    . SER C 1 127 ? -5.310  -53.558 12.312  1.00 70.75  ? 122  SER C CA    1 
ATOM   3655 C  C     . SER C 1 127 ? -5.202  -54.603 13.373  1.00 68.40  ? 122  SER C C     1 
ATOM   3656 O  O     . SER C 1 127 ? -5.436  -54.341 14.544  1.00 72.80  ? 122  SER C O     1 
ATOM   3657 C  CB    . SER C 1 127 ? -6.584  -53.879 11.570  1.00 76.12  ? 122  SER C CB    1 
ATOM   3658 O  OG    . SER C 1 127 ? -7.100  -52.703 11.002  1.00 93.04  ? 122  SER C OG    1 
ATOM   3659 N  N     . ASP C 1 128 ? -4.885  -55.811 12.939  1.00 72.77  ? 123  ASP C N     1 
ATOM   3660 C  CA    . ASP C 1 128 ? -4.732  -56.950 13.845  1.00 75.12  ? 123  ASP C CA    1 
ATOM   3661 C  C     . ASP C 1 128 ? -3.729  -56.587 14.932  1.00 67.14  ? 123  ASP C C     1 
ATOM   3662 O  O     . ASP C 1 128 ? -4.031  -56.675 16.124  1.00 63.40  ? 123  ASP C O     1 
ATOM   3663 C  CB    . ASP C 1 128 ? -4.255  -58.183 13.066  1.00 72.49  ? 123  ASP C CB    1 
ATOM   3664 C  CG    . ASP C 1 128 ? -4.330  -59.450 13.870  1.00 73.63  ? 123  ASP C CG    1 
ATOM   3665 O  OD1   . ASP C 1 128 ? -5.302  -59.613 14.616  1.00 73.32  ? 123  ASP C OD1   1 
ATOM   3666 O  OD2   . ASP C 1 128 ? -3.400  -60.274 13.769  1.00 76.06  ? 123  ASP C OD2   1 
ATOM   3667 N  N     . LEU C 1 129 ? -2.559  -56.136 14.501  1.00 61.28  ? 124  LEU C N     1 
ATOM   3668 C  CA    . LEU C 1 129 ? -1.522  -55.688 15.410  1.00 66.05  ? 124  LEU C CA    1 
ATOM   3669 C  C     . LEU C 1 129 ? -2.057  -54.689 16.429  1.00 67.42  ? 124  LEU C C     1 
ATOM   3670 O  O     . LEU C 1 129 ? -1.998  -54.938 17.631  1.00 73.40  ? 124  LEU C O     1 
ATOM   3671 C  CB    . LEU C 1 129 ? -0.364  -55.074 14.626  1.00 67.68  ? 124  LEU C CB    1 
ATOM   3672 C  CG    . LEU C 1 129 ? 0.914   -54.844 15.420  1.00 73.50  ? 124  LEU C CG    1 
ATOM   3673 C  CD1   . LEU C 1 129 ? 1.459   -56.156 15.939  1.00 78.50  ? 124  LEU C CD1   1 
ATOM   3674 C  CD2   . LEU C 1 129 ? 1.978   -54.173 14.574  1.00 72.89  ? 124  LEU C CD2   1 
ATOM   3675 N  N     . ASP C 1 130 ? -2.598  -53.571 15.960  1.00 69.08  ? 125  ASP C N     1 
ATOM   3676 C  CA    . ASP C 1 130 ? -2.923  -52.453 16.851  1.00 72.84  ? 125  ASP C CA    1 
ATOM   3677 C  C     . ASP C 1 130 ? -4.176  -52.750 17.670  1.00 70.52  ? 125  ASP C C     1 
ATOM   3678 O  O     . ASP C 1 130 ? -4.322  -52.272 18.798  1.00 77.30  ? 125  ASP C O     1 
ATOM   3679 C  CB    . ASP C 1 130 ? -3.134  -51.155 16.067  1.00 74.81  ? 125  ASP C CB    1 
ATOM   3680 C  CG    . ASP C 1 130 ? -1.887  -50.701 15.286  1.00 76.58  ? 125  ASP C CG    1 
ATOM   3681 O  OD1   . ASP C 1 130 ? -0.733  -51.033 15.654  1.00 69.32  ? 125  ASP C OD1   1 
ATOM   3682 O  OD2   . ASP C 1 130 ? -2.095  -50.007 14.271  1.00 78.50  ? 125  ASP C OD2   1 
ATOM   3683 N  N     . SER C 1 131 ? -5.050  -53.571 17.105  1.00 70.71  ? 126  SER C N     1 
ATOM   3684 C  CA    . SER C 1 131 ? -6.071  -54.305 17.855  1.00 72.24  ? 126  SER C CA    1 
ATOM   3685 C  C     . SER C 1 131 ? -5.580  -54.961 19.143  1.00 69.06  ? 126  SER C C     1 
ATOM   3686 O  O     . SER C 1 131 ? -6.327  -55.024 20.110  1.00 64.00  ? 126  SER C O     1 
ATOM   3687 C  CB    . SER C 1 131 ? -6.743  -55.346 16.954  1.00 72.26  ? 126  SER C CB    1 
ATOM   3688 O  OG    . SER C 1 131 ? -7.535  -56.229 17.703  1.00 73.44  ? 126  SER C OG    1 
ATOM   3689 N  N     . LYS C 1 132 ? -4.332  -55.421 19.168  1.00 66.11  ? 127  LYS C N     1 
ATOM   3690 C  CA    . LYS C 1 132 ? -3.897  -56.382 20.180  1.00 66.06  ? 127  LYS C CA    1 
ATOM   3691 C  C     . LYS C 1 132 ? -2.625  -56.058 20.934  1.00 69.31  ? 127  LYS C C     1 
ATOM   3692 O  O     . LYS C 1 132 ? -2.250  -56.819 21.776  1.00 73.69  ? 127  LYS C O     1 
ATOM   3693 C  CB    . LYS C 1 132 ? -3.717  -57.737 19.516  1.00 67.14  ? 127  LYS C CB    1 
ATOM   3694 C  CG    . LYS C 1 132 ? -5.018  -58.209 18.924  1.00 74.71  ? 127  LYS C CG    1 
ATOM   3695 C  CD    . LYS C 1 132 ? -4.940  -59.564 18.264  1.00 73.24  ? 127  LYS C CD    1 
ATOM   3696 C  CE    . LYS C 1 132 ? -6.270  -59.809 17.581  1.00 71.06  ? 127  LYS C CE    1 
ATOM   3697 N  NZ    . LYS C 1 132 ? -6.318  -61.134 16.937  1.00 72.97  ? 127  LYS C NZ    1 
ATOM   3698 N  N     . VAL C 1 133 ? -1.910  -54.990 20.608  1.00 72.89  ? 128  VAL C N     1 
ATOM   3699 C  CA    . VAL C 1 133 ? -0.742  -54.632 21.391  1.00 72.27  ? 128  VAL C CA    1 
ATOM   3700 C  C     . VAL C 1 133 ? -0.523  -53.147 21.390  1.00 84.14  ? 128  VAL C C     1 
ATOM   3701 O  O     . VAL C 1 133 ? -0.569  -52.501 20.331  1.00 90.01  ? 128  VAL C O     1 
ATOM   3702 C  CB    . VAL C 1 133 ? 0.568   -55.243 20.875  1.00 70.44  ? 128  VAL C CB    1 
ATOM   3703 C  CG1   . VAL C 1 133 ? 1.614   -55.271 21.987  1.00 71.26  ? 128  VAL C CG1   1 
ATOM   3704 C  CG2   . VAL C 1 133 ? 0.348   -56.634 20.383  1.00 69.95  ? 128  VAL C CG2   1 
ATOM   3705 N  N     . HIS C 1 134 ? -0.225  -52.647 22.589  1.00 85.74  ? 129  HIS C N     1 
ATOM   3706 C  CA    . HIS C 1 134 ? 0.193   -51.292 22.813  1.00 80.36  ? 129  HIS C CA    1 
ATOM   3707 C  C     . HIS C 1 134 ? 1.456   -51.362 23.635  1.00 79.68  ? 129  HIS C C     1 
ATOM   3708 O  O     . HIS C 1 134 ? 1.666   -52.307 24.387  1.00 70.40  ? 129  HIS C O     1 
ATOM   3709 C  CB    . HIS C 1 134 ? -0.876  -50.561 23.581  1.00 83.15  ? 129  HIS C CB    1 
ATOM   3710 C  CG    . HIS C 1 134 ? -1.659  -51.454 24.474  1.00 92.47  ? 129  HIS C CG    1 
ATOM   3711 N  ND1   . HIS C 1 134 ? -2.692  -52.243 24.010  1.00 99.95  ? 129  HIS C ND1   1 
ATOM   3712 C  CD2   . HIS C 1 134 ? -1.519  -51.742 25.788  1.00 94.06  ? 129  HIS C CD2   1 
ATOM   3713 C  CE1   . HIS C 1 134 ? -3.176  -52.957 25.009  1.00 107.87 ? 129  HIS C CE1   1 
ATOM   3714 N  NE2   . HIS C 1 134 ? -2.485  -52.666 26.101  1.00 107.03 ? 129  HIS C NE2   1 
ATOM   3715 N  N     . LEU C 1 135 ? 2.287   -50.336 23.502  1.00 85.47  ? 130  LEU C N     1 
ATOM   3716 C  CA    . LEU C 1 135 ? 3.330   -50.066 24.477  1.00 83.78  ? 130  LEU C CA    1 
ATOM   3717 C  C     . LEU C 1 135 ? 2.663   -49.782 25.824  1.00 86.84  ? 130  LEU C C     1 
ATOM   3718 O  O     . LEU C 1 135 ? 1.502   -49.362 25.851  1.00 78.65  ? 130  LEU C O     1 
ATOM   3719 C  CB    . LEU C 1 135 ? 4.179   -48.873 24.036  1.00 84.63  ? 130  LEU C CB    1 
ATOM   3720 C  CG    . LEU C 1 135 ? 4.966   -49.051 22.727  1.00 87.04  ? 130  LEU C CG    1 
ATOM   3721 C  CD1   . LEU C 1 135 ? 5.218   -47.704 22.050  1.00 92.31  ? 130  LEU C CD1   1 
ATOM   3722 C  CD2   . LEU C 1 135 ? 6.281   -49.804 22.926  1.00 83.34  ? 130  LEU C CD2   1 
ATOM   3723 N  N     . PRO C 1 136 ? 3.393   -50.002 26.943  1.00 88.45  ? 131  PRO C N     1 
ATOM   3724 C  CA    . PRO C 1 136 ? 2.825   -49.837 28.277  1.00 81.81  ? 131  PRO C CA    1 
ATOM   3725 C  C     . PRO C 1 136 ? 2.016   -48.558 28.467  1.00 83.23  ? 131  PRO C C     1 
ATOM   3726 O  O     . PRO C 1 136 ? 0.980   -48.582 29.129  1.00 81.01  ? 131  PRO C O     1 
ATOM   3727 C  CB    . PRO C 1 136 ? 4.056   -49.847 29.166  1.00 80.19  ? 131  PRO C CB    1 
ATOM   3728 C  CG    . PRO C 1 136 ? 4.981   -50.794 28.482  1.00 80.12  ? 131  PRO C CG    1 
ATOM   3729 C  CD    . PRO C 1 136 ? 4.765   -50.555 27.011  1.00 87.87  ? 131  PRO C CD    1 
ATOM   3730 N  N     . ASN C 1 137 ? 2.437   -47.465 27.838  1.00 87.93  ? 132  ASN C N     1 
ATOM   3731 C  CA    . ASN C 1 137 ? 1.674   -46.208 27.899  1.00 94.86  ? 132  ASN C CA    1 
ATOM   3732 C  C     . ASN C 1 137 ? 0.430   -46.113 27.000  1.00 90.71  ? 132  ASN C C     1 
ATOM   3733 O  O     . ASN C 1 137 ? -0.038  -45.015 26.723  1.00 82.27  ? 132  ASN C O     1 
ATOM   3734 C  CB    . ASN C 1 137 ? 2.597   -45.027 27.588  1.00 98.64  ? 132  ASN C CB    1 
ATOM   3735 C  CG    . ASN C 1 137 ? 3.349   -45.212 26.297  1.00 96.58  ? 132  ASN C CG    1 
ATOM   3736 O  OD1   . ASN C 1 137 ? 4.529   -45.559 26.306  1.00 103.95 ? 132  ASN C OD1   1 
ATOM   3737 N  ND2   . ASN C 1 137 ? 2.667   -45.026 25.183  1.00 95.07  ? 132  ASN C ND2   1 
ATOM   3738 N  N     . GLY C 1 138 ? -0.110  -47.245 26.555  1.00 100.83 ? 133  GLY C N     1 
ATOM   3739 C  CA    . GLY C 1 138 ? -1.352  -47.262 25.774  1.00 101.52 ? 133  GLY C CA    1 
ATOM   3740 C  C     . GLY C 1 138 ? -1.234  -46.950 24.285  1.00 97.13  ? 133  GLY C C     1 
ATOM   3741 O  O     . GLY C 1 138 ? -2.236  -46.950 23.573  1.00 94.81  ? 133  GLY C O     1 
ATOM   3742 N  N     . SER C 1 139 ? -0.024  -46.693 23.800  1.00 97.33  ? 134  SER C N     1 
ATOM   3743 C  CA    . SER C 1 139 ? 0.154   -46.266 22.408  1.00 96.61  ? 134  SER C CA    1 
ATOM   3744 C  C     . SER C 1 139 ? 0.669   -47.418 21.527  1.00 85.82  ? 134  SER C C     1 
ATOM   3745 O  O     . SER C 1 139 ? 1.493   -48.223 21.972  1.00 82.62  ? 134  SER C O     1 
ATOM   3746 C  CB    . SER C 1 139 ? 1.118   -45.080 22.357  1.00 102.44 ? 134  SER C CB    1 
ATOM   3747 O  OG    . SER C 1 139 ? 2.452   -45.554 22.296  1.00 111.39 ? 134  SER C OG    1 
ATOM   3748 N  N     . PRO C 1 140 ? 0.199   -47.488 20.270  1.00 78.94  ? 135  PRO C N     1 
ATOM   3749 C  CA    . PRO C 1 140 ? 0.555   -48.585 19.372  1.00 77.76  ? 135  PRO C CA    1 
ATOM   3750 C  C     . PRO C 1 140 ? 2.041   -48.685 19.115  1.00 75.85  ? 135  PRO C C     1 
ATOM   3751 O  O     . PRO C 1 140 ? 2.730   -47.671 19.046  1.00 81.19  ? 135  PRO C O     1 
ATOM   3752 C  CB    . PRO C 1 140 ? -0.155  -48.220 18.066  1.00 78.43  ? 135  PRO C CB    1 
ATOM   3753 C  CG    . PRO C 1 140 ? -0.271  -46.741 18.107  1.00 80.82  ? 135  PRO C CG    1 
ATOM   3754 C  CD    . PRO C 1 140 ? -0.544  -46.433 19.557  1.00 82.47  ? 135  PRO C CD    1 
ATOM   3755 N  N     . ILE C 1 141 ? 2.528   -49.899 18.940  1.00 71.67  ? 136  ILE C N     1 
ATOM   3756 C  CA    . ILE C 1 141 ? 3.958   -50.117 18.926  1.00 68.45  ? 136  ILE C CA    1 
ATOM   3757 C  C     . ILE C 1 141 ? 4.533   -49.628 17.610  1.00 64.69  ? 136  ILE C C     1 
ATOM   3758 O  O     . ILE C 1 141 ? 3.811   -49.512 16.622  1.00 59.37  ? 136  ILE C O     1 
ATOM   3759 C  CB    . ILE C 1 141 ? 4.314   -51.595 19.157  1.00 74.06  ? 136  ILE C CB    1 
ATOM   3760 C  CG1   . ILE C 1 141 ? 3.802   -52.491 18.038  1.00 74.96  ? 136  ILE C CG1   1 
ATOM   3761 C  CG2   . ILE C 1 141 ? 3.725   -52.086 20.471  1.00 80.47  ? 136  ILE C CG2   1 
ATOM   3762 C  CD1   . ILE C 1 141 ? 4.670   -53.712 17.858  1.00 76.53  ? 136  ILE C CD1   1 
ATOM   3763 N  N     . PRO C 1 142 ? 5.831   -49.295 17.595  1.00 67.55  ? 137  PRO C N     1 
ATOM   3764 C  CA    . PRO C 1 142 ? 6.459   -48.843 16.349  1.00 71.81  ? 137  PRO C CA    1 
ATOM   3765 C  C     . PRO C 1 142 ? 6.400   -49.888 15.249  1.00 71.15  ? 137  PRO C C     1 
ATOM   3766 O  O     . PRO C 1 142 ? 6.911   -50.987 15.438  1.00 68.37  ? 137  PRO C O     1 
ATOM   3767 C  CB    . PRO C 1 142 ? 7.928   -48.582 16.756  1.00 69.64  ? 137  PRO C CB    1 
ATOM   3768 C  CG    . PRO C 1 142 ? 8.123   -49.316 18.023  1.00 69.86  ? 137  PRO C CG    1 
ATOM   3769 C  CD    . PRO C 1 142 ? 6.782   -49.240 18.714  1.00 68.25  ? 137  PRO C CD    1 
ATOM   3770 N  N     . ALA C 1 143 ? 5.817   -49.513 14.106  1.00 74.46  ? 138  ALA C N     1 
ATOM   3771 C  CA    . ALA C 1 143 ? 5.760   -50.377 12.922  1.00 72.29  ? 138  ALA C CA    1 
ATOM   3772 C  C     . ALA C 1 143 ? 6.536   -49.810 11.722  1.00 69.60  ? 138  ALA C C     1 
ATOM   3773 O  O     . ALA C 1 143 ? 6.500   -48.622 11.442  1.00 74.20  ? 138  ALA C O     1 
ATOM   3774 C  CB    . ALA C 1 143 ? 4.323   -50.592 12.539  1.00 69.50  ? 138  ALA C CB    1 
ATOM   3775 N  N     . VAL C 1 144 ? 7.267   -50.668 11.036  1.00 65.70  ? 139  VAL C N     1 
ATOM   3776 C  CA    . VAL C 1 144 ? 8.061   -50.251 9.895   1.00 66.73  ? 139  VAL C CA    1 
ATOM   3777 C  C     . VAL C 1 144 ? 7.680   -51.117 8.710   1.00 71.92  ? 139  VAL C C     1 
ATOM   3778 O  O     . VAL C 1 144 ? 7.751   -52.332 8.777   1.00 81.76  ? 139  VAL C O     1 
ATOM   3779 C  CB    . VAL C 1 144 ? 9.564   -50.444 10.159  1.00 66.88  ? 139  VAL C CB    1 
ATOM   3780 C  CG1   . VAL C 1 144 ? 10.378  -50.167 8.916   1.00 64.35  ? 139  VAL C CG1   1 
ATOM   3781 C  CG2   . VAL C 1 144 ? 10.026  -49.533 11.282  1.00 70.12  ? 139  VAL C CG2   1 
ATOM   3782 N  N     . LEU C 1 145 ? 7.289   -50.479 7.621   1.00 72.05  ? 140  LEU C N     1 
ATOM   3783 C  CA    . LEU C 1 145 ? 6.810   -51.174 6.440   1.00 68.89  ? 140  LEU C CA    1 
ATOM   3784 C  C     . LEU C 1 145 ? 7.966   -51.606 5.538   1.00 65.75  ? 140  LEU C C     1 
ATOM   3785 O  O     . LEU C 1 145 ? 8.945   -50.898 5.408   1.00 64.80  ? 140  LEU C O     1 
ATOM   3786 C  CB    . LEU C 1 145 ? 5.863   -50.238 5.684   1.00 74.32  ? 140  LEU C CB    1 
ATOM   3787 C  CG    . LEU C 1 145 ? 5.132   -50.775 4.466   1.00 80.17  ? 140  LEU C CG    1 
ATOM   3788 C  CD1   . LEU C 1 145 ? 4.268   -51.979 4.823   1.00 85.45  ? 140  LEU C CD1   1 
ATOM   3789 C  CD2   . LEU C 1 145 ? 4.281   -49.661 3.887   1.00 84.65  ? 140  LEU C CD2   1 
ATOM   3790 N  N     . LEU C 1 146 ? 7.837   -52.746 4.883   1.00 64.81  ? 141  LEU C N     1 
ATOM   3791 C  CA    . LEU C 1 146 ? 8.915   -53.246 4.066   1.00 69.37  ? 141  LEU C CA    1 
ATOM   3792 C  C     . LEU C 1 146 ? 8.380   -53.656 2.699   1.00 77.42  ? 141  LEU C C     1 
ATOM   3793 O  O     . LEU C 1 146 ? 7.642   -54.629 2.567   1.00 80.32  ? 141  LEU C O     1 
ATOM   3794 C  CB    . LEU C 1 146 ? 9.600   -54.435 4.738   1.00 67.27  ? 141  LEU C CB    1 
ATOM   3795 C  CG    . LEU C 1 146 ? 10.377  -54.238 6.051   1.00 64.28  ? 141  LEU C CG    1 
ATOM   3796 C  CD1   . LEU C 1 146 ? 11.214  -55.472 6.344   1.00 62.69  ? 141  LEU C CD1   1 
ATOM   3797 C  CD2   . LEU C 1 146 ? 11.300  -53.044 6.051   1.00 62.84  ? 141  LEU C CD2   1 
ATOM   3798 N  N     . ALA C 1 147 ? 8.796   -52.930 1.671   1.00 79.38  ? 142  ALA C N     1 
ATOM   3799 C  CA    . ALA C 1 147 ? 8.484   -53.299 0.314   1.00 74.67  ? 142  ALA C CA    1 
ATOM   3800 C  C     . ALA C 1 147 ? 9.555   -54.259 -0.183  1.00 72.89  ? 142  ALA C C     1 
ATOM   3801 O  O     . ALA C 1 147 ? 10.638  -53.834 -0.588  1.00 76.86  ? 142  ALA C O     1 
ATOM   3802 C  CB    . ALA C 1 147 ? 8.433   -52.056 -0.544  1.00 73.00  ? 142  ALA C CB    1 
ATOM   3803 N  N     . ASN C 1 148 ? 9.267   -55.554 -0.130  1.00 65.24  ? 143  ASN C N     1 
ATOM   3804 C  CA    . ASN C 1 148 ? 10.313  -56.540 -0.338  1.00 66.12  ? 143  ASN C CA    1 
ATOM   3805 C  C     . ASN C 1 148 ? 10.357  -57.022 -1.782  1.00 68.57  ? 143  ASN C C     1 
ATOM   3806 O  O     . ASN C 1 148 ? 9.360   -56.930 -2.491  1.00 64.31  ? 143  ASN C O     1 
ATOM   3807 C  CB    . ASN C 1 148 ? 10.165  -57.726 0.612   1.00 62.24  ? 143  ASN C CB    1 
ATOM   3808 C  CG    . ASN C 1 148 ? 11.396  -58.628 0.611   1.00 64.66  ? 143  ASN C CG    1 
ATOM   3809 O  OD1   . ASN C 1 148 ? 11.277  -59.853 0.497   1.00 71.29  ? 143  ASN C OD1   1 
ATOM   3810 N  ND2   . ASN C 1 148 ? 12.585  -58.035 0.700   1.00 62.47  ? 143  ASN C ND2   1 
ATOM   3811 N  N     . LYS C 1 149 ? 11.514  -57.567 -2.175  1.00 74.25  ? 144  LYS C N     1 
ATOM   3812 C  CA    . LYS C 1 149 ? 11.775  -58.103 -3.516  1.00 77.24  ? 144  LYS C CA    1 
ATOM   3813 C  C     . LYS C 1 149 ? 11.930  -56.979 -4.525  1.00 78.21  ? 144  LYS C C     1 
ATOM   3814 O  O     . LYS C 1 149 ? 11.425  -57.068 -5.651  1.00 82.61  ? 144  LYS C O     1 
ATOM   3815 C  CB    . LYS C 1 149 ? 10.677  -59.081 -3.986  1.00 75.97  ? 144  LYS C CB    1 
ATOM   3816 C  CG    . LYS C 1 149 ? 10.545  -60.361 -3.202  1.00 75.16  ? 144  LYS C CG    1 
ATOM   3817 C  CD    . LYS C 1 149 ? 9.099   -60.807 -3.208  1.00 80.21  ? 144  LYS C CD    1 
ATOM   3818 C  CE    . LYS C 1 149 ? 8.890   -62.115 -2.455  1.00 86.96  ? 144  LYS C CE    1 
ATOM   3819 N  NZ    . LYS C 1 149 ? 8.638   -63.268 -3.366  1.00 84.31  ? 144  LYS C NZ    1 
ATOM   3820 N  N     . CYS C 1 150 ? 12.600  -55.908 -4.114  1.00 83.53  ? 145  CYS C N     1 
ATOM   3821 C  CA    . CYS C 1 150 ? 12.750  -54.709 -4.959  1.00 87.53  ? 145  CYS C CA    1 
ATOM   3822 C  C     . CYS C 1 150 ? 13.735  -54.948 -6.113  1.00 87.44  ? 145  CYS C C     1 
ATOM   3823 O  O     . CYS C 1 150 ? 13.674  -54.272 -7.140  1.00 95.16  ? 145  CYS C O     1 
ATOM   3824 C  CB    . CYS C 1 150 ? 13.224  -53.528 -4.121  1.00 82.24  ? 145  CYS C CB    1 
ATOM   3825 S  SG    . CYS C 1 150 ? 14.904  -53.796 -3.519  1.00 86.22  ? 145  CYS C SG    1 
ATOM   3826 N  N     . ASP C 1 151 ? 14.607  -55.934 -5.958  1.00 82.29  ? 146  ASP C N     1 
ATOM   3827 C  CA    . ASP C 1 151 ? 15.282  -56.526 -7.101  1.00 91.22  ? 146  ASP C CA    1 
ATOM   3828 C  C     . ASP C 1 151 ? 14.374  -57.009 -8.250  1.00 97.57  ? 146  ASP C C     1 
ATOM   3829 O  O     . ASP C 1 151 ? 14.884  -57.394 -9.295  1.00 120.93 ? 146  ASP C O     1 
ATOM   3830 C  CB    . ASP C 1 151 ? 16.151  -57.690 -6.641  1.00 94.71  ? 146  ASP C CB    1 
ATOM   3831 C  CG    . ASP C 1 151 ? 15.333  -58.844 -6.092  1.00 95.44  ? 146  ASP C CG    1 
ATOM   3832 O  OD1   . ASP C 1 151 ? 14.874  -58.739 -4.938  1.00 94.09  ? 146  ASP C OD1   1 
ATOM   3833 O  OD2   . ASP C 1 151 ? 15.152  -59.849 -6.809  1.00 92.97  ? 146  ASP C OD2   1 
ATOM   3834 N  N     . GLN C 1 152 ? 13.056  -57.013 -8.078  1.00 101.38 ? 147  GLN C N     1 
ATOM   3835 C  CA    . GLN C 1 152 ? 12.136  -57.419 -9.146  1.00 105.26 ? 147  GLN C CA    1 
ATOM   3836 C  C     . GLN C 1 152 ? 11.367  -56.240 -9.763  1.00 107.90 ? 147  GLN C C     1 
ATOM   3837 O  O     . GLN C 1 152 ? 11.556  -55.088 -9.374  1.00 100.76 ? 147  GLN C O     1 
ATOM   3838 C  CB    . GLN C 1 152 ? 11.148  -58.448 -8.603  1.00 103.73 ? 147  GLN C CB    1 
ATOM   3839 C  CG    . GLN C 1 152 ? 11.762  -59.789 -8.252  1.00 98.31  ? 147  GLN C CG    1 
ATOM   3840 C  CD    . GLN C 1 152 ? 10.686  -60.822 -7.932  1.00 100.89 ? 147  GLN C CD    1 
ATOM   3841 O  OE1   . GLN C 1 152 ? 9.507   -60.479 -7.730  1.00 100.05 ? 147  GLN C OE1   1 
ATOM   3842 N  NE2   . GLN C 1 152 ? 11.079  -62.088 -7.866  1.00 101.98 ? 147  GLN C NE2   1 
ATOM   3843 N  N     . ASN C 1 153 ? 10.513  -56.553 -10.742 1.00 116.14 ? 148  ASN C N     1 
ATOM   3844 C  CA    . ASN C 1 153 ? 9.694   -55.569 -11.460 1.00 118.72 ? 148  ASN C CA    1 
ATOM   3845 C  C     . ASN C 1 153 ? 8.381   -55.246 -10.757 1.00 116.22 ? 148  ASN C C     1 
ATOM   3846 O  O     . ASN C 1 153 ? 7.573   -56.147 -10.528 1.00 102.42 ? 148  ASN C O     1 
ATOM   3847 C  CB    . ASN C 1 153 ? 9.343   -56.111 -12.854 1.00 118.58 ? 148  ASN C CB    1 
ATOM   3848 C  CG    . ASN C 1 153 ? 10.563  -56.289 -13.748 1.00 116.32 ? 148  ASN C CG    1 
ATOM   3849 O  OD1   . ASN C 1 153 ? 10.945  -57.413 -14.067 1.00 112.84 ? 148  ASN C OD1   1 
ATOM   3850 N  ND2   . ASN C 1 153 ? 11.176  -55.184 -14.157 1.00 115.17 ? 148  ASN C ND2   1 
ATOM   3851 N  N     . LYS C 1 154 ? 8.167   -53.956 -10.479 1.00 121.33 ? 149  LYS C N     1 
ATOM   3852 C  CA    . LYS C 1 154 ? 6.917   -53.439 -9.892  1.00 124.09 ? 149  LYS C CA    1 
ATOM   3853 C  C     . LYS C 1 154 ? 5.642   -53.974 -10.584 1.00 118.56 ? 149  LYS C C     1 
ATOM   3854 O  O     . LYS C 1 154 ? 5.367   -53.643 -11.733 1.00 126.48 ? 149  LYS C O     1 
ATOM   3855 C  CB    . LYS C 1 154 ? 6.923   -51.892 -9.905  1.00 125.64 ? 149  LYS C CB    1 
ATOM   3856 C  CG    . LYS C 1 154 ? 7.867   -51.236 -8.893  1.00 131.78 ? 149  LYS C CG    1 
ATOM   3857 C  CD    . LYS C 1 154 ? 7.244   -50.047 -8.152  1.00 138.12 ? 149  LYS C CD    1 
ATOM   3858 C  CE    . LYS C 1 154 ? 8.173   -49.515 -7.061  1.00 144.18 ? 149  LYS C CE    1 
ATOM   3859 N  NZ    . LYS C 1 154 ? 7.475   -48.762 -5.977  1.00 147.01 ? 149  LYS C NZ    1 
ATOM   3860 N  N     . ASP C 1 155 ? 4.881   -54.790 -9.857  1.00 114.73 ? 150  ASP C N     1 
ATOM   3861 C  CA    . ASP C 1 155 ? 3.499   -55.169 -10.188 1.00 116.11 ? 150  ASP C CA    1 
ATOM   3862 C  C     . ASP C 1 155 ? 2.578   -53.942 -10.182 1.00 118.52 ? 150  ASP C C     1 
ATOM   3863 O  O     . ASP C 1 155 ? 1.657   -53.825 -10.995 1.00 109.48 ? 150  ASP C O     1 
ATOM   3864 C  CB    . ASP C 1 155 ? 3.013   -56.205 -9.153  1.00 117.66 ? 150  ASP C CB    1 
ATOM   3865 C  CG    . ASP C 1 155 ? 1.694   -56.875 -9.520  1.00 123.83 ? 150  ASP C CG    1 
ATOM   3866 O  OD1   . ASP C 1 155 ? 1.554   -57.351 -10.668 1.00 132.55 ? 150  ASP C OD1   1 
ATOM   3867 O  OD2   . ASP C 1 155 ? 0.802   -56.956 -8.642  1.00 115.87 ? 150  ASP C OD2   1 
ATOM   3868 N  N     . SER C 1 156 ? 2.829   -53.037 -9.244  1.00 127.61 ? 151  SER C N     1 
ATOM   3869 C  CA    . SER C 1 156 ? 2.143   -51.754 -9.170  1.00 132.90 ? 151  SER C CA    1 
ATOM   3870 C  C     . SER C 1 156 ? 3.170   -50.642 -9.356  1.00 138.34 ? 151  SER C C     1 
ATOM   3871 O  O     . SER C 1 156 ? 4.252   -50.670 -8.763  1.00 134.32 ? 151  SER C O     1 
ATOM   3872 C  CB    . SER C 1 156 ? 1.440   -51.613 -7.811  1.00 132.02 ? 151  SER C CB    1 
ATOM   3873 O  OG    . SER C 1 156 ? 0.760   -50.375 -7.704  1.00 114.20 ? 151  SER C OG    1 
ATOM   3874 N  N     . SER C 1 157 ? 2.824   -49.657 -10.175 1.00 145.55 ? 152  SER C N     1 
ATOM   3875 C  CA    . SER C 1 157 ? 3.478   -48.354 -10.118 1.00 149.34 ? 152  SER C CA    1 
ATOM   3876 C  C     . SER C 1 157 ? 2.767   -47.474 -9.093  1.00 145.77 ? 152  SER C C     1 
ATOM   3877 O  O     . SER C 1 157 ? 1.922   -46.642 -9.442  1.00 140.96 ? 152  SER C O     1 
ATOM   3878 C  CB    . SER C 1 157 ? 3.476   -47.696 -11.498 1.00 151.68 ? 152  SER C CB    1 
ATOM   3879 O  OG    . SER C 1 157 ? 2.151   -47.531 -11.968 1.00 153.55 ? 152  SER C OG    1 
ATOM   3880 N  N     . GLN C 1 158 ? 3.107   -47.688 -7.826  1.00 133.70 ? 153  GLN C N     1 
ATOM   3881 C  CA    . GLN C 1 158 ? 2.917   -46.682 -6.786  1.00 123.18 ? 153  GLN C CA    1 
ATOM   3882 C  C     . GLN C 1 158 ? 4.246   -46.012 -6.496  1.00 118.34 ? 153  GLN C C     1 
ATOM   3883 O  O     . GLN C 1 158 ? 5.305   -46.648 -6.497  1.00 100.48 ? 153  GLN C O     1 
ATOM   3884 C  CB    . GLN C 1 158 ? 2.335   -47.295 -5.508  1.00 126.81 ? 153  GLN C CB    1 
ATOM   3885 C  CG    . GLN C 1 158 ? 2.696   -48.763 -5.288  1.00 136.37 ? 153  GLN C CG    1 
ATOM   3886 C  CD    . GLN C 1 158 ? 2.361   -49.268 -3.899  1.00 128.29 ? 153  GLN C CD    1 
ATOM   3887 O  OE1   . GLN C 1 158 ? 2.248   -48.487 -2.957  1.00 124.78 ? 153  GLN C OE1   1 
ATOM   3888 N  NE2   . GLN C 1 158 ? 2.197   -50.585 -3.770  1.00 119.27 ? 153  GLN C NE2   1 
ATOM   3889 N  N     . SER C 1 159 ? 4.176   -44.710 -6.256  1.00 125.03 ? 154  SER C N     1 
ATOM   3890 C  CA    . SER C 1 159 ? 5.364   -43.897 -6.105  1.00 126.96 ? 154  SER C CA    1 
ATOM   3891 C  C     . SER C 1 159 ? 5.796   -44.043 -4.666  1.00 126.55 ? 154  SER C C     1 
ATOM   3892 O  O     . SER C 1 159 ? 4.945   -44.250 -3.792  1.00 125.36 ? 154  SER C O     1 
ATOM   3893 C  CB    . SER C 1 159 ? 5.072   -42.428 -6.415  1.00 122.22 ? 154  SER C CB    1 
ATOM   3894 O  OG    . SER C 1 159 ? 4.142   -41.891 -5.490  1.00 124.19 ? 154  SER C OG    1 
ATOM   3895 N  N     . PRO C 1 160 ? 7.108   -43.924 -4.409  1.00 118.99 ? 155  PRO C N     1 
ATOM   3896 C  CA    . PRO C 1 160 ? 7.588   -43.576 -3.076  1.00 119.45 ? 155  PRO C CA    1 
ATOM   3897 C  C     . PRO C 1 160 ? 6.762   -42.503 -2.356  1.00 119.63 ? 155  PRO C C     1 
ATOM   3898 O  O     . PRO C 1 160 ? 6.421   -42.676 -1.180  1.00 129.67 ? 155  PRO C O     1 
ATOM   3899 C  CB    . PRO C 1 160 ? 9.005   -43.081 -3.349  1.00 112.63 ? 155  PRO C CB    1 
ATOM   3900 C  CG    . PRO C 1 160 ? 9.448   -43.900 -4.517  1.00 110.84 ? 155  PRO C CG    1 
ATOM   3901 C  CD    . PRO C 1 160 ? 8.220   -44.155 -5.350  1.00 111.87 ? 155  PRO C CD    1 
ATOM   3902 N  N     . SER C 1 161 ? 6.412   -41.434 -3.065  1.00 116.14 ? 156  SER C N     1 
ATOM   3903 C  CA    . SER C 1 161 ? 5.623   -40.352 -2.469  1.00 114.45 ? 156  SER C CA    1 
ATOM   3904 C  C     . SER C 1 161 ? 4.249   -40.828 -1.917  1.00 118.96 ? 156  SER C C     1 
ATOM   3905 O  O     . SER C 1 161 ? 3.816   -40.381 -0.850  1.00 107.35 ? 156  SER C O     1 
ATOM   3906 C  CB    . SER C 1 161 ? 5.473   -39.181 -3.446  1.00 111.79 ? 156  SER C CB    1 
ATOM   3907 O  OG    . SER C 1 161 ? 4.835   -39.583 -4.641  1.00 111.03 ? 156  SER C OG    1 
ATOM   3908 N  N     . GLN C 1 162 ? 3.600   -41.775 -2.601  1.00 124.16 ? 157  GLN C N     1 
ATOM   3909 C  CA    . GLN C 1 162 ? 2.310   -42.336 -2.136  1.00 123.44 ? 157  GLN C CA    1 
ATOM   3910 C  C     . GLN C 1 162 ? 2.451   -43.236 -0.909  1.00 117.08 ? 157  GLN C C     1 
ATOM   3911 O  O     . GLN C 1 162 ? 1.621   -43.225 0.011   1.00 108.26 ? 157  GLN C O     1 
ATOM   3912 C  CB    . GLN C 1 162 ? 1.682   -43.176 -3.235  1.00 123.45 ? 157  GLN C CB    1 
ATOM   3913 C  CG    . GLN C 1 162 ? 1.085   -42.377 -4.365  1.00 120.53 ? 157  GLN C CG    1 
ATOM   3914 C  CD    . GLN C 1 162 ? 0.709   -43.282 -5.509  1.00 129.68 ? 157  GLN C CD    1 
ATOM   3915 O  OE1   . GLN C 1 162 ? -0.056  -44.225 -5.332  1.00 134.87 ? 157  GLN C OE1   1 
ATOM   3916 N  NE2   . GLN C 1 162 ? 1.273   -43.036 -6.677  1.00 141.48 ? 157  GLN C NE2   1 
ATOM   3917 N  N     . VAL C 1 163 ? 3.498   -44.049 -0.949  1.00 108.01 ? 158  VAL C N     1 
ATOM   3918 C  CA    . VAL C 1 163 ? 3.893   -44.891 0.161   1.00 102.19 ? 158  VAL C CA    1 
ATOM   3919 C  C     . VAL C 1 163 ? 4.234   -44.029 1.376   1.00 98.14  ? 158  VAL C C     1 
ATOM   3920 O  O     . VAL C 1 163 ? 3.845   -44.361 2.494   1.00 97.42  ? 158  VAL C O     1 
ATOM   3921 C  CB    . VAL C 1 163 ? 5.085   -45.794 -0.250  1.00 100.59 ? 158  VAL C CB    1 
ATOM   3922 C  CG1   . VAL C 1 163 ? 5.658   -46.556 0.932   1.00 99.75  ? 158  VAL C CG1   1 
ATOM   3923 C  CG2   . VAL C 1 163 ? 4.641   -46.774 -1.323  1.00 103.45 ? 158  VAL C CG2   1 
ATOM   3924 N  N     . ASP C 1 164 ? 4.937   -42.920 1.155   1.00 101.45 ? 159  ASP C N     1 
ATOM   3925 C  CA    . ASP C 1 164 ? 5.173   -41.934 2.220   1.00 104.36 ? 159  ASP C CA    1 
ATOM   3926 C  C     . ASP C 1 164 ? 3.859   -41.441 2.838   1.00 99.18  ? 159  ASP C C     1 
ATOM   3927 O  O     . ASP C 1 164 ? 3.751   -41.321 4.059   1.00 92.99  ? 159  ASP C O     1 
ATOM   3928 C  CB    . ASP C 1 164 ? 5.965   -40.717 1.705   1.00 105.85 ? 159  ASP C CB    1 
ATOM   3929 C  CG    . ASP C 1 164 ? 7.424   -41.032 1.421   1.00 105.63 ? 159  ASP C CG    1 
ATOM   3930 O  OD1   . ASP C 1 164 ? 8.045   -41.711 2.256   1.00 112.64 ? 159  ASP C OD1   1 
ATOM   3931 O  OD2   . ASP C 1 164 ? 7.955   -40.576 0.386   1.00 102.47 ? 159  ASP C OD2   1 
ATOM   3932 N  N     . GLN C 1 165 ? 2.875   -41.144 1.993   1.00 96.15  ? 160  GLN C N     1 
ATOM   3933 C  CA    . GLN C 1 165 ? 1.581   -40.683 2.479   1.00 104.82 ? 160  GLN C CA    1 
ATOM   3934 C  C     . GLN C 1 165 ? 0.921   -41.771 3.319   1.00 104.57 ? 160  GLN C C     1 
ATOM   3935 O  O     . GLN C 1 165 ? 0.618   -41.570 4.501   1.00 105.93 ? 160  GLN C O     1 
ATOM   3936 C  CB    . GLN C 1 165 ? 0.682   -40.232 1.324   1.00 115.62 ? 160  GLN C CB    1 
ATOM   3937 C  CG    . GLN C 1 165 ? -0.689  -39.690 1.726   1.00 121.76 ? 160  GLN C CG    1 
ATOM   3938 C  CD    . GLN C 1 165 ? -0.630  -38.686 2.883   1.00 132.48 ? 160  GLN C CD    1 
ATOM   3939 O  OE1   . GLN C 1 165 ? 0.262   -37.829 2.930   1.00 135.48 ? 160  GLN C OE1   1 
ATOM   3940 N  NE2   . GLN C 1 165 ? -1.564  -38.799 3.836   1.00 133.27 ? 160  GLN C NE2   1 
ATOM   3941 N  N     . PHE C 1 166 ? 0.762   -42.938 2.705   1.00 103.03 ? 161  PHE C N     1 
ATOM   3942 C  CA    . PHE C 1 166 ? 0.253   -44.144 3.373   1.00 95.86  ? 161  PHE C CA    1 
ATOM   3943 C  C     . PHE C 1 166 ? 0.788   -44.325 4.806   1.00 90.69  ? 161  PHE C C     1 
ATOM   3944 O  O     . PHE C 1 166 ? 0.008   -44.436 5.762   1.00 78.38  ? 161  PHE C O     1 
ATOM   3945 C  CB    . PHE C 1 166 ? 0.618   -45.359 2.513   1.00 92.84  ? 161  PHE C CB    1 
ATOM   3946 C  CG    . PHE C 1 166 ? 0.047   -46.655 3.010   1.00 90.73  ? 161  PHE C CG    1 
ATOM   3947 C  CD1   . PHE C 1 166 ? -1.253  -47.019 2.693   1.00 85.13  ? 161  PHE C CD1   1 
ATOM   3948 C  CD2   . PHE C 1 166 ? 0.815   -47.511 3.795   1.00 91.04  ? 161  PHE C CD2   1 
ATOM   3949 C  CE1   . PHE C 1 166 ? -1.786  -48.208 3.146   1.00 87.91  ? 161  PHE C CE1   1 
ATOM   3950 C  CE2   . PHE C 1 166 ? 0.286   -48.701 4.258   1.00 91.02  ? 161  PHE C CE2   1 
ATOM   3951 C  CZ    . PHE C 1 166 ? -1.018  -49.050 3.933   1.00 94.55  ? 161  PHE C CZ    1 
ATOM   3952 N  N     . CYS C 1 167 ? 2.118   -44.338 4.937   1.00 80.47  ? 162  CYS C N     1 
ATOM   3953 C  CA    . CYS C 1 167 ? 2.761   -44.527 6.225   1.00 76.29  ? 162  CYS C CA    1 
ATOM   3954 C  C     . CYS C 1 167 ? 2.291   -43.520 7.248   1.00 81.84  ? 162  CYS C C     1 
ATOM   3955 O  O     . CYS C 1 167 ? 1.937   -43.893 8.371   1.00 98.90  ? 162  CYS C O     1 
ATOM   3956 C  CB    . CYS C 1 167 ? 4.282   -44.461 6.109   1.00 73.82  ? 162  CYS C CB    1 
ATOM   3957 S  SG    . CYS C 1 167 ? 5.017   -45.884 5.263   1.00 79.51  ? 162  CYS C SG    1 
ATOM   3958 N  N     . LYS C 1 168 ? 2.264   -42.250 6.868   1.00 84.68  ? 163  LYS C N     1 
ATOM   3959 C  CA    . LYS C 1 168 ? 1.808   -41.213 7.776   1.00 93.53  ? 163  LYS C CA    1 
ATOM   3960 C  C     . LYS C 1 168 ? 0.334   -41.387 8.138   1.00 90.62  ? 163  LYS C C     1 
ATOM   3961 O  O     . LYS C 1 168 ? -0.061  -41.218 9.299   1.00 85.26  ? 163  LYS C O     1 
ATOM   3962 C  CB    . LYS C 1 168 ? 2.059   -39.845 7.163   1.00 111.09 ? 163  LYS C CB    1 
ATOM   3963 C  CG    . LYS C 1 168 ? 3.543   -39.567 6.989   1.00 126.04 ? 163  LYS C CG    1 
ATOM   3964 C  CD    . LYS C 1 168 ? 3.774   -38.113 6.657   1.00 136.70 ? 163  LYS C CD    1 
ATOM   3965 C  CE    . LYS C 1 168 ? 2.583   -37.589 5.863   1.00 144.10 ? 163  LYS C CE    1 
ATOM   3966 N  NZ    . LYS C 1 168 ? 2.775   -36.227 5.319   1.00 144.46 ? 163  LYS C NZ    1 
ATOM   3967 N  N     . GLU C 1 169 ? -0.474  -41.770 7.159   1.00 89.38  ? 164  GLU C N     1 
ATOM   3968 C  CA    . GLU C 1 169 ? -1.887  -41.973 7.406   1.00 96.88  ? 164  GLU C CA    1 
ATOM   3969 C  C     . GLU C 1 169 ? -2.221  -43.183 8.297   1.00 100.19 ? 164  GLU C C     1 
ATOM   3970 O  O     . GLU C 1 169 ? -3.287  -43.205 8.912   1.00 91.46  ? 164  GLU C O     1 
ATOM   3971 C  CB    . GLU C 1 169 ? -2.624  -42.100 6.086   1.00 106.99 ? 164  GLU C CB    1 
ATOM   3972 C  CG    . GLU C 1 169 ? -4.117  -41.829 6.201   1.00 114.88 ? 164  GLU C CG    1 
ATOM   3973 C  CD    . GLU C 1 169 ? -4.721  -41.431 4.871   1.00 118.89 ? 164  GLU C CD    1 
ATOM   3974 O  OE1   . GLU C 1 169 ? -4.229  -40.435 4.280   1.00 119.19 ? 164  GLU C OE1   1 
ATOM   3975 O  OE2   . GLU C 1 169 ? -5.663  -42.129 4.412   1.00 125.20 ? 164  GLU C OE2   1 
ATOM   3976 N  N     . HIS C 1 170 ? -1.333  -44.184 8.359   1.00 106.47 ? 165  HIS C N     1 
ATOM   3977 C  CA    . HIS C 1 170 ? -1.622  -45.451 9.064   1.00 96.58  ? 165  HIS C CA    1 
ATOM   3978 C  C     . HIS C 1 170 ? -0.569  -45.835 10.090  1.00 88.02  ? 165  HIS C C     1 
ATOM   3979 O  O     . HIS C 1 170 ? -0.391  -46.999 10.383  1.00 95.05  ? 165  HIS C O     1 
ATOM   3980 C  CB    . HIS C 1 170 ? -1.776  -46.578 8.056   1.00 93.42  ? 165  HIS C CB    1 
ATOM   3981 C  CG    . HIS C 1 170 ? -2.854  -46.322 7.057   1.00 93.93  ? 165  HIS C CG    1 
ATOM   3982 N  ND1   . HIS C 1 170 ? -4.191  -46.318 7.396   1.00 91.80  ? 165  HIS C ND1   1 
ATOM   3983 C  CD2   . HIS C 1 170 ? -2.796  -46.019 5.739   1.00 95.34  ? 165  HIS C CD2   1 
ATOM   3984 C  CE1   . HIS C 1 170 ? -4.912  -46.045 6.325   1.00 92.47  ? 165  HIS C CE1   1 
ATOM   3985 N  NE2   . HIS C 1 170 ? -4.089  -45.862 5.306   1.00 98.96  ? 165  HIS C NE2   1 
ATOM   3986 N  N     . GLY C 1 171 ? 0.090   -44.849 10.674  1.00 81.25  ? 166  GLY C N     1 
ATOM   3987 C  CA    . GLY C 1 171 ? 0.868   -45.072 11.871  1.00 77.15  ? 166  GLY C CA    1 
ATOM   3988 C  C     . GLY C 1 171 ? 2.083   -45.930 11.627  1.00 78.12  ? 166  GLY C C     1 
ATOM   3989 O  O     . GLY C 1 171 ? 2.533   -46.649 12.523  1.00 85.70  ? 166  GLY C O     1 
ATOM   3990 N  N     . PHE C 1 172 ? 2.655   -45.852 10.439  1.00 71.23  ? 167  PHE C N     1 
ATOM   3991 C  CA    . PHE C 1 172 ? 3.948   -46.486 10.238  1.00 74.54  ? 167  PHE C CA    1 
ATOM   3992 C  C     . PHE C 1 172 ? 5.069   -45.483 10.445  1.00 74.93  ? 167  PHE C C     1 
ATOM   3993 O  O     . PHE C 1 172 ? 5.087   -44.434 9.816   1.00 82.75  ? 167  PHE C O     1 
ATOM   3994 C  CB    . PHE C 1 172 ? 4.048   -47.056 8.838   1.00 78.34  ? 167  PHE C CB    1 
ATOM   3995 C  CG    . PHE C 1 172 ? 3.258   -48.315 8.639   1.00 76.75  ? 167  PHE C CG    1 
ATOM   3996 C  CD1   . PHE C 1 172 ? 1.922   -48.268 8.266   1.00 71.99  ? 167  PHE C CD1   1 
ATOM   3997 C  CD2   . PHE C 1 172 ? 3.855   -49.542 8.832   1.00 77.70  ? 167  PHE C CD2   1 
ATOM   3998 C  CE1   . PHE C 1 172 ? 1.200   -49.430 8.081   1.00 69.44  ? 167  PHE C CE1   1 
ATOM   3999 C  CE2   . PHE C 1 172 ? 3.138   -50.706 8.653   1.00 78.85  ? 167  PHE C CE2   1 
ATOM   4000 C  CZ    . PHE C 1 172 ? 1.808   -50.651 8.275   1.00 74.61  ? 167  PHE C CZ    1 
ATOM   4001 N  N     . ALA C 1 173 ? 6.010   -45.805 11.324  1.00 72.14  ? 168  ALA C N     1 
ATOM   4002 C  CA    . ALA C 1 173 ? 7.177   -44.939 11.556  1.00 75.33  ? 168  ALA C CA    1 
ATOM   4003 C  C     . ALA C 1 173 ? 8.069   -44.717 10.321  1.00 77.70  ? 168  ALA C C     1 
ATOM   4004 O  O     . ALA C 1 173 ? 8.855   -43.781 10.293  1.00 79.57  ? 168  ALA C O     1 
ATOM   4005 C  CB    . ALA C 1 173 ? 8.016   -45.499 12.699  1.00 78.46  ? 168  ALA C CB    1 
ATOM   4006 N  N     . GLY C 1 174 ? 7.988   -45.596 9.326   1.00 76.90  ? 169  GLY C N     1 
ATOM   4007 C  CA    . GLY C 1 174 ? 8.959   -45.569 8.249   1.00 73.41  ? 169  GLY C CA    1 
ATOM   4008 C  C     . GLY C 1 174 ? 8.634   -46.590 7.192   1.00 77.68  ? 169  GLY C C     1 
ATOM   4009 O  O     . GLY C 1 174 ? 7.584   -47.229 7.253   1.00 81.14  ? 169  GLY C O     1 
ATOM   4010 N  N     . TRP C 1 175 ? 9.531   -46.736 6.215   1.00 78.11  ? 170  TRP C N     1 
ATOM   4011 C  CA    . TRP C 1 175 ? 9.420   -47.772 5.183   1.00 76.21  ? 170  TRP C CA    1 
ATOM   4012 C  C     . TRP C 1 175 ? 10.696  -47.876 4.351   1.00 74.28  ? 170  TRP C C     1 
ATOM   4013 O  O     . TRP C 1 175 ? 11.494  -46.956 4.344   1.00 78.60  ? 170  TRP C O     1 
ATOM   4014 C  CB    . TRP C 1 175 ? 8.189   -47.533 4.290   1.00 84.03  ? 170  TRP C CB    1 
ATOM   4015 C  CG    . TRP C 1 175 ? 8.338   -46.480 3.238   1.00 93.82  ? 170  TRP C CG    1 
ATOM   4016 C  CD1   . TRP C 1 175 ? 8.148   -45.140 3.384   1.00 95.64  ? 170  TRP C CD1   1 
ATOM   4017 C  CD2   . TRP C 1 175 ? 8.671   -46.695 1.860   1.00 105.57 ? 170  TRP C CD2   1 
ATOM   4018 N  NE1   . TRP C 1 175 ? 8.348   -44.504 2.179   1.00 101.40 ? 170  TRP C NE1   1 
ATOM   4019 C  CE2   . TRP C 1 175 ? 8.681   -45.434 1.230   1.00 104.81 ? 170  TRP C CE2   1 
ATOM   4020 C  CE3   . TRP C 1 175 ? 8.962   -47.836 1.098   1.00 102.46 ? 170  TRP C CE3   1 
ATOM   4021 C  CZ2   . TRP C 1 175 ? 8.981   -45.281 -0.118  1.00 104.70 ? 170  TRP C CZ2   1 
ATOM   4022 C  CZ3   . TRP C 1 175 ? 9.254   -47.681 -0.242  1.00 102.47 ? 170  TRP C CZ3   1 
ATOM   4023 C  CH2   . TRP C 1 175 ? 9.265   -46.415 -0.837  1.00 106.20 ? 170  TRP C CH2   1 
ATOM   4024 N  N     . PHE C 1 176 ? 10.895  -49.006 3.675   1.00 73.52  ? 171  PHE C N     1 
ATOM   4025 C  CA    . PHE C 1 176 ? 12.125  -49.269 2.921   1.00 71.99  ? 171  PHE C CA    1 
ATOM   4026 C  C     . PHE C 1 176 ? 11.828  -50.231 1.768   1.00 71.63  ? 171  PHE C C     1 
ATOM   4027 O  O     . PHE C 1 176 ? 11.142  -51.224 1.948   1.00 68.86  ? 171  PHE C O     1 
ATOM   4028 C  CB    . PHE C 1 176 ? 13.189  -49.930 3.802   1.00 78.27  ? 171  PHE C CB    1 
ATOM   4029 C  CG    . PHE C 1 176 ? 13.642  -49.110 4.995   1.00 79.08  ? 171  PHE C CG    1 
ATOM   4030 C  CD1   . PHE C 1 176 ? 12.806  -48.896 6.078   1.00 86.05  ? 171  PHE C CD1   1 
ATOM   4031 C  CD2   . PHE C 1 176 ? 14.938  -48.623 5.061   1.00 78.93  ? 171  PHE C CD2   1 
ATOM   4032 C  CE1   . PHE C 1 176 ? 13.234  -48.162 7.174   1.00 85.46  ? 171  PHE C CE1   1 
ATOM   4033 C  CE2   . PHE C 1 176 ? 15.372  -47.890 6.148   1.00 76.68  ? 171  PHE C CE2   1 
ATOM   4034 C  CZ    . PHE C 1 176 ? 14.519  -47.658 7.204   1.00 83.60  ? 171  PHE C CZ    1 
ATOM   4035 N  N     . GLU C 1 177 ? 12.351  -49.948 0.585   1.00 79.43  ? 172  GLU C N     1 
ATOM   4036 C  CA    . GLU C 1 177 ? 12.494  -50.980 -0.444  1.00 89.10  ? 172  GLU C CA    1 
ATOM   4037 C  C     . GLU C 1 177 ? 13.576  -51.924 0.040   1.00 81.62  ? 172  GLU C C     1 
ATOM   4038 O  O     . GLU C 1 177 ? 14.673  -51.482 0.345   1.00 77.03  ? 172  GLU C O     1 
ATOM   4039 C  CB    . GLU C 1 177 ? 12.865  -50.375 -1.822  1.00 98.45  ? 172  GLU C CB    1 
ATOM   4040 C  CG    . GLU C 1 177 ? 11.911  -49.278 -2.328  1.00 108.04 ? 172  GLU C CG    1 
ATOM   4041 C  CD    . GLU C 1 177 ? 11.799  -49.212 -3.849  1.00 110.89 ? 172  GLU C CD    1 
ATOM   4042 O  OE1   . GLU C 1 177 ? 12.866  -49.199 -4.501  1.00 105.08 ? 172  GLU C OE1   1 
ATOM   4043 O  OE2   . GLU C 1 177 ? 10.652  -49.166 -4.390  1.00 121.85 ? 172  GLU C OE2   1 
ATOM   4044 N  N     . THR C 1 178 ? 13.256  -53.210 0.134   1.00 78.97  ? 173  THR C N     1 
ATOM   4045 C  CA    . THR C 1 178 ? 14.214  -54.200 0.614   1.00 78.54  ? 173  THR C CA    1 
ATOM   4046 C  C     . THR C 1 178 ? 14.387  -55.312 -0.382  1.00 74.08  ? 173  THR C C     1 
ATOM   4047 O  O     . THR C 1 178 ? 13.478  -55.594 -1.155  1.00 84.77  ? 173  THR C O     1 
ATOM   4048 C  CB    . THR C 1 178 ? 13.765  -54.860 1.933   1.00 84.83  ? 173  THR C CB    1 
ATOM   4049 O  OG1   . THR C 1 178 ? 12.498  -55.524 1.766   1.00 81.86  ? 173  THR C OG1   1 
ATOM   4050 C  CG2   . THR C 1 178 ? 13.664  -53.827 3.034   1.00 88.07  ? 173  THR C CG2   1 
ATOM   4051 N  N     . SER C 1 179 ? 15.528  -55.983 -0.325  1.00 68.22  ? 174  SER C N     1 
ATOM   4052 C  CA    . SER C 1 179 ? 15.665  -57.262 -0.992  1.00 72.38  ? 174  SER C CA    1 
ATOM   4053 C  C     . SER C 1 179 ? 16.447  -58.244 -0.150  1.00 75.58  ? 174  SER C C     1 
ATOM   4054 O  O     . SER C 1 179 ? 17.643  -58.081 0.075   1.00 68.56  ? 174  SER C O     1 
ATOM   4055 C  CB    . SER C 1 179 ? 16.351  -57.107 -2.343  1.00 72.60  ? 174  SER C CB    1 
ATOM   4056 O  OG    . SER C 1 179 ? 16.619  -58.377 -2.916  1.00 78.07  ? 174  SER C OG    1 
ATOM   4057 N  N     . ALA C 1 180 ? 15.767  -59.305 0.261   1.00 75.40  ? 175  ALA C N     1 
ATOM   4058 C  CA    . ALA C 1 180 ? 16.435  -60.464 0.815   1.00 77.55  ? 175  ALA C CA    1 
ATOM   4059 C  C     . ALA C 1 180 ? 17.405  -61.085 -0.167  1.00 77.38  ? 175  ALA C C     1 
ATOM   4060 O  O     . ALA C 1 180 ? 18.419  -61.620 0.252   1.00 73.86  ? 175  ALA C O     1 
ATOM   4061 C  CB    . ALA C 1 180 ? 15.419  -61.507 1.249   1.00 86.31  ? 175  ALA C CB    1 
ATOM   4062 N  N     . LYS C 1 181 ? 17.106  -61.046 -1.465  1.00 80.66  ? 176  LYS C N     1 
ATOM   4063 C  CA    . LYS C 1 181 ? 17.976  -61.715 -2.433  1.00 84.56  ? 176  LYS C CA    1 
ATOM   4064 C  C     . LYS C 1 181 ? 19.334  -61.019 -2.498  1.00 81.34  ? 176  LYS C C     1 
ATOM   4065 O  O     . LYS C 1 181 ? 20.375  -61.678 -2.432  1.00 71.37  ? 176  LYS C O     1 
ATOM   4066 C  CB    . LYS C 1 181 ? 17.358  -61.731 -3.816  1.00 84.46  ? 176  LYS C CB    1 
ATOM   4067 C  CG    . LYS C 1 181 ? 18.124  -62.611 -4.784  1.00 87.48  ? 176  LYS C CG    1 
ATOM   4068 C  CD    . LYS C 1 181 ? 17.893  -62.109 -6.217  1.00 96.44  ? 176  LYS C CD    1 
ATOM   4069 C  CE    . LYS C 1 181 ? 16.629  -62.693 -6.814  1.00 111.41 ? 176  LYS C CE    1 
ATOM   4070 N  NZ    . LYS C 1 181 ? 16.918  -64.049 -7.330  1.00 124.89 ? 176  LYS C NZ    1 
ATOM   4071 N  N     . ASP C 1 182 ? 19.287  -59.693 -2.625  1.00 79.98  ? 177  ASP C N     1 
ATOM   4072 C  CA    . ASP C 1 182 ? 20.444  -58.879 -2.975  1.00 83.89  ? 177  ASP C CA    1 
ATOM   4073 C  C     . ASP C 1 182 ? 20.835  -57.959 -1.819  1.00 80.49  ? 177  ASP C C     1 
ATOM   4074 O  O     . ASP C 1 182 ? 21.185  -56.814 -2.012  1.00 81.58  ? 177  ASP C O     1 
ATOM   4075 C  CB    . ASP C 1 182 ? 20.125  -58.037 -4.228  1.00 87.79  ? 177  ASP C CB    1 
ATOM   4076 C  CG    . ASP C 1 182 ? 20.126  -58.859 -5.507  1.00 91.21  ? 177  ASP C CG    1 
ATOM   4077 O  OD1   . ASP C 1 182 ? 20.868  -59.875 -5.570  1.00 102.59 ? 177  ASP C OD1   1 
ATOM   4078 O  OD2   . ASP C 1 182 ? 19.382  -58.494 -6.449  1.00 82.10  ? 177  ASP C OD2   1 
ATOM   4079 N  N     . ASN C 1 183 ? 20.760  -58.465 -0.610  1.00 76.15  ? 178  ASN C N     1 
ATOM   4080 C  CA    . ASN C 1 183 ? 20.907  -57.648 0.596   1.00 77.63  ? 178  ASN C CA    1 
ATOM   4081 C  C     . ASN C 1 183 ? 20.658  -56.144 0.525   1.00 71.02  ? 178  ASN C C     1 
ATOM   4082 O  O     . ASN C 1 183 ? 21.559  -55.383 0.795   1.00 88.34  ? 178  ASN C O     1 
ATOM   4083 C  CB    . ASN C 1 183 ? 22.308  -57.873 1.180   1.00 80.91  ? 178  ASN C CB    1 
ATOM   4084 C  CG    . ASN C 1 183 ? 22.353  -57.603 2.673   1.00 81.45  ? 178  ASN C CG    1 
ATOM   4085 O  OD1   . ASN C 1 183 ? 21.531  -56.845 3.196   1.00 88.17  ? 178  ASN C OD1   1 
ATOM   4086 N  ND2   . ASN C 1 183 ? 23.271  -58.251 3.375   1.00 83.38  ? 178  ASN C ND2   1 
ATOM   4087 N  N     . ILE C 1 184 ? 19.457  -55.692 0.220   1.00 70.38  ? 179  ILE C N     1 
ATOM   4088 C  CA    . ILE C 1 184 ? 19.210  -54.245 0.161   1.00 70.79  ? 179  ILE C CA    1 
ATOM   4089 C  C     . ILE C 1 184 ? 18.373  -53.734 1.318   1.00 72.22  ? 179  ILE C C     1 
ATOM   4090 O  O     . ILE C 1 184 ? 17.260  -54.207 1.539   1.00 76.75  ? 179  ILE C O     1 
ATOM   4091 C  CB    . ILE C 1 184 ? 18.495  -53.857 -1.131  1.00 74.07  ? 179  ILE C CB    1 
ATOM   4092 C  CG1   . ILE C 1 184 ? 19.445  -54.009 -2.313  1.00 75.30  ? 179  ILE C CG1   1 
ATOM   4093 C  CG2   . ILE C 1 184 ? 17.962  -52.435 -1.044  1.00 73.37  ? 179  ILE C CG2   1 
ATOM   4094 C  CD1   . ILE C 1 184 ? 18.749  -54.287 -3.628  1.00 78.19  ? 179  ILE C CD1   1 
ATOM   4095 N  N     . ASN C 1 185 ? 18.924  -52.764 2.047   1.00 73.31  ? 180  ASN C N     1 
ATOM   4096 C  CA    . ASN C 1 185 ? 18.186  -51.994 3.051   1.00 73.51  ? 180  ASN C CA    1 
ATOM   4097 C  C     . ASN C 1 185 ? 17.675  -52.743 4.293   1.00 75.01  ? 180  ASN C C     1 
ATOM   4098 O  O     . ASN C 1 185 ? 16.903  -52.211 5.101   1.00 64.65  ? 180  ASN C O     1 
ATOM   4099 C  CB    . ASN C 1 185 ? 17.039  -51.271 2.396   1.00 73.46  ? 180  ASN C CB    1 
ATOM   4100 C  CG    . ASN C 1 185 ? 17.466  -49.973 1.816   1.00 79.54  ? 180  ASN C CG    1 
ATOM   4101 O  OD1   . ASN C 1 185 ? 18.533  -49.451 2.149   1.00 87.19  ? 180  ASN C OD1   1 
ATOM   4102 N  ND2   . ASN C 1 185 ? 16.651  -49.436 0.934   1.00 85.56  ? 180  ASN C ND2   1 
ATOM   4103 N  N     . ILE C 1 186 ? 18.140  -53.966 4.473   1.00 79.16  ? 181  ILE C N     1 
ATOM   4104 C  CA    . ILE C 1 186 ? 17.679  -54.751 5.588   1.00 79.46  ? 181  ILE C CA    1 
ATOM   4105 C  C     . ILE C 1 186 ? 18.384  -54.239 6.850   1.00 79.47  ? 181  ILE C C     1 
ATOM   4106 O  O     . ILE C 1 186 ? 17.728  -53.801 7.795   1.00 69.17  ? 181  ILE C O     1 
ATOM   4107 C  CB    . ILE C 1 186 ? 17.930  -56.240 5.306   1.00 79.62  ? 181  ILE C CB    1 
ATOM   4108 C  CG1   . ILE C 1 186 ? 16.963  -56.705 4.214   1.00 76.29  ? 181  ILE C CG1   1 
ATOM   4109 C  CG2   . ILE C 1 186 ? 17.755  -57.055 6.574   1.00 84.58  ? 181  ILE C CG2   1 
ATOM   4110 C  CD1   . ILE C 1 186 ? 17.235  -58.094 3.711   1.00 79.91  ? 181  ILE C CD1   1 
ATOM   4111 N  N     . GLU C 1 187 ? 19.719  -54.233 6.813   1.00 81.95  ? 182  GLU C N     1 
ATOM   4112 C  CA    . GLU C 1 187 ? 20.539  -53.637 7.870   1.00 72.72  ? 182  GLU C CA    1 
ATOM   4113 C  C     . GLU C 1 187 ? 19.978  -52.290 8.309   1.00 68.33  ? 182  GLU C C     1 
ATOM   4114 O  O     . GLU C 1 187 ? 19.893  -51.988 9.503   1.00 59.50  ? 182  GLU C O     1 
ATOM   4115 C  CB    . GLU C 1 187 ? 21.979  -53.507 7.380   1.00 77.44  ? 182  GLU C CB    1 
ATOM   4116 C  CG    . GLU C 1 187 ? 22.747  -54.835 7.359   1.00 89.94  ? 182  GLU C CG    1 
ATOM   4117 C  CD    . GLU C 1 187 ? 23.176  -55.297 8.754   1.00 101.77 ? 182  GLU C CD    1 
ATOM   4118 O  OE1   . GLU C 1 187 ? 22.914  -54.573 9.744   1.00 115.61 ? 182  GLU C OE1   1 
ATOM   4119 O  OE2   . GLU C 1 187 ? 23.778  -56.388 8.876   1.00 101.42 ? 182  GLU C OE2   1 
ATOM   4120 N  N     . GLU C 1 188 ? 19.564  -51.498 7.324   1.00 67.78  ? 183  GLU C N     1 
ATOM   4121 C  CA    . GLU C 1 188 ? 19.172  -50.108 7.538   1.00 75.88  ? 183  GLU C CA    1 
ATOM   4122 C  C     . GLU C 1 188 ? 17.849  -50.063 8.248   1.00 67.90  ? 183  GLU C C     1 
ATOM   4123 O  O     . GLU C 1 188 ? 17.694  -49.352 9.235   1.00 76.16  ? 183  GLU C O     1 
ATOM   4124 C  CB    . GLU C 1 188 ? 19.077  -49.329 6.205   1.00 82.87  ? 183  GLU C CB    1 
ATOM   4125 C  CG    . GLU C 1 188 ? 20.417  -48.983 5.539   1.00 87.46  ? 183  GLU C CG    1 
ATOM   4126 C  CD    . GLU C 1 188 ? 21.102  -50.160 4.837   1.00 93.93  ? 183  GLU C CD    1 
ATOM   4127 O  OE1   . GLU C 1 188 ? 20.735  -51.338 5.067   1.00 111.43 ? 183  GLU C OE1   1 
ATOM   4128 O  OE2   . GLU C 1 188 ? 22.030  -49.920 4.048   1.00 96.37  ? 183  GLU C OE2   1 
ATOM   4129 N  N     . ALA C 1 189 ? 16.900  -50.825 7.732   1.00 68.83  ? 184  ALA C N     1 
ATOM   4130 C  CA    . ALA C 1 189 ? 15.549  -50.897 8.321   1.00 67.33  ? 184  ALA C CA    1 
ATOM   4131 C  C     . ALA C 1 189 ? 15.565  -51.449 9.735   1.00 58.99  ? 184  ALA C C     1 
ATOM   4132 O  O     . ALA C 1 189 ? 14.864  -50.937 10.599  1.00 53.14  ? 184  ALA C O     1 
ATOM   4133 C  CB    . ALA C 1 189 ? 14.626  -51.729 7.445   1.00 63.74  ? 184  ALA C CB    1 
ATOM   4134 N  N     . ALA C 1 190 ? 16.380  -52.479 9.957   1.00 59.55  ? 185  ALA C N     1 
ATOM   4135 C  CA    . ALA C 1 190 ? 16.631  -53.009 11.299  1.00 65.79  ? 185  ALA C CA    1 
ATOM   4136 C  C     . ALA C 1 190 ? 17.070  -51.915 12.249  1.00 68.77  ? 185  ALA C C     1 
ATOM   4137 O  O     . ALA C 1 190 ? 16.454  -51.693 13.297  1.00 66.62  ? 185  ALA C O     1 
ATOM   4138 C  CB    . ALA C 1 190 ? 17.689  -54.115 11.265  1.00 69.10  ? 185  ALA C CB    1 
ATOM   4139 N  N     . ARG C 1 191 ? 18.137  -51.230 11.858  1.00 73.57  ? 186  ARG C N     1 
ATOM   4140 C  CA    . ARG C 1 191 ? 18.680  -50.174 12.661  1.00 72.99  ? 186  ARG C CA    1 
ATOM   4141 C  C     . ARG C 1 191 ? 17.607  -49.116 12.917  1.00 68.81  ? 186  ARG C C     1 
ATOM   4142 O  O     . ARG C 1 191 ? 17.410  -48.729 14.062  1.00 69.31  ? 186  ARG C O     1 
ATOM   4143 C  CB    . ARG C 1 191 ? 19.941  -49.628 12.010  1.00 81.26  ? 186  ARG C CB    1 
ATOM   4144 C  CG    . ARG C 1 191 ? 20.623  -48.497 12.769  1.00 100.31 ? 186  ARG C CG    1 
ATOM   4145 C  CD    . ARG C 1 191 ? 22.021  -48.173 12.255  1.00 112.83 ? 186  ARG C CD    1 
ATOM   4146 N  NE    . ARG C 1 191 ? 23.027  -48.676 13.201  1.00 120.00 ? 186  ARG C NE    1 
ATOM   4147 C  CZ    . ARG C 1 191 ? 23.728  -49.804 13.057  1.00 124.89 ? 186  ARG C CZ    1 
ATOM   4148 N  NH1   . ARG C 1 191 ? 23.590  -50.566 11.970  1.00 129.39 ? 186  ARG C NH1   1 
ATOM   4149 N  NH2   . ARG C 1 191 ? 24.590  -50.170 14.006  1.00 119.90 ? 186  ARG C NH2   1 
ATOM   4150 N  N     . PHE C 1 192 ? 16.895  -48.683 11.869  1.00 62.01  ? 187  PHE C N     1 
ATOM   4151 C  CA    . PHE C 1 192 ? 15.866  -47.657 12.002  1.00 66.43  ? 187  PHE C CA    1 
ATOM   4152 C  C     . PHE C 1 192 ? 14.890  -48.042 13.090  1.00 72.00  ? 187  PHE C C     1 
ATOM   4153 O  O     . PHE C 1 192 ? 14.482  -47.196 13.909  1.00 77.94  ? 187  PHE C O     1 
ATOM   4154 C  CB    . PHE C 1 192 ? 15.114  -47.423 10.677  1.00 68.22  ? 187  PHE C CB    1 
ATOM   4155 C  CG    . PHE C 1 192 ? 13.989  -46.409 10.771  1.00 69.30  ? 187  PHE C CG    1 
ATOM   4156 C  CD1   . PHE C 1 192 ? 14.228  -45.072 10.557  1.00 71.58  ? 187  PHE C CD1   1 
ATOM   4157 C  CD2   . PHE C 1 192 ? 12.687  -46.797 11.082  1.00 76.01  ? 187  PHE C CD2   1 
ATOM   4158 C  CE1   . PHE C 1 192 ? 13.198  -44.140 10.655  1.00 79.48  ? 187  PHE C CE1   1 
ATOM   4159 C  CE2   . PHE C 1 192 ? 11.645  -45.865 11.187  1.00 79.17  ? 187  PHE C CE2   1 
ATOM   4160 C  CZ    . PHE C 1 192 ? 11.905  -44.532 10.973  1.00 78.10  ? 187  PHE C CZ    1 
ATOM   4161 N  N     . LEU C 1 193 ? 14.473  -49.304 13.065  1.00 77.46  ? 188  LEU C N     1 
ATOM   4162 C  CA    . LEU C 1 193 ? 13.444  -49.768 13.974  1.00 77.73  ? 188  LEU C CA    1 
ATOM   4163 C  C     . LEU C 1 193 ? 14.017  -49.772 15.380  1.00 83.79  ? 188  LEU C C     1 
ATOM   4164 O  O     . LEU C 1 193 ? 13.444  -49.159 16.280  1.00 88.99  ? 188  LEU C O     1 
ATOM   4165 C  CB    . LEU C 1 193 ? 12.956  -51.158 13.582  1.00 68.90  ? 188  LEU C CB    1 
ATOM   4166 C  CG    . LEU C 1 193 ? 11.889  -51.762 14.508  1.00 68.85  ? 188  LEU C CG    1 
ATOM   4167 C  CD1   . LEU C 1 193 ? 10.752  -50.801 14.848  1.00 67.64  ? 188  LEU C CD1   1 
ATOM   4168 C  CD2   . LEU C 1 193 ? 11.327  -53.035 13.893  1.00 68.88  ? 188  LEU C CD2   1 
ATOM   4169 N  N     . VAL C 1 194 ? 15.170  -50.418 15.553  1.00 77.69  ? 189  VAL C N     1 
ATOM   4170 C  CA    . VAL C 1 194 ? 15.808  -50.492 16.875  1.00 83.14  ? 189  VAL C CA    1 
ATOM   4171 C  C     . VAL C 1 194 ? 15.978  -49.124 17.582  1.00 84.08  ? 189  VAL C C     1 
ATOM   4172 O  O     . VAL C 1 194 ? 15.695  -48.988 18.770  1.00 74.72  ? 189  VAL C O     1 
ATOM   4173 C  CB    . VAL C 1 194 ? 17.212  -51.144 16.792  1.00 80.12  ? 189  VAL C CB    1 
ATOM   4174 C  CG1   . VAL C 1 194 ? 18.008  -50.955 18.082  1.00 83.76  ? 189  VAL C CG1   1 
ATOM   4175 C  CG2   . VAL C 1 194 ? 17.089  -52.610 16.504  1.00 71.60  ? 189  VAL C CG2   1 
ATOM   4176 N  N     . GLU C 1 195 ? 16.486  -48.144 16.844  1.00 80.99  ? 190  GLU C N     1 
ATOM   4177 C  CA    . GLU C 1 195 ? 16.522  -46.760 17.289  1.00 83.86  ? 190  GLU C CA    1 
ATOM   4178 C  C     . GLU C 1 195 ? 15.195  -46.328 17.874  1.00 75.24  ? 190  GLU C C     1 
ATOM   4179 O  O     . GLU C 1 195 ? 15.135  -45.840 18.996  1.00 71.56  ? 190  GLU C O     1 
ATOM   4180 C  CB    . GLU C 1 195 ? 16.826  -45.848 16.104  1.00 105.70 ? 190  GLU C CB    1 
ATOM   4181 C  CG    . GLU C 1 195 ? 18.282  -45.453 15.897  1.00 118.19 ? 190  GLU C CG    1 
ATOM   4182 C  CD    . GLU C 1 195 ? 18.505  -44.829 14.518  1.00 130.12 ? 190  GLU C CD    1 
ATOM   4183 O  OE1   . GLU C 1 195 ? 17.606  -44.079 14.036  1.00 126.87 ? 190  GLU C OE1   1 
ATOM   4184 O  OE2   . GLU C 1 195 ? 19.577  -45.088 13.914  1.00 121.99 ? 190  GLU C OE2   1 
ATOM   4185 N  N     . LYS C 1 196 ? 14.132  -46.490 17.094  1.00 67.95  ? 191  LYS C N     1 
ATOM   4186 C  CA    . LYS C 1 196 ? 12.819  -46.025 17.492  1.00 69.98  ? 191  LYS C CA    1 
ATOM   4187 C  C     . LYS C 1 196 ? 12.447  -46.693 18.798  1.00 71.37  ? 191  LYS C C     1 
ATOM   4188 O  O     . LYS C 1 196 ? 11.834  -46.069 19.682  1.00 76.38  ? 191  LYS C O     1 
ATOM   4189 C  CB    . LYS C 1 196 ? 11.779  -46.370 16.415  1.00 71.75  ? 191  LYS C CB    1 
ATOM   4190 C  CG    . LYS C 1 196 ? 10.406  -45.793 16.675  1.00 74.82  ? 191  LYS C CG    1 
ATOM   4191 C  CD    . LYS C 1 196 ? 10.154  -44.527 15.906  1.00 86.95  ? 191  LYS C CD    1 
ATOM   4192 C  CE    . LYS C 1 196 ? 8.688   -44.120 15.994  1.00 91.67  ? 191  LYS C CE    1 
ATOM   4193 N  NZ    . LYS C 1 196 ? 8.369   -43.451 17.282  1.00 92.46  ? 191  LYS C NZ    1 
ATOM   4194 N  N     . ILE C 1 197 ? 12.781  -47.980 18.890  1.00 69.78  ? 192  ILE C N     1 
ATOM   4195 C  CA    . ILE C 1 197 ? 12.466  -48.790 20.057  1.00 73.17  ? 192  ILE C CA    1 
ATOM   4196 C  C     . ILE C 1 197 ? 13.222  -48.281 21.264  1.00 70.61  ? 192  ILE C C     1 
ATOM   4197 O  O     . ILE C 1 197 ? 12.633  -48.107 22.326  1.00 74.79  ? 192  ILE C O     1 
ATOM   4198 C  CB    . ILE C 1 197 ? 12.792  -50.274 19.812  1.00 72.46  ? 192  ILE C CB    1 
ATOM   4199 C  CG1   . ILE C 1 197 ? 11.670  -50.917 18.991  1.00 75.36  ? 192  ILE C CG1   1 
ATOM   4200 C  CG2   . ILE C 1 197 ? 12.960  -51.042 21.122  1.00 72.10  ? 192  ILE C CG2   1 
ATOM   4201 C  CD1   . ILE C 1 197 ? 12.112  -52.139 18.222  1.00 76.72  ? 192  ILE C CD1   1 
ATOM   4202 N  N     . LEU C 1 198 ? 14.511  -48.015 21.090  1.00 71.78  ? 193  LEU C N     1 
ATOM   4203 C  CA    . LEU C 1 198 ? 15.351  -47.496 22.181  1.00 69.73  ? 193  LEU C CA    1 
ATOM   4204 C  C     . LEU C 1 198 ? 14.873  -46.142 22.710  1.00 81.57  ? 193  LEU C C     1 
ATOM   4205 O  O     . LEU C 1 198 ? 14.845  -45.900 23.921  1.00 97.05  ? 193  LEU C O     1 
ATOM   4206 C  CB    . LEU C 1 198 ? 16.794  -47.366 21.721  1.00 59.32  ? 193  LEU C CB    1 
ATOM   4207 C  CG    . LEU C 1 198 ? 17.526  -48.698 21.736  1.00 58.97  ? 193  LEU C CG    1 
ATOM   4208 C  CD1   . LEU C 1 198 ? 18.743  -48.670 20.836  1.00 61.13  ? 193  LEU C CD1   1 
ATOM   4209 C  CD2   . LEU C 1 198 ? 17.929  -49.082 23.147  1.00 56.88  ? 193  LEU C CD2   1 
ATOM   4210 N  N     . VAL C 1 199 ? 14.460  -45.285 21.792  1.00 82.15  ? 194  VAL C N     1 
ATOM   4211 C  CA    . VAL C 1 199 ? 13.871  -44.020 22.143  1.00 78.49  ? 194  VAL C CA    1 
ATOM   4212 C  C     . VAL C 1 199 ? 12.599  -44.161 23.004  1.00 81.12  ? 194  VAL C C     1 
ATOM   4213 O  O     . VAL C 1 199 ? 12.355  -43.310 23.862  1.00 88.40  ? 194  VAL C O     1 
ATOM   4214 C  CB    . VAL C 1 199 ? 13.618  -43.212 20.854  1.00 82.25  ? 194  VAL C CB    1 
ATOM   4215 C  CG1   . VAL C 1 199 ? 12.584  -42.098 21.063  1.00 85.48  ? 194  VAL C CG1   1 
ATOM   4216 C  CG2   . VAL C 1 199 ? 14.952  -42.683 20.334  1.00 72.97  ? 194  VAL C CG2   1 
ATOM   4217 N  N     . ASN C 1 200 ? 11.787  -45.200 22.784  1.00 81.62  ? 195  ASN C N     1 
ATOM   4218 C  CA    . ASN C 1 200 ? 10.613  -45.452 23.648  1.00 92.72  ? 195  ASN C CA    1 
ATOM   4219 C  C     . ASN C 1 200 ? 11.017  -45.939 25.046  1.00 103.49 ? 195  ASN C C     1 
ATOM   4220 O  O     . ASN C 1 200 ? 10.342  -45.622 26.029  1.00 108.66 ? 195  ASN C O     1 
ATOM   4221 C  CB    . ASN C 1 200 ? 9.635   -46.478 23.029  1.00 97.20  ? 195  ASN C CB    1 
ATOM   4222 C  CG    . ASN C 1 200 ? 9.120   -46.070 21.655  1.00 93.09  ? 195  ASN C CG    1 
ATOM   4223 O  OD1   . ASN C 1 200 ? 8.843   -44.902 21.401  1.00 78.70  ? 195  ASN C OD1   1 
ATOM   4224 N  ND2   . ASN C 1 200 ? 8.937   -47.060 20.776  1.00 101.80 ? 195  ASN C ND2   1 
ATOM   4225 N  N     . HIS C 1 201 ? 12.082  -46.753 25.099  1.00 113.35 ? 196  HIS C N     1 
ATOM   4226 C  CA    . HIS C 1 201 ? 12.537  -47.443 26.326  1.00 110.49 ? 196  HIS C CA    1 
ATOM   4227 C  C     . HIS C 1 201 ? 13.526  -46.599 27.108  1.00 109.72 ? 196  HIS C C     1 
ATOM   4228 O  O     . HIS C 1 201 ? 14.184  -47.119 28.002  1.00 125.86 ? 196  HIS C O     1 
ATOM   4229 C  CB    . HIS C 1 201 ? 13.125  -48.846 25.996  1.00 112.50 ? 196  HIS C CB    1 
ATOM   4230 C  CG    . HIS C 1 201 ? 12.076  -49.918 25.814  1.00 128.76 ? 196  HIS C CG    1 
ATOM   4231 N  ND1   . HIS C 1 201 ? 11.858  -50.928 26.733  1.00 130.07 ? 196  HIS C ND1   1 
ATOM   4232 C  CD2   . HIS C 1 201 ? 11.171  -50.119 24.822  1.00 122.14 ? 196  HIS C CD2   1 
ATOM   4233 C  CE1   . HIS C 1 201 ? 10.873  -51.704 26.310  1.00 120.56 ? 196  HIS C CE1   1 
ATOM   4234 N  NE2   . HIS C 1 201 ? 10.436  -51.232 25.156  1.00 115.03 ? 196  HIS C NE2   1 
ATOM   4235 N  N     . GLN C 1 202 ? 13.623  -45.306 26.774  1.00 113.42 ? 197  GLN C N     1 
ATOM   4236 C  CA    . GLN C 1 202 ? 14.135  -44.254 27.698  1.00 124.16 ? 197  GLN C CA    1 
ATOM   4237 C  C     . GLN C 1 202 ? 13.085  -43.296 28.306  1.00 126.70 ? 197  GLN C C     1 
ATOM   4238 O  O     . GLN C 1 202 ? 13.430  -42.454 29.153  1.00 132.53 ? 197  GLN C O     1 
ATOM   4239 C  CB    . GLN C 1 202 ? 15.198  -43.401 26.993  1.00 125.69 ? 197  GLN C CB    1 
ATOM   4240 C  CG    . GLN C 1 202 ? 14.633  -42.508 25.889  1.00 124.46 ? 197  GLN C CG    1 
ATOM   4241 C  CD    . GLN C 1 202 ? 15.644  -41.507 25.356  1.00 108.04 ? 197  GLN C CD    1 
ATOM   4242 O  OE1   . GLN C 1 202 ? 16.804  -41.843 25.128  1.00 95.83  ? 197  GLN C OE1   1 
ATOM   4243 N  NE2   . GLN C 1 202 ? 15.204  -40.273 25.153  1.00 98.43  ? 197  GLN C NE2   1 
ATOM   4244 N  N     . SER C 1 203 ? 11.835  -43.405 27.855  1.00 119.78 ? 198  SER C N     1 
ATOM   4245 C  CA    . SER C 1 203 ? 10.779  -42.459 28.204  1.00 113.44 ? 198  SER C CA    1 
ATOM   4246 C  C     . SER C 1 203 ? 9.430   -43.141 28.277  1.00 102.37 ? 198  SER C C     1 
ATOM   4247 O  O     . SER C 1 203 ? 9.338   -44.237 28.806  1.00 95.70  ? 198  SER C O     1 
ATOM   4248 C  CB    . SER C 1 203 ? 10.730  -41.370 27.164  1.00 114.67 ? 198  SER C CB    1 
ATOM   4249 O  OG    . SER C 1 203 ? 10.348  -41.920 25.916  1.00 117.81 ? 198  SER C OG    1 
ATOM   4250 N  N     . SER D 2 9   ? -22.542 -13.838 -16.521 1.00 105.97 ? 452  SER D N     1 
ATOM   4251 C  CA    . SER D 2 9   ? -21.474 -13.036 -17.189 1.00 103.63 ? 452  SER D CA    1 
ATOM   4252 C  C     . SER D 2 9   ? -20.232 -12.947 -16.275 1.00 105.32 ? 452  SER D C     1 
ATOM   4253 O  O     . SER D 2 9   ? -20.361 -12.627 -15.082 1.00 98.10  ? 452  SER D O     1 
ATOM   4254 C  CB    . SER D 2 9   ? -21.999 -11.637 -17.594 1.00 100.76 ? 452  SER D CB    1 
ATOM   4255 O  OG    . SER D 2 9   ? -23.083 -11.196 -16.783 1.00 91.52  ? 452  SER D OG    1 
ATOM   4256 N  N     . VAL D 2 10  ? -19.055 -13.279 -16.833 1.00 100.48 ? 453  VAL D N     1 
ATOM   4257 C  CA    . VAL D 2 10  ? -17.778 -13.295 -16.092 1.00 101.72 ? 453  VAL D CA    1 
ATOM   4258 C  C     . VAL D 2 10  ? -16.925 -12.118 -16.541 1.00 100.29 ? 453  VAL D C     1 
ATOM   4259 O  O     . VAL D 2 10  ? -17.206 -11.416 -17.526 1.00 86.90  ? 453  VAL D O     1 
ATOM   4260 C  CB    . VAL D 2 10  ? -16.938 -14.638 -16.269 1.00 102.60 ? 453  VAL D CB    1 
ATOM   4261 C  CG1   . VAL D 2 10  ? -15.814 -14.477 -17.302 1.00 101.88 ? 453  VAL D CG1   1 
ATOM   4262 C  CG2   . VAL D 2 10  ? -16.334 -15.128 -14.938 1.00 90.96  ? 453  VAL D CG2   1 
ATOM   4263 N  N     . VAL D 2 11  ? -15.849 -11.950 -15.785 1.00 97.97  ? 454  VAL D N     1 
ATOM   4264 C  CA    . VAL D 2 11  ? -14.896 -10.876 -15.958 1.00 90.29  ? 454  VAL D CA    1 
ATOM   4265 C  C     . VAL D 2 11  ? -14.350 -10.747 -17.407 1.00 85.91  ? 454  VAL D C     1 
ATOM   4266 O  O     . VAL D 2 11  ? -14.405 -11.698 -18.213 1.00 78.94  ? 454  VAL D O     1 
ATOM   4267 C  CB    . VAL D 2 11  ? -13.785 -10.998 -14.872 1.00 85.40  ? 454  VAL D CB    1 
ATOM   4268 C  CG1   . VAL D 2 11  ? -12.962 -12.254 -15.052 1.00 79.47  ? 454  VAL D CG1   1 
ATOM   4269 C  CG2   . VAL D 2 11  ? -12.904 -9.761  -14.836 1.00 90.19  ? 454  VAL D CG2   1 
ATOM   4270 N  N     . THR D 2 12  ? -13.912 -9.527  -17.732 1.00 75.60  ? 455  THR D N     1 
ATOM   4271 C  CA    . THR D 2 12  ? -13.093 -9.255  -18.898 1.00 73.14  ? 455  THR D CA    1 
ATOM   4272 C  C     . THR D 2 12  ? -11.764 -8.611  -18.475 1.00 73.75  ? 455  THR D C     1 
ATOM   4273 O  O     . THR D 2 12  ? -11.697 -7.406  -18.195 1.00 75.21  ? 455  THR D O     1 
ATOM   4274 C  CB    . THR D 2 12  ? -13.818 -8.339  -19.908 1.00 70.80  ? 455  THR D CB    1 
ATOM   4275 O  OG1   . THR D 2 12  ? -13.905 -7.008  -19.401 1.00 67.74  ? 455  THR D OG1   1 
ATOM   4276 C  CG2   . THR D 2 12  ? -15.232 -8.864  -20.216 1.00 72.10  ? 455  THR D CG2   1 
ATOM   4277 N  N     . PRO D 2 13  ? -10.696 -9.415  -18.432 1.00 62.99  ? 456  PRO D N     1 
ATOM   4278 C  CA    . PRO D 2 13  ? -9.430  -8.902  -17.946 1.00 57.50  ? 456  PRO D CA    1 
ATOM   4279 C  C     . PRO D 2 13  ? -8.694  -7.945  -18.905 1.00 51.89  ? 456  PRO D C     1 
ATOM   4280 O  O     . PRO D 2 13  ? -7.687  -7.339  -18.502 1.00 55.27  ? 456  PRO D O     1 
ATOM   4281 C  CB    . PRO D 2 13  ? -8.623  -10.172 -17.713 1.00 57.16  ? 456  PRO D CB    1 
ATOM   4282 C  CG    . PRO D 2 13  ? -9.144  -11.136 -18.702 1.00 61.47  ? 456  PRO D CG    1 
ATOM   4283 C  CD    . PRO D 2 13  ? -10.605 -10.823 -18.850 1.00 62.13  ? 456  PRO D CD    1 
ATOM   4284 N  N     . PHE D 2 14  ? -9.199  -7.804  -20.133 1.00 45.77  ? 457  PHE D N     1 
ATOM   4285 C  CA    . PHE D 2 14  ? -8.541  -6.996  -21.178 1.00 46.36  ? 457  PHE D CA    1 
ATOM   4286 C  C     . PHE D 2 14  ? -9.142  -5.613  -21.345 1.00 47.71  ? 457  PHE D C     1 
ATOM   4287 O  O     . PHE D 2 14  ? -8.690  -4.808  -22.158 1.00 46.47  ? 457  PHE D O     1 
ATOM   4288 C  CB    . PHE D 2 14  ? -8.622  -7.698  -22.521 1.00 45.28  ? 457  PHE D CB    1 
ATOM   4289 C  CG    . PHE D 2 14  ? -10.002 -8.127  -22.890 1.00 48.78  ? 457  PHE D CG    1 
ATOM   4290 C  CD1   . PHE D 2 14  ? -10.950 -7.184  -23.298 1.00 50.90  ? 457  PHE D CD1   1 
ATOM   4291 C  CD2   . PHE D 2 14  ? -10.365 -9.485  -22.853 1.00 47.55  ? 457  PHE D CD2   1 
ATOM   4292 C  CE1   . PHE D 2 14  ? -12.239 -7.582  -23.654 1.00 50.49  ? 457  PHE D CE1   1 
ATOM   4293 C  CE2   . PHE D 2 14  ? -11.641 -9.883  -23.205 1.00 47.54  ? 457  PHE D CE2   1 
ATOM   4294 C  CZ    . PHE D 2 14  ? -12.581 -8.935  -23.606 1.00 48.70  ? 457  PHE D CZ    1 
ATOM   4295 N  N     . SER D 2 15  ? -10.206 -5.367  -20.602 1.00 49.73  ? 458  SER D N     1 
ATOM   4296 C  CA    . SER D 2 15  ? -10.795 -4.060  -20.497 1.00 47.48  ? 458  SER D CA    1 
ATOM   4297 C  C     . SER D 2 15  ? -9.752  -2.946  -20.259 1.00 41.27  ? 458  SER D C     1 
ATOM   4298 O  O     . SER D 2 15  ? -8.802  -3.133  -19.528 1.00 39.12  ? 458  SER D O     1 
ATOM   4299 C  CB    . SER D 2 15  ? -11.846 -4.120  -19.381 1.00 50.25  ? 458  SER D CB    1 
ATOM   4300 O  OG    . SER D 2 15  ? -12.398 -2.829  -19.190 1.00 63.24  ? 458  SER D OG    1 
ATOM   4301 N  N     . ARG D 2 16  ? -9.975  -1.784  -20.853 1.00 38.43  ? 459  ARG D N     1 
ATOM   4302 C  CA    . ARG D 2 16  ? -9.172  -0.604  -20.582 1.00 41.37  ? 459  ARG D CA    1 
ATOM   4303 C  C     . ARG D 2 16  ? -10.013 0.609   -20.313 1.00 41.87  ? 459  ARG D C     1 
ATOM   4304 O  O     . ARG D 2 16  ? -10.999 0.832   -20.984 1.00 44.08  ? 459  ARG D O     1 
ATOM   4305 C  CB    . ARG D 2 16  ? -8.316  -0.259  -21.797 1.00 44.00  ? 459  ARG D CB    1 
ATOM   4306 C  CG    . ARG D 2 16  ? -7.343  -1.355  -22.190 1.00 46.85  ? 459  ARG D CG    1 
ATOM   4307 C  CD    . ARG D 2 16  ? -5.999  -1.226  -21.492 1.00 46.20  ? 459  ARG D CD    1 
ATOM   4308 N  NE    . ARG D 2 16  ? -5.145  -2.272  -21.994 1.00 45.81  ? 459  ARG D NE    1 
ATOM   4309 C  CZ    . ARG D 2 16  ? -3.837  -2.318  -21.838 1.00 48.22  ? 459  ARG D CZ    1 
ATOM   4310 N  NH1   . ARG D 2 16  ? -3.182  -1.361  -21.181 1.00 48.89  ? 459  ARG D NH1   1 
ATOM   4311 N  NH2   . ARG D 2 16  ? -3.178  -3.340  -22.369 1.00 49.18  ? 459  ARG D NH2   1 
ATOM   4312 N  N     . ASP D 2 17  ? -9.584  1.454   -19.391 1.00 44.58  ? 460  ASP D N     1 
ATOM   4313 C  CA    . ASP D 2 17  ? -10.063 2.836   -19.392 1.00 49.55  ? 460  ASP D CA    1 
ATOM   4314 C  C     . ASP D 2 17  ? -9.180  3.663   -20.344 1.00 51.39  ? 460  ASP D C     1 
ATOM   4315 O  O     . ASP D 2 17  ? -8.293  3.118   -21.020 1.00 51.75  ? 460  ASP D O     1 
ATOM   4316 C  CB    . ASP D 2 17  ? -10.088 3.407   -17.965 1.00 48.44  ? 460  ASP D CB    1 
ATOM   4317 C  CG    . ASP D 2 17  ? -8.698  3.749   -17.440 1.00 50.30  ? 460  ASP D CG    1 
ATOM   4318 O  OD1   . ASP D 2 17  ? -7.700  3.478   -18.158 1.00 53.92  ? 460  ASP D OD1   1 
ATOM   4319 O  OD2   . ASP D 2 17  ? -8.591  4.267   -16.301 1.00 47.75  ? 460  ASP D OD2   1 
ATOM   4320 N  N     . ASP D 2 18  ? -9.428  4.966   -20.388 1.00 47.95  ? 461  ASP D N     1 
ATOM   4321 C  CA    . ASP D 2 18  ? -8.727  5.851   -21.294 1.00 47.56  ? 461  ASP D CA    1 
ATOM   4322 C  C     . ASP D 2 18  ? -7.367  6.298   -20.780 1.00 49.52  ? 461  ASP D C     1 
ATOM   4323 O  O     . ASP D 2 18  ? -6.731  7.129   -21.388 1.00 53.66  ? 461  ASP D O     1 
ATOM   4324 C  CB    . ASP D 2 18  ? -9.616  7.068   -21.598 1.00 48.33  ? 461  ASP D CB    1 
ATOM   4325 C  CG    . ASP D 2 18  ? -10.912 6.692   -22.346 1.00 53.63  ? 461  ASP D CG    1 
ATOM   4326 O  OD1   . ASP D 2 18  ? -10.964 5.667   -23.062 1.00 57.93  ? 461  ASP D OD1   1 
ATOM   4327 O  OD2   . ASP D 2 18  ? -11.904 7.428   -22.219 1.00 57.85  ? 461  ASP D OD2   1 
ATOM   4328 N  N     . ARG D 2 19  ? -6.877  5.738   -19.689 1.00 52.29  ? 462  ARG D N     1 
ATOM   4329 C  CA    . ARG D 2 19  ? -5.445  5.833   -19.380 1.00 51.66  ? 462  ARG D CA    1 
ATOM   4330 C  C     . ARG D 2 19  ? -4.764  4.508   -19.443 1.00 44.26  ? 462  ARG D C     1 
ATOM   4331 O  O     . ARG D 2 19  ? -3.626  4.337   -19.010 1.00 41.43  ? 462  ARG D O     1 
ATOM   4332 C  CB    . ARG D 2 19  ? -5.321  6.402   -18.010 1.00 59.38  ? 462  ARG D CB    1 
ATOM   4333 C  CG    . ARG D 2 19  ? -5.818  7.806   -17.956 1.00 66.34  ? 462  ARG D CG    1 
ATOM   4334 C  CD    . ARG D 2 19  ? -5.465  8.394   -16.616 1.00 79.51  ? 462  ARG D CD    1 
ATOM   4335 N  NE    . ARG D 2 19  ? -5.573  9.832   -16.719 1.00 89.85  ? 462  ARG D NE    1 
ATOM   4336 C  CZ    . ARG D 2 19  ? -4.933  10.672  -15.930 1.00 105.25 ? 462  ARG D CZ    1 
ATOM   4337 N  NH1   . ARG D 2 19  ? -4.142  10.216  -14.956 1.00 107.61 ? 462  ARG D NH1   1 
ATOM   4338 N  NH2   . ARG D 2 19  ? -5.093  11.972  -16.110 1.00 119.60 ? 462  ARG D NH2   1 
ATOM   4339 N  N     . GLY D 2 20  ? -5.466  3.584   -20.057 1.00 43.43  ? 463  GLY D N     1 
ATOM   4340 C  CA    . GLY D 2 20  ? -4.909  2.294   -20.378 1.00 46.18  ? 463  GLY D CA    1 
ATOM   4341 C  C     . GLY D 2 20  ? -4.767  1.412   -19.166 1.00 46.44  ? 463  GLY D C     1 
ATOM   4342 O  O     . GLY D 2 20  ? -4.007  0.472   -19.216 1.00 45.55  ? 463  GLY D O     1 
ATOM   4343 N  N     . HIS D 2 21  ? -5.519  1.703   -18.093 1.00 47.27  ? 464  HIS D N     1 
ATOM   4344 C  CA    . HIS D 2 21  ? -5.558  0.849   -16.888 1.00 44.54  ? 464  HIS D CA    1 
ATOM   4345 C  C     . HIS D 2 21  ? -6.424  -0.390  -17.134 1.00 45.80  ? 464  HIS D C     1 
ATOM   4346 O  O     . HIS D 2 21  ? -7.604  -0.281  -17.529 1.00 43.76  ? 464  HIS D O     1 
ATOM   4347 C  CB    . HIS D 2 21  ? -6.008  1.651   -15.665 1.00 46.59  ? 464  HIS D CB    1 
ATOM   4348 C  CG    . HIS D 2 21  ? -4.980  2.658   -15.213 1.00 56.30  ? 464  HIS D CG    1 
ATOM   4349 N  ND1   . HIS D 2 21  ? -5.190  4.022   -15.251 1.00 61.66  ? 464  HIS D ND1   1 
ATOM   4350 C  CD2   . HIS D 2 21  ? -3.701  2.493   -14.788 1.00 58.41  ? 464  HIS D CD2   1 
ATOM   4351 C  CE1   . HIS D 2 21  ? -4.092  4.651   -14.860 1.00 61.03  ? 464  HIS D CE1   1 
ATOM   4352 N  NE2   . HIS D 2 21  ? -3.172  3.745   -14.580 1.00 57.63  ? 464  HIS D NE2   1 
ATOM   4353 N  N     . THR D 2 22  ? -5.789  -1.564  -17.029 1.00 41.41  ? 465  THR D N     1 
ATOM   4354 C  CA    . THR D 2 22  ? -6.488  -2.834  -16.908 1.00 41.35  ? 465  THR D CA    1 
ATOM   4355 C  C     . THR D 2 22  ? -6.990  -3.030  -15.507 1.00 41.62  ? 465  THR D C     1 
ATOM   4356 O  O     . THR D 2 22  ? -6.455  -2.448  -14.584 1.00 40.73  ? 465  THR D O     1 
ATOM   4357 C  CB    . THR D 2 22  ? -5.636  -4.058  -17.266 1.00 43.94  ? 465  THR D CB    1 
ATOM   4358 O  OG1   . THR D 2 22  ? -4.391  -4.033  -16.574 1.00 43.82  ? 465  THR D OG1   1 
ATOM   4359 C  CG2   . THR D 2 22  ? -5.381  -4.076  -18.726 1.00 46.28  ? 465  THR D CG2   1 
ATOM   4360 N  N     . PRO D 2 23  ? -8.003  -3.889  -15.337 1.00 41.81  ? 466  PRO D N     1 
ATOM   4361 C  CA    . PRO D 2 23  ? -8.284  -4.472  -14.036 1.00 40.44  ? 466  PRO D CA    1 
ATOM   4362 C  C     . PRO D 2 23  ? -7.022  -4.845  -13.273 1.00 40.50  ? 466  PRO D C     1 
ATOM   4363 O  O     . PRO D 2 23  ? -6.869  -4.488  -12.105 1.00 44.58  ? 466  PRO D O     1 
ATOM   4364 C  CB    . PRO D 2 23  ? -9.100  -5.720  -14.367 1.00 41.05  ? 466  PRO D CB    1 
ATOM   4365 C  CG    . PRO D 2 23  ? -9.759  -5.414  -15.678 1.00 42.76  ? 466  PRO D CG    1 
ATOM   4366 C  CD    . PRO D 2 23  ? -8.961  -4.328  -16.364 1.00 43.31  ? 466  PRO D CD    1 
ATOM   4367 N  N     . LEU D 2 24  ? -6.119  -5.563  -13.904 1.00 39.68  ? 467  LEU D N     1 
ATOM   4368 C  CA    . LEU D 2 24  ? -4.903  -5.926  -13.203 1.00 41.04  ? 467  LEU D CA    1 
ATOM   4369 C  C     . LEU D 2 24  ? -4.098  -4.726  -12.687 1.00 41.13  ? 467  LEU D C     1 
ATOM   4370 O  O     . LEU D 2 24  ? -3.501  -4.799  -11.617 1.00 43.57  ? 467  LEU D O     1 
ATOM   4371 C  CB    . LEU D 2 24  ? -4.040  -6.807  -14.092 1.00 44.76  ? 467  LEU D CB    1 
ATOM   4372 C  CG    . LEU D 2 24  ? -2.929  -7.523  -13.353 1.00 43.20  ? 467  LEU D CG    1 
ATOM   4373 C  CD1   . LEU D 2 24  ? -3.498  -8.560  -12.432 1.00 44.16  ? 467  LEU D CD1   1 
ATOM   4374 C  CD2   . LEU D 2 24  ? -2.017  -8.194  -14.344 1.00 47.29  ? 467  LEU D CD2   1 
ATOM   4375 N  N     . HIS D 2 25  ? -4.091  -3.615  -13.408 1.00 41.56  ? 468  HIS D N     1 
ATOM   4376 C  CA    . HIS D 2 25  ? -3.493  -2.391  -12.855 1.00 41.63  ? 468  HIS D CA    1 
ATOM   4377 C  C     . HIS D 2 25  ? -4.226  -1.974  -11.573 1.00 40.21  ? 468  HIS D C     1 
ATOM   4378 O  O     . HIS D 2 25  ? -3.600  -1.607  -10.572 1.00 42.58  ? 468  HIS D O     1 
ATOM   4379 C  CB    . HIS D 2 25  ? -3.538  -1.226  -13.850 1.00 40.26  ? 468  HIS D CB    1 
ATOM   4380 C  CG    . HIS D 2 25  ? -2.487  -1.278  -14.916 1.00 42.13  ? 468  HIS D CG    1 
ATOM   4381 N  ND1   . HIS D 2 25  ? -2.731  -1.794  -16.170 1.00 43.42  ? 468  HIS D ND1   1 
ATOM   4382 C  CD2   . HIS D 2 25  ? -1.208  -0.830  -14.940 1.00 41.40  ? 468  HIS D CD2   1 
ATOM   4383 C  CE1   . HIS D 2 25  ? -1.646  -1.676  -16.916 1.00 41.85  ? 468  HIS D CE1   1 
ATOM   4384 N  NE2   . HIS D 2 25  ? -0.710  -1.086  -16.194 1.00 41.99  ? 468  HIS D NE2   1 
ATOM   4385 N  N     . VAL D 2 26  ? -5.552  -1.989  -11.633 1.00 38.27  ? 469  VAL D N     1 
ATOM   4386 C  CA    . VAL D 2 26  ? -6.379  -1.489  -10.545 1.00 39.58  ? 469  VAL D CA    1 
ATOM   4387 C  C     . VAL D 2 26  ? -6.184  -2.407  -9.349  1.00 41.56  ? 469  VAL D C     1 
ATOM   4388 O  O     . VAL D 2 26  ? -5.760  -1.973  -8.287  1.00 44.12  ? 469  VAL D O     1 
ATOM   4389 C  CB    . VAL D 2 26  ? -7.879  -1.462  -10.921 1.00 40.13  ? 469  VAL D CB    1 
ATOM   4390 C  CG1   . VAL D 2 26  ? -8.712  -1.001  -9.750  1.00 40.65  ? 469  VAL D CG1   1 
ATOM   4391 C  CG2   . VAL D 2 26  ? -8.143  -0.542  -12.105 1.00 40.17  ? 469  VAL D CG2   1 
ATOM   4392 N  N     . ALA D 2 27  ? -6.426  -3.694  -9.552  1.00 43.51  ? 470  ALA D N     1 
ATOM   4393 C  CA    . ALA D 2 27  ? -6.098  -4.712  -8.555  1.00 43.72  ? 470  ALA D CA    1 
ATOM   4394 C  C     . ALA D 2 27  ? -4.736  -4.508  -7.906  1.00 47.96  ? 470  ALA D C     1 
ATOM   4395 O  O     . ALA D 2 27  ? -4.604  -4.702  -6.716  1.00 60.62  ? 470  ALA D O     1 
ATOM   4396 C  CB    . ALA D 2 27  ? -6.186  -6.116  -9.148  1.00 41.20  ? 470  ALA D CB    1 
ATOM   4397 N  N     . ALA D 2 28  ? -3.710  -4.165  -8.669  1.00 49.62  ? 471  ALA D N     1 
ATOM   4398 C  CA    . ALA D 2 28  ? -2.372  -4.039  -8.083  1.00 48.06  ? 471  ALA D CA    1 
ATOM   4399 C  C     . ALA D 2 28  ? -2.317  -2.839  -7.210  1.00 45.51  ? 471  ALA D C     1 
ATOM   4400 O  O     . ALA D 2 28  ? -1.801  -2.886  -6.126  1.00 52.14  ? 471  ALA D O     1 
ATOM   4401 C  CB    . ALA D 2 28  ? -1.319  -3.934  -9.159  1.00 50.25  ? 471  ALA D CB    1 
ATOM   4402 N  N     . VAL D 2 29  ? -2.857  -1.738  -7.685  1.00 49.73  ? 472  VAL D N     1 
ATOM   4403 C  CA    . VAL D 2 29  ? -2.645  -0.482  -6.991  1.00 52.09  ? 472  VAL D CA    1 
ATOM   4404 C  C     . VAL D 2 29  ? -3.510  -0.405  -5.728  1.00 54.60  ? 472  VAL D C     1 
ATOM   4405 O  O     . VAL D 2 29  ? -3.211  0.376   -4.840  1.00 59.19  ? 472  VAL D O     1 
ATOM   4406 C  CB    . VAL D 2 29  ? -2.887  0.722   -7.925  1.00 49.83  ? 472  VAL D CB    1 
ATOM   4407 C  CG1   . VAL D 2 29  ? -4.337  1.184   -7.903  1.00 52.28  ? 472  VAL D CG1   1 
ATOM   4408 C  CG2   . VAL D 2 29  ? -2.002  1.852   -7.507  1.00 49.39  ? 472  VAL D CG2   1 
ATOM   4409 N  N     . CYS D 2 30  ? -4.568  -1.218  -5.662  1.00 56.79  ? 473  CYS D N     1 
ATOM   4410 C  CA    . CYS D 2 30  ? -5.340  -1.412  -4.437  1.00 66.69  ? 473  CYS D CA    1 
ATOM   4411 C  C     . CYS D 2 30  ? -4.651  -2.302  -3.443  1.00 74.37  ? 473  CYS D C     1 
ATOM   4412 O  O     . CYS D 2 30  ? -4.614  -1.994  -2.259  1.00 97.47  ? 473  CYS D O     1 
ATOM   4413 C  CB    . CYS D 2 30  ? -6.655  -2.073  -4.738  1.00 67.61  ? 473  CYS D CB    1 
ATOM   4414 S  SG    . CYS D 2 30  ? -7.627  -1.064  -5.824  1.00 74.61  ? 473  CYS D SG    1 
ATOM   4415 N  N     . GLY D 2 31  ? -4.115  -3.408  -3.933  1.00 69.00  ? 474  GLY D N     1 
ATOM   4416 C  CA    . GLY D 2 31  ? -3.465  -4.398  -3.097  1.00 64.55  ? 474  GLY D CA    1 
ATOM   4417 C  C     . GLY D 2 31  ? -4.215  -5.693  -3.044  1.00 64.44  ? 474  GLY D C     1 
ATOM   4418 O  O     . GLY D 2 31  ? -3.845  -6.582  -2.310  1.00 64.22  ? 474  GLY D O     1 
ATOM   4419 N  N     . GLN D 2 32  ? -5.246  -5.833  -3.854  1.00 69.09  ? 475  GLN D N     1 
ATOM   4420 C  CA    . GLN D 2 32  ? -6.089  -6.985  -3.738  1.00 75.49  ? 475  GLN D CA    1 
ATOM   4421 C  C     . GLN D 2 32  ? -5.456  -8.237  -4.407  1.00 70.02  ? 475  GLN D C     1 
ATOM   4422 O  O     . GLN D 2 32  ? -5.760  -8.590  -5.554  1.00 69.77  ? 475  GLN D O     1 
ATOM   4423 C  CB    . GLN D 2 32  ? -7.471  -6.652  -4.294  1.00 89.22  ? 475  GLN D CB    1 
ATOM   4424 C  CG    . GLN D 2 32  ? -8.171  -5.476  -3.613  1.00 100.90 ? 475  GLN D CG    1 
ATOM   4425 C  CD    . GLN D 2 32  ? -9.521  -5.153  -4.283  1.00 119.34 ? 475  GLN D CD    1 
ATOM   4426 O  OE1   . GLN D 2 32  ? -10.509 -5.890  -4.109  1.00 108.70 ? 475  GLN D OE1   1 
ATOM   4427 N  NE2   . GLN D 2 32  ? -9.566  -4.054  -5.064  1.00 120.12 ? 475  GLN D NE2   1 
ATOM   4428 N  N     . ALA D 2 33  ? -4.590  -8.926  -3.663  1.00 62.46  ? 476  ALA D N     1 
ATOM   4429 C  CA    . ALA D 2 33  ? -3.876  -10.104 -4.190  1.00 59.16  ? 476  ALA D CA    1 
ATOM   4430 C  C     . ALA D 2 33  ? -4.798  -11.213 -4.675  1.00 60.82  ? 476  ALA D C     1 
ATOM   4431 O  O     . ALA D 2 33  ? -4.527  -11.856 -5.684  1.00 66.00  ? 476  ALA D O     1 
ATOM   4432 C  CB    . ALA D 2 33  ? -2.891  -10.658 -3.170  1.00 55.80  ? 476  ALA D CB    1 
ATOM   4433 N  N     . SER D 2 34  ? -5.882  -11.462 -3.968  1.00 63.78  ? 477  SER D N     1 
ATOM   4434 C  CA    . SER D 2 34  ? -6.787  -12.546 -4.374  1.00 71.81  ? 477  SER D CA    1 
ATOM   4435 C  C     . SER D 2 34  ? -7.360  -12.239 -5.755  1.00 68.62  ? 477  SER D C     1 
ATOM   4436 O  O     . SER D 2 34  ? -7.613  -13.137 -6.582  1.00 58.77  ? 477  SER D O     1 
ATOM   4437 C  CB    . SER D 2 34  ? -7.910  -12.660 -3.359  1.00 73.58  ? 477  SER D CB    1 
ATOM   4438 O  OG    . SER D 2 34  ? -8.175  -11.367 -2.840  1.00 84.09  ? 477  SER D OG    1 
ATOM   4439 N  N     . LEU D 2 35  ? -7.567  -10.943 -5.978  1.00 65.68  ? 478  LEU D N     1 
ATOM   4440 C  CA    . LEU D 2 35  ? -8.125  -10.445 -7.221  1.00 60.22  ? 478  LEU D CA    1 
ATOM   4441 C  C     . LEU D 2 35  ? -7.143  -10.577 -8.360  1.00 57.24  ? 478  LEU D C     1 
ATOM   4442 O  O     . LEU D 2 35  ? -7.506  -11.011 -9.462  1.00 50.36  ? 478  LEU D O     1 
ATOM   4443 C  CB    . LEU D 2 35  ? -8.475  -8.977  -7.055  1.00 60.33  ? 478  LEU D CB    1 
ATOM   4444 C  CG    . LEU D 2 35  ? -9.316  -8.346  -8.142  1.00 58.71  ? 478  LEU D CG    1 
ATOM   4445 C  CD1   . LEU D 2 35  ? -10.543 -9.187  -8.452  1.00 58.92  ? 478  LEU D CD1   1 
ATOM   4446 C  CD2   . LEU D 2 35  ? -9.707  -6.962  -7.678  1.00 62.48  ? 478  LEU D CD2   1 
ATOM   4447 N  N     . ILE D 2 36  ? -5.879  -10.263 -8.069  1.00 53.64  ? 479  ILE D N     1 
ATOM   4448 C  CA    . ILE D 2 36  ? -4.777  -10.637 -8.967  1.00 49.21  ? 479  ILE D CA    1 
ATOM   4449 C  C     . ILE D 2 36  ? -4.766  -12.112 -9.387  1.00 48.81  ? 479  ILE D C     1 
ATOM   4450 O  O     . ILE D 2 36  ? -4.850  -12.420 -10.570 1.00 48.03  ? 479  ILE D O     1 
ATOM   4451 C  CB    . ILE D 2 36  ? -3.431  -10.302 -8.360  1.00 49.45  ? 479  ILE D CB    1 
ATOM   4452 C  CG1   . ILE D 2 36  ? -3.306  -8.782  -8.231  1.00 54.20  ? 479  ILE D CG1   1 
ATOM   4453 C  CG2   . ILE D 2 36  ? -2.334  -10.851 -9.244  1.00 48.47  ? 479  ILE D CG2   1 
ATOM   4454 C  CD1   . ILE D 2 36  ? -2.035  -8.298  -7.559  1.00 53.47  ? 479  ILE D CD1   1 
ATOM   4455 N  N     . ASP D 2 37  ? -4.695  -13.032 -8.429  1.00 50.29  ? 480  ASP D N     1 
ATOM   4456 C  CA    . ASP D 2 37  ? -4.806  -14.464 -8.760  1.00 51.90  ? 480  ASP D CA    1 
ATOM   4457 C  C     . ASP D 2 37  ? -5.923  -14.686 -9.755  1.00 48.47  ? 480  ASP D C     1 
ATOM   4458 O  O     . ASP D 2 37  ? -5.758  -15.377 -10.755 1.00 43.56  ? 480  ASP D O     1 
ATOM   4459 C  CB    . ASP D 2 37  ? -5.117  -15.310 -7.527  1.00 58.14  ? 480  ASP D CB    1 
ATOM   4460 C  CG    . ASP D 2 37  ? -3.968  -15.397 -6.566  1.00 61.73  ? 480  ASP D CG    1 
ATOM   4461 O  OD1   . ASP D 2 37  ? -2.809  -15.553 -7.022  1.00 64.16  ? 480  ASP D OD1   1 
ATOM   4462 O  OD2   . ASP D 2 37  ? -4.229  -15.292 -5.337  1.00 66.13  ? 480  ASP D OD2   1 
ATOM   4463 N  N     . LEU D 2 38  ? -7.078  -14.115 -9.445  1.00 48.72  ? 481  LEU D N     1 
ATOM   4464 C  CA    . LEU D 2 38  ? -8.254  -14.394 -10.222 1.00 47.12  ? 481  LEU D CA    1 
ATOM   4465 C  C     . LEU D 2 38  ? -8.063  -13.860 -11.632 1.00 46.90  ? 481  LEU D C     1 
ATOM   4466 O  O     . LEU D 2 38  ? -8.303  -14.585 -12.615 1.00 47.17  ? 481  LEU D O     1 
ATOM   4467 C  CB    . LEU D 2 38  ? -9.494  -13.808 -9.549  1.00 47.90  ? 481  LEU D CB    1 
ATOM   4468 C  CG    . LEU D 2 38  ? -10.716 -13.566 -10.443 1.00 50.84  ? 481  LEU D CG    1 
ATOM   4469 C  CD1   . LEU D 2 38  ? -11.226 -14.808 -11.146 1.00 51.71  ? 481  LEU D CD1   1 
ATOM   4470 C  CD2   . LEU D 2 38  ? -11.819 -12.964 -9.600  1.00 54.99  ? 481  LEU D CD2   1 
ATOM   4471 N  N     . LEU D 2 39  ? -7.675  -12.585 -11.744 1.00 46.67  ? 482  LEU D N     1 
ATOM   4472 C  CA    . LEU D 2 39  ? -7.502  -11.956 -13.066 1.00 44.98  ? 482  LEU D CA    1 
ATOM   4473 C  C     . LEU D 2 39  ? -6.502  -12.691 -13.916 1.00 42.39  ? 482  LEU D C     1 
ATOM   4474 O  O     . LEU D 2 39  ? -6.749  -12.930 -15.094 1.00 40.95  ? 482  LEU D O     1 
ATOM   4475 C  CB    . LEU D 2 39  ? -7.059  -10.509 -12.932 1.00 46.35  ? 482  LEU D CB    1 
ATOM   4476 C  CG    . LEU D 2 39  ? -8.155  -9.586  -12.426 1.00 46.94  ? 482  LEU D CG    1 
ATOM   4477 C  CD1   . LEU D 2 39  ? -7.574  -8.196  -12.175 1.00 48.62  ? 482  LEU D CD1   1 
ATOM   4478 C  CD2   . LEU D 2 39  ? -9.297  -9.508  -13.418 1.00 47.86  ? 482  LEU D CD2   1 
ATOM   4479 N  N     . VAL D 2 40  ? -5.369  -13.052 -13.319 1.00 41.62  ? 483  VAL D N     1 
ATOM   4480 C  CA    . VAL D 2 40  ? -4.334  -13.796 -14.037 1.00 40.94  ? 483  VAL D CA    1 
ATOM   4481 C  C     . VAL D 2 40  ? -4.891  -15.119 -14.538 1.00 40.34  ? 483  VAL D C     1 
ATOM   4482 O  O     . VAL D 2 40  ? -4.728  -15.464 -15.695 1.00 39.64  ? 483  VAL D O     1 
ATOM   4483 C  CB    . VAL D 2 40  ? -3.102  -14.025 -13.161 1.00 41.37  ? 483  VAL D CB    1 
ATOM   4484 C  CG1   . VAL D 2 40  ? -2.150  -14.952 -13.848 1.00 41.58  ? 483  VAL D CG1   1 
ATOM   4485 C  CG2   . VAL D 2 40  ? -2.384  -12.710 -12.888 1.00 43.68  ? 483  VAL D CG2   1 
ATOM   4486 N  N     . SER D 2 41  ? -5.622  -15.825 -13.693 1.00 44.38  ? 484  SER D N     1 
ATOM   4487 C  CA    . SER D 2 41  ? -6.252  -17.093 -14.104 1.00 48.01  ? 484  SER D CA    1 
ATOM   4488 C  C     . SER D 2 41  ? -7.242  -16.934 -15.216 1.00 46.89  ? 484  SER D C     1 
ATOM   4489 O  O     . SER D 2 41  ? -7.595  -17.903 -15.856 1.00 50.72  ? 484  SER D O     1 
ATOM   4490 C  CB    . SER D 2 41  ? -6.989  -17.749 -12.942 1.00 52.43  ? 484  SER D CB    1 
ATOM   4491 O  OG    . SER D 2 41  ? -8.204  -17.077 -12.683 1.00 56.18  ? 484  SER D OG    1 
ATOM   4492 N  N     . LYS D 2 42  ? -7.717  -15.720 -15.427 1.00 48.69  ? 485  LYS D N     1 
ATOM   4493 C  CA    . LYS D 2 42  ? -8.717  -15.465 -16.449 1.00 55.88  ? 485  LYS D CA    1 
ATOM   4494 C  C     . LYS D 2 42  ? -8.104  -14.891 -17.729 1.00 51.11  ? 485  LYS D C     1 
ATOM   4495 O  O     . LYS D 2 42  ? -8.811  -14.436 -18.644 1.00 46.33  ? 485  LYS D O     1 
ATOM   4496 C  CB    . LYS D 2 42  ? -9.767  -14.513 -15.875 1.00 70.31  ? 485  LYS D CB    1 
ATOM   4497 C  CG    . LYS D 2 42  ? -11.165 -15.102 -15.859 1.00 81.57  ? 485  LYS D CG    1 
ATOM   4498 C  CD    . LYS D 2 42  ? -11.369 -16.109 -14.741 1.00 84.36  ? 485  LYS D CD    1 
ATOM   4499 C  CE    . LYS D 2 42  ? -12.792 -16.657 -14.783 1.00 88.17  ? 485  LYS D CE    1 
ATOM   4500 N  NZ    . LYS D 2 42  ? -12.840 -18.128 -14.574 1.00 87.37  ? 485  LYS D NZ    1 
ATOM   4501 N  N     . GLY D 2 43  ? -6.781  -14.889 -17.772 1.00 44.56  ? 486  GLY D N     1 
ATOM   4502 C  CA    . GLY D 2 43  ? -6.076  -14.498 -18.960 1.00 44.71  ? 486  GLY D CA    1 
ATOM   4503 C  C     . GLY D 2 43  ? -5.504  -13.088 -18.942 1.00 43.42  ? 486  GLY D C     1 
ATOM   4504 O  O     . GLY D 2 43  ? -4.893  -12.672 -19.911 1.00 40.74  ? 486  GLY D O     1 
ATOM   4505 N  N     . ALA D 2 44  ? -5.638  -12.366 -17.841 1.00 42.33  ? 487  ALA D N     1 
ATOM   4506 C  CA    . ALA D 2 44  ? -5.065  -11.022 -17.762 1.00 45.35  ? 487  ALA D CA    1 
ATOM   4507 C  C     . ALA D 2 44  ? -3.590  -10.909 -18.204 1.00 45.51  ? 487  ALA D C     1 
ATOM   4508 O  O     . ALA D 2 44  ? -2.755  -11.717 -17.820 1.00 51.43  ? 487  ALA D O     1 
ATOM   4509 C  CB    . ALA D 2 44  ? -5.223  -10.487 -16.361 1.00 48.08  ? 487  ALA D CB    1 
ATOM   4510 N  N     . MET D 2 45  ? -3.279  -9.895  -19.012 1.00 46.01  ? 488  MET D N     1 
ATOM   4511 C  CA    . MET D 2 45  ? -1.901  -9.678  -19.475 1.00 43.87  ? 488  MET D CA    1 
ATOM   4512 C  C     . MET D 2 45  ? -1.087  -8.987  -18.382 1.00 45.10  ? 488  MET D C     1 
ATOM   4513 O  O     . MET D 2 45  ? -1.323  -7.821  -18.057 1.00 42.13  ? 488  MET D O     1 
ATOM   4514 C  CB    . MET D 2 45  ? -1.857  -8.838  -20.751 1.00 43.18  ? 488  MET D CB    1 
ATOM   4515 C  CG    . MET D 2 45  ? -0.449  -8.397  -21.133 1.00 42.51  ? 488  MET D CG    1 
ATOM   4516 S  SD    . MET D 2 45  ? -0.357  -7.571  -22.737 1.00 43.49  ? 488  MET D SD    1 
ATOM   4517 C  CE    . MET D 2 45  ? 1.334   -6.980  -22.803 1.00 50.45  ? 488  MET D CE    1 
ATOM   4518 N  N     . VAL D 2 46  ? -0.125  -9.728  -17.834 1.00 46.41  ? 489  VAL D N     1 
ATOM   4519 C  CA    . VAL D 2 46  ? 0.648   -9.297  -16.689 1.00 42.47  ? 489  VAL D CA    1 
ATOM   4520 C  C     . VAL D 2 46  ? 1.527   -8.098  -16.983 1.00 41.40  ? 489  VAL D C     1 
ATOM   4521 O  O     . VAL D 2 46  ? 1.688   -7.230  -16.129 1.00 40.16  ? 489  VAL D O     1 
ATOM   4522 C  CB    . VAL D 2 46  ? 1.534   -10.442 -16.202 1.00 43.07  ? 489  VAL D CB    1 
ATOM   4523 C  CG1   . VAL D 2 46  ? 2.481   -9.969  -15.126 1.00 44.31  ? 489  VAL D CG1   1 
ATOM   4524 C  CG2   . VAL D 2 46  ? 0.659   -11.540 -15.654 1.00 45.93  ? 489  VAL D CG2   1 
ATOM   4525 N  N     . ASN D 2 47  ? 2.113   -8.047  -18.176 1.00 42.16  ? 490  ASN D N     1 
ATOM   4526 C  CA    . ASN D 2 47  ? 2.978   -6.905  -18.545 1.00 41.48  ? 490  ASN D CA    1 
ATOM   4527 C  C     . ASN D 2 47  ? 2.286   -5.792  -19.332 1.00 43.43  ? 490  ASN D C     1 
ATOM   4528 O  O     . ASN D 2 47  ? 2.933   -5.006  -20.059 1.00 45.08  ? 490  ASN D O     1 
ATOM   4529 C  CB    . ASN D 2 47  ? 4.197   -7.423  -19.285 1.00 38.09  ? 490  ASN D CB    1 
ATOM   4530 C  CG    . ASN D 2 47  ? 5.165   -8.101  -18.357 1.00 38.53  ? 490  ASN D CG    1 
ATOM   4531 O  OD1   . ASN D 2 47  ? 5.449   -7.627  -17.247 1.00 40.63  ? 490  ASN D OD1   1 
ATOM   4532 N  ND2   . ASN D 2 47  ? 5.667   -9.218  -18.784 1.00 40.75  ? 490  ASN D ND2   1 
ATOM   4533 N  N     . ALA D 2 48  ? 0.960   -5.769  -19.206 1.00 43.08  ? 491  ALA D N     1 
ATOM   4534 C  CA    . ALA D 2 48  ? 0.139   -4.761  -19.808 1.00 42.88  ? 491  ALA D CA    1 
ATOM   4535 C  C     . ALA D 2 48  ? 0.636   -3.413  -19.356 1.00 45.11  ? 491  ALA D C     1 
ATOM   4536 O  O     . ALA D 2 48  ? 1.048   -3.214  -18.249 1.00 37.93  ? 491  ALA D O     1 
ATOM   4537 C  CB    . ALA D 2 48  ? -1.301  -4.929  -19.375 1.00 42.90  ? 491  ALA D CB    1 
ATOM   4538 N  N     . THR D 2 49  ? 0.586   -2.471  -20.259 1.00 53.95  ? 492  THR D N     1 
ATOM   4539 C  CA    . THR D 2 49  ? 1.186   -1.223  -20.043 1.00 49.20  ? 492  THR D CA    1 
ATOM   4540 C  C     . THR D 2 49  ? 0.127   -0.089  -20.170 1.00 44.75  ? 492  THR D C     1 
ATOM   4541 O  O     . THR D 2 49  ? -0.702  -0.124  -21.079 1.00 41.26  ? 492  THR D O     1 
ATOM   4542 C  CB    . THR D 2 49  ? 2.280   -1.308  -21.100 1.00 47.96  ? 492  THR D CB    1 
ATOM   4543 O  OG1   . THR D 2 49  ? 3.526   -1.558  -20.440 1.00 52.36  ? 492  THR D OG1   1 
ATOM   4544 C  CG2   . THR D 2 49  ? 2.298   -0.142  -21.899 1.00 47.32  ? 492  THR D CG2   1 
ATOM   4545 N  N     . ASP D 2 50  ? 0.131   0.875   -19.236 1.00 41.59  ? 493  ASP D N     1 
ATOM   4546 C  CA    . ASP D 2 50  ? -0.832  1.983   -19.291 1.00 42.98  ? 493  ASP D CA    1 
ATOM   4547 C  C     . ASP D 2 50  ? -0.349  3.091   -20.219 1.00 45.68  ? 493  ASP D C     1 
ATOM   4548 O  O     . ASP D 2 50  ? 0.736   3.033   -20.801 1.00 44.58  ? 493  ASP D O     1 
ATOM   4549 C  CB    . ASP D 2 50  ? -1.176  2.514   -17.883 1.00 43.62  ? 493  ASP D CB    1 
ATOM   4550 C  CG    . ASP D 2 50  ? -0.082  3.389   -17.275 1.00 45.19  ? 493  ASP D CG    1 
ATOM   4551 O  OD1   . ASP D 2 50  ? 0.982   3.565   -17.923 1.00 45.71  ? 493  ASP D OD1   1 
ATOM   4552 O  OD2   . ASP D 2 50  ? -0.294  3.897   -16.133 1.00 44.26  ? 493  ASP D OD2   1 
ATOM   4553 N  N     . TYR D 2 51  ? -1.154  4.123   -20.342 1.00 46.66  ? 494  TYR D N     1 
ATOM   4554 C  CA    . TYR D 2 51  ? -0.827  5.211   -21.241 1.00 46.25  ? 494  TYR D CA    1 
ATOM   4555 C  C     . TYR D 2 51  ? 0.552   5.838   -21.017 1.00 43.94  ? 494  TYR D C     1 
ATOM   4556 O  O     . TYR D 2 51  ? 1.081   6.461   -21.922 1.00 45.97  ? 494  TYR D O     1 
ATOM   4557 C  CB    . TYR D 2 51  ? -1.928  6.282   -21.198 1.00 49.16  ? 494  TYR D CB    1 
ATOM   4558 C  CG    . TYR D 2 51  ? -1.774  7.293   -20.080 1.00 52.77  ? 494  TYR D CG    1 
ATOM   4559 C  CD1   . TYR D 2 51  ? -1.701  6.895   -18.759 1.00 54.34  ? 494  TYR D CD1   1 
ATOM   4560 C  CD2   . TYR D 2 51  ? -1.702  8.648   -20.350 1.00 56.34  ? 494  TYR D CD2   1 
ATOM   4561 C  CE1   . TYR D 2 51  ? -1.547  7.810   -17.736 1.00 57.02  ? 494  TYR D CE1   1 
ATOM   4562 C  CE2   . TYR D 2 51  ? -1.569  9.569   -19.325 1.00 57.19  ? 494  TYR D CE2   1 
ATOM   4563 C  CZ    . TYR D 2 51  ? -1.482  9.136   -18.022 1.00 55.76  ? 494  TYR D CZ    1 
ATOM   4564 O  OH    . TYR D 2 51  ? -1.332  10.013  -16.978 1.00 61.48  ? 494  TYR D OH    1 
ATOM   4565 N  N     . HIS D 2 52  ? 1.159   5.697   -19.843 1.00 45.38  ? 495  HIS D N     1 
ATOM   4566 C  CA    . HIS D 2 52  ? 2.535   6.206   -19.649 1.00 49.12  ? 495  HIS D CA    1 
ATOM   4567 C  C     . HIS D 2 52  ? 3.554   5.125   -19.342 1.00 45.92  ? 495  HIS D C     1 
ATOM   4568 O  O     . HIS D 2 52  ? 4.640   5.383   -18.845 1.00 42.25  ? 495  HIS D O     1 
ATOM   4569 C  CB    . HIS D 2 52  ? 2.545   7.280   -18.568 1.00 57.20  ? 495  HIS D CB    1 
ATOM   4570 C  CG    . HIS D 2 52  ? 2.070   8.625   -19.049 1.00 61.66  ? 495  HIS D CG    1 
ATOM   4571 N  ND1   . HIS D 2 52  ? 1.803   9.676   -18.192 1.00 64.09  ? 495  HIS D ND1   1 
ATOM   4572 C  CD2   . HIS D 2 52  ? 1.831   9.088   -20.299 1.00 62.40  ? 495  HIS D CD2   1 
ATOM   4573 C  CE1   . HIS D 2 52  ? 1.440   10.732  -18.899 1.00 64.91  ? 495  HIS D CE1   1 
ATOM   4574 N  NE2   . HIS D 2 52  ? 1.439   10.398  -20.178 1.00 65.54  ? 495  HIS D NE2   1 
ATOM   4575 N  N     . GLY D 2 53  ? 3.219   3.906   -19.705 1.00 48.05  ? 496  GLY D N     1 
ATOM   4576 C  CA    . GLY D 2 53  ? 4.231   2.877   -19.822 1.00 51.66  ? 496  GLY D CA    1 
ATOM   4577 C  C     . GLY D 2 53  ? 4.393   2.072   -18.550 1.00 47.98  ? 496  GLY D C     1 
ATOM   4578 O  O     . GLY D 2 53  ? 5.369   1.357   -18.400 1.00 49.26  ? 496  GLY D O     1 
ATOM   4579 N  N     . ALA D 2 54  ? 3.404   2.161   -17.668 1.00 45.97  ? 497  ALA D N     1 
ATOM   4580 C  CA    . ALA D 2 54  ? 3.465   1.554   -16.350 1.00 46.62  ? 497  ALA D CA    1 
ATOM   4581 C  C     . ALA D 2 54  ? 2.757   0.216   -16.364 1.00 45.02  ? 497  ALA D C     1 
ATOM   4582 O  O     . ALA D 2 54  ? 1.595   0.114   -16.774 1.00 39.62  ? 497  ALA D O     1 
ATOM   4583 C  CB    . ALA D 2 54  ? 2.824   2.453   -15.300 1.00 45.39  ? 497  ALA D CB    1 
ATOM   4584 N  N     . THR D 2 55  ? 3.484   -0.791  -15.891 1.00 43.03  ? 498  THR D N     1 
ATOM   4585 C  CA    . THR D 2 55  ? 2.953   -2.104  -15.631 1.00 44.05  ? 498  THR D CA    1 
ATOM   4586 C  C     . THR D 2 55  ? 2.317   -2.184  -14.230 1.00 42.81  ? 498  THR D C     1 
ATOM   4587 O  O     . THR D 2 55  ? 2.645   -1.409  -13.341 1.00 41.51  ? 498  THR D O     1 
ATOM   4588 C  CB    . THR D 2 55  ? 4.002   -3.192  -15.903 1.00 47.75  ? 498  THR D CB    1 
ATOM   4589 O  OG1   . THR D 2 55  ? 3.511   -4.457  -15.446 1.00 67.13  ? 498  THR D OG1   1 
ATOM   4590 C  CG2   . THR D 2 55  ? 5.219   -2.937  -15.209 1.00 47.32  ? 498  THR D CG2   1 
ATOM   4591 N  N     . PRO D 2 56  ? 1.387   -3.120  -14.024 1.00 42.47  ? 499  PRO D N     1 
ATOM   4592 C  CA    . PRO D 2 56  ? 0.966   -3.399  -12.664 1.00 44.27  ? 499  PRO D CA    1 
ATOM   4593 C  C     . PRO D 2 56  ? 2.108   -3.509  -11.655 1.00 43.45  ? 499  PRO D C     1 
ATOM   4594 O  O     . PRO D 2 56  ? 2.042   -2.928  -10.577 1.00 42.31  ? 499  PRO D O     1 
ATOM   4595 C  CB    . PRO D 2 56  ? 0.292   -4.764  -12.801 1.00 46.43  ? 499  PRO D CB    1 
ATOM   4596 C  CG    . PRO D 2 56  ? -0.276  -4.763  -14.168 1.00 40.62  ? 499  PRO D CG    1 
ATOM   4597 C  CD    . PRO D 2 56  ? 0.737   -4.025  -14.988 1.00 40.62  ? 499  PRO D CD    1 
ATOM   4598 N  N     . LEU D 2 57  ? 3.165   -4.213  -12.028 1.00 43.82  ? 500  LEU D N     1 
ATOM   4599 C  CA    . LEU D 2 57  ? 4.381   -4.211  -11.225 1.00 42.88  ? 500  LEU D CA    1 
ATOM   4600 C  C     . LEU D 2 57  ? 4.935   -2.812  -10.897 1.00 43.64  ? 500  LEU D C     1 
ATOM   4601 O  O     . LEU D 2 57  ? 5.340   -2.584  -9.771  1.00 47.72  ? 500  LEU D O     1 
ATOM   4602 C  CB    . LEU D 2 57  ? 5.472   -5.043  -11.889 1.00 41.73  ? 500  LEU D CB    1 
ATOM   4603 C  CG    . LEU D 2 57  ? 6.724   -5.275  -11.059 1.00 40.71  ? 500  LEU D CG    1 
ATOM   4604 C  CD1   . LEU D 2 57  ? 6.380   -6.055  -9.830  1.00 40.16  ? 500  LEU D CD1   1 
ATOM   4605 C  CD2   . LEU D 2 57  ? 7.747   -6.064  -11.846 1.00 45.01  ? 500  LEU D CD2   1 
ATOM   4606 N  N     . HIS D 2 58  ? 4.961   -1.886  -11.857 1.00 44.19  ? 501  HIS D N     1 
ATOM   4607 C  CA    . HIS D 2 58  ? 5.385   -0.502  -11.586 1.00 43.72  ? 501  HIS D CA    1 
ATOM   4608 C  C     . HIS D 2 58  ? 4.494   0.110   -10.507 1.00 42.12  ? 501  HIS D C     1 
ATOM   4609 O  O     . HIS D 2 58  ? 4.980   0.782   -9.618  1.00 43.23  ? 501  HIS D O     1 
ATOM   4610 C  CB    . HIS D 2 58  ? 5.275   0.387   -12.821 1.00 45.57  ? 501  HIS D CB    1 
ATOM   4611 C  CG    . HIS D 2 58  ? 6.446   0.324   -13.736 1.00 44.26  ? 501  HIS D CG    1 
ATOM   4612 N  ND1   . HIS D 2 58  ? 6.520   -0.568  -14.767 1.00 46.05  ? 501  HIS D ND1   1 
ATOM   4613 C  CD2   . HIS D 2 58  ? 7.545   1.101   -13.843 1.00 49.91  ? 501  HIS D CD2   1 
ATOM   4614 C  CE1   . HIS D 2 58  ? 7.636   -0.384  -15.449 1.00 46.31  ? 501  HIS D CE1   1 
ATOM   4615 N  NE2   . HIS D 2 58  ? 8.278   0.629   -14.910 1.00 49.31  ? 501  HIS D NE2   1 
ATOM   4616 N  N     . LEU D 2 59  ? 3.192   -0.127  -10.590 1.00 40.22  ? 502  LEU D N     1 
ATOM   4617 C  CA    . LEU D 2 59  ? 2.267   0.426   -9.611  1.00 42.14  ? 502  LEU D CA    1 
ATOM   4618 C  C     . LEU D 2 59  ? 2.448   -0.168  -8.239  1.00 43.25  ? 502  LEU D C     1 
ATOM   4619 O  O     . LEU D 2 59  ? 2.543   0.562   -7.277  1.00 45.35  ? 502  LEU D O     1 
ATOM   4620 C  CB    . LEU D 2 59  ? 0.834   0.194   -10.031 1.00 45.01  ? 502  LEU D CB    1 
ATOM   4621 C  CG    . LEU D 2 59  ? 0.441   0.854   -11.352 1.00 47.41  ? 502  LEU D CG    1 
ATOM   4622 C  CD1   . LEU D 2 59  ? -1.028  0.563   -11.626 1.00 48.48  ? 502  LEU D CD1   1 
ATOM   4623 C  CD2   . LEU D 2 59  ? 0.713   2.342   -11.356 1.00 45.62  ? 502  LEU D CD2   1 
ATOM   4624 N  N     . ALA D 2 60  ? 2.532   -1.489  -8.136  1.00 47.51  ? 503  ALA D N     1 
ATOM   4625 C  CA    . ALA D 2 60  ? 2.857   -2.114  -6.849  1.00 46.14  ? 503  ALA D CA    1 
ATOM   4626 C  C     . ALA D 2 60  ? 4.151   -1.549  -6.256  1.00 47.99  ? 503  ALA D C     1 
ATOM   4627 O  O     . ALA D 2 60  ? 4.176   -1.193  -5.091  1.00 48.70  ? 503  ALA D O     1 
ATOM   4628 C  CB    . ALA D 2 60  ? 2.939   -3.621  -6.970  1.00 44.70  ? 503  ALA D CB    1 
ATOM   4629 N  N     . CYS D 2 61  ? 5.219   -1.416  -7.039  1.00 49.20  ? 504  CYS D N     1 
ATOM   4630 C  CA    . CYS D 2 61  ? 6.514   -0.979  -6.449  1.00 50.28  ? 504  CYS D CA    1 
ATOM   4631 C  C     . CYS D 2 61  ? 6.502   0.467   -6.019  1.00 55.24  ? 504  CYS D C     1 
ATOM   4632 O  O     . CYS D 2 61  ? 7.253   0.880   -5.130  1.00 59.40  ? 504  CYS D O     1 
ATOM   4633 C  CB    . CYS D 2 61  ? 7.695   -1.263  -7.390  1.00 43.67  ? 504  CYS D CB    1 
ATOM   4634 S  SG    . CYS D 2 61  ? 8.027   -3.042  -7.395  1.00 45.89  ? 504  CYS D SG    1 
ATOM   4635 N  N     . GLN D 2 62  ? 5.648   1.245   -6.660  1.00 61.13  ? 505  GLN D N     1 
ATOM   4636 C  CA    . GLN D 2 62  ? 5.503   2.638   -6.300  1.00 64.97  ? 505  GLN D CA    1 
ATOM   4637 C  C     . GLN D 2 62  ? 4.803   2.748   -4.968  1.00 62.17  ? 505  GLN D C     1 
ATOM   4638 O  O     . GLN D 2 62  ? 5.236   3.461   -4.079  1.00 68.89  ? 505  GLN D O     1 
ATOM   4639 C  CB    . GLN D 2 62  ? 4.670   3.341   -7.338  1.00 68.19  ? 505  GLN D CB    1 
ATOM   4640 C  CG    . GLN D 2 62  ? 4.808   4.836   -7.240  1.00 73.31  ? 505  GLN D CG    1 
ATOM   4641 C  CD    . GLN D 2 62  ? 4.235   5.559   -8.431  1.00 73.95  ? 505  GLN D CD    1 
ATOM   4642 O  OE1   . GLN D 2 62  ? 4.867   6.460   -8.979  1.00 79.42  ? 505  GLN D OE1   1 
ATOM   4643 N  NE2   . GLN D 2 62  ? 3.047   5.146   -8.861  1.00 74.20  ? 505  GLN D NE2   1 
ATOM   4644 N  N     . LYS D 2 63  ? 3.726   1.993   -4.859  1.00 56.97  ? 506  LYS D N     1 
ATOM   4645 C  CA    . LYS D 2 63  ? 2.838   1.996   -3.728  1.00 52.27  ? 506  LYS D CA    1 
ATOM   4646 C  C     . LYS D 2 63  ? 3.494   1.221   -2.551  1.00 53.73  ? 506  LYS D C     1 
ATOM   4647 O  O     . LYS D 2 63  ? 3.133   1.403   -1.400  1.00 60.86  ? 506  LYS D O     1 
ATOM   4648 C  CB    . LYS D 2 63  ? 1.518   1.363   -4.223  1.00 54.36  ? 506  LYS D CB    1 
ATOM   4649 C  CG    . LYS D 2 63  ? 0.236   1.762   -3.553  1.00 61.06  ? 506  LYS D CG    1 
ATOM   4650 C  CD    . LYS D 2 63  ? -0.413  3.090   -3.889  1.00 66.47  ? 506  LYS D CD    1 
ATOM   4651 C  CE    . LYS D 2 63  ? -1.804  3.090   -3.216  1.00 74.87  ? 506  LYS D CE    1 
ATOM   4652 N  NZ    . LYS D 2 63  ? -2.392  4.410   -2.879  1.00 84.58  ? 506  LYS D NZ    1 
ATOM   4653 N  N     . GLY D 2 64  ? 4.484   0.374   -2.818  1.00 58.11  ? 507  GLY D N     1 
ATOM   4654 C  CA    . GLY D 2 64  ? 5.173   -0.376  -1.756  1.00 53.84  ? 507  GLY D CA    1 
ATOM   4655 C  C     . GLY D 2 64  ? 4.560   -1.674  -1.252  1.00 50.56  ? 507  GLY D C     1 
ATOM   4656 O  O     . GLY D 2 64  ? 4.790   -2.053  -0.106  1.00 57.54  ? 507  GLY D O     1 
ATOM   4657 N  N     . TYR D 2 65  ? 3.824   -2.373  -2.104  1.00 50.42  ? 508  TYR D N     1 
ATOM   4658 C  CA    . TYR D 2 65  ? 3.144   -3.595  -1.720  1.00 57.95  ? 508  TYR D CA    1 
ATOM   4659 C  C     . TYR D 2 65  ? 3.999   -4.825  -2.030  1.00 53.79  ? 508  TYR D C     1 
ATOM   4660 O  O     . TYR D 2 65  ? 3.800   -5.471  -3.045  1.00 63.75  ? 508  TYR D O     1 
ATOM   4661 C  CB    . TYR D 2 65  ? 1.808   -3.723  -2.452  1.00 66.57  ? 508  TYR D CB    1 
ATOM   4662 C  CG    . TYR D 2 65  ? 0.814   -2.612  -2.212  1.00 83.39  ? 508  TYR D CG    1 
ATOM   4663 C  CD1   . TYR D 2 65  ? 1.194   -1.392  -1.644  1.00 95.17  ? 508  TYR D CD1   1 
ATOM   4664 C  CD2   . TYR D 2 65  ? -0.514  -2.779  -2.575  1.00 91.75  ? 508  TYR D CD2   1 
ATOM   4665 C  CE1   . TYR D 2 65  ? 0.273   -0.393  -1.425  1.00 101.77 ? 508  TYR D CE1   1 
ATOM   4666 C  CE2   . TYR D 2 65  ? -1.439  -1.783  -2.372  1.00 98.90  ? 508  TYR D CE2   1 
ATOM   4667 C  CZ    . TYR D 2 65  ? -1.043  -0.597  -1.796  1.00 117.42 ? 508  TYR D CZ    1 
ATOM   4668 O  OH    . TYR D 2 65  ? -1.959  0.402   -1.595  1.00 137.43 ? 508  TYR D OH    1 
ATOM   4669 N  N     . GLN D 2 66  ? 4.904   -5.183  -1.133  1.00 47.28  ? 509  GLN D N     1 
ATOM   4670 C  CA    . GLN D 2 66  ? 5.751   -6.335  -1.357  1.00 48.85  ? 509  GLN D CA    1 
ATOM   4671 C  C     . GLN D 2 66  ? 4.964   -7.594  -1.754  1.00 48.80  ? 509  GLN D C     1 
ATOM   4672 O  O     . GLN D 2 66  ? 5.378   -8.312  -2.654  1.00 53.56  ? 509  GLN D O     1 
ATOM   4673 C  CB    . GLN D 2 66  ? 6.637   -6.630  -0.138  1.00 50.68  ? 509  GLN D CB    1 
ATOM   4674 C  CG    . GLN D 2 66  ? 7.876   -7.450  -0.458  1.00 50.85  ? 509  GLN D CG    1 
ATOM   4675 C  CD    . GLN D 2 66  ? 8.390   -8.283  0.716   1.00 51.16  ? 509  GLN D CD    1 
ATOM   4676 O  OE1   . GLN D 2 66  ? 7.705   -9.203  1.180   1.00 48.95  ? 509  GLN D OE1   1 
ATOM   4677 N  NE2   . GLN D 2 66  ? 9.632   -8.006  1.153   1.00 48.13  ? 509  GLN D NE2   1 
ATOM   4678 N  N     . SER D 2 67  ? 3.853   -7.857  -1.099  1.00 48.24  ? 510  SER D N     1 
ATOM   4679 C  CA    . SER D 2 67  ? 3.095   -9.074  -1.352  1.00 52.42  ? 510  SER D CA    1 
ATOM   4680 C  C     . SER D 2 67  ? 2.731   -9.186  -2.805  1.00 51.25  ? 510  SER D C     1 
ATOM   4681 O  O     . SER D 2 67  ? 2.940   -10.201 -3.460  1.00 51.76  ? 510  SER D O     1 
ATOM   4682 C  CB    . SER D 2 67  ? 1.761   -9.014  -0.582  1.00 60.17  ? 510  SER D CB    1 
ATOM   4683 O  OG    . SER D 2 67  ? 1.614   -10.067 0.351   1.00 71.44  ? 510  SER D OG    1 
ATOM   4684 N  N     . VAL D 2 68  ? 2.123   -8.120  -3.292  1.00 54.07  ? 511  VAL D N     1 
ATOM   4685 C  CA    . VAL D 2 68  ? 1.728   -7.990  -4.700  1.00 52.92  ? 511  VAL D CA    1 
ATOM   4686 C  C     . VAL D 2 68  ? 2.923   -8.001  -5.658  1.00 47.48  ? 511  VAL D C     1 
ATOM   4687 O  O     . VAL D 2 68  ? 2.986   -8.830  -6.591  1.00 49.07  ? 511  VAL D O     1 
ATOM   4688 C  CB    . VAL D 2 68  ? 0.967   -6.668  -4.911  1.00 53.74  ? 511  VAL D CB    1 
ATOM   4689 C  CG1   . VAL D 2 68  ? 0.811   -6.348  -6.380  1.00 55.25  ? 511  VAL D CG1   1 
ATOM   4690 C  CG2   . VAL D 2 68  ? -0.383  -6.731  -4.232  1.00 53.24  ? 511  VAL D CG2   1 
ATOM   4691 N  N     . THR D 2 69  ? 3.897   -7.148  -5.387  1.00 36.99  ? 512  THR D N     1 
ATOM   4692 C  CA    . THR D 2 69  ? 5.116   -7.221  -6.136  1.00 38.53  ? 512  THR D CA    1 
ATOM   4693 C  C     . THR D 2 69  ? 5.591   -8.676  -6.391  1.00 40.28  ? 512  THR D C     1 
ATOM   4694 O  O     . THR D 2 69  ? 5.878   -9.073  -7.525  1.00 36.42  ? 512  THR D O     1 
ATOM   4695 C  CB    . THR D 2 69  ? 6.211   -6.455  -5.398  1.00 36.83  ? 512  THR D CB    1 
ATOM   4696 O  OG1   . THR D 2 69  ? 5.823   -5.092  -5.266  1.00 35.62  ? 512  THR D OG1   1 
ATOM   4697 C  CG2   . THR D 2 69  ? 7.539   -6.540  -6.131  1.00 40.09  ? 512  THR D CG2   1 
ATOM   4698 N  N     . LEU D 2 70  ? 5.710   -9.459  -5.330  1.00 42.76  ? 513  LEU D N     1 
ATOM   4699 C  CA    . LEU D 2 70  ? 6.158   -10.838 -5.490  1.00 45.99  ? 513  LEU D CA    1 
ATOM   4700 C  C     . LEU D 2 70  ? 5.197   -11.700 -6.271  1.00 44.67  ? 513  LEU D C     1 
ATOM   4701 O  O     . LEU D 2 70  ? 5.607   -12.496 -7.103  1.00 41.25  ? 513  LEU D O     1 
ATOM   4702 C  CB    . LEU D 2 70  ? 6.446   -11.473 -4.132  1.00 49.18  ? 513  LEU D CB    1 
ATOM   4703 C  CG    . LEU D 2 70  ? 7.728   -10.918 -3.526  1.00 48.14  ? 513  LEU D CG    1 
ATOM   4704 C  CD1   . LEU D 2 70  ? 7.750   -11.209 -2.041  1.00 51.15  ? 513  LEU D CD1   1 
ATOM   4705 C  CD2   . LEU D 2 70  ? 8.957   -11.507 -4.199  1.00 49.63  ? 513  LEU D CD2   1 
ATOM   4706 N  N     . LEU D 2 71  ? 3.917   -11.550 -5.993  1.00 46.91  ? 514  LEU D N     1 
ATOM   4707 C  CA    . LEU D 2 71  ? 2.930   -12.342 -6.682  1.00 49.00  ? 514  LEU D CA    1 
ATOM   4708 C  C     . LEU D 2 71  ? 2.994   -12.061 -8.181  1.00 48.72  ? 514  LEU D C     1 
ATOM   4709 O  O     . LEU D 2 71  ? 2.919   -12.986 -8.993  1.00 53.23  ? 514  LEU D O     1 
ATOM   4710 C  CB    . LEU D 2 71  ? 1.552   -12.013 -6.147  1.00 52.19  ? 514  LEU D CB    1 
ATOM   4711 C  CG    . LEU D 2 71  ? 0.442   -12.836 -6.793  1.00 58.02  ? 514  LEU D CG    1 
ATOM   4712 C  CD1   . LEU D 2 71  ? 0.690   -14.337 -6.701  1.00 57.31  ? 514  LEU D CD1   1 
ATOM   4713 C  CD2   . LEU D 2 71  ? -0.895  -12.481 -6.149  1.00 63.54  ? 514  LEU D CD2   1 
ATOM   4714 N  N     . LEU D 2 72  ? 3.184   -10.796 -8.554  1.00 44.65  ? 515  LEU D N     1 
ATOM   4715 C  CA    . LEU D 2 72  ? 3.360   -10.454 -9.958  1.00 41.55  ? 515  LEU D CA    1 
ATOM   4716 C  C     . LEU D 2 72  ? 4.606   -11.107 -10.563 1.00 40.26  ? 515  LEU D C     1 
ATOM   4717 O  O     . LEU D 2 72  ? 4.519   -11.745 -11.629 1.00 37.41  ? 515  LEU D O     1 
ATOM   4718 C  CB    . LEU D 2 72  ? 3.424   -8.951  -10.130 1.00 42.79  ? 515  LEU D CB    1 
ATOM   4719 C  CG    . LEU D 2 72  ? 2.102   -8.238  -9.823  1.00 45.18  ? 515  LEU D CG    1 
ATOM   4720 C  CD1   . LEU D 2 72  ? 2.291   -6.730  -9.791  1.00 46.50  ? 515  LEU D CD1   1 
ATOM   4721 C  CD2   . LEU D 2 72  ? 1.026   -8.594  -10.835 1.00 43.72  ? 515  LEU D CD2   1 
ATOM   4722 N  N     . LEU D 2 73  ? 5.743   -11.012 -9.867  1.00 37.72  ? 516  LEU D N     1 
ATOM   4723 C  CA    . LEU D 2 73  ? 6.972   -11.690 -10.326 1.00 38.41  ? 516  LEU D CA    1 
ATOM   4724 C  C     . LEU D 2 73  ? 6.745   -13.201 -10.434 1.00 39.56  ? 516  LEU D C     1 
ATOM   4725 O  O     . LEU D 2 73  ? 7.180   -13.842 -11.373 1.00 38.65  ? 516  LEU D O     1 
ATOM   4726 C  CB    . LEU D 2 73  ? 8.134   -11.424 -9.394  1.00 39.19  ? 516  LEU D CB    1 
ATOM   4727 C  CG    . LEU D 2 73  ? 8.516   -9.944  -9.219  1.00 41.74  ? 516  LEU D CG    1 
ATOM   4728 C  CD1   . LEU D 2 73  ? 9.302   -9.705  -7.951  1.00 40.90  ? 516  LEU D CD1   1 
ATOM   4729 C  CD2   . LEU D 2 73  ? 9.303   -9.430  -10.406 1.00 42.22  ? 516  LEU D CD2   1 
ATOM   4730 N  N     . HIS D 2 74  ? 5.973   -13.740 -9.511  1.00 39.08  ? 517  HIS D N     1 
ATOM   4731 C  CA    . HIS D 2 74  ? 5.590   -15.124 -9.552  1.00 41.72  ? 517  HIS D CA    1 
ATOM   4732 C  C     . HIS D 2 74  ? 4.834   -15.472 -10.791 1.00 43.56  ? 517  HIS D C     1 
ATOM   4733 O  O     . HIS D 2 74  ? 5.046   -16.548 -11.350 1.00 54.00  ? 517  HIS D O     1 
ATOM   4734 C  CB    . HIS D 2 74  ? 4.723   -15.451 -8.347  1.00 46.80  ? 517  HIS D CB    1 
ATOM   4735 C  CG    . HIS D 2 74  ? 4.211   -16.849 -8.327  1.00 48.67  ? 517  HIS D CG    1 
ATOM   4736 N  ND1   . HIS D 2 74  ? 5.010   -17.928 -8.047  1.00 51.21  ? 517  HIS D ND1   1 
ATOM   4737 C  CD2   . HIS D 2 74  ? 2.975   -17.343 -8.560  1.00 51.96  ? 517  HIS D CD2   1 
ATOM   4738 C  CE1   . HIS D 2 74  ? 4.287   -19.029 -8.096  1.00 51.32  ? 517  HIS D CE1   1 
ATOM   4739 N  NE2   . HIS D 2 74  ? 3.047   -18.700 -8.396  1.00 51.79  ? 517  HIS D NE2   1 
ATOM   4740 N  N     . TYR D 2 75  ? 3.959   -14.573 -11.228 1.00 43.80  ? 518  TYR D N     1 
ATOM   4741 C  CA    . TYR D 2 75  ? 3.239   -14.727 -12.503 1.00 44.79  ? 518  TYR D CA    1 
ATOM   4742 C  C     . TYR D 2 75  ? 3.986   -14.099 -13.664 1.00 45.47  ? 518  TYR D C     1 
ATOM   4743 O  O     . TYR D 2 75  ? 3.383   -13.719 -14.659 1.00 48.34  ? 518  TYR D O     1 
ATOM   4744 C  CB    . TYR D 2 75  ? 1.868   -14.054 -12.424 1.00 44.74  ? 518  TYR D CB    1 
ATOM   4745 C  CG    . TYR D 2 75  ? 0.888   -14.723 -11.517 1.00 44.85  ? 518  TYR D CG    1 
ATOM   4746 C  CD1   . TYR D 2 75  ? 0.529   -16.038 -11.715 1.00 44.94  ? 518  TYR D CD1   1 
ATOM   4747 C  CD2   . TYR D 2 75  ? 0.311   -14.043 -10.468 1.00 45.42  ? 518  TYR D CD2   1 
ATOM   4748 C  CE1   . TYR D 2 75  ? -0.382  -16.668 -10.900 1.00 43.03  ? 518  TYR D CE1   1 
ATOM   4749 C  CE2   . TYR D 2 75  ? -0.586  -14.669 -9.633  1.00 47.24  ? 518  TYR D CE2   1 
ATOM   4750 C  CZ    . TYR D 2 75  ? -0.928  -15.989 -9.861  1.00 46.98  ? 518  TYR D CZ    1 
ATOM   4751 O  OH    . TYR D 2 75  ? -1.836  -16.615 -9.041  1.00 51.43  ? 518  TYR D OH    1 
ATOM   4752 N  N     . LYS D 2 76  ? 5.298   -13.994 -13.560 1.00 46.99  ? 519  LYS D N     1 
ATOM   4753 C  CA    . LYS D 2 76  ? 6.132   -13.860 -14.743 1.00 48.92  ? 519  LYS D CA    1 
ATOM   4754 C  C     . LYS D 2 76  ? 6.263   -12.388 -15.188 1.00 46.35  ? 519  LYS D C     1 
ATOM   4755 O  O     . LYS D 2 76  ? 6.674   -12.096 -16.287 1.00 47.64  ? 519  LYS D O     1 
ATOM   4756 C  CB    . LYS D 2 76  ? 5.601   -14.798 -15.858 1.00 51.01  ? 519  LYS D CB    1 
ATOM   4757 C  CG    . LYS D 2 76  ? 6.512   -15.969 -16.128 1.00 60.06  ? 519  LYS D CG    1 
ATOM   4758 C  CD    . LYS D 2 76  ? 6.335   -17.128 -15.165 1.00 71.99  ? 519  LYS D CD    1 
ATOM   4759 C  CE    . LYS D 2 76  ? 7.667   -17.870 -14.980 1.00 82.41  ? 519  LYS D CE    1 
ATOM   4760 N  NZ    . LYS D 2 76  ? 7.536   -19.121 -14.181 1.00 85.31  ? 519  LYS D NZ    1 
ATOM   4761 N  N     . ALA D 2 77  ? 5.920   -11.456 -14.321 1.00 45.70  ? 520  ALA D N     1 
ATOM   4762 C  CA    . ALA D 2 77  ? 6.011   -10.055 -14.667 1.00 46.11  ? 520  ALA D CA    1 
ATOM   4763 C  C     . ALA D 2 77  ? 7.434   -9.707  -14.949 1.00 43.91  ? 520  ALA D C     1 
ATOM   4764 O  O     . ALA D 2 77  ? 8.286   -10.068 -14.179 1.00 48.58  ? 520  ALA D O     1 
ATOM   4765 C  CB    . ALA D 2 77  ? 5.516   -9.210  -13.503 1.00 50.93  ? 520  ALA D CB    1 
ATOM   4766 N  N     . SER D 2 78  ? 7.685   -8.943  -16.001 1.00 43.45  ? 521  SER D N     1 
ATOM   4767 C  CA    . SER D 2 78  ? 9.027   -8.457  -16.257 1.00 44.64  ? 521  SER D CA    1 
ATOM   4768 C  C     . SER D 2 78  ? 9.391   -7.250  -15.415 1.00 40.65  ? 521  SER D C     1 
ATOM   4769 O  O     . SER D 2 78  ? 8.650   -6.259  -15.361 1.00 44.51  ? 521  SER D O     1 
ATOM   4770 C  CB    . SER D 2 78  ? 9.224   -8.096  -17.728 1.00 47.62  ? 521  SER D CB    1 
ATOM   4771 O  OG    . SER D 2 78  ? 10.468  -7.408  -17.878 1.00 53.35  ? 521  SER D OG    1 
ATOM   4772 N  N     . ALA D 2 79  ? 10.566  -7.323  -14.806 1.00 40.16  ? 522  ALA D N     1 
ATOM   4773 C  CA    . ALA D 2 79  ? 11.088  -6.248  -13.952 1.00 42.49  ? 522  ALA D CA    1 
ATOM   4774 C  C     . ALA D 2 79  ? 11.894  -5.206  -14.703 1.00 44.40  ? 522  ALA D C     1 
ATOM   4775 O  O     . ALA D 2 79  ? 12.272  -4.182  -14.120 1.00 49.04  ? 522  ALA D O     1 
ATOM   4776 C  CB    . ALA D 2 79  ? 11.971  -6.833  -12.876 1.00 45.31  ? 522  ALA D CB    1 
ATOM   4777 N  N     . GLU D 2 80  ? 12.119  -5.437  -15.987 1.00 45.17  ? 523  GLU D N     1 
ATOM   4778 C  CA    . GLU D 2 80  ? 12.930  -4.551  -16.798 1.00 49.99  ? 523  GLU D CA    1 
ATOM   4779 C  C     . GLU D 2 80  ? 12.096  -3.609  -17.708 1.00 49.58  ? 523  GLU D C     1 
ATOM   4780 O  O     . GLU D 2 80  ? 12.656  -2.909  -18.538 1.00 52.32  ? 523  GLU D O     1 
ATOM   4781 C  CB    . GLU D 2 80  ? 13.894  -5.389  -17.655 1.00 53.69  ? 523  GLU D CB    1 
ATOM   4782 C  CG    . GLU D 2 80  ? 14.496  -6.571  -16.910 1.00 64.79  ? 523  GLU D CG    1 
ATOM   4783 C  CD    . GLU D 2 80  ? 15.930  -6.897  -17.298 1.00 74.86  ? 523  GLU D CD    1 
ATOM   4784 O  OE1   . GLU D 2 80  ? 16.219  -6.943  -18.514 1.00 87.70  ? 523  GLU D OE1   1 
ATOM   4785 O  OE2   . GLU D 2 80  ? 16.769  -7.104  -16.381 1.00 78.59  ? 523  GLU D OE2   1 
ATOM   4786 N  N     . VAL D 2 81  ? 10.775  -3.588  -17.595 1.00 49.24  ? 524  VAL D N     1 
ATOM   4787 C  CA    . VAL D 2 81  ? 9.985   -2.707  -18.453 1.00 52.38  ? 524  VAL D CA    1 
ATOM   4788 C  C     . VAL D 2 81  ? 10.235  -1.275  -18.061 1.00 50.00  ? 524  VAL D C     1 
ATOM   4789 O  O     . VAL D 2 81  ? 10.208  -0.970  -16.865 1.00 56.59  ? 524  VAL D O     1 
ATOM   4790 C  CB    . VAL D 2 81  ? 8.478   -2.995  -18.338 1.00 58.48  ? 524  VAL D CB    1 
ATOM   4791 C  CG1   . VAL D 2 81  ? 7.661   -1.943  -19.083 1.00 59.12  ? 524  VAL D CG1   1 
ATOM   4792 C  CG2   . VAL D 2 81  ? 8.171   -4.368  -18.909 1.00 61.42  ? 524  VAL D CG2   1 
ATOM   4793 N  N     . GLN D 2 82  ? 10.456  -0.389  -19.043 1.00 45.55  ? 525  GLN D N     1 
ATOM   4794 C  CA    . GLN D 2 82  ? 10.684  1.045   -18.759 1.00 45.55  ? 525  GLN D CA    1 
ATOM   4795 C  C     . GLN D 2 82  ? 9.478   1.896   -19.091 1.00 42.27  ? 525  GLN D C     1 
ATOM   4796 O  O     . GLN D 2 82  ? 8.938   1.800   -20.192 1.00 45.11  ? 525  GLN D O     1 
ATOM   4797 C  CB    . GLN D 2 82  ? 11.879  1.567   -19.534 1.00 46.59  ? 525  GLN D CB    1 
ATOM   4798 C  CG    . GLN D 2 82  ? 13.129  0.770   -19.281 1.00 49.65  ? 525  GLN D CG    1 
ATOM   4799 C  CD    . GLN D 2 82  ? 14.351  1.425   -19.861 1.00 54.89  ? 525  GLN D CD    1 
ATOM   4800 O  OE1   . GLN D 2 82  ? 14.726  1.155   -20.993 1.00 56.29  ? 525  GLN D OE1   1 
ATOM   4801 N  NE2   . GLN D 2 82  ? 14.978  2.301   -19.085 1.00 57.93  ? 525  GLN D NE2   1 
ATOM   4802 N  N     . ASP D 2 83  ? 9.071   2.730   -18.141 1.00 39.53  ? 526  ASP D N     1 
ATOM   4803 C  CA    . ASP D 2 83  ? 7.941   3.624   -18.357 1.00 43.55  ? 526  ASP D CA    1 
ATOM   4804 C  C     . ASP D 2 83  ? 8.361   4.815   -19.198 1.00 41.99  ? 526  ASP D C     1 
ATOM   4805 O  O     . ASP D 2 83  ? 9.494   4.872   -19.655 1.00 39.90  ? 526  ASP D O     1 
ATOM   4806 C  CB    . ASP D 2 83  ? 7.312   4.061   -17.013 1.00 48.93  ? 526  ASP D CB    1 
ATOM   4807 C  CG    . ASP D 2 83  ? 8.256   4.874   -16.129 1.00 47.69  ? 526  ASP D CG    1 
ATOM   4808 O  OD1   . ASP D 2 83  ? 9.301   5.379   -16.613 1.00 50.51  ? 526  ASP D OD1   1 
ATOM   4809 O  OD2   . ASP D 2 83  ? 7.930   5.000   -14.929 1.00 45.60  ? 526  ASP D OD2   1 
ATOM   4810 N  N     . ASN D 2 84  ? 7.452   5.761   -19.405 1.00 43.40  ? 527  ASN D N     1 
ATOM   4811 C  CA    . ASN D 2 84  ? 7.783   6.980   -20.152 1.00 46.98  ? 527  ASN D CA    1 
ATOM   4812 C  C     . ASN D 2 84  ? 8.965   7.793   -19.687 1.00 48.65  ? 527  ASN D C     1 
ATOM   4813 O  O     . ASN D 2 84  ? 9.475   8.578   -20.469 1.00 53.54  ? 527  ASN D O     1 
ATOM   4814 C  CB    . ASN D 2 84  ? 6.580   7.910   -20.323 1.00 49.55  ? 527  ASN D CB    1 
ATOM   4815 C  CG    . ASN D 2 84  ? 6.053   8.488   -19.022 1.00 54.65  ? 527  ASN D CG    1 
ATOM   4816 O  OD1   . ASN D 2 84  ? 5.086   9.251   -19.056 1.00 59.37  ? 527  ASN D OD1   1 
ATOM   4817 N  ND2   . ASN D 2 84  ? 6.596   8.080   -17.882 1.00 56.67  ? 527  ASN D ND2   1 
ATOM   4818 N  N     . ASN D 2 85  ? 9.406   7.607   -18.449 1.00 47.71  ? 528  ASN D N     1 
ATOM   4819 C  CA    . ASN D 2 85  ? 10.589  8.287   -17.924 1.00 47.68  ? 528  ASN D CA    1 
ATOM   4820 C  C     . ASN D 2 85  ? 11.791  7.381   -17.848 1.00 47.94  ? 528  ASN D C     1 
ATOM   4821 O  O     . ASN D 2 85  ? 12.834  7.768   -17.303 1.00 45.46  ? 528  ASN D O     1 
ATOM   4822 C  CB    . ASN D 2 85  ? 10.310  8.769   -16.521 1.00 50.13  ? 528  ASN D CB    1 
ATOM   4823 C  CG    . ASN D 2 85  ? 9.177   9.743   -16.471 1.00 53.95  ? 528  ASN D CG    1 
ATOM   4824 O  OD1   . ASN D 2 85  ? 8.217   9.560   -15.735 1.00 58.20  ? 528  ASN D OD1   1 
ATOM   4825 N  ND2   . ASN D 2 85  ? 9.283   10.796  -17.251 1.00 58.83  ? 528  ASN D ND2   1 
ATOM   4826 N  N     . GLY D 2 86  ? 11.640  6.168   -18.373 1.00 48.20  ? 529  GLY D N     1 
ATOM   4827 C  CA    . GLY D 2 86  ? 12.731  5.206   -18.430 1.00 48.47  ? 529  GLY D CA    1 
ATOM   4828 C  C     . GLY D 2 86  ? 12.917  4.447   -17.140 1.00 48.37  ? 529  GLY D C     1 
ATOM   4829 O  O     . GLY D 2 86  ? 13.969  3.842   -16.933 1.00 46.59  ? 529  GLY D O     1 
ATOM   4830 N  N     . ASN D 2 87  ? 11.886  4.448   -16.292 1.00 45.97  ? 530  ASN D N     1 
ATOM   4831 C  CA    . ASN D 2 87  ? 11.997  3.839   -14.977 1.00 46.13  ? 530  ASN D CA    1 
ATOM   4832 C  C     . ASN D 2 87  ? 11.435  2.442   -14.967 1.00 44.23  ? 530  ASN D C     1 
ATOM   4833 O  O     . ASN D 2 87  ? 10.297  2.214   -15.407 1.00 43.22  ? 530  ASN D O     1 
ATOM   4834 C  CB    . ASN D 2 87  ? 11.245  4.647   -13.927 1.00 48.23  ? 530  ASN D CB    1 
ATOM   4835 C  CG    . ASN D 2 87  ? 11.929  5.946   -13.529 1.00 49.85  ? 530  ASN D CG    1 
ATOM   4836 O  OD1   . ASN D 2 87  ? 11.251  6.965   -13.376 1.00 41.28  ? 530  ASN D OD1   1 
ATOM   4837 N  ND2   . ASN D 2 87  ? 13.259  5.923   -13.329 1.00 52.15  ? 530  ASN D ND2   1 
ATOM   4838 N  N     . THR D 2 88  ? 12.238  1.515   -14.452 1.00 43.14  ? 531  THR D N     1 
ATOM   4839 C  CA    . THR D 2 88  ? 11.778  0.179   -14.106 1.00 45.13  ? 531  THR D CA    1 
ATOM   4840 C  C     . THR D 2 88  ? 11.016  0.199   -12.797 1.00 44.89  ? 531  THR D C     1 
ATOM   4841 O  O     . THR D 2 88  ? 11.121  1.146   -12.013 1.00 47.28  ? 531  THR D O     1 
ATOM   4842 C  CB    . THR D 2 88  ? 12.959  -0.787  -13.949 1.00 48.72  ? 531  THR D CB    1 
ATOM   4843 O  OG1   . THR D 2 88  ? 13.749  -0.397  -12.821 1.00 52.37  ? 531  THR D OG1   1 
ATOM   4844 C  CG2   . THR D 2 88  ? 13.843  -0.782  -15.171 1.00 48.26  ? 531  THR D CG2   1 
ATOM   4845 N  N     . PRO D 2 89  ? 10.275  -0.861  -12.513 1.00 44.96  ? 532  PRO D N     1 
ATOM   4846 C  CA    . PRO D 2 89  ? 9.714   -0.884  -11.179 1.00 48.31  ? 532  PRO D CA    1 
ATOM   4847 C  C     . PRO D 2 89  ? 10.772  -0.742  -10.088 1.00 44.53  ? 532  PRO D C     1 
ATOM   4848 O  O     . PRO D 2 89  ? 10.494  -0.147  -9.050  1.00 45.39  ? 532  PRO D O     1 
ATOM   4849 C  CB    . PRO D 2 89  ? 9.027   -2.261  -11.113 1.00 48.39  ? 532  PRO D CB    1 
ATOM   4850 C  CG    . PRO D 2 89  ? 8.711   -2.568  -12.522 1.00 45.95  ? 532  PRO D CG    1 
ATOM   4851 C  CD    . PRO D 2 89  ? 9.924   -2.069  -13.255 1.00 47.35  ? 532  PRO D CD    1 
ATOM   4852 N  N     . LEU D 2 90  ? 11.980  -1.239  -10.329 1.00 44.83  ? 533  LEU D N     1 
ATOM   4853 C  CA    . LEU D 2 90  ? 13.052  -1.019  -9.364  1.00 44.79  ? 533  LEU D CA    1 
ATOM   4854 C  C     . LEU D 2 90  ? 13.367  0.447   -9.140  1.00 45.12  ? 533  LEU D C     1 
ATOM   4855 O  O     . LEU D 2 90  ? 13.435  0.886   -7.999  1.00 44.93  ? 533  LEU D O     1 
ATOM   4856 C  CB    . LEU D 2 90  ? 14.318  -1.754  -9.752  1.00 44.31  ? 533  LEU D CB    1 
ATOM   4857 C  CG    . LEU D 2 90  ? 15.470  -1.629  -8.760  1.00 42.45  ? 533  LEU D CG    1 
ATOM   4858 C  CD1   . LEU D 2 90  ? 15.043  -2.087  -7.389  1.00 43.16  ? 533  LEU D CD1   1 
ATOM   4859 C  CD2   . LEU D 2 90  ? 16.664  -2.455  -9.211  1.00 41.65  ? 533  LEU D CD2   1 
ATOM   4860 N  N     . HIS D 2 91  ? 13.518  1.212   -10.216 1.00 46.26  ? 534  HIS D N     1 
ATOM   4861 C  CA    . HIS D 2 91  ? 13.716  2.670   -10.098 1.00 45.75  ? 534  HIS D CA    1 
ATOM   4862 C  C     . HIS D 2 91  ? 12.624  3.305   -9.270  1.00 43.79  ? 534  HIS D C     1 
ATOM   4863 O  O     . HIS D 2 91  ? 12.880  4.247   -8.538  1.00 45.21  ? 534  HIS D O     1 
ATOM   4864 C  CB    . HIS D 2 91  ? 13.699  3.390   -11.456 1.00 47.00  ? 534  HIS D CB    1 
ATOM   4865 C  CG    . HIS D 2 91  ? 14.897  3.140   -12.310 1.00 47.25  ? 534  HIS D CG    1 
ATOM   4866 N  ND1   . HIS D 2 91  ? 15.026  2.010   -13.077 1.00 51.28  ? 534  HIS D ND1   1 
ATOM   4867 C  CD2   . HIS D 2 91  ? 16.005  3.882   -12.541 1.00 47.30  ? 534  HIS D CD2   1 
ATOM   4868 C  CE1   . HIS D 2 91  ? 16.173  2.053   -13.731 1.00 51.22  ? 534  HIS D CE1   1 
ATOM   4869 N  NE2   . HIS D 2 91  ? 16.787  3.180   -13.421 1.00 47.11  ? 534  HIS D NE2   1 
ATOM   4870 N  N     . LEU D 2 92  ? 11.388  2.847   -9.416  1.00 42.50  ? 535  LEU D N     1 
ATOM   4871 C  CA    . LEU D 2 92  ? 10.320  3.475   -8.649  1.00 49.16  ? 535  LEU D CA    1 
ATOM   4872 C  C     . LEU D 2 92  ? 10.443  3.156   -7.153  1.00 52.62  ? 535  LEU D C     1 
ATOM   4873 O  O     . LEU D 2 92  ? 10.460  4.070   -6.317  1.00 55.36  ? 535  LEU D O     1 
ATOM   4874 C  CB    . LEU D 2 92  ? 8.943   3.069   -9.166  1.00 47.41  ? 535  LEU D CB    1 
ATOM   4875 C  CG    . LEU D 2 92  ? 8.635   3.540   -10.575 1.00 43.71  ? 535  LEU D CG    1 
ATOM   4876 C  CD1   . LEU D 2 92  ? 7.160   3.360   -10.871 1.00 45.49  ? 535  LEU D CD1   1 
ATOM   4877 C  CD2   . LEU D 2 92  ? 9.026   4.974   -10.789 1.00 41.24  ? 535  LEU D CD2   1 
ATOM   4878 N  N     . ALA D 2 93  ? 10.554  1.864   -6.842  1.00 54.09  ? 536  ALA D N     1 
ATOM   4879 C  CA    . ALA D 2 93  ? 10.812  1.399   -5.481  1.00 52.05  ? 536  ALA D CA    1 
ATOM   4880 C  C     . ALA D 2 93  ? 11.975  2.127   -4.823  1.00 53.14  ? 536  ALA D C     1 
ATOM   4881 O  O     . ALA D 2 93  ? 11.923  2.406   -3.636  1.00 55.67  ? 536  ALA D O     1 
ATOM   4882 C  CB    . ALA D 2 93  ? 11.067  -0.095  -5.471  1.00 50.88  ? 536  ALA D CB    1 
ATOM   4883 N  N     . CYS D 2 94  ? 13.022  2.443   -5.579  1.00 52.56  ? 537  CYS D N     1 
ATOM   4884 C  CA    . CYS D 2 94  ? 14.152  3.187   -5.016  1.00 50.68  ? 537  CYS D CA    1 
ATOM   4885 C  C     . CYS D 2 94  ? 13.826  4.636   -4.757  1.00 54.37  ? 537  CYS D C     1 
ATOM   4886 O  O     . CYS D 2 94  ? 14.275  5.158   -3.753  1.00 59.82  ? 537  CYS D O     1 
ATOM   4887 C  CB    . CYS D 2 94  ? 15.387  3.112   -5.905  1.00 50.60  ? 537  CYS D CB    1 
ATOM   4888 S  SG    . CYS D 2 94  ? 16.144  1.487   -5.916  1.00 60.23  ? 537  CYS D SG    1 
ATOM   4889 N  N     . THR D 2 95  ? 13.077  5.304   -5.637  1.00 55.98  ? 538  THR D N     1 
ATOM   4890 C  CA    . THR D 2 95  ? 12.793  6.719   -5.416  1.00 58.98  ? 538  THR D CA    1 
ATOM   4891 C  C     . THR D 2 95  ? 11.858  6.913   -4.213  1.00 58.47  ? 538  THR D C     1 
ATOM   4892 O  O     . THR D 2 95  ? 11.825  8.010   -3.639  1.00 61.64  ? 538  THR D O     1 
ATOM   4893 C  CB    . THR D 2 95  ? 12.072  7.418   -6.583  1.00 64.90  ? 538  THR D CB    1 
ATOM   4894 O  OG1   . THR D 2 95  ? 10.746  6.886   -6.699  1.00 71.15  ? 538  THR D OG1   1 
ATOM   4895 C  CG2   . THR D 2 95  ? 12.820  7.302   -7.902  1.00 63.17  ? 538  THR D CG2   1 
ATOM   4896 N  N     . TYR D 2 96  ? 11.062  5.900   -3.871  1.00 51.37  ? 539  TYR D N     1 
ATOM   4897 C  CA    . TYR D 2 96  ? 10.152  6.017   -2.731  1.00 57.36  ? 539  TYR D CA    1 
ATOM   4898 C  C     . TYR D 2 96  ? 10.586  5.215   -1.505  1.00 62.60  ? 539  TYR D C     1 
ATOM   4899 O  O     . TYR D 2 96  ? 9.794   4.985   -0.589  1.00 60.13  ? 539  TYR D O     1 
ATOM   4900 C  CB    . TYR D 2 96  ? 8.739   5.650   -3.173  1.00 62.82  ? 539  TYR D CB    1 
ATOM   4901 C  CG    . TYR D 2 96  ? 8.202   6.572   -4.244  1.00 72.83  ? 539  TYR D CG    1 
ATOM   4902 C  CD1   . TYR D 2 96  ? 8.751   7.854   -4.423  1.00 86.14  ? 539  TYR D CD1   1 
ATOM   4903 C  CD2   . TYR D 2 96  ? 7.164   6.195   -5.070  1.00 69.80  ? 539  TYR D CD2   1 
ATOM   4904 C  CE1   . TYR D 2 96  ? 8.286   8.716   -5.387  1.00 83.01  ? 539  TYR D CE1   1 
ATOM   4905 C  CE2   . TYR D 2 96  ? 6.694   7.069   -6.034  1.00 76.61  ? 539  TYR D CE2   1 
ATOM   4906 C  CZ    . TYR D 2 96  ? 7.257   8.317   -6.181  1.00 80.64  ? 539  TYR D CZ    1 
ATOM   4907 O  OH    . TYR D 2 96  ? 6.798   9.187   -7.128  1.00 93.24  ? 539  TYR D OH    1 
ATOM   4908 N  N     . GLY D 2 97  ? 11.867  4.831   -1.485  1.00 67.97  ? 540  GLY D N     1 
ATOM   4909 C  CA    . GLY D 2 97  ? 12.446  3.958   -0.464  1.00 60.89  ? 540  GLY D CA    1 
ATOM   4910 C  C     . GLY D 2 97  ? 11.568  2.846   0.063   1.00 61.16  ? 540  GLY D C     1 
ATOM   4911 O  O     . GLY D 2 97  ? 11.438  2.703   1.264   1.00 69.19  ? 540  GLY D O     1 
ATOM   4912 N  N     . HIS D 2 98  ? 10.973  2.034   -0.800  1.00 59.41  ? 541  HIS D N     1 
ATOM   4913 C  CA    . HIS D 2 98  ? 10.398  0.794   -0.332  1.00 59.20  ? 541  HIS D CA    1 
ATOM   4914 C  C     . HIS D 2 98  ? 11.441  -0.315  -0.391  1.00 62.13  ? 541  HIS D C     1 
ATOM   4915 O  O     . HIS D 2 98  ? 11.470  -1.123  -1.313  1.00 63.56  ? 541  HIS D O     1 
ATOM   4916 C  CB    . HIS D 2 98  ? 9.173   0.406   -1.114  1.00 63.80  ? 541  HIS D CB    1 
ATOM   4917 C  CG    . HIS D 2 98  ? 8.159   1.480   -1.198  1.00 68.09  ? 541  HIS D CG    1 
ATOM   4918 N  ND1   . HIS D 2 98  ? 6.894   1.359   -0.676  1.00 68.84  ? 541  HIS D ND1   1 
ATOM   4919 C  CD2   . HIS D 2 98  ? 8.211   2.685   -1.793  1.00 71.39  ? 541  HIS D CD2   1 
ATOM   4920 C  CE1   . HIS D 2 98  ? 6.213   2.456   -0.934  1.00 68.81  ? 541  HIS D CE1   1 
ATOM   4921 N  NE2   . HIS D 2 98  ? 6.992   3.277   -1.610  1.00 73.21  ? 541  HIS D NE2   1 
ATOM   4922 N  N     . GLU D 2 99  ? 12.245  -0.374  0.655   1.00 61.11  ? 542  GLU D N     1 
ATOM   4923 C  CA    . GLU D 2 99  ? 13.300  -1.329  0.754   1.00 62.60  ? 542  GLU D CA    1 
ATOM   4924 C  C     . GLU D 2 99  ? 12.756  -2.745  0.635   1.00 61.01  ? 542  GLU D C     1 
ATOM   4925 O  O     . GLU D 2 99  ? 13.391  -3.588  0.014   1.00 60.53  ? 542  GLU D O     1 
ATOM   4926 C  CB    . GLU D 2 99  ? 14.028  -1.126  2.081   1.00 77.63  ? 542  GLU D CB    1 
ATOM   4927 C  CG    . GLU D 2 99  ? 15.366  -1.833  2.233   1.00 84.30  ? 542  GLU D CG    1 
ATOM   4928 C  CD    . GLU D 2 99  ? 15.888  -1.739  3.665   1.00 90.90  ? 542  GLU D CD    1 
ATOM   4929 O  OE1   . GLU D 2 99  ? 15.543  -0.747  4.365   1.00 83.40  ? 542  GLU D OE1   1 
ATOM   4930 O  OE2   . GLU D 2 99  ? 16.639  -2.657  4.079   1.00 100.39 ? 542  GLU D OE2   1 
ATOM   4931 N  N     . ASP D 2 100 ? 11.594  -3.023  1.224   1.00 58.94  ? 543  ASP D N     1 
ATOM   4932 C  CA    . ASP D 2 100 ? 11.053  -4.387  1.176   1.00 59.31  ? 543  ASP D CA    1 
ATOM   4933 C  C     . ASP D 2 100 ? 10.793  -4.838  -0.279  1.00 60.30  ? 543  ASP D C     1 
ATOM   4934 O  O     . ASP D 2 100 ? 10.971  -6.019  -0.618  1.00 56.68  ? 543  ASP D O     1 
ATOM   4935 C  CB    . ASP D 2 100 ? 9.813   -4.540  2.078   1.00 61.10  ? 543  ASP D CB    1 
ATOM   4936 C  CG    . ASP D 2 100 ? 8.661   -3.599  1.702   1.00 71.83  ? 543  ASP D CG    1 
ATOM   4937 O  OD1   . ASP D 2 100 ? 8.900   -2.492  1.158   1.00 72.07  ? 543  ASP D OD1   1 
ATOM   4938 O  OD2   . ASP D 2 100 ? 7.486   -3.969  1.971   1.00 81.56  ? 543  ASP D OD2   1 
ATOM   4939 N  N     . CYS D 2 101 ? 10.396  -3.881  -1.123  1.00 59.76  ? 544  CYS D N     1 
ATOM   4940 C  CA    . CYS D 2 101 ? 10.083  -4.127  -2.535  1.00 55.04  ? 544  CYS D CA    1 
ATOM   4941 C  C     . CYS D 2 101 ? 11.348  -4.199  -3.369  1.00 51.60  ? 544  CYS D C     1 
ATOM   4942 O  O     . CYS D 2 101 ? 11.521  -5.102  -4.185  1.00 56.20  ? 544  CYS D O     1 
ATOM   4943 C  CB    . CYS D 2 101 ? 9.164   -3.031  -3.085  1.00 55.09  ? 544  CYS D CB    1 
ATOM   4944 S  SG    . CYS D 2 101 ? 7.409   -3.287  -2.643  1.00 57.15  ? 544  CYS D SG    1 
ATOM   4945 N  N     . VAL D 2 102 ? 12.256  -3.271  -3.127  1.00 46.60  ? 545  VAL D N     1 
ATOM   4946 C  CA    . VAL D 2 102 ? 13.583  -3.339  -3.709  1.00 45.20  ? 545  VAL D CA    1 
ATOM   4947 C  C     . VAL D 2 102 ? 14.136  -4.746  -3.576  1.00 47.89  ? 545  VAL D C     1 
ATOM   4948 O  O     . VAL D 2 102 ? 14.488  -5.380  -4.573  1.00 54.08  ? 545  VAL D O     1 
ATOM   4949 C  CB    . VAL D 2 102 ? 14.542  -2.358  -3.022  1.00 44.97  ? 545  VAL D CB    1 
ATOM   4950 C  CG1   . VAL D 2 102 ? 15.991  -2.615  -3.427  1.00 45.42  ? 545  VAL D CG1   1 
ATOM   4951 C  CG2   . VAL D 2 102 ? 14.151  -0.920  -3.343  1.00 45.12  ? 545  VAL D CG2   1 
ATOM   4952 N  N     . LYS D 2 103 ? 14.201  -5.235  -2.344  1.00 47.94  ? 546  LYS D N     1 
ATOM   4953 C  CA    . LYS D 2 103 ? 14.745  -6.563  -2.071  1.00 50.06  ? 546  LYS D CA    1 
ATOM   4954 C  C     . LYS D 2 103 ? 14.036  -7.659  -2.832  1.00 50.26  ? 546  LYS D C     1 
ATOM   4955 O  O     . LYS D 2 103 ? 14.672  -8.504  -3.474  1.00 45.79  ? 546  LYS D O     1 
ATOM   4956 C  CB    . LYS D 2 103 ? 14.645  -6.890  -0.597  1.00 52.59  ? 546  LYS D CB    1 
ATOM   4957 C  CG    . LYS D 2 103 ? 15.674  -6.195  0.275   1.00 56.84  ? 546  LYS D CG    1 
ATOM   4958 C  CD    . LYS D 2 103 ? 15.437  -6.558  1.730   1.00 59.71  ? 546  LYS D CD    1 
ATOM   4959 C  CE    . LYS D 2 103 ? 16.375  -5.825  2.663   1.00 63.50  ? 546  LYS D CE    1 
ATOM   4960 N  NZ    . LYS D 2 103 ? 15.799  -5.815  4.034   1.00 63.56  ? 546  LYS D NZ    1 
ATOM   4961 N  N     . ALA D 2 104 ? 12.708  -7.640  -2.797  1.00 51.10  ? 547  ALA D N     1 
ATOM   4962 C  CA    . ALA D 2 104 ? 11.964  -8.598  -3.614  1.00 49.30  ? 547  ALA D CA    1 
ATOM   4963 C  C     . ALA D 2 104 ? 12.479  -8.568  -5.044  1.00 46.41  ? 547  ALA D C     1 
ATOM   4964 O  O     . ALA D 2 104 ? 12.764  -9.622  -5.617  1.00 44.39  ? 547  ALA D O     1 
ATOM   4965 C  CB    . ALA D 2 104 ? 10.473  -8.334  -3.575  1.00 50.84  ? 547  ALA D CB    1 
ATOM   4966 N  N     . LEU D 2 105 ? 12.647  -7.367  -5.604  1.00 42.45  ? 548  LEU D N     1 
ATOM   4967 C  CA    . LEU D 2 105 ? 13.062  -7.264  -7.006  1.00 43.47  ? 548  LEU D CA    1 
ATOM   4968 C  C     . LEU D 2 105 ? 14.444  -7.857  -7.201  1.00 47.49  ? 548  LEU D C     1 
ATOM   4969 O  O     . LEU D 2 105 ? 14.672  -8.666  -8.118  1.00 53.34  ? 548  LEU D O     1 
ATOM   4970 C  CB    . LEU D 2 105 ? 13.010  -5.826  -7.526  1.00 40.92  ? 548  LEU D CB    1 
ATOM   4971 C  CG    . LEU D 2 105 ? 11.592  -5.260  -7.672  1.00 40.49  ? 548  LEU D CG    1 
ATOM   4972 C  CD1   . LEU D 2 105 ? 11.616  -3.745  -7.746  1.00 40.90  ? 548  LEU D CD1   1 
ATOM   4973 C  CD2   . LEU D 2 105 ? 10.892  -5.854  -8.886  1.00 38.24  ? 548  LEU D CD2   1 
ATOM   4974 N  N     . VAL D 2 106 ? 15.363  -7.470  -6.331  1.00 46.89  ? 549  VAL D N     1 
ATOM   4975 C  CA    . VAL D 2 106 ? 16.727  -7.906  -6.470  1.00 45.19  ? 549  VAL D CA    1 
ATOM   4976 C  C     . VAL D 2 106 ? 16.872  -9.424  -6.289  1.00 46.31  ? 549  VAL D C     1 
ATOM   4977 O  O     . VAL D 2 106 ? 17.539  -10.075 -7.090  1.00 50.80  ? 549  VAL D O     1 
ATOM   4978 C  CB    . VAL D 2 106 ? 17.596  -7.195  -5.468  1.00 47.69  ? 549  VAL D CB    1 
ATOM   4979 C  CG1   . VAL D 2 106 ? 18.986  -7.775  -5.532  1.00 48.14  ? 549  VAL D CG1   1 
ATOM   4980 C  CG2   . VAL D 2 106 ? 17.618  -5.696  -5.764  1.00 48.53  ? 549  VAL D CG2   1 
ATOM   4981 N  N     . TYR D 2 107 ? 16.203  -10.001 -5.290  1.00 46.65  ? 550  TYR D N     1 
ATOM   4982 C  CA    . TYR D 2 107 ? 16.424  -11.407 -4.946  1.00 44.99  ? 550  TYR D CA    1 
ATOM   4983 C  C     . TYR D 2 107 ? 15.482  -12.394 -5.623  1.00 46.13  ? 550  TYR D C     1 
ATOM   4984 O  O     . TYR D 2 107 ? 15.746  -13.597 -5.614  1.00 42.60  ? 550  TYR D O     1 
ATOM   4985 C  CB    . TYR D 2 107 ? 16.293  -11.636 -3.448  1.00 45.91  ? 550  TYR D CB    1 
ATOM   4986 C  CG    . TYR D 2 107 ? 17.390  -11.067 -2.613  1.00 44.95  ? 550  TYR D CG    1 
ATOM   4987 C  CD1   . TYR D 2 107 ? 17.369  -9.748  -2.222  1.00 47.13  ? 550  TYR D CD1   1 
ATOM   4988 C  CD2   . TYR D 2 107 ? 18.440  -11.858 -2.190  1.00 50.55  ? 550  TYR D CD2   1 
ATOM   4989 C  CE1   . TYR D 2 107 ? 18.376  -9.213  -1.453  1.00 52.60  ? 550  TYR D CE1   1 
ATOM   4990 C  CE2   . TYR D 2 107 ? 19.465  -11.334 -1.412  1.00 53.40  ? 550  TYR D CE2   1 
ATOM   4991 C  CZ    . TYR D 2 107 ? 19.418  -10.012 -1.054  1.00 53.76  ? 550  TYR D CZ    1 
ATOM   4992 O  OH    . TYR D 2 107 ? 20.396  -9.471  -0.289  1.00 50.42  ? 550  TYR D OH    1 
ATOM   4993 N  N     . TYR D 2 108 ? 14.371  -11.917 -6.176  1.00 48.93  ? 551  TYR D N     1 
ATOM   4994 C  CA    . TYR D 2 108 ? 13.403  -12.850 -6.722  1.00 51.19  ? 551  TYR D CA    1 
ATOM   4995 C  C     . TYR D 2 108 ? 14.165  -13.619 -7.752  1.00 57.93  ? 551  TYR D C     1 
ATOM   4996 O  O     . TYR D 2 108 ? 14.207  -14.848 -7.719  1.00 61.06  ? 551  TYR D O     1 
ATOM   4997 C  CB    . TYR D 2 108 ? 12.185  -12.173 -7.368  1.00 50.95  ? 551  TYR D CB    1 
ATOM   4998 C  CG    . TYR D 2 108 ? 11.215  -13.215 -7.873  1.00 50.97  ? 551  TYR D CG    1 
ATOM   4999 C  CD1   . TYR D 2 108 ? 10.378  -13.885 -6.990  1.00 55.90  ? 551  TYR D CD1   1 
ATOM   5000 C  CD2   . TYR D 2 108 ? 11.159  -13.569 -9.208  1.00 46.25  ? 551  TYR D CD2   1 
ATOM   5001 C  CE1   . TYR D 2 108 ? 9.503   -14.869 -7.426  1.00 52.40  ? 551  TYR D CE1   1 
ATOM   5002 C  CE2   . TYR D 2 108 ? 10.293  -14.546 -9.647  1.00 46.50  ? 551  TYR D CE2   1 
ATOM   5003 C  CZ    . TYR D 2 108 ? 9.469   -15.195 -8.748  1.00 49.81  ? 551  TYR D CZ    1 
ATOM   5004 O  OH    . TYR D 2 108 ? 8.608   -16.179 -9.151  1.00 56.58  ? 551  TYR D OH    1 
ATOM   5005 N  N     . ASP D 2 109 ? 14.849  -12.843 -8.607  1.00 79.13  ? 552  ASP D N     1 
ATOM   5006 C  CA    . ASP D 2 109 ? 14.963  -13.060 -10.073 1.00 95.71  ? 552  ASP D CA    1 
ATOM   5007 C  C     . ASP D 2 109 ? 15.841  -14.277 -10.253 1.00 96.13  ? 552  ASP D C     1 
ATOM   5008 O  O     . ASP D 2 109 ? 15.788  -14.938 -11.309 1.00 82.69  ? 552  ASP D O     1 
ATOM   5009 C  CB    . ASP D 2 109 ? 15.611  -11.822 -10.810 1.00 104.53 ? 552  ASP D CB    1 
ATOM   5010 C  CG    . ASP D 2 109 ? 14.572  -10.908 -11.663 1.00 118.35 ? 552  ASP D CG    1 
ATOM   5011 O  OD1   . ASP D 2 109 ? 13.315  -10.984 -11.518 1.00 94.06  ? 552  ASP D OD1   1 
ATOM   5012 O  OD2   . ASP D 2 109 ? 15.042  -10.077 -12.510 1.00 109.58 ? 552  ASP D OD2   1 
ATOM   5013 N  N     . VAL D 2 110 ? 16.598  -14.557 -9.171  1.00 109.73 ? 553  VAL D N     1 
ATOM   5014 C  CA    . VAL D 2 110 ? 17.865  -15.322 -9.139  1.00 120.79 ? 553  VAL D CA    1 
ATOM   5015 C  C     . VAL D 2 110 ? 18.976  -14.779 -10.107 1.00 122.03 ? 553  VAL D C     1 
ATOM   5016 O  O     . VAL D 2 110 ? 19.238  -15.363 -11.167 1.00 112.91 ? 553  VAL D O     1 
ATOM   5017 C  CB    . VAL D 2 110 ? 17.615  -16.896 -9.195  1.00 122.15 ? 553  VAL D CB    1 
ATOM   5018 C  CG1   . VAL D 2 110 ? 18.018  -17.564 -7.886  1.00 107.15 ? 553  VAL D CG1   1 
ATOM   5019 C  CG2   . VAL D 2 110 ? 16.144  -17.278 -9.453  1.00 124.99 ? 553  VAL D CG2   1 
ATOM   5020 N  N     . GLU D 2 111 ? 19.608  -13.655 -9.724  1.00 114.57 ? 554  GLU D N     1 
ATOM   5021 C  CA    . GLU D 2 111 ? 20.841  -13.117 -10.356 1.00 126.69 ? 554  GLU D CA    1 
ATOM   5022 C  C     . GLU D 2 111 ? 20.531  -12.343 -11.617 1.00 124.89 ? 554  GLU D C     1 
ATOM   5023 O  O     . GLU D 2 111 ? 20.996  -11.210 -11.796 1.00 114.91 ? 554  GLU D O     1 
ATOM   5024 C  CB    . GLU D 2 111 ? 21.913  -14.203 -10.648 1.00 142.70 ? 554  GLU D CB    1 
ATOM   5025 C  CG    . GLU D 2 111 ? 22.732  -14.034 -11.971 1.00 138.27 ? 554  GLU D CG    1 
ATOM   5026 C  CD    . GLU D 2 111 ? 24.257  -13.907 -11.747 1.00 125.12 ? 554  GLU D CD    1 
ATOM   5027 O  OE1   . GLU D 2 111 ? 24.715  -14.142 -10.610 1.00 115.70 ? 554  GLU D OE1   1 
ATOM   5028 O  OE2   . GLU D 2 111 ? 25.007  -13.557 -12.693 1.00 109.28 ? 554  GLU D OE2   1 
ATOM   5029 N  N     . SER D 2 112 ? 19.763  -12.957 -12.504 1.00 127.40 ? 555  SER D N     1 
ATOM   5030 C  CA    . SER D 2 112 ? 19.318  -12.263 -13.709 1.00 129.11 ? 555  SER D CA    1 
ATOM   5031 C  C     . SER D 2 112 ? 18.496  -10.986 -13.363 1.00 139.81 ? 555  SER D C     1 
ATOM   5032 O  O     . SER D 2 112 ? 17.404  -10.780 -13.892 1.00 150.89 ? 555  SER D O     1 
ATOM   5033 C  CB    . SER D 2 112 ? 18.548  -13.238 -14.621 1.00 118.07 ? 555  SER D CB    1 
ATOM   5034 O  OG    . SER D 2 112 ? 17.153  -13.027 -14.558 1.00 108.81 ? 555  SER D OG    1 
ATOM   5035 N  N     . CYS D 2 113 ? 19.038  -10.147 -12.466 1.00 129.32 ? 556  CYS D N     1 
ATOM   5036 C  CA    . CYS D 2 113 ? 18.553  -8.799  -12.179 1.00 109.72 ? 556  CYS D CA    1 
ATOM   5037 C  C     . CYS D 2 113 ? 19.591  -7.736  -12.482 1.00 98.48  ? 556  CYS D C     1 
ATOM   5038 O  O     . CYS D 2 113 ? 20.609  -7.641  -11.798 1.00 92.35  ? 556  CYS D O     1 
ATOM   5039 C  CB    . CYS D 2 113 ? 18.256  -8.666  -10.695 1.00 105.36 ? 556  CYS D CB    1 
ATOM   5040 S  SG    . CYS D 2 113 ? 17.743  -6.988  -10.327 1.00 103.84 ? 556  CYS D SG    1 
ATOM   5041 N  N     . ARG D 2 114 ? 19.328  -6.903  -13.475 1.00 89.62  ? 557  ARG D N     1 
ATOM   5042 C  CA    . ARG D 2 114 ? 20.300  -5.892  -13.825 1.00 81.58  ? 557  ARG D CA    1 
ATOM   5043 C  C     . ARG D 2 114 ? 20.082  -4.659  -13.003 1.00 70.30  ? 557  ARG D C     1 
ATOM   5044 O  O     . ARG D 2 114 ? 18.965  -4.165  -12.910 1.00 64.92  ? 557  ARG D O     1 
ATOM   5045 C  CB    . ARG D 2 114 ? 20.228  -5.551  -15.302 1.00 85.48  ? 557  ARG D CB    1 
ATOM   5046 C  CG    . ARG D 2 114 ? 20.589  -6.748  -16.170 1.00 90.94  ? 557  ARG D CG    1 
ATOM   5047 C  CD    . ARG D 2 114 ? 20.240  -6.562  -17.649 1.00 93.03  ? 557  ARG D CD    1 
ATOM   5048 N  NE    . ARG D 2 114 ? 20.744  -5.282  -18.142 1.00 89.60  ? 557  ARG D NE    1 
ATOM   5049 C  CZ    . ARG D 2 114 ? 20.164  -4.562  -19.101 1.00 94.50  ? 557  ARG D CZ    1 
ATOM   5050 N  NH1   . ARG D 2 114 ? 19.044  -4.978  -19.692 1.00 93.42  ? 557  ARG D NH1   1 
ATOM   5051 N  NH2   . ARG D 2 114 ? 20.705  -3.411  -19.484 1.00 97.94  ? 557  ARG D NH2   1 
ATOM   5052 N  N     . LEU D 2 115 ? 21.172  -4.157  -12.434 1.00 65.53  ? 558  LEU D N     1 
ATOM   5053 C  CA    . LEU D 2 115 ? 21.160  -2.952  -11.605 1.00 62.64  ? 558  LEU D CA    1 
ATOM   5054 C  C     . LEU D 2 115 ? 21.770  -1.764  -12.321 1.00 58.29  ? 558  LEU D C     1 
ATOM   5055 O  O     . LEU D 2 115 ? 21.922  -0.690  -11.736 1.00 62.07  ? 558  LEU D O     1 
ATOM   5056 C  CB    . LEU D 2 115 ? 21.955  -3.200  -10.328 1.00 63.34  ? 558  LEU D CB    1 
ATOM   5057 C  CG    . LEU D 2 115 ? 21.684  -4.509  -9.587  1.00 58.72  ? 558  LEU D CG    1 
ATOM   5058 C  CD1   . LEU D 2 115 ? 22.634  -4.667  -8.411  1.00 57.92  ? 558  LEU D CD1   1 
ATOM   5059 C  CD2   . LEU D 2 115 ? 20.253  -4.547  -9.096  1.00 62.59  ? 558  LEU D CD2   1 
ATOM   5060 N  N     . ASP D 2 116 ? 22.115  -1.960  -13.584 1.00 58.10  ? 559  ASP D N     1 
ATOM   5061 C  CA    . ASP D 2 116 ? 22.796  -0.944  -14.370 1.00 61.35  ? 559  ASP D CA    1 
ATOM   5062 C  C     . ASP D 2 116 ? 21.844  -0.146  -15.297 1.00 62.15  ? 559  ASP D C     1 
ATOM   5063 O  O     . ASP D 2 116 ? 22.294  0.735   -16.008 1.00 62.88  ? 559  ASP D O     1 
ATOM   5064 C  CB    . ASP D 2 116 ? 23.885  -1.607  -15.207 1.00 64.32  ? 559  ASP D CB    1 
ATOM   5065 C  CG    . ASP D 2 116 ? 23.316  -2.484  -16.329 1.00 68.79  ? 559  ASP D CG    1 
ATOM   5066 O  OD1   . ASP D 2 116 ? 22.550  -1.986  -17.158 1.00 74.35  ? 559  ASP D OD1   1 
ATOM   5067 O  OD2   . ASP D 2 116 ? 23.631  -3.681  -16.402 1.00 69.43  ? 559  ASP D OD2   1 
ATOM   5068 N  N     . ILE D 2 117 ? 20.546  -0.451  -15.316 1.00 60.44  ? 560  ILE D N     1 
ATOM   5069 C  CA    . ILE D 2 117 ? 19.644  0.152   -16.298 1.00 51.40  ? 560  ILE D CA    1 
ATOM   5070 C  C     . ILE D 2 117 ? 19.380  1.619   -15.997 1.00 48.96  ? 560  ILE D C     1 
ATOM   5071 O  O     . ILE D 2 117 ? 18.866  1.978   -14.954 1.00 41.17  ? 560  ILE D O     1 
ATOM   5072 C  CB    . ILE D 2 117 ? 18.294  -0.559  -16.362 1.00 52.69  ? 560  ILE D CB    1 
ATOM   5073 C  CG1   . ILE D 2 117 ? 18.479  -2.015  -16.815 1.00 52.21  ? 560  ILE D CG1   1 
ATOM   5074 C  CG2   . ILE D 2 117 ? 17.350  0.159   -17.323 1.00 51.62  ? 560  ILE D CG2   1 
ATOM   5075 C  CD1   . ILE D 2 117 ? 17.241  -2.879  -16.643 1.00 51.37  ? 560  ILE D CD1   1 
ATOM   5076 N  N     . GLY D 2 118 ? 19.745  2.467   -16.949 1.00 51.60  ? 561  GLY D N     1 
ATOM   5077 C  CA    . GLY D 2 118 ? 19.546  3.905   -16.810 1.00 51.21  ? 561  GLY D CA    1 
ATOM   5078 C  C     . GLY D 2 118 ? 18.150  4.312   -17.236 1.00 49.45  ? 561  GLY D C     1 
ATOM   5079 O  O     . GLY D 2 118 ? 17.654  3.859   -18.237 1.00 52.80  ? 561  GLY D O     1 
ATOM   5080 N  N     . ASN D 2 119 ? 17.558  5.150   -16.421 1.00 49.20  ? 562  ASN D N     1 
ATOM   5081 C  CA    . ASN D 2 119 ? 16.560  6.130   -16.686 1.00 54.91  ? 562  ASN D CA    1 
ATOM   5082 C  C     . ASN D 2 119 ? 16.663  6.991   -17.895 1.00 64.62  ? 562  ASN D C     1 
ATOM   5083 O  O     . ASN D 2 119 ? 17.741  7.156   -18.426 1.00 71.01  ? 562  ASN D O     1 
ATOM   5084 C  CB    . ASN D 2 119 ? 16.904  7.112   -15.566 1.00 57.39  ? 562  ASN D CB    1 
ATOM   5085 C  CG    . ASN D 2 119 ? 15.756  7.488   -14.770 1.00 61.57  ? 562  ASN D CG    1 
ATOM   5086 O  OD1   . ASN D 2 119 ? 14.705  6.887   -14.868 1.00 73.87  ? 562  ASN D OD1   1 
ATOM   5087 N  ND2   . ASN D 2 119 ? 15.939  8.495   -13.956 1.00 73.48  ? 562  ASN D ND2   1 
ATOM   5088 N  N     . GLU D 2 120 ? 15.576  7.703   -18.205 1.00 70.74  ? 563  GLU D N     1 
ATOM   5089 C  CA    . GLU D 2 120 ? 15.630  8.991   -18.908 1.00 72.85  ? 563  GLU D CA    1 
ATOM   5090 C  C     . GLU D 2 120 ? 16.901  9.784   -18.628 1.00 70.43  ? 563  GLU D C     1 
ATOM   5091 O  O     . GLU D 2 120 ? 17.636  10.140  -19.541 1.00 69.87  ? 563  GLU D O     1 
ATOM   5092 C  CB    . GLU D 2 120 ? 14.424  9.826   -18.453 1.00 90.41  ? 563  GLU D CB    1 
ATOM   5093 C  CG    . GLU D 2 120 ? 14.195  11.163  -19.118 1.00 98.98  ? 563  GLU D CG    1 
ATOM   5094 C  CD    . GLU D 2 120 ? 14.051  11.038  -20.614 1.00 107.40 ? 563  GLU D CD    1 
ATOM   5095 O  OE1   . GLU D 2 120 ? 12.932  10.679  -21.058 1.00 114.36 ? 563  GLU D OE1   1 
ATOM   5096 O  OE2   . GLU D 2 120 ? 15.038  11.294  -21.331 1.00 96.94  ? 563  GLU D OE2   1 
ATOM   5097 N  N     . LYS D 2 121 ? 17.154  10.052  -17.353 1.00 69.03  ? 564  LYS D N     1 
ATOM   5098 C  CA    . LYS D 2 121 ? 18.243  10.925  -16.942 1.00 64.03  ? 564  LYS D CA    1 
ATOM   5099 C  C     . LYS D 2 121 ? 19.589  10.234  -16.815 1.00 60.88  ? 564  LYS D C     1 
ATOM   5100 O  O     . LYS D 2 121 ? 20.561  10.874  -16.410 1.00 64.72  ? 564  LYS D O     1 
ATOM   5101 C  CB    . LYS D 2 121 ? 17.903  11.597  -15.617 1.00 66.57  ? 564  LYS D CB    1 
ATOM   5102 C  CG    . LYS D 2 121 ? 16.823  12.628  -15.790 1.00 71.56  ? 564  LYS D CG    1 
ATOM   5103 C  CD    . LYS D 2 121 ? 16.568  13.439  -14.533 1.00 79.52  ? 564  LYS D CD    1 
ATOM   5104 C  CE    . LYS D 2 121 ? 15.408  14.395  -14.801 1.00 92.56  ? 564  LYS D CE    1 
ATOM   5105 N  NZ    . LYS D 2 121 ? 14.936  15.121  -13.593 1.00 96.89  ? 564  LYS D NZ    1 
ATOM   5106 N  N     . GLY D 2 122 ? 19.656  8.947   -17.149 1.00 61.05  ? 565  GLY D N     1 
ATOM   5107 C  CA    . GLY D 2 122 ? 20.905  8.174   -17.051 1.00 63.51  ? 565  GLY D CA    1 
ATOM   5108 C  C     . GLY D 2 122 ? 21.075  7.477   -15.702 1.00 63.18  ? 565  GLY D C     1 
ATOM   5109 O  O     . GLY D 2 122 ? 21.987  6.658   -15.535 1.00 58.02  ? 565  GLY D O     1 
ATOM   5110 N  N     . ASP D 2 123 ? 20.176  7.789   -14.762 1.00 62.65  ? 566  ASP D N     1 
ATOM   5111 C  CA    . ASP D 2 123 ? 20.245  7.298   -13.391 1.00 64.33  ? 566  ASP D CA    1 
ATOM   5112 C  C     . ASP D 2 123 ? 19.971  5.792   -13.260 1.00 62.53  ? 566  ASP D C     1 
ATOM   5113 O  O     . ASP D 2 123 ? 18.874  5.326   -13.603 1.00 61.86  ? 566  ASP D O     1 
ATOM   5114 C  CB    . ASP D 2 123 ? 19.198  8.015   -12.552 1.00 70.48  ? 566  ASP D CB    1 
ATOM   5115 C  CG    . ASP D 2 123 ? 19.596  9.413   -12.207 1.00 71.97  ? 566  ASP D CG    1 
ATOM   5116 O  OD1   . ASP D 2 123 ? 20.825  9.655   -12.099 1.00 70.85  ? 566  ASP D OD1   1 
ATOM   5117 O  OD2   . ASP D 2 123 ? 18.676  10.246  -11.993 1.00 67.78  ? 566  ASP D OD2   1 
ATOM   5118 N  N     . THR D 2 124 ? 20.933  5.050   -12.716 1.00 54.72  ? 567  THR D N     1 
ATOM   5119 C  CA    . THR D 2 124 ? 20.634  3.736   -12.187 1.00 59.02  ? 567  THR D CA    1 
ATOM   5120 C  C     . THR D 2 124 ? 19.832  3.850   -10.885 1.00 63.09  ? 567  THR D C     1 
ATOM   5121 O  O     . THR D 2 124 ? 19.662  4.957   -10.330 1.00 62.17  ? 567  THR D O     1 
ATOM   5122 C  CB    . THR D 2 124 ? 21.877  2.868   -11.991 1.00 62.45  ? 567  THR D CB    1 
ATOM   5123 O  OG1   . THR D 2 124 ? 22.481  3.134   -10.713 1.00 70.47  ? 567  THR D OG1   1 
ATOM   5124 C  CG2   . THR D 2 124 ? 22.864  3.099   -13.109 1.00 65.97  ? 567  THR D CG2   1 
ATOM   5125 N  N     . PRO D 2 125 ? 19.293  2.713   -10.406 1.00 61.34  ? 568  PRO D N     1 
ATOM   5126 C  CA    . PRO D 2 125 ? 18.616  2.742   -9.113  1.00 61.08  ? 568  PRO D CA    1 
ATOM   5127 C  C     . PRO D 2 125 ? 19.497  3.255   -7.989  1.00 60.08  ? 568  PRO D C     1 
ATOM   5128 O  O     . PRO D 2 125 ? 19.022  3.974   -7.117  1.00 60.88  ? 568  PRO D O     1 
ATOM   5129 C  CB    . PRO D 2 125 ? 18.251  1.279   -8.891  1.00 59.68  ? 568  PRO D CB    1 
ATOM   5130 C  CG    . PRO D 2 125 ? 18.040  0.762   -10.267 1.00 59.45  ? 568  PRO D CG    1 
ATOM   5131 C  CD    . PRO D 2 125 ? 19.125  1.410   -11.074 1.00 58.58  ? 568  PRO D CD    1 
ATOM   5132 N  N     . LEU D 2 126 ? 20.781  2.916   -8.030  1.00 62.05  ? 569  LEU D N     1 
ATOM   5133 C  CA    . LEU D 2 126 ? 21.715  3.356   -6.995  1.00 62.51  ? 569  LEU D CA    1 
ATOM   5134 C  C     . LEU D 2 126 ? 21.888  4.859   -6.937  1.00 60.29  ? 569  LEU D C     1 
ATOM   5135 O  O     . LEU D 2 126 ? 21.997  5.432   -5.854  1.00 62.73  ? 569  LEU D O     1 
ATOM   5136 C  CB    . LEU D 2 126 ? 23.083  2.709   -7.192  1.00 65.96  ? 569  LEU D CB    1 
ATOM   5137 C  CG    . LEU D 2 126 ? 24.088  3.036   -6.073  1.00 66.68  ? 569  LEU D CG    1 
ATOM   5138 C  CD1   . LEU D 2 126 ? 23.527  2.713   -4.688  1.00 64.47  ? 569  LEU D CD1   1 
ATOM   5139 C  CD2   . LEU D 2 126 ? 25.414  2.307   -6.291  1.00 65.70  ? 569  LEU D CD2   1 
ATOM   5140 N  N     . HIS D 2 127 ? 21.921  5.493   -8.104  1.00 59.43  ? 570  HIS D N     1 
ATOM   5141 C  CA    . HIS D 2 127 ? 21.913  6.953   -8.179  1.00 60.33  ? 570  HIS D CA    1 
ATOM   5142 C  C     . HIS D 2 127 ? 20.723  7.481   -7.410  1.00 62.02  ? 570  HIS D C     1 
ATOM   5143 O  O     . HIS D 2 127 ? 20.836  8.423   -6.639  1.00 62.64  ? 570  HIS D O     1 
ATOM   5144 C  CB    . HIS D 2 127 ? 21.793  7.463   -9.618  1.00 63.63  ? 570  HIS D CB    1 
ATOM   5145 C  CG    . HIS D 2 127 ? 23.011  7.242   -10.459 1.00 64.61  ? 570  HIS D CG    1 
ATOM   5146 N  ND1   . HIS D 2 127 ? 23.368  5.999   -10.931 1.00 68.62  ? 570  HIS D ND1   1 
ATOM   5147 C  CD2   . HIS D 2 127 ? 23.915  8.112   -10.967 1.00 64.45  ? 570  HIS D CD2   1 
ATOM   5148 C  CE1   . HIS D 2 127 ? 24.451  6.110   -11.682 1.00 70.45  ? 570  HIS D CE1   1 
ATOM   5149 N  NE2   . HIS D 2 127 ? 24.807  7.380   -11.714 1.00 68.97  ? 570  HIS D NE2   1 
ATOM   5150 N  N     . ILE D 2 128 ? 19.565  6.894   -7.662  1.00 67.22  ? 571  ILE D N     1 
ATOM   5151 C  CA    . ILE D 2 128 ? 18.337  7.397   -7.072  1.00 67.34  ? 571  ILE D CA    1 
ATOM   5152 C  C     . ILE D 2 128 ? 18.374  7.216   -5.565  1.00 67.49  ? 571  ILE D C     1 
ATOM   5153 O  O     . ILE D 2 128 ? 18.014  8.119   -4.821  1.00 74.96  ? 571  ILE D O     1 
ATOM   5154 C  CB    . ILE D 2 128 ? 17.106  6.690   -7.660  1.00 64.75  ? 571  ILE D CB    1 
ATOM   5155 C  CG1   . ILE D 2 128 ? 16.906  7.145   -9.102  1.00 65.99  ? 571  ILE D CG1   1 
ATOM   5156 C  CG2   . ILE D 2 128 ? 15.870  6.956   -6.808  1.00 60.90  ? 571  ILE D CG2   1 
ATOM   5157 C  CD1   . ILE D 2 128 ? 16.014  6.237   -9.917  1.00 67.24  ? 571  ILE D CD1   1 
ATOM   5158 N  N     . ALA D 2 129 ? 18.792  6.042   -5.119  1.00 68.32  ? 572  ALA D N     1 
ATOM   5159 C  CA    . ALA D 2 129 ? 18.817  5.755   -3.696  1.00 76.38  ? 572  ALA D CA    1 
ATOM   5160 C  C     . ALA D 2 129 ? 19.796  6.664   -2.963  1.00 79.37  ? 572  ALA D C     1 
ATOM   5161 O  O     . ALA D 2 129 ? 19.536  7.075   -1.830  1.00 70.56  ? 572  ALA D O     1 
ATOM   5162 C  CB    . ALA D 2 129 ? 19.174  4.297   -3.457  1.00 80.60  ? 572  ALA D CB    1 
ATOM   5163 N  N     . ALA D 2 130 ? 20.918  6.974   -3.612  1.00 82.99  ? 573  ALA D N     1 
ATOM   5164 C  CA    . ALA D 2 130 ? 21.880  7.941   -3.068  1.00 84.24  ? 573  ALA D CA    1 
ATOM   5165 C  C     . ALA D 2 130 ? 21.305  9.368   -2.960  1.00 79.30  ? 573  ALA D C     1 
ATOM   5166 O  O     . ALA D 2 130 ? 21.404  10.007  -1.910  1.00 78.18  ? 573  ALA D O     1 
ATOM   5167 C  CB    . ALA D 2 130 ? 23.151  7.931   -3.902  1.00 83.36  ? 573  ALA D CB    1 
ATOM   5168 N  N     . ARG D 2 131 ? 20.681  9.846   -4.033  1.00 77.20  ? 574  ARG D N     1 
ATOM   5169 C  CA    . ARG D 2 131 ? 20.053  11.164  -4.043  1.00 77.36  ? 574  ARG D CA    1 
ATOM   5170 C  C     . ARG D 2 131 ? 19.115  11.362  -2.854  1.00 72.77  ? 574  ARG D C     1 
ATOM   5171 O  O     . ARG D 2 131 ? 19.227  12.340  -2.120  1.00 76.72  ? 574  ARG D O     1 
ATOM   5172 C  CB    . ARG D 2 131 ? 19.304  11.393  -5.365  1.00 83.10  ? 574  ARG D CB    1 
ATOM   5173 C  CG    . ARG D 2 131 ? 18.660  12.782  -5.510  1.00 88.80  ? 574  ARG D CG    1 
ATOM   5174 C  CD    . ARG D 2 131 ? 18.448  13.248  -6.960  1.00 87.51  ? 574  ARG D CD    1 
ATOM   5175 N  NE    . ARG D 2 131 ? 18.749  12.218  -7.962  1.00 93.85  ? 574  ARG D NE    1 
ATOM   5176 C  CZ    . ARG D 2 131 ? 19.710  12.268  -8.884  1.00 98.54  ? 574  ARG D CZ    1 
ATOM   5177 N  NH1   . ARG D 2 131 ? 20.529  13.314  -8.992  1.00 108.95 ? 574  ARG D NH1   1 
ATOM   5178 N  NH2   . ARG D 2 131 ? 19.850  11.243  -9.714  1.00 94.90  ? 574  ARG D NH2   1 
ATOM   5179 N  N     . TRP D 2 132 ? 18.197  10.430  -2.664  1.00 71.54  ? 575  TRP D N     1 
ATOM   5180 C  CA    . TRP D 2 132 ? 17.183  10.568  -1.625  1.00 73.82  ? 575  TRP D CA    1 
ATOM   5181 C  C     . TRP D 2 132 ? 17.673  9.956   -0.306  1.00 73.52  ? 575  TRP D C     1 
ATOM   5182 O  O     . TRP D 2 132 ? 16.897  9.769   0.623   1.00 71.87  ? 575  TRP D O     1 
ATOM   5183 C  CB    . TRP D 2 132 ? 15.849  9.938   -2.085  1.00 79.59  ? 575  TRP D CB    1 
ATOM   5184 C  CG    . TRP D 2 132 ? 15.048  10.783  -3.083  1.00 89.54  ? 575  TRP D CG    1 
ATOM   5185 C  CD1   . TRP D 2 132 ? 15.494  11.289  -4.266  1.00 84.11  ? 575  TRP D CD1   1 
ATOM   5186 C  CD2   . TRP D 2 132 ? 13.669  11.206  -2.963  1.00 104.06 ? 575  TRP D CD2   1 
ATOM   5187 N  NE1   . TRP D 2 132 ? 14.511  12.006  -4.876  1.00 92.67  ? 575  TRP D NE1   1 
ATOM   5188 C  CE2   . TRP D 2 132 ? 13.372  11.966  -4.110  1.00 108.35 ? 575  TRP D CE2   1 
ATOM   5189 C  CE3   . TRP D 2 132 ? 12.659  11.016  -1.996  1.00 109.33 ? 575  TRP D CE3   1 
ATOM   5190 C  CZ2   . TRP D 2 132 ? 12.084  12.538  -4.333  1.00 115.42 ? 575  TRP D CZ2   1 
ATOM   5191 C  CZ3   . TRP D 2 132 ? 11.379  11.582  -2.219  1.00 112.30 ? 575  TRP D CZ3   1 
ATOM   5192 C  CH2   . TRP D 2 132 ? 11.110  12.327  -3.382  1.00 112.16 ? 575  TRP D CH2   1 
ATOM   5193 N  N     . GLY D 2 133 ? 18.957  9.617   -0.233  1.00 72.43  ? 576  GLY D N     1 
ATOM   5194 C  CA    . GLY D 2 133 ? 19.535  8.984   0.963   1.00 79.18  ? 576  GLY D CA    1 
ATOM   5195 C  C     . GLY D 2 133 ? 18.753  7.884   1.680   1.00 79.44  ? 576  GLY D C     1 
ATOM   5196 O  O     . GLY D 2 133 ? 18.253  8.092   2.781   1.00 76.28  ? 576  GLY D O     1 
ATOM   5197 N  N     . TYR D 2 134 ? 18.656  6.711   1.059   1.00 82.53  ? 577  TYR D N     1 
ATOM   5198 C  CA    . TYR D 2 134 ? 17.925  5.587   1.642   1.00 78.17  ? 577  TYR D CA    1 
ATOM   5199 C  C     . TYR D 2 134 ? 18.885  4.458   1.982   1.00 69.52  ? 577  TYR D C     1 
ATOM   5200 O  O     . TYR D 2 134 ? 19.013  3.503   1.234   1.00 67.05  ? 577  TYR D O     1 
ATOM   5201 C  CB    . TYR D 2 134 ? 16.870  5.066   0.666   1.00 74.37  ? 577  TYR D CB    1 
ATOM   5202 C  CG    . TYR D 2 134 ? 15.682  5.961   0.395   1.00 72.52  ? 577  TYR D CG    1 
ATOM   5203 C  CD1   . TYR D 2 134 ? 14.735  6.209   1.371   1.00 78.34  ? 577  TYR D CD1   1 
ATOM   5204 C  CD2   . TYR D 2 134 ? 15.461  6.491   -0.864  1.00 75.93  ? 577  TYR D CD2   1 
ATOM   5205 C  CE1   . TYR D 2 134 ? 13.618  6.990   1.108   1.00 79.64  ? 577  TYR D CE1   1 
ATOM   5206 C  CE2   . TYR D 2 134 ? 14.354  7.276   -1.136  1.00 75.45  ? 577  TYR D CE2   1 
ATOM   5207 C  CZ    . TYR D 2 134 ? 13.438  7.523   -0.150  1.00 77.99  ? 577  TYR D CZ    1 
ATOM   5208 O  OH    . TYR D 2 134 ? 12.320  8.277   -0.426  1.00 84.18  ? 577  TYR D OH    1 
ATOM   5209 N  N     . GLN D 2 135 ? 19.551  4.576   3.115   1.00 68.54  ? 578  GLN D N     1 
ATOM   5210 C  CA    . GLN D 2 135 ? 20.641  3.679   3.455   1.00 73.04  ? 578  GLN D CA    1 
ATOM   5211 C  C     . GLN D 2 135 ? 20.362  2.184   3.205   1.00 74.10  ? 578  GLN D C     1 
ATOM   5212 O  O     . GLN D 2 135 ? 21.225  1.459   2.672   1.00 67.49  ? 578  GLN D O     1 
ATOM   5213 C  CB    . GLN D 2 135 ? 21.001  3.869   4.923   1.00 81.74  ? 578  GLN D CB    1 
ATOM   5214 C  CG    . GLN D 2 135 ? 22.054  2.888   5.443   1.00 90.19  ? 578  GLN D CG    1 
ATOM   5215 C  CD    . GLN D 2 135 ? 22.949  3.512   6.492   1.00 88.51  ? 578  GLN D CD    1 
ATOM   5216 O  OE1   . GLN D 2 135 ? 22.489  4.305   7.312   1.00 81.85  ? 578  GLN D OE1   1 
ATOM   5217 N  NE2   . GLN D 2 135 ? 24.234  3.177   6.456   1.00 86.90  ? 578  GLN D NE2   1 
ATOM   5218 N  N     . GLY D 2 136 ? 19.187  1.717   3.631   1.00 68.25  ? 579  GLY D N     1 
ATOM   5219 C  CA    . GLY D 2 136 ? 18.901  0.287   3.619   1.00 65.52  ? 579  GLY D CA    1 
ATOM   5220 C  C     . GLY D 2 136 ? 18.904  -0.236  2.190   1.00 69.24  ? 579  GLY D C     1 
ATOM   5221 O  O     . GLY D 2 136 ? 19.606  -1.206  1.861   1.00 67.56  ? 579  GLY D O     1 
ATOM   5222 N  N     . VAL D 2 137 ? 18.110  0.427   1.344   1.00 65.00  ? 580  VAL D N     1 
ATOM   5223 C  CA    . VAL D 2 137 ? 18.189  0.281   -0.115  1.00 57.05  ? 580  VAL D CA    1 
ATOM   5224 C  C     . VAL D 2 137 ? 19.636  0.276   -0.617  1.00 57.39  ? 580  VAL D C     1 
ATOM   5225 O  O     . VAL D 2 137 ? 20.107  -0.683  -1.253  1.00 56.21  ? 580  VAL D O     1 
ATOM   5226 C  CB    . VAL D 2 137 ? 17.453  1.428   -0.810  1.00 56.00  ? 580  VAL D CB    1 
ATOM   5227 C  CG1   . VAL D 2 137 ? 17.674  1.347   -2.302  1.00 58.69  ? 580  VAL D CG1   1 
ATOM   5228 C  CG2   . VAL D 2 137 ? 15.959  1.409   -0.498  1.00 55.40  ? 580  VAL D CG2   1 
ATOM   5229 N  N     . ILE D 2 138 ? 20.349  1.341   -0.293  1.00 55.14  ? 581  ILE D N     1 
ATOM   5230 C  CA    . ILE D 2 138 ? 21.691  1.534   -0.817  1.00 60.68  ? 581  ILE D CA    1 
ATOM   5231 C  C     . ILE D 2 138 ? 22.549  0.317   -0.527  1.00 61.29  ? 581  ILE D C     1 
ATOM   5232 O  O     . ILE D 2 138 ? 23.187  -0.242  -1.439  1.00 61.43  ? 581  ILE D O     1 
ATOM   5233 C  CB    . ILE D 2 138 ? 22.348  2.807   -0.246  1.00 62.34  ? 581  ILE D CB    1 
ATOM   5234 C  CG1   . ILE D 2 138 ? 21.602  4.048   -0.735  1.00 64.46  ? 581  ILE D CG1   1 
ATOM   5235 C  CG2   . ILE D 2 138 ? 23.780  2.926   -0.714  1.00 62.56  ? 581  ILE D CG2   1 
ATOM   5236 C  CD1   . ILE D 2 138 ? 21.776  5.261   0.135   1.00 69.16  ? 581  ILE D CD1   1 
ATOM   5237 N  N     . GLU D 2 139 ? 22.542  -0.107  0.732   1.00 61.35  ? 582  GLU D N     1 
ATOM   5238 C  CA    . GLU D 2 139 ? 23.323  -1.271  1.127   1.00 68.56  ? 582  GLU D CA    1 
ATOM   5239 C  C     . GLU D 2 139 ? 22.905  -2.521  0.319   1.00 63.74  ? 582  GLU D C     1 
ATOM   5240 O  O     . GLU D 2 139 ? 23.762  -3.156  -0.331  1.00 59.87  ? 582  GLU D O     1 
ATOM   5241 C  CB    . GLU D 2 139 ? 23.225  -1.515  2.642   1.00 76.59  ? 582  GLU D CB    1 
ATOM   5242 C  CG    . GLU D 2 139 ? 24.271  -0.772  3.486   1.00 83.39  ? 582  GLU D CG    1 
ATOM   5243 C  CD    . GLU D 2 139 ? 23.893  -0.647  4.975   1.00 88.53  ? 582  GLU D CD    1 
ATOM   5244 O  OE1   . GLU D 2 139 ? 22.686  -0.566  5.318   1.00 80.28  ? 582  GLU D OE1   1 
ATOM   5245 O  OE2   . GLU D 2 139 ? 24.819  -0.635  5.816   1.00 92.54  ? 582  GLU D OE2   1 
ATOM   5246 N  N     . THR D 2 140 ? 21.602  -2.817  0.312   1.00 53.84  ? 583  THR D N     1 
ATOM   5247 C  CA    . THR D 2 140 ? 21.036  -3.912  -0.496  1.00 55.82  ? 583  THR D CA    1 
ATOM   5248 C  C     . THR D 2 140 ? 21.583  -3.939  -1.947  1.00 61.20  ? 583  THR D C     1 
ATOM   5249 O  O     . THR D 2 140 ? 22.012  -4.980  -2.476  1.00 52.87  ? 583  THR D O     1 
ATOM   5250 C  CB    . THR D 2 140 ? 19.495  -3.784  -0.583  1.00 55.99  ? 583  THR D CB    1 
ATOM   5251 O  OG1   . THR D 2 140 ? 18.940  -3.522  0.714   1.00 61.65  ? 583  THR D OG1   1 
ATOM   5252 C  CG2   . THR D 2 140 ? 18.864  -5.041  -1.154  1.00 52.42  ? 583  THR D CG2   1 
ATOM   5253 N  N     . LEU D 2 141 ? 21.541  -2.773  -2.590  1.00 63.39  ? 584  LEU D N     1 
ATOM   5254 C  CA    . LEU D 2 141 ? 21.988  -2.658  -3.970  1.00 60.46  ? 584  LEU D CA    1 
ATOM   5255 C  C     . LEU D 2 141 ? 23.438  -3.000  -4.092  1.00 58.05  ? 584  LEU D C     1 
ATOM   5256 O  O     . LEU D 2 141 ? 23.819  -3.838  -4.911  1.00 59.58  ? 584  LEU D O     1 
ATOM   5257 C  CB    . LEU D 2 141 ? 21.751  -1.250  -4.490  1.00 61.17  ? 584  LEU D CB    1 
ATOM   5258 C  CG    . LEU D 2 141 ? 20.279  -0.919  -4.746  1.00 63.80  ? 584  LEU D CG    1 
ATOM   5259 C  CD1   . LEU D 2 141 ? 20.080  0.563   -5.060  1.00 63.34  ? 584  LEU D CD1   1 
ATOM   5260 C  CD2   . LEU D 2 141 ? 19.715  -1.778  -5.876  1.00 62.94  ? 584  LEU D CD2   1 
ATOM   5261 N  N     . LEU D 2 142 ? 24.246  -2.368  -3.251  1.00 56.11  ? 585  LEU D N     1 
ATOM   5262 C  CA    . LEU D 2 142 ? 25.688  -2.550  -3.309  1.00 55.37  ? 585  LEU D CA    1 
ATOM   5263 C  C     . LEU D 2 142 ? 26.046  -3.976  -3.034  1.00 53.08  ? 585  LEU D C     1 
ATOM   5264 O  O     . LEU D 2 142 ? 26.917  -4.545  -3.688  1.00 47.53  ? 585  LEU D O     1 
ATOM   5265 C  CB    . LEU D 2 142 ? 26.361  -1.662  -2.293  1.00 58.63  ? 585  LEU D CB    1 
ATOM   5266 C  CG    . LEU D 2 142 ? 26.284  -0.184  -2.684  1.00 59.02  ? 585  LEU D CG    1 
ATOM   5267 C  CD1   . LEU D 2 142 ? 26.365  0.706   -1.454  1.00 59.18  ? 585  LEU D CD1   1 
ATOM   5268 C  CD2   . LEU D 2 142 ? 27.386  0.148   -3.673  1.00 55.92  ? 585  LEU D CD2   1 
ATOM   5269 N  N     . GLN D 2 143 ? 25.354  -4.568  -2.068  1.00 54.54  ? 586  GLN D N     1 
ATOM   5270 C  CA    . GLN D 2 143 ? 25.655  -5.948  -1.672  1.00 58.32  ? 586  GLN D CA    1 
ATOM   5271 C  C     . GLN D 2 143 ? 25.433  -6.939  -2.786  1.00 55.21  ? 586  GLN D C     1 
ATOM   5272 O  O     . GLN D 2 143 ? 25.980  -8.024  -2.757  1.00 49.00  ? 586  GLN D O     1 
ATOM   5273 C  CB    . GLN D 2 143 ? 24.821  -6.353  -0.458  1.00 62.07  ? 586  GLN D CB    1 
ATOM   5274 C  CG    . GLN D 2 143 ? 25.319  -5.736  0.839   1.00 66.19  ? 586  GLN D CG    1 
ATOM   5275 C  CD    . GLN D 2 143 ? 24.268  -5.690  1.924   1.00 68.48  ? 586  GLN D CD    1 
ATOM   5276 O  OE1   . GLN D 2 143 ? 24.279  -4.793  2.767   1.00 77.90  ? 586  GLN D OE1   1 
ATOM   5277 N  NE2   . GLN D 2 143 ? 23.370  -6.660  1.930   1.00 68.57  ? 586  GLN D NE2   1 
ATOM   5278 N  N     . ASN D 2 144 ? 24.584  -6.577  -3.741  1.00 61.29  ? 587  ASN D N     1 
ATOM   5279 C  CA    . ASN D 2 144 ? 24.315  -7.435  -4.883  1.00 65.69  ? 587  ASN D CA    1 
ATOM   5280 C  C     . ASN D 2 144 ? 24.931  -6.876  -6.173  1.00 70.39  ? 587  ASN D C     1 
ATOM   5281 O  O     . ASN D 2 144 ? 24.660  -7.374  -7.271  1.00 72.36  ? 587  ASN D O     1 
ATOM   5282 C  CB    . ASN D 2 144 ? 22.807  -7.613  -5.047  1.00 62.59  ? 587  ASN D CB    1 
ATOM   5283 C  CG    . ASN D 2 144 ? 22.177  -8.467  -3.936  1.00 64.06  ? 587  ASN D CG    1 
ATOM   5284 O  OD1   . ASN D 2 144 ? 21.785  -7.955  -2.886  1.00 59.02  ? 587  ASN D OD1   1 
ATOM   5285 N  ND2   . ASN D 2 144 ? 22.052  -9.778  -4.184  1.00 65.06  ? 587  ASN D ND2   1 
ATOM   5286 N  N     . GLY D 2 145 ? 25.781  -5.862  -6.039  1.00 71.13  ? 588  GLY D N     1 
ATOM   5287 C  CA    . GLY D 2 145 ? 26.816  -5.584  -7.039  1.00 74.75  ? 588  GLY D CA    1 
ATOM   5288 C  C     . GLY D 2 145 ? 26.560  -4.328  -7.849  1.00 72.98  ? 588  GLY D C     1 
ATOM   5289 O  O     . GLY D 2 145 ? 27.080  -4.197  -8.945  1.00 71.38  ? 588  GLY D O     1 
ATOM   5290 N  N     . ALA D 2 146 ? 25.752  -3.409  -7.323  1.00 71.28  ? 589  ALA D N     1 
ATOM   5291 C  CA    . ALA D 2 146 ? 25.506  -2.143  -7.992  1.00 69.40  ? 589  ALA D CA    1 
ATOM   5292 C  C     . ALA D 2 146 ? 26.817  -1.439  -8.175  1.00 68.65  ? 589  ALA D C     1 
ATOM   5293 O  O     . ALA D 2 146 ? 27.649  -1.475  -7.291  1.00 72.29  ? 589  ALA D O     1 
ATOM   5294 C  CB    . ALA D 2 146 ? 24.576  -1.272  -7.166  1.00 72.62  ? 589  ALA D CB    1 
ATOM   5295 N  N     . SER D 2 147 ? 26.995  -0.784  -9.316  1.00 77.81  ? 590  SER D N     1 
ATOM   5296 C  CA    . SER D 2 147 ? 28.234  -0.067  -9.593  1.00 74.97  ? 590  SER D CA    1 
ATOM   5297 C  C     . SER D 2 147 ? 28.170  1.348   -9.068  1.00 76.62  ? 590  SER D C     1 
ATOM   5298 O  O     . SER D 2 147 ? 27.119  1.990   -9.067  1.00 73.55  ? 590  SER D O     1 
ATOM   5299 C  CB    . SER D 2 147 ? 28.541  -0.042  -11.082 1.00 76.50  ? 590  SER D CB    1 
ATOM   5300 O  OG    . SER D 2 147 ? 29.827  0.508   -11.314 1.00 78.05  ? 590  SER D OG    1 
ATOM   5301 N  N     . THR D 2 148 ? 29.330  1.813   -8.632  1.00 86.53  ? 591  THR D N     1 
ATOM   5302 C  CA    . THR D 2 148 ? 29.512  3.153   -8.098  1.00 94.99  ? 591  THR D CA    1 
ATOM   5303 C  C     . THR D 2 148 ? 30.103  4.091   -9.147  1.00 97.61  ? 591  THR D C     1 
ATOM   5304 O  O     . THR D 2 148 ? 30.227  5.308   -8.932  1.00 91.46  ? 591  THR D O     1 
ATOM   5305 C  CB    . THR D 2 148 ? 30.461  3.091   -6.888  1.00 101.17 ? 591  THR D CB    1 
ATOM   5306 O  OG1   . THR D 2 148 ? 31.179  1.849   -6.910  1.00 98.47  ? 591  THR D OG1   1 
ATOM   5307 C  CG2   . THR D 2 148 ? 29.673  3.173   -5.611  1.00 101.69 ? 591  THR D CG2   1 
ATOM   5308 N  N     . GLU D 2 149 ? 30.499  3.503   -10.276 1.00 107.03 ? 592  GLU D N     1 
ATOM   5309 C  CA    . GLU D 2 149 ? 31.217  4.220   -11.324 1.00 109.82 ? 592  GLU D CA    1 
ATOM   5310 C  C     . GLU D 2 149 ? 30.292  4.754   -12.400 1.00 100.44 ? 592  GLU D C     1 
ATOM   5311 O  O     . GLU D 2 149 ? 30.479  5.882   -12.831 1.00 112.91 ? 592  GLU D O     1 
ATOM   5312 C  CB    . GLU D 2 149 ? 32.302  3.342   -11.944 1.00 112.69 ? 592  GLU D CB    1 
ATOM   5313 C  CG    . GLU D 2 149 ? 33.614  3.489   -11.201 1.00 120.12 ? 592  GLU D CG    1 
ATOM   5314 C  CD    . GLU D 2 149 ? 34.514  2.306   -11.413 1.00 118.77 ? 592  GLU D CD    1 
ATOM   5315 O  OE1   . GLU D 2 149 ? 34.535  1.777   -12.549 1.00 111.38 ? 592  GLU D OE1   1 
ATOM   5316 O  OE2   . GLU D 2 149 ? 35.171  1.911   -10.437 1.00 117.59 ? 592  GLU D OE2   1 
ATOM   5317 N  N     . ILE D 2 150 ? 29.310  3.954   -12.819 1.00 86.33  ? 593  ILE D N     1 
ATOM   5318 C  CA    . ILE D 2 150 ? 28.331  4.391   -13.826 1.00 81.12  ? 593  ILE D CA    1 
ATOM   5319 C  C     . ILE D 2 150 ? 27.917  5.849   -13.605 1.00 82.95  ? 593  ILE D C     1 
ATOM   5320 O  O     . ILE D 2 150 ? 27.545  6.262   -12.496 1.00 74.79  ? 593  ILE D O     1 
ATOM   5321 C  CB    . ILE D 2 150 ? 27.046  3.523   -13.865 1.00 78.94  ? 593  ILE D CB    1 
ATOM   5322 C  CG1   . ILE D 2 150 ? 27.352  2.065   -14.225 1.00 80.43  ? 593  ILE D CG1   1 
ATOM   5323 C  CG2   . ILE D 2 150 ? 26.108  4.013   -14.947 1.00 74.50  ? 593  ILE D CG2   1 
ATOM   5324 C  CD1   . ILE D 2 150 ? 26.284  1.037   -13.869 1.00 83.52  ? 593  ILE D CD1   1 
ATOM   5325 N  N     . GLN D 2 151 ? 28.015  6.633   -14.669 1.00 83.64  ? 594  GLN D N     1 
ATOM   5326 C  CA    . GLN D 2 151 ? 27.625  8.028   -14.603 1.00 93.31  ? 594  GLN D CA    1 
ATOM   5327 C  C     . GLN D 2 151 ? 26.359  8.188   -15.389 1.00 89.38  ? 594  GLN D C     1 
ATOM   5328 O  O     . GLN D 2 151 ? 26.165  7.532   -16.412 1.00 80.42  ? 594  GLN D O     1 
ATOM   5329 C  CB    . GLN D 2 151 ? 28.658  8.957   -15.234 1.00 105.18 ? 594  GLN D CB    1 
ATOM   5330 C  CG    . GLN D 2 151 ? 30.103  8.505   -15.209 1.00 105.22 ? 594  GLN D CG    1 
ATOM   5331 C  CD    . GLN D 2 151 ? 30.972  9.443   -16.015 1.00 102.03 ? 594  GLN D CD    1 
ATOM   5332 O  OE1   . GLN D 2 151 ? 31.550  9.051   -17.022 1.00 110.87 ? 594  GLN D OE1   1 
ATOM   5333 N  NE2   . GLN D 2 151 ? 31.035  10.698  -15.600 1.00 93.44  ? 594  GLN D NE2   1 
ATOM   5334 N  N     . ASN D 2 152 ? 25.522  9.105   -14.933 1.00 81.34  ? 595  ASN D N     1 
ATOM   5335 C  CA    . ASN D 2 152 ? 24.300  9.426   -15.639 1.00 82.93  ? 595  ASN D CA    1 
ATOM   5336 C  C     . ASN D 2 152 ? 24.589  10.394  -16.779 1.00 88.30  ? 595  ASN D C     1 
ATOM   5337 O  O     . ASN D 2 152 ? 25.726  10.525  -17.200 1.00 86.75  ? 595  ASN D O     1 
ATOM   5338 C  CB    . ASN D 2 152 ? 23.301  9.998   -14.643 1.00 84.60  ? 595  ASN D CB    1 
ATOM   5339 C  CG    . ASN D 2 152 ? 23.772  11.302  -14.069 1.00 86.30  ? 595  ASN D CG    1 
ATOM   5340 O  OD1   . ASN D 2 152 ? 24.967  11.477  -13.911 1.00 86.51  ? 595  ASN D OD1   1 
ATOM   5341 N  ND2   . ASN D 2 152 ? 22.862  12.218  -13.760 1.00 91.62  ? 595  ASN D ND2   1 
ATOM   5342 N  N     . ARG D 2 153 ? 23.553  11.045  -17.300 1.00 102.58 ? 596  ARG D N     1 
ATOM   5343 C  CA    . ARG D 2 153 ? 23.715  12.040  -18.355 1.00 97.35  ? 596  ARG D CA    1 
ATOM   5344 C  C     . ARG D 2 153 ? 24.525  13.249  -17.880 1.00 96.23  ? 596  ARG D C     1 
ATOM   5345 O  O     . ARG D 2 153 ? 25.432  13.688  -18.585 1.00 96.84  ? 596  ARG D O     1 
ATOM   5346 C  CB    . ARG D 2 153 ? 22.345  12.479  -18.897 1.00 94.05  ? 596  ARG D CB    1 
ATOM   5347 C  CG    . ARG D 2 153 ? 21.854  11.736  -20.111 1.00 90.45  ? 596  ARG D CG    1 
ATOM   5348 C  CD    . ARG D 2 153 ? 20.856  12.686  -20.734 1.00 92.36  ? 596  ARG D CD    1 
ATOM   5349 N  NE    . ARG D 2 153 ? 20.155  12.122  -21.877 1.00 96.85  ? 596  ARG D NE    1 
ATOM   5350 C  CZ    . ARG D 2 153 ? 20.580  12.199  -23.144 1.00 95.88  ? 596  ARG D CZ    1 
ATOM   5351 N  NH1   . ARG D 2 153 ? 21.706  12.830  -23.458 1.00 102.41 ? 596  ARG D NH1   1 
ATOM   5352 N  NH2   . ARG D 2 153 ? 19.870  11.648  -24.115 1.00 90.62  ? 596  ARG D NH2   1 
ATOM   5353 N  N     . LEU D 2 154 ? 24.236  13.761  -16.684 1.00 91.69  ? 597  LEU D N     1 
ATOM   5354 C  CA    . LEU D 2 154 ? 25.054  14.843  -16.093 1.00 92.36  ? 597  LEU D CA    1 
ATOM   5355 C  C     . LEU D 2 154 ? 26.484  14.394  -15.743 1.00 92.97  ? 597  LEU D C     1 
ATOM   5356 O  O     . LEU D 2 154 ? 27.228  15.141  -15.110 1.00 85.09  ? 597  LEU D O     1 
ATOM   5357 C  CB    . LEU D 2 154 ? 24.405  15.387  -14.818 1.00 85.80  ? 597  LEU D CB    1 
ATOM   5358 C  CG    . LEU D 2 154 ? 22.961  15.860  -14.811 1.00 90.62  ? 597  LEU D CG    1 
ATOM   5359 C  CD1   . LEU D 2 154 ? 22.577  16.577  -13.509 1.00 87.25  ? 597  LEU D CD1   1 
ATOM   5360 C  CD2   . LEU D 2 154 ? 22.697  16.737  -16.024 1.00 89.53  ? 597  LEU D CD2   1 
ATOM   5361 N  N     . LYS D 2 155 ? 26.851  13.171  -16.125 1.00 95.10  ? 598  LYS D N     1 
ATOM   5362 C  CA    . LYS D 2 155 ? 28.186  12.608  -15.864 1.00 98.11  ? 598  LYS D CA    1 
ATOM   5363 C  C     . LYS D 2 155 ? 28.572  12.489  -14.376 1.00 97.05  ? 598  LYS D C     1 
ATOM   5364 O  O     . LYS D 2 155 ? 29.665  12.003  -14.071 1.00 86.44  ? 598  LYS D O     1 
ATOM   5365 C  CB    . LYS D 2 155 ? 29.250  13.362  -16.676 1.00 95.00  ? 598  LYS D CB    1 
ATOM   5366 C  CG    . LYS D 2 155 ? 28.835  13.507  -18.129 1.00 100.09 ? 598  LYS D CG    1 
ATOM   5367 C  CD    . LYS D 2 155 ? 29.977  13.438  -19.127 1.00 106.90 ? 598  LYS D CD    1 
ATOM   5368 C  CE    . LYS D 2 155 ? 29.450  12.947  -20.479 1.00 112.40 ? 598  LYS D CE    1 
ATOM   5369 N  NZ    . LYS D 2 155 ? 30.355  13.247  -21.625 1.00 117.10 ? 598  LYS D NZ    1 
ATOM   5370 N  N     . GLU D 2 156 ? 27.657  12.863  -13.470 1.00 99.94  ? 599  GLU D N     1 
ATOM   5371 C  CA    . GLU D 2 156 ? 27.760  12.528  -12.037 1.00 97.66  ? 599  GLU D CA    1 
ATOM   5372 C  C     . GLU D 2 156 ? 27.531  11.036  -11.717 1.00 99.25  ? 599  GLU D C     1 
ATOM   5373 O  O     . GLU D 2 156 ? 26.515  10.449  -12.097 1.00 94.72  ? 599  GLU D O     1 
ATOM   5374 C  CB    . GLU D 2 156 ? 26.857  13.452  -11.179 1.00 87.75  ? 599  GLU D CB    1 
ATOM   5375 C  CG    . GLU D 2 156 ? 25.354  13.328  -11.372 1.00 90.86  ? 599  GLU D CG    1 
ATOM   5376 C  CD    . GLU D 2 156 ? 24.545  14.470  -10.746 1.00 95.16  ? 599  GLU D CD    1 
ATOM   5377 O  OE1   . GLU D 2 156 ? 25.142  15.447  -10.254 1.00 99.49  ? 599  GLU D OE1   1 
ATOM   5378 O  OE2   . GLU D 2 156 ? 23.289  14.391  -10.734 1.00 89.41  ? 599  GLU D OE2   1 
ATOM   5379 N  N     . THR D 2 157 ? 28.502  10.443  -11.013 1.00 103.56 ? 600  THR D N     1 
ATOM   5380 C  CA    . THR D 2 157 ? 28.383  9.084   -10.471 1.00 96.84  ? 600  THR D CA    1 
ATOM   5381 C  C     . THR D 2 157 ? 27.347  9.064   -9.351  1.00 87.67  ? 600  THR D C     1 
ATOM   5382 O  O     . THR D 2 157 ? 26.885  10.122  -8.897  1.00 71.89  ? 600  THR D O     1 
ATOM   5383 C  CB    . THR D 2 157 ? 29.725  8.542   -9.905  1.00 98.33  ? 600  THR D CB    1 
ATOM   5384 O  OG1   . THR D 2 157 ? 30.147  9.333   -8.784  1.00 99.40  ? 600  THR D OG1   1 
ATOM   5385 C  CG2   . THR D 2 157 ? 30.810  8.525   -10.971 1.00 101.86 ? 600  THR D CG2   1 
ATOM   5386 N  N     . PRO D 2 158 ? 26.980  7.855   -8.894  1.00 81.23  ? 601  PRO D N     1 
ATOM   5387 C  CA    . PRO D 2 158 ? 26.105  7.783   -7.724  1.00 85.11  ? 601  PRO D CA    1 
ATOM   5388 C  C     . PRO D 2 158 ? 26.741  8.375   -6.445  1.00 95.82  ? 601  PRO D C     1 
ATOM   5389 O  O     . PRO D 2 158 ? 26.043  9.023   -5.650  1.00 90.06  ? 601  PRO D O     1 
ATOM   5390 C  CB    . PRO D 2 158 ? 25.808  6.280   -7.583  1.00 79.63  ? 601  PRO D CB    1 
ATOM   5391 C  CG    . PRO D 2 158 ? 26.810  5.580   -8.439  1.00 77.17  ? 601  PRO D CG    1 
ATOM   5392 C  CD    . PRO D 2 158 ? 27.184  6.538   -9.517  1.00 77.11  ? 601  PRO D CD    1 
ATOM   5393 N  N     . LEU D 2 159 ? 28.059  8.193   -6.289  1.00 103.32 ? 602  LEU D N     1 
ATOM   5394 C  CA    . LEU D 2 159 ? 28.844  8.861   -5.234  1.00 96.24  ? 602  LEU D CA    1 
ATOM   5395 C  C     . LEU D 2 159 ? 28.464  10.336  -5.151  1.00 95.08  ? 602  LEU D C     1 
ATOM   5396 O  O     . LEU D 2 159 ? 28.007  10.796  -4.109  1.00 97.48  ? 602  LEU D O     1 
ATOM   5397 C  CB    . LEU D 2 159 ? 30.349  8.745   -5.499  1.00 104.80 ? 602  LEU D CB    1 
ATOM   5398 C  CG    . LEU D 2 159 ? 31.184  7.498   -5.252  1.00 112.77 ? 602  LEU D CG    1 
ATOM   5399 C  CD1   . LEU D 2 159 ? 30.326  6.268   -5.192  1.00 118.24 ? 602  LEU D CD1   1 
ATOM   5400 C  CD2   . LEU D 2 159 ? 32.293  7.336   -6.296  1.00 112.48 ? 602  LEU D CD2   1 
ATOM   5401 N  N     . LYS D 2 160 ? 28.621  11.063  -6.260  1.00 89.69  ? 603  LYS D N     1 
ATOM   5402 C  CA    . LYS D 2 160 ? 28.346  12.505  -6.273  1.00 90.69  ? 603  LYS D CA    1 
ATOM   5403 C  C     . LYS D 2 160 ? 26.894  12.843  -5.980  1.00 93.51  ? 603  LYS D C     1 
ATOM   5404 O  O     . LYS D 2 160 ? 26.598  13.977  -5.608  1.00 92.46  ? 603  LYS D O     1 
ATOM   5405 C  CB    . LYS D 2 160 ? 28.724  13.128  -7.602  1.00 93.34  ? 603  LYS D CB    1 
ATOM   5406 C  CG    . LYS D 2 160 ? 30.207  13.101  -7.885  1.00 103.28 ? 603  LYS D CG    1 
ATOM   5407 C  CD    . LYS D 2 160 ? 30.493  13.467  -9.327  1.00 106.14 ? 603  LYS D CD    1 
ATOM   5408 C  CE    . LYS D 2 160 ? 31.631  12.600  -9.873  1.00 111.69 ? 603  LYS D CE    1 
ATOM   5409 N  NZ    . LYS D 2 160 ? 32.371  13.254  -10.983 1.00 118.66 ? 603  LYS D NZ    1 
ATOM   5410 N  N     . CYS D 2 161 ? 25.985  11.879  -6.137  1.00 94.69  ? 604  CYS D N     1 
ATOM   5411 C  CA    . CYS D 2 161 ? 24.559  12.136  -5.889  1.00 100.19 ? 604  CYS D CA    1 
ATOM   5412 C  C     . CYS D 2 161 ? 24.170  11.986  -4.432  1.00 95.14  ? 604  CYS D C     1 
ATOM   5413 O  O     . CYS D 2 161 ? 23.030  12.286  -4.062  1.00 87.32  ? 604  CYS D O     1 
ATOM   5414 C  CB    . CYS D 2 161 ? 23.679  11.223  -6.740  1.00 103.53 ? 604  CYS D CB    1 
ATOM   5415 S  SG    . CYS D 2 161 ? 24.039  11.309  -8.504  1.00 105.59 ? 604  CYS D SG    1 
ATOM   5416 N  N     . ALA D 2 162 ? 25.114  11.537  -3.607  1.00 94.26  ? 605  ALA D N     1 
ATOM   5417 C  CA    . ALA D 2 162 ? 24.832  11.259  -2.199  1.00 97.58  ? 605  ALA D CA    1 
ATOM   5418 C  C     . ALA D 2 162 ? 24.273  12.492  -1.479  1.00 93.29  ? 605  ALA D C     1 
ATOM   5419 O  O     . ALA D 2 162 ? 24.677  13.620  -1.756  1.00 105.84 ? 605  ALA D O     1 
ATOM   5420 C  CB    . ALA D 2 162 ? 26.087  10.754  -1.503  1.00 96.59  ? 605  ALA D CB    1 
ATOM   5421 N  N     . LEU D 2 163 ? 23.345  12.261  -0.562  1.00 79.21  ? 606  LEU D N     1 
ATOM   5422 C  CA    . LEU D 2 163 ? 22.713  13.332  0.189   1.00 79.33  ? 606  LEU D CA    1 
ATOM   5423 C  C     . LEU D 2 163 ? 23.604  13.879  1.337   1.00 90.79  ? 606  LEU D C     1 
ATOM   5424 O  O     . LEU D 2 163 ? 23.537  15.071  1.645   1.00 96.33  ? 606  LEU D O     1 
ATOM   5425 C  CB    . LEU D 2 163 ? 21.389  12.810  0.741   1.00 74.81  ? 606  LEU D CB    1 
ATOM   5426 C  CG    . LEU D 2 163 ? 20.424  13.795  1.387   1.00 75.67  ? 606  LEU D CG    1 
ATOM   5427 C  CD1   . LEU D 2 163 ? 19.727  14.660  0.348   1.00 79.13  ? 606  LEU D CD1   1 
ATOM   5428 C  CD2   . LEU D 2 163 ? 19.409  13.025  2.208   1.00 77.93  ? 606  LEU D CD2   1 
ATOM   5429 N  N     . ASN D 2 164 ? 24.400  13.005  1.978   1.00 100.10 ? 607  ASN D N     1 
ATOM   5430 C  CA    . ASN D 2 164 ? 25.304  13.354  3.103   1.00 93.58  ? 607  ASN D CA    1 
ATOM   5431 C  C     . ASN D 2 164 ? 26.685  12.788  2.951   1.00 105.37 ? 607  ASN D C     1 
ATOM   5432 O  O     . ASN D 2 164 ? 26.939  11.935  2.112   1.00 94.99  ? 607  ASN D O     1 
ATOM   5433 C  CB    . ASN D 2 164 ? 24.847  12.765  4.426   1.00 88.84  ? 607  ASN D CB    1 
ATOM   5434 C  CG    . ASN D 2 164 ? 23.378  12.768  4.582   1.00 91.41  ? 607  ASN D CG    1 
ATOM   5435 O  OD1   . ASN D 2 164 ? 22.742  13.804  4.434   1.00 89.15  ? 607  ASN D OD1   1 
ATOM   5436 N  ND2   . ASN D 2 164 ? 22.815  11.614  4.878   1.00 91.83  ? 607  ASN D ND2   1 
ATOM   5437 N  N     . SER D 2 165 ? 27.546  13.212  3.866   1.00 120.15 ? 608  SER D N     1 
ATOM   5438 C  CA    . SER D 2 165 ? 28.767  12.498  4.201   1.00 120.41 ? 608  SER D CA    1 
ATOM   5439 C  C     . SER D 2 165 ? 28.523  11.097  4.781   1.00 116.87 ? 608  SER D C     1 
ATOM   5440 O  O     . SER D 2 165 ? 29.293  10.179  4.472   1.00 119.14 ? 608  SER D O     1 
ATOM   5441 C  CB    . SER D 2 165 ? 29.546  13.332  5.208   1.00 121.01 ? 608  SER D CB    1 
ATOM   5442 O  OG    . SER D 2 165 ? 28.635  14.022  6.047   1.00 128.37 ? 608  SER D OG    1 
ATOM   5443 N  N     . LYS D 2 166 ? 27.493  10.929  5.627   1.00 109.19 ? 609  LYS D N     1 
ATOM   5444 C  CA    . LYS D 2 166 ? 27.137  9.588   6.156   1.00 109.32 ? 609  LYS D CA    1 
ATOM   5445 C  C     . LYS D 2 166 ? 27.141  8.619   5.007   1.00 114.24 ? 609  LYS D C     1 
ATOM   5446 O  O     . LYS D 2 166 ? 27.859  7.618   5.004   1.00 112.15 ? 609  LYS D O     1 
ATOM   5447 C  CB    . LYS D 2 166 ? 25.737  9.513   6.767   1.00 108.61 ? 609  LYS D CB    1 
ATOM   5448 C  CG    . LYS D 2 166 ? 25.480  10.336  8.008   1.00 123.50 ? 609  LYS D CG    1 
ATOM   5449 C  CD    . LYS D 2 166 ? 23.980  10.595  8.144   1.00 127.45 ? 609  LYS D CD    1 
ATOM   5450 C  CE    . LYS D 2 166 ? 23.654  12.053  7.879   1.00 128.34 ? 609  LYS D CE    1 
ATOM   5451 N  NZ    . LYS D 2 166 ? 23.783  12.835  9.134   1.00 131.00 ? 609  LYS D NZ    1 
ATOM   5452 N  N     . ILE D 2 167 ? 26.341  8.971   4.009   1.00 112.01 ? 610  ILE D N     1 
ATOM   5453 C  CA    . ILE D 2 167 ? 25.991  8.086   2.924   1.00 102.66 ? 610  ILE D CA    1 
ATOM   5454 C  C     . ILE D 2 167 ? 27.207  7.809   2.040   1.00 103.23 ? 610  ILE D C     1 
ATOM   5455 O  O     . ILE D 2 167 ? 27.598  6.655   1.827   1.00 96.94  ? 610  ILE D O     1 
ATOM   5456 C  CB    . ILE D 2 167 ? 24.824  8.711   2.125   1.00 98.56  ? 610  ILE D CB    1 
ATOM   5457 C  CG1   . ILE D 2 167 ? 23.532  8.544   2.927   1.00 92.32  ? 610  ILE D CG1   1 
ATOM   5458 C  CG2   . ILE D 2 167 ? 24.687  8.091   0.737   1.00 101.01 ? 610  ILE D CG2   1 
ATOM   5459 C  CD1   . ILE D 2 167 ? 22.434  9.480   2.520   1.00 91.87  ? 610  ILE D CD1   1 
ATOM   5460 N  N     . LEU D 2 168 ? 27.803  8.882   1.537   1.00 109.86 ? 611  LEU D N     1 
ATOM   5461 C  CA    . LEU D 2 168 ? 29.085  8.817   0.830   1.00 111.49 ? 611  LEU D CA    1 
ATOM   5462 C  C     . LEU D 2 168 ? 30.038  7.765   1.410   1.00 105.13 ? 611  LEU D C     1 
ATOM   5463 O  O     . LEU D 2 168 ? 30.643  6.967   0.672   1.00 92.10  ? 611  LEU D O     1 
ATOM   5464 C  CB    . LEU D 2 168 ? 29.759  10.190  0.917   1.00 113.67 ? 611  LEU D CB    1 
ATOM   5465 C  CG    . LEU D 2 168 ? 30.853  10.584  -0.047  1.00 108.94 ? 611  LEU D CG    1 
ATOM   5466 C  CD1   . LEU D 2 168 ? 30.602  10.031  -1.433  1.00 112.24 ? 611  LEU D CD1   1 
ATOM   5467 C  CD2   . LEU D 2 168 ? 30.972  12.093  -0.089  1.00 108.72 ? 611  LEU D CD2   1 
ATOM   5468 N  N     . SER D 2 169 ? 30.155  7.796   2.738   1.00 100.83 ? 612  SER D N     1 
ATOM   5469 C  CA    . SER D 2 169 ? 31.049  6.919   3.472   1.00 104.53 ? 612  SER D CA    1 
ATOM   5470 C  C     . SER D 2 169 ? 30.648  5.462   3.233   1.00 105.04 ? 612  SER D C     1 
ATOM   5471 O  O     . SER D 2 169 ? 31.487  4.629   2.856   1.00 96.60  ? 612  SER D O     1 
ATOM   5472 C  CB    . SER D 2 169 ? 30.986  7.208   4.994   1.00 107.75 ? 612  SER D CB    1 
ATOM   5473 O  OG    . SER D 2 169 ? 29.972  6.429   5.588   1.00 111.42 ? 612  SER D OG    1 
ATOM   5474 N  N     . VAL D 2 170 ? 29.358  5.173   3.475   1.00 103.51 ? 613  VAL D N     1 
ATOM   5475 C  CA    . VAL D 2 170 ? 28.770  3.814   3.301   1.00 96.32  ? 613  VAL D CA    1 
ATOM   5476 C  C     . VAL D 2 170 ? 29.025  3.258   1.909   1.00 90.11  ? 613  VAL D C     1 
ATOM   5477 O  O     . VAL D 2 170 ? 29.234  2.059   1.741   1.00 81.38  ? 613  VAL D O     1 
ATOM   5478 C  CB    . VAL D 2 170 ? 27.231  3.780   3.490   1.00 86.48  ? 613  VAL D CB    1 
ATOM   5479 C  CG1   . VAL D 2 170 ? 26.717  2.344   3.420   1.00 83.95  ? 613  VAL D CG1   1 
ATOM   5480 C  CG2   . VAL D 2 170 ? 26.801  4.426   4.799   1.00 78.62  ? 613  VAL D CG2   1 
ATOM   5481 N  N     . MET D 2 171 ? 28.994  4.155   0.928   1.00 90.29  ? 614  MET D N     1 
ATOM   5482 C  CA    . MET D 2 171 ? 29.210  3.795   -0.455  1.00 97.59  ? 614  MET D CA    1 
ATOM   5483 C  C     . MET D 2 171 ? 30.685  3.516   -0.741  1.00 103.78 ? 614  MET D C     1 
ATOM   5484 O  O     . MET D 2 171 ? 31.008  2.497   -1.362  1.00 95.51  ? 614  MET D O     1 
ATOM   5485 C  CB    . MET D 2 171 ? 28.654  4.891   -1.370  1.00 98.37  ? 614  MET D CB    1 
ATOM   5486 C  CG    . MET D 2 171 ? 27.136  5.029   -1.255  1.00 98.38  ? 614  MET D CG    1 
ATOM   5487 S  SD    . MET D 2 171 ? 26.360  6.319   -2.255  1.00 97.86  ? 614  MET D SD    1 
ATOM   5488 C  CE    . MET D 2 171 ? 26.546  5.620   -3.878  1.00 98.29  ? 614  MET D CE    1 
ATOM   5489 N  N     . GLU D 2 172 ? 31.574  4.402   -0.279  1.00 109.01 ? 615  GLU D N     1 
ATOM   5490 C  CA    . GLU D 2 172 ? 33.025  4.181   -0.425  1.00 109.38 ? 615  GLU D CA    1 
ATOM   5491 C  C     . GLU D 2 172 ? 33.499  2.908   0.253   1.00 102.95 ? 615  GLU D C     1 
ATOM   5492 O  O     . GLU D 2 172 ? 34.443  2.268   -0.223  1.00 90.68  ? 615  GLU D O     1 
ATOM   5493 C  CB    . GLU D 2 172 ? 33.813  5.340   0.145   1.00 110.52 ? 615  GLU D CB    1 
ATOM   5494 C  CG    . GLU D 2 172 ? 34.030  6.472   -0.838  1.00 118.90 ? 615  GLU D CG    1 
ATOM   5495 C  CD    . GLU D 2 172 ? 33.770  7.824   -0.202  1.00 131.50 ? 615  GLU D CD    1 
ATOM   5496 O  OE1   . GLU D 2 172 ? 34.364  8.127   0.853   1.00 138.26 ? 615  GLU D OE1   1 
ATOM   5497 O  OE2   . GLU D 2 172 ? 32.946  8.582   -0.737  1.00 138.45 ? 615  GLU D OE2   1 
ATOM   5498 N  N     . ALA D 2 173 ? 32.831  2.557   1.355   1.00 99.28  ? 616  ALA D N     1 
ATOM   5499 C  CA    . ALA D 2 173 ? 33.055  1.292   2.070   1.00 100.27 ? 616  ALA D CA    1 
ATOM   5500 C  C     . ALA D 2 173 ? 33.268  0.069   1.162   1.00 113.49 ? 616  ALA D C     1 
ATOM   5501 O  O     . ALA D 2 173 ? 34.096  -0.793  1.456   1.00 125.92 ? 616  ALA D O     1 
ATOM   5502 C  CB    . ALA D 2 173 ? 31.908  1.026   3.038   1.00 92.85  ? 616  ALA D CB    1 
ATOM   5503 N  N     . TYR D 2 174 ? 32.506  -0.023  0.077   1.00 127.05 ? 617  TYR D N     1 
ATOM   5504 C  CA    . TYR D 2 174 ? 32.644  -1.144  -0.864  1.00 125.93 ? 617  TYR D CA    1 
ATOM   5505 C  C     . TYR D 2 174 ? 33.718  -0.783  -1.905  1.00 123.41 ? 617  TYR D C     1 
ATOM   5506 O  O     . TYR D 2 174 ? 34.606  -1.584  -2.199  1.00 124.52 ? 617  TYR D O     1 
ATOM   5507 C  CB    . TYR D 2 174 ? 31.286  -1.482  -1.522  1.00 115.98 ? 617  TYR D CB    1 
ATOM   5508 C  CG    . TYR D 2 174 ? 30.192  -1.899  -0.529  1.00 102.45 ? 617  TYR D CG    1 
ATOM   5509 C  CD1   . TYR D 2 174 ? 29.524  -0.943  0.250   1.00 91.80  ? 617  TYR D CD1   1 
ATOM   5510 C  CD2   . TYR D 2 174 ? 29.821  -3.243  -0.375  1.00 94.98  ? 617  TYR D CD2   1 
ATOM   5511 C  CE1   . TYR D 2 174 ? 28.538  -1.311  1.157   1.00 89.27  ? 617  TYR D CE1   1 
ATOM   5512 C  CE2   . TYR D 2 174 ? 28.825  -3.622  0.530   1.00 85.62  ? 617  TYR D CE2   1 
ATOM   5513 C  CZ    . TYR D 2 174 ? 28.188  -2.650  1.294   1.00 89.67  ? 617  TYR D CZ    1 
ATOM   5514 O  OH    . TYR D 2 174 ? 27.201  -2.989  2.204   1.00 96.78  ? 617  TYR D OH    1 
ATOM   5515 N  N     . HIS D 2 175 ? 33.627  0.438   -2.430  1.00 119.60 ? 618  HIS D N     1 
ATOM   5516 C  CA    . HIS D 2 175 ? 34.674  1.042   -3.250  1.00 125.62 ? 618  HIS D CA    1 
ATOM   5517 C  C     . HIS D 2 175 ? 36.044  0.986   -2.566  1.00 124.47 ? 618  HIS D C     1 
ATOM   5518 O  O     . HIS D 2 175 ? 36.903  0.191   -2.950  1.00 113.37 ? 618  HIS D O     1 
ATOM   5519 C  CB    . HIS D 2 175 ? 34.303  2.498   -3.554  1.00 131.94 ? 618  HIS D CB    1 
ATOM   5520 C  CG    . HIS D 2 175 ? 34.862  3.014   -4.842  1.00 145.45 ? 618  HIS D CG    1 
ATOM   5521 N  ND1   . HIS D 2 175 ? 36.085  2.616   -5.342  1.00 156.31 ? 618  HIS D ND1   1 
ATOM   5522 C  CD2   . HIS D 2 175 ? 34.366  3.906   -5.733  1.00 149.43 ? 618  HIS D CD2   1 
ATOM   5523 C  CE1   . HIS D 2 175 ? 36.317  3.239   -6.484  1.00 153.19 ? 618  HIS D CE1   1 
ATOM   5524 N  NE2   . HIS D 2 175 ? 35.289  4.026   -6.744  1.00 150.42 ? 618  HIS D NE2   1 
ATOM   5525 N  N     . VAL E 2 10  ? 63.006  -62.955 43.918  1.00 104.76 ? 453  VAL E N     1 
ATOM   5526 C  CA    . VAL E 2 10  ? 62.585  -61.627 43.366  1.00 107.56 ? 453  VAL E CA    1 
ATOM   5527 C  C     . VAL E 2 10  ? 63.656  -60.604 43.718  1.00 99.33  ? 453  VAL E C     1 
ATOM   5528 O  O     . VAL E 2 10  ? 64.459  -60.804 44.623  1.00 86.83  ? 453  VAL E O     1 
ATOM   5529 C  CB    . VAL E 2 10  ? 61.163  -61.175 43.835  1.00 112.94 ? 453  VAL E CB    1 
ATOM   5530 C  CG1   . VAL E 2 10  ? 60.715  -59.846 43.201  1.00 102.97 ? 453  VAL E CG1   1 
ATOM   5531 C  CG2   . VAL E 2 10  ? 60.125  -62.253 43.525  1.00 113.87 ? 453  VAL E CG2   1 
ATOM   5532 N  N     . VAL E 2 11  ? 63.689  -59.541 42.927  1.00 99.18  ? 454  VAL E N     1 
ATOM   5533 C  CA    . VAL E 2 11  ? 64.616  -58.431 43.099  1.00 89.76  ? 454  VAL E CA    1 
ATOM   5534 C  C     . VAL E 2 11  ? 64.656  -57.926 44.554  1.00 86.50  ? 454  VAL E C     1 
ATOM   5535 O  O     . VAL E 2 11  ? 63.711  -58.138 45.341  1.00 93.59  ? 454  VAL E O     1 
ATOM   5536 C  CB    . VAL E 2 11  ? 64.300  -57.323 42.037  1.00 83.52  ? 454  VAL E CB    1 
ATOM   5537 C  CG1   . VAL E 2 11  ? 62.906  -56.742 42.220  1.00 88.08  ? 454  VAL E CG1   1 
ATOM   5538 C  CG2   . VAL E 2 11  ? 65.344  -56.229 42.022  1.00 78.45  ? 454  VAL E CG2   1 
ATOM   5539 N  N     . THR E 2 12  ? 65.767  -57.272 44.898  1.00 76.24  ? 455  THR E N     1 
ATOM   5540 C  CA    . THR E 2 12  ? 65.854  -56.427 46.091  1.00 70.38  ? 455  THR E CA    1 
ATOM   5541 C  C     . THR E 2 12  ? 66.239  -54.992 45.715  1.00 63.20  ? 455  THR E C     1 
ATOM   5542 O  O     . THR E 2 12  ? 67.396  -54.702 45.415  1.00 55.60  ? 455  THR E O     1 
ATOM   5543 C  CB    . THR E 2 12  ? 66.875  -56.987 47.094  1.00 72.85  ? 455  THR E CB    1 
ATOM   5544 O  OG1   . THR E 2 12  ? 68.201  -56.827 46.571  1.00 71.37  ? 455  THR E OG1   1 
ATOM   5545 C  CG2   . THR E 2 12  ? 66.597  -58.472 47.380  1.00 72.55  ? 455  THR E CG2   1 
ATOM   5546 N  N     . PRO E 2 13  ? 65.254  -54.083 45.714  1.00 61.47  ? 456  PRO E N     1 
ATOM   5547 C  CA    . PRO E 2 13  ? 65.521  -52.743 45.212  1.00 59.84  ? 456  PRO E CA    1 
ATOM   5548 C  C     . PRO E 2 13  ? 66.317  -51.871 46.184  1.00 55.85  ? 456  PRO E C     1 
ATOM   5549 O  O     . PRO E 2 13  ? 66.717  -50.767 45.803  1.00 64.61  ? 456  PRO E O     1 
ATOM   5550 C  CB    . PRO E 2 13  ? 64.118  -52.170 44.984  1.00 59.83  ? 456  PRO E CB    1 
ATOM   5551 C  CG    . PRO E 2 13  ? 63.258  -52.874 45.962  1.00 61.82  ? 456  PRO E CG    1 
ATOM   5552 C  CD    . PRO E 2 13  ? 63.838  -54.257 46.089  1.00 61.27  ? 456  PRO E CD    1 
ATOM   5553 N  N     . PHE E 2 14  ? 66.547  -52.365 47.402  1.00 50.06  ? 457  PHE E N     1 
ATOM   5554 C  CA    . PHE E 2 14  ? 67.234  -51.609 48.470  1.00 50.79  ? 457  PHE E CA    1 
ATOM   5555 C  C     . PHE E 2 14  ? 68.702  -51.979 48.641  1.00 47.29  ? 457  PHE E C     1 
ATOM   5556 O  O     . PHE E 2 14  ? 69.415  -51.355 49.414  1.00 46.74  ? 457  PHE E O     1 
ATOM   5557 C  CB    . PHE E 2 14  ? 66.559  -51.834 49.823  1.00 50.66  ? 457  PHE E CB    1 
ATOM   5558 C  CG    . PHE E 2 14  ? 66.419  -53.270 50.182  1.00 54.10  ? 457  PHE E CG    1 
ATOM   5559 C  CD1   . PHE E 2 14  ? 67.524  -54.026 50.553  1.00 55.35  ? 457  PHE E CD1   1 
ATOM   5560 C  CD2   . PHE E 2 14  ? 65.174  -53.890 50.108  1.00 58.19  ? 457  PHE E CD2   1 
ATOM   5561 C  CE1   . PHE E 2 14  ? 67.386  -55.371 50.865  1.00 58.91  ? 457  PHE E CE1   1 
ATOM   5562 C  CE2   . PHE E 2 14  ? 65.025  -55.234 50.427  1.00 58.92  ? 457  PHE E CE2   1 
ATOM   5563 C  CZ    . PHE E 2 14  ? 66.134  -55.975 50.803  1.00 61.04  ? 457  PHE E CZ    1 
ATOM   5564 N  N     . SER E 2 15  ? 69.131  -52.987 47.907  1.00 51.39  ? 458  SER E N     1 
ATOM   5565 C  CA    . SER E 2 15  ? 70.531  -53.310 47.733  1.00 54.30  ? 458  SER E CA    1 
ATOM   5566 C  C     . SER E 2 15  ? 71.439  -52.085 47.476  1.00 52.75  ? 458  SER E C     1 
ATOM   5567 O  O     . SER E 2 15  ? 71.050  -51.132 46.784  1.00 61.99  ? 458  SER E O     1 
ATOM   5568 C  CB    . SER E 2 15  ? 70.657  -54.308 46.589  1.00 55.57  ? 458  SER E CB    1 
ATOM   5569 O  OG    . SER E 2 15  ? 72.021  -54.607 46.405  1.00 72.11  ? 458  SER E OG    1 
ATOM   5570 N  N     . ARG E 2 16  ? 72.624  -52.090 48.081  1.00 49.43  ? 459  ARG E N     1 
ATOM   5571 C  CA    . ARG E 2 16  ? 73.628  -51.046 47.851  1.00 50.91  ? 459  ARG E CA    1 
ATOM   5572 C  C     . ARG E 2 16  ? 74.982  -51.659 47.603  1.00 49.65  ? 459  ARG E C     1 
ATOM   5573 O  O     . ARG E 2 16  ? 75.366  -52.613 48.264  1.00 51.02  ? 459  ARG E O     1 
ATOM   5574 C  CB    . ARG E 2 16  ? 73.794  -50.155 49.068  1.00 53.64  ? 459  ARG E CB    1 
ATOM   5575 C  CG    . ARG E 2 16  ? 72.543  -49.416 49.475  1.00 59.97  ? 459  ARG E CG    1 
ATOM   5576 C  CD    . ARG E 2 16  ? 72.424  -48.062 48.805  1.00 60.69  ? 459  ARG E CD    1 
ATOM   5577 N  NE    . ARG E 2 16  ? 71.239  -47.394 49.345  1.00 59.77  ? 459  ARG E NE    1 
ATOM   5578 C  CZ    . ARG E 2 16  ? 70.968  -46.098 49.229  1.00 54.07  ? 459  ARG E CZ    1 
ATOM   5579 N  NH1   . ARG E 2 16  ? 71.799  -45.286 48.575  1.00 54.74  ? 459  ARG E NH1   1 
ATOM   5580 N  NH2   . ARG E 2 16  ? 69.866  -45.612 49.795  1.00 51.80  ? 459  ARG E NH2   1 
ATOM   5581 N  N     . ASP E 2 17  ? 75.735  -51.078 46.685  1.00 47.82  ? 460  ASP E N     1 
ATOM   5582 C  CA    . ASP E 2 17  ? 77.162  -51.306 46.658  1.00 49.77  ? 460  ASP E CA    1 
ATOM   5583 C  C     . ASP E 2 17  ? 77.824  -50.293 47.575  1.00 51.31  ? 460  ASP E C     1 
ATOM   5584 O  O     . ASP E 2 17  ? 77.134  -49.538 48.277  1.00 54.01  ? 460  ASP E O     1 
ATOM   5585 C  CB    . ASP E 2 17  ? 77.703  -51.226 45.226  1.00 50.56  ? 460  ASP E CB    1 
ATOM   5586 C  CG    . ASP E 2 17  ? 77.796  -49.804 44.711  1.00 51.47  ? 460  ASP E CG    1 
ATOM   5587 O  OD1   . ASP E 2 17  ? 77.361  -48.878 45.440  1.00 55.23  ? 460  ASP E OD1   1 
ATOM   5588 O  OD2   . ASP E 2 17  ? 78.297  -49.610 43.573  1.00 51.31  ? 460  ASP E OD2   1 
ATOM   5589 N  N     . ASP E 2 18  ? 79.152  -50.326 47.610  1.00 52.35  ? 461  ASP E N     1 
ATOM   5590 C  CA    . ASP E 2 18  ? 79.916  -49.498 48.522  1.00 59.65  ? 461  ASP E CA    1 
ATOM   5591 C  C     . ASP E 2 18  ? 80.129  -48.086 48.008  1.00 56.95  ? 461  ASP E C     1 
ATOM   5592 O  O     . ASP E 2 18  ? 80.836  -47.322 48.624  1.00 64.52  ? 461  ASP E O     1 
ATOM   5593 C  CB    . ASP E 2 18  ? 81.291  -50.138 48.836  1.00 62.87  ? 461  ASP E CB    1 
ATOM   5594 C  CG    . ASP E 2 18  ? 81.198  -51.418 49.680  1.00 67.49  ? 461  ASP E CG    1 
ATOM   5595 O  OD1   . ASP E 2 18  ? 80.150  -51.697 50.300  1.00 70.83  ? 461  ASP E OD1   1 
ATOM   5596 O  OD2   . ASP E 2 18  ? 82.199  -52.170 49.717  1.00 78.03  ? 461  ASP E OD2   1 
ATOM   5597 N  N     . ARG E 2 19  ? 79.484  -47.696 46.942  1.00 52.59  ? 462  ARG E N     1 
ATOM   5598 C  CA    . ARG E 2 19  ? 79.311  -46.274 46.691  1.00 59.76  ? 462  ARG E CA    1 
ATOM   5599 C  C     . ARG E 2 19  ? 77.870  -45.822 46.791  1.00 56.28  ? 462  ARG E C     1 
ATOM   5600 O  O     . ARG E 2 19  ? 77.501  -44.716 46.375  1.00 53.64  ? 462  ARG E O     1 
ATOM   5601 C  CB    . ARG E 2 19  ? 79.850  -46.019 45.322  1.00 76.23  ? 462  ARG E CB    1 
ATOM   5602 C  CG    . ARG E 2 19  ? 81.327  -46.260 45.289  1.00 91.43  ? 462  ARG E CG    1 
ATOM   5603 C  CD    . ARG E 2 19  ? 81.922  -45.736 44.008  1.00 104.59 ? 462  ARG E CD    1 
ATOM   5604 N  NE    . ARG E 2 19  ? 83.359  -45.584 44.224  1.00 110.19 ? 462  ARG E NE    1 
ATOM   5605 C  CZ    . ARG E 2 19  ? 84.136  -44.779 43.524  1.00 116.05 ? 462  ARG E CZ    1 
ATOM   5606 N  NH1   . ARG E 2 19  ? 83.619  -44.058 42.532  1.00 121.70 ? 462  ARG E NH1   1 
ATOM   5607 N  NH2   . ARG E 2 19  ? 85.423  -44.710 43.809  1.00 117.47 ? 462  ARG E NH2   1 
ATOM   5608 N  N     . GLY E 2 20  ? 77.075  -46.689 47.384  1.00 49.72  ? 463  GLY E N     1 
ATOM   5609 C  CA    . GLY E 2 20  ? 75.719  -46.372 47.697  1.00 49.55  ? 463  GLY E CA    1 
ATOM   5610 C  C     . GLY E 2 20  ? 74.824  -46.385 46.507  1.00 49.94  ? 463  GLY E C     1 
ATOM   5611 O  O     . GLY E 2 20  ? 73.765  -45.778 46.553  1.00 51.70  ? 463  GLY E O     1 
ATOM   5612 N  N     . HIS E 2 21  ? 75.245  -47.060 45.442  1.00 52.31  ? 464  HIS E N     1 
ATOM   5613 C  CA    . HIS E 2 21  ? 74.411  -47.205 44.260  1.00 54.57  ? 464  HIS E CA    1 
ATOM   5614 C  C     . HIS E 2 21  ? 73.331  -48.280 44.509  1.00 54.33  ? 464  HIS E C     1 
ATOM   5615 O  O     . HIS E 2 21  ? 73.628  -49.413 44.836  1.00 51.03  ? 464  HIS E O     1 
ATOM   5616 C  CB    . HIS E 2 21  ? 75.267  -47.509 43.027  1.00 56.28  ? 464  HIS E CB    1 
ATOM   5617 C  CG    . HIS E 2 21  ? 76.136  -46.375 42.597  1.00 63.83  ? 464  HIS E CG    1 
ATOM   5618 N  ND1   . HIS E 2 21  ? 75.639  -45.123 42.306  1.00 71.83  ? 464  HIS E ND1   1 
ATOM   5619 C  CD2   . HIS E 2 21  ? 77.470  -46.308 42.384  1.00 70.70  ? 464  HIS E CD2   1 
ATOM   5620 C  CE1   . HIS E 2 21  ? 76.629  -44.328 41.943  1.00 72.15  ? 464  HIS E CE1   1 
ATOM   5621 N  NE2   . HIS E 2 21  ? 77.751  -45.023 41.985  1.00 79.94  ? 464  HIS E NE2   1 
ATOM   5622 N  N     . THR E 2 22  ? 72.078  -47.860 44.381  1.00 55.25  ? 465  THR E N     1 
ATOM   5623 C  CA    . THR E 2 22  ? 70.898  -48.686 44.217  1.00 52.88  ? 465  THR E CA    1 
ATOM   5624 C  C     . THR E 2 22  ? 70.816  -49.229 42.810  1.00 52.04  ? 465  THR E C     1 
ATOM   5625 O  O     . THR E 2 22  ? 71.306  -48.608 41.889  1.00 54.95  ? 465  THR E O     1 
ATOM   5626 C  CB    . THR E 2 22  ? 69.729  -47.706 44.471  1.00 58.08  ? 465  THR E CB    1 
ATOM   5627 O  OG1   . THR E 2 22  ? 69.825  -47.286 45.821  1.00 65.75  ? 465  THR E OG1   1 
ATOM   5628 C  CG2   . THR E 2 22  ? 68.324  -48.225 44.253  1.00 70.15  ? 465  THR E CG2   1 
ATOM   5629 N  N     . PRO E 2 23  ? 70.171  -50.381 42.622  1.00 50.74  ? 466  PRO E N     1 
ATOM   5630 C  CA    . PRO E 2 23  ? 69.637  -50.735 41.308  1.00 50.98  ? 466  PRO E CA    1 
ATOM   5631 C  C     . PRO E 2 23  ? 69.030  -49.569 40.531  1.00 52.89  ? 466  PRO E C     1 
ATOM   5632 O  O     . PRO E 2 23  ? 69.373  -49.321 39.374  1.00 55.59  ? 466  PRO E O     1 
ATOM   5633 C  CB    . PRO E 2 23  ? 68.560  -51.766 41.626  1.00 50.84  ? 466  PRO E CB    1 
ATOM   5634 C  CG    . PRO E 2 23  ? 68.989  -52.389 42.918  1.00 54.40  ? 466  PRO E CG    1 
ATOM   5635 C  CD    . PRO E 2 23  ? 69.923  -51.435 43.620  1.00 55.98  ? 466  PRO E CD    1 
ATOM   5636 N  N     . LEU E 2 24  ? 68.161  -48.821 41.167  1.00 54.04  ? 467  LEU E N     1 
ATOM   5637 C  CA    . LEU E 2 24  ? 67.606  -47.677 40.500  1.00 54.13  ? 467  LEU E CA    1 
ATOM   5638 C  C     . LEU E 2 24  ? 68.669  -46.675 40.000  1.00 53.70  ? 467  LEU E C     1 
ATOM   5639 O  O     . LEU E 2 24  ? 68.478  -46.053 38.949  1.00 52.37  ? 467  LEU E O     1 
ATOM   5640 C  CB    . LEU E 2 24  ? 66.594  -46.993 41.403  1.00 57.41  ? 467  LEU E CB    1 
ATOM   5641 C  CG    . LEU E 2 24  ? 65.698  -46.008 40.683  1.00 59.25  ? 467  LEU E CG    1 
ATOM   5642 C  CD1   . LEU E 2 24  ? 64.781  -46.743 39.738  1.00 66.72  ? 467  LEU E CD1   1 
ATOM   5643 C  CD2   . LEU E 2 24  ? 64.874  -45.241 41.689  1.00 60.44  ? 467  LEU E CD2   1 
ATOM   5644 N  N     . HIS E 2 25  ? 69.761  -46.486 40.735  1.00 49.87  ? 468  HIS E N     1 
ATOM   5645 C  CA    . HIS E 2 25  ? 70.840  -45.652 40.210  1.00 52.50  ? 468  HIS E CA    1 
ATOM   5646 C  C     . HIS E 2 25  ? 71.378  -46.262 38.919  1.00 53.41  ? 468  HIS E C     1 
ATOM   5647 O  O     . HIS E 2 25  ? 71.631  -45.561 37.922  1.00 56.69  ? 468  HIS E O     1 
ATOM   5648 C  CB    . HIS E 2 25  ? 71.992  -45.511 41.207  1.00 52.90  ? 468  HIS E CB    1 
ATOM   5649 C  CG    . HIS E 2 25  ? 71.750  -44.514 42.298  1.00 52.96  ? 468  HIS E CG    1 
ATOM   5650 N  ND1   . HIS E 2 25  ? 71.305  -44.867 43.551  1.00 50.31  ? 468  HIS E ND1   1 
ATOM   5651 C  CD2   . HIS E 2 25  ? 71.952  -43.176 42.341  1.00 56.80  ? 468  HIS E CD2   1 
ATOM   5652 C  CE1   . HIS E 2 25  ? 71.230  -43.797 44.318  1.00 49.89  ? 468  HIS E CE1   1 
ATOM   5653 N  NE2   . HIS E 2 25  ? 71.616  -42.755 43.607  1.00 57.15  ? 468  HIS E NE2   1 
ATOM   5654 N  N     . VAL E 2 26  ? 71.581  -47.570 38.951  1.00 54.08  ? 469  VAL E N     1 
ATOM   5655 C  CA    . VAL E 2 26  ? 72.228  -48.269 37.843  1.00 56.23  ? 469  VAL E CA    1 
ATOM   5656 C  C     . VAL E 2 26  ? 71.279  -48.196 36.649  1.00 52.54  ? 469  VAL E C     1 
ATOM   5657 O  O     . VAL E 2 26  ? 71.648  -47.717 35.585  1.00 52.86  ? 469  VAL E O     1 
ATOM   5658 C  CB    . VAL E 2 26  ? 72.540  -49.748 38.196  1.00 59.93  ? 469  VAL E CB    1 
ATOM   5659 C  CG1   . VAL E 2 26  ? 73.144  -50.472 37.016  1.00 68.54  ? 469  VAL E CG1   1 
ATOM   5660 C  CG2   . VAL E 2 26  ? 73.494  -49.862 39.371  1.00 59.50  ? 469  VAL E CG2   1 
ATOM   5661 N  N     . ALA E 2 27  ? 70.049  -48.650 36.847  1.00 49.33  ? 470  ALA E N     1 
ATOM   5662 C  CA    . ALA E 2 27  ? 68.993  -48.514 35.838  1.00 48.51  ? 470  ALA E CA    1 
ATOM   5663 C  C     . ALA E 2 27  ? 68.936  -47.144 35.214  1.00 45.86  ? 470  ALA E C     1 
ATOM   5664 O  O     . ALA E 2 27  ? 68.755  -47.030 34.029  1.00 53.87  ? 470  ALA E O     1 
ATOM   5665 C  CB    . ALA E 2 27  ? 67.628  -48.871 36.423  1.00 48.58  ? 470  ALA E CB    1 
ATOM   5666 N  N     . ALA E 2 28  ? 69.097  -46.097 35.993  1.00 47.82  ? 471  ALA E N     1 
ATOM   5667 C  CA    . ALA E 2 28  ? 69.007  -44.757 35.433  1.00 51.62  ? 471  ALA E CA    1 
ATOM   5668 C  C     . ALA E 2 28  ? 70.190  -44.481 34.564  1.00 50.95  ? 471  ALA E C     1 
ATOM   5669 O  O     . ALA E 2 28  ? 70.053  -43.950 33.484  1.00 67.26  ? 471  ALA E O     1 
ATOM   5670 C  CB    . ALA E 2 28  ? 68.936  -43.707 36.530  1.00 57.69  ? 471  ALA E CB    1 
ATOM   5671 N  N     . VAL E 2 29  ? 71.371  -44.818 35.037  1.00 49.50  ? 472  VAL E N     1 
ATOM   5672 C  CA    . VAL E 2 29  ? 72.558  -44.383 34.345  1.00 50.62  ? 472  VAL E CA    1 
ATOM   5673 C  C     . VAL E 2 29  ? 72.765  -45.184 33.056  1.00 52.99  ? 472  VAL E C     1 
ATOM   5674 O  O     . VAL E 2 29  ? 73.505  -44.750 32.191  1.00 52.01  ? 472  VAL E O     1 
ATOM   5675 C  CB    . VAL E 2 29  ? 73.794  -44.433 35.273  1.00 48.96  ? 472  VAL E CB    1 
ATOM   5676 C  CG1   . VAL E 2 29  ? 74.500  -45.768 35.223  1.00 50.10  ? 472  VAL E CG1   1 
ATOM   5677 C  CG2   . VAL E 2 29  ? 74.763  -43.354 34.872  1.00 52.25  ? 472  VAL E CG2   1 
ATOM   5678 N  N     . CYS E 2 30  ? 72.140  -46.358 32.964  1.00 54.75  ? 473  CYS E N     1 
ATOM   5679 C  CA    . CYS E 2 30  ? 72.106  -47.133 31.739  1.00 60.54  ? 473  CYS E CA    1 
ATOM   5680 C  C     . CYS E 2 30  ? 71.125  -46.577 30.765  1.00 69.05  ? 473  CYS E C     1 
ATOM   5681 O  O     . CYS E 2 30  ? 71.418  -46.476 29.579  1.00 96.13  ? 473  CYS E O     1 
ATOM   5682 C  CB    . CYS E 2 30  ? 71.692  -48.556 32.027  1.00 61.66  ? 473  CYS E CB    1 
ATOM   5683 S  SG    . CYS E 2 30  ? 72.882  -49.370 33.105  1.00 72.01  ? 473  CYS E SG    1 
ATOM   5684 N  N     . GLY E 2 31  ? 69.948  -46.235 31.263  1.00 69.89  ? 474  GLY E N     1 
ATOM   5685 C  CA    . GLY E 2 31  ? 68.852  -45.765 30.432  1.00 67.47  ? 474  GLY E CA    1 
ATOM   5686 C  C     . GLY E 2 31  ? 67.708  -46.750 30.339  1.00 68.93  ? 474  GLY E C     1 
ATOM   5687 O  O     . GLY E 2 31  ? 66.776  -46.533 29.601  1.00 65.77  ? 474  GLY E O     1 
ATOM   5688 N  N     . GLN E 2 32  ? 67.743  -47.817 31.121  1.00 76.01  ? 475  GLN E N     1 
ATOM   5689 C  CA    . GLN E 2 32  ? 66.756  -48.876 30.979  1.00 81.82  ? 475  GLN E CA    1 
ATOM   5690 C  C     . GLN E 2 32  ? 65.412  -48.481 31.655  1.00 75.48  ? 475  GLN E C     1 
ATOM   5691 O  O     . GLN E 2 32  ? 65.128  -48.856 32.805  1.00 77.50  ? 475  GLN E O     1 
ATOM   5692 C  CB    . GLN E 2 32  ? 67.338  -50.187 31.520  1.00 90.87  ? 475  GLN E CB    1 
ATOM   5693 C  CG    . GLN E 2 32  ? 68.632  -50.644 30.840  1.00 100.32 ? 475  GLN E CG    1 
ATOM   5694 C  CD    . GLN E 2 32  ? 69.205  -51.911 31.488  1.00 117.37 ? 475  GLN E CD    1 
ATOM   5695 O  OE1   . GLN E 2 32  ? 68.658  -53.009 31.312  1.00 112.35 ? 475  GLN E OE1   1 
ATOM   5696 N  NE2   . GLN E 2 32  ? 70.289  -51.765 32.267  1.00 121.04 ? 475  GLN E NE2   1 
ATOM   5697 N  N     . ALA E 2 33  ? 64.594  -47.712 30.936  1.00 66.66  ? 476  ALA E N     1 
ATOM   5698 C  CA    . ALA E 2 33  ? 63.311  -47.226 31.473  1.00 67.32  ? 476  ALA E CA    1 
ATOM   5699 C  C     . ALA E 2 33  ? 62.367  -48.338 31.936  1.00 73.38  ? 476  ALA E C     1 
ATOM   5700 O  O     . ALA E 2 33  ? 61.712  -48.212 32.956  1.00 80.43  ? 476  ALA E O     1 
ATOM   5701 C  CB    . ALA E 2 33  ? 62.599  -46.338 30.473  1.00 60.83  ? 476  ALA E CB    1 
ATOM   5702 N  N     . SER E 2 34  ? 62.304  -49.436 31.206  1.00 81.25  ? 477  SER E N     1 
ATOM   5703 C  CA    . SER E 2 34  ? 61.431  -50.545 31.601  1.00 84.91  ? 477  SER E CA    1 
ATOM   5704 C  C     . SER E 2 34  ? 61.854  -51.095 32.972  1.00 75.62  ? 477  SER E C     1 
ATOM   5705 O  O     . SER E 2 34  ? 61.024  -51.521 33.792  1.00 71.45  ? 477  SER E O     1 
ATOM   5706 C  CB    . SER E 2 34  ? 61.518  -51.645 30.552  1.00 88.55  ? 477  SER E CB    1 
ATOM   5707 O  OG    . SER E 2 34  ? 62.841  -51.684 30.037  1.00 92.79  ? 477  SER E OG    1 
ATOM   5708 N  N     . LEU E 2 35  ? 63.163  -51.075 33.196  1.00 66.67  ? 478  LEU E N     1 
ATOM   5709 C  CA    . LEU E 2 35  ? 63.738  -51.542 34.428  1.00 67.69  ? 478  LEU E CA    1 
ATOM   5710 C  C     . LEU E 2 35  ? 63.402  -50.604 35.573  1.00 68.11  ? 478  LEU E C     1 
ATOM   5711 O  O     . LEU E 2 35  ? 63.081  -51.053 36.695  1.00 68.61  ? 478  LEU E O     1 
ATOM   5712 C  CB    . LEU E 2 35  ? 65.253  -51.617 34.289  1.00 73.67  ? 478  LEU E CB    1 
ATOM   5713 C  CG    . LEU E 2 35  ? 66.050  -52.338 35.379  1.00 73.34  ? 478  LEU E CG    1 
ATOM   5714 C  CD1   . LEU E 2 35  ? 65.446  -53.703 35.677  1.00 70.52  ? 478  LEU E CD1   1 
ATOM   5715 C  CD2   . LEU E 2 35  ? 67.494  -52.465 34.915  1.00 75.36  ? 478  LEU E CD2   1 
ATOM   5716 N  N     . ILE E 2 36  ? 63.483  -49.304 35.298  1.00 59.45  ? 479  ILE E N     1 
ATOM   5717 C  CA    . ILE E 2 36  ? 62.954  -48.307 36.227  1.00 57.95  ? 479  ILE E CA    1 
ATOM   5718 C  C     . ILE E 2 36  ? 61.503  -48.569 36.653  1.00 59.13  ? 479  ILE E C     1 
ATOM   5719 O  O     . ILE E 2 36  ? 61.219  -48.713 37.838  1.00 66.05  ? 479  ILE E O     1 
ATOM   5720 C  CB    . ILE E 2 36  ? 63.050  -46.905 35.647  1.00 55.01  ? 479  ILE E CB    1 
ATOM   5721 C  CG1   . ILE E 2 36  ? 64.520  -46.505 35.542  1.00 57.83  ? 479  ILE E CG1   1 
ATOM   5722 C  CG2   . ILE E 2 36  ? 62.311  -45.936 36.546  1.00 55.95  ? 479  ILE E CG2   1 
ATOM   5723 C  CD1   . ILE E 2 36  ? 64.767  -45.156 34.894  1.00 57.70  ? 479  ILE E CD1   1 
ATOM   5724 N  N     . ASP E 2 37  ? 60.590  -48.650 35.700  1.00 59.85  ? 480  ASP E N     1 
ATOM   5725 C  CA    . ASP E 2 37  ? 59.215  -49.015 36.019  1.00 64.37  ? 480  ASP E CA    1 
ATOM   5726 C  C     . ASP E 2 37  ? 59.204  -50.161 37.006  1.00 61.61  ? 480  ASP E C     1 
ATOM   5727 O  O     . ASP E 2 37  ? 58.481  -50.138 38.008  1.00 57.55  ? 480  ASP E O     1 
ATOM   5728 C  CB    . ASP E 2 37  ? 58.445  -49.448 34.769  1.00 70.77  ? 480  ASP E CB    1 
ATOM   5729 C  CG    . ASP E 2 37  ? 58.171  -48.299 33.824  1.00 79.36  ? 480  ASP E CG    1 
ATOM   5730 O  OD1   . ASP E 2 37  ? 57.800  -47.199 34.303  1.00 75.83  ? 480  ASP E OD1   1 
ATOM   5731 O  OD2   . ASP E 2 37  ? 58.318  -48.499 32.597  1.00 87.60  ? 480  ASP E OD2   1 
ATOM   5732 N  N     . LEU E 2 38  ? 59.978  -51.190 36.688  1.00 63.08  ? 481  LEU E N     1 
ATOM   5733 C  CA    . LEU E 2 38  ? 59.924  -52.429 37.453  1.00 66.05  ? 481  LEU E CA    1 
ATOM   5734 C  C     . LEU E 2 38  ? 60.425  -52.196 38.878  1.00 63.89  ? 481  LEU E C     1 
ATOM   5735 O  O     . LEU E 2 38  ? 59.734  -52.550 39.842  1.00 54.64  ? 481  LEU E O     1 
ATOM   5736 C  CB    . LEU E 2 38  ? 60.725  -53.543 36.760  1.00 67.68  ? 481  LEU E CB    1 
ATOM   5737 C  CG    . LEU E 2 38  ? 61.189  -54.717 37.647  1.00 68.48  ? 481  LEU E CG    1 
ATOM   5738 C  CD1   . LEU E 2 38  ? 60.056  -55.460 38.334  1.00 66.18  ? 481  LEU E CD1   1 
ATOM   5739 C  CD2   . LEU E 2 38  ? 61.979  -55.676 36.791  1.00 70.04  ? 481  LEU E CD2   1 
ATOM   5740 N  N     . LEU E 2 39  ? 61.604  -51.577 38.998  1.00 61.76  ? 482  LEU E N     1 
ATOM   5741 C  CA    . LEU E 2 39  ? 62.175  -51.273 40.317  1.00 59.68  ? 482  LEU E CA    1 
ATOM   5742 C  C     . LEU E 2 39  ? 61.260  -50.418 41.187  1.00 57.29  ? 482  LEU E C     1 
ATOM   5743 O  O     . LEU E 2 39  ? 61.055  -50.736 42.359  1.00 59.28  ? 482  LEU E O     1 
ATOM   5744 C  CB    . LEU E 2 39  ? 63.510  -50.573 40.188  1.00 55.52  ? 482  LEU E CB    1 
ATOM   5745 C  CG    . LEU E 2 39  ? 64.609  -51.478 39.670  1.00 57.94  ? 482  LEU E CG    1 
ATOM   5746 C  CD1   . LEU E 2 39  ? 65.870  -50.662 39.420  1.00 58.66  ? 482  LEU E CD1   1 
ATOM   5747 C  CD2   . LEU E 2 39  ? 64.887  -52.615 40.657  1.00 58.60  ? 482  LEU E CD2   1 
ATOM   5748 N  N     . VAL E 2 40  ? 60.700  -49.367 40.602  1.00 50.57  ? 483  VAL E N     1 
ATOM   5749 C  CA    . VAL E 2 40  ? 59.785  -48.514 41.322  1.00 54.32  ? 483  VAL E CA    1 
ATOM   5750 C  C     . VAL E 2 40  ? 58.586  -49.312 41.814  1.00 55.40  ? 483  VAL E C     1 
ATOM   5751 O  O     . VAL E 2 40  ? 58.199  -49.212 42.975  1.00 57.16  ? 483  VAL E O     1 
ATOM   5752 C  CB    . VAL E 2 40  ? 59.331  -47.321 40.463  1.00 55.68  ? 483  VAL E CB    1 
ATOM   5753 C  CG1   . VAL E 2 40  ? 58.229  -46.556 41.149  1.00 53.04  ? 483  VAL E CG1   1 
ATOM   5754 C  CG2   . VAL E 2 40  ? 60.496  -46.377 40.203  1.00 55.59  ? 483  VAL E CG2   1 
ATOM   5755 N  N     . SER E 2 41  ? 58.029  -50.143 40.949  1.00 59.18  ? 484  SER E N     1 
ATOM   5756 C  CA    . SER E 2 41  ? 56.887  -50.994 41.333  1.00 62.28  ? 484  SER E CA    1 
ATOM   5757 C  C     . SER E 2 41  ? 57.228  -51.954 42.443  1.00 61.49  ? 484  SER E C     1 
ATOM   5758 O  O     . SER E 2 41  ? 56.342  -52.494 43.077  1.00 60.81  ? 484  SER E O     1 
ATOM   5759 C  CB    . SER E 2 41  ? 56.377  -51.822 40.148  1.00 59.68  ? 484  SER E CB    1 
ATOM   5760 O  OG    . SER E 2 41  ? 57.264  -52.897 39.893  1.00 57.56  ? 484  SER E OG    1 
ATOM   5761 N  N     . LYS E 2 42  ? 58.513  -52.209 42.643  1.00 67.36  ? 485  LYS E N     1 
ATOM   5762 C  CA    . LYS E 2 42  ? 58.955  -53.166 43.647  1.00 71.27  ? 485  LYS E CA    1 
ATOM   5763 C  C     . LYS E 2 42  ? 59.407  -52.469 44.925  1.00 70.94  ? 485  LYS E C     1 
ATOM   5764 O  O     . LYS E 2 42  ? 59.961  -53.104 45.842  1.00 72.24  ? 485  LYS E O     1 
ATOM   5765 C  CB    . LYS E 2 42  ? 60.080  -54.018 43.073  1.00 74.71  ? 485  LYS E CB    1 
ATOM   5766 C  CG    . LYS E 2 42  ? 59.751  -55.502 43.037  1.00 82.39  ? 485  LYS E CG    1 
ATOM   5767 C  CD    . LYS E 2 42  ? 58.795  -55.867 41.914  1.00 81.50  ? 485  LYS E CD    1 
ATOM   5768 C  CE    . LYS E 2 42  ? 58.521  -57.369 41.924  1.00 88.99  ? 485  LYS E CE    1 
ATOM   5769 N  NZ    . LYS E 2 42  ? 57.083  -57.686 41.701  1.00 89.33  ? 485  LYS E NZ    1 
ATOM   5770 N  N     . GLY E 2 43  ? 59.150  -51.166 44.994  1.00 69.50  ? 486  GLY E N     1 
ATOM   5771 C  CA    . GLY E 2 43  ? 59.358  -50.421 46.210  1.00 67.47  ? 486  GLY E CA    1 
ATOM   5772 C  C     . GLY E 2 43  ? 60.630  -49.612 46.225  1.00 60.61  ? 486  GLY E C     1 
ATOM   5773 O  O     . GLY E 2 43  ? 60.941  -48.996 47.233  1.00 55.71  ? 486  GLY E O     1 
ATOM   5774 N  N     . ALA E 2 44  ? 61.367  -49.590 45.123  1.00 55.01  ? 487  ALA E N     1 
ATOM   5775 C  CA    . ALA E 2 44  ? 62.596  -48.804 45.070  1.00 56.77  ? 487  ALA E CA    1 
ATOM   5776 C  C     . ALA E 2 44  ? 62.440  -47.339 45.550  1.00 54.88  ? 487  ALA E C     1 
ATOM   5777 O  O     . ALA E 2 44  ? 61.494  -46.660 45.177  1.00 59.29  ? 487  ALA E O     1 
ATOM   5778 C  CB    . ALA E 2 44  ? 63.163  -48.841 43.662  1.00 59.65  ? 487  ALA E CB    1 
ATOM   5779 N  N     . MET E 2 45  ? 63.381  -46.866 46.368  1.00 56.11  ? 488  MET E N     1 
ATOM   5780 C  CA    . MET E 2 45  ? 63.368  -45.484 46.841  1.00 54.74  ? 488  MET E CA    1 
ATOM   5781 C  C     . MET E 2 45  ? 63.909  -44.574 45.742  1.00 57.65  ? 488  MET E C     1 
ATOM   5782 O  O     . MET E 2 45  ? 65.114  -44.592 45.432  1.00 58.91  ? 488  MET E O     1 
ATOM   5783 C  CB    . MET E 2 45  ? 64.197  -45.299 48.126  1.00 53.09  ? 488  MET E CB    1 
ATOM   5784 C  CG    . MET E 2 45  ? 64.372  -43.837 48.504  1.00 59.62  ? 488  MET E CG    1 
ATOM   5785 S  SD    . MET E 2 45  ? 65.118  -43.368 50.053  1.00 61.23  ? 488  MET E SD    1 
ATOM   5786 C  CE    . MET E 2 45  ? 66.052  -44.857 50.299  1.00 74.60  ? 488  MET E CE    1 
ATOM   5787 N  N     . VAL E 2 46  ? 63.018  -43.752 45.203  1.00 55.01  ? 489  VAL E N     1 
ATOM   5788 C  CA    . VAL E 2 46  ? 63.335  -42.893 44.078  1.00 53.62  ? 489  VAL E CA    1 
ATOM   5789 C  C     . VAL E 2 46  ? 64.354  -41.814 44.406  1.00 52.15  ? 489  VAL E C     1 
ATOM   5790 O  O     . VAL E 2 46  ? 65.178  -41.478 43.552  1.00 55.71  ? 489  VAL E O     1 
ATOM   5791 C  CB    . VAL E 2 46  ? 62.070  -42.206 43.561  1.00 56.35  ? 489  VAL E CB    1 
ATOM   5792 C  CG1   . VAL E 2 46  ? 62.389  -41.165 42.494  1.00 58.20  ? 489  VAL E CG1   1 
ATOM   5793 C  CG2   . VAL E 2 46  ? 61.121  -43.239 43.007  1.00 56.04  ? 489  VAL E CG2   1 
ATOM   5794 N  N     . ASN E 2 47  ? 64.282  -41.235 45.603  1.00 50.33  ? 490  ASN E N     1 
ATOM   5795 C  CA    . ASN E 2 47  ? 65.244  -40.199 45.993  1.00 51.81  ? 490  ASN E CA    1 
ATOM   5796 C  C     . ASN E 2 47  ? 66.425  -40.699 46.826  1.00 54.89  ? 490  ASN E C     1 
ATOM   5797 O  O     . ASN E 2 47  ? 67.131  -39.922 47.497  1.00 57.98  ? 490  ASN E O     1 
ATOM   5798 C  CB    . ASN E 2 47  ? 64.534  -39.091 46.715  1.00 51.37  ? 490  ASN E CB    1 
ATOM   5799 C  CG    . ASN E 2 47  ? 63.710  -38.243 45.788  1.00 53.90  ? 490  ASN E CG    1 
ATOM   5800 O  OD1   . ASN E 2 47  ? 64.149  -37.852 44.696  1.00 63.77  ? 490  ASN E OD1   1 
ATOM   5801 N  ND2   . ASN E 2 47  ? 62.525  -37.917 46.227  1.00 56.01  ? 490  ASN E ND2   1 
ATOM   5802 N  N     . ALA E 2 48  ? 66.693  -41.992 46.694  1.00 55.15  ? 491  ALA E N     1 
ATOM   5803 C  CA    . ALA E 2 48  ? 67.891  -42.598 47.247  1.00 52.71  ? 491  ALA E CA    1 
ATOM   5804 C  C     . ALA E 2 48  ? 69.137  -41.838 46.821  1.00 51.26  ? 491  ALA E C     1 
ATOM   5805 O  O     . ALA E 2 48  ? 69.255  -41.432 45.675  1.00 51.82  ? 491  ALA E O     1 
ATOM   5806 C  CB    . ALA E 2 48  ? 67.978  -44.035 46.780  1.00 55.14  ? 491  ALA E CB    1 
ATOM   5807 N  N     . THR E 2 49  ? 70.063  -41.646 47.747  1.00 52.93  ? 492  THR E N     1 
ATOM   5808 C  CA    . THR E 2 49  ? 71.287  -40.888 47.459  1.00 52.73  ? 492  THR E CA    1 
ATOM   5809 C  C     . THR E 2 49  ? 72.522  -41.800 47.565  1.00 52.83  ? 492  THR E C     1 
ATOM   5810 O  O     . THR E 2 49  ? 72.609  -42.650 48.477  1.00 47.39  ? 492  THR E O     1 
ATOM   5811 C  CB    . THR E 2 49  ? 71.467  -39.621 48.345  1.00 49.50  ? 492  THR E CB    1 
ATOM   5812 O  OG1   . THR E 2 49  ? 71.381  -39.951 49.730  1.00 43.61  ? 492  THR E OG1   1 
ATOM   5813 C  CG2   . THR E 2 49  ? 70.455  -38.585 48.006  1.00 49.72  ? 492  THR E CG2   1 
ATOM   5814 N  N     . ASP E 2 50  ? 73.458  -41.626 46.629  1.00 49.80  ? 493  ASP E N     1 
ATOM   5815 C  CA    . ASP E 2 50  ? 74.707  -42.387 46.672  1.00 55.94  ? 493  ASP E CA    1 
ATOM   5816 C  C     . ASP E 2 50  ? 75.704  -41.725 47.602  1.00 56.07  ? 493  ASP E C     1 
ATOM   5817 O  O     . ASP E 2 50  ? 75.430  -40.688 48.220  1.00 54.69  ? 493  ASP E O     1 
ATOM   5818 C  CB    . ASP E 2 50  ? 75.298  -42.611 45.260  1.00 58.34  ? 493  ASP E CB    1 
ATOM   5819 C  CG    . ASP E 2 50  ? 75.977  -41.368 44.682  1.00 63.04  ? 493  ASP E CG    1 
ATOM   5820 O  OD1   . ASP E 2 50  ? 75.945  -40.302 45.341  1.00 62.01  ? 493  ASP E OD1   1 
ATOM   5821 O  OD2   . ASP E 2 50  ? 76.531  -41.455 43.551  1.00 68.29  ? 493  ASP E OD2   1 
ATOM   5822 N  N     . TYR E 2 51  ? 76.870  -42.335 47.703  1.00 54.75  ? 494  TYR E N     1 
ATOM   5823 C  CA    . TYR E 2 51  ? 77.866  -41.858 48.631  1.00 59.26  ? 494  TYR E CA    1 
ATOM   5824 C  C     . TYR E 2 51  ? 78.256  -40.384 48.454  1.00 51.59  ? 494  TYR E C     1 
ATOM   5825 O  O     . TYR E 2 51  ? 78.720  -39.777 49.400  1.00 53.56  ? 494  TYR E O     1 
ATOM   5826 C  CB    . TYR E 2 51  ? 79.106  -42.775 48.618  1.00 68.71  ? 494  TYR E CB    1 
ATOM   5827 C  CG    . TYR E 2 51  ? 80.114  -42.438 47.560  1.00 76.38  ? 494  TYR E CG    1 
ATOM   5828 C  CD1   . TYR E 2 51  ? 79.750  -42.412 46.226  1.00 80.42  ? 494  TYR E CD1   1 
ATOM   5829 C  CD2   . TYR E 2 51  ? 81.430  -42.128 47.898  1.00 80.63  ? 494  TYR E CD2   1 
ATOM   5830 C  CE1   . TYR E 2 51  ? 80.673  -42.086 45.257  1.00 83.43  ? 494  TYR E CE1   1 
ATOM   5831 C  CE2   . TYR E 2 51  ? 82.362  -41.802 46.935  1.00 81.34  ? 494  TYR E CE2   1 
ATOM   5832 C  CZ    . TYR E 2 51  ? 81.976  -41.776 45.615  1.00 85.73  ? 494  TYR E CZ    1 
ATOM   5833 O  OH    . TYR E 2 51  ? 82.865  -41.448 44.624  1.00 94.51  ? 494  TYR E OH    1 
ATOM   5834 N  N     . HIS E 2 52  ? 78.031  -39.787 47.297  1.00 48.74  ? 495  HIS E N     1 
ATOM   5835 C  CA    . HIS E 2 52  ? 78.250  -38.343 47.148  1.00 52.03  ? 495  HIS E CA    1 
ATOM   5836 C  C     . HIS E 2 52  ? 76.987  -37.532 46.803  1.00 52.35  ? 495  HIS E C     1 
ATOM   5837 O  O     . HIS E 2 52  ? 77.049  -36.405 46.321  1.00 48.42  ? 495  HIS E O     1 
ATOM   5838 C  CB    . HIS E 2 52  ? 79.328  -38.120 46.120  1.00 55.81  ? 495  HIS E CB    1 
ATOM   5839 C  CG    . HIS E 2 52  ? 80.705  -38.348 46.657  1.00 68.06  ? 495  HIS E CG    1 
ATOM   5840 N  ND1   . HIS E 2 52  ? 81.820  -38.420 45.852  1.00 80.89  ? 495  HIS E ND1   1 
ATOM   5841 C  CD2   . HIS E 2 52  ? 81.149  -38.529 47.924  1.00 75.04  ? 495  HIS E CD2   1 
ATOM   5842 C  CE1   . HIS E 2 52  ? 82.888  -38.637 46.599  1.00 80.47  ? 495  HIS E CE1   1 
ATOM   5843 N  NE2   . HIS E 2 52  ? 82.507  -38.710 47.860  1.00 74.45  ? 495  HIS E NE2   1 
ATOM   5844 N  N     . GLY E 2 53  ? 75.836  -38.083 47.133  1.00 51.18  ? 496  GLY E N     1 
ATOM   5845 C  CA    . GLY E 2 53  ? 74.643  -37.274 47.263  1.00 53.30  ? 496  GLY E CA    1 
ATOM   5846 C  C     . GLY E 2 53  ? 73.840  -37.230 45.991  1.00 50.77  ? 496  GLY E C     1 
ATOM   5847 O  O     . GLY E 2 53  ? 72.971  -36.383 45.845  1.00 50.92  ? 496  GLY E O     1 
ATOM   5848 N  N     . ALA E 2 54  ? 74.111  -38.170 45.099  1.00 51.47  ? 497  ALA E N     1 
ATOM   5849 C  CA    . ALA E 2 54  ? 73.504  -38.186 43.779  1.00 51.06  ? 497  ALA E CA    1 
ATOM   5850 C  C     . ALA E 2 54  ? 72.326  -39.136 43.775  1.00 55.86  ? 497  ALA E C     1 
ATOM   5851 O  O     . ALA E 2 54  ? 72.418  -40.281 44.198  1.00 53.89  ? 497  ALA E O     1 
ATOM   5852 C  CB    . ALA E 2 54  ? 74.502  -38.637 42.743  1.00 52.84  ? 497  ALA E CB    1 
ATOM   5853 N  N     . THR E 2 55  ? 71.215  -38.603 43.310  1.00 58.01  ? 498  THR E N     1 
ATOM   5854 C  CA    . THR E 2 55  ? 69.992  -39.293 43.054  1.00 53.80  ? 498  THR E CA    1 
ATOM   5855 C  C     . THR E 2 55  ? 70.042  -39.923 41.670  1.00 55.20  ? 498  THR E C     1 
ATOM   5856 O  O     . THR E 2 55  ? 70.733  -39.445 40.782  1.00 63.19  ? 498  THR E O     1 
ATOM   5857 C  CB    . THR E 2 55  ? 68.977  -38.133 43.128  1.00 58.66  ? 498  THR E CB    1 
ATOM   5858 O  OG1   . THR E 2 55  ? 68.945  -37.675 44.474  1.00 63.83  ? 498  THR E OG1   1 
ATOM   5859 C  CG2   . THR E 2 55  ? 67.579  -38.416 42.732  1.00 66.66  ? 498  THR E CG2   1 
ATOM   5860 N  N     . PRO E 2 56  ? 69.280  -40.984 41.447  1.00 50.43  ? 499  PRO E N     1 
ATOM   5861 C  CA    . PRO E 2 56  ? 69.087  -41.413 40.076  1.00 50.25  ? 499  PRO E CA    1 
ATOM   5862 C  C     . PRO E 2 56  ? 68.816  -40.274 39.119  1.00 51.55  ? 499  PRO E C     1 
ATOM   5863 O  O     . PRO E 2 56  ? 69.343  -40.245 38.009  1.00 57.59  ? 499  PRO E O     1 
ATOM   5864 C  CB    . PRO E 2 56  ? 67.854  -42.304 40.178  1.00 51.19  ? 499  PRO E CB    1 
ATOM   5865 C  CG    . PRO E 2 56  ? 67.947  -42.888 41.538  1.00 47.58  ? 499  PRO E CG    1 
ATOM   5866 C  CD    . PRO E 2 56  ? 68.491  -41.784 42.390  1.00 48.83  ? 499  PRO E CD    1 
ATOM   5867 N  N     . LEU E 2 57  ? 67.952  -39.355 39.514  1.00 54.45  ? 500  LEU E N     1 
ATOM   5868 C  CA    . LEU E 2 57  ? 67.695  -38.172 38.689  1.00 56.80  ? 500  LEU E CA    1 
ATOM   5869 C  C     . LEU E 2 57  ? 68.958  -37.369 38.358  1.00 52.07  ? 500  LEU E C     1 
ATOM   5870 O  O     . LEU E 2 57  ? 69.104  -36.902 37.234  1.00 44.25  ? 500  LEU E O     1 
ATOM   5871 C  CB    . LEU E 2 57  ? 66.654  -37.272 39.352  1.00 61.78  ? 500  LEU E CB    1 
ATOM   5872 C  CG    . LEU E 2 57  ? 66.211  -36.062 38.533  1.00 62.01  ? 500  LEU E CG    1 
ATOM   5873 C  CD1   . LEU E 2 57  ? 65.502  -36.519 37.294  1.00 61.75  ? 500  LEU E CD1   1 
ATOM   5874 C  CD2   . LEU E 2 57  ? 65.259  -35.209 39.342  1.00 67.45  ? 500  LEU E CD2   1 
ATOM   5875 N  N     . HIS E 2 58  ? 69.863  -37.216 39.324  1.00 55.26  ? 501  HIS E N     1 
ATOM   5876 C  CA    . HIS E 2 58  ? 71.159  -36.547 39.068  1.00 56.60  ? 501  HIS E CA    1 
ATOM   5877 C  C     . HIS E 2 58  ? 71.916  -37.285 37.979  1.00 53.40  ? 501  HIS E C     1 
ATOM   5878 O  O     . HIS E 2 58  ? 72.483  -36.670 37.088  1.00 53.90  ? 501  HIS E O     1 
ATOM   5879 C  CB    . HIS E 2 58  ? 72.057  -36.531 40.301  1.00 57.11  ? 501  HIS E CB    1 
ATOM   5880 C  CG    . HIS E 2 58  ? 71.792  -35.415 41.250  1.00 59.77  ? 501  HIS E CG    1 
ATOM   5881 N  ND1   . HIS E 2 58  ? 70.885  -35.519 42.279  1.00 60.50  ? 501  HIS E ND1   1 
ATOM   5882 C  CD2   . HIS E 2 58  ? 72.357  -34.190 41.370  1.00 66.06  ? 501  HIS E CD2   1 
ATOM   5883 C  CE1   . HIS E 2 58  ? 70.875  -34.397 42.975  1.00 59.35  ? 501  HIS E CE1   1 
ATOM   5884 N  NE2   . HIS E 2 58  ? 71.754  -33.570 42.441  1.00 62.78  ? 501  HIS E NE2   1 
ATOM   5885 N  N     . LEU E 2 59  ? 71.904  -38.609 38.044  1.00 48.67  ? 502  LEU E N     1 
ATOM   5886 C  CA    . LEU E 2 59  ? 72.597  -39.404 37.050  1.00 50.35  ? 502  LEU E CA    1 
ATOM   5887 C  C     . LEU E 2 59  ? 71.973  -39.288 35.672  1.00 53.77  ? 502  LEU E C     1 
ATOM   5888 O  O     . LEU E 2 59  ? 72.678  -39.060 34.707  1.00 59.64  ? 502  LEU E O     1 
ATOM   5889 C  CB    . LEU E 2 59  ? 72.633  -40.869 37.457  1.00 51.83  ? 502  LEU E CB    1 
ATOM   5890 C  CG    . LEU E 2 59  ? 73.346  -41.181 38.772  1.00 52.91  ? 502  LEU E CG    1 
ATOM   5891 C  CD1   . LEU E 2 59  ? 73.320  -42.674 39.026  1.00 54.65  ? 502  LEU E CD1   1 
ATOM   5892 C  CD2   . LEU E 2 59  ? 74.765  -40.653 38.777  1.00 52.65  ? 502  LEU E CD2   1 
ATOM   5893 N  N     . ALA E 2 60  ? 70.657  -39.442 35.566  1.00 59.53  ? 503  ALA E N     1 
ATOM   5894 C  CA    . ALA E 2 60  ? 69.987  -39.207 34.282  1.00 61.29  ? 503  ALA E CA    1 
ATOM   5895 C  C     . ALA E 2 60  ? 70.305  -37.812 33.690  1.00 61.18  ? 503  ALA E C     1 
ATOM   5896 O  O     . ALA E 2 60  ? 70.673  -37.721 32.537  1.00 56.09  ? 503  ALA E O     1 
ATOM   5897 C  CB    . ALA E 2 60  ? 68.488  -39.418 34.401  1.00 58.82  ? 503  ALA E CB    1 
ATOM   5898 N  N     . CYS E 2 61  ? 70.227  -36.745 34.484  1.00 64.71  ? 504  CYS E N     1 
ATOM   5899 C  CA    . CYS E 2 61  ? 70.461  -35.393 33.939  1.00 68.59  ? 504  CYS E CA    1 
ATOM   5900 C  C     . CYS E 2 61  ? 71.918  -35.128 33.541  1.00 71.36  ? 504  CYS E C     1 
ATOM   5901 O  O     . CYS E 2 61  ? 72.194  -34.319 32.656  1.00 73.55  ? 504  CYS E O     1 
ATOM   5902 C  CB    . CYS E 2 61  ? 69.970  -34.312 34.895  1.00 65.13  ? 504  CYS E CB    1 
ATOM   5903 S  SG    . CYS E 2 61  ? 68.169  -34.293 34.890  1.00 63.32  ? 504  CYS E SG    1 
ATOM   5904 N  N     . GLN E 2 62  ? 72.834  -35.843 34.165  1.00 67.62  ? 505  GLN E N     1 
ATOM   5905 C  CA    . GLN E 2 62  ? 74.205  -35.749 33.790  1.00 67.40  ? 505  GLN E CA    1 
ATOM   5906 C  C     . GLN E 2 62  ? 74.400  -36.383 32.440  1.00 67.73  ? 505  GLN E C     1 
ATOM   5907 O  O     . GLN E 2 62  ? 75.043  -35.816 31.560  1.00 67.97  ? 505  GLN E O     1 
ATOM   5908 C  CB    . GLN E 2 62  ? 75.041  -36.489 34.800  1.00 78.33  ? 505  GLN E CB    1 
ATOM   5909 C  CG    . GLN E 2 62  ? 76.493  -36.102 34.709  1.00 92.49  ? 505  GLN E CG    1 
ATOM   5910 C  CD    . GLN E 2 62  ? 77.299  -36.562 35.895  1.00 98.39  ? 505  GLN E CD    1 
ATOM   5911 O  OE1   . GLN E 2 62  ? 78.085  -35.792 36.456  1.00 103.04 ? 505  GLN E OE1   1 
ATOM   5912 N  NE2   . GLN E 2 62  ? 77.104  -37.814 36.296  1.00 102.30 ? 505  GLN E NE2   1 
ATOM   5913 N  N     . LYS E 2 63  ? 73.847  -37.584 32.299  1.00 68.07  ? 506  LYS E N     1 
ATOM   5914 C  CA    . LYS E 2 63  ? 74.022  -38.390 31.099  1.00 67.88  ? 506  LYS E CA    1 
ATOM   5915 C  C     . LYS E 2 63  ? 73.179  -37.849 29.959  1.00 75.36  ? 506  LYS E C     1 
ATOM   5916 O  O     . LYS E 2 63  ? 73.407  -38.201 28.812  1.00 81.59  ? 506  LYS E O     1 
ATOM   5917 C  CB    . LYS E 2 63  ? 73.583  -39.843 31.293  1.00 69.19  ? 506  LYS E CB    1 
ATOM   5918 C  CG    . LYS E 2 63  ? 74.342  -40.708 32.281  1.00 76.03  ? 506  LYS E CG    1 
ATOM   5919 C  CD    . LYS E 2 63  ? 75.743  -41.211 31.810  1.00 80.83  ? 506  LYS E CD    1 
ATOM   5920 C  CE    . LYS E 2 63  ? 75.660  -42.631 31.220  1.00 82.63  ? 506  LYS E CE    1 
ATOM   5921 N  NZ    . LYS E 2 63  ? 76.764  -43.090 30.323  1.00 81.96  ? 506  LYS E NZ    1 
ATOM   5922 N  N     . GLY E 2 64  ? 72.139  -37.079 30.272  1.00 82.89  ? 507  GLY E N     1 
ATOM   5923 C  CA    . GLY E 2 64  ? 71.264  -36.530 29.238  1.00 79.25  ? 507  GLY E CA    1 
ATOM   5924 C  C     . GLY E 2 64  ? 70.097  -37.357 28.721  1.00 72.65  ? 507  GLY E C     1 
ATOM   5925 O  O     . GLY E 2 64  ? 69.699  -37.189 27.566  1.00 70.55  ? 507  GLY E O     1 
ATOM   5926 N  N     . TYR E 2 65  ? 69.554  -38.234 29.558  1.00 65.05  ? 508  TYR E N     1 
ATOM   5927 C  CA    . TYR E 2 65  ? 68.485  -39.124 29.140  1.00 70.50  ? 508  TYR E CA    1 
ATOM   5928 C  C     . TYR E 2 65  ? 67.132  -38.518 29.463  1.00 70.73  ? 508  TYR E C     1 
ATOM   5929 O  O     . TYR E 2 65  ? 66.534  -38.829 30.490  1.00 69.69  ? 508  TYR E O     1 
ATOM   5930 C  CB    . TYR E 2 65  ? 68.595  -40.456 29.860  1.00 84.36  ? 508  TYR E CB    1 
ATOM   5931 C  CG    . TYR E 2 65  ? 69.863  -41.226 29.623  1.00 104.00 ? 508  TYR E CG    1 
ATOM   5932 C  CD1   . TYR E 2 65  ? 70.999  -40.626 29.080  1.00 114.14 ? 508  TYR E CD1   1 
ATOM   5933 C  CD2   . TYR E 2 65  ? 69.933  -42.572 29.967  1.00 114.48 ? 508  TYR E CD2   1 
ATOM   5934 C  CE1   . TYR E 2 65  ? 72.151  -41.351 28.877  1.00 120.90 ? 508  TYR E CE1   1 
ATOM   5935 C  CE2   . TYR E 2 65  ? 71.085  -43.302 29.772  1.00 116.84 ? 508  TYR E CE2   1 
ATOM   5936 C  CZ    . TYR E 2 65  ? 72.189  -42.687 29.228  1.00 123.11 ? 508  TYR E CZ    1 
ATOM   5937 O  OH    . TYR E 2 65  ? 73.335  -43.408 29.025  1.00 120.44 ? 508  TYR E OH    1 
ATOM   5938 N  N     . GLN E 2 66  ? 66.630  -37.652 28.591  1.00 69.85  ? 509  GLN E N     1 
ATOM   5939 C  CA    . GLN E 2 66  ? 65.352  -36.992 28.846  1.00 63.50  ? 509  GLN E CA    1 
ATOM   5940 C  C     . GLN E 2 66  ? 64.244  -37.981 29.206  1.00 63.66  ? 509  GLN E C     1 
ATOM   5941 O  O     . GLN E 2 66  ? 63.462  -37.741 30.119  1.00 66.30  ? 509  GLN E O     1 
ATOM   5942 C  CB    . GLN E 2 66  ? 64.922  -36.163 27.647  1.00 70.43  ? 509  GLN E CB    1 
ATOM   5943 C  CG    . GLN E 2 66  ? 63.889  -35.106 28.000  1.00 72.49  ? 509  GLN E CG    1 
ATOM   5944 C  CD    . GLN E 2 66  ? 62.962  -34.746 26.851  1.00 70.31  ? 509  GLN E CD    1 
ATOM   5945 O  OE1   . GLN E 2 66  ? 62.182  -35.588 26.368  1.00 62.17  ? 509  GLN E OE1   1 
ATOM   5946 N  NE2   . GLN E 2 66  ? 63.026  -33.484 26.412  1.00 74.35  ? 509  GLN E NE2   1 
ATOM   5947 N  N     . SER E 2 67  ? 64.181  -39.109 28.513  1.00 65.70  ? 510  SER E N     1 
ATOM   5948 C  CA    . SER E 2 67  ? 63.107  -40.070 28.747  1.00 67.82  ? 510  SER E CA    1 
ATOM   5949 C  C     . SER E 2 67  ? 63.057  -40.524 30.205  1.00 68.23  ? 510  SER E C     1 
ATOM   5950 O  O     . SER E 2 67  ? 62.015  -40.512 30.854  1.00 67.16  ? 510  SER E O     1 
ATOM   5951 C  CB    . SER E 2 67  ? 63.276  -41.285 27.858  1.00 68.91  ? 510  SER E CB    1 
ATOM   5952 O  OG    . SER E 2 67  ? 62.279  -42.211 28.194  1.00 77.23  ? 510  SER E OG    1 
ATOM   5953 N  N     . VAL E 2 68  ? 64.212  -40.938 30.696  1.00 72.61  ? 511  VAL E N     1 
ATOM   5954 C  CA    . VAL E 2 68  ? 64.389  -41.338 32.077  1.00 69.38  ? 511  VAL E CA    1 
ATOM   5955 C  C     . VAL E 2 68  ? 64.114  -40.164 33.006  1.00 64.55  ? 511  VAL E C     1 
ATOM   5956 O  O     . VAL E 2 68  ? 63.345  -40.288 33.976  1.00 64.17  ? 511  VAL E O     1 
ATOM   5957 C  CB    . VAL E 2 68  ? 65.827  -41.847 32.283  1.00 72.66  ? 511  VAL E CB    1 
ATOM   5958 C  CG1   . VAL E 2 68  ? 66.177  -41.979 33.753  1.00 75.41  ? 511  VAL E CG1   1 
ATOM   5959 C  CG2   . VAL E 2 68  ? 66.006  -43.178 31.571  1.00 75.50  ? 511  VAL E CG2   1 
ATOM   5960 N  N     . THR E 2 69  ? 64.772  -39.037 32.749  1.00 53.47  ? 512  THR E N     1 
ATOM   5961 C  CA    . THR E 2 69  ? 64.535  -37.857 33.564  1.00 48.85  ? 512  THR E CA    1 
ATOM   5962 C  C     . THR E 2 69  ? 63.048  -37.619 33.816  1.00 45.37  ? 512  THR E C     1 
ATOM   5963 O  O     . THR E 2 69  ? 62.616  -37.490 34.961  1.00 42.00  ? 512  THR E O     1 
ATOM   5964 C  CB    . THR E 2 69  ? 65.137  -36.636 32.877  1.00 48.46  ? 512  THR E CB    1 
ATOM   5965 O  OG1   . THR E 2 69  ? 66.560  -36.809 32.747  1.00 46.76  ? 512  THR E OG1   1 
ATOM   5966 C  CG2   . THR E 2 69  ? 64.820  -35.366 33.626  1.00 46.56  ? 512  THR E CG2   1 
ATOM   5967 N  N     . LEU E 2 70  ? 62.255  -37.643 32.760  1.00 48.37  ? 513  LEU E N     1 
ATOM   5968 C  CA    . LEU E 2 70  ? 60.798  -37.490 32.921  1.00 52.83  ? 513  LEU E CA    1 
ATOM   5969 C  C     . LEU E 2 70  ? 60.101  -38.611 33.678  1.00 49.98  ? 513  LEU E C     1 
ATOM   5970 O  O     . LEU E 2 70  ? 59.275  -38.366 34.542  1.00 46.59  ? 513  LEU E O     1 
ATOM   5971 C  CB    . LEU E 2 70  ? 60.126  -37.307 31.577  1.00 53.40  ? 513  LEU E CB    1 
ATOM   5972 C  CG    . LEU E 2 70  ? 60.464  -35.927 31.017  1.00 62.33  ? 513  LEU E CG    1 
ATOM   5973 C  CD1   . LEU E 2 70  ? 60.196  -35.917 29.533  1.00 67.52  ? 513  LEU E CD1   1 
ATOM   5974 C  CD2   . LEU E 2 70  ? 59.673  -34.818 31.704  1.00 63.35  ? 513  LEU E CD2   1 
ATOM   5975 N  N     . LEU E 2 71  ? 60.473  -39.837 33.386  1.00 49.79  ? 514  LEU E N     1 
ATOM   5976 C  CA    . LEU E 2 71  ? 59.882  -40.950 34.074  1.00 52.29  ? 514  LEU E CA    1 
ATOM   5977 C  C     . LEU E 2 71  ? 60.144  -40.848 35.575  1.00 57.46  ? 514  LEU E C     1 
ATOM   5978 O  O     . LEU E 2 71  ? 59.268  -41.131 36.389  1.00 58.50  ? 514  LEU E O     1 
ATOM   5979 C  CB    . LEU E 2 71  ? 60.457  -42.257 33.524  1.00 54.98  ? 514  LEU E CB    1 
ATOM   5980 C  CG    . LEU E 2 71  ? 59.868  -43.524 34.153  1.00 53.51  ? 514  LEU E CG    1 
ATOM   5981 C  CD1   . LEU E 2 71  ? 58.355  -43.540 34.061  1.00 52.31  ? 514  LEU E CD1   1 
ATOM   5982 C  CD2   . LEU E 2 71  ? 60.457  -44.750 33.487  1.00 55.07  ? 514  LEU E CD2   1 
ATOM   5983 N  N     . LEU E 2 72  ? 61.362  -40.460 35.947  1.00 59.14  ? 515  LEU E N     1 
ATOM   5984 C  CA    . LEU E 2 72  ? 61.689  -40.279 37.361  1.00 58.12  ? 515  LEU E CA    1 
ATOM   5985 C  C     . LEU E 2 72  ? 60.817  -39.193 37.983  1.00 58.68  ? 515  LEU E C     1 
ATOM   5986 O  O     . LEU E 2 72  ? 60.235  -39.406 39.053  1.00 55.96  ? 515  LEU E O     1 
ATOM   5987 C  CB    . LEU E 2 72  ? 63.168  -39.947 37.538  1.00 56.09  ? 515  LEU E CB    1 
ATOM   5988 C  CG    . LEU E 2 72  ? 64.100  -41.114 37.205  1.00 54.50  ? 515  LEU E CG    1 
ATOM   5989 C  CD1   . LEU E 2 72  ? 65.552  -40.657 37.175  1.00 53.54  ? 515  LEU E CD1   1 
ATOM   5990 C  CD2   . LEU E 2 72  ? 63.939  -42.246 38.194  1.00 54.11  ? 515  LEU E CD2   1 
ATOM   5991 N  N     . LEU E 2 73  ? 60.711  -38.045 37.308  1.00 55.79  ? 516  LEU E N     1 
ATOM   5992 C  CA    . LEU E 2 73  ? 59.856  -36.954 37.797  1.00 55.26  ? 516  LEU E CA    1 
ATOM   5993 C  C     . LEU E 2 73  ? 58.440  -37.454 37.919  1.00 52.04  ? 516  LEU E C     1 
ATOM   5994 O  O     . LEU E 2 73  ? 57.748  -37.143 38.868  1.00 49.97  ? 516  LEU E O     1 
ATOM   5995 C  CB    . LEU E 2 73  ? 59.903  -35.738 36.882  1.00 56.54  ? 516  LEU E CB    1 
ATOM   5996 C  CG    . LEU E 2 73  ? 61.291  -35.093 36.730  1.00 62.17  ? 516  LEU E CG    1 
ATOM   5997 C  CD1   . LEU E 2 73  ? 61.394  -34.252 35.468  1.00 62.68  ? 516  LEU E CD1   1 
ATOM   5998 C  CD2   . LEU E 2 73  ? 61.669  -34.250 37.934  1.00 61.46  ? 516  LEU E CD2   1 
ATOM   5999 N  N     . HIS E 2 74  ? 58.032  -38.279 36.973  1.00 52.81  ? 517  HIS E N     1 
ATOM   6000 C  CA    . HIS E 2 74  ? 56.720  -38.886 37.011  1.00 56.87  ? 517  HIS E CA    1 
ATOM   6001 C  C     . HIS E 2 74  ? 56.523  -39.698 38.254  1.00 55.88  ? 517  HIS E C     1 
ATOM   6002 O  O     . HIS E 2 74  ? 55.442  -39.693 38.816  1.00 61.10  ? 517  HIS E O     1 
ATOM   6003 C  CB    . HIS E 2 74  ? 56.525  -39.782 35.794  1.00 64.98  ? 517  HIS E CB    1 
ATOM   6004 C  CG    . HIS E 2 74  ? 55.244  -40.555 35.808  1.00 68.58  ? 517  HIS E CG    1 
ATOM   6005 N  ND1   . HIS E 2 74  ? 54.023  -39.967 35.585  1.00 71.20  ? 517  HIS E ND1   1 
ATOM   6006 C  CD2   . HIS E 2 74  ? 54.999  -41.873 36.019  1.00 71.34  ? 517  HIS E CD2   1 
ATOM   6007 C  CE1   . HIS E 2 74  ? 53.078  -40.889 35.662  1.00 76.41  ? 517  HIS E CE1   1 
ATOM   6008 N  NE2   . HIS E 2 74  ? 53.645  -42.054 35.920  1.00 72.75  ? 517  HIS E NE2   1 
ATOM   6009 N  N     . TYR E 2 75  ? 57.561  -40.416 38.663  1.00 57.41  ? 518  TYR E N     1 
ATOM   6010 C  CA    . TYR E 2 75  ? 57.531  -41.182 39.909  1.00 57.53  ? 518  TYR E CA    1 
ATOM   6011 C  C     . TYR E 2 75  ? 58.009  -40.362 41.089  1.00 57.42  ? 518  TYR E C     1 
ATOM   6012 O  O     . TYR E 2 75  ? 58.490  -40.917 42.061  1.00 56.46  ? 518  TYR E O     1 
ATOM   6013 C  CB    . TYR E 2 75  ? 58.439  -42.412 39.792  1.00 60.35  ? 518  TYR E CB    1 
ATOM   6014 C  CG    . TYR E 2 75  ? 57.940  -43.483 38.865  1.00 58.26  ? 518  TYR E CG    1 
ATOM   6015 C  CD1   . TYR E 2 75  ? 56.703  -44.069 39.062  1.00 57.07  ? 518  TYR E CD1   1 
ATOM   6016 C  CD2   . TYR E 2 75  ? 58.709  -43.910 37.807  1.00 57.00  ? 518  TYR E CD2   1 
ATOM   6017 C  CE1   . TYR E 2 75  ? 56.239  -45.045 38.218  1.00 58.62  ? 518  TYR E CE1   1 
ATOM   6018 C  CE2   . TYR E 2 75  ? 58.254  -44.882 36.947  1.00 63.13  ? 518  TYR E CE2   1 
ATOM   6019 C  CZ    . TYR E 2 75  ? 57.016  -45.450 37.154  1.00 65.80  ? 518  TYR E CZ    1 
ATOM   6020 O  OH    . TYR E 2 75  ? 56.573  -46.453 36.309  1.00 67.62  ? 518  TYR E OH    1 
ATOM   6021 N  N     . LYS E 2 76  ? 57.889  -39.043 41.014  1.00 60.64  ? 519  LYS E N     1 
ATOM   6022 C  CA    . LYS E 2 76  ? 57.924  -38.192 42.198  1.00 61.83  ? 519  LYS E CA    1 
ATOM   6023 C  C     . LYS E 2 76  ? 59.347  -37.915 42.654  1.00 59.25  ? 519  LYS E C     1 
ATOM   6024 O  O     . LYS E 2 76  ? 59.565  -37.510 43.777  1.00 62.69  ? 519  LYS E O     1 
ATOM   6025 C  CB    . LYS E 2 76  ? 57.158  -38.810 43.359  1.00 66.44  ? 519  LYS E CB    1 
ATOM   6026 C  CG    . LYS E 2 76  ? 55.737  -39.231 43.051  1.00 75.98  ? 519  LYS E CG    1 
ATOM   6027 C  CD    . LYS E 2 76  ? 54.774  -38.063 42.944  1.00 88.68  ? 519  LYS E CD    1 
ATOM   6028 C  CE    . LYS E 2 76  ? 53.386  -38.480 43.440  1.00 105.06 ? 519  LYS E CE    1 
ATOM   6029 N  NZ    . LYS E 2 76  ? 52.350  -37.425 43.240  1.00 115.63 ? 519  LYS E NZ    1 
ATOM   6030 N  N     . ALA E 2 77  ? 60.317  -38.075 41.777  1.00 55.58  ? 520  ALA E N     1 
ATOM   6031 C  CA    . ALA E 2 77  ? 61.679  -37.714 42.108  1.00 54.69  ? 520  ALA E CA    1 
ATOM   6032 C  C     . ALA E 2 77  ? 61.749  -36.248 42.418  1.00 52.57  ? 520  ALA E C     1 
ATOM   6033 O  O     . ALA E 2 77  ? 61.226  -35.463 41.668  1.00 57.45  ? 520  ALA E O     1 
ATOM   6034 C  CB    . ALA E 2 77  ? 62.593  -38.018 40.939  1.00 57.59  ? 520  ALA E CB    1 
ATOM   6035 N  N     . SER E 2 78  ? 62.447  -35.866 43.481  1.00 55.28  ? 521  SER E N     1 
ATOM   6036 C  CA    . SER E 2 78  ? 62.673  -34.453 43.752  1.00 54.83  ? 521  SER E CA    1 
ATOM   6037 C  C     . SER E 2 78  ? 63.813  -33.871 42.901  1.00 55.94  ? 521  SER E C     1 
ATOM   6038 O  O     . SER E 2 78  ? 64.926  -34.431 42.850  1.00 57.99  ? 521  SER E O     1 
ATOM   6039 C  CB    . SER E 2 78  ? 62.985  -34.210 45.219  1.00 54.34  ? 521  SER E CB    1 
ATOM   6040 O  OG    . SER E 2 78  ? 63.441  -32.859 45.376  1.00 56.80  ? 521  SER E OG    1 
ATOM   6041 N  N     . ALA E 2 79  ? 63.530  -32.719 42.299  1.00 54.60  ? 522  ALA E N     1 
ATOM   6042 C  CA    . ALA E 2 79  ? 64.488  -31.999 41.471  1.00 57.49  ? 522  ALA E CA    1 
ATOM   6043 C  C     . ALA E 2 79  ? 65.402  -31.071 42.256  1.00 61.40  ? 522  ALA E C     1 
ATOM   6044 O  O     . ALA E 2 79  ? 66.328  -30.478 41.674  1.00 66.52  ? 522  ALA E O     1 
ATOM   6045 C  CB    . ALA E 2 79  ? 63.755  -31.198 40.419  1.00 58.77  ? 522  ALA E CB    1 
ATOM   6046 N  N     . GLU E 2 80  ? 65.142  -30.919 43.558  1.00 62.97  ? 523  GLU E N     1 
ATOM   6047 C  CA    . GLU E 2 80  ? 65.859  -29.946 44.389  1.00 64.08  ? 523  GLU E CA    1 
ATOM   6048 C  C     . GLU E 2 80  ? 66.919  -30.600 45.298  1.00 61.26  ? 523  GLU E C     1 
ATOM   6049 O  O     . GLU E 2 80  ? 67.521  -29.932 46.120  1.00 60.85  ? 523  GLU E O     1 
ATOM   6050 C  CB    . GLU E 2 80  ? 64.867  -29.150 45.246  1.00 69.44  ? 523  GLU E CB    1 
ATOM   6051 C  CG    . GLU E 2 80  ? 63.597  -28.729 44.515  1.00 80.50  ? 523  GLU E CG    1 
ATOM   6052 C  CD    . GLU E 2 80  ? 63.049  -27.371 44.944  1.00 81.42  ? 523  GLU E CD    1 
ATOM   6053 O  OE1   . GLU E 2 80  ? 62.950  -27.127 46.170  1.00 75.99  ? 523  GLU E OE1   1 
ATOM   6054 O  OE2   . GLU E 2 80  ? 62.715  -26.550 44.044  1.00 89.75  ? 523  GLU E OE2   1 
ATOM   6055 N  N     . VAL E 2 81  ? 67.168  -31.892 45.162  1.00 57.75  ? 524  VAL E N     1 
ATOM   6056 C  CA    . VAL E 2 81  ? 68.188  -32.527 45.992  1.00 53.44  ? 524  VAL E CA    1 
ATOM   6057 C  C     . VAL E 2 81  ? 69.564  -32.018 45.585  1.00 51.50  ? 524  VAL E C     1 
ATOM   6058 O  O     . VAL E 2 81  ? 69.863  -31.973 44.406  1.00 52.51  ? 524  VAL E O     1 
ATOM   6059 C  CB    . VAL E 2 81  ? 68.156  -34.058 45.847  1.00 53.50  ? 524  VAL E CB    1 
ATOM   6060 C  CG1   . VAL E 2 81  ? 69.325  -34.698 46.577  1.00 57.41  ? 524  VAL E CG1   1 
ATOM   6061 C  CG2   . VAL E 2 81  ? 66.857  -34.615 46.394  1.00 53.29  ? 524  VAL E CG2   1 
ATOM   6062 N  N     . GLN E 2 82  ? 70.394  -31.654 46.557  1.00 55.23  ? 525  GLN E N     1 
ATOM   6063 C  CA    . GLN E 2 82  ? 71.756  -31.172 46.281  1.00 59.08  ? 525  GLN E CA    1 
ATOM   6064 C  C     . GLN E 2 82  ? 72.797  -32.223 46.610  1.00 62.88  ? 525  GLN E C     1 
ATOM   6065 O  O     . GLN E 2 82  ? 72.775  -32.816 47.703  1.00 66.47  ? 525  GLN E O     1 
ATOM   6066 C  CB    . GLN E 2 82  ? 72.053  -29.932 47.091  1.00 61.72  ? 525  GLN E CB    1 
ATOM   6067 C  CG    . GLN E 2 82  ? 71.058  -28.827 46.864  1.00 65.66  ? 525  GLN E CG    1 
ATOM   6068 C  CD    . GLN E 2 82  ? 71.506  -27.522 47.474  1.00 64.68  ? 525  GLN E CD    1 
ATOM   6069 O  OE1   . GLN E 2 82  ? 71.172  -27.216 48.610  1.00 61.39  ? 525  GLN E OE1   1 
ATOM   6070 N  NE2   . GLN E 2 82  ? 72.255  -26.743 46.715  1.00 69.31  ? 525  GLN E NE2   1 
ATOM   6071 N  N     . ASP E 2 83  ? 73.703  -32.457 45.665  1.00 62.39  ? 526  ASP E N     1 
ATOM   6072 C  CA    . ASP E 2 83  ? 74.754  -33.455 45.858  1.00 63.92  ? 526  ASP E CA    1 
ATOM   6073 C  C     . ASP E 2 83  ? 75.831  -32.859 46.742  1.00 62.05  ? 526  ASP E C     1 
ATOM   6074 O  O     . ASP E 2 83  ? 75.683  -31.731 47.222  1.00 60.49  ? 526  ASP E O     1 
ATOM   6075 C  CB    . ASP E 2 83  ? 75.310  -33.961 44.512  1.00 68.06  ? 526  ASP E CB    1 
ATOM   6076 C  CG    . ASP E 2 83  ? 75.960  -32.856 43.659  1.00 72.14  ? 526  ASP E CG    1 
ATOM   6077 O  OD1   . ASP E 2 83  ? 76.271  -31.752 44.176  1.00 68.00  ? 526  ASP E OD1   1 
ATOM   6078 O  OD2   . ASP E 2 83  ? 76.154  -33.118 42.453  1.00 72.51  ? 526  ASP E OD2   1 
ATOM   6079 N  N     . ASN E 2 84  ? 76.913  -33.600 46.959  1.00 60.20  ? 527  ASN E N     1 
ATOM   6080 C  CA    . ASN E 2 84  ? 78.035  -33.081 47.751  1.00 59.37  ? 527  ASN E CA    1 
ATOM   6081 C  C     . ASN E 2 84  ? 78.662  -31.776 47.310  1.00 56.94  ? 527  ASN E C     1 
ATOM   6082 O  O     . ASN E 2 84  ? 79.326  -31.164 48.116  1.00 59.86  ? 527  ASN E O     1 
ATOM   6083 C  CB    . ASN E 2 84  ? 79.133  -34.127 47.933  1.00 63.07  ? 527  ASN E CB    1 
ATOM   6084 C  CG    . ASN E 2 84  ? 79.800  -34.554 46.634  1.00 67.98  ? 527  ASN E CG    1 
ATOM   6085 O  OD1   . ASN E 2 84  ? 80.759  -35.319 46.684  1.00 68.13  ? 527  ASN E OD1   1 
ATOM   6086 N  ND2   . ASN E 2 84  ? 79.344  -34.047 45.476  1.00 67.91  ? 527  ASN E ND2   1 
ATOM   6087 N  N     . ASN E 2 85  ? 78.419  -31.333 46.076  1.00 55.52  ? 528  ASN E N     1 
ATOM   6088 C  CA    . ASN E 2 85  ? 78.863  -30.029 45.595  1.00 55.71  ? 528  ASN E CA    1 
ATOM   6089 C  C     . ASN E 2 85  ? 77.761  -28.996 45.528  1.00 55.95  ? 528  ASN E C     1 
ATOM   6090 O  O     . ASN E 2 85  ? 77.973  -27.878 45.025  1.00 54.22  ? 528  ASN E O     1 
ATOM   6091 C  CB    . ASN E 2 85  ? 79.415  -30.170 44.194  1.00 61.15  ? 528  ASN E CB    1 
ATOM   6092 C  CG    . ASN E 2 85  ? 80.573  -31.115 44.136  1.00 66.08  ? 528  ASN E CG    1 
ATOM   6093 O  OD1   . ASN E 2 85  ? 80.571  -32.073 43.370  1.00 69.12  ? 528  ASN E OD1   1 
ATOM   6094 N  ND2   . ASN E 2 85  ? 81.575  -30.856 44.955  1.00 71.62  ? 528  ASN E ND2   1 
ATOM   6095 N  N     . GLY E 2 86  ? 76.592  -29.369 46.026  1.00 57.48  ? 529  GLY E N     1 
ATOM   6096 C  CA    . GLY E 2 86  ? 75.465  -28.470 46.101  1.00 60.29  ? 529  GLY E CA    1 
ATOM   6097 C  C     . GLY E 2 86  ? 74.676  -28.416 44.816  1.00 60.61  ? 529  GLY E C     1 
ATOM   6098 O  O     . GLY E 2 86  ? 73.922  -27.465 44.597  1.00 61.74  ? 529  GLY E O     1 
ATOM   6099 N  N     . ASN E 2 87  ? 74.872  -29.394 43.939  1.00 59.51  ? 530  ASN E N     1 
ATOM   6100 C  CA    . ASN E 2 87  ? 74.256  -29.337 42.603  1.00 61.66  ? 530  ASN E CA    1 
ATOM   6101 C  C     . ASN E 2 87  ? 72.990  -30.143 42.548  1.00 59.61  ? 530  ASN E C     1 
ATOM   6102 O  O     . ASN E 2 87  ? 72.974  -31.298 42.964  1.00 60.45  ? 530  ASN E O     1 
ATOM   6103 C  CB    . ASN E 2 87  ? 75.195  -29.868 41.532  1.00 61.49  ? 530  ASN E CB    1 
ATOM   6104 C  CG    . ASN E 2 87  ? 76.279  -28.879 41.165  1.00 57.60  ? 530  ASN E CG    1 
ATOM   6105 O  OD1   . ASN E 2 87  ? 76.072  -27.646 41.112  1.00 52.67  ? 530  ASN E OD1   1 
ATOM   6106 N  ND2   . ASN E 2 87  ? 77.461  -29.415 40.934  1.00 52.89  ? 530  ASN E ND2   1 
ATOM   6107 N  N     . THR E 2 88  ? 71.941  -29.510 42.034  1.00 58.06  ? 531  THR E N     1 
ATOM   6108 C  CA    . THR E 2 88  ? 70.714  -30.185 41.686  1.00 57.03  ? 531  THR E CA    1 
ATOM   6109 C  C     . THR E 2 88  ? 70.872  -30.894 40.366  1.00 59.01  ? 531  THR E C     1 
ATOM   6110 O  O     . THR E 2 88  ? 71.798  -30.606 39.595  1.00 60.43  ? 531  THR E O     1 
ATOM   6111 C  CB    . THR E 2 88  ? 69.556  -29.191 41.536  1.00 58.06  ? 531  THR E CB    1 
ATOM   6112 O  OG1   . THR E 2 88  ? 69.801  -28.344 40.421  1.00 60.92  ? 531  THR E OG1   1 
ATOM   6113 C  CG2   . THR E 2 88  ? 69.408  -28.327 42.759  1.00 57.97  ? 531  THR E CG2   1 
ATOM   6114 N  N     . PRO E 2 89  ? 69.934  -31.790 40.051  1.00 57.46  ? 532  PRO E N     1 
ATOM   6115 C  CA    . PRO E 2 89  ? 70.016  -32.333 38.714  1.00 61.58  ? 532  PRO E CA    1 
ATOM   6116 C  C     . PRO E 2 89  ? 69.989  -31.239 37.652  1.00 65.51  ? 532  PRO E C     1 
ATOM   6117 O  O     . PRO E 2 89  ? 70.623  -31.392 36.607  1.00 69.80  ? 532  PRO E O     1 
ATOM   6118 C  CB    . PRO E 2 89  ? 68.784  -33.232 38.627  1.00 61.95  ? 532  PRO E CB    1 
ATOM   6119 C  CG    . PRO E 2 89  ? 68.534  -33.624 40.030  1.00 60.99  ? 532  PRO E CG    1 
ATOM   6120 C  CD    . PRO E 2 89  ? 68.810  -32.360 40.791  1.00 57.79  ? 532  PRO E CD    1 
ATOM   6121 N  N     . LEU E 2 90  ? 69.303  -30.129 37.918  1.00 63.71  ? 533  LEU E N     1 
ATOM   6122 C  CA    . LEU E 2 90  ? 69.328  -29.017 36.965  1.00 61.92  ? 533  LEU E CA    1 
ATOM   6123 C  C     . LEU E 2 90  ? 70.718  -28.462 36.735  1.00 60.49  ? 533  LEU E C     1 
ATOM   6124 O  O     . LEU E 2 90  ? 71.122  -28.282 35.603  1.00 57.60  ? 533  LEU E O     1 
ATOM   6125 C  CB    . LEU E 2 90  ? 68.370  -27.906 37.371  1.00 61.80  ? 533  LEU E CB    1 
ATOM   6126 C  CG    . LEU E 2 90  ? 68.294  -26.743 36.392  1.00 61.03  ? 533  LEU E CG    1 
ATOM   6127 C  CD1   . LEU E 2 90  ? 67.915  -27.230 35.014  1.00 64.39  ? 533  LEU E CD1   1 
ATOM   6128 C  CD2   . LEU E 2 90  ? 67.268  -25.728 36.854  1.00 62.16  ? 533  LEU E CD2   1 
ATOM   6129 N  N     . HIS E 2 91  ? 71.449  -28.217 37.813  1.00 64.83  ? 534  HIS E N     1 
ATOM   6130 C  CA    . HIS E 2 91  ? 72.828  -27.758 37.702  1.00 62.65  ? 534  HIS E CA    1 
ATOM   6131 C  C     . HIS E 2 91  ? 73.655  -28.699 36.869  1.00 61.63  ? 534  HIS E C     1 
ATOM   6132 O  O     . HIS E 2 91  ? 74.530  -28.254 36.147  1.00 62.61  ? 534  HIS E O     1 
ATOM   6133 C  CB    . HIS E 2 91  ? 73.518  -27.665 39.063  1.00 65.92  ? 534  HIS E CB    1 
ATOM   6134 C  CG    . HIS E 2 91  ? 72.985  -26.582 39.936  1.00 63.38  ? 534  HIS E CG    1 
ATOM   6135 N  ND1   . HIS E 2 91  ? 73.729  -25.489 40.325  1.00 65.28  ? 534  HIS E ND1   1 
ATOM   6136 C  CD2   . HIS E 2 91  ? 71.772  -26.433 40.504  1.00 63.10  ? 534  HIS E CD2   1 
ATOM   6137 C  CE1   . HIS E 2 91  ? 72.990  -24.717 41.101  1.00 67.14  ? 534  HIS E CE1   1 
ATOM   6138 N  NE2   . HIS E 2 91  ? 71.797  -25.269 41.225  1.00 65.68  ? 534  HIS E NE2   1 
ATOM   6139 N  N     . LEU E 2 92  ? 73.427  -30.003 36.994  1.00 60.87  ? 535  LEU E N     1 
ATOM   6140 C  CA    . LEU E 2 92  ? 74.228  -30.945 36.212  1.00 63.45  ? 535  LEU E CA    1 
ATOM   6141 C  C     . LEU E 2 92  ? 73.885  -30.841 34.731  1.00 71.45  ? 535  LEU E C     1 
ATOM   6142 O  O     . LEU E 2 92  ? 74.779  -30.630 33.891  1.00 66.33  ? 535  LEU E O     1 
ATOM   6143 C  CB    . LEU E 2 92  ? 74.045  -32.374 36.697  1.00 59.46  ? 535  LEU E CB    1 
ATOM   6144 C  CG    . LEU E 2 92  ? 74.548  -32.619 38.110  1.00 58.97  ? 535  LEU E CG    1 
ATOM   6145 C  CD1   . LEU E 2 92  ? 74.624  -34.100 38.384  1.00 57.77  ? 535  LEU E CD1   1 
ATOM   6146 C  CD2   . LEU E 2 92  ? 75.911  -31.983 38.332  1.00 60.63  ? 535  LEU E CD2   1 
ATOM   6147 N  N     . ALA E 2 93  ? 72.587  -30.938 34.425  1.00 74.62  ? 536  ALA E N     1 
ATOM   6148 C  CA    . ALA E 2 93  ? 72.085  -30.733 33.064  1.00 76.65  ? 536  ALA E CA    1 
ATOM   6149 C  C     . ALA E 2 93  ? 72.601  -29.441 32.413  1.00 79.23  ? 536  ALA E C     1 
ATOM   6150 O  O     . ALA E 2 93  ? 72.881  -29.425 31.223  1.00 76.19  ? 536  ALA E O     1 
ATOM   6151 C  CB    . ALA E 2 93  ? 70.564  -30.756 33.043  1.00 76.93  ? 536  ALA E CB    1 
ATOM   6152 N  N     . CYS E 2 94  ? 72.727  -28.369 33.185  1.00 78.40  ? 537  CYS E N     1 
ATOM   6153 C  CA    . CYS E 2 94  ? 73.257  -27.132 32.641  1.00 76.03  ? 537  CYS E CA    1 
ATOM   6154 C  C     . CYS E 2 94  ? 74.745  -27.207 32.372  1.00 77.70  ? 537  CYS E C     1 
ATOM   6155 O  O     . CYS E 2 94  ? 75.185  -26.632 31.389  1.00 87.04  ? 537  CYS E O     1 
ATOM   6156 C  CB    . CYS E 2 94  ? 72.958  -25.944 33.548  1.00 77.89  ? 537  CYS E CB    1 
ATOM   6157 S  SG    . CYS E 2 94  ? 71.209  -25.489 33.560  1.00 85.05  ? 537  CYS E SG    1 
ATOM   6158 N  N     . THR E 2 95  ? 75.532  -27.854 33.231  1.00 72.05  ? 538  THR E N     1 
ATOM   6159 C  CA    . THR E 2 95  ? 76.986  -27.856 33.017  1.00 74.38  ? 538  THR E CA    1 
ATOM   6160 C  C     . THR E 2 95  ? 77.349  -28.712 31.817  1.00 75.25  ? 538  THR E C     1 
ATOM   6161 O  O     . THR E 2 95  ? 78.428  -28.545 31.243  1.00 81.07  ? 538  THR E O     1 
ATOM   6162 C  CB    . THR E 2 95  ? 77.806  -28.446 34.172  1.00 75.29  ? 538  THR E CB    1 
ATOM   6163 O  OG1   . THR E 2 95  ? 77.515  -29.840 34.265  1.00 91.52  ? 538  THR E OG1   1 
ATOM   6164 C  CG2   . THR E 2 95  ? 77.551  -27.743 35.519  1.00 72.04  ? 538  THR E CG2   1 
ATOM   6165 N  N     . TYR E 2 96  ? 76.483  -29.655 31.455  1.00 76.62  ? 539  TYR E N     1 
ATOM   6166 C  CA    . TYR E 2 96  ? 76.755  -30.522 30.296  1.00 82.36  ? 539  TYR E CA    1 
ATOM   6167 C  C     . TYR E 2 96  ? 75.893  -30.220 29.074  1.00 84.85  ? 539  TYR E C     1 
ATOM   6168 O  O     . TYR E 2 96  ? 75.791  -31.043 28.155  1.00 89.54  ? 539  TYR E O     1 
ATOM   6169 C  CB    . TYR E 2 96  ? 76.637  -31.989 30.717  1.00 83.13  ? 539  TYR E CB    1 
ATOM   6170 C  CG    . TYR E 2 96  ? 77.637  -32.366 31.778  1.00 89.48  ? 539  TYR E CG    1 
ATOM   6171 C  CD1   . TYR E 2 96  ? 78.805  -31.600 31.971  1.00 96.98  ? 539  TYR E CD1   1 
ATOM   6172 C  CD2   . TYR E 2 96  ? 77.442  -33.474 32.588  1.00 84.15  ? 539  TYR E CD2   1 
ATOM   6173 C  CE1   . TYR E 2 96  ? 79.733  -31.923 32.929  1.00 94.35  ? 539  TYR E CE1   1 
ATOM   6174 C  CE2   . TYR E 2 96  ? 78.384  -33.803 33.547  1.00 89.29  ? 539  TYR E CE2   1 
ATOM   6175 C  CZ    . TYR E 2 96  ? 79.516  -33.022 33.712  1.00 92.39  ? 539  TYR E CZ    1 
ATOM   6176 O  OH    . TYR E 2 96  ? 80.446  -33.341 34.665  1.00 93.70  ? 539  TYR E OH    1 
ATOM   6177 N  N     . GLY E 2 97  ? 75.287  -29.034 29.076  1.00 79.70  ? 540  GLY E N     1 
ATOM   6178 C  CA    . GLY E 2 97  ? 74.313  -28.623 28.065  1.00 78.23  ? 540  GLY E CA    1 
ATOM   6179 C  C     . GLY E 2 97  ? 73.373  -29.686 27.512  1.00 70.91  ? 540  GLY E C     1 
ATOM   6180 O  O     . GLY E 2 97  ? 73.255  -29.814 26.308  1.00 86.98  ? 540  GLY E O     1 
ATOM   6181 N  N     . HIS E 2 98  ? 72.669  -30.419 28.361  1.00 63.05  ? 541  HIS E N     1 
ATOM   6182 C  CA    . HIS E 2 98  ? 71.552  -31.204 27.880  1.00 62.26  ? 541  HIS E CA    1 
ATOM   6183 C  C     . HIS E 2 98  ? 70.278  -30.387 27.921  1.00 64.38  ? 541  HIS E C     1 
ATOM   6184 O  O     . HIS E 2 98  ? 69.477  -30.485 28.864  1.00 65.88  ? 541  HIS E O     1 
ATOM   6185 C  CB    . HIS E 2 98  ? 71.381  -32.487 28.670  1.00 67.51  ? 541  HIS E CB    1 
ATOM   6186 C  CG    . HIS E 2 98  ? 72.597  -33.350 28.686  1.00 77.27  ? 541  HIS E CG    1 
ATOM   6187 N  ND1   . HIS E 2 98  ? 73.752  -33.003 29.350  1.00 84.84  ? 541  HIS E ND1   1 
ATOM   6188 C  CD2   . HIS E 2 98  ? 72.842  -34.545 28.109  1.00 80.03  ? 541  HIS E CD2   1 
ATOM   6189 C  CE1   . HIS E 2 98  ? 74.655  -33.952 29.183  1.00 85.99  ? 541  HIS E CE1   1 
ATOM   6190 N  NE2   . HIS E 2 98  ? 74.121  -34.906 28.448  1.00 82.75  ? 541  HIS E NE2   1 
ATOM   6191 N  N     . GLU E 2 99  ? 70.096  -29.571 26.888  1.00 63.46  ? 542  GLU E N     1 
ATOM   6192 C  CA    . GLU E 2 99  ? 68.962  -28.675 26.812  1.00 68.85  ? 542  GLU E CA    1 
ATOM   6193 C  C     . GLU E 2 99  ? 67.653  -29.443 26.918  1.00 65.25  ? 542  GLU E C     1 
ATOM   6194 O  O     . GLU E 2 99  ? 66.720  -28.982 27.573  1.00 63.52  ? 542  GLU E O     1 
ATOM   6195 C  CB    . GLU E 2 99  ? 69.029  -27.889 25.517  1.00 79.96  ? 542  GLU E CB    1 
ATOM   6196 C  CG    . GLU E 2 99  ? 68.092  -26.692 25.406  1.00 88.25  ? 542  GLU E CG    1 
ATOM   6197 C  CD    . GLU E 2 99  ? 68.081  -26.123 23.988  1.00 94.31  ? 542  GLU E CD    1 
ATOM   6198 O  OE1   . GLU E 2 99  ? 69.114  -26.253 23.282  1.00 93.32  ? 542  GLU E OE1   1 
ATOM   6199 O  OE2   . GLU E 2 99  ? 67.047  -25.552 23.577  1.00 91.16  ? 542  GLU E OE2   1 
ATOM   6200 N  N     . ASP E 2 100 ? 67.585  -30.627 26.314  1.00 65.85  ? 543  ASP E N     1 
ATOM   6201 C  CA    . ASP E 2 100 ? 66.342  -31.417 26.370  1.00 70.13  ? 543  ASP E CA    1 
ATOM   6202 C  C     . ASP E 2 100 ? 65.947  -31.784 27.818  1.00 72.17  ? 543  ASP E C     1 
ATOM   6203 O  O     . ASP E 2 100 ? 64.751  -31.821 28.166  1.00 61.78  ? 543  ASP E O     1 
ATOM   6204 C  CB    . ASP E 2 100 ? 66.406  -32.655 25.452  1.00 73.83  ? 543  ASP E CB    1 
ATOM   6205 C  CG    . ASP E 2 100 ? 67.542  -33.623 25.799  1.00 80.27  ? 543  ASP E CG    1 
ATOM   6206 O  OD1   . ASP E 2 100 ? 68.594  -33.197 26.330  1.00 82.11  ? 543  ASP E OD1   1 
ATOM   6207 O  OD2   . ASP E 2 100 ? 67.370  -34.836 25.530  1.00 83.16  ? 543  ASP E OD2   1 
ATOM   6208 N  N     . CYS E 2 101 ? 66.963  -32.003 28.660  1.00 74.01  ? 544  CYS E N     1 
ATOM   6209 C  CA    . CYS E 2 101 ? 66.769  -32.372 30.069  1.00 68.80  ? 544  CYS E CA    1 
ATOM   6210 C  C     . CYS E 2 101 ? 66.457  -31.145 30.909  1.00 66.78  ? 544  CYS E C     1 
ATOM   6211 O  O     . CYS E 2 101 ? 65.545  -31.163 31.747  1.00 66.24  ? 544  CYS E O     1 
ATOM   6212 C  CB    . CYS E 2 101 ? 68.004  -33.095 30.617  1.00 67.96  ? 544  CYS E CB    1 
ATOM   6213 S  SG    . CYS E 2 101 ? 68.059  -34.854 30.180  1.00 71.69  ? 544  CYS E SG    1 
ATOM   6214 N  N     . VAL E 2 102 ? 67.215  -30.078 30.676  1.00 58.61  ? 545  VAL E N     1 
ATOM   6215 C  CA    . VAL E 2 102 ? 66.939  -28.798 31.300  1.00 54.76  ? 545  VAL E CA    1 
ATOM   6216 C  C     . VAL E 2 102 ? 65.461  -28.495 31.182  1.00 58.95  ? 545  VAL E C     1 
ATOM   6217 O  O     . VAL E 2 102 ? 64.769  -28.296 32.185  1.00 62.32  ? 545  VAL E O     1 
ATOM   6218 C  CB    . VAL E 2 102 ? 67.735  -27.677 30.632  1.00 52.81  ? 545  VAL E CB    1 
ATOM   6219 C  CG1   . VAL E 2 102 ? 67.218  -26.308 31.065  1.00 56.52  ? 545  VAL E CG1   1 
ATOM   6220 C  CG2   . VAL E 2 102 ? 69.212  -27.820 30.958  1.00 48.52  ? 545  VAL E CG2   1 
ATOM   6221 N  N     . LYS E 2 103 ? 64.968  -28.498 29.949  1.00 62.23  ? 546  LYS E N     1 
ATOM   6222 C  CA    . LYS E 2 103 ? 63.560  -28.208 29.688  1.00 63.25  ? 546  LYS E CA    1 
ATOM   6223 C  C     . LYS E 2 103 ? 62.616  -29.111 30.460  1.00 60.86  ? 546  LYS E C     1 
ATOM   6224 O  O     . LYS E 2 103 ? 61.669  -28.645 31.095  1.00 58.00  ? 546  LYS E O     1 
ATOM   6225 C  CB    . LYS E 2 103 ? 63.257  -28.344 28.206  1.00 66.04  ? 546  LYS E CB    1 
ATOM   6226 C  CG    . LYS E 2 103 ? 63.766  -27.199 27.354  1.00 69.46  ? 546  LYS E CG    1 
ATOM   6227 C  CD    . LYS E 2 103 ? 63.438  -27.475 25.902  1.00 71.51  ? 546  LYS E CD    1 
ATOM   6228 C  CE    . LYS E 2 103 ? 63.974  -26.400 24.985  1.00 70.85  ? 546  LYS E CE    1 
ATOM   6229 N  NZ    . LYS E 2 103 ? 64.066  -26.938 23.608  1.00 69.04  ? 546  LYS E NZ    1 
ATOM   6230 N  N     . ALA E 2 104 ? 62.860  -30.417 30.410  1.00 64.85  ? 547  ALA E N     1 
ATOM   6231 C  CA    . ALA E 2 104 ? 62.030  -31.338 31.191  1.00 65.78  ? 547  ALA E CA    1 
ATOM   6232 C  C     . ALA E 2 104 ? 61.974  -30.859 32.633  1.00 62.75  ? 547  ALA E C     1 
ATOM   6233 O  O     . ALA E 2 104 ? 60.898  -30.760 33.206  1.00 60.40  ? 547  ALA E O     1 
ATOM   6234 C  CB    . ALA E 2 104 ? 62.542  -32.761 31.116  1.00 67.44  ? 547  ALA E CB    1 
ATOM   6235 N  N     . LEU E 2 105 ? 63.123  -30.511 33.203  1.00 63.60  ? 548  LEU E N     1 
ATOM   6236 C  CA    . LEU E 2 105 ? 63.152  -30.098 34.612  1.00 65.93  ? 548  LEU E CA    1 
ATOM   6237 C  C     . LEU E 2 105 ? 62.339  -28.826 34.825  1.00 61.28  ? 548  LEU E C     1 
ATOM   6238 O  O     . LEU E 2 105 ? 61.518  -28.744 35.747  1.00 58.57  ? 548  LEU E O     1 
ATOM   6239 C  CB    . LEU E 2 105 ? 64.584  -29.907 35.124  1.00 66.00  ? 548  LEU E CB    1 
ATOM   6240 C  CG    . LEU E 2 105 ? 65.384  -31.205 35.242  1.00 64.43  ? 548  LEU E CG    1 
ATOM   6241 C  CD1   . LEU E 2 105 ? 66.877  -30.911 35.315  1.00 63.98  ? 548  LEU E CD1   1 
ATOM   6242 C  CD2   . LEU E 2 105 ? 64.917  -32.020 36.443  1.00 59.86  ? 548  LEU E CD2   1 
ATOM   6243 N  N     . VAL E 2 106 ? 62.557  -27.850 33.956  1.00 55.02  ? 549  VAL E N     1 
ATOM   6244 C  CA    . VAL E 2 106 ? 61.896  -26.578 34.110  1.00 59.84  ? 549  VAL E CA    1 
ATOM   6245 C  C     . VAL E 2 106 ? 60.372  -26.725 33.949  1.00 63.66  ? 549  VAL E C     1 
ATOM   6246 O  O     . VAL E 2 106 ? 59.616  -26.170 34.742  1.00 71.71  ? 549  VAL E O     1 
ATOM   6247 C  CB    . VAL E 2 106 ? 62.447  -25.552 33.120  1.00 60.27  ? 549  VAL E CB    1 
ATOM   6248 C  CG1   . VAL E 2 106 ? 61.632  -24.285 33.201  1.00 58.38  ? 549  VAL E CG1   1 
ATOM   6249 C  CG2   . VAL E 2 106 ? 63.918  -25.264 33.412  1.00 61.11  ? 549  VAL E CG2   1 
ATOM   6250 N  N     . TYR E 2 107 ? 59.920  -27.475 32.947  1.00 60.63  ? 550  TYR E N     1 
ATOM   6251 C  CA    . TYR E 2 107 ? 58.507  -27.472 32.599  1.00 59.85  ? 550  TYR E CA    1 
ATOM   6252 C  C     . TYR E 2 107 ? 57.710  -28.583 33.243  1.00 58.20  ? 550  TYR E C     1 
ATOM   6253 O  O     . TYR E 2 107 ? 56.476  -28.561 33.192  1.00 56.68  ? 550  TYR E O     1 
ATOM   6254 C  CB    . TYR E 2 107 ? 58.310  -27.594 31.101  1.00 65.63  ? 550  TYR E CB    1 
ATOM   6255 C  CG    . TYR E 2 107 ? 58.659  -26.368 30.274  1.00 67.70  ? 550  TYR E CG    1 
ATOM   6256 C  CD1   . TYR E 2 107 ? 59.968  -26.152 29.858  1.00 71.38  ? 550  TYR E CD1   1 
ATOM   6257 C  CD2   . TYR E 2 107 ? 57.675  -25.477 29.844  1.00 66.33  ? 550  TYR E CD2   1 
ATOM   6258 C  CE1   . TYR E 2 107 ? 60.301  -25.071 29.066  1.00 70.42  ? 550  TYR E CE1   1 
ATOM   6259 C  CE2   . TYR E 2 107 ? 58.001  -24.392 29.043  1.00 68.94  ? 550  TYR E CE2   1 
ATOM   6260 C  CZ    . TYR E 2 107 ? 59.318  -24.197 28.663  1.00 68.70  ? 550  TYR E CZ    1 
ATOM   6261 O  OH    . TYR E 2 107 ? 59.670  -23.143 27.882  1.00 67.05  ? 550  TYR E OH    1 
ATOM   6262 N  N     . TYR E 2 108 ? 58.376  -29.587 33.806  1.00 63.58  ? 551  TYR E N     1 
ATOM   6263 C  CA    . TYR E 2 108 ? 57.631  -30.744 34.321  1.00 64.75  ? 551  TYR E CA    1 
ATOM   6264 C  C     . TYR E 2 108 ? 56.688  -30.202 35.357  1.00 74.13  ? 551  TYR E C     1 
ATOM   6265 O  O     . TYR E 2 108 ? 55.474  -30.492 35.331  1.00 70.30  ? 551  TYR E O     1 
ATOM   6266 C  CB    . TYR E 2 108 ? 58.518  -31.819 34.954  1.00 56.32  ? 551  TYR E CB    1 
ATOM   6267 C  CG    . TYR E 2 108 ? 57.684  -32.968 35.447  1.00 55.26  ? 551  TYR E CG    1 
ATOM   6268 C  CD1   . TYR E 2 108 ? 57.139  -33.874 34.558  1.00 55.63  ? 551  TYR E CD1   1 
ATOM   6269 C  CD2   . TYR E 2 108 ? 57.371  -33.114 36.791  1.00 51.78  ? 551  TYR E CD2   1 
ATOM   6270 C  CE1   . TYR E 2 108 ? 56.332  -34.910 34.993  1.00 54.60  ? 551  TYR E CE1   1 
ATOM   6271 C  CE2   . TYR E 2 108 ? 56.570  -34.149 37.230  1.00 49.85  ? 551  TYR E CE2   1 
ATOM   6272 C  CZ    . TYR E 2 108 ? 56.045  -35.033 36.322  1.00 53.09  ? 551  TYR E CZ    1 
ATOM   6273 O  OH    . TYR E 2 108 ? 55.218  -36.067 36.714  1.00 60.42  ? 551  TYR E OH    1 
ATOM   6274 N  N     . ASP E 2 109 ? 57.276  -29.337 36.198  1.00 90.17  ? 552  ASP E N     1 
ATOM   6275 C  CA    . ASP E 2 109 ? 57.026  -29.270 37.636  1.00 101.52 ? 552  ASP E CA    1 
ATOM   6276 C  C     . ASP E 2 109 ? 55.609  -28.724 37.804  1.00 102.87 ? 552  ASP E C     1 
ATOM   6277 O  O     . ASP E 2 109 ? 55.033  -28.835 38.889  1.00 85.86  ? 552  ASP E O     1 
ATOM   6278 C  CB    . ASP E 2 109 ? 58.100  -28.367 38.343  1.00 106.15 ? 552  ASP E CB    1 
ATOM   6279 C  CG    . ASP E 2 109 ? 59.417  -29.156 38.820  1.00 118.72 ? 552  ASP E CG    1 
ATOM   6280 O  OD1   . ASP E 2 109 ? 59.760  -30.223 38.229  1.00 102.08 ? 552  ASP E OD1   1 
ATOM   6281 O  OD2   . ASP E 2 109 ? 60.135  -28.685 39.783  1.00 113.62 ? 552  ASP E OD2   1 
ATOM   6282 N  N     . VAL E 2 110 ? 55.076  -28.204 36.677  1.00 127.78 ? 553  VAL E N     1 
ATOM   6283 C  CA    . VAL E 2 110 ? 53.916  -27.287 36.548  1.00 144.90 ? 553  VAL E CA    1 
ATOM   6284 C  C     . VAL E 2 110 ? 54.169  -26.085 37.424  1.00 149.37 ? 553  VAL E C     1 
ATOM   6285 O  O     . VAL E 2 110 ? 53.428  -25.787 38.378  1.00 136.09 ? 553  VAL E O     1 
ATOM   6286 C  CB    . VAL E 2 110 ? 52.530  -27.941 36.729  1.00 143.74 ? 553  VAL E CB    1 
ATOM   6287 C  CG1   . VAL E 2 110 ? 51.417  -26.980 36.335  1.00 126.03 ? 553  VAL E CG1   1 
ATOM   6288 C  CG2   . VAL E 2 110 ? 52.428  -29.186 35.860  1.00 144.08 ? 553  VAL E CG2   1 
ATOM   6289 N  N     . GLU E 2 111 ? 55.283  -25.440 37.071  1.00 147.29 ? 554  GLU E N     1 
ATOM   6290 C  CA    . GLU E 2 111 ? 55.667  -24.134 37.573  1.00 144.90 ? 554  GLU E CA    1 
ATOM   6291 C  C     . GLU E 2 111 ? 56.536  -24.236 38.798  1.00 134.10 ? 554  GLU E C     1 
ATOM   6292 O  O     . GLU E 2 111 ? 57.427  -23.416 38.963  1.00 128.31 ? 554  GLU E O     1 
ATOM   6293 C  CB    . GLU E 2 111 ? 54.455  -23.214 37.841  1.00 153.18 ? 554  GLU E CB    1 
ATOM   6294 C  CG    . GLU E 2 111 ? 53.863  -23.168 39.242  1.00 150.61 ? 554  GLU E CG    1 
ATOM   6295 C  CD    . GLU E 2 111 ? 53.032  -21.918 39.471  1.00 153.38 ? 554  GLU E CD    1 
ATOM   6296 O  OE1   . GLU E 2 111 ? 53.606  -20.808 39.517  1.00 152.28 ? 554  GLU E OE1   1 
ATOM   6297 O  OE2   . GLU E 2 111 ? 51.797  -22.039 39.596  1.00 150.40 ? 554  GLU E OE2   1 
ATOM   6298 N  N     . SER E 2 112 ? 56.285  -25.216 39.664  1.00 131.79 ? 555  SER E N     1 
ATOM   6299 C  CA    . SER E 2 112 ? 56.923  -25.237 40.973  1.00 129.35 ? 555  SER E CA    1 
ATOM   6300 C  C     . SER E 2 112 ? 58.429  -25.612 40.832  1.00 137.84 ? 555  SER E C     1 
ATOM   6301 O  O     . SER E 2 112 ? 58.917  -26.539 41.484  1.00 143.04 ? 555  SER E O     1 
ATOM   6302 C  CB    . SER E 2 112 ? 56.135  -26.148 41.938  1.00 118.01 ? 555  SER E CB    1 
ATOM   6303 O  OG    . SER E 2 112 ? 56.854  -27.313 42.281  1.00 114.81 ? 555  SER E OG    1 
ATOM   6304 N  N     . CYS E 2 113 ? 59.151  -24.874 39.973  1.00 138.64 ? 556  CYS E N     1 
ATOM   6305 C  CA    . CYS E 2 113 ? 60.596  -25.019 39.775  1.00 136.30 ? 556  CYS E CA    1 
ATOM   6306 C  C     . CYS E 2 113 ? 61.394  -23.784 40.177  1.00 123.55 ? 556  CYS E C     1 
ATOM   6307 O  O     . CYS E 2 113 ? 61.215  -22.722 39.580  1.00 112.96 ? 556  CYS E O     1 
ATOM   6308 C  CB    . CYS E 2 113 ? 60.855  -25.254 38.295  1.00 142.89 ? 556  CYS E CB    1 
ATOM   6309 S  SG    . CYS E 2 113 ? 62.607  -25.534 37.952  1.00 154.56 ? 556  CYS E SG    1 
ATOM   6310 N  N     . ARG E 2 114 ? 62.319  -23.938 41.132  1.00 109.46 ? 557  ARG E N     1 
ATOM   6311 C  CA    . ARG E 2 114 ? 63.211  -22.843 41.494  1.00 95.88  ? 557  ARG E CA    1 
ATOM   6312 C  C     . ARG E 2 114 ? 64.483  -22.830 40.660  1.00 85.84  ? 557  ARG E C     1 
ATOM   6313 O  O     . ARG E 2 114 ? 65.187  -23.834 40.566  1.00 82.71  ? 557  ARG E O     1 
ATOM   6314 C  CB    . ARG E 2 114 ? 63.583  -22.907 42.974  1.00 92.72  ? 557  ARG E CB    1 
ATOM   6315 C  CG    . ARG E 2 114 ? 62.386  -22.988 43.904  1.00 89.73  ? 557  ARG E CG    1 
ATOM   6316 C  CD    . ARG E 2 114 ? 62.675  -22.328 45.226  1.00 94.35  ? 557  ARG E CD    1 
ATOM   6317 N  NE    . ARG E 2 114 ? 63.535  -23.134 46.101  1.00 99.32  ? 557  ARG E NE    1 
ATOM   6318 C  CZ    . ARG E 2 114 ? 64.604  -22.679 46.772  1.00 91.10  ? 557  ARG E CZ    1 
ATOM   6319 N  NH1   . ARG E 2 114 ? 65.002  -21.415 46.684  1.00 83.75  ? 557  ARG E NH1   1 
ATOM   6320 N  NH2   . ARG E 2 114 ? 65.295  -23.513 47.535  1.00 92.26  ? 557  ARG E NH2   1 
ATOM   6321 N  N     . LEU E 2 115 ? 64.782  -21.660 40.109  1.00 77.93  ? 558  LEU E N     1 
ATOM   6322 C  CA    . LEU E 2 115 ? 65.968  -21.428 39.294  1.00 77.34  ? 558  LEU E CA    1 
ATOM   6323 C  C     . LEU E 2 115 ? 67.043  -20.615 40.027  1.00 76.95  ? 558  LEU E C     1 
ATOM   6324 O  O     . LEU E 2 115 ? 68.068  -20.239 39.438  1.00 78.66  ? 558  LEU E O     1 
ATOM   6325 C  CB    . LEU E 2 115 ? 65.574  -20.662 38.042  1.00 79.65  ? 558  LEU E CB    1 
ATOM   6326 C  CG    . LEU E 2 115 ? 64.335  -21.149 37.304  1.00 78.71  ? 558  LEU E CG    1 
ATOM   6327 C  CD1   . LEU E 2 115 ? 64.020  -20.218 36.152  1.00 76.39  ? 558  LEU E CD1   1 
ATOM   6328 C  CD2   . LEU E 2 115 ? 64.554  -22.558 36.795  1.00 86.72  ? 558  LEU E CD2   1 
ATOM   6329 N  N     . ASP E 2 116 ? 66.797  -20.353 41.309  1.00 72.53  ? 559  ASP E N     1 
ATOM   6330 C  CA    . ASP E 2 116 ? 67.657  -19.507 42.119  1.00 69.21  ? 559  ASP E CA    1 
ATOM   6331 C  C     . ASP E 2 116 ? 68.608  -20.319 43.028  1.00 63.32  ? 559  ASP E C     1 
ATOM   6332 O  O     . ASP E 2 116 ? 69.390  -19.740 43.757  1.00 64.30  ? 559  ASP E O     1 
ATOM   6333 C  CB    . ASP E 2 116 ? 66.796  -18.554 42.965  1.00 71.47  ? 559  ASP E CB    1 
ATOM   6334 C  CG    . ASP E 2 116 ? 66.016  -19.276 44.053  1.00 75.72  ? 559  ASP E CG    1 
ATOM   6335 O  OD1   . ASP E 2 116 ? 66.644  -19.983 44.880  1.00 91.05  ? 559  ASP E OD1   1 
ATOM   6336 O  OD2   . ASP E 2 116 ? 64.777  -19.166 44.078  1.00 75.49  ? 559  ASP E OD2   1 
ATOM   6337 N  N     . ILE E 2 117 ? 68.534  -21.645 43.016  1.00 60.13  ? 560  ILE E N     1 
ATOM   6338 C  CA    . ILE E 2 117 ? 69.287  -22.439 43.984  1.00 58.81  ? 560  ILE E CA    1 
ATOM   6339 C  C     . ILE E 2 117 ? 70.786  -22.393 43.681  1.00 59.02  ? 560  ILE E C     1 
ATOM   6340 O  O     . ILE E 2 117 ? 71.238  -22.854 42.635  1.00 57.76  ? 560  ILE E O     1 
ATOM   6341 C  CB    . ILE E 2 117 ? 68.828  -23.916 44.016  1.00 61.20  ? 560  ILE E CB    1 
ATOM   6342 C  CG1   . ILE E 2 117 ? 67.375  -24.007 44.469  1.00 67.16  ? 560  ILE E CG1   1 
ATOM   6343 C  CG2   . ILE E 2 117 ? 69.702  -24.738 44.961  1.00 59.69  ? 560  ILE E CG2   1 
ATOM   6344 C  CD1   . ILE E 2 117 ? 66.751  -25.380 44.284  1.00 74.41  ? 560  ILE E CD1   1 
ATOM   6345 N  N     . GLY E 2 118 ? 71.558  -21.904 44.638  1.00 61.68  ? 561  GLY E N     1 
ATOM   6346 C  CA    . GLY E 2 118 ? 73.003  -21.863 44.501  1.00 65.84  ? 561  GLY E CA    1 
ATOM   6347 C  C     . GLY E 2 118 ? 73.654  -23.165 44.888  1.00 66.67  ? 561  GLY E C     1 
ATOM   6348 O  O     . GLY E 2 118 ? 73.280  -23.792 45.883  1.00 71.30  ? 561  GLY E O     1 
ATOM   6349 N  N     . ASN E 2 119 ? 74.623  -23.595 44.098  1.00 67.26  ? 562  ASN E N     1 
ATOM   6350 C  CA    . ASN E 2 119 ? 75.493  -24.684 44.554  1.00 73.60  ? 562  ASN E CA    1 
ATOM   6351 C  C     . ASN E 2 119 ? 76.554  -24.271 45.573  1.00 79.08  ? 562  ASN E C     1 
ATOM   6352 O  O     . ASN E 2 119 ? 76.519  -23.141 46.077  1.00 83.28  ? 562  ASN E O     1 
ATOM   6353 C  CB    . ASN E 2 119 ? 76.135  -25.423 43.394  1.00 70.13  ? 562  ASN E CB    1 
ATOM   6354 C  CG    . ASN E 2 119 ? 77.082  -24.585 42.636  1.00 67.86  ? 562  ASN E CG    1 
ATOM   6355 O  OD1   . ASN E 2 119 ? 77.431  -23.478 43.041  1.00 72.87  ? 562  ASN E OD1   1 
ATOM   6356 N  ND2   . ASN E 2 119 ? 77.512  -25.107 41.512  1.00 70.63  ? 562  ASN E ND2   1 
ATOM   6357 N  N     . GLU E 2 120 ? 77.476  -25.189 45.888  1.00 85.93  ? 563  GLU E N     1 
ATOM   6358 C  CA    . GLU E 2 120 ? 78.659  -24.836 46.726  1.00 98.15  ? 563  GLU E CA    1 
ATOM   6359 C  C     . GLU E 2 120 ? 79.208  -23.446 46.405  1.00 95.47  ? 563  GLU E C     1 
ATOM   6360 O  O     . GLU E 2 120 ? 79.412  -22.661 47.313  1.00 84.77  ? 563  GLU E O     1 
ATOM   6361 C  CB    . GLU E 2 120 ? 79.811  -25.861 46.705  1.00 108.89 ? 563  GLU E CB    1 
ATOM   6362 C  CG    . GLU E 2 120 ? 80.441  -26.141 45.339  1.00 127.41 ? 563  GLU E CG    1 
ATOM   6363 C  CD    . GLU E 2 120 ? 81.678  -27.053 45.422  1.00 139.25 ? 563  GLU E CD    1 
ATOM   6364 O  OE1   . GLU E 2 120 ? 81.681  -27.973 46.274  1.00 148.32 ? 563  GLU E OE1   1 
ATOM   6365 O  OE2   . GLU E 2 120 ? 82.665  -26.863 44.646  1.00 147.32 ? 563  GLU E OE2   1 
ATOM   6366 N  N     . LYS E 2 121 ? 79.434  -23.151 45.118  1.00 93.02  ? 564  LYS E N     1 
ATOM   6367 C  CA    . LYS E 2 121 ? 80.105  -21.916 44.704  1.00 88.35  ? 564  LYS E CA    1 
ATOM   6368 C  C     . LYS E 2 121 ? 79.190  -20.713 44.577  1.00 87.83  ? 564  LYS E C     1 
ATOM   6369 O  O     . LYS E 2 121 ? 79.657  -19.634 44.217  1.00 95.70  ? 564  LYS E O     1 
ATOM   6370 C  CB    . LYS E 2 121 ? 80.835  -22.123 43.388  1.00 90.04  ? 564  LYS E CB    1 
ATOM   6371 C  CG    . LYS E 2 121 ? 82.017  -23.026 43.567  1.00 103.75 ? 564  LYS E CG    1 
ATOM   6372 C  CD    . LYS E 2 121 ? 82.845  -23.176 42.312  1.00 125.96 ? 564  LYS E CD    1 
ATOM   6373 C  CE    . LYS E 2 121 ? 83.958  -24.185 42.575  1.00 144.10 ? 564  LYS E CE    1 
ATOM   6374 N  NZ    . LYS E 2 121 ? 84.737  -24.557 41.362  1.00 157.76 ? 564  LYS E NZ    1 
ATOM   6375 N  N     . GLY E 2 122 ? 77.908  -20.886 44.890  1.00 80.14  ? 565  GLY E N     1 
ATOM   6376 C  CA    . GLY E 2 122 ? 76.930  -19.806 44.807  1.00 78.11  ? 565  GLY E CA    1 
ATOM   6377 C  C     . GLY E 2 122 ? 76.227  -19.755 43.467  1.00 79.88  ? 565  GLY E C     1 
ATOM   6378 O  O     . GLY E 2 122 ? 75.266  -18.992 43.303  1.00 75.54  ? 565  GLY E O     1 
ATOM   6379 N  N     . ASP E 2 123 ? 76.701  -20.576 42.520  1.00 82.96  ? 566  ASP E N     1 
ATOM   6380 C  CA    . ASP E 2 123 ? 76.225  -20.573 41.126  1.00 80.67  ? 566  ASP E CA    1 
ATOM   6381 C  C     . ASP E 2 123 ? 74.811  -21.108 40.973  1.00 76.07  ? 566  ASP E C     1 
ATOM   6382 O  O     . ASP E 2 123 ? 74.548  -22.269 41.309  1.00 70.24  ? 566  ASP E O     1 
ATOM   6383 C  CB    . ASP E 2 123 ? 77.127  -21.445 40.263  1.00 76.38  ? 566  ASP E CB    1 
ATOM   6384 C  CG    . ASP E 2 123 ? 78.426  -20.777 39.922  1.00 79.10  ? 566  ASP E CG    1 
ATOM   6385 O  OD1   . ASP E 2 123 ? 78.448  -19.528 39.871  1.00 75.85  ? 566  ASP E OD1   1 
ATOM   6386 O  OD2   . ASP E 2 123 ? 79.420  -21.510 39.714  1.00 81.54  ? 566  ASP E OD2   1 
ATOM   6387 N  N     . THR E 2 124 ? 73.915  -20.272 40.448  1.00 71.73  ? 567  THR E N     1 
ATOM   6388 C  CA    . THR E 2 124 ? 72.654  -20.764 39.914  1.00 72.56  ? 567  THR E CA    1 
ATOM   6389 C  C     . THR E 2 124 ? 72.900  -21.513 38.598  1.00 79.28  ? 567  THR E C     1 
ATOM   6390 O  O     . THR E 2 124 ? 74.018  -21.471 38.053  1.00 81.54  ? 567  THR E O     1 
ATOM   6391 C  CB    . THR E 2 124 ? 71.578  -19.666 39.746  1.00 68.43  ? 567  THR E CB    1 
ATOM   6392 O  OG1   . THR E 2 124 ? 71.724  -19.005 38.483  1.00 73.77  ? 567  THR E OG1   1 
ATOM   6393 C  CG2   . THR E 2 124 ? 71.630  -18.682 40.882  1.00 63.79  ? 567  THR E CG2   1 
ATOM   6394 N  N     . PRO E 2 125 ? 71.866  -22.237 38.099  1.00 77.93  ? 568  PRO E N     1 
ATOM   6395 C  CA    . PRO E 2 125 ? 72.007  -22.879 36.803  1.00 76.99  ? 568  PRO E CA    1 
ATOM   6396 C  C     . PRO E 2 125 ? 72.354  -21.893 35.697  1.00 80.91  ? 568  PRO E C     1 
ATOM   6397 O  O     . PRO E 2 125 ? 73.161  -22.218 34.826  1.00 78.66  ? 568  PRO E O     1 
ATOM   6398 C  CB    . PRO E 2 125 ? 70.629  -23.492 36.575  1.00 74.58  ? 568  PRO E CB    1 
ATOM   6399 C  CG    . PRO E 2 125 ? 70.159  -23.810 37.938  1.00 73.85  ? 568  PRO E CG    1 
ATOM   6400 C  CD    . PRO E 2 125 ? 70.606  -22.636 38.753  1.00 73.84  ? 568  PRO E CD    1 
ATOM   6401 N  N     . LEU E 2 126 ? 71.783  -20.692 35.759  1.00 82.42  ? 569  LEU E N     1 
ATOM   6402 C  CA    . LEU E 2 126 ? 72.059  -19.677 34.762  1.00 78.88  ? 569  LEU E CA    1 
ATOM   6403 C  C     . LEU E 2 126 ? 73.522  -19.241 34.726  1.00 72.89  ? 569  LEU E C     1 
ATOM   6404 O  O     . LEU E 2 126 ? 74.068  -19.007 33.646  1.00 69.29  ? 569  LEU E O     1 
ATOM   6405 C  CB    . LEU E 2 126 ? 71.180  -18.452 34.982  1.00 85.44  ? 569  LEU E CB    1 
ATOM   6406 C  CG    . LEU E 2 126 ? 71.329  -17.377 33.889  1.00 86.04  ? 569  LEU E CG    1 
ATOM   6407 C  CD1   . LEU E 2 126 ? 71.109  -17.951 32.491  1.00 84.60  ? 569  LEU E CD1   1 
ATOM   6408 C  CD2   . LEU E 2 126 ? 70.380  -16.212 34.134  1.00 85.54  ? 569  LEU E CD2   1 
ATOM   6409 N  N     . HIS E 2 127 ? 74.141  -19.129 35.898  1.00 71.22  ? 570  HIS E N     1 
ATOM   6410 C  CA    . HIS E 2 127 ? 75.577  -18.879 35.988  1.00 72.49  ? 570  HIS E CA    1 
ATOM   6411 C  C     . HIS E 2 127 ? 76.318  -19.936 35.201  1.00 70.97  ? 570  HIS E C     1 
ATOM   6412 O  O     . HIS E 2 127 ? 77.223  -19.639 34.428  1.00 75.97  ? 570  HIS E O     1 
ATOM   6413 C  CB    . HIS E 2 127 ? 76.088  -18.939 37.429  1.00 76.36  ? 570  HIS E CB    1 
ATOM   6414 C  CG    . HIS E 2 127 ? 75.608  -17.821 38.308  1.00 79.60  ? 570  HIS E CG    1 
ATOM   6415 N  ND1   . HIS E 2 127 ? 76.451  -16.865 38.838  1.00 77.28  ? 570  HIS E ND1   1 
ATOM   6416 C  CD2   . HIS E 2 127 ? 74.373  -17.523 38.768  1.00 82.43  ? 570  HIS E CD2   1 
ATOM   6417 C  CE1   . HIS E 2 127 ? 75.753  -16.020 39.575  1.00 76.95  ? 570  HIS E CE1   1 
ATOM   6418 N  NE2   . HIS E 2 127 ? 74.491  -16.402 39.554  1.00 81.61  ? 570  HIS E NE2   1 
ATOM   6419 N  N     . ILE E 2 128 ? 75.931  -21.181 35.403  1.00 70.84  ? 571  ILE E N     1 
ATOM   6420 C  CA    . ILE E 2 128 ? 76.643  -22.283 34.784  1.00 75.92  ? 571  ILE E CA    1 
ATOM   6421 C  C     . ILE E 2 128 ? 76.464  -22.250 33.276  1.00 78.32  ? 571  ILE E C     1 
ATOM   6422 O  O     . ILE E 2 128 ? 77.419  -22.439 32.530  1.00 86.50  ? 571  ILE E O     1 
ATOM   6423 C  CB    . ILE E 2 128 ? 76.174  -23.640 35.349  1.00 79.53  ? 571  ILE E CB    1 
ATOM   6424 C  CG1   . ILE E 2 128 ? 76.660  -23.789 36.794  1.00 74.72  ? 571  ILE E CG1   1 
ATOM   6425 C  CG2   . ILE E 2 128 ? 76.658  -24.800 34.477  1.00 78.26  ? 571  ILE E CG2   1 
ATOM   6426 C  CD1   . ILE E 2 128 ? 75.922  -24.839 37.586  1.00 73.16  ? 571  ILE E CD1   1 
ATOM   6427 N  N     . ALA E 2 129 ? 75.233  -22.039 32.828  1.00 84.91  ? 572  ALA E N     1 
ATOM   6428 C  CA    . ALA E 2 129 ? 74.937  -22.042 31.396  1.00 84.27  ? 572  ALA E CA    1 
ATOM   6429 C  C     . ALA E 2 129 ? 75.646  -20.897 30.692  1.00 86.99  ? 572  ALA E C     1 
ATOM   6430 O  O     . ALA E 2 129 ? 76.118  -21.060 29.567  1.00 91.87  ? 572  ALA E O     1 
ATOM   6431 C  CB    . ALA E 2 129 ? 73.449  -21.951 31.163  1.00 80.34  ? 572  ALA E CB    1 
ATOM   6432 N  N     . ALA E 2 130 ? 75.758  -19.757 31.371  1.00 90.64  ? 573  ALA E N     1 
ATOM   6433 C  CA    . ALA E 2 130 ? 76.546  -18.630 30.860  1.00 96.79  ? 573  ALA E CA    1 
ATOM   6434 C  C     . ALA E 2 130 ? 78.055  -18.948 30.746  1.00 93.26  ? 573  ALA E C     1 
ATOM   6435 O  O     . ALA E 2 130 ? 78.672  -18.696 29.703  1.00 87.48  ? 573  ALA E O     1 
ATOM   6436 C  CB    . ALA E 2 130 ? 76.316  -17.394 31.721  1.00 90.95  ? 573  ALA E CB    1 
ATOM   6437 N  N     . ARG E 2 131 ? 78.635  -19.498 31.809  1.00 91.68  ? 574  ARG E N     1 
ATOM   6438 C  CA    . ARG E 2 131 ? 80.049  -19.872 31.820  1.00 100.98 ? 574  ARG E CA    1 
ATOM   6439 C  C     . ARG E 2 131 ? 80.417  -20.739 30.619  1.00 105.58 ? 574  ARG E C     1 
ATOM   6440 O  O     . ARG E 2 131 ? 81.353  -20.419 29.882  1.00 111.76 ? 574  ARG E O     1 
ATOM   6441 C  CB    . ARG E 2 131 ? 80.405  -20.597 33.124  1.00 104.93 ? 574  ARG E CB    1 
ATOM   6442 C  CG    . ARG E 2 131 ? 81.876  -20.991 33.245  1.00 109.25 ? 574  ARG E CG    1 
ATOM   6443 C  CD    . ARG E 2 131 ? 82.377  -21.105 34.677  1.00 111.87 ? 574  ARG E CD    1 
ATOM   6444 N  NE    . ARG E 2 131 ? 81.777  -20.130 35.604  1.00 117.93 ? 574  ARG E NE    1 
ATOM   6445 C  CZ    . ARG E 2 131 ? 81.007  -20.404 36.662  1.00 121.93 ? 574  ARG E CZ    1 
ATOM   6446 N  NH1   . ARG E 2 131 ? 80.676  -21.649 36.997  1.00 124.17 ? 574  ARG E NH1   1 
ATOM   6447 N  NH2   . ARG E 2 131 ? 80.559  -19.398 37.400  1.00 124.51 ? 574  ARG E NH2   1 
ATOM   6448 N  N     . TRP E 2 132 ? 79.664  -21.815 30.409  1.00 110.29 ? 575  TRP E N     1 
ATOM   6449 C  CA    . TRP E 2 132 ? 79.960  -22.763 29.336  1.00 105.80 ? 575  TRP E CA    1 
ATOM   6450 C  C     . TRP E 2 132 ? 79.263  -22.344 28.020  1.00 100.58 ? 575  TRP E C     1 
ATOM   6451 O  O     . TRP E 2 132 ? 79.232  -23.110 27.071  1.00 95.93  ? 575  TRP E O     1 
ATOM   6452 C  CB    . TRP E 2 132 ? 79.577  -24.206 29.755  1.00 103.69 ? 575  TRP E CB    1 
ATOM   6453 C  CG    . TRP E 2 132 ? 80.556  -24.869 30.723  1.00 105.29 ? 575  TRP E CG    1 
ATOM   6454 C  CD1   . TRP E 2 132 ? 80.987  -24.359 31.903  1.00 98.19  ? 575  TRP E CD1   1 
ATOM   6455 C  CD2   . TRP E 2 132 ? 81.226  -26.158 30.571  1.00 121.02 ? 575  TRP E CD2   1 
ATOM   6456 N  NE1   . TRP E 2 132 ? 81.875  -25.223 32.498  1.00 107.10 ? 575  TRP E NE1   1 
ATOM   6457 C  CE2   . TRP E 2 132 ? 82.039  -26.337 31.704  1.00 119.25 ? 575  TRP E CE2   1 
ATOM   6458 C  CE3   . TRP E 2 132 ? 81.206  -27.177 29.590  1.00 125.61 ? 575  TRP E CE3   1 
ATOM   6459 C  CZ2   . TRP E 2 132 ? 82.835  -27.508 31.892  1.00 119.97 ? 575  TRP E CZ2   1 
ATOM   6460 C  CZ3   . TRP E 2 132 ? 82.001  -28.349 29.783  1.00 118.23 ? 575  TRP E CZ3   1 
ATOM   6461 C  CH2   . TRP E 2 132 ? 82.796  -28.492 30.923  1.00 112.28 ? 575  TRP E CH2   1 
ATOM   6462 N  N     . GLY E 2 133 ? 78.710  -21.133 27.966  1.00 99.08  ? 576  GLY E N     1 
ATOM   6463 C  CA    . GLY E 2 133 ? 77.999  -20.636 26.780  1.00 99.20  ? 576  GLY E CA    1 
ATOM   6464 C  C     . GLY E 2 133 ? 77.049  -21.592 26.056  1.00 96.90  ? 576  GLY E C     1 
ATOM   6465 O  O     . GLY E 2 133 ? 77.333  -22.006 24.941  1.00 110.53 ? 576  GLY E O     1 
ATOM   6466 N  N     . TYR E 2 134 ? 75.925  -21.944 26.673  1.00 82.12  ? 577  TYR E N     1 
ATOM   6467 C  CA    . TYR E 2 134 ? 74.963  -22.861 26.059  1.00 82.68  ? 577  TYR E CA    1 
ATOM   6468 C  C     . TYR E 2 134 ? 73.676  -22.110 25.735  1.00 84.98  ? 577  TYR E C     1 
ATOM   6469 O  O     . TYR E 2 134 ? 72.703  -22.161 26.489  1.00 77.32  ? 577  TYR E O     1 
ATOM   6470 C  CB    . TYR E 2 134 ? 74.621  -24.019 27.002  1.00 87.47  ? 577  TYR E CB    1 
ATOM   6471 C  CG    . TYR E 2 134 ? 75.695  -25.065 27.256  1.00 85.90  ? 577  TYR E CG    1 
ATOM   6472 C  CD1   . TYR E 2 134 ? 76.086  -25.952 26.272  1.00 85.28  ? 577  TYR E CD1   1 
ATOM   6473 C  CD2   . TYR E 2 134 ? 76.265  -25.207 28.518  1.00 93.28  ? 577  TYR E CD2   1 
ATOM   6474 C  CE1   . TYR E 2 134 ? 77.044  -26.928 26.522  1.00 79.62  ? 577  TYR E CE1   1 
ATOM   6475 C  CE2   . TYR E 2 134 ? 77.215  -26.181 28.777  1.00 84.77  ? 577  TYR E CE2   1 
ATOM   6476 C  CZ    . TYR E 2 134 ? 77.596  -27.041 27.776  1.00 78.12  ? 577  TYR E CZ    1 
ATOM   6477 O  OH    . TYR E 2 134 ? 78.554  -27.990 28.032  1.00 83.28  ? 577  TYR E OH    1 
ATOM   6478 N  N     . GLN E 2 135 ? 73.662  -21.413 24.609  1.00 88.71  ? 578  GLN E N     1 
ATOM   6479 C  CA    . GLN E 2 135 ? 72.576  -20.481 24.285  1.00 91.41  ? 578  GLN E CA    1 
ATOM   6480 C  C     . GLN E 2 135 ? 71.152  -21.020 24.527  1.00 94.22  ? 578  GLN E C     1 
ATOM   6481 O  O     . GLN E 2 135 ? 70.301  -20.320 25.090  1.00 89.11  ? 578  GLN E O     1 
ATOM   6482 C  CB    . GLN E 2 135 ? 72.698  -20.060 22.829  1.00 94.28  ? 578  GLN E CB    1 
ATOM   6483 C  CG    . GLN E 2 135 ? 71.549  -19.185 22.335  1.00 97.33  ? 578  GLN E CG    1 
ATOM   6484 C  CD    . GLN E 2 135 ? 71.999  -18.178 21.296  1.00 96.16  ? 578  GLN E CD    1 
ATOM   6485 O  OE1   . GLN E 2 135 ? 72.862  -18.471 20.478  1.00 97.07  ? 578  GLN E OE1   1 
ATOM   6486 N  NE2   . GLN E 2 135 ? 71.447  -16.973 21.350  1.00 99.34  ? 578  GLN E NE2   1 
ATOM   6487 N  N     . GLY E 2 136 ? 70.893  -22.246 24.076  1.00 97.92  ? 579  GLY E N     1 
ATOM   6488 C  CA    . GLY E 2 136 ? 69.538  -22.793 24.087  1.00 90.28  ? 579  GLY E CA    1 
ATOM   6489 C  C     . GLY E 2 136 ? 69.024  -22.929 25.506  1.00 88.48  ? 579  GLY E C     1 
ATOM   6490 O  O     . GLY E 2 136 ? 67.961  -22.408 25.851  1.00 84.83  ? 579  GLY E O     1 
ATOM   6491 N  N     . VAL E 2 137 ? 69.812  -23.611 26.331  1.00 88.96  ? 580  VAL E N     1 
ATOM   6492 C  CA    . VAL E 2 137 ? 69.661  -23.575 27.787  1.00 88.72  ? 580  VAL E CA    1 
ATOM   6493 C  C     . VAL E 2 137 ? 69.392  -22.151 28.311  1.00 90.13  ? 580  VAL E C     1 
ATOM   6494 O  O     . VAL E 2 137 ? 68.381  -21.876 28.970  1.00 89.56  ? 580  VAL E O     1 
ATOM   6495 C  CB    . VAL E 2 137 ? 70.933  -24.109 28.481  1.00 86.56  ? 580  VAL E CB    1 
ATOM   6496 C  CG1   . VAL E 2 137 ? 70.821  -23.931 29.988  1.00 89.09  ? 580  VAL E CG1   1 
ATOM   6497 C  CG2   . VAL E 2 137 ? 71.185  -25.579 28.135  1.00 83.59  ? 580  VAL E CG2   1 
ATOM   6498 N  N     . ILE E 2 138 ? 70.320  -21.253 28.020  1.00 86.47  ? 581  ILE E N     1 
ATOM   6499 C  CA    . ILE E 2 138 ? 70.283  -19.921 28.591  1.00 86.18  ? 581  ILE E CA    1 
ATOM   6500 C  C     . ILE E 2 138 ? 68.920  -19.283 28.319  1.00 87.04  ? 581  ILE E C     1 
ATOM   6501 O  O     . ILE E 2 138 ? 68.266  -18.752 29.224  1.00 78.09  ? 581  ILE E O     1 
ATOM   6502 C  CB    . ILE E 2 138 ? 71.425  -19.041 28.034  1.00 85.89  ? 581  ILE E CB    1 
ATOM   6503 C  CG1   . ILE E 2 138 ? 72.784  -19.562 28.505  1.00 87.32  ? 581  ILE E CG1   1 
ATOM   6504 C  CG2   . ILE E 2 138 ? 71.287  -17.608 28.522  1.00 88.73  ? 581  ILE E CG2   1 
ATOM   6505 C  CD1   . ILE E 2 138 ? 73.950  -19.142 27.642  1.00 85.87  ? 581  ILE E CD1   1 
ATOM   6506 N  N     . GLU E 2 139 ? 68.506  -19.331 27.063  1.00 83.81  ? 582  GLU E N     1 
ATOM   6507 C  CA    . GLU E 2 139 ? 67.237  -18.741 26.686  1.00 90.50  ? 582  GLU E CA    1 
ATOM   6508 C  C     . GLU E 2 139 ? 66.108  -19.385 27.500  1.00 83.82  ? 582  GLU E C     1 
ATOM   6509 O  O     . GLU E 2 139 ? 65.310  -18.670 28.118  1.00 75.10  ? 582  GLU E O     1 
ATOM   6510 C  CB    . GLU E 2 139 ? 67.009  -18.857 25.162  1.00 105.07 ? 582  GLU E CB    1 
ATOM   6511 C  CG    . GLU E 2 139 ? 67.567  -17.685 24.339  1.00 108.83 ? 582  GLU E CG    1 
ATOM   6512 C  CD    . GLU E 2 139 ? 67.752  -18.006 22.851  1.00 109.67 ? 582  GLU E CD    1 
ATOM   6513 O  OE1   . GLU E 2 139 ? 68.038  -19.174 22.479  1.00 102.74 ? 582  GLU E OE1   1 
ATOM   6514 O  OE2   . GLU E 2 139 ? 67.604  -17.072 22.031  1.00 120.01 ? 582  GLU E OE2   1 
ATOM   6515 N  N     . THR E 2 140 ? 66.054  -20.725 27.484  1.00 78.75  ? 583  THR E N     1 
ATOM   6516 C  CA    . THR E 2 140 ? 65.056  -21.515 28.235  1.00 78.80  ? 583  THR E CA    1 
ATOM   6517 C  C     . THR E 2 140 ? 64.922  -21.008 29.672  1.00 74.20  ? 583  THR E C     1 
ATOM   6518 O  O     . THR E 2 140 ? 63.812  -20.761 30.188  1.00 62.39  ? 583  THR E O     1 
ATOM   6519 C  CB    . THR E 2 140 ? 65.447  -23.024 28.280  1.00 84.71  ? 583  THR E CB    1 
ATOM   6520 O  OG1   . THR E 2 140 ? 65.796  -23.499 26.969  1.00 90.64  ? 583  THR E OG1   1 
ATOM   6521 C  CG2   . THR E 2 140 ? 64.318  -23.874 28.829  1.00 82.63  ? 583  THR E CG2   1 
ATOM   6522 N  N     . LEU E 2 141 ? 66.070  -20.873 30.323  1.00 75.24  ? 584  LEU E N     1 
ATOM   6523 C  CA    . LEU E 2 141 ? 66.103  -20.433 31.713  1.00 74.37  ? 584  LEU E CA    1 
ATOM   6524 C  C     . LEU E 2 141 ? 65.487  -19.047 31.843  1.00 75.43  ? 584  LEU E C     1 
ATOM   6525 O  O     . LEU E 2 141 ? 64.608  -18.831 32.679  1.00 65.82  ? 584  LEU E O     1 
ATOM   6526 C  CB    . LEU E 2 141 ? 67.541  -20.429 32.244  1.00 69.02  ? 584  LEU E CB    1 
ATOM   6527 C  CG    . LEU E 2 141 ? 68.124  -21.821 32.460  1.00 66.57  ? 584  LEU E CG    1 
ATOM   6528 C  CD1   . LEU E 2 141 ? 69.612  -21.757 32.778  1.00 65.16  ? 584  LEU E CD1   1 
ATOM   6529 C  CD2   . LEU E 2 141 ? 67.377  -22.543 33.568  1.00 69.49  ? 584  LEU E CD2   1 
ATOM   6530 N  N     . LEU E 2 142 ? 65.966  -18.117 31.017  1.00 77.16  ? 585  LEU E N     1 
ATOM   6531 C  CA    . LEU E 2 142 ? 65.550  -16.726 31.105  1.00 78.20  ? 585  LEU E CA    1 
ATOM   6532 C  C     . LEU E 2 142 ? 64.084  -16.606 30.825  1.00 77.57  ? 585  LEU E C     1 
ATOM   6533 O  O     . LEU E 2 142 ? 63.373  -15.872 31.509  1.00 84.76  ? 585  LEU E O     1 
ATOM   6534 C  CB    . LEU E 2 142 ? 66.313  -15.889 30.112  1.00 79.46  ? 585  LEU E CB    1 
ATOM   6535 C  CG    . LEU E 2 142 ? 67.769  -15.725 30.510  1.00 88.03  ? 585  LEU E CG    1 
ATOM   6536 C  CD1   . LEU E 2 142 ? 68.640  -15.461 29.293  1.00 89.99  ? 585  LEU E CD1   1 
ATOM   6537 C  CD2   . LEU E 2 142 ? 67.900  -14.601 31.533  1.00 89.52  ? 585  LEU E CD2   1 
ATOM   6538 N  N     . GLN E 2 143 ? 63.622  -17.361 29.841  1.00 73.80  ? 586  GLN E N     1 
ATOM   6539 C  CA    . GLN E 2 143 ? 62.220  -17.313 29.461  1.00 75.64  ? 586  GLN E CA    1 
ATOM   6540 C  C     . GLN E 2 143 ? 61.286  -17.748 30.583  1.00 74.57  ? 586  GLN E C     1 
ATOM   6541 O  O     . GLN E 2 143 ? 60.119  -17.412 30.569  1.00 75.10  ? 586  GLN E O     1 
ATOM   6542 C  CB    . GLN E 2 143 ? 61.973  -18.177 28.234  1.00 80.57  ? 586  GLN E CB    1 
ATOM   6543 C  CG    . GLN E 2 143 ? 62.502  -17.554 26.954  1.00 85.37  ? 586  GLN E CG    1 
ATOM   6544 C  CD    . GLN E 2 143 ? 62.736  -18.560 25.839  1.00 89.32  ? 586  GLN E CD    1 
ATOM   6545 O  OE1   . GLN E 2 143 ? 63.620  -18.377 25.009  1.00 90.70  ? 586  GLN E OE1   1 
ATOM   6546 N  NE2   . GLN E 2 143 ? 61.940  -19.622 25.810  1.00 90.94  ? 586  GLN E NE2   1 
ATOM   6547 N  N     . ASN E 2 144 ? 61.794  -18.519 31.534  1.00 76.99  ? 587  ASN E N     1 
ATOM   6548 C  CA    . ASN E 2 144 ? 61.006  -18.928 32.691  1.00 77.73  ? 587  ASN E CA    1 
ATOM   6549 C  C     . ASN E 2 144 ? 61.438  -18.258 33.985  1.00 77.82  ? 587  ASN E C     1 
ATOM   6550 O  O     . ASN E 2 144 ? 61.006  -18.646 35.070  1.00 69.98  ? 587  ASN E O     1 
ATOM   6551 C  CB    . ASN E 2 144 ? 61.106  -20.437 32.847  1.00 75.69  ? 587  ASN E CB    1 
ATOM   6552 C  CG    . ASN E 2 144 ? 60.352  -21.152 31.803  1.00 73.48  ? 587  ASN E CG    1 
ATOM   6553 O  OD1   . ASN E 2 144 ? 59.127  -21.259 31.893  1.00 80.32  ? 587  ASN E OD1   1 
ATOM   6554 N  ND2   . ASN E 2 144 ? 61.064  -21.668 30.802  1.00 70.82  ? 587  ASN E ND2   1 
ATOM   6555 N  N     . GLY E 2 145 ? 62.290  -17.252 33.863  1.00 80.39  ? 588  GLY E N     1 
ATOM   6556 C  CA    . GLY E 2 145 ? 62.385  -16.215 34.872  1.00 80.85  ? 588  GLY E CA    1 
ATOM   6557 C  C     . GLY E 2 145 ? 63.652  -16.295 35.683  1.00 82.21  ? 588  GLY E C     1 
ATOM   6558 O  O     . GLY E 2 145 ? 63.688  -15.787 36.797  1.00 86.48  ? 588  GLY E O     1 
ATOM   6559 N  N     . ALA E 2 146 ? 64.696  -16.919 35.139  1.00 86.66  ? 589  ALA E N     1 
ATOM   6560 C  CA    . ALA E 2 146 ? 65.994  -16.957 35.809  1.00 89.78  ? 589  ALA E CA    1 
ATOM   6561 C  C     . ALA E 2 146 ? 66.461  -15.543 36.030  1.00 92.88  ? 589  ALA E C     1 
ATOM   6562 O  O     . ALA E 2 146 ? 66.276  -14.698 35.157  1.00 87.44  ? 589  ALA E O     1 
ATOM   6563 C  CB    . ALA E 2 146 ? 67.012  -17.700 34.968  1.00 94.61  ? 589  ALA E CB    1 
ATOM   6564 N  N     . SER E 2 147 ? 67.064  -15.285 37.187  1.00 102.45 ? 590  SER E N     1 
ATOM   6565 C  CA    . SER E 2 147 ? 67.531  -13.942 37.499  1.00 101.87 ? 590  SER E CA    1 
ATOM   6566 C  C     . SER E 2 147 ? 68.940  -13.731 36.981  1.00 96.08  ? 590  SER E C     1 
ATOM   6567 O  O     . SER E 2 147 ? 69.761  -14.655 36.950  1.00 93.50  ? 590  SER E O     1 
ATOM   6568 C  CB    . SER E 2 147 ? 67.489  -13.666 38.997  1.00 100.67 ? 590  SER E CB    1 
ATOM   6569 O  OG    . SER E 2 147 ? 67.792  -12.305 39.254  1.00 96.37  ? 590  SER E OG    1 
ATOM   6570 N  N     . THR E 2 148 ? 69.188  -12.493 36.574  1.00 92.70  ? 591  THR E N     1 
ATOM   6571 C  CA    . THR E 2 148 ? 70.476  -12.057 36.042  1.00 99.41  ? 591  THR E CA    1 
ATOM   6572 C  C     . THR E 2 148 ? 71.288  -11.323 37.100  1.00 101.40 ? 591  THR E C     1 
ATOM   6573 O  O     . THR E 2 148 ? 72.462  -10.997 36.893  1.00 95.28  ? 591  THR E O     1 
ATOM   6574 C  CB    . THR E 2 148 ? 70.247  -11.112 34.850  1.00 93.68  ? 591  THR E CB    1 
ATOM   6575 O  OG1   . THR E 2 148 ? 68.890  -10.644 34.877  1.00 88.26  ? 591  THR E OG1   1 
ATOM   6576 C  CG2   . THR E 2 148 ? 70.479  -11.844 33.553  1.00 94.10  ? 591  THR E CG2   1 
ATOM   6577 N  N     . GLU E 2 149 ? 70.633  -11.053 38.225  1.00 107.68 ? 592  GLU E N     1 
ATOM   6578 C  CA    . GLU E 2 149 ? 71.193  -10.222 39.271  1.00 116.26 ? 592  GLU E CA    1 
ATOM   6579 C  C     . GLU E 2 149 ? 71.890  -11.070 40.334  1.00 121.39 ? 592  GLU E C     1 
ATOM   6580 O  O     . GLU E 2 149 ? 72.972  -10.703 40.783  1.00 145.96 ? 592  GLU E O     1 
ATOM   6581 C  CB    . GLU E 2 149 ? 70.102  -9.338  39.901  1.00 112.40 ? 592  GLU E CB    1 
ATOM   6582 C  CG    . GLU E 2 149 ? 69.787  -8.081  39.084  1.00 110.91 ? 592  GLU E CG    1 
ATOM   6583 C  CD    . GLU E 2 149 ? 68.324  -7.946  38.695  1.00 114.72 ? 592  GLU E CD    1 
ATOM   6584 O  OE1   . GLU E 2 149 ? 67.784  -8.896  38.091  1.00 120.75 ? 592  GLU E OE1   1 
ATOM   6585 O  OE2   . GLU E 2 149 ? 67.714  -6.883  38.961  1.00 115.43 ? 592  GLU E OE2   1 
ATOM   6586 N  N     . ILE E 2 150 ? 71.286  -12.195 40.731  1.00 107.63 ? 593  ILE E N     1 
ATOM   6587 C  CA    . ILE E 2 150 ? 71.893  -13.099 41.736  1.00 95.09  ? 593  ILE E CA    1 
ATOM   6588 C  C     . ILE E 2 150 ? 73.400  -13.235 41.514  1.00 94.21  ? 593  ILE E C     1 
ATOM   6589 O  O     . ILE E 2 150 ? 73.875  -13.516 40.404  1.00 92.32  ? 593  ILE E O     1 
ATOM   6590 C  CB    . ILE E 2 150 ? 71.276  -14.526 41.757  1.00 95.78  ? 593  ILE E CB    1 
ATOM   6591 C  CG1   . ILE E 2 150 ? 69.784  -14.500 42.113  1.00 98.40  ? 593  ILE E CG1   1 
ATOM   6592 C  CG2   . ILE E 2 150 ? 71.927  -15.379 42.830  1.00 86.74  ? 593  ILE E CG2   1 
ATOM   6593 C  CD1   . ILE E 2 150 ? 68.972  -15.728 41.723  1.00 99.89  ? 593  ILE E CD1   1 
ATOM   6594 N  N     . GLN E 2 151 ? 74.153  -13.026 42.581  1.00 101.04 ? 594  GLN E N     1 
ATOM   6595 C  CA    . GLN E 2 151 ? 75.594  -13.164 42.515  1.00 105.40 ? 594  GLN E CA    1 
ATOM   6596 C  C     . GLN E 2 151 ? 75.973  -14.401 43.268  1.00 104.14 ? 594  GLN E C     1 
ATOM   6597 O  O     . GLN E 2 151 ? 75.362  -14.733 44.283  1.00 115.02 ? 594  GLN E O     1 
ATOM   6598 C  CB    . GLN E 2 151 ? 76.312  -11.997 43.171  1.00 110.56 ? 594  GLN E CB    1 
ATOM   6599 C  CG    . GLN E 2 151 ? 75.602  -10.661 43.175  1.00 108.47 ? 594  GLN E CG    1 
ATOM   6600 C  CD    . GLN E 2 151 ? 76.357  -9.674  44.018  1.00 104.67 ? 594  GLN E CD    1 
ATOM   6601 O  OE1   . GLN E 2 151 ? 75.867  -9.214  45.046  1.00 105.80 ? 594  GLN E OE1   1 
ATOM   6602 N  NE2   . GLN E 2 151 ? 77.574  -9.358  43.601  1.00 106.01 ? 594  GLN E NE2   1 
ATOM   6603 N  N     . ASN E 2 152 ? 77.008  -15.062 42.791  1.00 96.02  ? 595  ASN E N     1 
ATOM   6604 C  CA    . ASN E 2 152 ? 77.529  -16.227 43.474  1.00 100.02 ? 595  ASN E CA    1 
ATOM   6605 C  C     . ASN E 2 152 ? 78.402  -15.791 44.647  1.00 99.99  ? 595  ASN E C     1 
ATOM   6606 O  O     . ASN E 2 152 ? 78.332  -14.643 45.079  1.00 99.83  ? 595  ASN E O     1 
ATOM   6607 C  CB    . ASN E 2 152 ? 78.290  -17.083 42.469  1.00 105.28 ? 595  ASN E CB    1 
ATOM   6608 C  CG    . ASN E 2 152 ? 79.494  -16.368 41.919  1.00 101.60 ? 595  ASN E CG    1 
ATOM   6609 O  OD1   . ASN E 2 152 ? 79.454  -15.154 41.795  1.00 94.30  ? 595  ASN E OD1   1 
ATOM   6610 N  ND2   . ASN E 2 152 ? 80.567  -17.093 41.603  1.00 101.72 ? 595  ASN E ND2   1 
ATOM   6611 N  N     . ARG E 2 153 ? 79.224  -16.698 45.165  1.00 102.20 ? 596  ARG E N     1 
ATOM   6612 C  CA    . ARG E 2 153 ? 80.139  -16.354 46.252  1.00 102.64 ? 596  ARG E CA    1 
ATOM   6613 C  C     . ARG E 2 153 ? 81.220  -15.337 45.822  1.00 94.20  ? 596  ARG E C     1 
ATOM   6614 O  O     . ARG E 2 153 ? 81.471  -14.372 46.539  1.00 86.93  ? 596  ARG E O     1 
ATOM   6615 C  CB    . ARG E 2 153 ? 80.759  -17.620 46.868  1.00 104.63 ? 596  ARG E CB    1 
ATOM   6616 C  CG    . ARG E 2 153 ? 79.958  -18.145 48.071  1.00 106.69 ? 596  ARG E CG    1 
ATOM   6617 C  CD    . ARG E 2 153 ? 80.784  -18.685 49.238  1.00 107.74 ? 596  ARG E CD    1 
ATOM   6618 N  NE    . ARG E 2 153 ? 81.245  -20.013 48.903  1.00 106.07 ? 596  ARG E NE    1 
ATOM   6619 C  CZ    . ARG E 2 153 ? 82.398  -20.274 48.287  1.00 109.96 ? 596  ARG E CZ    1 
ATOM   6620 N  NH1   . ARG E 2 153 ? 83.271  -19.310 47.978  1.00 110.22 ? 596  ARG E NH1   1 
ATOM   6621 N  NH2   . ARG E 2 153 ? 82.706  -21.533 48.000  1.00 112.45 ? 596  ARG E NH2   1 
ATOM   6622 N  N     . LEU E 2 154 ? 81.801  -15.509 44.638  1.00 88.69  ? 597  LEU E N     1 
ATOM   6623 C  CA    . LEU E 2 154 ? 82.727  -14.508 44.074  1.00 90.47  ? 597  LEU E CA    1 
ATOM   6624 C  C     . LEU E 2 154 ? 82.027  -13.174 43.733  1.00 98.08  ? 597  LEU E C     1 
ATOM   6625 O  O     . LEU E 2 154 ? 82.628  -12.304 43.108  1.00 97.96  ? 597  LEU E O     1 
ATOM   6626 C  CB    . LEU E 2 154 ? 83.411  -15.051 42.805  1.00 89.42  ? 597  LEU E CB    1 
ATOM   6627 C  CG    . LEU E 2 154 ? 84.275  -16.340 43.017  1.00 91.98  ? 597  LEU E CG    1 
ATOM   6628 C  CD1   . LEU E 2 154 ? 83.425  -17.618 43.054  1.00 97.86  ? 597  LEU E CD1   1 
ATOM   6629 C  CD2   . LEU E 2 154 ? 85.424  -16.511 42.003  1.00 84.44  ? 597  LEU E CD2   1 
ATOM   6630 N  N     . LYS E 2 155 ? 80.751  -13.033 44.094  1.00 108.80 ? 598  LYS E N     1 
ATOM   6631 C  CA    . LYS E 2 155 ? 79.957  -11.818 43.834  1.00 109.93 ? 598  LYS E CA    1 
ATOM   6632 C  C     . LYS E 2 155 ? 79.790  -11.433 42.342  1.00 113.52 ? 598  LYS E C     1 
ATOM   6633 O  O     . LYS E 2 155 ? 79.130  -10.426 42.048  1.00 110.99 ? 598  LYS E O     1 
ATOM   6634 C  CB    . LYS E 2 155 ? 80.491  -10.653 44.683  1.00 104.49 ? 598  LYS E CB    1 
ATOM   6635 C  CG    . LYS E 2 155 ? 80.670  -11.062 46.137  1.00 104.12 ? 598  LYS E CG    1 
ATOM   6636 C  CD    . LYS E 2 155 ? 80.368  -9.971  47.143  1.00 106.42 ? 598  LYS E CD    1 
ATOM   6637 C  CE    . LYS E 2 155 ? 79.928  -10.604 48.460  1.00 113.23 ? 598  LYS E CE    1 
ATOM   6638 N  NZ    . LYS E 2 155 ? 80.019  -9.683  49.627  1.00 119.78 ? 598  LYS E NZ    1 
ATOM   6639 N  N     . GLU E 2 156 ? 80.328  -12.252 41.420  1.00 112.86 ? 599  GLU E N     1 
ATOM   6640 C  CA    . GLU E 2 156 ? 79.997  -12.179 39.977  1.00 107.98 ? 599  GLU E CA    1 
ATOM   6641 C  C     . GLU E 2 156 ? 78.575  -12.667 39.631  1.00 106.11 ? 599  GLU E C     1 
ATOM   6642 O  O     . GLU E 2 156 ? 78.175  -13.772 40.001  1.00 107.44 ? 599  GLU E O     1 
ATOM   6643 C  CB    . GLU E 2 156 ? 81.072  -12.878 39.116  1.00 98.58  ? 599  GLU E CB    1 
ATOM   6644 C  CG    . GLU E 2 156 ? 81.212  -14.385 39.283  1.00 105.14 ? 599  GLU E CG    1 
ATOM   6645 C  CD    . GLU E 2 156 ? 82.476  -14.960 38.642  1.00 112.97 ? 599  GLU E CD    1 
ATOM   6646 O  OE1   . GLU E 2 156 ? 83.342  -14.188 38.185  1.00 110.36 ? 599  GLU E OE1   1 
ATOM   6647 O  OE2   . GLU E 2 156 ? 82.628  -16.205 38.614  1.00 126.61 ? 599  GLU E OE2   1 
ATOM   6648 N  N     . THR E 2 157 ? 77.821  -11.809 38.938  1.00 107.57 ? 600  THR E N     1 
ATOM   6649 C  CA    . THR E 2 157 ? 76.506  -12.160 38.394  1.00 108.30 ? 600  THR E CA    1 
ATOM   6650 C  C     . THR E 2 157 ? 76.674  -13.163 37.256  1.00 105.50 ? 600  THR E C     1 
ATOM   6651 O  O     . THR E 2 157 ? 77.793  -13.417 36.802  1.00 94.40  ? 600  THR E O     1 
ATOM   6652 C  CB    . THR E 2 157 ? 75.728  -10.922 37.856  1.00 108.14 ? 600  THR E CB    1 
ATOM   6653 O  OG1   . THR E 2 157 ? 76.432  -10.345 36.751  1.00 108.31 ? 600  THR E OG1   1 
ATOM   6654 C  CG2   . THR E 2 157 ? 75.514  -9.877  38.937  1.00 106.74 ? 600  THR E CG2   1 
ATOM   6655 N  N     . PRO E 2 158 ? 75.555  -13.733 36.784  1.00 112.15 ? 601  PRO E N     1 
ATOM   6656 C  CA    . PRO E 2 158 ? 75.643  -14.588 35.604  1.00 112.19 ? 601  PRO E CA    1 
ATOM   6657 C  C     . PRO E 2 158 ? 76.112  -13.830 34.353  1.00 111.97 ? 601  PRO E C     1 
ATOM   6658 O  O     . PRO E 2 158 ? 76.866  -14.385 33.540  1.00 112.35 ? 601  PRO E O     1 
ATOM   6659 C  CB    . PRO E 2 158 ? 74.210  -15.146 35.450  1.00 108.65 ? 601  PRO E CB    1 
ATOM   6660 C  CG    . PRO E 2 158 ? 73.340  -14.307 36.319  1.00 105.33 ? 601  PRO E CG    1 
ATOM   6661 C  CD    . PRO E 2 158 ? 74.219  -13.783 37.407  1.00 110.29 ? 601  PRO E CD    1 
ATOM   6662 N  N     . LEU E 2 159 ? 75.691  -12.569 34.228  1.00 111.08 ? 602  LEU E N     1 
ATOM   6663 C  CA    . LEU E 2 159 ? 76.199  -11.657 33.198  1.00 106.00 ? 602  LEU E CA    1 
ATOM   6664 C  C     . LEU E 2 159 ? 77.716  -11.749 33.096  1.00 103.03 ? 602  LEU E C     1 
ATOM   6665 O  O     . LEU E 2 159 ? 78.249  -12.095 32.045  1.00 107.49 ? 602  LEU E O     1 
ATOM   6666 C  CB    . LEU E 2 159 ? 75.783  -10.216 33.506  1.00 106.64 ? 602  LEU E CB    1 
ATOM   6667 C  CG    . LEU E 2 159 ? 74.265  -9.883  33.482  1.00 114.58 ? 602  LEU E CG    1 
ATOM   6668 C  CD1   . LEU E 2 159 ? 73.878  -8.530  34.093  1.00 116.13 ? 602  LEU E CD1   1 
ATOM   6669 C  CD2   . LEU E 2 159 ? 73.735  -9.966  32.056  1.00 108.13 ? 602  LEU E CD2   1 
ATOM   6670 N  N     . LYS E 2 160 ? 78.404  -11.486 34.200  1.00 96.36  ? 603  LYS E N     1 
ATOM   6671 C  CA    . LYS E 2 160 ? 79.863  -11.505 34.202  1.00 100.61 ? 603  LYS E CA    1 
ATOM   6672 C  C     . LYS E 2 160 ? 80.457  -12.871 33.870  1.00 98.58  ? 603  LYS E C     1 
ATOM   6673 O  O     . LYS E 2 160 ? 81.625  -12.954 33.494  1.00 95.61  ? 603  LYS E O     1 
ATOM   6674 C  CB    . LYS E 2 160 ? 80.414  -11.046 35.550  1.00 108.99 ? 603  LYS E CB    1 
ATOM   6675 C  CG    . LYS E 2 160 ? 80.131  -9.595  35.855  1.00 113.28 ? 603  LYS E CG    1 
ATOM   6676 C  CD    . LYS E 2 160 ? 80.438  -9.275  37.299  1.00 125.49 ? 603  LYS E CD    1 
ATOM   6677 C  CE    . LYS E 2 160 ? 79.382  -8.318  37.860  1.00 133.36 ? 603  LYS E CE    1 
ATOM   6678 N  NZ    . LYS E 2 160 ? 79.889  -7.485  38.985  1.00 141.83 ? 603  LYS E NZ    1 
ATOM   6679 N  N     . CYS E 2 161 ? 79.682  -13.942 34.032  1.00 102.46 ? 604  CYS E N     1 
ATOM   6680 C  CA    . CYS E 2 161 ? 80.195  -15.290 33.764  1.00 114.10 ? 604  CYS E CA    1 
ATOM   6681 C  C     . CYS E 2 161 ? 80.123  -15.668 32.289  1.00 117.43 ? 604  CYS E C     1 
ATOM   6682 O  O     . CYS E 2 161 ? 80.622  -16.730 31.901  1.00 117.18 ? 604  CYS E O     1 
ATOM   6683 C  CB    . CYS E 2 161 ? 79.452  -16.335 34.601  1.00 115.30 ? 604  CYS E CB    1 
ATOM   6684 S  SG    . CYS E 2 161 ? 79.474  -15.979 36.376  1.00 116.51 ? 604  CYS E SG    1 
ATOM   6685 N  N     . ALA E 2 162 ? 79.502  -14.810 31.480  1.00 114.52 ? 605  ALA E N     1 
ATOM   6686 C  CA    . ALA E 2 162 ? 79.280  -15.098 30.071  1.00 109.50 ? 605  ALA E CA    1 
ATOM   6687 C  C     . ALA E 2 162 ? 80.596  -15.402 29.356  1.00 103.01 ? 605  ALA E C     1 
ATOM   6688 O  O     . ALA E 2 162 ? 81.628  -14.812 29.648  1.00 112.60 ? 605  ALA E O     1 
ATOM   6689 C  CB    . ALA E 2 162 ? 78.560  -13.936 29.401  1.00 106.04 ? 605  ALA E CB    1 
ATOM   6690 N  N     . LEU E 2 163 ? 80.542  -16.333 28.418  1.00 102.54 ? 606  LEU E N     1 
ATOM   6691 C  CA    . LEU E 2 163 ? 81.711  -16.739 27.657  1.00 108.99 ? 606  LEU E CA    1 
ATOM   6692 C  C     . LEU E 2 163 ? 82.090  -15.739 26.529  1.00 117.71 ? 606  LEU E C     1 
ATOM   6693 O  O     . LEU E 2 163 ? 83.272  -15.587 26.224  1.00 123.30 ? 606  LEU E O     1 
ATOM   6694 C  CB    . LEU E 2 163 ? 81.445  -18.124 27.078  1.00 116.60 ? 606  LEU E CB    1 
ATOM   6695 C  CG    . LEU E 2 163 ? 82.595  -18.884 26.421  1.00 121.47 ? 606  LEU E CG    1 
ATOM   6696 C  CD1   . LEU E 2 163 ? 83.562  -19.429 27.462  1.00 121.06 ? 606  LEU E CD1   1 
ATOM   6697 C  CD2   . LEU E 2 163 ? 82.018  -20.009 25.568  1.00 116.21 ? 606  LEU E CD2   1 
ATOM   6698 N  N     . ASN E 2 164 ? 81.093  -15.091 25.912  1.00 117.23 ? 607  ASN E N     1 
ATOM   6699 C  CA    . ASN E 2 164 ? 81.291  -14.100 24.839  1.00 109.01 ? 607  ASN E CA    1 
ATOM   6700 C  C     . ASN E 2 164 ? 80.481  -12.851 25.018  1.00 114.70 ? 607  ASN E C     1 
ATOM   6701 O  O     . ASN E 2 164 ? 79.584  -12.789 25.849  1.00 107.41 ? 607  ASN E O     1 
ATOM   6702 C  CB    . ASN E 2 164 ? 80.817  -14.612 23.491  1.00 105.99 ? 607  ASN E CB    1 
ATOM   6703 C  CG    . ASN E 2 164 ? 80.917  -16.099 23.352  1.00 105.00 ? 607  ASN E CG    1 
ATOM   6704 O  OD1   . ASN E 2 164 ? 79.904  -16.768 23.113  1.00 106.20 ? 607  ASN E OD1   1 
ATOM   6705 N  ND2   . ASN E 2 164 ? 82.121  -16.635 23.489  1.00 94.61  ? 607  ASN E ND2   1 
ATOM   6706 N  N     . SER E 2 165 ? 80.754  -11.890 24.145  1.00 124.12 ? 608  SER E N     1 
ATOM   6707 C  CA    . SER E 2 165 ? 79.828  -10.806 23.832  1.00 128.04 ? 608  SER E CA    1 
ATOM   6708 C  C     . SER E 2 165 ? 78.498  -11.273 23.212  1.00 125.54 ? 608  SER E C     1 
ATOM   6709 O  O     . SER E 2 165 ? 77.447  -10.713 23.516  1.00 113.15 ? 608  SER E O     1 
ATOM   6710 C  CB    . SER E 2 165 ? 80.526  -9.843  22.880  1.00 129.83 ? 608  SER E CB    1 
ATOM   6711 O  OG    . SER E 2 165 ? 81.400  -10.577 22.037  1.00 137.54 ? 608  SER E OG    1 
ATOM   6712 N  N     . LYS E 2 166 ? 78.542  -12.280 22.339  1.00 127.59 ? 609  LYS E N     1 
ATOM   6713 C  CA    . LYS E 2 166 ? 77.311  -12.874 21.783  1.00 131.28 ? 609  LYS E CA    1 
ATOM   6714 C  C     . LYS E 2 166 ? 76.329  -13.095 22.911  1.00 126.57 ? 609  LYS E C     1 
ATOM   6715 O  O     . LYS E 2 166 ? 75.197  -12.605 22.896  1.00 117.67 ? 609  LYS E O     1 
ATOM   6716 C  CB    . LYS E 2 166 ? 77.562  -14.241 21.133  1.00 133.23 ? 609  LYS E CB    1 
ATOM   6717 C  CG    . LYS E 2 166 ? 78.520  -14.265 19.951  1.00 138.69 ? 609  LYS E CG    1 
ATOM   6718 C  CD    . LYS E 2 166 ? 79.339  -15.563 19.895  1.00 144.16 ? 609  LYS E CD    1 
ATOM   6719 C  CE    . LYS E 2 166 ? 80.843  -15.307 19.880  1.00 139.42 ? 609  LYS E CE    1 
ATOM   6720 N  NZ    . LYS E 2 166 ? 81.283  -15.002 18.497  1.00 141.99 ? 609  LYS E NZ    1 
ATOM   6721 N  N     . ILE E 2 167 ? 76.806  -13.850 23.892  1.00 120.04 ? 610  ILE E N     1 
ATOM   6722 C  CA    . ILE E 2 167 ? 75.981  -14.401 24.944  1.00 117.12 ? 610  ILE E CA    1 
ATOM   6723 C  C     . ILE E 2 167 ? 75.481  -13.279 25.856  1.00 112.88 ? 610  ILE E C     1 
ATOM   6724 O  O     . ILE E 2 167 ? 74.277  -13.118 26.067  1.00 102.29 ? 610  ILE E O     1 
ATOM   6725 C  CB    . ILE E 2 167 ? 76.793  -15.462 25.722  1.00 121.15 ? 610  ILE E CB    1 
ATOM   6726 C  CG1   . ILE E 2 167 ? 76.867  -16.744 24.891  1.00 116.60 ? 610  ILE E CG1   1 
ATOM   6727 C  CG2   . ILE E 2 167 ? 76.199  -15.747 27.100  1.00 128.58 ? 610  ILE E CG2   1 
ATOM   6728 C  CD1   . ILE E 2 167 ? 77.986  -17.667 25.293  1.00 124.14 ? 610  ILE E CD1   1 
ATOM   6729 N  N     . LEU E 2 168 ? 76.424  -12.506 26.383  1.00 110.72 ? 611  LEU E N     1 
ATOM   6730 C  CA    . LEU E 2 168 ? 76.129  -11.283 27.123  1.00 110.79 ? 611  LEU E CA    1 
ATOM   6731 C  C     . LEU E 2 168 ? 74.930  -10.527 26.555  1.00 108.62 ? 611  LEU E C     1 
ATOM   6732 O  O     . LEU E 2 168 ? 74.025  -10.086 27.284  1.00 92.43  ? 611  LEU E O     1 
ATOM   6733 C  CB    . LEU E 2 168 ? 77.354  -10.372 27.063  1.00 113.89 ? 611  LEU E CB    1 
ATOM   6734 C  CG    . LEU E 2 168 ? 77.533  -9.251  28.057  1.00 120.38 ? 611  LEU E CG    1 
ATOM   6735 C  CD1   . LEU E 2 168 ? 77.018  -9.628  29.431  1.00 118.00 ? 611  LEU E CD1   1 
ATOM   6736 C  CD2   . LEU E 2 168 ? 78.996  -8.854  28.133  1.00 125.02 ? 611  LEU E CD2   1 
ATOM   6737 N  N     . SER E 2 169 ? 74.950  -10.389 25.236  1.00 111.75 ? 612  SER E N     1 
ATOM   6738 C  CA    . SER E 2 169 ? 73.936  -9.657  24.506  1.00 117.41 ? 612  SER E CA    1 
ATOM   6739 C  C     . SER E 2 169 ? 72.545  -10.305 24.656  1.00 114.69 ? 612  SER E C     1 
ATOM   6740 O  O     . SER E 2 169 ? 71.573  -9.641  25.077  1.00 101.79 ? 612  SER E O     1 
ATOM   6741 C  CB    . SER E 2 169 ? 74.375  -9.576  23.055  1.00 118.77 ? 612  SER E CB    1 
ATOM   6742 O  OG    . SER E 2 169 ? 73.664  -8.589  22.355  1.00 136.00 ? 612  SER E OG    1 
ATOM   6743 N  N     . VAL E 2 170 ? 72.493  -11.612 24.389  1.00 106.84 ? 613  VAL E N     1 
ATOM   6744 C  CA    . VAL E 2 170 ? 71.278  -12.419 24.570  1.00 105.24 ? 613  VAL E CA    1 
ATOM   6745 C  C     . VAL E 2 170 ? 70.692  -12.274 25.970  1.00 114.64 ? 613  VAL E C     1 
ATOM   6746 O  O     . VAL E 2 170 ? 69.469  -12.330 26.156  1.00 126.19 ? 613  VAL E O     1 
ATOM   6747 C  CB    . VAL E 2 170 ? 71.533  -13.936 24.377  1.00 97.28  ? 613  VAL E CB    1 
ATOM   6748 C  CG1   . VAL E 2 170 ? 70.213  -14.712 24.443  1.00 94.32  ? 613  VAL E CG1   1 
ATOM   6749 C  CG2   . VAL E 2 170 ? 72.247  -14.227 23.064  1.00 90.88  ? 613  VAL E CG2   1 
ATOM   6750 N  N     . MET E 2 171 ? 71.576  -12.167 26.957  1.00 113.86 ? 614  MET E N     1 
ATOM   6751 C  CA    . MET E 2 171 ? 71.174  -12.072 28.353  1.00 118.13 ? 614  MET E CA    1 
ATOM   6752 C  C     . MET E 2 171 ? 70.643  -10.682 28.680  1.00 116.05 ? 614  MET E C     1 
ATOM   6753 O  O     . MET E 2 171 ? 69.588  -10.559 29.309  1.00 113.75 ? 614  MET E O     1 
ATOM   6754 C  CB    . MET E 2 171 ? 72.345  -12.456 29.270  1.00 123.28 ? 614  MET E CB    1 
ATOM   6755 C  CG    . MET E 2 171 ? 72.756  -13.923 29.129  1.00 125.44 ? 614  MET E CG    1 
ATOM   6756 S  SD    . MET E 2 171 ? 74.163  -14.479 30.125  1.00 124.26 ? 614  MET E SD    1 
ATOM   6757 C  CE    . MET E 2 171 ? 73.439  -14.454 31.758  1.00 121.49 ? 614  MET E CE    1 
ATOM   6758 N  N     . GLU E 2 172 ? 71.349  -9.644  28.232  1.00 116.90 ? 615  GLU E N     1 
ATOM   6759 C  CA    . GLU E 2 172 ? 70.867  -8.269  28.398  1.00 121.60 ? 615  GLU E CA    1 
ATOM   6760 C  C     . GLU E 2 172 ? 69.527  -8.030  27.732  1.00 126.37 ? 615  GLU E C     1 
ATOM   6761 O  O     . GLU E 2 172 ? 68.714  -7.233  28.238  1.00 123.22 ? 615  GLU E O     1 
ATOM   6762 C  CB    . GLU E 2 172 ? 71.857  -7.273  27.827  1.00 116.90 ? 615  GLU E CB    1 
ATOM   6763 C  CG    . GLU E 2 172 ? 72.925  -6.865  28.811  1.00 117.96 ? 615  GLU E CG    1 
ATOM   6764 C  CD    . GLU E 2 172 ? 74.295  -6.880  28.182  1.00 124.94 ? 615  GLU E CD    1 
ATOM   6765 O  OE1   . GLU E 2 172 ? 74.487  -6.222  27.138  1.00 134.50 ? 615  GLU E OE1   1 
ATOM   6766 O  OE2   . GLU E 2 172 ? 75.185  -7.555  28.729  1.00 124.58 ? 615  GLU E OE2   1 
ATOM   6767 N  N     . ALA E 2 173 ? 69.305  -8.721  26.609  1.00 112.27 ? 616  ALA E N     1 
ATOM   6768 C  CA    . ALA E 2 173 ? 68.012  -8.718  25.923  1.00 110.01 ? 616  ALA E CA    1 
ATOM   6769 C  C     . ALA E 2 173 ? 66.793  -8.702  26.884  1.00 116.95 ? 616  ALA E C     1 
ATOM   6770 O  O     . ALA E 2 173 ? 65.748  -8.139  26.553  1.00 130.49 ? 616  ALA E O     1 
ATOM   6771 C  CB    . ALA E 2 173 ? 67.942  -9.880  24.936  1.00 107.44 ? 616  ALA E CB    1 
ATOM   6772 N  N     . TYR E 2 174 ? 66.955  -9.256  28.088  1.00 125.31 ? 617  TYR E N     1 
ATOM   6773 C  CA    . TYR E 2 174 ? 65.972  -9.117  29.180  1.00 122.19 ? 617  TYR E CA    1 
ATOM   6774 C  C     . TYR E 2 174 ? 66.513  -8.162  30.259  1.00 112.66 ? 617  TYR E C     1 
ATOM   6775 O  O     . TYR E 2 174 ? 65.909  -7.131  30.554  1.00 101.00 ? 617  TYR E O     1 
ATOM   6776 C  CB    . TYR E 2 174 ? 65.627  -10.498 29.798  1.00 117.12 ? 617  TYR E CB    1 
ATOM   6777 C  CG    . TYR E 2 174 ? 65.401  -11.648 28.796  1.00 117.96 ? 617  TYR E CG    1 
ATOM   6778 C  CD1   . TYR E 2 174 ? 66.457  -12.142 28.010  1.00 116.94 ? 617  TYR E CD1   1 
ATOM   6779 C  CD2   . TYR E 2 174 ? 64.144  -12.253 28.650  1.00 104.63 ? 617  TYR E CD2   1 
ATOM   6780 C  CE1   . TYR E 2 174 ? 66.268  -13.173 27.105  1.00 107.44 ? 617  TYR E CE1   1 
ATOM   6781 C  CE2   . TYR E 2 174 ? 63.950  -13.290 27.743  1.00 98.21  ? 617  TYR E CE2   1 
ATOM   6782 C  CZ    . TYR E 2 174 ? 65.019  -13.747 26.973  1.00 104.25 ? 617  TYR E CZ    1 
ATOM   6783 O  OH    . TYR E 2 174 ? 64.882  -14.787 26.065  1.00 103.42 ? 617  TYR E OH    1 
ATOM   6784 N  N     . VAL F 2 10  ? -22.210 -77.540 34.416  1.00 112.13 ? 453  VAL F N     1 
ATOM   6785 C  CA    . VAL F 2 10  ? -20.964 -76.919 33.857  1.00 108.86 ? 453  VAL F CA    1 
ATOM   6786 C  C     . VAL F 2 10  ? -19.790 -77.839 34.178  1.00 99.56  ? 453  VAL F C     1 
ATOM   6787 O  O     . VAL F 2 10  ? -19.856 -78.665 35.089  1.00 90.27  ? 453  VAL F O     1 
ATOM   6788 C  CB    . VAL F 2 10  ? -20.725 -75.453 34.354  1.00 108.53 ? 453  VAL F CB    1 
ATOM   6789 C  CG1   . VAL F 2 10  ? -19.489 -74.805 33.715  1.00 100.00 ? 453  VAL F CG1   1 
ATOM   6790 C  CG2   . VAL F 2 10  ? -21.950 -74.589 34.074  1.00 108.60 ? 453  VAL F CG2   1 
ATOM   6791 N  N     . VAL F 2 11  ? -18.741 -77.704 33.382  1.00 91.57  ? 454  VAL F N     1 
ATOM   6792 C  CA    . VAL F 2 11  ? -17.500 -78.440 33.550  1.00 87.97  ? 454  VAL F CA    1 
ATOM   6793 C  C     . VAL F 2 11  ? -16.961 -78.404 35.000  1.00 87.96  ? 454  VAL F C     1 
ATOM   6794 O  O     . VAL F 2 11  ? -17.325 -77.527 35.805  1.00 84.72  ? 454  VAL F O     1 
ATOM   6795 C  CB    . VAL F 2 11  ? -16.465 -77.956 32.486  1.00 82.74  ? 454  VAL F CB    1 
ATOM   6796 C  CG1   . VAL F 2 11  ? -16.094 -76.499 32.675  1.00 77.79  ? 454  VAL F CG1   1 
ATOM   6797 C  CG2   . VAL F 2 11  ? -15.229 -78.835 32.458  1.00 86.30  ? 454  VAL F CG2   1 
ATOM   6798 N  N     . THR F 2 12  ? -16.144 -79.406 35.322  1.00 80.47  ? 455  THR F N     1 
ATOM   6799 C  CA    . THR F 2 12  ? -15.300 -79.384 36.499  1.00 73.52  ? 455  THR F CA    1 
ATOM   6800 C  C     . THR F 2 12  ? -13.837 -79.547 36.094  1.00 72.01  ? 455  THR F C     1 
ATOM   6801 O  O     . THR F 2 12  ? -13.377 -80.647 35.780  1.00 72.74  ? 455  THR F O     1 
ATOM   6802 C  CB    . THR F 2 12  ? -15.690 -80.495 37.482  1.00 75.91  ? 455  THR F CB    1 
ATOM   6803 O  OG1   . THR F 2 12  ? -15.356 -81.776 36.933  1.00 72.27  ? 455  THR F OG1   1 
ATOM   6804 C  CG2   . THR F 2 12  ? -17.200 -80.455 37.785  1.00 82.86  ? 455  THR F CG2   1 
ATOM   6805 N  N     . PRO F 2 13  ? -13.083 -78.446 36.103  1.00 68.62  ? 456  PRO F N     1 
ATOM   6806 C  CA    . PRO F 2 13  ? -11.724 -78.510 35.584  1.00 65.43  ? 456  PRO F CA    1 
ATOM   6807 C  C     . PRO F 2 13  ? -10.724 -79.180 36.536  1.00 61.80  ? 456  PRO F C     1 
ATOM   6808 O  O     . PRO F 2 13  ? -9.567  -79.409 36.147  1.00 59.04  ? 456  PRO F O     1 
ATOM   6809 C  CB    . PRO F 2 13  ? -11.377 -77.042 35.371  1.00 68.78  ? 456  PRO F CB    1 
ATOM   6810 C  CG    . PRO F 2 13  ? -12.202 -76.306 36.372  1.00 69.89  ? 456  PRO F CG    1 
ATOM   6811 C  CD    . PRO F 2 13  ? -13.467 -77.083 36.508  1.00 69.36  ? 456  PRO F CD    1 
ATOM   6812 N  N     . PHE F 2 14  ? -11.173 -79.497 37.754  1.00 56.84  ? 457  PHE F N     1 
ATOM   6813 C  CA    . PHE F 2 14  ? -10.303 -80.052 38.793  1.00 59.10  ? 457  PHE F CA    1 
ATOM   6814 C  C     . PHE F 2 14  ? -10.408 -81.553 38.938  1.00 55.73  ? 457  PHE F C     1 
ATOM   6815 O  O     . PHE F 2 14  ? -9.702  -82.161 39.745  1.00 55.41  ? 457  PHE F O     1 
ATOM   6816 C  CB    . PHE F 2 14  ? -10.620 -79.424 40.155  1.00 64.30  ? 457  PHE F CB    1 
ATOM   6817 C  CG    . PHE F 2 14  ? -12.066 -79.498 40.530  1.00 65.95  ? 457  PHE F CG    1 
ATOM   6818 C  CD1   . PHE F 2 14  ? -12.633 -80.702 40.915  1.00 64.55  ? 457  PHE F CD1   1 
ATOM   6819 C  CD2   . PHE F 2 14  ? -12.857 -78.354 40.491  1.00 66.80  ? 457  PHE F CD2   1 
ATOM   6820 C  CE1   . PHE F 2 14  ? -13.963 -80.762 41.254  1.00 65.11  ? 457  PHE F CE1   1 
ATOM   6821 C  CE2   . PHE F 2 14  ? -14.188 -78.408 40.826  1.00 61.99  ? 457  PHE F CE2   1 
ATOM   6822 C  CZ    . PHE F 2 14  ? -14.742 -79.615 41.199  1.00 65.35  ? 457  PHE F CZ    1 
ATOM   6823 N  N     . SER F 2 15  ? -11.329 -82.139 38.202  1.00 54.36  ? 458  SER F N     1 
ATOM   6824 C  CA    . SER F 2 15  ? -11.402 -83.585 38.077  1.00 56.19  ? 458  SER F CA    1 
ATOM   6825 C  C     . SER F 2 15  ? -10.067 -84.247 37.884  1.00 48.28  ? 458  SER F C     1 
ATOM   6826 O  O     . SER F 2 15  ? -9.240  -83.750 37.142  1.00 51.06  ? 458  SER F O     1 
ATOM   6827 C  CB    . SER F 2 15  ? -12.215 -83.934 36.842  1.00 62.78  ? 458  SER F CB    1 
ATOM   6828 O  OG    . SER F 2 15  ? -13.601 -83.683 37.024  1.00 77.31  ? 458  SER F OG    1 
ATOM   6829 N  N     . ARG F 2 16  ? -9.898  -85.415 38.480  1.00 46.24  ? 459  ARG F N     1 
ATOM   6830 C  CA    . ARG F 2 16  ? -8.726  -86.263 38.235  1.00 49.06  ? 459  ARG F CA    1 
ATOM   6831 C  C     . ARG F 2 16  ? -9.112  -87.699 37.960  1.00 48.55  ? 459  ARG F C     1 
ATOM   6832 O  O     . ARG F 2 16  ? -9.996  -88.237 38.610  1.00 51.50  ? 459  ARG F O     1 
ATOM   6833 C  CB    . ARG F 2 16  ? -7.825  -86.289 39.455  1.00 50.13  ? 459  ARG F CB    1 
ATOM   6834 C  CG    . ARG F 2 16  ? -7.293  -84.930 39.854  1.00 55.53  ? 459  ARG F CG    1 
ATOM   6835 C  CD    . ARG F 2 16  ? -5.963  -84.596 39.175  1.00 56.36  ? 459  ARG F CD    1 
ATOM   6836 N  NE    . ARG F 2 16  ? -5.482  -83.321 39.693  1.00 51.82  ? 459  ARG F NE    1 
ATOM   6837 C  CZ    . ARG F 2 16  ? -4.241  -82.863 39.572  1.00 52.94  ? 459  ARG F CZ    1 
ATOM   6838 N  NH1   . ARG F 2 16  ? -3.313  -83.557 38.939  1.00 52.48  ? 459  ARG F NH1   1 
ATOM   6839 N  NH2   . ARG F 2 16  ? -3.941  -81.700 40.123  1.00 58.05  ? 459  ARG F NH2   1 
ATOM   6840 N  N     . ASP F 2 17  ? -8.404  -88.350 37.053  1.00 49.09  ? 460  ASP F N     1 
ATOM   6841 C  CA    . ASP F 2 17  ? -8.389  -89.796 37.052  1.00 52.21  ? 460  ASP F CA    1 
ATOM   6842 C  C     . ASP F 2 17  ? -7.323  -90.267 38.046  1.00 58.20  ? 460  ASP F C     1 
ATOM   6843 O  O     . ASP F 2 17  ? -6.657  -89.456 38.711  1.00 54.85  ? 460  ASP F O     1 
ATOM   6844 C  CB    . ASP F 2 17  ? -8.197  -90.336 35.621  1.00 55.35  ? 460  ASP F CB    1 
ATOM   6845 C  CG    . ASP F 2 17  ? -6.775  -90.172 35.098  1.00 59.88  ? 460  ASP F CG    1 
ATOM   6846 O  OD1   . ASP F 2 17  ? -5.950  -89.595 35.836  1.00 69.63  ? 460  ASP F OD1   1 
ATOM   6847 O  OD2   . ASP F 2 17  ? -6.477  -90.656 33.977  1.00 55.49  ? 460  ASP F OD2   1 
ATOM   6848 N  N     . ASP F 2 18  ? -7.137  -91.576 38.122  1.00 60.95  ? 461  ASP F N     1 
ATOM   6849 C  CA    . ASP F 2 18  ? -6.055  -92.152 38.909  1.00 61.18  ? 461  ASP F CA    1 
ATOM   6850 C  C     . ASP F 2 18  ? -4.918  -91.910 37.900  1.00 64.41  ? 461  ASP F C     1 
ATOM   6851 O  O     . ASP F 2 18  ? -5.215  -91.568 36.772  1.00 69.39  ? 461  ASP F O     1 
ATOM   6852 C  CB    . ASP F 2 18  ? -6.393  -93.613 39.202  1.00 62.19  ? 461  ASP F CB    1 
ATOM   6853 C  CG    . ASP F 2 18  ? -7.692  -93.762 40.031  1.00 64.52  ? 461  ASP F CG    1 
ATOM   6854 O  OD1   . ASP F 2 18  ? -8.052  -92.822 40.777  1.00 63.64  ? 461  ASP F OD1   1 
ATOM   6855 O  OD2   . ASP F 2 18  ? -8.354  -94.822 39.950  1.00 67.64  ? 461  ASP F OD2   1 
ATOM   6856 N  N     . ARG F 2 19  ? -3.648  -91.964 38.232  1.00 63.87  ? 462  ARG F N     1 
ATOM   6857 C  CA    . ARG F 2 19  ? -2.661  -91.287 37.354  1.00 66.16  ? 462  ARG F CA    1 
ATOM   6858 C  C     . ARG F 2 19  ? -2.725  -89.725 37.350  1.00 65.92  ? 462  ARG F C     1 
ATOM   6859 O  O     . ARG F 2 19  ? -1.835  -89.101 36.803  1.00 67.37  ? 462  ARG F O     1 
ATOM   6860 C  CB    . ARG F 2 19  ? -2.694  -91.705 35.870  1.00 68.22  ? 462  ARG F CB    1 
ATOM   6861 C  CG    . ARG F 2 19  ? -2.291  -93.128 35.520  1.00 78.03  ? 462  ARG F CG    1 
ATOM   6862 C  CD    . ARG F 2 19  ? -2.044  -93.247 34.003  1.00 90.21  ? 462  ARG F CD    1 
ATOM   6863 N  NE    . ARG F 2 19  ? -1.087  -94.290 33.595  1.00 97.52  ? 462  ARG F NE    1 
ATOM   6864 C  CZ    . ARG F 2 19  ? -1.243  -95.610 33.738  1.00 95.18  ? 462  ARG F CZ    1 
ATOM   6865 N  NH1   . ARG F 2 19  ? -2.342  -96.125 34.285  1.00 97.44  ? 462  ARG F NH1   1 
ATOM   6866 N  NH2   . ARG F 2 19  ? -0.278  -96.429 33.312  1.00 89.73  ? 462  ARG F NH2   1 
ATOM   6867 N  N     . GLY F 2 20  ? -3.770  -89.072 37.876  1.00 69.27  ? 463  GLY F N     1 
ATOM   6868 C  CA    . GLY F 2 20  ? -3.730  -87.616 38.115  1.00 68.55  ? 463  GLY F CA    1 
ATOM   6869 C  C     . GLY F 2 20  ? -3.884  -86.720 36.887  1.00 65.32  ? 463  GLY F C     1 
ATOM   6870 O  O     . GLY F 2 20  ? -3.490  -85.561 36.932  1.00 64.04  ? 463  GLY F O     1 
ATOM   6871 N  N     . HIS F 2 21  ? -4.495  -87.234 35.815  1.00 60.68  ? 464  HIS F N     1 
ATOM   6872 C  CA    . HIS F 2 21  ? -4.806  -86.434 34.627  1.00 59.60  ? 464  HIS F CA    1 
ATOM   6873 C  C     . HIS F 2 21  ? -6.032  -85.541 34.859  1.00 57.21  ? 464  HIS F C     1 
ATOM   6874 O  O     . HIS F 2 21  ? -7.102  -86.027 35.202  1.00 57.18  ? 464  HIS F O     1 
ATOM   6875 C  CB    . HIS F 2 21  ? -4.935  -87.332 33.391  1.00 59.89  ? 464  HIS F CB    1 
ATOM   6876 C  CG    . HIS F 2 21  ? -3.618  -87.920 32.960  1.00 69.56  ? 464  HIS F CG    1 
ATOM   6877 N  ND1   . HIS F 2 21  ? -3.349  -89.272 33.004  1.00 77.02  ? 464  HIS F ND1   1 
ATOM   6878 C  CD2   . HIS F 2 21  ? -2.466  -87.326 32.550  1.00 72.57  ? 464  HIS F CD2   1 
ATOM   6879 C  CE1   . HIS F 2 21  ? -2.100  -89.487 32.619  1.00 77.08  ? 464  HIS F CE1   1 
ATOM   6880 N  NE2   . HIS F 2 21  ? -1.542  -88.322 32.342  1.00 72.49  ? 464  HIS F NE2   1 
ATOM   6881 N  N     . THR F 2 22  ? -5.825  -84.227 34.752  1.00 53.16  ? 465  THR F N     1 
ATOM   6882 C  CA    . THR F 2 22  ? -6.909  -83.255 34.596  1.00 55.90  ? 465  THR F CA    1 
ATOM   6883 C  C     . THR F 2 22  ? -7.427  -83.222 33.179  1.00 55.60  ? 465  THR F C     1 
ATOM   6884 O  O     . THR F 2 22  ? -6.712  -83.597 32.256  1.00 55.37  ? 465  THR F O     1 
ATOM   6885 C  CB    . THR F 2 22  ? -6.519  -81.808 34.955  1.00 56.61  ? 465  THR F CB    1 
ATOM   6886 O  OG1   . THR F 2 22  ? -5.329  -81.414 34.272  1.00 54.96  ? 465  THR F OG1   1 
ATOM   6887 C  CG2   . THR F 2 22  ? -6.301  -81.714 36.409  1.00 59.06  ? 465  THR F CG2   1 
ATOM   6888 N  N     . PRO F 2 23  ? -8.665  -82.734 32.994  1.00 48.61  ? 466  PRO F N     1 
ATOM   6889 C  CA    . PRO F 2 23  ? -9.108  -82.284 31.683  1.00 48.67  ? 466  PRO F CA    1 
ATOM   6890 C  C     . PRO F 2 23  ? -8.028  -81.504 30.910  1.00 48.03  ? 466  PRO F C     1 
ATOM   6891 O  O     . PRO F 2 23  ? -7.748  -81.791 29.749  1.00 45.24  ? 466  PRO F O     1 
ATOM   6892 C  CB    . PRO F 2 23  ? -10.309 -81.387 32.003  1.00 45.69  ? 466  PRO F CB    1 
ATOM   6893 C  CG    . PRO F 2 23  ? -10.836 -81.903 33.297  1.00 45.17  ? 466  PRO F CG    1 
ATOM   6894 C  CD    . PRO F 2 23  ? -9.740  -82.671 33.995  1.00 46.71  ? 466  PRO F CD    1 
ATOM   6895 N  N     . LEU F 2 24  ? -7.430  -80.522 31.548  1.00 50.78  ? 467  LEU F N     1 
ATOM   6896 C  CA    . LEU F 2 24  ? -6.397  -79.776 30.876  1.00 50.30  ? 467  LEU F CA    1 
ATOM   6897 C  C     . LEU F 2 24  ? -5.236  -80.654 30.371  1.00 50.15  ? 467  LEU F C     1 
ATOM   6898 O  O     . LEU F 2 24  ? -4.685  -80.368 29.313  1.00 50.70  ? 467  LEU F O     1 
ATOM   6899 C  CB    . LEU F 2 24  ? -5.888  -78.678 31.786  1.00 50.90  ? 467  LEU F CB    1 
ATOM   6900 C  CG    . LEU F 2 24  ? -5.059  -77.635 31.072  1.00 52.22  ? 467  LEU F CG    1 
ATOM   6901 C  CD1   . LEU F 2 24  ? -5.932  -76.834 30.134  1.00 59.21  ? 467  LEU F CD1   1 
ATOM   6902 C  CD2   . LEU F 2 24  ? -4.434  -76.705 32.081  1.00 53.01  ? 467  LEU F CD2   1 
ATOM   6903 N  N     . HIS F 2 25  ? -4.858  -81.710 31.099  1.00 47.64  ? 468  HIS F N     1 
ATOM   6904 C  CA    . HIS F 2 25  ? -3.866  -82.666 30.568  1.00 49.66  ? 468  HIS F CA    1 
ATOM   6905 C  C     . HIS F 2 25  ? -4.388  -83.310 29.293  1.00 52.18  ? 468  HIS F C     1 
ATOM   6906 O  O     . HIS F 2 25  ? -3.675  -83.411 28.287  1.00 57.34  ? 468  HIS F O     1 
ATOM   6907 C  CB    . HIS F 2 25  ? -3.538  -83.776 31.563  1.00 52.03  ? 468  HIS F CB    1 
ATOM   6908 C  CG    . HIS F 2 25  ? -2.587  -83.381 32.655  1.00 54.30  ? 468  HIS F CG    1 
ATOM   6909 N  ND1   . HIS F 2 25  ? -3.008  -82.976 33.906  1.00 55.53  ? 468  HIS F ND1   1 
ATOM   6910 C  CD2   . HIS F 2 25  ? -1.236  -83.381 32.701  1.00 55.42  ? 468  HIS F CD2   1 
ATOM   6911 C  CE1   . HIS F 2 25  ? -1.958  -82.723 34.667  1.00 54.98  ? 468  HIS F CE1   1 
ATOM   6912 N  NE2   . HIS F 2 25  ? -0.870  -82.954 33.957  1.00 55.97  ? 468  HIS F NE2   1 
ATOM   6913 N  N     . VAL F 2 26  ? -5.651  -83.730 29.331  1.00 52.78  ? 469  VAL F N     1 
ATOM   6914 C  CA    . VAL F 2 26  ? -6.255  -84.452 28.220  1.00 52.29  ? 469  VAL F CA    1 
ATOM   6915 C  C     . VAL F 2 26  ? -6.352  -83.504 27.022  1.00 53.51  ? 469  VAL F C     1 
ATOM   6916 O  O     . VAL F 2 26  ? -5.807  -83.785 25.959  1.00 49.80  ? 469  VAL F O     1 
ATOM   6917 C  CB    . VAL F 2 26  ? -7.661  -84.985 28.580  1.00 52.08  ? 469  VAL F CB    1 
ATOM   6918 C  CG1   . VAL F 2 26  ? -8.281  -85.700 27.389  1.00 54.59  ? 469  VAL F CG1   1 
ATOM   6919 C  CG2   . VAL F 2 26  ? -7.606  -85.940 29.756  1.00 47.93  ? 469  VAL F CG2   1 
ATOM   6920 N  N     . ALA F 2 27  ? -7.027  -82.365 27.216  1.00 53.91  ? 470  ALA F N     1 
ATOM   6921 C  CA    . ALA F 2 27  ? -7.065  -81.287 26.210  1.00 52.91  ? 470  ALA F CA    1 
ATOM   6922 C  C     . ALA F 2 27  ? -5.707  -81.011 25.585  1.00 53.73  ? 470  ALA F C     1 
ATOM   6923 O  O     . ALA F 2 27  ? -5.618  -80.810 24.406  1.00 61.92  ? 470  ALA F O     1 
ATOM   6924 C  CB    . ALA F 2 27  ? -7.621  -79.997 26.806  1.00 51.41  ? 470  ALA F CB    1 
ATOM   6925 N  N     . ALA F 2 28  ? -4.643  -80.989 26.365  1.00 56.09  ? 471  ALA F N     1 
ATOM   6926 C  CA    . ALA F 2 28  ? -3.337  -80.696 25.805  1.00 59.00  ? 471  ALA F CA    1 
ATOM   6927 C  C     . ALA F 2 28  ? -2.878  -81.823 24.929  1.00 57.43  ? 471  ALA F C     1 
ATOM   6928 O  O     . ALA F 2 28  ? -2.375  -81.591 23.845  1.00 62.67  ? 471  ALA F O     1 
ATOM   6929 C  CB    . ALA F 2 28  ? -2.303  -80.459 26.896  1.00 65.73  ? 471  ALA F CB    1 
ATOM   6930 N  N     . VAL F 2 29  ? -2.993  -83.044 25.412  1.00 56.04  ? 472  VAL F N     1 
ATOM   6931 C  CA    . VAL F 2 29  ? -2.360  -84.148 24.715  1.00 56.85  ? 472  VAL F CA    1 
ATOM   6932 C  C     . VAL F 2 29  ? -3.136  -84.502 23.443  1.00 58.63  ? 472  VAL F C     1 
ATOM   6933 O  O     . VAL F 2 29  ? -2.586  -85.133 22.553  1.00 61.10  ? 472  VAL F O     1 
ATOM   6934 C  CB    . VAL F 2 29  ? -2.195  -85.368 25.627  1.00 53.79  ? 472  VAL F CB    1 
ATOM   6935 C  CG1   . VAL F 2 29  ? -3.414  -86.282 25.594  1.00 56.33  ? 472  VAL F CG1   1 
ATOM   6936 C  CG2   . VAL F 2 29  ? -0.982  -86.131 25.216  1.00 51.06  ? 472  VAL F CG2   1 
ATOM   6937 N  N     . CYS F 2 30  ? -4.400  -84.080 23.356  1.00 61.30  ? 473  CYS F N     1 
ATOM   6938 C  CA    . CYS F 2 30  ? -5.169  -84.146 22.112  1.00 71.06  ? 473  CYS F CA    1 
ATOM   6939 C  C     . CYS F 2 30  ? -4.768  -83.073 21.136  1.00 74.00  ? 473  CYS F C     1 
ATOM   6940 O  O     . CYS F 2 30  ? -4.643  -83.338 19.952  1.00 71.27  ? 473  CYS F O     1 
ATOM   6941 C  CB    . CYS F 2 30  ? -6.648  -83.962 22.386  1.00 77.30  ? 473  CYS F CB    1 
ATOM   6942 S  SG    . CYS F 2 30  ? -7.247  -85.258 23.459  1.00 100.32 ? 473  CYS F SG    1 
ATOM   6943 N  N     . GLY F 2 31  ? -4.619  -81.849 21.642  1.00 78.32  ? 474  GLY F N     1 
ATOM   6944 C  CA    . GLY F 2 31  ? -4.347  -80.675 20.826  1.00 69.98  ? 474  GLY F CA    1 
ATOM   6945 C  C     . GLY F 2 31  ? -5.487  -79.686 20.771  1.00 69.61  ? 474  GLY F C     1 
ATOM   6946 O  O     . GLY F 2 31  ? -5.444  -78.739 20.008  1.00 68.99  ? 474  GLY F O     1 
ATOM   6947 N  N     . GLN F 2 32  ? -6.526  -79.898 21.559  1.00 74.36  ? 475  GLN F N     1 
ATOM   6948 C  CA    . GLN F 2 32  ? -7.729  -79.102 21.408  1.00 85.27  ? 475  GLN F CA    1 
ATOM   6949 C  C     . GLN F 2 32  ? -7.568  -77.715 22.086  1.00 78.63  ? 475  GLN F C     1 
ATOM   6950 O  O     . GLN F 2 32  ? -7.987  -77.500 23.224  1.00 78.52  ? 475  GLN F O     1 
ATOM   6951 C  CB    . GLN F 2 32  ? -8.935  -79.898 21.932  1.00 97.33  ? 475  GLN F CB    1 
ATOM   6952 C  CG    . GLN F 2 32  ? -9.150  -81.248 21.229  1.00 103.47 ? 475  GLN F CG    1 
ATOM   6953 C  CD    . GLN F 2 32  ? -10.165 -82.137 21.928  1.00 114.03 ? 475  GLN F CD    1 
ATOM   6954 O  OE1   . GLN F 2 32  ? -9.815  -83.214 22.436  1.00 113.21 ? 475  GLN F OE1   1 
ATOM   6955 N  NE2   . GLN F 2 32  ? -11.429 -81.695 21.968  1.00 115.31 ? 475  GLN F NE2   1 
ATOM   6956 N  N     . ALA F 2 33  ? -6.971  -76.773 21.360  1.00 71.89  ? 476  ALA F N     1 
ATOM   6957 C  CA    . ALA F 2 33  ? -6.701  -75.437 21.901  1.00 65.31  ? 476  ALA F CA    1 
ATOM   6958 C  C     . ALA F 2 33  ? -7.945  -74.713 22.375  1.00 65.76  ? 476  ALA F C     1 
ATOM   6959 O  O     . ALA F 2 33  ? -7.911  -74.022 23.382  1.00 75.08  ? 476  ALA F O     1 
ATOM   6960 C  CB    . ALA F 2 33  ? -5.951  -74.579 20.893  1.00 65.25  ? 476  ALA F CB    1 
ATOM   6961 N  N     . SER F 2 34  ? -9.040  -74.827 21.648  1.00 74.20  ? 477  SER F N     1 
ATOM   6962 C  CA    . SER F 2 34  ? -10.264 -74.103 22.022  1.00 84.84  ? 477  SER F CA    1 
ATOM   6963 C  C     . SER F 2 34  ? -10.740 -74.602 23.382  1.00 81.17  ? 477  SER F C     1 
ATOM   6964 O  O     . SER F 2 34  ? -11.276 -73.844 24.219  1.00 75.07  ? 477  SER F O     1 
ATOM   6965 C  CB    . SER F 2 34  ? -11.336 -74.350 20.973  1.00 91.61  ? 477  SER F CB    1 
ATOM   6966 O  OG    . SER F 2 34  ? -11.157 -75.657 20.448  1.00 106.49 ? 477  SER F OG    1 
ATOM   6967 N  N     . LEU F 2 35  ? -10.510 -75.894 23.596  1.00 69.99  ? 478  LEU F N     1 
ATOM   6968 C  CA    . LEU F 2 35  ? -10.863 -76.535 24.841  1.00 70.23  ? 478  LEU F CA    1 
ATOM   6969 C  C     . LEU F 2 35  ? -9.992  -76.048 25.991  1.00 73.16  ? 478  LEU F C     1 
ATOM   6970 O  O     . LEU F 2 35  ? -10.478 -75.812 27.111  1.00 75.07  ? 478  LEU F O     1 
ATOM   6971 C  CB    . LEU F 2 35  ? -10.697 -78.045 24.693  1.00 70.57  ? 478  LEU F CB    1 
ATOM   6972 C  CG    . LEU F 2 35  ? -11.281 -78.943 25.775  1.00 67.17  ? 478  LEU F CG    1 
ATOM   6973 C  CD1   . LEU F 2 35  ? -12.717 -78.550 26.083  1.00 66.16  ? 478  LEU F CD1   1 
ATOM   6974 C  CD2   . LEU F 2 35  ? -11.188 -80.389 25.307  1.00 68.94  ? 478  LEU F CD2   1 
ATOM   6975 N  N     . ILE F 2 36  ? -8.696  -75.924 25.721  1.00 68.51  ? 479  ILE F N     1 
ATOM   6976 C  CA    . ILE F 2 36  ? -7.789  -75.254 26.651  1.00 59.92  ? 479  ILE F CA    1 
ATOM   6977 C  C     . ILE F 2 36  ? -8.289  -73.871 27.077  1.00 58.20  ? 479  ILE F C     1 
ATOM   6978 O  O     . ILE F 2 36  ? -8.459  -73.610 28.261  1.00 52.91  ? 479  ILE F O     1 
ATOM   6979 C  CB    . ILE F 2 36  ? -6.386  -75.139 26.067  1.00 58.62  ? 479  ILE F CB    1 
ATOM   6980 C  CG1   . ILE F 2 36  ? -5.759  -76.535 25.939  1.00 60.96  ? 479  ILE F CG1   1 
ATOM   6981 C  CG2   . ILE F 2 36  ? -5.541  -74.265 26.966  1.00 61.69  ? 479  ILE F CG2   1 
ATOM   6982 C  CD1   . ILE F 2 36  ? -4.395  -76.567 25.279  1.00 59.75  ? 479  ILE F CD1   1 
ATOM   6983 N  N     . ASP F 2 37  ? -8.527  -72.985 26.118  1.00 60.41  ? 480  ASP F N     1 
ATOM   6984 C  CA    . ASP F 2 37  ? -9.090  -71.675 26.442  1.00 65.16  ? 480  ASP F CA    1 
ATOM   6985 C  C     . ASP F 2 37  ? -10.216 -71.823 27.424  1.00 63.82  ? 480  ASP F C     1 
ATOM   6986 O  O     . ASP F 2 37  ? -10.295 -71.103 28.432  1.00 60.10  ? 480  ASP F O     1 
ATOM   6987 C  CB    . ASP F 2 37  ? -9.635  -70.982 25.200  1.00 71.84  ? 480  ASP F CB    1 
ATOM   6988 C  CG    . ASP F 2 37  ? -8.544  -70.521 24.254  1.00 80.49  ? 480  ASP F CG    1 
ATOM   6989 O  OD1   . ASP F 2 37  ? -7.524  -69.971 24.725  1.00 78.69  ? 480  ASP F OD1   1 
ATOM   6990 O  OD2   . ASP F 2 37  ? -8.722  -70.695 23.028  1.00 93.02  ? 480  ASP F OD2   1 
ATOM   6991 N  N     . LEU F 2 38  ? -11.103 -72.759 27.113  1.00 63.31  ? 481  LEU F N     1 
ATOM   6992 C  CA    . LEU F 2 38  ? -12.326 -72.904 27.894  1.00 66.39  ? 481  LEU F CA    1 
ATOM   6993 C  C     . LEU F 2 38  ? -12.007 -73.368 29.317  1.00 58.69  ? 481  LEU F C     1 
ATOM   6994 O  O     . LEU F 2 38  ? -12.455 -72.751 30.288  1.00 57.29  ? 481  LEU F O     1 
ATOM   6995 C  CB    . LEU F 2 38  ? -13.303 -73.860 27.201  1.00 70.48  ? 481  LEU F CB    1 
ATOM   6996 C  CG    . LEU F 2 38  ? -14.369 -74.503 28.091  1.00 72.84  ? 481  LEU F CG    1 
ATOM   6997 C  CD1   . LEU F 2 38  ? -15.273 -73.493 28.783  1.00 73.33  ? 481  LEU F CD1   1 
ATOM   6998 C  CD2   . LEU F 2 38  ? -15.193 -75.441 27.239  1.00 78.87  ? 481  LEU F CD2   1 
ATOM   6999 N  N     . LEU F 2 39  ? -11.209 -74.428 29.431  1.00 56.54  ? 482  LEU F N     1 
ATOM   7000 C  CA    . LEU F 2 39  ? -10.826 -74.961 30.747  1.00 57.29  ? 482  LEU F CA    1 
ATOM   7001 C  C     . LEU F 2 39  ? -10.116 -73.942 31.619  1.00 55.98  ? 482  LEU F C     1 
ATOM   7002 O  O     . LEU F 2 39  ? -10.459 -73.781 32.793  1.00 57.22  ? 482  LEU F O     1 
ATOM   7003 C  CB    . LEU F 2 39  ? -9.927  -76.175 30.610  1.00 55.65  ? 482  LEU F CB    1 
ATOM   7004 C  CG    . LEU F 2 39  ? -10.650 -77.400 30.084  1.00 61.01  ? 482  LEU F CG    1 
ATOM   7005 C  CD1   . LEU F 2 39  ? -9.641  -78.522 29.829  1.00 62.19  ? 482  LEU F CD1   1 
ATOM   7006 C  CD2   . LEU F 2 39  ? -11.729 -77.853 31.063  1.00 63.07  ? 482  LEU F CD2   1 
ATOM   7007 N  N     . VAL F 2 40  ? -9.161  -73.233 31.034  1.00 51.24  ? 483  VAL F N     1 
ATOM   7008 C  CA    . VAL F 2 40  ? -8.468  -72.184 31.749  1.00 51.58  ? 483  VAL F CA    1 
ATOM   7009 C  C     . VAL F 2 40  ? -9.449  -71.114 32.254  1.00 51.28  ? 483  VAL F C     1 
ATOM   7010 O  O     . VAL F 2 40  ? -9.411  -70.719 33.411  1.00 46.61  ? 483  VAL F O     1 
ATOM   7011 C  CB    . VAL F 2 40  ? -7.375  -71.556 30.876  1.00 51.43  ? 483  VAL F CB    1 
ATOM   7012 C  CG1   . VAL F 2 40  ? -6.800  -70.353 31.573  1.00 52.98  ? 483  VAL F CG1   1 
ATOM   7013 C  CG2   . VAL F 2 40  ? -6.262  -72.552 30.610  1.00 50.58  ? 483  VAL F CG2   1 
ATOM   7014 N  N     . SER F 2 41  ? -10.359 -70.686 31.394  1.00 60.44  ? 484  SER F N     1 
ATOM   7015 C  CA    . SER F 2 41  ? -11.365 -69.698 31.790  1.00 69.88  ? 484  SER F CA    1 
ATOM   7016 C  C     . SER F 2 41  ? -12.263 -70.191 32.908  1.00 68.34  ? 484  SER F C     1 
ATOM   7017 O  O     . SER F 2 41  ? -12.919 -69.397 33.558  1.00 66.59  ? 484  SER F O     1 
ATOM   7018 C  CB    . SER F 2 41  ? -12.253 -69.319 30.614  1.00 70.97  ? 484  SER F CB    1 
ATOM   7019 O  OG    . SER F 2 41  ? -13.181 -70.356 30.360  1.00 75.69  ? 484  SER F OG    1 
ATOM   7020 N  N     . LYS F 2 42  ? -12.314 -71.499 33.107  1.00 71.29  ? 485  LYS F N     1 
ATOM   7021 C  CA    . LYS F 2 42  ? -13.181 -72.078 34.115  1.00 75.00  ? 485  LYS F CA    1 
ATOM   7022 C  C     . LYS F 2 42  ? -12.420 -72.426 35.390  1.00 67.25  ? 485  LYS F C     1 
ATOM   7023 O  O     . LYS F 2 42  ? -12.952 -73.063 36.306  1.00 62.62  ? 485  LYS F O     1 
ATOM   7024 C  CB    . LYS F 2 42  ? -13.848 -73.315 33.533  1.00 83.59  ? 485  LYS F CB    1 
ATOM   7025 C  CG    . LYS F 2 42  ? -15.352 -73.215 33.510  1.00 88.38  ? 485  LYS F CG    1 
ATOM   7026 C  CD    . LYS F 2 42  ? -15.851 -72.326 32.394  1.00 97.41  ? 485  LYS F CD    1 
ATOM   7027 C  CE    . LYS F 2 42  ? -17.373 -72.274 32.418  1.00 111.78 ? 485  LYS F CE    1 
ATOM   7028 N  NZ    . LYS F 2 42  ? -17.896 -70.891 32.211  1.00 119.62 ? 485  LYS F NZ    1 
ATOM   7029 N  N     . GLY F 2 43  ? -11.168 -71.996 35.445  1.00 63.82  ? 486  GLY F N     1 
ATOM   7030 C  CA    . GLY F 2 43  ? -10.393 -72.098 36.660  1.00 61.87  ? 486  GLY F CA    1 
ATOM   7031 C  C     . GLY F 2 43  ? -9.399  -73.233 36.661  1.00 59.47  ? 486  GLY F C     1 
ATOM   7032 O  O     . GLY F 2 43  ? -8.728  -73.447 37.651  1.00 61.95  ? 486  GLY F O     1 
ATOM   7033 N  N     . ALA F 2 44  ? -9.276  -73.957 35.559  1.00 56.99  ? 487  ALA F N     1 
ATOM   7034 C  CA    . ALA F 2 44  ? -8.306  -75.050 35.490  1.00 57.76  ? 487  ALA F CA    1 
ATOM   7035 C  C     . ALA F 2 44  ? -6.881  -74.661 35.958  1.00 54.72  ? 487  ALA F C     1 
ATOM   7036 O  O     . ALA F 2 44  ? -6.365  -73.613 35.587  1.00 51.52  ? 487  ALA F O     1 
ATOM   7037 C  CB    . ALA F 2 44  ? -8.258  -75.603 34.072  1.00 60.64  ? 487  ALA F CB    1 
ATOM   7038 N  N     . MET F 2 45  ? -6.251  -75.525 36.757  1.00 52.21  ? 488  MET F N     1 
ATOM   7039 C  CA    . MET F 2 45  ? -4.877  -75.289 37.224  1.00 50.46  ? 488  MET F CA    1 
ATOM   7040 C  C     . MET F 2 45  ? -3.898  -75.670 36.146  1.00 48.35  ? 488  MET F C     1 
ATOM   7041 O  O     . MET F 2 45  ? -3.740  -76.852 35.812  1.00 49.43  ? 488  MET F O     1 
ATOM   7042 C  CB    . MET F 2 45  ? -4.562  -76.088 38.496  1.00 53.94  ? 488  MET F CB    1 
ATOM   7043 C  CG    . MET F 2 45  ? -3.097  -76.056 38.915  1.00 55.29  ? 488  MET F CG    1 
ATOM   7044 S  SD    . MET F 2 45  ? -2.735  -76.862 40.521  1.00 55.74  ? 488  MET F SD    1 
ATOM   7045 C  CE    . MET F 2 45  ? -0.961  -76.804 40.580  1.00 57.08  ? 488  MET F CE    1 
ATOM   7046 N  N     . VAL F 2 46  ? -3.228  -74.662 35.615  1.00 46.65  ? 489  VAL F N     1 
ATOM   7047 C  CA    . VAL F 2 46  ? -2.345  -74.833 34.458  1.00 45.55  ? 489  VAL F CA    1 
ATOM   7048 C  C     . VAL F 2 46  ? -1.105  -75.668 34.759  1.00 44.95  ? 489  VAL F C     1 
ATOM   7049 O  O     . VAL F 2 46  ? -0.648  -76.421 33.904  1.00 39.47  ? 489  VAL F O     1 
ATOM   7050 C  CB    . VAL F 2 46  ? -1.886  -73.465 33.952  1.00 47.03  ? 489  VAL F CB    1 
ATOM   7051 C  CG1   . VAL F 2 46  ? -0.816  -73.590 32.889  1.00 46.80  ? 489  VAL F CG1   1 
ATOM   7052 C  CG2   . VAL F 2 46  ? -3.071  -72.692 33.411  1.00 46.27  ? 489  VAL F CG2   1 
ATOM   7053 N  N     . ASN F 2 47  ? -0.551  -75.510 35.960  1.00 46.35  ? 490  ASN F N     1 
ATOM   7054 C  CA    . ASN F 2 47  ? 0.627   -76.284 36.347  1.00 50.97  ? 490  ASN F CA    1 
ATOM   7055 C  C     . ASN F 2 47  ? 0.342   -77.535 37.161  1.00 51.55  ? 490  ASN F C     1 
ATOM   7056 O  O     . ASN F 2 47  ? 1.229   -78.095 37.841  1.00 57.86  ? 490  ASN F O     1 
ATOM   7057 C  CB    . ASN F 2 47  ? 1.596   -75.392 37.092  1.00 52.05  ? 490  ASN F CB    1 
ATOM   7058 C  CG    . ASN F 2 47  ? 2.290   -74.439 36.175  1.00 52.09  ? 490  ASN F CG    1 
ATOM   7059 O  OD1   . ASN F 2 47  ? 2.732   -74.803 35.070  1.00 60.81  ? 490  ASN F OD1   1 
ATOM   7060 N  ND2   . ASN F 2 47  ? 2.410   -73.217 36.618  1.00 56.16  ? 490  ASN F ND2   1 
ATOM   7061 N  N     . ALA F 2 48  ? -0.895  -77.998 37.043  1.00 50.10  ? 491  ALA F N     1 
ATOM   7062 C  CA    . ALA F 2 48  ? -1.307  -79.263 37.607  1.00 47.43  ? 491  ALA F CA    1 
ATOM   7063 C  C     . ALA F 2 48  ? -0.334  -80.365 37.189  1.00 44.89  ? 491  ALA F C     1 
ATOM   7064 O  O     . ALA F 2 48  ? 0.061   -80.429 36.034  1.00 43.81  ? 491  ALA F O     1 
ATOM   7065 C  CB    . ALA F 2 48  ? -2.718  -79.582 37.142  1.00 46.11  ? 491  ALA F CB    1 
ATOM   7066 N  N     . THR F 2 49  ? 0.008   -81.242 38.116  1.00 46.00  ? 492  THR F N     1 
ATOM   7067 C  CA    . THR F 2 49  ? 0.919   -82.336 37.818  1.00 49.73  ? 492  THR F CA    1 
ATOM   7068 C  C     . THR F 2 49  ? 0.199   -83.691 37.933  1.00 48.91  ? 492  THR F C     1 
ATOM   7069 O  O     . THR F 2 49  ? -0.596  -83.924 38.856  1.00 45.33  ? 492  THR F O     1 
ATOM   7070 C  CB    . THR F 2 49  ? 2.184   -82.321 38.694  1.00 52.38  ? 492  THR F CB    1 
ATOM   7071 O  OG1   . THR F 2 49  ? 1.822   -82.271 40.080  1.00 55.74  ? 492  THR F OG1   1 
ATOM   7072 C  CG2   . THR F 2 49  ? 3.049   -81.161 38.353  1.00 54.84  ? 492  THR F CG2   1 
ATOM   7073 N  N     . ASP F 2 50  ? 0.507   -84.585 36.997  1.00 50.73  ? 493  ASP F N     1 
ATOM   7074 C  CA    . ASP F 2 50  ? -0.003  -85.948 37.067  1.00 52.27  ? 493  ASP F CA    1 
ATOM   7075 C  C     . ASP F 2 50  ? 0.823   -86.826 38.009  1.00 51.79  ? 493  ASP F C     1 
ATOM   7076 O  O     . ASP F 2 50  ? 1.816   -86.418 38.604  1.00 48.01  ? 493  ASP F O     1 
ATOM   7077 C  CB    . ASP F 2 50  ? -0.132  -86.560 35.659  1.00 55.66  ? 493  ASP F CB    1 
ATOM   7078 C  CG    . ASP F 2 50  ? 1.187   -87.038 35.072  1.00 58.17  ? 493  ASP F CG    1 
ATOM   7079 O  OD1   . ASP F 2 50  ? 2.239   -86.838 35.721  1.00 65.73  ? 493  ASP F OD1   1 
ATOM   7080 O  OD2   . ASP F 2 50  ? 1.168   -87.605 33.940  1.00 57.07  ? 493  ASP F OD2   1 
ATOM   7081 N  N     . TYR F 2 51  ? 0.402   -88.056 38.140  1.00 54.35  ? 494  TYR F N     1 
ATOM   7082 C  CA    . TYR F 2 51  ? 1.063   -88.966 39.050  1.00 55.95  ? 494  TYR F CA    1 
ATOM   7083 C  C     . TYR F 2 51  ? 2.587   -89.117 38.840  1.00 50.16  ? 494  TYR F C     1 
ATOM   7084 O  O     . TYR F 2 51  ? 3.282   -89.524 39.743  1.00 47.78  ? 494  TYR F O     1 
ATOM   7085 C  CB    . TYR F 2 51  ? 0.363   -90.343 39.033  1.00 58.51  ? 494  TYR F CB    1 
ATOM   7086 C  CG    . TYR F 2 51  ? 0.848   -91.272 37.955  1.00 64.23  ? 494  TYR F CG    1 
ATOM   7087 C  CD1   . TYR F 2 51  ? 0.771   -90.909 36.624  1.00 70.73  ? 494  TYR F CD1   1 
ATOM   7088 C  CD2   . TYR F 2 51  ? 1.380   -92.520 38.265  1.00 67.42  ? 494  TYR F CD2   1 
ATOM   7089 C  CE1   . TYR F 2 51  ? 1.214   -91.752 35.630  1.00 77.68  ? 494  TYR F CE1   1 
ATOM   7090 C  CE2   . TYR F 2 51  ? 1.819   -93.377 37.274  1.00 68.19  ? 494  TYR F CE2   1 
ATOM   7091 C  CZ    . TYR F 2 51  ? 1.734   -92.984 35.956  1.00 73.09  ? 494  TYR F CZ    1 
ATOM   7092 O  OH    . TYR F 2 51  ? 2.159   -93.793 34.930  1.00 81.02  ? 494  TYR F OH    1 
ATOM   7093 N  N     . HIS F 2 52  ? 3.112   -88.806 37.672  1.00 53.40  ? 495  HIS F N     1 
ATOM   7094 C  CA    . HIS F 2 52  ? 4.558   -88.836 37.498  1.00 58.07  ? 495  HIS F CA    1 
ATOM   7095 C  C     . HIS F 2 52  ? 5.150   -87.456 37.227  1.00 56.59  ? 495  HIS F C     1 
ATOM   7096 O  O     . HIS F 2 52  ? 6.265   -87.332 36.721  1.00 56.18  ? 495  HIS F O     1 
ATOM   7097 C  CB    . HIS F 2 52  ? 4.926   -89.796 36.369  1.00 70.93  ? 495  HIS F CB    1 
ATOM   7098 C  CG    . HIS F 2 52  ? 4.946   -91.249 36.739  1.00 84.47  ? 495  HIS F CG    1 
ATOM   7099 N  ND1   . HIS F 2 52  ? 4.894   -91.705 38.040  1.00 88.88  ? 495  HIS F ND1   1 
ATOM   7100 C  CD2   . HIS F 2 52  ? 5.068   -92.353 35.957  1.00 83.99  ? 495  HIS F CD2   1 
ATOM   7101 C  CE1   . HIS F 2 52  ? 4.971   -93.024 38.045  1.00 85.04  ? 495  HIS F CE1   1 
ATOM   7102 N  NE2   . HIS F 2 52  ? 5.075   -93.440 36.796  1.00 88.44  ? 495  HIS F NE2   1 
ATOM   7103 N  N     . GLY F 2 53  ? 4.418   -86.407 37.577  1.00 57.15  ? 496  GLY F N     1 
ATOM   7104 C  CA    . GLY F 2 53  ? 5.014   -85.080 37.690  1.00 64.99  ? 496  GLY F CA    1 
ATOM   7105 C  C     . GLY F 2 53  ? 4.919   -84.266 36.414  1.00 66.00  ? 496  GLY F C     1 
ATOM   7106 O  O     . GLY F 2 53  ? 5.631   -83.289 36.255  1.00 66.56  ? 496  GLY F O     1 
ATOM   7107 N  N     . ALA F 2 54  ? 4.038   -84.683 35.504  1.00 65.00  ? 497  ALA F N     1 
ATOM   7108 C  CA    . ALA F 2 54  ? 3.918   -84.082 34.176  1.00 62.03  ? 497  ALA F CA    1 
ATOM   7109 C  C     . ALA F 2 54  ? 2.817   -83.056 34.179  1.00 58.25  ? 497  ALA F C     1 
ATOM   7110 O  O     . ALA F 2 54  ? 1.685   -83.365 34.566  1.00 53.91  ? 497  ALA F O     1 
ATOM   7111 C  CB    . ALA F 2 54  ? 3.624   -85.143 33.123  1.00 63.90  ? 497  ALA F CB    1 
ATOM   7112 N  N     . THR F 2 55  ? 3.173   -81.852 33.726  1.00 55.51  ? 498  THR F N     1 
ATOM   7113 C  CA    . THR F 2 55  ? 2.230   -80.765 33.415  1.00 53.05  ? 498  THR F CA    1 
ATOM   7114 C  C     . THR F 2 55  ? 1.626   -80.947 32.025  1.00 56.51  ? 498  THR F C     1 
ATOM   7115 O  O     . THR F 2 55  ? 2.218   -81.556 31.141  1.00 57.64  ? 498  THR F O     1 
ATOM   7116 C  CB    . THR F 2 55  ? 2.861   -79.334 33.391  1.00 53.94  ? 498  THR F CB    1 
ATOM   7117 O  OG1   . THR F 2 55  ? 4.033   -79.304 32.581  1.00 48.02  ? 498  THR F OG1   1 
ATOM   7118 C  CG2   . THR F 2 55  ? 3.251   -78.852 34.733  1.00 59.73  ? 498  THR F CG2   1 
ATOM   7119 N  N     . PRO F 2 56  ? 0.464   -80.357 31.792  1.00 52.27  ? 499  PRO F N     1 
ATOM   7120 C  CA    . PRO F 2 56  ? -0.001  -80.232 30.430  1.00 50.25  ? 499  PRO F CA    1 
ATOM   7121 C  C     . PRO F 2 56  ? 1.085   -79.767 29.465  1.00 48.94  ? 499  PRO F C     1 
ATOM   7122 O  O     . PRO F 2 56  ? 1.200   -80.301 28.359  1.00 48.71  ? 499  PRO F O     1 
ATOM   7123 C  CB    . PRO F 2 56  ? -1.088  -79.169 30.538  1.00 51.13  ? 499  PRO F CB    1 
ATOM   7124 C  CG    . PRO F 2 56  ? -1.632  -79.366 31.898  1.00 53.40  ? 499  PRO F CG    1 
ATOM   7125 C  CD    . PRO F 2 56  ? -0.452  -79.737 32.751  1.00 54.04  ? 499  PRO F CD    1 
ATOM   7126 N  N     . LEU F 2 57  ? 1.837   -78.756 29.863  1.00 44.57  ? 500  LEU F N     1 
ATOM   7127 C  CA    . LEU F 2 57  ? 2.953   -78.334 29.057  1.00 47.04  ? 500  LEU F CA    1 
ATOM   7128 C  C     . LEU F 2 57  ? 3.933   -79.457 28.727  1.00 49.22  ? 500  LEU F C     1 
ATOM   7129 O  O     . LEU F 2 57  ? 4.418   -79.525 27.600  1.00 50.50  ? 500  LEU F O     1 
ATOM   7130 C  CB    . LEU F 2 57  ? 3.694   -77.187 29.725  1.00 48.64  ? 500  LEU F CB    1 
ATOM   7131 C  CG    . LEU F 2 57  ? 4.814   -76.548 28.912  1.00 46.39  ? 500  LEU F CG    1 
ATOM   7132 C  CD1   . LEU F 2 57  ? 4.250   -75.907 27.666  1.00 50.07  ? 500  LEU F CD1   1 
ATOM   7133 C  CD2   . LEU F 2 57  ? 5.490   -75.472 29.714  1.00 47.64  ? 500  LEU F CD2   1 
ATOM   7134 N  N     . HIS F 2 58  ? 4.235   -80.324 29.692  1.00 51.05  ? 501  HIS F N     1 
ATOM   7135 C  CA    . HIS F 2 58  ? 5.104   -81.490 29.431  1.00 52.99  ? 501  HIS F CA    1 
ATOM   7136 C  C     . HIS F 2 58  ? 4.492   -82.326 28.320  1.00 49.23  ? 501  HIS F C     1 
ATOM   7137 O  O     . HIS F 2 58  ? 5.193   -82.817 27.459  1.00 49.72  ? 501  HIS F O     1 
ATOM   7138 C  CB    . HIS F 2 58  ? 5.282   -82.395 30.678  1.00 53.99  ? 501  HIS F CB    1 
ATOM   7139 C  CG    . HIS F 2 58  ? 6.355   -81.963 31.631  1.00 54.13  ? 501  HIS F CG    1 
ATOM   7140 N  ND1   . HIS F 2 58  ? 6.123   -81.064 32.645  1.00 57.19  ? 501  HIS F ND1   1 
ATOM   7141 C  CD2   . HIS F 2 58  ? 7.646   -82.346 31.761  1.00 56.86  ? 501  HIS F CD2   1 
ATOM   7142 C  CE1   . HIS F 2 58  ? 7.229   -80.884 33.343  1.00 57.21  ? 501  HIS F CE1   1 
ATOM   7143 N  NE2   . HIS F 2 58  ? 8.168   -81.659 32.833  1.00 60.74  ? 501  HIS F NE2   1 
ATOM   7144 N  N     . LEU F 2 59  ? 3.183   -82.518 28.374  1.00 47.34  ? 502  LEU F N     1 
ATOM   7145 C  CA    . LEU F 2 59  ? 2.519   -83.354 27.401  1.00 51.01  ? 502  LEU F CA    1 
ATOM   7146 C  C     . LEU F 2 59  ? 2.536   -82.731 26.023  1.00 55.58  ? 502  LEU F C     1 
ATOM   7147 O  O     . LEU F 2 59  ? 2.870   -83.397 25.058  1.00 56.50  ? 502  LEU F O     1 
ATOM   7148 C  CB    . LEU F 2 59  ? 1.084   -83.630 27.806  1.00 50.75  ? 502  LEU F CB    1 
ATOM   7149 C  CG    . LEU F 2 59  ? 0.916   -84.400 29.117  1.00 49.25  ? 502  LEU F CG    1 
ATOM   7150 C  CD1   . LEU F 2 59  ? -0.564  -84.615 29.380  1.00 51.05  ? 502  LEU F CD1   1 
ATOM   7151 C  CD2   . LEU F 2 59  ? 1.664   -85.721 29.116  1.00 45.99  ? 502  LEU F CD2   1 
ATOM   7152 N  N     . ALA F 2 60  ? 2.181   -81.459 25.925  1.00 58.71  ? 503  ALA F N     1 
ATOM   7153 C  CA    . ALA F 2 60  ? 2.296   -80.768 24.644  1.00 55.73  ? 503  ALA F CA    1 
ATOM   7154 C  C     . ALA F 2 60  ? 3.703   -80.892 24.082  1.00 54.49  ? 503  ALA F C     1 
ATOM   7155 O  O     . ALA F 2 60  ? 3.856   -81.215 22.922  1.00 54.51  ? 503  ALA F O     1 
ATOM   7156 C  CB    . ALA F 2 60  ? 1.871   -79.313 24.754  1.00 54.96  ? 503  ALA F CB    1 
ATOM   7157 N  N     . CYS F 2 61  ? 4.733   -80.640 24.876  1.00 57.69  ? 504  CYS F N     1 
ATOM   7158 C  CA    . CYS F 2 61  ? 6.100   -80.623 24.313  1.00 60.70  ? 504  CYS F CA    1 
ATOM   7159 C  C     . CYS F 2 61  ? 6.588   -81.995 23.900  1.00 63.40  ? 504  CYS F C     1 
ATOM   7160 O  O     . CYS F 2 61  ? 7.439   -82.134 23.023  1.00 74.02  ? 504  CYS F O     1 
ATOM   7161 C  CB    . CYS F 2 61  ? 7.094   -79.965 25.265  1.00 55.01  ? 504  CYS F CB    1 
ATOM   7162 S  SG    . CYS F 2 61  ? 6.805   -78.183 25.262  1.00 58.04  ? 504  CYS F SG    1 
ATOM   7163 N  N     . GLN F 2 62  ? 6.033   -83.017 24.521  1.00 68.14  ? 505  GLN F N     1 
ATOM   7164 C  CA    . GLN F 2 62  ? 6.362   -84.376 24.157  1.00 70.94  ? 505  GLN F CA    1 
ATOM   7165 C  C     . GLN F 2 62  ? 5.758   -84.685 22.816  1.00 72.08  ? 505  GLN F C     1 
ATOM   7166 O  O     . GLN F 2 62  ? 6.413   -85.214 21.928  1.00 69.51  ? 505  GLN F O     1 
ATOM   7167 C  CB    . GLN F 2 62  ? 5.780   -85.326 25.177  1.00 73.14  ? 505  GLN F CB    1 
ATOM   7168 C  CG    . GLN F 2 62  ? 6.397   -86.691 25.079  1.00 77.62  ? 505  GLN F CG    1 
ATOM   7169 C  CD    . GLN F 2 62  ? 6.076   -87.558 26.268  1.00 76.66  ? 505  GLN F CD    1 
ATOM   7170 O  OE1   . GLN F 2 62  ? 6.960   -88.222 26.824  1.00 79.32  ? 505  GLN F OE1   1 
ATOM   7171 N  NE2   . GLN F 2 62  ? 4.816   -87.560 26.673  1.00 75.66  ? 505  GLN F NE2   1 
ATOM   7172 N  N     . LYS F 2 63  ? 4.487   -84.328 22.700  1.00 71.30  ? 506  LYS F N     1 
ATOM   7173 C  CA    . LYS F 2 63  ? 3.667   -84.620 21.557  1.00 71.36  ? 506  LYS F CA    1 
ATOM   7174 C  C     . LYS F 2 63  ? 4.052   -83.666 20.375  1.00 74.08  ? 506  LYS F C     1 
ATOM   7175 O  O     . LYS F 2 63  ? 3.787   -83.960 19.220  1.00 74.96  ? 506  LYS F O     1 
ATOM   7176 C  CB    . LYS F 2 63  ? 2.200   -84.472 22.027  1.00 74.30  ? 506  LYS F CB    1 
ATOM   7177 C  CG    . LYS F 2 63  ? 1.128   -85.274 21.321  1.00 84.13  ? 506  LYS F CG    1 
ATOM   7178 C  CD    . LYS F 2 63  ? 0.940   -86.739 21.647  1.00 91.95  ? 506  LYS F CD    1 
ATOM   7179 C  CE    . LYS F 2 63  ? -0.350  -87.204 20.955  1.00 103.66 ? 506  LYS F CE    1 
ATOM   7180 N  NZ    . LYS F 2 63  ? -0.465  -88.647 20.608  1.00 112.94 ? 506  LYS F NZ    1 
ATOM   7181 N  N     . GLY F 2 64  ? 4.698   -82.538 20.655  1.00 79.32  ? 507  GLY F N     1 
ATOM   7182 C  CA    . GLY F 2 64  ? 5.117   -81.604 19.604  1.00 72.39  ? 507  GLY F CA    1 
ATOM   7183 C  C     . GLY F 2 64  ? 4.126   -80.566 19.096  1.00 71.04  ? 507  GLY F C     1 
ATOM   7184 O  O     . GLY F 2 64  ? 4.228   -80.135 17.951  1.00 81.79  ? 507  GLY F O     1 
ATOM   7185 N  N     . TYR F 2 65  ? 3.179   -80.153 19.928  1.00 62.48  ? 508  TYR F N     1 
ATOM   7186 C  CA    . TYR F 2 65  ? 2.134   -79.231 19.516  1.00 68.57  ? 508  TYR F CA    1 
ATOM   7187 C  C     . TYR F 2 65  ? 2.501   -77.790 19.827  1.00 66.48  ? 508  TYR F C     1 
ATOM   7188 O  O     . TYR F 2 65  ? 2.087   -77.249 20.844  1.00 73.94  ? 508  TYR F O     1 
ATOM   7189 C  CB    . TYR F 2 65  ? 0.826   -79.560 20.249  1.00 81.64  ? 508  TYR F CB    1 
ATOM   7190 C  CG    . TYR F 2 65  ? 0.256   -80.948 20.015  1.00 92.31  ? 508  TYR F CG    1 
ATOM   7191 C  CD1   . TYR F 2 65  ? 1.030   -81.977 19.466  1.00 99.72  ? 508  TYR F CD1   1 
ATOM   7192 C  CD2   . TYR F 2 65  ? -1.068  -81.225 20.335  1.00 87.25  ? 508  TYR F CD2   1 
ATOM   7193 C  CE1   . TYR F 2 65  ? 0.494   -83.223 19.231  1.00 101.98 ? 508  TYR F CE1   1 
ATOM   7194 C  CE2   . TYR F 2 65  ? -1.605  -82.470 20.111  1.00 90.46  ? 508  TYR F CE2   1 
ATOM   7195 C  CZ    . TYR F 2 65  ? -0.824  -83.464 19.559  1.00 103.13 ? 508  TYR F CZ    1 
ATOM   7196 O  OH    . TYR F 2 65  ? -1.343  -84.713 19.331  1.00 119.24 ? 508  TYR F OH    1 
ATOM   7197 N  N     . GLN F 2 66  ? 3.261   -77.150 18.955  1.00 68.30  ? 509  GLN F N     1 
ATOM   7198 C  CA    . GLN F 2 66  ? 3.692   -75.768 19.206  1.00 66.58  ? 509  GLN F CA    1 
ATOM   7199 C  C     . GLN F 2 66  ? 2.538   -74.851 19.585  1.00 60.86  ? 509  GLN F C     1 
ATOM   7200 O  O     . GLN F 2 66  ? 2.666   -74.033 20.492  1.00 67.23  ? 509  GLN F O     1 
ATOM   7201 C  CB    . GLN F 2 66  ? 4.437   -75.186 18.012  1.00 72.07  ? 509  GLN F CB    1 
ATOM   7202 C  CG    . GLN F 2 66  ? 5.317   -73.996 18.373  1.00 75.53  ? 509  GLN F CG    1 
ATOM   7203 C  CD    . GLN F 2 66  ? 5.540   -73.009 17.222  1.00 76.73  ? 509  GLN F CD    1 
ATOM   7204 O  OE1   . GLN F 2 66  ? 4.600   -72.366 16.732  1.00 68.91  ? 509  GLN F OE1   1 
ATOM   7205 N  NE2   . GLN F 2 66  ? 6.797   -72.885 16.791  1.00 76.66  ? 509  GLN F NE2   1 
ATOM   7206 N  N     . SER F 2 67  ? 1.405   -74.986 18.912  1.00 64.82  ? 510  SER F N     1 
ATOM   7207 C  CA    . SER F 2 67  ? 0.302   -74.056 19.140  1.00 69.53  ? 510  SER F CA    1 
ATOM   7208 C  C     . SER F 2 67  ? -0.159  -74.090 20.595  1.00 72.22  ? 510  SER F C     1 
ATOM   7209 O  O     . SER F 2 67  ? -0.304  -73.058 21.255  1.00 67.90  ? 510  SER F O     1 
ATOM   7210 C  CB    . SER F 2 67  ? -0.861  -74.379 18.248  1.00 72.56  ? 510  SER F CB    1 
ATOM   7211 O  OG    . SER F 2 67  ? -1.906  -73.500 18.601  1.00 82.24  ? 510  SER F OG    1 
ATOM   7212 N  N     . VAL F 2 68  ? -0.354  -75.310 21.083  1.00 71.54  ? 511  VAL F N     1 
ATOM   7213 C  CA    . VAL F 2 68  ? -0.690  -75.559 22.474  1.00 66.31  ? 511  VAL F CA    1 
ATOM   7214 C  C     . VAL F 2 68  ? 0.430   -75.122 23.422  1.00 57.93  ? 511  VAL F C     1 
ATOM   7215 O  O     . VAL F 2 68  ? 0.173   -74.374 24.378  1.00 57.30  ? 511  VAL F O     1 
ATOM   7216 C  CB    . VAL F 2 68  ? -0.974  -77.058 22.670  1.00 72.96  ? 511  VAL F CB    1 
ATOM   7217 C  CG1   . VAL F 2 68  ? -1.054  -77.433 24.143  1.00 77.90  ? 511  VAL F CG1   1 
ATOM   7218 C  CG2   . VAL F 2 68  ? -2.258  -77.440 21.964  1.00 80.28  ? 511  VAL F CG2   1 
ATOM   7219 N  N     . THR F 2 69  ? 1.655   -75.600 23.173  1.00 50.82  ? 512  THR F N     1 
ATOM   7220 C  CA    . THR F 2 69  ? 2.780   -75.191 24.020  1.00 53.93  ? 512  THR F CA    1 
ATOM   7221 C  C     . THR F 2 69  ? 2.805   -73.654 24.228  1.00 55.34  ? 512  THR F C     1 
ATOM   7222 O  O     . THR F 2 69  ? 2.812   -73.185 25.372  1.00 54.67  ? 512  THR F O     1 
ATOM   7223 C  CB    . THR F 2 69  ? 4.153   -75.875 23.776  1.00 54.21  ? 512  THR F CB    1 
ATOM   7224 O  OG1   . THR F 2 69  ? 5.172   -74.878 23.696  1.00 59.04  ? 512  THR F OG1   1 
ATOM   7225 C  CG2   . THR F 2 69  ? 4.165   -76.763 22.589  1.00 51.08  ? 512  THR F CG2   1 
ATOM   7226 N  N     . LEU F 2 70  ? 2.639   -72.869 23.170  1.00 54.11  ? 513  LEU F N     1 
ATOM   7227 C  CA    . LEU F 2 70  ? 2.517   -71.407 23.345  1.00 53.08  ? 513  LEU F CA    1 
ATOM   7228 C  C     . LEU F 2 70  ? 1.308   -70.942 24.132  1.00 50.04  ? 513  LEU F C     1 
ATOM   7229 O  O     . LEU F 2 70  ? 1.405   -70.067 24.970  1.00 51.26  ? 513  LEU F O     1 
ATOM   7230 C  CB    . LEU F 2 70  ? 2.555   -70.693 21.998  1.00 51.97  ? 513  LEU F CB    1 
ATOM   7231 C  CG    . LEU F 2 70  ? 3.962   -70.789 21.415  1.00 56.26  ? 513  LEU F CG    1 
ATOM   7232 C  CD1   . LEU F 2 70  ? 3.928   -70.508 19.936  1.00 57.47  ? 513  LEU F CD1   1 
ATOM   7233 C  CD2   . LEU F 2 70  ? 4.932   -69.837 22.101  1.00 56.80  ? 513  LEU F CD2   1 
ATOM   7234 N  N     . LEU F 2 71  ? 0.155   -71.502 23.834  1.00 53.57  ? 514  LEU F N     1 
ATOM   7235 C  CA    . LEU F 2 71  ? -1.043  -71.084 24.499  1.00 54.84  ? 514  LEU F CA    1 
ATOM   7236 C  C     . LEU F 2 71  ? -0.903  -71.325 25.998  1.00 55.19  ? 514  LEU F C     1 
ATOM   7237 O  O     . LEU F 2 71  ? -1.309  -70.502 26.817  1.00 57.20  ? 514  LEU F O     1 
ATOM   7238 C  CB    . LEU F 2 71  ? -2.227  -71.852 23.936  1.00 57.41  ? 514  LEU F CB    1 
ATOM   7239 C  CG    . LEU F 2 71  ? -3.563  -71.461 24.573  1.00 63.44  ? 514  LEU F CG    1 
ATOM   7240 C  CD1   . LEU F 2 71  ? -3.825  -69.960 24.490  1.00 64.20  ? 514  LEU F CD1   1 
ATOM   7241 C  CD2   . LEU F 2 71  ? -4.690  -72.232 23.904  1.00 65.52  ? 514  LEU F CD2   1 
ATOM   7242 N  N     . LEU F 2 72  ? -0.308  -72.450 26.358  1.00 53.46  ? 515  LEU F N     1 
ATOM   7243 C  CA    . LEU F 2 72  ? -0.067  -72.741 27.761  1.00 54.24  ? 515  LEU F CA    1 
ATOM   7244 C  C     . LEU F 2 72  ? 0.868   -71.724 28.394  1.00 51.32  ? 515  LEU F C     1 
ATOM   7245 O  O     . LEU F 2 72  ? 0.569   -71.174 29.459  1.00 48.37  ? 515  LEU F O     1 
ATOM   7246 C  CB    . LEU F 2 72  ? 0.497   -74.160 27.925  1.00 56.27  ? 515  LEU F CB    1 
ATOM   7247 C  CG    . LEU F 2 72  ? -0.498  -75.276 27.595  1.00 58.73  ? 515  LEU F CG    1 
ATOM   7248 C  CD1   . LEU F 2 72  ? 0.180   -76.624 27.557  1.00 58.45  ? 515  LEU F CD1   1 
ATOM   7249 C  CD2   . LEU F 2 72  ? -1.649  -75.303 28.598  1.00 59.90  ? 515  LEU F CD2   1 
ATOM   7250 N  N     . LEU F 2 73  ? 1.986   -71.453 27.729  1.00 48.52  ? 516  LEU F N     1 
ATOM   7251 C  CA    . LEU F 2 73  ? 2.901   -70.435 28.221  1.00 48.83  ? 516  LEU F CA    1 
ATOM   7252 C  C     . LEU F 2 73  ? 2.152   -69.107 28.375  1.00 55.01  ? 516  LEU F C     1 
ATOM   7253 O  O     . LEU F 2 73  ? 2.386   -68.340 29.315  1.00 45.25  ? 516  LEU F O     1 
ATOM   7254 C  CB    . LEU F 2 73  ? 4.096   -70.263 27.283  1.00 45.15  ? 516  LEU F CB    1 
ATOM   7255 C  CG    . LEU F 2 73  ? 4.956   -71.511 27.111  1.00 44.81  ? 516  LEU F CG    1 
ATOM   7256 C  CD1   . LEU F 2 73  ? 5.809   -71.454 25.864  1.00 44.45  ? 516  LEU F CD1   1 
ATOM   7257 C  CD2   . LEU F 2 73  ? 5.857   -71.757 28.312  1.00 46.94  ? 516  LEU F CD2   1 
ATOM   7258 N  N     . HIS F 2 74  ? 1.268   -68.827 27.418  1.00 59.81  ? 517  HIS F N     1 
ATOM   7259 C  CA    . HIS F 2 74  ? 0.487   -67.613 27.432  1.00 62.00  ? 517  HIS F CA    1 
ATOM   7260 C  C     . HIS F 2 74  ? -0.332  -67.537 28.674  1.00 62.45  ? 517  HIS F C     1 
ATOM   7261 O  O     . HIS F 2 74  ? -0.476  -66.454 29.250  1.00 66.52  ? 517  HIS F O     1 
ATOM   7262 C  CB    . HIS F 2 74  ? -0.424  -67.556 26.222  1.00 68.81  ? 517  HIS F CB    1 
ATOM   7263 C  CG    . HIS F 2 74  ? -1.309  -66.348 26.198  1.00 73.53  ? 517  HIS F CG    1 
ATOM   7264 N  ND1   . HIS F 2 74  ? -2.667  -66.413 26.426  1.00 77.18  ? 517  HIS F ND1   1 
ATOM   7265 C  CD2   . HIS F 2 74  ? -1.028  -65.046 25.979  1.00 71.54  ? 517  HIS F CD2   1 
ATOM   7266 C  CE1   . HIS F 2 74  ? -3.186  -65.204 26.345  1.00 71.87  ? 517  HIS F CE1   1 
ATOM   7267 N  NE2   . HIS F 2 74  ? -2.213  -64.358 26.080  1.00 73.05  ? 517  HIS F NE2   1 
ATOM   7268 N  N     . TYR F 2 75  ? -0.869  -68.689 29.077  1.00 61.22  ? 518  TYR F N     1 
ATOM   7269 C  CA    . TYR F 2 75  ? -1.616  -68.795 30.320  1.00 61.43  ? 518  TYR F CA    1 
ATOM   7270 C  C     . TYR F 2 75  ? -0.723  -69.150 31.496  1.00 58.94  ? 518  TYR F C     1 
ATOM   7271 O  O     . TYR F 2 75  ? -1.188  -69.728 32.479  1.00 60.63  ? 518  TYR F O     1 
ATOM   7272 C  CB    . TYR F 2 75  ? -2.681  -69.881 30.203  1.00 63.33  ? 518  TYR F CB    1 
ATOM   7273 C  CG    . TYR F 2 75  ? -3.807  -69.563 29.286  1.00 62.65  ? 518  TYR F CG    1 
ATOM   7274 C  CD1   . TYR F 2 75  ? -4.591  -68.444 29.495  1.00 63.15  ? 518  TYR F CD1   1 
ATOM   7275 C  CD2   . TYR F 2 75  ? -4.118  -70.397 28.224  1.00 66.29  ? 518  TYR F CD2   1 
ATOM   7276 C  CE1   . TYR F 2 75  ? -5.656  -68.142 28.659  1.00 64.52  ? 518  TYR F CE1   1 
ATOM   7277 C  CE2   . TYR F 2 75  ? -5.174  -70.105 27.380  1.00 67.50  ? 518  TYR F CE2   1 
ATOM   7278 C  CZ    . TYR F 2 75  ? -5.942  -68.974 27.605  1.00 67.75  ? 518  TYR F CZ    1 
ATOM   7279 O  OH    . TYR F 2 75  ? -6.997  -68.674 26.780  1.00 70.18  ? 518  TYR F OH    1 
ATOM   7280 N  N     . LYS F 2 76  ? 0.551   -68.807 31.426  1.00 57.92  ? 519  LYS F N     1 
ATOM   7281 C  CA    . LYS F 2 76  ? 1.391   -68.719 32.635  1.00 60.57  ? 519  LYS F CA    1 
ATOM   7282 C  C     . LYS F 2 76  ? 1.957   -70.066 33.066  1.00 49.76  ? 519  LYS F C     1 
ATOM   7283 O  O     . LYS F 2 76  ? 2.415   -70.200 34.160  1.00 43.23  ? 519  LYS F O     1 
ATOM   7284 C  CB    . LYS F 2 76  ? 0.638   -68.101 33.830  1.00 64.83  ? 519  LYS F CB    1 
ATOM   7285 C  CG    . LYS F 2 76  ? -0.075  -66.775 33.570  1.00 73.92  ? 519  LYS F CG    1 
ATOM   7286 C  CD    . LYS F 2 76  ? 0.867   -65.588 33.491  1.00 81.96  ? 519  LYS F CD    1 
ATOM   7287 C  CE    . LYS F 2 76  ? 0.185   -64.338 34.038  1.00 92.32  ? 519  LYS F CE    1 
ATOM   7288 N  NZ    . LYS F 2 76  ? 1.018   -63.110 33.881  1.00 105.21 ? 519  LYS F NZ    1 
ATOM   7289 N  N     . ALA F 2 77  ? 1.929   -71.052 32.194  1.00 50.64  ? 520  ALA F N     1 
ATOM   7290 C  CA    . ALA F 2 77  ? 2.476   -72.345 32.513  1.00 56.43  ? 520  ALA F CA    1 
ATOM   7291 C  C     . ALA F 2 77  ? 3.940   -72.219 32.806  1.00 57.07  ? 520  ALA F C     1 
ATOM   7292 O  O     . ALA F 2 77  ? 4.640   -71.553 32.057  1.00 62.62  ? 520  ALA F O     1 
ATOM   7293 C  CB    . ALA F 2 77  ? 2.309   -73.280 31.329  1.00 66.02  ? 520  ALA F CB    1 
ATOM   7294 N  N     . SER F 2 78  ? 4.422   -72.876 33.852  1.00 51.44  ? 521  SER F N     1 
ATOM   7295 C  CA    . SER F 2 78  ? 5.843   -72.853 34.130  1.00 53.76  ? 521  SER F CA    1 
ATOM   7296 C  C     . SER F 2 78  ? 6.590   -73.880 33.307  1.00 59.77  ? 521  SER F C     1 
ATOM   7297 O  O     . SER F 2 78  ? 6.203   -75.061 33.242  1.00 67.46  ? 521  SER F O     1 
ATOM   7298 C  CB    . SER F 2 78  ? 6.137   -73.099 35.596  1.00 57.01  ? 521  SER F CB    1 
ATOM   7299 O  OG    . SER F 2 78  ? 7.532   -73.334 35.760  1.00 61.04  ? 521  SER F OG    1 
ATOM   7300 N  N     . ALA F 2 79  ? 7.687   -73.416 32.711  1.00 57.95  ? 522  ALA F N     1 
ATOM   7301 C  CA    . ALA F 2 79  ? 8.532   -74.249 31.867  1.00 56.84  ? 522  ALA F CA    1 
ATOM   7302 C  C     . ALA F 2 79  ? 9.594   -75.016 32.655  1.00 59.14  ? 522  ALA F C     1 
ATOM   7303 O  O     . ALA F 2 79  ? 10.339  -75.800 32.065  1.00 55.63  ? 522  ALA F O     1 
ATOM   7304 C  CB    . ALA F 2 79  ? 9.198   -73.387 30.799  1.00 58.54  ? 522  ALA F CB    1 
ATOM   7305 N  N     . GLU F 2 80  ? 9.706   -74.736 33.954  1.00 61.14  ? 523  GLU F N     1 
ATOM   7306 C  CA    . GLU F 2 80  ? 10.788  -75.263 34.777  1.00 62.26  ? 523  GLU F CA    1 
ATOM   7307 C  C     . GLU F 2 80  ? 10.306  -76.388 35.689  1.00 61.82  ? 523  GLU F C     1 
ATOM   7308 O  O     . GLU F 2 80  ? 11.070  -76.880 36.516  1.00 65.39  ? 523  GLU F O     1 
ATOM   7309 C  CB    . GLU F 2 80  ? 11.400  -74.161 35.654  1.00 69.46  ? 523  GLU F CB    1 
ATOM   7310 C  CG    . GLU F 2 80  ? 11.628  -72.841 34.943  1.00 76.93  ? 523  GLU F CG    1 
ATOM   7311 C  CD    . GLU F 2 80  ? 12.865  -72.095 35.427  1.00 78.28  ? 523  GLU F CD    1 
ATOM   7312 O  OE1   . GLU F 2 80  ? 13.070  -71.985 36.646  1.00 77.43  ? 523  GLU F OE1   1 
ATOM   7313 O  OE2   . GLU F 2 80  ? 13.613  -71.578 34.575  1.00 84.25  ? 523  GLU F OE2   1 
ATOM   7314 N  N     . VAL F 2 81  ? 9.059   -76.823 35.559  1.00 56.56  ? 524  VAL F N     1 
ATOM   7315 C  CA    . VAL F 2 81  ? 8.609   -77.942 36.387  1.00 55.08  ? 524  VAL F CA    1 
ATOM   7316 C  C     . VAL F 2 81  ? 9.349   -79.221 35.979  1.00 61.38  ? 524  VAL F C     1 
ATOM   7317 O  O     . VAL F 2 81  ? 9.444   -79.513 34.781  1.00 60.78  ? 524  VAL F O     1 
ATOM   7318 C  CB    . VAL F 2 81  ? 7.112   -78.173 36.237  1.00 52.47  ? 524  VAL F CB    1 
ATOM   7319 C  CG1   . VAL F 2 81  ? 6.687   -79.431 36.963  1.00 51.73  ? 524  VAL F CG1   1 
ATOM   7320 C  CG2   . VAL F 2 81  ? 6.357   -76.989 36.792  1.00 57.10  ? 524  VAL F CG2   1 
ATOM   7321 N  N     . GLN F 2 82  ? 9.851   -79.979 36.963  1.00 60.40  ? 525  GLN F N     1 
ATOM   7322 C  CA    . GLN F 2 82  ? 10.529  -81.244 36.688  1.00 54.42  ? 525  GLN F CA    1 
ATOM   7323 C  C     . GLN F 2 82  ? 9.667   -82.435 37.008  1.00 55.33  ? 525  GLN F C     1 
ATOM   7324 O  O     . GLN F 2 82  ? 9.109   -82.539 38.109  1.00 54.57  ? 525  GLN F O     1 
ATOM   7325 C  CB    . GLN F 2 82  ? 11.792  -81.337 37.497  1.00 53.33  ? 525  GLN F CB    1 
ATOM   7326 C  CG    . GLN F 2 82  ? 12.714  -80.180 37.251  1.00 53.21  ? 525  GLN F CG    1 
ATOM   7327 C  CD    . GLN F 2 82  ? 14.071  -80.414 37.841  1.00 54.41  ? 525  GLN F CD    1 
ATOM   7328 O  OE1   . GLN F 2 82  ? 14.331  -80.035 38.988  1.00 61.83  ? 525  GLN F OE1   1 
ATOM   7329 N  NE2   . GLN F 2 82  ? 14.954  -81.035 37.077  1.00 53.52  ? 525  GLN F NE2   1 
ATOM   7330 N  N     . ASP F 2 83  ? 9.570   -83.347 36.043  1.00 60.95  ? 526  ASP F N     1 
ATOM   7331 C  CA    . ASP F 2 83  ? 8.787   -84.575 36.237  1.00 64.24  ? 526  ASP F CA    1 
ATOM   7332 C  C     . ASP F 2 83  ? 9.576   -85.569 37.109  1.00 61.46  ? 526  ASP F C     1 
ATOM   7333 O  O     . ASP F 2 83  ? 10.662  -85.247 37.595  1.00 56.68  ? 526  ASP F O     1 
ATOM   7334 C  CB    . ASP F 2 83  ? 8.362   -85.185 34.894  1.00 62.24  ? 526  ASP F CB    1 
ATOM   7335 C  CG    . ASP F 2 83  ? 9.547   -85.642 34.033  1.00 64.23  ? 526  ASP F CG    1 
ATOM   7336 O  OD1   . ASP F 2 83  ? 10.691  -85.789 34.535  1.00 56.32  ? 526  ASP F OD1   1 
ATOM   7337 O  OD2   . ASP F 2 83  ? 9.317   -85.870 32.821  1.00 69.83  ? 526  ASP F OD2   1 
ATOM   7338 N  N     . ASN F 2 84  ? 9.023   -86.756 37.327  1.00 57.19  ? 527  ASN F N     1 
ATOM   7339 C  CA    . ASN F 2 84  ? 9.721   -87.784 38.095  1.00 54.32  ? 527  ASN F CA    1 
ATOM   7340 C  C     . ASN F 2 84  ? 11.102  -88.173 37.632  1.00 52.82  ? 527  ASN F C     1 
ATOM   7341 O  O     . ASN F 2 84  ? 11.818  -88.779 38.393  1.00 57.30  ? 527  ASN F O     1 
ATOM   7342 C  CB    . ASN F 2 84  ? 8.881   -89.049 38.237  1.00 62.17  ? 527  ASN F CB    1 
ATOM   7343 C  CG    . ASN F 2 84  ? 8.581   -89.764 36.905  1.00 72.78  ? 527  ASN F CG    1 
ATOM   7344 O  OD1   . ASN F 2 84  ? 7.967   -90.824 36.926  1.00 76.40  ? 527  ASN F OD1   1 
ATOM   7345 N  ND2   . ASN F 2 84  ? 8.977   -89.205 35.768  1.00 78.36  ? 527  ASN F ND2   1 
ATOM   7346 N  N     . ASN F 2 85  ? 11.480  -87.846 36.401  1.00 55.31  ? 528  ASN F N     1 
ATOM   7347 C  CA    . ASN F 2 85  ? 12.836  -88.092 35.898  1.00 55.95  ? 528  ASN F CA    1 
ATOM   7348 C  C     . ASN F 2 85  ? 13.687  -86.844 35.862  1.00 58.81  ? 528  ASN F C     1 
ATOM   7349 O  O     . ASN F 2 85  ? 14.802  -86.860 35.331  1.00 50.74  ? 528  ASN F O     1 
ATOM   7350 C  CB    . ASN F 2 85  ? 12.771  -88.636 34.485  1.00 55.78  ? 528  ASN F CB    1 
ATOM   7351 C  CG    . ASN F 2 85  ? 12.040  -89.934 34.413  1.00 58.10  ? 528  ASN F CG    1 
ATOM   7352 O  OD1   . ASN F 2 85  ? 11.063  -90.073 33.692  1.00 58.38  ? 528  ASN F OD1   1 
ATOM   7353 N  ND2   . ASN F 2 85  ? 12.502  -90.904 35.172  1.00 68.34  ? 528  ASN F ND2   1 
ATOM   7354 N  N     . GLY F 2 86  ? 13.133  -85.754 36.387  1.00 66.83  ? 529  GLY F N     1 
ATOM   7355 C  CA    . GLY F 2 86  ? 13.823  -84.476 36.450  1.00 66.78  ? 529  GLY F CA    1 
ATOM   7356 C  C     . GLY F 2 86  ? 13.754  -83.685 35.161  1.00 63.16  ? 529  GLY F C     1 
ATOM   7357 O  O     . GLY F 2 86  ? 14.542  -82.773 34.961  1.00 68.99  ? 529  GLY F O     1 
ATOM   7358 N  N     . ASN F 2 87  ? 12.826  -84.033 34.274  1.00 59.34  ? 530  ASN F N     1 
ATOM   7359 C  CA    . ASN F 2 87  ? 12.758  -83.393 32.950  1.00 57.43  ? 530  ASN F CA    1 
ATOM   7360 C  C     . ASN F 2 87  ? 11.753  -82.270 32.931  1.00 58.36  ? 530  ASN F C     1 
ATOM   7361 O  O     . ASN F 2 87  ? 10.596  -82.451 33.340  1.00 61.60  ? 530  ASN F O     1 
ATOM   7362 C  CB    . ASN F 2 87  ? 12.372  -84.399 31.888  1.00 58.33  ? 530  ASN F CB    1 
ATOM   7363 C  CG    . ASN F 2 87  ? 13.510  -85.307 31.533  1.00 60.84  ? 530  ASN F CG    1 
ATOM   7364 O  OD1   . ASN F 2 87  ? 14.686  -84.902 31.474  1.00 59.43  ? 530  ASN F OD1   1 
ATOM   7365 N  ND2   . ASN F 2 87  ? 13.174  -86.549 31.280  1.00 66.41  ? 530  ASN F ND2   1 
ATOM   7366 N  N     . THR F 2 88  ? 12.198  -81.129 32.432  1.00 52.90  ? 531  THR F N     1 
ATOM   7367 C  CA    . THR F 2 88  ? 11.314  -80.039 32.065  1.00 51.69  ? 531  THR F CA    1 
ATOM   7368 C  C     . THR F 2 88  ? 10.636  -80.311 30.720  1.00 51.60  ? 531  THR F C     1 
ATOM   7369 O  O     . THR F 2 88  ? 11.070  -81.163 29.941  1.00 50.60  ? 531  THR F O     1 
ATOM   7370 C  CB    . THR F 2 88  ? 12.104  -78.739 31.917  1.00 55.33  ? 531  THR F CB    1 
ATOM   7371 O  OG1   . THR F 2 88  ? 12.988  -78.836 30.793  1.00 60.78  ? 531  THR F OG1   1 
ATOM   7372 C  CG2   . THR F 2 88  ? 12.935  -78.473 33.145  1.00 57.64  ? 531  THR F CG2   1 
ATOM   7373 N  N     . PRO F 2 89  ? 9.594   -79.554 30.400  1.00 51.28  ? 532  PRO F N     1 
ATOM   7374 C  CA    . PRO F 2 89  ? 9.068   -79.710 29.063  1.00 50.87  ? 532  PRO F CA    1 
ATOM   7375 C  C     . PRO F 2 89  ? 10.143  -79.505 28.005  1.00 53.59  ? 532  PRO F C     1 
ATOM   7376 O  O     . PRO F 2 89  ? 10.093  -80.131 26.956  1.00 51.04  ? 532  PRO F O     1 
ATOM   7377 C  CB    . PRO F 2 89  ? 7.979   -78.638 28.984  1.00 48.79  ? 532  PRO F CB    1 
ATOM   7378 C  CG    . PRO F 2 89  ? 7.554   -78.468 30.382  1.00 52.22  ? 532  PRO F CG    1 
ATOM   7379 C  CD    . PRO F 2 89  ? 8.849   -78.546 31.152  1.00 54.44  ? 532  PRO F CD    1 
ATOM   7380 N  N     . LEU F 2 90  ? 11.112  -78.638 28.271  1.00 61.72  ? 533  LEU F N     1 
ATOM   7381 C  CA    . LEU F 2 90  ? 12.200  -78.464 27.317  1.00 61.37  ? 533  LEU F CA    1 
ATOM   7382 C  C     . LEU F 2 90  ? 12.989  -79.748 27.105  1.00 60.15  ? 533  LEU F C     1 
ATOM   7383 O  O     . LEU F 2 90  ? 13.224  -80.124 25.961  1.00 63.24  ? 533  LEU F O     1 
ATOM   7384 C  CB    . LEU F 2 90  ? 13.127  -77.339 27.724  1.00 58.92  ? 533  LEU F CB    1 
ATOM   7385 C  CG    . LEU F 2 90  ? 14.260  -77.086 26.741  1.00 62.76  ? 533  LEU F CG    1 
ATOM   7386 C  CD1   . LEU F 2 90  ? 13.735  -76.780 25.359  1.00 64.88  ? 533  LEU F CD1   1 
ATOM   7387 C  CD2   . LEU F 2 90  ? 15.114  -75.923 27.213  1.00 66.52  ? 533  LEU F CD2   1 
ATOM   7388 N  N     . HIS F 2 91  ? 13.359  -80.429 28.186  1.00 57.72  ? 534  HIS F N     1 
ATOM   7389 C  CA    . HIS F 2 91  ? 14.036  -81.725 28.069  1.00 60.09  ? 534  HIS F CA    1 
ATOM   7390 C  C     . HIS F 2 91  ? 13.227  -82.693 27.219  1.00 60.70  ? 534  HIS F C     1 
ATOM   7391 O  O     . HIS F 2 91  ? 13.792  -83.490 26.488  1.00 57.10  ? 534  HIS F O     1 
ATOM   7392 C  CB    . HIS F 2 91  ? 14.245  -82.420 29.421  1.00 59.37  ? 534  HIS F CB    1 
ATOM   7393 C  CG    . HIS F 2 91  ? 15.283  -81.796 30.286  1.00 57.80  ? 534  HIS F CG    1 
ATOM   7394 N  ND1   . HIS F 2 91  ? 15.026  -80.679 31.045  1.00 57.44  ? 534  HIS F ND1   1 
ATOM   7395 C  CD2   . HIS F 2 91  ? 16.565  -82.143 30.544  1.00 54.95  ? 534  HIS F CD2   1 
ATOM   7396 C  CE1   . HIS F 2 91  ? 16.109  -80.344 31.715  1.00 56.26  ? 534  HIS F CE1   1 
ATOM   7397 N  NE2   . HIS F 2 91  ? 17.060  -81.213 31.425  1.00 58.15  ? 534  HIS F NE2   1 
ATOM   7398 N  N     . LEU F 2 92  ? 11.907  -82.665 27.341  1.00 57.94  ? 535  LEU F N     1 
ATOM   7399 C  CA    . LEU F 2 92  ? 11.116  -83.594 26.558  1.00 59.37  ? 535  LEU F CA    1 
ATOM   7400 C  C     . LEU F 2 92  ? 11.153  -83.234 25.082  1.00 63.90  ? 535  LEU F C     1 
ATOM   7401 O  O     . LEU F 2 92  ? 11.489  -84.088 24.242  1.00 72.67  ? 535  LEU F O     1 
ATOM   7402 C  CB    . LEU F 2 92  ? 9.679   -83.657 27.057  1.00 54.45  ? 535  LEU F CB    1 
ATOM   7403 C  CG    . LEU F 2 92  ? 9.520   -84.204 28.471  1.00 51.86  ? 535  LEU F CG    1 
ATOM   7404 C  CD1   . LEU F 2 92  ? 8.060   -84.531 28.750  1.00 51.32  ? 535  LEU F CD1   1 
ATOM   7405 C  CD2   . LEU F 2 92  ? 10.376  -85.436 28.698  1.00 51.40  ? 535  LEU F CD2   1 
ATOM   7406 N  N     . ALA F 2 93  ? 10.831  -81.978 24.775  1.00 65.52  ? 536  ALA F N     1 
ATOM   7407 C  CA    . ALA F 2 93  ? 10.943  -81.448 23.412  1.00 66.37  ? 536  ALA F CA    1 
ATOM   7408 C  C     . ALA F 2 93  ? 12.302  -81.741 22.759  1.00 65.45  ? 536  ALA F C     1 
ATOM   7409 O  O     . ALA F 2 93  ? 12.362  -82.024 21.565  1.00 60.62  ? 536  ALA F O     1 
ATOM   7410 C  CB    . ALA F 2 93  ? 10.678  -79.956 23.394  1.00 66.82  ? 536  ALA F CB    1 
ATOM   7411 N  N     . CYS F 2 94  ? 13.381  -81.707 23.531  1.00 64.06  ? 537  CYS F N     1 
ATOM   7412 C  CA    . CYS F 2 94  ? 14.692  -82.042 22.987  1.00 66.27  ? 537  CYS F CA    1 
ATOM   7413 C  C     . CYS F 2 94  ? 14.875  -83.525 22.719  1.00 72.72  ? 537  CYS F C     1 
ATOM   7414 O  O     . CYS F 2 94  ? 15.487  -83.870 21.728  1.00 88.15  ? 537  CYS F O     1 
ATOM   7415 C  CB    . CYS F 2 94  ? 15.824  -81.559 23.890  1.00 66.18  ? 537  CYS F CB    1 
ATOM   7416 S  SG    . CYS F 2 94  ? 15.994  -79.762 23.901  1.00 64.40  ? 537  CYS F SG    1 
ATOM   7417 N  N     . THR F 2 95  ? 14.366  -84.409 23.574  1.00 80.85  ? 538  THR F N     1 
ATOM   7418 C  CA    . THR F 2 95  ? 14.572  -85.855 23.347  1.00 84.12  ? 538  THR F CA    1 
ATOM   7419 C  C     . THR F 2 95  ? 13.779  -86.360 22.147  1.00 77.74  ? 538  THR F C     1 
ATOM   7420 O  O     . THR F 2 95  ? 14.128  -87.385 21.575  1.00 73.61  ? 538  THR F O     1 
ATOM   7421 C  CB    . THR F 2 95  ? 14.104  -86.753 24.507  1.00 89.70  ? 538  THR F CB    1 
ATOM   7422 O  OG1   . THR F 2 95  ? 12.675  -86.678 24.601  1.00 93.97  ? 538  THR F OG1   1 
ATOM   7423 C  CG2   . THR F 2 95  ? 14.761  -86.398 25.852  1.00 87.08  ? 538  THR F CG2   1 
ATOM   7424 N  N     . TYR F 2 96  ? 12.696  -85.664 21.796  1.00 70.15  ? 539  TYR F N     1 
ATOM   7425 C  CA    . TYR F 2 96  ? 11.885  -86.045 20.637  1.00 70.19  ? 539  TYR F CA    1 
ATOM   7426 C  C     . TYR F 2 96  ? 12.042  -85.129 19.418  1.00 72.33  ? 539  TYR F C     1 
ATOM   7427 O  O     . TYR F 2 96  ? 11.228  -85.161 18.498  1.00 74.42  ? 539  TYR F O     1 
ATOM   7428 C  CB    . TYR F 2 96  ? 10.429  -86.159 21.059  1.00 67.03  ? 539  TYR F CB    1 
ATOM   7429 C  CG    . TYR F 2 96  ? 10.226  -87.213 22.107  1.00 79.30  ? 539  TYR F CG    1 
ATOM   7430 C  CD1   . TYR F 2 96  ? 11.161  -88.246 22.280  1.00 86.84  ? 539  TYR F CD1   1 
ATOM   7431 C  CD2   . TYR F 2 96  ? 9.101   -87.205 22.927  1.00 86.74  ? 539  TYR F CD2   1 
ATOM   7432 C  CE1   . TYR F 2 96  ? 10.987  -89.223 23.229  1.00 89.91  ? 539  TYR F CE1   1 
ATOM   7433 C  CE2   . TYR F 2 96  ? 8.922   -88.195 23.879  1.00 88.29  ? 539  TYR F CE2   1 
ATOM   7434 C  CZ    . TYR F 2 96  ? 9.872   -89.182 24.021  1.00 89.17  ? 539  TYR F CZ    1 
ATOM   7435 O  OH    . TYR F 2 96  ? 9.718   -90.141 24.962  1.00 94.34  ? 539  TYR F OH    1 
ATOM   7436 N  N     . GLY F 2 97  ? 13.115  -84.338 19.413  1.00 77.64  ? 540  GLY F N     1 
ATOM   7437 C  CA    . GLY F 2 97  ? 13.369  -83.308 18.392  1.00 73.19  ? 540  GLY F CA    1 
ATOM   7438 C  C     . GLY F 2 97  ? 12.172  -82.533 17.843  1.00 69.27  ? 540  GLY F C     1 
ATOM   7439 O  O     . GLY F 2 97  ? 12.011  -82.433 16.643  1.00 63.86  ? 540  GLY F O     1 
ATOM   7440 N  N     . HIS F 2 98  ? 11.339  -81.965 18.700  1.00 67.47  ? 541  HIS F N     1 
ATOM   7441 C  CA    . HIS F 2 98  ? 10.377  -80.992 18.225  1.00 69.99  ? 541  HIS F CA    1 
ATOM   7442 C  C     . HIS F 2 98  ? 10.985  -79.598 18.288  1.00 71.16  ? 541  HIS F C     1 
ATOM   7443 O  O     . HIS F 2 98  ? 10.766  -78.828 19.228  1.00 72.08  ? 541  HIS F O     1 
ATOM   7444 C  CB    . HIS F 2 98  ? 9.079   -81.049 19.017  1.00 78.10  ? 541  HIS F CB    1 
ATOM   7445 C  CG    . HIS F 2 98  ? 8.428   -82.402 19.030  1.00 80.85  ? 541  HIS F CG    1 
ATOM   7446 N  ND1   . HIS F 2 98  ? 8.957   -83.485 19.699  1.00 79.29  ? 541  HIS F ND1   1 
ATOM   7447 C  CD2   . HIS F 2 98  ? 7.284   -82.840 18.462  1.00 83.05  ? 541  HIS F CD2   1 
ATOM   7448 C  CE1   . HIS F 2 98  ? 8.163   -84.528 19.546  1.00 76.70  ? 541  HIS F CE1   1 
ATOM   7449 N  NE2   . HIS F 2 98  ? 7.132   -84.159 18.812  1.00 80.98  ? 541  HIS F NE2   1 
ATOM   7450 N  N     . GLU F 2 99  ? 11.754  -79.284 17.260  1.00 72.50  ? 542  GLU F N     1 
ATOM   7451 C  CA    . GLU F 2 99  ? 12.448  -78.021 17.181  1.00 75.72  ? 542  GLU F CA    1 
ATOM   7452 C  C     . GLU F 2 99  ? 11.474  -76.854 17.299  1.00 72.18  ? 542  GLU F C     1 
ATOM   7453 O  O     . GLU F 2 99  ? 11.789  -75.857 17.944  1.00 80.91  ? 542  GLU F O     1 
ATOM   7454 C  CB    . GLU F 2 99  ? 13.223  -77.957 15.868  1.00 82.14  ? 542  GLU F CB    1 
ATOM   7455 C  CG    . GLU F 2 99  ? 14.260  -76.848 15.756  1.00 88.50  ? 542  GLU F CG    1 
ATOM   7456 C  CD    . GLU F 2 99  ? 14.809  -76.746 14.346  1.00 96.05  ? 542  GLU F CD    1 
ATOM   7457 O  OE1   . GLU F 2 99  ? 14.815  -77.786 13.622  1.00 100.40 ? 542  GLU F OE1   1 
ATOM   7458 O  OE2   . GLU F 2 99  ? 15.226  -75.628 13.958  1.00 97.89  ? 542  GLU F OE2   1 
ATOM   7459 N  N     . ASP F 2 100 ? 10.295  -76.965 16.701  1.00 68.11  ? 543  ASP F N     1 
ATOM   7460 C  CA    . ASP F 2 100 ? 9.337   -75.858 16.753  1.00 70.35  ? 543  ASP F CA    1 
ATOM   7461 C  C     . ASP F 2 100 ? 8.916   -75.534 18.194  1.00 64.89  ? 543  ASP F C     1 
ATOM   7462 O  O     . ASP F 2 100 ? 8.692   -74.360 18.545  1.00 55.12  ? 543  ASP F O     1 
ATOM   7463 C  CB    . ASP F 2 100 ? 8.125   -76.114 15.838  1.00 79.32  ? 543  ASP F CB    1 
ATOM   7464 C  CG    . ASP F 2 100 ? 7.338   -77.389 16.201  1.00 90.80  ? 543  ASP F CG    1 
ATOM   7465 O  OD1   . ASP F 2 100 ? 7.927   -78.359 16.730  1.00 100.20 ? 543  ASP F OD1   1 
ATOM   7466 O  OD2   . ASP F 2 100 ? 6.121   -77.424 15.915  1.00 84.91  ? 543  ASP F OD2   1 
ATOM   7467 N  N     . CYS F 2 101 ? 8.857   -76.577 19.025  1.00 62.78  ? 544  CYS F N     1 
ATOM   7468 C  CA    . CYS F 2 101 ? 8.468   -76.444 20.432  1.00 62.87  ? 544  CYS F CA    1 
ATOM   7469 C  C     . CYS F 2 101 ? 9.630   -75.924 21.277  1.00 59.36  ? 544  CYS F C     1 
ATOM   7470 O  O     . CYS F 2 101 ? 9.470   -75.043 22.116  1.00 51.43  ? 544  CYS F O     1 
ATOM   7471 C  CB    . CYS F 2 101 ? 7.971   -77.795 20.977  1.00 60.64  ? 544  CYS F CB    1 
ATOM   7472 S  SG    . CYS F 2 101 ? 6.251   -78.117 20.515  1.00 64.75  ? 544  CYS F SG    1 
ATOM   7473 N  N     . VAL F 2 102 ? 10.799  -76.508 21.060  1.00 58.53  ? 545  VAL F N     1 
ATOM   7474 C  CA    . VAL F 2 102 ? 12.021  -76.037 21.684  1.00 56.70  ? 545  VAL F CA    1 
ATOM   7475 C  C     . VAL F 2 102 ? 12.077  -74.533 21.572  1.00 59.10  ? 545  VAL F C     1 
ATOM   7476 O  O     . VAL F 2 102 ? 12.172  -73.831 22.561  1.00 61.81  ? 545  VAL F O     1 
ATOM   7477 C  CB    . VAL F 2 102 ? 13.259  -76.648 20.999  1.00 61.33  ? 545  VAL F CB    1 
ATOM   7478 C  CG1   . VAL F 2 102 ? 14.535  -75.938 21.426  1.00 61.57  ? 545  VAL F CG1   1 
ATOM   7479 C  CG2   . VAL F 2 102 ? 13.355  -78.137 21.307  1.00 66.24  ? 545  VAL F CG2   1 
ATOM   7480 N  N     . LYS F 2 103 ? 12.002  -74.044 20.343  1.00 61.68  ? 546  LYS F N     1 
ATOM   7481 C  CA    . LYS F 2 103 ? 12.061  -72.609 20.082  1.00 62.24  ? 546  LYS F CA    1 
ATOM   7482 C  C     . LYS F 2 103 ? 11.010  -71.818 20.868  1.00 59.40  ? 546  LYS F C     1 
ATOM   7483 O  O     . LYS F 2 103 ? 11.317  -70.802 21.484  1.00 55.34  ? 546  LYS F O     1 
ATOM   7484 C  CB    . LYS F 2 103 ? 11.869  -72.330 18.595  1.00 61.56  ? 546  LYS F CB    1 
ATOM   7485 C  CG    . LYS F 2 103 ? 13.077  -72.650 17.740  1.00 64.16  ? 546  LYS F CG    1 
ATOM   7486 C  CD    . LYS F 2 103 ? 12.755  -72.371 16.286  1.00 67.34  ? 546  LYS F CD    1 
ATOM   7487 C  CE    . LYS F 2 103 ? 13.906  -72.729 15.362  1.00 67.90  ? 546  LYS F CE    1 
ATOM   7488 N  NZ    . LYS F 2 103 ? 13.382  -72.912 13.984  1.00 68.97  ? 546  LYS F NZ    1 
ATOM   7489 N  N     . ALA F 2 104 ? 9.770   -72.276 20.824  1.00 56.00  ? 547  ALA F N     1 
ATOM   7490 C  CA    . ALA F 2 104 ? 8.746   -71.608 21.585  1.00 54.79  ? 547  ALA F CA    1 
ATOM   7491 C  C     . ALA F 2 104 ? 9.226   -71.482 23.009  1.00 53.41  ? 547  ALA F C     1 
ATOM   7492 O  O     . ALA F 2 104 ? 9.132   -70.401 23.598  1.00 56.18  ? 547  ALA F O     1 
ATOM   7493 C  CB    . ALA F 2 104 ? 7.420   -72.345 21.507  1.00 54.74  ? 547  ALA F CB    1 
ATOM   7494 N  N     . LEU F 2 105 ? 9.769   -72.565 23.558  1.00 51.69  ? 548  LEU F N     1 
ATOM   7495 C  CA    . LEU F 2 105 ? 10.166  -72.544 24.973  1.00 51.22  ? 548  LEU F CA    1 
ATOM   7496 C  C     . LEU F 2 105 ? 11.277  -71.558 25.201  1.00 46.69  ? 548  LEU F C     1 
ATOM   7497 O  O     . LEU F 2 105 ? 11.218  -70.730 26.107  1.00 45.33  ? 548  LEU F O     1 
ATOM   7498 C  CB    . LEU F 2 105 ? 10.580  -73.923 25.470  1.00 52.64  ? 548  LEU F CB    1 
ATOM   7499 C  CG    . LEU F 2 105 ? 9.420   -74.923 25.588  1.00 56.57  ? 548  LEU F CG    1 
ATOM   7500 C  CD1   . LEU F 2 105 ? 9.949   -76.346 25.675  1.00 56.82  ? 548  LEU F CD1   1 
ATOM   7501 C  CD2   . LEU F 2 105 ? 8.545   -74.602 26.791  1.00 59.29  ? 548  LEU F CD2   1 
ATOM   7502 N  N     . VAL F 2 106 ? 12.270  -71.607 24.346  1.00 46.83  ? 549  VAL F N     1 
ATOM   7503 C  CA    . VAL F 2 106 ? 13.410  -70.747 24.519  1.00 52.81  ? 549  VAL F CA    1 
ATOM   7504 C  C     . VAL F 2 106 ? 13.038  -69.268 24.390  1.00 55.53  ? 549  VAL F C     1 
ATOM   7505 O  O     . VAL F 2 106 ? 13.484  -68.446 25.202  1.00 55.41  ? 549  VAL F O     1 
ATOM   7506 C  CB    . VAL F 2 106 ? 14.501  -71.108 23.516  1.00 59.03  ? 549  VAL F CB    1 
ATOM   7507 C  CG1   . VAL F 2 106 ? 15.623  -70.105 23.597  1.00 61.83  ? 549  VAL F CG1   1 
ATOM   7508 C  CG2   . VAL F 2 106 ? 15.031  -72.512 23.795  1.00 63.22  ? 549  VAL F CG2   1 
ATOM   7509 N  N     . TYR F 2 107 ? 12.233  -68.923 23.378  1.00 57.29  ? 550  TYR F N     1 
ATOM   7510 C  CA    . TYR F 2 107 ? 12.018  -67.511 23.034  1.00 53.66  ? 550  TYR F CA    1 
ATOM   7511 C  C     . TYR F 2 107 ? 10.827  -66.908 23.699  1.00 50.37  ? 550  TYR F C     1 
ATOM   7512 O  O     . TYR F 2 107 ? 10.673  -65.701 23.661  1.00 59.15  ? 550  TYR F O     1 
ATOM   7513 C  CB    . TYR F 2 107 ? 11.846  -67.315 21.536  1.00 54.00  ? 550  TYR F CB    1 
ATOM   7514 C  CG    . TYR F 2 107 ? 13.103  -67.471 20.708  1.00 55.76  ? 550  TYR F CG    1 
ATOM   7515 C  CD1   . TYR F 2 107 ? 13.503  -68.719 20.265  1.00 57.30  ? 550  TYR F CD1   1 
ATOM   7516 C  CD2   . TYR F 2 107 ? 13.859  -66.362 20.310  1.00 58.15  ? 550  TYR F CD2   1 
ATOM   7517 C  CE1   . TYR F 2 107 ? 14.637  -68.877 19.480  1.00 59.86  ? 550  TYR F CE1   1 
ATOM   7518 C  CE2   . TYR F 2 107 ? 14.992  -66.510 19.516  1.00 58.25  ? 550  TYR F CE2   1 
ATOM   7519 C  CZ    . TYR F 2 107 ? 15.373  -67.776 19.109  1.00 56.71  ? 550  TYR F CZ    1 
ATOM   7520 O  OH    . TYR F 2 107 ? 16.472  -67.977 18.348  1.00 46.14  ? 550  TYR F OH    1 
ATOM   7521 N  N     . TYR F 2 108 ? 9.933   -67.716 24.243  1.00 53.33  ? 551  TYR F N     1 
ATOM   7522 C  CA    . TYR F 2 108 ? 8.688   -67.153 24.752  1.00 61.91  ? 551  TYR F CA    1 
ATOM   7523 C  C     . TYR F 2 108 ? 9.129   -66.166 25.795  1.00 68.70  ? 551  TYR F C     1 
ATOM   7524 O  O     . TYR F 2 108 ? 8.710   -65.006 25.841  1.00 66.27  ? 551  TYR F O     1 
ATOM   7525 C  CB    . TYR F 2 108 ? 7.727   -68.207 25.362  1.00 61.40  ? 551  TYR F CB    1 
ATOM   7526 C  CG    . TYR F 2 108 ? 6.448   -67.544 25.852  1.00 58.60  ? 551  TYR F CG    1 
ATOM   7527 C  CD1   . TYR F 2 108 ? 5.468   -67.141 24.951  1.00 62.68  ? 551  TYR F CD1   1 
ATOM   7528 C  CD2   . TYR F 2 108 ? 6.251   -67.245 27.179  1.00 53.56  ? 551  TYR F CD2   1 
ATOM   7529 C  CE1   . TYR F 2 108 ? 4.301   -66.486 25.371  1.00 63.33  ? 551  TYR F CE1   1 
ATOM   7530 C  CE2   . TYR F 2 108 ? 5.093   -66.588 27.601  1.00 54.11  ? 551  TYR F CE2   1 
ATOM   7531 C  CZ    . TYR F 2 108 ? 4.122   -66.208 26.695  1.00 56.46  ? 551  TYR F CZ    1 
ATOM   7532 O  OH    . TYR F 2 108 ? 2.978   -65.551 27.079  1.00 57.41  ? 551  TYR F OH    1 
ATOM   7533 N  N     . ASP F 2 109 ? 10.037  -66.668 26.615  1.00 88.78  ? 552  ASP F N     1 
ATOM   7534 C  CA    . ASP F 2 109 ? 10.008  -66.473 28.051  1.00 101.67 ? 552  ASP F CA    1 
ATOM   7535 C  C     . ASP F 2 109 ? 10.559  -65.091 28.298  1.00 103.77 ? 552  ASP F C     1 
ATOM   7536 O  O     . ASP F 2 109 ? 10.386  -64.552 29.394  1.00 90.76  ? 552  ASP F O     1 
ATOM   7537 C  CB    . ASP F 2 109 ? 10.796  -67.622 28.737  1.00 102.33 ? 552  ASP F CB    1 
ATOM   7538 C  CG    . ASP F 2 109 ? 9.920   -68.992 28.850  1.00 110.93 ? 552  ASP F CG    1 
ATOM   7539 O  OD1   . ASP F 2 109 ? 8.627   -68.987 28.965  1.00 87.25  ? 552  ASP F OD1   1 
ATOM   7540 O  OD2   . ASP F 2 109 ? 10.535  -70.099 28.779  1.00 93.29  ? 552  ASP F OD2   1 
ATOM   7541 N  N     . VAL F 2 110 ? 11.098  -64.510 27.203  1.00 123.86 ? 553  VAL F N     1 
ATOM   7542 C  CA    . VAL F 2 110 ? 11.984  -63.327 27.146  1.00 129.76 ? 553  VAL F CA    1 
ATOM   7543 C  C     . VAL F 2 110 ? 13.176  -63.608 28.086  1.00 138.71 ? 553  VAL F C     1 
ATOM   7544 O  O     . VAL F 2 110 ? 13.435  -62.903 29.080  1.00 133.75 ? 553  VAL F O     1 
ATOM   7545 C  CB    . VAL F 2 110 ? 11.226  -61.948 27.309  1.00 118.09 ? 553  VAL F CB    1 
ATOM   7546 C  CG1   . VAL F 2 110 ? 11.288  -61.141 26.020  1.00 98.76  ? 553  VAL F CG1   1 
ATOM   7547 C  CG2   . VAL F 2 110 ? 9.746   -62.131 27.661  1.00 120.21 ? 553  VAL F CG2   1 
ATOM   7548 N  N     . GLU F 2 111 ? 13.850  -64.713 27.740  1.00 124.75 ? 554  GLU F N     1 
ATOM   7549 C  CA    . GLU F 2 111 ? 15.110  -65.135 28.313  1.00 119.89 ? 554  GLU F CA    1 
ATOM   7550 C  C     . GLU F 2 111 ? 14.910  -66.040 29.511  1.00 125.75 ? 554  GLU F C     1 
ATOM   7551 O  O     . GLU F 2 111 ? 15.707  -66.955 29.690  1.00 127.69 ? 554  GLU F O     1 
ATOM   7552 C  CB    . GLU F 2 111 ? 16.014  -63.962 28.707  1.00 130.73 ? 554  GLU F CB    1 
ATOM   7553 C  CG    . GLU F 2 111 ? 15.890  -63.527 30.180  1.00 137.20 ? 554  GLU F CG    1 
ATOM   7554 C  CD    . GLU F 2 111 ? 17.207  -63.637 30.925  1.00 143.62 ? 554  GLU F CD    1 
ATOM   7555 O  OE1   . GLU F 2 111 ? 17.714  -64.769 31.069  1.00 140.88 ? 554  GLU F OE1   1 
ATOM   7556 O  OE2   . GLU F 2 111 ? 17.741  -62.590 31.353  1.00 143.07 ? 554  GLU F OE2   1 
ATOM   7557 N  N     . SER F 2 112 ? 13.878  -65.803 30.333  1.00 126.35 ? 555  SER F N     1 
ATOM   7558 C  CA    . SER F 2 112 ? 13.708  -66.552 31.589  1.00 129.63 ? 555  SER F CA    1 
ATOM   7559 C  C     . SER F 2 112 ? 13.235  -68.003 31.273  1.00 153.03 ? 555  SER F C     1 
ATOM   7560 O  O     . SER F 2 112 ? 12.311  -68.566 31.911  1.00 138.14 ? 555  SER F O     1 
ATOM   7561 C  CB    . SER F 2 112 ? 12.790  -65.802 32.560  1.00 113.91 ? 555  SER F CB    1 
ATOM   7562 O  OG    . SER F 2 112 ? 11.601  -66.522 32.830  1.00 112.23 ? 555  SER F OG    1 
ATOM   7563 N  N     . CYS F 2 113 ? 13.910  -68.576 30.263  1.00 155.94 ? 556  CYS F N     1 
ATOM   7564 C  CA    . CYS F 2 113 ? 14.122  -70.022 30.108  1.00 127.06 ? 556  CYS F CA    1 
ATOM   7565 C  C     . CYS F 2 113 ? 15.599  -70.333 30.405  1.00 104.53 ? 556  CYS F C     1 
ATOM   7566 O  O     . CYS F 2 113 ? 16.488  -69.895 29.683  1.00 95.08  ? 556  CYS F O     1 
ATOM   7567 C  CB    . CYS F 2 113 ? 13.730  -70.510 28.694  1.00 126.17 ? 556  CYS F CB    1 
ATOM   7568 S  SG    . CYS F 2 113 ? 13.026  -72.200 28.557  1.00 116.98 ? 556  CYS F SG    1 
ATOM   7569 N  N     . ARG F 2 114 ? 15.843  -71.060 31.488  1.00 88.31  ? 557  ARG F N     1 
ATOM   7570 C  CA    . ARG F 2 114 ? 17.181  -71.553 31.831  1.00 85.80  ? 557  ARG F CA    1 
ATOM   7571 C  C     . ARG F 2 114 ? 17.489  -72.797 31.046  1.00 81.30  ? 557  ARG F C     1 
ATOM   7572 O  O     . ARG F 2 114 ? 16.647  -73.664 30.924  1.00 84.76  ? 557  ARG F O     1 
ATOM   7573 C  CB    . ARG F 2 114 ? 17.259  -71.887 33.313  1.00 91.70  ? 557  ARG F CB    1 
ATOM   7574 C  CG    . ARG F 2 114 ? 16.954  -70.711 34.228  1.00 95.32  ? 557  ARG F CG    1 
ATOM   7575 C  CD    . ARG F 2 114 ? 17.671  -70.861 35.543  1.00 92.52  ? 557  ARG F CD    1 
ATOM   7576 N  NE    . ARG F 2 114 ? 17.039  -71.841 36.422  1.00 87.27  ? 557  ARG F NE    1 
ATOM   7577 C  CZ    . ARG F 2 114 ? 17.681  -72.792 37.098  1.00 86.02  ? 557  ARG F CZ    1 
ATOM   7578 N  NH1   . ARG F 2 114 ? 18.998  -72.948 37.004  1.00 78.02  ? 557  ARG F NH1   1 
ATOM   7579 N  NH2   . ARG F 2 114 ? 16.995  -73.612 37.891  1.00 98.81  ? 557  ARG F NH2   1 
ATOM   7580 N  N     . LEU F 2 115 ? 18.700  -72.869 30.510  1.00 84.51  ? 558  LEU F N     1 
ATOM   7581 C  CA    . LEU F 2 115 ? 19.140  -73.988 29.671  1.00 83.72  ? 558  LEU F CA    1 
ATOM   7582 C  C     . LEU F 2 115 ? 20.084  -74.925 30.398  1.00 82.63  ? 558  LEU F C     1 
ATOM   7583 O  O     . LEU F 2 115 ? 20.636  -75.848 29.804  1.00 88.69  ? 558  LEU F O     1 
ATOM   7584 C  CB    . LEU F 2 115 ? 19.849  -73.454 28.414  1.00 83.35  ? 558  LEU F CB    1 
ATOM   7585 C  CG    . LEU F 2 115 ? 19.157  -72.307 27.669  1.00 80.61  ? 558  LEU F CG    1 
ATOM   7586 C  CD1   . LEU F 2 115 ? 20.029  -71.830 26.520  1.00 81.98  ? 558  LEU F CD1   1 
ATOM   7587 C  CD2   . LEU F 2 115 ? 17.801  -72.747 27.152  1.00 80.38  ? 558  LEU F CD2   1 
ATOM   7588 N  N     . ASP F 2 116 ? 20.312  -74.636 31.669  1.00 87.65  ? 559  ASP F N     1 
ATOM   7589 C  CA    . ASP F 2 116 ? 21.316  -75.329 32.455  1.00 83.33  ? 559  ASP F CA    1 
ATOM   7590 C  C     . ASP F 2 116 ? 20.688  -76.385 33.381  1.00 84.28  ? 559  ASP F C     1 
ATOM   7591 O  O     . ASP F 2 116 ? 21.407  -77.051 34.110  1.00 77.00  ? 559  ASP F O     1 
ATOM   7592 C  CB    . ASP F 2 116 ? 22.108  -74.307 33.280  1.00 85.74  ? 559  ASP F CB    1 
ATOM   7593 C  CG    . ASP F 2 116 ? 21.265  -73.645 34.372  1.00 87.62  ? 559  ASP F CG    1 
ATOM   7594 O  OD1   . ASP F 2 116 ? 20.692  -74.369 35.213  1.00 98.01  ? 559  ASP F OD1   1 
ATOM   7595 O  OD2   . ASP F 2 116 ? 21.173  -72.403 34.401  1.00 91.26  ? 559  ASP F OD2   1 
ATOM   7596 N  N     . ILE F 2 117 ? 19.361  -76.537 33.378  1.00 82.06  ? 560  ILE F N     1 
ATOM   7597 C  CA    . ILE F 2 117 ? 18.705  -77.415 34.361  1.00 73.82  ? 560  ILE F CA    1 
ATOM   7598 C  C     . ILE F 2 117 ? 18.968  -78.893 34.056  1.00 67.36  ? 560  ILE F C     1 
ATOM   7599 O  O     . ILE F 2 117 ? 18.616  -79.396 32.990  1.00 56.52  ? 560  ILE F O     1 
ATOM   7600 C  CB    . ILE F 2 117 ? 17.188  -77.204 34.408  1.00 74.51  ? 560  ILE F CB    1 
ATOM   7601 C  CG1   . ILE F 2 117 ? 16.869  -75.785 34.862  1.00 79.73  ? 560  ILE F CG1   1 
ATOM   7602 C  CG2   . ILE F 2 117 ? 16.538  -78.204 35.353  1.00 71.65  ? 560  ILE F CG2   1 
ATOM   7603 C  CD1   . ILE F 2 117 ? 15.412  -75.392 34.681  1.00 83.84  ? 560  ILE F CD1   1 
ATOM   7604 N  N     . GLY F 2 118 ? 19.588  -79.575 35.007  1.00 64.48  ? 561  GLY F N     1 
ATOM   7605 C  CA    . GLY F 2 118 ? 19.893  -80.979 34.856  1.00 61.60  ? 561  GLY F CA    1 
ATOM   7606 C  C     . GLY F 2 118 ? 18.703  -81.809 35.242  1.00 57.30  ? 561  GLY F C     1 
ATOM   7607 O  O     . GLY F 2 118 ? 18.048  -81.542 36.229  1.00 57.14  ? 561  GLY F O     1 
ATOM   7608 N  N     . ASN F 2 119 ? 18.430  -82.837 34.461  1.00 56.07  ? 562  ASN F N     1 
ATOM   7609 C  CA    . ASN F 2 119 ? 17.514  -83.880 34.912  1.00 54.79  ? 562  ASN F CA    1 
ATOM   7610 C  C     . ASN F 2 119 ? 18.099  -84.868 35.913  1.00 57.92  ? 562  ASN F C     1 
ATOM   7611 O  O     . ASN F 2 119 ? 19.205  -84.675 36.412  1.00 55.94  ? 562  ASN F O     1 
ATOM   7612 C  CB    . ASN F 2 119 ? 16.892  -84.626 33.747  1.00 56.07  ? 562  ASN F CB    1 
ATOM   7613 C  CG    . ASN F 2 119 ? 17.880  -85.420 32.964  1.00 56.31  ? 562  ASN F CG    1 
ATOM   7614 O  OD1   . ASN F 2 119 ? 19.014  -85.610 33.369  1.00 57.89  ? 562  ASN F OD1   1 
ATOM   7615 N  ND2   . ASN F 2 119 ? 17.437  -85.901 31.827  1.00 59.08  ? 562  ASN F ND2   1 
ATOM   7616 N  N     . GLU F 2 120 ? 17.334  -85.911 36.217  1.00 65.16  ? 563  GLU F N     1 
ATOM   7617 C  CA    . GLU F 2 120 ? 17.817  -87.079 36.968  1.00 72.72  ? 563  GLU F CA    1 
ATOM   7618 C  C     . GLU F 2 120 ? 19.289  -87.394 36.673  1.00 68.99  ? 563  GLU F C     1 
ATOM   7619 O  O     . GLU F 2 120 ? 20.102  -87.480 37.585  1.00 72.94  ? 563  GLU F O     1 
ATOM   7620 C  CB    . GLU F 2 120 ? 16.914  -88.292 36.655  1.00 82.16  ? 563  GLU F CB    1 
ATOM   7621 C  CG    . GLU F 2 120 ? 16.774  -89.372 37.719  1.00 87.50  ? 563  GLU F CG    1 
ATOM   7622 C  CD    . GLU F 2 120 ? 18.061  -89.649 38.419  1.00 101.13 ? 563  GLU F CD    1 
ATOM   7623 O  OE1   . GLU F 2 120 ? 18.973  -90.161 37.747  1.00 122.12 ? 563  GLU F OE1   1 
ATOM   7624 O  OE2   . GLU F 2 120 ? 18.166  -89.324 39.621  1.00 110.45 ? 563  GLU F OE2   1 
ATOM   7625 N  N     . LYS F 2 121 ? 19.628  -87.562 35.404  1.00 67.41  ? 564  LYS F N     1 
ATOM   7626 C  CA    . LYS F 2 121 ? 20.955  -88.028 35.013  1.00 68.40  ? 564  LYS F CA    1 
ATOM   7627 C  C     . LYS F 2 121 ? 22.004  -86.938 34.899  1.00 71.63  ? 564  LYS F C     1 
ATOM   7628 O  O     . LYS F 2 121 ? 23.135  -87.224 34.518  1.00 80.22  ? 564  LYS F O     1 
ATOM   7629 C  CB    . LYS F 2 121 ? 20.865  -88.777 33.685  1.00 71.69  ? 564  LYS F CB    1 
ATOM   7630 C  CG    . LYS F 2 121 ? 20.145  -90.087 33.855  1.00 75.31  ? 564  LYS F CG    1 
ATOM   7631 C  CD    . LYS F 2 121 ? 20.123  -90.933 32.607  1.00 79.84  ? 564  LYS F CD    1 
ATOM   7632 C  CE    . LYS F 2 121 ? 19.280  -92.172 32.884  1.00 88.91  ? 564  LYS F CE    1 
ATOM   7633 N  NZ    . LYS F 2 121 ? 19.022  -92.997 31.678  1.00 97.38  ? 564  LYS F NZ    1 
ATOM   7634 N  N     . GLY F 2 122 ? 21.634  -85.699 35.219  1.00 77.37  ? 565  GLY F N     1 
ATOM   7635 C  CA    . GLY F 2 122 ? 22.546  -84.553 35.135  1.00 78.69  ? 565  GLY F CA    1 
ATOM   7636 C  C     . GLY F 2 122 ? 22.481  -83.846 33.791  1.00 85.70  ? 565  GLY F C     1 
ATOM   7637 O  O     . GLY F 2 122 ? 23.084  -82.774 33.618  1.00 94.86  ? 565  GLY F O     1 
ATOM   7638 N  N     . ASP F 2 123 ? 21.742  -84.437 32.844  1.00 83.82  ? 566  ASP F N     1 
ATOM   7639 C  CA    . ASP F 2 123 ? 21.666  -83.950 31.465  1.00 80.56  ? 566  ASP F CA    1 
ATOM   7640 C  C     . ASP F 2 123 ? 20.915  -82.630 31.330  1.00 76.50  ? 566  ASP F C     1 
ATOM   7641 O  O     . ASP F 2 123 ? 19.725  -82.561 31.649  1.00 66.38  ? 566  ASP F O     1 
ATOM   7642 C  CB    . ASP F 2 123 ? 20.941  -84.971 30.599  1.00 84.97  ? 566  ASP F CB    1 
ATOM   7643 C  CG    . ASP F 2 123 ? 21.800  -86.149 30.257  1.00 87.77  ? 566  ASP F CG    1 
ATOM   7644 O  OD1   . ASP F 2 123 ? 23.042  -85.968 30.174  1.00 79.58  ? 566  ASP F OD1   1 
ATOM   7645 O  OD2   . ASP F 2 123 ? 21.225  -87.244 30.037  1.00 91.71  ? 566  ASP F OD2   1 
ATOM   7646 N  N     . THR F 2 124 ? 21.590  -81.610 30.794  1.00 69.94  ? 567  THR F N     1 
ATOM   7647 C  CA    . THR F 2 124 ? 20.885  -80.466 30.244  1.00 68.38  ? 567  THR F CA    1 
ATOM   7648 C  C     . THR F 2 124 ? 20.191  -80.826 28.920  1.00 73.12  ? 567  THR F C     1 
ATOM   7649 O  O     . THR F 2 124 ? 20.402  -81.911 28.372  1.00 75.08  ? 567  THR F O     1 
ATOM   7650 C  CB    . THR F 2 124 ? 21.783  -79.236 30.070  1.00 69.94  ? 567  THR F CB    1 
ATOM   7651 O  OG1   . THR F 2 124 ? 22.447  -79.269 28.798  1.00 73.51  ? 567  THR F OG1   1 
ATOM   7652 C  CG2   . THR F 2 124 ? 22.785  -79.124 31.210  1.00 70.40  ? 567  THR F CG2   1 
ATOM   7653 N  N     . PRO F 2 125 ? 19.310  -79.936 28.432  1.00 77.13  ? 568  PRO F N     1 
ATOM   7654 C  CA    . PRO F 2 125 ? 18.701  -80.179 27.139  1.00 74.84  ? 568  PRO F CA    1 
ATOM   7655 C  C     . PRO F 2 125 ? 19.727  -80.362 26.040  1.00 75.68  ? 568  PRO F C     1 
ATOM   7656 O  O     . PRO F 2 125 ? 19.522  -81.181 25.157  1.00 76.77  ? 568  PRO F O     1 
ATOM   7657 C  CB    . PRO F 2 125 ? 17.875  -78.914 26.912  1.00 77.54  ? 568  PRO F CB    1 
ATOM   7658 C  CG    . PRO F 2 125 ? 17.480  -78.494 28.284  1.00 76.72  ? 568  PRO F CG    1 
ATOM   7659 C  CD    . PRO F 2 125 ? 18.708  -78.759 29.099  1.00 79.42  ? 568  PRO F CD    1 
ATOM   7660 N  N     . LEU F 2 126 ? 20.814  -79.595 26.094  1.00 76.99  ? 569  LEU F N     1 
ATOM   7661 C  CA    . LEU F 2 126 ? 21.842  -79.684 25.080  1.00 77.97  ? 569  LEU F CA    1 
ATOM   7662 C  C     . LEU F 2 126 ? 22.500  -81.057 25.033  1.00 83.39  ? 569  LEU F C     1 
ATOM   7663 O  O     . LEU F 2 126 ? 22.827  -81.552 23.950  1.00 87.90  ? 569  LEU F O     1 
ATOM   7664 C  CB    . LEU F 2 126 ? 22.917  -78.622 25.296  1.00 83.93  ? 569  LEU F CB    1 
ATOM   7665 C  CG    . LEU F 2 126 ? 23.998  -78.593 24.198  1.00 87.53  ? 569  LEU F CG    1 
ATOM   7666 C  CD1   . LEU F 2 126 ? 23.394  -78.465 22.802  1.00 83.40  ? 569  LEU F CD1   1 
ATOM   7667 C  CD2   . LEU F 2 126 ? 24.998  -77.471 24.445  1.00 90.84  ? 569  LEU F CD2   1 
ATOM   7668 N  N     . HIS F 2 127 ? 22.723  -81.656 26.203  1.00 84.75  ? 570  HIS F N     1 
ATOM   7669 C  CA    . HIS F 2 127 ? 23.217  -83.040 26.285  1.00 78.49  ? 570  HIS F CA    1 
ATOM   7670 C  C     . HIS F 2 127 ? 22.288  -83.931 25.500  1.00 76.71  ? 570  HIS F C     1 
ATOM   7671 O  O     . HIS F 2 127 ? 22.726  -84.771 24.727  1.00 78.44  ? 570  HIS F O     1 
ATOM   7672 C  CB    . HIS F 2 127 ? 23.251  -83.556 27.723  1.00 78.62  ? 570  HIS F CB    1 
ATOM   7673 C  CG    . HIS F 2 127 ? 24.275  -82.895 28.592  1.00 86.00  ? 570  HIS F CG    1 
ATOM   7674 N  ND1   . HIS F 2 127 ? 25.352  -83.573 29.122  1.00 91.62  ? 570  HIS F ND1   1 
ATOM   7675 C  CD2   . HIS F 2 127 ? 24.370  -81.625 29.052  1.00 88.08  ? 570  HIS F CD2   1 
ATOM   7676 C  CE1   . HIS F 2 127 ? 26.076  -82.745 29.856  1.00 89.85  ? 570  HIS F CE1   1 
ATOM   7677 N  NE2   . HIS F 2 127 ? 25.501  -81.557 29.830  1.00 86.03  ? 570  HIS F NE2   1 
ATOM   7678 N  N     . ILE F 2 128 ? 20.991  -83.749 25.712  1.00 75.12  ? 571  ILE F N     1 
ATOM   7679 C  CA    . ILE F 2 128 ? 20.008  -84.623 25.103  1.00 77.68  ? 571  ILE F CA    1 
ATOM   7680 C  C     . ILE F 2 128 ? 19.989  -84.441 23.599  1.00 82.82  ? 571  ILE F C     1 
ATOM   7681 O  O     . ILE F 2 128 ? 19.981  -85.416 22.852  1.00 93.12  ? 571  ILE F O     1 
ATOM   7682 C  CB    . ILE F 2 128 ? 18.608  -84.372 25.670  1.00 76.85  ? 571  ILE F CB    1 
ATOM   7683 C  CG1   . ILE F 2 128 ? 18.547  -84.890 27.108  1.00 75.43  ? 571  ILE F CG1   1 
ATOM   7684 C  CG2   . ILE F 2 128 ? 17.542  -85.028 24.797  1.00 78.47  ? 571  ILE F CG2   1 
ATOM   7685 C  CD1   . ILE F 2 128 ? 17.394  -84.337 27.909  1.00 81.21  ? 571  ILE F CD1   1 
ATOM   7686 N  N     . ALA F 2 129 ? 19.993  -83.192 23.158  1.00 87.43  ? 572  ALA F N     1 
ATOM   7687 C  CA    . ALA F 2 129 ? 19.962  -82.899 21.735  1.00 86.59  ? 572  ALA F CA    1 
ATOM   7688 C  C     . ALA F 2 129 ? 21.208  -83.438 21.024  1.00 89.64  ? 572  ALA F C     1 
ATOM   7689 O  O     . ALA F 2 129 ? 21.115  -83.905 19.888  1.00 102.51 ? 572  ALA F O     1 
ATOM   7690 C  CB    . ALA F 2 129 ? 19.818  -81.403 21.501  1.00 81.51  ? 572  ALA F CB    1 
ATOM   7691 N  N     . ALA F 2 130 ? 22.360  -83.364 21.685  1.00 84.55  ? 573  ALA F N     1 
ATOM   7692 C  CA    . ALA F 2 130 ? 23.594  -83.946 21.156  1.00 82.78  ? 573  ALA F CA    1 
ATOM   7693 C  C     . ALA F 2 130 ? 23.537  -85.485 21.042  1.00 84.62  ? 573  ALA F C     1 
ATOM   7694 O  O     . ALA F 2 130 ? 23.860  -86.049 20.004  1.00 81.90  ? 573  ALA F O     1 
ATOM   7695 C  CB    . ALA F 2 130 ? 24.771  -83.514 22.014  1.00 81.38  ? 573  ALA F CB    1 
ATOM   7696 N  N     . ARG F 2 131 ? 23.100  -86.150 22.104  1.00 90.12  ? 574  ARG F N     1 
ATOM   7697 C  CA    . ARG F 2 131 ? 22.949  -87.601 22.101  1.00 98.48  ? 574  ARG F CA    1 
ATOM   7698 C  C     . ARG F 2 131 ? 22.137  -88.086 20.901  1.00 99.95  ? 574  ARG F C     1 
ATOM   7699 O  O     . ARG F 2 131 ? 22.580  -88.960 20.174  1.00 106.42 ? 574  ARG F O     1 
ATOM   7700 C  CB    . ARG F 2 131 ? 22.289  -88.073 23.409  1.00 112.32 ? 574  ARG F CB    1 
ATOM   7701 C  CG    . ARG F 2 131 ? 22.134  -89.591 23.539  1.00 114.50 ? 574  ARG F CG    1 
ATOM   7702 C  CD    . ARG F 2 131 ? 22.057  -90.100 24.990  1.00 120.49 ? 574  ARG F CD    1 
ATOM   7703 N  NE    . ARG F 2 131 ? 21.990  -89.036 25.999  1.00 116.10 ? 574  ARG F NE    1 
ATOM   7704 C  CZ    . ARG F 2 131 ? 22.905  -88.773 26.934  1.00 110.65 ? 574  ARG F CZ    1 
ATOM   7705 N  NH1   . ARG F 2 131 ? 24.029  -89.484 27.051  1.00 110.31 ? 574  ARG F NH1   1 
ATOM   7706 N  NH2   . ARG F 2 131 ? 22.684  -87.766 27.768  1.00 102.78 ? 574  ARG F NH2   1 
ATOM   7707 N  N     . TRP F 2 132 ? 20.947  -87.520 20.704  1.00 96.88  ? 575  TRP F N     1 
ATOM   7708 C  CA    . TRP F 2 132 ? 20.048  -87.968 19.647  1.00 90.75  ? 575  TRP F CA    1 
ATOM   7709 C  C     . TRP F 2 132 ? 20.318  -87.191 18.350  1.00 90.82  ? 575  TRP F C     1 
ATOM   7710 O  O     . TRP F 2 132 ? 19.556  -87.288 17.396  1.00 95.90  ? 575  TRP F O     1 
ATOM   7711 C  CB    . TRP F 2 132 ? 18.575  -87.830 20.078  1.00 96.35  ? 575  TRP F CB    1 
ATOM   7712 C  CG    . TRP F 2 132 ? 18.088  -88.912 21.036  1.00 105.96 ? 575  TRP F CG    1 
ATOM   7713 C  CD1   . TRP F 2 132 ? 18.665  -89.261 22.218  1.00 103.24 ? 575  TRP F CD1   1 
ATOM   7714 C  CD2   . TRP F 2 132 ? 16.917  -89.765 20.892  1.00 117.06 ? 575  TRP F CD2   1 
ATOM   7715 N  NE1   . TRP F 2 132 ? 17.952  -90.276 22.803  1.00 108.40 ? 575  TRP F NE1   1 
ATOM   7716 C  CE2   . TRP F 2 132 ? 16.871  -90.601 22.021  1.00 113.88 ? 575  TRP F CE2   1 
ATOM   7717 C  CE3   . TRP F 2 132 ? 15.905  -89.899 19.916  1.00 122.03 ? 575  TRP F CE3   1 
ATOM   7718 C  CZ2   . TRP F 2 132 ? 15.842  -91.568 22.214  1.00 115.63 ? 575  TRP F CZ2   1 
ATOM   7719 C  CZ3   . TRP F 2 132 ? 14.876  -90.869 20.110  1.00 114.76 ? 575  TRP F CZ3   1 
ATOM   7720 C  CH2   . TRP F 2 132 ? 14.862  -91.681 21.249  1.00 111.08 ? 575  TRP F CH2   1 
ATOM   7721 N  N     . GLY F 2 133 ? 21.416  -86.446 18.296  1.00 90.59  ? 576  GLY F N     1 
ATOM   7722 C  CA    . GLY F 2 133 ? 21.790  -85.679 17.100  1.00 93.39  ? 576  GLY F CA    1 
ATOM   7723 C  C     . GLY F 2 133 ? 20.694  -84.906 16.377  1.00 97.06  ? 576  GLY F C     1 
ATOM   7724 O  O     . GLY F 2 133 ? 20.329  -85.252 15.258  1.00 103.90 ? 576  GLY F O     1 
ATOM   7725 N  N     . TYR F 2 134 ? 20.182  -83.847 16.999  1.00 98.93  ? 577  TYR F N     1 
ATOM   7726 C  CA    . TYR F 2 134 ? 19.129  -83.027 16.399  1.00 97.31  ? 577  TYR F CA    1 
ATOM   7727 C  C     . TYR F 2 134 ? 19.656  -81.636 16.070  1.00 98.70  ? 577  TYR F C     1 
ATOM   7728 O  O     . TYR F 2 134 ? 19.458  -80.692 16.824  1.00 96.87  ? 577  TYR F O     1 
ATOM   7729 C  CB    . TYR F 2 134 ? 17.956  -82.880 17.355  1.00 97.04  ? 577  TYR F CB    1 
ATOM   7730 C  CG    . TYR F 2 134 ? 17.117  -84.113 17.609  1.00 95.74  ? 577  TYR F CG    1 
ATOM   7731 C  CD1   . TYR F 2 134 ? 16.315  -84.647 16.618  1.00 99.95  ? 577  TYR F CD1   1 
ATOM   7732 C  CD2   . TYR F 2 134 ? 17.073  -84.703 18.869  1.00 93.00  ? 577  TYR F CD2   1 
ATOM   7733 C  CE1   . TYR F 2 134 ? 15.513  -85.754 16.866  1.00 103.62 ? 577  TYR F CE1   1 
ATOM   7734 C  CE2   . TYR F 2 134 ? 16.277  -85.805 19.124  1.00 85.60  ? 577  TYR F CE2   1 
ATOM   7735 C  CZ    . TYR F 2 134 ? 15.498  -86.324 18.124  1.00 91.49  ? 577  TYR F CZ    1 
ATOM   7736 O  OH    . TYR F 2 134 ? 14.699  -87.413 18.364  1.00 93.58  ? 577  TYR F OH    1 
ATOM   7737 N  N     . GLN F 2 135 ? 20.333  -81.513 14.939  1.00 102.32 ? 578  GLN F N     1 
ATOM   7738 C  CA    . GLN F 2 135 ? 21.084  -80.299 14.608  1.00 97.73  ? 578  GLN F CA    1 
ATOM   7739 C  C     . GLN F 2 135 ? 20.326  -78.989 14.841  1.00 86.10  ? 578  GLN F C     1 
ATOM   7740 O  O     . GLN F 2 135 ? 20.887  -78.029 15.399  1.00 74.76  ? 578  GLN F O     1 
ATOM   7741 C  CB    . GLN F 2 135 ? 21.517  -80.360 13.151  1.00 103.73 ? 578  GLN F CB    1 
ATOM   7742 C  CG    . GLN F 2 135 ? 22.202  -79.096 12.655  1.00 104.28 ? 578  GLN F CG    1 
ATOM   7743 C  CD    . GLN F 2 135 ? 23.276  -79.404 11.640  1.00 99.70  ? 578  GLN F CD    1 
ATOM   7744 O  OE1   . GLN F 2 135 ? 23.116  -80.295 10.810  1.00 98.24  ? 578  GLN F OE1   1 
ATOM   7745 N  NE2   . GLN F 2 135 ? 24.371  -78.665 11.692  1.00 99.83  ? 578  GLN F NE2   1 
ATOM   7746 N  N     . GLY F 2 136 ? 19.067  -78.943 14.402  1.00 78.52  ? 579  GLY F N     1 
ATOM   7747 C  CA    . GLY F 2 136 ? 18.316  -77.691 14.422  1.00 82.92  ? 579  GLY F CA    1 
ATOM   7748 C  C     . GLY F 2 136 ? 18.103  -77.183 15.839  1.00 80.13  ? 579  GLY F C     1 
ATOM   7749 O  O     . GLY F 2 136 ? 18.458  -76.043 16.180  1.00 70.80  ? 579  GLY F O     1 
ATOM   7750 N  N     . VAL F 2 137 ? 17.565  -78.075 16.669  1.00 77.10  ? 580  VAL F N     1 
ATOM   7751 C  CA    . VAL F 2 137 ? 17.596  -77.925 18.126  1.00 69.54  ? 580  VAL F CA    1 
ATOM   7752 C  C     . VAL F 2 137 ? 18.963  -77.429 18.640  1.00 66.20  ? 580  VAL F C     1 
ATOM   7753 O  O     . VAL F 2 137 ? 19.075  -76.385 19.296  1.00 61.10  ? 580  VAL F O     1 
ATOM   7754 C  CB    . VAL F 2 137 ? 17.274  -79.266 18.818  1.00 64.67  ? 580  VAL F CB    1 
ATOM   7755 C  CG1   . VAL F 2 137 ? 17.438  -79.126 20.322  1.00 64.68  ? 580  VAL F CG1   1 
ATOM   7756 C  CG2   . VAL F 2 137 ? 15.867  -79.738 18.481  1.00 61.83  ? 580  VAL F CG2   1 
ATOM   7757 N  N     . ILE F 2 138 ? 19.999  -78.204 18.348  1.00 64.26  ? 581  ILE F N     1 
ATOM   7758 C  CA    . ILE F 2 138 ? 21.309  -77.954 18.908  1.00 62.36  ? 581  ILE F CA    1 
ATOM   7759 C  C     . ILE F 2 138 ? 21.733  -76.516 18.626  1.00 64.99  ? 581  ILE F C     1 
ATOM   7760 O  O     . ILE F 2 138 ? 22.130  -75.780 19.534  1.00 59.15  ? 581  ILE F O     1 
ATOM   7761 C  CB    . ILE F 2 138 ? 22.344  -78.926 18.341  1.00 62.79  ? 581  ILE F CB    1 
ATOM   7762 C  CG1   . ILE F 2 138 ? 22.047  -80.347 18.812  1.00 68.59  ? 581  ILE F CG1   1 
ATOM   7763 C  CG2   . ILE F 2 138 ? 23.738  -78.566 18.832  1.00 65.11  ? 581  ILE F CG2   1 
ATOM   7764 C  CD1   . ILE F 2 138 ? 22.643  -81.439 17.952  1.00 69.22  ? 581  ILE F CD1   1 
ATOM   7765 N  N     . GLU F 2 139 ? 21.613  -76.108 17.368  1.00 73.70  ? 582  GLU F N     1 
ATOM   7766 C  CA    . GLU F 2 139 ? 21.970  -74.742 16.976  1.00 79.17  ? 582  GLU F CA    1 
ATOM   7767 C  C     . GLU F 2 139 ? 21.146  -73.715 17.772  1.00 76.52  ? 582  GLU F C     1 
ATOM   7768 O  O     . GLU F 2 139 ? 21.725  -72.838 18.430  1.00 79.95  ? 582  GLU F O     1 
ATOM   7769 C  CB    . GLU F 2 139 ? 21.804  -74.541 15.459  1.00 85.00  ? 582  GLU F CB    1 
ATOM   7770 C  CG    . GLU F 2 139 ? 23.040  -74.922 14.634  1.00 88.41  ? 582  GLU F CG    1 
ATOM   7771 C  CD    . GLU F 2 139 ? 22.742  -75.329 13.182  1.00 92.65  ? 582  GLU F CD    1 
ATOM   7772 O  OE1   . GLU F 2 139 ? 21.571  -75.537 12.771  1.00 94.27  ? 582  GLU F OE1   1 
ATOM   7773 O  OE2   . GLU F 2 139 ? 23.715  -75.486 12.427  1.00 88.32  ? 582  GLU F OE2   1 
ATOM   7774 N  N     . THR F 2 140 ? 19.817  -73.874 17.766  1.00 69.49  ? 583  THR F N     1 
ATOM   7775 C  CA    . THR F 2 140 ? 18.898  -73.038 18.563  1.00 69.34  ? 583  THR F CA    1 
ATOM   7776 C  C     . THR F 2 140 ? 19.362  -72.836 20.017  1.00 68.73  ? 583  THR F C     1 
ATOM   7777 O  O     . THR F 2 140 ? 19.438  -71.709 20.546  1.00 66.21  ? 583  THR F O     1 
ATOM   7778 C  CB    . THR F 2 140 ? 17.486  -73.666 18.624  1.00 68.47  ? 583  THR F CB    1 
ATOM   7779 O  OG1   . THR F 2 140 ? 17.058  -74.080 17.315  1.00 69.06  ? 583  THR F OG1   1 
ATOM   7780 C  CG2   . THR F 2 140 ? 16.475  -72.680 19.196  1.00 67.21  ? 583  THR F CG2   1 
ATOM   7781 N  N     . LEU F 2 141 ? 19.687  -73.945 20.661  1.00 69.11  ? 584  LEU F N     1 
ATOM   7782 C  CA    . LEU F 2 141 ? 20.145  -73.908 22.046  1.00 68.71  ? 584  LEU F CA    1 
ATOM   7783 C  C     . LEU F 2 141 ? 21.417  -73.089 22.194  1.00 65.03  ? 584  LEU F C     1 
ATOM   7784 O  O     . LEU F 2 141 ? 21.491  -72.189 23.022  1.00 59.11  ? 584  LEU F O     1 
ATOM   7785 C  CB    . LEU F 2 141 ? 20.376  -75.328 22.571  1.00 69.26  ? 584  LEU F CB    1 
ATOM   7786 C  CG    . LEU F 2 141 ? 19.093  -76.132 22.806  1.00 69.58  ? 584  LEU F CG    1 
ATOM   7787 C  CD1   . LEU F 2 141 ? 19.401  -77.591 23.114  1.00 71.05  ? 584  LEU F CD1   1 
ATOM   7788 C  CD2   . LEU F 2 141 ? 18.264  -75.514 23.925  1.00 67.00  ? 584  LEU F CD2   1 
ATOM   7789 N  N     . LEU F 2 142 ? 22.407  -73.410 21.372  1.00 69.66  ? 585  LEU F N     1 
ATOM   7790 C  CA    . LEU F 2 142 ? 23.710  -72.766 21.443  1.00 67.90  ? 585  LEU F CA    1 
ATOM   7791 C  C     . LEU F 2 142 ? 23.590  -71.292 21.150  1.00 67.77  ? 585  LEU F C     1 
ATOM   7792 O  O     . LEU F 2 142 ? 24.196  -70.470 21.831  1.00 67.19  ? 585  LEU F O     1 
ATOM   7793 C  CB    . LEU F 2 142 ? 24.647  -73.395 20.435  1.00 70.56  ? 585  LEU F CB    1 
ATOM   7794 C  CG    . LEU F 2 142 ? 25.051  -74.814 20.830  1.00 72.83  ? 585  LEU F CG    1 
ATOM   7795 C  CD1   . LEU F 2 142 ? 25.441  -75.618 19.604  1.00 73.17  ? 585  LEU F CD1   1 
ATOM   7796 C  CD2   . LEU F 2 142 ? 26.178  -74.764 21.845  1.00 69.62  ? 585  LEU F CD2   1 
ATOM   7797 N  N     . GLN F 2 143 ? 22.760  -70.962 20.168  1.00 68.04  ? 586  GLN F N     1 
ATOM   7798 C  CA    . GLN F 2 143 ? 22.571  -69.577 19.784  1.00 68.32  ? 586  GLN F CA    1 
ATOM   7799 C  C     . GLN F 2 143 ? 22.000  -68.730 20.904  1.00 70.67  ? 586  GLN F C     1 
ATOM   7800 O  O     . GLN F 2 143 ? 22.176  -67.525 20.905  1.00 84.16  ? 586  GLN F O     1 
ATOM   7801 C  CB    . GLN F 2 143 ? 21.673  -69.476 18.565  1.00 66.49  ? 586  GLN F CB    1 
ATOM   7802 C  CG    . GLN F 2 143 ? 22.372  -69.888 17.279  1.00 70.66  ? 586  GLN F CG    1 
ATOM   7803 C  CD    . GLN F 2 143 ? 21.415  -70.277 16.165  1.00 76.64  ? 586  GLN F CD    1 
ATOM   7804 O  OE1   . GLN F 2 143 ? 21.737  -71.115 15.333  1.00 83.88  ? 586  GLN F OE1   1 
ATOM   7805 N  NE2   . GLN F 2 143 ? 20.240  -69.666 16.140  1.00 80.55  ? 586  GLN F NE2   1 
ATOM   7806 N  N     . ASN F 2 144 ? 21.308  -69.351 21.846  1.00 72.80  ? 587  ASN F N     1 
ATOM   7807 C  CA    . ASN F 2 144 ? 20.768  -68.635 22.997  1.00 71.31  ? 587  ASN F CA    1 
ATOM   7808 C  C     . ASN F 2 144 ? 21.513  -68.963 24.289  1.00 69.65  ? 587  ASN F C     1 
ATOM   7809 O  O     . ASN F 2 144 ? 21.066  -68.606 25.380  1.00 74.92  ? 587  ASN F O     1 
ATOM   7810 C  CB    . ASN F 2 144 ? 19.286  -68.972 23.153  1.00 68.48  ? 587  ASN F CB    1 
ATOM   7811 C  CG    . ASN F 2 144 ? 18.418  -68.363 22.050  1.00 68.18  ? 587  ASN F CG    1 
ATOM   7812 O  OD1   . ASN F 2 144 ? 18.243  -68.956 20.973  1.00 71.57  ? 587  ASN F OD1   1 
ATOM   7813 N  ND2   . ASN F 2 144 ? 17.854  -67.183 22.319  1.00 63.82  ? 587  ASN F ND2   1 
ATOM   7814 N  N     . GLY F 2 145 ? 22.653  -69.638 24.173  1.00 66.88  ? 588  GLY F N     1 
ATOM   7815 C  CA    . GLY F 2 145 ? 23.686  -69.579 25.203  1.00 68.71  ? 588  GLY F CA    1 
ATOM   7816 C  C     . GLY F 2 145 ? 23.831  -70.840 26.023  1.00 68.93  ? 588  GLY F C     1 
ATOM   7817 O  O     . GLY F 2 145 ? 24.348  -70.795 27.131  1.00 65.83  ? 588  GLY F O     1 
ATOM   7818 N  N     . ALA F 2 146 ? 23.405  -71.975 25.473  1.00 72.29  ? 589  ALA F N     1 
ATOM   7819 C  CA    . ALA F 2 146 ? 23.587  -73.264 26.141  1.00 72.29  ? 589  ALA F CA    1 
ATOM   7820 C  C     . ALA F 2 146 ? 25.052  -73.496 26.353  1.00 70.91  ? 589  ALA F C     1 
ATOM   7821 O  O     . ALA F 2 146 ? 25.841  -73.172 25.485  1.00 73.95  ? 589  ALA F O     1 
ATOM   7822 C  CB    . ALA F 2 146 ? 23.014  -74.383 25.295  1.00 76.06  ? 589  ALA F CB    1 
ATOM   7823 N  N     . SER F 2 147 ? 25.412  -74.052 27.503  1.00 76.55  ? 590  SER F N     1 
ATOM   7824 C  CA    . SER F 2 147 ? 26.813  -74.312 27.821  1.00 75.61  ? 590  SER F CA    1 
ATOM   7825 C  C     . SER F 2 147 ? 27.247  -75.653 27.279  1.00 79.34  ? 590  SER F C     1 
ATOM   7826 O  O     . SER F 2 147 ? 26.470  -76.612 27.236  1.00 79.40  ? 590  SER F O     1 
ATOM   7827 C  CB    . SER F 2 147 ? 27.065  -74.268 29.325  1.00 71.16  ? 590  SER F CB    1 
ATOM   7828 O  OG    . SER F 2 147 ? 28.444  -74.366 29.588  1.00 70.37  ? 590  SER F OG    1 
ATOM   7829 N  N     . THR F 2 148 ? 28.505  -75.691 26.866  1.00 88.97  ? 591  THR F N     1 
ATOM   7830 C  CA    . THR F 2 148 ? 29.141  -76.889 26.329  1.00 98.15  ? 591  THR F CA    1 
ATOM   7831 C  C     . THR F 2 148 ? 30.019  -77.574 27.385  1.00 100.37 ? 591  THR F C     1 
ATOM   7832 O  O     . THR F 2 148 ? 30.507  -78.693 27.181  1.00 86.21  ? 591  THR F O     1 
ATOM   7833 C  CB    . THR F 2 148 ? 30.022  -76.512 25.133  1.00 90.02  ? 591  THR F CB    1 
ATOM   7834 O  OG1   . THR F 2 148 ? 30.259  -75.105 25.168  1.00 78.96  ? 591  THR F OG1   1 
ATOM   7835 C  CG2   . THR F 2 148 ? 29.326  -76.857 23.841  1.00 89.45  ? 591  THR F CG2   1 
ATOM   7836 N  N     . GLU F 2 149 ? 30.181  -76.895 28.516  1.00 105.72 ? 592  GLU F N     1 
ATOM   7837 C  CA    . GLU F 2 149 ? 31.075  -77.330 29.567  1.00 109.93 ? 592  GLU F CA    1 
ATOM   7838 C  C     . GLU F 2 149 ? 30.350  -78.163 30.624  1.00 107.07 ? 592  GLU F C     1 
ATOM   7839 O  O     . GLU F 2 149 ? 30.880  -79.174 31.072  1.00 119.20 ? 592  GLU F O     1 
ATOM   7840 C  CB    . GLU F 2 149 ? 31.749  -76.117 30.207  1.00 114.20 ? 592  GLU F CB    1 
ATOM   7841 C  CG    . GLU F 2 149 ? 32.894  -75.563 29.366  1.00 126.59 ? 592  GLU F CG    1 
ATOM   7842 C  CD    . GLU F 2 149 ? 32.716  -74.106 28.959  1.00 137.07 ? 592  GLU F CD    1 
ATOM   7843 O  OE1   . GLU F 2 149 ? 32.409  -73.244 29.815  1.00 139.21 ? 592  GLU F OE1   1 
ATOM   7844 O  OE2   . GLU F 2 149 ? 32.919  -73.814 27.764  1.00 145.58 ? 592  GLU F OE2   1 
ATOM   7845 N  N     . ILE F 2 150 ? 29.145  -77.751 31.011  1.00 98.50  ? 593  ILE F N     1 
ATOM   7846 C  CA    . ILE F 2 150 ? 28.346  -78.479 32.000  1.00 91.31  ? 593  ILE F CA    1 
ATOM   7847 C  C     . ILE F 2 150 ? 28.449  -79.996 31.786  1.00 93.96  ? 593  ILE F C     1 
ATOM   7848 O  O     . ILE F 2 150 ? 28.244  -80.511 30.681  1.00 91.48  ? 593  ILE F O     1 
ATOM   7849 C  CB    . ILE F 2 150 ? 26.840  -78.055 31.993  1.00 85.32  ? 593  ILE F CB    1 
ATOM   7850 C  CG1   . ILE F 2 150 ? 26.693  -76.501 31.967  1.00 89.72  ? 593  ILE F CG1   1 
ATOM   7851 C  CG2   . ILE F 2 150 ? 26.099  -78.823 33.098  1.00 79.94  ? 593  ILE F CG2   1 
ATOM   7852 C  CD1   . ILE F 2 150 ? 27.507  -75.748 32.997  1.00 94.95  ? 593  ILE F CD1   1 
ATOM   7853 N  N     . GLN F 2 151 ? 28.772  -80.711 32.859  1.00 96.42  ? 594  GLN F N     1 
ATOM   7854 C  CA    . GLN F 2 151 ? 28.860  -82.162 32.798  1.00 94.50  ? 594  GLN F CA    1 
ATOM   7855 C  C     . GLN F 2 151 ? 27.701  -82.732 33.546  1.00 87.98  ? 594  GLN F C     1 
ATOM   7856 O  O     . GLN F 2 151 ? 27.273  -82.177 34.558  1.00 91.41  ? 594  GLN F O     1 
ATOM   7857 C  CB    . GLN F 2 151 ? 30.123  -82.693 33.459  1.00 102.70 ? 594  GLN F CB    1 
ATOM   7858 C  CG    . GLN F 2 151 ? 31.336  -81.784 33.452  1.00 109.81 ? 594  GLN F CG    1 
ATOM   7859 C  CD    . GLN F 2 151 ? 32.454  -82.375 34.280  1.00 108.30 ? 594  GLN F CD    1 
ATOM   7860 O  OE1   . GLN F 2 151 ? 32.868  -81.804 35.284  1.00 115.34 ? 594  GLN F OE1   1 
ATOM   7861 N  NE2   . GLN F 2 151 ? 32.930  -83.535 33.875  1.00 100.56 ? 594  GLN F NE2   1 
ATOM   7862 N  N     . ASN F 2 152 ? 27.220  -83.866 33.072  1.00 81.37  ? 595  ASN F N     1 
ATOM   7863 C  CA    . ASN F 2 152 ? 26.166  -84.591 33.766  1.00 85.89  ? 595  ASN F CA    1 
ATOM   7864 C  C     . ASN F 2 152 ? 26.718  -85.381 34.958  1.00 87.05  ? 595  ASN F C     1 
ATOM   7865 O  O     . ASN F 2 152 ? 27.843  -85.118 35.395  1.00 88.32  ? 595  ASN F O     1 
ATOM   7866 C  CB    . ASN F 2 152 ? 25.419  -85.463 32.755  1.00 87.43  ? 595  ASN F CB    1 
ATOM   7867 C  CG    . ASN F 2 152 ? 26.266  -86.558 32.177  1.00 89.73  ? 595  ASN F CG    1 
ATOM   7868 O  OD1   . ASN F 2 152 ? 25.819  -87.380 31.361  1.00 98.93  ? 595  ASN F OD1   1 
ATOM   7869 N  ND2   . ASN F 2 152 ? 27.498  -86.581 32.592  1.00 93.76  ? 595  ASN F ND2   1 
ATOM   7870 N  N     . ARG F 2 153 ? 25.954  -86.345 35.465  1.00 90.76  ? 596  ARG F N     1 
ATOM   7871 C  CA    . ARG F 2 153 ? 26.431  -87.215 36.539  1.00 98.43  ? 596  ARG F CA    1 
ATOM   7872 C  C     . ARG F 2 153 ? 27.609  -88.108 36.104  1.00 104.66 ? 596  ARG F C     1 
ATOM   7873 O  O     . ARG F 2 153 ? 28.608  -88.198 36.815  1.00 117.69 ? 596  ARG F O     1 
ATOM   7874 C  CB    . ARG F 2 153 ? 25.286  -88.050 37.126  1.00 101.05 ? 596  ARG F CB    1 
ATOM   7875 C  CG    . ARG F 2 153 ? 24.636  -87.375 38.344  1.00 110.21 ? 596  ARG F CG    1 
ATOM   7876 C  CD    . ARG F 2 153 ? 24.220  -88.304 39.492  1.00 113.90 ? 596  ARG F CD    1 
ATOM   7877 N  NE    . ARG F 2 153 ? 22.959  -88.953 39.180  1.00 116.78 ? 596  ARG F NE    1 
ATOM   7878 C  CZ    . ARG F 2 153 ? 22.845  -90.123 38.552  1.00 122.89 ? 596  ARG F CZ    1 
ATOM   7879 N  NH1   . ARG F 2 153 ? 23.920  -90.825 38.191  1.00 130.41 ? 596  ARG F NH1   1 
ATOM   7880 N  NH2   . ARG F 2 153 ? 21.642  -90.608 38.298  1.00 117.57 ? 596  ARG F NH2   1 
ATOM   7881 N  N     . LEU F 2 154 ? 27.536  -88.694 34.909  1.00 100.06 ? 597  LEU F N     1 
ATOM   7882 C  CA    . LEU F 2 154 ? 28.677  -89.436 34.328  1.00 90.43  ? 597  LEU F CA    1 
ATOM   7883 C  C     . LEU F 2 154 ? 29.880  -88.533 34.004  1.00 99.70  ? 597  LEU F C     1 
ATOM   7884 O  O     . LEU F 2 154 ? 30.826  -88.982 33.362  1.00 104.87 ? 597  LEU F O     1 
ATOM   7885 C  CB    . LEU F 2 154 ? 28.264  -90.156 33.031  1.00 87.74  ? 597  LEU F CB    1 
ATOM   7886 C  CG    . LEU F 2 154 ? 27.039  -91.069 33.001  1.00 93.81  ? 597  LEU F CG    1 
ATOM   7887 C  CD1   . LEU F 2 154 ? 26.919  -91.862 31.698  1.00 86.84  ? 597  LEU F CD1   1 
ATOM   7888 C  CD2   . LEU F 2 154 ? 27.050  -91.986 34.215  1.00 92.79  ? 597  LEU F CD2   1 
ATOM   7889 N  N     . LYS F 2 155 ? 29.817  -87.252 34.376  1.00 106.17 ? 598  LYS F N     1 
ATOM   7890 C  CA    . LYS F 2 155 ? 30.883  -86.272 34.110  1.00 104.11 ? 598  LYS F CA    1 
ATOM   7891 C  C     . LYS F 2 155 ? 31.224  -86.030 32.616  1.00 99.21  ? 598  LYS F C     1 
ATOM   7892 O  O     . LYS F 2 155 ? 32.101  -85.215 32.326  1.00 80.35  ? 598  LYS F O     1 
ATOM   7893 C  CB    . LYS F 2 155 ? 32.124  -86.626 34.942  1.00 106.21 ? 598  LYS F CB    1 
ATOM   7894 C  CG    . LYS F 2 155 ? 31.760  -86.895 36.395  1.00 113.16 ? 598  LYS F CG    1 
ATOM   7895 C  CD    . LYS F 2 155 ? 32.812  -86.459 37.395  1.00 120.63 ? 598  LYS F CD    1 
ATOM   7896 C  CE    . LYS F 2 155 ? 32.144  -86.172 38.735  1.00 134.53 ? 598  LYS F CE    1 
ATOM   7897 N  NZ    . LYS F 2 155 ? 33.093  -86.165 39.885  1.00 147.28 ? 598  LYS F NZ    1 
ATOM   7898 N  N     . GLU F 2 156 ? 30.513  -86.695 31.689  1.00 100.36 ? 599  GLU F N     1 
ATOM   7899 C  CA    . GLU F 2 156 ? 30.530  -86.351 30.254  1.00 97.41  ? 599  GLU F CA    1 
ATOM   7900 C  C     . GLU F 2 156 ? 29.815  -85.015 29.919  1.00 102.08 ? 599  GLU F C     1 
ATOM   7901 O  O     . GLU F 2 156 ? 28.658  -84.800 30.287  1.00 90.92  ? 599  GLU F O     1 
ATOM   7902 C  CB    . GLU F 2 156 ? 29.993  -87.520 29.395  1.00 98.07  ? 599  GLU F CB    1 
ATOM   7903 C  CG    . GLU F 2 156 ? 28.517  -87.891 29.568  1.00 103.24 ? 599  GLU F CG    1 
ATOM   7904 C  CD    . GLU F 2 156 ? 28.125  -89.233 28.938  1.00 112.57 ? 599  GLU F CD    1 
ATOM   7905 O  OE1   . GLU F 2 156 ? 29.015  -89.975 28.458  1.00 112.56 ? 599  GLU F OE1   1 
ATOM   7906 O  OE2   . GLU F 2 156 ? 26.911  -89.556 28.921  1.00 111.39 ? 599  GLU F OE2   1 
ATOM   7907 N  N     . THR F 2 157 ? 30.538  -84.128 29.219  1.00 110.54 ? 600  THR F N     1 
ATOM   7908 C  CA    . THR F 2 157 ? 29.988  -82.872 28.666  1.00 102.69 ? 600  THR F CA    1 
ATOM   7909 C  C     . THR F 2 157 ? 29.060  -83.181 27.502  1.00 100.50 ? 600  THR F C     1 
ATOM   7910 O  O     . THR F 2 157 ? 28.954  -84.345 27.073  1.00 98.97  ? 600  THR F O     1 
ATOM   7911 C  CB    . THR F 2 157 ? 31.078  -81.910 28.127  1.00 98.30  ? 600  THR F CB    1 
ATOM   7912 O  OG1   . THR F 2 157 ? 31.752  -82.511 27.017  1.00 102.98 ? 600  THR F OG1   1 
ATOM   7913 C  CG2   . THR F 2 157 ? 32.080  -81.546 29.211  1.00 99.42  ? 600  THR F CG2   1 
ATOM   7914 N  N     . PRO F 2 158 ? 28.358  -82.149 27.008  1.00 93.91  ? 601  PRO F N     1 
ATOM   7915 C  CA    . PRO F 2 158 ? 27.474  -82.396 25.873  1.00 93.18  ? 601  PRO F CA    1 
ATOM   7916 C  C     . PRO F 2 158 ? 28.274  -82.735 24.621  1.00 95.55  ? 601  PRO F C     1 
ATOM   7917 O  O     . PRO F 2 158 ? 27.842  -83.577 23.818  1.00 86.45  ? 601  PRO F O     1 
ATOM   7918 C  CB    . PRO F 2 158 ? 26.687  -81.078 25.733  1.00 93.79  ? 601  PRO F CB    1 
ATOM   7919 C  CG    . PRO F 2 158 ? 27.380  -80.090 26.607  1.00 92.15  ? 601  PRO F CG    1 
ATOM   7920 C  CD    . PRO F 2 158 ? 28.045  -80.876 27.682  1.00 90.13  ? 601  PRO F CD    1 
ATOM   7921 N  N     . LEU F 2 159 ? 29.453  -82.120 24.500  1.00 102.33 ? 602  LEU F N     1 
ATOM   7922 C  CA    . LEU F 2 159 ? 30.437  -82.478 23.468  1.00 100.47 ? 602  LEU F CA    1 
ATOM   7923 C  C     . LEU F 2 159 ? 30.581  -83.986 23.367  1.00 99.48  ? 602  LEU F C     1 
ATOM   7924 O  O     . LEU F 2 159 ? 30.311  -84.562 22.309  1.00 95.44  ? 602  LEU F O     1 
ATOM   7925 C  CB    . LEU F 2 159 ? 31.797  -81.847 23.776  1.00 96.03  ? 602  LEU F CB    1 
ATOM   7926 C  CG    . LEU F 2 159 ? 31.872  -80.296 23.759  1.00 98.45  ? 602  LEU F CG    1 
ATOM   7927 C  CD1   . LEU F 2 159 ? 33.139  -79.697 24.368  1.00 101.58 ? 602  LEU F CD1   1 
ATOM   7928 C  CD2   . LEU F 2 159 ? 31.701  -79.780 22.338  1.00 97.81  ? 602  LEU F CD2   1 
ATOM   7929 N  N     . LYS F 2 160 ? 30.945  -84.624 24.481  1.00 92.79  ? 603  LYS F N     1 
ATOM   7930 C  CA    . LYS F 2 160 ? 31.158  -86.067 24.492  1.00 94.36  ? 603  LYS F CA    1 
ATOM   7931 C  C     . LYS F 2 160 ? 29.906  -86.870 24.149  1.00 94.79  ? 603  LYS F C     1 
ATOM   7932 O  O     . LYS F 2 160 ? 30.015  -88.034 23.755  1.00 101.33 ? 603  LYS F O     1 
ATOM   7933 C  CB    . LYS F 2 160 ? 31.706  -86.544 25.840  1.00 100.96 ? 603  LYS F CB    1 
ATOM   7934 C  CG    . LYS F 2 160 ? 33.114  -86.040 26.156  1.00 114.44 ? 603  LYS F CG    1 
ATOM   7935 C  CD    . LYS F 2 160 ? 33.534  -86.243 27.632  1.00 117.90 ? 603  LYS F CD    1 
ATOM   7936 C  CE    . LYS F 2 160 ? 34.880  -86.903 27.867  1.00 123.36 ? 603  LYS F CE    1 
ATOM   7937 N  NZ    . LYS F 2 160 ? 35.062  -88.197 27.165  1.00 126.42 ? 603  LYS F NZ    1 
ATOM   7938 N  N     . CYS F 2 161 ? 28.723  -86.281 24.303  1.00 95.98  ? 604  CYS F N     1 
ATOM   7939 C  CA    . CYS F 2 161 ? 27.478  -87.014 24.038  1.00 100.55 ? 604  CYS F CA    1 
ATOM   7940 C  C     . CYS F 2 161 ? 27.092  -87.004 22.572  1.00 104.16 ? 604  CYS F C     1 
ATOM   7941 O  O     . CYS F 2 161 ? 26.123  -87.663 22.185  1.00 106.29 ? 604  CYS F O     1 
ATOM   7942 C  CB    . CYS F 2 161 ? 26.329  -86.454 24.869  1.00 100.86 ? 604  CYS F CB    1 
ATOM   7943 S  SG    . CYS F 2 161 ? 26.680  -86.423 26.638  1.00 109.67 ? 604  CYS F SG    1 
ATOM   7944 N  N     . ALA F 2 162 ? 27.839  -86.256 21.759  1.00 102.43 ? 605  ALA F N     1 
ATOM   7945 C  CA    . ALA F 2 162 ? 27.502  -86.084 20.346  1.00 101.71 ? 605  ALA F CA    1 
ATOM   7946 C  C     . ALA F 2 162 ? 27.409  -87.424 19.614  1.00 100.89 ? 605  ALA F C     1 
ATOM   7947 O  O     . ALA F 2 162 ? 28.157  -88.356 19.901  1.00 100.88 ? 605  ALA F O     1 
ATOM   7948 C  CB    . ALA F 2 162 ? 28.523  -85.185 19.673  1.00 102.53 ? 605  ALA F CB    1 
ATOM   7949 N  N     . LEU F 2 163 ? 26.466  -87.512 18.684  1.00 99.60  ? 606  LEU F N     1 
ATOM   7950 C  CA    . LEU F 2 163 ? 26.218  -88.739 17.930  1.00 98.38  ? 606  LEU F CA    1 
ATOM   7951 C  C     . LEU F 2 163 ? 27.236  -88.974 16.803  1.00 107.88 ? 606  LEU F C     1 
ATOM   7952 O  O     . LEU F 2 163 ? 27.578  -90.120 16.498  1.00 117.10 ? 606  LEU F O     1 
ATOM   7953 C  CB    . LEU F 2 163 ? 24.809  -88.681 17.355  1.00 87.80  ? 606  LEU F CB    1 
ATOM   7954 C  CG    . LEU F 2 163 ? 24.239  -89.925 16.694  1.00 85.72  ? 606  LEU F CG    1 
ATOM   7955 C  CD1   . LEU F 2 163 ? 23.846  -90.980 17.732  1.00 85.76  ? 606  LEU F CD1   1 
ATOM   7956 C  CD2   . LEU F 2 163 ? 23.047  -89.527 15.846  1.00 82.86  ? 606  LEU F CD2   1 
ATOM   7957 N  N     . ASN F 2 164 ? 27.733  -87.901 16.192  1.00 114.64 ? 607  ASN F N     1 
ATOM   7958 C  CA    . ASN F 2 164 ? 28.793  -88.041 15.181  1.00 112.79 ? 607  ASN F CA    1 
ATOM   7959 C  C     . ASN F 2 164 ? 29.807  -86.899 15.230  1.00 115.35 ? 607  ASN F C     1 
ATOM   7960 O  O     . ASN F 2 164 ? 29.776  -85.993 16.085  1.00 116.48 ? 607  ASN F O     1 
ATOM   7961 C  CB    . ASN F 2 164 ? 28.236  -88.218 13.738  1.00 106.57 ? 607  ASN F CB    1 
ATOM   7962 C  CG    . ASN F 2 164 ? 27.014  -87.375 13.463  1.00 105.10 ? 607  ASN F CG    1 
ATOM   7963 O  OD1   . ASN F 2 164 ? 27.189  -86.230 13.124  1.00 107.88 ? 607  ASN F OD1   1 
ATOM   7964 N  ND2   . ASN F 2 164 ? 25.789  -87.924 13.557  1.00 96.99  ? 607  ASN F ND2   1 
ATOM   7965 N  N     . SER F 2 165 ? 30.746  -87.010 14.309  1.00 117.62 ? 608  SER F N     1 
ATOM   7966 C  CA    . SER F 2 165 ? 31.671  -85.948 13.972  1.00 116.54 ? 608  SER F CA    1 
ATOM   7967 C  C     . SER F 2 165 ? 30.999  -84.693 13.413  1.00 112.37 ? 608  SER F C     1 
ATOM   7968 O  O     . SER F 2 165 ? 31.437  -83.568 13.735  1.00 91.64  ? 608  SER F O     1 
ATOM   7969 C  CB    . SER F 2 165 ? 32.664  -86.492 12.954  1.00 120.73 ? 608  SER F CB    1 
ATOM   7970 O  OG    . SER F 2 165 ? 32.020  -87.455 12.130  1.00 120.22 ? 608  SER F OG    1 
ATOM   7971 N  N     . LYS F 2 166 ? 29.972  -84.875 12.568  1.00 112.64 ? 609  LYS F N     1 
ATOM   7972 C  CA    . LYS F 2 166 ? 29.230  -83.719 12.032  1.00 114.47 ? 609  LYS F CA    1 
ATOM   7973 C  C     . LYS F 2 166 ? 28.916  -82.804 13.191  1.00 118.54 ? 609  LYS F C     1 
ATOM   7974 O  O     . LYS F 2 166 ? 29.259  -81.620 13.197  1.00 116.96 ? 609  LYS F O     1 
ATOM   7975 C  CB    . LYS F 2 166 ? 27.901  -84.107 11.381  1.00 111.49 ? 609  LYS F CB    1 
ATOM   7976 C  CG    . LYS F 2 166 ? 27.987  -84.996 10.151  1.00 118.79 ? 609  LYS F CG    1 
ATOM   7977 C  CD    . LYS F 2 166 ? 26.755  -85.894 9.995   1.00 126.54 ? 609  LYS F CD    1 
ATOM   7978 C  CE    . LYS F 2 166 ? 27.112  -87.377 9.919   1.00 126.33 ? 609  LYS F CE    1 
ATOM   7979 N  NZ    . LYS F 2 166 ? 27.498  -87.725 8.530   1.00 134.77 ? 609  LYS F NZ    1 
ATOM   7980 N  N     . ILE F 2 167 ? 28.267  -83.403 14.184  1.00 118.82 ? 610  ILE F N     1 
ATOM   7981 C  CA    . ILE F 2 167 ? 27.617  -82.687 15.269  1.00 109.17 ? 610  ILE F CA    1 
ATOM   7982 C  C     . ILE F 2 167 ? 28.649  -82.024 16.189  1.00 109.79 ? 610  ILE F C     1 
ATOM   7983 O  O     . ILE F 2 167 ? 28.627  -80.803 16.379  1.00 102.60 ? 610  ILE F O     1 
ATOM   7984 C  CB    . ILE F 2 167 ? 26.704  -83.663 16.034  1.00 102.00 ? 610  ILE F CB    1 
ATOM   7985 C  CG1   . ILE F 2 167 ? 25.441  -83.933 15.203  1.00 98.96  ? 610  ILE F CG1   1 
ATOM   7986 C  CG2   . ILE F 2 167 ? 26.346  -83.131 17.408  1.00 102.94 ? 610  ILE F CG2   1 
ATOM   7987 C  CD1   . ILE F 2 167 ? 24.716  -85.192 15.589  1.00 100.15 ? 610  ILE F CD1   1 
ATOM   7988 N  N     . LEU F 2 168 ? 29.573  -82.834 16.704  1.00 110.44 ? 611  LEU F N     1 
ATOM   7989 C  CA    . LEU F 2 168 ? 30.751  -82.339 17.441  1.00 117.26 ? 611  LEU F CA    1 
ATOM   7990 C  C     . LEU F 2 168 ? 31.291  -81.045 16.849  1.00 120.19 ? 611  LEU F C     1 
ATOM   7991 O  O     . LEU F 2 168 ? 31.582  -80.082 17.562  1.00 119.12 ? 611  LEU F O     1 
ATOM   7992 C  CB    . LEU F 2 168 ? 31.875  -83.387 17.442  1.00 126.88 ? 611  LEU F CB    1 
ATOM   7993 C  CG    . LEU F 2 168 ? 32.042  -84.214 18.758  1.00 139.68 ? 611  LEU F CG    1 
ATOM   7994 C  CD1   . LEU F 2 168 ? 32.346  -85.704 18.525  1.00 143.65 ? 611  LEU F CD1   1 
ATOM   7995 C  CD2   . LEU F 2 168 ? 33.097  -83.647 19.705  1.00 134.22 ? 611  LEU F CD2   1 
ATOM   7996 N  N     . SER F 2 169 ? 31.426  -81.049 15.527  1.00 119.60 ? 612  SER F N     1 
ATOM   7997 C  CA    . SER F 2 169 ? 31.982  -79.930 14.790  1.00 114.11 ? 612  SER F CA    1 
ATOM   7998 C  C     . SER F 2 169 ? 31.117  -78.667 14.963  1.00 111.42 ? 612  SER F C     1 
ATOM   7999 O  O     . SER F 2 169 ? 31.627  -77.597 15.350  1.00 104.20 ? 612  SER F O     1 
ATOM   8000 C  CB    . SER F 2 169 ? 32.122  -80.346 13.329  1.00 113.29 ? 612  SER F CB    1 
ATOM   8001 O  OG    . SER F 2 169 ? 32.982  -79.490 12.617  1.00 118.50 ? 612  SER F OG    1 
ATOM   8002 N  N     . VAL F 2 170 ? 29.809  -78.823 14.725  1.00 109.77 ? 613  VAL F N     1 
ATOM   8003 C  CA    . VAL F 2 170 ? 28.811  -77.742 14.894  1.00 106.02 ? 613  VAL F CA    1 
ATOM   8004 C  C     . VAL F 2 170 ? 28.851  -77.135 16.282  1.00 104.17 ? 613  VAL F C     1 
ATOM   8005 O  O     . VAL F 2 170 ? 28.638  -75.930 16.453  1.00 100.69 ? 613  VAL F O     1 
ATOM   8006 C  CB    . VAL F 2 170 ? 27.361  -78.227 14.698  1.00 104.36 ? 613  VAL F CB    1 
ATOM   8007 C  CG1   . VAL F 2 170 ? 26.394  -77.044 14.754  1.00 111.44 ? 613  VAL F CG1   1 
ATOM   8008 C  CG2   . VAL F 2 170 ? 27.185  -78.974 13.382  1.00 107.00 ? 613  VAL F CG2   1 
ATOM   8009 N  N     . MET F 2 171 ? 29.108  -77.991 17.265  1.00 99.22  ? 614  MET F N     1 
ATOM   8010 C  CA    . MET F 2 171 ? 29.170  -77.574 18.650  1.00 104.32 ? 614  MET F CA    1 
ATOM   8011 C  C     . MET F 2 171 ? 30.460  -76.822 18.966  1.00 101.09 ? 614  MET F C     1 
ATOM   8012 O  O     . MET F 2 171 ? 30.418  -75.759 19.591  1.00 95.75  ? 614  MET F O     1 
ATOM   8013 C  CB    . MET F 2 171 ? 28.993  -78.793 19.561  1.00 118.40 ? 614  MET F CB    1 
ATOM   8014 C  CG    . MET F 2 171 ? 27.611  -79.434 19.423  1.00 126.71 ? 614  MET F CG    1 
ATOM   8015 S  SD    . MET F 2 171 ? 27.288  -80.905 20.423  1.00 133.11 ? 614  MET F SD    1 
ATOM   8016 C  CE    . MET F 2 171 ? 27.214  -80.196 22.059  1.00 126.94 ? 614  MET F CE    1 
ATOM   8017 N  N     . GLU F 2 172 ? 31.598  -77.356 18.515  1.00 103.46 ? 615  GLU F N     1 
ATOM   8018 C  CA    . GLU F 2 172 ? 32.886  -76.663 18.666  1.00 103.58 ? 615  GLU F CA    1 
ATOM   8019 C  C     . GLU F 2 172 ? 32.900  -75.304 17.991  1.00 107.55 ? 615  GLU F C     1 
ATOM   8020 O  O     . GLU F 2 172 ? 33.566  -74.387 18.473  1.00 110.99 ? 615  GLU F O     1 
ATOM   8021 C  CB    . GLU F 2 172 ? 34.020  -77.486 18.089  1.00 104.42 ? 615  GLU F CB    1 
ATOM   8022 C  CG    . GLU F 2 172 ? 34.598  -78.485 19.065  1.00 117.97 ? 615  GLU F CG    1 
ATOM   8023 C  CD    . GLU F 2 172 ? 34.797  -79.850 18.430  1.00 131.07 ? 615  GLU F CD    1 
ATOM   8024 O  OE1   . GLU F 2 172 ? 35.475  -79.936 17.386  1.00 128.06 ? 615  GLU F OE1   1 
ATOM   8025 O  OE2   . GLU F 2 172 ? 34.270  -80.839 18.971  1.00 135.45 ? 615  GLU F OE2   1 
ATOM   8026 N  N     . ALA F 2 173 ? 32.170  -75.192 16.878  1.00 111.85 ? 616  ALA F N     1 
ATOM   8027 C  CA    . ALA F 2 173 ? 31.957  -73.921 16.161  1.00 112.61 ? 616  ALA F CA    1 
ATOM   8028 C  C     . ALA F 2 173 ? 31.724  -72.699 17.060  1.00 117.94 ? 616  ALA F C     1 
ATOM   8029 O  O     . ALA F 2 173 ? 32.230  -71.609 16.779  1.00 124.99 ? 616  ALA F O     1 
ATOM   8030 C  CB    . ALA F 2 173 ? 30.802  -74.058 15.178  1.00 106.37 ? 616  ALA F CB    1 
ATOM   8031 N  N     . TYR F 2 174 ? 30.963  -72.875 18.136  1.00 125.15 ? 617  TYR F N     1 
ATOM   8032 C  CA    . TYR F 2 174 ? 30.704  -71.772 19.071  1.00 131.14 ? 617  TYR F CA    1 
ATOM   8033 C  C     . TYR F 2 174 ? 31.856  -71.698 20.066  1.00 136.42 ? 617  TYR F C     1 
ATOM   8034 O  O     . TYR F 2 174 ? 32.350  -70.610 20.404  1.00 145.44 ? 617  TYR F O     1 
ATOM   8035 C  CB    . TYR F 2 174 ? 29.328  -71.939 19.757  1.00 118.44 ? 617  TYR F CB    1 
ATOM   8036 C  CG    . TYR F 2 174 ? 28.172  -71.917 18.757  1.00 109.36 ? 617  TYR F CG    1 
ATOM   8037 C  CD1   . TYR F 2 174 ? 27.902  -73.021 17.942  1.00 103.39 ? 617  TYR F CD1   1 
ATOM   8038 C  CD2   . TYR F 2 174 ? 27.380  -70.768 18.587  1.00 98.46  ? 617  TYR F CD2   1 
ATOM   8039 C  CE1   . TYR F 2 174 ? 26.873  -72.988 17.005  1.00 104.15 ? 617  TYR F CE1   1 
ATOM   8040 C  CE2   . TYR F 2 174 ? 26.353  -70.727 17.645  1.00 87.19  ? 617  TYR F CE2   1 
ATOM   8041 C  CZ    . TYR F 2 174 ? 26.097  -71.840 16.861  1.00 93.58  ? 617  TYR F CZ    1 
ATOM   8042 O  OH    . TYR F 2 174 ? 25.064  -71.841 15.934  1.00 88.97  ? 617  TYR F OH    1 
ATOM   8043 N  N     . HIS F 2 175 ? 32.312  -72.875 20.480  1.00 134.89 ? 618  HIS F N     1 
ATOM   8044 C  CA    . HIS F 2 175 ? 33.507  -73.008 21.303  1.00 134.81 ? 618  HIS F CA    1 
ATOM   8045 C  C     . HIS F 2 175 ? 34.795  -72.548 20.611  1.00 122.81 ? 618  HIS F C     1 
ATOM   8046 O  O     . HIS F 2 175 ? 35.138  -71.371 20.642  1.00 102.43 ? 618  HIS F O     1 
ATOM   8047 C  CB    . HIS F 2 175 ? 33.660  -74.460 21.744  1.00 134.39 ? 618  HIS F CB    1 
ATOM   8048 C  CG    . HIS F 2 175 ? 34.119  -74.597 23.153  1.00 136.85 ? 618  HIS F CG    1 
ATOM   8049 N  ND1   . HIS F 2 175 ? 33.745  -75.651 23.959  1.00 138.20 ? 618  HIS F ND1   1 
ATOM   8050 C  CD2   . HIS F 2 175 ? 34.905  -73.795 23.911  1.00 133.53 ? 618  HIS F CD2   1 
ATOM   8051 C  CE1   . HIS F 2 175 ? 34.290  -75.499 25.153  1.00 137.86 ? 618  HIS F CE1   1 
ATOM   8052 N  NE2   . HIS F 2 175 ? 34.999  -74.381 25.149  1.00 142.16 ? 618  HIS F NE2   1 
HETATM 8053 P  PG    . GCP G 3 .   ? 9.733   -13.221 13.209  1.00 34.29  ? 1198 GCP A PG    1 
HETATM 8054 O  O1G   . GCP G 3 .   ? 9.848   -14.397 12.331  1.00 34.85  ? 1198 GCP A O1G   1 
HETATM 8055 O  O2G   . GCP G 3 .   ? 8.190   -13.040 13.516  1.00 42.54  ? 1198 GCP A O2G   1 
HETATM 8056 O  O3G   . GCP G 3 .   ? 10.121  -11.850 12.525  1.00 37.57  ? 1198 GCP A O3G   1 
HETATM 8057 C  C3B   . GCP G 3 .   ? 10.552  -13.603 14.703  1.00 36.10  ? 1198 GCP A C3B   1 
HETATM 8058 P  PB    . GCP G 3 .   ? 12.194  -14.121 14.312  1.00 37.96  ? 1198 GCP A PB    1 
HETATM 8059 O  O1B   . GCP G 3 .   ? 12.201  -15.575 13.974  1.00 38.06  ? 1198 GCP A O1B   1 
HETATM 8060 O  O2B   . GCP G 3 .   ? 12.903  -13.414 13.106  1.00 35.64  ? 1198 GCP A O2B   1 
HETATM 8061 O  O3A   . GCP G 3 .   ? 12.965  -13.751 15.676  1.00 39.53  ? 1198 GCP A O3A   1 
HETATM 8062 P  PA    . GCP G 3 .   ? 14.167  -12.689 15.779  1.00 43.68  ? 1198 GCP A PA    1 
HETATM 8063 O  O1A   . GCP G 3 .   ? 15.294  -13.161 14.900  1.00 44.88  ? 1198 GCP A O1A   1 
HETATM 8064 O  O2A   . GCP G 3 .   ? 13.647  -11.269 15.659  1.00 39.72  ? 1198 GCP A O2A   1 
HETATM 8065 O  "O5'" . GCP G 3 .   ? 14.535  -13.022 17.286  1.00 41.06  ? 1198 GCP A "O5'" 1 
HETATM 8066 C  "C5'" . GCP G 3 .   ? 13.444  -12.924 18.219  1.00 43.73  ? 1198 GCP A "C5'" 1 
HETATM 8067 C  "C4'" . GCP G 3 .   ? 13.965  -12.554 19.604  1.00 43.69  ? 1198 GCP A "C4'" 1 
HETATM 8068 O  "O4'" . GCP G 3 .   ? 14.708  -13.646 20.113  1.00 40.64  ? 1198 GCP A "O4'" 1 
HETATM 8069 C  "C3'" . GCP G 3 .   ? 14.927  -11.369 19.542  1.00 44.96  ? 1198 GCP A "C3'" 1 
HETATM 8070 O  "O3'" . GCP G 3 .   ? 14.770  -10.462 20.603  1.00 38.57  ? 1198 GCP A "O3'" 1 
HETATM 8071 C  "C2'" . GCP G 3 .   ? 16.278  -12.000 19.664  1.00 44.01  ? 1198 GCP A "C2'" 1 
HETATM 8072 O  "O2'" . GCP G 3 .   ? 17.184  -11.168 20.352  1.00 50.93  ? 1198 GCP A "O2'" 1 
HETATM 8073 C  "C1'" . GCP G 3 .   ? 15.996  -13.221 20.471  1.00 42.89  ? 1198 GCP A "C1'" 1 
HETATM 8074 N  N9    . GCP G 3 .   ? 16.931  -14.237 20.051  1.00 43.55  ? 1198 GCP A N9    1 
HETATM 8075 C  C8    . GCP G 3 .   ? 17.096  -14.685 18.822  1.00 45.56  ? 1198 GCP A C8    1 
HETATM 8076 N  N7    . GCP G 3 .   ? 18.045  -15.642 18.779  1.00 43.47  ? 1198 GCP A N7    1 
HETATM 8077 C  C5    . GCP G 3 .   ? 18.487  -15.785 19.990  1.00 42.08  ? 1198 GCP A C5    1 
HETATM 8078 C  C6    . GCP G 3 .   ? 19.488  -16.633 20.584  1.00 45.80  ? 1198 GCP A C6    1 
HETATM 8079 O  O6    . GCP G 3 .   ? 20.175  -17.449 19.898  1.00 47.12  ? 1198 GCP A O6    1 
HETATM 8080 N  N1    . GCP G 3 .   ? 19.620  -16.481 21.902  1.00 48.46  ? 1198 GCP A N1    1 
HETATM 8081 C  C2    . GCP G 3 .   ? 18.919  -15.601 22.640  1.00 49.68  ? 1198 GCP A C2    1 
HETATM 8082 N  N2    . GCP G 3 .   ? 19.185  -15.541 23.954  1.00 52.08  ? 1198 GCP A N2    1 
HETATM 8083 N  N3    . GCP G 3 .   ? 17.985  -14.772 22.138  1.00 48.37  ? 1198 GCP A N3    1 
HETATM 8084 C  C4    . GCP G 3 .   ? 17.751  -14.855 20.833  1.00 44.70  ? 1198 GCP A C4    1 
HETATM 8085 MG MG    . MG  H 4 .   ? 12.088  -12.040 11.695  1.00 32.86  ? 1199 MG  A MG    1 
HETATM 8086 P  PG    . GCP I 3 .   ? 57.747  -33.983 14.404  1.00 46.37  ? 1198 GCP B PG    1 
HETATM 8087 O  O1G   . GCP I 3 .   ? 56.683  -34.102 15.411  1.00 45.77  ? 1198 GCP B O1G   1 
HETATM 8088 O  O2G   . GCP I 3 .   ? 58.162  -35.486 14.068  1.00 55.37  ? 1198 GCP B O2G   1 
HETATM 8089 O  O3G   . GCP I 3 .   ? 58.991  -33.043 14.819  1.00 47.51  ? 1198 GCP B O3G   1 
HETATM 8090 C  C3B   . GCP I 3 .   ? 57.050  -33.322 12.935  1.00 46.21  ? 1198 GCP B C3B   1 
HETATM 8091 P  PB    . GCP I 3 .   ? 56.442  -31.712 13.334  1.00 44.72  ? 1198 GCP B PB    1 
HETATM 8092 O  O1B   . GCP I 3 .   ? 55.037  -32.023 13.675  1.00 43.33  ? 1198 GCP B O1B   1 
HETATM 8093 O  O2B   . GCP I 3 .   ? 57.181  -30.913 14.509  1.00 42.17  ? 1198 GCP B O2B   1 
HETATM 8094 O  O3A   . GCP I 3 .   ? 56.667  -30.972 11.926  1.00 48.07  ? 1198 GCP B O3A   1 
HETATM 8095 P  PA    . GCP I 3 .   ? 57.587  -29.669 11.865  1.00 48.32  ? 1198 GCP B PA    1 
HETATM 8096 O  O1A   . GCP I 3 .   ? 56.704  -28.655 12.529  1.00 57.51  ? 1198 GCP B O1A   1 
HETATM 8097 O  O2A   . GCP I 3 .   ? 58.993  -29.897 12.326  1.00 46.84  ? 1198 GCP B O2A   1 
HETATM 8098 O  "O5'" . GCP I 3 .   ? 57.683  -29.284 10.341  1.00 46.46  ? 1198 GCP B "O5'" 1 
HETATM 8099 C  "C5'" . GCP I 3 .   ? 57.347  -30.235 9.359   1.00 50.05  ? 1198 GCP B "C5'" 1 
HETATM 8100 C  "C4'" . GCP I 3 .   ? 57.678  -29.671 7.985   1.00 51.85  ? 1198 GCP B "C4'" 1 
HETATM 8101 O  "O4'" . GCP I 3 .   ? 56.509  -29.019 7.516   1.00 55.38  ? 1198 GCP B "O4'" 1 
HETATM 8102 C  "C3'" . GCP I 3 .   ? 58.769  -28.605 7.956   1.00 54.69  ? 1198 GCP B "C3'" 1 
HETATM 8103 O  "O3'" . GCP I 3 .   ? 59.460  -28.684 6.719   1.00 49.44  ? 1198 GCP B "O3'" 1 
HETATM 8104 C  "C2'" . GCP I 3 .   ? 58.039  -27.272 8.036   1.00 57.59  ? 1198 GCP B "C2'" 1 
HETATM 8105 O  "O2'" . GCP I 3 .   ? 58.730  -26.196 7.400   1.00 55.95  ? 1198 GCP B "O2'" 1 
HETATM 8106 C  "C1'" . GCP I 3 .   ? 56.786  -27.635 7.287   1.00 58.00  ? 1198 GCP B "C1'" 1 
HETATM 8107 N  N9    . GCP I 3 .   ? 55.602  -26.931 7.747   1.00 60.95  ? 1198 GCP B N9    1 
HETATM 8108 C  C8    . GCP I 3 .   ? 55.081  -26.923 8.967   1.00 63.94  ? 1198 GCP B C8    1 
HETATM 8109 N  N7    . GCP I 3 .   ? 53.942  -26.195 8.968   1.00 63.74  ? 1198 GCP B N7    1 
HETATM 8110 C  C5    . GCP I 3 .   ? 53.739  -25.744 7.727   1.00 71.34  ? 1198 GCP B C5    1 
HETATM 8111 C  C6    . GCP I 3 .   ? 52.734  -24.918 7.021   1.00 76.89  ? 1198 GCP B C6    1 
HETATM 8112 O  O6    . GCP I 3 .   ? 51.750  -24.444 7.640   1.00 85.45  ? 1198 GCP B O6    1 
HETATM 8113 N  N1    . GCP I 3 .   ? 52.909  -24.727 5.706   1.00 71.08  ? 1198 GCP B N1    1 
HETATM 8114 C  C2    . GCP I 3 .   ? 53.962  -25.241 5.042   1.00 70.31  ? 1198 GCP B C2    1 
HETATM 8115 N  N2    . GCP I 3 .   ? 54.117  -25.011 3.726   1.00 76.72  ? 1198 GCP B N2    1 
HETATM 8116 N  N3    . GCP I 3 .   ? 54.910  -25.988 5.618   1.00 69.93  ? 1198 GCP B N3    1 
HETATM 8117 C  C4    . GCP I 3 .   ? 54.839  -26.260 6.927   1.00 68.19  ? 1198 GCP B C4    1 
HETATM 8118 MG MG    . MG  J 4 .   ? 58.524  -31.500 15.817  1.00 44.99  ? 1199 MG  B MG    1 
HETATM 8119 P  PG    . GCP K 3 .   ? 5.259   -67.533 4.763   1.00 46.85  ? 1198 GCP C PG    1 
HETATM 8120 O  O1G   . GCP K 3 .   ? 4.776   -66.411 5.602   1.00 43.64  ? 1198 GCP C O1G   1 
HETATM 8121 O  O2G   . GCP K 3 .   ? 3.994   -68.060 3.953   1.00 48.82  ? 1198 GCP C O2G   1 
HETATM 8122 O  O3G   . GCP K 3 .   ? 5.969   -68.653 5.635   1.00 48.13  ? 1198 GCP C O3G   1 
HETATM 8123 C  C3B   . GCP K 3 .   ? 6.406   -67.331 3.442   1.00 44.83  ? 1198 GCP C C3B   1 
HETATM 8124 P  PB    . GCP K 3 .   ? 7.335   -65.878 3.672   1.00 47.38  ? 1198 GCP C PB    1 
HETATM 8125 O  O1B   . GCP K 3 .   ? 6.491   -64.694 3.838   1.00 45.41  ? 1198 GCP C O1B   1 
HETATM 8126 O  O2B   . GCP K 3 .   ? 8.218   -66.180 4.953   1.00 48.51  ? 1198 GCP C O2B   1 
HETATM 8127 O  O3A   . GCP K 3 .   ? 8.180   -65.866 2.320   1.00 52.81  ? 1198 GCP C O3A   1 
HETATM 8128 P  PA    . GCP K 3 .   ? 9.591   -66.643 2.203   1.00 56.75  ? 1198 GCP C PA    1 
HETATM 8129 O  O1A   . GCP K 3 .   ? 10.439  -65.886 3.208   1.00 54.95  ? 1198 GCP C O1A   1 
HETATM 8130 O  O2A   . GCP K 3 .   ? 9.611   -68.161 2.166   1.00 46.47  ? 1198 GCP C O2A   1 
HETATM 8131 O  "O5'" . GCP K 3 .   ? 9.756   -66.151 0.681   1.00 55.21  ? 1198 GCP C "O5'" 1 
HETATM 8132 C  "C5'" . GCP K 3 .   ? 8.950   -66.712 -0.363  1.00 56.11  ? 1198 GCP C "C5'" 1 
HETATM 8133 C  "C4'" . GCP K 3 .   ? 9.743   -66.862 -1.673  1.00 56.38  ? 1198 GCP C "C4'" 1 
HETATM 8134 O  "O4'" . GCP K 3 .   ? 10.107  -65.563 -2.126  1.00 54.75  ? 1198 GCP C "O4'" 1 
HETATM 8135 C  "C3'" . GCP K 3 .   ? 11.041  -67.669 -1.519  1.00 56.66  ? 1198 GCP C "C3'" 1 
HETATM 8136 O  "O3'" . GCP K 3 .   ? 11.174  -68.713 -2.479  1.00 50.52  ? 1198 GCP C "O3'" 1 
HETATM 8137 C  "C2'" . GCP K 3 .   ? 12.169  -66.675 -1.672  1.00 56.11  ? 1198 GCP C "C2'" 1 
HETATM 8138 O  "O2'" . GCP K 3 .   ? 13.253  -67.191 -2.438  1.00 56.75  ? 1198 GCP C "O2'" 1 
HETATM 8139 C  "C1'" . GCP K 3 .   ? 11.519  -65.499 -2.363  1.00 57.93  ? 1198 GCP C "C1'" 1 
HETATM 8140 N  N9    . GCP K 3 .   ? 12.026  -64.210 -1.855  1.00 61.22  ? 1198 GCP C N9    1 
HETATM 8141 C  C8    . GCP K 3 .   ? 11.967  -63.746 -0.597  1.00 62.09  ? 1198 GCP C C8    1 
HETATM 8142 N  N7    . GCP K 3 .   ? 12.499  -62.505 -0.520  1.00 64.07  ? 1198 GCP C N7    1 
HETATM 8143 C  C5    . GCP K 3 .   ? 12.915  -62.161 -1.755  1.00 68.34  ? 1198 GCP C C5    1 
HETATM 8144 C  C6    . GCP K 3 .   ? 13.572  -60.988 -2.391  1.00 69.43  ? 1198 GCP C C6    1 
HETATM 8145 O  O6    . GCP K 3 .   ? 13.894  -59.963 -1.749  1.00 63.82  ? 1198 GCP C O6    1 
HETATM 8146 N  N1    . GCP K 3 .   ? 13.800  -61.063 -3.708  1.00 78.47  ? 1198 GCP C N1    1 
HETATM 8147 C  C2    . GCP K 3 .   ? 13.469  -62.153 -4.455  1.00 78.31  ? 1198 GCP C C2    1 
HETATM 8148 N  N2    . GCP K 3 .   ? 13.736  -62.154 -5.781  1.00 80.47  ? 1198 GCP C N2    1 
HETATM 8149 N  N3    . GCP K 3 .   ? 12.874  -63.256 -3.946  1.00 68.73  ? 1198 GCP C N3    1 
HETATM 8150 C  C4    . GCP K 3 .   ? 12.587  -63.299 -2.629  1.00 66.88  ? 1198 GCP C C4    1 
HETATM 8151 MG MG    . MG  L 4 .   ? 7.956   -67.968 6.164   1.00 44.61  ? 1199 MG  C MG    1 
HETATM 8152 O  O     . HOH M 5 .   ? 17.666  -21.556 -6.346  1.00 51.07  ? 2001 HOH A O     1 
HETATM 8153 O  O     . HOH M 5 .   ? 11.988  -16.926 -6.875  1.00 41.26  ? 2002 HOH A O     1 
HETATM 8154 O  O     . HOH M 5 .   ? 11.712  -13.541 10.207  1.00 38.21  ? 2003 HOH A O     1 
HETATM 8155 O  O     . HOH M 5 .   ? 12.836  -10.841 13.327  1.00 32.93  ? 2004 HOH A O     1 
HETATM 8156 O  O     . HOH M 5 .   ? 18.849  -10.660 9.183   1.00 59.59  ? 2005 HOH A O     1 
HETATM 8157 O  O     . HOH M 5 .   ? 13.286  -9.064  9.248   1.00 54.12  ? 2008 HOH A O     1 
HETATM 8158 O  O     . HOH M 5 .   ? 21.135  -11.411 15.427  1.00 38.83  ? 2009 HOH A O     1 
HETATM 8159 O  O     . HOH M 5 .   ? 17.801  -8.746  15.437  1.00 49.53  ? 2010 HOH A O     1 
HETATM 8160 O  O     . HOH M 5 .   ? 3.537   -10.510 13.519  1.00 55.29  ? 2011 HOH A O     1 
HETATM 8161 O  O     . HOH M 5 .   ? 15.579  -14.673 23.456  1.00 68.71  ? 2012 HOH A O     1 
HETATM 8162 O  O     . HOH M 5 .   ? 14.944  -8.913  15.480  1.00 37.23  ? 2013 HOH A O     1 
HETATM 8163 O  O     . HOH M 5 .   ? 4.550   -10.938 8.142   1.00 42.58  ? 2014 HOH A O     1 
HETATM 8164 O  O     . HOH M 5 .   ? 5.298   -10.947 11.481  1.00 43.87  ? 2015 HOH A O     1 
HETATM 8165 O  O     . HOH M 5 .   ? 11.087  -7.363  7.151   1.00 53.34  ? 2016 HOH A O     1 
HETATM 8166 O  O     . HOH M 5 .   ? 11.335  -6.978  4.213   1.00 62.52  ? 2017 HOH A O     1 
HETATM 8167 O  O     . HOH M 5 .   ? 16.552  -11.275 7.618   1.00 27.15  ? 2018 HOH A O     1 
HETATM 8168 O  O     . HOH M 5 .   ? 15.942  -5.961  7.631   1.00 60.44  ? 2019 HOH A O     1 
HETATM 8169 O  O     . HOH M 5 .   ? 24.751  -9.258  2.164   1.00 57.58  ? 2020 HOH A O     1 
HETATM 8170 O  O     . HOH M 5 .   ? 29.019  -12.995 2.260   1.00 55.45  ? 2021 HOH A O     1 
HETATM 8171 O  O     . HOH M 5 .   ? 21.428  -12.977 -4.427  1.00 101.11 ? 2022 HOH A O     1 
HETATM 8172 O  O     . HOH M 5 .   ? 1.426   -15.963 3.632   1.00 66.89  ? 2023 HOH A O     1 
HETATM 8173 O  O     . HOH M 5 .   ? 1.099   -21.771 4.724   1.00 47.66  ? 2024 HOH A O     1 
HETATM 8174 O  O     . HOH M 5 .   ? -1.626  -23.067 8.959   1.00 60.10  ? 2025 HOH A O     1 
HETATM 8175 O  O     . HOH M 5 .   ? 0.489   -24.852 8.469   1.00 60.34  ? 2026 HOH A O     1 
HETATM 8176 O  O     . HOH M 5 .   ? -3.170  -16.163 -2.479  1.00 68.37  ? 2027 HOH A O     1 
HETATM 8177 O  O     . HOH M 5 .   ? -0.457  -20.212 -7.375  1.00 54.53  ? 2028 HOH A O     1 
HETATM 8178 O  O     . HOH M 5 .   ? 7.905   -17.487 -7.121  1.00 52.41  ? 2029 HOH A O     1 
HETATM 8179 O  O     . HOH M 5 .   ? 5.243   -10.331 1.087   1.00 49.41  ? 2030 HOH A O     1 
HETATM 8180 O  O     . HOH M 5 .   ? 7.250   -22.464 -13.546 1.00 67.78  ? 2031 HOH A O     1 
HETATM 8181 O  O     . HOH M 5 .   ? 4.028   -18.771 -12.714 1.00 73.82  ? 2032 HOH A O     1 
HETATM 8182 O  O     . HOH M 5 .   ? 7.971   -17.526 -10.976 1.00 72.21  ? 2033 HOH A O     1 
HETATM 8183 O  O     . HOH M 5 .   ? 9.550   -25.112 -7.360  1.00 63.50  ? 2034 HOH A O     1 
HETATM 8184 O  O     . HOH M 5 .   ? 11.380  -18.698 -8.486  1.00 55.16  ? 2035 HOH A O     1 
HETATM 8185 O  O     . HOH M 5 .   ? 5.409   -28.766 -5.813  1.00 65.64  ? 2036 HOH A O     1 
HETATM 8186 O  O     . HOH M 5 .   ? 8.315   -28.574 -7.172  1.00 69.40  ? 2037 HOH A O     1 
HETATM 8187 O  O     . HOH M 5 .   ? 21.068  -16.055 27.883  1.00 58.66  ? 2038 HOH A O     1 
HETATM 8188 O  O     . HOH M 5 .   ? 30.263  -22.529 16.087  1.00 57.85  ? 2039 HOH A O     1 
HETATM 8189 O  O     . HOH M 5 .   ? 17.916  -34.049 -1.373  1.00 52.60  ? 2040 HOH A O     1 
HETATM 8190 O  O     . HOH M 5 .   ? 8.747   -18.908 8.548   1.00 69.24  ? 2043 HOH A O     1 
HETATM 8191 O  O     . HOH M 5 .   ? 10.247  -13.740 21.384  1.00 34.89  ? 2044 HOH A O     1 
HETATM 8192 O  O     . HOH N 5 .   ? 52.607  -36.134 19.166  1.00 59.34  ? 2001 HOH B O     1 
HETATM 8193 O  O     . HOH N 5 .   ? 48.226  -36.594 12.835  1.00 52.78  ? 2002 HOH B O     1 
HETATM 8194 O  O     . HOH N 5 .   ? 57.252  -32.398 17.321  1.00 53.17  ? 2003 HOH B O     1 
HETATM 8195 O  O     . HOH N 5 .   ? 59.992  -30.425 14.654  1.00 52.60  ? 2004 HOH B O     1 
HETATM 8196 O  O     . HOH N 5 .   ? 61.682  -29.751 17.550  1.00 58.93  ? 2006 HOH B O     1 
HETATM 8197 O  O     . HOH N 5 .   ? 57.272  -22.274 12.111  1.00 62.89  ? 2007 HOH B O     1 
HETATM 8198 O  O     . HOH N 5 .   ? 61.096  -28.173 11.927  1.00 35.81  ? 2008 HOH B O     1 
HETATM 8199 O  O     . HOH N 5 .   ? 60.990  -38.263 16.059  1.00 58.27  ? 2009 HOH B O     1 
HETATM 8200 O  O     . HOH N 5 .   ? 63.701  -32.270 21.699  1.00 46.11  ? 2010 HOH B O     1 
HETATM 8201 O  O     . HOH N 5 .   ? 61.174  -39.311 19.522  1.00 70.75  ? 2011 HOH B O     1 
HETATM 8202 O  O     . HOH N 5 .   ? 56.476  -42.755 23.962  1.00 47.62  ? 2012 HOH B O     1 
HETATM 8203 O  O     . HOH N 5 .   ? 58.419  -49.380 22.018  1.00 89.65  ? 2013 HOH B O     1 
HETATM 8204 O  O     . HOH N 5 .   ? 52.527  -44.095 26.980  1.00 59.22  ? 2014 HOH B O     1 
HETATM 8205 O  O     . HOH N 5 .   ? 53.161  -45.566 35.237  1.00 59.81  ? 2015 HOH B O     1 
HETATM 8206 O  O     . HOH N 5 .   ? 53.921  -37.065 34.529  1.00 58.24  ? 2016 HOH B O     1 
HETATM 8207 O  O     . HOH N 5 .   ? 46.706  -36.273 34.081  1.00 60.74  ? 2017 HOH B O     1 
HETATM 8208 O  O     . HOH N 5 .   ? 37.361  -23.376 10.441  1.00 40.18  ? 2018 HOH B O     1 
HETATM 8209 O  O     . HOH N 5 .   ? 58.908  -24.583 18.557  1.00 63.82  ? 2033 HOH B O     1 
HETATM 8210 O  O     . HOH O 5 .   ? 6.129   -63.445 25.335  1.00 42.65  ? 2001 HOH C O     1 
HETATM 8211 O  O     . HOH O 5 .   ? 2.424   -63.027 9.109   1.00 57.06  ? 2002 HOH C O     1 
HETATM 8212 O  O     . HOH O 5 .   ? 7.029   -66.633 7.562   1.00 43.74  ? 2003 HOH C O     1 
HETATM 8213 O  O     . HOH O 5 .   ? 8.827   -69.217 4.657   1.00 49.45  ? 2004 HOH C O     1 
HETATM 8214 O  O     . HOH O 5 .   ? 16.655  -65.534 2.412   1.00 59.69  ? 2005 HOH C O     1 
HETATM 8215 O  O     . HOH O 5 .   ? 11.199  -70.140 2.207   1.00 38.51  ? 2006 HOH C O     1 
HETATM 8216 O  O     . HOH O 5 .   ? -5.550  -63.852 27.784  1.00 83.70  ? 2007 HOH C O     1 
HETATM 8217 O  O     . HOH O 5 .   ? 7.967   -73.189 11.263  1.00 65.62  ? 2008 HOH C O     1 
HETATM 8218 O  O     . HOH O 5 .   ? 0.687   -71.550 9.733   1.00 61.32  ? 2009 HOH C O     1 
HETATM 8219 O  O     . HOH O 5 .   ? 9.049   -72.796 13.723  1.00 55.50  ? 2010 HOH C O     1 
HETATM 8220 O  O     . HOH O 5 .   ? -3.404  -67.980 14.115  1.00 55.93  ? 2011 HOH C O     1 
HETATM 8221 O  O     . HOH O 5 .   ? -9.591  -70.191 12.439  1.00 55.03  ? 2012 HOH C O     1 
HETATM 8222 O  O     . HOH O 5 .   ? -5.824  -71.580 18.877  1.00 59.23  ? 2013 HOH C O     1 
HETATM 8223 O  O     . HOH O 5 .   ? -6.839  -64.691 25.569  1.00 52.53  ? 2014 HOH C O     1 
HETATM 8224 O  O     . HOH O 5 .   ? -6.811  -69.803 20.842  1.00 57.05  ? 2015 HOH C O     1 
HETATM 8225 O  O     . HOH O 5 .   ? 4.928   -62.175 26.925  1.00 54.37  ? 2016 HOH C O     1 
HETATM 8226 O  O     . HOH O 5 .   ? 3.844   -53.686 23.940  1.00 60.67  ? 2017 HOH C O     1 
HETATM 8227 O  O     . HOH O 5 .   ? -3.240  -51.813 21.869  1.00 71.98  ? 2018 HOH C O     1 
HETATM 8228 O  O     . HOH O 5 .   ? -0.153  -54.746 24.986  1.00 56.54  ? 2019 HOH C O     1 
HETATM 8229 O  O     . HOH P 5 .   ? -1.019  -11.633 -23.269 1.00 35.76  ? 2001 HOH D O     1 
HETATM 8230 O  O     . HOH P 5 .   ? -14.338 -7.758  -16.406 1.00 58.47  ? 2002 HOH D O     1 
HETATM 8231 O  O     . HOH P 5 .   ? -11.320 0.927   -23.439 1.00 62.99  ? 2005 HOH D O     1 
HETATM 8232 O  O     . HOH P 5 .   ? -13.407 6.690   -24.424 1.00 60.67  ? 2006 HOH D O     1 
HETATM 8233 O  O     . HOH P 5 .   ? -9.858  -1.173  -15.992 1.00 35.30  ? 2007 HOH D O     1 
HETATM 8234 O  O     . HOH P 5 .   ? -2.755  -14.142 -17.453 1.00 57.00  ? 2008 HOH D O     1 
HETATM 8235 O  O     . HOH P 5 .   ? -2.614  -13.186 -21.572 1.00 57.70  ? 2009 HOH D O     1 
HETATM 8236 O  O     . HOH P 5 .   ? 3.387   -6.370  -14.081 1.00 37.65  ? 2010 HOH D O     1 
HETATM 8237 O  O     . HOH P 5 .   ? 2.380   -10.346 -20.401 1.00 53.42  ? 2011 HOH D O     1 
HETATM 8238 O  O     . HOH P 5 .   ? 6.142   -5.810  -15.441 1.00 60.45  ? 2012 HOH D O     1 
HETATM 8239 O  O     . HOH P 5 .   ? 9.072   -12.398 -12.634 1.00 60.80  ? 2013 HOH D O     1 
HETATM 8240 O  O     . HOH P 5 .   ? 1.767   -12.343 -23.578 1.00 51.47  ? 2014 HOH D O     1 
HETATM 8241 O  O     . HOH P 5 .   ? 12.521  -9.502  -14.902 1.00 46.50  ? 2015 HOH D O     1 
HETATM 8242 O  O     . HOH P 5 .   ? 10.400  -1.645  -21.806 1.00 36.14  ? 2016 HOH D O     1 
HETATM 8243 O  O     . HOH P 5 .   ? 18.019  2.875   -20.667 1.00 68.04  ? 2017 HOH D O     1 
HETATM 8244 O  O     . HOH P 5 .   ? 8.687   7.334   -13.957 1.00 33.91  ? 2018 HOH D O     1 
HETATM 8245 O  O     . HOH P 5 .   ? 5.032   7.008   -15.538 1.00 53.13  ? 2019 HOH D O     1 
HETATM 8246 O  O     . HOH P 5 .   ? 5.508   4.549   -14.409 1.00 38.81  ? 2020 HOH D O     1 
HETATM 8247 O  O     . HOH P 5 .   ? 7.756   10.186  -22.607 1.00 50.57  ? 2021 HOH D O     1 
HETATM 8248 O  O     . HOH P 5 .   ? 10.349  10.429  -22.734 1.00 60.17  ? 2022 HOH D O     1 
HETATM 8249 O  O     . HOH P 5 .   ? 16.337  2.066   3.279   1.00 71.28  ? 2023 HOH D O     1 
HETATM 8250 O  O     . HOH P 5 .   ? 20.154  -6.759  0.701   1.00 55.93  ? 2024 HOH D O     1 
HETATM 8251 O  O     . HOH P 5 .   ? 18.888  -1.716  -13.387 1.00 45.50  ? 2026 HOH D O     1 
HETATM 8252 O  O     . HOH P 5 .   ? 21.866  0.562   -9.327  1.00 61.40  ? 2027 HOH D O     1 
HETATM 8253 O  O     . HOH P 5 .   ? 19.351  5.786   -21.118 1.00 36.20  ? 2028 HOH D O     1 
HETATM 8254 O  O     . HOH P 5 .   ? 15.606  10.454  -7.911  1.00 78.18  ? 2029 HOH D O     1 
HETATM 8255 O  O     . HOH P 5 .   ? 17.295  13.569  -10.367 1.00 85.95  ? 2030 HOH D O     1 
HETATM 8256 O  O     . HOH P 5 .   ? 7.882   13.144  -22.915 1.00 50.01  ? 2031 HOH D O     1 
HETATM 8257 O  O     . HOH P 5 .   ? -4.147  -6.773  -17.834 1.00 35.73  ? 2033 HOH D O     1 
HETATM 8258 O  O     . HOH P 5 .   ? -6.371  -4.373  -22.969 1.00 35.01  ? 2034 HOH D O     1 
HETATM 8259 O  O     . HOH Q 5 .   ? 58.154  -33.172 44.961  1.00 57.11  ? 2001 HOH E O     1 
HETATM 8260 O  O     . HOH Q 5 .   ? 66.153  -49.159 27.346  1.00 70.66  ? 2002 HOH E O     1 
HETATM 8261 O  O     . HOH Q 5 .   ? 66.851  -54.267 30.178  1.00 71.70  ? 2003 HOH E O     1 
HETATM 8262 O  O     . HOH Q 5 .   ? 65.689  -39.829 41.495  1.00 44.34  ? 2004 HOH E O     1 
HETATM 8263 O  O     . HOH Q 5 .   ? 59.978  -35.634 45.568  1.00 61.19  ? 2005 HOH E O     1 
HETATM 8264 O  O     . HOH Q 5 .   ? 75.365  -37.884 26.895  1.00 45.65  ? 2006 HOH E O     1 
HETATM 8265 O  O     . HOH Q 5 .   ? 58.918  -35.243 39.865  1.00 58.15  ? 2007 HOH E O     1 
HETATM 8266 O  O     . HOH Q 5 .   ? 64.453  -30.464 23.753  1.00 46.23  ? 2008 HOH E O     1 
HETATM 8267 O  O     . HOH Q 5 .   ? 67.971  -23.746 40.551  1.00 52.52  ? 2009 HOH E O     1 
HETATM 8268 O  O     . HOH Q 5 .   ? 65.992  -17.359 40.097  1.00 74.70  ? 2010 HOH E O     1 
HETATM 8269 O  O     . HOH R 5 .   ? -15.787 -75.735 37.538  1.00 61.42  ? 2001 HOH F O     1 
HETATM 8270 O  O     . HOH R 5 .   ? -6.206  -78.611 35.726  1.00 48.75  ? 2002 HOH F O     1 
HETATM 8271 O  O     . HOH R 5 .   ? -7.385  -77.950 38.189  1.00 45.39  ? 2003 HOH F O     1 
HETATM 8272 O  O     . HOH R 5 .   ? -7.009  -81.391 41.352  1.00 56.99  ? 2004 HOH F O     1 
HETATM 8273 O  O     . HOH R 5 .   ? -0.844  -73.306 38.199  1.00 48.16  ? 2005 HOH F O     1 
HETATM 8274 O  O     . HOH R 5 .   ? 4.935   -69.111 30.607  1.00 52.91  ? 2006 HOH F O     1 
HETATM 8275 O  O     . HOH R 5 .   ? -2.554  -64.620 30.276  1.00 65.41  ? 2007 HOH F O     1 
HETATM 8276 O  O     . HOH R 5 .   ? 7.608   -69.831 31.435  1.00 55.98  ? 2008 HOH F O     1 
HETATM 8277 O  O     . HOH R 5 .   ? 8.986   -70.780 33.609  1.00 60.27  ? 2009 HOH F O     1 
HETATM 8278 O  O     . HOH R 5 .   ? 10.639  -90.396 40.596  1.00 49.04  ? 2010 HOH F O     1 
HETATM 8279 O  O     . HOH R 5 .   ? 16.951  -73.067 13.856  1.00 81.43  ? 2011 HOH F O     1 
HETATM 8280 O  O     . HOH R 5 .   ? 16.735  -70.631 16.726  1.00 61.55  ? 2012 HOH F O     1 
HETATM 8281 O  O     . HOH R 5 .   ? 15.897  -76.486 31.103  1.00 72.30  ? 2014 HOH F O     1 
HETATM 8282 O  O     . HOH R 5 .   ? 19.639  -88.381 27.338  1.00 67.27  ? 2015 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  ?   ?   ?   A . n 
A 1 2   PRO 2   -3  ?   ?   ?   A . n 
A 1 3   LEU 3   -2  ?   ?   ?   A . n 
A 1 4   GLY 4   -1  ?   ?   ?   A . n 
A 1 5   SER 5   0   ?   ?   ?   A . n 
A 1 6   MET 6   1   ?   ?   ?   A . n 
A 1 7   ALA 7   2   ?   ?   ?   A . n 
A 1 8   GLY 8   3   ?   ?   ?   A . n 
A 1 9   GLY 9   4   ?   ?   ?   A . n 
A 1 10  GLY 10  5   ?   ?   ?   A . n 
A 1 11  ALA 11  6   ?   ?   ?   A . n 
A 1 12  GLY 12  7   ?   ?   ?   A . n 
A 1 13  ASP 13  8   ?   ?   ?   A . n 
A 1 14  PRO 14  9   ?   ?   ?   A . n 
A 1 15  GLY 15  10  ?   ?   ?   A . n 
A 1 16  LEU 16  11  ?   ?   ?   A . n 
A 1 17  GLY 17  12  ?   ?   ?   A . n 
A 1 18  ALA 18  13  ?   ?   ?   A . n 
A 1 19  ALA 19  14  ?   ?   ?   A . n 
A 1 20  ALA 20  15  ?   ?   ?   A . n 
A 1 21  ALA 21  16  ?   ?   ?   A . n 
A 1 22  PRO 22  17  ?   ?   ?   A . n 
A 1 23  ALA 23  18  ?   ?   ?   A . n 
A 1 24  PRO 24  19  ?   ?   ?   A . n 
A 1 25  GLU 25  20  ?   ?   ?   A . n 
A 1 26  THR 26  21  ?   ?   ?   A . n 
A 1 27  ARG 27  22  22  ARG ARG A . n 
A 1 28  GLU 28  23  23  GLU GLU A . n 
A 1 29  HIS 29  24  24  HIS HIS A . n 
A 1 30  LEU 30  25  25  LEU LEU A . n 
A 1 31  PHE 31  26  26  PHE PHE A . n 
A 1 32  LYS 32  27  27  LYS LYS A . n 
A 1 33  VAL 33  28  28  VAL VAL A . n 
A 1 34  LEU 34  29  29  LEU LEU A . n 
A 1 35  VAL 35  30  30  VAL VAL A . n 
A 1 36  ILE 36  31  31  ILE ILE A . n 
A 1 37  GLY 37  32  32  GLY GLY A . n 
A 1 38  GLU 38  33  33  GLU GLU A . n 
A 1 39  LEU 39  34  34  LEU LEU A . n 
A 1 40  GLY 40  35  35  GLY GLY A . n 
A 1 41  VAL 41  36  36  VAL VAL A . n 
A 1 42  GLY 42  37  37  GLY GLY A . n 
A 1 43  LYS 43  38  38  LYS LYS A . n 
A 1 44  THR 44  39  39  THR THR A . n 
A 1 45  SER 45  40  40  SER SER A . n 
A 1 46  ILE 46  41  41  ILE ILE A . n 
A 1 47  ILE 47  42  42  ILE ILE A . n 
A 1 48  LYS 48  43  43  LYS LYS A . n 
A 1 49  ARG 49  44  44  ARG ARG A . n 
A 1 50  TYR 50  45  45  TYR TYR A . n 
A 1 51  VAL 51  46  46  VAL VAL A . n 
A 1 52  HIS 52  47  47  HIS HIS A . n 
A 1 53  GLN 53  48  48  GLN GLN A . n 
A 1 54  LEU 54  49  49  LEU LEU A . n 
A 1 55  PHE 55  50  50  PHE PHE A . n 
A 1 56  SER 56  51  51  SER SER A . n 
A 1 57  GLN 57  52  52  GLN GLN A . n 
A 1 58  HIS 58  53  53  HIS HIS A . n 
A 1 59  TYR 59  54  54  TYR TYR A . n 
A 1 60  ARG 60  55  55  ARG ARG A . n 
A 1 61  ALA 61  56  56  ALA ALA A . n 
A 1 62  THR 62  57  57  THR THR A . n 
A 1 63  ILE 63  58  58  ILE ILE A . n 
A 1 64  GLY 64  59  59  GLY GLY A . n 
A 1 65  VAL 65  60  60  VAL VAL A . n 
A 1 66  ASP 66  61  61  ASP ASP A . n 
A 1 67  PHE 67  62  62  PHE PHE A . n 
A 1 68  ALA 68  63  63  ALA ALA A . n 
A 1 69  LEU 69  64  64  LEU LEU A . n 
A 1 70  LYS 70  65  65  LYS LYS A . n 
A 1 71  VAL 71  66  66  VAL VAL A . n 
A 1 72  LEU 72  67  67  LEU LEU A . n 
A 1 73  ASN 73  68  68  ASN ASN A . n 
A 1 74  TRP 74  69  69  TRP TRP A . n 
A 1 75  ASP 75  70  70  ASP ASP A . n 
A 1 76  SER 76  71  71  SER SER A . n 
A 1 77  ARG 77  72  72  ARG ARG A . n 
A 1 78  THR 78  73  73  THR THR A . n 
A 1 79  LEU 79  74  74  LEU LEU A . n 
A 1 80  VAL 80  75  75  VAL VAL A . n 
A 1 81  ARG 81  76  76  ARG ARG A . n 
A 1 82  LEU 82  77  77  LEU LEU A . n 
A 1 83  GLN 83  78  78  GLN GLN A . n 
A 1 84  LEU 84  79  79  LEU LEU A . n 
A 1 85  TRP 85  80  80  TRP TRP A . n 
A 1 86  ASP 86  81  81  ASP ASP A . n 
A 1 87  ILE 87  82  82  ILE ILE A . n 
A 1 88  ALA 88  83  83  ALA ALA A . n 
A 1 89  GLY 89  84  84  GLY GLY A . n 
A 1 90  LEU 90  85  85  LEU LEU A . n 
A 1 91  GLU 91  86  86  GLU GLU A . n 
A 1 92  ARG 92  87  87  ARG ARG A . n 
A 1 93  PHE 93  88  88  PHE PHE A . n 
A 1 94  GLY 94  89  89  GLY GLY A . n 
A 1 95  ASN 95  90  90  ASN ASN A . n 
A 1 96  MET 96  91  91  MET MET A . n 
A 1 97  THR 97  92  92  THR THR A . n 
A 1 98  ARG 98  93  93  ARG ARG A . n 
A 1 99  VAL 99  94  94  VAL VAL A . n 
A 1 100 TYR 100 95  95  TYR TYR A . n 
A 1 101 TYR 101 96  96  TYR TYR A . n 
A 1 102 LYS 102 97  97  LYS LYS A . n 
A 1 103 GLU 103 98  98  GLU GLU A . n 
A 1 104 ALA 104 99  99  ALA ALA A . n 
A 1 105 VAL 105 100 100 VAL VAL A . n 
A 1 106 GLY 106 101 101 GLY GLY A . n 
A 1 107 ALA 107 102 102 ALA ALA A . n 
A 1 108 PHE 108 103 103 PHE PHE A . n 
A 1 109 VAL 109 104 104 VAL VAL A . n 
A 1 110 VAL 110 105 105 VAL VAL A . n 
A 1 111 PHE 111 106 106 PHE PHE A . n 
A 1 112 ASP 112 107 107 ASP ASP A . n 
A 1 113 ILE 113 108 108 ILE ILE A . n 
A 1 114 SER 114 109 109 SER SER A . n 
A 1 115 ARG 115 110 110 ARG ARG A . n 
A 1 116 SER 116 111 111 SER SER A . n 
A 1 117 SER 117 112 112 SER SER A . n 
A 1 118 THR 118 113 113 THR THR A . n 
A 1 119 PHE 119 114 114 PHE PHE A . n 
A 1 120 GLU 120 115 115 GLU GLU A . n 
A 1 121 ALA 121 116 116 ALA ALA A . n 
A 1 122 VAL 122 117 117 VAL VAL A . n 
A 1 123 LEU 123 118 118 LEU LEU A . n 
A 1 124 LYS 124 119 119 LYS LYS A . n 
A 1 125 TRP 125 120 120 TRP TRP A . n 
A 1 126 LYS 126 121 121 LYS LYS A . n 
A 1 127 SER 127 122 122 SER SER A . n 
A 1 128 ASP 128 123 123 ASP ASP A . n 
A 1 129 LEU 129 124 124 LEU LEU A . n 
A 1 130 ASP 130 125 125 ASP ASP A . n 
A 1 131 SER 131 126 126 SER SER A . n 
A 1 132 LYS 132 127 127 LYS LYS A . n 
A 1 133 VAL 133 128 128 VAL VAL A . n 
A 1 134 HIS 134 129 129 HIS HIS A . n 
A 1 135 LEU 135 130 130 LEU LEU A . n 
A 1 136 PRO 136 131 131 PRO PRO A . n 
A 1 137 ASN 137 132 132 ASN ASN A . n 
A 1 138 GLY 138 133 133 GLY GLY A . n 
A 1 139 SER 139 134 134 SER SER A . n 
A 1 140 PRO 140 135 135 PRO PRO A . n 
A 1 141 ILE 141 136 136 ILE ILE A . n 
A 1 142 PRO 142 137 137 PRO PRO A . n 
A 1 143 ALA 143 138 138 ALA ALA A . n 
A 1 144 VAL 144 139 139 VAL VAL A . n 
A 1 145 LEU 145 140 140 LEU LEU A . n 
A 1 146 LEU 146 141 141 LEU LEU A . n 
A 1 147 ALA 147 142 142 ALA ALA A . n 
A 1 148 ASN 148 143 143 ASN ASN A . n 
A 1 149 LYS 149 144 144 LYS LYS A . n 
A 1 150 CYS 150 145 145 CYS CYS A . n 
A 1 151 ASP 151 146 146 ASP ASP A . n 
A 1 152 GLN 152 147 147 GLN GLN A . n 
A 1 153 ASN 153 148 148 ASN ASN A . n 
A 1 154 LYS 154 149 149 LYS LYS A . n 
A 1 155 ASP 155 150 150 ASP ASP A . n 
A 1 156 SER 156 151 151 SER SER A . n 
A 1 157 SER 157 152 152 SER SER A . n 
A 1 158 GLN 158 153 153 GLN GLN A . n 
A 1 159 SER 159 154 154 SER SER A . n 
A 1 160 PRO 160 155 155 PRO PRO A . n 
A 1 161 SER 161 156 156 SER SER A . n 
A 1 162 GLN 162 157 157 GLN GLN A . n 
A 1 163 VAL 163 158 158 VAL VAL A . n 
A 1 164 ASP 164 159 159 ASP ASP A . n 
A 1 165 GLN 165 160 160 GLN GLN A . n 
A 1 166 PHE 166 161 161 PHE PHE A . n 
A 1 167 CYS 167 162 162 CYS CYS A . n 
A 1 168 LYS 168 163 163 LYS LYS A . n 
A 1 169 GLU 169 164 164 GLU GLU A . n 
A 1 170 HIS 170 165 165 HIS HIS A . n 
A 1 171 GLY 171 166 166 GLY GLY A . n 
A 1 172 PHE 172 167 167 PHE PHE A . n 
A 1 173 ALA 173 168 168 ALA ALA A . n 
A 1 174 GLY 174 169 169 GLY GLY A . n 
A 1 175 TRP 175 170 170 TRP TRP A . n 
A 1 176 PHE 176 171 171 PHE PHE A . n 
A 1 177 GLU 177 172 172 GLU GLU A . n 
A 1 178 THR 178 173 173 THR THR A . n 
A 1 179 SER 179 174 174 SER SER A . n 
A 1 180 ALA 180 175 175 ALA ALA A . n 
A 1 181 LYS 181 176 176 LYS LYS A . n 
A 1 182 ASP 182 177 177 ASP ASP A . n 
A 1 183 ASN 183 178 178 ASN ASN A . n 
A 1 184 ILE 184 179 179 ILE ILE A . n 
A 1 185 ASN 185 180 180 ASN ASN A . n 
A 1 186 ILE 186 181 181 ILE ILE A . n 
A 1 187 GLU 187 182 182 GLU GLU A . n 
A 1 188 GLU 188 183 183 GLU GLU A . n 
A 1 189 ALA 189 184 184 ALA ALA A . n 
A 1 190 ALA 190 185 185 ALA ALA A . n 
A 1 191 ARG 191 186 186 ARG ARG A . n 
A 1 192 PHE 192 187 187 PHE PHE A . n 
A 1 193 LEU 193 188 188 LEU LEU A . n 
A 1 194 VAL 194 189 189 VAL VAL A . n 
A 1 195 GLU 195 190 190 GLU GLU A . n 
A 1 196 LYS 196 191 191 LYS LYS A . n 
A 1 197 ILE 197 192 192 ILE ILE A . n 
A 1 198 LEU 198 193 193 LEU LEU A . n 
A 1 199 VAL 199 194 194 VAL VAL A . n 
A 1 200 ASN 200 195 195 ASN ASN A . n 
A 1 201 HIS 201 196 196 HIS HIS A . n 
A 1 202 GLN 202 197 197 GLN GLN A . n 
A 1 203 SER 203 198 198 SER SER A . n 
A 1 204 PHE 204 199 ?   ?   ?   A . n 
A 1 205 PRO 205 200 ?   ?   ?   A . n 
A 1 206 ASN 206 201 ?   ?   ?   A . n 
A 1 207 GLU 207 202 ?   ?   ?   A . n 
A 1 208 GLU 208 203 ?   ?   ?   A . n 
A 1 209 ASN 209 204 ?   ?   ?   A . n 
A 1 210 ASP 210 205 ?   ?   ?   A . n 
A 1 211 VAL 211 206 ?   ?   ?   A . n 
A 1 212 ASP 212 207 ?   ?   ?   A . n 
A 1 213 LYS 213 208 ?   ?   ?   A . n 
A 1 214 ILE 214 209 ?   ?   ?   A . n 
A 1 215 LYS 215 210 ?   ?   ?   A . n 
A 1 216 LEU 216 211 ?   ?   ?   A . n 
A 1 217 ASP 217 212 ?   ?   ?   A . n 
A 1 218 GLN 218 213 ?   ?   ?   A . n 
A 1 219 GLU 219 214 ?   ?   ?   A . n 
A 1 220 THR 220 215 ?   ?   ?   A . n 
A 1 221 LEU 221 216 ?   ?   ?   A . n 
A 1 222 ARG 222 217 ?   ?   ?   A . n 
A 1 223 ALA 223 218 ?   ?   ?   A . n 
A 1 224 GLU 224 219 ?   ?   ?   A . n 
A 1 225 ASN 225 220 ?   ?   ?   A . n 
A 1 226 LYS 226 221 ?   ?   ?   A . n 
A 1 227 SER 227 222 ?   ?   ?   A . n 
A 1 228 GLN 228 223 ?   ?   ?   A . n 
A 1 229 CYS 229 224 ?   ?   ?   A . n 
A 1 230 CYS 230 225 ?   ?   ?   A . n 
B 1 1   GLY 1   -4  ?   ?   ?   B . n 
B 1 2   PRO 2   -3  ?   ?   ?   B . n 
B 1 3   LEU 3   -2  ?   ?   ?   B . n 
B 1 4   GLY 4   -1  ?   ?   ?   B . n 
B 1 5   SER 5   0   ?   ?   ?   B . n 
B 1 6   MET 6   1   ?   ?   ?   B . n 
B 1 7   ALA 7   2   ?   ?   ?   B . n 
B 1 8   GLY 8   3   ?   ?   ?   B . n 
B 1 9   GLY 9   4   ?   ?   ?   B . n 
B 1 10  GLY 10  5   ?   ?   ?   B . n 
B 1 11  ALA 11  6   ?   ?   ?   B . n 
B 1 12  GLY 12  7   ?   ?   ?   B . n 
B 1 13  ASP 13  8   ?   ?   ?   B . n 
B 1 14  PRO 14  9   ?   ?   ?   B . n 
B 1 15  GLY 15  10  ?   ?   ?   B . n 
B 1 16  LEU 16  11  ?   ?   ?   B . n 
B 1 17  GLY 17  12  ?   ?   ?   B . n 
B 1 18  ALA 18  13  ?   ?   ?   B . n 
B 1 19  ALA 19  14  ?   ?   ?   B . n 
B 1 20  ALA 20  15  ?   ?   ?   B . n 
B 1 21  ALA 21  16  ?   ?   ?   B . n 
B 1 22  PRO 22  17  ?   ?   ?   B . n 
B 1 23  ALA 23  18  ?   ?   ?   B . n 
B 1 24  PRO 24  19  ?   ?   ?   B . n 
B 1 25  GLU 25  20  ?   ?   ?   B . n 
B 1 26  THR 26  21  ?   ?   ?   B . n 
B 1 27  ARG 27  22  ?   ?   ?   B . n 
B 1 28  GLU 28  23  23  GLU GLU B . n 
B 1 29  HIS 29  24  24  HIS HIS B . n 
B 1 30  LEU 30  25  25  LEU LEU B . n 
B 1 31  PHE 31  26  26  PHE PHE B . n 
B 1 32  LYS 32  27  27  LYS LYS B . n 
B 1 33  VAL 33  28  28  VAL VAL B . n 
B 1 34  LEU 34  29  29  LEU LEU B . n 
B 1 35  VAL 35  30  30  VAL VAL B . n 
B 1 36  ILE 36  31  31  ILE ILE B . n 
B 1 37  GLY 37  32  32  GLY GLY B . n 
B 1 38  GLU 38  33  33  GLU GLU B . n 
B 1 39  LEU 39  34  34  LEU LEU B . n 
B 1 40  GLY 40  35  35  GLY GLY B . n 
B 1 41  VAL 41  36  36  VAL VAL B . n 
B 1 42  GLY 42  37  37  GLY GLY B . n 
B 1 43  LYS 43  38  38  LYS LYS B . n 
B 1 44  THR 44  39  39  THR THR B . n 
B 1 45  SER 45  40  40  SER SER B . n 
B 1 46  ILE 46  41  41  ILE ILE B . n 
B 1 47  ILE 47  42  42  ILE ILE B . n 
B 1 48  LYS 48  43  43  LYS LYS B . n 
B 1 49  ARG 49  44  44  ARG ARG B . n 
B 1 50  TYR 50  45  45  TYR TYR B . n 
B 1 51  VAL 51  46  46  VAL VAL B . n 
B 1 52  HIS 52  47  47  HIS HIS B . n 
B 1 53  GLN 53  48  48  GLN GLN B . n 
B 1 54  LEU 54  49  49  LEU LEU B . n 
B 1 55  PHE 55  50  50  PHE PHE B . n 
B 1 56  SER 56  51  51  SER SER B . n 
B 1 57  GLN 57  52  52  GLN GLN B . n 
B 1 58  HIS 58  53  53  HIS HIS B . n 
B 1 59  TYR 59  54  54  TYR TYR B . n 
B 1 60  ARG 60  55  55  ARG ARG B . n 
B 1 61  ALA 61  56  56  ALA ALA B . n 
B 1 62  THR 62  57  57  THR THR B . n 
B 1 63  ILE 63  58  58  ILE ILE B . n 
B 1 64  GLY 64  59  59  GLY GLY B . n 
B 1 65  VAL 65  60  60  VAL VAL B . n 
B 1 66  ASP 66  61  61  ASP ASP B . n 
B 1 67  PHE 67  62  62  PHE PHE B . n 
B 1 68  ALA 68  63  63  ALA ALA B . n 
B 1 69  LEU 69  64  64  LEU LEU B . n 
B 1 70  LYS 70  65  65  LYS LYS B . n 
B 1 71  VAL 71  66  66  VAL VAL B . n 
B 1 72  LEU 72  67  67  LEU LEU B . n 
B 1 73  ASN 73  68  68  ASN ASN B . n 
B 1 74  TRP 74  69  69  TRP TRP B . n 
B 1 75  ASP 75  70  70  ASP ASP B . n 
B 1 76  SER 76  71  71  SER SER B . n 
B 1 77  ARG 77  72  72  ARG ARG B . n 
B 1 78  THR 78  73  73  THR THR B . n 
B 1 79  LEU 79  74  74  LEU LEU B . n 
B 1 80  VAL 80  75  75  VAL VAL B . n 
B 1 81  ARG 81  76  76  ARG ARG B . n 
B 1 82  LEU 82  77  77  LEU LEU B . n 
B 1 83  GLN 83  78  78  GLN GLN B . n 
B 1 84  LEU 84  79  79  LEU LEU B . n 
B 1 85  TRP 85  80  80  TRP TRP B . n 
B 1 86  ASP 86  81  81  ASP ASP B . n 
B 1 87  ILE 87  82  82  ILE ILE B . n 
B 1 88  ALA 88  83  83  ALA ALA B . n 
B 1 89  GLY 89  84  84  GLY GLY B . n 
B 1 90  LEU 90  85  85  LEU LEU B . n 
B 1 91  GLU 91  86  86  GLU GLU B . n 
B 1 92  ARG 92  87  87  ARG ARG B . n 
B 1 93  PHE 93  88  88  PHE PHE B . n 
B 1 94  GLY 94  89  89  GLY GLY B . n 
B 1 95  ASN 95  90  90  ASN ASN B . n 
B 1 96  MET 96  91  91  MET MET B . n 
B 1 97  THR 97  92  92  THR THR B . n 
B 1 98  ARG 98  93  93  ARG ARG B . n 
B 1 99  VAL 99  94  94  VAL VAL B . n 
B 1 100 TYR 100 95  95  TYR TYR B . n 
B 1 101 TYR 101 96  96  TYR TYR B . n 
B 1 102 LYS 102 97  97  LYS LYS B . n 
B 1 103 GLU 103 98  98  GLU GLU B . n 
B 1 104 ALA 104 99  99  ALA ALA B . n 
B 1 105 VAL 105 100 100 VAL VAL B . n 
B 1 106 GLY 106 101 101 GLY GLY B . n 
B 1 107 ALA 107 102 102 ALA ALA B . n 
B 1 108 PHE 108 103 103 PHE PHE B . n 
B 1 109 VAL 109 104 104 VAL VAL B . n 
B 1 110 VAL 110 105 105 VAL VAL B . n 
B 1 111 PHE 111 106 106 PHE PHE B . n 
B 1 112 ASP 112 107 107 ASP ASP B . n 
B 1 113 ILE 113 108 108 ILE ILE B . n 
B 1 114 SER 114 109 109 SER SER B . n 
B 1 115 ARG 115 110 110 ARG ARG B . n 
B 1 116 SER 116 111 111 SER SER B . n 
B 1 117 SER 117 112 112 SER SER B . n 
B 1 118 THR 118 113 113 THR THR B . n 
B 1 119 PHE 119 114 114 PHE PHE B . n 
B 1 120 GLU 120 115 115 GLU GLU B . n 
B 1 121 ALA 121 116 116 ALA ALA B . n 
B 1 122 VAL 122 117 117 VAL VAL B . n 
B 1 123 LEU 123 118 118 LEU LEU B . n 
B 1 124 LYS 124 119 119 LYS LYS B . n 
B 1 125 TRP 125 120 120 TRP TRP B . n 
B 1 126 LYS 126 121 121 LYS LYS B . n 
B 1 127 SER 127 122 122 SER SER B . n 
B 1 128 ASP 128 123 123 ASP ASP B . n 
B 1 129 LEU 129 124 124 LEU LEU B . n 
B 1 130 ASP 130 125 125 ASP ASP B . n 
B 1 131 SER 131 126 126 SER SER B . n 
B 1 132 LYS 132 127 127 LYS LYS B . n 
B 1 133 VAL 133 128 128 VAL VAL B . n 
B 1 134 HIS 134 129 129 HIS HIS B . n 
B 1 135 LEU 135 130 130 LEU LEU B . n 
B 1 136 PRO 136 131 131 PRO PRO B . n 
B 1 137 ASN 137 132 132 ASN ASN B . n 
B 1 138 GLY 138 133 133 GLY GLY B . n 
B 1 139 SER 139 134 134 SER SER B . n 
B 1 140 PRO 140 135 135 PRO PRO B . n 
B 1 141 ILE 141 136 136 ILE ILE B . n 
B 1 142 PRO 142 137 137 PRO PRO B . n 
B 1 143 ALA 143 138 138 ALA ALA B . n 
B 1 144 VAL 144 139 139 VAL VAL B . n 
B 1 145 LEU 145 140 140 LEU LEU B . n 
B 1 146 LEU 146 141 141 LEU LEU B . n 
B 1 147 ALA 147 142 142 ALA ALA B . n 
B 1 148 ASN 148 143 143 ASN ASN B . n 
B 1 149 LYS 149 144 144 LYS LYS B . n 
B 1 150 CYS 150 145 145 CYS CYS B . n 
B 1 151 ASP 151 146 146 ASP ASP B . n 
B 1 152 GLN 152 147 147 GLN GLN B . n 
B 1 153 ASN 153 148 148 ASN ASN B . n 
B 1 154 LYS 154 149 149 LYS LYS B . n 
B 1 155 ASP 155 150 150 ASP ASP B . n 
B 1 156 SER 156 151 151 SER SER B . n 
B 1 157 SER 157 152 152 SER SER B . n 
B 1 158 GLN 158 153 153 GLN GLN B . n 
B 1 159 SER 159 154 154 SER SER B . n 
B 1 160 PRO 160 155 155 PRO PRO B . n 
B 1 161 SER 161 156 156 SER SER B . n 
B 1 162 GLN 162 157 157 GLN GLN B . n 
B 1 163 VAL 163 158 158 VAL VAL B . n 
B 1 164 ASP 164 159 159 ASP ASP B . n 
B 1 165 GLN 165 160 160 GLN GLN B . n 
B 1 166 PHE 166 161 161 PHE PHE B . n 
B 1 167 CYS 167 162 162 CYS CYS B . n 
B 1 168 LYS 168 163 163 LYS LYS B . n 
B 1 169 GLU 169 164 164 GLU GLU B . n 
B 1 170 HIS 170 165 165 HIS HIS B . n 
B 1 171 GLY 171 166 166 GLY GLY B . n 
B 1 172 PHE 172 167 167 PHE PHE B . n 
B 1 173 ALA 173 168 168 ALA ALA B . n 
B 1 174 GLY 174 169 169 GLY GLY B . n 
B 1 175 TRP 175 170 170 TRP TRP B . n 
B 1 176 PHE 176 171 171 PHE PHE B . n 
B 1 177 GLU 177 172 172 GLU GLU B . n 
B 1 178 THR 178 173 173 THR THR B . n 
B 1 179 SER 179 174 174 SER SER B . n 
B 1 180 ALA 180 175 175 ALA ALA B . n 
B 1 181 LYS 181 176 176 LYS LYS B . n 
B 1 182 ASP 182 177 177 ASP ASP B . n 
B 1 183 ASN 183 178 178 ASN ASN B . n 
B 1 184 ILE 184 179 179 ILE ILE B . n 
B 1 185 ASN 185 180 180 ASN ASN B . n 
B 1 186 ILE 186 181 181 ILE ILE B . n 
B 1 187 GLU 187 182 182 GLU GLU B . n 
B 1 188 GLU 188 183 183 GLU GLU B . n 
B 1 189 ALA 189 184 184 ALA ALA B . n 
B 1 190 ALA 190 185 185 ALA ALA B . n 
B 1 191 ARG 191 186 186 ARG ARG B . n 
B 1 192 PHE 192 187 187 PHE PHE B . n 
B 1 193 LEU 193 188 188 LEU LEU B . n 
B 1 194 VAL 194 189 189 VAL VAL B . n 
B 1 195 GLU 195 190 190 GLU GLU B . n 
B 1 196 LYS 196 191 191 LYS LYS B . n 
B 1 197 ILE 197 192 192 ILE ILE B . n 
B 1 198 LEU 198 193 193 LEU LEU B . n 
B 1 199 VAL 199 194 194 VAL VAL B . n 
B 1 200 ASN 200 195 195 ASN ASN B . n 
B 1 201 HIS 201 196 196 HIS HIS B . n 
B 1 202 GLN 202 197 197 GLN GLN B . n 
B 1 203 SER 203 198 ?   ?   ?   B . n 
B 1 204 PHE 204 199 ?   ?   ?   B . n 
B 1 205 PRO 205 200 ?   ?   ?   B . n 
B 1 206 ASN 206 201 ?   ?   ?   B . n 
B 1 207 GLU 207 202 ?   ?   ?   B . n 
B 1 208 GLU 208 203 ?   ?   ?   B . n 
B 1 209 ASN 209 204 ?   ?   ?   B . n 
B 1 210 ASP 210 205 ?   ?   ?   B . n 
B 1 211 VAL 211 206 ?   ?   ?   B . n 
B 1 212 ASP 212 207 ?   ?   ?   B . n 
B 1 213 LYS 213 208 ?   ?   ?   B . n 
B 1 214 ILE 214 209 ?   ?   ?   B . n 
B 1 215 LYS 215 210 ?   ?   ?   B . n 
B 1 216 LEU 216 211 ?   ?   ?   B . n 
B 1 217 ASP 217 212 ?   ?   ?   B . n 
B 1 218 GLN 218 213 ?   ?   ?   B . n 
B 1 219 GLU 219 214 ?   ?   ?   B . n 
B 1 220 THR 220 215 ?   ?   ?   B . n 
B 1 221 LEU 221 216 ?   ?   ?   B . n 
B 1 222 ARG 222 217 ?   ?   ?   B . n 
B 1 223 ALA 223 218 ?   ?   ?   B . n 
B 1 224 GLU 224 219 ?   ?   ?   B . n 
B 1 225 ASN 225 220 ?   ?   ?   B . n 
B 1 226 LYS 226 221 ?   ?   ?   B . n 
B 1 227 SER 227 222 ?   ?   ?   B . n 
B 1 228 GLN 228 223 ?   ?   ?   B . n 
B 1 229 CYS 229 224 ?   ?   ?   B . n 
B 1 230 CYS 230 225 ?   ?   ?   B . n 
C 1 1   GLY 1   -4  ?   ?   ?   C . n 
C 1 2   PRO 2   -3  ?   ?   ?   C . n 
C 1 3   LEU 3   -2  ?   ?   ?   C . n 
C 1 4   GLY 4   -1  ?   ?   ?   C . n 
C 1 5   SER 5   0   ?   ?   ?   C . n 
C 1 6   MET 6   1   ?   ?   ?   C . n 
C 1 7   ALA 7   2   ?   ?   ?   C . n 
C 1 8   GLY 8   3   ?   ?   ?   C . n 
C 1 9   GLY 9   4   ?   ?   ?   C . n 
C 1 10  GLY 10  5   ?   ?   ?   C . n 
C 1 11  ALA 11  6   ?   ?   ?   C . n 
C 1 12  GLY 12  7   ?   ?   ?   C . n 
C 1 13  ASP 13  8   ?   ?   ?   C . n 
C 1 14  PRO 14  9   ?   ?   ?   C . n 
C 1 15  GLY 15  10  ?   ?   ?   C . n 
C 1 16  LEU 16  11  ?   ?   ?   C . n 
C 1 17  GLY 17  12  ?   ?   ?   C . n 
C 1 18  ALA 18  13  ?   ?   ?   C . n 
C 1 19  ALA 19  14  ?   ?   ?   C . n 
C 1 20  ALA 20  15  ?   ?   ?   C . n 
C 1 21  ALA 21  16  ?   ?   ?   C . n 
C 1 22  PRO 22  17  ?   ?   ?   C . n 
C 1 23  ALA 23  18  ?   ?   ?   C . n 
C 1 24  PRO 24  19  ?   ?   ?   C . n 
C 1 25  GLU 25  20  ?   ?   ?   C . n 
C 1 26  THR 26  21  ?   ?   ?   C . n 
C 1 27  ARG 27  22  22  ARG ARG C . n 
C 1 28  GLU 28  23  23  GLU GLU C . n 
C 1 29  HIS 29  24  24  HIS HIS C . n 
C 1 30  LEU 30  25  25  LEU LEU C . n 
C 1 31  PHE 31  26  26  PHE PHE C . n 
C 1 32  LYS 32  27  27  LYS LYS C . n 
C 1 33  VAL 33  28  28  VAL VAL C . n 
C 1 34  LEU 34  29  29  LEU LEU C . n 
C 1 35  VAL 35  30  30  VAL VAL C . n 
C 1 36  ILE 36  31  31  ILE ILE C . n 
C 1 37  GLY 37  32  32  GLY GLY C . n 
C 1 38  GLU 38  33  33  GLU GLU C . n 
C 1 39  LEU 39  34  34  LEU LEU C . n 
C 1 40  GLY 40  35  35  GLY GLY C . n 
C 1 41  VAL 41  36  36  VAL VAL C . n 
C 1 42  GLY 42  37  37  GLY GLY C . n 
C 1 43  LYS 43  38  38  LYS LYS C . n 
C 1 44  THR 44  39  39  THR THR C . n 
C 1 45  SER 45  40  40  SER SER C . n 
C 1 46  ILE 46  41  41  ILE ILE C . n 
C 1 47  ILE 47  42  42  ILE ILE C . n 
C 1 48  LYS 48  43  43  LYS LYS C . n 
C 1 49  ARG 49  44  44  ARG ARG C . n 
C 1 50  TYR 50  45  45  TYR TYR C . n 
C 1 51  VAL 51  46  46  VAL VAL C . n 
C 1 52  HIS 52  47  47  HIS HIS C . n 
C 1 53  GLN 53  48  48  GLN GLN C . n 
C 1 54  LEU 54  49  49  LEU LEU C . n 
C 1 55  PHE 55  50  50  PHE PHE C . n 
C 1 56  SER 56  51  51  SER SER C . n 
C 1 57  GLN 57  52  52  GLN GLN C . n 
C 1 58  HIS 58  53  53  HIS HIS C . n 
C 1 59  TYR 59  54  54  TYR TYR C . n 
C 1 60  ARG 60  55  55  ARG ARG C . n 
C 1 61  ALA 61  56  56  ALA ALA C . n 
C 1 62  THR 62  57  57  THR THR C . n 
C 1 63  ILE 63  58  58  ILE ILE C . n 
C 1 64  GLY 64  59  59  GLY GLY C . n 
C 1 65  VAL 65  60  60  VAL VAL C . n 
C 1 66  ASP 66  61  61  ASP ASP C . n 
C 1 67  PHE 67  62  62  PHE PHE C . n 
C 1 68  ALA 68  63  63  ALA ALA C . n 
C 1 69  LEU 69  64  64  LEU LEU C . n 
C 1 70  LYS 70  65  65  LYS LYS C . n 
C 1 71  VAL 71  66  66  VAL VAL C . n 
C 1 72  LEU 72  67  67  LEU LEU C . n 
C 1 73  ASN 73  68  68  ASN ASN C . n 
C 1 74  TRP 74  69  69  TRP TRP C . n 
C 1 75  ASP 75  70  70  ASP ASP C . n 
C 1 76  SER 76  71  71  SER SER C . n 
C 1 77  ARG 77  72  72  ARG ARG C . n 
C 1 78  THR 78  73  73  THR THR C . n 
C 1 79  LEU 79  74  74  LEU LEU C . n 
C 1 80  VAL 80  75  75  VAL VAL C . n 
C 1 81  ARG 81  76  76  ARG ARG C . n 
C 1 82  LEU 82  77  77  LEU LEU C . n 
C 1 83  GLN 83  78  78  GLN GLN C . n 
C 1 84  LEU 84  79  79  LEU LEU C . n 
C 1 85  TRP 85  80  80  TRP TRP C . n 
C 1 86  ASP 86  81  81  ASP ASP C . n 
C 1 87  ILE 87  82  82  ILE ILE C . n 
C 1 88  ALA 88  83  83  ALA ALA C . n 
C 1 89  GLY 89  84  84  GLY GLY C . n 
C 1 90  LEU 90  85  85  LEU LEU C . n 
C 1 91  GLU 91  86  86  GLU GLU C . n 
C 1 92  ARG 92  87  87  ARG ARG C . n 
C 1 93  PHE 93  88  88  PHE PHE C . n 
C 1 94  GLY 94  89  89  GLY GLY C . n 
C 1 95  ASN 95  90  90  ASN ASN C . n 
C 1 96  MET 96  91  91  MET MET C . n 
C 1 97  THR 97  92  92  THR THR C . n 
C 1 98  ARG 98  93  93  ARG ARG C . n 
C 1 99  VAL 99  94  94  VAL VAL C . n 
C 1 100 TYR 100 95  95  TYR TYR C . n 
C 1 101 TYR 101 96  96  TYR TYR C . n 
C 1 102 LYS 102 97  97  LYS LYS C . n 
C 1 103 GLU 103 98  98  GLU GLU C . n 
C 1 104 ALA 104 99  99  ALA ALA C . n 
C 1 105 VAL 105 100 100 VAL VAL C . n 
C 1 106 GLY 106 101 101 GLY GLY C . n 
C 1 107 ALA 107 102 102 ALA ALA C . n 
C 1 108 PHE 108 103 103 PHE PHE C . n 
C 1 109 VAL 109 104 104 VAL VAL C . n 
C 1 110 VAL 110 105 105 VAL VAL C . n 
C 1 111 PHE 111 106 106 PHE PHE C . n 
C 1 112 ASP 112 107 107 ASP ASP C . n 
C 1 113 ILE 113 108 108 ILE ILE C . n 
C 1 114 SER 114 109 109 SER SER C . n 
C 1 115 ARG 115 110 110 ARG ARG C . n 
C 1 116 SER 116 111 111 SER SER C . n 
C 1 117 SER 117 112 112 SER SER C . n 
C 1 118 THR 118 113 113 THR THR C . n 
C 1 119 PHE 119 114 114 PHE PHE C . n 
C 1 120 GLU 120 115 115 GLU GLU C . n 
C 1 121 ALA 121 116 116 ALA ALA C . n 
C 1 122 VAL 122 117 117 VAL VAL C . n 
C 1 123 LEU 123 118 118 LEU LEU C . n 
C 1 124 LYS 124 119 119 LYS LYS C . n 
C 1 125 TRP 125 120 120 TRP TRP C . n 
C 1 126 LYS 126 121 121 LYS LYS C . n 
C 1 127 SER 127 122 122 SER SER C . n 
C 1 128 ASP 128 123 123 ASP ASP C . n 
C 1 129 LEU 129 124 124 LEU LEU C . n 
C 1 130 ASP 130 125 125 ASP ASP C . n 
C 1 131 SER 131 126 126 SER SER C . n 
C 1 132 LYS 132 127 127 LYS LYS C . n 
C 1 133 VAL 133 128 128 VAL VAL C . n 
C 1 134 HIS 134 129 129 HIS HIS C . n 
C 1 135 LEU 135 130 130 LEU LEU C . n 
C 1 136 PRO 136 131 131 PRO PRO C . n 
C 1 137 ASN 137 132 132 ASN ASN C . n 
C 1 138 GLY 138 133 133 GLY GLY C . n 
C 1 139 SER 139 134 134 SER SER C . n 
C 1 140 PRO 140 135 135 PRO PRO C . n 
C 1 141 ILE 141 136 136 ILE ILE C . n 
C 1 142 PRO 142 137 137 PRO PRO C . n 
C 1 143 ALA 143 138 138 ALA ALA C . n 
C 1 144 VAL 144 139 139 VAL VAL C . n 
C 1 145 LEU 145 140 140 LEU LEU C . n 
C 1 146 LEU 146 141 141 LEU LEU C . n 
C 1 147 ALA 147 142 142 ALA ALA C . n 
C 1 148 ASN 148 143 143 ASN ASN C . n 
C 1 149 LYS 149 144 144 LYS LYS C . n 
C 1 150 CYS 150 145 145 CYS CYS C . n 
C 1 151 ASP 151 146 146 ASP ASP C . n 
C 1 152 GLN 152 147 147 GLN GLN C . n 
C 1 153 ASN 153 148 148 ASN ASN C . n 
C 1 154 LYS 154 149 149 LYS LYS C . n 
C 1 155 ASP 155 150 150 ASP ASP C . n 
C 1 156 SER 156 151 151 SER SER C . n 
C 1 157 SER 157 152 152 SER SER C . n 
C 1 158 GLN 158 153 153 GLN GLN C . n 
C 1 159 SER 159 154 154 SER SER C . n 
C 1 160 PRO 160 155 155 PRO PRO C . n 
C 1 161 SER 161 156 156 SER SER C . n 
C 1 162 GLN 162 157 157 GLN GLN C . n 
C 1 163 VAL 163 158 158 VAL VAL C . n 
C 1 164 ASP 164 159 159 ASP ASP C . n 
C 1 165 GLN 165 160 160 GLN GLN C . n 
C 1 166 PHE 166 161 161 PHE PHE C . n 
C 1 167 CYS 167 162 162 CYS CYS C . n 
C 1 168 LYS 168 163 163 LYS LYS C . n 
C 1 169 GLU 169 164 164 GLU GLU C . n 
C 1 170 HIS 170 165 165 HIS HIS C . n 
C 1 171 GLY 171 166 166 GLY GLY C . n 
C 1 172 PHE 172 167 167 PHE PHE C . n 
C 1 173 ALA 173 168 168 ALA ALA C . n 
C 1 174 GLY 174 169 169 GLY GLY C . n 
C 1 175 TRP 175 170 170 TRP TRP C . n 
C 1 176 PHE 176 171 171 PHE PHE C . n 
C 1 177 GLU 177 172 172 GLU GLU C . n 
C 1 178 THR 178 173 173 THR THR C . n 
C 1 179 SER 179 174 174 SER SER C . n 
C 1 180 ALA 180 175 175 ALA ALA C . n 
C 1 181 LYS 181 176 176 LYS LYS C . n 
C 1 182 ASP 182 177 177 ASP ASP C . n 
C 1 183 ASN 183 178 178 ASN ASN C . n 
C 1 184 ILE 184 179 179 ILE ILE C . n 
C 1 185 ASN 185 180 180 ASN ASN C . n 
C 1 186 ILE 186 181 181 ILE ILE C . n 
C 1 187 GLU 187 182 182 GLU GLU C . n 
C 1 188 GLU 188 183 183 GLU GLU C . n 
C 1 189 ALA 189 184 184 ALA ALA C . n 
C 1 190 ALA 190 185 185 ALA ALA C . n 
C 1 191 ARG 191 186 186 ARG ARG C . n 
C 1 192 PHE 192 187 187 PHE PHE C . n 
C 1 193 LEU 193 188 188 LEU LEU C . n 
C 1 194 VAL 194 189 189 VAL VAL C . n 
C 1 195 GLU 195 190 190 GLU GLU C . n 
C 1 196 LYS 196 191 191 LYS LYS C . n 
C 1 197 ILE 197 192 192 ILE ILE C . n 
C 1 198 LEU 198 193 193 LEU LEU C . n 
C 1 199 VAL 199 194 194 VAL VAL C . n 
C 1 200 ASN 200 195 195 ASN ASN C . n 
C 1 201 HIS 201 196 196 HIS HIS C . n 
C 1 202 GLN 202 197 197 GLN GLN C . n 
C 1 203 SER 203 198 198 SER SER C . n 
C 1 204 PHE 204 199 ?   ?   ?   C . n 
C 1 205 PRO 205 200 ?   ?   ?   C . n 
C 1 206 ASN 206 201 ?   ?   ?   C . n 
C 1 207 GLU 207 202 ?   ?   ?   C . n 
C 1 208 GLU 208 203 ?   ?   ?   C . n 
C 1 209 ASN 209 204 ?   ?   ?   C . n 
C 1 210 ASP 210 205 ?   ?   ?   C . n 
C 1 211 VAL 211 206 ?   ?   ?   C . n 
C 1 212 ASP 212 207 ?   ?   ?   C . n 
C 1 213 LYS 213 208 ?   ?   ?   C . n 
C 1 214 ILE 214 209 ?   ?   ?   C . n 
C 1 215 LYS 215 210 ?   ?   ?   C . n 
C 1 216 LEU 216 211 ?   ?   ?   C . n 
C 1 217 ASP 217 212 ?   ?   ?   C . n 
C 1 218 GLN 218 213 ?   ?   ?   C . n 
C 1 219 GLU 219 214 ?   ?   ?   C . n 
C 1 220 THR 220 215 ?   ?   ?   C . n 
C 1 221 LEU 221 216 ?   ?   ?   C . n 
C 1 222 ARG 222 217 ?   ?   ?   C . n 
C 1 223 ALA 223 218 ?   ?   ?   C . n 
C 1 224 GLU 224 219 ?   ?   ?   C . n 
C 1 225 ASN 225 220 ?   ?   ?   C . n 
C 1 226 LYS 226 221 ?   ?   ?   C . n 
C 1 227 SER 227 222 ?   ?   ?   C . n 
C 1 228 GLN 228 223 ?   ?   ?   C . n 
C 1 229 CYS 229 224 ?   ?   ?   C . n 
C 1 230 CYS 230 225 ?   ?   ?   C . n 
D 2 1   GLY 1   444 ?   ?   ?   D . n 
D 2 2   PRO 2   445 ?   ?   ?   D . n 
D 2 3   LEU 3   446 ?   ?   ?   D . n 
D 2 4   GLY 4   447 ?   ?   ?   D . n 
D 2 5   SER 5   448 ?   ?   ?   D . n 
D 2 6   MET 6   449 ?   ?   ?   D . n 
D 2 7   ASP 7   450 ?   ?   ?   D . n 
D 2 8   PRO 8   451 ?   ?   ?   D . n 
D 2 9   SER 9   452 452 SER SER D . n 
D 2 10  VAL 10  453 453 VAL VAL D . n 
D 2 11  VAL 11  454 454 VAL VAL D . n 
D 2 12  THR 12  455 455 THR THR D . n 
D 2 13  PRO 13  456 456 PRO PRO D . n 
D 2 14  PHE 14  457 457 PHE PHE D . n 
D 2 15  SER 15  458 458 SER SER D . n 
D 2 16  ARG 16  459 459 ARG ARG D . n 
D 2 17  ASP 17  460 460 ASP ASP D . n 
D 2 18  ASP 18  461 461 ASP ASP D . n 
D 2 19  ARG 19  462 462 ARG ARG D . n 
D 2 20  GLY 20  463 463 GLY GLY D . n 
D 2 21  HIS 21  464 464 HIS HIS D . n 
D 2 22  THR 22  465 465 THR THR D . n 
D 2 23  PRO 23  466 466 PRO PRO D . n 
D 2 24  LEU 24  467 467 LEU LEU D . n 
D 2 25  HIS 25  468 468 HIS HIS D . n 
D 2 26  VAL 26  469 469 VAL VAL D . n 
D 2 27  ALA 27  470 470 ALA ALA D . n 
D 2 28  ALA 28  471 471 ALA ALA D . n 
D 2 29  VAL 29  472 472 VAL VAL D . n 
D 2 30  CYS 30  473 473 CYS CYS D . n 
D 2 31  GLY 31  474 474 GLY GLY D . n 
D 2 32  GLN 32  475 475 GLN GLN D . n 
D 2 33  ALA 33  476 476 ALA ALA D . n 
D 2 34  SER 34  477 477 SER SER D . n 
D 2 35  LEU 35  478 478 LEU LEU D . n 
D 2 36  ILE 36  479 479 ILE ILE D . n 
D 2 37  ASP 37  480 480 ASP ASP D . n 
D 2 38  LEU 38  481 481 LEU LEU D . n 
D 2 39  LEU 39  482 482 LEU LEU D . n 
D 2 40  VAL 40  483 483 VAL VAL D . n 
D 2 41  SER 41  484 484 SER SER D . n 
D 2 42  LYS 42  485 485 LYS LYS D . n 
D 2 43  GLY 43  486 486 GLY GLY D . n 
D 2 44  ALA 44  487 487 ALA ALA D . n 
D 2 45  MET 45  488 488 MET MET D . n 
D 2 46  VAL 46  489 489 VAL VAL D . n 
D 2 47  ASN 47  490 490 ASN ASN D . n 
D 2 48  ALA 48  491 491 ALA ALA D . n 
D 2 49  THR 49  492 492 THR THR D . n 
D 2 50  ASP 50  493 493 ASP ASP D . n 
D 2 51  TYR 51  494 494 TYR TYR D . n 
D 2 52  HIS 52  495 495 HIS HIS D . n 
D 2 53  GLY 53  496 496 GLY GLY D . n 
D 2 54  ALA 54  497 497 ALA ALA D . n 
D 2 55  THR 55  498 498 THR THR D . n 
D 2 56  PRO 56  499 499 PRO PRO D . n 
D 2 57  LEU 57  500 500 LEU LEU D . n 
D 2 58  HIS 58  501 501 HIS HIS D . n 
D 2 59  LEU 59  502 502 LEU LEU D . n 
D 2 60  ALA 60  503 503 ALA ALA D . n 
D 2 61  CYS 61  504 504 CYS CYS D . n 
D 2 62  GLN 62  505 505 GLN GLN D . n 
D 2 63  LYS 63  506 506 LYS LYS D . n 
D 2 64  GLY 64  507 507 GLY GLY D . n 
D 2 65  TYR 65  508 508 TYR TYR D . n 
D 2 66  GLN 66  509 509 GLN GLN D . n 
D 2 67  SER 67  510 510 SER SER D . n 
D 2 68  VAL 68  511 511 VAL VAL D . n 
D 2 69  THR 69  512 512 THR THR D . n 
D 2 70  LEU 70  513 513 LEU LEU D . n 
D 2 71  LEU 71  514 514 LEU LEU D . n 
D 2 72  LEU 72  515 515 LEU LEU D . n 
D 2 73  LEU 73  516 516 LEU LEU D . n 
D 2 74  HIS 74  517 517 HIS HIS D . n 
D 2 75  TYR 75  518 518 TYR TYR D . n 
D 2 76  LYS 76  519 519 LYS LYS D . n 
D 2 77  ALA 77  520 520 ALA ALA D . n 
D 2 78  SER 78  521 521 SER SER D . n 
D 2 79  ALA 79  522 522 ALA ALA D . n 
D 2 80  GLU 80  523 523 GLU GLU D . n 
D 2 81  VAL 81  524 524 VAL VAL D . n 
D 2 82  GLN 82  525 525 GLN GLN D . n 
D 2 83  ASP 83  526 526 ASP ASP D . n 
D 2 84  ASN 84  527 527 ASN ASN D . n 
D 2 85  ASN 85  528 528 ASN ASN D . n 
D 2 86  GLY 86  529 529 GLY GLY D . n 
D 2 87  ASN 87  530 530 ASN ASN D . n 
D 2 88  THR 88  531 531 THR THR D . n 
D 2 89  PRO 89  532 532 PRO PRO D . n 
D 2 90  LEU 90  533 533 LEU LEU D . n 
D 2 91  HIS 91  534 534 HIS HIS D . n 
D 2 92  LEU 92  535 535 LEU LEU D . n 
D 2 93  ALA 93  536 536 ALA ALA D . n 
D 2 94  CYS 94  537 537 CYS CYS D . n 
D 2 95  THR 95  538 538 THR THR D . n 
D 2 96  TYR 96  539 539 TYR TYR D . n 
D 2 97  GLY 97  540 540 GLY GLY D . n 
D 2 98  HIS 98  541 541 HIS HIS D . n 
D 2 99  GLU 99  542 542 GLU GLU D . n 
D 2 100 ASP 100 543 543 ASP ASP D . n 
D 2 101 CYS 101 544 544 CYS CYS D . n 
D 2 102 VAL 102 545 545 VAL VAL D . n 
D 2 103 LYS 103 546 546 LYS LYS D . n 
D 2 104 ALA 104 547 547 ALA ALA D . n 
D 2 105 LEU 105 548 548 LEU LEU D . n 
D 2 106 VAL 106 549 549 VAL VAL D . n 
D 2 107 TYR 107 550 550 TYR TYR D . n 
D 2 108 TYR 108 551 551 TYR TYR D . n 
D 2 109 ASP 109 552 552 ASP ASP D . n 
D 2 110 VAL 110 553 553 VAL VAL D . n 
D 2 111 GLU 111 554 554 GLU GLU D . n 
D 2 112 SER 112 555 555 SER SER D . n 
D 2 113 CYS 113 556 556 CYS CYS D . n 
D 2 114 ARG 114 557 557 ARG ARG D . n 
D 2 115 LEU 115 558 558 LEU LEU D . n 
D 2 116 ASP 116 559 559 ASP ASP D . n 
D 2 117 ILE 117 560 560 ILE ILE D . n 
D 2 118 GLY 118 561 561 GLY GLY D . n 
D 2 119 ASN 119 562 562 ASN ASN D . n 
D 2 120 GLU 120 563 563 GLU GLU D . n 
D 2 121 LYS 121 564 564 LYS LYS D . n 
D 2 122 GLY 122 565 565 GLY GLY D . n 
D 2 123 ASP 123 566 566 ASP ASP D . n 
D 2 124 THR 124 567 567 THR THR D . n 
D 2 125 PRO 125 568 568 PRO PRO D . n 
D 2 126 LEU 126 569 569 LEU LEU D . n 
D 2 127 HIS 127 570 570 HIS HIS D . n 
D 2 128 ILE 128 571 571 ILE ILE D . n 
D 2 129 ALA 129 572 572 ALA ALA D . n 
D 2 130 ALA 130 573 573 ALA ALA D . n 
D 2 131 ARG 131 574 574 ARG ARG D . n 
D 2 132 TRP 132 575 575 TRP TRP D . n 
D 2 133 GLY 133 576 576 GLY GLY D . n 
D 2 134 TYR 134 577 577 TYR TYR D . n 
D 2 135 GLN 135 578 578 GLN GLN D . n 
D 2 136 GLY 136 579 579 GLY GLY D . n 
D 2 137 VAL 137 580 580 VAL VAL D . n 
D 2 138 ILE 138 581 581 ILE ILE D . n 
D 2 139 GLU 139 582 582 GLU GLU D . n 
D 2 140 THR 140 583 583 THR THR D . n 
D 2 141 LEU 141 584 584 LEU LEU D . n 
D 2 142 LEU 142 585 585 LEU LEU D . n 
D 2 143 GLN 143 586 586 GLN GLN D . n 
D 2 144 ASN 144 587 587 ASN ASN D . n 
D 2 145 GLY 145 588 588 GLY GLY D . n 
D 2 146 ALA 146 589 589 ALA ALA D . n 
D 2 147 SER 147 590 590 SER SER D . n 
D 2 148 THR 148 591 591 THR THR D . n 
D 2 149 GLU 149 592 592 GLU GLU D . n 
D 2 150 ILE 150 593 593 ILE ILE D . n 
D 2 151 GLN 151 594 594 GLN GLN D . n 
D 2 152 ASN 152 595 595 ASN ASN D . n 
D 2 153 ARG 153 596 596 ARG ARG D . n 
D 2 154 LEU 154 597 597 LEU LEU D . n 
D 2 155 LYS 155 598 598 LYS LYS D . n 
D 2 156 GLU 156 599 599 GLU GLU D . n 
D 2 157 THR 157 600 600 THR THR D . n 
D 2 158 PRO 158 601 601 PRO PRO D . n 
D 2 159 LEU 159 602 602 LEU LEU D . n 
D 2 160 LYS 160 603 603 LYS LYS D . n 
D 2 161 CYS 161 604 604 CYS CYS D . n 
D 2 162 ALA 162 605 605 ALA ALA D . n 
D 2 163 LEU 163 606 606 LEU LEU D . n 
D 2 164 ASN 164 607 607 ASN ASN D . n 
D 2 165 SER 165 608 608 SER SER D . n 
D 2 166 LYS 166 609 609 LYS LYS D . n 
D 2 167 ILE 167 610 610 ILE ILE D . n 
D 2 168 LEU 168 611 611 LEU LEU D . n 
D 2 169 SER 169 612 612 SER SER D . n 
D 2 170 VAL 170 613 613 VAL VAL D . n 
D 2 171 MET 171 614 614 MET MET D . n 
D 2 172 GLU 172 615 615 GLU GLU D . n 
D 2 173 ALA 173 616 616 ALA ALA D . n 
D 2 174 TYR 174 617 617 TYR TYR D . n 
D 2 175 HIS 175 618 618 HIS HIS D . n 
D 2 176 LEU 176 619 ?   ?   ?   D . n 
D 2 177 SER 177 620 ?   ?   ?   D . n 
D 2 178 PHE 178 621 ?   ?   ?   D . n 
D 2 179 GLU 179 622 ?   ?   ?   D . n 
D 2 180 ARG 180 623 ?   ?   ?   D . n 
D 2 181 ARG 181 624 ?   ?   ?   D . n 
D 2 182 GLN 182 625 ?   ?   ?   D . n 
D 2 183 LYS 183 626 ?   ?   ?   D . n 
D 2 184 SER 184 627 ?   ?   ?   D . n 
D 2 185 SER 185 628 ?   ?   ?   D . n 
D 2 186 GLU 186 629 ?   ?   ?   D . n 
D 2 187 ALA 187 630 ?   ?   ?   D . n 
D 2 188 PRO 188 631 ?   ?   ?   D . n 
D 2 189 VAL 189 632 ?   ?   ?   D . n 
D 2 190 GLN 190 633 ?   ?   ?   D . n 
D 2 191 SER 191 634 ?   ?   ?   D . n 
D 2 192 PRO 192 635 ?   ?   ?   D . n 
D 2 193 GLN 193 636 ?   ?   ?   D . n 
D 2 194 ARG 194 637 ?   ?   ?   D . n 
D 2 195 SER 195 638 ?   ?   ?   D . n 
D 2 196 VAL 196 639 ?   ?   ?   D . n 
D 2 197 ASP 197 640 ?   ?   ?   D . n 
D 2 198 HIS 198 641 ?   ?   ?   D . n 
D 2 199 HIS 199 642 ?   ?   ?   D . n 
D 2 200 HIS 200 643 ?   ?   ?   D . n 
D 2 201 HIS 201 644 ?   ?   ?   D . n 
D 2 202 HIS 202 645 ?   ?   ?   D . n 
D 2 203 HIS 203 646 ?   ?   ?   D . n 
E 2 1   GLY 1   444 ?   ?   ?   E . n 
E 2 2   PRO 2   445 ?   ?   ?   E . n 
E 2 3   LEU 3   446 ?   ?   ?   E . n 
E 2 4   GLY 4   447 ?   ?   ?   E . n 
E 2 5   SER 5   448 ?   ?   ?   E . n 
E 2 6   MET 6   449 ?   ?   ?   E . n 
E 2 7   ASP 7   450 ?   ?   ?   E . n 
E 2 8   PRO 8   451 ?   ?   ?   E . n 
E 2 9   SER 9   452 ?   ?   ?   E . n 
E 2 10  VAL 10  453 453 VAL VAL E . n 
E 2 11  VAL 11  454 454 VAL VAL E . n 
E 2 12  THR 12  455 455 THR THR E . n 
E 2 13  PRO 13  456 456 PRO PRO E . n 
E 2 14  PHE 14  457 457 PHE PHE E . n 
E 2 15  SER 15  458 458 SER SER E . n 
E 2 16  ARG 16  459 459 ARG ARG E . n 
E 2 17  ASP 17  460 460 ASP ASP E . n 
E 2 18  ASP 18  461 461 ASP ASP E . n 
E 2 19  ARG 19  462 462 ARG ARG E . n 
E 2 20  GLY 20  463 463 GLY GLY E . n 
E 2 21  HIS 21  464 464 HIS HIS E . n 
E 2 22  THR 22  465 465 THR THR E . n 
E 2 23  PRO 23  466 466 PRO PRO E . n 
E 2 24  LEU 24  467 467 LEU LEU E . n 
E 2 25  HIS 25  468 468 HIS HIS E . n 
E 2 26  VAL 26  469 469 VAL VAL E . n 
E 2 27  ALA 27  470 470 ALA ALA E . n 
E 2 28  ALA 28  471 471 ALA ALA E . n 
E 2 29  VAL 29  472 472 VAL VAL E . n 
E 2 30  CYS 30  473 473 CYS CYS E . n 
E 2 31  GLY 31  474 474 GLY GLY E . n 
E 2 32  GLN 32  475 475 GLN GLN E . n 
E 2 33  ALA 33  476 476 ALA ALA E . n 
E 2 34  SER 34  477 477 SER SER E . n 
E 2 35  LEU 35  478 478 LEU LEU E . n 
E 2 36  ILE 36  479 479 ILE ILE E . n 
E 2 37  ASP 37  480 480 ASP ASP E . n 
E 2 38  LEU 38  481 481 LEU LEU E . n 
E 2 39  LEU 39  482 482 LEU LEU E . n 
E 2 40  VAL 40  483 483 VAL VAL E . n 
E 2 41  SER 41  484 484 SER SER E . n 
E 2 42  LYS 42  485 485 LYS LYS E . n 
E 2 43  GLY 43  486 486 GLY GLY E . n 
E 2 44  ALA 44  487 487 ALA ALA E . n 
E 2 45  MET 45  488 488 MET MET E . n 
E 2 46  VAL 46  489 489 VAL VAL E . n 
E 2 47  ASN 47  490 490 ASN ASN E . n 
E 2 48  ALA 48  491 491 ALA ALA E . n 
E 2 49  THR 49  492 492 THR THR E . n 
E 2 50  ASP 50  493 493 ASP ASP E . n 
E 2 51  TYR 51  494 494 TYR TYR E . n 
E 2 52  HIS 52  495 495 HIS HIS E . n 
E 2 53  GLY 53  496 496 GLY GLY E . n 
E 2 54  ALA 54  497 497 ALA ALA E . n 
E 2 55  THR 55  498 498 THR THR E . n 
E 2 56  PRO 56  499 499 PRO PRO E . n 
E 2 57  LEU 57  500 500 LEU LEU E . n 
E 2 58  HIS 58  501 501 HIS HIS E . n 
E 2 59  LEU 59  502 502 LEU LEU E . n 
E 2 60  ALA 60  503 503 ALA ALA E . n 
E 2 61  CYS 61  504 504 CYS CYS E . n 
E 2 62  GLN 62  505 505 GLN GLN E . n 
E 2 63  LYS 63  506 506 LYS LYS E . n 
E 2 64  GLY 64  507 507 GLY GLY E . n 
E 2 65  TYR 65  508 508 TYR TYR E . n 
E 2 66  GLN 66  509 509 GLN GLN E . n 
E 2 67  SER 67  510 510 SER SER E . n 
E 2 68  VAL 68  511 511 VAL VAL E . n 
E 2 69  THR 69  512 512 THR THR E . n 
E 2 70  LEU 70  513 513 LEU LEU E . n 
E 2 71  LEU 71  514 514 LEU LEU E . n 
E 2 72  LEU 72  515 515 LEU LEU E . n 
E 2 73  LEU 73  516 516 LEU LEU E . n 
E 2 74  HIS 74  517 517 HIS HIS E . n 
E 2 75  TYR 75  518 518 TYR TYR E . n 
E 2 76  LYS 76  519 519 LYS LYS E . n 
E 2 77  ALA 77  520 520 ALA ALA E . n 
E 2 78  SER 78  521 521 SER SER E . n 
E 2 79  ALA 79  522 522 ALA ALA E . n 
E 2 80  GLU 80  523 523 GLU GLU E . n 
E 2 81  VAL 81  524 524 VAL VAL E . n 
E 2 82  GLN 82  525 525 GLN GLN E . n 
E 2 83  ASP 83  526 526 ASP ASP E . n 
E 2 84  ASN 84  527 527 ASN ASN E . n 
E 2 85  ASN 85  528 528 ASN ASN E . n 
E 2 86  GLY 86  529 529 GLY GLY E . n 
E 2 87  ASN 87  530 530 ASN ASN E . n 
E 2 88  THR 88  531 531 THR THR E . n 
E 2 89  PRO 89  532 532 PRO PRO E . n 
E 2 90  LEU 90  533 533 LEU LEU E . n 
E 2 91  HIS 91  534 534 HIS HIS E . n 
E 2 92  LEU 92  535 535 LEU LEU E . n 
E 2 93  ALA 93  536 536 ALA ALA E . n 
E 2 94  CYS 94  537 537 CYS CYS E . n 
E 2 95  THR 95  538 538 THR THR E . n 
E 2 96  TYR 96  539 539 TYR TYR E . n 
E 2 97  GLY 97  540 540 GLY GLY E . n 
E 2 98  HIS 98  541 541 HIS HIS E . n 
E 2 99  GLU 99  542 542 GLU GLU E . n 
E 2 100 ASP 100 543 543 ASP ASP E . n 
E 2 101 CYS 101 544 544 CYS CYS E . n 
E 2 102 VAL 102 545 545 VAL VAL E . n 
E 2 103 LYS 103 546 546 LYS LYS E . n 
E 2 104 ALA 104 547 547 ALA ALA E . n 
E 2 105 LEU 105 548 548 LEU LEU E . n 
E 2 106 VAL 106 549 549 VAL VAL E . n 
E 2 107 TYR 107 550 550 TYR TYR E . n 
E 2 108 TYR 108 551 551 TYR TYR E . n 
E 2 109 ASP 109 552 552 ASP ASP E . n 
E 2 110 VAL 110 553 553 VAL VAL E . n 
E 2 111 GLU 111 554 554 GLU GLU E . n 
E 2 112 SER 112 555 555 SER SER E . n 
E 2 113 CYS 113 556 556 CYS CYS E . n 
E 2 114 ARG 114 557 557 ARG ARG E . n 
E 2 115 LEU 115 558 558 LEU LEU E . n 
E 2 116 ASP 116 559 559 ASP ASP E . n 
E 2 117 ILE 117 560 560 ILE ILE E . n 
E 2 118 GLY 118 561 561 GLY GLY E . n 
E 2 119 ASN 119 562 562 ASN ASN E . n 
E 2 120 GLU 120 563 563 GLU GLU E . n 
E 2 121 LYS 121 564 564 LYS LYS E . n 
E 2 122 GLY 122 565 565 GLY GLY E . n 
E 2 123 ASP 123 566 566 ASP ASP E . n 
E 2 124 THR 124 567 567 THR THR E . n 
E 2 125 PRO 125 568 568 PRO PRO E . n 
E 2 126 LEU 126 569 569 LEU LEU E . n 
E 2 127 HIS 127 570 570 HIS HIS E . n 
E 2 128 ILE 128 571 571 ILE ILE E . n 
E 2 129 ALA 129 572 572 ALA ALA E . n 
E 2 130 ALA 130 573 573 ALA ALA E . n 
E 2 131 ARG 131 574 574 ARG ARG E . n 
E 2 132 TRP 132 575 575 TRP TRP E . n 
E 2 133 GLY 133 576 576 GLY GLY E . n 
E 2 134 TYR 134 577 577 TYR TYR E . n 
E 2 135 GLN 135 578 578 GLN GLN E . n 
E 2 136 GLY 136 579 579 GLY GLY E . n 
E 2 137 VAL 137 580 580 VAL VAL E . n 
E 2 138 ILE 138 581 581 ILE ILE E . n 
E 2 139 GLU 139 582 582 GLU GLU E . n 
E 2 140 THR 140 583 583 THR THR E . n 
E 2 141 LEU 141 584 584 LEU LEU E . n 
E 2 142 LEU 142 585 585 LEU LEU E . n 
E 2 143 GLN 143 586 586 GLN GLN E . n 
E 2 144 ASN 144 587 587 ASN ASN E . n 
E 2 145 GLY 145 588 588 GLY GLY E . n 
E 2 146 ALA 146 589 589 ALA ALA E . n 
E 2 147 SER 147 590 590 SER SER E . n 
E 2 148 THR 148 591 591 THR THR E . n 
E 2 149 GLU 149 592 592 GLU GLU E . n 
E 2 150 ILE 150 593 593 ILE ILE E . n 
E 2 151 GLN 151 594 594 GLN GLN E . n 
E 2 152 ASN 152 595 595 ASN ASN E . n 
E 2 153 ARG 153 596 596 ARG ARG E . n 
E 2 154 LEU 154 597 597 LEU LEU E . n 
E 2 155 LYS 155 598 598 LYS LYS E . n 
E 2 156 GLU 156 599 599 GLU GLU E . n 
E 2 157 THR 157 600 600 THR THR E . n 
E 2 158 PRO 158 601 601 PRO PRO E . n 
E 2 159 LEU 159 602 602 LEU LEU E . n 
E 2 160 LYS 160 603 603 LYS LYS E . n 
E 2 161 CYS 161 604 604 CYS CYS E . n 
E 2 162 ALA 162 605 605 ALA ALA E . n 
E 2 163 LEU 163 606 606 LEU LEU E . n 
E 2 164 ASN 164 607 607 ASN ASN E . n 
E 2 165 SER 165 608 608 SER SER E . n 
E 2 166 LYS 166 609 609 LYS LYS E . n 
E 2 167 ILE 167 610 610 ILE ILE E . n 
E 2 168 LEU 168 611 611 LEU LEU E . n 
E 2 169 SER 169 612 612 SER SER E . n 
E 2 170 VAL 170 613 613 VAL VAL E . n 
E 2 171 MET 171 614 614 MET MET E . n 
E 2 172 GLU 172 615 615 GLU GLU E . n 
E 2 173 ALA 173 616 616 ALA ALA E . n 
E 2 174 TYR 174 617 617 TYR TYR E . n 
E 2 175 HIS 175 618 ?   ?   ?   E . n 
E 2 176 LEU 176 619 ?   ?   ?   E . n 
E 2 177 SER 177 620 ?   ?   ?   E . n 
E 2 178 PHE 178 621 ?   ?   ?   E . n 
E 2 179 GLU 179 622 ?   ?   ?   E . n 
E 2 180 ARG 180 623 ?   ?   ?   E . n 
E 2 181 ARG 181 624 ?   ?   ?   E . n 
E 2 182 GLN 182 625 ?   ?   ?   E . n 
E 2 183 LYS 183 626 ?   ?   ?   E . n 
E 2 184 SER 184 627 ?   ?   ?   E . n 
E 2 185 SER 185 628 ?   ?   ?   E . n 
E 2 186 GLU 186 629 ?   ?   ?   E . n 
E 2 187 ALA 187 630 ?   ?   ?   E . n 
E 2 188 PRO 188 631 ?   ?   ?   E . n 
E 2 189 VAL 189 632 ?   ?   ?   E . n 
E 2 190 GLN 190 633 ?   ?   ?   E . n 
E 2 191 SER 191 634 ?   ?   ?   E . n 
E 2 192 PRO 192 635 ?   ?   ?   E . n 
E 2 193 GLN 193 636 ?   ?   ?   E . n 
E 2 194 ARG 194 637 ?   ?   ?   E . n 
E 2 195 SER 195 638 ?   ?   ?   E . n 
E 2 196 VAL 196 639 ?   ?   ?   E . n 
E 2 197 ASP 197 640 ?   ?   ?   E . n 
E 2 198 HIS 198 641 ?   ?   ?   E . n 
E 2 199 HIS 199 642 ?   ?   ?   E . n 
E 2 200 HIS 200 643 ?   ?   ?   E . n 
E 2 201 HIS 201 644 ?   ?   ?   E . n 
E 2 202 HIS 202 645 ?   ?   ?   E . n 
E 2 203 HIS 203 646 ?   ?   ?   E . n 
F 2 1   GLY 1   444 ?   ?   ?   F . n 
F 2 2   PRO 2   445 ?   ?   ?   F . n 
F 2 3   LEU 3   446 ?   ?   ?   F . n 
F 2 4   GLY 4   447 ?   ?   ?   F . n 
F 2 5   SER 5   448 ?   ?   ?   F . n 
F 2 6   MET 6   449 ?   ?   ?   F . n 
F 2 7   ASP 7   450 ?   ?   ?   F . n 
F 2 8   PRO 8   451 ?   ?   ?   F . n 
F 2 9   SER 9   452 ?   ?   ?   F . n 
F 2 10  VAL 10  453 453 VAL VAL F . n 
F 2 11  VAL 11  454 454 VAL VAL F . n 
F 2 12  THR 12  455 455 THR THR F . n 
F 2 13  PRO 13  456 456 PRO PRO F . n 
F 2 14  PHE 14  457 457 PHE PHE F . n 
F 2 15  SER 15  458 458 SER SER F . n 
F 2 16  ARG 16  459 459 ARG ARG F . n 
F 2 17  ASP 17  460 460 ASP ASP F . n 
F 2 18  ASP 18  461 461 ASP ASP F . n 
F 2 19  ARG 19  462 462 ARG ARG F . n 
F 2 20  GLY 20  463 463 GLY GLY F . n 
F 2 21  HIS 21  464 464 HIS HIS F . n 
F 2 22  THR 22  465 465 THR THR F . n 
F 2 23  PRO 23  466 466 PRO PRO F . n 
F 2 24  LEU 24  467 467 LEU LEU F . n 
F 2 25  HIS 25  468 468 HIS HIS F . n 
F 2 26  VAL 26  469 469 VAL VAL F . n 
F 2 27  ALA 27  470 470 ALA ALA F . n 
F 2 28  ALA 28  471 471 ALA ALA F . n 
F 2 29  VAL 29  472 472 VAL VAL F . n 
F 2 30  CYS 30  473 473 CYS CYS F . n 
F 2 31  GLY 31  474 474 GLY GLY F . n 
F 2 32  GLN 32  475 475 GLN GLN F . n 
F 2 33  ALA 33  476 476 ALA ALA F . n 
F 2 34  SER 34  477 477 SER SER F . n 
F 2 35  LEU 35  478 478 LEU LEU F . n 
F 2 36  ILE 36  479 479 ILE ILE F . n 
F 2 37  ASP 37  480 480 ASP ASP F . n 
F 2 38  LEU 38  481 481 LEU LEU F . n 
F 2 39  LEU 39  482 482 LEU LEU F . n 
F 2 40  VAL 40  483 483 VAL VAL F . n 
F 2 41  SER 41  484 484 SER SER F . n 
F 2 42  LYS 42  485 485 LYS LYS F . n 
F 2 43  GLY 43  486 486 GLY GLY F . n 
F 2 44  ALA 44  487 487 ALA ALA F . n 
F 2 45  MET 45  488 488 MET MET F . n 
F 2 46  VAL 46  489 489 VAL VAL F . n 
F 2 47  ASN 47  490 490 ASN ASN F . n 
F 2 48  ALA 48  491 491 ALA ALA F . n 
F 2 49  THR 49  492 492 THR THR F . n 
F 2 50  ASP 50  493 493 ASP ASP F . n 
F 2 51  TYR 51  494 494 TYR TYR F . n 
F 2 52  HIS 52  495 495 HIS HIS F . n 
F 2 53  GLY 53  496 496 GLY GLY F . n 
F 2 54  ALA 54  497 497 ALA ALA F . n 
F 2 55  THR 55  498 498 THR THR F . n 
F 2 56  PRO 56  499 499 PRO PRO F . n 
F 2 57  LEU 57  500 500 LEU LEU F . n 
F 2 58  HIS 58  501 501 HIS HIS F . n 
F 2 59  LEU 59  502 502 LEU LEU F . n 
F 2 60  ALA 60  503 503 ALA ALA F . n 
F 2 61  CYS 61  504 504 CYS CYS F . n 
F 2 62  GLN 62  505 505 GLN GLN F . n 
F 2 63  LYS 63  506 506 LYS LYS F . n 
F 2 64  GLY 64  507 507 GLY GLY F . n 
F 2 65  TYR 65  508 508 TYR TYR F . n 
F 2 66  GLN 66  509 509 GLN GLN F . n 
F 2 67  SER 67  510 510 SER SER F . n 
F 2 68  VAL 68  511 511 VAL VAL F . n 
F 2 69  THR 69  512 512 THR THR F . n 
F 2 70  LEU 70  513 513 LEU LEU F . n 
F 2 71  LEU 71  514 514 LEU LEU F . n 
F 2 72  LEU 72  515 515 LEU LEU F . n 
F 2 73  LEU 73  516 516 LEU LEU F . n 
F 2 74  HIS 74  517 517 HIS HIS F . n 
F 2 75  TYR 75  518 518 TYR TYR F . n 
F 2 76  LYS 76  519 519 LYS LYS F . n 
F 2 77  ALA 77  520 520 ALA ALA F . n 
F 2 78  SER 78  521 521 SER SER F . n 
F 2 79  ALA 79  522 522 ALA ALA F . n 
F 2 80  GLU 80  523 523 GLU GLU F . n 
F 2 81  VAL 81  524 524 VAL VAL F . n 
F 2 82  GLN 82  525 525 GLN GLN F . n 
F 2 83  ASP 83  526 526 ASP ASP F . n 
F 2 84  ASN 84  527 527 ASN ASN F . n 
F 2 85  ASN 85  528 528 ASN ASN F . n 
F 2 86  GLY 86  529 529 GLY GLY F . n 
F 2 87  ASN 87  530 530 ASN ASN F . n 
F 2 88  THR 88  531 531 THR THR F . n 
F 2 89  PRO 89  532 532 PRO PRO F . n 
F 2 90  LEU 90  533 533 LEU LEU F . n 
F 2 91  HIS 91  534 534 HIS HIS F . n 
F 2 92  LEU 92  535 535 LEU LEU F . n 
F 2 93  ALA 93  536 536 ALA ALA F . n 
F 2 94  CYS 94  537 537 CYS CYS F . n 
F 2 95  THR 95  538 538 THR THR F . n 
F 2 96  TYR 96  539 539 TYR TYR F . n 
F 2 97  GLY 97  540 540 GLY GLY F . n 
F 2 98  HIS 98  541 541 HIS HIS F . n 
F 2 99  GLU 99  542 542 GLU GLU F . n 
F 2 100 ASP 100 543 543 ASP ASP F . n 
F 2 101 CYS 101 544 544 CYS CYS F . n 
F 2 102 VAL 102 545 545 VAL VAL F . n 
F 2 103 LYS 103 546 546 LYS LYS F . n 
F 2 104 ALA 104 547 547 ALA ALA F . n 
F 2 105 LEU 105 548 548 LEU LEU F . n 
F 2 106 VAL 106 549 549 VAL VAL F . n 
F 2 107 TYR 107 550 550 TYR TYR F . n 
F 2 108 TYR 108 551 551 TYR TYR F . n 
F 2 109 ASP 109 552 552 ASP ASP F . n 
F 2 110 VAL 110 553 553 VAL VAL F . n 
F 2 111 GLU 111 554 554 GLU GLU F . n 
F 2 112 SER 112 555 555 SER SER F . n 
F 2 113 CYS 113 556 556 CYS CYS F . n 
F 2 114 ARG 114 557 557 ARG ARG F . n 
F 2 115 LEU 115 558 558 LEU LEU F . n 
F 2 116 ASP 116 559 559 ASP ASP F . n 
F 2 117 ILE 117 560 560 ILE ILE F . n 
F 2 118 GLY 118 561 561 GLY GLY F . n 
F 2 119 ASN 119 562 562 ASN ASN F . n 
F 2 120 GLU 120 563 563 GLU GLU F . n 
F 2 121 LYS 121 564 564 LYS LYS F . n 
F 2 122 GLY 122 565 565 GLY GLY F . n 
F 2 123 ASP 123 566 566 ASP ASP F . n 
F 2 124 THR 124 567 567 THR THR F . n 
F 2 125 PRO 125 568 568 PRO PRO F . n 
F 2 126 LEU 126 569 569 LEU LEU F . n 
F 2 127 HIS 127 570 570 HIS HIS F . n 
F 2 128 ILE 128 571 571 ILE ILE F . n 
F 2 129 ALA 129 572 572 ALA ALA F . n 
F 2 130 ALA 130 573 573 ALA ALA F . n 
F 2 131 ARG 131 574 574 ARG ARG F . n 
F 2 132 TRP 132 575 575 TRP TRP F . n 
F 2 133 GLY 133 576 576 GLY GLY F . n 
F 2 134 TYR 134 577 577 TYR TYR F . n 
F 2 135 GLN 135 578 578 GLN GLN F . n 
F 2 136 GLY 136 579 579 GLY GLY F . n 
F 2 137 VAL 137 580 580 VAL VAL F . n 
F 2 138 ILE 138 581 581 ILE ILE F . n 
F 2 139 GLU 139 582 582 GLU GLU F . n 
F 2 140 THR 140 583 583 THR THR F . n 
F 2 141 LEU 141 584 584 LEU LEU F . n 
F 2 142 LEU 142 585 585 LEU LEU F . n 
F 2 143 GLN 143 586 586 GLN GLN F . n 
F 2 144 ASN 144 587 587 ASN ASN F . n 
F 2 145 GLY 145 588 588 GLY GLY F . n 
F 2 146 ALA 146 589 589 ALA ALA F . n 
F 2 147 SER 147 590 590 SER SER F . n 
F 2 148 THR 148 591 591 THR THR F . n 
F 2 149 GLU 149 592 592 GLU GLU F . n 
F 2 150 ILE 150 593 593 ILE ILE F . n 
F 2 151 GLN 151 594 594 GLN GLN F . n 
F 2 152 ASN 152 595 595 ASN ASN F . n 
F 2 153 ARG 153 596 596 ARG ARG F . n 
F 2 154 LEU 154 597 597 LEU LEU F . n 
F 2 155 LYS 155 598 598 LYS LYS F . n 
F 2 156 GLU 156 599 599 GLU GLU F . n 
F 2 157 THR 157 600 600 THR THR F . n 
F 2 158 PRO 158 601 601 PRO PRO F . n 
F 2 159 LEU 159 602 602 LEU LEU F . n 
F 2 160 LYS 160 603 603 LYS LYS F . n 
F 2 161 CYS 161 604 604 CYS CYS F . n 
F 2 162 ALA 162 605 605 ALA ALA F . n 
F 2 163 LEU 163 606 606 LEU LEU F . n 
F 2 164 ASN 164 607 607 ASN ASN F . n 
F 2 165 SER 165 608 608 SER SER F . n 
F 2 166 LYS 166 609 609 LYS LYS F . n 
F 2 167 ILE 167 610 610 ILE ILE F . n 
F 2 168 LEU 168 611 611 LEU LEU F . n 
F 2 169 SER 169 612 612 SER SER F . n 
F 2 170 VAL 170 613 613 VAL VAL F . n 
F 2 171 MET 171 614 614 MET MET F . n 
F 2 172 GLU 172 615 615 GLU GLU F . n 
F 2 173 ALA 173 616 616 ALA ALA F . n 
F 2 174 TYR 174 617 617 TYR TYR F . n 
F 2 175 HIS 175 618 618 HIS HIS F . n 
F 2 176 LEU 176 619 ?   ?   ?   F . n 
F 2 177 SER 177 620 ?   ?   ?   F . n 
F 2 178 PHE 178 621 ?   ?   ?   F . n 
F 2 179 GLU 179 622 ?   ?   ?   F . n 
F 2 180 ARG 180 623 ?   ?   ?   F . n 
F 2 181 ARG 181 624 ?   ?   ?   F . n 
F 2 182 GLN 182 625 ?   ?   ?   F . n 
F 2 183 LYS 183 626 ?   ?   ?   F . n 
F 2 184 SER 184 627 ?   ?   ?   F . n 
F 2 185 SER 185 628 ?   ?   ?   F . n 
F 2 186 GLU 186 629 ?   ?   ?   F . n 
F 2 187 ALA 187 630 ?   ?   ?   F . n 
F 2 188 PRO 188 631 ?   ?   ?   F . n 
F 2 189 VAL 189 632 ?   ?   ?   F . n 
F 2 190 GLN 190 633 ?   ?   ?   F . n 
F 2 191 SER 191 634 ?   ?   ?   F . n 
F 2 192 PRO 192 635 ?   ?   ?   F . n 
F 2 193 GLN 193 636 ?   ?   ?   F . n 
F 2 194 ARG 194 637 ?   ?   ?   F . n 
F 2 195 SER 195 638 ?   ?   ?   F . n 
F 2 196 VAL 196 639 ?   ?   ?   F . n 
F 2 197 ASP 197 640 ?   ?   ?   F . n 
F 2 198 HIS 198 641 ?   ?   ?   F . n 
F 2 199 HIS 199 642 ?   ?   ?   F . n 
F 2 200 HIS 200 643 ?   ?   ?   F . n 
F 2 201 HIS 201 644 ?   ?   ?   F . n 
F 2 202 HIS 202 645 ?   ?   ?   F . n 
F 2 203 HIS 203 646 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 GCP 1  1198 1198 GCP GCP A . 
H 4 MG  1  1199 1199 MG  MG  A . 
I 3 GCP 1  1198 1198 GCP GCP B . 
J 4 MG  1  1199 1199 MG  MG  B . 
K 3 GCP 1  1198 1198 GCP GCP C . 
L 4 MG  1  1199 1199 MG  MG  C . 
M 5 HOH 1  2001 2001 HOH HOH A . 
M 5 HOH 2  2002 2002 HOH HOH A . 
M 5 HOH 3  2003 2003 HOH HOH A . 
M 5 HOH 4  2004 2004 HOH HOH A . 
M 5 HOH 5  2005 2005 HOH HOH A . 
M 5 HOH 6  2008 2008 HOH HOH A . 
M 5 HOH 7  2009 2009 HOH HOH A . 
M 5 HOH 8  2010 2010 HOH HOH A . 
M 5 HOH 9  2011 2011 HOH HOH A . 
M 5 HOH 10 2012 2012 HOH HOH A . 
M 5 HOH 11 2013 2013 HOH HOH A . 
M 5 HOH 12 2014 2014 HOH HOH A . 
M 5 HOH 13 2015 2015 HOH HOH A . 
M 5 HOH 14 2016 2016 HOH HOH A . 
M 5 HOH 15 2017 2017 HOH HOH A . 
M 5 HOH 16 2018 2018 HOH HOH A . 
M 5 HOH 17 2019 2019 HOH HOH A . 
M 5 HOH 18 2020 2020 HOH HOH A . 
M 5 HOH 19 2021 2021 HOH HOH A . 
M 5 HOH 20 2022 2022 HOH HOH A . 
M 5 HOH 21 2023 2023 HOH HOH A . 
M 5 HOH 22 2024 2024 HOH HOH A . 
M 5 HOH 23 2025 2025 HOH HOH A . 
M 5 HOH 24 2026 2026 HOH HOH A . 
M 5 HOH 25 2027 2027 HOH HOH A . 
M 5 HOH 26 2028 2028 HOH HOH A . 
M 5 HOH 27 2029 2029 HOH HOH A . 
M 5 HOH 28 2030 2030 HOH HOH A . 
M 5 HOH 29 2031 2031 HOH HOH A . 
M 5 HOH 30 2032 2032 HOH HOH A . 
M 5 HOH 31 2033 2033 HOH HOH A . 
M 5 HOH 32 2034 2034 HOH HOH A . 
M 5 HOH 33 2035 2035 HOH HOH A . 
M 5 HOH 34 2036 2036 HOH HOH A . 
M 5 HOH 35 2037 2037 HOH HOH A . 
M 5 HOH 36 2038 2038 HOH HOH A . 
M 5 HOH 37 2039 2039 HOH HOH A . 
M 5 HOH 38 2040 2040 HOH HOH A . 
M 5 HOH 39 2043 2043 HOH HOH A . 
M 5 HOH 40 2044 2044 HOH HOH A . 
N 5 HOH 1  2001 2001 HOH HOH B . 
N 5 HOH 2  2002 2002 HOH HOH B . 
N 5 HOH 3  2003 2003 HOH HOH B . 
N 5 HOH 4  2004 2004 HOH HOH B . 
N 5 HOH 5  2006 2006 HOH HOH B . 
N 5 HOH 6  2007 2007 HOH HOH B . 
N 5 HOH 7  2008 2008 HOH HOH B . 
N 5 HOH 8  2009 2009 HOH HOH B . 
N 5 HOH 9  2010 2010 HOH HOH B . 
N 5 HOH 10 2011 2011 HOH HOH B . 
N 5 HOH 11 2012 2012 HOH HOH B . 
N 5 HOH 12 2013 2013 HOH HOH B . 
N 5 HOH 13 2014 2014 HOH HOH B . 
N 5 HOH 14 2015 2015 HOH HOH B . 
N 5 HOH 15 2016 2016 HOH HOH B . 
N 5 HOH 16 2017 2017 HOH HOH B . 
N 5 HOH 17 2018 2018 HOH HOH B . 
N 5 HOH 18 2033 2033 HOH HOH B . 
O 5 HOH 1  2001 2001 HOH HOH C . 
O 5 HOH 2  2002 2002 HOH HOH C . 
O 5 HOH 3  2003 2003 HOH HOH C . 
O 5 HOH 4  2004 2004 HOH HOH C . 
O 5 HOH 5  2005 2005 HOH HOH C . 
O 5 HOH 6  2006 2006 HOH HOH C . 
O 5 HOH 7  2007 2007 HOH HOH C . 
O 5 HOH 8  2008 2008 HOH HOH C . 
O 5 HOH 9  2009 2009 HOH HOH C . 
O 5 HOH 10 2010 2010 HOH HOH C . 
O 5 HOH 11 2011 2011 HOH HOH C . 
O 5 HOH 12 2012 2012 HOH HOH C . 
O 5 HOH 13 2013 2013 HOH HOH C . 
O 5 HOH 14 2014 2014 HOH HOH C . 
O 5 HOH 15 2015 2015 HOH HOH C . 
O 5 HOH 16 2016 2016 HOH HOH C . 
O 5 HOH 17 2017 2017 HOH HOH C . 
O 5 HOH 18 2018 2018 HOH HOH C . 
O 5 HOH 19 2019 2019 HOH HOH C . 
P 5 HOH 1  2001 2001 HOH HOH D . 
P 5 HOH 2  2002 2002 HOH HOH D . 
P 5 HOH 3  2005 2005 HOH HOH D . 
P 5 HOH 4  2006 2006 HOH HOH D . 
P 5 HOH 5  2007 2007 HOH HOH D . 
P 5 HOH 6  2008 2008 HOH HOH D . 
P 5 HOH 7  2009 2009 HOH HOH D . 
P 5 HOH 8  2010 2010 HOH HOH D . 
P 5 HOH 9  2011 2011 HOH HOH D . 
P 5 HOH 10 2012 2012 HOH HOH D . 
P 5 HOH 11 2013 2013 HOH HOH D . 
P 5 HOH 12 2014 2014 HOH HOH D . 
P 5 HOH 13 2015 2015 HOH HOH D . 
P 5 HOH 14 2016 2016 HOH HOH D . 
P 5 HOH 15 2017 2017 HOH HOH D . 
P 5 HOH 16 2018 2018 HOH HOH D . 
P 5 HOH 17 2019 2019 HOH HOH D . 
P 5 HOH 18 2020 2020 HOH HOH D . 
P 5 HOH 19 2021 2021 HOH HOH D . 
P 5 HOH 20 2022 2022 HOH HOH D . 
P 5 HOH 21 2023 2023 HOH HOH D . 
P 5 HOH 22 2024 2024 HOH HOH D . 
P 5 HOH 23 2026 2026 HOH HOH D . 
P 5 HOH 24 2027 2027 HOH HOH D . 
P 5 HOH 25 2028 2028 HOH HOH D . 
P 5 HOH 26 2029 2029 HOH HOH D . 
P 5 HOH 27 2030 2030 HOH HOH D . 
P 5 HOH 28 2031 2031 HOH HOH D . 
P 5 HOH 29 2033 2033 HOH HOH D . 
P 5 HOH 30 2034 2034 HOH HOH D . 
Q 5 HOH 1  2001 2001 HOH HOH E . 
Q 5 HOH 2  2002 2002 HOH HOH E . 
Q 5 HOH 3  2003 2003 HOH HOH E . 
Q 5 HOH 4  2004 2004 HOH HOH E . 
Q 5 HOH 5  2005 2005 HOH HOH E . 
Q 5 HOH 6  2006 2006 HOH HOH E . 
Q 5 HOH 7  2007 2007 HOH HOH E . 
Q 5 HOH 8  2008 2008 HOH HOH E . 
Q 5 HOH 9  2009 2009 HOH HOH E . 
Q 5 HOH 10 2010 2010 HOH HOH E . 
R 5 HOH 1  2001 2001 HOH HOH F . 
R 5 HOH 2  2002 2002 HOH HOH F . 
R 5 HOH 3  2003 2003 HOH HOH F . 
R 5 HOH 4  2004 2004 HOH HOH F . 
R 5 HOH 5  2005 2005 HOH HOH F . 
R 5 HOH 6  2006 2006 HOH HOH F . 
R 5 HOH 7  2007 2007 HOH HOH F . 
R 5 HOH 8  2008 2008 HOH HOH F . 
R 5 HOH 9  2009 2009 HOH HOH F . 
R 5 HOH 10 2010 2010 HOH HOH F . 
R 5 HOH 11 2011 2011 HOH HOH F . 
R 5 HOH 12 2012 2012 HOH HOH F . 
R 5 HOH 13 2014 2014 HOH HOH F . 
R 5 HOH 14 2015 2015 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
3 author_and_software_defined_assembly PISA tetrameric 4 
4 software_defined_assembly            PISA dimeric    2 
5 software_defined_assembly            PISA dimeric    2 
6 software_defined_assembly            PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,D,G,H,M,P 
2 1   B,E,I,J,N,Q 
2 3   C,F,K,L,O,R 
3 1   C,F,K,L,O,R 
3 4   B,E,I,J,N,Q 
4 1   A,D,G,H,M,P 
5 1   B,E,I,J,N,Q 
6 1   C,F,K,L,O,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7100  ? 
1 MORE         -35.5 ? 
1 'SSA (A^2)'  34710 ? 
2 'ABSA (A^2)' 19000 ? 
2 MORE         -43.7 ? 
2 'SSA (A^2)'  34450 ? 
3 'ABSA (A^2)' 19000 ? 
3 MORE         -43.7 ? 
3 'SSA (A^2)'  34450 ? 
4 'ABSA (A^2)' 1700  ? 
4 MORE         -6.8  ? 
4 'SSA (A^2)'  19210 ? 
5 'ABSA (A^2)' 1750  ? 
5 MORE         -8.6  ? 
5 'SSA (A^2)'  18640 ? 
6 'ABSA (A^2)' 1630  ? 
6 MORE         -7.8  ? 
6 'SSA (A^2)'  19070 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 4_555 y,x,-z            -0.5000000000 0.8660254038 0.0000000000 0.0000000000   0.8660254038 
0.5000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
3 'crystal symmetry operation' 5_545 x-y,-y-1,-z+1/3   1.0000000000  0.0000000000 0.0000000000 72.2225000000  0.0000000000 
-1.0000000000 0.0000000000 -125.0930394496 0.0000000000 0.0000000000 -1.0000000000 45.2266666667 
4 'crystal symmetry operation' 5_445 x-y-1,-y-1,-z+1/3 1.0000000000  0.0000000000 0.0000000000 -72.2225000000 0.0000000000 
-1.0000000000 0.0000000000 -125.0930394496 0.0000000000 0.0000000000 -1.0000000000 45.2266666667 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3G ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O2B ? G GCP .  ? A GCP 1198 ? 1_555 98.7  ? 
2  O3G ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 OG1 ? A THR 44 ? A THR 39   ? 1_555 171.1 ? 
3  O2B ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 OG1 ? A THR 44 ? A THR 39   ? 1_555 85.0  ? 
4  O3G ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 OG1 ? A THR 62 ? A THR 57   ? 1_555 90.7  ? 
5  O2B ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 OG1 ? A THR 62 ? A THR 57   ? 1_555 168.4 ? 
6  OG1 ? A THR 44 ? A THR 39   ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 OG1 ? A THR 62 ? A THR 57   ? 1_555 84.8  ? 
7  O3G ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2003 ? 1_555 99.8  ? 
8  O2B ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2003 ? 1_555 94.3  ? 
9  OG1 ? A THR 44 ? A THR 39   ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2003 ? 1_555 88.0  ? 
10 OG1 ? A THR 62 ? A THR 57   ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2003 ? 1_555 90.8  ? 
11 O3G ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2004 ? 1_555 88.6  ? 
12 O2B ? G GCP .  ? A GCP 1198 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2004 ? 1_555 74.0  ? 
13 OG1 ? A THR 44 ? A THR 39   ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2004 ? 1_555 84.6  ? 
14 OG1 ? A THR 62 ? A THR 57   ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2004 ? 1_555 99.5  ? 
15 O   ? M HOH .  ? A HOH 2003 ? 1_555 MG ? H MG . ? A MG 1199 ? 1_555 O   ? M HOH .  ? A HOH 2004 ? 1_555 166.7 ? 
16 O3G ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O2B ? I GCP .  ? B GCP 1198 ? 1_555 93.5  ? 
17 O3G ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2003 ? 1_555 100.0 ? 
18 O2B ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2003 ? 1_555 100.7 ? 
19 O3G ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 62 ? B THR 57   ? 1_555 97.0  ? 
20 O2B ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 62 ? B THR 57   ? 1_555 167.0 ? 
21 O   ? N HOH .  ? B HOH 2003 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 62 ? B THR 57   ? 1_555 85.1  ? 
22 O3G ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 44 ? B THR 39   ? 1_555 167.1 ? 
23 O2B ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 44 ? B THR 39   ? 1_555 86.9  ? 
24 O   ? N HOH .  ? B HOH 2003 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 44 ? B THR 39   ? 1_555 92.6  ? 
25 OG1 ? B THR 62 ? B THR 57   ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 OG1 ? B THR 44 ? B THR 39   ? 1_555 81.2  ? 
26 O3G ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2004 ? 1_555 87.4  ? 
27 O2B ? I GCP .  ? B GCP 1198 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2004 ? 1_555 87.6  ? 
28 O   ? N HOH .  ? B HOH 2003 ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2004 ? 1_555 168.6 ? 
29 OG1 ? B THR 62 ? B THR 57   ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2004 ? 1_555 85.3  ? 
30 OG1 ? B THR 44 ? B THR 39   ? 1_555 MG ? J MG . ? B MG 1199 ? 1_555 O   ? N HOH .  ? B HOH 2004 ? 1_555 79.8  ? 
31 O2B ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O3G ? K GCP .  ? C GCP 1198 ? 1_555 103.6 ? 
32 O2B ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O   ? O HOH .  ? C HOH 2003 ? 1_555 84.4  ? 
33 O3G ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O   ? O HOH .  ? C HOH 2003 ? 1_555 87.7  ? 
34 O2B ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O   ? O HOH .  ? C HOH 2004 ? 1_555 92.2  ? 
35 O3G ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O   ? O HOH .  ? C HOH 2004 ? 1_555 91.0  ? 
36 O   ? O HOH .  ? C HOH 2003 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 O   ? O HOH .  ? C HOH 2004 ? 1_555 176.0 ? 
37 O2B ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 44 ? C THR 39   ? 1_555 86.5  ? 
38 O3G ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 44 ? C THR 39   ? 1_555 168.6 ? 
39 O   ? O HOH .  ? C HOH 2003 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 44 ? C THR 39   ? 1_555 88.0  ? 
40 O   ? O HOH .  ? C HOH 2004 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 44 ? C THR 39   ? 1_555 94.0  ? 
41 O2B ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 62 ? C THR 57   ? 1_555 167.2 ? 
42 O3G ? K GCP .  ? C GCP 1198 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 62 ? C THR 57   ? 1_555 88.2  ? 
43 O   ? O HOH .  ? C HOH 2003 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 62 ? C THR 57   ? 1_555 91.1  ? 
44 O   ? O HOH .  ? C HOH 2004 ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 62 ? C THR 57   ? 1_555 92.6  ? 
45 OG1 ? C THR 44 ? C THR 39   ? 1_555 MG ? L MG . ? C MG 1199 ? 1_555 OG1 ? C THR 62 ? C THR 57   ? 1_555 81.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-06-04 
2 'Structure model' 1 1 2014-06-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.8.0069 ? 1 
MOSFLM  'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4CYM 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;NTERMINAL SEQUENCE GPLGSM IS AN INSERTION COMING FROM THE
EXPRESSION PLASMID USED. GLN 85 WAS MUTATED TO LEU
NTERMINAL SEQUENCE GPLGSM IS AN INSERTION COMING FROM THE
EXPRESSION PLASMID USED. LAST SIX RESIDUES CORRESPONDS TO
THE 6HIS-TAG
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH2 C ARG 93  ? ? O   C HOH 2015 ? ? 2.02 
2 1 NH1 A ARG 186 ? ? OD2 B ASP 159  ? ? 2.08 
3 1 OE2 A GLU 190 ? ? OG  B SER 154  ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N D THR 492 ? ? CA D THR 492 ? ? CB D THR 492 ? ? 98.67 110.30 -11.63 1.90 N 
2 1 N D ASN 562 ? ? CA D ASN 562 ? ? CB D ASN 562 ? ? 98.52 110.60 -12.08 1.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 69  ? ? -90.34  -65.84  
2  1 GLU A 98  ? ? 49.53   28.08   
3  1 ARG A 110 ? ? -160.48 102.31  
4  1 ASN A 132 ? ? -78.12  20.05   
5  1 LYS A 144 ? ? 72.43   40.05   
6  1 ASP A 146 ? ? -53.69  -7.50   
7  1 ASN A 178 ? ? 23.28   62.84   
8  1 TRP B 69  ? ? -90.77  -66.13  
9  1 ARG B 110 ? ? -161.77 101.98  
10 1 LYS B 144 ? ? 70.79   40.84   
11 1 ASP B 146 ? ? -52.22  -8.70   
12 1 ASN B 178 ? ? 21.30   63.94   
13 1 HIS B 196 ? ? -67.05  18.52   
14 1 GLU C 98  ? ? 49.45   27.52   
15 1 ARG C 110 ? ? -161.13 101.48  
16 1 LYS C 144 ? ? 73.28   39.74   
17 1 ASP C 146 ? ? -52.42  -7.99   
18 1 ASN C 178 ? ? 21.87   63.46   
19 1 LYS D 519 ? ? 86.18   16.07   
20 1 VAL D 553 ? ? 54.71   75.22   
21 1 GLU D 554 ? ? 81.15   -50.82  
22 1 SER D 555 ? ? -59.20  49.35   
23 1 ASN D 562 ? ? -42.72  167.95  
24 1 ILE D 593 ? ? -39.73  128.19  
25 1 LEU D 597 ? ? -66.57  6.58    
26 1 VAL E 454 ? ? -48.42  157.35  
27 1 LYS E 519 ? ? 81.32   20.65   
28 1 GLU E 554 ? ? 91.73   -35.94  
29 1 ASN E 595 ? ? -79.50  -163.19 
30 1 LEU E 597 ? ? -66.21  6.35    
31 1 ALA E 616 ? ? -37.35  -28.31  
32 1 VAL F 454 ? ? -48.71  156.93  
33 1 ARG F 462 ? ? 68.96   -13.42  
34 1 LYS F 519 ? ? 83.42   16.05   
35 1 GLU F 554 ? ? 90.56   -36.00  
36 1 SER F 555 ? ? -73.32  44.57   
37 1 ASN F 595 ? ? -78.48  -163.04 
38 1 LEU F 597 ? ? -65.83  5.69    
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 70  ? ? SER A 71  ? ? 144.76  
2 1 ASP B 70  ? ? SER B 71  ? ? 146.43  
3 1 ASP C 70  ? ? SER C 71  ? ? 144.66  
4 1 TYR D 551 ? ? ASP D 552 ? ? -138.82 
5 1 TYR E 551 ? ? ASP E 552 ? ? -140.13 
6 1 TYR F 551 ? ? ASP F 552 ? ? -136.52 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      D 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2014 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.59 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -4  ? A GLY 1   
2   1 Y 1 A PRO -3  ? A PRO 2   
3   1 Y 1 A LEU -2  ? A LEU 3   
4   1 Y 1 A GLY -1  ? A GLY 4   
5   1 Y 1 A SER 0   ? A SER 5   
6   1 Y 1 A MET 1   ? A MET 6   
7   1 Y 1 A ALA 2   ? A ALA 7   
8   1 Y 1 A GLY 3   ? A GLY 8   
9   1 Y 1 A GLY 4   ? A GLY 9   
10  1 Y 1 A GLY 5   ? A GLY 10  
11  1 Y 1 A ALA 6   ? A ALA 11  
12  1 Y 1 A GLY 7   ? A GLY 12  
13  1 Y 1 A ASP 8   ? A ASP 13  
14  1 Y 1 A PRO 9   ? A PRO 14  
15  1 Y 1 A GLY 10  ? A GLY 15  
16  1 Y 1 A LEU 11  ? A LEU 16  
17  1 Y 1 A GLY 12  ? A GLY 17  
18  1 Y 1 A ALA 13  ? A ALA 18  
19  1 Y 1 A ALA 14  ? A ALA 19  
20  1 Y 1 A ALA 15  ? A ALA 20  
21  1 Y 1 A ALA 16  ? A ALA 21  
22  1 Y 1 A PRO 17  ? A PRO 22  
23  1 Y 1 A ALA 18  ? A ALA 23  
24  1 Y 1 A PRO 19  ? A PRO 24  
25  1 Y 1 A GLU 20  ? A GLU 25  
26  1 Y 1 A THR 21  ? A THR 26  
27  1 Y 1 A PHE 199 ? A PHE 204 
28  1 Y 1 A PRO 200 ? A PRO 205 
29  1 Y 1 A ASN 201 ? A ASN 206 
30  1 Y 1 A GLU 202 ? A GLU 207 
31  1 Y 1 A GLU 203 ? A GLU 208 
32  1 Y 1 A ASN 204 ? A ASN 209 
33  1 Y 1 A ASP 205 ? A ASP 210 
34  1 Y 1 A VAL 206 ? A VAL 211 
35  1 Y 1 A ASP 207 ? A ASP 212 
36  1 Y 1 A LYS 208 ? A LYS 213 
37  1 Y 1 A ILE 209 ? A ILE 214 
38  1 Y 1 A LYS 210 ? A LYS 215 
39  1 Y 1 A LEU 211 ? A LEU 216 
40  1 Y 1 A ASP 212 ? A ASP 217 
41  1 Y 1 A GLN 213 ? A GLN 218 
42  1 Y 1 A GLU 214 ? A GLU 219 
43  1 Y 1 A THR 215 ? A THR 220 
44  1 Y 1 A LEU 216 ? A LEU 221 
45  1 Y 1 A ARG 217 ? A ARG 222 
46  1 Y 1 A ALA 218 ? A ALA 223 
47  1 Y 1 A GLU 219 ? A GLU 224 
48  1 Y 1 A ASN 220 ? A ASN 225 
49  1 Y 1 A LYS 221 ? A LYS 226 
50  1 Y 1 A SER 222 ? A SER 227 
51  1 Y 1 A GLN 223 ? A GLN 228 
52  1 Y 1 A CYS 224 ? A CYS 229 
53  1 Y 1 A CYS 225 ? A CYS 230 
54  1 Y 1 B GLY -4  ? B GLY 1   
55  1 Y 1 B PRO -3  ? B PRO 2   
56  1 Y 1 B LEU -2  ? B LEU 3   
57  1 Y 1 B GLY -1  ? B GLY 4   
58  1 Y 1 B SER 0   ? B SER 5   
59  1 Y 1 B MET 1   ? B MET 6   
60  1 Y 1 B ALA 2   ? B ALA 7   
61  1 Y 1 B GLY 3   ? B GLY 8   
62  1 Y 1 B GLY 4   ? B GLY 9   
63  1 Y 1 B GLY 5   ? B GLY 10  
64  1 Y 1 B ALA 6   ? B ALA 11  
65  1 Y 1 B GLY 7   ? B GLY 12  
66  1 Y 1 B ASP 8   ? B ASP 13  
67  1 Y 1 B PRO 9   ? B PRO 14  
68  1 Y 1 B GLY 10  ? B GLY 15  
69  1 Y 1 B LEU 11  ? B LEU 16  
70  1 Y 1 B GLY 12  ? B GLY 17  
71  1 Y 1 B ALA 13  ? B ALA 18  
72  1 Y 1 B ALA 14  ? B ALA 19  
73  1 Y 1 B ALA 15  ? B ALA 20  
74  1 Y 1 B ALA 16  ? B ALA 21  
75  1 Y 1 B PRO 17  ? B PRO 22  
76  1 Y 1 B ALA 18  ? B ALA 23  
77  1 Y 1 B PRO 19  ? B PRO 24  
78  1 Y 1 B GLU 20  ? B GLU 25  
79  1 Y 1 B THR 21  ? B THR 26  
80  1 Y 1 B ARG 22  ? B ARG 27  
81  1 Y 1 B SER 198 ? B SER 203 
82  1 Y 1 B PHE 199 ? B PHE 204 
83  1 Y 1 B PRO 200 ? B PRO 205 
84  1 Y 1 B ASN 201 ? B ASN 206 
85  1 Y 1 B GLU 202 ? B GLU 207 
86  1 Y 1 B GLU 203 ? B GLU 208 
87  1 Y 1 B ASN 204 ? B ASN 209 
88  1 Y 1 B ASP 205 ? B ASP 210 
89  1 Y 1 B VAL 206 ? B VAL 211 
90  1 Y 1 B ASP 207 ? B ASP 212 
91  1 Y 1 B LYS 208 ? B LYS 213 
92  1 Y 1 B ILE 209 ? B ILE 214 
93  1 Y 1 B LYS 210 ? B LYS 215 
94  1 Y 1 B LEU 211 ? B LEU 216 
95  1 Y 1 B ASP 212 ? B ASP 217 
96  1 Y 1 B GLN 213 ? B GLN 218 
97  1 Y 1 B GLU 214 ? B GLU 219 
98  1 Y 1 B THR 215 ? B THR 220 
99  1 Y 1 B LEU 216 ? B LEU 221 
100 1 Y 1 B ARG 217 ? B ARG 222 
101 1 Y 1 B ALA 218 ? B ALA 223 
102 1 Y 1 B GLU 219 ? B GLU 224 
103 1 Y 1 B ASN 220 ? B ASN 225 
104 1 Y 1 B LYS 221 ? B LYS 226 
105 1 Y 1 B SER 222 ? B SER 227 
106 1 Y 1 B GLN 223 ? B GLN 228 
107 1 Y 1 B CYS 224 ? B CYS 229 
108 1 Y 1 B CYS 225 ? B CYS 230 
109 1 Y 1 C GLY -4  ? C GLY 1   
110 1 Y 1 C PRO -3  ? C PRO 2   
111 1 Y 1 C LEU -2  ? C LEU 3   
112 1 Y 1 C GLY -1  ? C GLY 4   
113 1 Y 1 C SER 0   ? C SER 5   
114 1 Y 1 C MET 1   ? C MET 6   
115 1 Y 1 C ALA 2   ? C ALA 7   
116 1 Y 1 C GLY 3   ? C GLY 8   
117 1 Y 1 C GLY 4   ? C GLY 9   
118 1 Y 1 C GLY 5   ? C GLY 10  
119 1 Y 1 C ALA 6   ? C ALA 11  
120 1 Y 1 C GLY 7   ? C GLY 12  
121 1 Y 1 C ASP 8   ? C ASP 13  
122 1 Y 1 C PRO 9   ? C PRO 14  
123 1 Y 1 C GLY 10  ? C GLY 15  
124 1 Y 1 C LEU 11  ? C LEU 16  
125 1 Y 1 C GLY 12  ? C GLY 17  
126 1 Y 1 C ALA 13  ? C ALA 18  
127 1 Y 1 C ALA 14  ? C ALA 19  
128 1 Y 1 C ALA 15  ? C ALA 20  
129 1 Y 1 C ALA 16  ? C ALA 21  
130 1 Y 1 C PRO 17  ? C PRO 22  
131 1 Y 1 C ALA 18  ? C ALA 23  
132 1 Y 1 C PRO 19  ? C PRO 24  
133 1 Y 1 C GLU 20  ? C GLU 25  
134 1 Y 1 C THR 21  ? C THR 26  
135 1 Y 1 C PHE 199 ? C PHE 204 
136 1 Y 1 C PRO 200 ? C PRO 205 
137 1 Y 1 C ASN 201 ? C ASN 206 
138 1 Y 1 C GLU 202 ? C GLU 207 
139 1 Y 1 C GLU 203 ? C GLU 208 
140 1 Y 1 C ASN 204 ? C ASN 209 
141 1 Y 1 C ASP 205 ? C ASP 210 
142 1 Y 1 C VAL 206 ? C VAL 211 
143 1 Y 1 C ASP 207 ? C ASP 212 
144 1 Y 1 C LYS 208 ? C LYS 213 
145 1 Y 1 C ILE 209 ? C ILE 214 
146 1 Y 1 C LYS 210 ? C LYS 215 
147 1 Y 1 C LEU 211 ? C LEU 216 
148 1 Y 1 C ASP 212 ? C ASP 217 
149 1 Y 1 C GLN 213 ? C GLN 218 
150 1 Y 1 C GLU 214 ? C GLU 219 
151 1 Y 1 C THR 215 ? C THR 220 
152 1 Y 1 C LEU 216 ? C LEU 221 
153 1 Y 1 C ARG 217 ? C ARG 222 
154 1 Y 1 C ALA 218 ? C ALA 223 
155 1 Y 1 C GLU 219 ? C GLU 224 
156 1 Y 1 C ASN 220 ? C ASN 225 
157 1 Y 1 C LYS 221 ? C LYS 226 
158 1 Y 1 C SER 222 ? C SER 227 
159 1 Y 1 C GLN 223 ? C GLN 228 
160 1 Y 1 C CYS 224 ? C CYS 229 
161 1 Y 1 C CYS 225 ? C CYS 230 
162 1 Y 1 D GLY 444 ? D GLY 1   
163 1 Y 1 D PRO 445 ? D PRO 2   
164 1 Y 1 D LEU 446 ? D LEU 3   
165 1 Y 1 D GLY 447 ? D GLY 4   
166 1 Y 1 D SER 448 ? D SER 5   
167 1 Y 1 D MET 449 ? D MET 6   
168 1 Y 1 D ASP 450 ? D ASP 7   
169 1 Y 1 D PRO 451 ? D PRO 8   
170 1 Y 1 D LEU 619 ? D LEU 176 
171 1 Y 1 D SER 620 ? D SER 177 
172 1 Y 1 D PHE 621 ? D PHE 178 
173 1 Y 1 D GLU 622 ? D GLU 179 
174 1 Y 1 D ARG 623 ? D ARG 180 
175 1 Y 1 D ARG 624 ? D ARG 181 
176 1 Y 1 D GLN 625 ? D GLN 182 
177 1 Y 1 D LYS 626 ? D LYS 183 
178 1 Y 1 D SER 627 ? D SER 184 
179 1 Y 1 D SER 628 ? D SER 185 
180 1 Y 1 D GLU 629 ? D GLU 186 
181 1 Y 1 D ALA 630 ? D ALA 187 
182 1 Y 1 D PRO 631 ? D PRO 188 
183 1 Y 1 D VAL 632 ? D VAL 189 
184 1 Y 1 D GLN 633 ? D GLN 190 
185 1 Y 1 D SER 634 ? D SER 191 
186 1 Y 1 D PRO 635 ? D PRO 192 
187 1 Y 1 D GLN 636 ? D GLN 193 
188 1 Y 1 D ARG 637 ? D ARG 194 
189 1 Y 1 D SER 638 ? D SER 195 
190 1 Y 1 D VAL 639 ? D VAL 196 
191 1 Y 1 D ASP 640 ? D ASP 197 
192 1 Y 1 D HIS 641 ? D HIS 198 
193 1 Y 1 D HIS 642 ? D HIS 199 
194 1 Y 1 D HIS 643 ? D HIS 200 
195 1 Y 1 D HIS 644 ? D HIS 201 
196 1 Y 1 D HIS 645 ? D HIS 202 
197 1 Y 1 D HIS 646 ? D HIS 203 
198 1 Y 1 E GLY 444 ? E GLY 1   
199 1 Y 1 E PRO 445 ? E PRO 2   
200 1 Y 1 E LEU 446 ? E LEU 3   
201 1 Y 1 E GLY 447 ? E GLY 4   
202 1 Y 1 E SER 448 ? E SER 5   
203 1 Y 1 E MET 449 ? E MET 6   
204 1 Y 1 E ASP 450 ? E ASP 7   
205 1 Y 1 E PRO 451 ? E PRO 8   
206 1 Y 1 E SER 452 ? E SER 9   
207 1 Y 1 E HIS 618 ? E HIS 175 
208 1 Y 1 E LEU 619 ? E LEU 176 
209 1 Y 1 E SER 620 ? E SER 177 
210 1 Y 1 E PHE 621 ? E PHE 178 
211 1 Y 1 E GLU 622 ? E GLU 179 
212 1 Y 1 E ARG 623 ? E ARG 180 
213 1 Y 1 E ARG 624 ? E ARG 181 
214 1 Y 1 E GLN 625 ? E GLN 182 
215 1 Y 1 E LYS 626 ? E LYS 183 
216 1 Y 1 E SER 627 ? E SER 184 
217 1 Y 1 E SER 628 ? E SER 185 
218 1 Y 1 E GLU 629 ? E GLU 186 
219 1 Y 1 E ALA 630 ? E ALA 187 
220 1 Y 1 E PRO 631 ? E PRO 188 
221 1 Y 1 E VAL 632 ? E VAL 189 
222 1 Y 1 E GLN 633 ? E GLN 190 
223 1 Y 1 E SER 634 ? E SER 191 
224 1 Y 1 E PRO 635 ? E PRO 192 
225 1 Y 1 E GLN 636 ? E GLN 193 
226 1 Y 1 E ARG 637 ? E ARG 194 
227 1 Y 1 E SER 638 ? E SER 195 
228 1 Y 1 E VAL 639 ? E VAL 196 
229 1 Y 1 E ASP 640 ? E ASP 197 
230 1 Y 1 E HIS 641 ? E HIS 198 
231 1 Y 1 E HIS 642 ? E HIS 199 
232 1 Y 1 E HIS 643 ? E HIS 200 
233 1 Y 1 E HIS 644 ? E HIS 201 
234 1 Y 1 E HIS 645 ? E HIS 202 
235 1 Y 1 E HIS 646 ? E HIS 203 
236 1 Y 1 F GLY 444 ? F GLY 1   
237 1 Y 1 F PRO 445 ? F PRO 2   
238 1 Y 1 F LEU 446 ? F LEU 3   
239 1 Y 1 F GLY 447 ? F GLY 4   
240 1 Y 1 F SER 448 ? F SER 5   
241 1 Y 1 F MET 449 ? F MET 6   
242 1 Y 1 F ASP 450 ? F ASP 7   
243 1 Y 1 F PRO 451 ? F PRO 8   
244 1 Y 1 F SER 452 ? F SER 9   
245 1 Y 1 F LEU 619 ? F LEU 176 
246 1 Y 1 F SER 620 ? F SER 177 
247 1 Y 1 F PHE 621 ? F PHE 178 
248 1 Y 1 F GLU 622 ? F GLU 179 
249 1 Y 1 F ARG 623 ? F ARG 180 
250 1 Y 1 F ARG 624 ? F ARG 181 
251 1 Y 1 F GLN 625 ? F GLN 182 
252 1 Y 1 F LYS 626 ? F LYS 183 
253 1 Y 1 F SER 627 ? F SER 184 
254 1 Y 1 F SER 628 ? F SER 185 
255 1 Y 1 F GLU 629 ? F GLU 186 
256 1 Y 1 F ALA 630 ? F ALA 187 
257 1 Y 1 F PRO 631 ? F PRO 188 
258 1 Y 1 F VAL 632 ? F VAL 189 
259 1 Y 1 F GLN 633 ? F GLN 190 
260 1 Y 1 F SER 634 ? F SER 191 
261 1 Y 1 F PRO 635 ? F PRO 192 
262 1 Y 1 F GLN 636 ? F GLN 193 
263 1 Y 1 F ARG 637 ? F ARG 194 
264 1 Y 1 F SER 638 ? F SER 195 
265 1 Y 1 F VAL 639 ? F VAL 196 
266 1 Y 1 F ASP 640 ? F ASP 197 
267 1 Y 1 F HIS 641 ? F HIS 198 
268 1 Y 1 F HIS 642 ? F HIS 199 
269 1 Y 1 F HIS 643 ? F HIS 200 
270 1 Y 1 F HIS 644 ? F HIS 201 
271 1 Y 1 F HIS 645 ? F HIS 202 
272 1 Y 1 F HIS 646 ? F HIS 203 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' GCP 
4 'MAGNESIUM ION'                                MG  
5 water                                          HOH 
#