data_4E9F
# 
_entry.id   4E9F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4E9F         
NDB   NA1687       
RCSB  RCSB071335   
WWPDB D_1000071335 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4E9E . unspecified 
PDB 4E9G . unspecified 
PDB 4E9H . unspecified 
PDB 4EA4 . unspecified 
PDB 4EAB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4E9F 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Morera, S.'    1 
'Vigouroux, A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Biochemical and structural characterization of the glycosylase domain of MBD4 bound to thymine and 5-hydroxymethyuracil-containing DNA.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            40 
_citation.page_first                9917 
_citation.page_last                 9926 
_citation.year                      2012 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22848106 
_citation.pdbx_database_id_DOI      10.1093/nar/gks714 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Morera, S.'      1 
primary 'Grin, I.'        2 
primary 'Vigouroux, A.'   3 
primary 'Couve, S.'       4 
primary 'Henriot, V.'     5 
primary 'Saparbaev, M.'   6 
primary 'Ishchenko, A.A.' 7 
# 
_cell.entry_id           4E9F 
_cell.length_a           41.070 
_cell.length_b           55.840 
_cell.length_c           96.650 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4E9F 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methyl-CpG-binding domain protein 4'                    19416.393 1  3.2.2.- ? 
'glycosylase domain of MBD4 (residues 426-580)' ?                            
2 polymer     syn 
;DNA (5'-D(*CP*CP*AP*GP*CP*GP*(3DR)P*GP*CP*AP*GP*C)-3')
;
3524.284  1  ?       ? ?                                               'DNA fragment with 3DR site' 
3 polymer     syn 
;DNA (5'-D(*GP*CP*TP*GP*CP*GP*CP*GP*CP*TP*GP*G)-3')
;
3695.390  1  ?       ? ?                                               'DNA fragment'               
4 non-polymer syn 1,2-ETHANEDIOL                                           62.068    1  ?       ? ? ?                            
5 water       nat water                                                    18.015    86 ?       ? ? ?                            
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKP
LGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLSHHHHH
H
;
;MLSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKP
LGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLSHHHHH
H
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(DC)(DA)(DG)(DC)(DG)(3DR)(DG)(DC)(DA)(DG)(DC)' CCAGCGNGCAGC C ? 
3 polydeoxyribonucleotide no no  '(DG)(DC)(DT)(DG)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DG)' GCTGCGCGCTGG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   SER n 
1 4   PRO n 
1 5   PRO n 
1 6   ARG n 
1 7   ARG n 
1 8   LYS n 
1 9   ALA n 
1 10  PHE n 
1 11  LYS n 
1 12  LYS n 
1 13  TRP n 
1 14  THR n 
1 15  PRO n 
1 16  PRO n 
1 17  ARG n 
1 18  SER n 
1 19  PRO n 
1 20  PHE n 
1 21  ASN n 
1 22  LEU n 
1 23  VAL n 
1 24  GLN n 
1 25  GLU n 
1 26  THR n 
1 27  LEU n 
1 28  PHE n 
1 29  HIS n 
1 30  ASP n 
1 31  PRO n 
1 32  TRP n 
1 33  LYS n 
1 34  LEU n 
1 35  LEU n 
1 36  ILE n 
1 37  ALA n 
1 38  THR n 
1 39  ILE n 
1 40  PHE n 
1 41  LEU n 
1 42  ASN n 
1 43  ARG n 
1 44  THR n 
1 45  SER n 
1 46  GLY n 
1 47  LYS n 
1 48  MET n 
1 49  ALA n 
1 50  ILE n 
1 51  PRO n 
1 52  VAL n 
1 53  LEU n 
1 54  TRP n 
1 55  LYS n 
1 56  PHE n 
1 57  LEU n 
1 58  GLU n 
1 59  LYS n 
1 60  TYR n 
1 61  PRO n 
1 62  SER n 
1 63  ALA n 
1 64  GLU n 
1 65  VAL n 
1 66  ALA n 
1 67  ARG n 
1 68  THR n 
1 69  ALA n 
1 70  ASP n 
1 71  TRP n 
1 72  ARG n 
1 73  ASP n 
1 74  VAL n 
1 75  SER n 
1 76  GLU n 
1 77  LEU n 
1 78  LEU n 
1 79  LYS n 
1 80  PRO n 
1 81  LEU n 
1 82  GLY n 
1 83  LEU n 
1 84  TYR n 
1 85  ASP n 
1 86  LEU n 
1 87  ARG n 
1 88  ALA n 
1 89  LYS n 
1 90  THR n 
1 91  ILE n 
1 92  VAL n 
1 93  LYS n 
1 94  PHE n 
1 95  SER n 
1 96  ASP n 
1 97  GLU n 
1 98  TYR n 
1 99  LEU n 
1 100 THR n 
1 101 LYS n 
1 102 GLN n 
1 103 TRP n 
1 104 LYS n 
1 105 TYR n 
1 106 PRO n 
1 107 ILE n 
1 108 GLU n 
1 109 LEU n 
1 110 HIS n 
1 111 GLY n 
1 112 ILE n 
1 113 GLY n 
1 114 LYS n 
1 115 TYR n 
1 116 GLY n 
1 117 ASN n 
1 118 ASP n 
1 119 SER n 
1 120 TYR n 
1 121 ARG n 
1 122 ILE n 
1 123 PHE n 
1 124 CYS n 
1 125 VAL n 
1 126 ASN n 
1 127 GLU n 
1 128 TRP n 
1 129 LYS n 
1 130 GLN n 
1 131 VAL n 
1 132 HIS n 
1 133 PRO n 
1 134 GLU n 
1 135 ASP n 
1 136 HIS n 
1 137 LYS n 
1 138 LEU n 
1 139 ASN n 
1 140 LYS n 
1 141 TYR n 
1 142 HIS n 
1 143 ASP n 
1 144 TRP n 
1 145 LEU n 
1 146 TRP n 
1 147 GLU n 
1 148 ASN n 
1 149 HIS n 
1 150 GLU n 
1 151 LYS n 
1 152 LEU n 
1 153 SER n 
1 154 LEU n 
1 155 SER n 
1 156 HIS n 
1 157 HIS n 
1 158 HIS n 
1 159 HIS n 
1 160 HIS n 
1 161 HIS n 
2 1   DC  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DC  n 
2 6   DG  n 
2 7   3DR n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DG  n 
2 12  DC  n 
3 1   DG  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DC  n 
3 6   DG  n 
3 7   DC  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DG  n 
3 12  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MBD4, MED1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Synthetic DNA' 
3 1 sample ? ? ? ? ? 'Synthetic DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MBD4_HUMAN O95243 1 
;LSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKPL
GLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
;
427 ? 
2 PDB 4E9F       4E9F   2 CCAGCGNGCAGC 1   ? 
3 PDB 4E9F       4E9F   3 GCTGCGCGCTGG 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4E9F A 2 ? 155 ? O95243 427 ? 580 ? 427 580 
2 2 4E9F C 1 ? 12  ? 4E9F   1   ? 12  ? 1   12  
3 3 4E9F D 1 ? 12  ? 4E9F   1   ? 12  ? 1   12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4E9F MET A 1   ? UNP O95243 ? ? 'EXPRESSION TAG' 426 1 
1 4E9F HIS A 156 ? UNP O95243 ? ? 'EXPRESSION TAG' 581 2 
1 4E9F HIS A 157 ? UNP O95243 ? ? 'EXPRESSION TAG' 582 3 
1 4E9F HIS A 158 ? UNP O95243 ? ? 'EXPRESSION TAG' 583 4 
1 4E9F HIS A 159 ? UNP O95243 ? ? 'EXPRESSION TAG' 584 5 
1 4E9F HIS A 160 ? UNP O95243 ? ? 'EXPRESSION TAG' 585 6 
1 4E9F HIS A 161 ? UNP O95243 ? ? 'EXPRESSION TAG' 586 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'     198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                      'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                      'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL'      'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4E9F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.08 
_exptl_crystal.density_percent_sol   40.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_details    '25% ethylene glycol, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-08-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     4E9F 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             38 
_reflns.d_resolution_high            1.79 
_reflns.number_obs                   21525 
_reflns.number_all                   21600 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.79 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4E9F 
_refine.ls_number_reflns_obs                     21487 
_refine.ls_number_reflns_all                     21600 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.80 
_refine.ls_d_res_high                            1.79 
_refine.ls_percent_reflns_obs                    99.27 
_refine.ls_R_factor_obs                          0.2158 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2141 
_refine.ls_R_factor_R_free                       0.2485 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.12 
_refine.ls_number_reflns_R_free                  1101 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9431 
_refine.correlation_coeff_Fo_to_Fc_free          0.9289 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4ENE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.132 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4E9F 
_refine_analyze.Luzzati_coordinate_error_obs    0.238 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1179 
_refine_hist.pdbx_number_atoms_nucleic_acid   478 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1747 
_refine_hist.d_res_high                       1.79 
_refine_hist.d_res_low                        37.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  1760 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.07  ? 2.00  2479 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  678  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  26   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  193  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 1760 HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           3.21  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           18.29 ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  216  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  1915 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   11 
_refine_ls_shell.d_res_high                       1.79 
_refine_ls_shell.d_res_low                        1.88 
_refine_ls_shell.number_reflns_R_work             2564 
_refine_ls_shell.R_factor_R_work                  0.2340 
_refine_ls_shell.percent_reflns_obs               99.27 
_refine_ls_shell.R_factor_R_free                  0.1973 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.18 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.number_reflns_all                2704 
_refine_ls_shell.R_factor_all                     0.2319 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4E9F 
_struct.title                     'Structure of the glycosylase domain of MBD4 bound to AP site containing DNA' 
_struct.pdbx_descriptor           'Methyl-CpG-binding domain protein 4 (E.C.3.2.2.-)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4E9F 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'HhH DNA glycosylase family, HYDROLASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 23  ? PHE A 28  ? VAL A 448 PHE A 453 1 ? 6  
HELX_P HELX_P2  2  ASP A 30  ? LEU A 41  ? ASP A 455 LEU A 466 1 ? 12 
HELX_P HELX_P3  3  SER A 45  ? TYR A 60  ? SER A 470 TYR A 485 1 ? 16 
HELX_P HELX_P4  4  SER A 62  ? ARG A 67  ? SER A 487 ARG A 492 1 ? 6  
HELX_P HELX_P5  5  ASP A 70  ? LYS A 79  ? ASP A 495 LYS A 504 1 ? 10 
HELX_P HELX_P6  6  PRO A 80  ? GLY A 82  ? PRO A 505 GLY A 507 5 ? 3  
HELX_P HELX_P7  7  LEU A 83  ? LYS A 101 ? LEU A 508 LYS A 526 1 ? 19 
HELX_P HELX_P8  8  TYR A 105 ? LEU A 109 ? TYR A 530 LEU A 534 5 ? 5  
HELX_P HELX_P9  9  GLY A 113 ? CYS A 124 ? GLY A 538 CYS A 549 1 ? 12 
HELX_P HELX_P10 10 GLU A 127 ? VAL A 131 ? GLU A 552 VAL A 556 5 ? 5  
HELX_P HELX_P11 11 ASP A 135 ? ASN A 148 ? ASP A 560 ASN A 573 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DG  6  "O3'" ? ? ? 1_555 B 3DR 7  P  ? ? C DG  6  C 3DR 7  1_555 ? ? ? ? ? ? ?            1.656 ? 
covale2  covale ? ? B 3DR 7  "O3'" ? ? ? 1_555 B DG  8  P  ? ? C 3DR 7  C DG  8  1_555 ? ? ? ? ? ? ?            1.605 ? 
hydrog1  hydrog ? ? B DC  1  N4    ? ? ? 1_555 C DG  12 O6 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog2  hydrog ? ? B DC  2  O2    ? ? ? 1_555 C DG  11 N1 ? ? C DC  2  D DG  11 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog3  hydrog ? ? B DA  3  N1    ? ? ? 1_555 C DT  10 N3 ? ? C DA  3  D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  3  N6    ? ? ? 1_555 C DT  10 O4 ? ? C DA  3  D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  4  N1    ? ? ? 1_555 C DC  9  N3 ? ? C DG  4  D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  4  N2    ? ? ? 1_555 C DC  9  O2 ? ? C DG  4  D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  4  O6    ? ? ? 1_555 C DC  9  N4 ? ? C DG  4  D DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  5  N3    ? ? ? 1_555 C DG  8  N1 ? ? C DC  5  D DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  5  N4    ? ? ? 1_555 C DG  8  O6 ? ? C DC  5  D DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  5  O2    ? ? ? 1_555 C DG  8  N2 ? ? C DC  5  D DG  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  6  N1    ? ? ? 1_555 C DC  7  N3 ? ? C DG  6  D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  6  N2    ? ? ? 1_555 C DC  7  O2 ? ? C DG  6  D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  6  O6    ? ? ? 1_555 C DC  7  N4 ? ? C DG  6  D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  8  N1    ? ? ? 1_555 C DC  5  N3 ? ? C DG  8  D DC  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  8  N2    ? ? ? 1_555 C DC  5  O2 ? ? C DG  8  D DC  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  8  O6    ? ? ? 1_555 C DC  5  N4 ? ? C DG  8  D DC  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  9  N3    ? ? ? 1_555 C DG  4  N1 ? ? C DC  9  D DG  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9  N4    ? ? ? 1_555 C DG  4  O6 ? ? C DC  9  D DG  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  9  O2    ? ? ? 1_555 C DG  4  N2 ? ? C DC  9  D DG  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  10 N1    ? ? ? 1_555 C DT  3  N3 ? ? C DA  10 D DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  10 N6    ? ? ? 1_555 C DT  3  O4 ? ? C DA  10 D DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  11 N1    ? ? ? 1_555 C DC  2  N3 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  11 N2    ? ? ? 1_555 C DC  2  O2 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  11 O6    ? ? ? 1_555 C DC  2  N4 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  12 N3    ? ? ? 1_555 C DG  1  N1 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  12 N4    ? ? ? 1_555 C DG  1  O6 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  12 O2    ? ? ? 1_555 C DG  1  N2 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           12 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            437 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   TRP 
_struct_mon_prot_cis.pdbx_label_seq_id_2    13 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    TRP 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     438 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -6.56 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO C 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ARG A 43 ? ARG A 468 . ? 1_555 ? 
2 AC1 4 DC  B 5  ? DC  C 5   . ? 1_555 ? 
3 AC1 4 DG  B 6  ? DG  C 6   . ? 1_555 ? 
4 AC1 4 DG  C 6  ? DG  D 6   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4E9F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4E9F 
_atom_sites.fract_transf_matrix[1][1]   0.024349 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017908 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010347 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 12  ? 7.525   -27.492 -12.373 1.00 60.39  ? 437 LYS A N     1 
ATOM   2    C CA    . LYS A 1 12  ? 8.781   -27.774 -11.679 1.00 60.21  ? 437 LYS A CA    1 
ATOM   3    C C     . LYS A 1 12  ? 10.030  -26.980 -12.212 1.00 64.00  ? 437 LYS A C     1 
ATOM   4    O O     . LYS A 1 12  ? 11.032  -27.609 -12.566 1.00 66.21  ? 437 LYS A O     1 
ATOM   5    C CB    . LYS A 1 12  ? 9.044   -29.297 -11.642 1.00 62.11  ? 437 LYS A CB    1 
ATOM   6    C CG    . LYS A 1 12  ? 8.293   -30.017 -10.534 1.00 75.55  ? 437 LYS A CG    1 
ATOM   7    C CD    . LYS A 1 12  ? 7.255   -30.981 -11.086 1.00 86.66  ? 437 LYS A CD    1 
ATOM   8    C CE    . LYS A 1 12  ? 6.640   -31.849 -10.011 1.00 101.50 ? 437 LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 12  ? 7.571   -32.910 -9.531  1.00 110.36 ? 437 LYS A NZ    1 
ATOM   10   N N     . TRP A 1 13  ? 10.029  -25.619 -12.200 1.00 55.89  ? 438 TRP A N     1 
ATOM   11   C CA    . TRP A 1 13  ? 8.906   -24.729 -11.853 1.00 52.35  ? 438 TRP A CA    1 
ATOM   12   C C     . TRP A 1 13  ? 8.482   -24.047 -13.121 1.00 52.72  ? 438 TRP A C     1 
ATOM   13   O O     . TRP A 1 13  ? 9.329   -23.541 -13.865 1.00 52.78  ? 438 TRP A O     1 
ATOM   14   C CB    . TRP A 1 13  ? 9.300   -23.704 -10.758 1.00 49.72  ? 438 TRP A CB    1 
ATOM   15   C CG    . TRP A 1 13  ? 8.442   -22.457 -10.650 1.00 48.68  ? 438 TRP A CG    1 
ATOM   16   C CD1   . TRP A 1 13  ? 8.856   -21.173 -10.833 1.00 50.74  ? 438 TRP A CD1   1 
ATOM   17   C CD2   . TRP A 1 13  ? 7.048   -22.380 -10.279 1.00 48.11  ? 438 TRP A CD2   1 
ATOM   18   N NE1   . TRP A 1 13  ? 7.819   -20.297 -10.592 1.00 48.82  ? 438 TRP A NE1   1 
ATOM   19   C CE2   . TRP A 1 13  ? 6.693   -21.010 -10.271 1.00 50.57  ? 438 TRP A CE2   1 
ATOM   20   C CE3   . TRP A 1 13  ? 6.056   -23.333 -9.984  1.00 49.47  ? 438 TRP A CE3   1 
ATOM   21   C CZ2   . TRP A 1 13  ? 5.397   -20.569 -9.965  1.00 50.01  ? 438 TRP A CZ2   1 
ATOM   22   C CZ3   . TRP A 1 13  ? 4.770   -22.896 -9.685  1.00 50.56  ? 438 TRP A CZ3   1 
ATOM   23   C CH2   . TRP A 1 13  ? 4.449   -21.531 -9.676  1.00 50.98  ? 438 TRP A CH2   1 
ATOM   24   N N     . THR A 1 14  ? 7.177   -24.080 -13.412 1.00 46.79  ? 439 THR A N     1 
ATOM   25   C CA    . THR A 1 14  ? 6.676   -23.407 -14.599 1.00 44.50  ? 439 THR A CA    1 
ATOM   26   C C     . THR A 1 14  ? 5.580   -22.453 -14.158 1.00 44.73  ? 439 THR A C     1 
ATOM   27   O O     . THR A 1 14  ? 4.465   -22.905 -13.901 1.00 43.47  ? 439 THR A O     1 
ATOM   28   C CB    . THR A 1 14  ? 6.331   -24.380 -15.745 1.00 55.01  ? 439 THR A CB    1 
ATOM   29   O OG1   . THR A 1 14  ? 7.476   -25.198 -16.006 1.00 59.98  ? 439 THR A OG1   1 
ATOM   30   C CG2   . THR A 1 14  ? 5.959   -23.651 -17.035 1.00 51.89  ? 439 THR A CG2   1 
ATOM   31   N N     . PRO A 1 15  ? 5.892   -21.141 -14.003 1.00 37.47  ? 440 PRO A N     1 
ATOM   32   C CA    . PRO A 1 15  ? 4.843   -20.190 -13.610 1.00 34.99  ? 440 PRO A CA    1 
ATOM   33   C C     . PRO A 1 15  ? 3.736   -20.141 -14.681 1.00 37.04  ? 440 PRO A C     1 
ATOM   34   O O     . PRO A 1 15  ? 4.023   -20.017 -15.865 1.00 34.21  ? 440 PRO A O     1 
ATOM   35   C CB    . PRO A 1 15  ? 5.598   -18.873 -13.429 1.00 35.79  ? 440 PRO A CB    1 
ATOM   36   C CG    . PRO A 1 15  ? 6.784   -19.000 -14.312 1.00 41.35  ? 440 PRO A CG    1 
ATOM   37   C CD    . PRO A 1 15  ? 7.182   -20.450 -14.227 1.00 37.61  ? 440 PRO A CD    1 
ATOM   38   N N     . PRO A 1 16  ? 2.451   -20.292 -14.277 1.00 37.68  ? 441 PRO A N     1 
ATOM   39   C CA    . PRO A 1 16  ? 1.360   -20.315 -15.277 1.00 38.16  ? 441 PRO A CA    1 
ATOM   40   C C     . PRO A 1 16  ? 1.099   -18.975 -15.962 1.00 40.87  ? 441 PRO A C     1 
ATOM   41   O O     . PRO A 1 16  ? 1.423   -17.922 -15.413 1.00 39.16  ? 441 PRO A O     1 
ATOM   42   C CB    . PRO A 1 16  ? 0.140   -20.732 -14.444 1.00 40.07  ? 441 PRO A CB    1 
ATOM   43   C CG    . PRO A 1 16  ? 0.464   -20.259 -13.055 1.00 44.12  ? 441 PRO A CG    1 
ATOM   44   C CD    . PRO A 1 16  ? 1.936   -20.516 -12.909 1.00 39.09  ? 441 PRO A CD    1 
ATOM   45   N N     . ARG A 1 17  ? 0.503   -19.023 -17.163 1.00 38.56  ? 442 ARG A N     1 
ATOM   46   C CA    . ARG A 1 17  ? 0.095   -17.833 -17.892 1.00 38.29  ? 442 ARG A CA    1 
ATOM   47   C C     . ARG A 1 17  ? -1.119  -17.268 -17.156 1.00 40.50  ? 442 ARG A C     1 
ATOM   48   O O     . ARG A 1 17  ? -1.934  -18.033 -16.645 1.00 39.14  ? 442 ARG A O     1 
ATOM   49   C CB    . ARG A 1 17  ? -0.267  -18.132 -19.353 1.00 39.65  ? 442 ARG A CB    1 
ATOM   50   C CG    . ARG A 1 17  ? 0.805   -18.855 -20.182 1.00 57.19  ? 442 ARG A CG    1 
ATOM   51   C CD    . ARG A 1 17  ? 2.211   -18.290 -20.074 1.00 73.50  ? 442 ARG A CD    1 
ATOM   52   N NE    . ARG A 1 17  ? 2.354   -16.996 -20.738 1.00 77.63  ? 442 ARG A NE    1 
ATOM   53   C CZ    . ARG A 1 17  ? 2.597   -16.843 -22.036 1.00 83.72  ? 442 ARG A CZ    1 
ATOM   54   N NH1   . ARG A 1 17  ? 2.682   -17.904 -22.834 1.00 68.63  ? 442 ARG A NH1   1 
ATOM   55   N NH2   . ARG A 1 17  ? 2.732   -15.631 -22.551 1.00 57.35  ? 442 ARG A NH2   1 
ATOM   56   N N     . SER A 1 18  ? -1.222  -15.946 -17.069 1.00 37.19  ? 443 SER A N     1 
ATOM   57   C CA    . SER A 1 18  ? -2.335  -15.357 -16.323 1.00 35.89  ? 443 SER A CA    1 
ATOM   58   C C     . SER A 1 18  ? -3.173  -14.431 -17.181 1.00 39.89  ? 443 SER A C     1 
ATOM   59   O O     . SER A 1 18  ? -2.682  -13.923 -18.198 1.00 38.29  ? 443 SER A O     1 
ATOM   60   C CB    . SER A 1 18  ? -1.797  -14.614 -15.095 1.00 36.46  ? 443 SER A CB    1 
ATOM   61   O OG    . SER A 1 18  ? -1.347  -13.317 -15.443 1.00 34.30  ? 443 SER A OG    1 
ATOM   62   N N     . PRO A 1 19  ? -4.404  -14.070 -16.738 1.00 38.30  ? 444 PRO A N     1 
ATOM   63   C CA    . PRO A 1 19  ? -5.175  -13.074 -17.509 1.00 38.73  ? 444 PRO A CA    1 
ATOM   64   C C     . PRO A 1 19  ? -4.522  -11.685 -17.525 1.00 43.71  ? 444 PRO A C     1 
ATOM   65   O O     . PRO A 1 19  ? -4.947  -10.806 -18.276 1.00 44.76  ? 444 PRO A O     1 
ATOM   66   C CB    . PRO A 1 19  ? -6.525  -13.022 -16.786 1.00 39.97  ? 444 PRO A CB    1 
ATOM   67   C CG    . PRO A 1 19  ? -6.329  -13.640 -15.475 1.00 44.99  ? 444 PRO A CG    1 
ATOM   68   C CD    . PRO A 1 19  ? -5.149  -14.556 -15.558 1.00 40.84  ? 444 PRO A CD    1 
ATOM   69   N N     . PHE A 1 20  ? -3.488  -11.478 -16.691 1.00 37.53  ? 445 PHE A N     1 
ATOM   70   C CA    . PHE A 1 20  ? -2.820  -10.183 -16.604 1.00 35.61  ? 445 PHE A CA    1 
ATOM   71   C C     . PHE A 1 20  ? -1.690  -10.006 -17.624 1.00 38.95  ? 445 PHE A C     1 
ATOM   72   O O     . PHE A 1 20  ? -1.258  -8.882  -17.861 1.00 38.45  ? 445 PHE A O     1 
ATOM   73   C CB    . PHE A 1 20  ? -2.368  -9.921  -15.155 1.00 35.98  ? 445 PHE A CB    1 
ATOM   74   C CG    . PHE A 1 20  ? -3.420  -10.297 -14.135 1.00 36.58  ? 445 PHE A CG    1 
ATOM   75   C CD1   . PHE A 1 20  ? -3.244  -11.392 -13.305 1.00 38.42  ? 445 PHE A CD1   1 
ATOM   76   C CD2   . PHE A 1 20  ? -4.602  -9.566  -14.028 1.00 39.49  ? 445 PHE A CD2   1 
ATOM   77   C CE1   . PHE A 1 20  ? -4.208  -11.734 -12.354 1.00 40.08  ? 445 PHE A CE1   1 
ATOM   78   C CE2   . PHE A 1 20  ? -5.577  -9.921  -13.098 1.00 42.33  ? 445 PHE A CE2   1 
ATOM   79   C CZ    . PHE A 1 20  ? -5.365  -10.993 -12.250 1.00 40.09  ? 445 PHE A CZ    1 
ATOM   80   N N     . ASN A 1 21  ? -1.237  -11.114 -18.233 1.00 38.35  ? 446 ASN A N     1 
ATOM   81   C CA    . ASN A 1 21  ? -0.165  -11.147 -19.234 1.00 38.86  ? 446 ASN A CA    1 
ATOM   82   C C     . ASN A 1 21  ? 1.051   -10.275 -18.834 1.00 39.99  ? 446 ASN A C     1 
ATOM   83   O O     . ASN A 1 21  ? 1.462   -9.395  -19.585 1.00 40.19  ? 446 ASN A O     1 
ATOM   84   C CB    . ASN A 1 21  ? -0.690  -10.827 -20.650 1.00 44.06  ? 446 ASN A CB    1 
ATOM   85   C CG    . ASN A 1 21  ? -1.716  -11.817 -21.160 1.00 66.57  ? 446 ASN A CG    1 
ATOM   86   O OD1   . ASN A 1 21  ? -1.527  -13.041 -21.097 1.00 58.39  ? 446 ASN A OD1   1 
ATOM   87   N ND2   . ASN A 1 21  ? -2.827  -11.311 -21.688 1.00 58.13  ? 446 ASN A ND2   1 
ATOM   88   N N     . LEU A 1 22  ? 1.626   -10.535 -17.639 1.00 33.55  ? 447 LEU A N     1 
ATOM   89   C CA    . LEU A 1 22  ? 2.828   -9.815  -17.210 1.00 31.49  ? 447 LEU A CA    1 
ATOM   90   C C     . LEU A 1 22  ? 3.917   -10.228 -18.195 1.00 32.00  ? 447 LEU A C     1 
ATOM   91   O O     . LEU A 1 22  ? 3.934   -11.386 -18.618 1.00 30.19  ? 447 LEU A O     1 
ATOM   92   C CB    . LEU A 1 22  ? 3.303   -10.223 -15.793 1.00 31.74  ? 447 LEU A CB    1 
ATOM   93   C CG    . LEU A 1 22  ? 2.395   -10.123 -14.558 1.00 38.20  ? 447 LEU A CG    1 
ATOM   94   C CD1   . LEU A 1 22  ? 3.205   -9.886  -13.319 1.00 37.14  ? 447 LEU A CD1   1 
ATOM   95   C CD2   . LEU A 1 22  ? 1.291   -9.136  -14.703 1.00 40.76  ? 447 LEU A CD2   1 
ATOM   96   N N     . VAL A 1 23  ? 4.827   -9.305  -18.545 1.00 29.00  ? 448 VAL A N     1 
ATOM   97   C CA    . VAL A 1 23  ? 5.930   -9.626  -19.456 1.00 29.91  ? 448 VAL A CA    1 
ATOM   98   C C     . VAL A 1 23  ? 6.838   -10.751 -18.850 1.00 29.82  ? 448 VAL A C     1 
ATOM   99   O O     . VAL A 1 23  ? 7.425   -11.512 -19.607 1.00 28.96  ? 448 VAL A O     1 
ATOM   100  C CB    . VAL A 1 23  ? 6.703   -8.357  -19.882 1.00 34.19  ? 448 VAL A CB    1 
ATOM   101  C CG1   . VAL A 1 23  ? 7.594   -7.811  -18.739 1.00 32.87  ? 448 VAL A CG1   1 
ATOM   102  C CG2   . VAL A 1 23  ? 7.517   -8.624  -21.144 1.00 34.87  ? 448 VAL A CG2   1 
ATOM   103  N N     . GLN A 1 24  ? 6.901   -10.866 -17.489 1.00 27.34  ? 449 GLN A N     1 
ATOM   104  C CA    . GLN A 1 24  ? 7.702   -11.913 -16.809 1.00 27.60  ? 449 GLN A CA    1 
ATOM   105  C C     . GLN A 1 24  ? 7.252   -13.340 -17.218 1.00 31.57  ? 449 GLN A C     1 
ATOM   106  O O     . GLN A 1 24  ? 8.060   -14.263 -17.193 1.00 31.59  ? 449 GLN A O     1 
ATOM   107  C CB    . GLN A 1 24  ? 7.608   -11.779 -15.277 1.00 28.29  ? 449 GLN A CB    1 
ATOM   108  C CG    . GLN A 1 24  ? 8.349   -10.577 -14.661 1.00 30.12  ? 449 GLN A CG    1 
ATOM   109  C CD    . GLN A 1 24  ? 7.454   -9.372  -14.481 1.00 31.54  ? 449 GLN A CD    1 
ATOM   110  O OE1   . GLN A 1 24  ? 6.613   -9.071  -15.319 1.00 27.19  ? 449 GLN A OE1   1 
ATOM   111  N NE2   . GLN A 1 24  ? 7.656   -8.606  -13.425 1.00 26.69  ? 449 GLN A NE2   1 
ATOM   112  N N     . GLU A 1 25  ? 5.947   -13.527 -17.558 1.00 28.46  ? 450 GLU A N     1 
ATOM   113  C CA    . GLU A 1 25  ? 5.391   -14.830 -17.951 1.00 29.00  ? 450 GLU A CA    1 
ATOM   114  C C     . GLU A 1 25  ? 6.051   -15.378 -19.220 1.00 33.37  ? 450 GLU A C     1 
ATOM   115  O O     . GLU A 1 25  ? 6.103   -16.589 -19.400 1.00 34.22  ? 450 GLU A O     1 
ATOM   116  C CB    . GLU A 1 25  ? 3.856   -14.722 -18.189 1.00 30.33  ? 450 GLU A CB    1 
ATOM   117  C CG    . GLU A 1 25  ? 3.044   -14.394 -16.930 1.00 32.04  ? 450 GLU A CG    1 
ATOM   118  C CD    . GLU A 1 25  ? 1.587   -14.045 -17.224 1.00 48.76  ? 450 GLU A CD    1 
ATOM   119  O OE1   . GLU A 1 25  ? 1.039   -14.557 -18.227 1.00 42.92  ? 450 GLU A OE1   1 
ATOM   120  O OE2   . GLU A 1 25  ? 1.031   -13.171 -16.522 1.00 32.99  ? 450 GLU A OE2   1 
ATOM   121  N N     . THR A 1 26  ? 6.513   -14.499 -20.102 1.00 30.18  ? 451 THR A N     1 
ATOM   122  C CA    . THR A 1 26  ? 7.152   -14.918 -21.372 1.00 30.98  ? 451 THR A CA    1 
ATOM   123  C C     . THR A 1 26  ? 8.677   -15.009 -21.284 1.00 33.16  ? 451 THR A C     1 
ATOM   124  O O     . THR A 1 26  ? 9.313   -15.548 -22.203 1.00 34.68  ? 451 THR A O     1 
ATOM   125  C CB    . THR A 1 26  ? 6.753   -13.978 -22.540 1.00 42.33  ? 451 THR A CB    1 
ATOM   126  O OG1   . THR A 1 26  ? 7.469   -12.747 -22.480 1.00 48.47  ? 451 THR A OG1   1 
ATOM   127  C CG2   . THR A 1 26  ? 5.270   -13.691 -22.584 1.00 42.54  ? 451 THR A CG2   1 
ATOM   128  N N     . LEU A 1 27  ? 9.273   -14.450 -20.220 1.00 26.58  ? 452 LEU A N     1 
ATOM   129  C CA    . LEU A 1 27  ? 10.744  -14.345 -20.168 1.00 26.73  ? 452 LEU A CA    1 
ATOM   130  C C     . LEU A 1 27  ? 11.408  -15.175 -19.120 1.00 29.44  ? 452 LEU A C     1 
ATOM   131  O O     . LEU A 1 27  ? 12.645  -15.145 -19.021 1.00 28.02  ? 452 LEU A O     1 
ATOM   132  C CB    . LEU A 1 27  ? 11.129  -12.869 -19.906 1.00 27.05  ? 452 LEU A CB    1 
ATOM   133  C CG    . LEU A 1 27  ? 10.673  -11.842 -20.943 1.00 30.54  ? 452 LEU A CG    1 
ATOM   134  C CD1   . LEU A 1 27  ? 10.932  -10.453 -20.414 1.00 31.02  ? 452 LEU A CD1   1 
ATOM   135  C CD2   . LEU A 1 27  ? 11.427  -12.047 -22.285 1.00 31.05  ? 452 LEU A CD2   1 
ATOM   136  N N     . PHE A 1 28  ? 10.617  -15.827 -18.283 1.00 26.83  ? 453 PHE A N     1 
ATOM   137  C CA    . PHE A 1 28  ? 11.151  -16.558 -17.127 1.00 27.42  ? 453 PHE A CA    1 
ATOM   138  C C     . PHE A 1 28  ? 12.224  -17.632 -17.408 1.00 29.93  ? 453 PHE A C     1 
ATOM   139  O O     . PHE A 1 28  ? 12.927  -17.996 -16.473 1.00 28.45  ? 453 PHE A O     1 
ATOM   140  C CB    . PHE A 1 28  ? 10.016  -17.132 -16.260 1.00 28.80  ? 453 PHE A CB    1 
ATOM   141  C CG    . PHE A 1 28  ? 9.347   -18.345 -16.850 1.00 31.05  ? 453 PHE A CG    1 
ATOM   142  C CD1   . PHE A 1 28  ? 9.877   -19.617 -16.652 1.00 34.19  ? 453 PHE A CD1   1 
ATOM   143  C CD2   . PHE A 1 28  ? 8.189   -18.220 -17.607 1.00 33.10  ? 453 PHE A CD2   1 
ATOM   144  C CE1   . PHE A 1 28  ? 9.279   -20.733 -17.233 1.00 35.51  ? 453 PHE A CE1   1 
ATOM   145  C CE2   . PHE A 1 28  ? 7.591   -19.332 -18.179 1.00 35.49  ? 453 PHE A CE2   1 
ATOM   146  C CZ    . PHE A 1 28  ? 8.115   -20.587 -17.961 1.00 34.90  ? 453 PHE A CZ    1 
ATOM   147  N N     . HIS A 1 29  ? 12.295  -18.176 -18.655 1.00 27.23  ? 454 HIS A N     1 
ATOM   148  C CA    . HIS A 1 29  ? 13.303  -19.200 -19.017 1.00 27.40  ? 454 HIS A CA    1 
ATOM   149  C C     . HIS A 1 29  ? 14.717  -18.578 -19.051 1.00 31.89  ? 454 HIS A C     1 
ATOM   150  O O     . HIS A 1 29  ? 15.710  -19.273 -18.856 1.00 32.53  ? 454 HIS A O     1 
ATOM   151  C CB    . HIS A 1 29  ? 12.981  -19.834 -20.387 1.00 29.05  ? 454 HIS A CB    1 
ATOM   152  C CG    . HIS A 1 29  ? 11.761  -20.708 -20.381 1.00 33.93  ? 454 HIS A CG    1 
ATOM   153  N ND1   . HIS A 1 29  ? 11.800  -21.995 -19.869 1.00 36.47  ? 454 HIS A ND1   1 
ATOM   154  C CD2   . HIS A 1 29  ? 10.503  -20.441 -20.802 1.00 37.51  ? 454 HIS A CD2   1 
ATOM   155  C CE1   . HIS A 1 29  ? 10.572  -22.480 -20.018 1.00 37.29  ? 454 HIS A CE1   1 
ATOM   156  N NE2   . HIS A 1 29  ? 9.754   -21.581 -20.571 1.00 37.92  ? 454 HIS A NE2   1 
ATOM   157  N N     . ASP A 1 30  ? 14.796  -17.269 -19.246 1.00 26.83  ? 455 ASP A N     1 
ATOM   158  C CA    . ASP A 1 30  ? 16.075  -16.569 -19.282 1.00 26.13  ? 455 ASP A CA    1 
ATOM   159  C C     . ASP A 1 30  ? 16.068  -15.506 -18.171 1.00 28.76  ? 455 ASP A C     1 
ATOM   160  O O     . ASP A 1 30  ? 15.577  -14.391 -18.413 1.00 26.68  ? 455 ASP A O     1 
ATOM   161  C CB    . ASP A 1 30  ? 16.283  -15.923 -20.673 1.00 27.19  ? 455 ASP A CB    1 
ATOM   162  C CG    . ASP A 1 30  ? 17.653  -15.300 -20.858 1.00 33.19  ? 455 ASP A CG    1 
ATOM   163  O OD1   . ASP A 1 30  ? 18.112  -15.226 -22.003 1.00 31.01  ? 455 ASP A OD1   1 
ATOM   164  O OD2   . ASP A 1 30  ? 18.276  -14.898 -19.842 1.00 33.62  ? 455 ASP A OD2   1 
ATOM   165  N N     . PRO A 1 31  ? 16.554  -15.836 -16.945 1.00 26.19  ? 456 PRO A N     1 
ATOM   166  C CA    . PRO A 1 31  ? 16.502  -14.856 -15.846 1.00 26.39  ? 456 PRO A CA    1 
ATOM   167  C C     . PRO A 1 31  ? 17.106  -13.506 -16.169 1.00 27.22  ? 456 PRO A C     1 
ATOM   168  O O     . PRO A 1 31  ? 16.559  -12.507 -15.711 1.00 25.71  ? 456 PRO A O     1 
ATOM   169  C CB    . PRO A 1 31  ? 17.223  -15.568 -14.680 1.00 28.26  ? 456 PRO A CB    1 
ATOM   170  C CG    . PRO A 1 31  ? 17.045  -17.019 -14.969 1.00 32.19  ? 456 PRO A CG    1 
ATOM   171  C CD    . PRO A 1 31  ? 17.101  -17.127 -16.480 1.00 28.14  ? 456 PRO A CD    1 
ATOM   172  N N     . TRP A 1 32  ? 18.197  -13.446 -16.976 1.00 25.34  ? 457 TRP A N     1 
ATOM   173  C CA    . TRP A 1 32  ? 18.786  -12.145 -17.365 1.00 25.72  ? 457 TRP A CA    1 
ATOM   174  C C     . TRP A 1 32  ? 17.758  -11.306 -18.131 1.00 26.22  ? 457 TRP A C     1 
ATOM   175  O O     . TRP A 1 32  ? 17.573  -10.142 -17.793 1.00 24.93  ? 457 TRP A O     1 
ATOM   176  C CB    . TRP A 1 32  ? 20.077  -12.319 -18.198 1.00 25.24  ? 457 TRP A CB    1 
ATOM   177  C CG    . TRP A 1 32  ? 20.696  -11.029 -18.652 1.00 26.32  ? 457 TRP A CG    1 
ATOM   178  C CD1   . TRP A 1 32  ? 21.431  -10.152 -17.893 1.00 28.78  ? 457 TRP A CD1   1 
ATOM   179  C CD2   . TRP A 1 32  ? 20.562  -10.427 -19.947 1.00 26.09  ? 457 TRP A CD2   1 
ATOM   180  N NE1   . TRP A 1 32  ? 21.804  -9.069  -18.652 1.00 26.36  ? 457 TRP A NE1   1 
ATOM   181  C CE2   . TRP A 1 32  ? 21.305  -9.224  -19.928 1.00 28.71  ? 457 TRP A CE2   1 
ATOM   182  C CE3   . TRP A 1 32  ? 19.935  -10.823 -21.150 1.00 27.83  ? 457 TRP A CE3   1 
ATOM   183  C CZ2   . TRP A 1 32  ? 21.408  -8.390  -21.049 1.00 28.60  ? 457 TRP A CZ2   1 
ATOM   184  C CZ3   . TRP A 1 32  ? 20.062  -10.003 -22.274 1.00 29.09  ? 457 TRP A CZ3   1 
ATOM   185  C CH2   . TRP A 1 32  ? 20.743  -8.778  -22.200 1.00 29.32  ? 457 TRP A CH2   1 
ATOM   186  N N     . LYS A 1 33  ? 17.069  -11.892 -19.147 1.00 23.49  ? 458 LYS A N     1 
ATOM   187  C CA    . LYS A 1 33  ? 16.034  -11.144 -19.895 1.00 22.18  ? 458 LYS A CA    1 
ATOM   188  C C     . LYS A 1 33  ? 14.921  -10.672 -18.975 1.00 24.14  ? 458 LYS A C     1 
ATOM   189  O O     . LYS A 1 33  ? 14.477  -9.528  -19.069 1.00 25.96  ? 458 LYS A O     1 
ATOM   190  C CB    . LYS A 1 33  ? 15.459  -12.022 -21.005 1.00 24.68  ? 458 LYS A CB    1 
ATOM   191  C CG    . LYS A 1 33  ? 16.443  -12.208 -22.157 1.00 25.81  ? 458 LYS A CG    1 
ATOM   192  C CD    . LYS A 1 33  ? 15.720  -12.880 -23.331 1.00 26.47  ? 458 LYS A CD    1 
ATOM   193  C CE    . LYS A 1 33  ? 16.673  -13.083 -24.488 1.00 31.67  ? 458 LYS A CE    1 
ATOM   194  N NZ    . LYS A 1 33  ? 15.966  -13.691 -25.628 1.00 40.85  ? 458 LYS A NZ    1 
ATOM   195  N N     . LEU A 1 34  ? 14.463  -11.536 -18.059 1.00 22.06  ? 459 LEU A N     1 
ATOM   196  C CA    . LEU A 1 34  ? 13.388  -11.142 -17.150 1.00 22.46  ? 459 LEU A CA    1 
ATOM   197  C C     . LEU A 1 34  ? 13.828  -9.957  -16.306 1.00 24.52  ? 459 LEU A C     1 
ATOM   198  O O     . LEU A 1 34  ? 13.028  -9.031  -16.117 1.00 24.12  ? 459 LEU A O     1 
ATOM   199  C CB    . LEU A 1 34  ? 12.974  -12.311 -16.266 1.00 22.81  ? 459 LEU A CB    1 
ATOM   200  C CG    . LEU A 1 34  ? 11.862  -12.027 -15.226 1.00 26.68  ? 459 LEU A CG    1 
ATOM   201  C CD1   . LEU A 1 34  ? 10.968  -13.227 -15.089 1.00 26.52  ? 459 LEU A CD1   1 
ATOM   202  C CD2   . LEU A 1 34  ? 12.456  -11.642 -13.866 1.00 27.64  ? 459 LEU A CD2   1 
ATOM   203  N N     . LEU A 1 35  ? 15.063  -10.015 -15.762 1.00 22.72  ? 460 LEU A N     1 
ATOM   204  C CA    . LEU A 1 35  ? 15.598  -8.942  -14.921 1.00 21.55  ? 460 LEU A CA    1 
ATOM   205  C C     . LEU A 1 35  ? 15.824  -7.639  -15.705 1.00 26.66  ? 460 LEU A C     1 
ATOM   206  O O     . LEU A 1 35  ? 15.512  -6.562  -15.211 1.00 25.14  ? 460 LEU A O     1 
ATOM   207  C CB    . LEU A 1 35  ? 16.862  -9.395  -14.200 1.00 21.18  ? 460 LEU A CB    1 
ATOM   208  C CG    . LEU A 1 35  ? 16.596  -10.501 -13.155 1.00 24.47  ? 460 LEU A CG    1 
ATOM   209  C CD1   . LEU A 1 35  ? 17.911  -11.176 -12.752 1.00 25.33  ? 460 LEU A CD1   1 
ATOM   210  C CD2   . LEU A 1 35  ? 15.755  -9.977  -11.932 1.00 23.01  ? 460 LEU A CD2   1 
ATOM   211  N N     . ILE A 1 36  ? 16.280  -7.738  -16.948 1.00 23.41  ? 461 ILE A N     1 
ATOM   212  C CA    . ILE A 1 36  ? 16.434  -6.554  -17.829 1.00 21.65  ? 461 ILE A CA    1 
ATOM   213  C C     . ILE A 1 36  ? 15.039  -5.915  -18.026 1.00 24.84  ? 461 ILE A C     1 
ATOM   214  O O     . ILE A 1 36  ? 14.887  -4.692  -17.929 1.00 24.19  ? 461 ILE A O     1 
ATOM   215  C CB    . ILE A 1 36  ? 17.044  -6.982  -19.197 1.00 24.57  ? 461 ILE A CB    1 
ATOM   216  C CG1   . ILE A 1 36  ? 18.548  -7.383  -19.035 1.00 25.69  ? 461 ILE A CG1   1 
ATOM   217  C CG2   . ILE A 1 36  ? 16.896  -5.877  -20.277 1.00 26.57  ? 461 ILE A CG2   1 
ATOM   218  C CD1   . ILE A 1 36  ? 19.593  -6.193  -18.791 1.00 27.29  ? 461 ILE A CD1   1 
ATOM   219  N N     . ALA A 1 37  ? 14.010  -6.760  -18.230 1.00 23.62  ? 462 ALA A N     1 
ATOM   220  C CA    . ALA A 1 37  ? 12.621  -6.280  -18.393 1.00 22.54  ? 462 ALA A CA    1 
ATOM   221  C C     . ALA A 1 37  ? 12.192  -5.511  -17.154 1.00 26.21  ? 462 ALA A C     1 
ATOM   222  O O     . ALA A 1 37  ? 11.679  -4.407  -17.291 1.00 24.89  ? 462 ALA A O     1 
ATOM   223  C CB    . ALA A 1 37  ? 11.694  -7.439  -18.676 1.00 22.93  ? 462 ALA A CB    1 
ATOM   224  N N     . THR A 1 38  ? 12.502  -6.015  -15.929 1.00 23.78  ? 463 THR A N     1 
ATOM   225  C CA    . THR A 1 38  ? 12.189  -5.237  -14.719 1.00 23.46  ? 463 THR A CA    1 
ATOM   226  C C     . THR A 1 38  ? 12.839  -3.862  -14.730 1.00 26.48  ? 463 THR A C     1 
ATOM   227  O O     . THR A 1 38  ? 12.191  -2.880  -14.350 1.00 26.68  ? 463 THR A O     1 
ATOM   228  C CB    . THR A 1 38  ? 12.443  -6.033  -13.413 1.00 25.35  ? 463 THR A CB    1 
ATOM   229  O OG1   . THR A 1 38  ? 13.840  -6.092  -13.130 1.00 24.33  ? 463 THR A OG1   1 
ATOM   230  C CG2   . THR A 1 38  ? 11.841  -7.429  -13.467 1.00 26.18  ? 463 THR A CG2   1 
ATOM   231  N N     . ILE A 1 39  ? 14.115  -3.778  -15.145 1.00 24.48  ? 464 ILE A N     1 
ATOM   232  C CA    . ILE A 1 39  ? 14.843  -2.519  -15.206 1.00 23.94  ? 464 ILE A CA    1 
ATOM   233  C C     . ILE A 1 39  ? 14.149  -1.542  -16.191 1.00 28.54  ? 464 ILE A C     1 
ATOM   234  O O     . ILE A 1 39  ? 13.974  -0.356  -15.864 1.00 27.73  ? 464 ILE A O     1 
ATOM   235  C CB    . ILE A 1 39  ? 16.312  -2.752  -15.561 1.00 25.85  ? 464 ILE A CB    1 
ATOM   236  C CG1   . ILE A 1 39  ? 17.036  -3.450  -14.360 1.00 26.14  ? 464 ILE A CG1   1 
ATOM   237  C CG2   . ILE A 1 39  ? 17.005  -1.414  -15.974 1.00 27.16  ? 464 ILE A CG2   1 
ATOM   238  C CD1   . ILE A 1 39  ? 18.371  -4.137  -14.815 1.00 24.09  ? 464 ILE A CD1   1 
ATOM   239  N N     . PHE A 1 40  ? 13.718  -2.064  -17.344 1.00 24.47  ? 465 PHE A N     1 
ATOM   240  C CA    . PHE A 1 40  ? 12.981  -1.272  -18.363 1.00 25.82  ? 465 PHE A CA    1 
ATOM   241  C C     . PHE A 1 40  ? 11.685  -0.684  -17.816 1.00 30.39  ? 465 PHE A C     1 
ATOM   242  O O     . PHE A 1 40  ? 11.285  0.425   -18.196 1.00 28.32  ? 465 PHE A O     1 
ATOM   243  C CB    . PHE A 1 40  ? 12.672  -2.146  -19.573 1.00 27.46  ? 465 PHE A CB    1 
ATOM   244  C CG    . PHE A 1 40  ? 13.733  -2.041  -20.624 1.00 28.88  ? 465 PHE A CG    1 
ATOM   245  C CD1   . PHE A 1 40  ? 15.007  -2.556  -20.406 1.00 31.65  ? 465 PHE A CD1   1 
ATOM   246  C CD2   . PHE A 1 40  ? 13.462  -1.431  -21.851 1.00 33.54  ? 465 PHE A CD2   1 
ATOM   247  C CE1   . PHE A 1 40  ? 16.008  -2.437  -21.371 1.00 31.99  ? 465 PHE A CE1   1 
ATOM   248  C CE2   . PHE A 1 40  ? 14.473  -1.290  -22.813 1.00 34.28  ? 465 PHE A CE2   1 
ATOM   249  C CZ    . PHE A 1 40  ? 15.725  -1.825  -22.581 1.00 32.27  ? 465 PHE A CZ    1 
ATOM   250  N N     . LEU A 1 41  ? 11.082  -1.379  -16.846 1.00 26.58  ? 466 LEU A N     1 
ATOM   251  C CA    . LEU A 1 41  ? 9.841   -0.949  -16.198 1.00 26.90  ? 466 LEU A CA    1 
ATOM   252  C C     . LEU A 1 41  ? 10.012  0.010   -15.039 1.00 29.84  ? 466 LEU A C     1 
ATOM   253  O O     . LEU A 1 41  ? 9.013   0.496   -14.543 1.00 29.53  ? 466 LEU A O     1 
ATOM   254  C CB    . LEU A 1 41  ? 8.983   -2.175  -15.808 1.00 26.96  ? 466 LEU A CB    1 
ATOM   255  C CG    . LEU A 1 41  ? 8.523   -3.015  -16.998 1.00 30.54  ? 466 LEU A CG    1 
ATOM   256  C CD1   . LEU A 1 41  ? 7.980   -4.363  -16.534 1.00 31.17  ? 466 LEU A CD1   1 
ATOM   257  C CD2   . LEU A 1 41  ? 7.442   -2.289  -17.767 1.00 35.38  ? 466 LEU A CD2   1 
ATOM   258  N N     . ASN A 1 42  ? 11.259  0.284   -14.575 1.00 26.60  ? 467 ASN A N     1 
ATOM   259  C CA    . ASN A 1 42  ? 11.480  1.226   -13.455 1.00 27.36  ? 467 ASN A CA    1 
ATOM   260  C C     . ASN A 1 42  ? 10.878  2.594   -13.818 1.00 30.16  ? 467 ASN A C     1 
ATOM   261  O O     . ASN A 1 42  ? 11.357  3.200   -14.764 1.00 28.24  ? 467 ASN A O     1 
ATOM   262  C CB    . ASN A 1 42  ? 12.984  1.409   -13.185 1.00 26.58  ? 467 ASN A CB    1 
ATOM   263  C CG    . ASN A 1 42  ? 13.636  0.238   -12.468 1.00 29.24  ? 467 ASN A CG    1 
ATOM   264  O OD1   . ASN A 1 42  ? 13.117  -0.883  -12.426 1.00 29.28  ? 467 ASN A OD1   1 
ATOM   265  N ND2   . ASN A 1 42  ? 14.782  0.479   -11.927 1.00 24.64  ? 467 ASN A ND2   1 
ATOM   266  N N     . ARG A 1 43  ? 9.804   3.032   -13.116 1.00 30.94  ? 468 ARG A N     1 
ATOM   267  C CA    . ARG A 1 43  ? 9.178   4.370   -13.340 1.00 30.04  ? 468 ARG A CA    1 
ATOM   268  C C     . ARG A 1 43  ? 8.864   4.661   -14.823 1.00 34.12  ? 468 ARG A C     1 
ATOM   269  O O     . ARG A 1 43  ? 9.003   5.800   -15.315 1.00 33.56  ? 468 ARG A O     1 
ATOM   270  C CB    . ARG A 1 43  ? 10.065  5.481   -12.730 1.00 29.78  ? 468 ARG A CB    1 
ATOM   271  C CG    . ARG A 1 43  ? 10.318  5.333   -11.243 1.00 41.28  ? 468 ARG A CG    1 
ATOM   272  C CD    . ARG A 1 43  ? 9.243   5.996   -10.381 1.00 49.97  ? 468 ARG A CD    1 
ATOM   273  N NE    . ARG A 1 43  ? 8.045   5.170   -10.270 1.00 62.14  ? 468 ARG A NE    1 
ATOM   274  C CZ    . ARG A 1 43  ? 6.859   5.599   -9.862  1.00 78.18  ? 468 ARG A CZ    1 
ATOM   275  N NH1   . ARG A 1 43  ? 6.692   6.867   -9.500  1.00 68.06  ? 468 ARG A NH1   1 
ATOM   276  N NH2   . ARG A 1 43  ? 5.828   4.768   -9.816  1.00 65.80  ? 468 ARG A NH2   1 
ATOM   277  N N     . THR A 1 44  ? 8.471   3.605   -15.545 1.00 31.21  ? 469 THR A N     1 
ATOM   278  C CA    . THR A 1 44  ? 8.178   3.662   -16.976 1.00 31.47  ? 469 THR A CA    1 
ATOM   279  C C     . THR A 1 44  ? 7.005   2.724   -17.233 1.00 38.22  ? 469 THR A C     1 
ATOM   280  O O     . THR A 1 44  ? 7.018   1.575   -16.768 1.00 37.71  ? 469 THR A O     1 
ATOM   281  C CB    . THR A 1 44  ? 9.403   3.241   -17.807 1.00 32.41  ? 469 THR A CB    1 
ATOM   282  O OG1   . THR A 1 44  ? 10.562  3.984   -17.390 1.00 33.51  ? 469 THR A OG1   1 
ATOM   283  C CG2   . THR A 1 44  ? 9.185   3.408   -19.319 1.00 32.56  ? 469 THR A CG2   1 
ATOM   284  N N     . SER A 1 45  ? 5.995   3.214   -17.978 1.00 36.23  ? 470 SER A N     1 
ATOM   285  C CA    . SER A 1 45  ? 4.823   2.403   -18.309 1.00 35.90  ? 470 SER A CA    1 
ATOM   286  C C     . SER A 1 45  ? 5.263   1.322   -19.267 1.00 37.53  ? 470 SER A C     1 
ATOM   287  O O     . SER A 1 45  ? 6.144   1.570   -20.098 1.00 36.36  ? 470 SER A O     1 
ATOM   288  C CB    . SER A 1 45  ? 3.744   3.259   -18.967 1.00 39.06  ? 470 SER A CB    1 
ATOM   289  O OG    . SER A 1 45  ? 4.178   3.653   -20.257 1.00 47.77  ? 470 SER A OG    1 
ATOM   290  N N     . GLY A 1 46  ? 4.663   0.142   -19.126 1.00 35.56  ? 471 GLY A N     1 
ATOM   291  C CA    . GLY A 1 46  ? 4.928   -1.029  -19.960 1.00 33.76  ? 471 GLY A CA    1 
ATOM   292  C C     . GLY A 1 46  ? 4.556   -0.838  -21.413 1.00 36.25  ? 471 GLY A C     1 
ATOM   293  O O     . GLY A 1 46  ? 5.203   -1.391  -22.297 1.00 33.02  ? 471 GLY A O     1 
ATOM   294  N N     . LYS A 1 47  ? 3.487   -0.059  -21.669 1.00 35.50  ? 472 LYS A N     1 
ATOM   295  C CA    . LYS A 1 47  ? 3.027   0.229   -23.023 1.00 36.53  ? 472 LYS A CA    1 
ATOM   296  C C     . LYS A 1 47  ? 4.189   0.836   -23.825 1.00 40.05  ? 472 LYS A C     1 
ATOM   297  O O     . LYS A 1 47  ? 4.375   0.489   -24.989 1.00 40.40  ? 472 LYS A O     1 
ATOM   298  C CB    . LYS A 1 47  ? 1.823   1.199   -22.971 1.00 39.62  ? 472 LYS A CB    1 
ATOM   299  C CG    . LYS A 1 47  ? 1.116   1.366   -24.308 1.00 56.07  ? 472 LYS A CG    1 
ATOM   300  C CD    . LYS A 1 47  ? 0.103   2.490   -24.271 1.00 67.71  ? 472 LYS A CD    1 
ATOM   301  C CE    . LYS A 1 47  ? -0.557  2.726   -25.610 1.00 82.95  ? 472 LYS A CE    1 
ATOM   302  N NZ    . LYS A 1 47  ? -1.562  1.677   -25.933 1.00 95.39  ? 472 LYS A NZ    1 
ATOM   303  N N     . MET A 1 48  ? 5.023   1.669   -23.171 1.00 36.73  ? 473 MET A N     1 
ATOM   304  C CA    . MET A 1 48  ? 6.163   2.295   -23.842 1.00 37.32  ? 473 MET A CA    1 
ATOM   305  C C     . MET A 1 48  ? 7.465   1.487   -23.717 1.00 38.82  ? 473 MET A C     1 
ATOM   306  O O     . MET A 1 48  ? 8.186   1.325   -24.702 1.00 37.39  ? 473 MET A O     1 
ATOM   307  C CB    . MET A 1 48  ? 6.350   3.756   -23.385 1.00 40.36  ? 473 MET A CB    1 
ATOM   308  C CG    . MET A 1 48  ? 5.100   4.616   -23.556 1.00 46.20  ? 473 MET A CG    1 
ATOM   309  S SD    . MET A 1 48  ? 4.251   4.442   -25.162 1.00 53.41  ? 473 MET A SD    1 
ATOM   310  C CE    . MET A 1 48  ? 5.329   5.400   -26.233 1.00 50.35  ? 473 MET A CE    1 
ATOM   311  N N     . ALA A 1 49  ? 7.744   0.935   -22.514 1.00 35.15  ? 474 ALA A N     1 
ATOM   312  C CA    . ALA A 1 49  ? 8.968   0.157   -22.269 1.00 33.74  ? 474 ALA A CA    1 
ATOM   313  C C     . ALA A 1 49  ? 9.081   -1.139  -23.069 1.00 34.95  ? 474 ALA A C     1 
ATOM   314  O O     . ALA A 1 49  ? 10.168  -1.455  -23.546 1.00 31.89  ? 474 ALA A O     1 
ATOM   315  C CB    . ALA A 1 49  ? 9.097   -0.157  -20.779 1.00 34.36  ? 474 ALA A CB    1 
ATOM   316  N N     . ILE A 1 50  ? 8.008   -1.949  -23.124 1.00 31.46  ? 475 ILE A N     1 
ATOM   317  C CA    . ILE A 1 50  ? 8.107   -3.268  -23.762 1.00 31.26  ? 475 ILE A CA    1 
ATOM   318  C C     . ILE A 1 50  ? 8.511   -3.256  -25.264 1.00 34.60  ? 475 ILE A C     1 
ATOM   319  O O     . ILE A 1 50  ? 9.422   -4.012  -25.655 1.00 30.77  ? 475 ILE A O     1 
ATOM   320  C CB    . ILE A 1 50  ? 6.915   -4.207  -23.386 1.00 34.96  ? 475 ILE A CB    1 
ATOM   321  C CG1   . ILE A 1 50  ? 6.733   -4.366  -21.822 1.00 36.39  ? 475 ILE A CG1   1 
ATOM   322  C CG2   . ILE A 1 50  ? 7.005   -5.556  -24.098 1.00 36.95  ? 475 ILE A CG2   1 
ATOM   323  C CD1   . ILE A 1 50  ? 7.982   -4.874  -21.003 1.00 48.13  ? 475 ILE A CD1   1 
ATOM   324  N N     . PRO A 1 51  ? 7.885   -2.409  -26.139 1.00 35.15  ? 476 PRO A N     1 
ATOM   325  C CA    . PRO A 1 51  ? 8.354   -2.338  -27.535 1.00 35.14  ? 476 PRO A CA    1 
ATOM   326  C C     . PRO A 1 51  ? 9.851   -2.002  -27.596 1.00 37.61  ? 476 PRO A C     1 
ATOM   327  O O     . PRO A 1 51  ? 10.587  -2.616  -28.362 1.00 35.35  ? 476 PRO A O     1 
ATOM   328  C CB    . PRO A 1 51  ? 7.498   -1.208  -28.148 1.00 37.08  ? 476 PRO A CB    1 
ATOM   329  C CG    . PRO A 1 51  ? 6.294   -1.132  -27.309 1.00 41.45  ? 476 PRO A CG    1 
ATOM   330  C CD    . PRO A 1 51  ? 6.792   -1.450  -25.898 1.00 37.44  ? 476 PRO A CD    1 
ATOM   331  N N     . VAL A 1 52  ? 10.322  -1.061  -26.740 1.00 34.78  ? 477 VAL A N     1 
ATOM   332  C CA    . VAL A 1 52  ? 11.759  -0.713  -26.703 1.00 34.08  ? 477 VAL A CA    1 
ATOM   333  C C     . VAL A 1 52  ? 12.582  -1.913  -26.181 1.00 34.29  ? 477 VAL A C     1 
ATOM   334  O O     . VAL A 1 52  ? 13.646  -2.182  -26.720 1.00 33.32  ? 477 VAL A O     1 
ATOM   335  C CB    . VAL A 1 52  ? 12.056  0.622   -25.959 1.00 37.87  ? 477 VAL A CB    1 
ATOM   336  C CG1   . VAL A 1 52  ? 13.551  0.954   -25.991 1.00 36.33  ? 477 VAL A CG1   1 
ATOM   337  C CG2   . VAL A 1 52  ? 11.230  1.789   -26.541 1.00 37.65  ? 477 VAL A CG2   1 
ATOM   338  N N     . LEU A 1 53  ? 12.057  -2.690  -25.208 1.00 30.94  ? 478 LEU A N     1 
ATOM   339  C CA    . LEU A 1 53  ? 12.768  -3.905  -24.742 1.00 29.41  ? 478 LEU A CA    1 
ATOM   340  C C     . LEU A 1 53  ? 13.100  -4.847  -25.902 1.00 33.17  ? 478 LEU A C     1 
ATOM   341  O O     . LEU A 1 53  ? 14.209  -5.374  -25.950 1.00 29.75  ? 478 LEU A O     1 
ATOM   342  C CB    . LEU A 1 53  ? 11.926  -4.666  -23.698 1.00 28.81  ? 478 LEU A CB    1 
ATOM   343  C CG    . LEU A 1 53  ? 12.427  -6.040  -23.197 1.00 32.64  ? 478 LEU A CG    1 
ATOM   344  C CD1   . LEU A 1 53  ? 13.735  -5.913  -22.362 1.00 31.45  ? 478 LEU A CD1   1 
ATOM   345  C CD2   . LEU A 1 53  ? 11.356  -6.741  -22.371 1.00 30.65  ? 478 LEU A CD2   1 
ATOM   346  N N     . TRP A 1 54  ? 12.132  -5.096  -26.818 1.00 32.39  ? 479 TRP A N     1 
ATOM   347  C CA    . TRP A 1 54  ? 12.411  -6.001  -27.944 1.00 34.17  ? 479 TRP A CA    1 
ATOM   348  C C     . TRP A 1 54  ? 13.532  -5.439  -28.832 1.00 35.33  ? 479 TRP A C     1 
ATOM   349  O O     . TRP A 1 54  ? 14.422  -6.199  -29.247 1.00 33.31  ? 479 TRP A O     1 
ATOM   350  C CB    . TRP A 1 54  ? 11.126  -6.347  -28.760 1.00 33.72  ? 479 TRP A CB    1 
ATOM   351  C CG    . TRP A 1 54  ? 9.986   -6.857  -27.928 1.00 35.13  ? 479 TRP A CG    1 
ATOM   352  C CD1   . TRP A 1 54  ? 8.730   -6.338  -27.873 1.00 38.09  ? 479 TRP A CD1   1 
ATOM   353  C CD2   . TRP A 1 54  ? 10.046  -7.866  -26.911 1.00 35.37  ? 479 TRP A CD2   1 
ATOM   354  N NE1   . TRP A 1 54  ? 7.979   -7.012  -26.944 1.00 38.35  ? 479 TRP A NE1   1 
ATOM   355  C CE2   . TRP A 1 54  ? 8.768   -7.937  -26.317 1.00 39.81  ? 479 TRP A CE2   1 
ATOM   356  C CE3   . TRP A 1 54  ? 11.051  -8.743  -26.462 1.00 37.20  ? 479 TRP A CE3   1 
ATOM   357  C CZ2   . TRP A 1 54  ? 8.473   -8.823  -25.277 1.00 39.64  ? 479 TRP A CZ2   1 
ATOM   358  C CZ3   . TRP A 1 54  ? 10.760  -9.619  -25.425 1.00 39.47  ? 479 TRP A CZ3   1 
ATOM   359  C CH2   . TRP A 1 54  ? 9.476   -9.664  -24.857 1.00 40.17  ? 479 TRP A CH2   1 
ATOM   360  N N     . LYS A 1 55  ? 13.538  -4.103  -29.052 1.00 33.35  ? 480 LYS A N     1 
ATOM   361  C CA    . LYS A 1 55  ? 14.607  -3.437  -29.834 1.00 34.54  ? 480 LYS A CA    1 
ATOM   362  C C     . LYS A 1 55  ? 15.977  -3.661  -29.150 1.00 38.32  ? 480 LYS A C     1 
ATOM   363  O O     . LYS A 1 55  ? 16.967  -4.046  -29.796 1.00 38.34  ? 480 LYS A O     1 
ATOM   364  C CB    . LYS A 1 55  ? 14.282  -1.950  -30.009 1.00 38.00  ? 480 LYS A CB    1 
ATOM   365  C CG    . LYS A 1 55  ? 15.382  -1.092  -30.628 1.00 67.56  ? 480 LYS A CG    1 
ATOM   366  C CD    . LYS A 1 55  ? 15.075  -0.694  -32.075 1.00 76.91  ? 480 LYS A CD    1 
ATOM   367  C CE    . LYS A 1 55  ? 16.108  0.252   -32.654 1.00 77.91  ? 480 LYS A CE    1 
ATOM   368  N NZ    . LYS A 1 55  ? 17.408  -0.416  -32.934 1.00 76.48  ? 480 LYS A NZ    1 
ATOM   369  N N     . PHE A 1 56  ? 16.003  -3.473  -27.820 1.00 32.58  ? 481 PHE A N     1 
ATOM   370  C CA    . PHE A 1 56  ? 17.201  -3.701  -27.010 1.00 31.12  ? 481 PHE A CA    1 
ATOM   371  C C     . PHE A 1 56  ? 17.704  -5.144  -27.105 1.00 32.87  ? 481 PHE A C     1 
ATOM   372  O O     . PHE A 1 56  ? 18.901  -5.352  -27.245 1.00 34.36  ? 481 PHE A O     1 
ATOM   373  C CB    . PHE A 1 56  ? 16.917  -3.354  -25.523 1.00 31.40  ? 481 PHE A CB    1 
ATOM   374  C CG    . PHE A 1 56  ? 18.096  -3.680  -24.630 1.00 31.42  ? 481 PHE A CG    1 
ATOM   375  C CD1   . PHE A 1 56  ? 19.144  -2.773  -24.471 1.00 33.15  ? 481 PHE A CD1   1 
ATOM   376  C CD2   . PHE A 1 56  ? 18.169  -4.910  -23.964 1.00 30.38  ? 481 PHE A CD2   1 
ATOM   377  C CE1   . PHE A 1 56  ? 20.252  -3.102  -23.690 1.00 33.83  ? 481 PHE A CE1   1 
ATOM   378  C CE2   . PHE A 1 56  ? 19.252  -5.222  -23.157 1.00 32.00  ? 481 PHE A CE2   1 
ATOM   379  C CZ    . PHE A 1 56  ? 20.294  -4.322  -23.024 1.00 32.58  ? 481 PHE A CZ    1 
ATOM   380  N N     . LEU A 1 57  ? 16.810  -6.137  -26.947 1.00 33.80  ? 482 LEU A N     1 
ATOM   381  C CA    . LEU A 1 57  ? 17.187  -7.563  -26.957 1.00 33.94  ? 482 LEU A CA    1 
ATOM   382  C C     . LEU A 1 57  ? 17.721  -8.054  -28.317 1.00 39.42  ? 482 LEU A C     1 
ATOM   383  O O     . LEU A 1 57  ? 18.562  -8.945  -28.349 1.00 37.00  ? 482 LEU A O     1 
ATOM   384  C CB    . LEU A 1 57  ? 16.067  -8.469  -26.404 1.00 33.65  ? 482 LEU A CB    1 
ATOM   385  C CG    . LEU A 1 57  ? 15.793  -8.275  -24.869 1.00 36.23  ? 482 LEU A CG    1 
ATOM   386  C CD1   . LEU A 1 57  ? 14.562  -9.035  -24.420 1.00 35.97  ? 482 LEU A CD1   1 
ATOM   387  C CD2   . LEU A 1 57  ? 17.028  -8.654  -24.006 1.00 36.47  ? 482 LEU A CD2   1 
ATOM   388  N N     . GLU A 1 58  ? 17.274  -7.439  -29.411 1.00 39.46  ? 483 GLU A N     1 
ATOM   389  C CA    . GLU A 1 58  ? 17.755  -7.750  -30.769 1.00 40.53  ? 483 GLU A CA    1 
ATOM   390  C C     . GLU A 1 58  ? 19.238  -7.339  -30.852 1.00 47.01  ? 483 GLU A C     1 
ATOM   391  O O     . GLU A 1 58  ? 20.081  -8.150  -31.245 1.00 47.47  ? 483 GLU A O     1 
ATOM   392  C CB    . GLU A 1 58  ? 16.936  -6.955  -31.812 1.00 42.46  ? 483 GLU A CB    1 
ATOM   393  C CG    . GLU A 1 58  ? 15.579  -7.547  -32.154 1.00 60.15  ? 483 GLU A CG    1 
ATOM   394  C CD    . GLU A 1 58  ? 14.628  -6.665  -32.953 1.00 86.86  ? 483 GLU A CD    1 
ATOM   395  O OE1   . GLU A 1 58  ? 15.091  -5.689  -33.591 1.00 82.06  ? 483 GLU A OE1   1 
ATOM   396  O OE2   . GLU A 1 58  ? 13.410  -6.963  -32.948 1.00 77.31  ? 483 GLU A OE2   1 
ATOM   397  N N     . LYS A 1 59  ? 19.556  -6.103  -30.385 1.00 43.13  ? 484 LYS A N     1 
ATOM   398  C CA    . LYS A 1 59  ? 20.910  -5.521  -30.412 1.00 42.53  ? 484 LYS A CA    1 
ATOM   399  C C     . LYS A 1 59  ? 21.848  -6.095  -29.343 1.00 46.64  ? 484 LYS A C     1 
ATOM   400  O O     . LYS A 1 59  ? 23.039  -6.285  -29.608 1.00 46.31  ? 484 LYS A O     1 
ATOM   401  C CB    . LYS A 1 59  ? 20.829  -3.998  -30.329 1.00 44.02  ? 484 LYS A CB    1 
ATOM   402  C CG    . LYS A 1 59  ? 22.065  -3.278  -30.853 1.00 63.31  ? 484 LYS A CG    1 
ATOM   403  C CD    . LYS A 1 59  ? 21.757  -1.816  -31.131 1.00 81.15  ? 484 LYS A CD    1 
ATOM   404  C CE    . LYS A 1 59  ? 22.961  -1.060  -31.643 1.00 93.18  ? 484 LYS A CE    1 
ATOM   405  N NZ    . LYS A 1 59  ? 22.619  0.346   -31.982 1.00 99.17  ? 484 LYS A NZ    1 
ATOM   406  N N     . TYR A 1 60  ? 21.302  -6.382  -28.135 1.00 40.84  ? 485 TYR A N     1 
ATOM   407  C CA    . TYR A 1 60  ? 22.051  -6.946  -27.009 1.00 39.25  ? 485 TYR A CA    1 
ATOM   408  C C     . TYR A 1 60  ? 21.338  -8.239  -26.537 1.00 41.64  ? 485 TYR A C     1 
ATOM   409  O O     . TYR A 1 60  ? 20.575  -8.210  -25.565 1.00 38.67  ? 485 TYR A O     1 
ATOM   410  C CB    . TYR A 1 60  ? 22.213  -5.884  -25.888 1.00 38.51  ? 485 TYR A CB    1 
ATOM   411  C CG    . TYR A 1 60  ? 22.695  -4.534  -26.387 1.00 37.51  ? 485 TYR A CG    1 
ATOM   412  C CD1   . TYR A 1 60  ? 21.797  -3.505  -26.648 1.00 38.98  ? 485 TYR A CD1   1 
ATOM   413  C CD2   . TYR A 1 60  ? 24.050  -4.293  -26.621 1.00 39.06  ? 485 TYR A CD2   1 
ATOM   414  C CE1   . TYR A 1 60  ? 22.234  -2.255  -27.093 1.00 38.38  ? 485 TYR A CE1   1 
ATOM   415  C CE2   . TYR A 1 60  ? 24.500  -3.045  -27.060 1.00 39.37  ? 485 TYR A CE2   1 
ATOM   416  C CZ    . TYR A 1 60  ? 23.587  -2.031  -27.297 1.00 44.98  ? 485 TYR A CZ    1 
ATOM   417  O OH    . TYR A 1 60  ? 24.016  -0.804  -27.735 1.00 46.01  ? 485 TYR A OH    1 
ATOM   418  N N     . PRO A 1 61  ? 21.555  -9.381  -27.245 1.00 39.14  ? 486 PRO A N     1 
ATOM   419  C CA    . PRO A 1 61  ? 20.820  -10.615 -26.905 1.00 38.55  ? 486 PRO A CA    1 
ATOM   420  C C     . PRO A 1 61  ? 21.172  -11.349 -25.629 1.00 39.69  ? 486 PRO A C     1 
ATOM   421  O O     . PRO A 1 61  ? 20.435  -12.269 -25.250 1.00 38.58  ? 486 PRO A O     1 
ATOM   422  C CB    . PRO A 1 61  ? 21.045  -11.504 -28.141 1.00 40.62  ? 486 PRO A CB    1 
ATOM   423  C CG    . PRO A 1 61  ? 22.391  -11.077 -28.647 1.00 44.82  ? 486 PRO A CG    1 
ATOM   424  C CD    . PRO A 1 61  ? 22.381  -9.580  -28.463 1.00 41.15  ? 486 PRO A CD    1 
ATOM   425  N N     . SER A 1 62  ? 22.288  -10.973 -24.969 1.00 34.08  ? 487 SER A N     1 
ATOM   426  C CA    . SER A 1 62  ? 22.751  -11.671 -23.788 1.00 32.52  ? 487 SER A CA    1 
ATOM   427  C C     . SER A 1 62  ? 23.525  -10.767 -22.846 1.00 33.91  ? 487 SER A C     1 
ATOM   428  O O     . SER A 1 62  ? 23.992  -9.703  -23.260 1.00 32.67  ? 487 SER A O     1 
ATOM   429  C CB    . SER A 1 62  ? 23.652  -12.838 -24.202 1.00 35.71  ? 487 SER A CB    1 
ATOM   430  O OG    . SER A 1 62  ? 24.891  -12.344 -24.689 1.00 36.46  ? 487 SER A OG    1 
ATOM   431  N N     . ALA A 1 63  ? 23.768  -11.268 -21.619 1.00 34.24  ? 488 ALA A N     1 
ATOM   432  C CA    . ALA A 1 63  ? 24.561  -10.563 -20.610 1.00 35.92  ? 488 ALA A CA    1 
ATOM   433  C C     . ALA A 1 63  ? 26.017  -10.434 -21.124 1.00 40.72  ? 488 ALA A C     1 
ATOM   434  O O     . ALA A 1 63  ? 26.636  -9.401  -20.917 1.00 37.59  ? 488 ALA A O     1 
ATOM   435  C CB    . ALA A 1 63  ? 24.523  -11.318 -19.302 1.00 36.62  ? 488 ALA A CB    1 
ATOM   436  N N     . GLU A 1 64  ? 26.518  -11.474 -21.845 1.00 39.89  ? 489 GLU A N     1 
ATOM   437  C CA    . GLU A 1 64  ? 27.860  -11.516 -22.457 1.00 40.46  ? 489 GLU A CA    1 
ATOM   438  C C     . GLU A 1 64  ? 28.103  -10.332 -23.407 1.00 47.68  ? 489 GLU A C     1 
ATOM   439  O O     . GLU A 1 64  ? 29.160  -9.708  -23.331 1.00 50.54  ? 489 GLU A O     1 
ATOM   440  C CB    . GLU A 1 64  ? 28.130  -12.892 -23.128 1.00 41.18  ? 489 GLU A CB    1 
ATOM   441  C CG    . GLU A 1 64  ? 28.137  -14.098 -22.187 1.00 39.76  ? 489 GLU A CG    1 
ATOM   442  C CD    . GLU A 1 64  ? 26.819  -14.713 -21.741 1.00 54.14  ? 489 GLU A CD    1 
ATOM   443  O OE1   . GLU A 1 64  ? 25.749  -14.161 -22.087 1.00 55.44  ? 489 GLU A OE1   1 
ATOM   444  O OE2   . GLU A 1 64  ? 26.852  -15.754 -21.043 1.00 44.66  ? 489 GLU A OE2   1 
ATOM   445  N N     . VAL A 1 65  ? 27.102  -9.951  -24.226 1.00 44.19  ? 490 VAL A N     1 
ATOM   446  C CA    . VAL A 1 65  ? 27.203  -8.810  -25.143 1.00 43.73  ? 490 VAL A CA    1 
ATOM   447  C C     . VAL A 1 65  ? 26.981  -7.513  -24.371 1.00 44.18  ? 490 VAL A C     1 
ATOM   448  O O     . VAL A 1 65  ? 27.736  -6.556  -24.540 1.00 41.46  ? 490 VAL A O     1 
ATOM   449  C CB    . VAL A 1 65  ? 26.192  -8.887  -26.322 1.00 48.98  ? 490 VAL A CB    1 
ATOM   450  C CG1   . VAL A 1 65  ? 26.387  -7.735  -27.309 1.00 49.49  ? 490 VAL A CG1   1 
ATOM   451  C CG2   . VAL A 1 65  ? 26.272  -10.216 -27.038 1.00 48.92  ? 490 VAL A CG2   1 
ATOM   452  N N     . ALA A 1 66  ? 25.916  -7.468  -23.545 1.00 39.42  ? 491 ALA A N     1 
ATOM   453  C CA    . ALA A 1 66  ? 25.565  -6.262  -22.805 1.00 37.71  ? 491 ALA A CA    1 
ATOM   454  C C     . ALA A 1 66  ? 26.713  -5.707  -21.948 1.00 37.36  ? 491 ALA A C     1 
ATOM   455  O O     . ALA A 1 66  ? 26.918  -4.499  -21.962 1.00 37.58  ? 491 ALA A O     1 
ATOM   456  C CB    . ALA A 1 66  ? 24.321  -6.512  -21.958 1.00 38.19  ? 491 ALA A CB    1 
ATOM   457  N N     . ARG A 1 67  ? 27.424  -6.572  -21.211 1.00 32.75  ? 492 ARG A N     1 
ATOM   458  C CA    . ARG A 1 67  ? 28.535  -6.181  -20.326 1.00 33.98  ? 492 ARG A CA    1 
ATOM   459  C C     . ARG A 1 67  ? 29.730  -5.524  -21.061 1.00 39.71  ? 492 ARG A C     1 
ATOM   460  O O     . ARG A 1 67  ? 30.534  -4.847  -20.421 1.00 39.06  ? 492 ARG A O     1 
ATOM   461  C CB    . ARG A 1 67  ? 28.990  -7.343  -19.421 1.00 33.27  ? 492 ARG A CB    1 
ATOM   462  C CG    . ARG A 1 67  ? 29.826  -8.439  -20.073 1.00 41.02  ? 492 ARG A CG    1 
ATOM   463  C CD    . ARG A 1 67  ? 30.399  -9.319  -18.978 1.00 45.94  ? 492 ARG A CD    1 
ATOM   464  N NE    . ARG A 1 67  ? 31.531  -10.110 -19.447 1.00 66.42  ? 492 ARG A NE    1 
ATOM   465  C CZ    . ARG A 1 67  ? 32.742  -10.107 -18.896 1.00 71.60  ? 492 ARG A CZ    1 
ATOM   466  N NH1   . ARG A 1 67  ? 32.992  -9.365  -17.825 1.00 53.96  ? 492 ARG A NH1   1 
ATOM   467  N NH2   . ARG A 1 67  ? 33.708  -10.850 -19.407 1.00 56.80  ? 492 ARG A NH2   1 
ATOM   468  N N     . THR A 1 68  ? 29.821  -5.719  -22.395 1.00 37.37  ? 493 THR A N     1 
ATOM   469  C CA    . THR A 1 68  ? 30.880  -5.168  -23.263 1.00 37.78  ? 493 THR A CA    1 
ATOM   470  C C     . THR A 1 68  ? 30.407  -3.887  -23.974 1.00 43.46  ? 493 THR A C     1 
ATOM   471  O O     . THR A 1 68  ? 31.186  -3.227  -24.673 1.00 43.38  ? 493 THR A O     1 
ATOM   472  C CB    . THR A 1 68  ? 31.339  -6.237  -24.311 1.00 40.21  ? 493 THR A CB    1 
ATOM   473  O OG1   . THR A 1 68  ? 30.285  -6.473  -25.247 1.00 39.40  ? 493 THR A OG1   1 
ATOM   474  C CG2   . THR A 1 68  ? 31.783  -7.552  -23.674 1.00 34.34  ? 493 THR A CG2   1 
ATOM   475  N N     . ALA A 1 69  ? 29.128  -3.543  -23.818 1.00 39.56  ? 494 ALA A N     1 
ATOM   476  C CA    . ALA A 1 69  ? 28.583  -2.352  -24.461 1.00 39.74  ? 494 ALA A CA    1 
ATOM   477  C C     . ALA A 1 69  ? 29.076  -1.053  -23.837 1.00 42.08  ? 494 ALA A C     1 
ATOM   478  O O     . ALA A 1 69  ? 29.446  -1.011  -22.657 1.00 41.28  ? 494 ALA A O     1 
ATOM   479  C CB    . ALA A 1 69  ? 27.056  -2.389  -24.425 1.00 40.34  ? 494 ALA A CB    1 
ATOM   480  N N     . ASP A 1 70  ? 29.044  0.019   -24.638 1.00 37.06  ? 495 ASP A N     1 
ATOM   481  C CA    . ASP A 1 70  ? 29.353  1.358   -24.184 1.00 36.32  ? 495 ASP A CA    1 
ATOM   482  C C     . ASP A 1 70  ? 27.991  1.883   -23.761 1.00 38.62  ? 495 ASP A C     1 
ATOM   483  O O     . ASP A 1 70  ? 27.069  1.899   -24.580 1.00 36.81  ? 495 ASP A O     1 
ATOM   484  C CB    . ASP A 1 70  ? 29.928  2.231   -25.336 1.00 38.06  ? 495 ASP A CB    1 
ATOM   485  C CG    . ASP A 1 70  ? 30.482  3.561   -24.866 1.00 44.12  ? 495 ASP A CG    1 
ATOM   486  O OD1   . ASP A 1 70  ? 29.718  4.348   -24.250 1.00 43.14  ? 495 ASP A OD1   1 
ATOM   487  O OD2   . ASP A 1 70  ? 31.667  3.828   -25.125 1.00 55.25  ? 495 ASP A OD2   1 
ATOM   488  N N     . TRP A 1 71  ? 27.846  2.259   -22.484 1.00 35.47  ? 496 TRP A N     1 
ATOM   489  C CA    . TRP A 1 71  ? 26.573  2.762   -21.970 1.00 35.55  ? 496 TRP A CA    1 
ATOM   490  C C     . TRP A 1 71  ? 25.996  3.919   -22.806 1.00 35.22  ? 496 TRP A C     1 
ATOM   491  O O     . TRP A 1 71  ? 24.791  4.064   -22.844 1.00 32.07  ? 496 TRP A O     1 
ATOM   492  C CB    . TRP A 1 71  ? 26.675  3.157   -20.487 1.00 34.62  ? 496 TRP A CB    1 
ATOM   493  C CG    . TRP A 1 71  ? 27.513  4.382   -20.239 1.00 36.40  ? 496 TRP A CG    1 
ATOM   494  C CD1   . TRP A 1 71  ? 28.832  4.417   -19.877 1.00 39.58  ? 496 TRP A CD1   1 
ATOM   495  C CD2   . TRP A 1 71  ? 27.054  5.747   -20.225 1.00 36.63  ? 496 TRP A CD2   1 
ATOM   496  N NE1   . TRP A 1 71  ? 29.230  5.724   -19.672 1.00 39.50  ? 496 TRP A NE1   1 
ATOM   497  C CE2   . TRP A 1 71  ? 28.161  6.559   -19.886 1.00 40.74  ? 496 TRP A CE2   1 
ATOM   498  C CE3   . TRP A 1 71  ? 25.819  6.367   -20.511 1.00 37.83  ? 496 TRP A CE3   1 
ATOM   499  C CZ2   . TRP A 1 71  ? 28.076  7.957   -19.839 1.00 40.37  ? 496 TRP A CZ2   1 
ATOM   500  C CZ3   . TRP A 1 71  ? 25.730  7.751   -20.441 1.00 39.55  ? 496 TRP A CZ3   1 
ATOM   501  C CH2   . TRP A 1 71  ? 26.850  8.532   -20.119 1.00 40.17  ? 496 TRP A CH2   1 
ATOM   502  N N     . ARG A 1 72  ? 26.864  4.798   -23.396 1.00 33.38  ? 497 ARG A N     1 
ATOM   503  C CA    . ARG A 1 72  ? 26.389  5.915   -24.222 1.00 33.43  ? 497 ARG A CA    1 
ATOM   504  C C     . ARG A 1 72  ? 25.600  5.428   -25.454 1.00 33.90  ? 497 ARG A C     1 
ATOM   505  O O     . ARG A 1 72  ? 24.626  6.078   -25.859 1.00 33.96  ? 497 ARG A O     1 
ATOM   506  C CB    . ARG A 1 72  ? 27.535  6.850   -24.604 1.00 34.21  ? 497 ARG A CB    1 
ATOM   507  C CG    . ARG A 1 72  ? 28.014  7.726   -23.453 1.00 43.17  ? 497 ARG A CG    1 
ATOM   508  C CD    . ARG A 1 72  ? 29.350  8.396   -23.760 1.00 43.32  ? 497 ARG A CD    1 
ATOM   509  N NE    . ARG A 1 72  ? 30.415  7.411   -23.908 1.00 42.49  ? 497 ARG A NE    1 
ATOM   510  C CZ    . ARG A 1 72  ? 31.669  7.697   -24.249 1.00 70.67  ? 497 ARG A CZ    1 
ATOM   511  N NH1   . ARG A 1 72  ? 32.035  8.956   -24.472 1.00 66.52  ? 497 ARG A NH1   1 
ATOM   512  N NH2   . ARG A 1 72  ? 32.566  6.729   -24.372 1.00 56.84  ? 497 ARG A NH2   1 
ATOM   513  N N     . ASP A 1 73  ? 25.980  4.272   -26.022 1.00 29.42  ? 498 ASP A N     1 
ATOM   514  C CA    . ASP A 1 73  ? 25.226  3.723   -27.148 1.00 28.56  ? 498 ASP A CA    1 
ATOM   515  C C     . ASP A 1 73  ? 23.908  3.128   -26.669 1.00 33.17  ? 498 ASP A C     1 
ATOM   516  O O     . ASP A 1 73  ? 22.880  3.325   -27.322 1.00 33.58  ? 498 ASP A O     1 
ATOM   517  C CB    . ASP A 1 73  ? 26.043  2.620   -27.856 1.00 30.00  ? 498 ASP A CB    1 
ATOM   518  C CG    . ASP A 1 73  ? 27.302  3.156   -28.521 1.00 41.85  ? 498 ASP A CG    1 
ATOM   519  O OD1   . ASP A 1 73  ? 27.287  4.333   -28.969 1.00 43.06  ? 498 ASP A OD1   1 
ATOM   520  O OD2   . ASP A 1 73  ? 28.288  2.404   -28.604 1.00 43.91  ? 498 ASP A OD2   1 
ATOM   521  N N     . VAL A 1 74  ? 23.919  2.445   -25.496 1.00 30.06  ? 499 VAL A N     1 
ATOM   522  C CA    . VAL A 1 74  ? 22.695  1.868   -24.891 1.00 29.19  ? 499 VAL A CA    1 
ATOM   523  C C     . VAL A 1 74  ? 21.707  3.013   -24.595 1.00 34.29  ? 499 VAL A C     1 
ATOM   524  O O     . VAL A 1 74  ? 20.518  2.903   -24.897 1.00 32.89  ? 499 VAL A O     1 
ATOM   525  C CB    . VAL A 1 74  ? 22.972  1.007   -23.611 1.00 32.11  ? 499 VAL A CB    1 
ATOM   526  C CG1   . VAL A 1 74  ? 21.667  0.554   -22.957 1.00 31.70  ? 499 VAL A CG1   1 
ATOM   527  C CG2   . VAL A 1 74  ? 23.849  -0.204  -23.913 1.00 31.49  ? 499 VAL A CG2   1 
ATOM   528  N N     . SER A 1 75  ? 22.225  4.125   -24.031 1.00 30.65  ? 500 SER A N     1 
ATOM   529  C CA    . SER A 1 75  ? 21.440  5.317   -23.719 1.00 32.01  ? 500 SER A CA    1 
ATOM   530  C C     . SER A 1 75  ? 20.638  5.869   -24.944 1.00 34.81  ? 500 SER A C     1 
ATOM   531  O O     . SER A 1 75  ? 19.525  6.398   -24.780 1.00 32.02  ? 500 SER A O     1 
ATOM   532  C CB    . SER A 1 75  ? 22.369  6.397   -23.172 1.00 33.55  ? 500 SER A CB    1 
ATOM   533  O OG    . SER A 1 75  ? 21.587  7.480   -22.699 1.00 43.71  ? 500 SER A OG    1 
ATOM   534  N N     . GLU A 1 76  ? 21.206  5.767   -26.173 1.00 32.79  ? 501 GLU A N     1 
ATOM   535  C CA    . GLU A 1 76  ? 20.519  6.323   -27.362 1.00 32.23  ? 501 GLU A CA    1 
ATOM   536  C C     . GLU A 1 76  ? 19.182  5.629   -27.641 1.00 36.91  ? 501 GLU A C     1 
ATOM   537  O O     . GLU A 1 76  ? 18.181  6.288   -27.918 1.00 37.57  ? 501 GLU A O     1 
ATOM   538  C CB    . GLU A 1 76  ? 21.426  6.286   -28.599 1.00 33.18  ? 501 GLU A CB    1 
ATOM   539  C CG    . GLU A 1 76  ? 22.546  7.308   -28.524 1.00 42.36  ? 501 GLU A CG    1 
ATOM   540  C CD    . GLU A 1 76  ? 22.103  8.756   -28.409 1.00 45.68  ? 501 GLU A CD    1 
ATOM   541  O OE1   . GLU A 1 76  ? 22.514  9.415   -27.428 1.00 43.54  ? 501 GLU A OE1   1 
ATOM   542  O OE2   . GLU A 1 76  ? 21.302  9.212   -29.258 1.00 45.98  ? 501 GLU A OE2   1 
ATOM   543  N N     . LEU A 1 77  ? 19.172  4.316   -27.469 1.00 34.79  ? 502 LEU A N     1 
ATOM   544  C CA    . LEU A 1 77  ? 18.018  3.414   -27.591 1.00 35.91  ? 502 LEU A CA    1 
ATOM   545  C C     . LEU A 1 77  ? 16.989  3.717   -26.481 1.00 39.50  ? 502 LEU A C     1 
ATOM   546  O O     . LEU A 1 77  ? 15.776  3.678   -26.727 1.00 39.07  ? 502 LEU A O     1 
ATOM   547  C CB    . LEU A 1 77  ? 18.574  1.991   -27.450 1.00 37.03  ? 502 LEU A CB    1 
ATOM   548  C CG    . LEU A 1 77  ? 17.710  0.810   -27.860 1.00 43.82  ? 502 LEU A CG    1 
ATOM   549  C CD1   . LEU A 1 77  ? 18.548  -0.237  -28.590 1.00 43.65  ? 502 LEU A CD1   1 
ATOM   550  C CD2   . LEU A 1 77  ? 17.089  0.159   -26.645 1.00 46.83  ? 502 LEU A CD2   1 
ATOM   551  N N     . LEU A 1 78  ? 17.477  4.037   -25.261 1.00 34.09  ? 503 LEU A N     1 
ATOM   552  C CA    . LEU A 1 78  ? 16.613  4.291   -24.107 1.00 33.27  ? 503 LEU A CA    1 
ATOM   553  C C     . LEU A 1 78  ? 16.008  5.679   -24.042 1.00 37.45  ? 503 LEU A C     1 
ATOM   554  O O     . LEU A 1 78  ? 15.147  5.930   -23.192 1.00 36.86  ? 503 LEU A O     1 
ATOM   555  C CB    . LEU A 1 78  ? 17.394  4.006   -22.797 1.00 33.47  ? 503 LEU A CB    1 
ATOM   556  C CG    . LEU A 1 78  ? 17.922  2.595   -22.536 1.00 38.29  ? 503 LEU A CG    1 
ATOM   557  C CD1   . LEU A 1 78  ? 18.447  2.500   -21.114 1.00 38.47  ? 503 LEU A CD1   1 
ATOM   558  C CD2   . LEU A 1 78  ? 16.839  1.544   -22.704 1.00 42.46  ? 503 LEU A CD2   1 
ATOM   559  N N     . LYS A 1 79  ? 16.474  6.604   -24.908 1.00 34.41  ? 504 LYS A N     1 
ATOM   560  C CA    . LYS A 1 79  ? 16.041  7.992   -24.930 1.00 34.83  ? 504 LYS A CA    1 
ATOM   561  C C     . LYS A 1 79  ? 14.551  8.278   -24.757 1.00 39.66  ? 504 LYS A C     1 
ATOM   562  O O     . LYS A 1 79  ? 14.221  9.085   -23.867 1.00 37.67  ? 504 LYS A O     1 
ATOM   563  C CB    . LYS A 1 79  ? 16.648  8.793   -26.114 1.00 37.94  ? 504 LYS A CB    1 
ATOM   564  C CG    . LYS A 1 79  ? 17.432  10.012  -25.649 1.00 49.25  ? 504 LYS A CG    1 
ATOM   565  C CD    . LYS A 1 79  ? 18.884  9.666   -25.469 1.00 57.60  ? 504 LYS A CD    1 
ATOM   566  C CE    . LYS A 1 79  ? 19.672  10.794  -24.900 1.00 61.50  ? 504 LYS A CE    1 
ATOM   567  N NZ    . LYS A 1 79  ? 21.115  10.472  -24.875 1.00 63.56  ? 504 LYS A NZ    1 
ATOM   568  N N     . PRO A 1 80  ? 13.632  7.666   -25.556 1.00 38.43  ? 505 PRO A N     1 
ATOM   569  C CA    . PRO A 1 80  ? 12.199  7.995   -25.392 1.00 37.78  ? 505 PRO A CA    1 
ATOM   570  C C     . PRO A 1 80  ? 11.558  7.499   -24.095 1.00 40.81  ? 505 PRO A C     1 
ATOM   571  O O     . PRO A 1 80  ? 10.460  7.954   -23.776 1.00 39.95  ? 505 PRO A O     1 
ATOM   572  C CB    . PRO A 1 80  ? 11.528  7.370   -26.626 1.00 39.60  ? 505 PRO A CB    1 
ATOM   573  C CG    . PRO A 1 80  ? 12.648  6.933   -27.525 1.00 44.51  ? 505 PRO A CG    1 
ATOM   574  C CD    . PRO A 1 80  ? 13.824  6.690   -26.650 1.00 40.06  ? 505 PRO A CD    1 
ATOM   575  N N     . LEU A 1 81  ? 12.244  6.627   -23.321 1.00 37.07  ? 506 LEU A N     1 
ATOM   576  C CA    . LEU A 1 81  ? 11.714  6.106   -22.044 1.00 35.77  ? 506 LEU A CA    1 
ATOM   577  C C     . LEU A 1 81  ? 12.074  6.949   -20.821 1.00 36.26  ? 506 LEU A C     1 
ATOM   578  O O     . LEU A 1 81  ? 11.550  6.679   -19.724 1.00 36.06  ? 506 LEU A O     1 
ATOM   579  C CB    . LEU A 1 81  ? 12.241  4.680   -21.804 1.00 35.74  ? 506 LEU A CB    1 
ATOM   580  C CG    . LEU A 1 81  ? 11.989  3.610   -22.883 1.00 39.65  ? 506 LEU A CG    1 
ATOM   581  C CD1   . LEU A 1 81  ? 12.544  2.277   -22.444 1.00 39.20  ? 506 LEU A CD1   1 
ATOM   582  C CD2   . LEU A 1 81  ? 10.495  3.462   -23.198 1.00 39.72  ? 506 LEU A CD2   1 
ATOM   583  N N     . GLY A 1 82  ? 13.040  7.871   -20.983 1.00 29.29  ? 507 GLY A N     1 
ATOM   584  C CA    . GLY A 1 82  ? 13.560  8.648   -19.871 1.00 27.68  ? 507 GLY A CA    1 
ATOM   585  C C     . GLY A 1 82  ? 14.513  7.776   -19.060 1.00 31.01  ? 507 GLY A C     1 
ATOM   586  O O     . GLY A 1 82  ? 14.721  6.604   -19.412 1.00 31.64  ? 507 GLY A O     1 
ATOM   587  N N     . LEU A 1 83  ? 15.192  8.364   -18.042 1.00 27.71  ? 508 LEU A N     1 
ATOM   588  C CA    . LEU A 1 83  ? 16.156  7.660   -17.172 1.00 27.56  ? 508 LEU A CA    1 
ATOM   589  C C     . LEU A 1 83  ? 17.134  6.819   -18.066 1.00 33.64  ? 508 LEU A C     1 
ATOM   590  O O     . LEU A 1 83  ? 17.428  5.657   -17.790 1.00 33.96  ? 508 LEU A O     1 
ATOM   591  C CB    . LEU A 1 83  ? 15.376  6.740   -16.190 1.00 26.84  ? 508 LEU A CB    1 
ATOM   592  C CG    . LEU A 1 83  ? 14.251  7.383   -15.341 1.00 30.08  ? 508 LEU A CG    1 
ATOM   593  C CD1   . LEU A 1 83  ? 13.602  6.325   -14.375 1.00 28.74  ? 508 LEU A CD1   1 
ATOM   594  C CD2   . LEU A 1 83  ? 14.775  8.558   -14.524 1.00 31.26  ? 508 LEU A CD2   1 
ATOM   595  N N     . TYR A 1 84  ? 17.564  7.415   -19.189 1.00 31.13  ? 509 TYR A N     1 
ATOM   596  C CA    . TYR A 1 84  ? 18.342  6.776   -20.235 1.00 29.63  ? 509 TYR A CA    1 
ATOM   597  C C     . TYR A 1 84  ? 19.811  6.613   -19.920 1.00 33.97  ? 509 TYR A C     1 
ATOM   598  O O     . TYR A 1 84  ? 20.395  5.638   -20.375 1.00 32.44  ? 509 TYR A O     1 
ATOM   599  C CB    . TYR A 1 84  ? 18.164  7.532   -21.599 1.00 31.01  ? 509 TYR A CB    1 
ATOM   600  C CG    . TYR A 1 84  ? 18.095  9.037   -21.462 1.00 33.69  ? 509 TYR A CG    1 
ATOM   601  C CD1   . TYR A 1 84  ? 19.258  9.803   -21.336 1.00 36.28  ? 509 TYR A CD1   1 
ATOM   602  C CD2   . TYR A 1 84  ? 16.872  9.707   -21.516 1.00 34.27  ? 509 TYR A CD2   1 
ATOM   603  C CE1   . TYR A 1 84  ? 19.201  11.188  -21.200 1.00 38.54  ? 509 TYR A CE1   1 
ATOM   604  C CE2   . TYR A 1 84  ? 16.804  11.093  -21.396 1.00 34.79  ? 509 TYR A CE2   1 
ATOM   605  C CZ    . TYR A 1 84  ? 17.971  11.829  -21.226 1.00 43.38  ? 509 TYR A CZ    1 
ATOM   606  O OH    . TYR A 1 84  ? 17.911  13.191  -21.062 1.00 40.00  ? 509 TYR A OH    1 
ATOM   607  N N     . ASP A 1 85  ? 20.437  7.583   -19.223 1.00 31.33  ? 510 ASP A N     1 
ATOM   608  C CA    . ASP A 1 85  ? 21.872  7.461   -18.909 1.00 31.49  ? 510 ASP A CA    1 
ATOM   609  C C     . ASP A 1 85  ? 21.983  6.553   -17.695 1.00 33.61  ? 510 ASP A C     1 
ATOM   610  O O     . ASP A 1 85  ? 22.834  5.687   -17.645 1.00 31.75  ? 510 ASP A O     1 
ATOM   611  C CB    . ASP A 1 85  ? 22.497  8.841   -18.609 1.00 33.22  ? 510 ASP A CB    1 
ATOM   612  C CG    . ASP A 1 85  ? 22.873  9.664   -19.849 1.00 41.37  ? 510 ASP A CG    1 
ATOM   613  O OD1   . ASP A 1 85  ? 22.823  9.115   -20.964 1.00 38.45  ? 510 ASP A OD1   1 
ATOM   614  O OD2   . ASP A 1 85  ? 23.269  10.835  -19.686 1.00 43.80  ? 510 ASP A OD2   1 
ATOM   615  N N     . LEU A 1 86  ? 21.116  6.785   -16.712 1.00 33.83  ? 511 LEU A N     1 
ATOM   616  C CA    . LEU A 1 86  ? 21.070  6.001   -15.484 1.00 34.01  ? 511 LEU A CA    1 
ATOM   617  C C     . LEU A 1 86  ? 20.906  4.523   -15.794 1.00 34.72  ? 511 LEU A C     1 
ATOM   618  O O     . LEU A 1 86  ? 21.756  3.720   -15.398 1.00 34.39  ? 511 LEU A O     1 
ATOM   619  C CB    . LEU A 1 86  ? 19.901  6.505   -14.628 1.00 34.29  ? 511 LEU A CB    1 
ATOM   620  C CG    . LEU A 1 86  ? 19.645  5.742   -13.329 1.00 38.64  ? 511 LEU A CG    1 
ATOM   621  C CD1   . LEU A 1 86  ? 20.709  6.057   -12.301 1.00 39.68  ? 511 LEU A CD1   1 
ATOM   622  C CD2   . LEU A 1 86  ? 18.283  6.086   -12.791 1.00 39.22  ? 511 LEU A CD2   1 
ATOM   623  N N     . ARG A 1 87  ? 19.858  4.167   -16.558 1.00 30.83  ? 512 ARG A N     1 
ATOM   624  C CA    . ARG A 1 87  ? 19.631  2.755   -16.864 1.00 30.34  ? 512 ARG A CA    1 
ATOM   625  C C     . ARG A 1 87  ? 20.600  2.157   -17.817 1.00 30.88  ? 512 ARG A C     1 
ATOM   626  O O     . ARG A 1 87  ? 20.864  0.973   -17.716 1.00 28.32  ? 512 ARG A O     1 
ATOM   627  C CB    . ARG A 1 87  ? 18.192  2.474   -17.264 1.00 28.95  ? 512 ARG A CB    1 
ATOM   628  C CG    . ARG A 1 87  ? 17.283  2.786   -16.097 1.00 36.10  ? 512 ARG A CG    1 
ATOM   629  C CD    . ARG A 1 87  ? 15.890  2.383   -16.408 1.00 34.69  ? 512 ARG A CD    1 
ATOM   630  N NE    . ARG A 1 87  ? 15.224  3.338   -17.300 1.00 37.10  ? 512 ARG A NE    1 
ATOM   631  C CZ    . ARG A 1 87  ? 13.955  3.208   -17.647 1.00 36.09  ? 512 ARG A CZ    1 
ATOM   632  N NH1   . ARG A 1 87  ? 13.260  2.149   -17.246 1.00 29.72  ? 512 ARG A NH1   1 
ATOM   633  N NH2   . ARG A 1 87  ? 13.380  4.109   -18.435 1.00 30.64  ? 512 ARG A NH2   1 
ATOM   634  N N     . ALA A 1 88  ? 21.200  2.958   -18.706 1.00 29.27  ? 513 ALA A N     1 
ATOM   635  C CA    . ALA A 1 88  ? 22.197  2.387   -19.612 1.00 28.75  ? 513 ALA A CA    1 
ATOM   636  C C     . ALA A 1 88  ? 23.420  1.937   -18.803 1.00 30.98  ? 513 ALA A C     1 
ATOM   637  O O     . ALA A 1 88  ? 23.912  0.828   -18.992 1.00 30.09  ? 513 ALA A O     1 
ATOM   638  C CB    . ALA A 1 88  ? 22.594  3.411   -20.661 1.00 30.22  ? 513 ALA A CB    1 
ATOM   639  N N     . LYS A 1 89  ? 23.885  2.781   -17.865 1.00 29.15  ? 514 LYS A N     1 
ATOM   640  C CA    . LYS A 1 89  ? 25.009  2.457   -16.970 1.00 29.44  ? 514 LYS A CA    1 
ATOM   641  C C     . LYS A 1 89  ? 24.615  1.250   -16.110 1.00 31.09  ? 514 LYS A C     1 
ATOM   642  O O     . LYS A 1 89  ? 25.419  0.340   -15.936 1.00 29.41  ? 514 LYS A O     1 
ATOM   643  C CB    . LYS A 1 89  ? 25.334  3.662   -16.059 1.00 31.35  ? 514 LYS A CB    1 
ATOM   644  C CG    . LYS A 1 89  ? 26.152  4.744   -16.770 1.00 36.77  ? 514 LYS A CG    1 
ATOM   645  C CD    . LYS A 1 89  ? 26.392  5.949   -15.869 1.00 41.70  ? 514 LYS A CD    1 
ATOM   646  C CE    . LYS A 1 89  ? 26.915  7.150   -16.617 1.00 47.62  ? 514 LYS A CE    1 
ATOM   647  N NZ    . LYS A 1 89  ? 27.321  8.236   -15.685 1.00 59.82  ? 514 LYS A NZ    1 
ATOM   648  N N     . THR A 1 90  ? 23.349  1.219   -15.628 1.00 27.47  ? 515 THR A N     1 
ATOM   649  C CA    . THR A 1 90  ? 22.864  0.095   -14.809 1.00 26.28  ? 515 THR A CA    1 
ATOM   650  C C     . THR A 1 90  ? 22.938  -1.230  -15.571 1.00 28.62  ? 515 THR A C     1 
ATOM   651  O O     . THR A 1 90  ? 23.399  -2.222  -15.013 1.00 28.09  ? 515 THR A O     1 
ATOM   652  C CB    . THR A 1 90  ? 21.436  0.371   -14.292 1.00 28.99  ? 515 THR A CB    1 
ATOM   653  O OG1   . THR A 1 90  ? 21.503  1.481   -13.418 1.00 31.25  ? 515 THR A OG1   1 
ATOM   654  C CG2   . THR A 1 90  ? 20.858  -0.816  -13.544 1.00 30.97  ? 515 THR A CG2   1 
ATOM   655  N N     . ILE A 1 91  ? 22.429  -1.241  -16.811 1.00 25.75  ? 516 ILE A N     1 
ATOM   656  C CA    . ILE A 1 91  ? 22.349  -2.433  -17.659 1.00 26.12  ? 516 ILE A CA    1 
ATOM   657  C C     . ILE A 1 91  ? 23.712  -3.044  -17.887 1.00 30.15  ? 516 ILE A C     1 
ATOM   658  O O     . ILE A 1 91  ? 23.862  -4.250  -17.762 1.00 27.58  ? 516 ILE A O     1 
ATOM   659  C CB    . ILE A 1 91  ? 21.590  -2.167  -18.961 1.00 29.73  ? 516 ILE A CB    1 
ATOM   660  C CG1   . ILE A 1 91  ? 20.072  -2.019  -18.674 1.00 30.46  ? 516 ILE A CG1   1 
ATOM   661  C CG2   . ILE A 1 91  ? 21.855  -3.294  -19.990 1.00 29.67  ? 516 ILE A CG2   1 
ATOM   662  C CD1   . ILE A 1 91  ? 19.283  -1.206  -19.818 1.00 33.98  ? 516 ILE A CD1   1 
ATOM   663  N N     . VAL A 1 92  ? 24.712  -2.210  -18.188 1.00 29.66  ? 517 VAL A N     1 
ATOM   664  C CA    . VAL A 1 92  ? 26.072  -2.699  -18.402 1.00 29.36  ? 517 VAL A CA    1 
ATOM   665  C C     . VAL A 1 92  ? 26.648  -3.314  -17.123 1.00 29.34  ? 517 VAL A C     1 
ATOM   666  O O     . VAL A 1 92  ? 27.120  -4.454  -17.150 1.00 29.04  ? 517 VAL A O     1 
ATOM   667  C CB    . VAL A 1 92  ? 26.961  -1.575  -19.019 1.00 32.48  ? 517 VAL A CB    1 
ATOM   668  C CG1   . VAL A 1 92  ? 28.444  -1.986  -19.048 1.00 34.23  ? 517 VAL A CG1   1 
ATOM   669  C CG2   . VAL A 1 92  ? 26.479  -1.220  -20.413 1.00 31.22  ? 517 VAL A CG2   1 
ATOM   670  N N     . LYS A 1 93  ? 26.574  -2.587  -15.999 1.00 26.98  ? 518 LYS A N     1 
ATOM   671  C CA    . LYS A 1 93  ? 27.080  -3.077  -14.697 1.00 26.54  ? 518 LYS A CA    1 
ATOM   672  C C     . LYS A 1 93  ? 26.337  -4.332  -14.192 1.00 28.27  ? 518 LYS A C     1 
ATOM   673  O O     . LYS A 1 93  ? 26.951  -5.298  -13.757 1.00 28.52  ? 518 LYS A O     1 
ATOM   674  C CB    . LYS A 1 93  ? 27.062  -1.951  -13.657 1.00 30.01  ? 518 LYS A CB    1 
ATOM   675  C CG    . LYS A 1 93  ? 27.622  -2.364  -12.285 1.00 39.50  ? 518 LYS A CG    1 
ATOM   676  C CD    . LYS A 1 93  ? 27.922  -1.132  -11.443 1.00 49.02  ? 518 LYS A CD    1 
ATOM   677  C CE    . LYS A 1 93  ? 28.529  -1.471  -10.100 1.00 58.91  ? 518 LYS A CE    1 
ATOM   678  N NZ    . LYS A 1 93  ? 28.813  -0.245  -9.304  1.00 68.99  ? 518 LYS A NZ    1 
ATOM   679  N N     . PHE A 1 94  ? 25.029  -4.313  -14.234 1.00 26.36  ? 519 PHE A N     1 
ATOM   680  C CA    . PHE A 1 94  ? 24.208  -5.470  -13.841 1.00 24.97  ? 519 PHE A CA    1 
ATOM   681  C C     . PHE A 1 94  ? 24.612  -6.721  -14.673 1.00 29.17  ? 519 PHE A C     1 
ATOM   682  O O     . PHE A 1 94  ? 24.785  -7.792  -14.110 1.00 28.36  ? 519 PHE A O     1 
ATOM   683  C CB    . PHE A 1 94  ? 22.695  -5.156  -14.055 1.00 26.75  ? 519 PHE A CB    1 
ATOM   684  C CG    . PHE A 1 94  ? 21.855  -6.400  -14.119 1.00 26.81  ? 519 PHE A CG    1 
ATOM   685  C CD1   . PHE A 1 94  ? 21.625  -7.161  -12.979 1.00 27.62  ? 519 PHE A CD1   1 
ATOM   686  C CD2   . PHE A 1 94  ? 21.272  -6.809  -15.320 1.00 26.81  ? 519 PHE A CD2   1 
ATOM   687  C CE1   . PHE A 1 94  ? 20.848  -8.320  -13.038 1.00 27.26  ? 519 PHE A CE1   1 
ATOM   688  C CE2   . PHE A 1 94  ? 20.514  -7.986  -15.378 1.00 28.08  ? 519 PHE A CE2   1 
ATOM   689  C CZ    . PHE A 1 94  ? 20.326  -8.742  -14.240 1.00 25.98  ? 519 PHE A CZ    1 
ATOM   690  N N     . SER A 1 95  ? 24.710  -6.586  -15.995 1.00 27.73  ? 520 SER A N     1 
ATOM   691  C CA    . SER A 1 95  ? 25.020  -7.724  -16.882 1.00 26.51  ? 520 SER A CA    1 
ATOM   692  C C     . SER A 1 95  ? 26.404  -8.283  -16.529 1.00 29.98  ? 520 SER A C     1 
ATOM   693  O O     . SER A 1 95  ? 26.573  -9.490  -16.447 1.00 30.39  ? 520 SER A O     1 
ATOM   694  C CB    . SER A 1 95  ? 24.950  -7.297  -18.339 1.00 25.61  ? 520 SER A CB    1 
ATOM   695  O OG    . SER A 1 95  ? 23.664  -6.787  -18.696 1.00 30.02  ? 520 SER A OG    1 
ATOM   696  N N     . ASP A 1 96  ? 27.348  -7.399  -16.187 1.00 30.30  ? 521 ASP A N     1 
ATOM   697  C CA    . ASP A 1 96  ? 28.697  -7.804  -15.755 1.00 30.84  ? 521 ASP A CA    1 
ATOM   698  C C     . ASP A 1 96  ? 28.604  -8.641  -14.467 1.00 35.44  ? 521 ASP A C     1 
ATOM   699  O O     . ASP A 1 96  ? 29.086  -9.777  -14.436 1.00 35.47  ? 521 ASP A O     1 
ATOM   700  C CB    . ASP A 1 96  ? 29.599  -6.561  -15.588 1.00 32.70  ? 521 ASP A CB    1 
ATOM   701  C CG    . ASP A 1 96  ? 31.053  -6.938  -15.282 1.00 47.48  ? 521 ASP A CG    1 
ATOM   702  O OD1   . ASP A 1 96  ? 31.571  -7.882  -15.927 1.00 47.08  ? 521 ASP A OD1   1 
ATOM   703  O OD2   . ASP A 1 96  ? 31.649  -6.321  -14.363 1.00 47.02  ? 521 ASP A OD2   1 
ATOM   704  N N     . GLU A 1 97  ? 27.889  -8.124  -13.438 1.00 31.05  ? 522 GLU A N     1 
ATOM   705  C CA    . GLU A 1 97  ? 27.686  -8.814  -12.161 1.00 31.27  ? 522 GLU A CA    1 
ATOM   706  C C     . GLU A 1 97  ? 26.895  -10.115 -12.289 1.00 33.45  ? 522 GLU A C     1 
ATOM   707  O O     . GLU A 1 97  ? 27.230  -11.112 -11.654 1.00 31.69  ? 522 GLU A O     1 
ATOM   708  C CB    . GLU A 1 97  ? 27.035  -7.881  -11.132 1.00 32.38  ? 522 GLU A CB    1 
ATOM   709  C CG    . GLU A 1 97  ? 27.912  -6.663  -10.823 1.00 34.46  ? 522 GLU A CG    1 
ATOM   710  C CD    . GLU A 1 97  ? 27.494  -5.823  -9.633  1.00 43.02  ? 522 GLU A CD    1 
ATOM   711  O OE1   . GLU A 1 97  ? 26.505  -6.188  -8.960  1.00 32.08  ? 522 GLU A OE1   1 
ATOM   712  O OE2   . GLU A 1 97  ? 28.151  -4.787  -9.379  1.00 33.92  ? 522 GLU A OE2   1 
ATOM   713  N N     . TYR A 1 98  ? 25.866  -10.121 -13.148 1.00 30.66  ? 523 TYR A N     1 
ATOM   714  C CA    . TYR A 1 98  ? 25.045  -11.315 -13.372 1.00 29.04  ? 523 TYR A CA    1 
ATOM   715  C C     . TYR A 1 98  ? 25.941  -12.528 -13.715 1.00 32.87  ? 523 TYR A C     1 
ATOM   716  O O     . TYR A 1 98  ? 25.709  -13.622 -13.215 1.00 31.72  ? 523 TYR A O     1 
ATOM   717  C CB    . TYR A 1 98  ? 24.042  -11.053 -14.535 1.00 29.91  ? 523 TYR A CB    1 
ATOM   718  C CG    . TYR A 1 98  ? 23.118  -12.214 -14.825 1.00 28.70  ? 523 TYR A CG    1 
ATOM   719  C CD1   . TYR A 1 98  ? 21.872  -12.310 -14.211 1.00 29.13  ? 523 TYR A CD1   1 
ATOM   720  C CD2   . TYR A 1 98  ? 23.465  -13.194 -15.756 1.00 31.00  ? 523 TYR A CD2   1 
ATOM   721  C CE1   . TYR A 1 98  ? 20.987  -13.339 -14.535 1.00 27.18  ? 523 TYR A CE1   1 
ATOM   722  C CE2   . TYR A 1 98  ? 22.623  -14.272 -16.020 1.00 31.02  ? 523 TYR A CE2   1 
ATOM   723  C CZ    . TYR A 1 98  ? 21.373  -14.323 -15.433 1.00 30.78  ? 523 TYR A CZ    1 
ATOM   724  O OH    . TYR A 1 98  ? 20.518  -15.345 -15.745 1.00 34.20  ? 523 TYR A OH    1 
ATOM   725  N N     . LEU A 1 99  ? 26.956  -12.306 -14.554 1.00 32.20  ? 524 LEU A N     1 
ATOM   726  C CA    . LEU A 1 99  ? 27.834  -13.355 -15.048 1.00 34.06  ? 524 LEU A CA    1 
ATOM   727  C C     . LEU A 1 99  ? 29.061  -13.629 -14.215 1.00 39.41  ? 524 LEU A C     1 
ATOM   728  O O     . LEU A 1 99  ? 29.555  -14.753 -14.257 1.00 40.24  ? 524 LEU A O     1 
ATOM   729  C CB    . LEU A 1 99  ? 28.323  -12.969 -16.458 1.00 34.63  ? 524 LEU A CB    1 
ATOM   730  C CG    . LEU A 1 99  ? 27.311  -12.964 -17.577 1.00 39.49  ? 524 LEU A CG    1 
ATOM   731  C CD1   . LEU A 1 99  ? 27.955  -12.449 -18.815 1.00 40.00  ? 524 LEU A CD1   1 
ATOM   732  C CD2   . LEU A 1 99  ? 26.727  -14.372 -17.819 1.00 41.21  ? 524 LEU A CD2   1 
ATOM   733  N N     . THR A 1 100 ? 29.620  -12.589 -13.566 1.00 35.33  ? 525 THR A N     1 
ATOM   734  C CA    . THR A 1 100 ? 30.910  -12.649 -12.869 1.00 36.05  ? 525 THR A CA    1 
ATOM   735  C C     . THR A 1 100 ? 30.828  -12.750 -11.367 1.00 43.00  ? 525 THR A C     1 
ATOM   736  O O     . THR A 1 100 ? 31.783  -13.232 -10.742 1.00 41.41  ? 525 THR A O     1 
ATOM   737  C CB    . THR A 1 100 ? 31.830  -11.501 -13.336 1.00 41.99  ? 525 THR A CB    1 
ATOM   738  O OG1   . THR A 1 100 ? 31.417  -10.255 -12.757 1.00 42.14  ? 525 THR A OG1   1 
ATOM   739  C CG2   . THR A 1 100 ? 31.893  -11.379 -14.863 1.00 43.93  ? 525 THR A CG2   1 
ATOM   740  N N     . LYS A 1 101 ? 29.719  -12.253 -10.770 1.00 40.92  ? 526 LYS A N     1 
ATOM   741  C CA    . LYS A 1 101 ? 29.534  -12.317 -9.327  1.00 41.76  ? 526 LYS A CA    1 
ATOM   742  C C     . LYS A 1 101 ? 28.815  -13.603 -8.947  1.00 45.31  ? 526 LYS A C     1 
ATOM   743  O O     . LYS A 1 101 ? 28.002  -14.112 -9.722  1.00 45.62  ? 526 LYS A O     1 
ATOM   744  C CB    . LYS A 1 101 ? 28.739  -11.089 -8.847  1.00 45.53  ? 526 LYS A CB    1 
ATOM   745  C CG    . LYS A 1 101 ? 28.861  -10.770 -7.364  1.00 59.08  ? 526 LYS A CG    1 
ATOM   746  C CD    . LYS A 1 101 ? 27.802  -9.768  -6.903  1.00 65.64  ? 526 LYS A CD    1 
ATOM   747  C CE    . LYS A 1 101 ? 27.957  -9.375  -5.446  1.00 75.34  ? 526 LYS A CE    1 
ATOM   748  N NZ    . LYS A 1 101 ? 27.654  -10.499 -4.508  1.00 83.14  ? 526 LYS A NZ    1 
ATOM   749  N N     . GLN A 1 102 ? 29.124  -14.159 -7.762  1.00 41.01  ? 527 GLN A N     1 
ATOM   750  C CA    . GLN A 1 102 ? 28.368  -15.315 -7.289  1.00 40.75  ? 527 GLN A CA    1 
ATOM   751  C C     . GLN A 1 102 ? 27.141  -14.755 -6.537  1.00 42.60  ? 527 GLN A C     1 
ATOM   752  O O     . GLN A 1 102 ? 27.274  -13.884 -5.661  1.00 41.92  ? 527 GLN A O     1 
ATOM   753  C CB    . GLN A 1 102 ? 29.201  -16.309 -6.440  1.00 42.74  ? 527 GLN A CB    1 
ATOM   754  C CG    . GLN A 1 102 ? 29.816  -15.740 -5.165  1.00 65.04  ? 527 GLN A CG    1 
ATOM   755  C CD    . GLN A 1 102 ? 30.252  -16.795 -4.167  1.00 83.77  ? 527 GLN A CD    1 
ATOM   756  O OE1   . GLN A 1 102 ? 30.386  -17.992 -4.475  1.00 78.72  ? 527 GLN A OE1   1 
ATOM   757  N NE2   . GLN A 1 102 ? 30.520  -16.358 -2.946  1.00 74.61  ? 527 GLN A NE2   1 
ATOM   758  N N     . TRP A 1 103 ? 25.940  -15.193 -6.953  1.00 36.67  ? 528 TRP A N     1 
ATOM   759  C CA    . TRP A 1 103 ? 24.692  -14.710 -6.381  1.00 34.50  ? 528 TRP A CA    1 
ATOM   760  C C     . TRP A 1 103 ? 23.696  -15.825 -6.323  1.00 35.71  ? 528 TRP A C     1 
ATOM   761  O O     . TRP A 1 103 ? 23.729  -16.716 -7.183  1.00 35.53  ? 528 TRP A O     1 
ATOM   762  C CB    . TRP A 1 103 ? 24.134  -13.514 -7.200  1.00 32.30  ? 528 TRP A CB    1 
ATOM   763  C CG    . TRP A 1 103 ? 23.853  -13.832 -8.654  1.00 32.26  ? 528 TRP A CG    1 
ATOM   764  C CD1   . TRP A 1 103 ? 24.727  -13.734 -9.699  1.00 34.53  ? 528 TRP A CD1   1 
ATOM   765  C CD2   . TRP A 1 103 ? 22.594  -14.226 -9.218  1.00 32.03  ? 528 TRP A CD2   1 
ATOM   766  N NE1   . TRP A 1 103 ? 24.110  -14.103 -10.872 1.00 34.15  ? 528 TRP A NE1   1 
ATOM   767  C CE2   . TRP A 1 103 ? 22.789  -14.380 -10.614 1.00 35.94  ? 528 TRP A CE2   1 
ATOM   768  C CE3   . TRP A 1 103 ? 21.313  -14.474 -8.678  1.00 33.20  ? 528 TRP A CE3   1 
ATOM   769  C CZ2   . TRP A 1 103 ? 21.754  -14.779 -11.478 1.00 35.08  ? 528 TRP A CZ2   1 
ATOM   770  C CZ3   . TRP A 1 103 ? 20.296  -14.901 -9.527  1.00 34.88  ? 528 TRP A CZ3   1 
ATOM   771  C CH2   . TRP A 1 103 ? 20.516  -15.029 -10.915 1.00 35.74  ? 528 TRP A CH2   1 
ATOM   772  N N     . LYS A 1 104 ? 22.806  -15.784 -5.317  1.00 32.31  ? 529 LYS A N     1 
ATOM   773  C CA    . LYS A 1 104 ? 21.700  -16.724 -5.168  1.00 33.30  ? 529 LYS A CA    1 
ATOM   774  C C     . LYS A 1 104 ? 20.394  -15.999 -5.562  1.00 35.11  ? 529 LYS A C     1 
ATOM   775  O O     . LYS A 1 104 ? 19.528  -16.614 -6.177  1.00 34.53  ? 529 LYS A O     1 
ATOM   776  C CB    . LYS A 1 104 ? 21.559  -17.267 -3.741  1.00 35.74  ? 529 LYS A CB    1 
ATOM   777  C CG    . LYS A 1 104 ? 20.613  -18.461 -3.698  1.00 47.75  ? 529 LYS A CG    1 
ATOM   778  C CD    . LYS A 1 104 ? 20.408  -19.025 -2.304  1.00 66.95  ? 529 LYS A CD    1 
ATOM   779  C CE    . LYS A 1 104 ? 19.204  -19.939 -2.226  1.00 79.85  ? 529 LYS A CE    1 
ATOM   780  N NZ    . LYS A 1 104 ? 19.346  -21.150 -3.079  1.00 93.08  ? 529 LYS A NZ    1 
ATOM   781  N N     . TYR A 1 105 ? 20.245  -14.727 -5.122  1.00 29.79  ? 530 TYR A N     1 
ATOM   782  C CA    . TYR A 1 105 ? 19.087  -13.879 -5.455  1.00 29.92  ? 530 TYR A CA    1 
ATOM   783  C C     . TYR A 1 105 ? 19.565  -12.644 -6.188  1.00 32.13  ? 530 TYR A C     1 
ATOM   784  O O     . TYR A 1 105 ? 20.613  -12.104 -5.821  1.00 34.32  ? 530 TYR A O     1 
ATOM   785  C CB    . TYR A 1 105 ? 18.250  -13.556 -4.203  1.00 31.04  ? 530 TYR A CB    1 
ATOM   786  C CG    . TYR A 1 105 ? 17.639  -14.828 -3.652  1.00 35.10  ? 530 TYR A CG    1 
ATOM   787  C CD1   . TYR A 1 105 ? 18.147  -15.422 -2.501  1.00 38.71  ? 530 TYR A CD1   1 
ATOM   788  C CD2   . TYR A 1 105 ? 16.709  -15.556 -4.398  1.00 35.17  ? 530 TYR A CD2   1 
ATOM   789  C CE1   . TYR A 1 105 ? 17.624  -16.618 -2.016  1.00 41.05  ? 530 TYR A CE1   1 
ATOM   790  C CE2   . TYR A 1 105 ? 16.190  -16.761 -3.934  1.00 36.27  ? 530 TYR A CE2   1 
ATOM   791  C CZ    . TYR A 1 105 ? 16.667  -17.299 -2.749  1.00 47.13  ? 530 TYR A CZ    1 
ATOM   792  O OH    . TYR A 1 105 ? 16.162  -18.479 -2.274  1.00 48.82  ? 530 TYR A OH    1 
ATOM   793  N N     . PRO A 1 106 ? 18.873  -12.203 -7.274  1.00 26.20  ? 531 PRO A N     1 
ATOM   794  C CA    . PRO A 1 106 ? 19.386  -11.057 -8.042  1.00 25.66  ? 531 PRO A CA    1 
ATOM   795  C C     . PRO A 1 106 ? 19.438  -9.705  -7.330  1.00 27.24  ? 531 PRO A C     1 
ATOM   796  O O     . PRO A 1 106 ? 20.118  -8.798  -7.820  1.00 28.56  ? 531 PRO A O     1 
ATOM   797  C CB    . PRO A 1 106 ? 18.522  -11.055 -9.311  1.00 25.89  ? 531 PRO A CB    1 
ATOM   798  C CG    . PRO A 1 106 ? 17.244  -11.632 -8.878  1.00 28.49  ? 531 PRO A CG    1 
ATOM   799  C CD    . PRO A 1 106 ? 17.604  -12.707 -7.845  1.00 26.26  ? 531 PRO A CD    1 
ATOM   800  N N     . ILE A 1 107 ? 18.750  -9.560  -6.191  1.00 25.44  ? 532 ILE A N     1 
ATOM   801  C CA    . ILE A 1 107 ? 18.840  -8.367  -5.346  1.00 25.28  ? 532 ILE A CA    1 
ATOM   802  C C     . ILE A 1 107 ? 20.314  -8.065  -4.972  1.00 27.88  ? 532 ILE A C     1 
ATOM   803  O O     . ILE A 1 107 ? 20.674  -6.923  -4.697  1.00 28.12  ? 532 ILE A O     1 
ATOM   804  C CB    . ILE A 1 107 ? 17.954  -8.471  -4.075  1.00 28.09  ? 532 ILE A CB    1 
ATOM   805  C CG1   . ILE A 1 107 ? 17.812  -7.087  -3.379  1.00 29.10  ? 532 ILE A CG1   1 
ATOM   806  C CG2   . ILE A 1 107 ? 18.433  -9.587  -3.095  1.00 29.36  ? 532 ILE A CG2   1 
ATOM   807  C CD1   . ILE A 1 107 ? 16.488  -6.878  -2.577  1.00 37.43  ? 532 ILE A CD1   1 
ATOM   808  N N     . GLU A 1 108 ? 21.164  -9.103  -4.965  1.00 27.75  ? 533 GLU A N     1 
ATOM   809  C CA    . GLU A 1 108 ? 22.591  -8.971  -4.656  1.00 28.15  ? 533 GLU A CA    1 
ATOM   810  C C     . GLU A 1 108 ? 23.340  -8.221  -5.739  1.00 33.05  ? 533 GLU A C     1 
ATOM   811  O O     . GLU A 1 108 ? 24.474  -7.807  -5.527  1.00 33.55  ? 533 GLU A O     1 
ATOM   812  C CB    . GLU A 1 108 ? 23.216  -10.366 -4.572  1.00 29.05  ? 533 GLU A CB    1 
ATOM   813  C CG    . GLU A 1 108 ? 22.634  -11.229 -3.462  1.00 33.19  ? 533 GLU A CG    1 
ATOM   814  C CD    . GLU A 1 108 ? 23.285  -12.595 -3.485  1.00 42.53  ? 533 GLU A CD    1 
ATOM   815  O OE1   . GLU A 1 108 ? 24.532  -12.650 -3.560  1.00 41.45  ? 533 GLU A OE1   1 
ATOM   816  O OE2   . GLU A 1 108 ? 22.550  -13.607 -3.490  1.00 34.62  ? 533 GLU A OE2   1 
ATOM   817  N N     . LEU A 1 109 ? 22.710  -8.080  -6.912  1.00 29.34  ? 534 LEU A N     1 
ATOM   818  C CA    . LEU A 1 109 ? 23.299  -7.473  -8.096  1.00 29.84  ? 534 LEU A CA    1 
ATOM   819  C C     . LEU A 1 109 ? 22.885  -6.022  -8.243  1.00 32.42  ? 534 LEU A C     1 
ATOM   820  O O     . LEU A 1 109 ? 21.757  -5.663  -7.932  1.00 28.92  ? 534 LEU A O     1 
ATOM   821  C CB    . LEU A 1 109 ? 22.875  -8.281  -9.349  1.00 29.62  ? 534 LEU A CB    1 
ATOM   822  C CG    . LEU A 1 109 ? 23.139  -9.794  -9.325  1.00 33.21  ? 534 LEU A CG    1 
ATOM   823  C CD1   . LEU A 1 109 ? 22.565  -10.471 -10.557 1.00 32.95  ? 534 LEU A CD1   1 
ATOM   824  C CD2   . LEU A 1 109 ? 24.632  -10.108 -9.202  1.00 33.10  ? 534 LEU A CD2   1 
ATOM   825  N N     . HIS A 1 110 ? 23.801  -5.189  -8.739  1.00 32.75  ? 535 HIS A N     1 
ATOM   826  C CA    . HIS A 1 110 ? 23.592  -3.762  -8.936  1.00 34.01  ? 535 HIS A CA    1 
ATOM   827  C C     . HIS A 1 110 ? 22.440  -3.539  -9.918  1.00 31.86  ? 535 HIS A C     1 
ATOM   828  O O     . HIS A 1 110 ? 22.449  -4.137  -11.000 1.00 30.88  ? 535 HIS A O     1 
ATOM   829  C CB    . HIS A 1 110 ? 24.884  -3.131  -9.488  1.00 36.11  ? 535 HIS A CB    1 
ATOM   830  C CG    . HIS A 1 110 ? 24.768  -1.664  -9.787  1.00 41.02  ? 535 HIS A CG    1 
ATOM   831  N ND1   . HIS A 1 110 ? 24.248  -1.204  -10.994 1.00 43.49  ? 535 HIS A ND1   1 
ATOM   832  C CD2   . HIS A 1 110 ? 25.111  -0.602  -9.029  1.00 42.75  ? 535 HIS A CD2   1 
ATOM   833  C CE1   . HIS A 1 110 ? 24.264  0.111   -10.909 1.00 42.44  ? 535 HIS A CE1   1 
ATOM   834  N NE2   . HIS A 1 110 ? 24.788  0.519   -9.757  1.00 43.10  ? 535 HIS A NE2   1 
ATOM   835  N N     . GLY A 1 111 ? 21.480  -2.681  -9.545  1.00 27.01  ? 536 GLY A N     1 
ATOM   836  C CA    . GLY A 1 111 ? 20.363  -2.347  -10.431 1.00 26.38  ? 536 GLY A CA    1 
ATOM   837  C C     . GLY A 1 111 ? 19.111  -3.184  -10.218 1.00 27.37  ? 536 GLY A C     1 
ATOM   838  O O     . GLY A 1 111 ? 18.040  -2.833  -10.726 1.00 28.96  ? 536 GLY A O     1 
ATOM   839  N N     . ILE A 1 112 ? 19.209  -4.240  -9.410  1.00 23.51  ? 537 ILE A N     1 
ATOM   840  C CA    . ILE A 1 112 ? 18.032  -5.059  -9.043  1.00 22.83  ? 537 ILE A CA    1 
ATOM   841  C C     . ILE A 1 112 ? 17.687  -4.820  -7.551  1.00 30.51  ? 537 ILE A C     1 
ATOM   842  O O     . ILE A 1 112 ? 18.526  -5.054  -6.689  1.00 29.94  ? 537 ILE A O     1 
ATOM   843  C CB    . ILE A 1 112 ? 18.252  -6.582  -9.318  1.00 26.18  ? 537 ILE A CB    1 
ATOM   844  C CG1   . ILE A 1 112 ? 18.540  -6.850  -10.820 1.00 25.53  ? 537 ILE A CG1   1 
ATOM   845  C CG2   . ILE A 1 112 ? 17.030  -7.444  -8.799  1.00 25.53  ? 537 ILE A CG2   1 
ATOM   846  C CD1   . ILE A 1 112 ? 17.506  -6.156  -11.789 1.00 25.56  ? 537 ILE A CD1   1 
ATOM   847  N N     . GLY A 1 113 ? 16.459  -4.392  -7.282  1.00 25.32  ? 538 GLY A N     1 
ATOM   848  C CA    . GLY A 1 113 ? 15.985  -4.172  -5.918  1.00 26.16  ? 538 GLY A CA    1 
ATOM   849  C C     . GLY A 1 113 ? 14.850  -5.119  -5.603  1.00 28.58  ? 538 GLY A C     1 
ATOM   850  O O     . GLY A 1 113 ? 14.718  -6.166  -6.237  1.00 27.55  ? 538 GLY A O     1 
ATOM   851  N N     . LYS A 1 114 ? 13.960  -4.713  -4.687  1.00 26.48  ? 539 LYS A N     1 
ATOM   852  C CA    . LYS A 1 114 ? 12.808  -5.562  -4.319  1.00 26.30  ? 539 LYS A CA    1 
ATOM   853  C C     . LYS A 1 114 ? 11.941  -6.011  -5.494  1.00 28.20  ? 539 LYS A C     1 
ATOM   854  O O     . LYS A 1 114 ? 11.495  -7.151  -5.500  1.00 26.20  ? 539 LYS A O     1 
ATOM   855  C CB    . LYS A 1 114 ? 11.926  -4.844  -3.292  1.00 30.89  ? 539 LYS A CB    1 
ATOM   856  C CG    . LYS A 1 114 ? 10.779  -5.703  -2.797  1.00 32.89  ? 539 LYS A CG    1 
ATOM   857  C CD    . LYS A 1 114 ? 10.080  -5.082  -1.588  1.00 33.07  ? 539 LYS A CD    1 
ATOM   858  C CE    . LYS A 1 114 ? 8.706   -5.717  -1.436  1.00 42.78  ? 539 LYS A CE    1 
ATOM   859  N NZ    . LYS A 1 114 ? 8.795   -7.203  -1.261  1.00 33.91  ? 539 LYS A NZ    1 
ATOM   860  N N     . TYR A 1 115 ? 11.619  -5.109  -6.436  1.00 26.26  ? 540 TYR A N     1 
ATOM   861  C CA    . TYR A 1 115 ? 10.723  -5.461  -7.557  1.00 25.55  ? 540 TYR A CA    1 
ATOM   862  C C     . TYR A 1 115 ? 11.306  -6.577  -8.459  1.00 25.73  ? 540 TYR A C     1 
ATOM   863  O O     . TYR A 1 115 ? 10.623  -7.571  -8.726  1.00 25.51  ? 540 TYR A O     1 
ATOM   864  C CB    . TYR A 1 115 ? 10.318  -4.207  -8.368  1.00 26.85  ? 540 TYR A CB    1 
ATOM   865  C CG    . TYR A 1 115 ? 9.601   -4.520  -9.666  1.00 28.40  ? 540 TYR A CG    1 
ATOM   866  C CD1   . TYR A 1 115 ? 8.419   -5.263  -9.674  1.00 30.46  ? 540 TYR A CD1   1 
ATOM   867  C CD2   . TYR A 1 115 ? 10.143  -4.145  -10.891 1.00 29.05  ? 540 TYR A CD2   1 
ATOM   868  C CE1   . TYR A 1 115 ? 7.775   -5.583  -10.865 1.00 29.77  ? 540 TYR A CE1   1 
ATOM   869  C CE2   . TYR A 1 115 ? 9.501   -4.449  -12.090 1.00 29.97  ? 540 TYR A CE2   1 
ATOM   870  C CZ    . TYR A 1 115 ? 8.319   -5.174  -12.069 1.00 35.52  ? 540 TYR A CZ    1 
ATOM   871  O OH    . TYR A 1 115 ? 7.670   -5.495  -13.239 1.00 38.10  ? 540 TYR A OH    1 
ATOM   872  N N     . GLY A 1 116 ? 12.543  -6.400  -8.906  1.00 25.42  ? 541 GLY A N     1 
ATOM   873  C CA    . GLY A 1 116 ? 13.216  -7.407  -9.720  1.00 24.94  ? 541 GLY A CA    1 
ATOM   874  C C     . GLY A 1 116 ? 13.398  -8.710  -8.948  1.00 26.90  ? 541 GLY A C     1 
ATOM   875  O O     . GLY A 1 116 ? 13.219  -9.813  -9.489  1.00 23.74  ? 541 GLY A O     1 
ATOM   876  N N     . ASN A 1 117 ? 13.747  -8.586  -7.652  1.00 23.85  ? 542 ASN A N     1 
ATOM   877  C CA    . ASN A 1 117 ? 13.928  -9.775  -6.812  1.00 22.95  ? 542 ASN A CA    1 
ATOM   878  C C     . ASN A 1 117 ? 12.619  -10.538 -6.595  1.00 24.97  ? 542 ASN A C     1 
ATOM   879  O O     . ASN A 1 117 ? 12.620  -11.755 -6.685  1.00 25.67  ? 542 ASN A O     1 
ATOM   880  C CB    . ASN A 1 117 ? 14.550  -9.394  -5.471  1.00 25.92  ? 542 ASN A CB    1 
ATOM   881  C CG    . ASN A 1 117 ? 15.285  -10.555 -4.850  1.00 32.29  ? 542 ASN A CG    1 
ATOM   882  O OD1   . ASN A 1 117 ? 16.206  -11.101 -5.444  1.00 25.75  ? 542 ASN A OD1   1 
ATOM   883  N ND2   . ASN A 1 117 ? 14.892  -10.938 -3.631  1.00 29.27  ? 542 ASN A ND2   1 
ATOM   884  N N     . ASP A 1 118 ? 11.503  -9.834  -6.292  1.00 24.26  ? 543 ASP A N     1 
ATOM   885  C CA    . ASP A 1 118 ? 10.167  -10.457 -6.120  1.00 23.50  ? 543 ASP A CA    1 
ATOM   886  C C     . ASP A 1 118 ? 9.768   -11.140 -7.457  1.00 26.19  ? 543 ASP A C     1 
ATOM   887  O O     . ASP A 1 118 ? 9.253   -12.260 -7.457  1.00 24.00  ? 543 ASP A O     1 
ATOM   888  C CB    . ASP A 1 118 ? 9.126   -9.386  -5.745  1.00 25.29  ? 543 ASP A CB    1 
ATOM   889  C CG    . ASP A 1 118 ? 9.208   -8.915  -4.294  1.00 29.79  ? 543 ASP A CG    1 
ATOM   890  O OD1   . ASP A 1 118 ? 9.952   -9.555  -3.493  1.00 29.58  ? 543 ASP A OD1   1 
ATOM   891  O OD2   . ASP A 1 118 ? 8.500   -7.958  -3.949  1.00 30.66  ? 543 ASP A OD2   1 
ATOM   892  N N     . SER A 1 119 ? 10.100  -10.501 -8.592  1.00 22.66  ? 544 SER A N     1 
ATOM   893  C CA    . SER A 1 119 ? 9.808   -11.058 -9.915  1.00 22.72  ? 544 SER A CA    1 
ATOM   894  C C     . SER A 1 119 ? 10.544  -12.407 -10.122 1.00 25.91  ? 544 SER A C     1 
ATOM   895  O O     . SER A 1 119 ? 9.949   -13.396 -10.569 1.00 26.26  ? 544 SER A O     1 
ATOM   896  C CB    . SER A 1 119 ? 10.215  -10.085 -11.013 1.00 23.40  ? 544 SER A CB    1 
ATOM   897  O OG    . SER A 1 119 ? 9.370   -8.950  -11.012 1.00 27.53  ? 544 SER A OG    1 
ATOM   898  N N     . TYR A 1 120 ? 11.826  -12.416 -9.806  1.00 24.56  ? 545 TYR A N     1 
ATOM   899  C CA    . TYR A 1 120 ? 12.693  -13.578 -9.933  1.00 23.46  ? 545 TYR A CA    1 
ATOM   900  C C     . TYR A 1 120 ? 12.158  -14.722 -9.037  1.00 26.91  ? 545 TYR A C     1 
ATOM   901  O O     . TYR A 1 120 ? 12.044  -15.861 -9.488  1.00 26.29  ? 545 TYR A O     1 
ATOM   902  C CB    . TYR A 1 120 ? 14.129  -13.187 -9.530  1.00 22.86  ? 545 TYR A CB    1 
ATOM   903  C CG    . TYR A 1 120 ? 15.098  -14.351 -9.549  1.00 22.84  ? 545 TYR A CG    1 
ATOM   904  C CD1   . TYR A 1 120 ? 15.784  -14.695 -10.712 1.00 26.21  ? 545 TYR A CD1   1 
ATOM   905  C CD2   . TYR A 1 120 ? 15.249  -15.176 -8.434  1.00 24.19  ? 545 TYR A CD2   1 
ATOM   906  C CE1   . TYR A 1 120 ? 16.656  -15.787 -10.740 1.00 27.55  ? 545 TYR A CE1   1 
ATOM   907  C CE2   . TYR A 1 120 ? 16.108  -16.273 -8.456  1.00 25.39  ? 545 TYR A CE2   1 
ATOM   908  C CZ    . TYR A 1 120 ? 16.783  -16.594 -9.617  1.00 32.08  ? 545 TYR A CZ    1 
ATOM   909  O OH    . TYR A 1 120 ? 17.631  -17.677 -9.619  1.00 33.09  ? 545 TYR A OH    1 
ATOM   910  N N     . ARG A 1 121 ? 11.799  -14.405 -7.797  1.00 25.65  ? 546 ARG A N     1 
ATOM   911  C CA    . ARG A 1 121 ? 11.331  -15.409 -6.808  1.00 25.10  ? 546 ARG A CA    1 
ATOM   912  C C     . ARG A 1 121 ? 9.960   -15.997 -7.117  1.00 28.33  ? 546 ARG A C     1 
ATOM   913  O O     . ARG A 1 121 ? 9.617   -17.057 -6.607  1.00 30.92  ? 546 ARG A O     1 
ATOM   914  C CB    . ARG A 1 121 ? 11.428  -14.833 -5.375  1.00 23.88  ? 546 ARG A CB    1 
ATOM   915  C CG    . ARG A 1 121 ? 12.846  -14.606 -4.927  1.00 26.79  ? 546 ARG A CG    1 
ATOM   916  C CD    . ARG A 1 121 ? 12.848  -14.000 -3.520  1.00 34.05  ? 546 ARG A CD    1 
ATOM   917  N NE    . ARG A 1 121 ? 12.535  -15.046 -2.540  1.00 48.93  ? 546 ARG A NE    1 
ATOM   918  C CZ    . ARG A 1 121 ? 11.952  -14.843 -1.363  1.00 61.76  ? 546 ARG A CZ    1 
ATOM   919  N NH1   . ARG A 1 121 ? 11.601  -13.616 -0.989  1.00 40.54  ? 546 ARG A NH1   1 
ATOM   920  N NH2   . ARG A 1 121 ? 11.719  -15.864 -0.548  1.00 51.59  ? 546 ARG A NH2   1 
ATOM   921  N N     . ILE A 1 122 ? 9.141   -15.294 -7.928  1.00 25.26  ? 547 ILE A N     1 
ATOM   922  C CA    . ILE A 1 122 ? 7.841   -15.812 -8.349  1.00 24.59  ? 547 ILE A CA    1 
ATOM   923  C C     . ILE A 1 122 ? 7.993   -16.624 -9.662  1.00 29.96  ? 547 ILE A C     1 
ATOM   924  O O     . ILE A 1 122 ? 7.329   -17.663 -9.836  1.00 29.01  ? 547 ILE A O     1 
ATOM   925  C CB    . ILE A 1 122 ? 6.800   -14.657 -8.540  1.00 26.22  ? 547 ILE A CB    1 
ATOM   926  C CG1   . ILE A 1 122 ? 6.442   -13.982 -7.192  1.00 27.63  ? 547 ILE A CG1   1 
ATOM   927  C CG2   . ILE A 1 122 ? 5.523   -15.177 -9.264  1.00 27.16  ? 547 ILE A CG2   1 
ATOM   928  C CD1   . ILE A 1 122 ? 5.637   -12.730 -7.307  1.00 30.85  ? 547 ILE A CD1   1 
ATOM   929  N N     . PHE A 1 123 ? 8.794   -16.106 -10.611 1.00 25.23  ? 548 PHE A N     1 
ATOM   930  C CA    . PHE A 1 123 ? 8.885   -16.688 -11.953 1.00 22.03  ? 548 PHE A CA    1 
ATOM   931  C C     . PHE A 1 123 ? 10.046  -17.623 -12.260 1.00 28.06  ? 548 PHE A C     1 
ATOM   932  O O     . PHE A 1 123 ? 9.860   -18.544 -13.067 1.00 28.67  ? 548 PHE A O     1 
ATOM   933  C CB    . PHE A 1 123 ? 8.860   -15.549 -13.014 1.00 22.99  ? 548 PHE A CB    1 
ATOM   934  C CG    . PHE A 1 123 ? 7.504   -14.864 -13.081 1.00 26.00  ? 548 PHE A CG    1 
ATOM   935  C CD1   . PHE A 1 123 ? 7.217   -13.767 -12.266 1.00 28.88  ? 548 PHE A CD1   1 
ATOM   936  C CD2   . PHE A 1 123 ? 6.490   -15.371 -13.886 1.00 28.80  ? 548 PHE A CD2   1 
ATOM   937  C CE1   . PHE A 1 123 ? 5.968   -13.131 -12.337 1.00 29.39  ? 548 PHE A CE1   1 
ATOM   938  C CE2   . PHE A 1 123 ? 5.240   -14.748 -13.939 1.00 29.91  ? 548 PHE A CE2   1 
ATOM   939  C CZ    . PHE A 1 123 ? 4.987   -13.644 -13.147 1.00 28.74  ? 548 PHE A CZ    1 
ATOM   940  N N     . CYS A 1 124 ? 11.252  -17.322 -11.750 1.00 26.32  ? 549 CYS A N     1 
ATOM   941  C CA    . CYS A 1 124 ? 12.468  -18.092 -12.070 1.00 26.85  ? 549 CYS A CA    1 
ATOM   942  C C     . CYS A 1 124 ? 12.760  -19.253 -11.142 1.00 34.77  ? 549 CYS A C     1 
ATOM   943  O O     . CYS A 1 124 ? 13.484  -20.180 -11.533 1.00 33.71  ? 549 CYS A O     1 
ATOM   944  C CB    . CYS A 1 124 ? 13.676  -17.173 -12.206 1.00 26.79  ? 549 CYS A CB    1 
ATOM   945  S SG    . CYS A 1 124 ? 13.482  -15.902 -13.479 1.00 30.22  ? 549 CYS A SG    1 
ATOM   946  N N     . VAL A 1 125 ? 12.252  -19.169 -9.919  1.00 31.69  ? 550 VAL A N     1 
ATOM   947  C CA    . VAL A 1 125 ? 12.374  -20.196 -8.862  1.00 31.59  ? 550 VAL A CA    1 
ATOM   948  C C     . VAL A 1 125 ? 10.983  -20.403 -8.242  1.00 37.26  ? 550 VAL A C     1 
ATOM   949  O O     . VAL A 1 125 ? 10.113  -19.541 -8.390  1.00 34.75  ? 550 VAL A O     1 
ATOM   950  C CB    . VAL A 1 125 ? 13.509  -19.942 -7.817  1.00 34.33  ? 550 VAL A CB    1 
ATOM   951  C CG1   . VAL A 1 125 ? 14.893  -20.061 -8.449  1.00 34.35  ? 550 VAL A CG1   1 
ATOM   952  C CG2   . VAL A 1 125 ? 13.349  -18.607 -7.073  1.00 33.12  ? 550 VAL A CG2   1 
ATOM   953  N N     . ASN A 1 126 ? 10.753  -21.550 -7.581  1.00 37.32  ? 551 ASN A N     1 
ATOM   954  C CA    . ASN A 1 126 ? 9.447   -21.870 -6.994  1.00 37.57  ? 551 ASN A CA    1 
ATOM   955  C C     . ASN A 1 126 ? 9.287   -21.280 -5.579  1.00 40.59  ? 551 ASN A C     1 
ATOM   956  O O     . ASN A 1 126 ? 9.037   -22.022 -4.625  1.00 43.22  ? 551 ASN A O     1 
ATOM   957  C CB    . ASN A 1 126 ? 9.193   -23.394 -7.033  1.00 40.89  ? 551 ASN A CB    1 
ATOM   958  C CG    . ASN A 1 126 ? 7.765   -23.823 -6.759  1.00 67.08  ? 551 ASN A CG    1 
ATOM   959  O OD1   . ASN A 1 126 ? 6.882   -23.020 -6.440  1.00 58.55  ? 551 ASN A OD1   1 
ATOM   960  N ND2   . ASN A 1 126 ? 7.519   -25.122 -6.832  1.00 65.99  ? 551 ASN A ND2   1 
ATOM   961  N N     . GLU A 1 127 ? 9.406   -19.944 -5.438  1.00 33.17  ? 552 GLU A N     1 
ATOM   962  C CA    . GLU A 1 127 ? 9.300   -19.306 -4.111  1.00 31.16  ? 552 GLU A CA    1 
ATOM   963  C C     . GLU A 1 127 ? 8.143   -18.333 -3.950  1.00 34.99  ? 552 GLU A C     1 
ATOM   964  O O     . GLU A 1 127 ? 8.126   -17.578 -2.973  1.00 34.07  ? 552 GLU A O     1 
ATOM   965  C CB    . GLU A 1 127 ? 10.625  -18.598 -3.773  1.00 31.92  ? 552 GLU A CB    1 
ATOM   966  C CG    . GLU A 1 127 ? 11.770  -19.545 -3.487  1.00 33.52  ? 552 GLU A CG    1 
ATOM   967  C CD    . GLU A 1 127 ? 13.086  -18.887 -3.146  1.00 43.62  ? 552 GLU A CD    1 
ATOM   968  O OE1   . GLU A 1 127 ? 13.086  -17.763 -2.594  1.00 41.69  ? 552 GLU A OE1   1 
ATOM   969  O OE2   . GLU A 1 127 ? 14.130  -19.511 -3.427  1.00 44.67  ? 552 GLU A OE2   1 
ATOM   970  N N     . TRP A 1 128 ? 7.178   -18.350 -4.882  1.00 30.55  ? 553 TRP A N     1 
ATOM   971  C CA    . TRP A 1 128 ? 6.042   -17.431 -4.908  1.00 31.38  ? 553 TRP A CA    1 
ATOM   972  C C     . TRP A 1 128 ? 5.278   -17.322 -3.592  1.00 34.76  ? 553 TRP A C     1 
ATOM   973  O O     . TRP A 1 128 ? 4.837   -16.230 -3.230  1.00 33.90  ? 553 TRP A O     1 
ATOM   974  C CB    . TRP A 1 128 ? 5.102   -17.749 -6.076  1.00 31.62  ? 553 TRP A CB    1 
ATOM   975  C CG    . TRP A 1 128 ? 4.293   -19.007 -5.939  1.00 33.61  ? 553 TRP A CG    1 
ATOM   976  C CD1   . TRP A 1 128 ? 4.615   -20.246 -6.411  1.00 36.84  ? 553 TRP A CD1   1 
ATOM   977  C CD2   . TRP A 1 128 ? 2.988   -19.125 -5.347  1.00 33.86  ? 553 TRP A CD2   1 
ATOM   978  N NE1   . TRP A 1 128 ? 3.586   -21.133 -6.152  1.00 36.32  ? 553 TRP A NE1   1 
ATOM   979  C CE2   . TRP A 1 128 ? 2.569   -20.466 -5.514  1.00 38.18  ? 553 TRP A CE2   1 
ATOM   980  C CE3   . TRP A 1 128 ? 2.113   -18.212 -4.714  1.00 35.55  ? 553 TRP A CE3   1 
ATOM   981  C CZ2   . TRP A 1 128 ? 1.340   -20.935 -5.018  1.00 37.80  ? 553 TRP A CZ2   1 
ATOM   982  C CZ3   . TRP A 1 128 ? 0.890   -18.675 -4.236  1.00 36.79  ? 553 TRP A CZ3   1 
ATOM   983  C CH2   . TRP A 1 128 ? 0.508   -20.018 -4.407  1.00 37.46  ? 553 TRP A CH2   1 
ATOM   984  N N     . LYS A 1 129 ? 5.182   -18.445 -2.835  1.00 32.67  ? 554 LYS A N     1 
ATOM   985  C CA    . LYS A 1 129 ? 4.458   -18.448 -1.565  1.00 34.21  ? 554 LYS A CA    1 
ATOM   986  C C     . LYS A 1 129 ? 5.104   -17.572 -0.493  1.00 39.79  ? 554 LYS A C     1 
ATOM   987  O O     . LYS A 1 129 ? 4.404   -17.082 0.392   1.00 40.37  ? 554 LYS A O     1 
ATOM   988  C CB    . LYS A 1 129 ? 4.269   -19.892 -1.065  1.00 35.95  ? 554 LYS A CB    1 
ATOM   989  C CG    . LYS A 1 129 ? 3.227   -20.659 -1.854  1.00 39.54  ? 554 LYS A CG    1 
ATOM   990  C CD    . LYS A 1 129 ? 2.990   -22.031 -1.233  1.00 45.47  ? 554 LYS A CD    1 
ATOM   991  C CE    . LYS A 1 129 ? 1.995   -22.843 -2.032  1.00 54.81  ? 554 LYS A CE    1 
ATOM   992  N NZ    . LYS A 1 129 ? 1.763   -24.185 -1.426  1.00 66.92  ? 554 LYS A NZ    1 
ATOM   993  N N     . GLN A 1 130 ? 6.424   -17.346 -0.606  1.00 35.64  ? 555 GLN A N     1 
ATOM   994  C CA    . GLN A 1 130 ? 7.257   -16.564 0.325   1.00 34.96  ? 555 GLN A CA    1 
ATOM   995  C C     . GLN A 1 130 ? 7.365   -15.077 -0.037  1.00 37.51  ? 555 GLN A C     1 
ATOM   996  O O     . GLN A 1 130 ? 7.858   -14.272 0.757   1.00 38.36  ? 555 GLN A O     1 
ATOM   997  C CB    . GLN A 1 130 ? 8.672   -17.155 0.338   1.00 35.69  ? 555 GLN A CB    1 
ATOM   998  C CG    . GLN A 1 130 ? 8.806   -18.512 1.016   1.00 47.44  ? 555 GLN A CG    1 
ATOM   999  C CD    . GLN A 1 130 ? 10.176  -19.073 0.758   1.00 61.81  ? 555 GLN A CD    1 
ATOM   1000 O OE1   . GLN A 1 130 ? 11.177  -18.582 1.282   1.00 65.81  ? 555 GLN A OE1   1 
ATOM   1001 N NE2   . GLN A 1 130 ? 10.261  -20.075 -0.102  1.00 46.50  ? 555 GLN A NE2   1 
ATOM   1002 N N     . VAL A 1 131 ? 6.883   -14.705 -1.210  1.00 33.08  ? 556 VAL A N     1 
ATOM   1003 C CA    . VAL A 1 131 ? 6.993   -13.337 -1.734  1.00 31.77  ? 556 VAL A CA    1 
ATOM   1004 C C     . VAL A 1 131 ? 5.819   -12.446 -1.321  1.00 34.71  ? 556 VAL A C     1 
ATOM   1005 O O     . VAL A 1 131 ? 4.675   -12.877 -1.390  1.00 33.93  ? 556 VAL A O     1 
ATOM   1006 C CB    . VAL A 1 131 ? 7.144   -13.431 -3.284  1.00 33.75  ? 556 VAL A CB    1 
ATOM   1007 C CG1   . VAL A 1 131 ? 7.222   -12.055 -3.934  1.00 33.72  ? 556 VAL A CG1   1 
ATOM   1008 C CG2   . VAL A 1 131 ? 8.349   -14.287 -3.657  1.00 32.53  ? 556 VAL A CG2   1 
ATOM   1009 N N     . HIS A 1 132 ? 6.101   -11.167 -0.958  1.00 31.64  ? 557 HIS A N     1 
ATOM   1010 C CA    . HIS A 1 132 ? 5.074   -10.171 -0.622  1.00 31.92  ? 557 HIS A CA    1 
ATOM   1011 C C     . HIS A 1 132 ? 5.333   -8.949  -1.479  1.00 35.02  ? 557 HIS A C     1 
ATOM   1012 O O     . HIS A 1 132 ? 6.063   -8.051  -1.049  1.00 35.68  ? 557 HIS A O     1 
ATOM   1013 C CB    . HIS A 1 132 ? 5.115   -9.811  0.871   1.00 33.56  ? 557 HIS A CB    1 
ATOM   1014 C CG    . HIS A 1 132 ? 5.312   -11.009 1.727   1.00 37.09  ? 557 HIS A CG    1 
ATOM   1015 N ND1   . HIS A 1 132 ? 6.508   -11.241 2.360   1.00 38.92  ? 557 HIS A ND1   1 
ATOM   1016 C CD2   . HIS A 1 132 ? 4.487   -12.062 1.936   1.00 38.65  ? 557 HIS A CD2   1 
ATOM   1017 C CE1   . HIS A 1 132 ? 6.356   -12.392 2.986   1.00 38.45  ? 557 HIS A CE1   1 
ATOM   1018 N NE2   . HIS A 1 132 ? 5.167   -12.936 2.731   1.00 38.30  ? 557 HIS A NE2   1 
ATOM   1019 N N     . PRO A 1 133 ? 4.840   -8.954  -2.729  1.00 32.46  ? 558 PRO A N     1 
ATOM   1020 C CA    . PRO A 1 133 ? 5.133   -7.825  -3.626  1.00 32.61  ? 558 PRO A CA    1 
ATOM   1021 C C     . PRO A 1 133 ? 4.476   -6.504  -3.227  1.00 39.79  ? 558 PRO A C     1 
ATOM   1022 O O     . PRO A 1 133 ? 3.412   -6.490  -2.596  1.00 38.02  ? 558 PRO A O     1 
ATOM   1023 C CB    . PRO A 1 133 ? 4.657   -8.294  -5.001  1.00 33.83  ? 558 PRO A CB    1 
ATOM   1024 C CG    . PRO A 1 133 ? 4.114   -9.694  -4.825  1.00 38.01  ? 558 PRO A CG    1 
ATOM   1025 C CD    . PRO A 1 133 ? 3.960   -9.959  -3.367  1.00 33.85  ? 558 PRO A CD    1 
ATOM   1026 N N     . GLU A 1 134 ? 5.117   -5.397  -3.607  1.00 37.44  ? 559 GLU A N     1 
ATOM   1027 C CA    . GLU A 1 134 ? 4.569   -4.061  -3.379  1.00 39.11  ? 559 GLU A CA    1 
ATOM   1028 C C     . GLU A 1 134 ? 4.082   -3.508  -4.731  1.00 46.81  ? 559 GLU A C     1 
ATOM   1029 O O     . GLU A 1 134 ? 3.275   -2.587  -4.776  1.00 49.22  ? 559 GLU A O     1 
ATOM   1030 C CB    . GLU A 1 134 ? 5.616   -3.142  -2.722  1.00 40.52  ? 559 GLU A CB    1 
ATOM   1031 C CG    . GLU A 1 134 ? 5.834   -3.442  -1.250  1.00 55.42  ? 559 GLU A CG    1 
ATOM   1032 C CD    . GLU A 1 134 ? 4.774   -2.953  -0.276  1.00 96.74  ? 559 GLU A CD    1 
ATOM   1033 O OE1   . GLU A 1 134 ? 4.076   -1.959  -0.588  1.00 102.45 ? 559 GLU A OE1   1 
ATOM   1034 O OE2   . GLU A 1 134 ? 4.673   -3.543  0.825   1.00 96.68  ? 559 GLU A OE2   1 
ATOM   1035 N N     . ASP A 1 135 ? 4.541   -4.110  -5.824  1.00 42.42  ? 560 ASP A N     1 
ATOM   1036 C CA    . ASP A 1 135 ? 4.193   -3.706  -7.184  1.00 41.32  ? 560 ASP A CA    1 
ATOM   1037 C C     . ASP A 1 135 ? 2.791   -4.177  -7.509  1.00 46.54  ? 560 ASP A C     1 
ATOM   1038 O O     . ASP A 1 135 ? 2.439   -5.318  -7.186  1.00 45.55  ? 560 ASP A O     1 
ATOM   1039 C CB    . ASP A 1 135 ? 5.223   -4.263  -8.184  1.00 41.30  ? 560 ASP A CB    1 
ATOM   1040 C CG    . ASP A 1 135 ? 4.874   -3.968  -9.620  1.00 41.31  ? 560 ASP A CG    1 
ATOM   1041 O OD1   . ASP A 1 135 ? 5.231   -2.860  -10.106 1.00 41.80  ? 560 ASP A OD1   1 
ATOM   1042 O OD2   . ASP A 1 135 ? 4.219   -4.824  -10.256 1.00 37.45  ? 560 ASP A OD2   1 
ATOM   1043 N N     . HIS A 1 136 ? 1.994   -3.289  -8.131  1.00 45.83  ? 561 HIS A N     1 
ATOM   1044 C CA    . HIS A 1 136 ? 0.593   -3.537  -8.497  1.00 47.32  ? 561 HIS A CA    1 
ATOM   1045 C C     . HIS A 1 136 ? 0.372   -4.769  -9.372  1.00 45.54  ? 561 HIS A C     1 
ATOM   1046 O O     . HIS A 1 136 ? -0.398  -5.636  -8.967  1.00 43.87  ? 561 HIS A O     1 
ATOM   1047 C CB    . HIS A 1 136 ? -0.069  -2.271  -9.088  1.00 50.09  ? 561 HIS A CB    1 
ATOM   1048 C CG    . HIS A 1 136 ? -1.493  -2.465  -9.524  1.00 55.43  ? 561 HIS A CG    1 
ATOM   1049 N ND1   . HIS A 1 136 ? -2.548  -2.339  -8.629  1.00 58.16  ? 561 HIS A ND1   1 
ATOM   1050 C CD2   . HIS A 1 136 ? -1.989  -2.785  -10.744 1.00 58.48  ? 561 HIS A CD2   1 
ATOM   1051 C CE1   . HIS A 1 136 ? -3.646  -2.575  -9.333  1.00 58.08  ? 561 HIS A CE1   1 
ATOM   1052 N NE2   . HIS A 1 136 ? -3.360  -2.851  -10.611 1.00 58.60  ? 561 HIS A NE2   1 
ATOM   1053 N N     . LYS A 1 137 ? 1.014   -4.855  -10.563 1.00 41.14  ? 562 LYS A N     1 
ATOM   1054 C CA    . LYS A 1 137 ? 0.799   -6.010  -11.464 1.00 40.84  ? 562 LYS A CA    1 
ATOM   1055 C C     . LYS A 1 137 ? 1.269   -7.331  -10.834 1.00 40.11  ? 562 LYS A C     1 
ATOM   1056 O O     . LYS A 1 137 ? 0.593   -8.356  -10.971 1.00 37.10  ? 562 LYS A O     1 
ATOM   1057 C CB    . LYS A 1 137 ? 1.452   -5.817  -12.840 1.00 43.90  ? 562 LYS A CB    1 
ATOM   1058 C CG    . LYS A 1 137 ? 0.731   -4.843  -13.747 1.00 58.81  ? 562 LYS A CG    1 
ATOM   1059 C CD    . LYS A 1 137 ? 1.553   -4.514  -15.005 1.00 70.78  ? 562 LYS A CD    1 
ATOM   1060 C CE    . LYS A 1 137 ? 2.654   -3.489  -14.768 1.00 78.82  ? 562 LYS A CE    1 
ATOM   1061 N NZ    . LYS A 1 137 ? 3.207   -2.958  -16.045 1.00 84.12  ? 562 LYS A NZ    1 
ATOM   1062 N N     . LEU A 1 138 ? 2.424   -7.297  -10.137 1.00 36.82  ? 563 LEU A N     1 
ATOM   1063 C CA    . LEU A 1 138 ? 2.969   -8.461  -9.444  1.00 35.34  ? 563 LEU A CA    1 
ATOM   1064 C C     . LEU A 1 138 ? 2.003   -8.908  -8.354  1.00 38.09  ? 563 LEU A C     1 
ATOM   1065 O O     . LEU A 1 138 ? 1.761   -10.109 -8.220  1.00 34.78  ? 563 LEU A O     1 
ATOM   1066 C CB    . LEU A 1 138 ? 4.337   -8.138  -8.873  1.00 35.23  ? 563 LEU A CB    1 
ATOM   1067 C CG    . LEU A 1 138 ? 5.405   -9.217  -8.881  1.00 38.48  ? 563 LEU A CG    1 
ATOM   1068 C CD1   . LEU A 1 138 ? 5.559   -9.908  -10.263 1.00 37.74  ? 563 LEU A CD1   1 
ATOM   1069 C CD2   . LEU A 1 138 ? 6.745   -8.613  -8.412  1.00 32.85  ? 563 LEU A CD2   1 
ATOM   1070 N N     . ASN A 1 139 ? 1.376   -7.940  -7.640  1.00 36.34  ? 564 ASN A N     1 
ATOM   1071 C CA    . ASN A 1 139 ? 0.349   -8.244  -6.647  1.00 37.05  ? 564 ASN A CA    1 
ATOM   1072 C C     . ASN A 1 139 ? -0.887  -8.874  -7.279  1.00 39.78  ? 564 ASN A C     1 
ATOM   1073 O O     . ASN A 1 139 ? -1.429  -9.790  -6.682  1.00 41.12  ? 564 ASN A O     1 
ATOM   1074 C CB    . ASN A 1 139 ? -0.016  -7.031  -5.802  1.00 40.62  ? 564 ASN A CB    1 
ATOM   1075 C CG    . ASN A 1 139 ? 0.827   -6.920  -4.558  1.00 62.80  ? 564 ASN A CG    1 
ATOM   1076 O OD1   . ASN A 1 139 ? 1.026   -7.892  -3.814  1.00 56.53  ? 564 ASN A OD1   1 
ATOM   1077 N ND2   . ASN A 1 139 ? 1.318   -5.722  -4.289  1.00 53.72  ? 564 ASN A ND2   1 
ATOM   1078 N N     . LYS A 1 140 ? -1.304  -8.424  -8.482  1.00 36.27  ? 565 LYS A N     1 
ATOM   1079 C CA    . LYS A 1 140 ? -2.446  -8.987  -9.224  1.00 35.66  ? 565 LYS A CA    1 
ATOM   1080 C C     . LYS A 1 140 ? -2.137  -10.442 -9.545  1.00 39.09  ? 565 LYS A C     1 
ATOM   1081 O O     . LYS A 1 140 ? -2.924  -11.336 -9.211  1.00 38.72  ? 565 LYS A O     1 
ATOM   1082 C CB    . LYS A 1 140 ? -2.700  -8.210  -10.529 1.00 39.28  ? 565 LYS A CB    1 
ATOM   1083 C CG    . LYS A 1 140 ? -3.332  -6.838  -10.332 1.00 60.12  ? 565 LYS A CG    1 
ATOM   1084 C CD    . LYS A 1 140 ? -3.556  -6.131  -11.665 1.00 70.95  ? 565 LYS A CD    1 
ATOM   1085 C CE    . LYS A 1 140 ? -4.992  -5.691  -11.825 1.00 83.37  ? 565 LYS A CE    1 
ATOM   1086 N NZ    . LYS A 1 140 ? -5.136  -4.621  -12.851 1.00 90.09  ? 565 LYS A NZ    1 
ATOM   1087 N N     . TYR A 1 141 ? -0.933  -10.691 -10.122 1.00 32.54  ? 566 TYR A N     1 
ATOM   1088 C CA    . TYR A 1 141 ? -0.488  -12.041 -10.456 1.00 31.54  ? 566 TYR A CA    1 
ATOM   1089 C C     . TYR A 1 141 ? -0.351  -12.915 -9.202  1.00 35.30  ? 566 TYR A C     1 
ATOM   1090 O O     . TYR A 1 141 ? -0.810  -14.053 -9.192  1.00 34.32  ? 566 TYR A O     1 
ATOM   1091 C CB    . TYR A 1 141 ? 0.869   -11.977 -11.186 1.00 31.60  ? 566 TYR A CB    1 
ATOM   1092 C CG    . TYR A 1 141 ? 1.321   -13.328 -11.698 1.00 32.13  ? 566 TYR A CG    1 
ATOM   1093 C CD1   . TYR A 1 141 ? 0.958   -13.772 -12.967 1.00 33.50  ? 566 TYR A CD1   1 
ATOM   1094 C CD2   . TYR A 1 141 ? 2.116   -14.164 -10.914 1.00 31.82  ? 566 TYR A CD2   1 
ATOM   1095 C CE1   . TYR A 1 141 ? 1.386   -15.007 -13.451 1.00 33.84  ? 566 TYR A CE1   1 
ATOM   1096 C CE2   . TYR A 1 141 ? 2.536   -15.407 -11.381 1.00 32.60  ? 566 TYR A CE2   1 
ATOM   1097 C CZ    . TYR A 1 141 ? 2.162   -15.827 -12.649 1.00 36.62  ? 566 TYR A CZ    1 
ATOM   1098 O OH    . TYR A 1 141 ? 2.595   -17.039 -13.127 1.00 34.85  ? 566 TYR A OH    1 
ATOM   1099 N N     . HIS A 1 142 ? 0.303   -12.390 -8.153  1.00 32.48  ? 567 HIS A N     1 
ATOM   1100 C CA    . HIS A 1 142 ? 0.559   -13.134 -6.919  1.00 32.88  ? 567 HIS A CA    1 
ATOM   1101 C C     . HIS A 1 142 ? -0.744  -13.489 -6.187  1.00 37.84  ? 567 HIS A C     1 
ATOM   1102 O O     . HIS A 1 142 ? -0.848  -14.607 -5.667  1.00 35.90  ? 567 HIS A O     1 
ATOM   1103 C CB    . HIS A 1 142 ? 1.501   -12.320 -6.014  1.00 33.48  ? 567 HIS A CB    1 
ATOM   1104 C CG    . HIS A 1 142 ? 1.890   -12.982 -4.739  1.00 36.04  ? 567 HIS A CG    1 
ATOM   1105 N ND1   . HIS A 1 142 ? 1.431   -12.511 -3.522  1.00 36.75  ? 567 HIS A ND1   1 
ATOM   1106 C CD2   . HIS A 1 142 ? 2.718   -14.027 -4.528  1.00 36.74  ? 567 HIS A CD2   1 
ATOM   1107 C CE1   . HIS A 1 142 ? 1.971   -13.295 -2.614  1.00 36.30  ? 567 HIS A CE1   1 
ATOM   1108 N NE2   . HIS A 1 142 ? 2.764   -14.220 -3.167  1.00 36.92  ? 567 HIS A NE2   1 
ATOM   1109 N N     . ASP A 1 143 ? -1.720  -12.531 -6.134  1.00 36.42  ? 568 ASP A N     1 
ATOM   1110 C CA    . ASP A 1 143 ? -3.015  -12.773 -5.457  1.00 37.43  ? 568 ASP A CA    1 
ATOM   1111 C C     . ASP A 1 143 ? -3.744  -13.905 -6.187  1.00 43.29  ? 568 ASP A C     1 
ATOM   1112 O O     . ASP A 1 143 ? -4.301  -14.783 -5.545  1.00 43.75  ? 568 ASP A O     1 
ATOM   1113 C CB    . ASP A 1 143 ? -3.899  -11.507 -5.438  1.00 38.84  ? 568 ASP A CB    1 
ATOM   1114 C CG    . ASP A 1 143 ? -3.501  -10.399 -4.462  1.00 48.45  ? 568 ASP A CG    1 
ATOM   1115 O OD1   . ASP A 1 143 ? -2.628  -10.646 -3.591  1.00 48.23  ? 568 ASP A OD1   1 
ATOM   1116 O OD2   . ASP A 1 143 ? -4.076  -9.298  -4.554  1.00 54.91  ? 568 ASP A OD2   1 
ATOM   1117 N N     . TRP A 1 144 ? -3.698  -13.878 -7.530  1.00 41.75  ? 569 TRP A N     1 
ATOM   1118 C CA    . TRP A 1 144 ? -4.310  -14.833 -8.451  1.00 42.12  ? 569 TRP A CA    1 
ATOM   1119 C C     . TRP A 1 144 ? -3.734  -16.244 -8.284  1.00 43.44  ? 569 TRP A C     1 
ATOM   1120 O O     . TRP A 1 144 ? -4.478  -17.224 -8.365  1.00 43.02  ? 569 TRP A O     1 
ATOM   1121 C CB    . TRP A 1 144 ? -4.158  -14.317 -9.881  1.00 41.93  ? 569 TRP A CB    1 
ATOM   1122 C CG    . TRP A 1 144 ? -4.624  -15.255 -10.953 1.00 43.92  ? 569 TRP A CG    1 
ATOM   1123 C CD1   . TRP A 1 144 ? -5.880  -15.337 -11.482 1.00 46.98  ? 569 TRP A CD1   1 
ATOM   1124 C CD2   . TRP A 1 144 ? -3.809  -16.159 -11.709 1.00 44.27  ? 569 TRP A CD2   1 
ATOM   1125 N NE1   . TRP A 1 144 ? -5.911  -16.279 -12.481 1.00 46.59  ? 569 TRP A NE1   1 
ATOM   1126 C CE2   . TRP A 1 144 ? -4.647  -16.783 -12.659 1.00 48.30  ? 569 TRP A CE2   1 
ATOM   1127 C CE3   . TRP A 1 144 ? -2.441  -16.497 -11.684 1.00 46.02  ? 569 TRP A CE3   1 
ATOM   1128 C CZ2   . TRP A 1 144 ? -4.172  -17.750 -13.555 1.00 48.09  ? 569 TRP A CZ2   1 
ATOM   1129 C CZ3   . TRP A 1 144 ? -1.967  -17.442 -12.585 1.00 47.76  ? 569 TRP A CZ3   1 
ATOM   1130 C CH2   . TRP A 1 144 ? -2.828  -18.065 -13.498 1.00 48.54  ? 569 TRP A CH2   1 
ATOM   1131 N N     . LEU A 1 145 ? -2.427  -16.341 -8.008  1.00 37.93  ? 570 LEU A N     1 
ATOM   1132 C CA    . LEU A 1 145 ? -1.724  -17.601 -7.770  1.00 38.19  ? 570 LEU A CA    1 
ATOM   1133 C C     . LEU A 1 145 ? -2.256  -18.264 -6.493  1.00 42.70  ? 570 LEU A C     1 
ATOM   1134 O O     . LEU A 1 145 ? -2.532  -19.465 -6.500  1.00 39.58  ? 570 LEU A O     1 
ATOM   1135 C CB    . LEU A 1 145 ? -0.230  -17.301 -7.607  1.00 38.45  ? 570 LEU A CB    1 
ATOM   1136 C CG    . LEU A 1 145 ? 0.823   -18.004 -8.464  1.00 43.67  ? 570 LEU A CG    1 
ATOM   1137 C CD1   . LEU A 1 145 ? 0.445   -18.093 -9.917  1.00 42.96  ? 570 LEU A CD1   1 
ATOM   1138 C CD2   . LEU A 1 145 ? 2.154   -17.299 -8.319  1.00 45.47  ? 570 LEU A CD2   1 
ATOM   1139 N N     . TRP A 1 146 ? -2.375  -17.480 -5.398  1.00 40.40  ? 571 TRP A N     1 
ATOM   1140 C CA    . TRP A 1 146 ? -2.886  -17.976 -4.107  1.00 40.39  ? 571 TRP A CA    1 
ATOM   1141 C C     . TRP A 1 146 ? -4.326  -18.455 -4.216  1.00 47.56  ? 571 TRP A C     1 
ATOM   1142 O O     . TRP A 1 146 ? -4.656  -19.487 -3.639  1.00 47.54  ? 571 TRP A O     1 
ATOM   1143 C CB    . TRP A 1 146 ? -2.785  -16.890 -3.024  1.00 38.14  ? 571 TRP A CB    1 
ATOM   1144 C CG    . TRP A 1 146 ? -1.492  -16.907 -2.275  1.00 37.95  ? 571 TRP A CG    1 
ATOM   1145 C CD1   . TRP A 1 146 ? -0.506  -15.962 -2.322  1.00 40.75  ? 571 TRP A CD1   1 
ATOM   1146 C CD2   . TRP A 1 146 ? -1.030  -17.927 -1.388  1.00 37.23  ? 571 TRP A CD2   1 
ATOM   1147 N NE1   . TRP A 1 146 ? 0.539   -16.330 -1.512  1.00 40.06  ? 571 TRP A NE1   1 
ATOM   1148 C CE2   . TRP A 1 146 ? 0.237   -17.526 -0.911  1.00 40.93  ? 571 TRP A CE2   1 
ATOM   1149 C CE3   . TRP A 1 146 ? -1.554  -19.166 -0.962  1.00 38.19  ? 571 TRP A CE3   1 
ATOM   1150 C CZ2   . TRP A 1 146 ? 0.989   -18.316 -0.035  1.00 39.83  ? 571 TRP A CZ2   1 
ATOM   1151 C CZ3   . TRP A 1 146 ? -0.813  -19.935 -0.084  1.00 39.01  ? 571 TRP A CZ3   1 
ATOM   1152 C CH2   . TRP A 1 146 ? 0.431   -19.501 0.388   1.00 39.39  ? 571 TRP A CH2   1 
ATOM   1153 N N     . GLU A 1 147 ? -5.171  -17.723 -4.968  1.00 46.71  ? 572 GLU A N     1 
ATOM   1154 C CA    . GLU A 1 147 ? -6.583  -18.081 -5.193  1.00 47.49  ? 572 GLU A CA    1 
ATOM   1155 C C     . GLU A 1 147 ? -6.718  -19.343 -6.025  1.00 55.56  ? 572 GLU A C     1 
ATOM   1156 O O     . GLU A 1 147 ? -7.571  -20.180 -5.729  1.00 55.84  ? 572 GLU A O     1 
ATOM   1157 C CB    . GLU A 1 147 ? -7.337  -16.954 -5.902  1.00 48.11  ? 572 GLU A CB    1 
ATOM   1158 C CG    . GLU A 1 147 ? -7.519  -15.703 -5.073  1.00 53.38  ? 572 GLU A CG    1 
ATOM   1159 C CD    . GLU A 1 147 ? -7.927  -14.477 -5.866  1.00 68.76  ? 572 GLU A CD    1 
ATOM   1160 O OE1   . GLU A 1 147 ? -8.252  -13.448 -5.232  1.00 81.44  ? 572 GLU A OE1   1 
ATOM   1161 O OE2   . GLU A 1 147 ? -7.921  -14.541 -7.116  1.00 56.63  ? 572 GLU A OE2   1 
ATOM   1162 N N     . ASN A 1 148 ? -5.891  -19.472 -7.077  1.00 53.80  ? 573 ASN A N     1 
ATOM   1163 C CA    . ASN A 1 148 ? -5.940  -20.610 -7.987  1.00 53.87  ? 573 ASN A CA    1 
ATOM   1164 C C     . ASN A 1 148 ? -4.946  -21.722 -7.635  1.00 61.14  ? 573 ASN A C     1 
ATOM   1165 O O     . ASN A 1 148 ? -4.591  -22.517 -8.508  1.00 62.36  ? 573 ASN A O     1 
ATOM   1166 C CB    . ASN A 1 148 ? -5.857  -20.146 -9.439  1.00 50.72  ? 573 ASN A CB    1 
ATOM   1167 C CG    . ASN A 1 148 ? -7.013  -19.258 -9.841  1.00 63.44  ? 573 ASN A CG    1 
ATOM   1168 O OD1   . ASN A 1 148 ? -6.995  -18.037 -9.645  1.00 54.18  ? 573 ASN A OD1   1 
ATOM   1169 N ND2   . ASN A 1 148 ? -8.056  -19.852 -10.392 1.00 51.56  ? 573 ASN A ND2   1 
ATOM   1170 N N     . HIS A 1 149 ? -4.538  -21.782 -6.331  1.00 58.28  ? 574 HIS A N     1 
ATOM   1171 C CA    . HIS A 1 149 ? -3.658  -22.737 -5.624  1.00 100.87 ? 574 HIS A CA    1 
ATOM   1172 C C     . HIS A 1 149 ? -2.544  -22.094 -4.816  1.00 117.55 ? 574 HIS A C     1 
ATOM   1173 O O     . HIS A 1 149 ? -2.544  -22.198 -3.593  1.00 77.20  ? 574 HIS A O     1 
ATOM   1174 C CB    . HIS A 1 149 ? -3.140  -23.903 -6.488  1.00 101.91 ? 574 HIS A CB    1 
ATOM   1175 C CG    . HIS A 1 149 ? -3.625  -25.250 -6.042  1.00 105.48 ? 574 HIS A CG    1 
ATOM   1176 N ND1   . HIS A 1 149 ? -2.950  -26.408 -6.389  1.00 107.30 ? 574 HIS A ND1   1 
ATOM   1177 C CD2   . HIS A 1 149 ? -4.695  -25.582 -5.279  1.00 107.31 ? 574 HIS A CD2   1 
ATOM   1178 C CE1   . HIS A 1 149 ? -3.627  -27.399 -5.834  1.00 106.80 ? 574 HIS A CE1   1 
ATOM   1179 N NE2   . HIS A 1 149 ? -4.684  -26.950 -5.155  1.00 107.15 ? 574 HIS A NE2   1 
ATOM   1180 O "O5'" . DC  B 2 1   ? 1.417   24.237  -24.975 1.00 79.75  ? 1   DC  C "O5'" 1 
ATOM   1181 C "C5'" . DC  B 2 1   ? 0.384   23.248  -25.053 1.00 79.69  ? 1   DC  C "C5'" 1 
ATOM   1182 C "C4'" . DC  B 2 1   ? -1.011  23.860  -25.002 1.00 78.93  ? 1   DC  C "C4'" 1 
ATOM   1183 O "O4'" . DC  B 2 1   ? -1.911  23.051  -25.800 1.00 78.29  ? 1   DC  C "O4'" 1 
ATOM   1184 C "C3'" . DC  B 2 1   ? -1.649  23.893  -23.622 1.00 79.07  ? 1   DC  C "C3'" 1 
ATOM   1185 O "O3'" . DC  B 2 1   ? -1.368  25.114  -22.965 1.00 79.89  ? 1   DC  C "O3'" 1 
ATOM   1186 C "C2'" . DC  B 2 1   ? -3.133  23.797  -23.935 1.00 78.38  ? 1   DC  C "C2'" 1 
ATOM   1187 C "C1'" . DC  B 2 1   ? -3.111  22.799  -25.084 1.00 77.50  ? 1   DC  C "C1'" 1 
ATOM   1188 N N1    . DC  B 2 1   ? -3.362  21.298  -24.842 1.00 75.95  ? 1   DC  C N1    1 
ATOM   1189 C C2    . DC  B 2 1   ? -3.811  20.699  -23.621 1.00 75.04  ? 1   DC  C C2    1 
ATOM   1190 O O2    . DC  B 2 1   ? -3.997  21.331  -22.571 1.00 75.04  ? 1   DC  C O2    1 
ATOM   1191 N N3    . DC  B 2 1   ? -4.046  19.354  -23.598 1.00 74.19  ? 1   DC  C N3    1 
ATOM   1192 C C4    . DC  B 2 1   ? -3.876  18.605  -24.693 1.00 73.87  ? 1   DC  C C4    1 
ATOM   1193 N N4    . DC  B 2 1   ? -4.145  17.301  -24.597 1.00 73.44  ? 1   DC  C N4    1 
ATOM   1194 C C5    . DC  B 2 1   ? -3.429  19.166  -25.930 1.00 74.37  ? 1   DC  C C5    1 
ATOM   1195 C C6    . DC  B 2 1   ? -3.209  20.492  -25.954 1.00 75.29  ? 1   DC  C C6    1 
ATOM   1196 P P     . DC  B 2 2   ? -0.370  25.210  -21.711 1.00 80.39  ? 2   DC  C P     1 
ATOM   1197 O OP1   . DC  B 2 2   ? -0.618  26.542  -21.097 1.00 80.12  ? 2   DC  C OP1   1 
ATOM   1198 O OP2   . DC  B 2 2   ? 0.989   24.848  -22.173 1.00 80.60  ? 2   DC  C OP2   1 
ATOM   1199 O "O5'" . DC  B 2 2   ? -0.822  24.037  -20.713 1.00 79.62  ? 2   DC  C "O5'" 1 
ATOM   1200 C "C5'" . DC  B 2 2   ? -1.793  24.234  -19.678 1.00 78.89  ? 2   DC  C "C5'" 1 
ATOM   1201 C "C4'" . DC  B 2 2   ? -1.745  23.119  -18.648 1.00 77.88  ? 2   DC  C "C4'" 1 
ATOM   1202 O "O4'" . DC  B 2 2   ? -2.262  21.893  -19.225 1.00 76.93  ? 2   DC  C "O4'" 1 
ATOM   1203 C "C3'" . DC  B 2 2   ? -0.357  22.827  -18.087 1.00 77.51  ? 2   DC  C "C3'" 1 
ATOM   1204 O "O3'" . DC  B 2 2   ? -0.313  23.109  -16.687 1.00 77.72  ? 2   DC  C "O3'" 1 
ATOM   1205 C "C2'" . DC  B 2 2   ? -0.089  21.359  -18.410 1.00 76.64  ? 2   DC  C "C2'" 1 
ATOM   1206 C "C1'" . DC  B 2 2   ? -1.404  20.802  -18.949 1.00 75.46  ? 2   DC  C "C1'" 1 
ATOM   1207 N N1    . DC  B 2 2   ? -1.294  19.902  -20.172 1.00 72.80  ? 2   DC  C N1    1 
ATOM   1208 C C2    . DC  B 2 2   ? -1.918  18.635  -20.180 1.00 71.29  ? 2   DC  C C2    1 
ATOM   1209 O O2    . DC  B 2 2   ? -2.554  18.247  -19.189 1.00 71.09  ? 2   DC  C O2    1 
ATOM   1210 N N3    . DC  B 2 2   ? -1.820  17.855  -21.294 1.00 70.53  ? 2   DC  C N3    1 
ATOM   1211 C C4    . DC  B 2 2   ? -1.135  18.277  -22.361 1.00 70.55  ? 2   DC  C C4    1 
ATOM   1212 N N4    . DC  B 2 2   ? -1.065  17.465  -23.423 1.00 70.51  ? 2   DC  C N4    1 
ATOM   1213 C C5    . DC  B 2 2   ? -0.490  19.557  -22.382 1.00 71.25  ? 2   DC  C C5    1 
ATOM   1214 C C6    . DC  B 2 2   ? -0.607  20.329  -21.287 1.00 71.86  ? 2   DC  C C6    1 
ATOM   1215 P P     . DA  B 2 3   ? 1.027   23.262  -15.814 1.00 77.98  ? 3   DA  C P     1 
ATOM   1216 O OP1   . DA  B 2 3   ? 0.903   24.513  -15.026 1.00 78.46  ? 3   DA  C OP1   1 
ATOM   1217 O OP2   . DA  B 2 3   ? 2.228   23.064  -16.669 1.00 78.07  ? 3   DA  C OP2   1 
ATOM   1218 O "O5'" . DA  B 2 3   ? 0.905   22.014  -14.817 1.00 76.85  ? 3   DA  C "O5'" 1 
ATOM   1219 C "C5'" . DA  B 2 3   ? -0.186  21.898  -13.891 1.00 75.85  ? 3   DA  C "C5'" 1 
ATOM   1220 C "C4'" . DA  B 2 3   ? -0.328  20.474  -13.360 1.00 74.75  ? 3   DA  C "C4'" 1 
ATOM   1221 O "O4'" . DA  B 2 3   ? -0.537  19.543  -14.456 1.00 73.34  ? 3   DA  C "O4'" 1 
ATOM   1222 C "C3'" . DA  B 2 3   ? 0.821   19.899  -12.533 1.00 74.56  ? 3   DA  C "C3'" 1 
ATOM   1223 O "O3'" . DA  B 2 3   ? 0.254   19.065  -11.506 1.00 76.01  ? 3   DA  C "O3'" 1 
ATOM   1224 C "C2'" . DA  B 2 3   ? 1.616   19.104  -13.573 1.00 72.82  ? 3   DA  C "C2'" 1 
ATOM   1225 C "C1'" . DA  B 2 3   ? 0.506   18.588  -14.486 1.00 71.26  ? 3   DA  C "C1'" 1 
ATOM   1226 N N9    . DA  B 2 3   ? 0.869   18.327  -15.880 1.00 67.54  ? 3   DA  C N9    1 
ATOM   1227 C C8    . DA  B 2 3   ? 1.726   19.029  -16.694 1.00 66.08  ? 3   DA  C C8    1 
ATOM   1228 N N7    . DA  B 2 3   ? 1.821   18.556  -17.914 1.00 64.85  ? 3   DA  C N7    1 
ATOM   1229 C C5    . DA  B 2 3   ? 0.961   17.472  -17.898 1.00 64.29  ? 3   DA  C C5    1 
ATOM   1230 C C6    . DA  B 2 3   ? 0.597   16.530  -18.882 1.00 63.30  ? 3   DA  C C6    1 
ATOM   1231 N N6    . DA  B 2 3   ? 1.091   16.540  -20.125 1.00 63.26  ? 3   DA  C N6    1 
ATOM   1232 N N1    . DA  B 2 3   ? -0.299  15.575  -18.537 1.00 63.00  ? 3   DA  C N1    1 
ATOM   1233 C C2    . DA  B 2 3   ? -0.804  15.545  -17.293 1.00 63.48  ? 3   DA  C C2    1 
ATOM   1234 N N3    . DA  B 2 3   ? -0.551  16.389  -16.292 1.00 64.41  ? 3   DA  C N3    1 
ATOM   1235 C C4    . DA  B 2 3   ? 0.360   17.320  -16.656 1.00 65.22  ? 3   DA  C C4    1 
ATOM   1236 P P     . DG  B 2 4   ? 1.076   18.304  -10.354 1.00 76.92  ? 4   DG  C P     1 
ATOM   1237 O OP1   . DG  B 2 4   ? 1.430   19.332  -9.345  1.00 77.60  ? 4   DG  C OP1   1 
ATOM   1238 O OP2   . DG  B 2 4   ? 2.151   17.469  -10.950 1.00 77.13  ? 4   DG  C OP2   1 
ATOM   1239 O "O5'" . DG  B 2 4   ? 0.013   17.313  -9.662  1.00 75.29  ? 4   DG  C "O5'" 1 
ATOM   1240 C "C5'" . DG  B 2 4   ? -1.032  16.596  -10.334 1.00 73.29  ? 4   DG  C "C5'" 1 
ATOM   1241 C "C4'" . DG  B 2 4   ? -0.701  15.155  -10.707 1.00 71.57  ? 4   DG  C "C4'" 1 
ATOM   1242 O "O4'" . DG  B 2 4   ? -0.336  15.068  -12.103 1.00 70.47  ? 4   DG  C "O4'" 1 
ATOM   1243 C "C3'" . DG  B 2 4   ? 0.332   14.349  -9.911  1.00 70.84  ? 4   DG  C "C3'" 1 
ATOM   1244 O "O3'" . DG  B 2 4   ? -0.283  13.112  -9.491  1.00 70.90  ? 4   DG  C "O3'" 1 
ATOM   1245 C "C2'" . DG  B 2 4   ? 1.468   14.136  -10.920 1.00 70.12  ? 4   DG  C "C2'" 1 
ATOM   1246 C "C1'" . DG  B 2 4   ? 0.702   14.120  -12.240 1.00 68.90  ? 4   DG  C "C1'" 1 
ATOM   1247 N N9    . DG  B 2 4   ? 1.448   14.438  -13.459 1.00 65.48  ? 4   DG  C N9    1 
ATOM   1248 C C8    . DG  B 2 4   ? 2.251   15.527  -13.700 1.00 64.22  ? 4   DG  C C8    1 
ATOM   1249 N N7    . DG  B 2 4   ? 2.727   15.579  -14.913 1.00 62.87  ? 4   DG  C N7    1 
ATOM   1250 C C5    . DG  B 2 4   ? 2.177   14.468  -15.528 1.00 61.98  ? 4   DG  C C5    1 
ATOM   1251 C C6    . DG  B 2 4   ? 2.352   13.984  -16.845 1.00 60.22  ? 4   DG  C C6    1 
ATOM   1252 O O6    . DG  B 2 4   ? 3.032   14.494  -17.741 1.00 59.02  ? 4   DG  C O6    1 
ATOM   1253 N N1    . DG  B 2 4   ? 1.634   12.808  -17.079 1.00 60.63  ? 4   DG  C N1    1 
ATOM   1254 C C2    . DG  B 2 4   ? 0.837   12.176  -16.144 1.00 61.56  ? 4   DG  C C2    1 
ATOM   1255 N N2    . DG  B 2 4   ? 0.211   11.057  -16.526 1.00 61.64  ? 4   DG  C N2    1 
ATOM   1256 N N3    . DG  B 2 4   ? 0.689   12.603  -14.893 1.00 62.73  ? 4   DG  C N3    1 
ATOM   1257 C C4    . DG  B 2 4   ? 1.379   13.758  -14.653 1.00 63.45  ? 4   DG  C C4    1 
ATOM   1258 P P     . DC  B 2 5   ? 0.411   11.892  -8.709  1.00 70.83  ? 5   DC  C P     1 
ATOM   1259 O OP1   . DC  B 2 5   ? -0.630  11.186  -7.930  1.00 71.29  ? 5   DC  C OP1   1 
ATOM   1260 O OP2   . DC  B 2 5   ? 1.639   12.353  -8.018  1.00 70.98  ? 5   DC  C OP2   1 
ATOM   1261 O "O5'" . DC  B 2 5   ? 0.868   10.956  -9.929  1.00 70.11  ? 5   DC  C "O5'" 1 
ATOM   1262 C "C5'" . DC  B 2 5   ? -0.056  10.360  -10.866 1.00 68.10  ? 5   DC  C "C5'" 1 
ATOM   1263 C "C4'" . DC  B 2 5   ? 0.663   9.525   -11.915 1.00 65.94  ? 5   DC  C "C4'" 1 
ATOM   1264 O "O4'" . DC  B 2 5   ? 1.319   10.392  -12.879 1.00 64.36  ? 5   DC  C "O4'" 1 
ATOM   1265 C "C3'" . DC  B 2 5   ? 1.744   8.589   -11.376 1.00 65.51  ? 5   DC  C "C3'" 1 
ATOM   1266 O "O3'" . DC  B 2 5   ? 1.612   7.269   -11.886 1.00 66.36  ? 5   DC  C "O3'" 1 
ATOM   1267 C "C2'" . DC  B 2 5   ? 3.051   9.219   -11.843 1.00 63.63  ? 5   DC  C "C2'" 1 
ATOM   1268 C "C1'" . DC  B 2 5   ? 2.604   9.868   -13.146 1.00 61.68  ? 5   DC  C "C1'" 1 
ATOM   1269 N N1    . DC  B 2 5   ? 3.512   10.929  -13.713 1.00 57.46  ? 5   DC  C N1    1 
ATOM   1270 C C2    . DC  B 2 5   ? 3.894   10.848  -15.065 1.00 54.34  ? 5   DC  C C2    1 
ATOM   1271 O O2    . DC  B 2 5   ? 3.475   9.922   -15.761 1.00 53.61  ? 5   DC  C O2    1 
ATOM   1272 N N3    . DC  B 2 5   ? 4.716   11.805  -15.575 1.00 53.02  ? 5   DC  C N3    1 
ATOM   1273 C C4    . DC  B 2 5   ? 5.149   12.815  -14.815 1.00 52.51  ? 5   DC  C C4    1 
ATOM   1274 N N4    . DC  B 2 5   ? 5.947   13.725  -15.381 1.00 51.35  ? 5   DC  C N4    1 
ATOM   1275 C C5    . DC  B 2 5   ? 4.789   12.919  -13.434 1.00 54.24  ? 5   DC  C C5    1 
ATOM   1276 C C6    . DC  B 2 5   ? 3.964   11.978  -12.938 1.00 55.89  ? 5   DC  C C6    1 
ATOM   1277 P P     . DG  B 2 6   ? 1.823   6.039   -10.884 1.00 66.74  ? 6   DG  C P     1 
ATOM   1278 O OP1   . DG  B 2 6   ? 0.546   5.877   -10.145 1.00 67.72  ? 6   DG  C OP1   1 
ATOM   1279 O OP2   . DG  B 2 6   ? 3.091   6.207   -10.121 1.00 66.81  ? 6   DG  C OP2   1 
ATOM   1280 O "O5'" . DG  B 2 6   ? 2.031   4.784   -11.876 1.00 63.38  ? 6   DG  C "O5'" 1 
ATOM   1281 C "C5'" . DG  B 2 6   ? 1.385   4.654   -13.150 1.00 58.79  ? 6   DG  C "C5'" 1 
ATOM   1282 C "C4'" . DG  B 2 6   ? 2.354   4.238   -14.255 1.00 54.04  ? 6   DG  C "C4'" 1 
ATOM   1283 O "O4'" . DG  B 2 6   ? 3.182   5.343   -14.716 1.00 52.19  ? 6   DG  C "O4'" 1 
ATOM   1284 C "C3'" . DG  B 2 6   ? 3.315   3.091   -13.955 1.00 50.81  ? 6   DG  C "C3'" 1 
ATOM   1285 O "O3'" . DG  B 2 6   ? 3.412   2.283   -15.096 1.00 49.73  ? 6   DG  C "O3'" 1 
ATOM   1286 C "C2'" . DG  B 2 6   ? 4.651   3.791   -13.669 1.00 50.67  ? 6   DG  C "C2'" 1 
ATOM   1287 C "C1'" . DG  B 2 6   ? 4.558   4.981   -14.622 1.00 49.57  ? 6   DG  C "C1'" 1 
ATOM   1288 N N9    . DG  B 2 6   ? 5.319   6.177   -14.274 1.00 45.25  ? 6   DG  C N9    1 
ATOM   1289 C C8    . DG  B 2 6   ? 5.407   6.831   -13.059 1.00 44.29  ? 6   DG  C C8    1 
ATOM   1290 N N7    . DG  B 2 6   ? 6.077   7.963   -13.112 1.00 43.16  ? 6   DG  C N7    1 
ATOM   1291 C C5    . DG  B 2 6   ? 6.428   8.074   -14.459 1.00 41.62  ? 6   DG  C C5    1 
ATOM   1292 C C6    . DG  B 2 6   ? 7.156   9.084   -15.130 1.00 40.95  ? 6   DG  C C6    1 
ATOM   1293 O O6    . DG  B 2 6   ? 7.652   10.113  -14.640 1.00 41.67  ? 6   DG  C O6    1 
ATOM   1294 N N1    . DG  B 2 6   ? 7.327   8.790   -16.480 1.00 39.90  ? 6   DG  C N1    1 
ATOM   1295 C C2    . DG  B 2 6   ? 6.834   7.650   -17.097 1.00 40.54  ? 6   DG  C C2    1 
ATOM   1296 N N2    . DG  B 2 6   ? 7.033   7.498   -18.413 1.00 40.07  ? 6   DG  C N2    1 
ATOM   1297 N N3    . DG  B 2 6   ? 6.084   6.740   -16.497 1.00 41.60  ? 6   DG  C N3    1 
ATOM   1298 C C4    . DG  B 2 6   ? 5.943   7.003   -15.179 1.00 42.59  ? 6   DG  C C4    1 
HETATM 1299 O "O5'" . 3DR B 2 7   ? 3.633   -0.131  -14.265 1.00 58.20  ? 7   3DR C "O5'" 1 
HETATM 1300 P P     . 3DR B 2 7   ? 2.847   0.736   -15.270 1.00 57.77  ? 7   3DR C P     1 
HETATM 1301 O OP1   . 3DR B 2 7   ? 2.876   0.163   -16.687 1.00 55.83  ? 7   3DR C OP1   1 
HETATM 1302 O OP2   . 3DR B 2 7   ? 1.312   0.765   -14.916 1.00 56.66  ? 7   3DR C OP2   1 
HETATM 1303 C "C2'" . 3DR B 2 7   ? 7.422   -1.656  -12.326 1.00 48.38  ? 7   3DR C "C2'" 1 
HETATM 1304 C "C5'" . 3DR B 2 7   ? 4.903   0.096   -13.998 1.00 54.70  ? 7   3DR C "C5'" 1 
HETATM 1305 C "C4'" . 3DR B 2 7   ? 5.455   -0.839  -13.053 1.00 49.97  ? 7   3DR C "C4'" 1 
HETATM 1306 O "O4'" . 3DR B 2 7   ? 5.723   -1.948  -13.834 1.00 53.71  ? 7   3DR C "O4'" 1 
HETATM 1307 C "C1'" . 3DR B 2 7   ? 6.573   -2.664  -13.031 1.00 53.36  ? 7   3DR C "C1'" 1 
HETATM 1308 C "C3'" . 3DR B 2 7   ? 6.762   -0.438  -12.479 1.00 42.88  ? 7   3DR C "C3'" 1 
HETATM 1309 O "O3'" . 3DR B 2 7   ? 6.643   0.131   -11.186 1.00 36.77  ? 7   3DR C "O3'" 1 
ATOM   1310 P P     . DG  B 2 8   ? 7.489   1.373   -10.623 1.00 35.13  ? 8   DG  C P     1 
ATOM   1311 O OP1   . DG  B 2 8   ? 6.994   1.574   -9.235  1.00 35.00  ? 8   DG  C OP1   1 
ATOM   1312 O OP2   . DG  B 2 8   ? 7.342   2.383   -11.687 1.00 35.68  ? 8   DG  C OP2   1 
ATOM   1313 O "O5'" . DG  B 2 8   ? 9.061   1.059   -10.555 1.00 35.55  ? 8   DG  C "O5'" 1 
ATOM   1314 C "C5'" . DG  B 2 8   ? 9.567   0.268   -9.497  1.00 34.42  ? 8   DG  C "C5'" 1 
ATOM   1315 C "C4'" . DG  B 2 8   ? 11.047  0.031   -9.764  1.00 32.11  ? 8   DG  C "C4'" 1 
ATOM   1316 O "O4'" . DG  B 2 8   ? 11.759  1.264   -10.043 1.00 31.38  ? 8   DG  C "O4'" 1 
ATOM   1317 C "C3'" . DG  B 2 8   ? 11.789  -0.597  -8.600  1.00 30.88  ? 8   DG  C "C3'" 1 
ATOM   1318 O "O3'" . DG  B 2 8   ? 12.734  -1.585  -9.120  1.00 28.91  ? 8   DG  C "O3'" 1 
ATOM   1319 C "C2'" . DG  B 2 8   ? 12.473  0.577   -7.874  1.00 30.36  ? 8   DG  C "C2'" 1 
ATOM   1320 C "C1'" . DG  B 2 8   ? 12.632  1.617   -8.985  1.00 31.72  ? 8   DG  C "C1'" 1 
ATOM   1321 N N9    . DG  B 2 8   ? 12.284  2.980   -8.595  1.00 34.31  ? 8   DG  C N9    1 
ATOM   1322 C C8    . DG  B 2 8   ? 11.200  3.390   -7.833  1.00 35.82  ? 8   DG  C C8    1 
ATOM   1323 N N7    . DG  B 2 8   ? 11.126  4.693   -7.710  1.00 36.74  ? 8   DG  C N7    1 
ATOM   1324 C C5    . DG  B 2 8   ? 12.220  5.170   -8.438  1.00 35.50  ? 8   DG  C C5    1 
ATOM   1325 C C6    . DG  B 2 8   ? 12.631  6.512   -8.717  1.00 35.58  ? 8   DG  C C6    1 
ATOM   1326 O O6    . DG  B 2 8   ? 12.143  7.557   -8.232  1.00 35.39  ? 8   DG  C O6    1 
ATOM   1327 N N1    . DG  B 2 8   ? 13.781  6.566   -9.528  1.00 34.42  ? 8   DG  C N1    1 
ATOM   1328 C C2    . DG  B 2 8   ? 14.432  5.444   -10.053 1.00 33.66  ? 8   DG  C C2    1 
ATOM   1329 N N2    . DG  B 2 8   ? 15.502  5.647   -10.831 1.00 31.60  ? 8   DG  C N2    1 
ATOM   1330 N N3    . DG  B 2 8   ? 14.017  4.196   -9.840  1.00 33.43  ? 8   DG  C N3    1 
ATOM   1331 C C4    . DG  B 2 8   ? 12.908  4.130   -9.037  1.00 34.22  ? 8   DG  C C4    1 
ATOM   1332 P P     . DC  B 2 9   ? 13.602  -2.495  -8.102  1.00 27.97  ? 9   DC  C P     1 
ATOM   1333 O OP1   . DC  B 2 9   ? 14.021  -3.734  -8.796  1.00 27.92  ? 9   DC  C OP1   1 
ATOM   1334 O OP2   . DC  B 2 9   ? 12.915  -2.567  -6.805  1.00 28.35  ? 9   DC  C OP2   1 
ATOM   1335 O "O5'" . DC  B 2 9   ? 14.897  -1.594  -7.861  1.00 29.08  ? 9   DC  C "O5'" 1 
ATOM   1336 C "C5'" . DC  B 2 9   ? 15.714  -1.250  -8.989  1.00 29.90  ? 9   DC  C "C5'" 1 
ATOM   1337 C "C4'" . DC  B 2 9   ? 16.746  -0.198  -8.597  1.00 31.80  ? 9   DC  C "C4'" 1 
ATOM   1338 O "O4'" . DC  B 2 9   ? 16.064  1.068   -8.426  1.00 32.12  ? 9   DC  C "O4'" 1 
ATOM   1339 C "C3'" . DC  B 2 9   ? 17.453  -0.459  -7.260  1.00 32.13  ? 9   DC  C "C3'" 1 
ATOM   1340 O "O3'" . DC  B 2 9   ? 18.743  -0.966  -7.497  1.00 31.29  ? 9   DC  C "O3'" 1 
ATOM   1341 C "C2'" . DC  B 2 9   ? 17.475  0.904   -6.573  1.00 33.67  ? 9   DC  C "C2'" 1 
ATOM   1342 C "C1'" . DC  B 2 9   ? 16.882  1.855   -7.612  1.00 33.27  ? 9   DC  C "C1'" 1 
ATOM   1343 N N1    . DC  B 2 9   ? 16.034  2.938   -7.028  1.00 34.19  ? 9   DC  C N1    1 
ATOM   1344 C C2    . DC  B 2 9   ? 16.328  4.292   -7.332  1.00 35.08  ? 9   DC  C C2    1 
ATOM   1345 O O2    . DC  B 2 9   ? 17.265  4.599   -8.071  1.00 33.47  ? 9   DC  C O2    1 
ATOM   1346 N N3    . DC  B 2 9   ? 15.524  5.266   -6.817  1.00 36.43  ? 9   DC  C N3    1 
ATOM   1347 C C4    . DC  B 2 9   ? 14.512  4.958   -6.002  1.00 36.08  ? 9   DC  C C4    1 
ATOM   1348 N N4    . DC  B 2 9   ? 13.788  5.991   -5.539  1.00 36.70  ? 9   DC  C N4    1 
ATOM   1349 C C5    . DC  B 2 9   ? 14.162  3.593   -5.705  1.00 35.49  ? 9   DC  C C5    1 
ATOM   1350 C C6    . DC  B 2 9   ? 14.955  2.627   -6.224  1.00 34.66  ? 9   DC  C C6    1 
ATOM   1351 P P     . DA  B 2 10  ? 19.841  -1.282  -6.355  1.00 33.94  ? 10  DA  C P     1 
ATOM   1352 O OP1   . DA  B 2 10  ? 20.712  -2.380  -6.852  1.00 33.89  ? 10  DA  C OP1   1 
ATOM   1353 O OP2   . DA  B 2 10  ? 19.241  -1.410  -5.005  1.00 32.19  ? 10  DA  C OP2   1 
ATOM   1354 O "O5'" . DA  B 2 10  ? 20.701  0.066   -6.378  1.00 34.13  ? 10  DA  C "O5'" 1 
ATOM   1355 C "C5'" . DA  B 2 10  ? 21.256  0.539   -7.605  1.00 37.92  ? 10  DA  C "C5'" 1 
ATOM   1356 C "C4'" . DA  B 2 10  ? 21.889  1.907   -7.407  1.00 41.78  ? 10  DA  C "C4'" 1 
ATOM   1357 O "O4'" . DA  B 2 10  ? 20.868  2.878   -7.065  1.00 41.33  ? 10  DA  C "O4'" 1 
ATOM   1358 C "C3'" . DA  B 2 10  ? 22.923  1.959   -6.294  1.00 45.82  ? 10  DA  C "C3'" 1 
ATOM   1359 O "O3'" . DA  B 2 10  ? 24.063  2.620   -6.777  1.00 51.26  ? 10  DA  C "O3'" 1 
ATOM   1360 C "C2'" . DA  B 2 10  ? 22.249  2.735   -5.172  1.00 44.50  ? 10  DA  C "C2'" 1 
ATOM   1361 C "C1'" . DA  B 2 10  ? 21.268  3.628   -5.937  1.00 42.13  ? 10  DA  C "C1'" 1 
ATOM   1362 N N9    . DA  B 2 10  ? 20.046  3.871   -5.185  1.00 40.72  ? 10  DA  C N9    1 
ATOM   1363 C C8    . DA  B 2 10  ? 19.317  2.910   -4.523  1.00 39.86  ? 10  DA  C C8    1 
ATOM   1364 N N7    . DA  B 2 10  ? 18.218  3.361   -3.991  1.00 39.63  ? 10  DA  C N7    1 
ATOM   1365 C C5    . DA  B 2 10  ? 18.233  4.710   -4.302  1.00 39.61  ? 10  DA  C C5    1 
ATOM   1366 C C6    . DA  B 2 10  ? 17.378  5.766   -3.946  1.00 39.40  ? 10  DA  C C6    1 
ATOM   1367 N N6    . DA  B 2 10  ? 16.262  5.568   -3.242  1.00 39.13  ? 10  DA  C N6    1 
ATOM   1368 N N1    . DA  B 2 10  ? 17.672  7.013   -4.404  1.00 40.16  ? 10  DA  C N1    1 
ATOM   1369 C C2    . DA  B 2 10  ? 18.796  7.210   -5.114  1.00 40.37  ? 10  DA  C C2    1 
ATOM   1370 N N3    . DA  B 2 10  ? 19.686  6.285   -5.491  1.00 40.56  ? 10  DA  C N3    1 
ATOM   1371 C C4    . DA  B 2 10  ? 19.362  5.052   -5.033  1.00 40.28  ? 10  DA  C C4    1 
ATOM   1372 P P     . DG  B 2 11  ? 25.487  2.630   -6.031  1.00 56.20  ? 11  DG  C P     1 
ATOM   1373 O OP1   . DG  B 2 11  ? 26.510  2.527   -7.103  1.00 56.51  ? 11  DG  C OP1   1 
ATOM   1374 O OP2   . DG  B 2 11  ? 25.460  1.732   -4.853  1.00 55.45  ? 11  DG  C OP2   1 
ATOM   1375 O "O5'" . DG  B 2 11  ? 25.481  4.116   -5.475  1.00 59.18  ? 11  DG  C "O5'" 1 
ATOM   1376 C "C5'" . DG  B 2 11  ? 25.495  5.283   -6.295  1.00 61.56  ? 11  DG  C "C5'" 1 
ATOM   1377 C "C4'" . DG  B 2 11  ? 25.437  6.458   -5.338  1.00 64.08  ? 11  DG  C "C4'" 1 
ATOM   1378 O "O4'" . DG  B 2 11  ? 24.074  6.552   -4.844  1.00 63.67  ? 11  DG  C "O4'" 1 
ATOM   1379 C "C3'" . DG  B 2 11  ? 26.348  6.266   -4.120  1.00 66.26  ? 11  DG  C "C3'" 1 
ATOM   1380 O "O3'" . DG  B 2 11  ? 27.401  7.237   -4.095  1.00 70.08  ? 11  DG  C "O3'" 1 
ATOM   1381 C "C2'" . DG  B 2 11  ? 25.422  6.216   -2.904  1.00 64.59  ? 11  DG  C "C2'" 1 
ATOM   1382 C "C1'" . DG  B 2 11  ? 24.083  6.694   -3.441  1.00 62.90  ? 11  DG  C "C1'" 1 
ATOM   1383 N N9    . DG  B 2 11  ? 22.908  6.057   -2.846  1.00 60.31  ? 11  DG  C N9    1 
ATOM   1384 C C8    . DG  B 2 11  ? 22.714  4.731   -2.527  1.00 59.58  ? 11  DG  C C8    1 
ATOM   1385 N N7    . DG  B 2 11  ? 21.558  4.484   -1.975  1.00 58.77  ? 11  DG  C N7    1 
ATOM   1386 C C5    . DG  B 2 11  ? 20.972  5.739   -1.860  1.00 57.88  ? 11  DG  C C5    1 
ATOM   1387 C C6    . DG  B 2 11  ? 19.729  6.127   -1.301  1.00 56.80  ? 11  DG  C C6    1 
ATOM   1388 O O6    . DG  B 2 11  ? 18.861  5.393   -0.808  1.00 56.20  ? 11  DG  C O6    1 
ATOM   1389 N N1    . DG  B 2 11  ? 19.508  7.510   -1.406  1.00 56.76  ? 11  DG  C N1    1 
ATOM   1390 C C2    . DG  B 2 11  ? 20.395  8.420   -1.955  1.00 57.39  ? 11  DG  C C2    1 
ATOM   1391 N N2    . DG  B 2 11  ? 20.043  9.720   -1.955  1.00 57.67  ? 11  DG  C N2    1 
ATOM   1392 N N3    . DG  B 2 11  ? 21.564  8.065   -2.477  1.00 57.79  ? 11  DG  C N3    1 
ATOM   1393 C C4    . DG  B 2 11  ? 21.797  6.721   -2.378  1.00 58.63  ? 11  DG  C C4    1 
ATOM   1394 P P     . DC  B 2 12  ? 28.433  7.587   -2.905  1.00 73.20  ? 12  DC  C P     1 
ATOM   1395 O OP1   . DC  B 2 12  ? 29.795  7.406   -3.462  1.00 73.79  ? 12  DC  C OP1   1 
ATOM   1396 O OP2   . DC  B 2 12  ? 28.106  6.896   -1.630  1.00 73.17  ? 12  DC  C OP2   1 
ATOM   1397 O "O5'" . DC  B 2 12  ? 28.150  9.157   -2.708  1.00 74.83  ? 12  DC  C "O5'" 1 
ATOM   1398 C "C5'" . DC  B 2 12  ? 26.867  9.820   -2.872  1.00 75.52  ? 12  DC  C "C5'" 1 
ATOM   1399 C "C4'" . DC  B 2 12  ? 26.164  10.154  -1.560  1.00 75.95  ? 12  DC  C "C4'" 1 
ATOM   1400 O "O4'" . DC  B 2 12  ? 25.065  9.247   -1.314  1.00 75.68  ? 12  DC  C "O4'" 1 
ATOM   1401 C "C3'" . DC  B 2 12  ? 27.002  10.124  -0.284  1.00 76.40  ? 12  DC  C "C3'" 1 
ATOM   1402 O "O3'" . DC  B 2 12  ? 27.585  11.412  -0.056  1.00 76.75  ? 12  DC  C "O3'" 1 
ATOM   1403 C "C2'" . DC  B 2 12  ? 26.019  9.709   0.815   1.00 76.07  ? 12  DC  C "C2'" 1 
ATOM   1404 C "C1'" . DC  B 2 12  ? 24.745  9.323   0.058   1.00 75.68  ? 12  DC  C "C1'" 1 
ATOM   1405 N N1    . DC  B 2 12  ? 24.005  8.069   0.498   1.00 75.48  ? 12  DC  C N1    1 
ATOM   1406 C C2    . DC  B 2 12  ? 22.630  8.133   0.844   1.00 75.25  ? 12  DC  C C2    1 
ATOM   1407 O O2    . DC  B 2 12  ? 22.024  9.215   0.805   1.00 74.96  ? 12  DC  C O2    1 
ATOM   1408 N N3    . DC  B 2 12  ? 21.981  6.985   1.210   1.00 75.10  ? 12  DC  C N3    1 
ATOM   1409 C C4    . DC  B 2 12  ? 22.637  5.814   1.244   1.00 75.41  ? 12  DC  C C4    1 
ATOM   1410 N N4    . DC  B 2 12  ? 21.962  4.719   1.620   1.00 75.38  ? 12  DC  C N4    1 
ATOM   1411 C C5    . DC  B 2 12  ? 24.027  5.724   0.900   1.00 75.48  ? 12  DC  C C5    1 
ATOM   1412 C C6    . DC  B 2 12  ? 24.657  6.856   0.537   1.00 75.41  ? 12  DC  C C6    1 
ATOM   1413 O "O5'" . DG  C 3 1   ? 14.044  7.294   7.964   1.00 82.38  ? 1   DG  D "O5'" 1 
ATOM   1414 C "C5'" . DG  C 3 1   ? 13.961  8.718   7.940   1.00 82.27  ? 1   DG  D "C5'" 1 
ATOM   1415 C "C4'" . DG  C 3 1   ? 14.092  9.271   6.529   1.00 82.00  ? 1   DG  D "C4'" 1 
ATOM   1416 O "O4'" . DG  C 3 1   ? 15.284  8.716   5.920   1.00 81.73  ? 1   DG  D "O4'" 1 
ATOM   1417 C "C3'" . DG  C 3 1   ? 12.939  8.960   5.571   1.00 82.08  ? 1   DG  D "C3'" 1 
ATOM   1418 O "O3'" . DG  C 3 1   ? 12.082  10.076  5.244   1.00 82.49  ? 1   DG  D "O3'" 1 
ATOM   1419 C "C2'" . DG  C 3 1   ? 13.555  8.286   4.345   1.00 81.44  ? 1   DG  D "C2'" 1 
ATOM   1420 C "C1'" . DG  C 3 1   ? 15.056  8.490   4.543   1.00 81.01  ? 1   DG  D "C1'" 1 
ATOM   1421 N N9    . DG  C 3 1   ? 15.921  7.393   4.101   1.00 79.73  ? 1   DG  D N9    1 
ATOM   1422 C C8    . DG  C 3 1   ? 15.698  6.041   4.253   1.00 79.53  ? 1   DG  D C8    1 
ATOM   1423 N N7    . DG  C 3 1   ? 16.667  5.293   3.803   1.00 79.09  ? 1   DG  D N7    1 
ATOM   1424 C C5    . DG  C 3 1   ? 17.602  6.203   3.330   1.00 78.47  ? 1   DG  D C5    1 
ATOM   1425 C C6    . DG  C 3 1   ? 18.865  5.975   2.727   1.00 77.84  ? 1   DG  D C6    1 
ATOM   1426 O O6    . DG  C 3 1   ? 19.398  4.882   2.485   1.00 77.55  ? 1   DG  D O6    1 
ATOM   1427 N N1    . DG  C 3 1   ? 19.513  7.169   2.386   1.00 77.89  ? 1   DG  D N1    1 
ATOM   1428 C C2    . DG  C 3 1   ? 19.003  8.434   2.620   1.00 78.00  ? 1   DG  D C2    1 
ATOM   1429 N N2    . DG  C 3 1   ? 19.757  9.472   2.233   1.00 77.94  ? 1   DG  D N2    1 
ATOM   1430 N N3    . DG  C 3 1   ? 17.817  8.658   3.183   1.00 78.22  ? 1   DG  D N3    1 
ATOM   1431 C C4    . DG  C 3 1   ? 17.167  7.504   3.516   1.00 78.75  ? 1   DG  D C4    1 
ATOM   1432 P P     . DC  C 3 2   ? 12.421  11.619  4.929   1.00 82.82  ? 2   DC  D P     1 
ATOM   1433 O OP1   . DC  C 3 2   ? 12.534  12.319  6.233   1.00 83.49  ? 2   DC  D OP1   1 
ATOM   1434 O OP2   . DC  C 3 2   ? 11.415  12.095  3.943   1.00 83.11  ? 2   DC  D OP2   1 
ATOM   1435 O "O5'" . DC  C 3 2   ? 13.845  11.608  4.186   1.00 80.79  ? 2   DC  D "O5'" 1 
ATOM   1436 C "C5'" . DC  C 3 2   ? 14.724  12.732  4.264   1.00 78.50  ? 2   DC  D "C5'" 1 
ATOM   1437 C "C4'" . DC  C 3 2   ? 15.384  13.027  2.928   1.00 75.66  ? 2   DC  D "C4'" 1 
ATOM   1438 O "O4'" . DC  C 3 2   ? 16.083  11.857  2.434   1.00 74.39  ? 2   DC  D "O4'" 1 
ATOM   1439 C "C3'" . DC  C 3 2   ? 14.462  13.518  1.816   1.00 74.04  ? 2   DC  D "C3'" 1 
ATOM   1440 O "O3'" . DC  C 3 2   ? 15.014  14.752  1.357   1.00 73.08  ? 2   DC  D "O3'" 1 
ATOM   1441 C "C2'" . DC  C 3 2   ? 14.497  12.396  0.777   1.00 73.37  ? 2   DC  D "C2'" 1 
ATOM   1442 C "C1'" . DC  C 3 2   ? 15.832  11.704  1.054   1.00 73.05  ? 2   DC  D "C1'" 1 
ATOM   1443 N N1    . DC  C 3 2   ? 15.949  10.227  0.713   1.00 71.42  ? 2   DC  D N1    1 
ATOM   1444 C C2    . DC  C 3 2   ? 17.111  9.732   0.078   1.00 70.16  ? 2   DC  D C2    1 
ATOM   1445 O O2    . DC  C 3 2   ? 18.040  10.484  -0.237  1.00 69.59  ? 2   DC  D O2    1 
ATOM   1446 N N3    . DC  C 3 2   ? 17.194  8.402   -0.187  1.00 70.09  ? 2   DC  D N3    1 
ATOM   1447 C C4    . DC  C 3 2   ? 16.194  7.572   0.140   1.00 70.35  ? 2   DC  D C4    1 
ATOM   1448 N N4    . DC  C 3 2   ? 16.347  6.276   -0.153  1.00 70.34  ? 2   DC  D N4    1 
ATOM   1449 C C5    . DC  C 3 2   ? 15.002  8.042   0.783   1.00 70.43  ? 2   DC  D C5    1 
ATOM   1450 C C6    . DC  C 3 2   ? 14.930  9.358   1.049   1.00 70.85  ? 2   DC  D C6    1 
ATOM   1451 P P     . DT  C 3 3   ? 14.564  15.677  0.128   1.00 72.13  ? 3   DT  D P     1 
ATOM   1452 O OP1   . DT  C 3 3   ? 14.979  17.063  0.464   1.00 73.01  ? 3   DT  D OP1   1 
ATOM   1453 O OP2   . DT  C 3 3   ? 13.164  15.390  -0.278  1.00 72.00  ? 3   DT  D OP2   1 
ATOM   1454 O "O5'" . DT  C 3 3   ? 15.501  15.140  -1.052  1.00 69.64  ? 3   DT  D "O5'" 1 
ATOM   1455 C "C5'" . DT  C 3 3   ? 16.916  15.310  -1.084  1.00 66.75  ? 3   DT  D "C5'" 1 
ATOM   1456 C "C4'" . DT  C 3 3   ? 17.465  14.796  -2.403  1.00 64.16  ? 3   DT  D "C4'" 1 
ATOM   1457 O "O4'" . DT  C 3 3   ? 17.480  13.346  -2.441  1.00 63.04  ? 3   DT  D "O4'" 1 
ATOM   1458 C "C3'" . DT  C 3 3   ? 16.708  15.268  -3.637  1.00 62.81  ? 3   DT  D "C3'" 1 
ATOM   1459 O "O3'" . DT  C 3 3   ? 17.639  15.906  -4.497  1.00 62.15  ? 3   DT  D "O3'" 1 
ATOM   1460 C "C2'" . DT  C 3 3   ? 16.062  14.008  -4.217  1.00 62.01  ? 3   DT  D "C2'" 1 
ATOM   1461 C "C1'" . DT  C 3 3   ? 16.946  12.894  -3.669  1.00 61.71  ? 3   DT  D "C1'" 1 
ATOM   1462 N N1    . DT  C 3 3   ? 16.284  11.548  -3.462  1.00 59.58  ? 3   DT  D N1    1 
ATOM   1463 C C2    . DT  C 3 3   ? 16.979  10.400  -3.833  1.00 58.29  ? 3   DT  D C2    1 
ATOM   1464 O O2    . DT  C 3 3   ? 18.092  10.413  -4.350  1.00 57.65  ? 3   DT  D O2    1 
ATOM   1465 N N3    . DT  C 3 3   ? 16.306  9.220   -3.577  1.00 57.41  ? 3   DT  D N3    1 
ATOM   1466 C C4    . DT  C 3 3   ? 15.042  9.066   -3.015  1.00 57.18  ? 3   DT  D C4    1 
ATOM   1467 O O4    . DT  C 3 3   ? 14.595  7.931   -2.852  1.00 56.49  ? 3   DT  D O4    1 
ATOM   1468 C C5    . DT  C 3 3   ? 14.377  10.306  -2.644  1.00 57.90  ? 3   DT  D C5    1 
ATOM   1469 C C7    . DT  C 3 3   ? 13.010  10.297  -2.020  1.00 58.03  ? 3   DT  D C7    1 
ATOM   1470 C C6    . DT  C 3 3   ? 15.021  11.463  -2.878  1.00 58.75  ? 3   DT  D C6    1 
ATOM   1471 P P     . DG  C 3 4   ? 17.295  16.623  -5.886  1.00 60.85  ? 4   DG  D P     1 
ATOM   1472 O OP1   . DG  C 3 4   ? 18.005  17.924  -5.909  1.00 61.59  ? 4   DG  D OP1   1 
ATOM   1473 O OP2   . DG  C 3 4   ? 15.832  16.559  -6.143  1.00 60.60  ? 4   DG  D OP2   1 
ATOM   1474 O "O5'" . DG  C 3 4   ? 18.001  15.651  -6.947  1.00 57.44  ? 4   DG  D "O5'" 1 
ATOM   1475 C "C5'" . DG  C 3 4   ? 19.393  15.385  -6.971  1.00 54.19  ? 4   DG  D "C5'" 1 
ATOM   1476 C "C4'" . DG  C 3 4   ? 19.711  14.314  -8.007  1.00 52.06  ? 4   DG  D "C4'" 1 
ATOM   1477 O "O4'" . DG  C 3 4   ? 19.183  13.015  -7.627  1.00 51.11  ? 4   DG  D "O4'" 1 
ATOM   1478 C "C3'" . DG  C 3 4   ? 19.219  14.566  -9.427  1.00 50.71  ? 4   DG  D "C3'" 1 
ATOM   1479 O "O3'" . DG  C 3 4   ? 20.286  14.254  -10.330 1.00 49.73  ? 4   DG  D "O3'" 1 
ATOM   1480 C "C2'" . DG  C 3 4   ? 18.022  13.628  -9.581  1.00 50.45  ? 4   DG  D "C2'" 1 
ATOM   1481 C "C1'" . DG  C 3 4   ? 18.428  12.460  -8.688  1.00 50.07  ? 4   DG  D "C1'" 1 
ATOM   1482 N N9    . DG  C 3 4   ? 17.317  11.754  -8.051  1.00 49.27  ? 4   DG  D N9    1 
ATOM   1483 C C8    . DG  C 3 4   ? 16.264  12.313  -7.366  1.00 48.97  ? 4   DG  D C8    1 
ATOM   1484 N N7    . DG  C 3 4   ? 15.419  11.449  -6.880  1.00 48.52  ? 4   DG  D N7    1 
ATOM   1485 C C5    . DG  C 3 4   ? 15.981  10.222  -7.218  1.00 47.94  ? 4   DG  D C5    1 
ATOM   1486 C C6    . DG  C 3 4   ? 15.537  8.904   -6.921  1.00 46.54  ? 4   DG  D C6    1 
ATOM   1487 O O6    . DG  C 3 4   ? 14.524  8.586   -6.297  1.00 46.25  ? 4   DG  D O6    1 
ATOM   1488 N N1    . DG  C 3 4   ? 16.369  7.915   -7.455  1.00 45.61  ? 4   DG  D N1    1 
ATOM   1489 C C2    . DG  C 3 4   ? 17.501  8.172   -8.187  1.00 45.33  ? 4   DG  D C2    1 
ATOM   1490 N N2    . DG  C 3 4   ? 18.183  7.094   -8.606  1.00 44.82  ? 4   DG  D N2    1 
ATOM   1491 N N3    . DG  C 3 4   ? 17.963  9.405   -8.430  1.00 46.27  ? 4   DG  D N3    1 
ATOM   1492 C C4    . DG  C 3 4   ? 17.150  10.385  -7.940  1.00 48.25  ? 4   DG  D C4    1 
ATOM   1493 P P     . DC  C 3 5   ? 20.218  14.734  -11.865 1.00 49.15  ? 5   DC  D P     1 
ATOM   1494 O OP1   . DC  C 3 5   ? 21.612  14.977  -12.321 1.00 49.46  ? 5   DC  D OP1   1 
ATOM   1495 O OP2   . DC  C 3 5   ? 19.157  15.761  -12.012 1.00 47.54  ? 5   DC  D OP2   1 
ATOM   1496 O "O5'" . DC  C 3 5   ? 19.658  13.428  -12.615 1.00 45.75  ? 5   DC  D "O5'" 1 
ATOM   1497 C "C5'" . DC  C 3 5   ? 20.278  12.162  -12.564 1.00 42.88  ? 5   DC  D "C5'" 1 
ATOM   1498 C "C4'" . DC  C 3 5   ? 19.284  11.097  -13.004 1.00 40.11  ? 5   DC  D "C4'" 1 
ATOM   1499 O "O4'" . DC  C 3 5   ? 18.299  10.801  -11.988 1.00 38.53  ? 5   DC  D "O4'" 1 
ATOM   1500 C "C3'" . DC  C 3 5   ? 18.502  11.410  -14.272 1.00 38.58  ? 5   DC  D "C3'" 1 
ATOM   1501 O "O3'" . DC  C 3 5   ? 18.662  10.283  -15.127 1.00 37.70  ? 5   DC  D "O3'" 1 
ATOM   1502 C "C2'" . DC  C 3 5   ? 17.050  11.564  -13.823 1.00 37.81  ? 5   DC  D "C2'" 1 
ATOM   1503 C "C1'" . DC  C 3 5   ? 17.080  10.592  -12.652 1.00 37.98  ? 5   DC  D "C1'" 1 
ATOM   1504 N N1    . DC  C 3 5   ? 15.942  10.503  -11.703 1.00 37.95  ? 5   DC  D N1    1 
ATOM   1505 C C2    . DC  C 3 5   ? 15.681  9.269   -11.065 1.00 37.97  ? 5   DC  D C2    1 
ATOM   1506 O O2    . DC  C 3 5   ? 16.400  8.285   -11.302 1.00 38.59  ? 5   DC  D O2    1 
ATOM   1507 N N3    . DC  C 3 5   ? 14.650  9.195   -10.178 1.00 38.49  ? 5   DC  D N3    1 
ATOM   1508 C C4    . DC  C 3 5   ? 13.871  10.268  -9.941  1.00 39.14  ? 5   DC  D C4    1 
ATOM   1509 N N4    . DC  C 3 5   ? 12.880  10.147  -9.062  1.00 38.18  ? 5   DC  D N4    1 
ATOM   1510 C C5    . DC  C 3 5   ? 14.122  11.533  -10.580 1.00 39.46  ? 5   DC  D C5    1 
ATOM   1511 C C6    . DC  C 3 5   ? 15.131  11.592  -11.463 1.00 38.56  ? 5   DC  D C6    1 
ATOM   1512 P P     . DG  C 3 6   ? 18.967  10.473  -16.667 1.00 35.03  ? 6   DG  D P     1 
ATOM   1513 O OP1   . DG  C 3 6   ? 19.510  9.199   -17.143 1.00 32.75  ? 6   DG  D OP1   1 
ATOM   1514 O OP2   . DG  C 3 6   ? 19.784  11.719  -16.835 1.00 35.19  ? 6   DG  D OP2   1 
ATOM   1515 O "O5'" . DG  C 3 6   ? 17.545  10.691  -17.350 1.00 35.61  ? 6   DG  D "O5'" 1 
ATOM   1516 C "C5'" . DG  C 3 6   ? 16.895  11.970  -17.484 1.00 34.94  ? 6   DG  D "C5'" 1 
ATOM   1517 C "C4'" . DG  C 3 6   ? 15.566  11.774  -18.195 1.00 34.79  ? 6   DG  D "C4'" 1 
ATOM   1518 O "O4'" . DG  C 3 6   ? 14.656  10.987  -17.392 1.00 33.49  ? 6   DG  D "O4'" 1 
ATOM   1519 C "C3'" . DG  C 3 6   ? 14.823  13.053  -18.563 1.00 34.22  ? 6   DG  D "C3'" 1 
ATOM   1520 O "O3'" . DG  C 3 6   ? 14.234  12.840  -19.830 1.00 34.53  ? 6   DG  D "O3'" 1 
ATOM   1521 C "C2'" . DG  C 3 6   ? 13.755  13.166  -17.471 1.00 33.98  ? 6   DG  D "C2'" 1 
ATOM   1522 C "C1'" . DG  C 3 6   ? 13.428  11.677  -17.282 1.00 32.39  ? 6   DG  D "C1'" 1 
ATOM   1523 N N9    . DG  C 3 6   ? 12.764  11.297  -16.045 1.00 30.57  ? 6   DG  D N9    1 
ATOM   1524 C C8    . DG  C 3 6   ? 12.799  11.914  -14.812 1.00 31.42  ? 6   DG  D C8    1 
ATOM   1525 N N7    . DG  C 3 6   ? 12.032  11.330  -13.920 1.00 31.95  ? 6   DG  D N7    1 
ATOM   1526 C C5    . DG  C 3 6   ? 11.532  10.217  -14.593 1.00 31.73  ? 6   DG  D C5    1 
ATOM   1527 C C6    . DG  C 3 6   ? 10.729  9.132   -14.138 1.00 31.24  ? 6   DG  D C6    1 
ATOM   1528 O O6    . DG  C 3 6   ? 10.213  9.010   -13.021 1.00 32.75  ? 6   DG  D O6    1 
ATOM   1529 N N1    . DG  C 3 6   ? 10.443  8.209   -15.147 1.00 29.53  ? 6   DG  D N1    1 
ATOM   1530 C C2    . DG  C 3 6   ? 10.932  8.282   -16.431 1.00 28.91  ? 6   DG  D C2    1 
ATOM   1531 N N2    . DG  C 3 6   ? 10.561  7.332   -17.314 1.00 29.52  ? 6   DG  D N2    1 
ATOM   1532 N N3    . DG  C 3 6   ? 11.672  9.296   -16.870 1.00 29.50  ? 6   DG  D N3    1 
ATOM   1533 C C4    . DG  C 3 6   ? 11.967  10.198  -15.904 1.00 29.95  ? 6   DG  D C4    1 
ATOM   1534 P P     . DC  C 3 7   ? 14.020  14.025  -20.918 1.00 36.12  ? 7   DC  D P     1 
ATOM   1535 O OP1   . DC  C 3 7   ? 15.286  14.169  -21.664 1.00 35.38  ? 7   DC  D OP1   1 
ATOM   1536 O OP2   . DC  C 3 7   ? 13.451  15.195  -20.212 1.00 36.32  ? 7   DC  D OP2   1 
ATOM   1537 O "O5'" . DC  C 3 7   ? 12.910  13.434  -21.894 1.00 34.51  ? 7   DC  D "O5'" 1 
ATOM   1538 C "C5'" . DC  C 3 7   ? 13.241  12.298  -22.713 1.00 34.13  ? 7   DC  D "C5'" 1 
ATOM   1539 C "C4'" . DC  C 3 7   ? 12.125  11.272  -22.617 1.00 34.46  ? 7   DC  D "C4'" 1 
ATOM   1540 O "O4'" . DC  C 3 7   ? 11.866  10.935  -21.229 1.00 33.77  ? 7   DC  D "O4'" 1 
ATOM   1541 C "C3'" . DC  C 3 7   ? 10.789  11.822  -23.098 1.00 35.31  ? 7   DC  D "C3'" 1 
ATOM   1542 O "O3'" . DC  C 3 7   ? 10.723  11.667  -24.502 1.00 39.00  ? 7   DC  D "O3'" 1 
ATOM   1543 C "C2'" . DC  C 3 7   ? 9.766   10.973  -22.349 1.00 34.48  ? 7   DC  D "C2'" 1 
ATOM   1544 C "C1'" . DC  C 3 7   ? 10.516  10.551  -21.097 1.00 34.25  ? 7   DC  D "C1'" 1 
ATOM   1545 N N1    . DC  C 3 7   ? 10.028  11.107  -19.811 1.00 35.73  ? 7   DC  D N1    1 
ATOM   1546 C C2    . DC  C 3 7   ? 9.175   10.334  -18.999 1.00 37.06  ? 7   DC  D C2    1 
ATOM   1547 O O2    . DC  C 3 7   ? 8.730   9.263   -19.414 1.00 39.00  ? 7   DC  D O2    1 
ATOM   1548 N N3    . DC  C 3 7   ? 8.803   10.825  -17.792 1.00 37.31  ? 7   DC  D N3    1 
ATOM   1549 C C4    . DC  C 3 7   ? 9.269   12.008  -17.367 1.00 36.86  ? 7   DC  D C4    1 
ATOM   1550 N N4    . DC  C 3 7   ? 8.931   12.407  -16.137 1.00 36.85  ? 7   DC  D N4    1 
ATOM   1551 C C5    . DC  C 3 7   ? 10.120  12.824  -18.179 1.00 36.79  ? 7   DC  D C5    1 
ATOM   1552 C C6    . DC  C 3 7   ? 10.461  12.346  -19.393 1.00 36.17  ? 7   DC  D C6    1 
ATOM   1553 P P     . DG  C 3 8   ? 9.610   12.413  -25.432 1.00 41.66  ? 8   DG  D P     1 
ATOM   1554 O OP1   . DG  C 3 8   ? 10.084  12.279  -26.824 1.00 41.49  ? 8   DG  D OP1   1 
ATOM   1555 O OP2   . DG  C 3 8   ? 9.267   13.729  -24.860 1.00 41.41  ? 8   DG  D OP2   1 
ATOM   1556 O "O5'" . DG  C 3 8   ? 8.360   11.448  -25.188 1.00 43.63  ? 8   DG  D "O5'" 1 
ATOM   1557 C "C5'" . DG  C 3 8   ? 8.354   10.065  -25.552 1.00 45.47  ? 8   DG  D "C5'" 1 
ATOM   1558 C "C4'" . DG  C 3 8   ? 7.065   9.451   -25.023 1.00 46.92  ? 8   DG  D "C4'" 1 
ATOM   1559 O "O4'" . DG  C 3 8   ? 6.989   9.607   -23.580 1.00 46.26  ? 8   DG  D "O4'" 1 
ATOM   1560 C "C3'" . DG  C 3 8   ? 5.777   10.056  -25.579 1.00 49.23  ? 8   DG  D "C3'" 1 
ATOM   1561 O "O3'" . DG  C 3 8   ? 4.936   8.970   -25.937 1.00 52.33  ? 8   DG  D "O3'" 1 
ATOM   1562 C "C2'" . DG  C 3 8   ? 5.202   10.890  -24.428 1.00 47.80  ? 8   DG  D "C2'" 1 
ATOM   1563 C "C1'" . DG  C 3 8   ? 5.822   10.264  -23.173 1.00 46.20  ? 8   DG  D "C1'" 1 
ATOM   1564 N N9    . DG  C 3 8   ? 6.151   11.224  -22.114 1.00 43.81  ? 8   DG  D N9    1 
ATOM   1565 C C8    . DG  C 3 8   ? 6.796   12.433  -22.262 1.00 42.92  ? 8   DG  D C8    1 
ATOM   1566 N N7    . DG  C 3 8   ? 6.917   13.093  -21.141 1.00 42.68  ? 8   DG  D N7    1 
ATOM   1567 C C5    . DG  C 3 8   ? 6.307   12.300  -20.188 1.00 41.74  ? 8   DG  D C5    1 
ATOM   1568 C C6    . DG  C 3 8   ? 6.079   12.532  -18.803 1.00 40.90  ? 8   DG  D C6    1 
ATOM   1569 O O6    . DG  C 3 8   ? 6.421   13.519  -18.112 1.00 40.33  ? 8   DG  D O6    1 
ATOM   1570 N N1    . DG  C 3 8   ? 5.362   11.478  -18.208 1.00 40.66  ? 8   DG  D N1    1 
ATOM   1571 C C2    . DG  C 3 8   ? 4.927   10.354  -18.872 1.00 41.29  ? 8   DG  D C2    1 
ATOM   1572 N N2    . DG  C 3 8   ? 4.223   9.471   -18.160 1.00 41.33  ? 8   DG  D N2    1 
ATOM   1573 N N3    . DG  C 3 8   ? 5.121   10.138  -20.170 1.00 42.32  ? 8   DG  D N3    1 
ATOM   1574 C C4    . DG  C 3 8   ? 5.824   11.140  -20.773 1.00 42.42  ? 8   DG  D C4    1 
ATOM   1575 P P     . DC  C 3 9   ? 3.385   9.051   -26.347 1.00 53.34  ? 9   DC  D P     1 
ATOM   1576 O OP1   . DC  C 3 9   ? 3.207   7.912   -27.272 1.00 52.80  ? 9   DC  D OP1   1 
ATOM   1577 O OP2   . DC  C 3 9   ? 3.101   10.438  -26.801 1.00 53.07  ? 9   DC  D OP2   1 
ATOM   1578 O "O5'" . DC  C 3 9   ? 2.659   8.783   -24.944 1.00 55.65  ? 9   DC  D "O5'" 1 
ATOM   1579 C "C5'" . DC  C 3 9   ? 3.021   7.627   -24.169 1.00 56.80  ? 9   DC  D "C5'" 1 
ATOM   1580 C "C4'" . DC  C 3 9   ? 2.149   7.427   -22.940 1.00 58.28  ? 9   DC  D "C4'" 1 
ATOM   1581 O "O4'" . DC  C 3 9   ? 2.508   8.353   -21.882 1.00 57.19  ? 9   DC  D "O4'" 1 
ATOM   1582 C "C3'" . DC  C 3 9   ? 0.655   7.585   -23.166 1.00 60.22  ? 9   DC  D "C3'" 1 
ATOM   1583 O "O3'" . DC  C 3 9   ? -0.059  6.507   -22.579 1.00 63.21  ? 9   DC  D "O3'" 1 
ATOM   1584 C "C2'" . DC  C 3 9   ? 0.318   8.940   -22.544 1.00 58.39  ? 9   DC  D "C2'" 1 
ATOM   1585 C "C1'" . DC  C 3 9   ? 1.391   9.119   -21.468 1.00 55.97  ? 9   DC  D "C1'" 1 
ATOM   1586 N N1    . DC  C 3 9   ? 1.873   10.529  -21.202 1.00 52.34  ? 9   DC  D N1    1 
ATOM   1587 C C2    . DC  C 3 9   ? 1.746   11.111  -19.927 1.00 50.50  ? 9   DC  D C2    1 
ATOM   1588 O O2    . DC  C 3 9   ? 1.214   10.487  -19.009 1.00 50.34  ? 9   DC  D O2    1 
ATOM   1589 N N3    . DC  C 3 9   ? 2.212   12.374  -19.733 1.00 50.33  ? 9   DC  D N3    1 
ATOM   1590 C C4    . DC  C 3 9   ? 2.822   13.043  -20.719 1.00 50.74  ? 9   DC  D C4    1 
ATOM   1591 N N4    . DC  C 3 9   ? 3.303   14.267  -20.462 1.00 51.32  ? 9   DC  D N4    1 
ATOM   1592 C C5    . DC  C 3 9   ? 2.979   12.471  -22.022 1.00 50.99  ? 9   DC  D C5    1 
ATOM   1593 C C6    . DC  C 3 9   ? 2.492   11.234  -22.205 1.00 51.19  ? 9   DC  D C6    1 
ATOM   1594 P P     . DT  C 3 10  ? -1.559  6.200   -23.057 1.00 66.00  ? 10  DT  D P     1 
ATOM   1595 O OP1   . DT  C 3 10  ? -1.816  4.750   -22.895 1.00 66.59  ? 10  DT  D OP1   1 
ATOM   1596 O OP2   . DT  C 3 10  ? -1.795  6.824   -24.386 1.00 66.07  ? 10  DT  D OP2   1 
ATOM   1597 O "O5'" . DT  C 3 10  ? -2.399  7.014   -21.958 1.00 66.72  ? 10  DT  D "O5'" 1 
ATOM   1598 C "C5'" . DT  C 3 10  ? -2.320  6.658   -20.576 1.00 66.76  ? 10  DT  D "C5'" 1 
ATOM   1599 C "C4'" . DT  C 3 10  ? -2.746  7.807   -19.685 1.00 66.65  ? 10  DT  D "C4'" 1 
ATOM   1600 O "O4'" . DT  C 3 10  ? -1.916  8.957   -19.955 1.00 65.79  ? 10  DT  D "O4'" 1 
ATOM   1601 C "C3'" . DT  C 3 10  ? -4.161  8.294   -19.948 1.00 67.28  ? 10  DT  D "C3'" 1 
ATOM   1602 O "O3'" . DT  C 3 10  ? -5.056  7.672   -19.039 1.00 69.06  ? 10  DT  D "O3'" 1 
ATOM   1603 C "C2'" . DT  C 3 10  ? -4.099  9.812   -19.797 1.00 65.98  ? 10  DT  D "C2'" 1 
ATOM   1604 C "C1'" . DT  C 3 10  ? -2.631  10.092  -19.523 1.00 64.61  ? 10  DT  D "C1'" 1 
ATOM   1605 N N1    . DT  C 3 10  ? -2.024  11.354  -20.090 1.00 61.69  ? 10  DT  D N1    1 
ATOM   1606 C C2    . DT  C 3 10  ? -1.766  12.412  -19.236 1.00 60.33  ? 10  DT  D C2    1 
ATOM   1607 O O2    . DT  C 3 10  ? -2.061  12.438  -18.053 1.00 61.14  ? 10  DT  D O2    1 
ATOM   1608 N N3    . DT  C 3 10  ? -1.132  13.472  -19.823 1.00 58.98  ? 10  DT  D N3    1 
ATOM   1609 C C4    . DT  C 3 10  ? -0.719  13.592  -21.136 1.00 58.80  ? 10  DT  D C4    1 
ATOM   1610 O O4    . DT  C 3 10  ? -0.166  14.633  -21.487 1.00 58.93  ? 10  DT  D O4    1 
ATOM   1611 C C5    . DT  C 3 10  ? -1.014  12.457  -21.975 1.00 59.29  ? 10  DT  D C5    1 
ATOM   1612 C C7    . DT  C 3 10  ? -0.629  12.468  -23.425 1.00 59.57  ? 10  DT  D C7    1 
ATOM   1613 C C6    . DT  C 3 10  ? -1.644  11.410  -21.423 1.00 60.05  ? 10  DT  D C6    1 
ATOM   1614 P P     . DG  C 3 11  ? -6.623  7.572   -19.358 1.00 70.34  ? 11  DG  D P     1 
ATOM   1615 O OP1   . DG  C 3 11  ? -7.181  6.393   -18.643 1.00 70.33  ? 11  DG  D OP1   1 
ATOM   1616 O OP2   . DG  C 3 11  ? -6.815  7.687   -20.830 1.00 70.10  ? 11  DG  D OP2   1 
ATOM   1617 O "O5'" . DG  C 3 11  ? -7.139  8.907   -18.634 1.00 69.98  ? 11  DG  D "O5'" 1 
ATOM   1618 C "C5'" . DG  C 3 11  ? -7.089  9.002   -17.193 1.00 69.20  ? 11  DG  D "C5'" 1 
ATOM   1619 C "C4'" . DG  C 3 11  ? -7.432  10.397  -16.691 1.00 68.18  ? 11  DG  D "C4'" 1 
ATOM   1620 O "O4'" . DG  C 3 11  ? -6.473  11.355  -17.201 1.00 67.17  ? 11  DG  D "O4'" 1 
ATOM   1621 C "C3'" . DG  C 3 11  ? -8.828  10.946  -17.003 1.00 68.02  ? 11  DG  D "C3'" 1 
ATOM   1622 O "O3'" . DG  C 3 11  ? -9.368  11.535  -15.800 1.00 69.37  ? 11  DG  D "O3'" 1 
ATOM   1623 C "C2'" . DG  C 3 11  ? -8.588  11.979  -18.107 1.00 66.59  ? 11  DG  D "C2'" 1 
ATOM   1624 C "C1'" . DG  C 3 11  ? -7.145  12.423  -17.844 1.00 65.29  ? 11  DG  D "C1'" 1 
ATOM   1625 N N9    . DG  C 3 11  ? -6.338  12.859  -18.992 1.00 61.69  ? 11  DG  D N9    1 
ATOM   1626 C C8    . DG  C 3 11  ? -6.218  12.271  -20.236 1.00 59.54  ? 11  DG  D C8    1 
ATOM   1627 N N7    . DG  C 3 11  ? -5.383  12.885  -21.035 1.00 58.35  ? 11  DG  D N7    1 
ATOM   1628 C C5    . DG  C 3 11  ? -4.907  13.957  -20.276 1.00 57.96  ? 11  DG  D C5    1 
ATOM   1629 C C6    . DG  C 3 11  ? -3.988  14.998  -20.602 1.00 56.10  ? 11  DG  D C6    1 
ATOM   1630 O O6    . DG  C 3 11  ? -3.405  15.196  -21.675 1.00 55.36  ? 11  DG  D O6    1 
ATOM   1631 N N1    . DG  C 3 11  ? -3.808  15.907  -19.556 1.00 56.08  ? 11  DG  D N1    1 
ATOM   1632 C C2    . DG  C 3 11  ? -4.418  15.799  -18.318 1.00 57.40  ? 11  DG  D C2    1 
ATOM   1633 N N2    . DG  C 3 11  ? -4.125  16.751  -17.419 1.00 57.82  ? 11  DG  D N2    1 
ATOM   1634 N N3    . DG  C 3 11  ? -5.283  14.838  -17.992 1.00 58.16  ? 11  DG  D N3    1 
ATOM   1635 C C4    . DG  C 3 11  ? -5.501  13.964  -19.020 1.00 59.51  ? 11  DG  D C4    1 
ATOM   1636 P P     . DG  C 3 12  ? -10.912 11.871  -15.471 1.00 69.59  ? 12  DG  D P     1 
ATOM   1637 O OP1   . DG  C 3 12  ? -11.014 11.887  -13.987 1.00 69.59  ? 12  DG  D OP1   1 
ATOM   1638 O OP2   . DG  C 3 12  ? -11.801 10.963  -16.249 1.00 69.80  ? 12  DG  D OP2   1 
ATOM   1639 O "O5'" . DG  C 3 12  ? -11.078 13.362  -16.061 1.00 67.89  ? 12  DG  D "O5'" 1 
ATOM   1640 C "C5'" . DG  C 3 12  ? -10.907 14.530  -15.249 1.00 65.74  ? 12  DG  D "C5'" 1 
ATOM   1641 C "C4'" . DG  C 3 12  ? -10.569 15.766  -16.063 1.00 63.87  ? 12  DG  D "C4'" 1 
ATOM   1642 O "O4'" . DG  C 3 12  ? -9.601  15.427  -17.092 1.00 61.79  ? 12  DG  D "O4'" 1 
ATOM   1643 C "C3'" . DG  C 3 12  ? -11.744 16.435  -16.788 1.00 63.74  ? 12  DG  D "C3'" 1 
ATOM   1644 O "O3'" . DG  C 3 12  ? -12.047 17.717  -16.216 1.00 64.70  ? 12  DG  D "O3'" 1 
ATOM   1645 C "C2'" . DG  C 3 12  ? -11.272 16.583  -18.238 1.00 61.80  ? 12  DG  D "C2'" 1 
ATOM   1646 C "C1'" . DG  C 3 12  ? -9.765  16.397  -18.100 1.00 59.61  ? 12  DG  D "C1'" 1 
ATOM   1647 N N9    . DG  C 3 12  ? -9.067  16.012  -19.326 1.00 55.24  ? 12  DG  D N9    1 
ATOM   1648 C C8    . DG  C 3 12  ? -9.362  14.977  -20.189 1.00 53.83  ? 12  DG  D C8    1 
ATOM   1649 N N7    . DG  C 3 12  ? -8.590  14.933  -21.239 1.00 52.08  ? 12  DG  D N7    1 
ATOM   1650 C C5    . DG  C 3 12  ? -7.711  15.991  -21.059 1.00 51.06  ? 12  DG  D C5    1 
ATOM   1651 C C6    . DG  C 3 12  ? -6.622  16.437  -21.858 1.00 48.90  ? 12  DG  D C6    1 
ATOM   1652 O O6    . DG  C 3 12  ? -6.211  15.971  -22.929 1.00 48.47  ? 12  DG  D O6    1 
ATOM   1653 N N1    . DG  C 3 12  ? -6.013  17.575  -21.333 1.00 48.27  ? 12  DG  D N1    1 
ATOM   1654 C C2    . DG  C 3 12  ? -6.373  18.185  -20.152 1.00 49.19  ? 12  DG  D C2    1 
ATOM   1655 N N2    . DG  C 3 12  ? -5.657  19.258  -19.778 1.00 49.78  ? 12  DG  D N2    1 
ATOM   1656 N N3    . DG  C 3 12  ? -7.369  17.759  -19.378 1.00 50.74  ? 12  DG  D N3    1 
ATOM   1657 C C4    . DG  C 3 12  ? -8.008  16.678  -19.896 1.00 52.07  ? 12  DG  D C4    1 
HETATM 1658 C C1    . EDO D 4 .   ? 7.207   11.713  -10.777 1.00 82.82  ? 101 EDO C C1    1 
HETATM 1659 O O1    . EDO D 4 .   ? 7.744   11.495  -12.032 1.00 83.56  ? 101 EDO C O1    1 
HETATM 1660 C C2    . EDO D 4 .   ? 6.331   10.653  -10.195 1.00 82.04  ? 101 EDO C C2    1 
HETATM 1661 O O2    . EDO D 4 .   ? 6.242   9.453   -10.872 1.00 81.55  ? 101 EDO C O2    1 
HETATM 1662 O O     . HOH E 5 .   ? 13.031  -23.624 -7.779  1.00 52.52  ? 601 HOH A O     1 
HETATM 1663 O O     . HOH E 5 .   ? 2.239   -23.973 -15.640 1.00 60.48  ? 602 HOH A O     1 
HETATM 1664 O O     . HOH E 5 .   ? 15.625  -21.956 -18.098 1.00 36.54  ? 603 HOH A O     1 
HETATM 1665 O O     . HOH E 5 .   ? 14.393  -19.982 -15.160 1.00 54.04  ? 604 HOH A O     1 
HETATM 1666 O O     . HOH E 5 .   ? 22.285  -13.786 -20.760 1.00 39.86  ? 605 HOH A O     1 
HETATM 1667 O O     . HOH E 5 .   ? 7.352   -5.841  -5.329  1.00 33.32  ? 606 HOH A O     1 
HETATM 1668 O O     . HOH E 5 .   ? -5.099  -25.380 -9.636  1.00 71.57  ? 607 HOH A O     1 
HETATM 1669 O O     . HOH E 5 .   ? 8.800   -10.271 -1.079  1.00 36.05  ? 608 HOH A O     1 
HETATM 1670 O O     . HOH E 5 .   ? 17.287  -0.382  -12.047 1.00 26.53  ? 609 HOH A O     1 
HETATM 1671 O O     . HOH E 5 .   ? -5.573  -10.739 -8.771  1.00 37.67  ? 610 HOH A O     1 
HETATM 1672 O O     . HOH E 5 .   ? 3.993   -6.517  -18.052 1.00 40.14  ? 611 HOH A O     1 
HETATM 1673 O O     . HOH E 5 .   ? 4.800   -6.918  -15.467 1.00 37.46  ? 612 HOH A O     1 
HETATM 1674 O O     . HOH E 5 .   ? 12.241  -10.263 -2.731  1.00 42.87  ? 613 HOH A O     1 
HETATM 1675 O O     . HOH E 5 .   ? 7.415   -19.423 -7.636  1.00 36.86  ? 614 HOH A O     1 
HETATM 1676 O O     . HOH E 5 .   ? 18.275  -18.695 -7.271  1.00 42.41  ? 615 HOH A O     1 
HETATM 1677 O O     . HOH E 5 .   ? 23.119  -4.338  -5.096  1.00 42.29  ? 616 HOH A O     1 
HETATM 1678 O O     . HOH E 5 .   ? -8.559  -16.623 -14.057 1.00 53.38  ? 617 HOH A O     1 
HETATM 1679 O O     . HOH E 5 .   ? 6.463   -21.390 -3.326  1.00 39.02  ? 618 HOH A O     1 
HETATM 1680 O O     . HOH E 5 .   ? 26.166  -17.073 -9.352  1.00 52.30  ? 619 HOH A O     1 
HETATM 1681 O O     . HOH E 5 .   ? 7.857   2.571   -27.099 1.00 44.25  ? 620 HOH A O     1 
HETATM 1682 O O     . HOH E 5 .   ? 22.080  -18.618 -8.709  1.00 65.36  ? 621 HOH A O     1 
HETATM 1683 O O     . HOH E 5 .   ? 8.440   -3.362  -5.194  1.00 39.04  ? 622 HOH A O     1 
HETATM 1684 O O     . HOH E 5 .   ? 11.377  -17.304 -21.314 1.00 33.75  ? 623 HOH A O     1 
HETATM 1685 O O     . HOH E 5 .   ? 33.699  -12.667 -8.842  1.00 46.46  ? 624 HOH A O     1 
HETATM 1686 O O     . HOH E 5 .   ? 13.775  -8.919  -29.619 1.00 45.12  ? 625 HOH A O     1 
HETATM 1687 O O     . HOH E 5 .   ? 13.284  -15.915 -22.567 1.00 48.43  ? 626 HOH A O     1 
HETATM 1688 O O     . HOH E 5 .   ? 3.535   -24.019 -6.349  1.00 48.35  ? 627 HOH A O     1 
HETATM 1689 O O     . HOH E 5 .   ? 14.830  -2.643  -3.027  1.00 34.78  ? 628 HOH A O     1 
HETATM 1690 O O     . HOH E 5 .   ? -0.074  -10.244 -3.467  1.00 40.71  ? 629 HOH A O     1 
HETATM 1691 O O     . HOH E 5 .   ? 3.002   -14.940 -0.429  1.00 37.09  ? 630 HOH A O     1 
HETATM 1692 O O     . HOH E 5 .   ? 8.059   -21.662 -1.125  1.00 49.99  ? 631 HOH A O     1 
HETATM 1693 O O     . HOH E 5 .   ? 20.389  11.652  -28.568 1.00 54.60  ? 632 HOH A O     1 
HETATM 1694 O O     . HOH E 5 .   ? 17.474  -2.970  -32.209 1.00 50.02  ? 633 HOH A O     1 
HETATM 1695 O O     . HOH E 5 .   ? 20.406  -14.142 -22.760 1.00 38.53  ? 634 HOH A O     1 
HETATM 1696 O O     . HOH E 5 .   ? 19.075  -14.579 -29.382 1.00 57.38  ? 635 HOH A O     1 
HETATM 1697 O O     . HOH E 5 .   ? 2.341   -8.025  -0.319  1.00 47.43  ? 636 HOH A O     1 
HETATM 1698 O O     . HOH E 5 .   ? 0.759   -13.988 1.357   1.00 44.71  ? 637 HOH A O     1 
HETATM 1699 O O     . HOH E 5 .   ? 5.452   -8.736  4.684   1.00 65.64  ? 638 HOH A O     1 
HETATM 1700 O O     . HOH E 5 .   ? -5.829  -17.387 0.145   1.00 54.77  ? 639 HOH A O     1 
HETATM 1701 O O     . HOH E 5 .   ? 16.222  -12.611 -1.451  1.00 43.52  ? 640 HOH A O     1 
HETATM 1702 O O     . HOH E 5 .   ? 20.721  -4.819  -5.873  1.00 24.38  ? 641 HOH A O     1 
HETATM 1703 O O     . HOH E 5 .   ? 14.390  -2.786  -35.394 1.00 72.79  ? 642 HOH A O     1 
HETATM 1704 O O     . HOH E 5 .   ? -5.518  -13.850 -3.035  1.00 57.89  ? 643 HOH A O     1 
HETATM 1705 O O     . HOH E 5 .   ? 29.551  -4.898  -6.324  1.00 70.77  ? 644 HOH A O     1 
HETATM 1706 O O     . HOH E 5 .   ? 21.907  7.862   -32.093 1.00 52.65  ? 645 HOH A O     1 
HETATM 1707 O O     . HOH E 5 .   ? 15.714  -16.099 -27.268 1.00 52.56  ? 646 HOH A O     1 
HETATM 1708 O O     . HOH E 5 .   ? 29.310  -17.220 -20.553 1.00 46.29  ? 647 HOH A O     1 
HETATM 1709 O O     . HOH E 5 .   ? 2.852   -12.141 -20.973 1.00 45.41  ? 648 HOH A O     1 
HETATM 1710 O O     . HOH E 5 .   ? 9.453   -3.296  -30.650 1.00 41.73  ? 649 HOH A O     1 
HETATM 1711 O O     . HOH E 5 .   ? 24.288  8.726   -25.600 1.00 45.18  ? 650 HOH A O     1 
HETATM 1712 O O     . HOH E 5 .   ? 33.840  -5.174  -17.963 1.00 61.76  ? 651 HOH A O     1 
HETATM 1713 O O     . HOH E 5 .   ? 23.354  3.930   -13.001 1.00 42.43  ? 652 HOH A O     1 
HETATM 1714 O O     . HOH E 5 .   ? 22.714  8.967   -14.443 1.00 52.42  ? 653 HOH A O     1 
HETATM 1715 O O     . HOH E 5 .   ? 25.278  2.075   -12.874 1.00 46.80  ? 654 HOH A O     1 
HETATM 1716 O O     . HOH E 5 .   ? 18.491  1.950   -12.923 1.00 39.16  ? 655 HOH A O     1 
HETATM 1717 O O     . HOH E 5 .   ? 5.173   -6.246  -12.833 1.00 48.91  ? 656 HOH A O     1 
HETATM 1718 O O     . HOH E 5 .   ? 29.541  -12.544 -4.343  1.00 67.09  ? 657 HOH A O     1 
HETATM 1719 O O     . HOH E 5 .   ? 31.548  -2.505  -20.998 1.00 47.92  ? 658 HOH A O     1 
HETATM 1720 O O     . HOH E 5 .   ? -2.776  -4.872  -7.458  1.00 60.13  ? 659 HOH A O     1 
HETATM 1721 O O     . HOH E 5 .   ? 29.975  1.250   -20.755 1.00 42.35  ? 660 HOH A O     1 
HETATM 1722 O O     . HOH E 5 .   ? 8.396   6.253   -25.258 1.00 56.73  ? 661 HOH A O     1 
HETATM 1723 O O     . HOH E 5 .   ? 30.615  -4.338  -10.483 1.00 55.52  ? 662 HOH A O     1 
HETATM 1724 O O     . HOH E 5 .   ? 29.194  -4.705  -27.264 1.00 65.77  ? 663 HOH A O     1 
HETATM 1725 O O     . HOH E 5 .   ? 8.177   -0.827  -1.801  1.00 63.18  ? 664 HOH A O     1 
HETATM 1726 O O     . HOH F 5 .   ? 14.227  -3.533  -11.547 1.00 29.07  ? 201 HOH C O     1 
HETATM 1727 O O     . HOH F 5 .   ? 14.100  -0.606  -4.885  1.00 43.05  ? 202 HOH C O     1 
HETATM 1728 O O     . HOH F 5 .   ? 9.552   0.562   -5.933  1.00 41.75  ? 203 HOH C O     1 
HETATM 1729 O O     . HOH F 5 .   ? 6.099   -0.867  -8.271  1.00 50.98  ? 204 HOH C O     1 
HETATM 1730 O O     . HOH F 5 .   ? 21.840  7.206   -6.662  1.00 48.67  ? 205 HOH C O     1 
HETATM 1731 O O     . HOH F 5 .   ? 19.800  -3.645  -3.867  1.00 40.87  ? 206 HOH C O     1 
HETATM 1732 O O     . HOH F 5 .   ? 10.963  -1.786  -5.116  1.00 45.11  ? 207 HOH C O     1 
HETATM 1733 O O     . HOH F 5 .   ? 17.262  1.179   -2.500  1.00 52.80  ? 208 HOH C O     1 
HETATM 1734 O O     . HOH F 5 .   ? 6.182   5.652   -19.991 1.00 52.35  ? 209 HOH C O     1 
HETATM 1735 O O     . HOH G 5 .   ? 9.471   15.229  -22.591 1.00 67.30  ? 101 HOH D O     1 
HETATM 1736 O O     . HOH G 5 .   ? 14.857  16.401  -18.244 1.00 49.36  ? 102 HOH D O     1 
HETATM 1737 O O     . HOH G 5 .   ? 19.233  14.465  -16.820 1.00 55.63  ? 103 HOH D O     1 
HETATM 1738 O O     . HOH G 5 .   ? 16.533  15.312  -12.145 1.00 57.09  ? 104 HOH D O     1 
HETATM 1739 O O     . HOH G 5 .   ? 15.208  14.738  -14.391 1.00 46.61  ? 105 HOH D O     1 
HETATM 1740 O O     . HOH G 5 .   ? 16.723  15.272  -16.549 1.00 48.26  ? 106 HOH D O     1 
HETATM 1741 O O     . HOH G 5 .   ? 11.089  12.533  -11.671 1.00 48.23  ? 107 HOH D O     1 
HETATM 1742 O O     . HOH G 5 .   ? 7.470   13.569  -2.516  1.00 53.93  ? 108 HOH D O     1 
HETATM 1743 O O     . HOH G 5 .   ? 20.322  9.284   -10.341 1.00 49.44  ? 109 HOH D O     1 
HETATM 1744 O O     . HOH G 5 .   ? 11.385  12.579  -8.930  1.00 48.19  ? 110 HOH D O     1 
HETATM 1745 O O     . HOH G 5 .   ? 9.494   9.188   -10.280 1.00 60.67  ? 111 HOH D O     1 
HETATM 1746 O O     . HOH G 5 .   ? 8.214   6.944   -21.141 1.00 69.16  ? 112 HOH D O     1 
HETATM 1747 O O     . HOH G 5 .   ? 12.707  11.620  -5.541  1.00 77.83  ? 113 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   426 ?   ?   ?   A . n 
A 1 2   LEU 2   427 ?   ?   ?   A . n 
A 1 3   SER 3   428 ?   ?   ?   A . n 
A 1 4   PRO 4   429 ?   ?   ?   A . n 
A 1 5   PRO 5   430 ?   ?   ?   A . n 
A 1 6   ARG 6   431 ?   ?   ?   A . n 
A 1 7   ARG 7   432 ?   ?   ?   A . n 
A 1 8   LYS 8   433 ?   ?   ?   A . n 
A 1 9   ALA 9   434 ?   ?   ?   A . n 
A 1 10  PHE 10  435 ?   ?   ?   A . n 
A 1 11  LYS 11  436 ?   ?   ?   A . n 
A 1 12  LYS 12  437 437 LYS LYS A . n 
A 1 13  TRP 13  438 438 TRP TRP A . n 
A 1 14  THR 14  439 439 THR THR A . n 
A 1 15  PRO 15  440 440 PRO PRO A . n 
A 1 16  PRO 16  441 441 PRO PRO A . n 
A 1 17  ARG 17  442 442 ARG ARG A . n 
A 1 18  SER 18  443 443 SER SER A . n 
A 1 19  PRO 19  444 444 PRO PRO A . n 
A 1 20  PHE 20  445 445 PHE PHE A . n 
A 1 21  ASN 21  446 446 ASN ASN A . n 
A 1 22  LEU 22  447 447 LEU LEU A . n 
A 1 23  VAL 23  448 448 VAL VAL A . n 
A 1 24  GLN 24  449 449 GLN GLN A . n 
A 1 25  GLU 25  450 450 GLU GLU A . n 
A 1 26  THR 26  451 451 THR THR A . n 
A 1 27  LEU 27  452 452 LEU LEU A . n 
A 1 28  PHE 28  453 453 PHE PHE A . n 
A 1 29  HIS 29  454 454 HIS HIS A . n 
A 1 30  ASP 30  455 455 ASP ASP A . n 
A 1 31  PRO 31  456 456 PRO PRO A . n 
A 1 32  TRP 32  457 457 TRP TRP A . n 
A 1 33  LYS 33  458 458 LYS LYS A . n 
A 1 34  LEU 34  459 459 LEU LEU A . n 
A 1 35  LEU 35  460 460 LEU LEU A . n 
A 1 36  ILE 36  461 461 ILE ILE A . n 
A 1 37  ALA 37  462 462 ALA ALA A . n 
A 1 38  THR 38  463 463 THR THR A . n 
A 1 39  ILE 39  464 464 ILE ILE A . n 
A 1 40  PHE 40  465 465 PHE PHE A . n 
A 1 41  LEU 41  466 466 LEU LEU A . n 
A 1 42  ASN 42  467 467 ASN ASN A . n 
A 1 43  ARG 43  468 468 ARG ARG A . n 
A 1 44  THR 44  469 469 THR THR A . n 
A 1 45  SER 45  470 470 SER SER A . n 
A 1 46  GLY 46  471 471 GLY GLY A . n 
A 1 47  LYS 47  472 472 LYS LYS A . n 
A 1 48  MET 48  473 473 MET MET A . n 
A 1 49  ALA 49  474 474 ALA ALA A . n 
A 1 50  ILE 50  475 475 ILE ILE A . n 
A 1 51  PRO 51  476 476 PRO PRO A . n 
A 1 52  VAL 52  477 477 VAL VAL A . n 
A 1 53  LEU 53  478 478 LEU LEU A . n 
A 1 54  TRP 54  479 479 TRP TRP A . n 
A 1 55  LYS 55  480 480 LYS LYS A . n 
A 1 56  PHE 56  481 481 PHE PHE A . n 
A 1 57  LEU 57  482 482 LEU LEU A . n 
A 1 58  GLU 58  483 483 GLU GLU A . n 
A 1 59  LYS 59  484 484 LYS LYS A . n 
A 1 60  TYR 60  485 485 TYR TYR A . n 
A 1 61  PRO 61  486 486 PRO PRO A . n 
A 1 62  SER 62  487 487 SER SER A . n 
A 1 63  ALA 63  488 488 ALA ALA A . n 
A 1 64  GLU 64  489 489 GLU GLU A . n 
A 1 65  VAL 65  490 490 VAL VAL A . n 
A 1 66  ALA 66  491 491 ALA ALA A . n 
A 1 67  ARG 67  492 492 ARG ARG A . n 
A 1 68  THR 68  493 493 THR THR A . n 
A 1 69  ALA 69  494 494 ALA ALA A . n 
A 1 70  ASP 70  495 495 ASP ASP A . n 
A 1 71  TRP 71  496 496 TRP TRP A . n 
A 1 72  ARG 72  497 497 ARG ARG A . n 
A 1 73  ASP 73  498 498 ASP ASP A . n 
A 1 74  VAL 74  499 499 VAL VAL A . n 
A 1 75  SER 75  500 500 SER SER A . n 
A 1 76  GLU 76  501 501 GLU GLU A . n 
A 1 77  LEU 77  502 502 LEU LEU A . n 
A 1 78  LEU 78  503 503 LEU LEU A . n 
A 1 79  LYS 79  504 504 LYS LYS A . n 
A 1 80  PRO 80  505 505 PRO PRO A . n 
A 1 81  LEU 81  506 506 LEU LEU A . n 
A 1 82  GLY 82  507 507 GLY GLY A . n 
A 1 83  LEU 83  508 508 LEU LEU A . n 
A 1 84  TYR 84  509 509 TYR TYR A . n 
A 1 85  ASP 85  510 510 ASP ASP A . n 
A 1 86  LEU 86  511 511 LEU LEU A . n 
A 1 87  ARG 87  512 512 ARG ARG A . n 
A 1 88  ALA 88  513 513 ALA ALA A . n 
A 1 89  LYS 89  514 514 LYS LYS A . n 
A 1 90  THR 90  515 515 THR THR A . n 
A 1 91  ILE 91  516 516 ILE ILE A . n 
A 1 92  VAL 92  517 517 VAL VAL A . n 
A 1 93  LYS 93  518 518 LYS LYS A . n 
A 1 94  PHE 94  519 519 PHE PHE A . n 
A 1 95  SER 95  520 520 SER SER A . n 
A 1 96  ASP 96  521 521 ASP ASP A . n 
A 1 97  GLU 97  522 522 GLU GLU A . n 
A 1 98  TYR 98  523 523 TYR TYR A . n 
A 1 99  LEU 99  524 524 LEU LEU A . n 
A 1 100 THR 100 525 525 THR THR A . n 
A 1 101 LYS 101 526 526 LYS LYS A . n 
A 1 102 GLN 102 527 527 GLN GLN A . n 
A 1 103 TRP 103 528 528 TRP TRP A . n 
A 1 104 LYS 104 529 529 LYS LYS A . n 
A 1 105 TYR 105 530 530 TYR TYR A . n 
A 1 106 PRO 106 531 531 PRO PRO A . n 
A 1 107 ILE 107 532 532 ILE ILE A . n 
A 1 108 GLU 108 533 533 GLU GLU A . n 
A 1 109 LEU 109 534 534 LEU LEU A . n 
A 1 110 HIS 110 535 535 HIS HIS A . n 
A 1 111 GLY 111 536 536 GLY GLY A . n 
A 1 112 ILE 112 537 537 ILE ILE A . n 
A 1 113 GLY 113 538 538 GLY GLY A . n 
A 1 114 LYS 114 539 539 LYS LYS A . n 
A 1 115 TYR 115 540 540 TYR TYR A . n 
A 1 116 GLY 116 541 541 GLY GLY A . n 
A 1 117 ASN 117 542 542 ASN ASN A . n 
A 1 118 ASP 118 543 543 ASP ASP A . n 
A 1 119 SER 119 544 544 SER SER A . n 
A 1 120 TYR 120 545 545 TYR TYR A . n 
A 1 121 ARG 121 546 546 ARG ARG A . n 
A 1 122 ILE 122 547 547 ILE ILE A . n 
A 1 123 PHE 123 548 548 PHE PHE A . n 
A 1 124 CYS 124 549 549 CYS CYS A . n 
A 1 125 VAL 125 550 550 VAL VAL A . n 
A 1 126 ASN 126 551 551 ASN ASN A . n 
A 1 127 GLU 127 552 552 GLU GLU A . n 
A 1 128 TRP 128 553 553 TRP TRP A . n 
A 1 129 LYS 129 554 554 LYS LYS A . n 
A 1 130 GLN 130 555 555 GLN GLN A . n 
A 1 131 VAL 131 556 556 VAL VAL A . n 
A 1 132 HIS 132 557 557 HIS HIS A . n 
A 1 133 PRO 133 558 558 PRO PRO A . n 
A 1 134 GLU 134 559 559 GLU GLU A . n 
A 1 135 ASP 135 560 560 ASP ASP A . n 
A 1 136 HIS 136 561 561 HIS HIS A . n 
A 1 137 LYS 137 562 562 LYS LYS A . n 
A 1 138 LEU 138 563 563 LEU LEU A . n 
A 1 139 ASN 139 564 564 ASN ASN A . n 
A 1 140 LYS 140 565 565 LYS LYS A . n 
A 1 141 TYR 141 566 566 TYR TYR A . n 
A 1 142 HIS 142 567 567 HIS HIS A . n 
A 1 143 ASP 143 568 568 ASP ASP A . n 
A 1 144 TRP 144 569 569 TRP TRP A . n 
A 1 145 LEU 145 570 570 LEU LEU A . n 
A 1 146 TRP 146 571 571 TRP TRP A . n 
A 1 147 GLU 147 572 572 GLU GLU A . n 
A 1 148 ASN 148 573 573 ASN ASN A . n 
A 1 149 HIS 149 574 574 HIS HIS A . n 
A 1 150 GLU 150 575 ?   ?   ?   A . n 
A 1 151 LYS 151 576 ?   ?   ?   A . n 
A 1 152 LEU 152 577 ?   ?   ?   A . n 
A 1 153 SER 153 578 ?   ?   ?   A . n 
A 1 154 LEU 154 579 ?   ?   ?   A . n 
A 1 155 SER 155 580 ?   ?   ?   A . n 
A 1 156 HIS 156 581 ?   ?   ?   A . n 
A 1 157 HIS 157 582 ?   ?   ?   A . n 
A 1 158 HIS 158 583 ?   ?   ?   A . n 
A 1 159 HIS 159 584 ?   ?   ?   A . n 
A 1 160 HIS 160 585 ?   ?   ?   A . n 
A 1 161 HIS 161 586 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  C   C . n 
B 2 2   DC  2   2   2   DC  C   C . n 
B 2 3   DA  3   3   3   DA  A   C . n 
B 2 4   DG  4   4   4   DG  G   C . n 
B 2 5   DC  5   5   5   DC  C   C . n 
B 2 6   DG  6   6   6   DG  G   C . n 
B 2 7   3DR 7   7   7   3DR 3DR C . n 
B 2 8   DG  8   8   8   DG  G   C . n 
B 2 9   DC  9   9   9   DC  C   C . n 
B 2 10  DA  10  10  10  DA  A   C . n 
B 2 11  DG  11  11  11  DG  G   C . n 
B 2 12  DC  12  12  12  DC  C   C . n 
C 3 1   DG  1   1   1   DG  G   D . n 
C 3 2   DC  2   2   2   DC  C   D . n 
C 3 3   DT  3   3   3   DT  T   D . n 
C 3 4   DG  4   4   4   DG  G   D . n 
C 3 5   DC  5   5   5   DC  C   D . n 
C 3 6   DG  6   6   6   DG  G   D . n 
C 3 7   DC  7   7   7   DC  C   D . n 
C 3 8   DG  8   8   8   DG  G   D . n 
C 3 9   DC  9   9   9   DC  C   D . n 
C 3 10  DT  10  10  10  DT  T   D . n 
C 3 11  DG  11  11  11  DG  G   D . n 
C 3 12  DG  12  12  12  DG  G   D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3820  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  10240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-08-08 
2 'Structure model' 1 1 2012-11-07 
3 'Structure model' 1 2 2016-12-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Structure summary'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .      ? 1 
PHASER phasing           .      ? 2 
BUSTER refinement        2.10.0 ? 3 
XDS    'data reduction'  .      ? 4 
XDS    'data scaling'    .      ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DC 1  ? ? "C1'" C DC 1  ? ? N1    C DC  1  ? ? 112.94 108.30 4.64  0.30 N 
2  1 N1    C DC 1  ? ? C2    C DC 1  ? ? O2    C DC  1  ? ? 123.78 118.90 4.88  0.60 N 
3  1 N3    C DC 1  ? ? C2    C DC 1  ? ? O2    C DC  1  ? ? 117.52 121.90 -4.38 0.70 N 
4  1 C2    C DC 1  ? ? N1    C DC 1  ? ? "C1'" C DC  1  ? ? 126.32 118.80 7.52  1.10 N 
5  1 "C3'" C DG 4  ? ? "O3'" C DG 4  ? ? P     C DC  5  ? ? 127.45 119.70 7.75  1.20 Y 
6  1 "O4'" C DC 5  ? ? "C1'" C DC 5  ? ? N1    C DC  5  ? ? 110.97 108.30 2.67  0.30 N 
7  1 "C3'" C DG 6  ? ? "O3'" C DG 6  ? ? P     C 3DR 7  ? ? 126.90 119.70 7.20  1.20 Y 
8  1 "O4'" C DG 11 ? ? "C1'" C DG 11 ? ? N9    C DG  11 ? ? 110.83 108.30 2.53  0.30 N 
9  1 "C3'" C DG 11 ? ? "O3'" C DG 11 ? ? P     C DC  12 ? ? 129.05 119.70 9.35  1.20 Y 
10 1 "O4'" C DC 12 ? ? "C1'" C DC 12 ? ? N1    C DC  12 ? ? 110.32 108.30 2.02  0.30 N 
11 1 "C3'" D DG 1  ? ? "O3'" D DG 1  ? ? P     D DC  2  ? ? 131.25 119.70 11.55 1.20 Y 
12 1 "C3'" D DC 2  ? ? "O3'" D DC 2  ? ? P     D DT  3  ? ? 129.56 119.70 9.86  1.20 Y 
13 1 "O4'" D DC 5  ? ? "C1'" D DC 5  ? ? N1    D DC  5  ? ? 111.85 108.30 3.55  0.30 N 
14 1 "O4'" D DT 10 ? ? "C1'" D DT 10 ? ? N1    D DT  10 ? ? 110.72 108.30 2.42  0.30 N 
15 1 "C3'" D DG 11 ? ? "O3'" D DG 11 ? ? P     D DG  12 ? ? 127.76 119.70 8.06  1.20 Y 
16 1 "O4'" D DG 12 ? ? "C1'" D DG 12 ? ? N9    D DG  12 ? ? 111.29 108.30 2.99  0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 426 ? A MET 1   
2  1 Y 1 A LEU 427 ? A LEU 2   
3  1 Y 1 A SER 428 ? A SER 3   
4  1 Y 1 A PRO 429 ? A PRO 4   
5  1 Y 1 A PRO 430 ? A PRO 5   
6  1 Y 1 A ARG 431 ? A ARG 6   
7  1 Y 1 A ARG 432 ? A ARG 7   
8  1 Y 1 A LYS 433 ? A LYS 8   
9  1 Y 1 A ALA 434 ? A ALA 9   
10 1 Y 1 A PHE 435 ? A PHE 10  
11 1 Y 1 A LYS 436 ? A LYS 11  
12 1 Y 1 A GLU 575 ? A GLU 150 
13 1 Y 1 A LYS 576 ? A LYS 151 
14 1 Y 1 A LEU 577 ? A LEU 152 
15 1 Y 1 A SER 578 ? A SER 153 
16 1 Y 1 A LEU 579 ? A LEU 154 
17 1 Y 1 A SER 580 ? A SER 155 
18 1 Y 1 A HIS 581 ? A HIS 156 
19 1 Y 1 A HIS 582 ? A HIS 157 
20 1 Y 1 A HIS 583 ? A HIS 158 
21 1 Y 1 A HIS 584 ? A HIS 159 
22 1 Y 1 A HIS 585 ? A HIS 160 
23 1 Y 1 A HIS 586 ? A HIS 161 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4E9F 'b-form double helix'  
4E9F 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 12 1_555 -0.388 0.519  0.529  -32.907 -9.443  -14.628 1  C_DC1:DG12_D C 1  ? D 12 ? ?  1 
1 B DC 2  1_555 C DG 11 1_555 1.907  -0.254 0.162  -10.099 -0.971  11.581  2  C_DC2:DG11_D C 2  ? D 11 ? ?  1 
1 B DA 3  1_555 C DT 10 1_555 0.510  -0.354 0.199  9.398   -10.200 -0.959  3  C_DA3:DT10_D C 3  ? D 10 ? 20 1 
1 B DG 4  1_555 C DC 9  1_555 -0.825 -0.511 0.188  4.109   -9.659  -2.211  4  C_DG4:DC9_D  C 4  ? D 9  ? 19 1 
1 B DC 5  1_555 C DG 8  1_555 0.219  -0.273 0.010  -4.700  -5.342  1.491   5  C_DC5:DG8_D  C 5  ? D 8  ? 19 1 
1 B DG 6  1_555 C DC 7  1_555 -0.577 -0.226 0.331  8.392   -10.224 3.491   6  C_DG6:DC7_D  C 6  ? D 7  ? 19 1 
1 B DG 8  1_555 C DC 5  1_555 -0.231 -0.164 -0.508 -16.731 -7.115  -1.775  7  C_DG8:DC5_D  C 8  ? D 5  ? 19 1 
1 B DC 9  1_555 C DG 4  1_555 0.318  -0.196 -0.001 3.438   -4.113  -1.493  8  C_DC9:DG4_D  C 9  ? D 4  ? 19 1 
1 B DA 10 1_555 C DT 3  1_555 -0.029 -0.222 0.004  8.086   -11.753 2.008   9  C_DA10:DT3_D C 10 ? D 3  ? 20 1 
1 B DG 11 1_555 C DC 2  1_555 -0.149 -0.273 0.157  7.552   -14.333 -1.805  10 C_DG11:DC2_D C 11 ? D 2  ? 19 1 
1 B DC 12 1_555 C DG 1  1_555 0.073  -0.266 -0.343 10.260  -9.444  -1.484  11 C_DC12:DG1_D C 12 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 12 1_555 B DC 2  1_555 C DG 11 1_555 0.257  -0.302 2.899 4.331  4.427  44.028 -0.761 0.014  2.869 5.870  
-5.743  44.440 1 CC_DC1DC2:DG11DG12_DD C 1  ? D 12 ? C 2  ? D 11 ? 
1 B DC 2  1_555 C DG 11 1_555 B DA 3  1_555 C DT 10 1_555 -0.749 1.251  2.992 1.602  5.114  29.618 1.425  1.751  3.115 9.901  
-3.102  30.088 2 CC_DC2DA3:DT10DG11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 B DA 3  1_555 C DT 10 1_555 B DG 4  1_555 C DC 9  1_555 -0.579 -0.162 3.357 -2.329 1.256  29.949 -0.577 0.623  3.382 2.425  
4.496   30.063 3 CC_DA3DG4:DC9DT10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 B DG 4  1_555 C DC 9  1_555 B DC 5  1_555 C DG 8  1_555 0.697  -0.521 3.580 3.272  -1.741 38.668 -0.548 -0.608 3.644 -2.621 
-4.927  38.838 4 CC_DG4DC5:DG8DC9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 B DC 5  1_555 C DG 8  1_555 B DG 6  1_555 C DC 7  1_555 -0.589 0.959  3.170 -3.054 3.443  33.174 1.102  0.523  3.289 5.994  
5.318   33.483 5 CC_DC5DG6:DC7DG8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 B DG 8  1_555 C DC 5  1_555 B DC 9  1_555 C DG 4  1_555 -0.365 0.047  2.839 -6.251 1.238  24.972 -0.202 -0.727 2.843 2.806  
14.164  25.760 6 CC_DG8DC9:DG4DC5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 B DC 9  1_555 C DG 4  1_555 B DA 10 1_555 C DT 3  1_555 0.440  0.540  3.233 3.494  5.778  36.298 0.065  -0.219 3.304 9.178  
-5.550  36.900 7 CC_DC9DA10:DT3DG4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 B DA 10 1_555 C DT 3  1_555 B DG 11 1_555 C DC 2  1_555 -0.164 0.230  3.406 -1.556 4.890  32.692 -0.462 0.013  3.408 8.620  
2.743   33.082 8 CC_DA10DG11:DC2DT3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
1 B DG 11 1_555 C DC 2  1_555 B DC 12 1_555 C DG 1  1_555 0.751  0.081  3.280 6.528  -4.792 33.946 0.880  -0.239 3.321 -8.066 
-10.987 34.871 9 CC_DG11DC12:DG1DC2_DD C 11 ? D 2  ? C 12 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 1,2-ETHANEDIOL EDO 
5 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 EDO 1  101 1003 EDO EGL C . 
E 5 HOH 1  601 1    HOH HOH A . 
E 5 HOH 2  602 2    HOH HOH A . 
E 5 HOH 3  603 3    HOH HOH A . 
E 5 HOH 4  604 4    HOH HOH A . 
E 5 HOH 5  605 5    HOH HOH A . 
E 5 HOH 6  606 6    HOH HOH A . 
E 5 HOH 7  607 7    HOH HOH A . 
E 5 HOH 8  608 8    HOH HOH A . 
E 5 HOH 9  609 10   HOH HOH A . 
E 5 HOH 10 610 11   HOH HOH A . 
E 5 HOH 11 611 12   HOH HOH A . 
E 5 HOH 12 612 13   HOH HOH A . 
E 5 HOH 13 613 15   HOH HOH A . 
E 5 HOH 14 614 16   HOH HOH A . 
E 5 HOH 15 615 17   HOH HOH A . 
E 5 HOH 16 616 18   HOH HOH A . 
E 5 HOH 17 617 19   HOH HOH A . 
E 5 HOH 18 618 20   HOH HOH A . 
E 5 HOH 19 619 21   HOH HOH A . 
E 5 HOH 20 620 22   HOH HOH A . 
E 5 HOH 21 621 23   HOH HOH A . 
E 5 HOH 22 622 24   HOH HOH A . 
E 5 HOH 23 623 25   HOH HOH A . 
E 5 HOH 24 624 26   HOH HOH A . 
E 5 HOH 25 625 27   HOH HOH A . 
E 5 HOH 26 626 28   HOH HOH A . 
E 5 HOH 27 627 29   HOH HOH A . 
E 5 HOH 28 628 30   HOH HOH A . 
E 5 HOH 29 629 31   HOH HOH A . 
E 5 HOH 30 630 32   HOH HOH A . 
E 5 HOH 31 631 35   HOH HOH A . 
E 5 HOH 32 632 36   HOH HOH A . 
E 5 HOH 33 633 37   HOH HOH A . 
E 5 HOH 34 634 39   HOH HOH A . 
E 5 HOH 35 635 40   HOH HOH A . 
E 5 HOH 36 636 41   HOH HOH A . 
E 5 HOH 37 637 42   HOH HOH A . 
E 5 HOH 38 638 43   HOH HOH A . 
E 5 HOH 39 639 44   HOH HOH A . 
E 5 HOH 40 640 45   HOH HOH A . 
E 5 HOH 41 641 46   HOH HOH A . 
E 5 HOH 42 642 53   HOH HOH A . 
E 5 HOH 43 643 54   HOH HOH A . 
E 5 HOH 44 644 56   HOH HOH A . 
E 5 HOH 45 645 57   HOH HOH A . 
E 5 HOH 46 646 58   HOH HOH A . 
E 5 HOH 47 647 59   HOH HOH A . 
E 5 HOH 48 648 62   HOH HOH A . 
E 5 HOH 49 649 64   HOH HOH A . 
E 5 HOH 50 650 65   HOH HOH A . 
E 5 HOH 51 651 66   HOH HOH A . 
E 5 HOH 52 652 71   HOH HOH A . 
E 5 HOH 53 653 80   HOH HOH A . 
E 5 HOH 54 654 81   HOH HOH A . 
E 5 HOH 55 655 82   HOH HOH A . 
E 5 HOH 56 656 85   HOH HOH A . 
E 5 HOH 57 657 87   HOH HOH A . 
E 5 HOH 58 658 89   HOH HOH A . 
E 5 HOH 59 659 90   HOH HOH A . 
E 5 HOH 60 660 93   HOH HOH A . 
E 5 HOH 61 661 97   HOH HOH A . 
E 5 HOH 62 662 98   HOH HOH A . 
E 5 HOH 63 663 103  HOH HOH A . 
E 5 HOH 64 664 105  HOH HOH A . 
F 5 HOH 1  201 9    HOH HOH C . 
F 5 HOH 2  202 38   HOH HOH C . 
F 5 HOH 3  203 47   HOH HOH C . 
F 5 HOH 4  204 48   HOH HOH C . 
F 5 HOH 5  205 67   HOH HOH C . 
F 5 HOH 6  206 88   HOH HOH C . 
F 5 HOH 7  207 91   HOH HOH C . 
F 5 HOH 8  208 92   HOH HOH C . 
F 5 HOH 9  209 107  HOH HOH C . 
G 5 HOH 1  101 14   HOH HOH D . 
G 5 HOH 2  102 68   HOH HOH D . 
G 5 HOH 3  103 69   HOH HOH D . 
G 5 HOH 4  104 72   HOH HOH D . 
G 5 HOH 5  105 77   HOH HOH D . 
G 5 HOH 6  106 78   HOH HOH D . 
G 5 HOH 7  107 79   HOH HOH D . 
G 5 HOH 8  108 86   HOH HOH D . 
G 5 HOH 9  109 95   HOH HOH D . 
G 5 HOH 10 110 99   HOH HOH D . 
G 5 HOH 11 111 104  HOH HOH D . 
G 5 HOH 12 112 106  HOH HOH D . 
G 5 HOH 13 113 108  HOH HOH D . 
#