data_4ERV
# 
_entry.id   4ERV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ERV         
RCSB  RCSB071991   
WWPDB D_1000071991 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ERT 'RyR1 2734-2940' unspecified 
PDB 4ETT 'RyR1 E2764K'    unspecified 
PDB 4ESU 'RyR1 S2776M'    unspecified 
PDB 4ETU 'RyR1 R2939S'    unspecified 
PDB 4ETV 'RyR2 K2879A'    unspecified 
# 
_pdbx_database_status.entry_id                        4ERV 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-20 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yuchi, Z.'       1 
'Lau, K.'         2 
'Van Petegem, F.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Disease mutations in the ryanodine receptor central region: crystal structures of a phosphorylation hot spot domain.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1201 
_citation.page_last                 1211 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22705209 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.04.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yuchi, Z.'       1 
primary 'Lau, K.'         2 
primary 'Van Petegem, F.' 3 
# 
_cell.length_a           93.570 
_cell.length_b           58.540 
_cell.length_c           47.460 
_cell.angle_alpha        90.000 
_cell.angle_beta         97.210 
_cell.angle_gamma        90.000 
_cell.entry_id           4ERV 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         4ERV 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ryanodine receptor 3' 23741.969 1   ? K2775A ? ? 
2 non-polymer syn 'SULFATE ION'          96.063    3   ? ?      ? ? 
3 non-polymer syn GLYCEROL               92.094    3   ? ?      ? ? 
4 water       nat water                  18.015    209 ? ?      ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'RYR-3, RyR3, Brain ryanodine receptor-calcium release channel, Brain-type ryanodine receptor, Type 3 ryanodine receptor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNANFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPAR
ESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKL
ELESKGGGSHPLLVPYDTLTAAEKFKDREKAQDLFKFLQVNGIIVSR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNANFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPAR
ESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKL
ELESKGGGSHPLLVPYDTLTAAEKFKDREKAQDLFKFLQVNGIIVSR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   ASN n 
1 5   PHE n 
1 6   ASP n 
1 7   PRO n 
1 8   LYS n 
1 9   PRO n 
1 10  ILE n 
1 11  ASN n 
1 12  THR n 
1 13  MET n 
1 14  ASN n 
1 15  PHE n 
1 16  SER n 
1 17  LEU n 
1 18  PRO n 
1 19  GLU n 
1 20  LYS n 
1 21  LEU n 
1 22  GLU n 
1 23  TYR n 
1 24  ILE n 
1 25  VAL n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  ALA n 
1 30  GLU n 
1 31  HIS n 
1 32  SER n 
1 33  HIS n 
1 34  ASP n 
1 35  LYS n 
1 36  TRP n 
1 37  ALA n 
1 38  CYS n 
1 39  ASP n 
1 40  LYS n 
1 41  SER n 
1 42  GLN n 
1 43  SER n 
1 44  GLY n 
1 45  TRP n 
1 46  LYS n 
1 47  TYR n 
1 48  GLY n 
1 49  ILE n 
1 50  SER n 
1 51  LEU n 
1 52  ASP n 
1 53  GLU n 
1 54  ASN n 
1 55  VAL n 
1 56  LYS n 
1 57  THR n 
1 58  HIS n 
1 59  PRO n 
1 60  LEU n 
1 61  ILE n 
1 62  ARG n 
1 63  PRO n 
1 64  PHE n 
1 65  LYS n 
1 66  THR n 
1 67  LEU n 
1 68  THR n 
1 69  GLU n 
1 70  LYS n 
1 71  GLU n 
1 72  LYS n 
1 73  GLU n 
1 74  ILE n 
1 75  TYR n 
1 76  ARG n 
1 77  TRP n 
1 78  PRO n 
1 79  ALA n 
1 80  ARG n 
1 81  GLU n 
1 82  SER n 
1 83  LEU n 
1 84  LYS n 
1 85  THR n 
1 86  MET n 
1 87  LEU n 
1 88  ALA n 
1 89  VAL n 
1 90  GLY n 
1 91  TRP n 
1 92  THR n 
1 93  VAL n 
1 94  GLU n 
1 95  ARG n 
1 96  THR n 
1 97  LYS n 
1 98  GLU n 
1 99  GLY n 
1 100 GLU n 
1 101 ALA n 
1 102 LEU n 
1 103 VAL n 
1 104 GLN n 
1 105 GLN n 
1 106 ARG n 
1 107 GLU n 
1 108 ASN n 
1 109 GLU n 
1 110 LYS n 
1 111 LEU n 
1 112 ARG n 
1 113 SER n 
1 114 VAL n 
1 115 SER n 
1 116 GLN n 
1 117 ALA n 
1 118 ASN n 
1 119 GLN n 
1 120 GLY n 
1 121 ASN n 
1 122 SER n 
1 123 TYR n 
1 124 SER n 
1 125 PRO n 
1 126 ALA n 
1 127 PRO n 
1 128 LEU n 
1 129 ASP n 
1 130 LEU n 
1 131 SER n 
1 132 ASN n 
1 133 VAL n 
1 134 VAL n 
1 135 LEU n 
1 136 SER n 
1 137 ARG n 
1 138 GLU n 
1 139 LEU n 
1 140 GLN n 
1 141 GLY n 
1 142 MET n 
1 143 VAL n 
1 144 GLU n 
1 145 VAL n 
1 146 VAL n 
1 147 ALA n 
1 148 GLU n 
1 149 ASN n 
1 150 TYR n 
1 151 HIS n 
1 152 ASN n 
1 153 ILE n 
1 154 TRP n 
1 155 ALA n 
1 156 LYS n 
1 157 LYS n 
1 158 LYS n 
1 159 LYS n 
1 160 LEU n 
1 161 GLU n 
1 162 LEU n 
1 163 GLU n 
1 164 SER n 
1 165 LYS n 
1 166 GLY n 
1 167 GLY n 
1 168 GLY n 
1 169 SER n 
1 170 HIS n 
1 171 PRO n 
1 172 LEU n 
1 173 LEU n 
1 174 VAL n 
1 175 PRO n 
1 176 TYR n 
1 177 ASP n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 ALA n 
1 182 ALA n 
1 183 GLU n 
1 184 LYS n 
1 185 PHE n 
1 186 LYS n 
1 187 ASP n 
1 188 ARG n 
1 189 GLU n 
1 190 LYS n 
1 191 ALA n 
1 192 GLN n 
1 193 ASP n 
1 194 LEU n 
1 195 PHE n 
1 196 LYS n 
1 197 PHE n 
1 198 LEU n 
1 199 GLN n 
1 200 VAL n 
1 201 ASN n 
1 202 GLY n 
1 203 ILE n 
1 204 ILE n 
1 205 VAL n 
1 206 SER n 
1 207 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RYR3, HBRR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta(DE3)pLacI' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28HMT 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RYR3_HUMAN 
_struct_ref.pdbx_db_accession          Q15413 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESL
KTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELE
SKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSR
;
_struct_ref.pdbx_align_begin           2597 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4ERV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 207 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15413 
_struct_ref_seq.db_align_beg                  2597 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  2800 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2597 
_struct_ref_seq.pdbx_auth_seq_align_end       2800 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ERV SER A 1   ? UNP Q15413 ?   ?    'EXPRESSION TAG'      2594 1 
1 4ERV ASN A 2   ? UNP Q15413 ?   ?    'EXPRESSION TAG'      2595 2 
1 4ERV ALA A 3   ? UNP Q15413 ?   ?    'EXPRESSION TAG'      2596 3 
1 4ERV ALA A 182 ? UNP Q15413 LYS 2775 'ENGINEERED MUTATION' 2775 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4ERV 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.pdbx_details    '1.4M Ammonium sulfate, 0.1M Bicine, pH 9.5, vapor diffusion, hanging drop, temperature 295K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-11-29 
_diffrn_detector.details                'Double Crystal Monochromator, mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    
'Double Crystal Monochromator with cryo-cooled 1st crystal sagittally bent 2nd crystal followed by vertically focusing mirror' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
# 
_reflns.entry_id                     4ERV 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   25284 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_netI_over_sigmaI        20.300 
_reflns.percent_possible_obs         98.100 
_reflns.B_iso_Wilson_estimate        34.270 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.750 1.800 6841 ? 1871 0.452 3.150  ? ? ? ? ? 99.200 1  1 
1.800 1.840 6711 ? 1826 0.340 3.920  ? ? ? ? ? 99.100 2  1 
1.840 1.900 6382 ? 1749 0.269 5.120  ? ? ? ? ? 96.600 3  1 
1.900 1.960 5836 ? 1660 0.213 6.520  ? ? ? ? ? 94.900 4  1 
1.960 2.020 6200 ? 1681 0.143 8.880  ? ? ? ? ? 99.000 5  1 
2.020 2.090 5486 ? 1575 0.106 12.190 ? ? ? ? ? 97.400 6  1 
2.090 2.170 5751 ? 1565 0.081 14.490 ? ? ? ? ? 98.700 7  1 
2.170 2.260 5204 ? 1483 0.067 17.350 ? ? ? ? ? 96.500 8  1 
2.260 2.360 5118 ? 1406 0.053 20.570 ? ? ? ? ? 97.100 9  1 
2.360 2.470 5103 ? 1376 0.047 23.040 ? ? ? ? ? 98.600 10 1 
2.470 2.610 4928 ? 1320 0.043 25.370 ? ? ? ? ? 98.500 11 1 
2.610 2.770 4536 ? 1250 0.040 28.850 ? ? ? ? ? 98.400 12 1 
2.770 2.960 4315 ? 1162 0.035 31.810 ? ? ? ? ? 99.100 13 1 
2.960 3.200 4080 ? 1094 0.027 37.800 ? ? ? ? ? 99.000 14 1 
3.200 3.500 3715 ? 1014 0.025 41.210 ? ? ? ? ? 99.100 15 1 
3.500 3.910 3296 ? 911  0.024 43.620 ? ? ? ? ? 98.600 16 1 
3.910 4.520 2991 ? 810  0.024 45.890 ? ? ? ? ? 98.500 17 1 
4.520 5.530 2547 ? 684  0.021 46.710 ? ? ? ? ? 98.800 18 1 
5.530 7.830 1984 ? 546  0.023 45.030 ? ? ? ? ? 99.500 19 1 
7.830 ?     1050 ? 301  0.027 47.130 ? ? ? ? ? 97.700 20 1 
# 
_refine.entry_id                                 4ERV 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             35.3500 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.0900 
_refine.ls_number_reflns_obs                     25283 
_refine.ls_number_reflns_all                     25284 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1914 
_refine.ls_R_factor_R_work                       0.1899 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2201 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               26.9336 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.6300 
_refine.aniso_B[2][2]                            -1.4400 
_refine.aniso_B[3][3]                            1.8900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.7000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9630 
_refine.correlation_coeff_Fo_to_Fc_free          0.9580 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1600 
_refine.pdbx_overall_ESU_R_Free                  0.1070 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                59.040 
_refine.B_iso_min                                16.270 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1528 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             209 
_refine_hist.number_atoms_total               1770 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        35.3500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1600 0.013  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2167 1.214  1.979  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 195  5.144  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 66   33.297 24.394 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 275  11.902 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 7    22.178 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         244  0.075  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1169 0.006  0.021  ? ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr     1600 4.245  3.000  ? ? 'X-RAY DIFFRACTION' 
r_sphericity_free      209  0.000  5.000  ? ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded    1569 0.000  5.000  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.7500 
_refine_ls_shell.d_res_low                        1.7950 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.1000 
_refine_ls_shell.number_reflns_R_work             1776 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2260 
_refine_ls_shell.R_factor_R_free                  0.2540 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1870 
_refine_ls_shell.number_reflns_obs                1871 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4ERV 
_struct.title                     'Crystal structure of human ryanodine receptor 3 (2597-2800)' 
_struct.pdbx_descriptor           'Ryanodine receptor 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ERV 
_struct_keywords.text            'Ryanodine Receptor Calcium Release Channel, METAL TRANSPORT' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 18  ? SER A 43  ? PRO A 2611 SER A 2636 1 ? 26 
HELX_P HELX_P2 2 PRO A 63  ? LEU A 67  ? PRO A 2656 LEU A 2660 5 ? 5  
HELX_P HELX_P3 3 THR A 68  ? VAL A 89  ? THR A 2661 VAL A 2682 1 ? 22 
HELX_P HELX_P4 4 ALA A 101 ? ARG A 112 ? ALA A 2694 ARG A 2705 1 ? 12 
HELX_P HELX_P5 5 ASP A 129 ? VAL A 133 ? ASP A 2722 VAL A 2726 5 ? 5  
HELX_P HELX_P6 6 SER A 136 ? LYS A 165 ? SER A 2729 LYS A 2758 1 ? 30 
HELX_P HELX_P7 7 PRO A 175 ? LEU A 179 ? PRO A 2768 LEU A 2772 5 ? 5  
HELX_P HELX_P8 8 THR A 180 ? VAL A 200 ? THR A 2773 VAL A 2793 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 92  ? ARG A 95  ? THR A 2685 ARG A 2688 
A 2 ILE A 203 ? SER A 206 ? ILE A 2796 SER A 2799 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   GLU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    94 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    GLU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     2687 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    204 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     2797 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 2901' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 2902' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 2903' 
AC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 2904' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 2905' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 2906' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 TRP A 154 ? TRP A 2747 . ? 1_555 ? 
2  AC1 8 LYS A 157 ? LYS A 2750 . ? 2_655 ? 
3  AC1 8 LYS A 158 ? LYS A 2751 . ? 1_555 ? 
4  AC1 8 GOL G .   ? GOL A 2906 . ? 1_555 ? 
5  AC1 8 HOH H .   ? HOH A 3050 . ? 1_555 ? 
6  AC1 8 HOH H .   ? HOH A 3100 . ? 1_555 ? 
7  AC1 8 HOH H .   ? HOH A 3133 . ? 1_555 ? 
8  AC1 8 HOH H .   ? HOH A 3151 . ? 1_555 ? 
9  AC2 3 ALA A 181 ? ALA A 2774 . ? 1_555 ? 
10 AC2 3 LYS A 184 ? LYS A 2777 . ? 1_555 ? 
11 AC2 3 ARG A 188 ? ARG A 2781 . ? 1_555 ? 
12 AC3 6 TRP A 36  ? TRP A 2629 . ? 1_555 ? 
13 AC3 6 LYS A 40  ? LYS A 2633 . ? 1_555 ? 
14 AC3 6 LYS A 186 ? LYS A 2779 . ? 2_655 ? 
15 AC3 6 GOL E .   ? GOL A 2904 . ? 1_555 ? 
16 AC3 6 HOH H .   ? HOH A 3092 . ? 2_655 ? 
17 AC3 6 HOH H .   ? HOH A 3206 . ? 1_555 ? 
18 AC4 9 LYS A 40  ? LYS A 2633 . ? 1_555 ? 
19 AC4 9 TRP A 45  ? TRP A 2638 . ? 1_555 ? 
20 AC4 9 HIS A 58  ? HIS A 2651 . ? 1_555 ? 
21 AC4 9 ALA A 182 ? ALA A 2775 . ? 2_655 ? 
22 AC4 9 PHE A 185 ? PHE A 2778 . ? 2_655 ? 
23 AC4 9 SO4 D .   ? SO4 A 2903 . ? 1_555 ? 
24 AC4 9 HOH H .   ? HOH A 3092 . ? 2_655 ? 
25 AC4 9 HOH H .   ? HOH A 3168 . ? 1_555 ? 
26 AC4 9 HOH H .   ? HOH A 3206 . ? 1_555 ? 
27 AC5 7 LYS A 70  ? LYS A 2663 . ? 2_655 ? 
28 AC5 7 PRO A 171 ? PRO A 2764 . ? 1_555 ? 
29 AC5 7 VAL A 174 ? VAL A 2767 . ? 1_555 ? 
30 AC5 7 THR A 178 ? THR A 2771 . ? 1_555 ? 
31 AC5 7 GLU A 183 ? GLU A 2776 . ? 1_555 ? 
32 AC5 7 HOH H .   ? HOH A 3016 . ? 2_655 ? 
33 AC5 7 HOH H .   ? HOH A 3201 . ? 1_555 ? 
34 AC6 5 TRP A 154 ? TRP A 2747 . ? 1_555 ? 
35 AC6 5 SO4 B .   ? SO4 A 2901 . ? 1_555 ? 
36 AC6 5 HOH H .   ? HOH A 3087 . ? 1_555 ? 
37 AC6 5 HOH H .   ? HOH A 3205 . ? 1_555 ? 
38 AC6 5 HOH H .   ? HOH A 3208 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ERV 
_atom_sites.fract_transf_matrix[1][1]   0.010687 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001352 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017082 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021238 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PHE A 1 5   ? 45.430 43.271 -16.518 1.00 32.83 ? 2598 PHE A N   1 
ATOM   2    C CA  . PHE A 1 5   ? 44.525 42.501 -15.603 1.00 31.94 ? 2598 PHE A CA  1 
ATOM   3    C C   . PHE A 1 5   ? 44.402 43.194 -14.254 1.00 31.20 ? 2598 PHE A C   1 
ATOM   4    O O   . PHE A 1 5   ? 45.395 43.399 -13.560 1.00 31.48 ? 2598 PHE A O   1 
ATOM   5    C CB  . PHE A 1 5   ? 45.016 41.059 -15.420 1.00 32.37 ? 2598 PHE A CB  1 
ATOM   6    C CG  . PHE A 1 5   ? 44.124 40.209 -14.543 1.00 31.08 ? 2598 PHE A CG  1 
ATOM   7    C CD1 . PHE A 1 5   ? 42.745 40.178 -14.743 1.00 31.39 ? 2598 PHE A CD1 1 
ATOM   8    C CD2 . PHE A 1 5   ? 44.671 39.427 -13.525 1.00 30.78 ? 2598 PHE A CD2 1 
ATOM   9    C CE1 . PHE A 1 5   ? 41.921 39.389 -13.928 1.00 30.66 ? 2598 PHE A CE1 1 
ATOM   10   C CE2 . PHE A 1 5   ? 43.860 38.624 -12.713 1.00 29.83 ? 2598 PHE A CE2 1 
ATOM   11   C CZ  . PHE A 1 5   ? 42.483 38.602 -12.921 1.00 29.52 ? 2598 PHE A CZ  1 
ATOM   12   N N   . ASP A 1 6   ? 43.168 43.547 -13.903 1.00 30.38 ? 2599 ASP A N   1 
ATOM   13   C CA  . ASP A 1 6   ? 42.864 44.258 -12.657 1.00 29.36 ? 2599 ASP A CA  1 
ATOM   14   C C   . ASP A 1 6   ? 41.733 43.517 -11.930 1.00 27.94 ? 2599 ASP A C   1 
ATOM   15   O O   . ASP A 1 6   ? 40.559 43.848 -12.096 1.00 27.70 ? 2599 ASP A O   1 
ATOM   16   C CB  . ASP A 1 6   ? 42.478 45.712 -12.981 1.00 30.21 ? 2599 ASP A CB  1 
ATOM   17   C CG  . ASP A 1 6   ? 42.281 46.563 -11.754 1.00 32.11 ? 2599 ASP A CG  1 
ATOM   18   O OD1 . ASP A 1 6   ? 42.886 46.286 -10.693 1.00 35.38 ? 2599 ASP A OD1 1 
ATOM   19   O OD2 . ASP A 1 6   ? 41.502 47.539 -11.856 1.00 37.45 ? 2599 ASP A OD2 1 
ATOM   20   N N   . PRO A 1 7   ? 42.088 42.483 -11.137 1.00 26.20 ? 2600 PRO A N   1 
ATOM   21   C CA  . PRO A 1 7   ? 41.055 41.646 -10.512 1.00 25.33 ? 2600 PRO A CA  1 
ATOM   22   C C   . PRO A 1 7   ? 40.321 42.410 -9.434  1.00 24.88 ? 2600 PRO A C   1 
ATOM   23   O O   . PRO A 1 7   ? 40.948 43.088 -8.609  1.00 24.77 ? 2600 PRO A O   1 
ATOM   24   C CB  . PRO A 1 7   ? 41.856 40.483 -9.904  1.00 25.13 ? 2600 PRO A CB  1 
ATOM   25   C CG  . PRO A 1 7   ? 43.253 41.019 -9.732  1.00 24.74 ? 2600 PRO A CG  1 
ATOM   26   C CD  . PRO A 1 7   ? 43.455 42.004 -10.851 1.00 25.52 ? 2600 PRO A CD  1 
ATOM   27   N N   . LYS A 1 8   ? 38.998 42.302 -9.449  1.00 24.00 ? 2601 LYS A N   1 
ATOM   28   C CA  . LYS A 1 8   ? 38.165 42.985 -8.477  1.00 24.35 ? 2601 LYS A CA  1 
ATOM   29   C C   . LYS A 1 8   ? 37.277 41.974 -7.744  1.00 23.42 ? 2601 LYS A C   1 
ATOM   30   O O   . LYS A 1 8   ? 36.266 41.544 -8.287  1.00 23.56 ? 2601 LYS A O   1 
ATOM   31   C CB  . LYS A 1 8   ? 37.298 44.031 -9.191  1.00 25.37 ? 2601 LYS A CB  1 
ATOM   32   C CG  . LYS A 1 8   ? 38.091 45.144 -9.893  1.00 28.14 ? 2601 LYS A CG  1 
ATOM   33   C CD  . LYS A 1 8   ? 37.234 45.920 -10.880 1.00 32.14 ? 2601 LYS A CD  1 
ATOM   34   C CE  . LYS A 1 8   ? 37.375 45.384 -12.308 1.00 36.63 ? 2601 LYS A CE  1 
ATOM   35   N NZ  . LYS A 1 8   ? 38.691 45.791 -12.908 1.00 37.55 ? 2601 LYS A NZ  1 
ATOM   36   N N   . PRO A 1 9   ? 37.651 41.597 -6.510  1.00 22.68 ? 2602 PRO A N   1 
ATOM   37   C CA  . PRO A 1 9   ? 36.787 40.732 -5.708  1.00 22.28 ? 2602 PRO A CA  1 
ATOM   38   C C   . PRO A 1 9   ? 35.388 41.335 -5.503  1.00 22.15 ? 2602 PRO A C   1 
ATOM   39   O O   . PRO A 1 9   ? 35.246 42.574 -5.460  1.00 21.98 ? 2602 PRO A O   1 
ATOM   40   C CB  . PRO A 1 9   ? 37.512 40.680 -4.366  1.00 22.30 ? 2602 PRO A CB  1 
ATOM   41   C CG  . PRO A 1 9   ? 38.958 40.866 -4.720  1.00 22.57 ? 2602 PRO A CG  1 
ATOM   42   C CD  . PRO A 1 9   ? 38.917 41.898 -5.819  1.00 22.83 ? 2602 PRO A CD  1 
ATOM   43   N N   . ILE A 1 10  ? 34.379 40.476 -5.408  1.00 20.68 ? 2603 ILE A N   1 
ATOM   44   C CA  . ILE A 1 10  ? 33.026 40.885 -5.015  1.00 20.97 ? 2603 ILE A CA  1 
ATOM   45   C C   . ILE A 1 10  ? 33.068 41.367 -3.571  1.00 20.94 ? 2603 ILE A C   1 
ATOM   46   O O   . ILE A 1 10  ? 33.432 40.620 -2.663  1.00 20.81 ? 2603 ILE A O   1 
ATOM   47   C CB  . ILE A 1 10  ? 32.031 39.706 -5.149  1.00 19.83 ? 2603 ILE A CB  1 
ATOM   48   C CG1 . ILE A 1 10  ? 31.865 39.310 -6.625  1.00 21.54 ? 2603 ILE A CG1 1 
ATOM   49   C CG2 . ILE A 1 10  ? 30.694 40.031 -4.452  1.00 21.38 ? 2603 ILE A CG2 1 
ATOM   50   C CD1 . ILE A 1 10  ? 31.178 37.961 -6.841  1.00 20.60 ? 2603 ILE A CD1 1 
ATOM   51   N N   . ASN A 1 11  ? 32.715 42.629 -3.345  1.00 21.21 ? 2604 ASN A N   1 
ATOM   52   C CA  . ASN A 1 11  ? 32.825 43.176 -1.987  1.00 21.99 ? 2604 ASN A CA  1 
ATOM   53   C C   . ASN A 1 11  ? 31.607 42.859 -1.133  1.00 21.80 ? 2604 ASN A C   1 
ATOM   54   O O   . ASN A 1 11  ? 30.472 43.215 -1.500  1.00 21.64 ? 2604 ASN A O   1 
ATOM   55   C CB  . ASN A 1 11  ? 33.063 44.693 -2.023  1.00 21.91 ? 2604 ASN A CB  1 
ATOM   56   C CG  . ASN A 1 11  ? 33.588 45.204 -0.734  1.00 24.52 ? 2604 ASN A CG  1 
ATOM   57   O OD1 . ASN A 1 11  ? 32.863 45.282 0.239   1.00 28.69 ? 2604 ASN A OD1 1 
ATOM   58   N ND2 . ASN A 1 11  ? 34.882 45.520 -0.692  1.00 29.68 ? 2604 ASN A ND2 1 
ATOM   59   N N   . THR A 1 12  ? 31.849 42.219 0.012   1.00 21.75 ? 2605 THR A N   1 
ATOM   60   C CA  . THR A 1 12  ? 30.778 41.740 0.913   1.00 21.84 ? 2605 THR A CA  1 
ATOM   61   C C   . THR A 1 12  ? 30.457 42.728 2.038   1.00 21.75 ? 2605 THR A C   1 
ATOM   62   O O   . THR A 1 12  ? 29.702 42.403 2.938   1.00 20.47 ? 2605 THR A O   1 
ATOM   63   C CB  . THR A 1 12  ? 31.159 40.371 1.544   1.00 21.99 ? 2605 THR A CB  1 
ATOM   64   O OG1 . THR A 1 12  ? 32.446 40.473 2.179   1.00 22.04 ? 2605 THR A OG1 1 
ATOM   65   C CG2 . THR A 1 12  ? 31.231 39.291 0.456   1.00 22.22 ? 2605 THR A CG2 1 
ATOM   66   N N   . MET A 1 13  ? 31.047 43.930 2.003   1.00 21.24 ? 2606 MET A N   1 
ATOM   67   C CA  . MET A 1 13  ? 30.851 44.865 3.125   1.00 21.92 ? 2606 MET A CA  1 
ATOM   68   C C   . MET A 1 13  ? 29.362 45.094 3.350   1.00 21.49 ? 2606 MET A C   1 
ATOM   69   O O   . MET A 1 13  ? 28.599 45.229 2.383   1.00 21.92 ? 2606 MET A O   1 
ATOM   70   C CB  . MET A 1 13  ? 31.548 46.200 2.856   1.00 22.86 ? 2606 MET A CB  1 
ATOM   71   C CG  . MET A 1 13  ? 31.451 47.197 4.013   1.00 26.45 ? 2606 MET A CG  1 
ATOM   72   S SD  . MET A 1 13  ? 32.486 48.673 3.745   1.00 37.43 ? 2606 MET A SD  1 
ATOM   73   C CE  . MET A 1 13  ? 32.283 48.832 1.968   1.00 32.22 ? 2606 MET A CE  1 
ATOM   74   N N   . ASN A 1 14  ? 28.980 45.103 4.627   1.00 21.27 ? 2607 ASN A N   1 
ATOM   75   C CA  . ASN A 1 14  ? 27.627 45.441 5.076   1.00 21.96 ? 2607 ASN A CA  1 
ATOM   76   C C   . ASN A 1 14  ? 26.597 44.332 4.890   1.00 21.91 ? 2607 ASN A C   1 
ATOM   77   O O   . ASN A 1 14  ? 25.435 44.501 5.251   1.00 21.65 ? 2607 ASN A O   1 
ATOM   78   C CB  . ASN A 1 14  ? 27.160 46.778 4.453   1.00 21.91 ? 2607 ASN A CB  1 
ATOM   79   C CG  . ASN A 1 14  ? 28.061 47.956 4.850   1.00 22.89 ? 2607 ASN A CG  1 
ATOM   80   O OD1 . ASN A 1 14  ? 28.375 48.830 4.032   1.00 24.81 ? 2607 ASN A OD1 1 
ATOM   81   N ND2 . ASN A 1 14  ? 28.438 48.001 6.109   1.00 22.01 ? 2607 ASN A ND2 1 
ATOM   82   N N   . PHE A 1 15  ? 27.024 43.175 4.375   1.00 21.11 ? 2608 PHE A N   1 
ATOM   83   C CA  . PHE A 1 15  ? 26.147 41.999 4.376   1.00 21.43 ? 2608 PHE A CA  1 
ATOM   84   C C   . PHE A 1 15  ? 26.374 41.200 5.653   1.00 22.06 ? 2608 PHE A C   1 
ATOM   85   O O   . PHE A 1 15  ? 27.520 41.060 6.132   1.00 22.70 ? 2608 PHE A O   1 
ATOM   86   C CB  . PHE A 1 15  ? 26.396 41.119 3.149   1.00 20.40 ? 2608 PHE A CB  1 
ATOM   87   C CG  . PHE A 1 15  ? 25.812 41.667 1.889   1.00 20.02 ? 2608 PHE A CG  1 
ATOM   88   C CD1 . PHE A 1 15  ? 24.488 41.379 1.537   1.00 19.68 ? 2608 PHE A CD1 1 
ATOM   89   C CD2 . PHE A 1 15  ? 26.562 42.503 1.064   1.00 20.26 ? 2608 PHE A CD2 1 
ATOM   90   C CE1 . PHE A 1 15  ? 23.936 41.904 0.365   1.00 17.75 ? 2608 PHE A CE1 1 
ATOM   91   C CE2 . PHE A 1 15  ? 26.025 43.031 -0.114  1.00 18.39 ? 2608 PHE A CE2 1 
ATOM   92   C CZ  . PHE A 1 15  ? 24.693 42.732 -0.464  1.00 21.22 ? 2608 PHE A CZ  1 
ATOM   93   N N   . SER A 1 16  ? 25.291 40.679 6.204   1.00 22.66 ? 2609 SER A N   1 
ATOM   94   C CA  . SER A 1 16  ? 25.343 39.867 7.400   1.00 24.26 ? 2609 SER A CA  1 
ATOM   95   C C   . SER A 1 16  ? 24.456 38.643 7.160   1.00 24.55 ? 2609 SER A C   1 
ATOM   96   O O   . SER A 1 16  ? 23.407 38.763 6.524   1.00 25.39 ? 2609 SER A O   1 
ATOM   97   C CB  . SER A 1 16  ? 24.802 40.694 8.566   1.00 24.86 ? 2609 SER A CB  1 
ATOM   98   O OG  . SER A 1 16  ? 25.098 40.076 9.798   1.00 30.77 ? 2609 SER A OG  1 
ATOM   99   N N   . LEU A 1 17  ? 24.857 37.464 7.637   1.00 23.67 ? 2610 LEU A N   1 
ATOM   100  C CA  . LEU A 1 17  ? 24.001 36.289 7.463   1.00 23.36 ? 2610 LEU A CA  1 
ATOM   101  C C   . LEU A 1 17  ? 22.944 36.196 8.563   1.00 24.16 ? 2610 LEU A C   1 
ATOM   102  O O   . LEU A 1 17  ? 23.237 36.431 9.728   1.00 24.24 ? 2610 LEU A O   1 
ATOM   103  C CB  . LEU A 1 17  ? 24.837 34.994 7.449   1.00 22.91 ? 2610 LEU A CB  1 
ATOM   104  C CG  . LEU A 1 17  ? 25.890 34.788 6.352   1.00 22.55 ? 2610 LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 17  ? 26.514 33.419 6.516   1.00 20.89 ? 2610 LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 17  ? 25.326 34.927 4.942   1.00 20.66 ? 2610 LEU A CD2 1 
ATOM   107  N N   . PRO A 1 18  ? 21.704 35.826 8.203   1.00 25.16 ? 2611 PRO A N   1 
ATOM   108  C CA  . PRO A 1 18  ? 20.779 35.511 9.295   1.00 25.54 ? 2611 PRO A CA  1 
ATOM   109  C C   . PRO A 1 18  ? 21.234 34.272 10.067  1.00 26.23 ? 2611 PRO A C   1 
ATOM   110  O O   . PRO A 1 18  ? 21.977 33.448 9.524   1.00 25.36 ? 2611 PRO A O   1 
ATOM   111  C CB  . PRO A 1 18  ? 19.467 35.231 8.570   1.00 25.55 ? 2611 PRO A CB  1 
ATOM   112  C CG  . PRO A 1 18  ? 19.837 34.859 7.201   1.00 26.20 ? 2611 PRO A CG  1 
ATOM   113  C CD  . PRO A 1 18  ? 21.104 35.619 6.879   1.00 24.73 ? 2611 PRO A CD  1 
ATOM   114  N N   . GLU A 1 19  ? 20.777 34.146 11.313  1.00 26.95 ? 2612 GLU A N   1 
ATOM   115  C CA  . GLU A 1 19  ? 21.154 33.033 12.184  1.00 27.21 ? 2612 GLU A CA  1 
ATOM   116  C C   . GLU A 1 19  ? 20.966 31.654 11.559  1.00 27.58 ? 2612 GLU A C   1 
ATOM   117  O O   . GLU A 1 19  ? 21.813 30.769 11.767  1.00 27.65 ? 2612 GLU A O   1 
ATOM   118  C CB  . GLU A 1 19  ? 20.403 33.116 13.523  1.00 27.77 ? 2612 GLU A CB  1 
ATOM   119  N N   . LYS A 1 20  ? 19.867 31.474 10.819  1.00 27.98 ? 2613 LYS A N   1 
ATOM   120  C CA  . LYS A 1 20  ? 19.559 30.189 10.154  1.00 27.71 ? 2613 LYS A CA  1 
ATOM   121  C C   . LYS A 1 20  ? 20.633 29.784 9.156   1.00 27.65 ? 2613 LYS A C   1 
ATOM   122  O O   . LYS A 1 20  ? 20.932 28.589 9.010   1.00 27.59 ? 2613 LYS A O   1 
ATOM   123  C CB  . LYS A 1 20  ? 18.188 30.229 9.470   1.00 28.69 ? 2613 LYS A CB  1 
ATOM   124  N N   . LEU A 1 21  ? 21.238 30.780 8.502   1.00 26.65 ? 2614 LEU A N   1 
ATOM   125  C CA  . LEU A 1 21  ? 22.350 30.523 7.584   1.00 25.86 ? 2614 LEU A CA  1 
ATOM   126  C C   . LEU A 1 21  ? 23.682 30.356 8.295   1.00 25.00 ? 2614 LEU A C   1 
ATOM   127  O O   . LEU A 1 21  ? 24.525 29.602 7.840   1.00 23.88 ? 2614 LEU A O   1 
ATOM   128  C CB  . LEU A 1 21  ? 22.450 31.584 6.488   1.00 26.35 ? 2614 LEU A CB  1 
ATOM   129  C CG  . LEU A 1 21  ? 21.314 31.556 5.461   1.00 27.92 ? 2614 LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 21  ? 21.581 32.581 4.393   1.00 26.94 ? 2614 LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 21  ? 21.133 30.159 4.854   1.00 29.85 ? 2614 LEU A CD2 1 
ATOM   132  N N   . GLU A 1 22  ? 23.861 31.043 9.416   1.00 24.00 ? 2615 GLU A N   1 
ATOM   133  C CA  . GLU A 1 22  ? 25.056 30.846 10.231  1.00 24.05 ? 2615 GLU A CA  1 
ATOM   134  C C   . GLU A 1 22  ? 25.074 29.411 10.753  1.00 23.29 ? 2615 GLU A C   1 
ATOM   135  O O   . GLU A 1 22  ? 26.129 28.799 10.872  1.00 22.91 ? 2615 GLU A O   1 
ATOM   136  C CB  . GLU A 1 22  ? 25.126 31.860 11.380  1.00 24.23 ? 2615 GLU A CB  1 
ATOM   137  C CG  . GLU A 1 22  ? 25.375 33.287 10.926  1.00 26.14 ? 2615 GLU A CG  1 
ATOM   138  C CD  . GLU A 1 22  ? 26.848 33.599 10.645  1.00 28.31 ? 2615 GLU A CD  1 
ATOM   139  O OE1 . GLU A 1 22  ? 27.673 32.647 10.580  1.00 27.96 ? 2615 GLU A OE1 1 
ATOM   140  O OE2 . GLU A 1 22  ? 27.178 34.812 10.512  1.00 27.24 ? 2615 GLU A OE2 1 
ATOM   141  N N   . TYR A 1 23  ? 23.895 28.860 11.025  1.00 23.38 ? 2616 TYR A N   1 
ATOM   142  C CA  . TYR A 1 23  ? 23.805 27.467 11.463  1.00 23.07 ? 2616 TYR A CA  1 
ATOM   143  C C   . TYR A 1 23  ? 24.265 26.502 10.363  1.00 22.50 ? 2616 TYR A C   1 
ATOM   144  O O   . TYR A 1 23  ? 24.963 25.520 10.645  1.00 22.48 ? 2616 TYR A O   1 
ATOM   145  C CB  . TYR A 1 23  ? 22.378 27.133 11.914  1.00 23.95 ? 2616 TYR A CB  1 
ATOM   146  C CG  . TYR A 1 23  ? 22.243 25.758 12.543  1.00 25.68 ? 2616 TYR A CG  1 
ATOM   147  C CD1 . TYR A 1 23  ? 22.569 25.549 13.884  1.00 27.98 ? 2616 TYR A CD1 1 
ATOM   148  C CD2 . TYR A 1 23  ? 21.785 24.671 11.796  1.00 29.01 ? 2616 TYR A CD2 1 
ATOM   149  C CE1 . TYR A 1 23  ? 22.439 24.286 14.475  1.00 31.34 ? 2616 TYR A CE1 1 
ATOM   150  C CE2 . TYR A 1 23  ? 21.656 23.398 12.376  1.00 31.24 ? 2616 TYR A CE2 1 
ATOM   151  C CZ  . TYR A 1 23  ? 21.986 23.220 13.716  1.00 32.00 ? 2616 TYR A CZ  1 
ATOM   152  O OH  . TYR A 1 23  ? 21.871 21.975 14.304  1.00 33.59 ? 2616 TYR A OH  1 
ATOM   153  N N   . ILE A 1 24  ? 23.895 26.798 9.120   1.00 21.21 ? 2617 ILE A N   1 
ATOM   154  C CA  . ILE A 1 24  ? 24.370 26.027 7.964   1.00 21.24 ? 2617 ILE A CA  1 
ATOM   155  C C   . ILE A 1 24  ? 25.891 26.176 7.823   1.00 20.48 ? 2617 ILE A C   1 
ATOM   156  O O   . ILE A 1 24  ? 26.571 25.217 7.508   1.00 20.75 ? 2617 ILE A O   1 
ATOM   157  C CB  . ILE A 1 24  ? 23.653 26.414 6.673   1.00 21.64 ? 2617 ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 24  ? 22.159 26.042 6.754   1.00 23.40 ? 2617 ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 24  ? 24.300 25.710 5.465   1.00 22.75 ? 2617 ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 24  ? 21.875 24.554 6.968   1.00 27.28 ? 2617 ILE A CD1 1 
ATOM   161  N N   . VAL A 1 25  ? 26.405 27.382 8.073   1.00 19.82 ? 2618 VAL A N   1 
ATOM   162  C CA  . VAL A 1 25  ? 27.868 27.599 8.105   1.00 19.85 ? 2618 VAL A CA  1 
ATOM   163  C C   . VAL A 1 25  ? 28.547 26.625 9.060   1.00 19.65 ? 2618 VAL A C   1 
ATOM   164  O O   . VAL A 1 25  ? 29.552 25.986 8.715   1.00 20.06 ? 2618 VAL A O   1 
ATOM   165  C CB  . VAL A 1 25  ? 28.246 29.082 8.437   1.00 19.94 ? 2618 VAL A CB  1 
ATOM   166  C CG1 . VAL A 1 25  ? 29.782 29.241 8.737   1.00 20.17 ? 2618 VAL A CG1 1 
ATOM   167  C CG2 . VAL A 1 25  ? 27.845 30.002 7.297   1.00 19.99 ? 2618 VAL A CG2 1 
ATOM   168  N N   . THR A 1 26  ? 27.995 26.497 10.264  1.00 19.43 ? 2619 THR A N   1 
ATOM   169  C CA  . THR A 1 26  ? 28.570 25.608 11.244  1.00 20.21 ? 2619 THR A CA  1 
ATOM   170  C C   . THR A 1 26  ? 28.479 24.136 10.848  1.00 19.80 ? 2619 THR A C   1 
ATOM   171  O O   . THR A 1 26  ? 29.407 23.383 11.080  1.00 20.23 ? 2619 THR A O   1 
ATOM   172  C CB  . THR A 1 26  ? 27.964 25.875 12.626  1.00 20.50 ? 2619 THR A CB  1 
ATOM   173  O OG1 . THR A 1 26  ? 28.401 27.173 13.059  1.00 22.18 ? 2619 THR A OG1 1 
ATOM   174  C CG2 . THR A 1 26  ? 28.448 24.857 13.611  1.00 22.76 ? 2619 THR A CG2 1 
ATOM   175  N N   . LYS A 1 27  ? 27.367 23.733 10.256  1.00 19.73 ? 2620 LYS A N   1 
ATOM   176  C CA  . LYS A 1 27  ? 27.246 22.369 9.717   1.00 19.81 ? 2620 LYS A CA  1 
ATOM   177  C C   . LYS A 1 27  ? 28.250 22.100 8.607   1.00 19.59 ? 2620 LYS A C   1 
ATOM   178  O O   . LYS A 1 27  ? 28.834 21.008 8.526   1.00 18.86 ? 2620 LYS A O   1 
ATOM   179  C CB  . LYS A 1 27  ? 25.827 22.147 9.203   1.00 20.67 ? 2620 LYS A CB  1 
ATOM   180  C CG  . LYS A 1 27  ? 24.828 22.013 10.332  1.00 22.70 ? 2620 LYS A CG  1 
ATOM   181  C CD  . LYS A 1 27  ? 24.960 20.633 10.962  1.00 26.10 ? 2620 LYS A CD  1 
ATOM   182  C CE  . LYS A 1 27  ? 24.275 20.595 12.323  1.00 30.33 ? 2620 LYS A CE  1 
ATOM   183  N NZ  . LYS A 1 27  ? 25.165 21.127 13.398  1.00 32.25 ? 2620 LYS A NZ  1 
ATOM   184  N N   . TYR A 1 28  ? 28.457 23.097 7.744   1.00 19.36 ? 2621 TYR A N   1 
ATOM   185  C CA  . TYR A 1 28  ? 29.423 22.921 6.669   1.00 18.54 ? 2621 TYR A CA  1 
ATOM   186  C C   . TYR A 1 28  ? 30.855 22.871 7.192   1.00 18.59 ? 2621 TYR A C   1 
ATOM   187  O O   . TYR A 1 28  ? 31.686 22.103 6.689   1.00 18.80 ? 2621 TYR A O   1 
ATOM   188  C CB  . TYR A 1 28  ? 29.261 23.987 5.581   1.00 18.70 ? 2621 TYR A CB  1 
ATOM   189  C CG  . TYR A 1 28  ? 30.152 23.703 4.396   1.00 18.90 ? 2621 TYR A CG  1 
ATOM   190  C CD1 . TYR A 1 28  ? 29.907 22.607 3.567   1.00 20.31 ? 2621 TYR A CD1 1 
ATOM   191  C CD2 . TYR A 1 28  ? 31.262 24.521 4.107   1.00 20.69 ? 2621 TYR A CD2 1 
ATOM   192  C CE1 . TYR A 1 28  ? 30.708 22.336 2.472   1.00 21.93 ? 2621 TYR A CE1 1 
ATOM   193  C CE2 . TYR A 1 28  ? 32.070 24.257 3.009   1.00 23.31 ? 2621 TYR A CE2 1 
ATOM   194  C CZ  . TYR A 1 28  ? 31.802 23.155 2.207   1.00 23.98 ? 2621 TYR A CZ  1 
ATOM   195  O OH  . TYR A 1 28  ? 32.596 22.875 1.112   1.00 24.55 ? 2621 TYR A OH  1 
ATOM   196  N N   . ALA A 1 29  ? 31.137 23.666 8.222   1.00 19.12 ? 2622 ALA A N   1 
ATOM   197  C CA  . ALA A 1 29  ? 32.444 23.643 8.886   1.00 18.97 ? 2622 ALA A CA  1 
ATOM   198  C C   . ALA A 1 29  ? 32.741 22.240 9.419   1.00 19.60 ? 2622 ALA A C   1 
ATOM   199  O O   . ALA A 1 29  ? 33.860 21.717 9.247   1.00 19.62 ? 2622 ALA A O   1 
ATOM   200  C CB  . ALA A 1 29  ? 32.484 24.677 10.039  1.00 19.02 ? 2622 ALA A CB  1 
ATOM   201  N N   . GLU A 1 30  ? 31.729 21.624 10.037  1.00 20.22 ? 2623 GLU A N   1 
ATOM   202  C CA  . GLU A 1 30  ? 31.892 20.277 10.586  1.00 20.99 ? 2623 GLU A CA  1 
ATOM   203  C C   . GLU A 1 30  ? 32.091 19.271 9.452   1.00 21.31 ? 2623 GLU A C   1 
ATOM   204  O O   . GLU A 1 30  ? 32.933 18.360 9.555   1.00 20.91 ? 2623 GLU A O   1 
ATOM   205  C CB  . GLU A 1 30  ? 30.717 19.873 11.488  1.00 21.38 ? 2623 GLU A CB  1 
ATOM   206  C CG  . GLU A 1 30  ? 30.836 18.410 12.041  1.00 22.48 ? 2623 GLU A CG  1 
ATOM   207  C CD  . GLU A 1 30  ? 30.030 18.183 13.307  1.00 27.93 ? 2623 GLU A CD  1 
ATOM   208  O OE1 . GLU A 1 30  ? 29.144 19.010 13.583  1.00 27.60 ? 2623 GLU A OE1 1 
ATOM   209  O OE2 . GLU A 1 30  ? 30.285 17.179 14.023  1.00 30.09 ? 2623 GLU A OE2 1 
ATOM   210  N N   . HIS A 1 31  ? 31.331 19.452 8.365   1.00 21.93 ? 2624 HIS A N   1 
ATOM   211  C CA  . HIS A 1 31  ? 31.538 18.648 7.165   1.00 22.66 ? 2624 HIS A CA  1 
ATOM   212  C C   . HIS A 1 31  ? 32.984 18.726 6.672   1.00 22.94 ? 2624 HIS A C   1 
ATOM   213  O O   . HIS A 1 31  ? 33.602 17.689 6.425   1.00 23.64 ? 2624 HIS A O   1 
ATOM   214  C CB  . HIS A 1 31  ? 30.581 19.054 6.042   1.00 22.86 ? 2624 HIS A CB  1 
ATOM   215  C CG  . HIS A 1 31  ? 30.766 18.259 4.792   1.00 23.18 ? 2624 HIS A CG  1 
ATOM   216  N ND1 . HIS A 1 31  ? 31.572 18.673 3.755   1.00 26.11 ? 2624 HIS A ND1 1 
ATOM   217  C CD2 . HIS A 1 31  ? 30.270 17.057 4.426   1.00 22.69 ? 2624 HIS A CD2 1 
ATOM   218  C CE1 . HIS A 1 31  ? 31.559 17.762 2.798   1.00 22.50 ? 2624 HIS A CE1 1 
ATOM   219  N NE2 . HIS A 1 31  ? 30.780 16.770 3.185   1.00 25.52 ? 2624 HIS A NE2 1 
ATOM   220  N N   . SER A 1 32  ? 33.498 19.952 6.512   1.00 22.66 ? 2625 SER A N   1 
ATOM   221  C CA  . SER A 1 32  ? 34.871 20.207 6.018   1.00 22.58 ? 2625 SER A CA  1 
ATOM   222  C C   . SER A 1 32  ? 35.901 19.548 6.945   1.00 22.02 ? 2625 SER A C   1 
ATOM   223  O O   . SER A 1 32  ? 36.848 18.903 6.483   1.00 21.64 ? 2625 SER A O   1 
ATOM   224  C CB  . SER A 1 32  ? 35.162 21.716 5.896   1.00 23.40 ? 2625 SER A CB  1 
ATOM   225  O OG  . SER A 1 32  ? 34.272 22.369 4.993   1.00 25.31 ? 2625 SER A OG  1 
ATOM   226  N N   . HIS A 1 33  ? 35.694 19.693 8.253   1.00 21.38 ? 2626 HIS A N   1 
ATOM   227  C CA  . HIS A 1 33  ? 36.569 19.025 9.239   1.00 21.13 ? 2626 HIS A CA  1 
ATOM   228  C C   . HIS A 1 33  ? 36.546 17.488 9.150   1.00 21.93 ? 2626 HIS A C   1 
ATOM   229  O O   . HIS A 1 33  ? 37.607 16.840 9.163   1.00 21.88 ? 2626 HIS A O   1 
ATOM   230  C CB  . HIS A 1 33  ? 36.225 19.477 10.655  1.00 20.17 ? 2626 HIS A CB  1 
ATOM   231  C CG  . HIS A 1 33  ? 37.013 18.765 11.709  1.00 19.48 ? 2626 HIS A CG  1 
ATOM   232  N ND1 . HIS A 1 33  ? 38.382 18.877 11.805  1.00 19.14 ? 2626 HIS A ND1 1 
ATOM   233  C CD2 . HIS A 1 33  ? 36.629 17.912 12.690  1.00 18.36 ? 2626 HIS A CD2 1 
ATOM   234  C CE1 . HIS A 1 33  ? 38.807 18.144 12.822  1.00 18.36 ? 2626 HIS A CE1 1 
ATOM   235  N NE2 . HIS A 1 33  ? 37.764 17.531 13.360  1.00 18.53 ? 2626 HIS A NE2 1 
ATOM   236  N N   . ASP A 1 34  ? 35.350 16.911 9.053   1.00 22.51 ? 2627 ASP A N   1 
ATOM   237  C CA  . ASP A 1 34  ? 35.221 15.456 9.003   1.00 24.10 ? 2627 ASP A CA  1 
ATOM   238  C C   . ASP A 1 34  ? 35.863 14.942 7.725   1.00 24.19 ? 2627 ASP A C   1 
ATOM   239  O O   . ASP A 1 34  ? 36.506 13.895 7.730   1.00 24.42 ? 2627 ASP A O   1 
ATOM   240  C CB  . ASP A 1 34  ? 33.766 15.010 9.094   1.00 23.83 ? 2627 ASP A CB  1 
ATOM   241  C CG  . ASP A 1 34  ? 33.165 15.185 10.480  1.00 25.45 ? 2627 ASP A CG  1 
ATOM   242  O OD1 . ASP A 1 34  ? 33.892 15.336 11.486  1.00 24.61 ? 2627 ASP A OD1 1 
ATOM   243  O OD2 . ASP A 1 34  ? 31.925 15.138 10.578  1.00 26.00 ? 2627 ASP A OD2 1 
ATOM   244  N N   . LYS A 1 35  ? 35.721 15.712 6.646   1.00 24.93 ? 2628 LYS A N   1 
ATOM   245  C CA  . LYS A 1 35  ? 36.344 15.380 5.372   1.00 25.99 ? 2628 LYS A CA  1 
ATOM   246  C C   . LYS A 1 35  ? 37.857 15.354 5.518   1.00 25.81 ? 2628 LYS A C   1 
ATOM   247  O O   . LYS A 1 35  ? 38.504 14.363 5.155   1.00 26.11 ? 2628 LYS A O   1 
ATOM   248  C CB  . LYS A 1 35  ? 35.913 16.368 4.279   1.00 26.47 ? 2628 LYS A CB  1 
ATOM   249  C CG  . LYS A 1 35  ? 36.421 16.028 2.888   1.00 30.68 ? 2628 LYS A CG  1 
ATOM   250  C CD  . LYS A 1 35  ? 35.859 14.698 2.383   1.00 34.78 ? 2628 LYS A CD  1 
ATOM   251  C CE  . LYS A 1 35  ? 36.113 14.501 0.882   1.00 38.14 ? 2628 LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 35  ? 37.556 14.639 0.507   1.00 39.81 ? 2628 LYS A NZ  1 
ATOM   253  N N   . TRP A 1 36  ? 38.409 16.444 6.048   1.00 25.24 ? 2629 TRP A N   1 
ATOM   254  C CA  . TRP A 1 36  ? 39.841 16.541 6.323   1.00 25.30 ? 2629 TRP A CA  1 
ATOM   255  C C   . TRP A 1 36  ? 40.349 15.367 7.177   1.00 25.48 ? 2629 TRP A C   1 
ATOM   256  O O   . TRP A 1 36  ? 41.375 14.741 6.861   1.00 24.75 ? 2629 TRP A O   1 
ATOM   257  C CB  . TRP A 1 36  ? 40.155 17.879 7.016   1.00 25.23 ? 2629 TRP A CB  1 
ATOM   258  C CG  . TRP A 1 36  ? 41.586 17.967 7.405   1.00 25.21 ? 2629 TRP A CG  1 
ATOM   259  C CD1 . TRP A 1 36  ? 42.619 18.397 6.628   1.00 25.85 ? 2629 TRP A CD1 1 
ATOM   260  C CD2 . TRP A 1 36  ? 42.158 17.552 8.653   1.00 24.97 ? 2629 TRP A CD2 1 
ATOM   261  N NE1 . TRP A 1 36  ? 43.805 18.306 7.328   1.00 27.19 ? 2629 TRP A NE1 1 
ATOM   262  C CE2 . TRP A 1 36  ? 43.547 17.776 8.570   1.00 27.10 ? 2629 TRP A CE2 1 
ATOM   263  C CE3 . TRP A 1 36  ? 41.622 17.022 9.841   1.00 25.70 ? 2629 TRP A CE3 1 
ATOM   264  C CZ2 . TRP A 1 36  ? 44.418 17.504 9.641   1.00 27.51 ? 2629 TRP A CZ2 1 
ATOM   265  C CZ3 . TRP A 1 36  ? 42.488 16.729 10.897  1.00 25.61 ? 2629 TRP A CZ3 1 
ATOM   266  C CH2 . TRP A 1 36  ? 43.869 16.971 10.785  1.00 25.12 ? 2629 TRP A CH2 1 
ATOM   267  N N   . ALA A 1 37  ? 39.660 15.095 8.286   1.00 25.44 ? 2630 ALA A N   1 
ATOM   268  C CA  . ALA A 1 37  ? 40.092 14.053 9.217   1.00 26.52 ? 2630 ALA A CA  1 
ATOM   269  C C   . ALA A 1 37  ? 39.932 12.643 8.649   1.00 27.59 ? 2630 ALA A C   1 
ATOM   270  O O   . ALA A 1 37  ? 40.774 11.775 8.903   1.00 27.45 ? 2630 ALA A O   1 
ATOM   271  C CB  . ALA A 1 37  ? 39.356 14.175 10.562  1.00 25.91 ? 2630 ALA A CB  1 
ATOM   272  N N   . CYS A 1 38  ? 38.859 12.416 7.892   1.00 29.07 ? 2631 CYS A N   1 
ATOM   273  C CA  . CYS A 1 38  ? 38.658 11.130 7.217   1.00 31.64 ? 2631 CYS A CA  1 
ATOM   274  C C   . CYS A 1 38  ? 39.826 10.840 6.268   1.00 32.18 ? 2631 CYS A C   1 
ATOM   275  O O   . CYS A 1 38  ? 40.424 9.754  6.332   1.00 33.12 ? 2631 CYS A O   1 
ATOM   276  C CB  . CYS A 1 38  ? 37.332 11.120 6.455   1.00 31.74 ? 2631 CYS A CB  1 
ATOM   277  S SG  . CYS A 1 38  ? 37.006 9.548  5.618   1.00 36.95 ? 2631 CYS A SG  1 
ATOM   278  N N   . ASP A 1 39  ? 40.141 11.814 5.412   1.00 32.62 ? 2632 ASP A N   1 
ATOM   279  C CA  . ASP A 1 39  ? 41.262 11.731 4.469   1.00 33.56 ? 2632 ASP A CA  1 
ATOM   280  C C   . ASP A 1 39  ? 42.585 11.467 5.206   1.00 33.32 ? 2632 ASP A C   1 
ATOM   281  O O   . ASP A 1 39  ? 43.312 10.536 4.855   1.00 32.84 ? 2632 ASP A O   1 
ATOM   282  C CB  . ASP A 1 39  ? 41.370 13.005 3.617   1.00 34.09 ? 2632 ASP A CB  1 
ATOM   283  C CG  . ASP A 1 39  ? 40.262 13.115 2.534   1.00 36.62 ? 2632 ASP A CG  1 
ATOM   284  O OD1 . ASP A 1 39  ? 39.594 12.110 2.204   1.00 39.47 ? 2632 ASP A OD1 1 
ATOM   285  O OD2 . ASP A 1 39  ? 40.067 14.231 2.012   1.00 39.80 ? 2632 ASP A OD2 1 
ATOM   286  N N   . LYS A 1 40  ? 42.876 12.270 6.236   1.00 32.55 ? 2633 LYS A N   1 
ATOM   287  C CA  . LYS A 1 40  ? 44.055 12.051 7.093   1.00 32.15 ? 2633 LYS A CA  1 
ATOM   288  C C   . LYS A 1 40  ? 44.140 10.649 7.675   1.00 31.74 ? 2633 LYS A C   1 
ATOM   289  O O   . LYS A 1 40  ? 45.230 10.075 7.728   1.00 31.89 ? 2633 LYS A O   1 
ATOM   290  C CB  . LYS A 1 40  ? 44.107 13.061 8.246   1.00 32.11 ? 2633 LYS A CB  1 
ATOM   291  C CG  . LYS A 1 40  ? 44.824 14.328 7.902   1.00 32.87 ? 2633 LYS A CG  1 
ATOM   292  C CD  . LYS A 1 40  ? 46.299 14.100 7.841   1.00 33.80 ? 2633 LYS A CD  1 
ATOM   293  C CE  . LYS A 1 40  ? 46.969 15.318 7.299   1.00 35.55 ? 2633 LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 40  ? 48.435 15.141 7.229   1.00 37.08 ? 2633 LYS A NZ  1 
ATOM   295  N N   . SER A 1 41  ? 43.004 10.123 8.132   1.00 31.39 ? 2634 SER A N   1 
ATOM   296  C CA  A SER A 1 41  ? 42.930 8.781  8.714   0.50 32.06 ? 2634 SER A CA  1 
ATOM   297  C CA  B SER A 1 41  ? 42.959 8.787  8.714   0.50 31.81 ? 2634 SER A CA  1 
ATOM   298  C C   . SER A 1 41  ? 43.277 7.723  7.660   1.00 32.16 ? 2634 SER A C   1 
ATOM   299  O O   . SER A 1 41  ? 44.043 6.791  7.927   1.00 32.41 ? 2634 SER A O   1 
ATOM   300  C CB  A SER A 1 41  ? 41.538 8.527  9.304   0.50 31.94 ? 2634 SER A CB  1 
ATOM   301  C CB  B SER A 1 41  ? 41.609 8.531  9.377   0.50 31.64 ? 2634 SER A CB  1 
ATOM   302  O OG  A SER A 1 41  ? 41.459 7.265  9.950   0.50 32.05 ? 2634 SER A OG  1 
ATOM   303  O OG  B SER A 1 41  ? 41.473 9.332  10.537  0.50 30.23 ? 2634 SER A OG  1 
ATOM   304  N N   . GLN A 1 42  ? 42.723 7.892  6.456   1.00 33.28 ? 2635 GLN A N   1 
ATOM   305  C CA  . GLN A 1 42  ? 42.996 6.991  5.327   1.00 33.98 ? 2635 GLN A CA  1 
ATOM   306  C C   . GLN A 1 42  ? 44.474 7.013  4.950   1.00 34.63 ? 2635 GLN A C   1 
ATOM   307  O O   . GLN A 1 42  ? 45.037 5.971  4.585   1.00 34.78 ? 2635 GLN A O   1 
ATOM   308  C CB  . GLN A 1 42  ? 42.133 7.351  4.113   1.00 34.09 ? 2635 GLN A CB  1 
ATOM   309  N N   . SER A 1 43  ? 45.089 8.196  5.040   1.00 34.12 ? 2636 SER A N   1 
ATOM   310  C CA  . SER A 1 43  ? 46.533 8.377  4.836   1.00 34.85 ? 2636 SER A CA  1 
ATOM   311  C C   . SER A 1 43  ? 47.404 7.794  5.949   1.00 34.02 ? 2636 SER A C   1 
ATOM   312  O O   . SER A 1 43  ? 48.628 7.900  5.877   1.00 34.77 ? 2636 SER A O   1 
ATOM   313  C CB  . SER A 1 43  ? 46.883 9.859  4.686   1.00 35.01 ? 2636 SER A CB  1 
ATOM   314  O OG  . SER A 1 43  ? 46.570 10.352 3.402   1.00 37.69 ? 2636 SER A OG  1 
ATOM   315  N N   . GLY A 1 44  ? 46.785 7.216  6.981   1.00 33.20 ? 2637 GLY A N   1 
ATOM   316  C CA  . GLY A 1 44  ? 47.519 6.501  8.025   1.00 32.09 ? 2637 GLY A CA  1 
ATOM   317  C C   . GLY A 1 44  ? 47.728 7.246  9.338   1.00 31.07 ? 2637 GLY A C   1 
ATOM   318  O O   . GLY A 1 44  ? 48.460 6.775  10.215  1.00 31.50 ? 2637 GLY A O   1 
ATOM   319  N N   . TRP A 1 45  ? 47.082 8.403  9.470   1.00 29.41 ? 2638 TRP A N   1 
ATOM   320  C CA  . TRP A 1 45  ? 47.168 9.219  10.696  1.00 27.21 ? 2638 TRP A CA  1 
ATOM   321  C C   . TRP A 1 45  ? 46.086 8.844  11.715  1.00 25.93 ? 2638 TRP A C   1 
ATOM   322  O O   . TRP A 1 45  ? 45.023 8.320  11.371  1.00 26.18 ? 2638 TRP A O   1 
ATOM   323  C CB  . TRP A 1 45  ? 47.069 10.706 10.354  1.00 26.84 ? 2638 TRP A CB  1 
ATOM   324  C CG  . TRP A 1 45  ? 48.198 11.276 9.545   1.00 26.66 ? 2638 TRP A CG  1 
ATOM   325  C CD1 . TRP A 1 45  ? 48.441 11.079 8.204   1.00 28.22 ? 2638 TRP A CD1 1 
ATOM   326  C CD2 . TRP A 1 45  ? 49.219 12.167 10.008  1.00 26.74 ? 2638 TRP A CD2 1 
ATOM   327  N NE1 . TRP A 1 45  ? 49.557 11.785 7.822   1.00 29.25 ? 2638 TRP A NE1 1 
ATOM   328  C CE2 . TRP A 1 45  ? 50.053 12.460 8.908   1.00 27.29 ? 2638 TRP A CE2 1 
ATOM   329  C CE3 . TRP A 1 45  ? 49.513 12.746 11.254  1.00 24.63 ? 2638 TRP A CE3 1 
ATOM   330  C CZ2 . TRP A 1 45  ? 51.160 13.298 9.015   1.00 27.49 ? 2638 TRP A CZ2 1 
ATOM   331  C CZ3 . TRP A 1 45  ? 50.610 13.567 11.362  1.00 25.24 ? 2638 TRP A CZ3 1 
ATOM   332  C CH2 . TRP A 1 45  ? 51.428 13.843 10.242  1.00 28.34 ? 2638 TRP A CH2 1 
ATOM   333  N N   . LYS A 1 46  ? 46.355 9.119  12.988  1.00 24.53 ? 2639 LYS A N   1 
ATOM   334  C CA  . LYS A 1 46  ? 45.384 8.850  14.033  1.00 23.23 ? 2639 LYS A CA  1 
ATOM   335  C C   . LYS A 1 46  ? 45.478 9.965  15.056  1.00 21.59 ? 2639 LYS A C   1 
ATOM   336  O O   . LYS A 1 46  ? 46.464 10.707 15.067  1.00 21.04 ? 2639 LYS A O   1 
ATOM   337  C CB  . LYS A 1 46  ? 45.676 7.510  14.713  1.00 24.01 ? 2639 LYS A CB  1 
ATOM   338  C CG  . LYS A 1 46  ? 47.029 7.424  15.405  1.00 25.02 ? 2639 LYS A CG  1 
ATOM   339  C CD  . LYS A 1 46  ? 47.201 6.044  16.028  1.00 32.03 ? 2639 LYS A CD  1 
ATOM   340  C CE  . LYS A 1 46  ? 48.655 5.744  16.342  1.00 35.12 ? 2639 LYS A CE  1 
ATOM   341  N NZ  . LYS A 1 46  ? 48.749 4.737  17.452  1.00 38.12 ? 2639 LYS A NZ  1 
ATOM   342  N N   . TYR A 1 47  ? 44.466 10.068 15.910  1.00 20.97 ? 2640 TYR A N   1 
ATOM   343  C CA  . TYR A 1 47  ? 44.537 11.027 17.023  1.00 21.36 ? 2640 TYR A CA  1 
ATOM   344  C C   . TYR A 1 47  ? 45.782 10.810 17.890  1.00 21.44 ? 2640 TYR A C   1 
ATOM   345  O O   . TYR A 1 47  ? 46.147 9.682  18.204  1.00 22.59 ? 2640 TYR A O   1 
ATOM   346  C CB  . TYR A 1 47  ? 43.295 10.977 17.913  1.00 20.45 ? 2640 TYR A CB  1 
ATOM   347  C CG  . TYR A 1 47  ? 43.434 11.932 19.078  1.00 20.37 ? 2640 TYR A CG  1 
ATOM   348  C CD1 . TYR A 1 47  ? 43.290 13.313 18.883  1.00 19.61 ? 2640 TYR A CD1 1 
ATOM   349  C CD2 . TYR A 1 47  ? 43.768 11.469 20.358  1.00 19.74 ? 2640 TYR A CD2 1 
ATOM   350  C CE1 . TYR A 1 47  ? 43.459 14.212 19.927  1.00 18.82 ? 2640 TYR A CE1 1 
ATOM   351  C CE2 . TYR A 1 47  ? 43.927 12.369 21.428  1.00 19.79 ? 2640 TYR A CE2 1 
ATOM   352  C CZ  . TYR A 1 47  ? 43.774 13.736 21.199  1.00 18.48 ? 2640 TYR A CZ  1 
ATOM   353  O OH  . TYR A 1 47  ? 43.940 14.648 22.223  1.00 19.56 ? 2640 TYR A OH  1 
ATOM   354  N N   . GLY A 1 48  ? 46.412 11.907 18.287  1.00 21.19 ? 2641 GLY A N   1 
ATOM   355  C CA  . GLY A 1 48  ? 47.364 11.891 19.408  1.00 21.03 ? 2641 GLY A CA  1 
ATOM   356  C C   . GLY A 1 48  ? 47.297 13.238 20.092  1.00 20.89 ? 2641 GLY A C   1 
ATOM   357  O O   . GLY A 1 48  ? 46.873 14.230 19.491  1.00 20.47 ? 2641 GLY A O   1 
ATOM   358  N N   . ILE A 1 49  ? 47.720 13.286 21.353  1.00 20.55 ? 2642 ILE A N   1 
ATOM   359  C CA  . ILE A 1 49  ? 47.809 14.554 22.077  1.00 21.01 ? 2642 ILE A CA  1 
ATOM   360  C C   . ILE A 1 49  ? 48.766 15.527 21.387  1.00 20.92 ? 2642 ILE A C   1 
ATOM   361  O O   . ILE A 1 49  ? 48.520 16.741 21.350  1.00 21.58 ? 2642 ILE A O   1 
ATOM   362  C CB  . ILE A 1 49  ? 48.233 14.294 23.542  1.00 20.35 ? 2642 ILE A CB  1 
ATOM   363  C CG1 . ILE A 1 49  ? 47.081 13.606 24.285  1.00 21.20 ? 2642 ILE A CG1 1 
ATOM   364  C CG2 . ILE A 1 49  ? 48.678 15.600 24.219  1.00 21.38 ? 2642 ILE A CG2 1 
ATOM   365  C CD1 . ILE A 1 49  ? 47.512 13.009 25.624  1.00 21.85 ? 2642 ILE A CD1 1 
ATOM   366  N N   . SER A 1 50  ? 49.840 14.991 20.817  1.00 21.20 ? 2643 SER A N   1 
ATOM   367  C CA  . SER A 1 50  ? 50.839 15.801 20.160  1.00 21.88 ? 2643 SER A CA  1 
ATOM   368  C C   . SER A 1 50  ? 50.856 15.505 18.673  1.00 21.71 ? 2643 SER A C   1 
ATOM   369  O O   . SER A 1 50  ? 50.574 14.385 18.251  1.00 21.64 ? 2643 SER A O   1 
ATOM   370  C CB  . SER A 1 50  ? 52.228 15.509 20.733  1.00 22.46 ? 2643 SER A CB  1 
ATOM   371  O OG  . SER A 1 50  ? 52.299 15.952 22.075  1.00 25.34 ? 2643 SER A OG  1 
ATOM   372  N N   . LEU A 1 51  ? 51.182 16.523 17.892  1.00 22.06 ? 2644 LEU A N   1 
ATOM   373  C CA  . LEU A 1 51  ? 51.436 16.325 16.465  1.00 22.77 ? 2644 LEU A CA  1 
ATOM   374  C C   . LEU A 1 51  ? 52.825 15.730 16.288  1.00 23.68 ? 2644 LEU A C   1 
ATOM   375  O O   . LEU A 1 51  ? 53.802 16.322 16.726  1.00 23.79 ? 2644 LEU A O   1 
ATOM   376  C CB  . LEU A 1 51  ? 51.331 17.656 15.719  1.00 22.58 ? 2644 LEU A CB  1 
ATOM   377  C CG  . LEU A 1 51  ? 51.596 17.631 14.213  1.00 23.13 ? 2644 LEU A CG  1 
ATOM   378  C CD1 . LEU A 1 51  ? 50.650 16.711 13.455  1.00 25.53 ? 2644 LEU A CD1 1 
ATOM   379  C CD2 . LEU A 1 51  ? 51.496 19.040 13.662  1.00 25.95 ? 2644 LEU A CD2 1 
ATOM   380  N N   . ASP A 1 52  ? 52.911 14.570 15.642  1.00 25.32 ? 2645 ASP A N   1 
ATOM   381  C CA  . ASP A 1 52  ? 54.198 13.886 15.475  1.00 28.02 ? 2645 ASP A CA  1 
ATOM   382  C C   . ASP A 1 52  ? 54.159 13.150 14.140  1.00 29.04 ? 2645 ASP A C   1 
ATOM   383  O O   . ASP A 1 52  ? 53.460 12.163 14.003  1.00 29.14 ? 2645 ASP A O   1 
ATOM   384  C CB  . ASP A 1 52  ? 54.451 12.896 16.635  1.00 28.13 ? 2645 ASP A CB  1 
ATOM   385  C CG  . ASP A 1 52  ? 55.874 12.296 16.618  1.00 31.47 ? 2645 ASP A CG  1 
ATOM   386  O OD1 . ASP A 1 52  ? 56.454 12.112 15.526  1.00 34.31 ? 2645 ASP A OD1 1 
ATOM   387  O OD2 . ASP A 1 52  ? 56.416 12.028 17.713  1.00 34.30 ? 2645 ASP A OD2 1 
ATOM   388  N N   . GLU A 1 53  ? 54.892 13.669 13.166  1.00 30.99 ? 2646 GLU A N   1 
ATOM   389  C CA  . GLU A 1 53  ? 54.974 13.071 11.829  1.00 33.44 ? 2646 GLU A CA  1 
ATOM   390  C C   . GLU A 1 53  ? 55.553 11.663 11.815  1.00 33.83 ? 2646 GLU A C   1 
ATOM   391  O O   . GLU A 1 53  ? 55.167 10.843 10.978  1.00 34.61 ? 2646 GLU A O   1 
ATOM   392  C CB  . GLU A 1 53  ? 55.880 13.906 10.955  1.00 33.85 ? 2646 GLU A CB  1 
ATOM   393  C CG  . GLU A 1 53  ? 55.212 14.976 10.166  1.00 37.49 ? 2646 GLU A CG  1 
ATOM   394  C CD  . GLU A 1 53  ? 56.222 15.673 9.300   1.00 40.46 ? 2646 GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 53  ? 57.124 16.324 9.871   1.00 42.43 ? 2646 GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 53  ? 56.126 15.541 8.060   1.00 41.92 ? 2646 GLU A OE2 1 
ATOM   397  N N   . ASN A 1 54  ? 56.502 11.398 12.712  1.00 34.69 ? 2647 ASN A N   1 
ATOM   398  C CA  . ASN A 1 54  ? 57.161 10.091 12.769  1.00 34.46 ? 2647 ASN A CA  1 
ATOM   399  C C   . ASN A 1 54  ? 56.196 8.962  13.114  1.00 34.17 ? 2647 ASN A C   1 
ATOM   400  O O   . ASN A 1 54  ? 56.286 7.873  12.545  1.00 35.35 ? 2647 ASN A O   1 
ATOM   401  C CB  . ASN A 1 54  ? 58.351 10.109 13.739  1.00 35.00 ? 2647 ASN A CB  1 
ATOM   402  N N   . VAL A 1 55  ? 55.261 9.215  14.028  1.00 32.66 ? 2648 VAL A N   1 
ATOM   403  C CA  . VAL A 1 55  ? 54.263 8.206  14.382  1.00 30.83 ? 2648 VAL A CA  1 
ATOM   404  C C   . VAL A 1 55  ? 52.871 8.513  13.799  1.00 29.47 ? 2648 VAL A C   1 
ATOM   405  O O   . VAL A 1 55  ? 51.909 7.771  14.039  1.00 29.22 ? 2648 VAL A O   1 
ATOM   406  C CB  . VAL A 1 55  ? 54.201 7.926  15.920  1.00 31.28 ? 2648 VAL A CB  1 
ATOM   407  C CG1 . VAL A 1 55  ? 55.549 7.385  16.440  1.00 31.58 ? 2648 VAL A CG1 1 
ATOM   408  C CG2 . VAL A 1 55  ? 53.796 9.164  16.703  1.00 31.17 ? 2648 VAL A CG2 1 
ATOM   409  N N   . LYS A 1 56  ? 52.794 9.584  13.007  1.00 28.01 ? 2649 LYS A N   1 
ATOM   410  C CA  . LYS A 1 56  ? 51.535 10.033 12.385  1.00 26.66 ? 2649 LYS A CA  1 
ATOM   411  C C   . LYS A 1 56  ? 50.393 10.202 13.390  1.00 25.18 ? 2649 LYS A C   1 
ATOM   412  O O   . LYS A 1 56  ? 49.320 9.602  13.256  1.00 24.50 ? 2649 LYS A O   1 
ATOM   413  C CB  . LYS A 1 56  ? 51.127 9.127  11.216  1.00 27.19 ? 2649 LYS A CB  1 
ATOM   414  C CG  . LYS A 1 56  ? 51.998 9.296  9.982   1.00 29.64 ? 2649 LYS A CG  1 
ATOM   415  C CD  . LYS A 1 56  ? 51.378 8.588  8.760   1.00 33.88 ? 2649 LYS A CD  1 
ATOM   416  C CE  . LYS A 1 56  ? 52.090 9.001  7.489   1.00 36.67 ? 2649 LYS A CE  1 
ATOM   417  N NZ  . LYS A 1 56  ? 51.686 8.160  6.317   1.00 38.19 ? 2649 LYS A NZ  1 
ATOM   418  N N   . THR A 1 57  ? 50.648 11.000 14.424  1.00 24.10 ? 2650 THR A N   1 
ATOM   419  C CA  . THR A 1 57  ? 49.579 11.415 15.341  1.00 22.65 ? 2650 THR A CA  1 
ATOM   420  C C   . THR A 1 57  ? 49.253 12.874 15.068  1.00 21.55 ? 2650 THR A C   1 
ATOM   421  O O   . THR A 1 57  ? 50.158 13.673 14.836  1.00 22.02 ? 2650 THR A O   1 
ATOM   422  C CB  . THR A 1 57  ? 49.947 11.217 16.852  1.00 23.24 ? 2650 THR A CB  1 
ATOM   423  O OG1 . THR A 1 57  ? 51.198 11.852 17.155  1.00 22.53 ? 2650 THR A OG1 1 
ATOM   424  C CG2 . THR A 1 57  ? 50.009 9.732  17.198  1.00 23.34 ? 2650 THR A CG2 1 
ATOM   425  N N   . HIS A 1 58  ? 47.964 13.202 15.056  1.00 20.58 ? 2651 HIS A N   1 
ATOM   426  C CA  . HIS A 1 58  ? 47.510 14.580 14.823  1.00 20.70 ? 2651 HIS A CA  1 
ATOM   427  C C   . HIS A 1 58  ? 46.385 14.928 15.795  1.00 19.60 ? 2651 HIS A C   1 
ATOM   428  O O   . HIS A 1 58  ? 45.366 14.243 15.823  1.00 20.30 ? 2651 HIS A O   1 
ATOM   429  C CB  . HIS A 1 58  ? 47.026 14.747 13.366  1.00 20.58 ? 2651 HIS A CB  1 
ATOM   430  C CG  . HIS A 1 58  ? 46.974 16.174 12.921  1.00 21.89 ? 2651 HIS A CG  1 
ATOM   431  N ND1 . HIS A 1 58  ? 46.224 17.122 13.583  1.00 21.27 ? 2651 HIS A ND1 1 
ATOM   432  C CD2 . HIS A 1 58  ? 47.566 16.817 11.886  1.00 23.23 ? 2651 HIS A CD2 1 
ATOM   433  C CE1 . HIS A 1 58  ? 46.361 18.289 12.984  1.00 22.11 ? 2651 HIS A CE1 1 
ATOM   434  N NE2 . HIS A 1 58  ? 47.176 18.136 11.954  1.00 24.54 ? 2651 HIS A NE2 1 
ATOM   435  N N   . PRO A 1 59  ? 46.559 15.988 16.608  1.00 20.16 ? 2652 PRO A N   1 
ATOM   436  C CA  . PRO A 1 59  ? 45.518 16.312 17.602  1.00 19.85 ? 2652 PRO A CA  1 
ATOM   437  C C   . PRO A 1 59  ? 44.174 16.761 17.022  1.00 19.74 ? 2652 PRO A C   1 
ATOM   438  O O   . PRO A 1 59  ? 43.150 16.712 17.731  1.00 19.48 ? 2652 PRO A O   1 
ATOM   439  C CB  . PRO A 1 59  ? 46.148 17.436 18.442  1.00 20.27 ? 2652 PRO A CB  1 
ATOM   440  C CG  . PRO A 1 59  ? 47.284 17.928 17.694  1.00 21.52 ? 2652 PRO A CG  1 
ATOM   441  C CD  . PRO A 1 59  ? 47.728 16.876 16.707  1.00 19.60 ? 2652 PRO A CD  1 
ATOM   442  N N   . LEU A 1 60  ? 44.150 17.216 15.765  1.00 18.88 ? 2653 LEU A N   1 
ATOM   443  C CA  . LEU A 1 60  ? 42.876 17.625 15.146  1.00 19.60 ? 2653 LEU A CA  1 
ATOM   444  C C   . LEU A 1 60  ? 41.996 16.468 14.681  1.00 19.90 ? 2653 LEU A C   1 
ATOM   445  O O   . LEU A 1 60  ? 40.838 16.683 14.322  1.00 19.12 ? 2653 LEU A O   1 
ATOM   446  C CB  . LEU A 1 60  ? 43.120 18.593 13.972  1.00 19.64 ? 2653 LEU A CB  1 
ATOM   447  C CG  . LEU A 1 60  ? 43.500 20.022 14.377  1.00 21.69 ? 2653 LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 60  ? 43.706 20.834 13.117  1.00 21.73 ? 2653 LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 60  ? 42.409 20.699 15.200  1.00 21.33 ? 2653 LEU A CD2 1 
ATOM   450  N N   . ILE A 1 61  ? 42.522 15.243 14.690  1.00 20.25 ? 2654 ILE A N   1 
ATOM   451  C CA  . ILE A 1 61  ? 41.665 14.079 14.398  1.00 20.72 ? 2654 ILE A CA  1 
ATOM   452  C C   . ILE A 1 61  ? 40.830 13.751 15.629  1.00 20.90 ? 2654 ILE A C   1 
ATOM   453  O O   . ILE A 1 61  ? 41.115 12.793 16.360  1.00 20.90 ? 2654 ILE A O   1 
ATOM   454  C CB  . ILE A 1 61  ? 42.459 12.853 13.897  1.00 21.49 ? 2654 ILE A CB  1 
ATOM   455  C CG1 . ILE A 1 61  ? 43.333 13.254 12.712  1.00 21.91 ? 2654 ILE A CG1 1 
ATOM   456  C CG2 . ILE A 1 61  ? 41.524 11.743 13.462  1.00 21.89 ? 2654 ILE A CG2 1 
ATOM   457  C CD1 . ILE A 1 61  ? 44.296 12.134 12.236  1.00 22.07 ? 2654 ILE A CD1 1 
ATOM   458  N N   . ARG A 1 62  ? 39.803 14.573 15.832  1.00 20.10 ? 2655 ARG A N   1 
ATOM   459  C CA  . ARG A 1 62  ? 38.863 14.450 16.945  1.00 20.28 ? 2655 ARG A CA  1 
ATOM   460  C C   . ARG A 1 62  ? 37.545 15.148 16.552  1.00 19.87 ? 2655 ARG A C   1 
ATOM   461  O O   . ARG A 1 62  ? 37.509 15.884 15.557  1.00 19.94 ? 2655 ARG A O   1 
ATOM   462  C CB  . ARG A 1 62  ? 39.463 15.028 18.229  1.00 19.92 ? 2655 ARG A CB  1 
ATOM   463  C CG  . ARG A 1 62  ? 39.716 16.546 18.211  1.00 19.33 ? 2655 ARG A CG  1 
ATOM   464  C CD  . ARG A 1 62  ? 40.335 16.957 19.536  1.00 19.85 ? 2655 ARG A CD  1 
ATOM   465  N NE  . ARG A 1 62  ? 40.158 18.376 19.859  1.00 20.07 ? 2655 ARG A NE  1 
ATOM   466  C CZ  . ARG A 1 62  ? 41.040 19.342 19.580  1.00 20.37 ? 2655 ARG A CZ  1 
ATOM   467  N NH1 . ARG A 1 62  ? 42.167 19.061 18.942  1.00 18.10 ? 2655 ARG A NH1 1 
ATOM   468  N NH2 . ARG A 1 62  ? 40.806 20.595 19.974  1.00 20.63 ? 2655 ARG A NH2 1 
ATOM   469  N N   . PRO A 1 63  ? 36.453 14.906 17.308  1.00 19.38 ? 2656 PRO A N   1 
ATOM   470  C CA  . PRO A 1 63  ? 35.156 15.397 16.839  1.00 19.57 ? 2656 PRO A CA  1 
ATOM   471  C C   . PRO A 1 63  ? 35.139 16.919 16.798  1.00 19.55 ? 2656 PRO A C   1 
ATOM   472  O O   . PRO A 1 63  ? 35.824 17.570 17.581  1.00 19.39 ? 2656 PRO A O   1 
ATOM   473  C CB  . PRO A 1 63  ? 34.175 14.865 17.894  1.00 19.90 ? 2656 PRO A CB  1 
ATOM   474  C CG  . PRO A 1 63  ? 34.866 13.624 18.424  1.00 19.25 ? 2656 PRO A CG  1 
ATOM   475  C CD  . PRO A 1 63  ? 36.308 14.030 18.490  1.00 19.73 ? 2656 PRO A CD  1 
ATOM   476  N N   . PHE A 1 64  ? 34.365 17.465 15.873  1.00 19.55 ? 2657 PHE A N   1 
ATOM   477  C CA  . PHE A 1 64  ? 34.248 18.910 15.718  1.00 20.22 ? 2657 PHE A CA  1 
ATOM   478  C C   . PHE A 1 64  ? 33.865 19.624 17.016  1.00 20.30 ? 2657 PHE A C   1 
ATOM   479  O O   . PHE A 1 64  ? 34.381 20.712 17.301  1.00 20.03 ? 2657 PHE A O   1 
ATOM   480  C CB  . PHE A 1 64  ? 33.225 19.213 14.612  1.00 20.31 ? 2657 PHE A CB  1 
ATOM   481  C CG  . PHE A 1 64  ? 33.144 20.672 14.228  1.00 21.78 ? 2657 PHE A CG  1 
ATOM   482  C CD1 . PHE A 1 64  ? 34.055 21.223 13.326  1.00 22.05 ? 2657 PHE A CD1 1 
ATOM   483  C CD2 . PHE A 1 64  ? 32.152 21.488 14.771  1.00 20.93 ? 2657 PHE A CD2 1 
ATOM   484  C CE1 . PHE A 1 64  ? 33.973 22.577 12.968  1.00 21.56 ? 2657 PHE A CE1 1 
ATOM   485  C CE2 . PHE A 1 64  ? 32.062 22.832 14.414  1.00 19.87 ? 2657 PHE A CE2 1 
ATOM   486  C CZ  . PHE A 1 64  ? 32.978 23.377 13.509  1.00 20.85 ? 2657 PHE A CZ  1 
ATOM   487  N N   . LYS A 1 65  ? 32.960 19.021 17.789  1.00 19.98 ? 2658 LYS A N   1 
ATOM   488  C CA  . LYS A 1 65  ? 32.515 19.637 19.037  1.00 21.28 ? 2658 LYS A CA  1 
ATOM   489  C C   . LYS A 1 65  ? 33.640 19.806 20.066  1.00 21.37 ? 2658 LYS A C   1 
ATOM   490  O O   . LYS A 1 65  ? 33.498 20.602 21.002  1.00 23.03 ? 2658 LYS A O   1 
ATOM   491  C CB  . LYS A 1 65  ? 31.343 18.865 19.657  1.00 21.40 ? 2658 LYS A CB  1 
ATOM   492  N N   . THR A 1 66  ? 34.744 19.075 19.906  1.00 20.75 ? 2659 THR A N   1 
ATOM   493  C CA  . THR A 1 66  ? 35.843 19.134 20.864  1.00 20.59 ? 2659 THR A CA  1 
ATOM   494  C C   . THR A 1 66  ? 36.959 20.064 20.396  1.00 20.08 ? 2659 THR A C   1 
ATOM   495  O O   . THR A 1 66  ? 37.949 20.263 21.098  1.00 19.97 ? 2659 THR A O   1 
ATOM   496  C CB  . THR A 1 66  ? 36.455 17.747 21.174  1.00 20.56 ? 2659 THR A CB  1 
ATOM   497  O OG1 . THR A 1 66  ? 37.171 17.276 20.021  1.00 20.72 ? 2659 THR A OG1 1 
ATOM   498  C CG2 . THR A 1 66  ? 35.390 16.741 21.560  1.00 20.65 ? 2659 THR A CG2 1 
ATOM   499  N N   . LEU A 1 67  ? 36.805 20.634 19.206  1.00 19.73 ? 2660 LEU A N   1 
ATOM   500  C CA  . LEU A 1 67  ? 37.731 21.682 18.751  1.00 19.34 ? 2660 LEU A CA  1 
ATOM   501  C C   . LEU A 1 67  ? 37.516 22.948 19.580  1.00 19.42 ? 2660 LEU A C   1 
ATOM   502  O O   . LEU A 1 67  ? 36.403 23.201 20.070  1.00 20.41 ? 2660 LEU A O   1 
ATOM   503  C CB  . LEU A 1 67  ? 37.502 22.000 17.259  1.00 19.17 ? 2660 LEU A CB  1 
ATOM   504  C CG  . LEU A 1 67  ? 37.671 20.837 16.293  1.00 19.43 ? 2660 LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 67  ? 37.543 21.320 14.847  1.00 18.48 ? 2660 LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 67  ? 39.000 20.099 16.512  1.00 21.10 ? 2660 LEU A CD2 1 
ATOM   507  N N   . THR A 1 68  ? 38.560 23.759 19.721  1.00 19.88 ? 2661 THR A N   1 
ATOM   508  C CA  . THR A 1 68  ? 38.403 25.084 20.309  1.00 20.64 ? 2661 THR A CA  1 
ATOM   509  C C   . THR A 1 68  ? 37.501 25.958 19.441  1.00 21.11 ? 2661 THR A C   1 
ATOM   510  O O   . THR A 1 68  ? 37.295 25.681 18.257  1.00 20.17 ? 2661 THR A O   1 
ATOM   511  C CB  . THR A 1 68  ? 39.773 25.814 20.525  1.00 20.18 ? 2661 THR A CB  1 
ATOM   512  O OG1 . THR A 1 68  ? 40.351 26.155 19.251  1.00 21.56 ? 2661 THR A OG1 1 
ATOM   513  C CG2 . THR A 1 68  ? 40.742 24.951 21.298  1.00 22.01 ? 2661 THR A CG2 1 
ATOM   514  N N   . GLU A 1 69  ? 36.954 27.022 20.027  1.00 22.13 ? 2662 GLU A N   1 
ATOM   515  C CA  . GLU A 1 69  ? 36.147 27.948 19.234  1.00 22.94 ? 2662 GLU A CA  1 
ATOM   516  C C   . GLU A 1 69  ? 36.962 28.505 18.061  1.00 22.48 ? 2662 GLU A C   1 
ATOM   517  O O   . GLU A 1 69  ? 36.455 28.590 16.938  1.00 22.45 ? 2662 GLU A O   1 
ATOM   518  C CB  . GLU A 1 69  ? 35.526 29.058 20.097  1.00 23.88 ? 2662 GLU A CB  1 
ATOM   519  C CG  . GLU A 1 69  ? 34.751 30.151 19.318  1.00 27.11 ? 2662 GLU A CG  1 
ATOM   520  C CD  . GLU A 1 69  ? 33.676 29.630 18.342  1.00 31.47 ? 2662 GLU A CD  1 
ATOM   521  O OE1 . GLU A 1 69  ? 33.086 28.549 18.560  1.00 30.94 ? 2662 GLU A OE1 1 
ATOM   522  O OE2 . GLU A 1 69  ? 33.413 30.333 17.346  1.00 33.94 ? 2662 GLU A OE2 1 
ATOM   523  N N   . LYS A 1 70  ? 38.224 28.863 18.313  1.00 22.76 ? 2663 LYS A N   1 
ATOM   524  C CA  . LYS A 1 70  ? 39.093 29.321 17.219  1.00 22.83 ? 2663 LYS A CA  1 
ATOM   525  C C   . LYS A 1 70  ? 39.308 28.256 16.144  1.00 22.01 ? 2663 LYS A C   1 
ATOM   526  O O   . LYS A 1 70  ? 39.279 28.558 14.949  1.00 20.86 ? 2663 LYS A O   1 
ATOM   527  C CB  . LYS A 1 70  ? 40.431 29.838 17.762  1.00 23.72 ? 2663 LYS A CB  1 
ATOM   528  C CG  . LYS A 1 70  ? 40.282 31.181 18.484  1.00 27.67 ? 2663 LYS A CG  1 
ATOM   529  C CD  . LYS A 1 70  ? 41.611 31.663 19.045  1.00 31.89 ? 2663 LYS A CD  1 
ATOM   530  C CE  . LYS A 1 70  ? 41.437 32.907 19.913  1.00 36.56 ? 2663 LYS A CE  1 
ATOM   531  N NZ  . LYS A 1 70  ? 40.692 33.993 19.193  1.00 38.44 ? 2663 LYS A NZ  1 
ATOM   532  N N   . GLU A 1 71  ? 39.536 27.016 16.568  1.00 20.57 ? 2664 GLU A N   1 
ATOM   533  C CA  . GLU A 1 71  ? 39.686 25.910 15.607  1.00 20.76 ? 2664 GLU A CA  1 
ATOM   534  C C   . GLU A 1 71  ? 38.409 25.690 14.780  1.00 20.40 ? 2664 GLU A C   1 
ATOM   535  O O   . GLU A 1 71  ? 38.483 25.434 13.593  1.00 20.33 ? 2664 GLU A O   1 
ATOM   536  C CB  . GLU A 1 71  ? 40.143 24.638 16.330  1.00 20.35 ? 2664 GLU A CB  1 
ATOM   537  C CG  . GLU A 1 71  ? 41.609 24.723 16.754  1.00 20.83 ? 2664 GLU A CG  1 
ATOM   538  C CD  . GLU A 1 71  ? 42.010 23.658 17.750  1.00 21.64 ? 2664 GLU A CD  1 
ATOM   539  O OE1 . GLU A 1 71  ? 41.104 23.015 18.337  1.00 22.92 ? 2664 GLU A OE1 1 
ATOM   540  O OE2 . GLU A 1 71  ? 43.234 23.472 17.952  1.00 21.21 ? 2664 GLU A OE2 1 
ATOM   541  N N   . LYS A 1 72  ? 37.239 25.831 15.406  1.00 19.73 ? 2665 LYS A N   1 
ATOM   542  C CA  . LYS A 1 72  ? 35.990 25.791 14.653  1.00 19.90 ? 2665 LYS A CA  1 
ATOM   543  C C   . LYS A 1 72  ? 35.878 26.932 13.654  1.00 20.37 ? 2665 LYS A C   1 
ATOM   544  O O   . LYS A 1 72  ? 35.435 26.734 12.525  1.00 20.32 ? 2665 LYS A O   1 
ATOM   545  C CB  . LYS A 1 72  ? 34.786 25.832 15.584  1.00 20.39 ? 2665 LYS A CB  1 
ATOM   546  C CG  . LYS A 1 72  ? 34.601 24.568 16.416  1.00 18.79 ? 2665 LYS A CG  1 
ATOM   547  C CD  . LYS A 1 72  ? 33.461 24.847 17.432  1.00 23.21 ? 2665 LYS A CD  1 
ATOM   548  C CE  . LYS A 1 72  ? 33.197 23.694 18.366  1.00 26.30 ? 2665 LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 72  ? 31.873 23.940 19.036  1.00 29.69 ? 2665 LYS A NZ  1 
ATOM   550  N N   . GLU A 1 73  ? 36.312 28.115 14.077  1.00 19.87 ? 2666 GLU A N   1 
ATOM   551  C CA  . GLU A 1 73  ? 36.111 29.326 13.293  1.00 20.29 ? 2666 GLU A CA  1 
ATOM   552  C C   . GLU A 1 73  ? 36.967 29.309 12.034  1.00 19.71 ? 2666 GLU A C   1 
ATOM   553  O O   . GLU A 1 73  ? 36.592 29.891 11.026  1.00 20.18 ? 2666 GLU A O   1 
ATOM   554  C CB  . GLU A 1 73  ? 36.398 30.561 14.141  1.00 20.70 ? 2666 GLU A CB  1 
ATOM   555  C CG  . GLU A 1 73  ? 36.213 31.927 13.411  1.00 21.24 ? 2666 GLU A CG  1 
ATOM   556  C CD  . GLU A 1 73  ? 34.805 32.222 12.860  1.00 24.58 ? 2666 GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 73  ? 33.827 31.495 13.141  1.00 24.62 ? 2666 GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 73  ? 34.694 33.211 12.106  1.00 27.59 ? 2666 GLU A OE2 1 
ATOM   559  N N   . ILE A 1 74  ? 38.112 28.629 12.096  1.00 19.75 ? 2667 ILE A N   1 
ATOM   560  C CA  . ILE A 1 74  ? 38.981 28.455 10.934  1.00 20.08 ? 2667 ILE A CA  1 
ATOM   561  C C   . ILE A 1 74  ? 38.246 27.754 9.778   1.00 20.07 ? 2667 ILE A C   1 
ATOM   562  O O   . ILE A 1 74  ? 38.448 28.079 8.600   1.00 20.24 ? 2667 ILE A O   1 
ATOM   563  C CB  . ILE A 1 74  ? 40.296 27.719 11.329  1.00 20.35 ? 2667 ILE A CB  1 
ATOM   564  C CG1 . ILE A 1 74  ? 41.161 28.638 12.197  1.00 20.85 ? 2667 ILE A CG1 1 
ATOM   565  C CG2 . ILE A 1 74  ? 41.075 27.241 10.099  1.00 20.78 ? 2667 ILE A CG2 1 
ATOM   566  C CD1 . ILE A 1 74  ? 42.293 27.908 12.912  1.00 22.63 ? 2667 ILE A CD1 1 
ATOM   567  N N   . TYR A 1 75  ? 37.381 26.805 10.129  1.00 19.70 ? 2668 TYR A N   1 
ATOM   568  C CA  . TYR A 1 75  ? 36.575 26.095 9.164   1.00 19.28 ? 2668 TYR A CA  1 
ATOM   569  C C   . TYR A 1 75  ? 35.318 26.903 8.763   1.00 19.38 ? 2668 TYR A C   1 
ATOM   570  O O   . TYR A 1 75  ? 34.893 26.836 7.626   1.00 20.61 ? 2668 TYR A O   1 
ATOM   571  C CB  . TYR A 1 75  ? 36.132 24.768 9.755   1.00 18.68 ? 2668 TYR A CB  1 
ATOM   572  C CG  . TYR A 1 75  ? 37.171 23.674 9.857   1.00 18.80 ? 2668 TYR A CG  1 
ATOM   573  C CD1 . TYR A 1 75  ? 37.619 23.007 8.717   1.00 20.60 ? 2668 TYR A CD1 1 
ATOM   574  C CD2 . TYR A 1 75  ? 37.634 23.236 11.103  1.00 18.00 ? 2668 TYR A CD2 1 
ATOM   575  C CE1 . TYR A 1 75  ? 38.552 21.935 8.818   1.00 20.48 ? 2668 TYR A CE1 1 
ATOM   576  C CE2 . TYR A 1 75  ? 38.552 22.178 11.215  1.00 18.81 ? 2668 TYR A CE2 1 
ATOM   577  C CZ  . TYR A 1 75  ? 39.001 21.534 10.065  1.00 18.99 ? 2668 TYR A CZ  1 
ATOM   578  O OH  . TYR A 1 75  ? 39.893 20.479 10.143  1.00 20.23 ? 2668 TYR A OH  1 
ATOM   579  N N   . ARG A 1 76  ? 34.738 27.645 9.694   1.00 19.28 ? 2669 ARG A N   1 
ATOM   580  C CA  . ARG A 1 76  ? 33.539 28.456 9.388   1.00 19.89 ? 2669 ARG A CA  1 
ATOM   581  C C   . ARG A 1 76  ? 33.827 29.611 8.434   1.00 20.14 ? 2669 ARG A C   1 
ATOM   582  O O   . ARG A 1 76  ? 33.040 29.881 7.522   1.00 20.00 ? 2669 ARG A O   1 
ATOM   583  C CB  . ARG A 1 76  ? 32.937 29.040 10.654  1.00 19.68 ? 2669 ARG A CB  1 
ATOM   584  C CG  . ARG A 1 76  ? 32.319 28.027 11.619  1.00 20.49 ? 2669 ARG A CG  1 
ATOM   585  C CD  . ARG A 1 76  ? 31.376 28.762 12.540  1.00 22.43 ? 2669 ARG A CD  1 
ATOM   586  N NE  . ARG A 1 76  ? 31.140 28.113 13.821  1.00 24.62 ? 2669 ARG A NE  1 
ATOM   587  C CZ  . ARG A 1 76  ? 31.831 28.366 14.928  1.00 25.19 ? 2669 ARG A CZ  1 
ATOM   588  N NH1 . ARG A 1 76  ? 32.836 29.240 14.920  1.00 24.99 ? 2669 ARG A NH1 1 
ATOM   589  N NH2 . ARG A 1 76  ? 31.521 27.747 16.055  1.00 25.61 ? 2669 ARG A NH2 1 
ATOM   590  N N   . TRP A 1 77  ? 34.958 30.282 8.655   1.00 20.08 ? 2670 TRP A N   1 
ATOM   591  C CA  . TRP A 1 77  ? 35.217 31.572 8.012   1.00 20.11 ? 2670 TRP A CA  1 
ATOM   592  C C   . TRP A 1 77  ? 35.045 31.565 6.469   1.00 19.77 ? 2670 TRP A C   1 
ATOM   593  O O   . TRP A 1 77  ? 34.336 32.430 5.928   1.00 19.91 ? 2670 TRP A O   1 
ATOM   594  C CB  . TRP A 1 77  ? 36.601 32.121 8.444   1.00 20.71 ? 2670 TRP A CB  1 
ATOM   595  C CG  . TRP A 1 77  ? 36.795 33.603 8.143   1.00 22.96 ? 2670 TRP A CG  1 
ATOM   596  C CD1 . TRP A 1 77  ? 36.614 34.632 9.010   1.00 25.30 ? 2670 TRP A CD1 1 
ATOM   597  C CD2 . TRP A 1 77  ? 37.204 34.194 6.896   1.00 24.51 ? 2670 TRP A CD2 1 
ATOM   598  N NE1 . TRP A 1 77  ? 36.883 35.835 8.393   1.00 25.55 ? 2670 TRP A NE1 1 
ATOM   599  C CE2 . TRP A 1 77  ? 37.239 35.597 7.092   1.00 25.79 ? 2670 TRP A CE2 1 
ATOM   600  C CE3 . TRP A 1 77  ? 37.537 33.678 5.636   1.00 26.01 ? 2670 TRP A CE3 1 
ATOM   601  C CZ2 . TRP A 1 77  ? 37.599 36.491 6.077   1.00 24.71 ? 2670 TRP A CZ2 1 
ATOM   602  C CZ3 . TRP A 1 77  ? 37.889 34.569 4.621   1.00 25.29 ? 2670 TRP A CZ3 1 
ATOM   603  C CH2 . TRP A 1 77  ? 37.927 35.962 4.855   1.00 24.39 ? 2670 TRP A CH2 1 
ATOM   604  N N   . PRO A 1 78  ? 35.675 30.615 5.749   1.00 20.07 ? 2671 PRO A N   1 
ATOM   605  C CA  . PRO A 1 78  ? 35.535 30.679 4.291   1.00 20.30 ? 2671 PRO A CA  1 
ATOM   606  C C   . PRO A 1 78  ? 34.103 30.410 3.803   1.00 20.38 ? 2671 PRO A C   1 
ATOM   607  O O   . PRO A 1 78  ? 33.666 30.992 2.814   1.00 21.14 ? 2671 PRO A O   1 
ATOM   608  C CB  . PRO A 1 78  ? 36.498 29.590 3.788   1.00 21.52 ? 2671 PRO A CB  1 
ATOM   609  C CG  . PRO A 1 78  ? 36.839 28.762 4.982   1.00 20.69 ? 2671 PRO A CG  1 
ATOM   610  C CD  . PRO A 1 78  ? 36.690 29.626 6.170   1.00 19.95 ? 2671 PRO A CD  1 
ATOM   611  N N   . ALA A 1 79  ? 33.374 29.538 4.496   1.00 20.47 ? 2672 ALA A N   1 
ATOM   612  C CA  . ALA A 1 79  ? 31.993 29.241 4.116   1.00 20.08 ? 2672 ALA A CA  1 
ATOM   613  C C   . ALA A 1 79  ? 31.080 30.456 4.332   1.00 19.37 ? 2672 ALA A C   1 
ATOM   614  O O   . ALA A 1 79  ? 30.216 30.734 3.504   1.00 18.82 ? 2672 ALA A O   1 
ATOM   615  C CB  . ALA A 1 79  ? 31.472 28.045 4.910   1.00 20.31 ? 2672 ALA A CB  1 
ATOM   616  N N   . ARG A 1 80  ? 31.270 31.142 5.453   1.00 18.94 ? 2673 ARG A N   1 
ATOM   617  C CA  . ARG A 1 80  ? 30.510 32.362 5.764   1.00 19.03 ? 2673 ARG A CA  1 
ATOM   618  C C   . ARG A 1 80  ? 30.740 33.408 4.668   1.00 18.70 ? 2673 ARG A C   1 
ATOM   619  O O   . ARG A 1 80  ? 29.781 33.992 4.124   1.00 18.43 ? 2673 ARG A O   1 
ATOM   620  C CB  . ARG A 1 80  ? 30.903 32.910 7.140   1.00 18.69 ? 2673 ARG A CB  1 
ATOM   621  C CG  . ARG A 1 80  ? 29.988 34.070 7.608   1.00 20.46 ? 2673 ARG A CG  1 
ATOM   622  C CD  . ARG A 1 80  ? 30.424 34.692 8.918   1.00 23.18 ? 2673 ARG A CD  1 
ATOM   623  N NE  . ARG A 1 80  ? 30.417 33.724 10.016  1.00 23.06 ? 2673 ARG A NE  1 
ATOM   624  C CZ  . ARG A 1 80  ? 31.515 33.269 10.610  1.00 23.35 ? 2673 ARG A CZ  1 
ATOM   625  N NH1 . ARG A 1 80  ? 32.705 33.714 10.224  1.00 23.34 ? 2673 ARG A NH1 1 
ATOM   626  N NH2 . ARG A 1 80  ? 31.425 32.389 11.607  1.00 23.27 ? 2673 ARG A NH2 1 
ATOM   627  N N   . GLU A 1 81  ? 32.002 33.625 4.318   1.00 18.83 ? 2674 GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 32.323 34.633 3.299   1.00 18.69 ? 2674 GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 31.807 34.252 1.907   1.00 19.01 ? 2674 GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 31.414 35.125 1.126   1.00 18.73 ? 2674 GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 33.831 34.956 3.280   1.00 19.04 ? 2674 GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 34.369 35.652 4.524   1.00 21.84 ? 2674 GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 33.584 36.923 4.897   1.00 23.87 ? 2674 GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 33.336 37.745 3.998   1.00 24.24 ? 2674 GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 33.199 37.067 6.078   1.00 25.25 ? 2674 GLU A OE2 1 
ATOM   636  N N   . SER A 1 82  ? 31.746 32.944 1.626   1.00 19.12 ? 2675 SER A N   1 
ATOM   637  C CA  . SER A 1 82  ? 31.225 32.458 0.361   1.00 18.92 ? 2675 SER A CA  1 
ATOM   638  C C   . SER A 1 82  ? 29.726 32.746 0.269   1.00 18.40 ? 2675 SER A C   1 
ATOM   639  O O   . SER A 1 82  ? 29.249 33.199 -0.764  1.00 17.92 ? 2675 SER A O   1 
ATOM   640  C CB  . SER A 1 82  ? 31.489 30.952 0.208   1.00 19.45 ? 2675 SER A CB  1 
ATOM   641  O OG  . SER A 1 82  ? 32.878 30.736 0.013   1.00 22.24 ? 2675 SER A OG  1 
ATOM   642  N N   . LEU A 1 83  ? 29.003 32.494 1.356   1.00 17.59 ? 2676 LEU A N   1 
ATOM   643  C CA  . LEU A 1 83  ? 27.556 32.789 1.377   1.00 18.65 ? 2676 LEU A CA  1 
ATOM   644  C C   . LEU A 1 83  ? 27.286 34.304 1.274   1.00 18.65 ? 2676 LEU A C   1 
ATOM   645  O O   . LEU A 1 83  ? 26.370 34.727 0.560   1.00 17.72 ? 2676 LEU A O   1 
ATOM   646  C CB  . LEU A 1 83  ? 26.870 32.183 2.603   1.00 18.25 ? 2676 LEU A CB  1 
ATOM   647  C CG  . LEU A 1 83  ? 26.778 30.640 2.699   1.00 20.45 ? 2676 LEU A CG  1 
ATOM   648  C CD1 . LEU A 1 83  ? 25.988 30.227 3.958   1.00 22.76 ? 2676 LEU A CD1 1 
ATOM   649  C CD2 . LEU A 1 83  ? 26.150 30.016 1.462   1.00 23.58 ? 2676 LEU A CD2 1 
ATOM   650  N N   . LYS A 1 84  ? 28.082 35.116 1.968   1.00 18.84 ? 2677 LYS A N   1 
ATOM   651  C CA  . LYS A 1 84  ? 27.958 36.572 1.852   1.00 18.38 ? 2677 LYS A CA  1 
ATOM   652  C C   . LYS A 1 84  ? 28.215 37.025 0.402   1.00 18.95 ? 2677 LYS A C   1 
ATOM   653  O O   . LYS A 1 84  ? 27.556 37.931 -0.106  1.00 19.16 ? 2677 LYS A O   1 
ATOM   654  C CB  . LYS A 1 84  ? 28.913 37.276 2.815   1.00 18.84 ? 2677 LYS A CB  1 
ATOM   655  C CG  . LYS A 1 84  ? 28.552 37.190 4.296   1.00 19.63 ? 2677 LYS A CG  1 
ATOM   656  C CD  . LYS A 1 84  ? 29.675 37.935 5.021   1.00 23.90 ? 2677 LYS A CD  1 
ATOM   657  C CE  . LYS A 1 84  ? 29.446 38.155 6.481   1.00 27.37 ? 2677 LYS A CE  1 
ATOM   658  N NZ  . LYS A 1 84  ? 30.707 38.775 7.002   1.00 28.38 ? 2677 LYS A NZ  1 
ATOM   659  N N   . THR A 1 85  ? 29.156 36.368 -0.265  1.00 18.25 ? 2678 THR A N   1 
ATOM   660  C CA  . THR A 1 85  ? 29.447 36.652 -1.665  1.00 18.19 ? 2678 THR A CA  1 
ATOM   661  C C   . THR A 1 85  ? 28.229 36.417 -2.576  1.00 18.47 ? 2678 THR A C   1 
ATOM   662  O O   . THR A 1 85  ? 27.912 37.245 -3.448  1.00 19.04 ? 2678 THR A O   1 
ATOM   663  C CB  . THR A 1 85  ? 30.647 35.811 -2.138  1.00 18.65 ? 2678 THR A CB  1 
ATOM   664  O OG1 . THR A 1 85  ? 31.821 36.174 -1.385  1.00 19.67 ? 2678 THR A OG1 1 
ATOM   665  C CG2 . THR A 1 85  ? 30.879 36.042 -3.597  1.00 18.97 ? 2678 THR A CG2 1 
ATOM   666  N N   . MET A 1 86  ? 27.534 35.299 -2.354  1.00 18.57 ? 2679 MET A N   1 
ATOM   667  C CA  . MET A 1 86  ? 26.304 34.962 -3.073  1.00 19.09 ? 2679 MET A CA  1 
ATOM   668  C C   . MET A 1 86  ? 25.237 36.051 -2.919  1.00 19.06 ? 2679 MET A C   1 
ATOM   669  O O   . MET A 1 86  ? 24.641 36.481 -3.909  1.00 19.89 ? 2679 MET A O   1 
ATOM   670  C CB  . MET A 1 86  ? 25.758 33.618 -2.574  1.00 19.29 ? 2679 MET A CB  1 
ATOM   671  C CG  . MET A 1 86  ? 26.702 32.448 -2.828  1.00 20.20 ? 2679 MET A CG  1 
ATOM   672  S SD  . MET A 1 86  ? 25.979 30.879 -2.268  1.00 21.66 ? 2679 MET A SD  1 
ATOM   673  C CE  . MET A 1 86  ? 27.409 29.773 -2.428  1.00 19.93 ? 2679 MET A CE  1 
ATOM   674  N N   . LEU A 1 87  ? 25.048 36.513 -1.689  1.00 19.71 ? 2680 LEU A N   1 
ATOM   675  C CA  . LEU A 1 87  ? 24.117 37.612 -1.406  1.00 20.56 ? 2680 LEU A CA  1 
ATOM   676  C C   . LEU A 1 87  ? 24.558 38.900 -2.121  1.00 20.92 ? 2680 LEU A C   1 
ATOM   677  O O   . LEU A 1 87  ? 23.730 39.585 -2.752  1.00 21.20 ? 2680 LEU A O   1 
ATOM   678  C CB  . LEU A 1 87  ? 24.000 37.835 0.105   1.00 20.34 ? 2680 LEU A CB  1 
ATOM   679  C CG  . LEU A 1 87  ? 23.454 36.688 0.971   1.00 22.89 ? 2680 LEU A CG  1 
ATOM   680  C CD1 . LEU A 1 87  ? 23.396 37.097 2.445   1.00 25.30 ? 2680 LEU A CD1 1 
ATOM   681  C CD2 . LEU A 1 87  ? 22.070 36.235 0.496   1.00 23.78 ? 2680 LEU A CD2 1 
ATOM   682  N N   . ALA A 1 88  ? 25.857 39.209 -2.047  1.00 20.82 ? 2681 ALA A N   1 
ATOM   683  C CA  . ALA A 1 88  ? 26.407 40.453 -2.617  1.00 21.05 ? 2681 ALA A CA  1 
ATOM   684  C C   . ALA A 1 88  ? 26.322 40.541 -4.130  1.00 21.23 ? 2681 ALA A C   1 
ATOM   685  O O   . ALA A 1 88  ? 26.136 41.632 -4.683  1.00 21.49 ? 2681 ALA A O   1 
ATOM   686  C CB  . ALA A 1 88  ? 27.870 40.676 -2.151  1.00 20.91 ? 2681 ALA A CB  1 
ATOM   687  N N   . VAL A 1 89  ? 26.451 39.406 -4.811  1.00 21.10 ? 2682 VAL A N   1 
ATOM   688  C CA  . VAL A 1 89  ? 26.379 39.403 -6.272  1.00 22.04 ? 2682 VAL A CA  1 
ATOM   689  C C   . VAL A 1 89  ? 24.909 39.391 -6.752  1.00 22.50 ? 2682 VAL A C   1 
ATOM   690  O O   . VAL A 1 89  ? 24.648 39.473 -7.947  1.00 23.32 ? 2682 VAL A O   1 
ATOM   691  C CB  . VAL A 1 89  ? 27.213 38.250 -6.869  1.00 21.98 ? 2682 VAL A CB  1 
ATOM   692  C CG1 . VAL A 1 89  ? 26.438 36.905 -6.805  1.00 21.49 ? 2682 VAL A CG1 1 
ATOM   693  C CG2 . VAL A 1 89  ? 27.668 38.579 -8.294  1.00 22.32 ? 2682 VAL A CG2 1 
ATOM   694  N N   . GLY A 1 90  ? 23.988 39.263 -5.804  1.00 23.06 ? 2683 GLY A N   1 
ATOM   695  C CA  . GLY A 1 90  ? 22.545 39.395 -6.044  1.00 24.33 ? 2683 GLY A CA  1 
ATOM   696  C C   . GLY A 1 90  ? 21.719 38.119 -6.015  1.00 24.67 ? 2683 GLY A C   1 
ATOM   697  O O   . GLY A 1 90  ? 20.538 38.128 -6.384  1.00 25.40 ? 2683 GLY A O   1 
ATOM   698  N N   . TRP A 1 91  ? 22.299 37.008 -5.578  1.00 24.17 ? 2684 TRP A N   1 
ATOM   699  C CA  . TRP A 1 91  ? 21.526 35.768 -5.569  1.00 24.41 ? 2684 TRP A CA  1 
ATOM   700  C C   . TRP A 1 91  ? 20.716 35.649 -4.293  1.00 25.14 ? 2684 TRP A C   1 
ATOM   701  O O   . TRP A 1 91  ? 21.012 36.304 -3.300  1.00 25.63 ? 2684 TRP A O   1 
ATOM   702  C CB  . TRP A 1 91  ? 22.441 34.529 -5.725  1.00 23.42 ? 2684 TRP A CB  1 
ATOM   703  C CG  . TRP A 1 91  ? 23.274 34.502 -6.965  1.00 23.45 ? 2684 TRP A CG  1 
ATOM   704  C CD1 . TRP A 1 91  ? 22.976 35.059 -8.169  1.00 23.49 ? 2684 TRP A CD1 1 
ATOM   705  C CD2 . TRP A 1 91  ? 24.537 33.842 -7.133  1.00 23.23 ? 2684 TRP A CD2 1 
ATOM   706  N NE1 . TRP A 1 91  ? 23.970 34.812 -9.069  1.00 23.47 ? 2684 TRP A NE1 1 
ATOM   707  C CE2 . TRP A 1 91  ? 24.947 34.067 -8.467  1.00 22.33 ? 2684 TRP A CE2 1 
ATOM   708  C CE3 . TRP A 1 91  ? 25.365 33.100 -6.284  1.00 24.54 ? 2684 TRP A CE3 1 
ATOM   709  C CZ2 . TRP A 1 91  ? 26.150 33.573 -8.982  1.00 22.65 ? 2684 TRP A CZ2 1 
ATOM   710  C CZ3 . TRP A 1 91  ? 26.576 32.606 -6.797  1.00 22.62 ? 2684 TRP A CZ3 1 
ATOM   711  C CH2 . TRP A 1 91  ? 26.952 32.849 -8.134  1.00 23.69 ? 2684 TRP A CH2 1 
ATOM   712  N N   . THR A 1 92  ? 19.686 34.806 -4.351  1.00 26.59 ? 2685 THR A N   1 
ATOM   713  C CA  . THR A 1 92  ? 18.835 34.459 -3.229  1.00 28.04 ? 2685 THR A CA  1 
ATOM   714  C C   . THR A 1 92  ? 19.338 33.169 -2.556  1.00 27.73 ? 2685 THR A C   1 
ATOM   715  O O   . THR A 1 92  ? 19.610 32.191 -3.238  1.00 27.57 ? 2685 THR A O   1 
ATOM   716  C CB  . THR A 1 92  ? 17.387 34.248 -3.752  1.00 28.63 ? 2685 THR A CB  1 
ATOM   717  O OG1 . THR A 1 92  ? 16.914 35.462 -4.367  1.00 32.00 ? 2685 THR A OG1 1 
ATOM   718  C CG2 . THR A 1 92  ? 16.445 33.822 -2.647  1.00 28.80 ? 2685 THR A CG2 1 
ATOM   719  N N   . VAL A 1 93  ? 19.454 33.180 -1.224  1.00 27.76 ? 2686 VAL A N   1 
ATOM   720  C CA  . VAL A 1 93  ? 19.889 32.003 -0.454  1.00 28.37 ? 2686 VAL A CA  1 
ATOM   721  C C   . VAL A 1 93  ? 18.841 31.751 0.618   1.00 29.57 ? 2686 VAL A C   1 
ATOM   722  O O   . VAL A 1 93  ? 18.749 32.505 1.593   1.00 29.64 ? 2686 VAL A O   1 
ATOM   723  C CB  . VAL A 1 93  ? 21.299 32.214 0.184   1.00 27.70 ? 2686 VAL A CB  1 
ATOM   724  C CG1 . VAL A 1 93  ? 21.706 31.027 1.047   1.00 27.60 ? 2686 VAL A CG1 1 
ATOM   725  C CG2 . VAL A 1 93  ? 22.354 32.480 -0.903  1.00 27.05 ? 2686 VAL A CG2 1 
ATOM   726  N N   . GLU A 1 94  ? 18.040 30.703 0.421   1.00 30.45 ? 2687 GLU A N   1 
ATOM   727  C CA  . GLU A 1 94  ? 16.868 30.471 1.272   1.00 31.53 ? 2687 GLU A CA  1 
ATOM   728  C C   . GLU A 1 94  ? 16.639 28.998 1.639   1.00 32.05 ? 2687 GLU A C   1 
ATOM   729  O O   . GLU A 1 94  ? 17.086 28.089 0.934   1.00 31.31 ? 2687 GLU A O   1 
ATOM   730  C CB  . GLU A 1 94  ? 15.619 31.045 0.586   1.00 31.71 ? 2687 GLU A CB  1 
ATOM   731  N N   . ARG A 1 95  ? 15.941 28.780 2.756   1.00 32.83 ? 2688 ARG A N   1 
ATOM   732  C CA  . ARG A 1 95  ? 15.490 27.443 3.168   1.00 34.13 ? 2688 ARG A CA  1 
ATOM   733  C C   . ARG A 1 95  ? 14.411 26.896 2.216   1.00 34.94 ? 2688 ARG A C   1 
ATOM   734  O O   . ARG A 1 95  ? 13.589 27.657 1.699   1.00 35.16 ? 2688 ARG A O   1 
ATOM   735  C CB  . ARG A 1 95  ? 14.953 27.484 4.603   1.00 34.09 ? 2688 ARG A CB  1 
ATOM   736  N N   . THR A 1 96  ? 14.432 25.591 1.950   1.00 35.34 ? 2689 THR A N   1 
ATOM   737  C CA  . THR A 1 96  ? 13.330 24.961 1.212   1.00 36.33 ? 2689 THR A CA  1 
ATOM   738  C C   . THR A 1 96  ? 12.305 24.418 2.199   1.00 36.58 ? 2689 THR A C   1 
ATOM   739  O O   . THR A 1 96  ? 12.629 24.140 3.362   1.00 36.41 ? 2689 THR A O   1 
ATOM   740  C CB  . THR A 1 96  ? 13.776 23.777 0.315   1.00 36.15 ? 2689 THR A CB  1 
ATOM   741  O OG1 . THR A 1 96  ? 14.443 22.795 1.116   1.00 37.19 ? 2689 THR A OG1 1 
ATOM   742  C CG2 . THR A 1 96  ? 14.686 24.224 -0.800  1.00 37.40 ? 2689 THR A CG2 1 
ATOM   743  N N   . LYS A 1 97  ? 11.071 24.266 1.719   1.00 37.11 ? 2690 LYS A N   1 
ATOM   744  C CA  . LYS A 1 97  ? 10.026 23.548 2.446   1.00 37.19 ? 2690 LYS A CA  1 
ATOM   745  C C   . LYS A 1 97  ? 10.321 22.048 2.411   1.00 37.39 ? 2690 LYS A C   1 
ATOM   746  O O   . LYS A 1 97  ? 10.793 21.524 1.390   1.00 37.10 ? 2690 LYS A O   1 
ATOM   747  C CB  . LYS A 1 97  ? 8.653  23.832 1.823   1.00 37.72 ? 2690 LYS A CB  1 
ATOM   748  N N   . GLY A 1 99  ? 13.064 20.537 2.507   1.00 35.18 ? 2692 GLY A N   1 
ATOM   749  C CA  . GLY A 1 99  ? 14.241 19.976 3.168   1.00 34.30 ? 2692 GLY A CA  1 
ATOM   750  C C   . GLY A 1 99  ? 14.390 20.423 4.611   1.00 33.80 ? 2692 GLY A C   1 
ATOM   751  O O   . GLY A 1 99  ? 15.464 20.269 5.200   1.00 34.31 ? 2692 GLY A O   1 
ATOM   752  N N   . GLU A 1 100 ? 13.302 20.928 5.192   1.00 33.23 ? 2693 GLU A N   1 
ATOM   753  C CA  . GLU A 1 100 ? 13.321 21.574 6.514   1.00 32.45 ? 2693 GLU A CA  1 
ATOM   754  C C   . GLU A 1 100 ? 13.615 20.678 7.723   1.00 31.71 ? 2693 GLU A C   1 
ATOM   755  O O   . GLU A 1 100 ? 13.934 21.170 8.814   1.00 31.96 ? 2693 GLU A O   1 
ATOM   756  C CB  . GLU A 1 100 ? 12.006 22.341 6.744   1.00 33.26 ? 2693 GLU A CB  1 
ATOM   757  N N   . ALA A 1 101 ? 13.506 19.362 7.551   1.00 29.94 ? 2694 ALA A N   1 
ATOM   758  C CA  . ALA A 1 101 ? 13.717 18.448 8.672   1.00 28.24 ? 2694 ALA A CA  1 
ATOM   759  C C   . ALA A 1 101 ? 15.046 17.701 8.588   1.00 26.90 ? 2694 ALA A C   1 
ATOM   760  O O   . ALA A 1 101 ? 15.483 17.101 9.560   1.00 25.24 ? 2694 ALA A O   1 
ATOM   761  C CB  . ALA A 1 101 ? 12.578 17.444 8.739   1.00 28.37 ? 2694 ALA A CB  1 
ATOM   762  N N   . LEU A 1 102 ? 15.667 17.751 7.414   1.00 26.06 ? 2695 LEU A N   1 
ATOM   763  C CA  . LEU A 1 102 ? 16.751 16.833 7.058   1.00 25.45 ? 2695 LEU A CA  1 
ATOM   764  C C   . LEU A 1 102 ? 18.036 16.984 7.881   1.00 24.74 ? 2695 LEU A C   1 
ATOM   765  O O   . LEU A 1 102 ? 18.668 15.981 8.284   1.00 24.67 ? 2695 LEU A O   1 
ATOM   766  C CB  . LEU A 1 102 ? 17.038 16.962 5.557   1.00 25.61 ? 2695 LEU A CB  1 
ATOM   767  C CG  . LEU A 1 102 ? 17.997 15.945 4.935   1.00 26.47 ? 2695 LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 102 ? 17.545 14.502 5.211   1.00 25.90 ? 2695 LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 102 ? 18.078 16.224 3.451   1.00 27.74 ? 2695 LEU A CD2 1 
ATOM   770  N N   . VAL A 1 103 ? 18.433 18.229 8.144   1.00 24.17 ? 2696 VAL A N   1 
ATOM   771  C CA  . VAL A 1 103 ? 19.649 18.472 8.907   1.00 23.97 ? 2696 VAL A CA  1 
ATOM   772  C C   . VAL A 1 103 ? 19.523 17.877 10.314  1.00 23.95 ? 2696 VAL A C   1 
ATOM   773  O O   . VAL A 1 103 ? 20.434 17.197 10.798  1.00 23.46 ? 2696 VAL A O   1 
ATOM   774  C CB  . VAL A 1 103 ? 20.001 19.976 8.960   1.00 24.22 ? 2696 VAL A CB  1 
ATOM   775  C CG1 . VAL A 1 103 ? 21.155 20.223 9.927   1.00 24.37 ? 2696 VAL A CG1 1 
ATOM   776  C CG2 . VAL A 1 103 ? 20.358 20.477 7.544   1.00 23.99 ? 2696 VAL A CG2 1 
ATOM   777  N N   . GLN A 1 104 ? 18.369 18.101 10.946  1.00 24.54 ? 2697 GLN A N   1 
ATOM   778  C CA  . GLN A 1 104 ? 18.125 17.570 12.275  1.00 24.84 ? 2697 GLN A CA  1 
ATOM   779  C C   . GLN A 1 104 ? 18.056 16.029 12.296  1.00 24.62 ? 2697 GLN A C   1 
ATOM   780  O O   . GLN A 1 104 ? 18.584 15.397 13.211  1.00 23.87 ? 2697 GLN A O   1 
ATOM   781  C CB  . GLN A 1 104 ? 16.840 18.157 12.867  1.00 26.10 ? 2697 GLN A CB  1 
ATOM   782  C CG  . GLN A 1 104 ? 16.690 17.897 14.348  1.00 29.04 ? 2697 GLN A CG  1 
ATOM   783  C CD  . GLN A 1 104 ? 17.817 18.530 15.159  1.00 34.90 ? 2697 GLN A CD  1 
ATOM   784  O OE1 . GLN A 1 104 ? 18.005 19.750 15.132  1.00 37.93 ? 2697 GLN A OE1 1 
ATOM   785  N NE2 . GLN A 1 104 ? 18.572 17.705 15.881  1.00 36.48 ? 2697 GLN A NE2 1 
ATOM   786  N N   . GLN A 1 105 ? 17.404 15.440 11.292  1.00 24.22 ? 2698 GLN A N   1 
ATOM   787  C CA  . GLN A 1 105 ? 17.340 13.980 11.151  1.00 24.74 ? 2698 GLN A CA  1 
ATOM   788  C C   . GLN A 1 105 ? 18.739 13.373 11.015  1.00 24.95 ? 2698 GLN A C   1 
ATOM   789  O O   . GLN A 1 105 ? 19.069 12.373 11.660  1.00 24.11 ? 2698 GLN A O   1 
ATOM   790  C CB  . GLN A 1 105 ? 16.503 13.606 9.934   1.00 24.91 ? 2698 GLN A CB  1 
ATOM   791  C CG  . GLN A 1 105 ? 15.024 13.885 10.102  1.00 24.89 ? 2698 GLN A CG  1 
ATOM   792  C CD  . GLN A 1 105 ? 14.253 13.753 8.805   1.00 27.76 ? 2698 GLN A CD  1 
ATOM   793  O OE1 . GLN A 1 105 ? 14.788 14.009 7.729   1.00 27.75 ? 2698 GLN A OE1 1 
ATOM   794  N NE2 . GLN A 1 105 ? 12.980 13.353 8.901   1.00 29.58 ? 2698 GLN A NE2 1 
ATOM   795  N N   . ARG A 1 106 ? 19.566 14.006 10.190  1.00 25.26 ? 2699 ARG A N   1 
ATOM   796  C CA  . ARG A 1 106 ? 20.945 13.555 9.994   1.00 26.37 ? 2699 ARG A CA  1 
ATOM   797  C C   . ARG A 1 106 ? 21.760 13.647 11.295  1.00 26.95 ? 2699 ARG A C   1 
ATOM   798  O O   . ARG A 1 106 ? 22.506 12.717 11.630  1.00 27.11 ? 2699 ARG A O   1 
ATOM   799  C CB  . ARG A 1 106 ? 21.571 14.326 8.822   1.00 26.33 ? 2699 ARG A CB  1 
ATOM   800  C CG  . ARG A 1 106 ? 22.717 13.654 8.129   1.00 27.50 ? 2699 ARG A CG  1 
ATOM   801  C CD  . ARG A 1 106 ? 23.134 14.504 6.926   1.00 26.44 ? 2699 ARG A CD  1 
ATOM   802  N NE  . ARG A 1 106 ? 22.292 14.326 5.744   1.00 26.04 ? 2699 ARG A NE  1 
ATOM   803  C CZ  . ARG A 1 106 ? 21.978 15.309 4.902   1.00 25.32 ? 2699 ARG A CZ  1 
ATOM   804  N NH1 . ARG A 1 106 ? 22.421 16.547 5.133   1.00 25.52 ? 2699 ARG A NH1 1 
ATOM   805  N NH2 . ARG A 1 106 ? 21.239 15.066 3.823   1.00 24.61 ? 2699 ARG A NH2 1 
ATOM   806  N N   . GLU A 1 107 ? 21.574 14.728 12.063  1.00 27.12 ? 2700 GLU A N   1 
ATOM   807  C CA  . GLU A 1 107 ? 22.263 14.871 13.350  1.00 27.41 ? 2700 GLU A CA  1 
ATOM   808  C C   . GLU A 1 107 ? 21.801 13.847 14.394  1.00 27.58 ? 2700 GLU A C   1 
ATOM   809  O O   . GLU A 1 107 ? 22.625 13.248 15.100  1.00 27.24 ? 2700 GLU A O   1 
ATOM   810  C CB  . GLU A 1 107 ? 22.143 16.306 13.893  1.00 28.27 ? 2700 GLU A CB  1 
ATOM   811  N N   . ASN A 1 108 ? 20.484 13.637 14.480  1.00 27.23 ? 2701 ASN A N   1 
ATOM   812  C CA  . ASN A 1 108 ? 19.933 12.612 15.364  1.00 28.03 ? 2701 ASN A CA  1 
ATOM   813  C C   . ASN A 1 108 ? 20.475 11.221 15.008  1.00 27.85 ? 2701 ASN A C   1 
ATOM   814  O O   . ASN A 1 108 ? 20.776 10.432 15.898  1.00 28.12 ? 2701 ASN A O   1 
ATOM   815  C CB  . ASN A 1 108 ? 18.405 12.594 15.302  1.00 27.88 ? 2701 ASN A CB  1 
ATOM   816  C CG  . ASN A 1 108 ? 17.764 13.841 15.909  1.00 29.29 ? 2701 ASN A CG  1 
ATOM   817  O OD1 . ASN A 1 108 ? 18.419 14.642 16.588  1.00 32.34 ? 2701 ASN A OD1 1 
ATOM   818  N ND2 . ASN A 1 108 ? 16.467 14.003 15.667  1.00 30.13 ? 2701 ASN A ND2 1 
ATOM   819  N N   . GLU A 1 109 ? 20.598 10.937 13.711  1.00 28.27 ? 2702 GLU A N   1 
ATOM   820  C CA  . GLU A 1 109 ? 21.116 9.637  13.250  1.00 29.02 ? 2702 GLU A CA  1 
ATOM   821  C C   . GLU A 1 109 ? 22.593 9.445  13.620  1.00 30.41 ? 2702 GLU A C   1 
ATOM   822  O O   . GLU A 1 109 ? 22.988 8.370  14.102  1.00 30.14 ? 2702 GLU A O   1 
ATOM   823  C CB  . GLU A 1 109 ? 20.885 9.445  11.742  1.00 28.96 ? 2702 GLU A CB  1 
ATOM   824  C CG  . GLU A 1 109 ? 21.464 8.141  11.136  1.00 27.61 ? 2702 GLU A CG  1 
ATOM   825  C CD  . GLU A 1 109 ? 21.142 6.869  11.953  1.00 27.18 ? 2702 GLU A CD  1 
ATOM   826  O OE1 . GLU A 1 109 ? 20.053 6.772  12.569  1.00 26.24 ? 2702 GLU A OE1 1 
ATOM   827  O OE2 . GLU A 1 109 ? 21.992 5.951  11.954  1.00 28.81 ? 2702 GLU A OE2 1 
ATOM   828  N N   . LYS A 1 110 ? 23.396 10.488 13.404  1.00 31.77 ? 2703 LYS A N   1 
ATOM   829  C CA  . LYS A 1 110 ? 24.803 10.476 13.816  1.00 33.34 ? 2703 LYS A CA  1 
ATOM   830  C C   . LYS A 1 110 ? 24.959 10.095 15.298  1.00 34.54 ? 2703 LYS A C   1 
ATOM   831  O O   . LYS A 1 110 ? 25.880 9.348  15.664  1.00 35.18 ? 2703 LYS A O   1 
ATOM   832  C CB  . LYS A 1 110 ? 25.462 11.828 13.531  1.00 33.28 ? 2703 LYS A CB  1 
ATOM   833  N N   . LEU A 1 111 ? 24.039 10.569 16.135  1.00 35.75 ? 2704 LEU A N   1 
ATOM   834  C CA  . LEU A 1 111 ? 24.118 10.369 17.586  1.00 36.85 ? 2704 LEU A CA  1 
ATOM   835  C C   . LEU A 1 111 ? 23.509 9.066  18.107  1.00 37.40 ? 2704 LEU A C   1 
ATOM   836  O O   . LEU A 1 111 ? 23.813 8.647  19.233  1.00 37.77 ? 2704 LEU A O   1 
ATOM   837  C CB  . LEU A 1 111 ? 23.525 11.575 18.335  1.00 37.54 ? 2704 LEU A CB  1 
ATOM   838  C CG  . LEU A 1 111 ? 24.259 12.923 18.182  1.00 38.96 ? 2704 LEU A CG  1 
ATOM   839  C CD1 . LEU A 1 111 ? 23.656 13.982 19.102  1.00 40.37 ? 2704 LEU A CD1 1 
ATOM   840  C CD2 . LEU A 1 111 ? 25.766 12.815 18.420  1.00 39.28 ? 2704 LEU A CD2 1 
ATOM   841  N N   . ARG A 1 112 ? 22.659 8.425  17.297  1.00 37.31 ? 2705 ARG A N   1 
ATOM   842  C CA  . ARG A 1 112 ? 22.028 7.161  17.673  1.00 37.62 ? 2705 ARG A CA  1 
ATOM   843  C C   . ARG A 1 112 ? 23.079 6.065  17.855  1.00 38.82 ? 2705 ARG A C   1 
ATOM   844  O O   . ARG A 1 112 ? 23.957 5.897  17.013  1.00 38.73 ? 2705 ARG A O   1 
ATOM   845  C CB  . ARG A 1 112 ? 21.003 6.734  16.615  1.00 36.70 ? 2705 ARG A CB  1 
ATOM   846  C CG  . ARG A 1 112 ? 20.232 5.456  16.942  1.00 34.58 ? 2705 ARG A CG  1 
ATOM   847  C CD  . ARG A 1 112 ? 19.368 5.018  15.764  1.00 29.48 ? 2705 ARG A CD  1 
ATOM   848  N NE  . ARG A 1 112 ? 20.167 4.772  14.561  1.00 27.32 ? 2705 ARG A NE  1 
ATOM   849  C CZ  . ARG A 1 112 ? 20.895 3.674  14.351  1.00 27.35 ? 2705 ARG A CZ  1 
ATOM   850  N NH1 . ARG A 1 112 ? 20.941 2.707  15.264  1.00 28.89 ? 2705 ARG A NH1 1 
ATOM   851  N NH2 . ARG A 1 112 ? 21.581 3.552  13.231  1.00 24.88 ? 2705 ARG A NH2 1 
ATOM   852  N N   . SER A 1 113 ? 22.987 5.331  18.959  1.00 40.70 ? 2706 SER A N   1 
ATOM   853  C CA  . SER A 1 113 ? 23.892 4.194  19.211  1.00 42.74 ? 2706 SER A CA  1 
ATOM   854  C C   . SER A 1 113 ? 23.121 2.877  19.388  1.00 43.43 ? 2706 SER A C   1 
ATOM   855  O O   . SER A 1 113 ? 22.028 2.864  19.964  1.00 43.61 ? 2706 SER A O   1 
ATOM   856  C CB  . SER A 1 113 ? 24.775 4.462  20.437  1.00 42.76 ? 2706 SER A CB  1 
ATOM   857  O OG  . SER A 1 113 ? 23.974 4.632  21.598  1.00 44.73 ? 2706 SER A OG  1 
ATOM   858  N N   . VAL A 1 114 ? 23.702 1.784  18.888  1.00 44.46 ? 2707 VAL A N   1 
ATOM   859  C CA  . VAL A 1 114 ? 23.116 0.443  18.999  1.00 45.41 ? 2707 VAL A CA  1 
ATOM   860  C C   . VAL A 1 114 ? 24.181 -0.575 19.389  1.00 46.11 ? 2707 VAL A C   1 
ATOM   861  O O   . VAL A 1 114 ? 25.304 -0.542 18.873  1.00 46.99 ? 2707 VAL A O   1 
ATOM   862  C CB  . VAL A 1 114 ? 22.449 -0.015 17.675  1.00 45.41 ? 2707 VAL A CB  1 
ATOM   863  N N   . TYR A 1 123 ? 36.039 8.323  17.631  1.00 32.92 ? 2716 TYR A N   1 
ATOM   864  C CA  . TYR A 1 123 ? 35.693 9.219  16.525  1.00 32.67 ? 2716 TYR A CA  1 
ATOM   865  C C   . TYR A 1 123 ? 36.092 8.562  15.228  1.00 33.26 ? 2716 TYR A C   1 
ATOM   866  O O   . TYR A 1 123 ? 37.272 8.245  15.016  1.00 33.96 ? 2716 TYR A O   1 
ATOM   867  C CB  . TYR A 1 123 ? 36.408 10.562 16.688  1.00 31.62 ? 2716 TYR A CB  1 
ATOM   868  C CG  . TYR A 1 123 ? 36.371 11.538 15.514  1.00 28.95 ? 2716 TYR A CG  1 
ATOM   869  C CD1 . TYR A 1 123 ? 35.158 12.067 15.028  1.00 26.54 ? 2716 TYR A CD1 1 
ATOM   870  C CD2 . TYR A 1 123 ? 37.566 12.000 14.945  1.00 25.85 ? 2716 TYR A CD2 1 
ATOM   871  C CE1 . TYR A 1 123 ? 35.151 13.002 13.964  1.00 24.97 ? 2716 TYR A CE1 1 
ATOM   872  C CE2 . TYR A 1 123 ? 37.567 12.915 13.890  1.00 25.28 ? 2716 TYR A CE2 1 
ATOM   873  C CZ  . TYR A 1 123 ? 36.355 13.415 13.412  1.00 23.81 ? 2716 TYR A CZ  1 
ATOM   874  O OH  . TYR A 1 123 ? 36.370 14.339 12.395  1.00 23.05 ? 2716 TYR A OH  1 
ATOM   875  N N   . SER A 1 124 ? 35.111 8.352  14.362  1.00 33.90 ? 2717 SER A N   1 
ATOM   876  C CA  . SER A 1 124 ? 35.391 7.801  13.039  1.00 34.61 ? 2717 SER A CA  1 
ATOM   877  C C   . SER A 1 124 ? 34.646 8.628  12.009  1.00 34.54 ? 2717 SER A C   1 
ATOM   878  O O   . SER A 1 124 ? 33.465 8.367  11.741  1.00 35.37 ? 2717 SER A O   1 
ATOM   879  C CB  . SER A 1 124 ? 34.986 6.323  12.954  1.00 35.18 ? 2717 SER A CB  1 
ATOM   880  O OG  . SER A 1 124 ? 35.566 5.717  11.800  1.00 37.75 ? 2717 SER A OG  1 
ATOM   881  N N   . PRO A 1 125 ? 35.325 9.639  11.434  1.00 33.96 ? 2718 PRO A N   1 
ATOM   882  C CA  . PRO A 1 125 ? 34.611 10.548 10.535  1.00 33.41 ? 2718 PRO A CA  1 
ATOM   883  C C   . PRO A 1 125 ? 34.180 9.852  9.249   1.00 33.14 ? 2718 PRO A C   1 
ATOM   884  O O   . PRO A 1 125 ? 34.967 9.119  8.643   1.00 32.42 ? 2718 PRO A O   1 
ATOM   885  C CB  . PRO A 1 125 ? 35.633 11.647 10.246  1.00 33.26 ? 2718 PRO A CB  1 
ATOM   886  C CG  . PRO A 1 125 ? 36.980 11.027 10.520  1.00 33.65 ? 2718 PRO A CG  1 
ATOM   887  C CD  . PRO A 1 125 ? 36.775 9.916  11.500  1.00 33.86 ? 2718 PRO A CD  1 
ATOM   888  N N   . ALA A 1 126 ? 32.923 10.064 8.872   1.00 33.10 ? 2719 ALA A N   1 
ATOM   889  C CA  . ALA A 1 126 ? 32.400 9.576  7.603   1.00 33.03 ? 2719 ALA A CA  1 
ATOM   890  C C   . ALA A 1 126 ? 31.375 10.597 7.083   1.00 32.86 ? 2719 ALA A C   1 
ATOM   891  O O   . ALA A 1 126 ? 30.162 10.394 7.221   1.00 33.32 ? 2719 ALA A O   1 
ATOM   892  C CB  . ALA A 1 126 ? 31.782 8.178  7.765   1.00 33.44 ? 2719 ALA A CB  1 
ATOM   893  N N   . PRO A 1 127 ? 31.864 11.713 6.503   1.00 32.04 ? 2720 PRO A N   1 
ATOM   894  C CA  . PRO A 1 127 ? 30.966 12.785 6.056   1.00 31.38 ? 2720 PRO A CA  1 
ATOM   895  C C   . PRO A 1 127 ? 30.162 12.420 4.804   1.00 30.67 ? 2720 PRO A C   1 
ATOM   896  O O   . PRO A 1 127 ? 30.476 11.439 4.122   1.00 30.41 ? 2720 PRO A O   1 
ATOM   897  C CB  . PRO A 1 127 ? 31.928 13.926 5.745   1.00 31.50 ? 2720 PRO A CB  1 
ATOM   898  C CG  . PRO A 1 127 ? 33.178 13.258 5.355   1.00 31.69 ? 2720 PRO A CG  1 
ATOM   899  C CD  . PRO A 1 127 ? 33.272 12.022 6.185   1.00 32.16 ? 2720 PRO A CD  1 
ATOM   900  N N   . LEU A 1 128 ? 29.124 13.200 4.521   1.00 29.82 ? 2721 LEU A N   1 
ATOM   901  C CA  . LEU A 1 128 ? 28.345 13.031 3.288   1.00 28.96 ? 2721 LEU A CA  1 
ATOM   902  C C   . LEU A 1 128 ? 29.235 12.958 2.061   1.00 28.43 ? 2721 LEU A C   1 
ATOM   903  O O   . LEU A 1 128 ? 30.145 13.767 1.905   1.00 27.99 ? 2721 LEU A O   1 
ATOM   904  C CB  . LEU A 1 128 ? 27.368 14.194 3.117   1.00 29.55 ? 2721 LEU A CB  1 
ATOM   905  C CG  . LEU A 1 128 ? 26.120 14.310 3.989   1.00 30.36 ? 2721 LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 128 ? 25.432 15.636 3.697   1.00 30.37 ? 2721 LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 128 ? 25.157 13.130 3.729   1.00 30.90 ? 2721 LEU A CD2 1 
ATOM   908  N N   . ASP A 1 129 ? 28.970 11.980 1.192   1.00 27.55 ? 2722 ASP A N   1 
ATOM   909  C CA  . ASP A 1 129 ? 29.638 11.901 -0.101  1.00 27.14 ? 2722 ASP A CA  1 
ATOM   910  C C   . ASP A 1 129 ? 28.906 12.785 -1.088  1.00 26.20 ? 2722 ASP A C   1 
ATOM   911  O O   . ASP A 1 129 ? 27.845 12.417 -1.606  1.00 25.49 ? 2722 ASP A O   1 
ATOM   912  C CB  . ASP A 1 129 ? 29.628 10.457 -0.611  1.00 27.52 ? 2722 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 129 ? 30.528 10.242 -1.805  1.00 28.61 ? 2722 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 129 ? 30.899 11.219 -2.498  1.00 28.41 ? 2722 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 129 ? 30.880 9.062  -2.050  1.00 29.74 ? 2722 ASP A OD2 1 
ATOM   916  N N   . LEU A 1 130 ? 29.482 13.945 -1.376  1.00 25.77 ? 2723 LEU A N   1 
ATOM   917  C CA  . LEU A 1 130 ? 28.822 14.891 -2.280  1.00 24.37 ? 2723 LEU A CA  1 
ATOM   918  C C   . LEU A 1 130 ? 28.992 14.532 -3.760  1.00 23.89 ? 2723 LEU A C   1 
ATOM   919  O O   . LEU A 1 130 ? 28.411 15.183 -4.612  1.00 22.55 ? 2723 LEU A O   1 
ATOM   920  C CB  . LEU A 1 130 ? 29.273 16.334 -1.984  1.00 25.06 ? 2723 LEU A CB  1 
ATOM   921  C CG  . LEU A 1 130 ? 29.044 16.782 -0.528  1.00 24.06 ? 2723 LEU A CG  1 
ATOM   922  C CD1 . LEU A 1 130 ? 29.614 18.196 -0.260  1.00 25.46 ? 2723 LEU A CD1 1 
ATOM   923  C CD2 . LEU A 1 130 ? 27.562 16.721 -0.122  1.00 25.37 ? 2723 LEU A CD2 1 
ATOM   924  N N   . SER A 1 131 ? 29.763 13.487 -4.069  1.00 23.86 ? 2724 SER A N   1 
ATOM   925  C CA  . SER A 1 131 ? 29.856 13.033 -5.457  1.00 24.42 ? 2724 SER A CA  1 
ATOM   926  C C   . SER A 1 131 ? 28.483 12.551 -5.948  1.00 24.48 ? 2724 SER A C   1 
ATOM   927  O O   . SER A 1 131 ? 28.236 12.526 -7.146  1.00 24.99 ? 2724 SER A O   1 
ATOM   928  C CB  . SER A 1 131 ? 30.929 11.950 -5.644  1.00 24.92 ? 2724 SER A CB  1 
ATOM   929  O OG  . SER A 1 131 ? 30.630 10.792 -4.875  1.00 27.54 ? 2724 SER A OG  1 
ATOM   930  N N   . ASN A 1 132 ? 27.591 12.207 -5.018  1.00 23.75 ? 2725 ASN A N   1 
ATOM   931  C CA  . ASN A 1 132 ? 26.233 11.749 -5.374  1.00 24.08 ? 2725 ASN A CA  1 
ATOM   932  C C   . ASN A 1 132 ? 25.202 12.884 -5.458  1.00 24.50 ? 2725 ASN A C   1 
ATOM   933  O O   . ASN A 1 132 ? 23.990 12.642 -5.604  1.00 24.68 ? 2725 ASN A O   1 
ATOM   934  C CB  . ASN A 1 132 ? 25.757 10.673 -4.385  1.00 24.41 ? 2725 ASN A CB  1 
ATOM   935  C CG  . ASN A 1 132 ? 26.641 9.436  -4.410  1.00 24.99 ? 2725 ASN A CG  1 
ATOM   936  O OD1 . ASN A 1 132 ? 27.094 9.012  -5.481  1.00 27.95 ? 2725 ASN A OD1 1 
ATOM   937  N ND2 . ASN A 1 132 ? 26.907 8.867  -3.234  1.00 24.17 ? 2725 ASN A ND2 1 
ATOM   938  N N   . VAL A 1 133 ? 25.675 14.121 -5.378  1.00 24.18 ? 2726 VAL A N   1 
ATOM   939  C CA  . VAL A 1 133 ? 24.755 15.266 -5.395  1.00 24.88 ? 2726 VAL A CA  1 
ATOM   940  C C   . VAL A 1 133 ? 24.761 15.936 -6.754  1.00 26.08 ? 2726 VAL A C   1 
ATOM   941  O O   . VAL A 1 133 ? 25.825 16.264 -7.292  1.00 26.22 ? 2726 VAL A O   1 
ATOM   942  C CB  . VAL A 1 133 ? 25.059 16.258 -4.251  1.00 24.08 ? 2726 VAL A CB  1 
ATOM   943  C CG1 . VAL A 1 133 ? 24.157 17.501 -4.324  1.00 23.94 ? 2726 VAL A CG1 1 
ATOM   944  C CG2 . VAL A 1 133 ? 24.874 15.557 -2.923  1.00 24.44 ? 2726 VAL A CG2 1 
ATOM   945  N N   . VAL A 1 134 ? 23.553 16.147 -7.287  1.00 27.19 ? 2727 VAL A N   1 
ATOM   946  C CA  . VAL A 1 134 ? 23.336 16.780 -8.601  1.00 29.13 ? 2727 VAL A CA  1 
ATOM   947  C C   . VAL A 1 134 ? 23.225 18.306 -8.530  1.00 28.82 ? 2727 VAL A C   1 
ATOM   948  O O   . VAL A 1 134 ? 22.618 18.852 -7.603  1.00 29.49 ? 2727 VAL A O   1 
ATOM   949  C CB  . VAL A 1 134 ? 22.036 16.256 -9.300  1.00 29.21 ? 2727 VAL A CB  1 
ATOM   950  C CG1 . VAL A 1 134 ? 22.175 14.782 -9.672  1.00 31.18 ? 2727 VAL A CG1 1 
ATOM   951  C CG2 . VAL A 1 134 ? 20.787 16.511 -8.433  1.00 31.50 ? 2727 VAL A CG2 1 
ATOM   952  N N   . LEU A 1 135 ? 23.814 18.974 -9.517  1.00 28.99 ? 2728 LEU A N   1 
ATOM   953  C CA  . LEU A 1 135 ? 23.663 20.425 -9.672  1.00 28.67 ? 2728 LEU A CA  1 
ATOM   954  C C   . LEU A 1 135 ? 22.963 20.741 -10.988 1.00 28.95 ? 2728 LEU A C   1 
ATOM   955  O O   . LEU A 1 135 ? 23.445 20.334 -12.034 1.00 29.43 ? 2728 LEU A O   1 
ATOM   956  C CB  . LEU A 1 135 ? 25.035 21.121 -9.657  1.00 28.10 ? 2728 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 135 ? 25.864 21.129 -8.364  1.00 26.67 ? 2728 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 135 ? 27.124 21.969 -8.559  1.00 26.39 ? 2728 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 135 ? 25.064 21.651 -7.202  1.00 25.81 ? 2728 LEU A CD2 1 
ATOM   960  N N   . SER A 1 136 ? 21.856 21.490 -10.939 1.00 29.77 ? 2729 SER A N   1 
ATOM   961  C CA  . SER A 1 136 ? 21.220 22.009 -12.170 1.00 30.20 ? 2729 SER A CA  1 
ATOM   962  C C   . SER A 1 136 ? 22.238 22.774 -13.029 1.00 30.60 ? 2729 SER A C   1 
ATOM   963  O O   . SER A 1 136 ? 23.267 23.226 -12.507 1.00 31.11 ? 2729 SER A O   1 
ATOM   964  C CB  . SER A 1 136 ? 20.066 22.938 -11.803 1.00 30.44 ? 2729 SER A CB  1 
ATOM   965  O OG  . SER A 1 136 ? 20.551 24.168 -11.279 1.00 31.05 ? 2729 SER A OG  1 
ATOM   966  N N   . ARG A 1 137 ? 21.974 22.904 -14.339 1.00 30.63 ? 2730 ARG A N   1 
ATOM   967  C CA  . ARG A 1 137 ? 22.827 23.715 -15.232 1.00 30.20 ? 2730 ARG A CA  1 
ATOM   968  C C   . ARG A 1 137 ? 22.994 25.174 -14.737 1.00 29.88 ? 2730 ARG A C   1 
ATOM   969  O O   . ARG A 1 137 ? 24.084 25.746 -14.861 1.00 29.46 ? 2730 ARG A O   1 
ATOM   970  C CB  . ARG A 1 137 ? 22.304 23.681 -16.679 1.00 31.18 ? 2730 ARG A CB  1 
ATOM   971  N N   . GLU A 1 138 ? 21.918 25.748 -14.191 1.00 29.23 ? 2731 GLU A N   1 
ATOM   972  C CA  . GLU A 1 138 ? 21.937 27.051 -13.501 1.00 29.70 ? 2731 GLU A CA  1 
ATOM   973  C C   . GLU A 1 138 ? 23.000 27.071 -12.390 1.00 28.71 ? 2731 GLU A C   1 
ATOM   974  O O   . GLU A 1 138 ? 23.855 27.953 -12.351 1.00 27.48 ? 2731 GLU A O   1 
ATOM   975  C CB  . GLU A 1 138 ? 20.539 27.387 -12.928 1.00 30.48 ? 2731 GLU A CB  1 
ATOM   976  C CG  . GLU A 1 138 ? 20.433 28.680 -12.075 1.00 34.10 ? 2731 GLU A CG  1 
ATOM   977  C CD  . GLU A 1 138 ? 19.109 28.821 -11.283 1.00 38.69 ? 2731 GLU A CD  1 
ATOM   978  O OE1 . GLU A 1 138 ? 18.299 27.860 -11.250 1.00 41.90 ? 2731 GLU A OE1 1 
ATOM   979  O OE2 . GLU A 1 138 ? 18.862 29.900 -10.681 1.00 39.50 ? 2731 GLU A OE2 1 
ATOM   980  N N   . LEU A 1 139 ? 22.950 26.083 -11.503 1.00 28.04 ? 2732 LEU A N   1 
ATOM   981  C CA  . LEU A 1 139 ? 23.889 26.045 -10.381 1.00 28.17 ? 2732 LEU A CA  1 
ATOM   982  C C   . LEU A 1 139 ? 25.328 25.808 -10.848 1.00 27.60 ? 2732 LEU A C   1 
ATOM   983  O O   . LEU A 1 139 ? 26.276 26.313 -10.237 1.00 27.85 ? 2732 LEU A O   1 
ATOM   984  C CB  . LEU A 1 139 ? 23.448 25.019 -9.325  1.00 27.44 ? 2732 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 139 ? 22.247 25.429 -8.465  1.00 28.68 ? 2732 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 139 ? 21.610 24.203 -7.803  1.00 29.24 ? 2732 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 139 ? 22.648 26.437 -7.406  1.00 28.79 ? 2732 LEU A CD2 1 
ATOM   988  N N   . GLN A 1 140 ? 25.503 25.083 -11.948 1.00 27.64 ? 2733 GLN A N   1 
ATOM   989  C CA  . GLN A 1 140 ? 26.843 24.877 -12.503 1.00 28.16 ? 2733 GLN A CA  1 
ATOM   990  C C   . GLN A 1 140 ? 27.442 26.186 -13.025 1.00 27.79 ? 2733 GLN A C   1 
ATOM   991  O O   . GLN A 1 140 ? 28.639 26.424 -12.894 1.00 28.03 ? 2733 GLN A O   1 
ATOM   992  C CB  . GLN A 1 140 ? 26.834 23.813 -13.608 1.00 28.97 ? 2733 GLN A CB  1 
ATOM   993  C CG  . GLN A 1 140 ? 26.485 22.415 -13.095 1.00 32.45 ? 2733 GLN A CG  1 
ATOM   994  C CD  . GLN A 1 140 ? 26.146 21.418 -14.209 1.00 37.97 ? 2733 GLN A CD  1 
ATOM   995  O OE1 . GLN A 1 140 ? 26.460 21.635 -15.384 1.00 41.24 ? 2733 GLN A OE1 1 
ATOM   996  N NE2 . GLN A 1 140 ? 25.505 20.313 -13.832 1.00 40.54 ? 2733 GLN A NE2 1 
ATOM   997  N N   . GLY A 1 141 ? 26.606 27.034 -13.618 1.00 26.75 ? 2734 GLY A N   1 
ATOM   998  C CA  . GLY A 1 141 ? 27.053 28.358 -14.061 1.00 25.40 ? 2734 GLY A CA  1 
ATOM   999  C C   . GLY A 1 141 ? 27.422 29.219 -12.858 1.00 24.57 ? 2734 GLY A C   1 
ATOM   1000 O O   . GLY A 1 141 ? 28.409 29.976 -12.897 1.00 24.61 ? 2734 GLY A O   1 
ATOM   1001 N N   . MET A 1 142 ? 26.657 29.085 -11.778 1.00 24.10 ? 2735 MET A N   1 
ATOM   1002 C CA  . MET A 1 142 ? 26.939 29.817 -10.533 1.00 23.68 ? 2735 MET A CA  1 
ATOM   1003 C C   . MET A 1 142 ? 28.241 29.356 -9.868  1.00 23.71 ? 2735 MET A C   1 
ATOM   1004 O O   . MET A 1 142 ? 29.026 30.170 -9.361  1.00 22.11 ? 2735 MET A O   1 
ATOM   1005 C CB  . MET A 1 142 ? 25.757 29.734 -9.584  1.00 24.57 ? 2735 MET A CB  1 
ATOM   1006 C CG  . MET A 1 142 ? 24.533 30.476 -10.152 1.00 25.25 ? 2735 MET A CG  1 
ATOM   1007 S SD  . MET A 1 142 ? 22.968 29.809 -9.572  1.00 29.84 ? 2735 MET A SD  1 
ATOM   1008 C CE  . MET A 1 142 ? 22.951 30.486 -7.930  1.00 26.56 ? 2735 MET A CE  1 
ATOM   1009 N N   . VAL A 1 143 ? 28.490 28.052 -9.909  1.00 22.93 ? 2736 VAL A N   1 
ATOM   1010 C CA  . VAL A 1 143 ? 29.798 27.523 -9.485  1.00 23.28 ? 2736 VAL A CA  1 
ATOM   1011 C C   . VAL A 1 143 ? 30.962 28.281 -10.126 1.00 23.16 ? 2736 VAL A C   1 
ATOM   1012 O O   . VAL A 1 143 ? 31.924 28.661 -9.428  1.00 23.50 ? 2736 VAL A O   1 
ATOM   1013 C CB  . VAL A 1 143 ? 29.921 26.013 -9.807  1.00 23.26 ? 2736 VAL A CB  1 
ATOM   1014 C CG1 . VAL A 1 143 ? 31.364 25.558 -9.723  1.00 23.37 ? 2736 VAL A CG1 1 
ATOM   1015 C CG2 . VAL A 1 143 ? 29.047 25.215 -8.870  1.00 24.36 ? 2736 VAL A CG2 1 
ATOM   1016 N N   . GLU A 1 144 ? 30.895 28.482 -11.443 1.00 23.04 ? 2737 GLU A N   1 
ATOM   1017 C CA  . GLU A 1 144 ? 31.946 29.196 -12.164 1.00 23.17 ? 2737 GLU A CA  1 
ATOM   1018 C C   . GLU A 1 144 ? 32.134 30.652 -11.729 1.00 22.55 ? 2737 GLU A C   1 
ATOM   1019 O O   . GLU A 1 144 ? 33.260 31.141 -11.694 1.00 22.66 ? 2737 GLU A O   1 
ATOM   1020 C CB  . GLU A 1 144 ? 31.769 29.115 -13.688 1.00 23.62 ? 2737 GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 144 ? 31.944 27.721 -14.279 1.00 26.65 ? 2737 GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 144 ? 33.272 27.090 -13.897 1.00 28.55 ? 2737 GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 144 ? 34.324 27.619 -14.306 1.00 29.22 ? 2737 GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 144 ? 33.252 26.077 -13.171 1.00 30.73 ? 2737 GLU A OE2 1 
ATOM   1025 N N   . VAL A 1 145 ? 31.036 31.347 -11.440 1.00 21.46 ? 2738 VAL A N   1 
ATOM   1026 C CA  . VAL A 1 145 ? 31.111 32.725 -10.917 1.00 20.77 ? 2738 VAL A CA  1 
ATOM   1027 C C   . VAL A 1 145 ? 31.851 32.737 -9.586  1.00 20.28 ? 2738 VAL A C   1 
ATOM   1028 O O   . VAL A 1 145 ? 32.770 33.532 -9.388  1.00 19.62 ? 2738 VAL A O   1 
ATOM   1029 C CB  . VAL A 1 145 ? 29.684 33.343 -10.767 1.00 20.89 ? 2738 VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 145 ? 29.735 34.716 -10.053 1.00 20.70 ? 2738 VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 145 ? 29.015 33.440 -12.125 1.00 20.33 ? 2738 VAL A CG2 1 
ATOM   1032 N N   . VAL A 1 146 ? 31.472 31.835 -8.683  1.00 19.60 ? 2739 VAL A N   1 
ATOM   1033 C CA  . VAL A 1 146 ? 32.101 31.759 -7.361  1.00 18.51 ? 2739 VAL A CA  1 
ATOM   1034 C C   . VAL A 1 146 ? 33.590 31.357 -7.481  1.00 18.68 ? 2739 VAL A C   1 
ATOM   1035 O O   . VAL A 1 146 ? 34.459 31.959 -6.836  1.00 18.27 ? 2739 VAL A O   1 
ATOM   1036 C CB  . VAL A 1 146 ? 31.296 30.808 -6.410  1.00 18.10 ? 2739 VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 146 ? 32.021 30.553 -5.105  1.00 17.99 ? 2739 VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 146 ? 29.901 31.407 -6.086  1.00 19.24 ? 2739 VAL A CG2 1 
ATOM   1039 N N   . ALA A 1 147 ? 33.886 30.361 -8.324  1.00 18.71 ? 2740 ALA A N   1 
ATOM   1040 C CA  . ALA A 1 147 ? 35.283 29.935 -8.514  1.00 18.76 ? 2740 ALA A CA  1 
ATOM   1041 C C   . ALA A 1 147 ? 36.141 31.070 -9.090  1.00 18.54 ? 2740 ALA A C   1 
ATOM   1042 O O   . ALA A 1 147 ? 37.273 31.274 -8.657  1.00 18.33 ? 2740 ALA A O   1 
ATOM   1043 C CB  . ALA A 1 147 ? 35.357 28.693 -9.424  1.00 18.07 ? 2740 ALA A CB  1 
ATOM   1044 N N   . GLU A 1 148 ? 35.604 31.813 -10.056 1.00 19.28 ? 2741 GLU A N   1 
ATOM   1045 C CA  . GLU A 1 148 ? 36.341 32.959 -10.626 1.00 19.46 ? 2741 GLU A CA  1 
ATOM   1046 C C   . GLU A 1 148 ? 36.603 34.009 -9.562  1.00 19.04 ? 2741 GLU A C   1 
ATOM   1047 O O   . GLU A 1 148 ? 37.680 34.605 -9.536  1.00 18.17 ? 2741 GLU A O   1 
ATOM   1048 C CB  . GLU A 1 148 ? 35.629 33.569 -11.851 1.00 20.37 ? 2741 GLU A CB  1 
ATOM   1049 C CG  . GLU A 1 148 ? 36.216 34.930 -12.293 1.00 22.00 ? 2741 GLU A CG  1 
ATOM   1050 C CD  . GLU A 1 148 ? 35.988 35.271 -13.773 1.00 25.76 ? 2741 GLU A CD  1 
ATOM   1051 O OE1 . GLU A 1 148 ? 35.057 34.725 -14.394 1.00 25.33 ? 2741 GLU A OE1 1 
ATOM   1052 O OE2 . GLU A 1 148 ? 36.763 36.094 -14.315 1.00 29.37 ? 2741 GLU A OE2 1 
ATOM   1053 N N   . ASN A 1 149 ? 35.625 34.225 -8.682  1.00 18.85 ? 2742 ASN A N   1 
ATOM   1054 C CA  . ASN A 1 149 ? 35.806 35.188 -7.599  1.00 19.07 ? 2742 ASN A CA  1 
ATOM   1055 C C   . ASN A 1 149 ? 36.902 34.774 -6.612  1.00 18.96 ? 2742 ASN A C   1 
ATOM   1056 O O   . ASN A 1 149 ? 37.730 35.596 -6.219  1.00 18.97 ? 2742 ASN A O   1 
ATOM   1057 C CB  . ASN A 1 149 ? 34.494 35.471 -6.881  1.00 19.90 ? 2742 ASN A CB  1 
ATOM   1058 C CG  . ASN A 1 149 ? 34.628 36.580 -5.878  1.00 20.07 ? 2742 ASN A CG  1 
ATOM   1059 O OD1 . ASN A 1 149 ? 34.906 37.733 -6.241  1.00 19.97 ? 2742 ASN A OD1 1 
ATOM   1060 N ND2 . ASN A 1 149 ? 34.432 36.254 -4.608  1.00 20.21 ? 2742 ASN A ND2 1 
ATOM   1061 N N   . TYR A 1 150 ? 36.931 33.496 -6.222  1.00 17.49 ? 2743 TYR A N   1 
ATOM   1062 C CA  . TYR A 1 150 ? 38.073 33.012 -5.451  1.00 17.57 ? 2743 TYR A CA  1 
ATOM   1063 C C   . TYR A 1 150 ? 39.407 33.313 -6.123  1.00 16.80 ? 2743 TYR A C   1 
ATOM   1064 O O   . TYR A 1 150 ? 40.361 33.740 -5.433  1.00 17.16 ? 2743 TYR A O   1 
ATOM   1065 C CB  . TYR A 1 150 ? 37.983 31.499 -5.185  1.00 17.15 ? 2743 TYR A CB  1 
ATOM   1066 C CG  . TYR A 1 150 ? 36.805 30.995 -4.382  1.00 17.86 ? 2743 TYR A CG  1 
ATOM   1067 C CD1 . TYR A 1 150 ? 36.322 31.684 -3.260  1.00 19.27 ? 2743 TYR A CD1 1 
ATOM   1068 C CD2 . TYR A 1 150 ? 36.222 29.769 -4.702  1.00 19.31 ? 2743 TYR A CD2 1 
ATOM   1069 C CE1 . TYR A 1 150 ? 35.258 31.191 -2.519  1.00 20.50 ? 2743 TYR A CE1 1 
ATOM   1070 C CE2 . TYR A 1 150 ? 35.171 29.243 -3.950  1.00 20.62 ? 2743 TYR A CE2 1 
ATOM   1071 C CZ  . TYR A 1 150 ? 34.690 29.963 -2.868  1.00 22.49 ? 2743 TYR A CZ  1 
ATOM   1072 O OH  . TYR A 1 150 ? 33.635 29.448 -2.150  1.00 21.83 ? 2743 TYR A OH  1 
ATOM   1073 N N   . HIS A 1 151 ? 39.500 33.081 -7.447  1.00 16.27 ? 2744 HIS A N   1 
ATOM   1074 C CA  . HIS A 1 151 ? 40.733 33.382 -8.167  1.00 17.18 ? 2744 HIS A CA  1 
ATOM   1075 C C   . HIS A 1 151 ? 41.059 34.881 -8.093  1.00 17.91 ? 2744 HIS A C   1 
ATOM   1076 O O   . HIS A 1 151 ? 42.225 35.277 -7.913  1.00 17.86 ? 2744 HIS A O   1 
ATOM   1077 C CB  . HIS A 1 151 ? 40.656 32.969 -9.644  1.00 17.05 ? 2744 HIS A CB  1 
ATOM   1078 C CG  . HIS A 1 151 ? 41.860 33.375 -10.434 1.00 17.90 ? 2744 HIS A CG  1 
ATOM   1079 N ND1 . HIS A 1 151 ? 43.123 32.886 -10.160 1.00 18.81 ? 2744 HIS A ND1 1 
ATOM   1080 C CD2 . HIS A 1 151 ? 42.001 34.228 -11.477 1.00 21.23 ? 2744 HIS A CD2 1 
ATOM   1081 C CE1 . HIS A 1 151 ? 43.986 33.407 -11.019 1.00 21.01 ? 2744 HIS A CE1 1 
ATOM   1082 N NE2 . HIS A 1 151 ? 43.331 34.219 -11.833 1.00 21.09 ? 2744 HIS A NE2 1 
ATOM   1083 N N   . ASN A 1 152 ? 40.036 35.714 -8.264  1.00 18.35 ? 2745 ASN A N   1 
ATOM   1084 C CA  . ASN A 1 152 ? 40.237 37.167 -8.213  1.00 18.74 ? 2745 ASN A CA  1 
ATOM   1085 C C   . ASN A 1 152 ? 40.708 37.671 -6.863  1.00 18.68 ? 2745 ASN A C   1 
ATOM   1086 O O   . ASN A 1 152 ? 41.500 38.627 -6.786  1.00 18.95 ? 2745 ASN A O   1 
ATOM   1087 C CB  . ASN A 1 152 ? 38.964 37.916 -8.625  1.00 18.13 ? 2745 ASN A CB  1 
ATOM   1088 C CG  . ASN A 1 152 ? 38.681 37.809 -10.097 1.00 20.15 ? 2745 ASN A CG  1 
ATOM   1089 O OD1 . ASN A 1 152 ? 39.572 37.525 -10.902 1.00 21.88 ? 2745 ASN A OD1 1 
ATOM   1090 N ND2 . ASN A 1 152 ? 37.427 38.024 -10.468 1.00 20.46 ? 2745 ASN A ND2 1 
ATOM   1091 N N   . ILE A 1 153 ? 40.230 37.034 -5.804  1.00 18.92 ? 2746 ILE A N   1 
ATOM   1092 C CA  . ILE A 1 153 ? 40.668 37.357 -4.442  1.00 18.97 ? 2746 ILE A CA  1 
ATOM   1093 C C   . ILE A 1 153 ? 42.176 37.024 -4.310  1.00 19.09 ? 2746 ILE A C   1 
ATOM   1094 O O   . ILE A 1 153 ? 42.975 37.851 -3.846  1.00 18.78 ? 2746 ILE A O   1 
ATOM   1095 C CB  . ILE A 1 153 ? 39.826 36.614 -3.372  1.00 19.53 ? 2746 ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 153 ? 38.398 37.183 -3.328  1.00 18.81 ? 2746 ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 153 ? 40.461 36.740 -1.984  1.00 18.79 ? 2746 ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 153 ? 37.411 36.302 -2.543  1.00 21.07 ? 2746 ILE A CD1 1 
ATOM   1099 N N   . TRP A 1 154 ? 42.553 35.824 -4.742  1.00 18.80 ? 2747 TRP A N   1 
ATOM   1100 C CA  . TRP A 1 154 ? 43.963 35.427 -4.715  1.00 18.53 ? 2747 TRP A CA  1 
ATOM   1101 C C   . TRP A 1 154 ? 44.811 36.376 -5.575  1.00 18.61 ? 2747 TRP A C   1 
ATOM   1102 O O   . TRP A 1 154 ? 45.926 36.772 -5.178  1.00 18.95 ? 2747 TRP A O   1 
ATOM   1103 C CB  . TRP A 1 154 ? 44.133 33.959 -5.199  1.00 19.16 ? 2747 TRP A CB  1 
ATOM   1104 C CG  . TRP A 1 154 ? 45.595 33.576 -5.305  1.00 18.36 ? 2747 TRP A CG  1 
ATOM   1105 C CD1 . TRP A 1 154 ? 46.381 33.061 -4.328  1.00 22.92 ? 2747 TRP A CD1 1 
ATOM   1106 C CD2 . TRP A 1 154 ? 46.434 33.761 -6.443  1.00 21.35 ? 2747 TRP A CD2 1 
ATOM   1107 N NE1 . TRP A 1 154 ? 47.673 32.907 -4.785  1.00 22.39 ? 2747 TRP A NE1 1 
ATOM   1108 C CE2 . TRP A 1 154 ? 47.730 33.326 -6.086  1.00 21.43 ? 2747 TRP A CE2 1 
ATOM   1109 C CE3 . TRP A 1 154 ? 46.213 34.234 -7.745  1.00 19.56 ? 2747 TRP A CE3 1 
ATOM   1110 C CZ2 . TRP A 1 154 ? 48.803 33.374 -6.974  1.00 20.76 ? 2747 TRP A CZ2 1 
ATOM   1111 C CZ3 . TRP A 1 154 ? 47.280 34.290 -8.622  1.00 22.04 ? 2747 TRP A CZ3 1 
ATOM   1112 C CH2 . TRP A 1 154 ? 48.560 33.865 -8.233  1.00 21.75 ? 2747 TRP A CH2 1 
ATOM   1113 N N   . ALA A 1 155 ? 44.301 36.690 -6.759  1.00 18.60 ? 2748 ALA A N   1 
ATOM   1114 C CA  . ALA A 1 155 ? 45.052 37.488 -7.744  1.00 19.38 ? 2748 ALA A CA  1 
ATOM   1115 C C   . ALA A 1 155 ? 45.265 38.920 -7.259  1.00 19.92 ? 2748 ALA A C   1 
ATOM   1116 O O   . ALA A 1 155 ? 46.353 39.474 -7.435  1.00 19.60 ? 2748 ALA A O   1 
ATOM   1117 C CB  . ALA A 1 155 ? 44.370 37.454 -9.103  1.00 19.66 ? 2748 ALA A CB  1 
ATOM   1118 N N   . LYS A 1 156 ? 44.241 39.513 -6.642  1.00 20.39 ? 2749 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 156 ? 44.396 40.861 -6.079  1.00 21.13 ? 2749 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 156 ? 45.429 40.845 -4.941  1.00 21.86 ? 2749 LYS A C   1 
ATOM   1121 O O   . LYS A 1 156 ? 46.307 41.728 -4.858  1.00 21.63 ? 2749 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 156 ? 43.047 41.420 -5.614  1.00 21.85 ? 2749 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 156 ? 43.136 42.895 -5.209  1.00 24.05 ? 2749 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 156 ? 41.846 43.350 -4.528  1.00 29.93 ? 2749 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 156 ? 41.902 44.834 -4.127  1.00 33.51 ? 2749 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 156 ? 40.673 45.166 -3.353  1.00 33.79 ? 2749 LYS A NZ  1 
ATOM   1127 N N   . LYS A 1 157 ? 45.352 39.830 -4.072  1.00 22.27 ? 2750 LYS A N   1 
ATOM   1128 C CA  . LYS A 1 157 ? 46.380 39.641 -3.050  1.00 22.40 ? 2750 LYS A CA  1 
ATOM   1129 C C   . LYS A 1 157 ? 47.784 39.528 -3.659  1.00 22.63 ? 2750 LYS A C   1 
ATOM   1130 O O   . LYS A 1 157 ? 48.728 40.133 -3.137  1.00 22.83 ? 2750 LYS A O   1 
ATOM   1131 C CB  . LYS A 1 157 ? 46.078 38.414 -2.154  1.00 22.46 ? 2750 LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 157 ? 45.013 38.642 -1.118  1.00 24.60 ? 2750 LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 157 ? 44.530 37.303 -0.550  1.00 24.78 ? 2750 LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 157 ? 43.885 37.508 0.803   1.00 27.28 ? 2750 LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 157 ? 43.222 36.260 1.245   1.00 27.89 ? 2750 LYS A NZ  1 
ATOM   1136 N N   . LYS A 1 158 ? 47.923 38.797 -4.773  1.00 21.92 ? 2751 LYS A N   1 
ATOM   1137 C CA  . LYS A 1 158 ? 49.238 38.625 -5.409  1.00 23.05 ? 2751 LYS A CA  1 
ATOM   1138 C C   . LYS A 1 158 ? 49.717 39.938 -6.050  1.00 23.17 ? 2751 LYS A C   1 
ATOM   1139 O O   . LYS A 1 158 ? 50.883 40.308 -5.930  1.00 22.95 ? 2751 LYS A O   1 
ATOM   1140 C CB  . LYS A 1 158 ? 49.210 37.490 -6.445  1.00 22.87 ? 2751 LYS A CB  1 
ATOM   1141 C CG  . LYS A 1 158 ? 50.564 37.234 -7.162  1.00 24.04 ? 2751 LYS A CG  1 
ATOM   1142 C CD  . LYS A 1 158 ? 51.688 36.777 -6.238  1.00 27.67 ? 2751 LYS A CD  1 
ATOM   1143 C CE  . LYS A 1 158 ? 51.324 35.525 -5.422  1.00 29.86 ? 2751 LYS A CE  1 
ATOM   1144 N NZ  . LYS A 1 158 ? 52.366 35.168 -4.408  1.00 32.39 ? 2751 LYS A NZ  1 
ATOM   1145 N N   . LYS A 1 159 ? 48.797 40.650 -6.692  1.00 23.01 ? 2752 LYS A N   1 
ATOM   1146 C CA  . LYS A 1 159 ? 49.106 41.951 -7.299  1.00 24.05 ? 2752 LYS A CA  1 
ATOM   1147 C C   . LYS A 1 159 ? 49.626 42.934 -6.237  1.00 24.08 ? 2752 LYS A C   1 
ATOM   1148 O O   . LYS A 1 159 ? 50.661 43.577 -6.444  1.00 24.90 ? 2752 LYS A O   1 
ATOM   1149 C CB  . LYS A 1 159 ? 47.873 42.489 -8.017  1.00 24.05 ? 2752 LYS A CB  1 
ATOM   1150 C CG  . LYS A 1 159 ? 48.073 43.762 -8.823  1.00 28.19 ? 2752 LYS A CG  1 
ATOM   1151 C CD  . LYS A 1 159 ? 46.740 44.189 -9.449  1.00 31.13 ? 2752 LYS A CD  1 
ATOM   1152 C CE  . LYS A 1 159 ? 46.680 45.699 -9.652  1.00 36.01 ? 2752 LYS A CE  1 
ATOM   1153 N NZ  . LYS A 1 159 ? 46.334 46.401 -8.377  1.00 38.81 ? 2752 LYS A NZ  1 
ATOM   1154 N N   . LEU A 1 160 ? 48.938 43.024 -5.101  1.00 24.26 ? 2753 LEU A N   1 
ATOM   1155 C CA  . LEU A 1 160 ? 49.377 43.904 -4.016  1.00 24.90 ? 2753 LEU A CA  1 
ATOM   1156 C C   . LEU A 1 160 ? 50.708 43.459 -3.405  1.00 25.57 ? 2753 LEU A C   1 
ATOM   1157 O O   . LEU A 1 160 ? 51.564 44.296 -3.053  1.00 25.73 ? 2753 LEU A O   1 
ATOM   1158 C CB  . LEU A 1 160 ? 48.306 44.006 -2.940  1.00 25.23 ? 2753 LEU A CB  1 
ATOM   1159 C CG  . LEU A 1 160 ? 47.035 44.760 -3.339  1.00 25.61 ? 2753 LEU A CG  1 
ATOM   1160 C CD1 . LEU A 1 160 ? 45.975 44.646 -2.251  1.00 28.32 ? 2753 LEU A CD1 1 
ATOM   1161 C CD2 . LEU A 1 160 ? 47.355 46.227 -3.660  1.00 27.24 ? 2753 LEU A CD2 1 
ATOM   1162 N N   . GLU A 1 161 ? 50.880 42.144 -3.279  1.00 25.22 ? 2754 GLU A N   1 
ATOM   1163 C CA  . GLU A 1 161 ? 52.151 41.581 -2.828  1.00 26.32 ? 2754 GLU A CA  1 
ATOM   1164 C C   . GLU A 1 161 ? 53.307 41.959 -3.757  1.00 26.66 ? 2754 GLU A C   1 
ATOM   1165 O O   . GLU A 1 161 ? 54.336 42.448 -3.284  1.00 27.42 ? 2754 GLU A O   1 
ATOM   1166 C CB  . GLU A 1 161 ? 52.040 40.060 -2.644  1.00 26.11 ? 2754 GLU A CB  1 
ATOM   1167 C CG  . GLU A 1 161 ? 53.355 39.371 -2.285  1.00 25.44 ? 2754 GLU A CG  1 
ATOM   1168 C CD  . GLU A 1 161 ? 53.233 37.847 -2.253  1.00 25.53 ? 2754 GLU A CD  1 
ATOM   1169 O OE1 . GLU A 1 161 ? 52.216 37.318 -2.725  1.00 26.32 ? 2754 GLU A OE1 1 
ATOM   1170 O OE2 . GLU A 1 161 ? 54.155 37.181 -1.750  1.00 26.72 ? 2754 GLU A OE2 1 
ATOM   1171 N N   . LEU A 1 162 ? 53.137 41.744 -5.063  1.00 27.55 ? 2755 LEU A N   1 
ATOM   1172 C CA  . LEU A 1 162 ? 54.127 42.135 -6.083  1.00 28.21 ? 2755 LEU A CA  1 
ATOM   1173 C C   . LEU A 1 162 ? 54.440 43.637 -6.049  1.00 29.16 ? 2755 LEU A C   1 
ATOM   1174 O O   . LEU A 1 162 ? 55.601 44.029 -6.104  1.00 29.00 ? 2755 LEU A O   1 
ATOM   1175 C CB  . LEU A 1 162 ? 53.671 41.740 -7.493  1.00 28.22 ? 2755 LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 162 ? 53.664 40.259 -7.931  1.00 28.99 ? 2755 LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 162 ? 52.930 40.112 -9.235  1.00 28.32 ? 2755 LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 162 ? 55.075 39.659 -8.055  1.00 29.97 ? 2755 LEU A CD2 1 
ATOM   1179 N N   . GLU A 1 163 ? 53.409 44.468 -5.947  1.00 29.93 ? 2756 GLU A N   1 
ATOM   1180 C CA  . GLU A 1 163 ? 53.613 45.915 -5.839  1.00 31.19 ? 2756 GLU A CA  1 
ATOM   1181 C C   . GLU A 1 163 ? 54.407 46.311 -4.577  1.00 31.64 ? 2756 GLU A C   1 
ATOM   1182 O O   . GLU A 1 163 ? 55.240 47.233 -4.624  1.00 31.38 ? 2756 GLU A O   1 
ATOM   1183 C CB  . GLU A 1 163 ? 52.273 46.664 -5.950  1.00 31.24 ? 2756 GLU A CB  1 
ATOM   1184 C CG  . GLU A 1 163 ? 51.714 46.638 -7.383  1.00 33.24 ? 2756 GLU A CG  1 
ATOM   1185 C CD  . GLU A 1 163 ? 50.233 46.992 -7.495  1.00 35.66 ? 2756 GLU A CD  1 
ATOM   1186 O OE1 . GLU A 1 163 ? 49.614 47.351 -6.472  1.00 36.26 ? 2756 GLU A OE1 1 
ATOM   1187 O OE2 . GLU A 1 163 ? 49.691 46.915 -8.628  1.00 35.75 ? 2756 GLU A OE2 1 
ATOM   1188 N N   . SER A 1 164 ? 54.192 45.600 -3.468  1.00 32.20 ? 2757 SER A N   1 
ATOM   1189 C CA  . SER A 1 164 ? 54.930 45.873 -2.231  1.00 33.09 ? 2757 SER A CA  1 
ATOM   1190 C C   . SER A 1 164 ? 56.437 45.582 -2.370  1.00 33.63 ? 2757 SER A C   1 
ATOM   1191 O O   . SER A 1 164 ? 57.235 46.163 -1.631  1.00 34.18 ? 2757 SER A O   1 
ATOM   1192 C CB  . SER A 1 164 ? 54.340 45.092 -1.044  1.00 33.18 ? 2757 SER A CB  1 
ATOM   1193 O OG  . SER A 1 164 ? 54.727 43.727 -1.120  1.00 34.88 ? 2757 SER A OG  1 
ATOM   1194 N N   . LYS A 1 165 ? 56.788 44.711 -3.327  1.00 34.60 ? 2758 LYS A N   1 
ATOM   1195 C CA  . LYS A 1 165 ? 58.172 44.267 -3.640  1.00 35.86 ? 2758 LYS A CA  1 
ATOM   1196 C C   . LYS A 1 165 ? 58.882 45.089 -4.722  1.00 36.47 ? 2758 LYS A C   1 
ATOM   1197 O O   . LYS A 1 165 ? 59.955 44.696 -5.202  1.00 37.14 ? 2758 LYS A O   1 
ATOM   1198 C CB  . LYS A 1 165 ? 58.155 42.817 -4.160  1.00 35.97 ? 2758 LYS A CB  1 
ATOM   1199 C CG  . LYS A 1 165 ? 57.850 41.741 -3.133  1.00 34.73 ? 2758 LYS A CG  1 
ATOM   1200 C CD  . LYS A 1 165 ? 57.607 40.380 -3.827  1.00 33.75 ? 2758 LYS A CD  1 
ATOM   1201 C CE  . LYS A 1 165 ? 57.503 39.246 -2.808  1.00 32.81 ? 2758 LYS A CE  1 
ATOM   1202 N NZ  . LYS A 1 165 ? 58.819 38.905 -2.124  1.00 33.82 ? 2758 LYS A NZ  1 
ATOM   1203 N N   . GLY A 1 166 ? 58.279 46.198 -5.137  1.00 37.21 ? 2759 GLY A N   1 
ATOM   1204 C CA  . GLY A 1 166 ? 58.828 47.005 -6.237  1.00 37.70 ? 2759 GLY A CA  1 
ATOM   1205 C C   . GLY A 1 166 ? 58.451 46.477 -7.610  1.00 38.32 ? 2759 GLY A C   1 
ATOM   1206 O O   . GLY A 1 166 ? 59.121 46.770 -8.613  1.00 38.65 ? 2759 GLY A O   1 
ATOM   1207 N N   . GLY A 1 167 ? 57.374 45.697 -7.668  1.00 38.10 ? 2760 GLY A N   1 
ATOM   1208 C CA  . GLY A 1 167 ? 56.877 45.194 -8.940  1.00 37.73 ? 2760 GLY A CA  1 
ATOM   1209 C C   . GLY A 1 167 ? 57.286 43.761 -9.216  1.00 37.45 ? 2760 GLY A C   1 
ATOM   1210 O O   . GLY A 1 167 ? 57.823 43.065 -8.340  1.00 38.18 ? 2760 GLY A O   1 
ATOM   1211 N N   . GLY A 1 168 ? 57.029 43.323 -10.441 1.00 37.02 ? 2761 GLY A N   1 
ATOM   1212 C CA  . GLY A 1 168 ? 57.309 41.954 -10.856 1.00 35.55 ? 2761 GLY A CA  1 
ATOM   1213 C C   . GLY A 1 168 ? 56.065 41.296 -11.419 1.00 34.96 ? 2761 GLY A C   1 
ATOM   1214 O O   . GLY A 1 168 ? 54.988 41.904 -11.445 1.00 34.61 ? 2761 GLY A O   1 
ATOM   1215 N N   . SER A 1 169 ? 56.219 40.043 -11.845 1.00 33.78 ? 2762 SER A N   1 
ATOM   1216 C CA  . SER A 1 169 ? 55.183 39.301 -12.551 1.00 32.98 ? 2762 SER A CA  1 
ATOM   1217 C C   . SER A 1 169 ? 54.881 37.995 -11.803 1.00 31.38 ? 2762 SER A C   1 
ATOM   1218 O O   . SER A 1 169 ? 55.697 37.532 -10.987 1.00 31.71 ? 2762 SER A O   1 
ATOM   1219 C CB  . SER A 1 169 ? 55.679 38.983 -13.966 1.00 33.70 ? 2762 SER A CB  1 
ATOM   1220 O OG  . SER A 1 169 ? 54.619 39.024 -14.909 1.00 37.65 ? 2762 SER A OG  1 
ATOM   1221 N N   . HIS A 1 170 ? 53.711 37.419 -12.065 1.00 28.96 ? 2763 HIS A N   1 
ATOM   1222 C CA  . HIS A 1 170 ? 53.412 36.043 -11.645 1.00 26.85 ? 2763 HIS A CA  1 
ATOM   1223 C C   . HIS A 1 170 ? 52.617 35.329 -12.734 1.00 26.05 ? 2763 HIS A C   1 
ATOM   1224 O O   . HIS A 1 170 ? 51.669 35.894 -13.286 1.00 25.80 ? 2763 HIS A O   1 
ATOM   1225 C CB  . HIS A 1 170 ? 52.661 36.003 -10.313 1.00 26.43 ? 2763 HIS A CB  1 
ATOM   1226 C CG  . HIS A 1 170 ? 52.550 34.627 -9.731  1.00 25.64 ? 2763 HIS A CG  1 
ATOM   1227 N ND1 . HIS A 1 170 ? 51.589 33.725 -10.134 1.00 23.88 ? 2763 HIS A ND1 1 
ATOM   1228 C CD2 . HIS A 1 170 ? 53.288 33.995 -8.786  1.00 26.86 ? 2763 HIS A CD2 1 
ATOM   1229 C CE1 . HIS A 1 170 ? 51.735 32.596 -9.463  1.00 24.50 ? 2763 HIS A CE1 1 
ATOM   1230 N NE2 . HIS A 1 170 ? 52.760 32.732 -8.638  1.00 24.72 ? 2763 HIS A NE2 1 
ATOM   1231 N N   . PRO A 1 171 ? 52.980 34.067 -13.044 1.00 25.21 ? 2764 PRO A N   1 
ATOM   1232 C CA  . PRO A 1 171 ? 52.305 33.386 -14.132 1.00 25.17 ? 2764 PRO A CA  1 
ATOM   1233 C C   . PRO A 1 171 ? 50.781 33.234 -13.975 1.00 24.91 ? 2764 PRO A C   1 
ATOM   1234 O O   . PRO A 1 171 ? 50.093 33.131 -14.980 1.00 25.90 ? 2764 PRO A O   1 
ATOM   1235 C CB  . PRO A 1 171 ? 53.022 32.015 -14.200 1.00 25.27 ? 2764 PRO A CB  1 
ATOM   1236 C CG  . PRO A 1 171 ? 53.738 31.878 -12.906 1.00 25.30 ? 2764 PRO A CG  1 
ATOM   1237 C CD  . PRO A 1 171 ? 54.093 33.271 -12.503 1.00 25.31 ? 2764 PRO A CD  1 
ATOM   1238 N N   . LEU A 1 172 ? 50.262 33.260 -12.742 1.00 24.03 ? 2765 LEU A N   1 
ATOM   1239 C CA  . LEU A 1 172 ? 48.834 33.027 -12.489 1.00 23.59 ? 2765 LEU A CA  1 
ATOM   1240 C C   . LEU A 1 172 ? 48.041 34.336 -12.301 1.00 23.98 ? 2765 LEU A C   1 
ATOM   1241 O O   . LEU A 1 172 ? 46.830 34.316 -12.068 1.00 23.30 ? 2765 LEU A O   1 
ATOM   1242 C CB  . LEU A 1 172 ? 48.627 32.088 -11.288 1.00 23.61 ? 2765 LEU A CB  1 
ATOM   1243 C CG  . LEU A 1 172 ? 48.998 30.614 -11.503 1.00 23.82 ? 2765 LEU A CG  1 
ATOM   1244 C CD1 . LEU A 1 172 ? 49.052 29.853 -10.162 1.00 22.45 ? 2765 LEU A CD1 1 
ATOM   1245 C CD2 . LEU A 1 172 ? 48.068 29.925 -12.505 1.00 24.52 ? 2765 LEU A CD2 1 
ATOM   1246 N N   . LEU A 1 173 ? 48.730 35.468 -12.418 1.00 23.79 ? 2766 LEU A N   1 
ATOM   1247 C CA  . LEU A 1 173 ? 48.053 36.770 -12.335 1.00 25.13 ? 2766 LEU A CA  1 
ATOM   1248 C C   . LEU A 1 173 ? 47.495 37.105 -13.714 1.00 25.10 ? 2766 LEU A C   1 
ATOM   1249 O O   . LEU A 1 173 ? 48.020 37.962 -14.430 1.00 26.03 ? 2766 LEU A O   1 
ATOM   1250 C CB  . LEU A 1 173 ? 48.992 37.851 -11.750 1.00 25.48 ? 2766 LEU A CB  1 
ATOM   1251 C CG  . LEU A 1 173 ? 48.509 39.302 -11.552 1.00 26.94 ? 2766 LEU A CG  1 
ATOM   1252 C CD1 . LEU A 1 173 ? 47.130 39.396 -10.906 1.00 27.69 ? 2766 LEU A CD1 1 
ATOM   1253 C CD2 . LEU A 1 173 ? 49.532 40.123 -10.764 1.00 27.22 ? 2766 LEU A CD2 1 
ATOM   1254 N N   . VAL A 1 174 ? 46.437 36.369 -14.079 1.00 25.42 ? 2767 VAL A N   1 
ATOM   1255 C CA  . VAL A 1 174 ? 45.766 36.425 -15.389 1.00 25.81 ? 2767 VAL A CA  1 
ATOM   1256 C C   . VAL A 1 174 ? 44.285 36.142 -15.141 1.00 25.99 ? 2767 VAL A C   1 
ATOM   1257 O O   . VAL A 1 174 ? 43.935 35.617 -14.084 1.00 26.21 ? 2767 VAL A O   1 
ATOM   1258 C CB  . VAL A 1 174 ? 46.293 35.348 -16.375 1.00 25.95 ? 2767 VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 174 ? 47.742 35.617 -16.803 1.00 26.70 ? 2767 VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 174 ? 46.124 33.935 -15.799 1.00 25.54 ? 2767 VAL A CG2 1 
ATOM   1261 N N   . PRO A 1 175 ? 43.398 36.494 -16.092 1.00 26.54 ? 2768 PRO A N   1 
ATOM   1262 C CA  . PRO A 1 175 ? 41.987 36.204 -15.837 1.00 26.26 ? 2768 PRO A CA  1 
ATOM   1263 C C   . PRO A 1 175 ? 41.710 34.717 -15.702 1.00 26.29 ? 2768 PRO A C   1 
ATOM   1264 O O   . PRO A 1 175 ? 42.368 33.897 -16.353 1.00 26.29 ? 2768 PRO A O   1 
ATOM   1265 C CB  . PRO A 1 175 ? 41.280 36.775 -17.071 1.00 26.72 ? 2768 PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 175 ? 42.188 37.843 -17.542 1.00 26.41 ? 2768 PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 175 ? 43.566 37.283 -17.329 1.00 26.83 ? 2768 PRO A CD  1 
ATOM   1268 N N   . TYR A 1 176 ? 40.751 34.391 -14.840 1.00 25.45 ? 2769 TYR A N   1 
ATOM   1269 C CA  . TYR A 1 176 ? 40.296 33.020 -14.603 1.00 25.93 ? 2769 TYR A CA  1 
ATOM   1270 C C   . TYR A 1 176 ? 40.088 32.201 -15.891 1.00 26.74 ? 2769 TYR A C   1 
ATOM   1271 O O   . TYR A 1 176 ? 40.450 31.022 -15.938 1.00 26.13 ? 2769 TYR A O   1 
ATOM   1272 C CB  . TYR A 1 176 ? 38.994 33.071 -13.794 1.00 25.79 ? 2769 TYR A CB  1 
ATOM   1273 C CG  . TYR A 1 176 ? 38.352 31.737 -13.492 1.00 24.88 ? 2769 TYR A CG  1 
ATOM   1274 C CD1 . TYR A 1 176 ? 38.801 30.945 -12.424 1.00 23.37 ? 2769 TYR A CD1 1 
ATOM   1275 C CD2 . TYR A 1 176 ? 37.271 31.281 -14.246 1.00 23.53 ? 2769 TYR A CD2 1 
ATOM   1276 C CE1 . TYR A 1 176 ? 38.199 29.722 -12.142 1.00 23.78 ? 2769 TYR A CE1 1 
ATOM   1277 C CE2 . TYR A 1 176 ? 36.662 30.079 -13.967 1.00 25.07 ? 2769 TYR A CE2 1 
ATOM   1278 C CZ  . TYR A 1 176 ? 37.132 29.298 -12.914 1.00 23.79 ? 2769 TYR A CZ  1 
ATOM   1279 O OH  . TYR A 1 176 ? 36.525 28.109 -12.641 1.00 26.41 ? 2769 TYR A OH  1 
ATOM   1280 N N   . ASP A 1 177 ? 39.503 32.816 -16.920 1.00 27.59 ? 2770 ASP A N   1 
ATOM   1281 C CA  . ASP A 1 177 ? 39.165 32.077 -18.153 1.00 29.28 ? 2770 ASP A CA  1 
ATOM   1282 C C   . ASP A 1 177 ? 40.394 31.593 -18.923 1.00 29.19 ? 2770 ASP A C   1 
ATOM   1283 O O   . ASP A 1 177 ? 40.284 30.687 -19.761 1.00 31.05 ? 2770 ASP A O   1 
ATOM   1284 C CB  . ASP A 1 177 ? 38.269 32.906 -19.081 1.00 29.88 ? 2770 ASP A CB  1 
ATOM   1285 C CG  . ASP A 1 177 ? 36.828 32.926 -18.643 1.00 32.78 ? 2770 ASP A CG  1 
ATOM   1286 O OD1 . ASP A 1 177 ? 36.402 32.039 -17.866 1.00 34.88 ? 2770 ASP A OD1 1 
ATOM   1287 O OD2 . ASP A 1 177 ? 36.102 33.844 -19.096 1.00 38.08 ? 2770 ASP A OD2 1 
ATOM   1288 N N   . THR A 1 178 ? 41.549 32.184 -18.641 1.00 28.12 ? 2771 THR A N   1 
ATOM   1289 C CA  . THR A 1 178 ? 42.800 31.813 -19.312 1.00 27.68 ? 2771 THR A CA  1 
ATOM   1290 C C   . THR A 1 178 ? 43.593 30.726 -18.558 1.00 26.28 ? 2771 THR A C   1 
ATOM   1291 O O   . THR A 1 178 ? 44.587 30.208 -19.072 1.00 26.15 ? 2771 THR A O   1 
ATOM   1292 C CB  . THR A 1 178 ? 43.702 33.049 -19.598 1.00 28.34 ? 2771 THR A CB  1 
ATOM   1293 O OG1 . THR A 1 178 ? 44.218 33.564 -18.367 1.00 30.74 ? 2771 THR A OG1 1 
ATOM   1294 C CG2 . THR A 1 178 ? 42.915 34.141 -20.300 1.00 28.52 ? 2771 THR A CG2 1 
ATOM   1295 N N   . LEU A 1 179 ? 43.134 30.364 -17.358 1.00 23.62 ? 2772 LEU A N   1 
ATOM   1296 C CA  . LEU A 1 179 ? 43.752 29.278 -16.602 1.00 22.61 ? 2772 LEU A CA  1 
ATOM   1297 C C   . LEU A 1 179 ? 43.491 27.909 -17.203 1.00 22.12 ? 2772 LEU A C   1 
ATOM   1298 O O   . LEU A 1 179 ? 42.451 27.668 -17.828 1.00 21.58 ? 2772 LEU A O   1 
ATOM   1299 C CB  . LEU A 1 179 ? 43.269 29.289 -15.146 1.00 22.03 ? 2772 LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 179 ? 43.526 30.595 -14.413 1.00 21.88 ? 2772 LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 179 ? 42.815 30.526 -13.079 1.00 20.37 ? 2772 LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 179 ? 45.026 30.836 -14.217 1.00 22.89 ? 2772 LEU A CD2 1 
ATOM   1303 N N   . THR A 1 180 ? 44.431 26.989 -16.986 1.00 21.92 ? 2773 THR A N   1 
ATOM   1304 C CA  . THR A 1 180 ? 44.198 25.600 -17.351 1.00 21.46 ? 2773 THR A CA  1 
ATOM   1305 C C   . THR A 1 180 ? 43.206 24.969 -16.395 1.00 21.54 ? 2773 THR A C   1 
ATOM   1306 O O   . THR A 1 180 ? 42.987 25.491 -15.284 1.00 20.20 ? 2773 THR A O   1 
ATOM   1307 C CB  . THR A 1 180 ? 45.511 24.783 -17.317 1.00 21.74 ? 2773 THR A CB  1 
ATOM   1308 O OG1 . THR A 1 180 ? 45.990 24.675 -15.967 1.00 20.24 ? 2773 THR A OG1 1 
ATOM   1309 C CG2 . THR A 1 180 ? 46.554 25.438 -18.209 1.00 22.37 ? 2773 THR A CG2 1 
ATOM   1310 N N   . ALA A 1 181 ? 42.631 23.830 -16.794 1.00 21.79 ? 2774 ALA A N   1 
ATOM   1311 C CA  . ALA A 1 181 ? 41.764 23.074 -15.892 1.00 22.09 ? 2774 ALA A CA  1 
ATOM   1312 C C   . ALA A 1 181 ? 42.427 22.763 -14.545 1.00 22.27 ? 2774 ALA A C   1 
ATOM   1313 O O   . ALA A 1 181 ? 41.788 22.899 -13.492 1.00 21.76 ? 2774 ALA A O   1 
ATOM   1314 C CB  . ALA A 1 181 ? 41.284 21.782 -16.568 1.00 22.38 ? 2774 ALA A CB  1 
ATOM   1315 N N   . ALA A 1 182 ? 43.699 22.335 -14.573 1.00 21.99 ? 2775 ALA A N   1 
ATOM   1316 C CA  . ALA A 1 182 ? 44.402 21.998 -13.329 1.00 20.98 ? 2775 ALA A CA  1 
ATOM   1317 C C   . ALA A 1 182 ? 44.551 23.240 -12.456 1.00 20.35 ? 2775 ALA A C   1 
ATOM   1318 O O   . ALA A 1 182 ? 44.472 23.167 -11.220 1.00 19.78 ? 2775 ALA A O   1 
ATOM   1319 C CB  . ALA A 1 182 ? 45.779 21.397 -13.626 1.00 21.61 ? 2775 ALA A CB  1 
ATOM   1320 N N   . GLU A 1 183 ? 44.734 24.385 -13.103 1.00 19.34 ? 2776 GLU A N   1 
ATOM   1321 C CA  . GLU A 1 183 ? 44.894 25.653 -12.381 1.00 20.25 ? 2776 GLU A CA  1 
ATOM   1322 C C   . GLU A 1 183 ? 43.592 26.163 -11.733 1.00 20.44 ? 2776 GLU A C   1 
ATOM   1323 O O   . GLU A 1 183 ? 43.649 26.833 -10.697 1.00 21.55 ? 2776 GLU A O   1 
ATOM   1324 C CB  . GLU A 1 183 ? 45.532 26.714 -13.292 1.00 19.56 ? 2776 GLU A CB  1 
ATOM   1325 C CG  . GLU A 1 183 ? 47.032 26.418 -13.522 1.00 20.24 ? 2776 GLU A CG  1 
ATOM   1326 C CD  . GLU A 1 183 ? 47.621 27.093 -14.764 1.00 22.66 ? 2776 GLU A CD  1 
ATOM   1327 O OE1 . GLU A 1 183 ? 46.906 27.850 -15.474 1.00 23.66 ? 2776 GLU A OE1 1 
ATOM   1328 O OE2 . GLU A 1 183 ? 48.819 26.855 -15.025 1.00 22.51 ? 2776 GLU A OE2 1 
ATOM   1329 N N   . LYS A 1 184 ? 42.451 25.814 -12.329 1.00 20.68 ? 2777 LYS A N   1 
ATOM   1330 C CA  . LYS A 1 184 ? 41.125 26.190 -11.814 1.00 20.71 ? 2777 LYS A CA  1 
ATOM   1331 C C   . LYS A 1 184 ? 40.605 25.184 -10.793 1.00 19.93 ? 2777 LYS A C   1 
ATOM   1332 O O   . LYS A 1 184 ? 39.635 25.452 -10.088 1.00 18.25 ? 2777 LYS A O   1 
ATOM   1333 C CB  . LYS A 1 184 ? 40.084 26.227 -12.942 1.00 20.94 ? 2777 LYS A CB  1 
ATOM   1334 C CG  . LYS A 1 184 ? 40.295 27.248 -14.047 1.00 23.95 ? 2777 LYS A CG  1 
ATOM   1335 C CD  . LYS A 1 184 ? 39.233 27.049 -15.094 1.00 25.92 ? 2777 LYS A CD  1 
ATOM   1336 C CE  . LYS A 1 184 ? 39.406 28.019 -16.244 1.00 30.39 ? 2777 LYS A CE  1 
ATOM   1337 N NZ  . LYS A 1 184 ? 38.565 27.568 -17.371 1.00 31.78 ? 2777 LYS A NZ  1 
ATOM   1338 N N   . PHE A 1 185 ? 41.234 24.014 -10.728 1.00 19.13 ? 2778 PHE A N   1 
ATOM   1339 C CA  . PHE A 1 185 ? 40.618 22.882 -10.047 1.00 19.22 ? 2778 PHE A CA  1 
ATOM   1340 C C   . PHE A 1 185 ? 40.247 23.143 -8.579  1.00 18.73 ? 2778 PHE A C   1 
ATOM   1341 O O   . PHE A 1 185 ? 39.113 22.840 -8.173  1.00 18.71 ? 2778 PHE A O   1 
ATOM   1342 C CB  . PHE A 1 185 ? 41.492 21.614 -10.136 1.00 19.08 ? 2778 PHE A CB  1 
ATOM   1343 C CG  . PHE A 1 185 ? 40.873 20.433 -9.440  1.00 23.25 ? 2778 PHE A CG  1 
ATOM   1344 C CD1 . PHE A 1 185 ? 39.966 19.618 -10.110 1.00 27.05 ? 2778 PHE A CD1 1 
ATOM   1345 C CD2 . PHE A 1 185 ? 41.127 20.192 -8.099  1.00 26.32 ? 2778 PHE A CD2 1 
ATOM   1346 C CE1 . PHE A 1 185 ? 39.350 18.550 -9.455  1.00 27.81 ? 2778 PHE A CE1 1 
ATOM   1347 C CE2 . PHE A 1 185 ? 40.507 19.131 -7.432  1.00 28.06 ? 2778 PHE A CE2 1 
ATOM   1348 C CZ  . PHE A 1 185 ? 39.619 18.316 -8.116  1.00 28.27 ? 2778 PHE A CZ  1 
ATOM   1349 N N   . LYS A 1 186 ? 41.177 23.699 -7.798  1.00 18.47 ? 2779 LYS A N   1 
ATOM   1350 C CA  . LYS A 1 186 ? 40.917 23.890 -6.340  1.00 19.05 ? 2779 LYS A CA  1 
ATOM   1351 C C   . LYS A 1 186 ? 39.798 24.919 -6.122  1.00 19.06 ? 2779 LYS A C   1 
ATOM   1352 O O   . LYS A 1 186 ? 38.945 24.705 -5.263  1.00 18.89 ? 2779 LYS A O   1 
ATOM   1353 C CB  . LYS A 1 186 ? 42.180 24.297 -5.580  1.00 19.74 ? 2779 LYS A CB  1 
ATOM   1354 C CG  . LYS A 1 186 ? 43.189 23.143 -5.407  1.00 22.85 ? 2779 LYS A CG  1 
ATOM   1355 C CD  . LYS A 1 186 ? 44.342 23.596 -4.489  1.00 29.30 ? 2779 LYS A CD  1 
ATOM   1356 C CE  . LYS A 1 186 ? 45.512 22.619 -4.488  1.00 34.05 ? 2779 LYS A CE  1 
ATOM   1357 N NZ  . LYS A 1 186 ? 45.223 21.388 -3.721  1.00 36.83 ? 2779 LYS A NZ  1 
ATOM   1358 N N   . ASP A 1 187 ? 39.782 25.996 -6.918  1.00 18.10 ? 2780 ASP A N   1 
ATOM   1359 C CA  . ASP A 1 187 ? 38.726 27.036 -6.773  1.00 18.55 ? 2780 ASP A CA  1 
ATOM   1360 C C   . ASP A 1 187 ? 37.370 26.435 -7.185  1.00 18.54 ? 2780 ASP A C   1 
ATOM   1361 O O   . ASP A 1 187 ? 36.362 26.668 -6.513  1.00 18.06 ? 2780 ASP A O   1 
ATOM   1362 C CB  . ASP A 1 187 ? 39.013 28.274 -7.627  1.00 18.90 ? 2780 ASP A CB  1 
ATOM   1363 C CG  . ASP A 1 187 ? 40.219 29.080 -7.142  1.00 21.05 ? 2780 ASP A CG  1 
ATOM   1364 O OD1 . ASP A 1 187 ? 40.447 29.190 -5.919  1.00 22.78 ? 2780 ASP A OD1 1 
ATOM   1365 O OD2 . ASP A 1 187 ? 40.921 29.623 -8.027  1.00 25.00 ? 2780 ASP A OD2 1 
ATOM   1366 N N   . ARG A 1 188 ? 37.350 25.672 -8.288  1.00 18.79 ? 2781 ARG A N   1 
ATOM   1367 C CA  . ARG A 1 188 ? 36.111 25.019 -8.744  1.00 19.89 ? 2781 ARG A CA  1 
ATOM   1368 C C   . ARG A 1 188 ? 35.600 24.027 -7.699  1.00 20.38 ? 2781 ARG A C   1 
ATOM   1369 O O   . ARG A 1 188 ? 34.406 24.004 -7.385  1.00 19.93 ? 2781 ARG A O   1 
ATOM   1370 C CB  . ARG A 1 188 ? 36.291 24.318 -10.095 1.00 21.05 ? 2781 ARG A CB  1 
ATOM   1371 C CG  . ARG A 1 188 ? 36.394 25.277 -11.265 1.00 25.24 ? 2781 ARG A CG  1 
ATOM   1372 C CD  . ARG A 1 188 ? 35.819 24.755 -12.610 1.00 31.62 ? 2781 ARG A CD  1 
ATOM   1373 N NE  . ARG A 1 188 ? 36.799 24.114 -13.462 1.00 36.80 ? 2781 ARG A NE  1 
ATOM   1374 C CZ  . ARG A 1 188 ? 36.868 24.234 -14.791 1.00 35.84 ? 2781 ARG A CZ  1 
ATOM   1375 N NH1 . ARG A 1 188 ? 36.037 25.027 -15.474 1.00 36.36 ? 2781 ARG A NH1 1 
ATOM   1376 N NH2 . ARG A 1 188 ? 37.808 23.572 -15.440 1.00 35.59 ? 2781 ARG A NH2 1 
ATOM   1377 N N   . GLU A 1 189 ? 36.510 23.228 -7.157  1.00 19.79 ? 2782 GLU A N   1 
ATOM   1378 C CA  . GLU A 1 189 ? 36.166 22.238 -6.132  1.00 20.55 ? 2782 GLU A CA  1 
ATOM   1379 C C   . GLU A 1 189 ? 35.571 22.873 -4.879  1.00 20.15 ? 2782 GLU A C   1 
ATOM   1380 O O   . GLU A 1 189 ? 34.550 22.411 -4.375  1.00 20.72 ? 2782 GLU A O   1 
ATOM   1381 C CB  . GLU A 1 189 ? 37.401 21.419 -5.757  1.00 21.05 ? 2782 GLU A CB  1 
ATOM   1382 C CG  . GLU A 1 189 ? 37.137 20.326 -4.724  1.00 25.02 ? 2782 GLU A CG  1 
ATOM   1383 C CD  . GLU A 1 189 ? 38.393 19.523 -4.446  1.00 29.31 ? 2782 GLU A CD  1 
ATOM   1384 O OE1 . GLU A 1 189 ? 39.400 20.116 -3.996  1.00 32.39 ? 2782 GLU A OE1 1 
ATOM   1385 O OE2 . GLU A 1 189 ? 38.377 18.302 -4.703  1.00 30.93 ? 2782 GLU A OE2 1 
ATOM   1386 N N   . LYS A 1 190 ? 36.197 23.947 -4.403  1.00 19.13 ? 2783 LYS A N   1 
ATOM   1387 C CA  . LYS A 1 190 ? 35.700 24.703 -3.263  1.00 18.92 ? 2783 LYS A CA  1 
ATOM   1388 C C   . LYS A 1 190 ? 34.265 25.211 -3.521  1.00 18.86 ? 2783 LYS A C   1 
ATOM   1389 O O   . LYS A 1 190 ? 33.417 25.082 -2.655  1.00 19.95 ? 2783 LYS A O   1 
ATOM   1390 C CB  . LYS A 1 190 ? 36.638 25.890 -2.944  1.00 19.25 ? 2783 LYS A CB  1 
ATOM   1391 C CG  . LYS A 1 190 ? 36.234 26.703 -1.710  1.00 20.86 ? 2783 LYS A CG  1 
ATOM   1392 C CD  . LYS A 1 190 ? 37.273 27.803 -1.330  1.00 24.08 ? 2783 LYS A CD  1 
ATOM   1393 C CE  . LYS A 1 190 ? 36.691 28.724 -0.221  1.00 26.56 ? 2783 LYS A CE  1 
ATOM   1394 N NZ  . LYS A 1 190 ? 37.537 29.916 0.083   1.00 31.12 ? 2783 LYS A NZ  1 
ATOM   1395 N N   . ALA A 1 191 ? 34.023 25.784 -4.700  1.00 18.30 ? 2784 ALA A N   1 
ATOM   1396 C CA  . ALA A 1 191 ? 32.681 26.277 -5.055  1.00 18.37 ? 2784 ALA A CA  1 
ATOM   1397 C C   . ALA A 1 191 ? 31.681 25.117 -5.169  1.00 18.80 ? 2784 ALA A C   1 
ATOM   1398 O O   . ALA A 1 191 ? 30.589 25.182 -4.605  1.00 18.56 ? 2784 ALA A O   1 
ATOM   1399 C CB  . ALA A 1 191 ? 32.721 27.077 -6.336  1.00 18.54 ? 2784 ALA A CB  1 
ATOM   1400 N N   . GLN A 1 192 ? 32.073 24.054 -5.879  1.00 19.20 ? 2785 GLN A N   1 
ATOM   1401 C CA  . GLN A 1 192 ? 31.182 22.910 -6.111  1.00 20.22 ? 2785 GLN A CA  1 
ATOM   1402 C C   . GLN A 1 192 ? 30.765 22.238 -4.820  1.00 19.95 ? 2785 GLN A C   1 
ATOM   1403 O O   . GLN A 1 192 ? 29.592 21.880 -4.667  1.00 19.90 ? 2785 GLN A O   1 
ATOM   1404 C CB  . GLN A 1 192 ? 31.848 21.863 -7.016  1.00 20.43 ? 2785 GLN A CB  1 
ATOM   1405 C CG  . GLN A 1 192 ? 31.844 22.198 -8.485  1.00 25.52 ? 2785 GLN A CG  1 
ATOM   1406 C CD  . GLN A 1 192 ? 32.636 21.199 -9.320  1.00 31.25 ? 2785 GLN A CD  1 
ATOM   1407 O OE1 . GLN A 1 192 ? 33.405 20.385 -8.793  1.00 33.61 ? 2785 GLN A OE1 1 
ATOM   1408 N NE2 . GLN A 1 192 ? 32.467 21.273 -10.632 1.00 33.59 ? 2785 GLN A NE2 1 
ATOM   1409 N N   . ASP A 1 193 ? 31.723 22.040 -3.909  1.00 19.92 ? 2786 ASP A N   1 
ATOM   1410 C CA  A ASP A 1 193 ? 31.453 21.363 -2.644  0.50 20.29 ? 2786 ASP A CA  1 
ATOM   1411 C CA  B ASP A 1 193 ? 31.445 21.357 -2.642  0.50 20.53 ? 2786 ASP A CA  1 
ATOM   1412 C C   . ASP A 1 193 ? 30.407 22.102 -1.818  1.00 20.39 ? 2786 ASP A C   1 
ATOM   1413 O O   . ASP A 1 193 ? 29.478 21.496 -1.257  1.00 21.44 ? 2786 ASP A O   1 
ATOM   1414 C CB  A ASP A 1 193 ? 32.739 21.199 -1.837  0.50 20.44 ? 2786 ASP A CB  1 
ATOM   1415 C CB  B ASP A 1 193 ? 32.729 21.132 -1.834  0.50 21.04 ? 2786 ASP A CB  1 
ATOM   1416 C CG  A ASP A 1 193 ? 32.650 20.070 -0.857  0.50 21.19 ? 2786 ASP A CG  1 
ATOM   1417 C CG  B ASP A 1 193 ? 33.390 19.806 -2.155  0.50 22.37 ? 2786 ASP A CG  1 
ATOM   1418 O OD1 A ASP A 1 193 ? 32.654 18.905 -1.309  0.50 20.58 ? 2786 ASP A OD1 1 
ATOM   1419 O OD1 B ASP A 1 193 ? 33.077 19.214 -3.210  0.50 23.90 ? 2786 ASP A OD1 1 
ATOM   1420 O OD2 A ASP A 1 193 ? 32.561 20.353 0.352   0.50 20.17 ? 2786 ASP A OD2 1 
ATOM   1421 O OD2 B ASP A 1 193 ? 34.225 19.345 -1.344  0.50 26.20 ? 2786 ASP A OD2 1 
ATOM   1422 N N   . LEU A 1 194 ? 30.538 23.418 -1.745  1.00 20.08 ? 2787 LEU A N   1 
ATOM   1423 C CA  . LEU A 1 194 ? 29.594 24.190 -0.965  1.00 19.10 ? 2787 LEU A CA  1 
ATOM   1424 C C   . LEU A 1 194 ? 28.190 24.146 -1.564  1.00 19.09 ? 2787 LEU A C   1 
ATOM   1425 O O   . LEU A 1 194 ? 27.232 23.896 -0.830  1.00 18.51 ? 2787 LEU A O   1 
ATOM   1426 C CB  . LEU A 1 194 ? 30.053 25.647 -0.788  1.00 19.60 ? 2787 LEU A CB  1 
ATOM   1427 C CG  . LEU A 1 194 ? 29.122 26.538 0.041   1.00 20.44 ? 2787 LEU A CG  1 
ATOM   1428 C CD1 . LEU A 1 194 ? 28.892 25.978 1.463   1.00 22.57 ? 2787 LEU A CD1 1 
ATOM   1429 C CD2 . LEU A 1 194 ? 29.736 27.934 0.109   1.00 22.28 ? 2787 LEU A CD2 1 
ATOM   1430 N N   . PHE A 1 195 ? 28.064 24.416 -2.872  1.00 18.32 ? 2788 PHE A N   1 
ATOM   1431 C CA  . PHE A 1 195 ? 26.753 24.306 -3.535  1.00 18.88 ? 2788 PHE A CA  1 
ATOM   1432 C C   . PHE A 1 195 ? 26.131 22.916 -3.338  1.00 18.51 ? 2788 PHE A C   1 
ATOM   1433 O O   . PHE A 1 195 ? 24.937 22.805 -3.030  1.00 19.01 ? 2788 PHE A O   1 
ATOM   1434 C CB  . PHE A 1 195 ? 26.817 24.613 -5.043  1.00 18.91 ? 2788 PHE A CB  1 
ATOM   1435 C CG  . PHE A 1 195 ? 26.831 26.089 -5.369  1.00 20.67 ? 2788 PHE A CG  1 
ATOM   1436 C CD1 . PHE A 1 195 ? 25.660 26.831 -5.372  1.00 23.45 ? 2788 PHE A CD1 1 
ATOM   1437 C CD2 . PHE A 1 195 ? 28.018 26.721 -5.690  1.00 23.76 ? 2788 PHE A CD2 1 
ATOM   1438 C CE1 . PHE A 1 195 ? 25.686 28.217 -5.678  1.00 24.29 ? 2788 PHE A CE1 1 
ATOM   1439 C CE2 . PHE A 1 195 ? 28.045 28.084 -6.009  1.00 23.88 ? 2788 PHE A CE2 1 
ATOM   1440 C CZ  . PHE A 1 195 ? 26.878 28.821 -6.001  1.00 22.89 ? 2788 PHE A CZ  1 
ATOM   1441 N N   . LYS A 1 196 ? 26.927 21.861 -3.511  1.00 18.33 ? 2789 LYS A N   1 
ATOM   1442 C CA  . LYS A 1 196 ? 26.405 20.508 -3.335  1.00 18.58 ? 2789 LYS A CA  1 
ATOM   1443 C C   . LYS A 1 196 ? 25.929 20.296 -1.893  1.00 18.86 ? 2789 LYS A C   1 
ATOM   1444 O O   . LYS A 1 196 ? 24.874 19.680 -1.673  1.00 19.15 ? 2789 LYS A O   1 
ATOM   1445 C CB  . LYS A 1 196 ? 27.427 19.437 -3.741  1.00 18.74 ? 2789 LYS A CB  1 
ATOM   1446 C CG  . LYS A 1 196 ? 27.641 19.370 -5.240  1.00 20.12 ? 2789 LYS A CG  1 
ATOM   1447 C CD  . LYS A 1 196 ? 28.672 18.337 -5.598  1.00 23.93 ? 2789 LYS A CD  1 
ATOM   1448 C CE  . LYS A 1 196 ? 28.773 18.256 -7.126  1.00 28.17 ? 2789 LYS A CE  1 
ATOM   1449 N NZ  . LYS A 1 196 ? 29.174 16.909 -7.569  1.00 32.41 ? 2789 LYS A NZ  1 
ATOM   1450 N N   . PHE A 1 197 ? 26.669 20.828 -0.924  1.00 18.80 ? 2790 PHE A N   1 
ATOM   1451 C CA  . PHE A 1 197 ? 26.256 20.699 0.495   1.00 18.61 ? 2790 PHE A CA  1 
ATOM   1452 C C   . PHE A 1 197 ? 24.923 21.399 0.726   1.00 18.97 ? 2790 PHE A C   1 
ATOM   1453 O O   . PHE A 1 197 ? 24.025 20.837 1.362   1.00 19.66 ? 2790 PHE A O   1 
ATOM   1454 C CB  . PHE A 1 197 ? 27.319 21.246 1.451   1.00 18.29 ? 2790 PHE A CB  1 
ATOM   1455 C CG  . PHE A 1 197 ? 27.034 20.976 2.922   1.00 18.85 ? 2790 PHE A CG  1 
ATOM   1456 C CD1 . PHE A 1 197 ? 27.417 19.768 3.512   1.00 19.18 ? 2790 PHE A CD1 1 
ATOM   1457 C CD2 . PHE A 1 197 ? 26.453 21.951 3.721   1.00 19.16 ? 2790 PHE A CD2 1 
ATOM   1458 C CE1 . PHE A 1 197 ? 27.185 19.525 4.874   1.00 20.34 ? 2790 PHE A CE1 1 
ATOM   1459 C CE2 . PHE A 1 197 ? 26.233 21.726 5.103   1.00 20.52 ? 2790 PHE A CE2 1 
ATOM   1460 C CZ  . PHE A 1 197 ? 26.589 20.515 5.671   1.00 20.21 ? 2790 PHE A CZ  1 
ATOM   1461 N N   . LEU A 1 198 ? 24.792 22.620 0.202   1.00 19.27 ? 2791 LEU A N   1 
ATOM   1462 C CA  . LEU A 1 198 ? 23.555 23.383 0.347   1.00 20.17 ? 2791 LEU A CA  1 
ATOM   1463 C C   . LEU A 1 198 ? 22.369 22.614 -0.218  1.00 20.65 ? 2791 LEU A C   1 
ATOM   1464 O O   . LEU A 1 198 ? 21.341 22.518 0.453   1.00 22.75 ? 2791 LEU A O   1 
ATOM   1465 C CB  . LEU A 1 198 ? 23.668 24.767 -0.288  1.00 19.93 ? 2791 LEU A CB  1 
ATOM   1466 C CG  . LEU A 1 198 ? 24.732 25.685 0.330   1.00 20.46 ? 2791 LEU A CG  1 
ATOM   1467 C CD1 . LEU A 1 198 ? 24.776 27.014 -0.417  1.00 21.38 ? 2791 LEU A CD1 1 
ATOM   1468 C CD2 . LEU A 1 198 ? 24.500 25.932 1.830   1.00 19.33 ? 2791 LEU A CD2 1 
ATOM   1469 N N   . GLN A 1 199 ? 22.556 22.024 -1.400  1.00 21.08 ? 2792 GLN A N   1 
ATOM   1470 C CA  . GLN A 1 199 ? 21.540 21.211 -2.106  1.00 22.31 ? 2792 GLN A CA  1 
ATOM   1471 C C   . GLN A 1 199 ? 20.943 20.108 -1.249  1.00 22.15 ? 2792 GLN A C   1 
ATOM   1472 O O   . GLN A 1 199 ? 19.754 19.765 -1.401  1.00 21.72 ? 2792 GLN A O   1 
ATOM   1473 C CB  . GLN A 1 199 ? 22.157 20.552 -3.342  1.00 22.71 ? 2792 GLN A CB  1 
ATOM   1474 C CG  . GLN A 1 199 ? 22.372 21.445 -4.526  1.00 25.59 ? 2792 GLN A CG  1 
ATOM   1475 C CD  . GLN A 1 199 ? 21.101 21.734 -5.275  1.00 28.67 ? 2792 GLN A CD  1 
ATOM   1476 O OE1 . GLN A 1 199 ? 20.353 22.656 -4.927  1.00 28.50 ? 2792 GLN A OE1 1 
ATOM   1477 N NE2 . GLN A 1 199 ? 20.853 20.969 -6.336  1.00 30.12 ? 2792 GLN A NE2 1 
ATOM   1478 N N   . VAL A 1 200 ? 21.747 19.536 -0.360  1.00 22.00 ? 2793 VAL A N   1 
ATOM   1479 C CA  . VAL A 1 200 ? 21.250 18.424 0.459   1.00 22.66 ? 2793 VAL A CA  1 
ATOM   1480 C C   . VAL A 1 200 ? 21.149 18.751 1.945   1.00 23.74 ? 2793 VAL A C   1 
ATOM   1481 O O   . VAL A 1 200 ? 21.015 17.844 2.781   1.00 24.16 ? 2793 VAL A O   1 
ATOM   1482 C CB  . VAL A 1 200 ? 22.037 17.106 0.217   1.00 22.71 ? 2793 VAL A CB  1 
ATOM   1483 C CG1 . VAL A 1 200 ? 21.920 16.688 -1.238  1.00 21.84 ? 2793 VAL A CG1 1 
ATOM   1484 C CG2 . VAL A 1 200 ? 23.530 17.247 0.632   1.00 21.71 ? 2793 VAL A CG2 1 
ATOM   1485 N N   . ASN A 1 201 ? 21.219 20.049 2.261   1.00 23.51 ? 2794 ASN A N   1 
ATOM   1486 C CA  . ASN A 1 201 ? 20.992 20.569 3.607   1.00 24.57 ? 2794 ASN A CA  1 
ATOM   1487 C C   . ASN A 1 201 ? 19.846 21.566 3.655   1.00 25.44 ? 2794 ASN A C   1 
ATOM   1488 O O   . ASN A 1 201 ? 19.819 22.459 4.502   1.00 25.78 ? 2794 ASN A O   1 
ATOM   1489 C CB  . ASN A 1 201 ? 22.261 21.206 4.192   1.00 24.52 ? 2794 ASN A CB  1 
ATOM   1490 C CG  . ASN A 1 201 ? 23.209 20.184 4.712   1.00 23.22 ? 2794 ASN A CG  1 
ATOM   1491 O OD1 . ASN A 1 201 ? 23.250 19.906 5.911   1.00 25.33 ? 2794 ASN A OD1 1 
ATOM   1492 N ND2 . ASN A 1 201 ? 23.954 19.568 3.812   1.00 23.26 ? 2794 ASN A ND2 1 
ATOM   1493 N N   . GLY A 1 202 ? 18.908 21.416 2.728   1.00 26.31 ? 2795 GLY A N   1 
ATOM   1494 C CA  . GLY A 1 202 ? 17.685 22.212 2.746   1.00 26.92 ? 2795 GLY A CA  1 
ATOM   1495 C C   . GLY A 1 202 ? 17.801 23.675 2.377   1.00 27.36 ? 2795 GLY A C   1 
ATOM   1496 O O   . GLY A 1 202 ? 16.938 24.475 2.755   1.00 28.36 ? 2795 GLY A O   1 
ATOM   1497 N N   . ILE A 1 203 ? 18.837 24.022 1.612   1.00 26.92 ? 2796 ILE A N   1 
ATOM   1498 C CA  . ILE A 1 203 ? 19.057 25.402 1.151   1.00 26.71 ? 2796 ILE A CA  1 
ATOM   1499 C C   . ILE A 1 203 ? 19.034 25.464 -0.374  1.00 27.49 ? 2796 ILE A C   1 
ATOM   1500 O O   . ILE A 1 203 ? 19.693 24.667 -1.035  1.00 28.62 ? 2796 ILE A O   1 
ATOM   1501 C CB  . ILE A 1 203 ? 20.424 25.957 1.648   1.00 25.99 ? 2796 ILE A CB  1 
ATOM   1502 C CG1 . ILE A 1 203 ? 20.494 26.009 3.184   1.00 25.67 ? 2796 ILE A CG1 1 
ATOM   1503 C CG2 . ILE A 1 203 ? 20.719 27.328 1.025   1.00 26.36 ? 2796 ILE A CG2 1 
ATOM   1504 C CD1 . ILE A 1 203 ? 19.469 26.940 3.853   1.00 26.52 ? 2796 ILE A CD1 1 
ATOM   1505 N N   . ILE A 1 204 ? 18.291 26.420 -0.932  1.00 27.63 ? 2797 ILE A N   1 
ATOM   1506 C CA  . ILE A 1 204 ? 18.289 26.648 -2.378  1.00 28.38 ? 2797 ILE A CA  1 
ATOM   1507 C C   . ILE A 1 204 ? 18.902 28.010 -2.706  1.00 28.12 ? 2797 ILE A C   1 
ATOM   1508 O O   . ILE A 1 204 ? 18.494 29.034 -2.149  1.00 28.27 ? 2797 ILE A O   1 
ATOM   1509 C CB  . ILE A 1 204 ? 16.857 26.513 -2.993  1.00 29.08 ? 2797 ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 204 ? 16.841 26.845 -4.494  1.00 30.98 ? 2797 ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 204 ? 15.849 27.391 -2.248  1.00 29.76 ? 2797 ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 204 ? 17.543 25.818 -5.402  1.00 35.35 ? 2797 ILE A CD1 1 
ATOM   1513 N N   . VAL A 1 205 ? 19.883 28.013 -3.606  1.00 27.74 ? 2798 VAL A N   1 
ATOM   1514 C CA  . VAL A 1 205 ? 20.454 29.262 -4.096  1.00 28.50 ? 2798 VAL A CA  1 
ATOM   1515 C C   . VAL A 1 205 ? 19.918 29.451 -5.508  1.00 29.20 ? 2798 VAL A C   1 
ATOM   1516 O O   . VAL A 1 205 ? 19.991 28.530 -6.320  1.00 29.52 ? 2798 VAL A O   1 
ATOM   1517 C CB  . VAL A 1 205 ? 22.006 29.225 -4.131  1.00 27.75 ? 2798 VAL A CB  1 
ATOM   1518 C CG1 . VAL A 1 205 ? 22.577 30.623 -4.374  1.00 28.07 ? 2798 VAL A CG1 1 
ATOM   1519 C CG2 . VAL A 1 205 ? 22.557 28.652 -2.850  1.00 28.49 ? 2798 VAL A CG2 1 
ATOM   1520 N N   . SER A 1 206 ? 19.365 30.626 -5.789  1.00 29.89 ? 2799 SER A N   1 
ATOM   1521 C CA  . SER A 1 206 ? 18.841 30.924 -7.127  1.00 30.99 ? 2799 SER A CA  1 
ATOM   1522 C C   . SER A 1 206 ? 19.191 32.335 -7.570  1.00 31.29 ? 2799 SER A C   1 
ATOM   1523 O O   . SER A 1 206 ? 19.470 33.203 -6.740  1.00 30.71 ? 2799 SER A O   1 
ATOM   1524 C CB  . SER A 1 206 ? 17.326 30.690 -7.209  1.00 31.28 ? 2799 SER A CB  1 
ATOM   1525 O OG  . SER A 1 206 ? 16.637 31.493 -6.281  1.00 33.75 ? 2799 SER A OG  1 
ATOM   1526 N N   . ARG A 1 207 ? 19.165 32.551 -8.886  1.00 31.89 ? 2800 ARG A N   1 
ATOM   1527 C CA  . ARG A 1 207 ? 19.618 33.812 -9.487  1.00 33.28 ? 2800 ARG A CA  1 
ATOM   1528 C C   . ARG A 1 207 ? 18.839 35.009 -8.955  1.00 33.74 ? 2800 ARG A C   1 
ATOM   1529 O O   . ARG A 1 207 ? 17.628 34.919 -8.742  1.00 34.70 ? 2800 ARG A O   1 
ATOM   1530 C CB  . ARG A 1 207 ? 19.487 33.767 -11.009 1.00 33.17 ? 2800 ARG A CB  1 
ATOM   1531 C CG  . ARG A 1 207 ? 20.127 32.579 -11.690 1.00 34.47 ? 2800 ARG A CG  1 
ATOM   1532 C CD  . ARG A 1 207 ? 21.618 32.750 -11.918 1.00 35.98 ? 2800 ARG A CD  1 
ATOM   1533 N NE  . ARG A 1 207 ? 21.959 33.996 -12.614 1.00 36.44 ? 2800 ARG A NE  1 
ATOM   1534 C CZ  . ARG A 1 207 ? 22.073 34.133 -13.935 1.00 36.72 ? 2800 ARG A CZ  1 
ATOM   1535 N NH1 . ARG A 1 207 ? 21.857 33.106 -14.751 1.00 36.39 ? 2800 ARG A NH1 1 
ATOM   1536 N NH2 . ARG A 1 207 ? 22.410 35.311 -14.445 1.00 35.98 ? 2800 ARG A NH2 1 
HETATM 1537 S S   . SO4 B 2 .   ? 50.593 32.518 -2.720  1.00 45.28 ? 2901 SO4 A S   1 
HETATM 1538 O O1  . SO4 B 2 .   ? 51.217 32.312 -4.022  1.00 44.45 ? 2901 SO4 A O1  1 
HETATM 1539 O O2  . SO4 B 2 .   ? 49.327 31.796 -2.629  1.00 45.60 ? 2901 SO4 A O2  1 
HETATM 1540 O O3  . SO4 B 2 .   ? 51.486 32.072 -1.664  1.00 47.49 ? 2901 SO4 A O3  1 
HETATM 1541 O O4  . SO4 B 2 .   ? 50.337 33.946 -2.568  1.00 48.01 ? 2901 SO4 A O4  1 
HETATM 1542 S S   . SO4 C 2 .   ? 38.245 24.202 -18.427 1.00 58.40 ? 2902 SO4 A S   1 
HETATM 1543 O O1  . SO4 C 2 .   ? 38.396 24.022 -19.871 1.00 59.04 ? 2902 SO4 A O1  1 
HETATM 1544 O O2  . SO4 C 2 .   ? 37.141 25.124 -18.153 1.00 58.54 ? 2902 SO4 A O2  1 
HETATM 1545 O O3  . SO4 C 2 .   ? 37.960 22.907 -17.807 1.00 58.21 ? 2902 SO4 A O3  1 
HETATM 1546 O O4  . SO4 C 2 .   ? 39.490 24.753 -17.900 1.00 58.44 ? 2902 SO4 A O4  1 
HETATM 1547 S S   . SO4 D 2 .   ? 46.948 18.964 6.175   1.00 43.81 ? 2903 SO4 A S   1 
HETATM 1548 O O1  . SO4 D 2 .   ? 47.999 19.970 6.194   1.00 44.86 ? 2903 SO4 A O1  1 
HETATM 1549 O O2  . SO4 D 2 .   ? 45.864 19.385 5.287   1.00 43.03 ? 2903 SO4 A O2  1 
HETATM 1550 O O3  . SO4 D 2 .   ? 47.516 17.701 5.717   1.00 43.98 ? 2903 SO4 A O3  1 
HETATM 1551 O O4  . SO4 D 2 .   ? 46.443 18.754 7.528   1.00 45.40 ? 2903 SO4 A O4  1 
HETATM 1552 C C1  . GOL E 3 .   ? 50.725 16.839 8.852   1.00 30.76 ? 2904 GOL A C1  1 
HETATM 1553 O O1  . GOL E 3 .   ? 50.758 16.403 7.493   1.00 30.58 ? 2904 GOL A O1  1 
HETATM 1554 C C2  . GOL E 3 .   ? 49.657 17.907 8.954   1.00 28.59 ? 2904 GOL A C2  1 
HETATM 1555 O O2  . GOL E 3 .   ? 48.407 17.283 8.843   1.00 29.64 ? 2904 GOL A O2  1 
HETATM 1556 C C3  . GOL E 3 .   ? 49.764 18.744 10.227  1.00 30.41 ? 2904 GOL A C3  1 
HETATM 1557 O O3  . GOL E 3 .   ? 48.681 19.666 10.319  1.00 32.09 ? 2904 GOL A O3  1 
HETATM 1558 C C1  . GOL F 3 .   ? 49.665 29.700 -16.573 1.00 30.21 ? 2905 GOL A C1  1 
HETATM 1559 O O1  . GOL F 3 .   ? 50.215 28.395 -16.692 1.00 31.27 ? 2905 GOL A O1  1 
HETATM 1560 C C2  . GOL F 3 .   ? 48.665 29.975 -17.694 1.00 31.09 ? 2905 GOL A C2  1 
HETATM 1561 O O2  . GOL F 3 .   ? 47.603 29.039 -17.675 1.00 27.48 ? 2905 GOL A O2  1 
HETATM 1562 C C3  . GOL F 3 .   ? 48.099 31.387 -17.560 1.00 32.19 ? 2905 GOL A C3  1 
HETATM 1563 O O3  . GOL F 3 .   ? 47.214 31.608 -18.647 1.00 33.07 ? 2905 GOL A O3  1 
HETATM 1564 C C1  . GOL G 3 .   ? 48.592 30.028 -5.502  1.00 41.17 ? 2906 GOL A C1  1 
HETATM 1565 O O1  . GOL G 3 .   ? 49.807 29.318 -5.430  1.00 44.30 ? 2906 GOL A O1  1 
HETATM 1566 C C2  . GOL G 3 .   ? 47.563 29.275 -6.340  1.00 40.19 ? 2906 GOL A C2  1 
HETATM 1567 O O2  . GOL G 3 .   ? 46.902 28.348 -5.512  1.00 41.47 ? 2906 GOL A O2  1 
HETATM 1568 C C3  . GOL G 3 .   ? 46.537 30.258 -6.911  1.00 37.62 ? 2906 GOL A C3  1 
HETATM 1569 O O3  . GOL G 3 .   ? 45.649 29.592 -7.774  1.00 35.75 ? 2906 GOL A O3  1 
HETATM 1570 O O   . HOH H 4 .   ? 41.058 24.133 12.797  1.00 22.57 ? 3001 HOH A O   1 
HETATM 1571 O O   . HOH H 4 .   ? 49.012 24.233 -11.199 1.00 19.21 ? 3002 HOH A O   1 
HETATM 1572 O O   . HOH H 4 .   ? 48.522 23.511 -15.843 1.00 21.31 ? 3003 HOH A O   1 
HETATM 1573 O O   . HOH H 4 .   ? 42.255 26.893 -8.259  1.00 19.54 ? 3004 HOH A O   1 
HETATM 1574 O O   . HOH H 4 .   ? 49.871 24.741 -13.724 1.00 19.48 ? 3005 HOH A O   1 
HETATM 1575 O O   . HOH H 4 .   ? 42.794 23.009 -19.539 1.00 25.76 ? 3006 HOH A O   1 
HETATM 1576 O O   . HOH H 4 .   ? 29.272 31.228 -15.241 1.00 24.09 ? 3007 HOH A O   1 
HETATM 1577 O O   . HOH H 4 .   ? 33.869 37.986 -2.318  1.00 19.88 ? 3008 HOH A O   1 
HETATM 1578 O O   . HOH H 4 .   ? 32.928 15.873 13.981  1.00 22.27 ? 3009 HOH A O   1 
HETATM 1579 O O   . HOH H 4 .   ? 40.499 32.970 -2.871  1.00 23.84 ? 3010 HOH A O   1 
HETATM 1580 O O   . HOH H 4 .   ? 42.011 23.638 10.202  1.00 23.59 ? 3011 HOH A O   1 
HETATM 1581 O O   . HOH H 4 .   ? 39.270 36.533 -13.529 1.00 25.88 ? 3012 HOH A O   1 
HETATM 1582 O O   . HOH H 4 .   ? 28.823 45.419 -0.316  1.00 22.32 ? 3013 HOH A O   1 
HETATM 1583 O O   . HOH H 4 .   ? 45.971 20.960 16.745  1.00 27.22 ? 3014 HOH A O   1 
HETATM 1584 O O   . HOH H 4 .   ? 16.552 20.313 10.353  1.00 27.42 ? 3015 HOH A O   1 
HETATM 1585 O O   . HOH H 4 .   ? 42.722 27.338 19.280  1.00 27.46 ? 3016 HOH A O   1 
HETATM 1586 O O   . HOH H 4 .   ? 13.742 15.120 5.562   1.00 28.35 ? 3017 HOH A O   1 
HETATM 1587 O O   . HOH H 4 .   ? 39.502 26.226 6.616   1.00 26.41 ? 3018 HOH A O   1 
HETATM 1588 O O   . HOH H 4 .   ? 39.174 29.313 20.968  1.00 26.29 ? 3019 HOH A O   1 
HETATM 1589 O O   . HOH H 4 .   ? 33.420 28.019 1.079   1.00 24.95 ? 3020 HOH A O   1 
HETATM 1590 O O   . HOH H 4 .   ? 23.725 30.309 -13.790 1.00 26.46 ? 3021 HOH A O   1 
HETATM 1591 O O   . HOH H 4 .   ? 39.230 22.301 -13.278 1.00 24.48 ? 3022 HOH A O   1 
HETATM 1592 O O   . HOH H 4 .   ? 23.220 17.366 9.831   1.00 29.69 ? 3023 HOH A O   1 
HETATM 1593 O O   . HOH H 4 .   ? 25.928 10.598 -0.915  1.00 26.42 ? 3024 HOH A O   1 
HETATM 1594 O O   . HOH H 4 .   ? 42.334 21.078 9.116   1.00 26.94 ? 3025 HOH A O   1 
HETATM 1595 O O   . HOH H 4 .   ? 44.074 21.040 18.922  1.00 25.07 ? 3026 HOH A O   1 
HETATM 1596 O O   . HOH H 4 .   ? 37.736 24.687 5.240   1.00 29.35 ? 3027 HOH A O   1 
HETATM 1597 O O   . HOH H 4 .   ? 49.909 26.667 -7.572  1.00 32.93 ? 3028 HOH A O   1 
HETATM 1598 O O   . HOH H 4 .   ? 16.998 20.660 7.335   1.00 27.89 ? 3029 HOH A O   1 
HETATM 1599 O O   . HOH H 4 .   ? 37.597 41.411 -11.898 1.00 29.39 ? 3030 HOH A O   1 
HETATM 1600 O O   . HOH H 4 .   ? 12.587 17.533 5.312   1.00 31.83 ? 3031 HOH A O   1 
HETATM 1601 O O   . HOH H 4 .   ? 43.908 24.184 -8.746  1.00 22.79 ? 3032 HOH A O   1 
HETATM 1602 O O   . HOH H 4 .   ? 33.548 33.507 -4.391  1.00 25.91 ? 3033 HOH A O   1 
HETATM 1603 O O   . HOH H 4 .   ? 41.391 24.703 7.659   1.00 27.06 ? 3034 HOH A O   1 
HETATM 1604 O O   . HOH H 4 .   ? 33.645 34.149 -1.666  1.00 28.45 ? 3035 HOH A O   1 
HETATM 1605 O O   . HOH H 4 .   ? 38.061 35.405 -16.773 1.00 25.96 ? 3036 HOH A O   1 
HETATM 1606 O O   . HOH H 4 .   ? 38.059 19.761 4.156   1.00 27.40 ? 3037 HOH A O   1 
HETATM 1607 O O   . HOH H 4 .   ? 48.364 10.642 22.399  1.00 27.27 ? 3038 HOH A O   1 
HETATM 1608 O O   . HOH H 4 .   ? 27.466 36.993 8.799   1.00 28.88 ? 3039 HOH A O   1 
HETATM 1609 O O   . HOH H 4 .   ? 21.085 25.090 -3.540  1.00 30.78 ? 3040 HOH A O   1 
HETATM 1610 O O   . HOH H 4 .   ? 58.359 36.941 -0.046  1.00 24.36 ? 3041 HOH A O   1 
HETATM 1611 O O   . HOH H 4 .   ? 35.905 34.430 -0.279  1.00 29.54 ? 3042 HOH A O   1 
HETATM 1612 O O   . HOH H 4 .   ? 50.747 12.280 21.260  1.00 26.61 ? 3043 HOH A O   1 
HETATM 1613 O O   . HOH H 4 .   ? 42.120 8.364  15.661  1.00 31.04 ? 3044 HOH A O   1 
HETATM 1614 O O   . HOH H 4 .   ? 47.955 26.389 -9.652  1.00 27.25 ? 3045 HOH A O   1 
HETATM 1615 O O   . HOH H 4 .   ? 33.525 32.495 -14.315 1.00 26.01 ? 3046 HOH A O   1 
HETATM 1616 O O   . HOH H 4 .   ? 55.758 38.474 -0.219  1.00 30.38 ? 3047 HOH A O   1 
HETATM 1617 O O   . HOH H 4 .   ? 33.698 35.079 8.027   1.00 29.30 ? 3048 HOH A O   1 
HETATM 1618 O O   . HOH H 4 .   ? 31.117 33.322 -15.303 1.00 28.44 ? 3049 HOH A O   1 
HETATM 1619 O O   . HOH H 4 .   ? 48.023 35.794 -3.471  1.00 23.96 ? 3050 HOH A O   1 
HETATM 1620 O O   . HOH H 4 .   ? 19.059 24.786 -14.536 1.00 33.05 ? 3051 HOH A O   1 
HETATM 1621 O O   . HOH H 4 .   ? 46.002 25.155 -7.412  1.00 28.86 ? 3052 HOH A O   1 
HETATM 1622 O O   . HOH H 4 .   ? 39.705 11.006 18.318  1.00 26.94 ? 3053 HOH A O   1 
HETATM 1623 O O   . HOH H 4 .   ? 44.391 7.248  18.657  1.00 35.21 ? 3054 HOH A O   1 
HETATM 1624 O O   . HOH H 4 .   ? 34.837 26.694 3.077   1.00 30.90 ? 3055 HOH A O   1 
HETATM 1625 O O   . HOH H 4 .   ? 29.426 35.999 12.296  1.00 38.15 ? 3056 HOH A O   1 
HETATM 1626 O O   . HOH H 4 .   ? 27.943 18.490 9.142   1.00 27.01 ? 3057 HOH A O   1 
HETATM 1627 O O   . HOH H 4 .   ? 31.211 16.859 16.854  1.00 27.81 ? 3058 HOH A O   1 
HETATM 1628 O O   . HOH H 4 .   ? 44.864 21.056 -16.981 1.00 27.72 ? 3059 HOH A O   1 
HETATM 1629 O O   . HOH H 4 .   ? 30.148 41.690 5.872   1.00 35.64 ? 3060 HOH A O   1 
HETATM 1630 O O   . HOH H 4 .   ? 19.284 26.453 9.543   1.00 28.60 ? 3061 HOH A O   1 
HETATM 1631 O O   . HOH H 4 .   ? 53.727 34.631 -1.413  1.00 27.03 ? 3062 HOH A O   1 
HETATM 1632 O O   . HOH H 4 .   ? 41.623 21.982 6.491   1.00 29.82 ? 3063 HOH A O   1 
HETATM 1633 O O   . HOH H 4 .   ? 21.151 39.152 -2.613  1.00 35.77 ? 3064 HOH A O   1 
HETATM 1634 O O   . HOH H 4 .   ? 37.205 27.491 22.873  1.00 37.52 ? 3065 HOH A O   1 
HETATM 1635 O O   . HOH H 4 .   ? 53.542 30.265 -7.537  1.00 26.81 ? 3066 HOH A O   1 
HETATM 1636 O O   . HOH H 4 .   ? 39.435 23.008 -3.021  1.00 25.70 ? 3067 HOH A O   1 
HETATM 1637 O O   . HOH H 4 .   ? 30.046 15.899 8.826   1.00 31.79 ? 3068 HOH A O   1 
HETATM 1638 O O   . HOH H 4 .   ? 33.773 25.077 0.090   1.00 29.49 ? 3069 HOH A O   1 
HETATM 1639 O O   . HOH H 4 .   ? 42.830 30.733 -5.669  1.00 33.99 ? 3070 HOH A O   1 
HETATM 1640 O O   . HOH H 4 .   ? 17.888 8.029  13.278  1.00 28.21 ? 3071 HOH A O   1 
HETATM 1641 O O   . HOH H 4 .   ? 58.725 40.977 -0.111  1.00 30.45 ? 3072 HOH A O   1 
HETATM 1642 O O   . HOH H 4 .   ? 35.642 32.135 1.109   1.00 29.13 ? 3073 HOH A O   1 
HETATM 1643 O O   . HOH H 4 .   ? 35.430 38.825 -8.567  1.00 28.01 ? 3074 HOH A O   1 
HETATM 1644 O O   . HOH H 4 .   ? 49.900 20.533 19.259  1.00 39.48 ? 3075 HOH A O   1 
HETATM 1645 O O   . HOH H 4 .   ? 18.269 23.171 6.898   1.00 26.66 ? 3076 HOH A O   1 
HETATM 1646 O O   . HOH H 4 .   ? 19.620 23.703 9.411   1.00 31.31 ? 3077 HOH A O   1 
HETATM 1647 O O   . HOH H 4 .   ? 28.481 30.671 12.026  1.00 35.92 ? 3078 HOH A O   1 
HETATM 1648 O O   . HOH H 4 .   ? 28.870 15.543 6.428   1.00 26.56 ? 3079 HOH A O   1 
HETATM 1649 O O   . HOH H 4 .   ? 43.732 27.725 -5.834  1.00 29.49 ? 3080 HOH A O   1 
HETATM 1650 O O   . HOH H 4 .   ? 30.454 24.503 -13.215 1.00 41.18 ? 3081 HOH A O   1 
HETATM 1651 O O   . HOH H 4 .   ? 30.804 44.729 6.927   1.00 32.74 ? 3082 HOH A O   1 
HETATM 1652 O O   . HOH H 4 .   ? 52.529 11.134 19.379  1.00 28.65 ? 3083 HOH A O   1 
HETATM 1653 O O   . HOH H 4 .   ? 25.378 36.688 11.347  1.00 45.62 ? 3084 HOH A O   1 
HETATM 1654 O O   . HOH H 4 .   ? 17.982 19.238 0.917   1.00 33.54 ? 3085 HOH A O   1 
HETATM 1655 O O   . HOH H 4 .   ? 36.499 35.098 12.655  1.00 32.30 ? 3086 HOH A O   1 
HETATM 1656 O O   . HOH H 4 .   ? 43.423 31.013 -8.110  1.00 29.41 ? 3087 HOH A O   1 
HETATM 1657 O O   . HOH H 4 .   ? 18.696 36.320 12.209  1.00 46.00 ? 3088 HOH A O   1 
HETATM 1658 O O   . HOH H 4 .   ? 52.339 18.846 22.276  1.00 43.47 ? 3089 HOH A O   1 
HETATM 1659 O O   . HOH H 4 .   ? 33.186 36.067 -10.760 1.00 31.60 ? 3090 HOH A O   1 
HETATM 1660 O O   . HOH H 4 .   ? 52.141 13.515 23.499  1.00 34.83 ? 3091 HOH A O   1 
HETATM 1661 O O   . HOH H 4 .   ? 43.222 17.803 -4.988  1.00 34.62 ? 3092 HOH A O   1 
HETATM 1662 O O   . HOH H 4 .   ? 38.772 26.015 24.460  1.00 51.92 ? 3093 HOH A O   1 
HETATM 1663 O O   . HOH H 4 .   ? 14.877 23.529 9.167   1.00 38.68 ? 3094 HOH A O   1 
HETATM 1664 O O   . HOH H 4 .   ? 49.517 19.240 21.437  1.00 35.07 ? 3095 HOH A O   1 
HETATM 1665 O O   . HOH H 4 .   ? 31.282 35.799 -13.570 1.00 30.74 ? 3096 HOH A O   1 
HETATM 1666 O O   . HOH H 4 .   ? 28.704 39.569 10.138  1.00 44.58 ? 3097 HOH A O   1 
HETATM 1667 O O   . HOH H 4 .   ? 22.874 39.741 -10.168 1.00 31.03 ? 3098 HOH A O   1 
HETATM 1668 O O   . HOH H 4 .   ? 24.078 17.869 7.491   1.00 29.49 ? 3099 HOH A O   1 
HETATM 1669 O O   . HOH H 4 .   ? 53.902 31.379 -2.516  1.00 51.48 ? 3100 HOH A O   1 
HETATM 1670 O O   . HOH H 4 .   ? 28.289 21.405 13.220  1.00 30.02 ? 3101 HOH A O   1 
HETATM 1671 O O   . HOH H 4 .   ? 38.557 33.487 -0.795  1.00 28.87 ? 3102 HOH A O   1 
HETATM 1672 O O   . HOH H 4 .   ? 18.073 22.378 -1.631  1.00 34.73 ? 3103 HOH A O   1 
HETATM 1673 O O   . HOH H 4 .   ? 28.634 30.574 14.689  1.00 38.33 ? 3104 HOH A O   1 
HETATM 1674 O O   . HOH H 4 .   ? 34.981 25.138 5.491   1.00 43.61 ? 3105 HOH A O   1 
HETATM 1675 O O   . HOH H 4 .   ? 36.238 24.005 0.890   1.00 43.94 ? 3106 HOH A O   1 
HETATM 1676 O O   . HOH H 4 .   ? 49.281 6.520  12.998  1.00 35.79 ? 3107 HOH A O   1 
HETATM 1677 O O   . HOH H 4 .   ? 26.186 28.272 14.571  1.00 37.32 ? 3108 HOH A O   1 
HETATM 1678 O O   . HOH H 4 .   ? 52.140 18.857 19.144  1.00 39.06 ? 3109 HOH A O   1 
HETATM 1679 O O   . HOH H 4 .   ? 17.136 10.499 12.443  1.00 28.59 ? 3110 HOH A O   1 
HETATM 1680 O O   . HOH H 4 .   ? 19.488 20.779 13.287  1.00 42.73 ? 3111 HOH A O   1 
HETATM 1681 O O   . HOH H 4 .   ? 19.580 2.016  17.601  1.00 40.03 ? 3112 HOH A O   1 
HETATM 1682 O O   . HOH H 4 .   ? 56.676 15.598 13.833  1.00 45.80 ? 3113 HOH A O   1 
HETATM 1683 O O   . HOH H 4 .   ? 33.226 16.927 0.303   1.00 32.38 ? 3114 HOH A O   1 
HETATM 1684 O O   . HOH H 4 .   ? 32.325 14.551 -0.513  1.00 37.04 ? 3115 HOH A O   1 
HETATM 1685 O O   . HOH H 4 .   ? 39.351 22.435 4.929   1.00 34.09 ? 3116 HOH A O   1 
HETATM 1686 O O   . HOH H 4 .   ? 51.091 46.840 -2.209  1.00 34.08 ? 3117 HOH A O   1 
HETATM 1687 O O   . HOH H 4 .   ? 53.040 27.956 -4.348  1.00 40.78 ? 3118 HOH A O   1 
HETATM 1688 O O   . HOH H 4 .   ? 15.193 11.950 13.736  1.00 38.02 ? 3119 HOH A O   1 
HETATM 1689 O O   . HOH H 4 .   ? 18.260 22.129 11.310  1.00 34.63 ? 3120 HOH A O   1 
HETATM 1690 O O   . HOH H 4 .   ? 36.715 21.554 -0.804  1.00 50.16 ? 3121 HOH A O   1 
HETATM 1691 O O   . HOH H 4 .   ? 15.021 31.127 4.351   1.00 40.43 ? 3122 HOH A O   1 
HETATM 1692 O O   . HOH H 4 .   ? 29.960 22.534 -11.769 1.00 34.44 ? 3123 HOH A O   1 
HETATM 1693 O O   . HOH H 4 .   ? 17.558 22.362 -4.734  1.00 44.65 ? 3124 HOH A O   1 
HETATM 1694 O O   . HOH H 4 .   ? 35.765 18.851 -8.655  1.00 46.91 ? 3125 HOH A O   1 
HETATM 1695 O O   . HOH H 4 .   ? 18.778 25.507 -9.987  1.00 44.32 ? 3126 HOH A O   1 
HETATM 1696 O O   . HOH H 4 .   ? 38.463 28.481 -19.801 1.00 44.04 ? 3127 HOH A O   1 
HETATM 1697 O O   . HOH H 4 .   ? 10.521 25.348 -0.898  1.00 45.50 ? 3128 HOH A O   1 
HETATM 1698 O O   . HOH H 4 .   ? 26.225 9.708  -8.190  1.00 40.35 ? 3129 HOH A O   1 
HETATM 1699 O O   . HOH H 4 .   ? 43.387 17.233 21.739  1.00 32.91 ? 3130 HOH A O   1 
HETATM 1700 O O   . HOH H 4 .   ? 47.907 8.481  20.281  1.00 32.57 ? 3131 HOH A O   1 
HETATM 1701 O O   . HOH H 4 .   ? 56.399 42.168 0.377   1.00 33.68 ? 3132 HOH A O   1 
HETATM 1702 O O   . HOH H 4 .   ? 53.426 31.167 -5.001  1.00 42.37 ? 3133 HOH A O   1 
HETATM 1703 O O   . HOH H 4 .   ? 29.884 15.007 12.183  1.00 43.83 ? 3134 HOH A O   1 
HETATM 1704 O O   . HOH H 4 .   ? 52.116 39.233 -13.841 1.00 38.16 ? 3135 HOH A O   1 
HETATM 1705 O O   . HOH H 4 .   ? 28.464 22.176 15.750  1.00 41.09 ? 3136 HOH A O   1 
HETATM 1706 O O   . HOH H 4 .   ? 17.837 3.997  19.120  1.00 47.10 ? 3137 HOH A O   1 
HETATM 1707 O O   . HOH H 4 .   ? 31.786 13.702 15.076  1.00 33.21 ? 3138 HOH A O   1 
HETATM 1708 O O   . HOH H 4 .   ? 41.465 7.935  12.717  1.00 41.01 ? 3139 HOH A O   1 
HETATM 1709 O O   . HOH H 4 .   ? 19.329 40.935 -7.207  1.00 46.03 ? 3140 HOH A O   1 
HETATM 1710 O O   . HOH H 4 .   ? 16.482 30.648 -3.531  1.00 41.87 ? 3141 HOH A O   1 
HETATM 1711 O O   . HOH H 4 .   ? 39.310 28.192 1.929   1.00 42.44 ? 3142 HOH A O   1 
HETATM 1712 O O   . HOH H 4 .   ? 18.449 35.763 -0.071  1.00 41.22 ? 3143 HOH A O   1 
HETATM 1713 O O   . HOH H 4 .   ? 49.971 48.529 -4.424  1.00 41.24 ? 3144 HOH A O   1 
HETATM 1714 O O   . HOH H 4 .   ? 54.478 40.456 1.278   1.00 26.16 ? 3145 HOH A O   1 
HETATM 1715 O O   . HOH H 4 .   ? 43.192 15.608 4.809   1.00 38.49 ? 3146 HOH A O   1 
HETATM 1716 O O   . HOH H 4 .   ? 26.585 16.930 7.252   1.00 30.54 ? 3147 HOH A O   1 
HETATM 1717 O O   . HOH H 4 .   ? 46.198 20.853 20.369  1.00 43.69 ? 3148 HOH A O   1 
HETATM 1718 O O   . HOH H 4 .   ? 21.651 36.606 -11.162 1.00 39.76 ? 3149 HOH A O   1 
HETATM 1719 O O   . HOH H 4 .   ? 36.603 44.091 -2.711  1.00 34.51 ? 3150 HOH A O   1 
HETATM 1720 O O   . HOH H 4 .   ? 48.200 34.226 -1.232  1.00 38.79 ? 3151 HOH A O   1 
HETATM 1721 O O   . HOH H 4 .   ? 39.534 30.228 -1.900  1.00 38.03 ? 3152 HOH A O   1 
HETATM 1722 O O   . HOH H 4 .   ? 39.934 8.927  16.809  1.00 45.25 ? 3153 HOH A O   1 
HETATM 1723 O O   . HOH H 4 .   ? 11.899 12.581 12.064  1.00 43.26 ? 3154 HOH A O   1 
HETATM 1724 O O   . HOH H 4 .   ? 46.153 18.208 21.991  1.00 37.48 ? 3155 HOH A O   1 
HETATM 1725 O O   . HOH H 4 .   ? 55.921 35.579 -14.867 1.00 42.42 ? 3156 HOH A O   1 
HETATM 1726 O O   . HOH H 4 .   ? 24.958 16.084 11.320  1.00 42.14 ? 3157 HOH A O   1 
HETATM 1727 O O   . HOH H 4 .   ? 33.062 18.854 -5.807  1.00 53.07 ? 3158 HOH A O   1 
HETATM 1728 O O   . HOH H 4 .   ? 32.553 9.162  14.424  1.00 48.18 ? 3159 HOH A O   1 
HETATM 1729 O O   . HOH H 4 .   ? 15.023 23.679 4.504   1.00 35.24 ? 3160 HOH A O   1 
HETATM 1730 O O   . HOH H 4 .   ? 28.848 26.255 -16.274 1.00 36.22 ? 3161 HOH A O   1 
HETATM 1731 O O   . HOH H 4 .   ? 44.537 45.864 -6.362  1.00 48.70 ? 3162 HOH A O   1 
HETATM 1732 O O   . HOH H 4 .   ? 31.700 16.125 -5.155  1.00 45.37 ? 3163 HOH A O   1 
HETATM 1733 O O   . HOH H 4 .   ? 50.318 4.928  9.802   1.00 49.84 ? 3164 HOH A O   1 
HETATM 1734 O O   . HOH H 4 .   ? 27.506 17.366 11.543  1.00 40.52 ? 3165 HOH A O   1 
HETATM 1735 O O   . HOH H 4 .   ? 14.422 20.441 12.201  1.00 43.68 ? 3166 HOH A O   1 
HETATM 1736 O O   . HOH H 4 .   ? 37.685 26.083 2.514   1.00 40.18 ? 3167 HOH A O   1 
HETATM 1737 O O   . HOH H 4 .   ? 52.822 15.052 6.481   1.00 38.86 ? 3168 HOH A O   1 
HETATM 1738 O O   . HOH H 4 .   ? 38.630 38.755 -15.423 1.00 38.15 ? 3169 HOH A O   1 
HETATM 1739 O O   . HOH H 4 .   ? 37.085 20.955 -9.465  1.00 38.82 ? 3170 HOH A O   1 
HETATM 1740 O O   . HOH H 4 .   ? 42.082 28.839 21.458  1.00 42.61 ? 3171 HOH A O   1 
HETATM 1741 O O   . HOH H 4 .   ? 38.846 45.553 -5.976  1.00 54.81 ? 3172 HOH A O   1 
HETATM 1742 O O   . HOH H 4 .   ? 31.949 11.893 17.373  1.00 53.33 ? 3173 HOH A O   1 
HETATM 1743 O O   . HOH H 4 .   ? 42.995 44.636 -8.580  1.00 41.96 ? 3174 HOH A O   1 
HETATM 1744 O O   . HOH H 4 .   ? 40.770 47.794 -9.115  1.00 43.44 ? 3175 HOH A O   1 
HETATM 1745 O O   . HOH H 4 .   ? 45.929 23.017 7.214   1.00 37.93 ? 3176 HOH A O   1 
HETATM 1746 O O   . HOH H 4 .   ? 45.475 9.645  23.761  1.00 44.33 ? 3177 HOH A O   1 
HETATM 1747 O O   . HOH H 4 .   ? 49.700 46.312 -0.145  1.00 39.65 ? 3178 HOH A O   1 
HETATM 1748 O O   . HOH H 4 .   ? 38.927 43.397 -2.010  1.00 40.28 ? 3179 HOH A O   1 
HETATM 1749 O O   . HOH H 4 .   ? 40.574 42.867 -15.383 1.00 41.96 ? 3180 HOH A O   1 
HETATM 1750 O O   . HOH H 4 .   ? 20.137 10.415 18.519  1.00 42.20 ? 3181 HOH A O   1 
HETATM 1751 O O   . HOH H 4 .   ? 12.097 26.370 -2.690  1.00 52.46 ? 3182 HOH A O   1 
HETATM 1752 O O   . HOH H 4 .   ? 30.995 49.625 7.174   1.00 44.05 ? 3183 HOH A O   1 
HETATM 1753 O O   . HOH H 4 .   ? 25.309 23.822 13.161  1.00 35.30 ? 3184 HOH A O   1 
HETATM 1754 O O   . HOH H 4 .   ? 37.895 32.034 21.239  1.00 41.97 ? 3185 HOH A O   1 
HETATM 1755 O O   . HOH H 4 .   ? 50.840 34.415 -17.330 1.00 44.70 ? 3186 HOH A O   1 
HETATM 1756 O O   . HOH H 4 .   ? 34.607 32.662 16.821  1.00 44.41 ? 3187 HOH A O   1 
HETATM 1757 O O   . HOH H 4 .   ? 47.835 39.508 -16.665 1.00 50.13 ? 3188 HOH A O   1 
HETATM 1758 O O   . HOH H 4 .   ? 31.268 22.121 21.103  1.00 44.67 ? 3189 HOH A O   1 
HETATM 1759 O O   . HOH H 4 .   ? 50.086 30.766 2.496   1.00 39.68 ? 3190 HOH A O   1 
HETATM 1760 O O   . HOH H 4 .   ? 18.756 21.590 -15.305 1.00 43.57 ? 3191 HOH A O   1 
HETATM 1761 O O   . HOH H 4 .   ? 18.363 27.648 -8.533  1.00 47.47 ? 3192 HOH A O   1 
HETATM 1762 O O   . HOH H 4 .   ? 48.061 41.546 -0.314  1.00 38.41 ? 3193 HOH A O   1 
HETATM 1763 O O   . HOH H 4 .   ? 34.481 6.479  19.100  1.00 51.08 ? 3194 HOH A O   1 
HETATM 1764 O O   . HOH H 4 .   ? 48.678 13.369 4.797   1.00 47.36 ? 3195 HOH A O   1 
HETATM 1765 O O   . HOH H 4 .   ? 29.329 25.549 17.213  1.00 39.66 ? 3196 HOH A O   1 
HETATM 1766 O O   . HOH H 4 .   ? 47.698 22.230 -10.264 1.00 39.65 ? 3197 HOH A O   1 
HETATM 1767 O O   . HOH H 4 .   ? 32.907 26.628 20.349  1.00 33.91 ? 3198 HOH A O   1 
HETATM 1768 O O   . HOH H 4 .   ? 35.176 39.574 6.997   1.00 46.80 ? 3199 HOH A O   1 
HETATM 1769 O O   . HOH H 4 .   ? 42.951 42.462 -0.585  1.00 54.69 ? 3200 HOH A O   1 
HETATM 1770 O O   . HOH H 4 .   ? 46.947 28.414 -20.262 1.00 36.93 ? 3201 HOH A O   1 
HETATM 1771 O O   . HOH H 4 .   ? 17.550 33.298 10.797  1.00 31.96 ? 3202 HOH A O   1 
HETATM 1772 O O   . HOH H 4 .   ? 21.242 30.443 -14.337 1.00 38.71 ? 3203 HOH A O   1 
HETATM 1773 O O   . HOH H 4 .   ? 50.632 33.835 1.597   1.00 35.57 ? 3204 HOH A O   1 
HETATM 1774 O O   . HOH H 4 .   ? 45.944 27.972 -9.731  1.00 32.25 ? 3205 HOH A O   1 
HETATM 1775 O O   . HOH H 4 .   ? 48.870 21.196 8.194   1.00 29.68 ? 3206 HOH A O   1 
HETATM 1776 O O   . HOH H 4 .   ? 41.732 40.166 -2.276  1.00 33.73 ? 3207 HOH A O   1 
HETATM 1777 O O   . HOH H 4 .   ? 47.654 25.799 -4.129  1.00 51.35 ? 3208 HOH A O   1 
HETATM 1778 O O   . HOH H 4 .   ? 54.781 18.951 23.212  1.00 45.66 ? 3209 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PHE A 5   ? 0.4157 0.4157 0.4157 0.0000 0.0000 0.0000 2598 PHE A N   
2    C CA  . PHE A 5   ? 0.4045 0.4045 0.4045 0.0000 0.0000 0.0000 2598 PHE A CA  
3    C C   . PHE A 5   ? 0.3951 0.3951 0.3951 0.0000 0.0000 0.0000 2598 PHE A C   
4    O O   . PHE A 5   ? 0.3986 0.3986 0.3986 0.0000 0.0000 0.0000 2598 PHE A O   
5    C CB  . PHE A 5   ? 0.4099 0.4099 0.4099 0.0000 0.0000 0.0000 2598 PHE A CB  
6    C CG  . PHE A 5   ? 0.3936 0.3936 0.3936 0.0000 0.0000 0.0000 2598 PHE A CG  
7    C CD1 . PHE A 5   ? 0.3975 0.3975 0.3975 0.0000 0.0000 0.0000 2598 PHE A CD1 
8    C CD2 . PHE A 5   ? 0.3898 0.3898 0.3898 0.0000 0.0000 0.0000 2598 PHE A CD2 
9    C CE1 . PHE A 5   ? 0.3883 0.3883 0.3883 0.0000 0.0000 0.0000 2598 PHE A CE1 
10   C CE2 . PHE A 5   ? 0.3778 0.3778 0.3778 0.0000 0.0000 0.0000 2598 PHE A CE2 
11   C CZ  . PHE A 5   ? 0.3738 0.3738 0.3738 0.0000 0.0000 0.0000 2598 PHE A CZ  
12   N N   . ASP A 6   ? 0.3847 0.3847 0.3847 0.0000 0.0000 0.0000 2599 ASP A N   
13   C CA  . ASP A 6   ? 0.3718 0.3718 0.3718 0.0000 0.0000 0.0000 2599 ASP A CA  
14   C C   . ASP A 6   ? 0.3538 0.3538 0.3538 0.0000 0.0000 0.0000 2599 ASP A C   
15   O O   . ASP A 6   ? 0.3508 0.3508 0.3508 0.0000 0.0000 0.0000 2599 ASP A O   
16   C CB  . ASP A 6   ? 0.3826 0.3826 0.3826 0.0000 0.0000 0.0000 2599 ASP A CB  
17   C CG  . ASP A 6   ? 0.4066 0.4066 0.4066 0.0000 0.0000 0.0000 2599 ASP A CG  
18   O OD1 . ASP A 6   ? 0.4480 0.4480 0.4480 0.0000 0.0000 0.0000 2599 ASP A OD1 
19   O OD2 . ASP A 6   ? 0.4743 0.4743 0.4743 0.0000 0.0000 0.0000 2599 ASP A OD2 
20   N N   . PRO A 7   ? 0.3318 0.3318 0.3318 0.0000 0.0000 0.0000 2600 PRO A N   
21   C CA  . PRO A 7   ? 0.3208 0.3208 0.3208 0.0000 0.0000 0.0000 2600 PRO A CA  
22   C C   . PRO A 7   ? 0.3151 0.3151 0.3151 0.0000 0.0000 0.0000 2600 PRO A C   
23   O O   . PRO A 7   ? 0.3137 0.3137 0.3137 0.0000 0.0000 0.0000 2600 PRO A O   
24   C CB  . PRO A 7   ? 0.3182 0.3182 0.3182 0.0000 0.0000 0.0000 2600 PRO A CB  
25   C CG  . PRO A 7   ? 0.3133 0.3133 0.3133 0.0000 0.0000 0.0000 2600 PRO A CG  
26   C CD  . PRO A 7   ? 0.3232 0.3232 0.3232 0.0000 0.0000 0.0000 2600 PRO A CD  
27   N N   . LYS A 8   ? 0.3039 0.3039 0.3039 0.0000 0.0000 0.0000 2601 LYS A N   
28   C CA  . LYS A 8   ? 0.3083 0.3083 0.3083 0.0000 0.0000 0.0000 2601 LYS A CA  
29   C C   . LYS A 8   ? 0.2966 0.2966 0.2966 0.0000 0.0000 0.0000 2601 LYS A C   
30   O O   . LYS A 8   ? 0.2983 0.2983 0.2983 0.0000 0.0000 0.0000 2601 LYS A O   
31   C CB  . LYS A 8   ? 0.3213 0.3213 0.3213 0.0000 0.0000 0.0000 2601 LYS A CB  
32   C CG  . LYS A 8   ? 0.3563 0.3563 0.3563 0.0000 0.0000 0.0000 2601 LYS A CG  
33   C CD  . LYS A 8   ? 0.4070 0.4070 0.4070 0.0000 0.0000 0.0000 2601 LYS A CD  
34   C CE  . LYS A 8   ? 0.4639 0.4639 0.4639 0.0000 0.0000 0.0000 2601 LYS A CE  
35   N NZ  . LYS A 8   ? 0.4755 0.4755 0.4755 0.0000 0.0000 0.0000 2601 LYS A NZ  
36   N N   . PRO A 9   ? 0.2872 0.2872 0.2872 0.0000 0.0000 0.0000 2602 PRO A N   
37   C CA  . PRO A 9   ? 0.2821 0.2821 0.2821 0.0000 0.0000 0.0000 2602 PRO A CA  
38   C C   . PRO A 9   ? 0.2805 0.2805 0.2805 0.0000 0.0000 0.0000 2602 PRO A C   
39   O O   . PRO A 9   ? 0.2783 0.2783 0.2783 0.0000 0.0000 0.0000 2602 PRO A O   
40   C CB  . PRO A 9   ? 0.2824 0.2824 0.2824 0.0000 0.0000 0.0000 2602 PRO A CB  
41   C CG  . PRO A 9   ? 0.2858 0.2858 0.2858 0.0000 0.0000 0.0000 2602 PRO A CG  
42   C CD  . PRO A 9   ? 0.2891 0.2891 0.2891 0.0000 0.0000 0.0000 2602 PRO A CD  
43   N N   . ILE A 10  ? 0.2619 0.2619 0.2619 0.0000 0.0000 0.0000 2603 ILE A N   
44   C CA  . ILE A 10  ? 0.2655 0.2655 0.2655 0.0000 0.0000 0.0000 2603 ILE A CA  
45   C C   . ILE A 10  ? 0.2652 0.2652 0.2652 0.0000 0.0000 0.0000 2603 ILE A C   
46   O O   . ILE A 10  ? 0.2635 0.2635 0.2635 0.0000 0.0000 0.0000 2603 ILE A O   
47   C CB  . ILE A 10  ? 0.2511 0.2511 0.2511 0.0000 0.0000 0.0000 2603 ILE A CB  
48   C CG1 . ILE A 10  ? 0.2728 0.2728 0.2728 0.0000 0.0000 0.0000 2603 ILE A CG1 
49   C CG2 . ILE A 10  ? 0.2707 0.2707 0.2707 0.0000 0.0000 0.0000 2603 ILE A CG2 
50   C CD1 . ILE A 10  ? 0.2609 0.2609 0.2609 0.0000 0.0000 0.0000 2603 ILE A CD1 
51   N N   . ASN A 11  ? 0.2686 0.2686 0.2686 0.0000 0.0000 0.0000 2604 ASN A N   
52   C CA  . ASN A 11  ? 0.2785 0.2785 0.2785 0.0000 0.0000 0.0000 2604 ASN A CA  
53   C C   . ASN A 11  ? 0.2761 0.2761 0.2761 0.0000 0.0000 0.0000 2604 ASN A C   
54   O O   . ASN A 11  ? 0.2740 0.2740 0.2740 0.0000 0.0000 0.0000 2604 ASN A O   
55   C CB  . ASN A 11  ? 0.2774 0.2774 0.2774 0.0000 0.0000 0.0000 2604 ASN A CB  
56   C CG  . ASN A 11  ? 0.3105 0.3105 0.3105 0.0000 0.0000 0.0000 2604 ASN A CG  
57   O OD1 . ASN A 11  ? 0.3633 0.3633 0.3633 0.0000 0.0000 0.0000 2604 ASN A OD1 
58   N ND2 . ASN A 11  ? 0.3759 0.3759 0.3759 0.0000 0.0000 0.0000 2604 ASN A ND2 
59   N N   . THR A 12  ? 0.2754 0.2754 0.2754 0.0000 0.0000 0.0000 2605 THR A N   
60   C CA  . THR A 12  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 2605 THR A CA  
61   C C   . THR A 12  ? 0.2754 0.2754 0.2754 0.0000 0.0000 0.0000 2605 THR A C   
62   O O   . THR A 12  ? 0.2592 0.2592 0.2592 0.0000 0.0000 0.0000 2605 THR A O   
63   C CB  . THR A 12  ? 0.2785 0.2785 0.2785 0.0000 0.0000 0.0000 2605 THR A CB  
64   O OG1 . THR A 12  ? 0.2791 0.2791 0.2791 0.0000 0.0000 0.0000 2605 THR A OG1 
65   C CG2 . THR A 12  ? 0.2814 0.2814 0.2814 0.0000 0.0000 0.0000 2605 THR A CG2 
66   N N   . MET A 13  ? 0.2690 0.2690 0.2690 0.0000 0.0000 0.0000 2606 MET A N   
67   C CA  . MET A 13  ? 0.2776 0.2776 0.2776 0.0000 0.0000 0.0000 2606 MET A CA  
68   C C   . MET A 13  ? 0.2721 0.2721 0.2721 0.0000 0.0000 0.0000 2606 MET A C   
69   O O   . MET A 13  ? 0.2776 0.2776 0.2776 0.0000 0.0000 0.0000 2606 MET A O   
70   C CB  . MET A 13  ? 0.2895 0.2895 0.2895 0.0000 0.0000 0.0000 2606 MET A CB  
71   C CG  . MET A 13  ? 0.3349 0.3349 0.3349 0.0000 0.0000 0.0000 2606 MET A CG  
72   S SD  . MET A 13  ? 0.4740 0.4740 0.4740 0.0000 0.0000 0.0000 2606 MET A SD  
73   C CE  . MET A 13  ? 0.4080 0.4080 0.4080 0.0000 0.0000 0.0000 2606 MET A CE  
74   N N   . ASN A 14  ? 0.2693 0.2693 0.2693 0.0000 0.0000 0.0000 2607 ASN A N   
75   C CA  . ASN A 14  ? 0.2781 0.2781 0.2781 0.0000 0.0000 0.0000 2607 ASN A CA  
76   C C   . ASN A 14  ? 0.2774 0.2774 0.2774 0.0000 0.0000 0.0000 2607 ASN A C   
77   O O   . ASN A 14  ? 0.2742 0.2742 0.2742 0.0000 0.0000 0.0000 2607 ASN A O   
78   C CB  . ASN A 14  ? 0.2774 0.2774 0.2774 0.0000 0.0000 0.0000 2607 ASN A CB  
79   C CG  . ASN A 14  ? 0.2899 0.2899 0.2899 0.0000 0.0000 0.0000 2607 ASN A CG  
80   O OD1 . ASN A 14  ? 0.3142 0.3142 0.3142 0.0000 0.0000 0.0000 2607 ASN A OD1 
81   N ND2 . ASN A 14  ? 0.2787 0.2787 0.2787 0.0000 0.0000 0.0000 2607 ASN A ND2 
82   N N   . PHE A 15  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 2608 PHE A N   
83   C CA  . PHE A 15  ? 0.2714 0.2714 0.2714 0.0000 0.0000 0.0000 2608 PHE A CA  
84   C C   . PHE A 15  ? 0.2793 0.2793 0.2793 0.0000 0.0000 0.0000 2608 PHE A C   
85   O O   . PHE A 15  ? 0.2874 0.2874 0.2874 0.0000 0.0000 0.0000 2608 PHE A O   
86   C CB  . PHE A 15  ? 0.2583 0.2583 0.2583 0.0000 0.0000 0.0000 2608 PHE A CB  
87   C CG  . PHE A 15  ? 0.2535 0.2535 0.2535 0.0000 0.0000 0.0000 2608 PHE A CG  
88   C CD1 . PHE A 15  ? 0.2492 0.2492 0.2492 0.0000 0.0000 0.0000 2608 PHE A CD1 
89   C CD2 . PHE A 15  ? 0.2565 0.2565 0.2565 0.0000 0.0000 0.0000 2608 PHE A CD2 
90   C CE1 . PHE A 15  ? 0.2248 0.2248 0.2248 0.0000 0.0000 0.0000 2608 PHE A CE1 
91   C CE2 . PHE A 15  ? 0.2329 0.2329 0.2329 0.0000 0.0000 0.0000 2608 PHE A CE2 
92   C CZ  . PHE A 15  ? 0.2687 0.2687 0.2687 0.0000 0.0000 0.0000 2608 PHE A CZ  
93   N N   . SER A 16  ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2609 SER A N   
94   C CA  . SER A 16  ? 0.3072 0.3072 0.3072 0.0000 0.0000 0.0000 2609 SER A CA  
95   C C   . SER A 16  ? 0.3109 0.3109 0.3109 0.0000 0.0000 0.0000 2609 SER A C   
96   O O   . SER A 16  ? 0.3215 0.3215 0.3215 0.0000 0.0000 0.0000 2609 SER A O   
97   C CB  . SER A 16  ? 0.3148 0.3148 0.3148 0.0000 0.0000 0.0000 2609 SER A CB  
98   O OG  . SER A 16  ? 0.3897 0.3897 0.3897 0.0000 0.0000 0.0000 2609 SER A OG  
99   N N   . LEU A 17  ? 0.2997 0.2997 0.2997 0.0000 0.0000 0.0000 2610 LEU A N   
100  C CA  . LEU A 17  ? 0.2958 0.2958 0.2958 0.0000 0.0000 0.0000 2610 LEU A CA  
101  C C   . LEU A 17  ? 0.3059 0.3059 0.3059 0.0000 0.0000 0.0000 2610 LEU A C   
102  O O   . LEU A 17  ? 0.3070 0.3070 0.3070 0.0000 0.0000 0.0000 2610 LEU A O   
103  C CB  . LEU A 17  ? 0.2901 0.2901 0.2901 0.0000 0.0000 0.0000 2610 LEU A CB  
104  C CG  . LEU A 17  ? 0.2855 0.2855 0.2855 0.0000 0.0000 0.0000 2610 LEU A CG  
105  C CD1 . LEU A 17  ? 0.2645 0.2645 0.2645 0.0000 0.0000 0.0000 2610 LEU A CD1 
106  C CD2 . LEU A 17  ? 0.2616 0.2616 0.2616 0.0000 0.0000 0.0000 2610 LEU A CD2 
107  N N   . PRO A 18  ? 0.3186 0.3186 0.3186 0.0000 0.0000 0.0000 2611 PRO A N   
108  C CA  . PRO A 18  ? 0.3234 0.3234 0.3234 0.0000 0.0000 0.0000 2611 PRO A CA  
109  C C   . PRO A 18  ? 0.3322 0.3322 0.3322 0.0000 0.0000 0.0000 2611 PRO A C   
110  O O   . PRO A 18  ? 0.3211 0.3211 0.3211 0.0000 0.0000 0.0000 2611 PRO A O   
111  C CB  . PRO A 18  ? 0.3235 0.3235 0.3235 0.0000 0.0000 0.0000 2611 PRO A CB  
112  C CG  . PRO A 18  ? 0.3318 0.3318 0.3318 0.0000 0.0000 0.0000 2611 PRO A CG  
113  C CD  . PRO A 18  ? 0.3132 0.3132 0.3132 0.0000 0.0000 0.0000 2611 PRO A CD  
114  N N   . GLU A 19  ? 0.3413 0.3413 0.3413 0.0000 0.0000 0.0000 2612 GLU A N   
115  C CA  . GLU A 19  ? 0.3446 0.3446 0.3446 0.0000 0.0000 0.0000 2612 GLU A CA  
116  C C   . GLU A 19  ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 2612 GLU A C   
117  O O   . GLU A 19  ? 0.3501 0.3501 0.3501 0.0000 0.0000 0.0000 2612 GLU A O   
118  C CB  . GLU A 19  ? 0.3517 0.3517 0.3517 0.0000 0.0000 0.0000 2612 GLU A CB  
119  N N   . LYS A 20  ? 0.3543 0.3543 0.3543 0.0000 0.0000 0.0000 2613 LYS A N   
120  C CA  . LYS A 20  ? 0.3509 0.3509 0.3509 0.0000 0.0000 0.0000 2613 LYS A CA  
121  C C   . LYS A 20  ? 0.3501 0.3501 0.3501 0.0000 0.0000 0.0000 2613 LYS A C   
122  O O   . LYS A 20  ? 0.3494 0.3494 0.3494 0.0000 0.0000 0.0000 2613 LYS A O   
123  C CB  . LYS A 20  ? 0.3633 0.3633 0.3633 0.0000 0.0000 0.0000 2613 LYS A CB  
124  N N   . LEU A 21  ? 0.3375 0.3375 0.3375 0.0000 0.0000 0.0000 2614 LEU A N   
125  C CA  . LEU A 21  ? 0.3275 0.3275 0.3275 0.0000 0.0000 0.0000 2614 LEU A CA  
126  C C   . LEU A 21  ? 0.3166 0.3166 0.3166 0.0000 0.0000 0.0000 2614 LEU A C   
127  O O   . LEU A 21  ? 0.3024 0.3024 0.3024 0.0000 0.0000 0.0000 2614 LEU A O   
128  C CB  . LEU A 21  ? 0.3337 0.3337 0.3337 0.0000 0.0000 0.0000 2614 LEU A CB  
129  C CG  . LEU A 21  ? 0.3536 0.3536 0.3536 0.0000 0.0000 0.0000 2614 LEU A CG  
130  C CD1 . LEU A 21  ? 0.3411 0.3411 0.3411 0.0000 0.0000 0.0000 2614 LEU A CD1 
131  C CD2 . LEU A 21  ? 0.3780 0.3780 0.3780 0.0000 0.0000 0.0000 2614 LEU A CD2 
132  N N   . GLU A 22  ? 0.3039 0.3039 0.3039 0.0000 0.0000 0.0000 2615 GLU A N   
133  C CA  . GLU A 22  ? 0.3045 0.3045 0.3045 0.0000 0.0000 0.0000 2615 GLU A CA  
134  C C   . GLU A 22  ? 0.2949 0.2949 0.2949 0.0000 0.0000 0.0000 2615 GLU A C   
135  O O   . GLU A 22  ? 0.2901 0.2901 0.2901 0.0000 0.0000 0.0000 2615 GLU A O   
136  C CB  . GLU A 22  ? 0.3068 0.3068 0.3068 0.0000 0.0000 0.0000 2615 GLU A CB  
137  C CG  . GLU A 22  ? 0.3310 0.3310 0.3310 0.0000 0.0000 0.0000 2615 GLU A CG  
138  C CD  . GLU A 22  ? 0.3585 0.3585 0.3585 0.0000 0.0000 0.0000 2615 GLU A CD  
139  O OE1 . GLU A 22  ? 0.3541 0.3541 0.3541 0.0000 0.0000 0.0000 2615 GLU A OE1 
140  O OE2 . GLU A 22  ? 0.3449 0.3449 0.3449 0.0000 0.0000 0.0000 2615 GLU A OE2 
141  N N   . TYR A 23  ? 0.2961 0.2961 0.2961 0.0000 0.0000 0.0000 2616 TYR A N   
142  C CA  . TYR A 23  ? 0.2921 0.2921 0.2921 0.0000 0.0000 0.0000 2616 TYR A CA  
143  C C   . TYR A 23  ? 0.2849 0.2849 0.2849 0.0000 0.0000 0.0000 2616 TYR A C   
144  O O   . TYR A 23  ? 0.2847 0.2847 0.2847 0.0000 0.0000 0.0000 2616 TYR A O   
145  C CB  . TYR A 23  ? 0.3033 0.3033 0.3033 0.0000 0.0000 0.0000 2616 TYR A CB  
146  C CG  . TYR A 23  ? 0.3252 0.3252 0.3252 0.0000 0.0000 0.0000 2616 TYR A CG  
147  C CD1 . TYR A 23  ? 0.3543 0.3543 0.3543 0.0000 0.0000 0.0000 2616 TYR A CD1 
148  C CD2 . TYR A 23  ? 0.3674 0.3674 0.3674 0.0000 0.0000 0.0000 2616 TYR A CD2 
149  C CE1 . TYR A 23  ? 0.3969 0.3969 0.3969 0.0000 0.0000 0.0000 2616 TYR A CE1 
150  C CE2 . TYR A 23  ? 0.3956 0.3956 0.3956 0.0000 0.0000 0.0000 2616 TYR A CE2 
151  C CZ  . TYR A 23  ? 0.4052 0.4052 0.4052 0.0000 0.0000 0.0000 2616 TYR A CZ  
152  O OH  . TYR A 23  ? 0.4254 0.4254 0.4254 0.0000 0.0000 0.0000 2616 TYR A OH  
153  N N   . ILE A 24  ? 0.2686 0.2686 0.2686 0.0000 0.0000 0.0000 2617 ILE A N   
154  C CA  . ILE A 24  ? 0.2690 0.2690 0.2690 0.0000 0.0000 0.0000 2617 ILE A CA  
155  C C   . ILE A 24  ? 0.2593 0.2593 0.2593 0.0000 0.0000 0.0000 2617 ILE A C   
156  O O   . ILE A 24  ? 0.2628 0.2628 0.2628 0.0000 0.0000 0.0000 2617 ILE A O   
157  C CB  . ILE A 24  ? 0.2740 0.2740 0.2740 0.0000 0.0000 0.0000 2617 ILE A CB  
158  C CG1 . ILE A 24  ? 0.2963 0.2963 0.2963 0.0000 0.0000 0.0000 2617 ILE A CG1 
159  C CG2 . ILE A 24  ? 0.2881 0.2881 0.2881 0.0000 0.0000 0.0000 2617 ILE A CG2 
160  C CD1 . ILE A 24  ? 0.3455 0.3455 0.3455 0.0000 0.0000 0.0000 2617 ILE A CD1 
161  N N   . VAL A 25  ? 0.2510 0.2510 0.2510 0.0000 0.0000 0.0000 2618 VAL A N   
162  C CA  . VAL A 25  ? 0.2514 0.2514 0.2514 0.0000 0.0000 0.0000 2618 VAL A CA  
163  C C   . VAL A 25  ? 0.2488 0.2488 0.2488 0.0000 0.0000 0.0000 2618 VAL A C   
164  O O   . VAL A 25  ? 0.2540 0.2540 0.2540 0.0000 0.0000 0.0000 2618 VAL A O   
165  C CB  . VAL A 25  ? 0.2525 0.2525 0.2525 0.0000 0.0000 0.0000 2618 VAL A CB  
166  C CG1 . VAL A 25  ? 0.2554 0.2554 0.2554 0.0000 0.0000 0.0000 2618 VAL A CG1 
167  C CG2 . VAL A 25  ? 0.2531 0.2531 0.2531 0.0000 0.0000 0.0000 2618 VAL A CG2 
168  N N   . THR A 26  ? 0.2460 0.2460 0.2460 0.0000 0.0000 0.0000 2619 THR A N   
169  C CA  . THR A 26  ? 0.2559 0.2559 0.2559 0.0000 0.0000 0.0000 2619 THR A CA  
170  C C   . THR A 26  ? 0.2507 0.2507 0.2507 0.0000 0.0000 0.0000 2619 THR A C   
171  O O   . THR A 26  ? 0.2562 0.2562 0.2562 0.0000 0.0000 0.0000 2619 THR A O   
172  C CB  . THR A 26  ? 0.2596 0.2596 0.2596 0.0000 0.0000 0.0000 2619 THR A CB  
173  O OG1 . THR A 26  ? 0.2809 0.2809 0.2809 0.0000 0.0000 0.0000 2619 THR A OG1 
174  C CG2 . THR A 26  ? 0.2882 0.2882 0.2882 0.0000 0.0000 0.0000 2619 THR A CG2 
175  N N   . LYS A 27  ? 0.2498 0.2498 0.2498 0.0000 0.0000 0.0000 2620 LYS A N   
176  C CA  . LYS A 27  ? 0.2508 0.2508 0.2508 0.0000 0.0000 0.0000 2620 LYS A CA  
177  C C   . LYS A 27  ? 0.2481 0.2481 0.2481 0.0000 0.0000 0.0000 2620 LYS A C   
178  O O   . LYS A 27  ? 0.2388 0.2388 0.2388 0.0000 0.0000 0.0000 2620 LYS A O   
179  C CB  . LYS A 27  ? 0.2617 0.2617 0.2617 0.0000 0.0000 0.0000 2620 LYS A CB  
180  C CG  . LYS A 27  ? 0.2874 0.2874 0.2874 0.0000 0.0000 0.0000 2620 LYS A CG  
181  C CD  . LYS A 27  ? 0.3305 0.3305 0.3305 0.0000 0.0000 0.0000 2620 LYS A CD  
182  C CE  . LYS A 27  ? 0.3841 0.3841 0.3841 0.0000 0.0000 0.0000 2620 LYS A CE  
183  N NZ  . LYS A 27  ? 0.4084 0.4084 0.4084 0.0000 0.0000 0.0000 2620 LYS A NZ  
184  N N   . TYR A 28  ? 0.2451 0.2451 0.2451 0.0000 0.0000 0.0000 2621 TYR A N   
185  C CA  . TYR A 28  ? 0.2348 0.2348 0.2348 0.0000 0.0000 0.0000 2621 TYR A CA  
186  C C   . TYR A 28  ? 0.2354 0.2354 0.2354 0.0000 0.0000 0.0000 2621 TYR A C   
187  O O   . TYR A 28  ? 0.2381 0.2381 0.2381 0.0000 0.0000 0.0000 2621 TYR A O   
188  C CB  . TYR A 28  ? 0.2368 0.2368 0.2368 0.0000 0.0000 0.0000 2621 TYR A CB  
189  C CG  . TYR A 28  ? 0.2393 0.2393 0.2393 0.0000 0.0000 0.0000 2621 TYR A CG  
190  C CD1 . TYR A 28  ? 0.2572 0.2572 0.2572 0.0000 0.0000 0.0000 2621 TYR A CD1 
191  C CD2 . TYR A 28  ? 0.2620 0.2620 0.2620 0.0000 0.0000 0.0000 2621 TYR A CD2 
192  C CE1 . TYR A 28  ? 0.2777 0.2777 0.2777 0.0000 0.0000 0.0000 2621 TYR A CE1 
193  C CE2 . TYR A 28  ? 0.2952 0.2952 0.2952 0.0000 0.0000 0.0000 2621 TYR A CE2 
194  C CZ  . TYR A 28  ? 0.3037 0.3037 0.3037 0.0000 0.0000 0.0000 2621 TYR A CZ  
195  O OH  . TYR A 28  ? 0.3109 0.3109 0.3109 0.0000 0.0000 0.0000 2621 TYR A OH  
196  N N   . ALA A 29  ? 0.2421 0.2421 0.2421 0.0000 0.0000 0.0000 2622 ALA A N   
197  C CA  . ALA A 29  ? 0.2402 0.2402 0.2402 0.0000 0.0000 0.0000 2622 ALA A CA  
198  C C   . ALA A 29  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2622 ALA A C   
199  O O   . ALA A 29  ? 0.2484 0.2484 0.2484 0.0000 0.0000 0.0000 2622 ALA A O   
200  C CB  . ALA A 29  ? 0.2408 0.2408 0.2408 0.0000 0.0000 0.0000 2622 ALA A CB  
201  N N   . GLU A 30  ? 0.2560 0.2560 0.2560 0.0000 0.0000 0.0000 2623 GLU A N   
202  C CA  . GLU A 30  ? 0.2658 0.2658 0.2658 0.0000 0.0000 0.0000 2623 GLU A CA  
203  C C   . GLU A 30  ? 0.2698 0.2698 0.2698 0.0000 0.0000 0.0000 2623 GLU A C   
204  O O   . GLU A 30  ? 0.2648 0.2648 0.2648 0.0000 0.0000 0.0000 2623 GLU A O   
205  C CB  . GLU A 30  ? 0.2707 0.2707 0.2707 0.0000 0.0000 0.0000 2623 GLU A CB  
206  C CG  . GLU A 30  ? 0.2847 0.2847 0.2847 0.0000 0.0000 0.0000 2623 GLU A CG  
207  C CD  . GLU A 30  ? 0.3537 0.3537 0.3537 0.0000 0.0000 0.0000 2623 GLU A CD  
208  O OE1 . GLU A 30  ? 0.3495 0.3495 0.3495 0.0000 0.0000 0.0000 2623 GLU A OE1 
209  O OE2 . GLU A 30  ? 0.3810 0.3810 0.3810 0.0000 0.0000 0.0000 2623 GLU A OE2 
210  N N   . HIS A 31  ? 0.2777 0.2777 0.2777 0.0000 0.0000 0.0000 2624 HIS A N   
211  C CA  . HIS A 31  ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2624 HIS A CA  
212  C C   . HIS A 31  ? 0.2905 0.2905 0.2905 0.0000 0.0000 0.0000 2624 HIS A C   
213  O O   . HIS A 31  ? 0.2994 0.2994 0.2994 0.0000 0.0000 0.0000 2624 HIS A O   
214  C CB  . HIS A 31  ? 0.2895 0.2895 0.2895 0.0000 0.0000 0.0000 2624 HIS A CB  
215  C CG  . HIS A 31  ? 0.2935 0.2935 0.2935 0.0000 0.0000 0.0000 2624 HIS A CG  
216  N ND1 . HIS A 31  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 2624 HIS A ND1 
217  C CD2 . HIS A 31  ? 0.2873 0.2873 0.2873 0.0000 0.0000 0.0000 2624 HIS A CD2 
218  C CE1 . HIS A 31  ? 0.2849 0.2849 0.2849 0.0000 0.0000 0.0000 2624 HIS A CE1 
219  N NE2 . HIS A 31  ? 0.3232 0.3232 0.3232 0.0000 0.0000 0.0000 2624 HIS A NE2 
220  N N   . SER A 32  ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2625 SER A N   
221  C CA  . SER A 32  ? 0.2859 0.2859 0.2859 0.0000 0.0000 0.0000 2625 SER A CA  
222  C C   . SER A 32  ? 0.2788 0.2788 0.2788 0.0000 0.0000 0.0000 2625 SER A C   
223  O O   . SER A 32  ? 0.2740 0.2740 0.2740 0.0000 0.0000 0.0000 2625 SER A O   
224  C CB  . SER A 32  ? 0.2963 0.2963 0.2963 0.0000 0.0000 0.0000 2625 SER A CB  
225  O OG  . SER A 32  ? 0.3205 0.3205 0.3205 0.0000 0.0000 0.0000 2625 SER A OG  
226  N N   . HIS A 33  ? 0.2707 0.2707 0.2707 0.0000 0.0000 0.0000 2626 HIS A N   
227  C CA  . HIS A 33  ? 0.2676 0.2676 0.2676 0.0000 0.0000 0.0000 2626 HIS A CA  
228  C C   . HIS A 33  ? 0.2777 0.2777 0.2777 0.0000 0.0000 0.0000 2626 HIS A C   
229  O O   . HIS A 33  ? 0.2771 0.2771 0.2771 0.0000 0.0000 0.0000 2626 HIS A O   
230  C CB  . HIS A 33  ? 0.2554 0.2554 0.2554 0.0000 0.0000 0.0000 2626 HIS A CB  
231  C CG  . HIS A 33  ? 0.2467 0.2467 0.2467 0.0000 0.0000 0.0000 2626 HIS A CG  
232  N ND1 . HIS A 33  ? 0.2424 0.2424 0.2424 0.0000 0.0000 0.0000 2626 HIS A ND1 
233  C CD2 . HIS A 33  ? 0.2325 0.2325 0.2325 0.0000 0.0000 0.0000 2626 HIS A CD2 
234  C CE1 . HIS A 33  ? 0.2325 0.2325 0.2325 0.0000 0.0000 0.0000 2626 HIS A CE1 
235  N NE2 . HIS A 33  ? 0.2346 0.2346 0.2346 0.0000 0.0000 0.0000 2626 HIS A NE2 
236  N N   . ASP A 34  ? 0.2850 0.2850 0.2850 0.0000 0.0000 0.0000 2627 ASP A N   
237  C CA  . ASP A 34  ? 0.3052 0.3052 0.3052 0.0000 0.0000 0.0000 2627 ASP A CA  
238  C C   . ASP A 34  ? 0.3063 0.3063 0.3063 0.0000 0.0000 0.0000 2627 ASP A C   
239  O O   . ASP A 34  ? 0.3092 0.3092 0.3092 0.0000 0.0000 0.0000 2627 ASP A O   
240  C CB  . ASP A 34  ? 0.3018 0.3018 0.3018 0.0000 0.0000 0.0000 2627 ASP A CB  
241  C CG  . ASP A 34  ? 0.3223 0.3223 0.3223 0.0000 0.0000 0.0000 2627 ASP A CG  
242  O OD1 . ASP A 34  ? 0.3116 0.3116 0.3116 0.0000 0.0000 0.0000 2627 ASP A OD1 
243  O OD2 . ASP A 34  ? 0.3292 0.3292 0.3292 0.0000 0.0000 0.0000 2627 ASP A OD2 
244  N N   . LYS A 35  ? 0.3157 0.3157 0.3157 0.0000 0.0000 0.0000 2628 LYS A N   
245  C CA  . LYS A 35  ? 0.3291 0.3291 0.3291 0.0000 0.0000 0.0000 2628 LYS A CA  
246  C C   . LYS A 35  ? 0.3268 0.3268 0.3268 0.0000 0.0000 0.0000 2628 LYS A C   
247  O O   . LYS A 35  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 2628 LYS A O   
248  C CB  . LYS A 35  ? 0.3352 0.3352 0.3352 0.0000 0.0000 0.0000 2628 LYS A CB  
249  C CG  . LYS A 35  ? 0.3885 0.3885 0.3885 0.0000 0.0000 0.0000 2628 LYS A CG  
250  C CD  . LYS A 35  ? 0.4404 0.4404 0.4404 0.0000 0.0000 0.0000 2628 LYS A CD  
251  C CE  . LYS A 35  ? 0.4830 0.4830 0.4830 0.0000 0.0000 0.0000 2628 LYS A CE  
252  N NZ  . LYS A 35  ? 0.5041 0.5041 0.5041 0.0000 0.0000 0.0000 2628 LYS A NZ  
253  N N   . TRP A 36  ? 0.3196 0.3196 0.3196 0.0000 0.0000 0.0000 2629 TRP A N   
254  C CA  . TRP A 36  ? 0.3204 0.3204 0.3204 0.0000 0.0000 0.0000 2629 TRP A CA  
255  C C   . TRP A 36  ? 0.3227 0.3227 0.3227 0.0000 0.0000 0.0000 2629 TRP A C   
256  O O   . TRP A 36  ? 0.3134 0.3134 0.3134 0.0000 0.0000 0.0000 2629 TRP A O   
257  C CB  . TRP A 36  ? 0.3195 0.3195 0.3195 0.0000 0.0000 0.0000 2629 TRP A CB  
258  C CG  . TRP A 36  ? 0.3192 0.3192 0.3192 0.0000 0.0000 0.0000 2629 TRP A CG  
259  C CD1 . TRP A 36  ? 0.3273 0.3273 0.3273 0.0000 0.0000 0.0000 2629 TRP A CD1 
260  C CD2 . TRP A 36  ? 0.3162 0.3162 0.3162 0.0000 0.0000 0.0000 2629 TRP A CD2 
261  N NE1 . TRP A 36  ? 0.3443 0.3443 0.3443 0.0000 0.0000 0.0000 2629 TRP A NE1 
262  C CE2 . TRP A 36  ? 0.3432 0.3432 0.3432 0.0000 0.0000 0.0000 2629 TRP A CE2 
263  C CE3 . TRP A 36  ? 0.3254 0.3254 0.3254 0.0000 0.0000 0.0000 2629 TRP A CE3 
264  C CZ2 . TRP A 36  ? 0.3484 0.3484 0.3484 0.0000 0.0000 0.0000 2629 TRP A CZ2 
265  C CZ3 . TRP A 36  ? 0.3243 0.3243 0.3243 0.0000 0.0000 0.0000 2629 TRP A CZ3 
266  C CH2 . TRP A 36  ? 0.3181 0.3181 0.3181 0.0000 0.0000 0.0000 2629 TRP A CH2 
267  N N   . ALA A 37  ? 0.3222 0.3222 0.3222 0.0000 0.0000 0.0000 2630 ALA A N   
268  C CA  . ALA A 37  ? 0.3358 0.3358 0.3358 0.0000 0.0000 0.0000 2630 ALA A CA  
269  C C   . ALA A 37  ? 0.3494 0.3494 0.3494 0.0000 0.0000 0.0000 2630 ALA A C   
270  O O   . ALA A 37  ? 0.3476 0.3476 0.3476 0.0000 0.0000 0.0000 2630 ALA A O   
271  C CB  . ALA A 37  ? 0.3281 0.3281 0.3281 0.0000 0.0000 0.0000 2630 ALA A CB  
272  N N   . CYS A 38  ? 0.3681 0.3681 0.3681 0.0000 0.0000 0.0000 2631 CYS A N   
273  C CA  . CYS A 38  ? 0.4007 0.4007 0.4007 0.0000 0.0000 0.0000 2631 CYS A CA  
274  C C   . CYS A 38  ? 0.4075 0.4075 0.4075 0.0000 0.0000 0.0000 2631 CYS A C   
275  O O   . CYS A 38  ? 0.4194 0.4194 0.4194 0.0000 0.0000 0.0000 2631 CYS A O   
276  C CB  . CYS A 38  ? 0.4019 0.4019 0.4019 0.0000 0.0000 0.0000 2631 CYS A CB  
277  S SG  . CYS A 38  ? 0.4679 0.4679 0.4679 0.0000 0.0000 0.0000 2631 CYS A SG  
278  N N   . ASP A 39  ? 0.4131 0.4131 0.4131 0.0000 0.0000 0.0000 2632 ASP A N   
279  C CA  . ASP A 39  ? 0.4250 0.4250 0.4250 0.0000 0.0000 0.0000 2632 ASP A CA  
280  C C   . ASP A 39  ? 0.4220 0.4220 0.4220 0.0000 0.0000 0.0000 2632 ASP A C   
281  O O   . ASP A 39  ? 0.4159 0.4159 0.4159 0.0000 0.0000 0.0000 2632 ASP A O   
282  C CB  . ASP A 39  ? 0.4317 0.4317 0.4317 0.0000 0.0000 0.0000 2632 ASP A CB  
283  C CG  . ASP A 39  ? 0.4637 0.4637 0.4637 0.0000 0.0000 0.0000 2632 ASP A CG  
284  O OD1 . ASP A 39  ? 0.4998 0.4998 0.4998 0.0000 0.0000 0.0000 2632 ASP A OD1 
285  O OD2 . ASP A 39  ? 0.5040 0.5040 0.5040 0.0000 0.0000 0.0000 2632 ASP A OD2 
286  N N   . LYS A 40  ? 0.4122 0.4122 0.4122 0.0000 0.0000 0.0000 2633 LYS A N   
287  C CA  . LYS A 40  ? 0.4071 0.4071 0.4071 0.0000 0.0000 0.0000 2633 LYS A CA  
288  C C   . LYS A 40  ? 0.4019 0.4019 0.4019 0.0000 0.0000 0.0000 2633 LYS A C   
289  O O   . LYS A 40  ? 0.4038 0.4038 0.4038 0.0000 0.0000 0.0000 2633 LYS A O   
290  C CB  . LYS A 40  ? 0.4066 0.4066 0.4066 0.0000 0.0000 0.0000 2633 LYS A CB  
291  C CG  . LYS A 40  ? 0.4163 0.4163 0.4163 0.0000 0.0000 0.0000 2633 LYS A CG  
292  C CD  . LYS A 40  ? 0.4280 0.4280 0.4280 0.0000 0.0000 0.0000 2633 LYS A CD  
293  C CE  . LYS A 40  ? 0.4502 0.4502 0.4502 0.0000 0.0000 0.0000 2633 LYS A CE  
294  N NZ  . LYS A 40  ? 0.4696 0.4696 0.4696 0.0000 0.0000 0.0000 2633 LYS A NZ  
295  N N   . SER A 41  ? 0.3975 0.3975 0.3975 0.0000 0.0000 0.0000 2634 SER A N   
296  C CA  A SER A 41  ? 0.4060 0.4060 0.4060 0.0000 0.0000 0.0000 2634 SER A CA  
297  C CA  B SER A 41  ? 0.4028 0.4028 0.4028 0.0000 0.0000 0.0000 2634 SER A CA  
298  C C   . SER A 41  ? 0.4073 0.4073 0.4073 0.0000 0.0000 0.0000 2634 SER A C   
299  O O   . SER A 41  ? 0.4104 0.4104 0.4104 0.0000 0.0000 0.0000 2634 SER A O   
300  C CB  A SER A 41  ? 0.4045 0.4045 0.4045 0.0000 0.0000 0.0000 2634 SER A CB  
301  C CB  B SER A 41  ? 0.4007 0.4007 0.4007 0.0000 0.0000 0.0000 2634 SER A CB  
302  O OG  A SER A 41  ? 0.4059 0.4059 0.4059 0.0000 0.0000 0.0000 2634 SER A OG  
303  O OG  B SER A 41  ? 0.3828 0.3828 0.3828 0.0000 0.0000 0.0000 2634 SER A OG  
304  N N   . GLN A 42  ? 0.4214 0.4214 0.4214 0.0000 0.0000 0.0000 2635 GLN A N   
305  C CA  . GLN A 42  ? 0.4303 0.4303 0.4303 0.0000 0.0000 0.0000 2635 GLN A CA  
306  C C   . GLN A 42  ? 0.4385 0.4385 0.4385 0.0000 0.0000 0.0000 2635 GLN A C   
307  O O   . GLN A 42  ? 0.4404 0.4404 0.4404 0.0000 0.0000 0.0000 2635 GLN A O   
308  C CB  . GLN A 42  ? 0.4317 0.4317 0.4317 0.0000 0.0000 0.0000 2635 GLN A CB  
309  N N   . SER A 43  ? 0.4321 0.4321 0.4321 0.0000 0.0000 0.0000 2636 SER A N   
310  C CA  . SER A 43  ? 0.4413 0.4413 0.4413 0.0000 0.0000 0.0000 2636 SER A CA  
311  C C   . SER A 43  ? 0.4308 0.4308 0.4308 0.0000 0.0000 0.0000 2636 SER A C   
312  O O   . SER A 43  ? 0.4403 0.4403 0.4403 0.0000 0.0000 0.0000 2636 SER A O   
313  C CB  . SER A 43  ? 0.4434 0.4434 0.4434 0.0000 0.0000 0.0000 2636 SER A CB  
314  O OG  . SER A 43  ? 0.4773 0.4773 0.4773 0.0000 0.0000 0.0000 2636 SER A OG  
315  N N   . GLY A 44  ? 0.4204 0.4204 0.4204 0.0000 0.0000 0.0000 2637 GLY A N   
316  C CA  . GLY A 44  ? 0.4064 0.4064 0.4064 0.0000 0.0000 0.0000 2637 GLY A CA  
317  C C   . GLY A 44  ? 0.3935 0.3935 0.3935 0.0000 0.0000 0.0000 2637 GLY A C   
318  O O   . GLY A 44  ? 0.3989 0.3989 0.3989 0.0000 0.0000 0.0000 2637 GLY A O   
319  N N   . TRP A 45  ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 2638 TRP A N   
320  C CA  . TRP A 45  ? 0.3446 0.3446 0.3446 0.0000 0.0000 0.0000 2638 TRP A CA  
321  C C   . TRP A 45  ? 0.3284 0.3284 0.3284 0.0000 0.0000 0.0000 2638 TRP A C   
322  O O   . TRP A 45  ? 0.3315 0.3315 0.3315 0.0000 0.0000 0.0000 2638 TRP A O   
323  C CB  . TRP A 45  ? 0.3399 0.3399 0.3399 0.0000 0.0000 0.0000 2638 TRP A CB  
324  C CG  . TRP A 45  ? 0.3376 0.3376 0.3376 0.0000 0.0000 0.0000 2638 TRP A CG  
325  C CD1 . TRP A 45  ? 0.3574 0.3574 0.3574 0.0000 0.0000 0.0000 2638 TRP A CD1 
326  C CD2 . TRP A 45  ? 0.3386 0.3386 0.3386 0.0000 0.0000 0.0000 2638 TRP A CD2 
327  N NE1 . TRP A 45  ? 0.3704 0.3704 0.3704 0.0000 0.0000 0.0000 2638 TRP A NE1 
328  C CE2 . TRP A 45  ? 0.3456 0.3456 0.3456 0.0000 0.0000 0.0000 2638 TRP A CE2 
329  C CE3 . TRP A 45  ? 0.3119 0.3119 0.3119 0.0000 0.0000 0.0000 2638 TRP A CE3 
330  C CZ2 . TRP A 45  ? 0.3481 0.3481 0.3481 0.0000 0.0000 0.0000 2638 TRP A CZ2 
331  C CZ3 . TRP A 45  ? 0.3196 0.3196 0.3196 0.0000 0.0000 0.0000 2638 TRP A CZ3 
332  C CH2 . TRP A 45  ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 2638 TRP A CH2 
333  N N   . LYS A 46  ? 0.3106 0.3106 0.3106 0.0000 0.0000 0.0000 2639 LYS A N   
334  C CA  . LYS A 46  ? 0.2942 0.2942 0.2942 0.0000 0.0000 0.0000 2639 LYS A CA  
335  C C   . LYS A 46  ? 0.2734 0.2734 0.2734 0.0000 0.0000 0.0000 2639 LYS A C   
336  O O   . LYS A 46  ? 0.2664 0.2664 0.2664 0.0000 0.0000 0.0000 2639 LYS A O   
337  C CB  . LYS A 46  ? 0.3040 0.3040 0.3040 0.0000 0.0000 0.0000 2639 LYS A CB  
338  C CG  . LYS A 46  ? 0.3168 0.3168 0.3168 0.0000 0.0000 0.0000 2639 LYS A CG  
339  C CD  . LYS A 46  ? 0.4056 0.4056 0.4056 0.0000 0.0000 0.0000 2639 LYS A CD  
340  C CE  . LYS A 46  ? 0.4447 0.4447 0.4447 0.0000 0.0000 0.0000 2639 LYS A CE  
341  N NZ  . LYS A 46  ? 0.4827 0.4827 0.4827 0.0000 0.0000 0.0000 2639 LYS A NZ  
342  N N   . TYR A 47  ? 0.2655 0.2655 0.2655 0.0000 0.0000 0.0000 2640 TYR A N   
343  C CA  . TYR A 47  ? 0.2705 0.2705 0.2705 0.0000 0.0000 0.0000 2640 TYR A CA  
344  C C   . TYR A 47  ? 0.2715 0.2715 0.2715 0.0000 0.0000 0.0000 2640 TYR A C   
345  O O   . TYR A 47  ? 0.2861 0.2861 0.2861 0.0000 0.0000 0.0000 2640 TYR A O   
346  C CB  . TYR A 47  ? 0.2590 0.2590 0.2590 0.0000 0.0000 0.0000 2640 TYR A CB  
347  C CG  . TYR A 47  ? 0.2579 0.2579 0.2579 0.0000 0.0000 0.0000 2640 TYR A CG  
348  C CD1 . TYR A 47  ? 0.2483 0.2483 0.2483 0.0000 0.0000 0.0000 2640 TYR A CD1 
349  C CD2 . TYR A 47  ? 0.2500 0.2500 0.2500 0.0000 0.0000 0.0000 2640 TYR A CD2 
350  C CE1 . TYR A 47  ? 0.2383 0.2383 0.2383 0.0000 0.0000 0.0000 2640 TYR A CE1 
351  C CE2 . TYR A 47  ? 0.2506 0.2506 0.2506 0.0000 0.0000 0.0000 2640 TYR A CE2 
352  C CZ  . TYR A 47  ? 0.2340 0.2340 0.2340 0.0000 0.0000 0.0000 2640 TYR A CZ  
353  O OH  . TYR A 47  ? 0.2477 0.2477 0.2477 0.0000 0.0000 0.0000 2640 TYR A OH  
354  N N   . GLY A 48  ? 0.2683 0.2683 0.2683 0.0000 0.0000 0.0000 2641 GLY A N   
355  C CA  . GLY A 48  ? 0.2663 0.2663 0.2663 0.0000 0.0000 0.0000 2641 GLY A CA  
356  C C   . GLY A 48  ? 0.2645 0.2645 0.2645 0.0000 0.0000 0.0000 2641 GLY A C   
357  O O   . GLY A 48  ? 0.2592 0.2592 0.2592 0.0000 0.0000 0.0000 2641 GLY A O   
358  N N   . ILE A 49  ? 0.2602 0.2602 0.2602 0.0000 0.0000 0.0000 2642 ILE A N   
359  C CA  . ILE A 49  ? 0.2660 0.2660 0.2660 0.0000 0.0000 0.0000 2642 ILE A CA  
360  C C   . ILE A 49  ? 0.2649 0.2649 0.2649 0.0000 0.0000 0.0000 2642 ILE A C   
361  O O   . ILE A 49  ? 0.2733 0.2733 0.2733 0.0000 0.0000 0.0000 2642 ILE A O   
362  C CB  . ILE A 49  ? 0.2577 0.2577 0.2577 0.0000 0.0000 0.0000 2642 ILE A CB  
363  C CG1 . ILE A 49  ? 0.2685 0.2685 0.2685 0.0000 0.0000 0.0000 2642 ILE A CG1 
364  C CG2 . ILE A 49  ? 0.2707 0.2707 0.2707 0.0000 0.0000 0.0000 2642 ILE A CG2 
365  C CD1 . ILE A 49  ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 2642 ILE A CD1 
366  N N   . SER A 50  ? 0.2685 0.2685 0.2685 0.0000 0.0000 0.0000 2643 SER A N   
367  C CA  . SER A 50  ? 0.2771 0.2771 0.2771 0.0000 0.0000 0.0000 2643 SER A CA  
368  C C   . SER A 50  ? 0.2749 0.2749 0.2749 0.0000 0.0000 0.0000 2643 SER A C   
369  O O   . SER A 50  ? 0.2740 0.2740 0.2740 0.0000 0.0000 0.0000 2643 SER A O   
370  C CB  . SER A 50  ? 0.2844 0.2844 0.2844 0.0000 0.0000 0.0000 2643 SER A CB  
371  O OG  . SER A 50  ? 0.3209 0.3209 0.3209 0.0000 0.0000 0.0000 2643 SER A OG  
372  N N   . LEU A 51  ? 0.2793 0.2793 0.2793 0.0000 0.0000 0.0000 2644 LEU A N   
373  C CA  . LEU A 51  ? 0.2883 0.2883 0.2883 0.0000 0.0000 0.0000 2644 LEU A CA  
374  C C   . LEU A 51  ? 0.2999 0.2999 0.2999 0.0000 0.0000 0.0000 2644 LEU A C   
375  O O   . LEU A 51  ? 0.3013 0.3013 0.3013 0.0000 0.0000 0.0000 2644 LEU A O   
376  C CB  . LEU A 51  ? 0.2859 0.2859 0.2859 0.0000 0.0000 0.0000 2644 LEU A CB  
377  C CG  . LEU A 51  ? 0.2929 0.2929 0.2929 0.0000 0.0000 0.0000 2644 LEU A CG  
378  C CD1 . LEU A 51  ? 0.3233 0.3233 0.3233 0.0000 0.0000 0.0000 2644 LEU A CD1 
379  C CD2 . LEU A 51  ? 0.3286 0.3286 0.3286 0.0000 0.0000 0.0000 2644 LEU A CD2 
380  N N   . ASP A 52  ? 0.3206 0.3206 0.3206 0.0000 0.0000 0.0000 2645 ASP A N   
381  C CA  . ASP A 52  ? 0.3548 0.3548 0.3548 0.0000 0.0000 0.0000 2645 ASP A CA  
382  C C   . ASP A 52  ? 0.3677 0.3677 0.3677 0.0000 0.0000 0.0000 2645 ASP A C   
383  O O   . ASP A 52  ? 0.3690 0.3690 0.3690 0.0000 0.0000 0.0000 2645 ASP A O   
384  C CB  . ASP A 52  ? 0.3562 0.3562 0.3562 0.0000 0.0000 0.0000 2645 ASP A CB  
385  C CG  . ASP A 52  ? 0.3985 0.3985 0.3985 0.0000 0.0000 0.0000 2645 ASP A CG  
386  O OD1 . ASP A 52  ? 0.4345 0.4345 0.4345 0.0000 0.0000 0.0000 2645 ASP A OD1 
387  O OD2 . ASP A 52  ? 0.4344 0.4344 0.4344 0.0000 0.0000 0.0000 2645 ASP A OD2 
388  N N   . GLU A 53  ? 0.3924 0.3924 0.3924 0.0000 0.0000 0.0000 2646 GLU A N   
389  C CA  . GLU A 53  ? 0.4235 0.4235 0.4235 0.0000 0.0000 0.0000 2646 GLU A CA  
390  C C   . GLU A 53  ? 0.4284 0.4284 0.4284 0.0000 0.0000 0.0000 2646 GLU A C   
391  O O   . GLU A 53  ? 0.4383 0.4383 0.4383 0.0000 0.0000 0.0000 2646 GLU A O   
392  C CB  . GLU A 53  ? 0.4287 0.4287 0.4287 0.0000 0.0000 0.0000 2646 GLU A CB  
393  C CG  . GLU A 53  ? 0.4748 0.4748 0.4748 0.0000 0.0000 0.0000 2646 GLU A CG  
394  C CD  . GLU A 53  ? 0.5124 0.5124 0.5124 0.0000 0.0000 0.0000 2646 GLU A CD  
395  O OE1 . GLU A 53  ? 0.5373 0.5373 0.5373 0.0000 0.0000 0.0000 2646 GLU A OE1 
396  O OE2 . GLU A 53  ? 0.5309 0.5309 0.5309 0.0000 0.0000 0.0000 2646 GLU A OE2 
397  N N   . ASN A 54  ? 0.4393 0.4393 0.4393 0.0000 0.0000 0.0000 2647 ASN A N   
398  C CA  . ASN A 54  ? 0.4364 0.4364 0.4364 0.0000 0.0000 0.0000 2647 ASN A CA  
399  C C   . ASN A 54  ? 0.4327 0.4327 0.4327 0.0000 0.0000 0.0000 2647 ASN A C   
400  O O   . ASN A 54  ? 0.4477 0.4477 0.4477 0.0000 0.0000 0.0000 2647 ASN A O   
401  C CB  . ASN A 54  ? 0.4432 0.4432 0.4432 0.0000 0.0000 0.0000 2647 ASN A CB  
402  N N   . VAL A 55  ? 0.4136 0.4136 0.4136 0.0000 0.0000 0.0000 2648 VAL A N   
403  C CA  . VAL A 55  ? 0.3904 0.3904 0.3904 0.0000 0.0000 0.0000 2648 VAL A CA  
404  C C   . VAL A 55  ? 0.3732 0.3732 0.3732 0.0000 0.0000 0.0000 2648 VAL A C   
405  O O   . VAL A 55  ? 0.3700 0.3700 0.3700 0.0000 0.0000 0.0000 2648 VAL A O   
406  C CB  . VAL A 55  ? 0.3961 0.3961 0.3961 0.0000 0.0000 0.0000 2648 VAL A CB  
407  C CG1 . VAL A 55  ? 0.3999 0.3999 0.3999 0.0000 0.0000 0.0000 2648 VAL A CG1 
408  C CG2 . VAL A 55  ? 0.3947 0.3947 0.3947 0.0000 0.0000 0.0000 2648 VAL A CG2 
409  N N   . LYS A 56  ? 0.3547 0.3547 0.3547 0.0000 0.0000 0.0000 2649 LYS A N   
410  C CA  . LYS A 56  ? 0.3376 0.3376 0.3376 0.0000 0.0000 0.0000 2649 LYS A CA  
411  C C   . LYS A 56  ? 0.3189 0.3189 0.3189 0.0000 0.0000 0.0000 2649 LYS A C   
412  O O   . LYS A 56  ? 0.3102 0.3102 0.3102 0.0000 0.0000 0.0000 2649 LYS A O   
413  C CB  . LYS A 56  ? 0.3443 0.3443 0.3443 0.0000 0.0000 0.0000 2649 LYS A CB  
414  C CG  . LYS A 56  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 2649 LYS A CG  
415  C CD  . LYS A 56  ? 0.4290 0.4290 0.4290 0.0000 0.0000 0.0000 2649 LYS A CD  
416  C CE  . LYS A 56  ? 0.4644 0.4644 0.4644 0.0000 0.0000 0.0000 2649 LYS A CE  
417  N NZ  . LYS A 56  ? 0.4836 0.4836 0.4836 0.0000 0.0000 0.0000 2649 LYS A NZ  
418  N N   . THR A 57  ? 0.3052 0.3052 0.3052 0.0000 0.0000 0.0000 2650 THR A N   
419  C CA  . THR A 57  ? 0.2868 0.2868 0.2868 0.0000 0.0000 0.0000 2650 THR A CA  
420  C C   . THR A 57  ? 0.2729 0.2729 0.2729 0.0000 0.0000 0.0000 2650 THR A C   
421  O O   . THR A 57  ? 0.2788 0.2788 0.2788 0.0000 0.0000 0.0000 2650 THR A O   
422  C CB  . THR A 57  ? 0.2943 0.2943 0.2943 0.0000 0.0000 0.0000 2650 THR A CB  
423  O OG1 . THR A 57  ? 0.2853 0.2853 0.2853 0.0000 0.0000 0.0000 2650 THR A OG1 
424  C CG2 . THR A 57  ? 0.2956 0.2956 0.2956 0.0000 0.0000 0.0000 2650 THR A CG2 
425  N N   . HIS A 58  ? 0.2606 0.2606 0.2606 0.0000 0.0000 0.0000 2651 HIS A N   
426  C CA  . HIS A 58  ? 0.2621 0.2621 0.2621 0.0000 0.0000 0.0000 2651 HIS A CA  
427  C C   . HIS A 58  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2651 HIS A C   
428  O O   . HIS A 58  ? 0.2571 0.2571 0.2571 0.0000 0.0000 0.0000 2651 HIS A O   
429  C CB  . HIS A 58  ? 0.2606 0.2606 0.2606 0.0000 0.0000 0.0000 2651 HIS A CB  
430  C CG  . HIS A 58  ? 0.2772 0.2772 0.2772 0.0000 0.0000 0.0000 2651 HIS A CG  
431  N ND1 . HIS A 58  ? 0.2693 0.2693 0.2693 0.0000 0.0000 0.0000 2651 HIS A ND1 
432  C CD2 . HIS A 58  ? 0.2942 0.2942 0.2942 0.0000 0.0000 0.0000 2651 HIS A CD2 
433  C CE1 . HIS A 58  ? 0.2800 0.2800 0.2800 0.0000 0.0000 0.0000 2651 HIS A CE1 
434  N NE2 . HIS A 58  ? 0.3108 0.3108 0.3108 0.0000 0.0000 0.0000 2651 HIS A NE2 
435  N N   . PRO A 59  ? 0.2553 0.2553 0.2553 0.0000 0.0000 0.0000 2652 PRO A N   
436  C CA  . PRO A 59  ? 0.2514 0.2514 0.2514 0.0000 0.0000 0.0000 2652 PRO A CA  
437  C C   . PRO A 59  ? 0.2500 0.2500 0.2500 0.0000 0.0000 0.0000 2652 PRO A C   
438  O O   . PRO A 59  ? 0.2467 0.2467 0.2467 0.0000 0.0000 0.0000 2652 PRO A O   
439  C CB  . PRO A 59  ? 0.2567 0.2567 0.2567 0.0000 0.0000 0.0000 2652 PRO A CB  
440  C CG  . PRO A 59  ? 0.2725 0.2725 0.2725 0.0000 0.0000 0.0000 2652 PRO A CG  
441  C CD  . PRO A 59  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2652 PRO A CD  
442  N N   . LEU A 60  ? 0.2391 0.2391 0.2391 0.0000 0.0000 0.0000 2653 LEU A N   
443  C CA  . LEU A 60  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2653 LEU A CA  
444  C C   . LEU A 60  ? 0.2520 0.2520 0.2520 0.0000 0.0000 0.0000 2653 LEU A C   
445  O O   . LEU A 60  ? 0.2421 0.2421 0.2421 0.0000 0.0000 0.0000 2653 LEU A O   
446  C CB  . LEU A 60  ? 0.2487 0.2487 0.2487 0.0000 0.0000 0.0000 2653 LEU A CB  
447  C CG  . LEU A 60  ? 0.2747 0.2747 0.2747 0.0000 0.0000 0.0000 2653 LEU A CG  
448  C CD1 . LEU A 60  ? 0.2752 0.2752 0.2752 0.0000 0.0000 0.0000 2653 LEU A CD1 
449  C CD2 . LEU A 60  ? 0.2701 0.2701 0.2701 0.0000 0.0000 0.0000 2653 LEU A CD2 
450  N N   . ILE A 61  ? 0.2564 0.2564 0.2564 0.0000 0.0000 0.0000 2654 ILE A N   
451  C CA  . ILE A 61  ? 0.2624 0.2624 0.2624 0.0000 0.0000 0.0000 2654 ILE A CA  
452  C C   . ILE A 61  ? 0.2647 0.2647 0.2647 0.0000 0.0000 0.0000 2654 ILE A C   
453  O O   . ILE A 61  ? 0.2647 0.2647 0.2647 0.0000 0.0000 0.0000 2654 ILE A O   
454  C CB  . ILE A 61  ? 0.2721 0.2721 0.2721 0.0000 0.0000 0.0000 2654 ILE A CB  
455  C CG1 . ILE A 61  ? 0.2774 0.2774 0.2774 0.0000 0.0000 0.0000 2654 ILE A CG1 
456  C CG2 . ILE A 61  ? 0.2772 0.2772 0.2772 0.0000 0.0000 0.0000 2654 ILE A CG2 
457  C CD1 . ILE A 61  ? 0.2795 0.2795 0.2795 0.0000 0.0000 0.0000 2654 ILE A CD1 
458  N N   . ARG A 62  ? 0.2545 0.2545 0.2545 0.0000 0.0000 0.0000 2655 ARG A N   
459  C CA  . ARG A 62  ? 0.2568 0.2568 0.2568 0.0000 0.0000 0.0000 2655 ARG A CA  
460  C C   . ARG A 62  ? 0.2516 0.2516 0.2516 0.0000 0.0000 0.0000 2655 ARG A C   
461  O O   . ARG A 62  ? 0.2525 0.2525 0.2525 0.0000 0.0000 0.0000 2655 ARG A O   
462  C CB  . ARG A 62  ? 0.2522 0.2522 0.2522 0.0000 0.0000 0.0000 2655 ARG A CB  
463  C CG  . ARG A 62  ? 0.2448 0.2448 0.2448 0.0000 0.0000 0.0000 2655 ARG A CG  
464  C CD  . ARG A 62  ? 0.2514 0.2514 0.2514 0.0000 0.0000 0.0000 2655 ARG A CD  
465  N NE  . ARG A 62  ? 0.2541 0.2541 0.2541 0.0000 0.0000 0.0000 2655 ARG A NE  
466  C CZ  . ARG A 62  ? 0.2579 0.2579 0.2579 0.0000 0.0000 0.0000 2655 ARG A CZ  
467  N NH1 . ARG A 62  ? 0.2292 0.2292 0.2292 0.0000 0.0000 0.0000 2655 ARG A NH1 
468  N NH2 . ARG A 62  ? 0.2612 0.2612 0.2612 0.0000 0.0000 0.0000 2655 ARG A NH2 
469  N N   . PRO A 63  ? 0.2454 0.2454 0.2454 0.0000 0.0000 0.0000 2656 PRO A N   
470  C CA  . PRO A 63  ? 0.2478 0.2478 0.2478 0.0000 0.0000 0.0000 2656 PRO A CA  
471  C C   . PRO A 63  ? 0.2476 0.2476 0.2476 0.0000 0.0000 0.0000 2656 PRO A C   
472  O O   . PRO A 63  ? 0.2455 0.2455 0.2455 0.0000 0.0000 0.0000 2656 PRO A O   
473  C CB  . PRO A 63  ? 0.2520 0.2520 0.2520 0.0000 0.0000 0.0000 2656 PRO A CB  
474  C CG  . PRO A 63  ? 0.2438 0.2438 0.2438 0.0000 0.0000 0.0000 2656 PRO A CG  
475  C CD  . PRO A 63  ? 0.2498 0.2498 0.2498 0.0000 0.0000 0.0000 2656 PRO A CD  
476  N N   . PHE A 64  ? 0.2476 0.2476 0.2476 0.0000 0.0000 0.0000 2657 PHE A N   
477  C CA  . PHE A 64  ? 0.2560 0.2560 0.2560 0.0000 0.0000 0.0000 2657 PHE A CA  
478  C C   . PHE A 64  ? 0.2571 0.2571 0.2571 0.0000 0.0000 0.0000 2657 PHE A C   
479  O O   . PHE A 64  ? 0.2536 0.2536 0.2536 0.0000 0.0000 0.0000 2657 PHE A O   
480  C CB  . PHE A 64  ? 0.2572 0.2572 0.2572 0.0000 0.0000 0.0000 2657 PHE A CB  
481  C CG  . PHE A 64  ? 0.2758 0.2758 0.2758 0.0000 0.0000 0.0000 2657 PHE A CG  
482  C CD1 . PHE A 64  ? 0.2792 0.2792 0.2792 0.0000 0.0000 0.0000 2657 PHE A CD1 
483  C CD2 . PHE A 64  ? 0.2650 0.2650 0.2650 0.0000 0.0000 0.0000 2657 PHE A CD2 
484  C CE1 . PHE A 64  ? 0.2730 0.2730 0.2730 0.0000 0.0000 0.0000 2657 PHE A CE1 
485  C CE2 . PHE A 64  ? 0.2516 0.2516 0.2516 0.0000 0.0000 0.0000 2657 PHE A CE2 
486  C CZ  . PHE A 64  ? 0.2640 0.2640 0.2640 0.0000 0.0000 0.0000 2657 PHE A CZ  
487  N N   . LYS A 65  ? 0.2530 0.2530 0.2530 0.0000 0.0000 0.0000 2658 LYS A N   
488  C CA  . LYS A 65  ? 0.2695 0.2695 0.2695 0.0000 0.0000 0.0000 2658 LYS A CA  
489  C C   . LYS A 65  ? 0.2706 0.2706 0.2706 0.0000 0.0000 0.0000 2658 LYS A C   
490  O O   . LYS A 65  ? 0.2916 0.2916 0.2916 0.0000 0.0000 0.0000 2658 LYS A O   
491  C CB  . LYS A 65  ? 0.2710 0.2710 0.2710 0.0000 0.0000 0.0000 2658 LYS A CB  
492  N N   . THR A 66  ? 0.2628 0.2628 0.2628 0.0000 0.0000 0.0000 2659 THR A N   
493  C CA  . THR A 66  ? 0.2607 0.2607 0.2607 0.0000 0.0000 0.0000 2659 THR A CA  
494  C C   . THR A 66  ? 0.2543 0.2543 0.2543 0.0000 0.0000 0.0000 2659 THR A C   
495  O O   . THR A 66  ? 0.2529 0.2529 0.2529 0.0000 0.0000 0.0000 2659 THR A O   
496  C CB  . THR A 66  ? 0.2603 0.2603 0.2603 0.0000 0.0000 0.0000 2659 THR A CB  
497  O OG1 . THR A 66  ? 0.2624 0.2624 0.2624 0.0000 0.0000 0.0000 2659 THR A OG1 
498  C CG2 . THR A 66  ? 0.2615 0.2615 0.2615 0.0000 0.0000 0.0000 2659 THR A CG2 
499  N N   . LEU A 67  ? 0.2498 0.2498 0.2498 0.0000 0.0000 0.0000 2660 LEU A N   
500  C CA  . LEU A 67  ? 0.2449 0.2449 0.2449 0.0000 0.0000 0.0000 2660 LEU A CA  
501  C C   . LEU A 67  ? 0.2459 0.2459 0.2459 0.0000 0.0000 0.0000 2660 LEU A C   
502  O O   . LEU A 67  ? 0.2584 0.2584 0.2584 0.0000 0.0000 0.0000 2660 LEU A O   
503  C CB  . LEU A 67  ? 0.2427 0.2427 0.2427 0.0000 0.0000 0.0000 2660 LEU A CB  
504  C CG  . LEU A 67  ? 0.2460 0.2460 0.2460 0.0000 0.0000 0.0000 2660 LEU A CG  
505  C CD1 . LEU A 67  ? 0.2340 0.2340 0.2340 0.0000 0.0000 0.0000 2660 LEU A CD1 
506  C CD2 . LEU A 67  ? 0.2672 0.2672 0.2672 0.0000 0.0000 0.0000 2660 LEU A CD2 
507  N N   . THR A 68  ? 0.2517 0.2517 0.2517 0.0000 0.0000 0.0000 2661 THR A N   
508  C CA  . THR A 68  ? 0.2614 0.2614 0.2614 0.0000 0.0000 0.0000 2661 THR A CA  
509  C C   . THR A 68  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 2661 THR A C   
510  O O   . THR A 68  ? 0.2554 0.2554 0.2554 0.0000 0.0000 0.0000 2661 THR A O   
511  C CB  . THR A 68  ? 0.2555 0.2555 0.2555 0.0000 0.0000 0.0000 2661 THR A CB  
512  O OG1 . THR A 68  ? 0.2730 0.2730 0.2730 0.0000 0.0000 0.0000 2661 THR A OG1 
513  C CG2 . THR A 68  ? 0.2787 0.2787 0.2787 0.0000 0.0000 0.0000 2661 THR A CG2 
514  N N   . GLU A 69  ? 0.2802 0.2802 0.2802 0.0000 0.0000 0.0000 2662 GLU A N   
515  C CA  . GLU A 69  ? 0.2905 0.2905 0.2905 0.0000 0.0000 0.0000 2662 GLU A CA  
516  C C   . GLU A 69  ? 0.2847 0.2847 0.2847 0.0000 0.0000 0.0000 2662 GLU A C   
517  O O   . GLU A 69  ? 0.2843 0.2843 0.2843 0.0000 0.0000 0.0000 2662 GLU A O   
518  C CB  . GLU A 69  ? 0.3024 0.3024 0.3024 0.0000 0.0000 0.0000 2662 GLU A CB  
519  C CG  . GLU A 69  ? 0.3433 0.3433 0.3433 0.0000 0.0000 0.0000 2662 GLU A CG  
520  C CD  . GLU A 69  ? 0.3985 0.3985 0.3985 0.0000 0.0000 0.0000 2662 GLU A CD  
521  O OE1 . GLU A 69  ? 0.3918 0.3918 0.3918 0.0000 0.0000 0.0000 2662 GLU A OE1 
522  O OE2 . GLU A 69  ? 0.4298 0.4298 0.4298 0.0000 0.0000 0.0000 2662 GLU A OE2 
523  N N   . LYS A 70  ? 0.2882 0.2882 0.2882 0.0000 0.0000 0.0000 2663 LYS A N   
524  C CA  . LYS A 70  ? 0.2891 0.2891 0.2891 0.0000 0.0000 0.0000 2663 LYS A CA  
525  C C   . LYS A 70  ? 0.2787 0.2787 0.2787 0.0000 0.0000 0.0000 2663 LYS A C   
526  O O   . LYS A 70  ? 0.2641 0.2641 0.2641 0.0000 0.0000 0.0000 2663 LYS A O   
527  C CB  . LYS A 70  ? 0.3004 0.3004 0.3004 0.0000 0.0000 0.0000 2663 LYS A CB  
528  C CG  . LYS A 70  ? 0.3504 0.3504 0.3504 0.0000 0.0000 0.0000 2663 LYS A CG  
529  C CD  . LYS A 70  ? 0.4038 0.4038 0.4038 0.0000 0.0000 0.0000 2663 LYS A CD  
530  C CE  . LYS A 70  ? 0.4630 0.4630 0.4630 0.0000 0.0000 0.0000 2663 LYS A CE  
531  N NZ  . LYS A 70  ? 0.4868 0.4868 0.4868 0.0000 0.0000 0.0000 2663 LYS A NZ  
532  N N   . GLU A 71  ? 0.2605 0.2605 0.2605 0.0000 0.0000 0.0000 2664 GLU A N   
533  C CA  . GLU A 71  ? 0.2629 0.2629 0.2629 0.0000 0.0000 0.0000 2664 GLU A CA  
534  C C   . GLU A 71  ? 0.2583 0.2583 0.2583 0.0000 0.0000 0.0000 2664 GLU A C   
535  O O   . GLU A 71  ? 0.2574 0.2574 0.2574 0.0000 0.0000 0.0000 2664 GLU A O   
536  C CB  . GLU A 71  ? 0.2577 0.2577 0.2577 0.0000 0.0000 0.0000 2664 GLU A CB  
537  C CG  . GLU A 71  ? 0.2638 0.2638 0.2638 0.0000 0.0000 0.0000 2664 GLU A CG  
538  C CD  . GLU A 71  ? 0.2740 0.2740 0.2740 0.0000 0.0000 0.0000 2664 GLU A CD  
539  O OE1 . GLU A 71  ? 0.2902 0.2902 0.2902 0.0000 0.0000 0.0000 2664 GLU A OE1 
540  O OE2 . GLU A 71  ? 0.2686 0.2686 0.2686 0.0000 0.0000 0.0000 2664 GLU A OE2 
541  N N   . LYS A 72  ? 0.2498 0.2498 0.2498 0.0000 0.0000 0.0000 2665 LYS A N   
542  C CA  . LYS A 72  ? 0.2520 0.2520 0.2520 0.0000 0.0000 0.0000 2665 LYS A CA  
543  C C   . LYS A 72  ? 0.2579 0.2579 0.2579 0.0000 0.0000 0.0000 2665 LYS A C   
544  O O   . LYS A 72  ? 0.2573 0.2573 0.2573 0.0000 0.0000 0.0000 2665 LYS A O   
545  C CB  . LYS A 72  ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 2665 LYS A CB  
546  C CG  . LYS A 72  ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 2665 LYS A CG  
547  C CD  . LYS A 72  ? 0.2939 0.2939 0.2939 0.0000 0.0000 0.0000 2665 LYS A CD  
548  C CE  . LYS A 72  ? 0.3330 0.3330 0.3330 0.0000 0.0000 0.0000 2665 LYS A CE  
549  N NZ  . LYS A 72  ? 0.3760 0.3760 0.3760 0.0000 0.0000 0.0000 2665 LYS A NZ  
550  N N   . GLU A 73  ? 0.2516 0.2516 0.2516 0.0000 0.0000 0.0000 2666 GLU A N   
551  C CA  . GLU A 73  ? 0.2569 0.2569 0.2569 0.0000 0.0000 0.0000 2666 GLU A CA  
552  C C   . GLU A 73  ? 0.2496 0.2496 0.2496 0.0000 0.0000 0.0000 2666 GLU A C   
553  O O   . GLU A 73  ? 0.2555 0.2555 0.2555 0.0000 0.0000 0.0000 2666 GLU A O   
554  C CB  . GLU A 73  ? 0.2621 0.2621 0.2621 0.0000 0.0000 0.0000 2666 GLU A CB  
555  C CG  . GLU A 73  ? 0.2690 0.2690 0.2690 0.0000 0.0000 0.0000 2666 GLU A CG  
556  C CD  . GLU A 73  ? 0.3113 0.3113 0.3113 0.0000 0.0000 0.0000 2666 GLU A CD  
557  O OE1 . GLU A 73  ? 0.3118 0.3118 0.3118 0.0000 0.0000 0.0000 2666 GLU A OE1 
558  O OE2 . GLU A 73  ? 0.3494 0.3494 0.3494 0.0000 0.0000 0.0000 2666 GLU A OE2 
559  N N   . ILE A 74  ? 0.2501 0.2501 0.2501 0.0000 0.0000 0.0000 2667 ILE A N   
560  C CA  . ILE A 74  ? 0.2543 0.2543 0.2543 0.0000 0.0000 0.0000 2667 ILE A CA  
561  C C   . ILE A 74  ? 0.2541 0.2541 0.2541 0.0000 0.0000 0.0000 2667 ILE A C   
562  O O   . ILE A 74  ? 0.2563 0.2563 0.2563 0.0000 0.0000 0.0000 2667 ILE A O   
563  C CB  . ILE A 74  ? 0.2577 0.2577 0.2577 0.0000 0.0000 0.0000 2667 ILE A CB  
564  C CG1 . ILE A 74  ? 0.2640 0.2640 0.2640 0.0000 0.0000 0.0000 2667 ILE A CG1 
565  C CG2 . ILE A 74  ? 0.2631 0.2631 0.2631 0.0000 0.0000 0.0000 2667 ILE A CG2 
566  C CD1 . ILE A 74  ? 0.2866 0.2866 0.2866 0.0000 0.0000 0.0000 2667 ILE A CD1 
567  N N   . TYR A 75  ? 0.2495 0.2495 0.2495 0.0000 0.0000 0.0000 2668 TYR A N   
568  C CA  . TYR A 75  ? 0.2441 0.2441 0.2441 0.0000 0.0000 0.0000 2668 TYR A CA  
569  C C   . TYR A 75  ? 0.2454 0.2454 0.2454 0.0000 0.0000 0.0000 2668 TYR A C   
570  O O   . TYR A 75  ? 0.2610 0.2610 0.2610 0.0000 0.0000 0.0000 2668 TYR A O   
571  C CB  . TYR A 75  ? 0.2365 0.2365 0.2365 0.0000 0.0000 0.0000 2668 TYR A CB  
572  C CG  . TYR A 75  ? 0.2381 0.2381 0.2381 0.0000 0.0000 0.0000 2668 TYR A CG  
573  C CD1 . TYR A 75  ? 0.2609 0.2609 0.2609 0.0000 0.0000 0.0000 2668 TYR A CD1 
574  C CD2 . TYR A 75  ? 0.2279 0.2279 0.2279 0.0000 0.0000 0.0000 2668 TYR A CD2 
575  C CE1 . TYR A 75  ? 0.2593 0.2593 0.2593 0.0000 0.0000 0.0000 2668 TYR A CE1 
576  C CE2 . TYR A 75  ? 0.2382 0.2382 0.2382 0.0000 0.0000 0.0000 2668 TYR A CE2 
577  C CZ  . TYR A 75  ? 0.2405 0.2405 0.2405 0.0000 0.0000 0.0000 2668 TYR A CZ  
578  O OH  . TYR A 75  ? 0.2562 0.2562 0.2562 0.0000 0.0000 0.0000 2668 TYR A OH  
579  N N   . ARG A 76  ? 0.2441 0.2441 0.2441 0.0000 0.0000 0.0000 2669 ARG A N   
580  C CA  . ARG A 76  ? 0.2519 0.2519 0.2519 0.0000 0.0000 0.0000 2669 ARG A CA  
581  C C   . ARG A 76  ? 0.2550 0.2550 0.2550 0.0000 0.0000 0.0000 2669 ARG A C   
582  O O   . ARG A 76  ? 0.2533 0.2533 0.2533 0.0000 0.0000 0.0000 2669 ARG A O   
583  C CB  . ARG A 76  ? 0.2492 0.2492 0.2492 0.0000 0.0000 0.0000 2669 ARG A CB  
584  C CG  . ARG A 76  ? 0.2595 0.2595 0.2595 0.0000 0.0000 0.0000 2669 ARG A CG  
585  C CD  . ARG A 76  ? 0.2840 0.2840 0.2840 0.0000 0.0000 0.0000 2669 ARG A CD  
586  N NE  . ARG A 76  ? 0.3118 0.3118 0.3118 0.0000 0.0000 0.0000 2669 ARG A NE  
587  C CZ  . ARG A 76  ? 0.3190 0.3190 0.3190 0.0000 0.0000 0.0000 2669 ARG A CZ  
588  N NH1 . ARG A 76  ? 0.3165 0.3165 0.3165 0.0000 0.0000 0.0000 2669 ARG A NH1 
589  N NH2 . ARG A 76  ? 0.3243 0.3243 0.3243 0.0000 0.0000 0.0000 2669 ARG A NH2 
590  N N   . TRP A 77  ? 0.2543 0.2543 0.2543 0.0000 0.0000 0.0000 2670 TRP A N   
591  C CA  . TRP A 77  ? 0.2546 0.2546 0.2546 0.0000 0.0000 0.0000 2670 TRP A CA  
592  C C   . TRP A 77  ? 0.2503 0.2503 0.2503 0.0000 0.0000 0.0000 2670 TRP A C   
593  O O   . TRP A 77  ? 0.2521 0.2521 0.2521 0.0000 0.0000 0.0000 2670 TRP A O   
594  C CB  . TRP A 77  ? 0.2622 0.2622 0.2622 0.0000 0.0000 0.0000 2670 TRP A CB  
595  C CG  . TRP A 77  ? 0.2907 0.2907 0.2907 0.0000 0.0000 0.0000 2670 TRP A CG  
596  C CD1 . TRP A 77  ? 0.3204 0.3204 0.3204 0.0000 0.0000 0.0000 2670 TRP A CD1 
597  C CD2 . TRP A 77  ? 0.3104 0.3104 0.3104 0.0000 0.0000 0.0000 2670 TRP A CD2 
598  N NE1 . TRP A 77  ? 0.3235 0.3235 0.3235 0.0000 0.0000 0.0000 2670 TRP A NE1 
599  C CE2 . TRP A 77  ? 0.3266 0.3266 0.3266 0.0000 0.0000 0.0000 2670 TRP A CE2 
600  C CE3 . TRP A 77  ? 0.3294 0.3294 0.3294 0.0000 0.0000 0.0000 2670 TRP A CE3 
601  C CZ2 . TRP A 77  ? 0.3129 0.3129 0.3129 0.0000 0.0000 0.0000 2670 TRP A CZ2 
602  C CZ3 . TRP A 77  ? 0.3203 0.3203 0.3203 0.0000 0.0000 0.0000 2670 TRP A CZ3 
603  C CH2 . TRP A 77  ? 0.3089 0.3089 0.3089 0.0000 0.0000 0.0000 2670 TRP A CH2 
604  N N   . PRO A 78  ? 0.2541 0.2541 0.2541 0.0000 0.0000 0.0000 2671 PRO A N   
605  C CA  . PRO A 78  ? 0.2571 0.2571 0.2571 0.0000 0.0000 0.0000 2671 PRO A CA  
606  C C   . PRO A 78  ? 0.2581 0.2581 0.2581 0.0000 0.0000 0.0000 2671 PRO A C   
607  O O   . PRO A 78  ? 0.2677 0.2677 0.2677 0.0000 0.0000 0.0000 2671 PRO A O   
608  C CB  . PRO A 78  ? 0.2725 0.2725 0.2725 0.0000 0.0000 0.0000 2671 PRO A CB  
609  C CG  . PRO A 78  ? 0.2620 0.2620 0.2620 0.0000 0.0000 0.0000 2671 PRO A CG  
610  C CD  . PRO A 78  ? 0.2526 0.2526 0.2526 0.0000 0.0000 0.0000 2671 PRO A CD  
611  N N   . ALA A 79  ? 0.2592 0.2592 0.2592 0.0000 0.0000 0.0000 2672 ALA A N   
612  C CA  . ALA A 79  ? 0.2543 0.2543 0.2543 0.0000 0.0000 0.0000 2672 ALA A CA  
613  C C   . ALA A 79  ? 0.2453 0.2453 0.2453 0.0000 0.0000 0.0000 2672 ALA A C   
614  O O   . ALA A 79  ? 0.2383 0.2383 0.2383 0.0000 0.0000 0.0000 2672 ALA A O   
615  C CB  . ALA A 79  ? 0.2572 0.2572 0.2572 0.0000 0.0000 0.0000 2672 ALA A CB  
616  N N   . ARG A 80  ? 0.2398 0.2398 0.2398 0.0000 0.0000 0.0000 2673 ARG A N   
617  C CA  . ARG A 80  ? 0.2410 0.2410 0.2410 0.0000 0.0000 0.0000 2673 ARG A CA  
618  C C   . ARG A 80  ? 0.2368 0.2368 0.2368 0.0000 0.0000 0.0000 2673 ARG A C   
619  O O   . ARG A 80  ? 0.2334 0.2334 0.2334 0.0000 0.0000 0.0000 2673 ARG A O   
620  C CB  . ARG A 80  ? 0.2367 0.2367 0.2367 0.0000 0.0000 0.0000 2673 ARG A CB  
621  C CG  . ARG A 80  ? 0.2591 0.2591 0.2591 0.0000 0.0000 0.0000 2673 ARG A CG  
622  C CD  . ARG A 80  ? 0.2935 0.2935 0.2935 0.0000 0.0000 0.0000 2673 ARG A CD  
623  N NE  . ARG A 80  ? 0.2920 0.2920 0.2920 0.0000 0.0000 0.0000 2673 ARG A NE  
624  C CZ  . ARG A 80  ? 0.2957 0.2957 0.2957 0.0000 0.0000 0.0000 2673 ARG A CZ  
625  N NH1 . ARG A 80  ? 0.2956 0.2956 0.2956 0.0000 0.0000 0.0000 2673 ARG A NH1 
626  N NH2 . ARG A 80  ? 0.2947 0.2947 0.2947 0.0000 0.0000 0.0000 2673 ARG A NH2 
627  N N   . GLU A 81  ? 0.2384 0.2384 0.2384 0.0000 0.0000 0.0000 2674 GLU A N   
628  C CA  . GLU A 81  ? 0.2367 0.2367 0.2367 0.0000 0.0000 0.0000 2674 GLU A CA  
629  C C   . GLU A 81  ? 0.2407 0.2407 0.2407 0.0000 0.0000 0.0000 2674 GLU A C   
630  O O   . GLU A 81  ? 0.2372 0.2372 0.2372 0.0000 0.0000 0.0000 2674 GLU A O   
631  C CB  . GLU A 81  ? 0.2411 0.2411 0.2411 0.0000 0.0000 0.0000 2674 GLU A CB  
632  C CG  . GLU A 81  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 2674 GLU A CG  
633  C CD  . GLU A 81  ? 0.3023 0.3023 0.3023 0.0000 0.0000 0.0000 2674 GLU A CD  
634  O OE1 . GLU A 81  ? 0.3070 0.3070 0.3070 0.0000 0.0000 0.0000 2674 GLU A OE1 
635  O OE2 . GLU A 81  ? 0.3197 0.3197 0.3197 0.0000 0.0000 0.0000 2674 GLU A OE2 
636  N N   . SER A 82  ? 0.2421 0.2421 0.2421 0.0000 0.0000 0.0000 2675 SER A N   
637  C CA  . SER A 82  ? 0.2396 0.2396 0.2396 0.0000 0.0000 0.0000 2675 SER A CA  
638  C C   . SER A 82  ? 0.2330 0.2330 0.2330 0.0000 0.0000 0.0000 2675 SER A C   
639  O O   . SER A 82  ? 0.2269 0.2269 0.2269 0.0000 0.0000 0.0000 2675 SER A O   
640  C CB  . SER A 82  ? 0.2463 0.2463 0.2463 0.0000 0.0000 0.0000 2675 SER A CB  
641  O OG  . SER A 82  ? 0.2816 0.2816 0.2816 0.0000 0.0000 0.0000 2675 SER A OG  
642  N N   . LEU A 83  ? 0.2227 0.2227 0.2227 0.0000 0.0000 0.0000 2676 LEU A N   
643  C CA  . LEU A 83  ? 0.2362 0.2362 0.2362 0.0000 0.0000 0.0000 2676 LEU A CA  
644  C C   . LEU A 83  ? 0.2362 0.2362 0.2362 0.0000 0.0000 0.0000 2676 LEU A C   
645  O O   . LEU A 83  ? 0.2244 0.2244 0.2244 0.0000 0.0000 0.0000 2676 LEU A O   
646  C CB  . LEU A 83  ? 0.2311 0.2311 0.2311 0.0000 0.0000 0.0000 2676 LEU A CB  
647  C CG  . LEU A 83  ? 0.2590 0.2590 0.2590 0.0000 0.0000 0.0000 2676 LEU A CG  
648  C CD1 . LEU A 83  ? 0.2882 0.2882 0.2882 0.0000 0.0000 0.0000 2676 LEU A CD1 
649  C CD2 . LEU A 83  ? 0.2986 0.2986 0.2986 0.0000 0.0000 0.0000 2676 LEU A CD2 
650  N N   . LYS A 84  ? 0.2386 0.2386 0.2386 0.0000 0.0000 0.0000 2677 LYS A N   
651  C CA  . LYS A 84  ? 0.2327 0.2327 0.2327 0.0000 0.0000 0.0000 2677 LYS A CA  
652  C C   . LYS A 84  ? 0.2400 0.2400 0.2400 0.0000 0.0000 0.0000 2677 LYS A C   
653  O O   . LYS A 84  ? 0.2426 0.2426 0.2426 0.0000 0.0000 0.0000 2677 LYS A O   
654  C CB  . LYS A 84  ? 0.2386 0.2386 0.2386 0.0000 0.0000 0.0000 2677 LYS A CB  
655  C CG  . LYS A 84  ? 0.2486 0.2486 0.2486 0.0000 0.0000 0.0000 2677 LYS A CG  
656  C CD  . LYS A 84  ? 0.3026 0.3026 0.3026 0.0000 0.0000 0.0000 2677 LYS A CD  
657  C CE  . LYS A 84  ? 0.3466 0.3466 0.3466 0.0000 0.0000 0.0000 2677 LYS A CE  
658  N NZ  . LYS A 84  ? 0.3594 0.3594 0.3594 0.0000 0.0000 0.0000 2677 LYS A NZ  
659  N N   . THR A 85  ? 0.2311 0.2311 0.2311 0.0000 0.0000 0.0000 2678 THR A N   
660  C CA  . THR A 85  ? 0.2303 0.2303 0.2303 0.0000 0.0000 0.0000 2678 THR A CA  
661  C C   . THR A 85  ? 0.2339 0.2339 0.2339 0.0000 0.0000 0.0000 2678 THR A C   
662  O O   . THR A 85  ? 0.2411 0.2411 0.2411 0.0000 0.0000 0.0000 2678 THR A O   
663  C CB  . THR A 85  ? 0.2362 0.2362 0.2362 0.0000 0.0000 0.0000 2678 THR A CB  
664  O OG1 . THR A 85  ? 0.2491 0.2491 0.2491 0.0000 0.0000 0.0000 2678 THR A OG1 
665  C CG2 . THR A 85  ? 0.2402 0.2402 0.2402 0.0000 0.0000 0.0000 2678 THR A CG2 
666  N N   . MET A 86  ? 0.2351 0.2351 0.2351 0.0000 0.0000 0.0000 2679 MET A N   
667  C CA  . MET A 86  ? 0.2417 0.2417 0.2417 0.0000 0.0000 0.0000 2679 MET A CA  
668  C C   . MET A 86  ? 0.2413 0.2413 0.2413 0.0000 0.0000 0.0000 2679 MET A C   
669  O O   . MET A 86  ? 0.2519 0.2519 0.2519 0.0000 0.0000 0.0000 2679 MET A O   
670  C CB  . MET A 86  ? 0.2443 0.2443 0.2443 0.0000 0.0000 0.0000 2679 MET A CB  
671  C CG  . MET A 86  ? 0.2558 0.2558 0.2558 0.0000 0.0000 0.0000 2679 MET A CG  
672  S SD  . MET A 86  ? 0.2743 0.2743 0.2743 0.0000 0.0000 0.0000 2679 MET A SD  
673  C CE  . MET A 86  ? 0.2524 0.2524 0.2524 0.0000 0.0000 0.0000 2679 MET A CE  
674  N N   . LEU A 87  ? 0.2496 0.2496 0.2496 0.0000 0.0000 0.0000 2680 LEU A N   
675  C CA  . LEU A 87  ? 0.2603 0.2603 0.2603 0.0000 0.0000 0.0000 2680 LEU A CA  
676  C C   . LEU A 87  ? 0.2649 0.2649 0.2649 0.0000 0.0000 0.0000 2680 LEU A C   
677  O O   . LEU A 87  ? 0.2685 0.2685 0.2685 0.0000 0.0000 0.0000 2680 LEU A O   
678  C CB  . LEU A 87  ? 0.2576 0.2576 0.2576 0.0000 0.0000 0.0000 2680 LEU A CB  
679  C CG  . LEU A 87  ? 0.2899 0.2899 0.2899 0.0000 0.0000 0.0000 2680 LEU A CG  
680  C CD1 . LEU A 87  ? 0.3204 0.3204 0.3204 0.0000 0.0000 0.0000 2680 LEU A CD1 
681  C CD2 . LEU A 87  ? 0.3011 0.3011 0.3011 0.0000 0.0000 0.0000 2680 LEU A CD2 
682  N N   . ALA A 88  ? 0.2636 0.2636 0.2636 0.0000 0.0000 0.0000 2681 ALA A N   
683  C CA  . ALA A 88  ? 0.2666 0.2666 0.2666 0.0000 0.0000 0.0000 2681 ALA A CA  
684  C C   . ALA A 88  ? 0.2688 0.2688 0.2688 0.0000 0.0000 0.0000 2681 ALA A C   
685  O O   . ALA A 88  ? 0.2721 0.2721 0.2721 0.0000 0.0000 0.0000 2681 ALA A O   
686  C CB  . ALA A 88  ? 0.2648 0.2648 0.2648 0.0000 0.0000 0.0000 2681 ALA A CB  
687  N N   . VAL A 89  ? 0.2672 0.2672 0.2672 0.0000 0.0000 0.0000 2682 VAL A N   
688  C CA  . VAL A 89  ? 0.2791 0.2791 0.2791 0.0000 0.0000 0.0000 2682 VAL A CA  
689  C C   . VAL A 89  ? 0.2849 0.2849 0.2849 0.0000 0.0000 0.0000 2682 VAL A C   
690  O O   . VAL A 89  ? 0.2953 0.2953 0.2953 0.0000 0.0000 0.0000 2682 VAL A O   
691  C CB  . VAL A 89  ? 0.2783 0.2783 0.2783 0.0000 0.0000 0.0000 2682 VAL A CB  
692  C CG1 . VAL A 89  ? 0.2721 0.2721 0.2721 0.0000 0.0000 0.0000 2682 VAL A CG1 
693  C CG2 . VAL A 89  ? 0.2826 0.2826 0.2826 0.0000 0.0000 0.0000 2682 VAL A CG2 
694  N N   . GLY A 90  ? 0.2920 0.2920 0.2920 0.0000 0.0000 0.0000 2683 GLY A N   
695  C CA  . GLY A 90  ? 0.3081 0.3081 0.3081 0.0000 0.0000 0.0000 2683 GLY A CA  
696  C C   . GLY A 90  ? 0.3124 0.3124 0.3124 0.0000 0.0000 0.0000 2683 GLY A C   
697  O O   . GLY A 90  ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 2683 GLY A O   
698  N N   . TRP A 91  ? 0.3061 0.3061 0.3061 0.0000 0.0000 0.0000 2684 TRP A N   
699  C CA  . TRP A 91  ? 0.3091 0.3091 0.3091 0.0000 0.0000 0.0000 2684 TRP A CA  
700  C C   . TRP A 91  ? 0.3184 0.3184 0.3184 0.0000 0.0000 0.0000 2684 TRP A C   
701  O O   . TRP A 91  ? 0.3246 0.3246 0.3246 0.0000 0.0000 0.0000 2684 TRP A O   
702  C CB  . TRP A 91  ? 0.2966 0.2966 0.2966 0.0000 0.0000 0.0000 2684 TRP A CB  
703  C CG  . TRP A 91  ? 0.2969 0.2969 0.2969 0.0000 0.0000 0.0000 2684 TRP A CG  
704  C CD1 . TRP A 91  ? 0.2975 0.2975 0.2975 0.0000 0.0000 0.0000 2684 TRP A CD1 
705  C CD2 . TRP A 91  ? 0.2942 0.2942 0.2942 0.0000 0.0000 0.0000 2684 TRP A CD2 
706  N NE1 . TRP A 91  ? 0.2972 0.2972 0.2972 0.0000 0.0000 0.0000 2684 TRP A NE1 
707  C CE2 . TRP A 91  ? 0.2828 0.2828 0.2828 0.0000 0.0000 0.0000 2684 TRP A CE2 
708  C CE3 . TRP A 91  ? 0.3108 0.3108 0.3108 0.0000 0.0000 0.0000 2684 TRP A CE3 
709  C CZ2 . TRP A 91  ? 0.2868 0.2868 0.2868 0.0000 0.0000 0.0000 2684 TRP A CZ2 
710  C CZ3 . TRP A 91  ? 0.2864 0.2864 0.2864 0.0000 0.0000 0.0000 2684 TRP A CZ3 
711  C CH2 . TRP A 91  ? 0.3000 0.3000 0.3000 0.0000 0.0000 0.0000 2684 TRP A CH2 
712  N N   . THR A 92  ? 0.3367 0.3367 0.3367 0.0000 0.0000 0.0000 2685 THR A N   
713  C CA  . THR A 92  ? 0.3551 0.3551 0.3551 0.0000 0.0000 0.0000 2685 THR A CA  
714  C C   . THR A 92  ? 0.3512 0.3512 0.3512 0.0000 0.0000 0.0000 2685 THR A C   
715  O O   . THR A 92  ? 0.3491 0.3491 0.3491 0.0000 0.0000 0.0000 2685 THR A O   
716  C CB  . THR A 92  ? 0.3626 0.3626 0.3626 0.0000 0.0000 0.0000 2685 THR A CB  
717  O OG1 . THR A 92  ? 0.4052 0.4052 0.4052 0.0000 0.0000 0.0000 2685 THR A OG1 
718  C CG2 . THR A 92  ? 0.3647 0.3647 0.3647 0.0000 0.0000 0.0000 2685 THR A CG2 
719  N N   . VAL A 93  ? 0.3515 0.3515 0.3515 0.0000 0.0000 0.0000 2686 VAL A N   
720  C CA  . VAL A 93  ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 2686 VAL A CA  
721  C C   . VAL A 93  ? 0.3745 0.3745 0.3745 0.0000 0.0000 0.0000 2686 VAL A C   
722  O O   . VAL A 93  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 2686 VAL A O   
723  C CB  . VAL A 93  ? 0.3508 0.3508 0.3508 0.0000 0.0000 0.0000 2686 VAL A CB  
724  C CG1 . VAL A 93  ? 0.3495 0.3495 0.3495 0.0000 0.0000 0.0000 2686 VAL A CG1 
725  C CG2 . VAL A 93  ? 0.3425 0.3425 0.3425 0.0000 0.0000 0.0000 2686 VAL A CG2 
726  N N   . GLU A 94  ? 0.3856 0.3856 0.3856 0.0000 0.0000 0.0000 2687 GLU A N   
727  C CA  . GLU A 94  ? 0.3993 0.3993 0.3993 0.0000 0.0000 0.0000 2687 GLU A CA  
728  C C   . GLU A 94  ? 0.4059 0.4059 0.4059 0.0000 0.0000 0.0000 2687 GLU A C   
729  O O   . GLU A 94  ? 0.3965 0.3965 0.3965 0.0000 0.0000 0.0000 2687 GLU A O   
730  C CB  . GLU A 94  ? 0.4016 0.4016 0.4016 0.0000 0.0000 0.0000 2687 GLU A CB  
731  N N   . ARG A 95  ? 0.4157 0.4157 0.4157 0.0000 0.0000 0.0000 2688 ARG A N   
732  C CA  . ARG A 95  ? 0.4322 0.4322 0.4322 0.0000 0.0000 0.0000 2688 ARG A CA  
733  C C   . ARG A 95  ? 0.4425 0.4425 0.4425 0.0000 0.0000 0.0000 2688 ARG A C   
734  O O   . ARG A 95  ? 0.4453 0.4453 0.4453 0.0000 0.0000 0.0000 2688 ARG A O   
735  C CB  . ARG A 95  ? 0.4317 0.4317 0.4317 0.0000 0.0000 0.0000 2688 ARG A CB  
736  N N   . THR A 96  ? 0.4475 0.4475 0.4475 0.0000 0.0000 0.0000 2689 THR A N   
737  C CA  . THR A 96  ? 0.4601 0.4601 0.4601 0.0000 0.0000 0.0000 2689 THR A CA  
738  C C   . THR A 96  ? 0.4632 0.4632 0.4632 0.0000 0.0000 0.0000 2689 THR A C   
739  O O   . THR A 96  ? 0.4611 0.4611 0.4611 0.0000 0.0000 0.0000 2689 THR A O   
740  C CB  . THR A 96  ? 0.4578 0.4578 0.4578 0.0000 0.0000 0.0000 2689 THR A CB  
741  O OG1 . THR A 96  ? 0.4710 0.4710 0.4710 0.0000 0.0000 0.0000 2689 THR A OG1 
742  C CG2 . THR A 96  ? 0.4736 0.4736 0.4736 0.0000 0.0000 0.0000 2689 THR A CG2 
743  N N   . LYS A 97  ? 0.4700 0.4700 0.4700 0.0000 0.0000 0.0000 2690 LYS A N   
744  C CA  . LYS A 97  ? 0.4710 0.4710 0.4710 0.0000 0.0000 0.0000 2690 LYS A CA  
745  C C   . LYS A 97  ? 0.4735 0.4735 0.4735 0.0000 0.0000 0.0000 2690 LYS A C   
746  O O   . LYS A 97  ? 0.4698 0.4698 0.4698 0.0000 0.0000 0.0000 2690 LYS A O   
747  C CB  . LYS A 97  ? 0.4777 0.4777 0.4777 0.0000 0.0000 0.0000 2690 LYS A CB  
748  N N   . GLY A 99  ? 0.4455 0.4455 0.4455 0.0000 0.0000 0.0000 2692 GLY A N   
749  C CA  . GLY A 99  ? 0.4344 0.4344 0.4344 0.0000 0.0000 0.0000 2692 GLY A CA  
750  C C   . GLY A 99  ? 0.4280 0.4280 0.4280 0.0000 0.0000 0.0000 2692 GLY A C   
751  O O   . GLY A 99  ? 0.4345 0.4345 0.4345 0.0000 0.0000 0.0000 2692 GLY A O   
752  N N   . GLU A 100 ? 0.4208 0.4208 0.4208 0.0000 0.0000 0.0000 2693 GLU A N   
753  C CA  . GLU A 100 ? 0.4109 0.4109 0.4109 0.0000 0.0000 0.0000 2693 GLU A CA  
754  C C   . GLU A 100 ? 0.4016 0.4016 0.4016 0.0000 0.0000 0.0000 2693 GLU A C   
755  O O   . GLU A 100 ? 0.4047 0.4047 0.4047 0.0000 0.0000 0.0000 2693 GLU A O   
756  C CB  . GLU A 100 ? 0.4212 0.4212 0.4212 0.0000 0.0000 0.0000 2693 GLU A CB  
757  N N   . ALA A 101 ? 0.3791 0.3791 0.3791 0.0000 0.0000 0.0000 2694 ALA A N   
758  C CA  . ALA A 101 ? 0.3576 0.3576 0.3576 0.0000 0.0000 0.0000 2694 ALA A CA  
759  C C   . ALA A 101 ? 0.3406 0.3406 0.3406 0.0000 0.0000 0.0000 2694 ALA A C   
760  O O   . ALA A 101 ? 0.3196 0.3196 0.3196 0.0000 0.0000 0.0000 2694 ALA A O   
761  C CB  . ALA A 101 ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 2694 ALA A CB  
762  N N   . LEU A 102 ? 0.3300 0.3300 0.3300 0.0000 0.0000 0.0000 2695 LEU A N   
763  C CA  . LEU A 102 ? 0.3223 0.3223 0.3223 0.0000 0.0000 0.0000 2695 LEU A CA  
764  C C   . LEU A 102 ? 0.3133 0.3133 0.3133 0.0000 0.0000 0.0000 2695 LEU A C   
765  O O   . LEU A 102 ? 0.3124 0.3124 0.3124 0.0000 0.0000 0.0000 2695 LEU A O   
766  C CB  . LEU A 102 ? 0.3243 0.3243 0.3243 0.0000 0.0000 0.0000 2695 LEU A CB  
767  C CG  . LEU A 102 ? 0.3352 0.3352 0.3352 0.0000 0.0000 0.0000 2695 LEU A CG  
768  C CD1 . LEU A 102 ? 0.3280 0.3280 0.3280 0.0000 0.0000 0.0000 2695 LEU A CD1 
769  C CD2 . LEU A 102 ? 0.3513 0.3513 0.3513 0.0000 0.0000 0.0000 2695 LEU A CD2 
770  N N   . VAL A 103 ? 0.3061 0.3061 0.3061 0.0000 0.0000 0.0000 2696 VAL A N   
771  C CA  . VAL A 103 ? 0.3035 0.3035 0.3035 0.0000 0.0000 0.0000 2696 VAL A CA  
772  C C   . VAL A 103 ? 0.3033 0.3033 0.3033 0.0000 0.0000 0.0000 2696 VAL A C   
773  O O   . VAL A 103 ? 0.2971 0.2971 0.2971 0.0000 0.0000 0.0000 2696 VAL A O   
774  C CB  . VAL A 103 ? 0.3067 0.3067 0.3067 0.0000 0.0000 0.0000 2696 VAL A CB  
775  C CG1 . VAL A 103 ? 0.3086 0.3086 0.3086 0.0000 0.0000 0.0000 2696 VAL A CG1 
776  C CG2 . VAL A 103 ? 0.3038 0.3038 0.3038 0.0000 0.0000 0.0000 2696 VAL A CG2 
777  N N   . GLN A 104 ? 0.3108 0.3108 0.3108 0.0000 0.0000 0.0000 2697 GLN A N   
778  C CA  . GLN A 104 ? 0.3146 0.3146 0.3146 0.0000 0.0000 0.0000 2697 GLN A CA  
779  C C   . GLN A 104 ? 0.3118 0.3118 0.3118 0.0000 0.0000 0.0000 2697 GLN A C   
780  O O   . GLN A 104 ? 0.3023 0.3023 0.3023 0.0000 0.0000 0.0000 2697 GLN A O   
781  C CB  . GLN A 104 ? 0.3305 0.3305 0.3305 0.0000 0.0000 0.0000 2697 GLN A CB  
782  C CG  . GLN A 104 ? 0.3677 0.3677 0.3677 0.0000 0.0000 0.0000 2697 GLN A CG  
783  C CD  . GLN A 104 ? 0.4420 0.4420 0.4420 0.0000 0.0000 0.0000 2697 GLN A CD  
784  O OE1 . GLN A 104 ? 0.4803 0.4803 0.4803 0.0000 0.0000 0.0000 2697 GLN A OE1 
785  N NE2 . GLN A 104 ? 0.4620 0.4620 0.4620 0.0000 0.0000 0.0000 2697 GLN A NE2 
786  N N   . GLN A 105 ? 0.3067 0.3067 0.3067 0.0000 0.0000 0.0000 2698 GLN A N   
787  C CA  . GLN A 105 ? 0.3133 0.3133 0.3133 0.0000 0.0000 0.0000 2698 GLN A CA  
788  C C   . GLN A 105 ? 0.3159 0.3159 0.3159 0.0000 0.0000 0.0000 2698 GLN A C   
789  O O   . GLN A 105 ? 0.3053 0.3053 0.3053 0.0000 0.0000 0.0000 2698 GLN A O   
790  C CB  . GLN A 105 ? 0.3154 0.3154 0.3154 0.0000 0.0000 0.0000 2698 GLN A CB  
791  C CG  . GLN A 105 ? 0.3152 0.3152 0.3152 0.0000 0.0000 0.0000 2698 GLN A CG  
792  C CD  . GLN A 105 ? 0.3515 0.3515 0.3515 0.0000 0.0000 0.0000 2698 GLN A CD  
793  O OE1 . GLN A 105 ? 0.3514 0.3514 0.3514 0.0000 0.0000 0.0000 2698 GLN A OE1 
794  N NE2 . GLN A 105 ? 0.3746 0.3746 0.3746 0.0000 0.0000 0.0000 2698 GLN A NE2 
795  N N   . ARG A 106 ? 0.3199 0.3199 0.3199 0.0000 0.0000 0.0000 2699 ARG A N   
796  C CA  . ARG A 106 ? 0.3339 0.3339 0.3339 0.0000 0.0000 0.0000 2699 ARG A CA  
797  C C   . ARG A 106 ? 0.3413 0.3413 0.3413 0.0000 0.0000 0.0000 2699 ARG A C   
798  O O   . ARG A 106 ? 0.3433 0.3433 0.3433 0.0000 0.0000 0.0000 2699 ARG A O   
799  C CB  . ARG A 106 ? 0.3334 0.3334 0.3334 0.0000 0.0000 0.0000 2699 ARG A CB  
800  C CG  . ARG A 106 ? 0.3482 0.3482 0.3482 0.0000 0.0000 0.0000 2699 ARG A CG  
801  C CD  . ARG A 106 ? 0.3348 0.3348 0.3348 0.0000 0.0000 0.0000 2699 ARG A CD  
802  N NE  . ARG A 106 ? 0.3298 0.3298 0.3298 0.0000 0.0000 0.0000 2699 ARG A NE  
803  C CZ  . ARG A 106 ? 0.3206 0.3206 0.3206 0.0000 0.0000 0.0000 2699 ARG A CZ  
804  N NH1 . ARG A 106 ? 0.3232 0.3232 0.3232 0.0000 0.0000 0.0000 2699 ARG A NH1 
805  N NH2 . ARG A 106 ? 0.3116 0.3116 0.3116 0.0000 0.0000 0.0000 2699 ARG A NH2 
806  N N   . GLU A 107 ? 0.3434 0.3434 0.3434 0.0000 0.0000 0.0000 2700 GLU A N   
807  C CA  . GLU A 107 ? 0.3471 0.3471 0.3471 0.0000 0.0000 0.0000 2700 GLU A CA  
808  C C   . GLU A 107 ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 2700 GLU A C   
809  O O   . GLU A 107 ? 0.3449 0.3449 0.3449 0.0000 0.0000 0.0000 2700 GLU A O   
810  C CB  . GLU A 107 ? 0.3580 0.3580 0.3580 0.0000 0.0000 0.0000 2700 GLU A CB  
811  N N   . ASN A 108 ? 0.3448 0.3448 0.3448 0.0000 0.0000 0.0000 2701 ASN A N   
812  C CA  . ASN A 108 ? 0.3550 0.3550 0.3550 0.0000 0.0000 0.0000 2701 ASN A CA  
813  C C   . ASN A 108 ? 0.3527 0.3527 0.3527 0.0000 0.0000 0.0000 2701 ASN A C   
814  O O   . ASN A 108 ? 0.3561 0.3561 0.3561 0.0000 0.0000 0.0000 2701 ASN A O   
815  C CB  . ASN A 108 ? 0.3531 0.3531 0.3531 0.0000 0.0000 0.0000 2701 ASN A CB  
816  C CG  . ASN A 108 ? 0.3709 0.3709 0.3709 0.0000 0.0000 0.0000 2701 ASN A CG  
817  O OD1 . ASN A 108 ? 0.4095 0.4095 0.4095 0.0000 0.0000 0.0000 2701 ASN A OD1 
818  N ND2 . ASN A 108 ? 0.3816 0.3816 0.3816 0.0000 0.0000 0.0000 2701 ASN A ND2 
819  N N   . GLU A 109 ? 0.3580 0.3580 0.3580 0.0000 0.0000 0.0000 2702 GLU A N   
820  C CA  . GLU A 109 ? 0.3675 0.3675 0.3675 0.0000 0.0000 0.0000 2702 GLU A CA  
821  C C   . GLU A 109 ? 0.3851 0.3851 0.3851 0.0000 0.0000 0.0000 2702 GLU A C   
822  O O   . GLU A 109 ? 0.3817 0.3817 0.3817 0.0000 0.0000 0.0000 2702 GLU A O   
823  C CB  . GLU A 109 ? 0.3667 0.3667 0.3667 0.0000 0.0000 0.0000 2702 GLU A CB  
824  C CG  . GLU A 109 ? 0.3496 0.3496 0.3496 0.0000 0.0000 0.0000 2702 GLU A CG  
825  C CD  . GLU A 109 ? 0.3442 0.3442 0.3442 0.0000 0.0000 0.0000 2702 GLU A CD  
826  O OE1 . GLU A 109 ? 0.3323 0.3323 0.3323 0.0000 0.0000 0.0000 2702 GLU A OE1 
827  O OE2 . GLU A 109 ? 0.3648 0.3648 0.3648 0.0000 0.0000 0.0000 2702 GLU A OE2 
828  N N   . LYS A 110 ? 0.4023 0.4023 0.4023 0.0000 0.0000 0.0000 2703 LYS A N   
829  C CA  . LYS A 110 ? 0.4222 0.4222 0.4222 0.0000 0.0000 0.0000 2703 LYS A CA  
830  C C   . LYS A 110 ? 0.4374 0.4374 0.4374 0.0000 0.0000 0.0000 2703 LYS A C   
831  O O   . LYS A 110 ? 0.4455 0.4455 0.4455 0.0000 0.0000 0.0000 2703 LYS A O   
832  C CB  . LYS A 110 ? 0.4214 0.4214 0.4214 0.0000 0.0000 0.0000 2703 LYS A CB  
833  N N   . LEU A 111 ? 0.4527 0.4527 0.4527 0.0000 0.0000 0.0000 2704 LEU A N   
834  C CA  . LEU A 111 ? 0.4667 0.4667 0.4667 0.0000 0.0000 0.0000 2704 LEU A CA  
835  C C   . LEU A 111 ? 0.4736 0.4736 0.4736 0.0000 0.0000 0.0000 2704 LEU A C   
836  O O   . LEU A 111 ? 0.4783 0.4783 0.4783 0.0000 0.0000 0.0000 2704 LEU A O   
837  C CB  . LEU A 111 ? 0.4754 0.4754 0.4754 0.0000 0.0000 0.0000 2704 LEU A CB  
838  C CG  . LEU A 111 ? 0.4934 0.4934 0.4934 0.0000 0.0000 0.0000 2704 LEU A CG  
839  C CD1 . LEU A 111 ? 0.5112 0.5112 0.5112 0.0000 0.0000 0.0000 2704 LEU A CD1 
840  C CD2 . LEU A 111 ? 0.4974 0.4974 0.4974 0.0000 0.0000 0.0000 2704 LEU A CD2 
841  N N   . ARG A 112 ? 0.4725 0.4725 0.4725 0.0000 0.0000 0.0000 2705 ARG A N   
842  C CA  . ARG A 112 ? 0.4764 0.4764 0.4764 0.0000 0.0000 0.0000 2705 ARG A CA  
843  C C   . ARG A 112 ? 0.4916 0.4916 0.4916 0.0000 0.0000 0.0000 2705 ARG A C   
844  O O   . ARG A 112 ? 0.4905 0.4905 0.4905 0.0000 0.0000 0.0000 2705 ARG A O   
845  C CB  . ARG A 112 ? 0.4648 0.4648 0.4648 0.0000 0.0000 0.0000 2705 ARG A CB  
846  C CG  . ARG A 112 ? 0.4379 0.4379 0.4379 0.0000 0.0000 0.0000 2705 ARG A CG  
847  C CD  . ARG A 112 ? 0.3733 0.3733 0.3733 0.0000 0.0000 0.0000 2705 ARG A CD  
848  N NE  . ARG A 112 ? 0.3460 0.3460 0.3460 0.0000 0.0000 0.0000 2705 ARG A NE  
849  C CZ  . ARG A 112 ? 0.3463 0.3463 0.3463 0.0000 0.0000 0.0000 2705 ARG A CZ  
850  N NH1 . ARG A 112 ? 0.3658 0.3658 0.3658 0.0000 0.0000 0.0000 2705 ARG A NH1 
851  N NH2 . ARG A 112 ? 0.3151 0.3151 0.3151 0.0000 0.0000 0.0000 2705 ARG A NH2 
852  N N   . SER A 113 ? 0.5154 0.5154 0.5154 0.0000 0.0000 0.0000 2706 SER A N   
853  C CA  . SER A 113 ? 0.5413 0.5413 0.5413 0.0000 0.0000 0.0000 2706 SER A CA  
854  C C   . SER A 113 ? 0.5500 0.5500 0.5500 0.0000 0.0000 0.0000 2706 SER A C   
855  O O   . SER A 113 ? 0.5523 0.5523 0.5523 0.0000 0.0000 0.0000 2706 SER A O   
856  C CB  . SER A 113 ? 0.5415 0.5415 0.5415 0.0000 0.0000 0.0000 2706 SER A CB  
857  O OG  . SER A 113 ? 0.5665 0.5665 0.5665 0.0000 0.0000 0.0000 2706 SER A OG  
858  N N   . VAL A 114 ? 0.5630 0.5630 0.5630 0.0000 0.0000 0.0000 2707 VAL A N   
859  C CA  . VAL A 114 ? 0.5751 0.5751 0.5751 0.0000 0.0000 0.0000 2707 VAL A CA  
860  C C   . VAL A 114 ? 0.5839 0.5839 0.5839 0.0000 0.0000 0.0000 2707 VAL A C   
861  O O   . VAL A 114 ? 0.5951 0.5951 0.5951 0.0000 0.0000 0.0000 2707 VAL A O   
862  C CB  . VAL A 114 ? 0.5751 0.5751 0.5751 0.0000 0.0000 0.0000 2707 VAL A CB  
863  N N   . TYR A 123 ? 0.4169 0.4169 0.4169 0.0000 0.0000 0.0000 2716 TYR A N   
864  C CA  . TYR A 123 ? 0.4137 0.4137 0.4137 0.0000 0.0000 0.0000 2716 TYR A CA  
865  C C   . TYR A 123 ? 0.4212 0.4212 0.4212 0.0000 0.0000 0.0000 2716 TYR A C   
866  O O   . TYR A 123 ? 0.4301 0.4301 0.4301 0.0000 0.0000 0.0000 2716 TYR A O   
867  C CB  . TYR A 123 ? 0.4004 0.4004 0.4004 0.0000 0.0000 0.0000 2716 TYR A CB  
868  C CG  . TYR A 123 ? 0.3666 0.3666 0.3666 0.0000 0.0000 0.0000 2716 TYR A CG  
869  C CD1 . TYR A 123 ? 0.3361 0.3361 0.3361 0.0000 0.0000 0.0000 2716 TYR A CD1 
870  C CD2 . TYR A 123 ? 0.3273 0.3273 0.3273 0.0000 0.0000 0.0000 2716 TYR A CD2 
871  C CE1 . TYR A 123 ? 0.3162 0.3162 0.3162 0.0000 0.0000 0.0000 2716 TYR A CE1 
872  C CE2 . TYR A 123 ? 0.3201 0.3201 0.3201 0.0000 0.0000 0.0000 2716 TYR A CE2 
873  C CZ  . TYR A 123 ? 0.3015 0.3015 0.3015 0.0000 0.0000 0.0000 2716 TYR A CZ  
874  O OH  . TYR A 123 ? 0.2919 0.2919 0.2919 0.0000 0.0000 0.0000 2716 TYR A OH  
875  N N   . SER A 124 ? 0.4293 0.4293 0.4293 0.0000 0.0000 0.0000 2717 SER A N   
876  C CA  . SER A 124 ? 0.4383 0.4383 0.4383 0.0000 0.0000 0.0000 2717 SER A CA  
877  C C   . SER A 124 ? 0.4374 0.4374 0.4374 0.0000 0.0000 0.0000 2717 SER A C   
878  O O   . SER A 124 ? 0.4479 0.4479 0.4479 0.0000 0.0000 0.0000 2717 SER A O   
879  C CB  . SER A 124 ? 0.4455 0.4455 0.4455 0.0000 0.0000 0.0000 2717 SER A CB  
880  O OG  . SER A 124 ? 0.4781 0.4781 0.4781 0.0000 0.0000 0.0000 2717 SER A OG  
881  N N   . PRO A 125 ? 0.4301 0.4301 0.4301 0.0000 0.0000 0.0000 2718 PRO A N   
882  C CA  . PRO A 125 ? 0.4231 0.4231 0.4231 0.0000 0.0000 0.0000 2718 PRO A CA  
883  C C   . PRO A 125 ? 0.4197 0.4197 0.4197 0.0000 0.0000 0.0000 2718 PRO A C   
884  O O   . PRO A 125 ? 0.4106 0.4106 0.4106 0.0000 0.0000 0.0000 2718 PRO A O   
885  C CB  . PRO A 125 ? 0.4212 0.4212 0.4212 0.0000 0.0000 0.0000 2718 PRO A CB  
886  C CG  . PRO A 125 ? 0.4261 0.4261 0.4261 0.0000 0.0000 0.0000 2718 PRO A CG  
887  C CD  . PRO A 125 ? 0.4288 0.4288 0.4288 0.0000 0.0000 0.0000 2718 PRO A CD  
888  N N   . ALA A 126 ? 0.4192 0.4192 0.4192 0.0000 0.0000 0.0000 2719 ALA A N   
889  C CA  . ALA A 126 ? 0.4183 0.4183 0.4183 0.0000 0.0000 0.0000 2719 ALA A CA  
890  C C   . ALA A 126 ? 0.4161 0.4161 0.4161 0.0000 0.0000 0.0000 2719 ALA A C   
891  O O   . ALA A 126 ? 0.4220 0.4220 0.4220 0.0000 0.0000 0.0000 2719 ALA A O   
892  C CB  . ALA A 126 ? 0.4235 0.4235 0.4235 0.0000 0.0000 0.0000 2719 ALA A CB  
893  N N   . PRO A 127 ? 0.4057 0.4057 0.4057 0.0000 0.0000 0.0000 2720 PRO A N   
894  C CA  . PRO A 127 ? 0.3974 0.3974 0.3974 0.0000 0.0000 0.0000 2720 PRO A CA  
895  C C   . PRO A 127 ? 0.3884 0.3884 0.3884 0.0000 0.0000 0.0000 2720 PRO A C   
896  O O   . PRO A 127 ? 0.3851 0.3851 0.3851 0.0000 0.0000 0.0000 2720 PRO A O   
897  C CB  . PRO A 127 ? 0.3989 0.3989 0.3989 0.0000 0.0000 0.0000 2720 PRO A CB  
898  C CG  . PRO A 127 ? 0.4013 0.4013 0.4013 0.0000 0.0000 0.0000 2720 PRO A CG  
899  C CD  . PRO A 127 ? 0.4073 0.4073 0.4073 0.0000 0.0000 0.0000 2720 PRO A CD  
900  N N   . LEU A 128 ? 0.3776 0.3776 0.3776 0.0000 0.0000 0.0000 2721 LEU A N   
901  C CA  . LEU A 128 ? 0.3667 0.3667 0.3667 0.0000 0.0000 0.0000 2721 LEU A CA  
902  C C   . LEU A 128 ? 0.3600 0.3600 0.3600 0.0000 0.0000 0.0000 2721 LEU A C   
903  O O   . LEU A 128 ? 0.3544 0.3544 0.3544 0.0000 0.0000 0.0000 2721 LEU A O   
904  C CB  . LEU A 128 ? 0.3742 0.3742 0.3742 0.0000 0.0000 0.0000 2721 LEU A CB  
905  C CG  . LEU A 128 ? 0.3845 0.3845 0.3845 0.0000 0.0000 0.0000 2721 LEU A CG  
906  C CD1 . LEU A 128 ? 0.3846 0.3846 0.3846 0.0000 0.0000 0.0000 2721 LEU A CD1 
907  C CD2 . LEU A 128 ? 0.3913 0.3913 0.3913 0.0000 0.0000 0.0000 2721 LEU A CD2 
908  N N   . ASP A 129 ? 0.3489 0.3489 0.3489 0.0000 0.0000 0.0000 2722 ASP A N   
909  C CA  . ASP A 129 ? 0.3437 0.3437 0.3437 0.0000 0.0000 0.0000 2722 ASP A CA  
910  C C   . ASP A 129 ? 0.3318 0.3318 0.3318 0.0000 0.0000 0.0000 2722 ASP A C   
911  O O   . ASP A 129 ? 0.3228 0.3228 0.3228 0.0000 0.0000 0.0000 2722 ASP A O   
912  C CB  . ASP A 129 ? 0.3485 0.3485 0.3485 0.0000 0.0000 0.0000 2722 ASP A CB  
913  C CG  . ASP A 129 ? 0.3623 0.3623 0.3623 0.0000 0.0000 0.0000 2722 ASP A CG  
914  O OD1 . ASP A 129 ? 0.3598 0.3598 0.3598 0.0000 0.0000 0.0000 2722 ASP A OD1 
915  O OD2 . ASP A 129 ? 0.3766 0.3766 0.3766 0.0000 0.0000 0.0000 2722 ASP A OD2 
916  N N   . LEU A 130 ? 0.3263 0.3263 0.3263 0.0000 0.0000 0.0000 2723 LEU A N   
917  C CA  . LEU A 130 ? 0.3086 0.3086 0.3086 0.0000 0.0000 0.0000 2723 LEU A CA  
918  C C   . LEU A 130 ? 0.3025 0.3025 0.3025 0.0000 0.0000 0.0000 2723 LEU A C   
919  O O   . LEU A 130 ? 0.2855 0.2855 0.2855 0.0000 0.0000 0.0000 2723 LEU A O   
920  C CB  . LEU A 130 ? 0.3173 0.3173 0.3173 0.0000 0.0000 0.0000 2723 LEU A CB  
921  C CG  . LEU A 130 ? 0.3047 0.3047 0.3047 0.0000 0.0000 0.0000 2723 LEU A CG  
922  C CD1 . LEU A 130 ? 0.3224 0.3224 0.3224 0.0000 0.0000 0.0000 2723 LEU A CD1 
923  C CD2 . LEU A 130 ? 0.3213 0.3213 0.3213 0.0000 0.0000 0.0000 2723 LEU A CD2 
924  N N   . SER A 131 ? 0.3021 0.3021 0.3021 0.0000 0.0000 0.0000 2724 SER A N   
925  C CA  . SER A 131 ? 0.3092 0.3092 0.3092 0.0000 0.0000 0.0000 2724 SER A CA  
926  C C   . SER A 131 ? 0.3100 0.3100 0.3100 0.0000 0.0000 0.0000 2724 SER A C   
927  O O   . SER A 131 ? 0.3165 0.3165 0.3165 0.0000 0.0000 0.0000 2724 SER A O   
928  C CB  . SER A 131 ? 0.3156 0.3156 0.3156 0.0000 0.0000 0.0000 2724 SER A CB  
929  O OG  . SER A 131 ? 0.3487 0.3487 0.3487 0.0000 0.0000 0.0000 2724 SER A OG  
930  N N   . ASN A 132 ? 0.3007 0.3007 0.3007 0.0000 0.0000 0.0000 2725 ASN A N   
931  C CA  . ASN A 132 ? 0.3049 0.3049 0.3049 0.0000 0.0000 0.0000 2725 ASN A CA  
932  C C   . ASN A 132 ? 0.3102 0.3102 0.3102 0.0000 0.0000 0.0000 2725 ASN A C   
933  O O   . ASN A 132 ? 0.3125 0.3125 0.3125 0.0000 0.0000 0.0000 2725 ASN A O   
934  C CB  . ASN A 132 ? 0.3091 0.3091 0.3091 0.0000 0.0000 0.0000 2725 ASN A CB  
935  C CG  . ASN A 132 ? 0.3165 0.3165 0.3165 0.0000 0.0000 0.0000 2725 ASN A CG  
936  O OD1 . ASN A 132 ? 0.3539 0.3539 0.3539 0.0000 0.0000 0.0000 2725 ASN A OD1 
937  N ND2 . ASN A 132 ? 0.3061 0.3061 0.3061 0.0000 0.0000 0.0000 2725 ASN A ND2 
938  N N   . VAL A 133 ? 0.3062 0.3062 0.3062 0.0000 0.0000 0.0000 2726 VAL A N   
939  C CA  . VAL A 133 ? 0.3151 0.3151 0.3151 0.0000 0.0000 0.0000 2726 VAL A CA  
940  C C   . VAL A 133 ? 0.3303 0.3303 0.3303 0.0000 0.0000 0.0000 2726 VAL A C   
941  O O   . VAL A 133 ? 0.3320 0.3320 0.3320 0.0000 0.0000 0.0000 2726 VAL A O   
942  C CB  . VAL A 133 ? 0.3049 0.3049 0.3049 0.0000 0.0000 0.0000 2726 VAL A CB  
943  C CG1 . VAL A 133 ? 0.3032 0.3032 0.3032 0.0000 0.0000 0.0000 2726 VAL A CG1 
944  C CG2 . VAL A 133 ? 0.3095 0.3095 0.3095 0.0000 0.0000 0.0000 2726 VAL A CG2 
945  N N   . VAL A 134 ? 0.3443 0.3443 0.3443 0.0000 0.0000 0.0000 2727 VAL A N   
946  C CA  . VAL A 134 ? 0.3689 0.3689 0.3689 0.0000 0.0000 0.0000 2727 VAL A CA  
947  C C   . VAL A 134 ? 0.3650 0.3650 0.3650 0.0000 0.0000 0.0000 2727 VAL A C   
948  O O   . VAL A 134 ? 0.3734 0.3734 0.3734 0.0000 0.0000 0.0000 2727 VAL A O   
949  C CB  . VAL A 134 ? 0.3699 0.3699 0.3699 0.0000 0.0000 0.0000 2727 VAL A CB  
950  C CG1 . VAL A 134 ? 0.3948 0.3948 0.3948 0.0000 0.0000 0.0000 2727 VAL A CG1 
951  C CG2 . VAL A 134 ? 0.3989 0.3989 0.3989 0.0000 0.0000 0.0000 2727 VAL A CG2 
952  N N   . LEU A 135 ? 0.3671 0.3671 0.3671 0.0000 0.0000 0.0000 2728 LEU A N   
953  C CA  . LEU A 135 ? 0.3631 0.3631 0.3631 0.0000 0.0000 0.0000 2728 LEU A CA  
954  C C   . LEU A 135 ? 0.3666 0.3666 0.3666 0.0000 0.0000 0.0000 2728 LEU A C   
955  O O   . LEU A 135 ? 0.3727 0.3727 0.3727 0.0000 0.0000 0.0000 2728 LEU A O   
956  C CB  . LEU A 135 ? 0.3558 0.3558 0.3558 0.0000 0.0000 0.0000 2728 LEU A CB  
957  C CG  . LEU A 135 ? 0.3377 0.3377 0.3377 0.0000 0.0000 0.0000 2728 LEU A CG  
958  C CD1 . LEU A 135 ? 0.3342 0.3342 0.3342 0.0000 0.0000 0.0000 2728 LEU A CD1 
959  C CD2 . LEU A 135 ? 0.3268 0.3268 0.3268 0.0000 0.0000 0.0000 2728 LEU A CD2 
960  N N   . SER A 136 ? 0.3770 0.3770 0.3770 0.0000 0.0000 0.0000 2729 SER A N   
961  C CA  . SER A 136 ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 2729 SER A CA  
962  C C   . SER A 136 ? 0.3875 0.3875 0.3875 0.0000 0.0000 0.0000 2729 SER A C   
963  O O   . SER A 136 ? 0.3940 0.3940 0.3940 0.0000 0.0000 0.0000 2729 SER A O   
964  C CB  . SER A 136 ? 0.3855 0.3855 0.3855 0.0000 0.0000 0.0000 2729 SER A CB  
965  O OG  . SER A 136 ? 0.3932 0.3932 0.3932 0.0000 0.0000 0.0000 2729 SER A OG  
966  N N   . ARG A 137 ? 0.3879 0.3879 0.3879 0.0000 0.0000 0.0000 2730 ARG A N   
967  C CA  . ARG A 137 ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 2730 ARG A CA  
968  C C   . ARG A 137 ? 0.3784 0.3784 0.3784 0.0000 0.0000 0.0000 2730 ARG A C   
969  O O   . ARG A 137 ? 0.3731 0.3731 0.3731 0.0000 0.0000 0.0000 2730 ARG A O   
970  C CB  . ARG A 137 ? 0.3948 0.3948 0.3948 0.0000 0.0000 0.0000 2730 ARG A CB  
971  N N   . GLU A 138 ? 0.3702 0.3702 0.3702 0.0000 0.0000 0.0000 2731 GLU A N   
972  C CA  . GLU A 138 ? 0.3761 0.3761 0.3761 0.0000 0.0000 0.0000 2731 GLU A CA  
973  C C   . GLU A 138 ? 0.3636 0.3636 0.3636 0.0000 0.0000 0.0000 2731 GLU A C   
974  O O   . GLU A 138 ? 0.3480 0.3480 0.3480 0.0000 0.0000 0.0000 2731 GLU A O   
975  C CB  . GLU A 138 ? 0.3860 0.3860 0.3860 0.0000 0.0000 0.0000 2731 GLU A CB  
976  C CG  . GLU A 138 ? 0.4318 0.4318 0.4318 0.0000 0.0000 0.0000 2731 GLU A CG  
977  C CD  . GLU A 138 ? 0.4900 0.4900 0.4900 0.0000 0.0000 0.0000 2731 GLU A CD  
978  O OE1 . GLU A 138 ? 0.5306 0.5306 0.5306 0.0000 0.0000 0.0000 2731 GLU A OE1 
979  O OE2 . GLU A 138 ? 0.5002 0.5002 0.5002 0.0000 0.0000 0.0000 2731 GLU A OE2 
980  N N   . LEU A 139 ? 0.3551 0.3551 0.3551 0.0000 0.0000 0.0000 2732 LEU A N   
981  C CA  . LEU A 139 ? 0.3567 0.3567 0.3567 0.0000 0.0000 0.0000 2732 LEU A CA  
982  C C   . LEU A 139 ? 0.3495 0.3495 0.3495 0.0000 0.0000 0.0000 2732 LEU A C   
983  O O   . LEU A 139 ? 0.3527 0.3527 0.3527 0.0000 0.0000 0.0000 2732 LEU A O   
984  C CB  . LEU A 139 ? 0.3475 0.3475 0.3475 0.0000 0.0000 0.0000 2732 LEU A CB  
985  C CG  . LEU A 139 ? 0.3632 0.3632 0.3632 0.0000 0.0000 0.0000 2732 LEU A CG  
986  C CD1 . LEU A 139 ? 0.3703 0.3703 0.3703 0.0000 0.0000 0.0000 2732 LEU A CD1 
987  C CD2 . LEU A 139 ? 0.3646 0.3646 0.3646 0.0000 0.0000 0.0000 2732 LEU A CD2 
988  N N   . GLN A 140 ? 0.3500 0.3500 0.3500 0.0000 0.0000 0.0000 2733 GLN A N   
989  C CA  . GLN A 140 ? 0.3566 0.3566 0.3566 0.0000 0.0000 0.0000 2733 GLN A CA  
990  C C   . GLN A 140 ? 0.3519 0.3519 0.3519 0.0000 0.0000 0.0000 2733 GLN A C   
991  O O   . GLN A 140 ? 0.3550 0.3550 0.3550 0.0000 0.0000 0.0000 2733 GLN A O   
992  C CB  . GLN A 140 ? 0.3669 0.3669 0.3669 0.0000 0.0000 0.0000 2733 GLN A CB  
993  C CG  . GLN A 140 ? 0.4109 0.4109 0.4109 0.0000 0.0000 0.0000 2733 GLN A CG  
994  C CD  . GLN A 140 ? 0.4808 0.4808 0.4808 0.0000 0.0000 0.0000 2733 GLN A CD  
995  O OE1 . GLN A 140 ? 0.5223 0.5223 0.5223 0.0000 0.0000 0.0000 2733 GLN A OE1 
996  N NE2 . GLN A 140 ? 0.5134 0.5134 0.5134 0.0000 0.0000 0.0000 2733 GLN A NE2 
997  N N   . GLY A 141 ? 0.3387 0.3387 0.3387 0.0000 0.0000 0.0000 2734 GLY A N   
998  C CA  . GLY A 141 ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 2734 GLY A CA  
999  C C   . GLY A 141 ? 0.3111 0.3111 0.3111 0.0000 0.0000 0.0000 2734 GLY A C   
1000 O O   . GLY A 141 ? 0.3116 0.3116 0.3116 0.0000 0.0000 0.0000 2734 GLY A O   
1001 N N   . MET A 142 ? 0.3052 0.3052 0.3052 0.0000 0.0000 0.0000 2735 MET A N   
1002 C CA  . MET A 142 ? 0.2999 0.2999 0.2999 0.0000 0.0000 0.0000 2735 MET A CA  
1003 C C   . MET A 142 ? 0.3002 0.3002 0.3002 0.0000 0.0000 0.0000 2735 MET A C   
1004 O O   . MET A 142 ? 0.2800 0.2800 0.2800 0.0000 0.0000 0.0000 2735 MET A O   
1005 C CB  . MET A 142 ? 0.3111 0.3111 0.3111 0.0000 0.0000 0.0000 2735 MET A CB  
1006 C CG  . MET A 142 ? 0.3197 0.3197 0.3197 0.0000 0.0000 0.0000 2735 MET A CG  
1007 S SD  . MET A 142 ? 0.3779 0.3779 0.3779 0.0000 0.0000 0.0000 2735 MET A SD  
1008 C CE  . MET A 142 ? 0.3363 0.3363 0.3363 0.0000 0.0000 0.0000 2735 MET A CE  
1009 N N   . VAL A 143 ? 0.2904 0.2904 0.2904 0.0000 0.0000 0.0000 2736 VAL A N   
1010 C CA  . VAL A 143 ? 0.2948 0.2948 0.2948 0.0000 0.0000 0.0000 2736 VAL A CA  
1011 C C   . VAL A 143 ? 0.2933 0.2933 0.2933 0.0000 0.0000 0.0000 2736 VAL A C   
1012 O O   . VAL A 143 ? 0.2976 0.2976 0.2976 0.0000 0.0000 0.0000 2736 VAL A O   
1013 C CB  . VAL A 143 ? 0.2945 0.2945 0.2945 0.0000 0.0000 0.0000 2736 VAL A CB  
1014 C CG1 . VAL A 143 ? 0.2959 0.2959 0.2959 0.0000 0.0000 0.0000 2736 VAL A CG1 
1015 C CG2 . VAL A 143 ? 0.3085 0.3085 0.3085 0.0000 0.0000 0.0000 2736 VAL A CG2 
1016 N N   . GLU A 144 ? 0.2918 0.2918 0.2918 0.0000 0.0000 0.0000 2737 GLU A N   
1017 C CA  . GLU A 144 ? 0.2934 0.2934 0.2934 0.0000 0.0000 0.0000 2737 GLU A CA  
1018 C C   . GLU A 144 ? 0.2855 0.2855 0.2855 0.0000 0.0000 0.0000 2737 GLU A C   
1019 O O   . GLU A 144 ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2737 GLU A O   
1020 C CB  . GLU A 144 ? 0.2991 0.2991 0.2991 0.0000 0.0000 0.0000 2737 GLU A CB  
1021 C CG  . GLU A 144 ? 0.3375 0.3375 0.3375 0.0000 0.0000 0.0000 2737 GLU A CG  
1022 C CD  . GLU A 144 ? 0.3615 0.3615 0.3615 0.0000 0.0000 0.0000 2737 GLU A CD  
1023 O OE1 . GLU A 144 ? 0.3700 0.3700 0.3700 0.0000 0.0000 0.0000 2737 GLU A OE1 
1024 O OE2 . GLU A 144 ? 0.3891 0.3891 0.3891 0.0000 0.0000 0.0000 2737 GLU A OE2 
1025 N N   . VAL A 145 ? 0.2717 0.2717 0.2717 0.0000 0.0000 0.0000 2738 VAL A N   
1026 C CA  . VAL A 145 ? 0.2630 0.2630 0.2630 0.0000 0.0000 0.0000 2738 VAL A CA  
1027 C C   . VAL A 145 ? 0.2568 0.2568 0.2568 0.0000 0.0000 0.0000 2738 VAL A C   
1028 O O   . VAL A 145 ? 0.2484 0.2484 0.2484 0.0000 0.0000 0.0000 2738 VAL A O   
1029 C CB  . VAL A 145 ? 0.2645 0.2645 0.2645 0.0000 0.0000 0.0000 2738 VAL A CB  
1030 C CG1 . VAL A 145 ? 0.2621 0.2621 0.2621 0.0000 0.0000 0.0000 2738 VAL A CG1 
1031 C CG2 . VAL A 145 ? 0.2574 0.2574 0.2574 0.0000 0.0000 0.0000 2738 VAL A CG2 
1032 N N   . VAL A 146 ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2739 VAL A N   
1033 C CA  . VAL A 146 ? 0.2344 0.2344 0.2344 0.0000 0.0000 0.0000 2739 VAL A CA  
1034 C C   . VAL A 146 ? 0.2365 0.2365 0.2365 0.0000 0.0000 0.0000 2739 VAL A C   
1035 O O   . VAL A 146 ? 0.2313 0.2313 0.2313 0.0000 0.0000 0.0000 2739 VAL A O   
1036 C CB  . VAL A 146 ? 0.2292 0.2292 0.2292 0.0000 0.0000 0.0000 2739 VAL A CB  
1037 C CG1 . VAL A 146 ? 0.2278 0.2278 0.2278 0.0000 0.0000 0.0000 2739 VAL A CG1 
1038 C CG2 . VAL A 146 ? 0.2436 0.2436 0.2436 0.0000 0.0000 0.0000 2739 VAL A CG2 
1039 N N   . ALA A 147 ? 0.2369 0.2369 0.2369 0.0000 0.0000 0.0000 2740 ALA A N   
1040 C CA  . ALA A 147 ? 0.2375 0.2375 0.2375 0.0000 0.0000 0.0000 2740 ALA A CA  
1041 C C   . ALA A 147 ? 0.2348 0.2348 0.2348 0.0000 0.0000 0.0000 2740 ALA A C   
1042 O O   . ALA A 147 ? 0.2321 0.2321 0.2321 0.0000 0.0000 0.0000 2740 ALA A O   
1043 C CB  . ALA A 147 ? 0.2288 0.2288 0.2288 0.0000 0.0000 0.0000 2740 ALA A CB  
1044 N N   . GLU A 148 ? 0.2441 0.2441 0.2441 0.0000 0.0000 0.0000 2741 GLU A N   
1045 C CA  . GLU A 148 ? 0.2464 0.2464 0.2464 0.0000 0.0000 0.0000 2741 GLU A CA  
1046 C C   . GLU A 148 ? 0.2411 0.2411 0.2411 0.0000 0.0000 0.0000 2741 GLU A C   
1047 O O   . GLU A 148 ? 0.2301 0.2301 0.2301 0.0000 0.0000 0.0000 2741 GLU A O   
1048 C CB  . GLU A 148 ? 0.2579 0.2579 0.2579 0.0000 0.0000 0.0000 2741 GLU A CB  
1049 C CG  . GLU A 148 ? 0.2786 0.2786 0.2786 0.0000 0.0000 0.0000 2741 GLU A CG  
1050 C CD  . GLU A 148 ? 0.3262 0.3262 0.3262 0.0000 0.0000 0.0000 2741 GLU A CD  
1051 O OE1 . GLU A 148 ? 0.3208 0.3208 0.3208 0.0000 0.0000 0.0000 2741 GLU A OE1 
1052 O OE2 . GLU A 148 ? 0.3719 0.3719 0.3719 0.0000 0.0000 0.0000 2741 GLU A OE2 
1053 N N   . ASN A 149 ? 0.2387 0.2387 0.2387 0.0000 0.0000 0.0000 2742 ASN A N   
1054 C CA  . ASN A 149 ? 0.2415 0.2415 0.2415 0.0000 0.0000 0.0000 2742 ASN A CA  
1055 C C   . ASN A 149 ? 0.2401 0.2401 0.2401 0.0000 0.0000 0.0000 2742 ASN A C   
1056 O O   . ASN A 149 ? 0.2402 0.2402 0.2402 0.0000 0.0000 0.0000 2742 ASN A O   
1057 C CB  . ASN A 149 ? 0.2520 0.2520 0.2520 0.0000 0.0000 0.0000 2742 ASN A CB  
1058 C CG  . ASN A 149 ? 0.2541 0.2541 0.2541 0.0000 0.0000 0.0000 2742 ASN A CG  
1059 O OD1 . ASN A 149 ? 0.2529 0.2529 0.2529 0.0000 0.0000 0.0000 2742 ASN A OD1 
1060 N ND2 . ASN A 149 ? 0.2559 0.2559 0.2559 0.0000 0.0000 0.0000 2742 ASN A ND2 
1061 N N   . TYR A 150 ? 0.2215 0.2215 0.2215 0.0000 0.0000 0.0000 2743 TYR A N   
1062 C CA  . TYR A 150 ? 0.2225 0.2225 0.2225 0.0000 0.0000 0.0000 2743 TYR A CA  
1063 C C   . TYR A 150 ? 0.2127 0.2127 0.2127 0.0000 0.0000 0.0000 2743 TYR A C   
1064 O O   . TYR A 150 ? 0.2173 0.2173 0.2173 0.0000 0.0000 0.0000 2743 TYR A O   
1065 C CB  . TYR A 150 ? 0.2172 0.2172 0.2172 0.0000 0.0000 0.0000 2743 TYR A CB  
1066 C CG  . TYR A 150 ? 0.2261 0.2261 0.2261 0.0000 0.0000 0.0000 2743 TYR A CG  
1067 C CD1 . TYR A 150 ? 0.2440 0.2440 0.2440 0.0000 0.0000 0.0000 2743 TYR A CD1 
1068 C CD2 . TYR A 150 ? 0.2445 0.2445 0.2445 0.0000 0.0000 0.0000 2743 TYR A CD2 
1069 C CE1 . TYR A 150 ? 0.2596 0.2596 0.2596 0.0000 0.0000 0.0000 2743 TYR A CE1 
1070 C CE2 . TYR A 150 ? 0.2611 0.2611 0.2611 0.0000 0.0000 0.0000 2743 TYR A CE2 
1071 C CZ  . TYR A 150 ? 0.2848 0.2848 0.2848 0.0000 0.0000 0.0000 2743 TYR A CZ  
1072 O OH  . TYR A 150 ? 0.2764 0.2764 0.2764 0.0000 0.0000 0.0000 2743 TYR A OH  
1073 N N   . HIS A 151 ? 0.2060 0.2060 0.2060 0.0000 0.0000 0.0000 2744 HIS A N   
1074 C CA  . HIS A 151 ? 0.2175 0.2175 0.2175 0.0000 0.0000 0.0000 2744 HIS A CA  
1075 C C   . HIS A 151 ? 0.2268 0.2268 0.2268 0.0000 0.0000 0.0000 2744 HIS A C   
1076 O O   . HIS A 151 ? 0.2261 0.2261 0.2261 0.0000 0.0000 0.0000 2744 HIS A O   
1077 C CB  . HIS A 151 ? 0.2159 0.2159 0.2159 0.0000 0.0000 0.0000 2744 HIS A CB  
1078 C CG  . HIS A 151 ? 0.2267 0.2267 0.2267 0.0000 0.0000 0.0000 2744 HIS A CG  
1079 N ND1 . HIS A 151 ? 0.2382 0.2382 0.2382 0.0000 0.0000 0.0000 2744 HIS A ND1 
1080 C CD2 . HIS A 151 ? 0.2688 0.2688 0.2688 0.0000 0.0000 0.0000 2744 HIS A CD2 
1081 C CE1 . HIS A 151 ? 0.2660 0.2660 0.2660 0.0000 0.0000 0.0000 2744 HIS A CE1 
1082 N NE2 . HIS A 151 ? 0.2671 0.2671 0.2671 0.0000 0.0000 0.0000 2744 HIS A NE2 
1083 N N   . ASN A 152 ? 0.2324 0.2324 0.2324 0.0000 0.0000 0.0000 2745 ASN A N   
1084 C CA  . ASN A 152 ? 0.2373 0.2373 0.2373 0.0000 0.0000 0.0000 2745 ASN A CA  
1085 C C   . ASN A 152 ? 0.2365 0.2365 0.2365 0.0000 0.0000 0.0000 2745 ASN A C   
1086 O O   . ASN A 152 ? 0.2400 0.2400 0.2400 0.0000 0.0000 0.0000 2745 ASN A O   
1087 C CB  . ASN A 152 ? 0.2296 0.2296 0.2296 0.0000 0.0000 0.0000 2745 ASN A CB  
1088 C CG  . ASN A 152 ? 0.2552 0.2552 0.2552 0.0000 0.0000 0.0000 2745 ASN A CG  
1089 O OD1 . ASN A 152 ? 0.2771 0.2771 0.2771 0.0000 0.0000 0.0000 2745 ASN A OD1 
1090 N ND2 . ASN A 152 ? 0.2591 0.2591 0.2591 0.0000 0.0000 0.0000 2745 ASN A ND2 
1091 N N   . ILE A 153 ? 0.2396 0.2396 0.2396 0.0000 0.0000 0.0000 2746 ILE A N   
1092 C CA  . ILE A 153 ? 0.2402 0.2402 0.2402 0.0000 0.0000 0.0000 2746 ILE A CA  
1093 C C   . ILE A 153 ? 0.2417 0.2417 0.2417 0.0000 0.0000 0.0000 2746 ILE A C   
1094 O O   . ILE A 153 ? 0.2378 0.2378 0.2378 0.0000 0.0000 0.0000 2746 ILE A O   
1095 C CB  . ILE A 153 ? 0.2473 0.2473 0.2473 0.0000 0.0000 0.0000 2746 ILE A CB  
1096 C CG1 . ILE A 153 ? 0.2382 0.2382 0.2382 0.0000 0.0000 0.0000 2746 ILE A CG1 
1097 C CG2 . ILE A 153 ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 2746 ILE A CG2 
1098 C CD1 . ILE A 153 ? 0.2668 0.2668 0.2668 0.0000 0.0000 0.0000 2746 ILE A CD1 
1099 N N   . TRP A 154 ? 0.2381 0.2381 0.2381 0.0000 0.0000 0.0000 2747 TRP A N   
1100 C CA  . TRP A 154 ? 0.2346 0.2346 0.2346 0.0000 0.0000 0.0000 2747 TRP A CA  
1101 C C   . TRP A 154 ? 0.2356 0.2356 0.2356 0.0000 0.0000 0.0000 2747 TRP A C   
1102 O O   . TRP A 154 ? 0.2400 0.2400 0.2400 0.0000 0.0000 0.0000 2747 TRP A O   
1103 C CB  . TRP A 154 ? 0.2426 0.2426 0.2426 0.0000 0.0000 0.0000 2747 TRP A CB  
1104 C CG  . TRP A 154 ? 0.2325 0.2325 0.2325 0.0000 0.0000 0.0000 2747 TRP A CG  
1105 C CD1 . TRP A 154 ? 0.2902 0.2902 0.2902 0.0000 0.0000 0.0000 2747 TRP A CD1 
1106 C CD2 . TRP A 154 ? 0.2704 0.2704 0.2704 0.0000 0.0000 0.0000 2747 TRP A CD2 
1107 N NE1 . TRP A 154 ? 0.2835 0.2835 0.2835 0.0000 0.0000 0.0000 2747 TRP A NE1 
1108 C CE2 . TRP A 154 ? 0.2714 0.2714 0.2714 0.0000 0.0000 0.0000 2747 TRP A CE2 
1109 C CE3 . TRP A 154 ? 0.2477 0.2477 0.2477 0.0000 0.0000 0.0000 2747 TRP A CE3 
1110 C CZ2 . TRP A 154 ? 0.2629 0.2629 0.2629 0.0000 0.0000 0.0000 2747 TRP A CZ2 
1111 C CZ3 . TRP A 154 ? 0.2791 0.2791 0.2791 0.0000 0.0000 0.0000 2747 TRP A CZ3 
1112 C CH2 . TRP A 154 ? 0.2754 0.2754 0.2754 0.0000 0.0000 0.0000 2747 TRP A CH2 
1113 N N   . ALA A 155 ? 0.2355 0.2355 0.2355 0.0000 0.0000 0.0000 2748 ALA A N   
1114 C CA  . ALA A 155 ? 0.2454 0.2454 0.2454 0.0000 0.0000 0.0000 2748 ALA A CA  
1115 C C   . ALA A 155 ? 0.2522 0.2522 0.2522 0.0000 0.0000 0.0000 2748 ALA A C   
1116 O O   . ALA A 155 ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2748 ALA A O   
1117 C CB  . ALA A 155 ? 0.2489 0.2489 0.2489 0.0000 0.0000 0.0000 2748 ALA A CB  
1118 N N   . LYS A 156 ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 2749 LYS A N   
1119 C CA  . LYS A 156 ? 0.2676 0.2676 0.2676 0.0000 0.0000 0.0000 2749 LYS A CA  
1120 C C   . LYS A 156 ? 0.2768 0.2768 0.2768 0.0000 0.0000 0.0000 2749 LYS A C   
1121 O O   . LYS A 156 ? 0.2739 0.2739 0.2739 0.0000 0.0000 0.0000 2749 LYS A O   
1122 C CB  . LYS A 156 ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 2749 LYS A CB  
1123 C CG  . LYS A 156 ? 0.3045 0.3045 0.3045 0.0000 0.0000 0.0000 2749 LYS A CG  
1124 C CD  . LYS A 156 ? 0.3790 0.3790 0.3790 0.0000 0.0000 0.0000 2749 LYS A CD  
1125 C CE  . LYS A 156 ? 0.4244 0.4244 0.4244 0.0000 0.0000 0.0000 2749 LYS A CE  
1126 N NZ  . LYS A 156 ? 0.4279 0.4279 0.4279 0.0000 0.0000 0.0000 2749 LYS A NZ  
1127 N N   . LYS A 157 ? 0.2820 0.2820 0.2820 0.0000 0.0000 0.0000 2750 LYS A N   
1128 C CA  . LYS A 157 ? 0.2836 0.2836 0.2836 0.0000 0.0000 0.0000 2750 LYS A CA  
1129 C C   . LYS A 157 ? 0.2866 0.2866 0.2866 0.0000 0.0000 0.0000 2750 LYS A C   
1130 O O   . LYS A 157 ? 0.2891 0.2891 0.2891 0.0000 0.0000 0.0000 2750 LYS A O   
1131 C CB  . LYS A 157 ? 0.2844 0.2844 0.2844 0.0000 0.0000 0.0000 2750 LYS A CB  
1132 C CG  . LYS A 157 ? 0.3115 0.3115 0.3115 0.0000 0.0000 0.0000 2750 LYS A CG  
1133 C CD  . LYS A 157 ? 0.3138 0.3138 0.3138 0.0000 0.0000 0.0000 2750 LYS A CD  
1134 C CE  . LYS A 157 ? 0.3455 0.3455 0.3455 0.0000 0.0000 0.0000 2750 LYS A CE  
1135 N NZ  . LYS A 157 ? 0.3532 0.3532 0.3532 0.0000 0.0000 0.0000 2750 LYS A NZ  
1136 N N   . LYS A 158 ? 0.2776 0.2776 0.2776 0.0000 0.0000 0.0000 2751 LYS A N   
1137 C CA  . LYS A 158 ? 0.2919 0.2919 0.2919 0.0000 0.0000 0.0000 2751 LYS A CA  
1138 C C   . LYS A 158 ? 0.2934 0.2934 0.2934 0.0000 0.0000 0.0000 2751 LYS A C   
1139 O O   . LYS A 158 ? 0.2906 0.2906 0.2906 0.0000 0.0000 0.0000 2751 LYS A O   
1140 C CB  . LYS A 158 ? 0.2896 0.2896 0.2896 0.0000 0.0000 0.0000 2751 LYS A CB  
1141 C CG  . LYS A 158 ? 0.3044 0.3044 0.3044 0.0000 0.0000 0.0000 2751 LYS A CG  
1142 C CD  . LYS A 158 ? 0.3504 0.3504 0.3504 0.0000 0.0000 0.0000 2751 LYS A CD  
1143 C CE  . LYS A 158 ? 0.3781 0.3781 0.3781 0.0000 0.0000 0.0000 2751 LYS A CE  
1144 N NZ  . LYS A 158 ? 0.4102 0.4102 0.4102 0.0000 0.0000 0.0000 2751 LYS A NZ  
1145 N N   . LYS A 159 ? 0.2914 0.2914 0.2914 0.0000 0.0000 0.0000 2752 LYS A N   
1146 C CA  . LYS A 159 ? 0.3045 0.3045 0.3045 0.0000 0.0000 0.0000 2752 LYS A CA  
1147 C C   . LYS A 159 ? 0.3049 0.3049 0.3049 0.0000 0.0000 0.0000 2752 LYS A C   
1148 O O   . LYS A 159 ? 0.3153 0.3153 0.3153 0.0000 0.0000 0.0000 2752 LYS A O   
1149 C CB  . LYS A 159 ? 0.3045 0.3045 0.3045 0.0000 0.0000 0.0000 2752 LYS A CB  
1150 C CG  . LYS A 159 ? 0.3570 0.3570 0.3570 0.0000 0.0000 0.0000 2752 LYS A CG  
1151 C CD  . LYS A 159 ? 0.3942 0.3942 0.3942 0.0000 0.0000 0.0000 2752 LYS A CD  
1152 C CE  . LYS A 159 ? 0.4560 0.4560 0.4560 0.0000 0.0000 0.0000 2752 LYS A CE  
1153 N NZ  . LYS A 159 ? 0.4915 0.4915 0.4915 0.0000 0.0000 0.0000 2752 LYS A NZ  
1154 N N   . LEU A 160 ? 0.3072 0.3072 0.3072 0.0000 0.0000 0.0000 2753 LEU A N   
1155 C CA  . LEU A 160 ? 0.3153 0.3153 0.3153 0.0000 0.0000 0.0000 2753 LEU A CA  
1156 C C   . LEU A 160 ? 0.3238 0.3238 0.3238 0.0000 0.0000 0.0000 2753 LEU A C   
1157 O O   . LEU A 160 ? 0.3258 0.3258 0.3258 0.0000 0.0000 0.0000 2753 LEU A O   
1158 C CB  . LEU A 160 ? 0.3195 0.3195 0.3195 0.0000 0.0000 0.0000 2753 LEU A CB  
1159 C CG  . LEU A 160 ? 0.3243 0.3243 0.3243 0.0000 0.0000 0.0000 2753 LEU A CG  
1160 C CD1 . LEU A 160 ? 0.3586 0.3586 0.3586 0.0000 0.0000 0.0000 2753 LEU A CD1 
1161 C CD2 . LEU A 160 ? 0.3449 0.3449 0.3449 0.0000 0.0000 0.0000 2753 LEU A CD2 
1162 N N   . GLU A 161 ? 0.3194 0.3194 0.3194 0.0000 0.0000 0.0000 2754 GLU A N   
1163 C CA  . GLU A 161 ? 0.3333 0.3333 0.3333 0.0000 0.0000 0.0000 2754 GLU A CA  
1164 C C   . GLU A 161 ? 0.3376 0.3376 0.3376 0.0000 0.0000 0.0000 2754 GLU A C   
1165 O O   . GLU A 161 ? 0.3472 0.3472 0.3472 0.0000 0.0000 0.0000 2754 GLU A O   
1166 C CB  . GLU A 161 ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 2754 GLU A CB  
1167 C CG  . GLU A 161 ? 0.3222 0.3222 0.3222 0.0000 0.0000 0.0000 2754 GLU A CG  
1168 C CD  . GLU A 161 ? 0.3233 0.3233 0.3233 0.0000 0.0000 0.0000 2754 GLU A CD  
1169 O OE1 . GLU A 161 ? 0.3333 0.3333 0.3333 0.0000 0.0000 0.0000 2754 GLU A OE1 
1170 O OE2 . GLU A 161 ? 0.3384 0.3384 0.3384 0.0000 0.0000 0.0000 2754 GLU A OE2 
1171 N N   . LEU A 162 ? 0.3489 0.3489 0.3489 0.0000 0.0000 0.0000 2755 LEU A N   
1172 C CA  . LEU A 162 ? 0.3572 0.3572 0.3572 0.0000 0.0000 0.0000 2755 LEU A CA  
1173 C C   . LEU A 162 ? 0.3693 0.3693 0.3693 0.0000 0.0000 0.0000 2755 LEU A C   
1174 O O   . LEU A 162 ? 0.3672 0.3672 0.3672 0.0000 0.0000 0.0000 2755 LEU A O   
1175 C CB  . LEU A 162 ? 0.3574 0.3574 0.3574 0.0000 0.0000 0.0000 2755 LEU A CB  
1176 C CG  . LEU A 162 ? 0.3671 0.3671 0.3671 0.0000 0.0000 0.0000 2755 LEU A CG  
1177 C CD1 . LEU A 162 ? 0.3586 0.3586 0.3586 0.0000 0.0000 0.0000 2755 LEU A CD1 
1178 C CD2 . LEU A 162 ? 0.3795 0.3795 0.3795 0.0000 0.0000 0.0000 2755 LEU A CD2 
1179 N N   . GLU A 163 ? 0.3790 0.3790 0.3790 0.0000 0.0000 0.0000 2756 GLU A N   
1180 C CA  . GLU A 163 ? 0.3950 0.3950 0.3950 0.0000 0.0000 0.0000 2756 GLU A CA  
1181 C C   . GLU A 163 ? 0.4007 0.4007 0.4007 0.0000 0.0000 0.0000 2756 GLU A C   
1182 O O   . GLU A 163 ? 0.3974 0.3974 0.3974 0.0000 0.0000 0.0000 2756 GLU A O   
1183 C CB  . GLU A 163 ? 0.3956 0.3956 0.3956 0.0000 0.0000 0.0000 2756 GLU A CB  
1184 C CG  . GLU A 163 ? 0.4209 0.4209 0.4209 0.0000 0.0000 0.0000 2756 GLU A CG  
1185 C CD  . GLU A 163 ? 0.4516 0.4516 0.4516 0.0000 0.0000 0.0000 2756 GLU A CD  
1186 O OE1 . GLU A 163 ? 0.4592 0.4592 0.4592 0.0000 0.0000 0.0000 2756 GLU A OE1 
1187 O OE2 . GLU A 163 ? 0.4527 0.4527 0.4527 0.0000 0.0000 0.0000 2756 GLU A OE2 
1188 N N   . SER A 164 ? 0.4078 0.4078 0.4078 0.0000 0.0000 0.0000 2757 SER A N   
1189 C CA  . SER A 164 ? 0.4190 0.4190 0.4190 0.0000 0.0000 0.0000 2757 SER A CA  
1190 C C   . SER A 164 ? 0.4259 0.4259 0.4259 0.0000 0.0000 0.0000 2757 SER A C   
1191 O O   . SER A 164 ? 0.4328 0.4328 0.4328 0.0000 0.0000 0.0000 2757 SER A O   
1192 C CB  . SER A 164 ? 0.4202 0.4202 0.4202 0.0000 0.0000 0.0000 2757 SER A CB  
1193 O OG  . SER A 164 ? 0.4417 0.4417 0.4417 0.0000 0.0000 0.0000 2757 SER A OG  
1194 N N   . LYS A 165 ? 0.4382 0.4382 0.4382 0.0000 0.0000 0.0000 2758 LYS A N   
1195 C CA  . LYS A 165 ? 0.4541 0.4541 0.4541 0.0000 0.0000 0.0000 2758 LYS A CA  
1196 C C   . LYS A 165 ? 0.4618 0.4618 0.4618 0.0000 0.0000 0.0000 2758 LYS A C   
1197 O O   . LYS A 165 ? 0.4703 0.4703 0.4703 0.0000 0.0000 0.0000 2758 LYS A O   
1198 C CB  . LYS A 165 ? 0.4555 0.4555 0.4555 0.0000 0.0000 0.0000 2758 LYS A CB  
1199 C CG  . LYS A 165 ? 0.4398 0.4398 0.4398 0.0000 0.0000 0.0000 2758 LYS A CG  
1200 C CD  . LYS A 165 ? 0.4274 0.4274 0.4274 0.0000 0.0000 0.0000 2758 LYS A CD  
1201 C CE  . LYS A 165 ? 0.4155 0.4155 0.4155 0.0000 0.0000 0.0000 2758 LYS A CE  
1202 N NZ  . LYS A 165 ? 0.4283 0.4283 0.4283 0.0000 0.0000 0.0000 2758 LYS A NZ  
1203 N N   . GLY A 166 ? 0.4712 0.4712 0.4712 0.0000 0.0000 0.0000 2759 GLY A N   
1204 C CA  . GLY A 166 ? 0.4774 0.4774 0.4774 0.0000 0.0000 0.0000 2759 GLY A CA  
1205 C C   . GLY A 166 ? 0.4853 0.4853 0.4853 0.0000 0.0000 0.0000 2759 GLY A C   
1206 O O   . GLY A 166 ? 0.4895 0.4895 0.4895 0.0000 0.0000 0.0000 2759 GLY A O   
1207 N N   . GLY A 167 ? 0.4825 0.4825 0.4825 0.0000 0.0000 0.0000 2760 GLY A N   
1208 C CA  . GLY A 167 ? 0.4778 0.4778 0.4778 0.0000 0.0000 0.0000 2760 GLY A CA  
1209 C C   . GLY A 167 ? 0.4743 0.4743 0.4743 0.0000 0.0000 0.0000 2760 GLY A C   
1210 O O   . GLY A 167 ? 0.4835 0.4835 0.4835 0.0000 0.0000 0.0000 2760 GLY A O   
1211 N N   . GLY A 168 ? 0.4688 0.4688 0.4688 0.0000 0.0000 0.0000 2761 GLY A N   
1212 C CA  . GLY A 168 ? 0.4502 0.4502 0.4502 0.0000 0.0000 0.0000 2761 GLY A CA  
1213 C C   . GLY A 168 ? 0.4427 0.4427 0.4427 0.0000 0.0000 0.0000 2761 GLY A C   
1214 O O   . GLY A 168 ? 0.4383 0.4383 0.4383 0.0000 0.0000 0.0000 2761 GLY A O   
1215 N N   . SER A 169 ? 0.4278 0.4278 0.4278 0.0000 0.0000 0.0000 2762 SER A N   
1216 C CA  . SER A 169 ? 0.4176 0.4176 0.4176 0.0000 0.0000 0.0000 2762 SER A CA  
1217 C C   . SER A 169 ? 0.3974 0.3974 0.3974 0.0000 0.0000 0.0000 2762 SER A C   
1218 O O   . SER A 169 ? 0.4016 0.4016 0.4016 0.0000 0.0000 0.0000 2762 SER A O   
1219 C CB  . SER A 169 ? 0.4268 0.4268 0.4268 0.0000 0.0000 0.0000 2762 SER A CB  
1220 O OG  . SER A 169 ? 0.4768 0.4768 0.4768 0.0000 0.0000 0.0000 2762 SER A OG  
1221 N N   . HIS A 170 ? 0.3667 0.3667 0.3667 0.0000 0.0000 0.0000 2763 HIS A N   
1222 C CA  . HIS A 170 ? 0.3400 0.3400 0.3400 0.0000 0.0000 0.0000 2763 HIS A CA  
1223 C C   . HIS A 170 ? 0.3299 0.3299 0.3299 0.0000 0.0000 0.0000 2763 HIS A C   
1224 O O   . HIS A 170 ? 0.3267 0.3267 0.3267 0.0000 0.0000 0.0000 2763 HIS A O   
1225 C CB  . HIS A 170 ? 0.3347 0.3347 0.3347 0.0000 0.0000 0.0000 2763 HIS A CB  
1226 C CG  . HIS A 170 ? 0.3247 0.3247 0.3247 0.0000 0.0000 0.0000 2763 HIS A CG  
1227 N ND1 . HIS A 170 ? 0.3024 0.3024 0.3024 0.0000 0.0000 0.0000 2763 HIS A ND1 
1228 C CD2 . HIS A 170 ? 0.3401 0.3401 0.3401 0.0000 0.0000 0.0000 2763 HIS A CD2 
1229 C CE1 . HIS A 170 ? 0.3102 0.3102 0.3102 0.0000 0.0000 0.0000 2763 HIS A CE1 
1230 N NE2 . HIS A 170 ? 0.3130 0.3130 0.3130 0.0000 0.0000 0.0000 2763 HIS A NE2 
1231 N N   . PRO A 171 ? 0.3192 0.3192 0.3192 0.0000 0.0000 0.0000 2764 PRO A N   
1232 C CA  . PRO A 171 ? 0.3187 0.3187 0.3187 0.0000 0.0000 0.0000 2764 PRO A CA  
1233 C C   . PRO A 171 ? 0.3154 0.3154 0.3154 0.0000 0.0000 0.0000 2764 PRO A C   
1234 O O   . PRO A 171 ? 0.3280 0.3280 0.3280 0.0000 0.0000 0.0000 2764 PRO A O   
1235 C CB  . PRO A 171 ? 0.3200 0.3200 0.3200 0.0000 0.0000 0.0000 2764 PRO A CB  
1236 C CG  . PRO A 171 ? 0.3204 0.3204 0.3204 0.0000 0.0000 0.0000 2764 PRO A CG  
1237 C CD  . PRO A 171 ? 0.3205 0.3205 0.3205 0.0000 0.0000 0.0000 2764 PRO A CD  
1238 N N   . LEU A 172 ? 0.3043 0.3043 0.3043 0.0000 0.0000 0.0000 2765 LEU A N   
1239 C CA  . LEU A 172 ? 0.2987 0.2987 0.2987 0.0000 0.0000 0.0000 2765 LEU A CA  
1240 C C   . LEU A 172 ? 0.3037 0.3037 0.3037 0.0000 0.0000 0.0000 2765 LEU A C   
1241 O O   . LEU A 172 ? 0.2950 0.2950 0.2950 0.0000 0.0000 0.0000 2765 LEU A O   
1242 C CB  . LEU A 172 ? 0.2990 0.2990 0.2990 0.0000 0.0000 0.0000 2765 LEU A CB  
1243 C CG  . LEU A 172 ? 0.3016 0.3016 0.3016 0.0000 0.0000 0.0000 2765 LEU A CG  
1244 C CD1 . LEU A 172 ? 0.2843 0.2843 0.2843 0.0000 0.0000 0.0000 2765 LEU A CD1 
1245 C CD2 . LEU A 172 ? 0.3105 0.3105 0.3105 0.0000 0.0000 0.0000 2765 LEU A CD2 
1246 N N   . LEU A 173 ? 0.3013 0.3013 0.3013 0.0000 0.0000 0.0000 2766 LEU A N   
1247 C CA  . LEU A 173 ? 0.3182 0.3182 0.3182 0.0000 0.0000 0.0000 2766 LEU A CA  
1248 C C   . LEU A 173 ? 0.3178 0.3178 0.3178 0.0000 0.0000 0.0000 2766 LEU A C   
1249 O O   . LEU A 173 ? 0.3296 0.3296 0.3296 0.0000 0.0000 0.0000 2766 LEU A O   
1250 C CB  . LEU A 173 ? 0.3227 0.3227 0.3227 0.0000 0.0000 0.0000 2766 LEU A CB  
1251 C CG  . LEU A 173 ? 0.3411 0.3411 0.3411 0.0000 0.0000 0.0000 2766 LEU A CG  
1252 C CD1 . LEU A 173 ? 0.3506 0.3506 0.3506 0.0000 0.0000 0.0000 2766 LEU A CD1 
1253 C CD2 . LEU A 173 ? 0.3447 0.3447 0.3447 0.0000 0.0000 0.0000 2766 LEU A CD2 
1254 N N   . VAL A 174 ? 0.3219 0.3219 0.3219 0.0000 0.0000 0.0000 2767 VAL A N   
1255 C CA  . VAL A 174 ? 0.3268 0.3268 0.3268 0.0000 0.0000 0.0000 2767 VAL A CA  
1256 C C   . VAL A 174 ? 0.3291 0.3291 0.3291 0.0000 0.0000 0.0000 2767 VAL A C   
1257 O O   . VAL A 174 ? 0.3319 0.3319 0.3319 0.0000 0.0000 0.0000 2767 VAL A O   
1258 C CB  . VAL A 174 ? 0.3286 0.3286 0.3286 0.0000 0.0000 0.0000 2767 VAL A CB  
1259 C CG1 . VAL A 174 ? 0.3381 0.3381 0.3381 0.0000 0.0000 0.0000 2767 VAL A CG1 
1260 C CG2 . VAL A 174 ? 0.3234 0.3234 0.3234 0.0000 0.0000 0.0000 2767 VAL A CG2 
1261 N N   . PRO A 175 ? 0.3361 0.3361 0.3361 0.0000 0.0000 0.0000 2768 PRO A N   
1262 C CA  . PRO A 175 ? 0.3325 0.3325 0.3325 0.0000 0.0000 0.0000 2768 PRO A CA  
1263 C C   . PRO A 175 ? 0.3329 0.3329 0.3329 0.0000 0.0000 0.0000 2768 PRO A C   
1264 O O   . PRO A 175 ? 0.3329 0.3329 0.3329 0.0000 0.0000 0.0000 2768 PRO A O   
1265 C CB  . PRO A 175 ? 0.3384 0.3384 0.3384 0.0000 0.0000 0.0000 2768 PRO A CB  
1266 C CG  . PRO A 175 ? 0.3344 0.3344 0.3344 0.0000 0.0000 0.0000 2768 PRO A CG  
1267 C CD  . PRO A 175 ? 0.3398 0.3398 0.3398 0.0000 0.0000 0.0000 2768 PRO A CD  
1268 N N   . TYR A 176 ? 0.3223 0.3223 0.3223 0.0000 0.0000 0.0000 2769 TYR A N   
1269 C CA  . TYR A 176 ? 0.3284 0.3284 0.3284 0.0000 0.0000 0.0000 2769 TYR A CA  
1270 C C   . TYR A 176 ? 0.3386 0.3386 0.3386 0.0000 0.0000 0.0000 2769 TYR A C   
1271 O O   . TYR A 176 ? 0.3309 0.3309 0.3309 0.0000 0.0000 0.0000 2769 TYR A O   
1272 C CB  . TYR A 176 ? 0.3266 0.3266 0.3266 0.0000 0.0000 0.0000 2769 TYR A CB  
1273 C CG  . TYR A 176 ? 0.3151 0.3151 0.3151 0.0000 0.0000 0.0000 2769 TYR A CG  
1274 C CD1 . TYR A 176 ? 0.2959 0.2959 0.2959 0.0000 0.0000 0.0000 2769 TYR A CD1 
1275 C CD2 . TYR A 176 ? 0.2980 0.2980 0.2980 0.0000 0.0000 0.0000 2769 TYR A CD2 
1276 C CE1 . TYR A 176 ? 0.3011 0.3011 0.3011 0.0000 0.0000 0.0000 2769 TYR A CE1 
1277 C CE2 . TYR A 176 ? 0.3175 0.3175 0.3175 0.0000 0.0000 0.0000 2769 TYR A CE2 
1278 C CZ  . TYR A 176 ? 0.3013 0.3013 0.3013 0.0000 0.0000 0.0000 2769 TYR A CZ  
1279 O OH  . TYR A 176 ? 0.3344 0.3344 0.3344 0.0000 0.0000 0.0000 2769 TYR A OH  
1280 N N   . ASP A 177 ? 0.3494 0.3494 0.3494 0.0000 0.0000 0.0000 2770 ASP A N   
1281 C CA  . ASP A 177 ? 0.3708 0.3708 0.3708 0.0000 0.0000 0.0000 2770 ASP A CA  
1282 C C   . ASP A 177 ? 0.3696 0.3696 0.3696 0.0000 0.0000 0.0000 2770 ASP A C   
1283 O O   . ASP A 177 ? 0.3932 0.3932 0.3932 0.0000 0.0000 0.0000 2770 ASP A O   
1284 C CB  . ASP A 177 ? 0.3784 0.3784 0.3784 0.0000 0.0000 0.0000 2770 ASP A CB  
1285 C CG  . ASP A 177 ? 0.4151 0.4151 0.4151 0.0000 0.0000 0.0000 2770 ASP A CG  
1286 O OD1 . ASP A 177 ? 0.4417 0.4417 0.4417 0.0000 0.0000 0.0000 2770 ASP A OD1 
1287 O OD2 . ASP A 177 ? 0.4822 0.4822 0.4822 0.0000 0.0000 0.0000 2770 ASP A OD2 
1288 N N   . THR A 178 ? 0.3561 0.3561 0.3561 0.0000 0.0000 0.0000 2771 THR A N   
1289 C CA  . THR A 178 ? 0.3505 0.3505 0.3505 0.0000 0.0000 0.0000 2771 THR A CA  
1290 C C   . THR A 178 ? 0.3328 0.3328 0.3328 0.0000 0.0000 0.0000 2771 THR A C   
1291 O O   . THR A 178 ? 0.3311 0.3311 0.3311 0.0000 0.0000 0.0000 2771 THR A O   
1292 C CB  . THR A 178 ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 2771 THR A CB  
1293 O OG1 . THR A 178 ? 0.3893 0.3893 0.3893 0.0000 0.0000 0.0000 2771 THR A OG1 
1294 C CG2 . THR A 178 ? 0.3612 0.3612 0.3612 0.0000 0.0000 0.0000 2771 THR A CG2 
1295 N N   . LEU A 179 ? 0.2991 0.2991 0.2991 0.0000 0.0000 0.0000 2772 LEU A N   
1296 C CA  . LEU A 179 ? 0.2863 0.2863 0.2863 0.0000 0.0000 0.0000 2772 LEU A CA  
1297 C C   . LEU A 179 ? 0.2801 0.2801 0.2801 0.0000 0.0000 0.0000 2772 LEU A C   
1298 O O   . LEU A 179 ? 0.2733 0.2733 0.2733 0.0000 0.0000 0.0000 2772 LEU A O   
1299 C CB  . LEU A 179 ? 0.2790 0.2790 0.2790 0.0000 0.0000 0.0000 2772 LEU A CB  
1300 C CG  . LEU A 179 ? 0.2771 0.2771 0.2771 0.0000 0.0000 0.0000 2772 LEU A CG  
1301 C CD1 . LEU A 179 ? 0.2579 0.2579 0.2579 0.0000 0.0000 0.0000 2772 LEU A CD1 
1302 C CD2 . LEU A 179 ? 0.2899 0.2899 0.2899 0.0000 0.0000 0.0000 2772 LEU A CD2 
1303 N N   . THR A 180 ? 0.2776 0.2776 0.2776 0.0000 0.0000 0.0000 2773 THR A N   
1304 C CA  . THR A 180 ? 0.2717 0.2717 0.2717 0.0000 0.0000 0.0000 2773 THR A CA  
1305 C C   . THR A 180 ? 0.2728 0.2728 0.2728 0.0000 0.0000 0.0000 2773 THR A C   
1306 O O   . THR A 180 ? 0.2558 0.2558 0.2558 0.0000 0.0000 0.0000 2773 THR A O   
1307 C CB  . THR A 180 ? 0.2753 0.2753 0.2753 0.0000 0.0000 0.0000 2773 THR A CB  
1308 O OG1 . THR A 180 ? 0.2563 0.2563 0.2563 0.0000 0.0000 0.0000 2773 THR A OG1 
1309 C CG2 . THR A 180 ? 0.2833 0.2833 0.2833 0.0000 0.0000 0.0000 2773 THR A CG2 
1310 N N   . ALA A 181 ? 0.2759 0.2759 0.2759 0.0000 0.0000 0.0000 2774 ALA A N   
1311 C CA  . ALA A 181 ? 0.2797 0.2797 0.2797 0.0000 0.0000 0.0000 2774 ALA A CA  
1312 C C   . ALA A 181 ? 0.2820 0.2820 0.2820 0.0000 0.0000 0.0000 2774 ALA A C   
1313 O O   . ALA A 181 ? 0.2755 0.2755 0.2755 0.0000 0.0000 0.0000 2774 ALA A O   
1314 C CB  . ALA A 181 ? 0.2834 0.2834 0.2834 0.0000 0.0000 0.0000 2774 ALA A CB  
1315 N N   . ALA A 182 ? 0.2785 0.2785 0.2785 0.0000 0.0000 0.0000 2775 ALA A N   
1316 C CA  . ALA A 182 ? 0.2657 0.2657 0.2657 0.0000 0.0000 0.0000 2775 ALA A CA  
1317 C C   . ALA A 182 ? 0.2577 0.2577 0.2577 0.0000 0.0000 0.0000 2775 ALA A C   
1318 O O   . ALA A 182 ? 0.2505 0.2505 0.2505 0.0000 0.0000 0.0000 2775 ALA A O   
1319 C CB  . ALA A 182 ? 0.2736 0.2736 0.2736 0.0000 0.0000 0.0000 2775 ALA A CB  
1320 N N   . GLU A 183 ? 0.2449 0.2449 0.2449 0.0000 0.0000 0.0000 2776 GLU A N   
1321 C CA  . GLU A 183 ? 0.2564 0.2564 0.2564 0.0000 0.0000 0.0000 2776 GLU A CA  
1322 C C   . GLU A 183 ? 0.2588 0.2588 0.2588 0.0000 0.0000 0.0000 2776 GLU A C   
1323 O O   . GLU A 183 ? 0.2729 0.2729 0.2729 0.0000 0.0000 0.0000 2776 GLU A O   
1324 C CB  . GLU A 183 ? 0.2477 0.2477 0.2477 0.0000 0.0000 0.0000 2776 GLU A CB  
1325 C CG  . GLU A 183 ? 0.2563 0.2563 0.2563 0.0000 0.0000 0.0000 2776 GLU A CG  
1326 C CD  . GLU A 183 ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2776 GLU A CD  
1327 O OE1 . GLU A 183 ? 0.2996 0.2996 0.2996 0.0000 0.0000 0.0000 2776 GLU A OE1 
1328 O OE2 . GLU A 183 ? 0.2850 0.2850 0.2850 0.0000 0.0000 0.0000 2776 GLU A OE2 
1329 N N   . LYS A 184 ? 0.2619 0.2619 0.2619 0.0000 0.0000 0.0000 2777 LYS A N   
1330 C CA  . LYS A 184 ? 0.2622 0.2622 0.2622 0.0000 0.0000 0.0000 2777 LYS A CA  
1331 C C   . LYS A 184 ? 0.2524 0.2524 0.2524 0.0000 0.0000 0.0000 2777 LYS A C   
1332 O O   . LYS A 184 ? 0.2311 0.2311 0.2311 0.0000 0.0000 0.0000 2777 LYS A O   
1333 C CB  . LYS A 184 ? 0.2652 0.2652 0.2652 0.0000 0.0000 0.0000 2777 LYS A CB  
1334 C CG  . LYS A 184 ? 0.3033 0.3033 0.3033 0.0000 0.0000 0.0000 2777 LYS A CG  
1335 C CD  . LYS A 184 ? 0.3282 0.3282 0.3282 0.0000 0.0000 0.0000 2777 LYS A CD  
1336 C CE  . LYS A 184 ? 0.3848 0.3848 0.3848 0.0000 0.0000 0.0000 2777 LYS A CE  
1337 N NZ  . LYS A 184 ? 0.4024 0.4024 0.4024 0.0000 0.0000 0.0000 2777 LYS A NZ  
1338 N N   . PHE A 185 ? 0.2422 0.2422 0.2422 0.0000 0.0000 0.0000 2778 PHE A N   
1339 C CA  . PHE A 185 ? 0.2434 0.2434 0.2434 0.0000 0.0000 0.0000 2778 PHE A CA  
1340 C C   . PHE A 185 ? 0.2372 0.2372 0.2372 0.0000 0.0000 0.0000 2778 PHE A C   
1341 O O   . PHE A 185 ? 0.2369 0.2369 0.2369 0.0000 0.0000 0.0000 2778 PHE A O   
1342 C CB  . PHE A 185 ? 0.2416 0.2416 0.2416 0.0000 0.0000 0.0000 2778 PHE A CB  
1343 C CG  . PHE A 185 ? 0.2944 0.2944 0.2944 0.0000 0.0000 0.0000 2778 PHE A CG  
1344 C CD1 . PHE A 185 ? 0.3425 0.3425 0.3425 0.0000 0.0000 0.0000 2778 PHE A CD1 
1345 C CD2 . PHE A 185 ? 0.3333 0.3333 0.3333 0.0000 0.0000 0.0000 2778 PHE A CD2 
1346 C CE1 . PHE A 185 ? 0.3522 0.3522 0.3522 0.0000 0.0000 0.0000 2778 PHE A CE1 
1347 C CE2 . PHE A 185 ? 0.3553 0.3553 0.3553 0.0000 0.0000 0.0000 2778 PHE A CE2 
1348 C CZ  . PHE A 185 ? 0.3580 0.3580 0.3580 0.0000 0.0000 0.0000 2778 PHE A CZ  
1349 N N   . LYS A 186 ? 0.2339 0.2339 0.2339 0.0000 0.0000 0.0000 2779 LYS A N   
1350 C CA  . LYS A 186 ? 0.2412 0.2412 0.2412 0.0000 0.0000 0.0000 2779 LYS A CA  
1351 C C   . LYS A 186 ? 0.2413 0.2413 0.2413 0.0000 0.0000 0.0000 2779 LYS A C   
1352 O O   . LYS A 186 ? 0.2392 0.2392 0.2392 0.0000 0.0000 0.0000 2779 LYS A O   
1353 C CB  . LYS A 186 ? 0.2500 0.2500 0.2500 0.0000 0.0000 0.0000 2779 LYS A CB  
1354 C CG  . LYS A 186 ? 0.2893 0.2893 0.2893 0.0000 0.0000 0.0000 2779 LYS A CG  
1355 C CD  . LYS A 186 ? 0.3710 0.3710 0.3710 0.0000 0.0000 0.0000 2779 LYS A CD  
1356 C CE  . LYS A 186 ? 0.4312 0.4312 0.4312 0.0000 0.0000 0.0000 2779 LYS A CE  
1357 N NZ  . LYS A 186 ? 0.4664 0.4664 0.4664 0.0000 0.0000 0.0000 2779 LYS A NZ  
1358 N N   . ASP A 187 ? 0.2292 0.2292 0.2292 0.0000 0.0000 0.0000 2780 ASP A N   
1359 C CA  . ASP A 187 ? 0.2349 0.2349 0.2349 0.0000 0.0000 0.0000 2780 ASP A CA  
1360 C C   . ASP A 187 ? 0.2348 0.2348 0.2348 0.0000 0.0000 0.0000 2780 ASP A C   
1361 O O   . ASP A 187 ? 0.2287 0.2287 0.2287 0.0000 0.0000 0.0000 2780 ASP A O   
1362 C CB  . ASP A 187 ? 0.2393 0.2393 0.2393 0.0000 0.0000 0.0000 2780 ASP A CB  
1363 C CG  . ASP A 187 ? 0.2666 0.2666 0.2666 0.0000 0.0000 0.0000 2780 ASP A CG  
1364 O OD1 . ASP A 187 ? 0.2885 0.2885 0.2885 0.0000 0.0000 0.0000 2780 ASP A OD1 
1365 O OD2 . ASP A 187 ? 0.3166 0.3166 0.3166 0.0000 0.0000 0.0000 2780 ASP A OD2 
1366 N N   . ARG A 188 ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 2781 ARG A N   
1367 C CA  . ARG A 188 ? 0.2519 0.2519 0.2519 0.0000 0.0000 0.0000 2781 ARG A CA  
1368 C C   . ARG A 188 ? 0.2581 0.2581 0.2581 0.0000 0.0000 0.0000 2781 ARG A C   
1369 O O   . ARG A 188 ? 0.2524 0.2524 0.2524 0.0000 0.0000 0.0000 2781 ARG A O   
1370 C CB  . ARG A 188 ? 0.2666 0.2666 0.2666 0.0000 0.0000 0.0000 2781 ARG A CB  
1371 C CG  . ARG A 188 ? 0.3196 0.3196 0.3196 0.0000 0.0000 0.0000 2781 ARG A CG  
1372 C CD  . ARG A 188 ? 0.4004 0.4004 0.4004 0.0000 0.0000 0.0000 2781 ARG A CD  
1373 N NE  . ARG A 188 ? 0.4660 0.4660 0.4660 0.0000 0.0000 0.0000 2781 ARG A NE  
1374 C CZ  . ARG A 188 ? 0.4539 0.4539 0.4539 0.0000 0.0000 0.0000 2781 ARG A CZ  
1375 N NH1 . ARG A 188 ? 0.4605 0.4605 0.4605 0.0000 0.0000 0.0000 2781 ARG A NH1 
1376 N NH2 . ARG A 188 ? 0.4507 0.4507 0.4507 0.0000 0.0000 0.0000 2781 ARG A NH2 
1377 N N   . GLU A 189 ? 0.2506 0.2506 0.2506 0.0000 0.0000 0.0000 2782 GLU A N   
1378 C CA  . GLU A 189 ? 0.2602 0.2602 0.2602 0.0000 0.0000 0.0000 2782 GLU A CA  
1379 C C   . GLU A 189 ? 0.2552 0.2552 0.2552 0.0000 0.0000 0.0000 2782 GLU A C   
1380 O O   . GLU A 189 ? 0.2624 0.2624 0.2624 0.0000 0.0000 0.0000 2782 GLU A O   
1381 C CB  . GLU A 189 ? 0.2666 0.2666 0.2666 0.0000 0.0000 0.0000 2782 GLU A CB  
1382 C CG  . GLU A 189 ? 0.3168 0.3168 0.3168 0.0000 0.0000 0.0000 2782 GLU A CG  
1383 C CD  . GLU A 189 ? 0.3712 0.3712 0.3712 0.0000 0.0000 0.0000 2782 GLU A CD  
1384 O OE1 . GLU A 189 ? 0.4102 0.4102 0.4102 0.0000 0.0000 0.0000 2782 GLU A OE1 
1385 O OE2 . GLU A 189 ? 0.3917 0.3917 0.3917 0.0000 0.0000 0.0000 2782 GLU A OE2 
1386 N N   . LYS A 190 ? 0.2422 0.2422 0.2422 0.0000 0.0000 0.0000 2783 LYS A N   
1387 C CA  . LYS A 190 ? 0.2396 0.2396 0.2396 0.0000 0.0000 0.0000 2783 LYS A CA  
1388 C C   . LYS A 190 ? 0.2388 0.2388 0.2388 0.0000 0.0000 0.0000 2783 LYS A C   
1389 O O   . LYS A 190 ? 0.2526 0.2526 0.2526 0.0000 0.0000 0.0000 2783 LYS A O   
1390 C CB  . LYS A 190 ? 0.2438 0.2438 0.2438 0.0000 0.0000 0.0000 2783 LYS A CB  
1391 C CG  . LYS A 190 ? 0.2641 0.2641 0.2641 0.0000 0.0000 0.0000 2783 LYS A CG  
1392 C CD  . LYS A 190 ? 0.3049 0.3049 0.3049 0.0000 0.0000 0.0000 2783 LYS A CD  
1393 C CE  . LYS A 190 ? 0.3363 0.3363 0.3363 0.0000 0.0000 0.0000 2783 LYS A CE  
1394 N NZ  . LYS A 190 ? 0.3941 0.3941 0.3941 0.0000 0.0000 0.0000 2783 LYS A NZ  
1395 N N   . ALA A 191 ? 0.2317 0.2317 0.2317 0.0000 0.0000 0.0000 2784 ALA A N   
1396 C CA  . ALA A 191 ? 0.2326 0.2326 0.2326 0.0000 0.0000 0.0000 2784 ALA A CA  
1397 C C   . ALA A 191 ? 0.2381 0.2381 0.2381 0.0000 0.0000 0.0000 2784 ALA A C   
1398 O O   . ALA A 191 ? 0.2350 0.2350 0.2350 0.0000 0.0000 0.0000 2784 ALA A O   
1399 C CB  . ALA A 191 ? 0.2348 0.2348 0.2348 0.0000 0.0000 0.0000 2784 ALA A CB  
1400 N N   . GLN A 192 ? 0.2431 0.2431 0.2431 0.0000 0.0000 0.0000 2785 GLN A N   
1401 C CA  . GLN A 192 ? 0.2560 0.2560 0.2560 0.0000 0.0000 0.0000 2785 GLN A CA  
1402 C C   . GLN A 192 ? 0.2526 0.2526 0.2526 0.0000 0.0000 0.0000 2785 GLN A C   
1403 O O   . GLN A 192 ? 0.2520 0.2520 0.2520 0.0000 0.0000 0.0000 2785 GLN A O   
1404 C CB  . GLN A 192 ? 0.2587 0.2587 0.2587 0.0000 0.0000 0.0000 2785 GLN A CB  
1405 C CG  . GLN A 192 ? 0.3232 0.3232 0.3232 0.0000 0.0000 0.0000 2785 GLN A CG  
1406 C CD  . GLN A 192 ? 0.3957 0.3957 0.3957 0.0000 0.0000 0.0000 2785 GLN A CD  
1407 O OE1 . GLN A 192 ? 0.4256 0.4256 0.4256 0.0000 0.0000 0.0000 2785 GLN A OE1 
1408 N NE2 . GLN A 192 ? 0.4254 0.4254 0.4254 0.0000 0.0000 0.0000 2785 GLN A NE2 
1409 N N   . ASP A 193 ? 0.2522 0.2522 0.2522 0.0000 0.0000 0.0000 2786 ASP A N   
1410 C CA  A ASP A 193 ? 0.2569 0.2569 0.2569 0.0000 0.0000 0.0000 2786 ASP A CA  
1411 C CA  B ASP A 193 ? 0.2600 0.2600 0.2600 0.0000 0.0000 0.0000 2786 ASP A CA  
1412 C C   . ASP A 193 ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 2786 ASP A C   
1413 O O   . ASP A 193 ? 0.2715 0.2715 0.2715 0.0000 0.0000 0.0000 2786 ASP A O   
1414 C CB  A ASP A 193 ? 0.2588 0.2588 0.2588 0.0000 0.0000 0.0000 2786 ASP A CB  
1415 C CB  B ASP A 193 ? 0.2664 0.2664 0.2664 0.0000 0.0000 0.0000 2786 ASP A CB  
1416 C CG  A ASP A 193 ? 0.2683 0.2683 0.2683 0.0000 0.0000 0.0000 2786 ASP A CG  
1417 C CG  B ASP A 193 ? 0.2833 0.2833 0.2833 0.0000 0.0000 0.0000 2786 ASP A CG  
1418 O OD1 A ASP A 193 ? 0.2606 0.2606 0.2606 0.0000 0.0000 0.0000 2786 ASP A OD1 
1419 O OD1 B ASP A 193 ? 0.3026 0.3026 0.3026 0.0000 0.0000 0.0000 2786 ASP A OD1 
1420 O OD2 A ASP A 193 ? 0.2554 0.2554 0.2554 0.0000 0.0000 0.0000 2786 ASP A OD2 
1421 O OD2 B ASP A 193 ? 0.3318 0.3318 0.3318 0.0000 0.0000 0.0000 2786 ASP A OD2 
1422 N N   . LEU A 194 ? 0.2543 0.2543 0.2543 0.0000 0.0000 0.0000 2787 LEU A N   
1423 C CA  . LEU A 194 ? 0.2419 0.2419 0.2419 0.0000 0.0000 0.0000 2787 LEU A CA  
1424 C C   . LEU A 194 ? 0.2417 0.2417 0.2417 0.0000 0.0000 0.0000 2787 LEU A C   
1425 O O   . LEU A 194 ? 0.2344 0.2344 0.2344 0.0000 0.0000 0.0000 2787 LEU A O   
1426 C CB  . LEU A 194 ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 2787 LEU A CB  
1427 C CG  . LEU A 194 ? 0.2588 0.2588 0.2588 0.0000 0.0000 0.0000 2787 LEU A CG  
1428 C CD1 . LEU A 194 ? 0.2858 0.2858 0.2858 0.0000 0.0000 0.0000 2787 LEU A CD1 
1429 C CD2 . LEU A 194 ? 0.2821 0.2821 0.2821 0.0000 0.0000 0.0000 2787 LEU A CD2 
1430 N N   . PHE A 195 ? 0.2320 0.2320 0.2320 0.0000 0.0000 0.0000 2788 PHE A N   
1431 C CA  . PHE A 195 ? 0.2391 0.2391 0.2391 0.0000 0.0000 0.0000 2788 PHE A CA  
1432 C C   . PHE A 195 ? 0.2344 0.2344 0.2344 0.0000 0.0000 0.0000 2788 PHE A C   
1433 O O   . PHE A 195 ? 0.2407 0.2407 0.2407 0.0000 0.0000 0.0000 2788 PHE A O   
1434 C CB  . PHE A 195 ? 0.2394 0.2394 0.2394 0.0000 0.0000 0.0000 2788 PHE A CB  
1435 C CG  . PHE A 195 ? 0.2617 0.2617 0.2617 0.0000 0.0000 0.0000 2788 PHE A CG  
1436 C CD1 . PHE A 195 ? 0.2969 0.2969 0.2969 0.0000 0.0000 0.0000 2788 PHE A CD1 
1437 C CD2 . PHE A 195 ? 0.3009 0.3009 0.3009 0.0000 0.0000 0.0000 2788 PHE A CD2 
1438 C CE1 . PHE A 195 ? 0.3076 0.3076 0.3076 0.0000 0.0000 0.0000 2788 PHE A CE1 
1439 C CE2 . PHE A 195 ? 0.3024 0.3024 0.3024 0.0000 0.0000 0.0000 2788 PHE A CE2 
1440 C CZ  . PHE A 195 ? 0.2899 0.2899 0.2899 0.0000 0.0000 0.0000 2788 PHE A CZ  
1441 N N   . LYS A 196 ? 0.2321 0.2321 0.2321 0.0000 0.0000 0.0000 2789 LYS A N   
1442 C CA  . LYS A 196 ? 0.2353 0.2353 0.2353 0.0000 0.0000 0.0000 2789 LYS A CA  
1443 C C   . LYS A 196 ? 0.2388 0.2388 0.2388 0.0000 0.0000 0.0000 2789 LYS A C   
1444 O O   . LYS A 196 ? 0.2425 0.2425 0.2425 0.0000 0.0000 0.0000 2789 LYS A O   
1445 C CB  . LYS A 196 ? 0.2373 0.2373 0.2373 0.0000 0.0000 0.0000 2789 LYS A CB  
1446 C CG  . LYS A 196 ? 0.2548 0.2548 0.2548 0.0000 0.0000 0.0000 2789 LYS A CG  
1447 C CD  . LYS A 196 ? 0.3030 0.3030 0.3030 0.0000 0.0000 0.0000 2789 LYS A CD  
1448 C CE  . LYS A 196 ? 0.3567 0.3567 0.3567 0.0000 0.0000 0.0000 2789 LYS A CE  
1449 N NZ  . LYS A 196 ? 0.4104 0.4104 0.4104 0.0000 0.0000 0.0000 2789 LYS A NZ  
1450 N N   . PHE A 197 ? 0.2381 0.2381 0.2381 0.0000 0.0000 0.0000 2790 PHE A N   
1451 C CA  . PHE A 197 ? 0.2356 0.2356 0.2356 0.0000 0.0000 0.0000 2790 PHE A CA  
1452 C C   . PHE A 197 ? 0.2402 0.2402 0.2402 0.0000 0.0000 0.0000 2790 PHE A C   
1453 O O   . PHE A 197 ? 0.2489 0.2489 0.2489 0.0000 0.0000 0.0000 2790 PHE A O   
1454 C CB  . PHE A 197 ? 0.2316 0.2316 0.2316 0.0000 0.0000 0.0000 2790 PHE A CB  
1455 C CG  . PHE A 197 ? 0.2387 0.2387 0.2387 0.0000 0.0000 0.0000 2790 PHE A CG  
1456 C CD1 . PHE A 197 ? 0.2429 0.2429 0.2429 0.0000 0.0000 0.0000 2790 PHE A CD1 
1457 C CD2 . PHE A 197 ? 0.2426 0.2426 0.2426 0.0000 0.0000 0.0000 2790 PHE A CD2 
1458 C CE1 . PHE A 197 ? 0.2576 0.2576 0.2576 0.0000 0.0000 0.0000 2790 PHE A CE1 
1459 C CE2 . PHE A 197 ? 0.2598 0.2598 0.2598 0.0000 0.0000 0.0000 2790 PHE A CE2 
1460 C CZ  . PHE A 197 ? 0.2559 0.2559 0.2559 0.0000 0.0000 0.0000 2790 PHE A CZ  
1461 N N   . LEU A 198 ? 0.2440 0.2440 0.2440 0.0000 0.0000 0.0000 2791 LEU A N   
1462 C CA  . LEU A 198 ? 0.2554 0.2554 0.2554 0.0000 0.0000 0.0000 2791 LEU A CA  
1463 C C   . LEU A 198 ? 0.2615 0.2615 0.2615 0.0000 0.0000 0.0000 2791 LEU A C   
1464 O O   . LEU A 198 ? 0.2881 0.2881 0.2881 0.0000 0.0000 0.0000 2791 LEU A O   
1465 C CB  . LEU A 198 ? 0.2524 0.2524 0.2524 0.0000 0.0000 0.0000 2791 LEU A CB  
1466 C CG  . LEU A 198 ? 0.2591 0.2591 0.2591 0.0000 0.0000 0.0000 2791 LEU A CG  
1467 C CD1 . LEU A 198 ? 0.2707 0.2707 0.2707 0.0000 0.0000 0.0000 2791 LEU A CD1 
1468 C CD2 . LEU A 198 ? 0.2448 0.2448 0.2448 0.0000 0.0000 0.0000 2791 LEU A CD2 
1469 N N   . GLN A 199 ? 0.2669 0.2669 0.2669 0.0000 0.0000 0.0000 2792 GLN A N   
1470 C CA  . GLN A 199 ? 0.2825 0.2825 0.2825 0.0000 0.0000 0.0000 2792 GLN A CA  
1471 C C   . GLN A 199 ? 0.2805 0.2805 0.2805 0.0000 0.0000 0.0000 2792 GLN A C   
1472 O O   . GLN A 199 ? 0.2750 0.2750 0.2750 0.0000 0.0000 0.0000 2792 GLN A O   
1473 C CB  . GLN A 199 ? 0.2876 0.2876 0.2876 0.0000 0.0000 0.0000 2792 GLN A CB  
1474 C CG  . GLN A 199 ? 0.3241 0.3241 0.3241 0.0000 0.0000 0.0000 2792 GLN A CG  
1475 C CD  . GLN A 199 ? 0.3631 0.3631 0.3631 0.0000 0.0000 0.0000 2792 GLN A CD  
1476 O OE1 . GLN A 199 ? 0.3609 0.3609 0.3609 0.0000 0.0000 0.0000 2792 GLN A OE1 
1477 N NE2 . GLN A 199 ? 0.3814 0.3814 0.3814 0.0000 0.0000 0.0000 2792 GLN A NE2 
1478 N N   . VAL A 200 ? 0.2786 0.2786 0.2786 0.0000 0.0000 0.0000 2793 VAL A N   
1479 C CA  . VAL A 200 ? 0.2869 0.2869 0.2869 0.0000 0.0000 0.0000 2793 VAL A CA  
1480 C C   . VAL A 200 ? 0.3006 0.3006 0.3006 0.0000 0.0000 0.0000 2793 VAL A C   
1481 O O   . VAL A 200 ? 0.3059 0.3059 0.3059 0.0000 0.0000 0.0000 2793 VAL A O   
1482 C CB  . VAL A 200 ? 0.2876 0.2876 0.2876 0.0000 0.0000 0.0000 2793 VAL A CB  
1483 C CG1 . VAL A 200 ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 2793 VAL A CG1 
1484 C CG2 . VAL A 200 ? 0.2749 0.2749 0.2749 0.0000 0.0000 0.0000 2793 VAL A CG2 
1485 N N   . ASN A 201 ? 0.2977 0.2977 0.2977 0.0000 0.0000 0.0000 2794 ASN A N   
1486 C CA  . ASN A 201 ? 0.3111 0.3111 0.3111 0.0000 0.0000 0.0000 2794 ASN A CA  
1487 C C   . ASN A 201 ? 0.3222 0.3222 0.3222 0.0000 0.0000 0.0000 2794 ASN A C   
1488 O O   . ASN A 201 ? 0.3265 0.3265 0.3265 0.0000 0.0000 0.0000 2794 ASN A O   
1489 C CB  . ASN A 201 ? 0.3105 0.3105 0.3105 0.0000 0.0000 0.0000 2794 ASN A CB  
1490 C CG  . ASN A 201 ? 0.2940 0.2940 0.2940 0.0000 0.0000 0.0000 2794 ASN A CG  
1491 O OD1 . ASN A 201 ? 0.3208 0.3208 0.3208 0.0000 0.0000 0.0000 2794 ASN A OD1 
1492 N ND2 . ASN A 201 ? 0.2945 0.2945 0.2945 0.0000 0.0000 0.0000 2794 ASN A ND2 
1493 N N   . GLY A 202 ? 0.3332 0.3332 0.3332 0.0000 0.0000 0.0000 2795 GLY A N   
1494 C CA  . GLY A 202 ? 0.3409 0.3409 0.3409 0.0000 0.0000 0.0000 2795 GLY A CA  
1495 C C   . GLY A 202 ? 0.3465 0.3465 0.3465 0.0000 0.0000 0.0000 2795 GLY A C   
1496 O O   . GLY A 202 ? 0.3591 0.3591 0.3591 0.0000 0.0000 0.0000 2795 GLY A O   
1497 N N   . ILE A 203 ? 0.3409 0.3409 0.3409 0.0000 0.0000 0.0000 2796 ILE A N   
1498 C CA  . ILE A 203 ? 0.3382 0.3382 0.3382 0.0000 0.0000 0.0000 2796 ILE A CA  
1499 C C   . ILE A 203 ? 0.3481 0.3481 0.3481 0.0000 0.0000 0.0000 2796 ILE A C   
1500 O O   . ILE A 203 ? 0.3624 0.3624 0.3624 0.0000 0.0000 0.0000 2796 ILE A O   
1501 C CB  . ILE A 203 ? 0.3291 0.3291 0.3291 0.0000 0.0000 0.0000 2796 ILE A CB  
1502 C CG1 . ILE A 203 ? 0.3251 0.3251 0.3251 0.0000 0.0000 0.0000 2796 ILE A CG1 
1503 C CG2 . ILE A 203 ? 0.3338 0.3338 0.3338 0.0000 0.0000 0.0000 2796 ILE A CG2 
1504 C CD1 . ILE A 203 ? 0.3358 0.3358 0.3358 0.0000 0.0000 0.0000 2796 ILE A CD1 
1505 N N   . ILE A 204 ? 0.3499 0.3499 0.3499 0.0000 0.0000 0.0000 2797 ILE A N   
1506 C CA  . ILE A 204 ? 0.3594 0.3594 0.3594 0.0000 0.0000 0.0000 2797 ILE A CA  
1507 C C   . ILE A 204 ? 0.3561 0.3561 0.3561 0.0000 0.0000 0.0000 2797 ILE A C   
1508 O O   . ILE A 204 ? 0.3580 0.3580 0.3580 0.0000 0.0000 0.0000 2797 ILE A O   
1509 C CB  . ILE A 204 ? 0.3683 0.3683 0.3683 0.0000 0.0000 0.0000 2797 ILE A CB  
1510 C CG1 . ILE A 204 ? 0.3923 0.3923 0.3923 0.0000 0.0000 0.0000 2797 ILE A CG1 
1511 C CG2 . ILE A 204 ? 0.3769 0.3769 0.3769 0.0000 0.0000 0.0000 2797 ILE A CG2 
1512 C CD1 . ILE A 204 ? 0.4477 0.4477 0.4477 0.0000 0.0000 0.0000 2797 ILE A CD1 
1513 N N   . VAL A 205 ? 0.3513 0.3513 0.3513 0.0000 0.0000 0.0000 2798 VAL A N   
1514 C CA  . VAL A 205 ? 0.3609 0.3609 0.3609 0.0000 0.0000 0.0000 2798 VAL A CA  
1515 C C   . VAL A 205 ? 0.3698 0.3698 0.3698 0.0000 0.0000 0.0000 2798 VAL A C   
1516 O O   . VAL A 205 ? 0.3738 0.3738 0.3738 0.0000 0.0000 0.0000 2798 VAL A O   
1517 C CB  . VAL A 205 ? 0.3514 0.3514 0.3514 0.0000 0.0000 0.0000 2798 VAL A CB  
1518 C CG1 . VAL A 205 ? 0.3555 0.3555 0.3555 0.0000 0.0000 0.0000 2798 VAL A CG1 
1519 C CG2 . VAL A 205 ? 0.3608 0.3608 0.3608 0.0000 0.0000 0.0000 2798 VAL A CG2 
1520 N N   . SER A 206 ? 0.3785 0.3785 0.3785 0.0000 0.0000 0.0000 2799 SER A N   
1521 C CA  . SER A 206 ? 0.3924 0.3924 0.3924 0.0000 0.0000 0.0000 2799 SER A CA  
1522 C C   . SER A 206 ? 0.3962 0.3962 0.3962 0.0000 0.0000 0.0000 2799 SER A C   
1523 O O   . SER A 206 ? 0.3889 0.3889 0.3889 0.0000 0.0000 0.0000 2799 SER A O   
1524 C CB  . SER A 206 ? 0.3961 0.3961 0.3961 0.0000 0.0000 0.0000 2799 SER A CB  
1525 O OG  . SER A 206 ? 0.4274 0.4274 0.4274 0.0000 0.0000 0.0000 2799 SER A OG  
1526 N N   . ARG A 207 ? 0.4038 0.4038 0.4038 0.0000 0.0000 0.0000 2800 ARG A N   
1527 C CA  . ARG A 207 ? 0.4214 0.4214 0.4214 0.0000 0.0000 0.0000 2800 ARG A CA  
1528 C C   . ARG A 207 ? 0.4273 0.4273 0.4273 0.0000 0.0000 0.0000 2800 ARG A C   
1529 O O   . ARG A 207 ? 0.4394 0.4394 0.4394 0.0000 0.0000 0.0000 2800 ARG A O   
1530 C CB  . ARG A 207 ? 0.4201 0.4201 0.4201 0.0000 0.0000 0.0000 2800 ARG A CB  
1531 C CG  . ARG A 207 ? 0.4365 0.4365 0.4365 0.0000 0.0000 0.0000 2800 ARG A CG  
1532 C CD  . ARG A 207 ? 0.4556 0.4556 0.4556 0.0000 0.0000 0.0000 2800 ARG A CD  
1533 N NE  . ARG A 207 ? 0.4615 0.4615 0.4615 0.0000 0.0000 0.0000 2800 ARG A NE  
1534 C CZ  . ARG A 207 ? 0.4650 0.4650 0.4650 0.0000 0.0000 0.0000 2800 ARG A CZ  
1535 N NH1 . ARG A 207 ? 0.4608 0.4608 0.4608 0.0000 0.0000 0.0000 2800 ARG A NH1 
1536 N NH2 . ARG A 207 ? 0.4556 0.4556 0.4556 0.0000 0.0000 0.0000 2800 ARG A NH2 
1537 S S   . SO4 B .   ? 0.5734 0.5734 0.5734 0.0000 0.0000 0.0000 2901 SO4 A S   
1538 O O1  . SO4 B .   ? 0.5629 0.5629 0.5629 0.0000 0.0000 0.0000 2901 SO4 A O1  
1539 O O2  . SO4 B .   ? 0.5775 0.5775 0.5775 0.0000 0.0000 0.0000 2901 SO4 A O2  
1540 O O3  . SO4 B .   ? 0.6014 0.6014 0.6014 0.0000 0.0000 0.0000 2901 SO4 A O3  
1541 O O4  . SO4 B .   ? 0.6080 0.6080 0.6080 0.0000 0.0000 0.0000 2901 SO4 A O4  
1542 S S   . SO4 C .   ? 0.7396 0.7396 0.7396 0.0000 0.0000 0.0000 2902 SO4 A S   
1543 O O1  . SO4 C .   ? 0.7477 0.7477 0.7477 0.0000 0.0000 0.0000 2902 SO4 A O1  
1544 O O2  . SO4 C .   ? 0.7414 0.7414 0.7414 0.0000 0.0000 0.0000 2902 SO4 A O2  
1545 O O3  . SO4 C .   ? 0.7372 0.7372 0.7372 0.0000 0.0000 0.0000 2902 SO4 A O3  
1546 O O4  . SO4 C .   ? 0.7401 0.7401 0.7401 0.0000 0.0000 0.0000 2902 SO4 A O4  
1547 S S   . SO4 D .   ? 0.5548 0.5548 0.5548 0.0000 0.0000 0.0000 2903 SO4 A S   
1548 O O1  . SO4 D .   ? 0.5681 0.5681 0.5681 0.0000 0.0000 0.0000 2903 SO4 A O1  
1549 O O2  . SO4 D .   ? 0.5449 0.5449 0.5449 0.0000 0.0000 0.0000 2903 SO4 A O2  
1550 O O3  . SO4 D .   ? 0.5570 0.5570 0.5570 0.0000 0.0000 0.0000 2903 SO4 A O3  
1551 O O4  . SO4 D .   ? 0.5749 0.5749 0.5749 0.0000 0.0000 0.0000 2903 SO4 A O4  
1552 C C1  . GOL E .   ? 0.3895 0.3895 0.3895 0.0000 0.0000 0.0000 2904 GOL A C1  
1553 O O1  . GOL E .   ? 0.3873 0.3873 0.3873 0.0000 0.0000 0.0000 2904 GOL A O1  
1554 C C2  . GOL E .   ? 0.3620 0.3620 0.3620 0.0000 0.0000 0.0000 2904 GOL A C2  
1555 O O2  . GOL E .   ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 2904 GOL A O2  
1556 C C3  . GOL E .   ? 0.3851 0.3851 0.3851 0.0000 0.0000 0.0000 2904 GOL A C3  
1557 O O3  . GOL E .   ? 0.4064 0.4064 0.4064 0.0000 0.0000 0.0000 2904 GOL A O3  
1558 C C1  . GOL F .   ? 0.3826 0.3826 0.3826 0.0000 0.0000 0.0000 2905 GOL A C1  
1559 O O1  . GOL F .   ? 0.3960 0.3960 0.3960 0.0000 0.0000 0.0000 2905 GOL A O1  
1560 C C2  . GOL F .   ? 0.3937 0.3937 0.3937 0.0000 0.0000 0.0000 2905 GOL A C2  
1561 O O2  . GOL F .   ? 0.3480 0.3480 0.3480 0.0000 0.0000 0.0000 2905 GOL A O2  
1562 C C3  . GOL F .   ? 0.4076 0.4076 0.4076 0.0000 0.0000 0.0000 2905 GOL A C3  
1563 O O3  . GOL F .   ? 0.4188 0.4188 0.4188 0.0000 0.0000 0.0000 2905 GOL A O3  
1564 C C1  . GOL G .   ? 0.5214 0.5214 0.5214 0.0000 0.0000 0.0000 2906 GOL A C1  
1565 O O1  . GOL G .   ? 0.5610 0.5610 0.5610 0.0000 0.0000 0.0000 2906 GOL A O1  
1566 C C2  . GOL G .   ? 0.5090 0.5090 0.5090 0.0000 0.0000 0.0000 2906 GOL A C2  
1567 O O2  . GOL G .   ? 0.5252 0.5252 0.5252 0.0000 0.0000 0.0000 2906 GOL A O2  
1568 C C3  . GOL G .   ? 0.4764 0.4764 0.4764 0.0000 0.0000 0.0000 2906 GOL A C3  
1569 O O3  . GOL G .   ? 0.4527 0.4527 0.4527 0.0000 0.0000 0.0000 2906 GOL A O3  
1570 O O   . HOH H .   ? 0.2858 0.2858 0.2858 0.0000 0.0000 0.0000 3001 HOH A O   
1571 O O   . HOH H .   ? 0.2432 0.2432 0.2432 0.0000 0.0000 0.0000 3002 HOH A O   
1572 O O   . HOH H .   ? 0.2698 0.2698 0.2698 0.0000 0.0000 0.0000 3003 HOH A O   
1573 O O   . HOH H .   ? 0.2474 0.2474 0.2474 0.0000 0.0000 0.0000 3004 HOH A O   
1574 O O   . HOH H .   ? 0.2467 0.2467 0.2467 0.0000 0.0000 0.0000 3005 HOH A O   
1575 O O   . HOH H .   ? 0.3262 0.3262 0.3262 0.0000 0.0000 0.0000 3006 HOH A O   
1576 O O   . HOH H .   ? 0.3051 0.3051 0.3051 0.0000 0.0000 0.0000 3007 HOH A O   
1577 O O   . HOH H .   ? 0.2517 0.2517 0.2517 0.0000 0.0000 0.0000 3008 HOH A O   
1578 O O   . HOH H .   ? 0.2820 0.2820 0.2820 0.0000 0.0000 0.0000 3009 HOH A O   
1579 O O   . HOH H .   ? 0.3019 0.3019 0.3019 0.0000 0.0000 0.0000 3010 HOH A O   
1580 O O   . HOH H .   ? 0.2987 0.2987 0.2987 0.0000 0.0000 0.0000 3011 HOH A O   
1581 O O   . HOH H .   ? 0.3277 0.3277 0.3277 0.0000 0.0000 0.0000 3012 HOH A O   
1582 O O   . HOH H .   ? 0.2826 0.2826 0.2826 0.0000 0.0000 0.0000 3013 HOH A O   
1583 O O   . HOH H .   ? 0.3447 0.3447 0.3447 0.0000 0.0000 0.0000 3014 HOH A O   
1584 O O   . HOH H .   ? 0.3472 0.3472 0.3472 0.0000 0.0000 0.0000 3015 HOH A O   
1585 O O   . HOH H .   ? 0.3477 0.3477 0.3477 0.0000 0.0000 0.0000 3016 HOH A O   
1586 O O   . HOH H .   ? 0.3590 0.3590 0.3590 0.0000 0.0000 0.0000 3017 HOH A O   
1587 O O   . HOH H .   ? 0.3344 0.3344 0.3344 0.0000 0.0000 0.0000 3018 HOH A O   
1588 O O   . HOH H .   ? 0.3329 0.3329 0.3329 0.0000 0.0000 0.0000 3019 HOH A O   
1589 O O   . HOH H .   ? 0.3159 0.3159 0.3159 0.0000 0.0000 0.0000 3020 HOH A O   
1590 O O   . HOH H .   ? 0.3351 0.3351 0.3351 0.0000 0.0000 0.0000 3021 HOH A O   
1591 O O   . HOH H .   ? 0.3100 0.3100 0.3100 0.0000 0.0000 0.0000 3022 HOH A O   
1592 O O   . HOH H .   ? 0.3760 0.3760 0.3760 0.0000 0.0000 0.0000 3023 HOH A O   
1593 O O   . HOH H .   ? 0.3346 0.3346 0.3346 0.0000 0.0000 0.0000 3024 HOH A O   
1594 O O   . HOH H .   ? 0.3411 0.3411 0.3411 0.0000 0.0000 0.0000 3025 HOH A O   
1595 O O   . HOH H .   ? 0.3175 0.3175 0.3175 0.0000 0.0000 0.0000 3026 HOH A O   
1596 O O   . HOH H .   ? 0.3717 0.3717 0.3717 0.0000 0.0000 0.0000 3027 HOH A O   
1597 O O   . HOH H .   ? 0.4170 0.4170 0.4170 0.0000 0.0000 0.0000 3028 HOH A O   
1598 O O   . HOH H .   ? 0.3532 0.3532 0.3532 0.0000 0.0000 0.0000 3029 HOH A O   
1599 O O   . HOH H .   ? 0.3722 0.3722 0.3722 0.0000 0.0000 0.0000 3030 HOH A O   
1600 O O   . HOH H .   ? 0.4031 0.4031 0.4031 0.0000 0.0000 0.0000 3031 HOH A O   
1601 O O   . HOH H .   ? 0.2886 0.2886 0.2886 0.0000 0.0000 0.0000 3032 HOH A O   
1602 O O   . HOH H .   ? 0.3281 0.3281 0.3281 0.0000 0.0000 0.0000 3033 HOH A O   
1603 O O   . HOH H .   ? 0.3427 0.3427 0.3427 0.0000 0.0000 0.0000 3034 HOH A O   
1604 O O   . HOH H .   ? 0.3603 0.3603 0.3603 0.0000 0.0000 0.0000 3035 HOH A O   
1605 O O   . HOH H .   ? 0.3287 0.3287 0.3287 0.0000 0.0000 0.0000 3036 HOH A O   
1606 O O   . HOH H .   ? 0.3470 0.3470 0.3470 0.0000 0.0000 0.0000 3037 HOH A O   
1607 O O   . HOH H .   ? 0.3453 0.3453 0.3453 0.0000 0.0000 0.0000 3038 HOH A O   
1608 O O   . HOH H .   ? 0.3657 0.3657 0.3657 0.0000 0.0000 0.0000 3039 HOH A O   
1609 O O   . HOH H .   ? 0.3898 0.3898 0.3898 0.0000 0.0000 0.0000 3040 HOH A O   
1610 O O   . HOH H .   ? 0.3085 0.3085 0.3085 0.0000 0.0000 0.0000 3041 HOH A O   
1611 O O   . HOH H .   ? 0.3741 0.3741 0.3741 0.0000 0.0000 0.0000 3042 HOH A O   
1612 O O   . HOH H .   ? 0.3370 0.3370 0.3370 0.0000 0.0000 0.0000 3043 HOH A O   
1613 O O   . HOH H .   ? 0.3931 0.3931 0.3931 0.0000 0.0000 0.0000 3044 HOH A O   
1614 O O   . HOH H .   ? 0.3451 0.3451 0.3451 0.0000 0.0000 0.0000 3045 HOH A O   
1615 O O   . HOH H .   ? 0.3294 0.3294 0.3294 0.0000 0.0000 0.0000 3046 HOH A O   
1616 O O   . HOH H .   ? 0.3847 0.3847 0.3847 0.0000 0.0000 0.0000 3047 HOH A O   
1617 O O   . HOH H .   ? 0.3710 0.3710 0.3710 0.0000 0.0000 0.0000 3048 HOH A O   
1618 O O   . HOH H .   ? 0.3601 0.3601 0.3601 0.0000 0.0000 0.0000 3049 HOH A O   
1619 O O   . HOH H .   ? 0.3034 0.3034 0.3034 0.0000 0.0000 0.0000 3050 HOH A O   
1620 O O   . HOH H .   ? 0.4185 0.4185 0.4185 0.0000 0.0000 0.0000 3051 HOH A O   
1621 O O   . HOH H .   ? 0.3655 0.3655 0.3655 0.0000 0.0000 0.0000 3052 HOH A O   
1622 O O   . HOH H .   ? 0.3411 0.3411 0.3411 0.0000 0.0000 0.0000 3053 HOH A O   
1623 O O   . HOH H .   ? 0.4459 0.4459 0.4459 0.0000 0.0000 0.0000 3054 HOH A O   
1624 O O   . HOH H .   ? 0.3913 0.3913 0.3913 0.0000 0.0000 0.0000 3055 HOH A O   
1625 O O   . HOH H .   ? 0.4831 0.4831 0.4831 0.0000 0.0000 0.0000 3056 HOH A O   
1626 O O   . HOH H .   ? 0.3420 0.3420 0.3420 0.0000 0.0000 0.0000 3057 HOH A O   
1627 O O   . HOH H .   ? 0.3522 0.3522 0.3522 0.0000 0.0000 0.0000 3058 HOH A O   
1628 O O   . HOH H .   ? 0.3510 0.3510 0.3510 0.0000 0.0000 0.0000 3059 HOH A O   
1629 O O   . HOH H .   ? 0.4513 0.4513 0.4513 0.0000 0.0000 0.0000 3060 HOH A O   
1630 O O   . HOH H .   ? 0.3622 0.3622 0.3622 0.0000 0.0000 0.0000 3061 HOH A O   
1631 O O   . HOH H .   ? 0.3423 0.3423 0.3423 0.0000 0.0000 0.0000 3062 HOH A O   
1632 O O   . HOH H .   ? 0.3776 0.3776 0.3776 0.0000 0.0000 0.0000 3063 HOH A O   
1633 O O   . HOH H .   ? 0.4530 0.4530 0.4530 0.0000 0.0000 0.0000 3064 HOH A O   
1634 O O   . HOH H .   ? 0.4751 0.4751 0.4751 0.0000 0.0000 0.0000 3065 HOH A O   
1635 O O   . HOH H .   ? 0.3395 0.3395 0.3395 0.0000 0.0000 0.0000 3066 HOH A O   
1636 O O   . HOH H .   ? 0.3254 0.3254 0.3254 0.0000 0.0000 0.0000 3067 HOH A O   
1637 O O   . HOH H .   ? 0.4026 0.4026 0.4026 0.0000 0.0000 0.0000 3068 HOH A O   
1638 O O   . HOH H .   ? 0.3734 0.3734 0.3734 0.0000 0.0000 0.0000 3069 HOH A O   
1639 O O   . HOH H .   ? 0.4304 0.4304 0.4304 0.0000 0.0000 0.0000 3070 HOH A O   
1640 O O   . HOH H .   ? 0.3572 0.3572 0.3572 0.0000 0.0000 0.0000 3071 HOH A O   
1641 O O   . HOH H .   ? 0.3856 0.3856 0.3856 0.0000 0.0000 0.0000 3072 HOH A O   
1642 O O   . HOH H .   ? 0.3689 0.3689 0.3689 0.0000 0.0000 0.0000 3073 HOH A O   
1643 O O   . HOH H .   ? 0.3547 0.3547 0.3547 0.0000 0.0000 0.0000 3074 HOH A O   
1644 O O   . HOH H .   ? 0.5000 0.5000 0.5000 0.0000 0.0000 0.0000 3075 HOH A O   
1645 O O   . HOH H .   ? 0.3376 0.3376 0.3376 0.0000 0.0000 0.0000 3076 HOH A O   
1646 O O   . HOH H .   ? 0.3965 0.3965 0.3965 0.0000 0.0000 0.0000 3077 HOH A O   
1647 O O   . HOH H .   ? 0.4549 0.4549 0.4549 0.0000 0.0000 0.0000 3078 HOH A O   
1648 O O   . HOH H .   ? 0.3363 0.3363 0.3363 0.0000 0.0000 0.0000 3079 HOH A O   
1649 O O   . HOH H .   ? 0.3734 0.3734 0.3734 0.0000 0.0000 0.0000 3080 HOH A O   
1650 O O   . HOH H .   ? 0.5215 0.5215 0.5215 0.0000 0.0000 0.0000 3081 HOH A O   
1651 O O   . HOH H .   ? 0.4146 0.4146 0.4146 0.0000 0.0000 0.0000 3082 HOH A O   
1652 O O   . HOH H .   ? 0.3628 0.3628 0.3628 0.0000 0.0000 0.0000 3083 HOH A O   
1653 O O   . HOH H .   ? 0.5777 0.5777 0.5777 0.0000 0.0000 0.0000 3084 HOH A O   
1654 O O   . HOH H .   ? 0.4247 0.4247 0.4247 0.0000 0.0000 0.0000 3085 HOH A O   
1655 O O   . HOH H .   ? 0.4090 0.4090 0.4090 0.0000 0.0000 0.0000 3086 HOH A O   
1656 O O   . HOH H .   ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 3087 HOH A O   
1657 O O   . HOH H .   ? 0.5825 0.5825 0.5825 0.0000 0.0000 0.0000 3088 HOH A O   
1658 O O   . HOH H .   ? 0.5505 0.5505 0.5505 0.0000 0.0000 0.0000 3089 HOH A O   
1659 O O   . HOH H .   ? 0.4002 0.4002 0.4002 0.0000 0.0000 0.0000 3090 HOH A O   
1660 O O   . HOH H .   ? 0.4411 0.4411 0.4411 0.0000 0.0000 0.0000 3091 HOH A O   
1661 O O   . HOH H .   ? 0.4384 0.4384 0.4384 0.0000 0.0000 0.0000 3092 HOH A O   
1662 O O   . HOH H .   ? 0.6575 0.6575 0.6575 0.0000 0.0000 0.0000 3093 HOH A O   
1663 O O   . HOH H .   ? 0.4898 0.4898 0.4898 0.0000 0.0000 0.0000 3094 HOH A O   
1664 O O   . HOH H .   ? 0.4441 0.4441 0.4441 0.0000 0.0000 0.0000 3095 HOH A O   
1665 O O   . HOH H .   ? 0.3893 0.3893 0.3893 0.0000 0.0000 0.0000 3096 HOH A O   
1666 O O   . HOH H .   ? 0.5646 0.5646 0.5646 0.0000 0.0000 0.0000 3097 HOH A O   
1667 O O   . HOH H .   ? 0.3929 0.3929 0.3929 0.0000 0.0000 0.0000 3098 HOH A O   
1668 O O   . HOH H .   ? 0.3734 0.3734 0.3734 0.0000 0.0000 0.0000 3099 HOH A O   
1669 O O   . HOH H .   ? 0.6520 0.6520 0.6520 0.0000 0.0000 0.0000 3100 HOH A O   
1670 O O   . HOH H .   ? 0.3802 0.3802 0.3802 0.0000 0.0000 0.0000 3101 HOH A O   
1671 O O   . HOH H .   ? 0.3656 0.3656 0.3656 0.0000 0.0000 0.0000 3102 HOH A O   
1672 O O   . HOH H .   ? 0.4398 0.4398 0.4398 0.0000 0.0000 0.0000 3103 HOH A O   
1673 O O   . HOH H .   ? 0.4854 0.4854 0.4854 0.0000 0.0000 0.0000 3104 HOH A O   
1674 O O   . HOH H .   ? 0.5523 0.5523 0.5523 0.0000 0.0000 0.0000 3105 HOH A O   
1675 O O   . HOH H .   ? 0.5565 0.5565 0.5565 0.0000 0.0000 0.0000 3106 HOH A O   
1676 O O   . HOH H .   ? 0.4532 0.4532 0.4532 0.0000 0.0000 0.0000 3107 HOH A O   
1677 O O   . HOH H .   ? 0.4726 0.4726 0.4726 0.0000 0.0000 0.0000 3108 HOH A O   
1678 O O   . HOH H .   ? 0.4947 0.4947 0.4947 0.0000 0.0000 0.0000 3109 HOH A O   
1679 O O   . HOH H .   ? 0.3620 0.3620 0.3620 0.0000 0.0000 0.0000 3110 HOH A O   
1680 O O   . HOH H .   ? 0.5411 0.5411 0.5411 0.0000 0.0000 0.0000 3111 HOH A O   
1681 O O   . HOH H .   ? 0.5069 0.5069 0.5069 0.0000 0.0000 0.0000 3112 HOH A O   
1682 O O   . HOH H .   ? 0.5800 0.5800 0.5800 0.0000 0.0000 0.0000 3113 HOH A O   
1683 O O   . HOH H .   ? 0.4100 0.4100 0.4100 0.0000 0.0000 0.0000 3114 HOH A O   
1684 O O   . HOH H .   ? 0.4691 0.4691 0.4691 0.0000 0.0000 0.0000 3115 HOH A O   
1685 O O   . HOH H .   ? 0.4317 0.4317 0.4317 0.0000 0.0000 0.0000 3116 HOH A O   
1686 O O   . HOH H .   ? 0.4316 0.4316 0.4316 0.0000 0.0000 0.0000 3117 HOH A O   
1687 O O   . HOH H .   ? 0.5164 0.5164 0.5164 0.0000 0.0000 0.0000 3118 HOH A O   
1688 O O   . HOH H .   ? 0.4815 0.4815 0.4815 0.0000 0.0000 0.0000 3119 HOH A O   
1689 O O   . HOH H .   ? 0.4385 0.4385 0.4385 0.0000 0.0000 0.0000 3120 HOH A O   
1690 O O   . HOH H .   ? 0.6352 0.6352 0.6352 0.0000 0.0000 0.0000 3121 HOH A O   
1691 O O   . HOH H .   ? 0.5120 0.5120 0.5120 0.0000 0.0000 0.0000 3122 HOH A O   
1692 O O   . HOH H .   ? 0.4361 0.4361 0.4361 0.0000 0.0000 0.0000 3123 HOH A O   
1693 O O   . HOH H .   ? 0.5654 0.5654 0.5654 0.0000 0.0000 0.0000 3124 HOH A O   
1694 O O   . HOH H .   ? 0.5941 0.5941 0.5941 0.0000 0.0000 0.0000 3125 HOH A O   
1695 O O   . HOH H .   ? 0.5613 0.5613 0.5613 0.0000 0.0000 0.0000 3126 HOH A O   
1696 O O   . HOH H .   ? 0.5577 0.5577 0.5577 0.0000 0.0000 0.0000 3127 HOH A O   
1697 O O   . HOH H .   ? 0.5762 0.5762 0.5762 0.0000 0.0000 0.0000 3128 HOH A O   
1698 O O   . HOH H .   ? 0.5110 0.5110 0.5110 0.0000 0.0000 0.0000 3129 HOH A O   
1699 O O   . HOH H .   ? 0.4168 0.4168 0.4168 0.0000 0.0000 0.0000 3130 HOH A O   
1700 O O   . HOH H .   ? 0.4125 0.4125 0.4125 0.0000 0.0000 0.0000 3131 HOH A O   
1701 O O   . HOH H .   ? 0.4265 0.4265 0.4265 0.0000 0.0000 0.0000 3132 HOH A O   
1702 O O   . HOH H .   ? 0.5366 0.5366 0.5366 0.0000 0.0000 0.0000 3133 HOH A O   
1703 O O   . HOH H .   ? 0.5551 0.5551 0.5551 0.0000 0.0000 0.0000 3134 HOH A O   
1704 O O   . HOH H .   ? 0.4833 0.4833 0.4833 0.0000 0.0000 0.0000 3135 HOH A O   
1705 O O   . HOH H .   ? 0.5204 0.5204 0.5204 0.0000 0.0000 0.0000 3136 HOH A O   
1706 O O   . HOH H .   ? 0.5965 0.5965 0.5965 0.0000 0.0000 0.0000 3137 HOH A O   
1707 O O   . HOH H .   ? 0.4206 0.4206 0.4206 0.0000 0.0000 0.0000 3138 HOH A O   
1708 O O   . HOH H .   ? 0.5193 0.5193 0.5193 0.0000 0.0000 0.0000 3139 HOH A O   
1709 O O   . HOH H .   ? 0.5829 0.5829 0.5829 0.0000 0.0000 0.0000 3140 HOH A O   
1710 O O   . HOH H .   ? 0.5302 0.5302 0.5302 0.0000 0.0000 0.0000 3141 HOH A O   
1711 O O   . HOH H .   ? 0.5375 0.5375 0.5375 0.0000 0.0000 0.0000 3142 HOH A O   
1712 O O   . HOH H .   ? 0.5220 0.5220 0.5220 0.0000 0.0000 0.0000 3143 HOH A O   
1713 O O   . HOH H .   ? 0.5223 0.5223 0.5223 0.0000 0.0000 0.0000 3144 HOH A O   
1714 O O   . HOH H .   ? 0.3313 0.3313 0.3313 0.0000 0.0000 0.0000 3145 HOH A O   
1715 O O   . HOH H .   ? 0.4874 0.4874 0.4874 0.0000 0.0000 0.0000 3146 HOH A O   
1716 O O   . HOH H .   ? 0.3867 0.3867 0.3867 0.0000 0.0000 0.0000 3147 HOH A O   
1717 O O   . HOH H .   ? 0.5533 0.5533 0.5533 0.0000 0.0000 0.0000 3148 HOH A O   
1718 O O   . HOH H .   ? 0.5035 0.5035 0.5035 0.0000 0.0000 0.0000 3149 HOH A O   
1719 O O   . HOH H .   ? 0.4370 0.4370 0.4370 0.0000 0.0000 0.0000 3150 HOH A O   
1720 O O   . HOH H .   ? 0.4912 0.4912 0.4912 0.0000 0.0000 0.0000 3151 HOH A O   
1721 O O   . HOH H .   ? 0.4816 0.4816 0.4816 0.0000 0.0000 0.0000 3152 HOH A O   
1722 O O   . HOH H .   ? 0.5730 0.5730 0.5730 0.0000 0.0000 0.0000 3153 HOH A O   
1723 O O   . HOH H .   ? 0.5478 0.5478 0.5478 0.0000 0.0000 0.0000 3154 HOH A O   
1724 O O   . HOH H .   ? 0.4746 0.4746 0.4746 0.0000 0.0000 0.0000 3155 HOH A O   
1725 O O   . HOH H .   ? 0.5372 0.5372 0.5372 0.0000 0.0000 0.0000 3156 HOH A O   
1726 O O   . HOH H .   ? 0.5337 0.5337 0.5337 0.0000 0.0000 0.0000 3157 HOH A O   
1727 O O   . HOH H .   ? 0.6721 0.6721 0.6721 0.0000 0.0000 0.0000 3158 HOH A O   
1728 O O   . HOH H .   ? 0.6102 0.6102 0.6102 0.0000 0.0000 0.0000 3159 HOH A O   
1729 O O   . HOH H .   ? 0.4463 0.4463 0.4463 0.0000 0.0000 0.0000 3160 HOH A O   
1730 O O   . HOH H .   ? 0.4587 0.4587 0.4587 0.0000 0.0000 0.0000 3161 HOH A O   
1731 O O   . HOH H .   ? 0.6167 0.6167 0.6167 0.0000 0.0000 0.0000 3162 HOH A O   
1732 O O   . HOH H .   ? 0.5746 0.5746 0.5746 0.0000 0.0000 0.0000 3163 HOH A O   
1733 O O   . HOH H .   ? 0.6312 0.6312 0.6312 0.0000 0.0000 0.0000 3164 HOH A O   
1734 O O   . HOH H .   ? 0.5131 0.5131 0.5131 0.0000 0.0000 0.0000 3165 HOH A O   
1735 O O   . HOH H .   ? 0.5532 0.5532 0.5532 0.0000 0.0000 0.0000 3166 HOH A O   
1736 O O   . HOH H .   ? 0.5088 0.5088 0.5088 0.0000 0.0000 0.0000 3167 HOH A O   
1737 O O   . HOH H .   ? 0.4921 0.4921 0.4921 0.0000 0.0000 0.0000 3168 HOH A O   
1738 O O   . HOH H .   ? 0.4831 0.4831 0.4831 0.0000 0.0000 0.0000 3169 HOH A O   
1739 O O   . HOH H .   ? 0.4916 0.4916 0.4916 0.0000 0.0000 0.0000 3170 HOH A O   
1740 O O   . HOH H .   ? 0.5396 0.5396 0.5396 0.0000 0.0000 0.0000 3171 HOH A O   
1741 O O   . HOH H .   ? 0.6941 0.6941 0.6941 0.0000 0.0000 0.0000 3172 HOH A O   
1742 O O   . HOH H .   ? 0.6754 0.6754 0.6754 0.0000 0.0000 0.0000 3173 HOH A O   
1743 O O   . HOH H .   ? 0.5314 0.5314 0.5314 0.0000 0.0000 0.0000 3174 HOH A O   
1744 O O   . HOH H .   ? 0.5501 0.5501 0.5501 0.0000 0.0000 0.0000 3175 HOH A O   
1745 O O   . HOH H .   ? 0.4803 0.4803 0.4803 0.0000 0.0000 0.0000 3176 HOH A O   
1746 O O   . HOH H .   ? 0.5614 0.5614 0.5614 0.0000 0.0000 0.0000 3177 HOH A O   
1747 O O   . HOH H .   ? 0.5021 0.5021 0.5021 0.0000 0.0000 0.0000 3178 HOH A O   
1748 O O   . HOH H .   ? 0.5101 0.5101 0.5101 0.0000 0.0000 0.0000 3179 HOH A O   
1749 O O   . HOH H .   ? 0.5314 0.5314 0.5314 0.0000 0.0000 0.0000 3180 HOH A O   
1750 O O   . HOH H .   ? 0.5344 0.5344 0.5344 0.0000 0.0000 0.0000 3181 HOH A O   
1751 O O   . HOH H .   ? 0.6644 0.6644 0.6644 0.0000 0.0000 0.0000 3182 HOH A O   
1752 O O   . HOH H .   ? 0.5578 0.5578 0.5578 0.0000 0.0000 0.0000 3183 HOH A O   
1753 O O   . HOH H .   ? 0.4470 0.4470 0.4470 0.0000 0.0000 0.0000 3184 HOH A O   
1754 O O   . HOH H .   ? 0.5315 0.5315 0.5315 0.0000 0.0000 0.0000 3185 HOH A O   
1755 O O   . HOH H .   ? 0.5661 0.5661 0.5661 0.0000 0.0000 0.0000 3186 HOH A O   
1756 O O   . HOH H .   ? 0.5624 0.5624 0.5624 0.0000 0.0000 0.0000 3187 HOH A O   
1757 O O   . HOH H .   ? 0.6349 0.6349 0.6349 0.0000 0.0000 0.0000 3188 HOH A O   
1758 O O   . HOH H .   ? 0.5657 0.5657 0.5657 0.0000 0.0000 0.0000 3189 HOH A O   
1759 O O   . HOH H .   ? 0.5025 0.5025 0.5025 0.0000 0.0000 0.0000 3190 HOH A O   
1760 O O   . HOH H .   ? 0.5518 0.5518 0.5518 0.0000 0.0000 0.0000 3191 HOH A O   
1761 O O   . HOH H .   ? 0.6012 0.6012 0.6012 0.0000 0.0000 0.0000 3192 HOH A O   
1762 O O   . HOH H .   ? 0.4864 0.4864 0.4864 0.0000 0.0000 0.0000 3193 HOH A O   
1763 O O   . HOH H .   ? 0.6469 0.6469 0.6469 0.0000 0.0000 0.0000 3194 HOH A O   
1764 O O   . HOH H .   ? 0.5998 0.5998 0.5998 0.0000 0.0000 0.0000 3195 HOH A O   
1765 O O   . HOH H .   ? 0.5022 0.5022 0.5022 0.0000 0.0000 0.0000 3196 HOH A O   
1766 O O   . HOH H .   ? 0.5021 0.5021 0.5021 0.0000 0.0000 0.0000 3197 HOH A O   
1767 O O   . HOH H .   ? 0.4294 0.4294 0.4294 0.0000 0.0000 0.0000 3198 HOH A O   
1768 O O   . HOH H .   ? 0.5927 0.5927 0.5927 0.0000 0.0000 0.0000 3199 HOH A O   
1769 O O   . HOH H .   ? 0.6926 0.6926 0.6926 0.0000 0.0000 0.0000 3200 HOH A O   
1770 O O   . HOH H .   ? 0.4677 0.4677 0.4677 0.0000 0.0000 0.0000 3201 HOH A O   
1771 O O   . HOH H .   ? 0.4047 0.4047 0.4047 0.0000 0.0000 0.0000 3202 HOH A O   
1772 O O   . HOH H .   ? 0.4902 0.4902 0.4902 0.0000 0.0000 0.0000 3203 HOH A O   
1773 O O   . HOH H .   ? 0.4504 0.4504 0.4504 0.0000 0.0000 0.0000 3204 HOH A O   
1774 O O   . HOH H .   ? 0.4084 0.4084 0.4084 0.0000 0.0000 0.0000 3205 HOH A O   
1775 O O   . HOH H .   ? 0.3759 0.3759 0.3759 0.0000 0.0000 0.0000 3206 HOH A O   
1776 O O   . HOH H .   ? 0.4271 0.4271 0.4271 0.0000 0.0000 0.0000 3207 HOH A O   
1777 O O   . HOH H .   ? 0.6503 0.6503 0.6503 0.0000 0.0000 0.0000 3208 HOH A O   
1778 O O   . HOH H .   ? 0.5782 0.5782 0.5782 0.0000 0.0000 0.0000 3209 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2594 ?    ?   ?   A . n 
A 1 2   ASN 2   2595 ?    ?   ?   A . n 
A 1 3   ALA 3   2596 ?    ?   ?   A . n 
A 1 4   ASN 4   2597 ?    ?   ?   A . n 
A 1 5   PHE 5   2598 2598 PHE PHE A . n 
A 1 6   ASP 6   2599 2599 ASP ASP A . n 
A 1 7   PRO 7   2600 2600 PRO PRO A . n 
A 1 8   LYS 8   2601 2601 LYS LYS A . n 
A 1 9   PRO 9   2602 2602 PRO PRO A . n 
A 1 10  ILE 10  2603 2603 ILE ILE A . n 
A 1 11  ASN 11  2604 2604 ASN ASN A . n 
A 1 12  THR 12  2605 2605 THR THR A . n 
A 1 13  MET 13  2606 2606 MET MET A . n 
A 1 14  ASN 14  2607 2607 ASN ASN A . n 
A 1 15  PHE 15  2608 2608 PHE PHE A . n 
A 1 16  SER 16  2609 2609 SER SER A . n 
A 1 17  LEU 17  2610 2610 LEU LEU A . n 
A 1 18  PRO 18  2611 2611 PRO PRO A . n 
A 1 19  GLU 19  2612 2612 GLU GLU A . n 
A 1 20  LYS 20  2613 2613 LYS LYS A . n 
A 1 21  LEU 21  2614 2614 LEU LEU A . n 
A 1 22  GLU 22  2615 2615 GLU GLU A . n 
A 1 23  TYR 23  2616 2616 TYR TYR A . n 
A 1 24  ILE 24  2617 2617 ILE ILE A . n 
A 1 25  VAL 25  2618 2618 VAL VAL A . n 
A 1 26  THR 26  2619 2619 THR THR A . n 
A 1 27  LYS 27  2620 2620 LYS LYS A . n 
A 1 28  TYR 28  2621 2621 TYR TYR A . n 
A 1 29  ALA 29  2622 2622 ALA ALA A . n 
A 1 30  GLU 30  2623 2623 GLU GLU A . n 
A 1 31  HIS 31  2624 2624 HIS HIS A . n 
A 1 32  SER 32  2625 2625 SER SER A . n 
A 1 33  HIS 33  2626 2626 HIS HIS A . n 
A 1 34  ASP 34  2627 2627 ASP ASP A . n 
A 1 35  LYS 35  2628 2628 LYS LYS A . n 
A 1 36  TRP 36  2629 2629 TRP TRP A . n 
A 1 37  ALA 37  2630 2630 ALA ALA A . n 
A 1 38  CYS 38  2631 2631 CYS CYS A . n 
A 1 39  ASP 39  2632 2632 ASP ASP A . n 
A 1 40  LYS 40  2633 2633 LYS LYS A . n 
A 1 41  SER 41  2634 2634 SER SER A . n 
A 1 42  GLN 42  2635 2635 GLN GLN A . n 
A 1 43  SER 43  2636 2636 SER SER A . n 
A 1 44  GLY 44  2637 2637 GLY GLY A . n 
A 1 45  TRP 45  2638 2638 TRP TRP A . n 
A 1 46  LYS 46  2639 2639 LYS LYS A . n 
A 1 47  TYR 47  2640 2640 TYR TYR A . n 
A 1 48  GLY 48  2641 2641 GLY GLY A . n 
A 1 49  ILE 49  2642 2642 ILE ILE A . n 
A 1 50  SER 50  2643 2643 SER SER A . n 
A 1 51  LEU 51  2644 2644 LEU LEU A . n 
A 1 52  ASP 52  2645 2645 ASP ASP A . n 
A 1 53  GLU 53  2646 2646 GLU GLU A . n 
A 1 54  ASN 54  2647 2647 ASN ASN A . n 
A 1 55  VAL 55  2648 2648 VAL VAL A . n 
A 1 56  LYS 56  2649 2649 LYS LYS A . n 
A 1 57  THR 57  2650 2650 THR THR A . n 
A 1 58  HIS 58  2651 2651 HIS HIS A . n 
A 1 59  PRO 59  2652 2652 PRO PRO A . n 
A 1 60  LEU 60  2653 2653 LEU LEU A . n 
A 1 61  ILE 61  2654 2654 ILE ILE A . n 
A 1 62  ARG 62  2655 2655 ARG ARG A . n 
A 1 63  PRO 63  2656 2656 PRO PRO A . n 
A 1 64  PHE 64  2657 2657 PHE PHE A . n 
A 1 65  LYS 65  2658 2658 LYS LYS A . n 
A 1 66  THR 66  2659 2659 THR THR A . n 
A 1 67  LEU 67  2660 2660 LEU LEU A . n 
A 1 68  THR 68  2661 2661 THR THR A . n 
A 1 69  GLU 69  2662 2662 GLU GLU A . n 
A 1 70  LYS 70  2663 2663 LYS LYS A . n 
A 1 71  GLU 71  2664 2664 GLU GLU A . n 
A 1 72  LYS 72  2665 2665 LYS LYS A . n 
A 1 73  GLU 73  2666 2666 GLU GLU A . n 
A 1 74  ILE 74  2667 2667 ILE ILE A . n 
A 1 75  TYR 75  2668 2668 TYR TYR A . n 
A 1 76  ARG 76  2669 2669 ARG ARG A . n 
A 1 77  TRP 77  2670 2670 TRP TRP A . n 
A 1 78  PRO 78  2671 2671 PRO PRO A . n 
A 1 79  ALA 79  2672 2672 ALA ALA A . n 
A 1 80  ARG 80  2673 2673 ARG ARG A . n 
A 1 81  GLU 81  2674 2674 GLU GLU A . n 
A 1 82  SER 82  2675 2675 SER SER A . n 
A 1 83  LEU 83  2676 2676 LEU LEU A . n 
A 1 84  LYS 84  2677 2677 LYS LYS A . n 
A 1 85  THR 85  2678 2678 THR THR A . n 
A 1 86  MET 86  2679 2679 MET MET A . n 
A 1 87  LEU 87  2680 2680 LEU LEU A . n 
A 1 88  ALA 88  2681 2681 ALA ALA A . n 
A 1 89  VAL 89  2682 2682 VAL VAL A . n 
A 1 90  GLY 90  2683 2683 GLY GLY A . n 
A 1 91  TRP 91  2684 2684 TRP TRP A . n 
A 1 92  THR 92  2685 2685 THR THR A . n 
A 1 93  VAL 93  2686 2686 VAL VAL A . n 
A 1 94  GLU 94  2687 2687 GLU GLU A . n 
A 1 95  ARG 95  2688 2688 ARG ARG A . n 
A 1 96  THR 96  2689 2689 THR THR A . n 
A 1 97  LYS 97  2690 2690 LYS LYS A . n 
A 1 98  GLU 98  2691 ?    ?   ?   A . n 
A 1 99  GLY 99  2692 2692 GLY GLY A . n 
A 1 100 GLU 100 2693 2693 GLU GLU A . n 
A 1 101 ALA 101 2694 2694 ALA ALA A . n 
A 1 102 LEU 102 2695 2695 LEU LEU A . n 
A 1 103 VAL 103 2696 2696 VAL VAL A . n 
A 1 104 GLN 104 2697 2697 GLN GLN A . n 
A 1 105 GLN 105 2698 2698 GLN GLN A . n 
A 1 106 ARG 106 2699 2699 ARG ARG A . n 
A 1 107 GLU 107 2700 2700 GLU GLU A . n 
A 1 108 ASN 108 2701 2701 ASN ASN A . n 
A 1 109 GLU 109 2702 2702 GLU GLU A . n 
A 1 110 LYS 110 2703 2703 LYS LYS A . n 
A 1 111 LEU 111 2704 2704 LEU LEU A . n 
A 1 112 ARG 112 2705 2705 ARG ARG A . n 
A 1 113 SER 113 2706 2706 SER SER A . n 
A 1 114 VAL 114 2707 2707 VAL VAL A . n 
A 1 115 SER 115 2708 ?    ?   ?   A . n 
A 1 116 GLN 116 2709 ?    ?   ?   A . n 
A 1 117 ALA 117 2710 ?    ?   ?   A . n 
A 1 118 ASN 118 2711 ?    ?   ?   A . n 
A 1 119 GLN 119 2712 ?    ?   ?   A . n 
A 1 120 GLY 120 2713 ?    ?   ?   A . n 
A 1 121 ASN 121 2714 ?    ?   ?   A . n 
A 1 122 SER 122 2715 ?    ?   ?   A . n 
A 1 123 TYR 123 2716 2716 TYR TYR A . n 
A 1 124 SER 124 2717 2717 SER SER A . n 
A 1 125 PRO 125 2718 2718 PRO PRO A . n 
A 1 126 ALA 126 2719 2719 ALA ALA A . n 
A 1 127 PRO 127 2720 2720 PRO PRO A . n 
A 1 128 LEU 128 2721 2721 LEU LEU A . n 
A 1 129 ASP 129 2722 2722 ASP ASP A . n 
A 1 130 LEU 130 2723 2723 LEU LEU A . n 
A 1 131 SER 131 2724 2724 SER SER A . n 
A 1 132 ASN 132 2725 2725 ASN ASN A . n 
A 1 133 VAL 133 2726 2726 VAL VAL A . n 
A 1 134 VAL 134 2727 2727 VAL VAL A . n 
A 1 135 LEU 135 2728 2728 LEU LEU A . n 
A 1 136 SER 136 2729 2729 SER SER A . n 
A 1 137 ARG 137 2730 2730 ARG ARG A . n 
A 1 138 GLU 138 2731 2731 GLU GLU A . n 
A 1 139 LEU 139 2732 2732 LEU LEU A . n 
A 1 140 GLN 140 2733 2733 GLN GLN A . n 
A 1 141 GLY 141 2734 2734 GLY GLY A . n 
A 1 142 MET 142 2735 2735 MET MET A . n 
A 1 143 VAL 143 2736 2736 VAL VAL A . n 
A 1 144 GLU 144 2737 2737 GLU GLU A . n 
A 1 145 VAL 145 2738 2738 VAL VAL A . n 
A 1 146 VAL 146 2739 2739 VAL VAL A . n 
A 1 147 ALA 147 2740 2740 ALA ALA A . n 
A 1 148 GLU 148 2741 2741 GLU GLU A . n 
A 1 149 ASN 149 2742 2742 ASN ASN A . n 
A 1 150 TYR 150 2743 2743 TYR TYR A . n 
A 1 151 HIS 151 2744 2744 HIS HIS A . n 
A 1 152 ASN 152 2745 2745 ASN ASN A . n 
A 1 153 ILE 153 2746 2746 ILE ILE A . n 
A 1 154 TRP 154 2747 2747 TRP TRP A . n 
A 1 155 ALA 155 2748 2748 ALA ALA A . n 
A 1 156 LYS 156 2749 2749 LYS LYS A . n 
A 1 157 LYS 157 2750 2750 LYS LYS A . n 
A 1 158 LYS 158 2751 2751 LYS LYS A . n 
A 1 159 LYS 159 2752 2752 LYS LYS A . n 
A 1 160 LEU 160 2753 2753 LEU LEU A . n 
A 1 161 GLU 161 2754 2754 GLU GLU A . n 
A 1 162 LEU 162 2755 2755 LEU LEU A . n 
A 1 163 GLU 163 2756 2756 GLU GLU A . n 
A 1 164 SER 164 2757 2757 SER SER A . n 
A 1 165 LYS 165 2758 2758 LYS LYS A . n 
A 1 166 GLY 166 2759 2759 GLY GLY A . n 
A 1 167 GLY 167 2760 2760 GLY GLY A . n 
A 1 168 GLY 168 2761 2761 GLY GLY A . n 
A 1 169 SER 169 2762 2762 SER SER A . n 
A 1 170 HIS 170 2763 2763 HIS HIS A . n 
A 1 171 PRO 171 2764 2764 PRO PRO A . n 
A 1 172 LEU 172 2765 2765 LEU LEU A . n 
A 1 173 LEU 173 2766 2766 LEU LEU A . n 
A 1 174 VAL 174 2767 2767 VAL VAL A . n 
A 1 175 PRO 175 2768 2768 PRO PRO A . n 
A 1 176 TYR 176 2769 2769 TYR TYR A . n 
A 1 177 ASP 177 2770 2770 ASP ASP A . n 
A 1 178 THR 178 2771 2771 THR THR A . n 
A 1 179 LEU 179 2772 2772 LEU LEU A . n 
A 1 180 THR 180 2773 2773 THR THR A . n 
A 1 181 ALA 181 2774 2774 ALA ALA A . n 
A 1 182 ALA 182 2775 2775 ALA ALA A . n 
A 1 183 GLU 183 2776 2776 GLU GLU A . n 
A 1 184 LYS 184 2777 2777 LYS LYS A . n 
A 1 185 PHE 185 2778 2778 PHE PHE A . n 
A 1 186 LYS 186 2779 2779 LYS LYS A . n 
A 1 187 ASP 187 2780 2780 ASP ASP A . n 
A 1 188 ARG 188 2781 2781 ARG ARG A . n 
A 1 189 GLU 189 2782 2782 GLU GLU A . n 
A 1 190 LYS 190 2783 2783 LYS LYS A . n 
A 1 191 ALA 191 2784 2784 ALA ALA A . n 
A 1 192 GLN 192 2785 2785 GLN GLN A . n 
A 1 193 ASP 193 2786 2786 ASP ASP A . n 
A 1 194 LEU 194 2787 2787 LEU LEU A . n 
A 1 195 PHE 195 2788 2788 PHE PHE A . n 
A 1 196 LYS 196 2789 2789 LYS LYS A . n 
A 1 197 PHE 197 2790 2790 PHE PHE A . n 
A 1 198 LEU 198 2791 2791 LEU LEU A . n 
A 1 199 GLN 199 2792 2792 GLN GLN A . n 
A 1 200 VAL 200 2793 2793 VAL VAL A . n 
A 1 201 ASN 201 2794 2794 ASN ASN A . n 
A 1 202 GLY 202 2795 2795 GLY GLY A . n 
A 1 203 ILE 203 2796 2796 ILE ILE A . n 
A 1 204 ILE 204 2797 2797 ILE ILE A . n 
A 1 205 VAL 205 2798 2798 VAL VAL A . n 
A 1 206 SER 206 2799 2799 SER SER A . n 
A 1 207 ARG 207 2800 2800 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   2901 1   SO4 SO4 A . 
C 2 SO4 1   2902 2   SO4 SO4 A . 
D 2 SO4 1   2903 3   SO4 SO4 A . 
E 3 GOL 1   2904 3   GOL GOL A . 
F 3 GOL 1   2905 1   GOL GOL A . 
G 3 GOL 1   2906 2   GOL GOL A . 
H 4 HOH 1   3001 1   HOH HOH A . 
H 4 HOH 2   3002 2   HOH HOH A . 
H 4 HOH 3   3003 3   HOH HOH A . 
H 4 HOH 4   3004 4   HOH HOH A . 
H 4 HOH 5   3005 5   HOH HOH A . 
H 4 HOH 6   3006 6   HOH HOH A . 
H 4 HOH 7   3007 7   HOH HOH A . 
H 4 HOH 8   3008 8   HOH HOH A . 
H 4 HOH 9   3009 9   HOH HOH A . 
H 4 HOH 10  3010 10  HOH HOH A . 
H 4 HOH 11  3011 11  HOH HOH A . 
H 4 HOH 12  3012 12  HOH HOH A . 
H 4 HOH 13  3013 14  HOH HOH A . 
H 4 HOH 14  3014 15  HOH HOH A . 
H 4 HOH 15  3015 16  HOH HOH A . 
H 4 HOH 16  3016 17  HOH HOH A . 
H 4 HOH 17  3017 18  HOH HOH A . 
H 4 HOH 18  3018 19  HOH HOH A . 
H 4 HOH 19  3019 20  HOH HOH A . 
H 4 HOH 20  3020 21  HOH HOH A . 
H 4 HOH 21  3021 22  HOH HOH A . 
H 4 HOH 22  3022 24  HOH HOH A . 
H 4 HOH 23  3023 25  HOH HOH A . 
H 4 HOH 24  3024 26  HOH HOH A . 
H 4 HOH 25  3025 27  HOH HOH A . 
H 4 HOH 26  3026 28  HOH HOH A . 
H 4 HOH 27  3027 29  HOH HOH A . 
H 4 HOH 28  3028 30  HOH HOH A . 
H 4 HOH 29  3029 31  HOH HOH A . 
H 4 HOH 30  3030 32  HOH HOH A . 
H 4 HOH 31  3031 33  HOH HOH A . 
H 4 HOH 32  3032 34  HOH HOH A . 
H 4 HOH 33  3033 35  HOH HOH A . 
H 4 HOH 34  3034 36  HOH HOH A . 
H 4 HOH 35  3035 38  HOH HOH A . 
H 4 HOH 36  3036 39  HOH HOH A . 
H 4 HOH 37  3037 40  HOH HOH A . 
H 4 HOH 38  3038 41  HOH HOH A . 
H 4 HOH 39  3039 42  HOH HOH A . 
H 4 HOH 40  3040 43  HOH HOH A . 
H 4 HOH 41  3041 44  HOH HOH A . 
H 4 HOH 42  3042 45  HOH HOH A . 
H 4 HOH 43  3043 46  HOH HOH A . 
H 4 HOH 44  3044 47  HOH HOH A . 
H 4 HOH 45  3045 48  HOH HOH A . 
H 4 HOH 46  3046 49  HOH HOH A . 
H 4 HOH 47  3047 50  HOH HOH A . 
H 4 HOH 48  3048 51  HOH HOH A . 
H 4 HOH 49  3049 52  HOH HOH A . 
H 4 HOH 50  3050 53  HOH HOH A . 
H 4 HOH 51  3051 54  HOH HOH A . 
H 4 HOH 52  3052 55  HOH HOH A . 
H 4 HOH 53  3053 56  HOH HOH A . 
H 4 HOH 54  3054 57  HOH HOH A . 
H 4 HOH 55  3055 58  HOH HOH A . 
H 4 HOH 56  3056 59  HOH HOH A . 
H 4 HOH 57  3057 61  HOH HOH A . 
H 4 HOH 58  3058 62  HOH HOH A . 
H 4 HOH 59  3059 63  HOH HOH A . 
H 4 HOH 60  3060 64  HOH HOH A . 
H 4 HOH 61  3061 65  HOH HOH A . 
H 4 HOH 62  3062 66  HOH HOH A . 
H 4 HOH 63  3063 67  HOH HOH A . 
H 4 HOH 64  3064 68  HOH HOH A . 
H 4 HOH 65  3065 69  HOH HOH A . 
H 4 HOH 66  3066 70  HOH HOH A . 
H 4 HOH 67  3067 71  HOH HOH A . 
H 4 HOH 68  3068 72  HOH HOH A . 
H 4 HOH 69  3069 74  HOH HOH A . 
H 4 HOH 70  3070 75  HOH HOH A . 
H 4 HOH 71  3071 76  HOH HOH A . 
H 4 HOH 72  3072 77  HOH HOH A . 
H 4 HOH 73  3073 78  HOH HOH A . 
H 4 HOH 74  3074 79  HOH HOH A . 
H 4 HOH 75  3075 80  HOH HOH A . 
H 4 HOH 76  3076 81  HOH HOH A . 
H 4 HOH 77  3077 82  HOH HOH A . 
H 4 HOH 78  3078 84  HOH HOH A . 
H 4 HOH 79  3079 85  HOH HOH A . 
H 4 HOH 80  3080 86  HOH HOH A . 
H 4 HOH 81  3081 88  HOH HOH A . 
H 4 HOH 82  3082 89  HOH HOH A . 
H 4 HOH 83  3083 90  HOH HOH A . 
H 4 HOH 84  3084 91  HOH HOH A . 
H 4 HOH 85  3085 92  HOH HOH A . 
H 4 HOH 86  3086 93  HOH HOH A . 
H 4 HOH 87  3087 94  HOH HOH A . 
H 4 HOH 88  3088 95  HOH HOH A . 
H 4 HOH 89  3089 96  HOH HOH A . 
H 4 HOH 90  3090 98  HOH HOH A . 
H 4 HOH 91  3091 99  HOH HOH A . 
H 4 HOH 92  3092 100 HOH HOH A . 
H 4 HOH 93  3093 101 HOH HOH A . 
H 4 HOH 94  3094 103 HOH HOH A . 
H 4 HOH 95  3095 104 HOH HOH A . 
H 4 HOH 96  3096 105 HOH HOH A . 
H 4 HOH 97  3097 106 HOH HOH A . 
H 4 HOH 98  3098 107 HOH HOH A . 
H 4 HOH 99  3099 108 HOH HOH A . 
H 4 HOH 100 3100 109 HOH HOH A . 
H 4 HOH 101 3101 110 HOH HOH A . 
H 4 HOH 102 3102 111 HOH HOH A . 
H 4 HOH 103 3103 112 HOH HOH A . 
H 4 HOH 104 3104 113 HOH HOH A . 
H 4 HOH 105 3105 115 HOH HOH A . 
H 4 HOH 106 3106 117 HOH HOH A . 
H 4 HOH 107 3107 118 HOH HOH A . 
H 4 HOH 108 3108 119 HOH HOH A . 
H 4 HOH 109 3109 120 HOH HOH A . 
H 4 HOH 110 3110 121 HOH HOH A . 
H 4 HOH 111 3111 122 HOH HOH A . 
H 4 HOH 112 3112 123 HOH HOH A . 
H 4 HOH 113 3113 124 HOH HOH A . 
H 4 HOH 114 3114 125 HOH HOH A . 
H 4 HOH 115 3115 128 HOH HOH A . 
H 4 HOH 116 3116 129 HOH HOH A . 
H 4 HOH 117 3117 130 HOH HOH A . 
H 4 HOH 118 3118 131 HOH HOH A . 
H 4 HOH 119 3119 132 HOH HOH A . 
H 4 HOH 120 3120 133 HOH HOH A . 
H 4 HOH 121 3121 134 HOH HOH A . 
H 4 HOH 122 3122 135 HOH HOH A . 
H 4 HOH 123 3123 136 HOH HOH A . 
H 4 HOH 124 3124 138 HOH HOH A . 
H 4 HOH 125 3125 139 HOH HOH A . 
H 4 HOH 126 3126 140 HOH HOH A . 
H 4 HOH 127 3127 142 HOH HOH A . 
H 4 HOH 128 3128 143 HOH HOH A . 
H 4 HOH 129 3129 144 HOH HOH A . 
H 4 HOH 130 3130 146 HOH HOH A . 
H 4 HOH 131 3131 148 HOH HOH A . 
H 4 HOH 132 3132 149 HOH HOH A . 
H 4 HOH 133 3133 150 HOH HOH A . 
H 4 HOH 134 3134 152 HOH HOH A . 
H 4 HOH 135 3135 153 HOH HOH A . 
H 4 HOH 136 3136 155 HOH HOH A . 
H 4 HOH 137 3137 156 HOH HOH A . 
H 4 HOH 138 3138 157 HOH HOH A . 
H 4 HOH 139 3139 158 HOH HOH A . 
H 4 HOH 140 3140 160 HOH HOH A . 
H 4 HOH 141 3141 161 HOH HOH A . 
H 4 HOH 142 3142 162 HOH HOH A . 
H 4 HOH 143 3143 163 HOH HOH A . 
H 4 HOH 144 3144 164 HOH HOH A . 
H 4 HOH 145 3145 165 HOH HOH A . 
H 4 HOH 146 3146 167 HOH HOH A . 
H 4 HOH 147 3147 168 HOH HOH A . 
H 4 HOH 148 3148 169 HOH HOH A . 
H 4 HOH 149 3149 171 HOH HOH A . 
H 4 HOH 150 3150 172 HOH HOH A . 
H 4 HOH 151 3151 173 HOH HOH A . 
H 4 HOH 152 3152 175 HOH HOH A . 
H 4 HOH 153 3153 176 HOH HOH A . 
H 4 HOH 154 3154 177 HOH HOH A . 
H 4 HOH 155 3155 180 HOH HOH A . 
H 4 HOH 156 3156 181 HOH HOH A . 
H 4 HOH 157 3157 182 HOH HOH A . 
H 4 HOH 158 3158 183 HOH HOH A . 
H 4 HOH 159 3159 188 HOH HOH A . 
H 4 HOH 160 3160 189 HOH HOH A . 
H 4 HOH 161 3161 191 HOH HOH A . 
H 4 HOH 162 3162 192 HOH HOH A . 
H 4 HOH 163 3163 193 HOH HOH A . 
H 4 HOH 164 3164 195 HOH HOH A . 
H 4 HOH 165 3165 196 HOH HOH A . 
H 4 HOH 166 3166 197 HOH HOH A . 
H 4 HOH 167 3167 198 HOH HOH A . 
H 4 HOH 168 3168 199 HOH HOH A . 
H 4 HOH 169 3169 200 HOH HOH A . 
H 4 HOH 170 3170 201 HOH HOH A . 
H 4 HOH 171 3171 202 HOH HOH A . 
H 4 HOH 172 3172 203 HOH HOH A . 
H 4 HOH 173 3173 205 HOH HOH A . 
H 4 HOH 174 3174 206 HOH HOH A . 
H 4 HOH 175 3175 207 HOH HOH A . 
H 4 HOH 176 3176 208 HOH HOH A . 
H 4 HOH 177 3177 209 HOH HOH A . 
H 4 HOH 178 3178 210 HOH HOH A . 
H 4 HOH 179 3179 211 HOH HOH A . 
H 4 HOH 180 3180 213 HOH HOH A . 
H 4 HOH 181 3181 214 HOH HOH A . 
H 4 HOH 182 3182 219 HOH HOH A . 
H 4 HOH 183 3183 220 HOH HOH A . 
H 4 HOH 184 3184 221 HOH HOH A . 
H 4 HOH 185 3185 222 HOH HOH A . 
H 4 HOH 186 3186 223 HOH HOH A . 
H 4 HOH 187 3187 224 HOH HOH A . 
H 4 HOH 188 3188 225 HOH HOH A . 
H 4 HOH 189 3189 226 HOH HOH A . 
H 4 HOH 190 3190 227 HOH HOH A . 
H 4 HOH 191 3191 228 HOH HOH A . 
H 4 HOH 192 3192 229 HOH HOH A . 
H 4 HOH 193 3193 230 HOH HOH A . 
H 4 HOH 194 3194 231 HOH HOH A . 
H 4 HOH 195 3195 233 HOH HOH A . 
H 4 HOH 196 3196 236 HOH HOH A . 
H 4 HOH 197 3197 237 HOH HOH A . 
H 4 HOH 198 3198 238 HOH HOH A . 
H 4 HOH 199 3199 240 HOH HOH A . 
H 4 HOH 200 3200 241 HOH HOH A . 
H 4 HOH 201 3201 243 HOH HOH A . 
H 4 HOH 202 3202 244 HOH HOH A . 
H 4 HOH 203 3203 245 HOH HOH A . 
H 4 HOH 204 3204 246 HOH HOH A . 
H 4 HOH 205 3205 247 HOH HOH A . 
H 4 HOH 206 3206 248 HOH HOH A . 
H 4 HOH 207 3207 249 HOH HOH A . 
H 4 HOH 208 3208 250 HOH HOH A . 
H 4 HOH 209 3209 251 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 5970  ? 
2 MORE         -111  ? 
2 'SSA (A^2)'  19860 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 93.5700000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-13 
2 'Structure model' 1 1 2012-10-17 
3 'Structure model' 1 2 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 XSCALE      .        ?                package 'Wolfgang Kabsch'    ?                        'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
2 REFMAC      5.6.0117 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 
3 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
4 MxDC        GUI      ?                ?       ?                    ?                        'data collection' ? ?          ? 
5 XDS         .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
6 XDS         .        ?                ?       ?                    ?                        'data scaling'    ? ?          ? 
7 PHASER      .        ?                ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 2612 ? CG  ? A GLU 19  CG  
2  1 Y 1 A GLU 2612 ? CD  ? A GLU 19  CD  
3  1 Y 1 A GLU 2612 ? OE1 ? A GLU 19  OE1 
4  1 Y 1 A GLU 2612 ? OE2 ? A GLU 19  OE2 
5  1 Y 1 A LYS 2613 ? CG  ? A LYS 20  CG  
6  1 Y 1 A LYS 2613 ? CD  ? A LYS 20  CD  
7  1 Y 1 A LYS 2613 ? CE  ? A LYS 20  CE  
8  1 Y 1 A LYS 2613 ? NZ  ? A LYS 20  NZ  
9  1 Y 1 A GLN 2635 ? CG  ? A GLN 42  CG  
10 1 Y 1 A GLN 2635 ? CD  ? A GLN 42  CD  
11 1 Y 1 A GLN 2635 ? OE1 ? A GLN 42  OE1 
12 1 Y 1 A GLN 2635 ? NE2 ? A GLN 42  NE2 
13 1 Y 1 A ASN 2647 ? CG  ? A ASN 54  CG  
14 1 Y 1 A ASN 2647 ? OD1 ? A ASN 54  OD1 
15 1 Y 1 A ASN 2647 ? ND2 ? A ASN 54  ND2 
16 1 Y 1 A LYS 2658 ? CG  ? A LYS 65  CG  
17 1 Y 1 A LYS 2658 ? CD  ? A LYS 65  CD  
18 1 Y 1 A LYS 2658 ? CE  ? A LYS 65  CE  
19 1 Y 1 A LYS 2658 ? NZ  ? A LYS 65  NZ  
20 1 Y 1 A GLU 2687 ? CG  ? A GLU 94  CG  
21 1 Y 1 A GLU 2687 ? CD  ? A GLU 94  CD  
22 1 Y 1 A GLU 2687 ? OE1 ? A GLU 94  OE1 
23 1 Y 1 A GLU 2687 ? OE2 ? A GLU 94  OE2 
24 1 Y 1 A ARG 2688 ? CG  ? A ARG 95  CG  
25 1 Y 1 A ARG 2688 ? CD  ? A ARG 95  CD  
26 1 Y 1 A ARG 2688 ? NE  ? A ARG 95  NE  
27 1 Y 1 A ARG 2688 ? CZ  ? A ARG 95  CZ  
28 1 Y 1 A ARG 2688 ? NH1 ? A ARG 95  NH1 
29 1 Y 1 A ARG 2688 ? NH2 ? A ARG 95  NH2 
30 1 Y 1 A LYS 2690 ? CG  ? A LYS 97  CG  
31 1 Y 1 A LYS 2690 ? CD  ? A LYS 97  CD  
32 1 Y 1 A LYS 2690 ? CE  ? A LYS 97  CE  
33 1 Y 1 A LYS 2690 ? NZ  ? A LYS 97  NZ  
34 1 Y 1 A GLU 2693 ? CG  ? A GLU 100 CG  
35 1 Y 1 A GLU 2693 ? CD  ? A GLU 100 CD  
36 1 Y 1 A GLU 2693 ? OE1 ? A GLU 100 OE1 
37 1 Y 1 A GLU 2693 ? OE2 ? A GLU 100 OE2 
38 1 Y 1 A GLU 2700 ? CG  ? A GLU 107 CG  
39 1 Y 1 A GLU 2700 ? CD  ? A GLU 107 CD  
40 1 Y 1 A GLU 2700 ? OE1 ? A GLU 107 OE1 
41 1 Y 1 A GLU 2700 ? OE2 ? A GLU 107 OE2 
42 1 Y 1 A LYS 2703 ? CG  ? A LYS 110 CG  
43 1 Y 1 A LYS 2703 ? CD  ? A LYS 110 CD  
44 1 Y 1 A LYS 2703 ? CE  ? A LYS 110 CE  
45 1 Y 1 A LYS 2703 ? NZ  ? A LYS 110 NZ  
46 1 Y 1 A VAL 2707 ? CG1 ? A VAL 114 CG1 
47 1 Y 1 A VAL 2707 ? CG2 ? A VAL 114 CG2 
48 1 Y 1 A ARG 2730 ? CG  ? A ARG 137 CG  
49 1 Y 1 A ARG 2730 ? CD  ? A ARG 137 CD  
50 1 Y 1 A ARG 2730 ? NE  ? A ARG 137 NE  
51 1 Y 1 A ARG 2730 ? CZ  ? A ARG 137 CZ  
52 1 Y 1 A ARG 2730 ? NH1 ? A ARG 137 NH1 
53 1 Y 1 A ARG 2730 ? NH2 ? A ARG 137 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 2594 ? A SER 1   
2  1 Y 1 A ASN 2595 ? A ASN 2   
3  1 Y 1 A ALA 2596 ? A ALA 3   
4  1 Y 1 A ASN 2597 ? A ASN 4   
5  1 Y 1 A GLU 2691 ? A GLU 98  
6  1 Y 1 A SER 2708 ? A SER 115 
7  1 Y 1 A GLN 2709 ? A GLN 116 
8  1 Y 1 A ALA 2710 ? A ALA 117 
9  1 Y 1 A ASN 2711 ? A ASN 118 
10 1 Y 1 A GLN 2712 ? A GLN 119 
11 1 Y 1 A GLY 2713 ? A GLY 120 
12 1 Y 1 A ASN 2714 ? A ASN 121 
13 1 Y 1 A SER 2715 ? A SER 122 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 GLYCEROL      GOL 
4 water         HOH 
#