data_4FAO
# 
_entry.id   4FAO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4FAO         
RCSB  RCSB072665   
WWPDB D_1000072665 
# 
_pdbx_database_status.entry_id                        4FAO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-22 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Townson, S.A.'        1  
'Martinez-Hackert, E.' 2  
'Greppi, C.'           3  
'Lowden, P.'           4  
'Sako, D.'             5  
'Liu, J.'              6  
'Ucran, J.A.'          7  
'Liharska, K.'         8  
'Underwood, K.W.'      9  
'Seehra, J.'           10 
'Kumar, R.'            11 
'Grinberg, A.V.'       12 
# 
_citation.id                        primary 
_citation.title                     
'Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                27313 
_citation.page_last                 27325 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22718755 
_citation.pdbx_database_id_DOI      10.1074/jbc.M112.377960 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Townson, S.A.'        1  ? 
primary 'Martinez-Hackert, E.' 2  ? 
primary 'Greppi, C.'           3  ? 
primary 'Lowden, P.'           4  ? 
primary 'Sako, D.'             5  ? 
primary 'Liu, J.'              6  ? 
primary 'Ucran, J.A.'          7  ? 
primary 'Liharska, K.'         8  ? 
primary 'Underwood, K.W.'      9  ? 
primary 'Seehra, J.'           10 ? 
primary 'Kumar, R.'            11 ? 
primary 'Grinberg, A.V.'       12 ? 
# 
_cell.length_a           216.453 
_cell.length_b           216.453 
_cell.length_c           216.953 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4FAO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              72 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31 1 2' 
_symmetry.entry_id                         4FAO 
_symmetry.Int_Tables_number                151 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Growth/differentiation factor 2'             12102.971 12 ? ? ?                      ? 
2 polymer     man 'Serine/threonine-protein kinase receptor R3' 11592.863 12 ? ? 'Extracellular domain' ? 
3 polymer     man 'Activin receptor type-2B'                    14118.272 12 ? ? 'Extracellular domain' ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose      221.208   24 ? ? ?                      ? 
5 non-polymer syn 'SODIUM ION'                                  22.990    6  ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'GDF-2, Bone morphogenetic protein 9, BMP-9'                                            
2 'SKR3, Activin receptor-like kinase 1, ALK-1, TGF-B superfamily receptor type I, TSR-I' 
3 'Activin receptor type IIB, ACTR-IIB'                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS
PISVLYKDDMGVPTLKYHYEGMSVAECGCR
;
;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS
PISVLYKDDMGVPTLKYHYEGMSVAECGCR
;
A,B,G,H,M,N,S,T,a,b,g,h ? 
2 'polypeptide(L)' no no 
;GADPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNV
SLVLEATQPPSEQPGTDGQSGDDDDK
;
;GADPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNV
SLVLEATQPPSEQPGTDGQSGDDDDK
;
C,D,I,J,O,P,U,V,c,d,i,j ? 
3 'polypeptide(L)' no no 
;GASGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEEN
PQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGDDDDK
;
;GASGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEEN
PQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGDDDDK
;
E,F,K,L,Q,R,W,X,e,f,k,l ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   GLY n 
1 4   ALA n 
1 5   GLY n 
1 6   SER n 
1 7   HIS n 
1 8   CYS n 
1 9   GLN n 
1 10  LYS n 
1 11  THR n 
1 12  SER n 
1 13  LEU n 
1 14  ARG n 
1 15  VAL n 
1 16  ASN n 
1 17  PHE n 
1 18  GLU n 
1 19  ASP n 
1 20  ILE n 
1 21  GLY n 
1 22  TRP n 
1 23  ASP n 
1 24  SER n 
1 25  TRP n 
1 26  ILE n 
1 27  ILE n 
1 28  ALA n 
1 29  PRO n 
1 30  LYS n 
1 31  GLU n 
1 32  TYR n 
1 33  GLU n 
1 34  ALA n 
1 35  TYR n 
1 36  GLU n 
1 37  CYS n 
1 38  LYS n 
1 39  GLY n 
1 40  GLY n 
1 41  CYS n 
1 42  PHE n 
1 43  PHE n 
1 44  PRO n 
1 45  LEU n 
1 46  ALA n 
1 47  ASP n 
1 48  ASP n 
1 49  VAL n 
1 50  THR n 
1 51  PRO n 
1 52  THR n 
1 53  LYS n 
1 54  HIS n 
1 55  ALA n 
1 56  ILE n 
1 57  VAL n 
1 58  GLN n 
1 59  THR n 
1 60  LEU n 
1 61  VAL n 
1 62  HIS n 
1 63  LEU n 
1 64  LYS n 
1 65  PHE n 
1 66  PRO n 
1 67  THR n 
1 68  LYS n 
1 69  VAL n 
1 70  GLY n 
1 71  LYS n 
1 72  ALA n 
1 73  CYS n 
1 74  CYS n 
1 75  VAL n 
1 76  PRO n 
1 77  THR n 
1 78  LYS n 
1 79  LEU n 
1 80  SER n 
1 81  PRO n 
1 82  ILE n 
1 83  SER n 
1 84  VAL n 
1 85  LEU n 
1 86  TYR n 
1 87  LYS n 
1 88  ASP n 
1 89  ASP n 
1 90  MET n 
1 91  GLY n 
1 92  VAL n 
1 93  PRO n 
1 94  THR n 
1 95  LEU n 
1 96  LYS n 
1 97  TYR n 
1 98  HIS n 
1 99  TYR n 
1 100 GLU n 
1 101 GLY n 
1 102 MET n 
1 103 SER n 
1 104 VAL n 
1 105 ALA n 
1 106 GLU n 
1 107 CYS n 
1 108 GLY n 
1 109 CYS n 
1 110 ARG n 
2 1   GLY n 
2 2   ALA n 
2 3   ASP n 
2 4   PRO n 
2 5   VAL n 
2 6   LYS n 
2 7   PRO n 
2 8   SER n 
2 9   ARG n 
2 10  GLY n 
2 11  PRO n 
2 12  LEU n 
2 13  VAL n 
2 14  THR n 
2 15  CYS n 
2 16  THR n 
2 17  CYS n 
2 18  GLU n 
2 19  SER n 
2 20  PRO n 
2 21  HIS n 
2 22  CYS n 
2 23  LYS n 
2 24  GLY n 
2 25  PRO n 
2 26  THR n 
2 27  CYS n 
2 28  ARG n 
2 29  GLY n 
2 30  ALA n 
2 31  TRP n 
2 32  CYS n 
2 33  THR n 
2 34  VAL n 
2 35  VAL n 
2 36  LEU n 
2 37  VAL n 
2 38  ARG n 
2 39  GLU n 
2 40  GLU n 
2 41  GLY n 
2 42  ARG n 
2 43  HIS n 
2 44  PRO n 
2 45  GLN n 
2 46  GLU n 
2 47  HIS n 
2 48  ARG n 
2 49  GLY n 
2 50  CYS n 
2 51  GLY n 
2 52  ASN n 
2 53  LEU n 
2 54  HIS n 
2 55  ARG n 
2 56  GLU n 
2 57  LEU n 
2 58  CYS n 
2 59  ARG n 
2 60  GLY n 
2 61  ARG n 
2 62  PRO n 
2 63  THR n 
2 64  GLU n 
2 65  PHE n 
2 66  VAL n 
2 67  ASN n 
2 68  HIS n 
2 69  TYR n 
2 70  CYS n 
2 71  CYS n 
2 72  ASP n 
2 73  SER n 
2 74  HIS n 
2 75  LEU n 
2 76  CYS n 
2 77  ASN n 
2 78  HIS n 
2 79  ASN n 
2 80  VAL n 
2 81  SER n 
2 82  LEU n 
2 83  VAL n 
2 84  LEU n 
2 85  GLU n 
2 86  ALA n 
2 87  THR n 
2 88  GLN n 
2 89  PRO n 
2 90  PRO n 
2 91  SER n 
2 92  GLU n 
2 93  GLN n 
2 94  PRO n 
2 95  GLY n 
2 96  THR n 
2 97  ASP n 
2 98  GLY n 
2 99  GLN n 
2 100 SER n 
2 101 GLY n 
2 102 ASP n 
2 103 ASP n 
2 104 ASP n 
2 105 ASP n 
2 106 LYS n 
3 1   GLY n 
3 2   ALA n 
3 3   SER n 
3 4   GLY n 
3 5   ARG n 
3 6   GLY n 
3 7   GLU n 
3 8   ALA n 
3 9   GLU n 
3 10  THR n 
3 11  ARG n 
3 12  GLU n 
3 13  CYS n 
3 14  ILE n 
3 15  TYR n 
3 16  TYR n 
3 17  ASN n 
3 18  ALA n 
3 19  ASN n 
3 20  TRP n 
3 21  GLU n 
3 22  LEU n 
3 23  GLU n 
3 24  ARG n 
3 25  THR n 
3 26  ASN n 
3 27  GLN n 
3 28  SER n 
3 29  GLY n 
3 30  LEU n 
3 31  GLU n 
3 32  ARG n 
3 33  CYS n 
3 34  GLU n 
3 35  GLY n 
3 36  GLU n 
3 37  GLN n 
3 38  ASP n 
3 39  LYS n 
3 40  ARG n 
3 41  LEU n 
3 42  HIS n 
3 43  CYS n 
3 44  TYR n 
3 45  ALA n 
3 46  SER n 
3 47  TRP n 
3 48  ARG n 
3 49  ASN n 
3 50  SER n 
3 51  SER n 
3 52  GLY n 
3 53  THR n 
3 54  ILE n 
3 55  GLU n 
3 56  LEU n 
3 57  VAL n 
3 58  LYS n 
3 59  LYS n 
3 60  GLY n 
3 61  CYS n 
3 62  TRP n 
3 63  LEU n 
3 64  ASP n 
3 65  ASP n 
3 66  PHE n 
3 67  ASN n 
3 68  CYS n 
3 69  TYR n 
3 70  ASP n 
3 71  ARG n 
3 72  GLN n 
3 73  GLU n 
3 74  CYS n 
3 75  VAL n 
3 76  ALA n 
3 77  THR n 
3 78  GLU n 
3 79  GLU n 
3 80  ASN n 
3 81  PRO n 
3 82  GLN n 
3 83  VAL n 
3 84  TYR n 
3 85  PHE n 
3 86  CYS n 
3 87  CYS n 
3 88  CYS n 
3 89  GLU n 
3 90  GLY n 
3 91  ASN n 
3 92  PHE n 
3 93  CYS n 
3 94  ASN n 
3 95  GLU n 
3 96  ARG n 
3 97  PHE n 
3 98  THR n 
3 99  HIS n 
3 100 LEU n 
3 101 PRO n 
3 102 GLU n 
3 103 ALA n 
3 104 GLY n 
3 105 GLY n 
3 106 PRO n 
3 107 GLU n 
3 108 VAL n 
3 109 THR n 
3 110 TYR n 
3 111 GLU n 
3 112 PRO n 
3 113 PRO n 
3 114 PRO n 
3 115 THR n 
3 116 ALA n 
3 117 PRO n 
3 118 THR n 
3 119 GLY n 
3 120 ASP n 
3 121 ASP n 
3 122 ASP n 
3 123 ASP n 
3 124 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'BMP9, GDF2'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pAID4 ? ? 
2 1 sample ? ? ? human ? 'ACVRL1, ACVRLK1, ALK1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pAID4 ? ? 
3 1 sample ? ? ? human ? 'ActRIIB, ACVR2B'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pAID4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GDF2_HUMAN  Q9UK05 1 
;SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS
PISVLYKDDMGVPTLKYHYEGMSVAECGCR
;
320 ? 
2 UNP ACVL1_HUMAN P37023 2 
;DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSL
VLEATQPPSEQPGTDGQ
;
22  ? 
3 UNP AVR2B_HUMAN Q13705 3 
;SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQ
VYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
;
19  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4FAO A 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
2  1 4FAO B 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
3  2 4FAO C 3 ? 99  ? P37023 22  ? 118 ? 22 118 
4  2 4FAO D 3 ? 99  ? P37023 22  ? 118 ? 22 118 
5  3 4FAO E 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
6  3 4FAO F 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
7  1 4FAO G 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
8  1 4FAO H 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
9  2 4FAO I 3 ? 99  ? P37023 22  ? 118 ? 22 118 
10 2 4FAO J 3 ? 99  ? P37023 22  ? 118 ? 22 118 
11 3 4FAO K 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
12 3 4FAO L 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
13 1 4FAO M 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
14 1 4FAO N 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
15 2 4FAO O 3 ? 99  ? P37023 22  ? 118 ? 22 118 
16 2 4FAO P 3 ? 99  ? P37023 22  ? 118 ? 22 118 
17 3 4FAO Q 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
18 3 4FAO R 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
19 1 4FAO S 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
20 1 4FAO T 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
21 2 4FAO U 3 ? 99  ? P37023 22  ? 118 ? 22 118 
22 2 4FAO V 3 ? 99  ? P37023 22  ? 118 ? 22 118 
23 3 4FAO W 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
24 3 4FAO X 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
25 1 4FAO a 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
26 1 4FAO b 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
27 2 4FAO c 3 ? 99  ? P37023 22  ? 118 ? 22 118 
28 2 4FAO d 3 ? 99  ? P37023 22  ? 118 ? 22 118 
29 3 4FAO e 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
30 3 4FAO f 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
31 1 4FAO g 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
32 1 4FAO h 1 ? 110 ? Q9UK05 320 ? 429 ? 1  110 
33 2 4FAO i 3 ? 99  ? P37023 22  ? 118 ? 22 118 
34 2 4FAO j 3 ? 99  ? P37023 22  ? 118 ? 22 118 
35 3 4FAO k 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
36 3 4FAO l 3 ? 118 ? Q13705 19  ? 134 ? 1  116 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3  4FAO GLY C 1   ? UNP P37023 ? ? 'expression tag' 20  1   
3  4FAO ALA C 2   ? UNP P37023 ? ? 'expression tag' 21  2   
3  4FAO SER C 100 ? UNP P37023 ? ? 'expression tag' 119 3   
3  4FAO GLY C 101 ? UNP P37023 ? ? 'expression tag' 120 4   
3  4FAO ASP C 102 ? UNP P37023 ? ? 'expression tag' 121 5   
3  4FAO ASP C 103 ? UNP P37023 ? ? 'expression tag' 122 6   
3  4FAO ASP C 104 ? UNP P37023 ? ? 'expression tag' 123 7   
3  4FAO ASP C 105 ? UNP P37023 ? ? 'expression tag' 124 8   
3  4FAO LYS C 106 ? UNP P37023 ? ? 'expression tag' 125 9   
4  4FAO GLY D 1   ? UNP P37023 ? ? 'expression tag' 20  10  
4  4FAO ALA D 2   ? UNP P37023 ? ? 'expression tag' 21  11  
4  4FAO SER D 100 ? UNP P37023 ? ? 'expression tag' 119 12  
4  4FAO GLY D 101 ? UNP P37023 ? ? 'expression tag' 120 13  
4  4FAO ASP D 102 ? UNP P37023 ? ? 'expression tag' 121 14  
4  4FAO ASP D 103 ? UNP P37023 ? ? 'expression tag' 122 15  
4  4FAO ASP D 104 ? UNP P37023 ? ? 'expression tag' 123 16  
4  4FAO ASP D 105 ? UNP P37023 ? ? 'expression tag' 124 17  
4  4FAO LYS D 106 ? UNP P37023 ? ? 'expression tag' 125 18  
5  4FAO GLY E 1   ? UNP Q13705 ? ? 'expression tag' -1  19  
5  4FAO ALA E 2   ? UNP Q13705 ? ? 'expression tag' 0   20  
5  4FAO GLY E 119 ? UNP Q13705 ? ? 'expression tag' 117 21  
5  4FAO ASP E 120 ? UNP Q13705 ? ? 'expression tag' 118 22  
5  4FAO ASP E 121 ? UNP Q13705 ? ? 'expression tag' 119 23  
5  4FAO ASP E 122 ? UNP Q13705 ? ? 'expression tag' 120 24  
5  4FAO ASP E 123 ? UNP Q13705 ? ? 'expression tag' 121 25  
5  4FAO LYS E 124 ? UNP Q13705 ? ? 'expression tag' 122 26  
6  4FAO GLY F 1   ? UNP Q13705 ? ? 'expression tag' -1  27  
6  4FAO ALA F 2   ? UNP Q13705 ? ? 'expression tag' 0   28  
6  4FAO GLY F 119 ? UNP Q13705 ? ? 'expression tag' 117 29  
6  4FAO ASP F 120 ? UNP Q13705 ? ? 'expression tag' 118 30  
6  4FAO ASP F 121 ? UNP Q13705 ? ? 'expression tag' 119 31  
6  4FAO ASP F 122 ? UNP Q13705 ? ? 'expression tag' 120 32  
6  4FAO ASP F 123 ? UNP Q13705 ? ? 'expression tag' 121 33  
6  4FAO LYS F 124 ? UNP Q13705 ? ? 'expression tag' 122 34  
9  4FAO GLY I 1   ? UNP P37023 ? ? 'expression tag' 20  35  
9  4FAO ALA I 2   ? UNP P37023 ? ? 'expression tag' 21  36  
9  4FAO SER I 100 ? UNP P37023 ? ? 'expression tag' 119 37  
9  4FAO GLY I 101 ? UNP P37023 ? ? 'expression tag' 120 38  
9  4FAO ASP I 102 ? UNP P37023 ? ? 'expression tag' 121 39  
9  4FAO ASP I 103 ? UNP P37023 ? ? 'expression tag' 122 40  
9  4FAO ASP I 104 ? UNP P37023 ? ? 'expression tag' 123 41  
9  4FAO ASP I 105 ? UNP P37023 ? ? 'expression tag' 124 42  
9  4FAO LYS I 106 ? UNP P37023 ? ? 'expression tag' 125 43  
10 4FAO GLY J 1   ? UNP P37023 ? ? 'expression tag' 20  44  
10 4FAO ALA J 2   ? UNP P37023 ? ? 'expression tag' 21  45  
10 4FAO SER J 100 ? UNP P37023 ? ? 'expression tag' 119 46  
10 4FAO GLY J 101 ? UNP P37023 ? ? 'expression tag' 120 47  
10 4FAO ASP J 102 ? UNP P37023 ? ? 'expression tag' 121 48  
10 4FAO ASP J 103 ? UNP P37023 ? ? 'expression tag' 122 49  
10 4FAO ASP J 104 ? UNP P37023 ? ? 'expression tag' 123 50  
10 4FAO ASP J 105 ? UNP P37023 ? ? 'expression tag' 124 51  
10 4FAO LYS J 106 ? UNP P37023 ? ? 'expression tag' 125 52  
11 4FAO GLY K 1   ? UNP Q13705 ? ? 'expression tag' -1  53  
11 4FAO ALA K 2   ? UNP Q13705 ? ? 'expression tag' 0   54  
11 4FAO GLY K 119 ? UNP Q13705 ? ? 'expression tag' 117 55  
11 4FAO ASP K 120 ? UNP Q13705 ? ? 'expression tag' 118 56  
11 4FAO ASP K 121 ? UNP Q13705 ? ? 'expression tag' 119 57  
11 4FAO ASP K 122 ? UNP Q13705 ? ? 'expression tag' 120 58  
11 4FAO ASP K 123 ? UNP Q13705 ? ? 'expression tag' 121 59  
11 4FAO LYS K 124 ? UNP Q13705 ? ? 'expression tag' 122 60  
12 4FAO GLY L 1   ? UNP Q13705 ? ? 'expression tag' -1  61  
12 4FAO ALA L 2   ? UNP Q13705 ? ? 'expression tag' 0   62  
12 4FAO GLY L 119 ? UNP Q13705 ? ? 'expression tag' 117 63  
12 4FAO ASP L 120 ? UNP Q13705 ? ? 'expression tag' 118 64  
12 4FAO ASP L 121 ? UNP Q13705 ? ? 'expression tag' 119 65  
12 4FAO ASP L 122 ? UNP Q13705 ? ? 'expression tag' 120 66  
12 4FAO ASP L 123 ? UNP Q13705 ? ? 'expression tag' 121 67  
12 4FAO LYS L 124 ? UNP Q13705 ? ? 'expression tag' 122 68  
15 4FAO GLY O 1   ? UNP P37023 ? ? 'expression tag' 20  69  
15 4FAO ALA O 2   ? UNP P37023 ? ? 'expression tag' 21  70  
15 4FAO SER O 100 ? UNP P37023 ? ? 'expression tag' 119 71  
15 4FAO GLY O 101 ? UNP P37023 ? ? 'expression tag' 120 72  
15 4FAO ASP O 102 ? UNP P37023 ? ? 'expression tag' 121 73  
15 4FAO ASP O 103 ? UNP P37023 ? ? 'expression tag' 122 74  
15 4FAO ASP O 104 ? UNP P37023 ? ? 'expression tag' 123 75  
15 4FAO ASP O 105 ? UNP P37023 ? ? 'expression tag' 124 76  
15 4FAO LYS O 106 ? UNP P37023 ? ? 'expression tag' 125 77  
16 4FAO GLY P 1   ? UNP P37023 ? ? 'expression tag' 20  78  
16 4FAO ALA P 2   ? UNP P37023 ? ? 'expression tag' 21  79  
16 4FAO SER P 100 ? UNP P37023 ? ? 'expression tag' 119 80  
16 4FAO GLY P 101 ? UNP P37023 ? ? 'expression tag' 120 81  
16 4FAO ASP P 102 ? UNP P37023 ? ? 'expression tag' 121 82  
16 4FAO ASP P 103 ? UNP P37023 ? ? 'expression tag' 122 83  
16 4FAO ASP P 104 ? UNP P37023 ? ? 'expression tag' 123 84  
16 4FAO ASP P 105 ? UNP P37023 ? ? 'expression tag' 124 85  
16 4FAO LYS P 106 ? UNP P37023 ? ? 'expression tag' 125 86  
17 4FAO GLY Q 1   ? UNP Q13705 ? ? 'expression tag' -1  87  
17 4FAO ALA Q 2   ? UNP Q13705 ? ? 'expression tag' 0   88  
17 4FAO GLY Q 119 ? UNP Q13705 ? ? 'expression tag' 117 89  
17 4FAO ASP Q 120 ? UNP Q13705 ? ? 'expression tag' 118 90  
17 4FAO ASP Q 121 ? UNP Q13705 ? ? 'expression tag' 119 91  
17 4FAO ASP Q 122 ? UNP Q13705 ? ? 'expression tag' 120 92  
17 4FAO ASP Q 123 ? UNP Q13705 ? ? 'expression tag' 121 93  
17 4FAO LYS Q 124 ? UNP Q13705 ? ? 'expression tag' 122 94  
18 4FAO GLY R 1   ? UNP Q13705 ? ? 'expression tag' -1  95  
18 4FAO ALA R 2   ? UNP Q13705 ? ? 'expression tag' 0   96  
18 4FAO GLY R 119 ? UNP Q13705 ? ? 'expression tag' 117 97  
18 4FAO ASP R 120 ? UNP Q13705 ? ? 'expression tag' 118 98  
18 4FAO ASP R 121 ? UNP Q13705 ? ? 'expression tag' 119 99  
18 4FAO ASP R 122 ? UNP Q13705 ? ? 'expression tag' 120 100 
18 4FAO ASP R 123 ? UNP Q13705 ? ? 'expression tag' 121 101 
18 4FAO LYS R 124 ? UNP Q13705 ? ? 'expression tag' 122 102 
21 4FAO GLY U 1   ? UNP P37023 ? ? 'expression tag' 20  103 
21 4FAO ALA U 2   ? UNP P37023 ? ? 'expression tag' 21  104 
21 4FAO SER U 100 ? UNP P37023 ? ? 'expression tag' 119 105 
21 4FAO GLY U 101 ? UNP P37023 ? ? 'expression tag' 120 106 
21 4FAO ASP U 102 ? UNP P37023 ? ? 'expression tag' 121 107 
21 4FAO ASP U 103 ? UNP P37023 ? ? 'expression tag' 122 108 
21 4FAO ASP U 104 ? UNP P37023 ? ? 'expression tag' 123 109 
21 4FAO ASP U 105 ? UNP P37023 ? ? 'expression tag' 124 110 
21 4FAO LYS U 106 ? UNP P37023 ? ? 'expression tag' 125 111 
22 4FAO GLY V 1   ? UNP P37023 ? ? 'expression tag' 20  112 
22 4FAO ALA V 2   ? UNP P37023 ? ? 'expression tag' 21  113 
22 4FAO SER V 100 ? UNP P37023 ? ? 'expression tag' 119 114 
22 4FAO GLY V 101 ? UNP P37023 ? ? 'expression tag' 120 115 
22 4FAO ASP V 102 ? UNP P37023 ? ? 'expression tag' 121 116 
22 4FAO ASP V 103 ? UNP P37023 ? ? 'expression tag' 122 117 
22 4FAO ASP V 104 ? UNP P37023 ? ? 'expression tag' 123 118 
22 4FAO ASP V 105 ? UNP P37023 ? ? 'expression tag' 124 119 
22 4FAO LYS V 106 ? UNP P37023 ? ? 'expression tag' 125 120 
23 4FAO GLY W 1   ? UNP Q13705 ? ? 'expression tag' -1  121 
23 4FAO ALA W 2   ? UNP Q13705 ? ? 'expression tag' 0   122 
23 4FAO GLY W 119 ? UNP Q13705 ? ? 'expression tag' 117 123 
23 4FAO ASP W 120 ? UNP Q13705 ? ? 'expression tag' 118 124 
23 4FAO ASP W 121 ? UNP Q13705 ? ? 'expression tag' 119 125 
23 4FAO ASP W 122 ? UNP Q13705 ? ? 'expression tag' 120 126 
23 4FAO ASP W 123 ? UNP Q13705 ? ? 'expression tag' 121 127 
23 4FAO LYS W 124 ? UNP Q13705 ? ? 'expression tag' 122 128 
24 4FAO GLY X 1   ? UNP Q13705 ? ? 'expression tag' -1  129 
24 4FAO ALA X 2   ? UNP Q13705 ? ? 'expression tag' 0   130 
24 4FAO GLY X 119 ? UNP Q13705 ? ? 'expression tag' 117 131 
24 4FAO ASP X 120 ? UNP Q13705 ? ? 'expression tag' 118 132 
24 4FAO ASP X 121 ? UNP Q13705 ? ? 'expression tag' 119 133 
24 4FAO ASP X 122 ? UNP Q13705 ? ? 'expression tag' 120 134 
24 4FAO ASP X 123 ? UNP Q13705 ? ? 'expression tag' 121 135 
24 4FAO LYS X 124 ? UNP Q13705 ? ? 'expression tag' 122 136 
27 4FAO GLY c 1   ? UNP P37023 ? ? 'expression tag' 20  137 
27 4FAO ALA c 2   ? UNP P37023 ? ? 'expression tag' 21  138 
27 4FAO SER c 100 ? UNP P37023 ? ? 'expression tag' 119 139 
27 4FAO GLY c 101 ? UNP P37023 ? ? 'expression tag' 120 140 
27 4FAO ASP c 102 ? UNP P37023 ? ? 'expression tag' 121 141 
27 4FAO ASP c 103 ? UNP P37023 ? ? 'expression tag' 122 142 
27 4FAO ASP c 104 ? UNP P37023 ? ? 'expression tag' 123 143 
27 4FAO ASP c 105 ? UNP P37023 ? ? 'expression tag' 124 144 
27 4FAO LYS c 106 ? UNP P37023 ? ? 'expression tag' 125 145 
28 4FAO GLY d 1   ? UNP P37023 ? ? 'expression tag' 20  146 
28 4FAO ALA d 2   ? UNP P37023 ? ? 'expression tag' 21  147 
28 4FAO SER d 100 ? UNP P37023 ? ? 'expression tag' 119 148 
28 4FAO GLY d 101 ? UNP P37023 ? ? 'expression tag' 120 149 
28 4FAO ASP d 102 ? UNP P37023 ? ? 'expression tag' 121 150 
28 4FAO ASP d 103 ? UNP P37023 ? ? 'expression tag' 122 151 
28 4FAO ASP d 104 ? UNP P37023 ? ? 'expression tag' 123 152 
28 4FAO ASP d 105 ? UNP P37023 ? ? 'expression tag' 124 153 
28 4FAO LYS d 106 ? UNP P37023 ? ? 'expression tag' 125 154 
29 4FAO GLY e 1   ? UNP Q13705 ? ? 'expression tag' -1  155 
29 4FAO ALA e 2   ? UNP Q13705 ? ? 'expression tag' 0   156 
29 4FAO GLY e 119 ? UNP Q13705 ? ? 'expression tag' 117 157 
29 4FAO ASP e 120 ? UNP Q13705 ? ? 'expression tag' 118 158 
29 4FAO ASP e 121 ? UNP Q13705 ? ? 'expression tag' 119 159 
29 4FAO ASP e 122 ? UNP Q13705 ? ? 'expression tag' 120 160 
29 4FAO ASP e 123 ? UNP Q13705 ? ? 'expression tag' 121 161 
29 4FAO LYS e 124 ? UNP Q13705 ? ? 'expression tag' 122 162 
30 4FAO GLY f 1   ? UNP Q13705 ? ? 'expression tag' -1  163 
30 4FAO ALA f 2   ? UNP Q13705 ? ? 'expression tag' 0   164 
30 4FAO GLY f 119 ? UNP Q13705 ? ? 'expression tag' 117 165 
30 4FAO ASP f 120 ? UNP Q13705 ? ? 'expression tag' 118 166 
30 4FAO ASP f 121 ? UNP Q13705 ? ? 'expression tag' 119 167 
30 4FAO ASP f 122 ? UNP Q13705 ? ? 'expression tag' 120 168 
30 4FAO ASP f 123 ? UNP Q13705 ? ? 'expression tag' 121 169 
30 4FAO LYS f 124 ? UNP Q13705 ? ? 'expression tag' 122 170 
33 4FAO GLY i 1   ? UNP P37023 ? ? 'expression tag' 20  171 
33 4FAO ALA i 2   ? UNP P37023 ? ? 'expression tag' 21  172 
33 4FAO SER i 100 ? UNP P37023 ? ? 'expression tag' 119 173 
33 4FAO GLY i 101 ? UNP P37023 ? ? 'expression tag' 120 174 
33 4FAO ASP i 102 ? UNP P37023 ? ? 'expression tag' 121 175 
33 4FAO ASP i 103 ? UNP P37023 ? ? 'expression tag' 122 176 
33 4FAO ASP i 104 ? UNP P37023 ? ? 'expression tag' 123 177 
33 4FAO ASP i 105 ? UNP P37023 ? ? 'expression tag' 124 178 
33 4FAO LYS i 106 ? UNP P37023 ? ? 'expression tag' 125 179 
34 4FAO GLY j 1   ? UNP P37023 ? ? 'expression tag' 20  180 
34 4FAO ALA j 2   ? UNP P37023 ? ? 'expression tag' 21  181 
34 4FAO SER j 100 ? UNP P37023 ? ? 'expression tag' 119 182 
34 4FAO GLY j 101 ? UNP P37023 ? ? 'expression tag' 120 183 
34 4FAO ASP j 102 ? UNP P37023 ? ? 'expression tag' 121 184 
34 4FAO ASP j 103 ? UNP P37023 ? ? 'expression tag' 122 185 
34 4FAO ASP j 104 ? UNP P37023 ? ? 'expression tag' 123 186 
34 4FAO ASP j 105 ? UNP P37023 ? ? 'expression tag' 124 187 
34 4FAO LYS j 106 ? UNP P37023 ? ? 'expression tag' 125 188 
35 4FAO GLY k 1   ? UNP Q13705 ? ? 'expression tag' -1  189 
35 4FAO ALA k 2   ? UNP Q13705 ? ? 'expression tag' 0   190 
35 4FAO GLY k 119 ? UNP Q13705 ? ? 'expression tag' 117 191 
35 4FAO ASP k 120 ? UNP Q13705 ? ? 'expression tag' 118 192 
35 4FAO ASP k 121 ? UNP Q13705 ? ? 'expression tag' 119 193 
35 4FAO ASP k 122 ? UNP Q13705 ? ? 'expression tag' 120 194 
35 4FAO ASP k 123 ? UNP Q13705 ? ? 'expression tag' 121 195 
35 4FAO LYS k 124 ? UNP Q13705 ? ? 'expression tag' 122 196 
36 4FAO GLY l 1   ? UNP Q13705 ? ? 'expression tag' -1  197 
36 4FAO ALA l 2   ? UNP Q13705 ? ? 'expression tag' 0   198 
36 4FAO GLY l 119 ? UNP Q13705 ? ? 'expression tag' 117 199 
36 4FAO ASP l 120 ? UNP Q13705 ? ? 'expression tag' 118 200 
36 4FAO ASP l 121 ? UNP Q13705 ? ? 'expression tag' 119 201 
36 4FAO ASP l 122 ? UNP Q13705 ? ? 'expression tag' 120 202 
36 4FAO ASP l 123 ? UNP Q13705 ? ? 'expression tag' 121 203 
36 4FAO LYS l 124 ? UNP Q13705 ? ? 'expression tag' 122 204 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer                  . 'SODIUM ION'                             ? 'Na 1'           22.990  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4FAO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.23 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'20% PEG 3350, 0.2 M sodium malonate, 0.1 M Bis-Tris propane, pH 6.5, vapor diffusion, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 944' 
_diffrn_detector.pdbx_collection_date   2010-08-05 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Ni Filter' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4FAO 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            3.35 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   82408 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.137 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.91 
_reflns.B_iso_Wilson_estimate        64.18 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.35 
_reflns_shell.d_res_low              3.41 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.372 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_Rsym_value        0.372 
_reflns_shell.pdbx_redundancy        3.9 
_reflns_shell.number_unique_all      4084 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4FAO 
_refine.ls_d_res_high                            3.3570 
_refine.ls_d_res_low                             26.8490 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    84.0300 
_refine.ls_number_reflns_obs                     69521 
_refine.ls_number_reflns_all                     79681 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_obs                          0.2200 
_refine.ls_R_factor_R_work                       0.2190 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2614 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.4200 
_refine.ls_number_reflns_R_free                  1685 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               80.4386 
_refine.solvent_model_param_bsol                 30.9180 
_refine.solvent_model_param_ksol                 0.2890 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -21.5924 
_refine.aniso_B[2][2]                            -21.5924 
_refine.aniso_B[3][3]                            17.9779 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.8300 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'structures solved in-house, not deposited' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8066 
_refine.B_iso_max                                251.720 
_refine.B_iso_min                                7.120 
_refine.pdbx_overall_phase_error                 26.4200 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          3.0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        25069 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         342 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25411 
_refine_hist.d_res_high                       3.3570 
_refine_hist.d_res_low                        26.8490 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           26917 0.014  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          35486 1.241  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     3834  0.079  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      4590  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 9304  16.107 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1 1  POSITIONAL A 799 0.064 ? ? ? ? 
2  'X-RAY DIFFRACTION' 1 2  POSITIONAL B 799 0.064 ? ? ? ? 
3  'X-RAY DIFFRACTION' 1 3  POSITIONAL G 795 0.065 ? ? ? ? 
4  'X-RAY DIFFRACTION' 1 4  POSITIONAL H 806 0.048 ? ? ? ? 
5  'X-RAY DIFFRACTION' 1 5  POSITIONAL M 802 0.054 ? ? ? ? 
6  'X-RAY DIFFRACTION' 1 6  POSITIONAL N 796 0.067 ? ? ? ? 
7  'X-RAY DIFFRACTION' 1 7  POSITIONAL S 806 0.044 ? ? ? ? 
8  'X-RAY DIFFRACTION' 1 8  POSITIONAL T 798 0.067 ? ? ? ? 
9  'X-RAY DIFFRACTION' 1 9  POSITIONAL a 796 0.066 ? ? ? ? 
10 'X-RAY DIFFRACTION' 1 10 POSITIONAL b 806 0.051 ? ? ? ? 
11 'X-RAY DIFFRACTION' 1 11 POSITIONAL g 806 0.064 ? ? ? ? 
12 'X-RAY DIFFRACTION' 1 12 POSITIONAL h 806 0.051 ? ? ? ? 
13 'X-RAY DIFFRACTION' 2 1  POSITIONAL E 707 0.049 ? ? ? ? 
14 'X-RAY DIFFRACTION' 2 2  POSITIONAL X 707 0.049 ? ? ? ? 
15 'X-RAY DIFFRACTION' 2 3  POSITIONAL e 713 0.052 ? ? ? ? 
16 'X-RAY DIFFRACTION' 2 4  POSITIONAL f 717 0.056 ? ? ? ? 
17 'X-RAY DIFFRACTION' 2 5  POSITIONAL k 703 0.056 ? ? ? ? 
18 'X-RAY DIFFRACTION' 2 6  POSITIONAL l 709 0.053 ? ? ? ? 
19 'X-RAY DIFFRACTION' 2 7  POSITIONAL W 720 0.037 ? ? ? ? 
20 'X-RAY DIFFRACTION' 2 8  POSITIONAL F 711 0.057 ? ? ? ? 
21 'X-RAY DIFFRACTION' 2 9  POSITIONAL K 706 0.060 ? ? ? ? 
22 'X-RAY DIFFRACTION' 2 10 POSITIONAL L 719 0.056 ? ? ? ? 
23 'X-RAY DIFFRACTION' 2 11 POSITIONAL Q 729 0.040 ? ? ? ? 
24 'X-RAY DIFFRACTION' 2 12 POSITIONAL R 713 0.061 ? ? ? ? 
25 'X-RAY DIFFRACTION' 3 1  POSITIONAL C 495 0.034 ? ? ? ? 
26 'X-RAY DIFFRACTION' 3 2  POSITIONAL U 495 0.034 ? ? ? ? 
27 'X-RAY DIFFRACTION' 3 3  POSITIONAL V 491 0.040 ? ? ? ? 
28 'X-RAY DIFFRACTION' 3 4  POSITIONAL c 492 0.039 ? ? ? ? 
29 'X-RAY DIFFRACTION' 3 5  POSITIONAL d 487 0.041 ? ? ? ? 
30 'X-RAY DIFFRACTION' 3 6  POSITIONAL i 496 0.039 ? ? ? ? 
31 'X-RAY DIFFRACTION' 3 7  POSITIONAL j 497 0.042 ? ? ? ? 
32 'X-RAY DIFFRACTION' 3 8  POSITIONAL P 491 0.043 ? ? ? ? 
33 'X-RAY DIFFRACTION' 3 9  POSITIONAL D 497 0.042 ? ? ? ? 
34 'X-RAY DIFFRACTION' 3 10 POSITIONAL I 488 0.034 ? ? ? ? 
35 'X-RAY DIFFRACTION' 3 11 POSITIONAL J 481 0.045 ? ? ? ? 
36 'X-RAY DIFFRACTION' 3 12 POSITIONAL O 470 0.040 ? ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.357  3.4764  10 80.0000 6454 . 0.2863 0.3436 . 160 . 6614 . . 'X-RAY DIFFRACTION' 
3.4764 3.6153  10 81.0000 6557 . 0.2568 0.3019 . 160 . 6717 . . 'X-RAY DIFFRACTION' 
3.6153 3.7794  10 85.0000 6806 . 0.2346 0.2632 . 165 . 6971 . . 'X-RAY DIFFRACTION' 
3.7794 3.9781  10 79.0000 6354 . 0.2075 0.2731 . 168 . 6522 . . 'X-RAY DIFFRACTION' 
3.9781 4.2264  10 77.0000 6194 . 0.2032 0.2291 . 163 . 6357 . . 'X-RAY DIFFRACTION' 
4.2264 4.5513  10 84.0000 6788 . 0.1917 0.2331 . 167 . 6955 . . 'X-RAY DIFFRACTION' 
4.5513 5.0066  10 84.0000 6776 . 0.1943 0.2524 . 161 . 6937 . . 'X-RAY DIFFRACTION' 
5.0066 5.7250  10 87.0000 7002 . 0.2323 0.2985 . 175 . 7177 . . 'X-RAY DIFFRACTION' 
5.7250 7.1898  10 89.0000 7215 . 0.2252 0.2457 . 176 . 7391 . . 'X-RAY DIFFRACTION' 
7.1898 26.8495 10 93.0000 7690 . 0.2118 0.2398 . 190 . 7880 . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 0.282101  0.063828  -0.957259 0.081211  -0.995792 -0.042465 -0.955941 -0.065760 -0.286097 64.132202  -45.986401  
82.197403  
2  given ? -0.182977 0.196952  -0.963187 0.806922  0.589752  -0.032700 0.561601  -0.783200 -0.266836 67.609497  -99.916199  
-37.686901 
3  given ? -0.531447 0.846433  -0.033397 -0.846707 -0.531981 -0.009159 -0.025519 0.023409  0.999400  111.679001 61.540798   
33.497898  
4  given ? -0.473919 0.880124  -0.027977 -0.872660 -0.473674 -0.118732 -0.117750 -0.031855 0.992532  108.794998 68.126404   
-55.629902 
5  given ? -0.070637 0.239238  -0.968388 0.831485  0.550416  0.075328  0.551038  -0.799879 -0.237803 152.283997 -102.438004 
-11.774600 
6  given ? -0.518628 -0.854305 -0.034469 0.853560  -0.519672 0.037097  -0.049605 -0.010182 0.998717  111.873001 -63.222698  
-28.103300 
7  given ? -0.032706 -0.259761 -0.965119 -0.886549 0.453397  -0.091988 0.461477  0.852616  -0.245120 117.972000 27.393299   
-13.188900 
8  given ? 0.169977  -0.160202 0.972339  0.906411  0.412594  -0.090474 -0.386687 0.896717  0.215340  30.540800  -41.140800  
72.043503  
9  given ? 0.489412  -0.870145 0.057652  -0.867401 -0.478917 0.135110  -0.089955 -0.116131 -0.989152 0.779450   -5.991880   
35.135601  
10 given ? 0.049036  0.270384  0.961503  -0.795192 0.593074  -0.126224 -0.604372 -0.758390 0.244089  101.153000 27.396299   
-13.495900 
11 given ? 0.524125  0.850670  0.040670  0.836393  -0.523149 0.163587  0.160435  -0.051723 -0.985690 108.044998 -64.431198  
-10.480900 
12 given ? -0.076017 -0.261471 -0.962213 -0.867695 0.492781  -0.065358 0.491250  0.829939  -0.264337 118.972000 25.908701   
-13.454000 
13 given ? 0.222032  -0.156518 0.962395  0.883221  0.450430  -0.130511 -0.413064 0.878985  0.238250  26.872299  -35.633801  
72.090500  
14 given ? 0.484815  -0.872721 0.057553  -0.868925 -0.473121 0.145345  -0.099616 -0.120475 -0.987706 0.776625   -5.887480   
35.049198  
15 given ? 0.014145  0.318598  0.947784  -0.811617 0.557293  -0.175221 -0.584018 -0.766760 0.266462  102.684998 26.528299   
-13.905400 
16 given ? 0.527800  0.847433  0.057307  0.829932  -0.528898 0.177427  0.180667  -0.046085 -0.982464 107.813004 -64.445900  
-11.348000 
17 given ? -0.520215 -0.853960 -0.011317 0.853411  -0.520296 0.031352  -0.032661 0.006651  0.999444  111.241997 -63.026100  
-28.907101 
18 given ? 0.276987  0.015839  -0.960743 0.049891  -0.998752 -0.002082 -0.959578 -0.047356 -0.277432 62.548100  -43.049198  
83.339996  
19 given ? -0.124477 0.241048  -0.962497 0.824748  0.564435  0.034695  0.551630  -0.789499 -0.269063 60.115299  -98.296402  
-36.564400 
20 given ? -0.533065 0.844056  -0.058404 -0.843237 -0.535659 -0.044962 -0.069235 0.025281  0.997280  111.170998 60.039398   
35.883099  
21 given ? -0.471401 0.881862  -0.010019 -0.878311 -0.470469 -0.085025 -0.079694 -0.031281 0.996328  107.449997 66.479202   
-58.011799 
22 given ? -0.050016 0.267118  -0.962365 0.851309  0.515282  0.098780  0.522275  -0.814329 -0.253172 148.865997 -104.709000 
-7.480650  
23 given ? -0.511139 -0.857758 -0.054671 0.856785  -0.513543 0.046820  -0.068236 -0.022909 0.997406  112.037003 -63.733501  
-27.229099 
24 given ? -0.051485 -0.268441 -0.961919 -0.877591 0.471866  -0.084711 0.476637  0.839810  -0.259875 118.695999 26.705601   
-13.408100 
25 given ? 0.493733  -0.869373 0.020456  -0.866866 -0.490170 0.090974  -0.069064 -0.062649 -0.995643 1.763530   -5.822060   
38.638901  
26 given ? 0.205103  -0.167710 0.964264  0.884691  0.453169  -0.109360 -0.418634 0.875506  0.241318  27.866301  -36.532299  
72.047302  
27 given ? 0.509165  0.860560  0.013697  0.852252  -0.506342 0.131471  0.120074  -0.055268 -0.991225 108.859001 -65.020699  
-8.747830  
28 given ? 0.059571  0.319714  0.945640  -0.816830 0.560147  -0.137925 -0.573794 -0.764211 0.294521  102.535004 26.644800   
-14.008100 
29 given ? -0.054579 0.270573  -0.961151 0.851899  0.514734  0.096527  0.520855  -0.813535 -0.258594 149.345001 -104.670998 
-7.191100  
30 given ? 0.315427  0.058642  -0.947136 0.054205  -0.997573 -0.043713 -0.947401 -0.037551 -0.317840 61.057400  -43.758900  
82.258202  
31 given ? -0.531096 0.846171  -0.043945 -0.847006 -0.531583 0.000717  -0.022754 0.037603  0.999034  111.285004 61.823399   
33.067001  
32 given ? -0.197820 0.235322  -0.951573 0.827954  0.559783  -0.033688 0.524746  -0.794523 -0.305572 68.309998  -101.234001 
-35.193600 
33 given ? -0.464639 0.885475  0.006662  -0.883345 -0.462970 -0.073219 -0.061749 -0.039905 0.997294  105.528000 64.954498   
-59.217300 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  G 
1 4  H 
1 5  M 
1 6  N 
1 7  S 
1 8  T 
1 9  a 
1 10 b 
1 11 g 
1 12 h 
2 1  E 
2 2  X 
2 3  e 
2 4  f 
2 5  k 
2 6  l 
2 7  W 
2 8  F 
2 9  K 
2 10 L 
2 11 Q 
2 12 R 
3 1  C 
3 2  U 
3 3  V 
3 4  c 
3 5  d 
3 6  i 
3 7  j 
3 8  P 
3 9  D 
3 10 I 
3 11 J 
3 12 O 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1  1 ? A 8  A 110 'CHAIN A AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 2  1 ? B 8  B 110 'CHAIN B AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 3  1 ? G 8  G 110 'CHAIN G AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 4  1 ? H 8  H 110 'CHAIN H AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 5  1 ? M 8  M 110 'CHAIN M AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 6  1 ? N 8  N 110 'CHAIN N AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 7  1 ? S 8  S 110 'CHAIN S AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 8  1 ? T 8  T 110 'CHAIN T AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 9  1 ? a 8  a 110 'CHAIN a AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 10 1 ? b 8  b 110 'CHAIN b AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 11 1 ? g 8  g 110 'CHAIN g AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
1 12 1 ? h 8  h 110 'CHAIN h AND (RESSEQ 8:110 )'                  ? ? ? ? ? ? ? ? 
2 1  1 ? E 8  E 99  'CHAIN E AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 2  1 ? X 8  X 99  'CHAIN X AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 3  1 ? e 8  e 99  'CHAIN e AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 4  1 ? f 8  f 99  'CHAIN f AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 5  1 ? k 8  k 99  'CHAIN k AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 6  1 ? l 8  l 99  'CHAIN l AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 7  1 ? W 8  W 99  'CHAIN W AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 8  1 ? F 8  F 99  'CHAIN F AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 9  1 ? K 8  K 99  'CHAIN K AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 10 1 ? L 8  L 99  'CHAIN L AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 11 1 ? Q 8  Q 99  'CHAIN Q AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
2 12 1 ? R 8  R 99  'CHAIN R AND (RESSEQ 8:99 )'                   ? ? ? ? ? ? ? ? 
3 1  1 ? C 30 C 56  'CHAIN C AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 1  2 ? C 62 C 100 'CHAIN C AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 2  1 ? U 30 U 56  'CHAIN U AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 2  2 ? U 62 U 100 'CHAIN U AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 3  1 ? V 30 V 56  'CHAIN V AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 3  2 ? V 62 V 100 'CHAIN V AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 4  1 ? c 30 c 56  'CHAIN c AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 4  2 ? c 62 c 100 'CHAIN c AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 5  1 ? d 30 d 56  'CHAIN d AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 5  2 ? d 62 d 100 'CHAIN d AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 6  1 ? i 30 i 56  'CHAIN i AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 6  2 ? i 62 i 100 'CHAIN i AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 7  1 ? j 30 j 56  'CHAIN j AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 7  2 ? j 62 j 100 'CHAIN j AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 8  1 ? P 30 P 56  'CHAIN P AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 8  2 ? P 62 P 100 'CHAIN P AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 9  1 ? D 30 D 56  'CHAIN D AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 9  2 ? D 62 D 100 'CHAIN D AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 10 1 ? I 30 I 56  'CHAIN I AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 10 2 ? I 62 I 100 'CHAIN I AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 11 1 ? J 30 J 56  'CHAIN J AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 11 2 ? J 62 J 100 'CHAIN J AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 12 1 ? O 30 O 56  'CHAIN O AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
3 12 2 ? O 62 O 100 'CHAIN O AND (RESSEQ 30:56 OR RESSEQ 62:100 )' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  4FAO 
_struct.title                     'Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex' 
_struct.pdbx_descriptor           
;Growth/differentiation factor 2, Serine/threonine-protein kinase receptor R3 (E.C.2.7.11.30), Activin receptor type-2B (E.C.2.7.11.30)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4FAO 
_struct_keywords.text            
'tgf-beta, CTK, cystine knot, extracellular domain, receptor, SIGNALING PROTEIN-SIGNALING PROTEIN complex' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 1 ? 
FA N N 1 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 5 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 5 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 5 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 4 ? 
CB N N 4 ? 
DB N N 5 ? 
EB N N 4 ? 
FB N N 4 ? 
GB N N 5 ? 
HB N N 4 ? 
IB N N 4 ? 
JB N N 4 ? 
KB N N 4 ? 
LB N N 5 ? 
MB N N 4 ? 
NB N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A  46 ? THR A  50 ? ALA A 46 THR A 50 5 ? 5  
HELX_P HELX_P2  2  THR A  52 ? PHE A  65 ? THR A 52 PHE A 65 1 ? 14 
HELX_P HELX_P3  3  ALA B  46 ? THR B  50 ? ALA B 46 THR B 50 5 ? 5  
HELX_P HELX_P4  4  THR B  52 ? PHE B  65 ? THR B 52 PHE B 65 1 ? 14 
HELX_P HELX_P5  5  HIS C  54 ? GLY C  60 ? HIS C 73 GLY C 79 5 ? 7  
HELX_P HELX_P6  6  HIS D  54 ? GLY D  60 ? HIS D 73 GLY D 79 5 ? 7  
HELX_P HELX_P7  7  ASN E  19 ? ARG E  24 ? ASN E 17 ARG E 22 1 ? 6  
HELX_P HELX_P8  8  ASP E  65 ? TYR E  69 ? ASP E 63 TYR E 67 5 ? 5  
HELX_P HELX_P9  9  ASN F  19 ? ARG F  24 ? ASN F 17 ARG F 22 1 ? 6  
HELX_P HELX_P10 10 ASP F  65 ? TYR F  69 ? ASP F 63 TYR F 67 5 ? 5  
HELX_P HELX_P11 11 ALA G  46 ? THR G  50 ? ALA G 46 THR G 50 5 ? 5  
HELX_P HELX_P12 12 THR G  52 ? PHE G  65 ? THR G 52 PHE G 65 1 ? 14 
HELX_P HELX_P13 13 ALA H  46 ? THR H  50 ? ALA H 46 THR H 50 5 ? 5  
HELX_P HELX_P14 14 THR H  52 ? PHE H  65 ? THR H 52 PHE H 65 1 ? 14 
HELX_P HELX_P15 15 HIS I  54 ? GLY I  60 ? HIS I 73 GLY I 79 5 ? 7  
HELX_P HELX_P16 16 HIS J  54 ? GLY J  60 ? HIS J 73 GLY J 79 5 ? 7  
HELX_P HELX_P17 17 ASN K  19 ? ARG K  24 ? ASN K 17 ARG K 22 1 ? 6  
HELX_P HELX_P18 18 ASP K  65 ? TYR K  69 ? ASP K 63 TYR K 67 5 ? 5  
HELX_P HELX_P19 19 ASN L  19 ? ARG L  24 ? ASN L 17 ARG L 22 1 ? 6  
HELX_P HELX_P20 20 ASP L  65 ? TYR L  69 ? ASP L 63 TYR L 67 5 ? 5  
HELX_P HELX_P21 21 ALA M  46 ? THR M  50 ? ALA M 46 THR M 50 5 ? 5  
HELX_P HELX_P22 22 THR M  52 ? PHE M  65 ? THR M 52 PHE M 65 1 ? 14 
HELX_P HELX_P23 23 GLU N  18 ? GLY N  21 ? GLU N 18 GLY N 21 5 ? 4  
HELX_P HELX_P24 24 ALA N  46 ? THR N  50 ? ALA N 46 THR N 50 5 ? 5  
HELX_P HELX_P25 25 THR N  52 ? PHE N  65 ? THR N 52 PHE N 65 1 ? 14 
HELX_P HELX_P26 26 HIS O  54 ? GLY O  60 ? HIS O 73 GLY O 79 5 ? 7  
HELX_P HELX_P27 27 HIS P  54 ? GLY P  60 ? HIS P 73 GLY P 79 5 ? 7  
HELX_P HELX_P28 28 ASN Q  19 ? ARG Q  24 ? ASN Q 17 ARG Q 22 1 ? 6  
HELX_P HELX_P29 29 ASP Q  65 ? TYR Q  69 ? ASP Q 63 TYR Q 67 5 ? 5  
HELX_P HELX_P30 30 ASN R  19 ? ARG R  24 ? ASN R 17 ARG R 22 1 ? 6  
HELX_P HELX_P31 31 ASP R  65 ? TYR R  69 ? ASP R 63 TYR R 67 5 ? 5  
HELX_P HELX_P32 32 ALA S  46 ? THR S  50 ? ALA S 46 THR S 50 5 ? 5  
HELX_P HELX_P33 33 THR S  52 ? PHE S  65 ? THR S 52 PHE S 65 1 ? 14 
HELX_P HELX_P34 34 ALA T  46 ? THR T  50 ? ALA T 46 THR T 50 5 ? 5  
HELX_P HELX_P35 35 THR T  52 ? PHE T  65 ? THR T 52 PHE T 65 1 ? 14 
HELX_P HELX_P36 36 HIS U  54 ? GLY U  60 ? HIS U 73 GLY U 79 5 ? 7  
HELX_P HELX_P37 37 HIS V  54 ? GLY V  60 ? HIS V 73 GLY V 79 5 ? 7  
HELX_P HELX_P38 38 ASN W  19 ? ARG W  24 ? ASN W 17 ARG W 22 1 ? 6  
HELX_P HELX_P39 39 ASP W  65 ? TYR W  69 ? ASP W 63 TYR W 67 5 ? 5  
HELX_P HELX_P40 40 ASN X  19 ? ARG X  24 ? ASN X 17 ARG X 22 1 ? 6  
HELX_P HELX_P41 41 ASP X  65 ? TYR X  69 ? ASP X 63 TYR X 67 5 ? 5  
HELX_P HELX_P42 42 ALA Y  46 ? THR Y  50 ? ALA a 46 THR a 50 5 ? 5  
HELX_P HELX_P43 43 THR Y  52 ? PHE Y  65 ? THR a 52 PHE a 65 1 ? 14 
HELX_P HELX_P44 44 ALA Z  46 ? THR Z  50 ? ALA b 46 THR b 50 5 ? 5  
HELX_P HELX_P45 45 THR Z  52 ? PHE Z  65 ? THR b 52 PHE b 65 1 ? 14 
HELX_P HELX_P46 46 HIS AA 54 ? GLY AA 60 ? HIS c 73 GLY c 79 5 ? 7  
HELX_P HELX_P47 47 HIS BA 54 ? GLY BA 60 ? HIS d 73 GLY d 79 5 ? 7  
HELX_P HELX_P48 48 ASN CA 19 ? ARG CA 24 ? ASN e 17 ARG e 22 1 ? 6  
HELX_P HELX_P49 49 ASP CA 65 ? TYR CA 69 ? ASP e 63 TYR e 67 5 ? 5  
HELX_P HELX_P50 50 ASN DA 19 ? ARG DA 24 ? ASN f 17 ARG f 22 1 ? 6  
HELX_P HELX_P51 51 ASP DA 65 ? TYR DA 69 ? ASP f 63 TYR f 67 5 ? 5  
HELX_P HELX_P52 52 ALA EA 46 ? THR EA 50 ? ALA g 46 THR g 50 5 ? 5  
HELX_P HELX_P53 53 THR EA 52 ? PHE EA 65 ? THR g 52 PHE g 65 1 ? 14 
HELX_P HELX_P54 54 ALA FA 46 ? THR FA 50 ? ALA h 46 THR h 50 5 ? 5  
HELX_P HELX_P55 55 THR FA 52 ? PHE FA 65 ? THR h 52 PHE h 65 1 ? 14 
HELX_P HELX_P56 56 HIS GA 54 ? GLY GA 60 ? HIS i 73 GLY i 79 5 ? 7  
HELX_P HELX_P57 57 HIS HA 54 ? GLY HA 60 ? HIS j 73 GLY j 79 5 ? 7  
HELX_P HELX_P58 58 ASN IA 19 ? ARG IA 24 ? ASN k 17 ARG k 22 1 ? 6  
HELX_P HELX_P59 59 ASP IA 65 ? TYR IA 69 ? ASP k 63 TYR k 67 5 ? 5  
HELX_P HELX_P60 60 ASN JA 19 ? ARG JA 24 ? ASN l 17 ARG l 22 1 ? 6  
HELX_P HELX_P61 61 ASP JA 65 ? TYR JA 69 ? ASP l 63 TYR l 67 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?   ? A  CYS 8  SG  ? ? ? 1_555 A  CYS 74  SG ? ? A CYS 8  A CYS 74  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2   disulf ?   ? A  CYS 37 SG  ? ? ? 1_555 A  CYS 107 SG ? ? A CYS 37 A CYS 107 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3   disulf ?   ? A  CYS 41 SG  ? ? ? 1_555 A  CYS 109 SG ? ? A CYS 41 A CYS 109 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf4   disulf ?   ? A  CYS 73 SG  ? ? ? 1_555 B  CYS 73  SG ? ? A CYS 73 B CYS 73  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5   disulf ?   ? B  CYS 8  SG  ? ? ? 1_555 B  CYS 74  SG ? ? B CYS 8  B CYS 74  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf6   disulf ?   ? B  CYS 37 SG  ? ? ? 1_555 B  CYS 107 SG ? ? B CYS 37 B CYS 107 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf7   disulf ?   ? B  CYS 41 SG  ? ? ? 1_555 B  CYS 109 SG ? ? B CYS 41 B CYS 109 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf8   disulf ?   ? C  CYS 15 SG  ? ? ? 1_555 C  CYS 32  SG ? ? C CYS 34 C CYS 51  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf9   disulf ?   ? C  CYS 17 SG  ? ? ? 1_555 C  CYS 22  SG ? ? C CYS 36 C CYS 41  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf10  disulf ?   ? C  CYS 27 SG  ? ? ? 1_555 C  CYS 50  SG ? ? C CYS 46 C CYS 69  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf11  disulf ?   ? C  CYS 58 SG  ? ? ? 1_555 C  CYS 70  SG ? ? C CYS 77 C CYS 89  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf12  disulf ?   ? C  CYS 71 SG  ? ? ? 1_555 C  CYS 76  SG ? ? C CYS 90 C CYS 95  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf13  disulf ?   ? D  CYS 15 SG  ? ? ? 1_555 D  CYS 32  SG ? ? D CYS 34 D CYS 51  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf14  disulf ?   ? D  CYS 17 SG  ? ? ? 1_555 D  CYS 22  SG ? ? D CYS 36 D CYS 41  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf15  disulf ?   ? D  CYS 27 SG  ? ? ? 1_555 D  CYS 50  SG ? ? D CYS 46 D CYS 69  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf16  disulf ?   ? D  CYS 58 SG  ? ? ? 1_555 D  CYS 70  SG ? ? D CYS 77 D CYS 89  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf17  disulf ?   ? D  CYS 71 SG  ? ? ? 1_555 D  CYS 76  SG ? ? D CYS 90 D CYS 95  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf18  disulf ?   ? E  CYS 13 SG  ? ? ? 1_555 E  CYS 43  SG ? ? E CYS 11 E CYS 41  1_555 ? ? ? ? ? ? ? 2.008 ? ?               
disulf19  disulf ?   ? E  CYS 33 SG  ? ? ? 1_555 E  CYS 61  SG ? ? E CYS 31 E CYS 59  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf20  disulf ?   ? E  CYS 68 SG  ? ? ? 1_555 E  CYS 87  SG ? ? E CYS 66 E CYS 85  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf21  disulf ?   ? E  CYS 74 SG  ? ? ? 1_555 E  CYS 86  SG ? ? E CYS 72 E CYS 84  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf22  disulf ?   ? E  CYS 88 SG  ? ? ? 1_555 E  CYS 93  SG ? ? E CYS 86 E CYS 91  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf23  disulf ?   ? F  CYS 13 SG  ? ? ? 1_555 F  CYS 43  SG ? ? F CYS 11 F CYS 41  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf24  disulf ?   ? F  CYS 33 SG  ? ? ? 1_555 F  CYS 61  SG ? ? F CYS 31 F CYS 59  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf25  disulf ?   ? F  CYS 68 SG  ? ? ? 1_555 F  CYS 87  SG ? ? F CYS 66 F CYS 85  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf26  disulf ?   ? F  CYS 74 SG  ? ? ? 1_555 F  CYS 86  SG ? ? F CYS 72 F CYS 84  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf27  disulf ?   ? F  CYS 88 SG  ? ? ? 1_555 F  CYS 93  SG ? ? F CYS 86 F CYS 91  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf28  disulf ?   ? G  CYS 8  SG  ? ? ? 1_555 G  CYS 74  SG ? ? G CYS 8  G CYS 74  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf29  disulf ?   ? G  CYS 37 SG  ? ? ? 1_555 G  CYS 107 SG ? ? G CYS 37 G CYS 107 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf30  disulf ?   ? G  CYS 41 SG  ? ? ? 1_555 G  CYS 109 SG ? ? G CYS 41 G CYS 109 1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf31  disulf ?   ? G  CYS 73 SG  ? ? ? 1_555 H  CYS 73  SG ? ? G CYS 73 H CYS 73  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf32  disulf ?   ? H  CYS 8  SG  ? ? ? 1_555 H  CYS 74  SG ? ? H CYS 8  H CYS 74  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf33  disulf ?   ? H  CYS 37 SG  ? ? ? 1_555 H  CYS 107 SG ? ? H CYS 37 H CYS 107 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf34  disulf ?   ? H  CYS 41 SG  ? ? ? 1_555 H  CYS 109 SG ? ? H CYS 41 H CYS 109 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf35  disulf ?   ? I  CYS 15 SG  ? ? ? 1_555 I  CYS 32  SG ? ? I CYS 34 I CYS 51  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf36  disulf ?   ? I  CYS 17 SG  ? ? ? 1_555 I  CYS 22  SG ? ? I CYS 36 I CYS 41  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf37  disulf ?   ? I  CYS 27 SG  ? ? ? 1_555 I  CYS 50  SG ? ? I CYS 46 I CYS 69  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf38  disulf ?   ? I  CYS 58 SG  ? ? ? 1_555 I  CYS 70  SG ? ? I CYS 77 I CYS 89  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf39  disulf ?   ? I  CYS 71 SG  ? ? ? 1_555 I  CYS 76  SG ? ? I CYS 90 I CYS 95  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf40  disulf ?   ? J  CYS 15 SG  ? ? ? 1_555 J  CYS 32  SG ? ? J CYS 34 J CYS 51  1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf41  disulf ?   ? J  CYS 17 SG  ? ? ? 1_555 J  CYS 22  SG ? ? J CYS 36 J CYS 41  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf42  disulf ?   ? J  CYS 27 SG  ? ? ? 1_555 J  CYS 50  SG ? ? J CYS 46 J CYS 69  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf43  disulf ?   ? J  CYS 58 SG  ? ? ? 1_555 J  CYS 70  SG ? ? J CYS 77 J CYS 89  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf44  disulf ?   ? J  CYS 71 SG  ? ? ? 1_555 J  CYS 76  SG ? ? J CYS 90 J CYS 95  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf45  disulf ?   ? K  CYS 13 SG  ? ? ? 1_555 K  CYS 43  SG ? ? K CYS 11 K CYS 41  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf46  disulf ?   ? K  CYS 33 SG  ? ? ? 1_555 K  CYS 61  SG ? ? K CYS 31 K CYS 59  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf47  disulf ?   ? K  CYS 68 SG  ? ? ? 1_555 K  CYS 87  SG ? ? K CYS 66 K CYS 85  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf48  disulf ?   ? K  CYS 74 SG  ? ? ? 1_555 K  CYS 86  SG ? ? K CYS 72 K CYS 84  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf49  disulf ?   ? K  CYS 88 SG  ? ? ? 1_555 K  CYS 93  SG ? ? K CYS 86 K CYS 91  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf50  disulf ?   ? L  CYS 13 SG  ? ? ? 1_555 L  CYS 43  SG ? ? L CYS 11 L CYS 41  1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf51  disulf ?   ? L  CYS 33 SG  ? ? ? 1_555 L  CYS 61  SG ? ? L CYS 31 L CYS 59  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf52  disulf ?   ? L  CYS 68 SG  ? ? ? 1_555 L  CYS 87  SG ? ? L CYS 66 L CYS 85  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf53  disulf ?   ? L  CYS 74 SG  ? ? ? 1_555 L  CYS 86  SG ? ? L CYS 72 L CYS 84  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf54  disulf ?   ? L  CYS 88 SG  ? ? ? 1_555 L  CYS 93  SG ? ? L CYS 86 L CYS 91  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf55  disulf ?   ? M  CYS 8  SG  ? ? ? 1_555 M  CYS 74  SG ? ? M CYS 8  M CYS 74  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf56  disulf ?   ? M  CYS 37 SG  ? ? ? 1_555 M  CYS 107 SG ? ? M CYS 37 M CYS 107 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf57  disulf ?   ? M  CYS 41 SG  ? ? ? 1_555 M  CYS 109 SG ? ? M CYS 41 M CYS 109 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf58  disulf ?   ? M  CYS 73 SG  ? ? ? 1_555 N  CYS 73  SG ? ? M CYS 73 N CYS 73  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf59  disulf ?   ? N  CYS 8  SG  ? ? ? 1_555 N  CYS 74  SG ? ? N CYS 8  N CYS 74  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf60  disulf ?   ? N  CYS 37 SG  ? ? ? 1_555 N  CYS 107 SG ? ? N CYS 37 N CYS 107 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf61  disulf ?   ? N  CYS 41 SG  ? ? ? 1_555 N  CYS 109 SG ? ? N CYS 41 N CYS 109 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf62  disulf ?   ? O  CYS 15 SG  ? ? ? 1_555 O  CYS 32  SG ? ? O CYS 34 O CYS 51  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf63  disulf ?   ? O  CYS 17 SG  ? ? ? 1_555 O  CYS 22  SG ? ? O CYS 36 O CYS 41  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf64  disulf ?   ? O  CYS 27 SG  ? ? ? 1_555 O  CYS 50  SG ? ? O CYS 46 O CYS 69  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf65  disulf ?   ? O  CYS 58 SG  ? ? ? 1_555 O  CYS 70  SG ? ? O CYS 77 O CYS 89  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf66  disulf ?   ? O  CYS 71 SG  ? ? ? 1_555 O  CYS 76  SG ? ? O CYS 90 O CYS 95  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf67  disulf ?   ? P  CYS 15 SG  ? ? ? 1_555 P  CYS 32  SG ? ? P CYS 34 P CYS 51  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf68  disulf ?   ? P  CYS 17 SG  ? ? ? 1_555 P  CYS 22  SG ? ? P CYS 36 P CYS 41  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf69  disulf ?   ? P  CYS 27 SG  ? ? ? 1_555 P  CYS 50  SG ? ? P CYS 46 P CYS 69  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf70  disulf ?   ? P  CYS 58 SG  ? ? ? 1_555 P  CYS 70  SG ? ? P CYS 77 P CYS 89  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf71  disulf ?   ? P  CYS 71 SG  ? ? ? 1_555 P  CYS 76  SG ? ? P CYS 90 P CYS 95  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf72  disulf ?   ? Q  CYS 13 SG  ? ? ? 1_555 Q  CYS 43  SG ? ? Q CYS 11 Q CYS 41  1_555 ? ? ? ? ? ? ? 2.005 ? ?               
disulf73  disulf ?   ? Q  CYS 33 SG  ? ? ? 1_555 Q  CYS 61  SG ? ? Q CYS 31 Q CYS 59  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf74  disulf ?   ? Q  CYS 68 SG  ? ? ? 1_555 Q  CYS 87  SG ? ? Q CYS 66 Q CYS 85  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf75  disulf ?   ? Q  CYS 74 SG  ? ? ? 1_555 Q  CYS 86  SG ? ? Q CYS 72 Q CYS 84  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf76  disulf ?   ? Q  CYS 88 SG  ? ? ? 1_555 Q  CYS 93  SG ? ? Q CYS 86 Q CYS 91  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf77  disulf ?   ? R  CYS 13 SG  ? ? ? 1_555 R  CYS 43  SG ? ? R CYS 11 R CYS 41  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf78  disulf ?   ? R  CYS 33 SG  ? ? ? 1_555 R  CYS 61  SG ? ? R CYS 31 R CYS 59  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf79  disulf ?   ? R  CYS 68 SG  ? ? ? 1_555 R  CYS 87  SG ? ? R CYS 66 R CYS 85  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf80  disulf ?   ? R  CYS 74 SG  ? ? ? 1_555 R  CYS 86  SG ? ? R CYS 72 R CYS 84  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf81  disulf ?   ? R  CYS 88 SG  ? ? ? 1_555 R  CYS 93  SG ? ? R CYS 86 R CYS 91  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf82  disulf ?   ? S  CYS 8  SG  ? ? ? 1_555 S  CYS 74  SG ? ? S CYS 8  S CYS 74  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf83  disulf ?   ? S  CYS 37 SG  ? ? ? 1_555 S  CYS 107 SG ? ? S CYS 37 S CYS 107 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf84  disulf ?   ? S  CYS 41 SG  ? ? ? 1_555 S  CYS 109 SG ? ? S CYS 41 S CYS 109 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf85  disulf ?   ? S  CYS 73 SG  ? ? ? 1_555 T  CYS 73  SG ? ? S CYS 73 T CYS 73  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf86  disulf ?   ? T  CYS 8  SG  ? ? ? 1_555 T  CYS 74  SG ? ? T CYS 8  T CYS 74  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf87  disulf ?   ? T  CYS 37 SG  ? ? ? 1_555 T  CYS 107 SG ? ? T CYS 37 T CYS 107 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf88  disulf ?   ? T  CYS 41 SG  ? ? ? 1_555 T  CYS 109 SG ? ? T CYS 41 T CYS 109 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf89  disulf ?   ? U  CYS 15 SG  ? ? ? 1_555 U  CYS 32  SG ? ? U CYS 34 U CYS 51  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf90  disulf ?   ? U  CYS 17 SG  ? ? ? 1_555 U  CYS 22  SG ? ? U CYS 36 U CYS 41  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf91  disulf ?   ? U  CYS 27 SG  ? ? ? 1_555 U  CYS 50  SG ? ? U CYS 46 U CYS 69  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf92  disulf ?   ? U  CYS 58 SG  ? ? ? 1_555 U  CYS 70  SG ? ? U CYS 77 U CYS 89  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf93  disulf ?   ? U  CYS 71 SG  ? ? ? 1_555 U  CYS 76  SG ? ? U CYS 90 U CYS 95  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf94  disulf ?   ? V  CYS 15 SG  ? ? ? 1_555 V  CYS 32  SG ? ? V CYS 34 V CYS 51  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf95  disulf ?   ? V  CYS 17 SG  ? ? ? 1_555 V  CYS 22  SG ? ? V CYS 36 V CYS 41  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf96  disulf ?   ? V  CYS 27 SG  ? ? ? 1_555 V  CYS 50  SG ? ? V CYS 46 V CYS 69  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf97  disulf ?   ? V  CYS 58 SG  ? ? ? 1_555 V  CYS 70  SG ? ? V CYS 77 V CYS 89  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf98  disulf ?   ? V  CYS 71 SG  ? ? ? 1_555 V  CYS 76  SG ? ? V CYS 90 V CYS 95  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf99  disulf ?   ? W  CYS 13 SG  ? ? ? 1_555 W  CYS 43  SG ? ? W CYS 11 W CYS 41  1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf100 disulf ?   ? W  CYS 33 SG  ? ? ? 1_555 W  CYS 61  SG ? ? W CYS 31 W CYS 59  1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf101 disulf ?   ? W  CYS 68 SG  ? ? ? 1_555 W  CYS 87  SG ? ? W CYS 66 W CYS 85  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf102 disulf ?   ? W  CYS 74 SG  ? ? ? 1_555 W  CYS 86  SG ? ? W CYS 72 W CYS 84  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf103 disulf ?   ? W  CYS 88 SG  ? ? ? 1_555 W  CYS 93  SG ? ? W CYS 86 W CYS 91  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf104 disulf ?   ? X  CYS 13 SG  ? ? ? 1_555 X  CYS 43  SG ? ? X CYS 11 X CYS 41  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf105 disulf ?   ? X  CYS 33 SG  ? ? ? 1_555 X  CYS 61  SG ? ? X CYS 31 X CYS 59  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf106 disulf ?   ? X  CYS 68 SG  ? ? ? 1_555 X  CYS 87  SG ? ? X CYS 66 X CYS 85  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf107 disulf ?   ? X  CYS 74 SG  ? ? ? 1_555 X  CYS 86  SG ? ? X CYS 72 X CYS 84  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf108 disulf ?   ? X  CYS 88 SG  ? ? ? 1_555 X  CYS 93  SG ? ? X CYS 86 X CYS 91  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf109 disulf ?   ? Y  CYS 8  SG  ? ? ? 1_555 Y  CYS 74  SG ? ? a CYS 8  a CYS 74  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf110 disulf ?   ? Y  CYS 37 SG  ? ? ? 1_555 Y  CYS 107 SG ? ? a CYS 37 a CYS 107 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf111 disulf ?   ? Y  CYS 41 SG  ? ? ? 1_555 Y  CYS 109 SG ? ? a CYS 41 a CYS 109 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf112 disulf ?   ? Y  CYS 73 SG  ? ? ? 1_555 Z  CYS 73  SG ? ? a CYS 73 b CYS 73  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf113 disulf ?   ? Z  CYS 8  SG  ? ? ? 1_555 Z  CYS 74  SG ? ? b CYS 8  b CYS 74  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf114 disulf ?   ? Z  CYS 37 SG  ? ? ? 1_555 Z  CYS 107 SG ? ? b CYS 37 b CYS 107 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf115 disulf ?   ? Z  CYS 41 SG  ? ? ? 1_555 Z  CYS 109 SG ? ? b CYS 41 b CYS 109 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf116 disulf ?   ? AA CYS 15 SG  ? ? ? 1_555 AA CYS 32  SG ? ? c CYS 34 c CYS 51  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf117 disulf ?   ? AA CYS 17 SG  ? ? ? 1_555 AA CYS 22  SG ? ? c CYS 36 c CYS 41  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf118 disulf ?   ? AA CYS 27 SG  ? ? ? 1_555 AA CYS 50  SG ? ? c CYS 46 c CYS 69  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf119 disulf ?   ? AA CYS 58 SG  ? ? ? 1_555 AA CYS 70  SG ? ? c CYS 77 c CYS 89  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf120 disulf ?   ? AA CYS 71 SG  ? ? ? 1_555 AA CYS 76  SG ? ? c CYS 90 c CYS 95  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf121 disulf ?   ? BA CYS 15 SG  ? ? ? 1_555 BA CYS 32  SG ? ? d CYS 34 d CYS 51  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf122 disulf ?   ? BA CYS 17 SG  ? ? ? 1_555 BA CYS 22  SG ? ? d CYS 36 d CYS 41  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf123 disulf ?   ? BA CYS 27 SG  ? ? ? 1_555 BA CYS 50  SG ? ? d CYS 46 d CYS 69  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf124 disulf ?   ? BA CYS 58 SG  ? ? ? 1_555 BA CYS 70  SG ? ? d CYS 77 d CYS 89  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf125 disulf ?   ? BA CYS 71 SG  ? ? ? 1_555 BA CYS 76  SG ? ? d CYS 90 d CYS 95  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf126 disulf ?   ? CA CYS 13 SG  ? ? ? 1_555 CA CYS 43  SG ? ? e CYS 11 e CYS 41  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf127 disulf ?   ? CA CYS 33 SG  ? ? ? 1_555 CA CYS 61  SG ? ? e CYS 31 e CYS 59  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf128 disulf ?   ? CA CYS 68 SG  ? ? ? 1_555 CA CYS 87  SG ? ? e CYS 66 e CYS 85  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf129 disulf ?   ? CA CYS 74 SG  ? ? ? 1_555 CA CYS 86  SG ? ? e CYS 72 e CYS 84  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf130 disulf ?   ? CA CYS 88 SG  ? ? ? 1_555 CA CYS 93  SG ? ? e CYS 86 e CYS 91  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf131 disulf ?   ? DA CYS 13 SG  ? ? ? 1_555 DA CYS 43  SG ? ? f CYS 11 f CYS 41  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf132 disulf ?   ? DA CYS 33 SG  ? ? ? 1_555 DA CYS 61  SG ? ? f CYS 31 f CYS 59  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf133 disulf ?   ? DA CYS 68 SG  ? ? ? 1_555 DA CYS 87  SG ? ? f CYS 66 f CYS 85  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf134 disulf ?   ? DA CYS 74 SG  ? ? ? 1_555 DA CYS 86  SG ? ? f CYS 72 f CYS 84  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf135 disulf ?   ? DA CYS 88 SG  ? ? ? 1_555 DA CYS 93  SG ? ? f CYS 86 f CYS 91  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf136 disulf ?   ? EA CYS 8  SG  ? ? ? 1_555 EA CYS 74  SG ? ? g CYS 8  g CYS 74  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf137 disulf ?   ? EA CYS 37 SG  ? ? ? 1_555 EA CYS 107 SG ? ? g CYS 37 g CYS 107 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf138 disulf ?   ? EA CYS 41 SG  ? ? ? 1_555 EA CYS 109 SG ? ? g CYS 41 g CYS 109 1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf139 disulf ?   ? EA CYS 73 SG  ? ? ? 1_555 FA CYS 73  SG ? ? g CYS 73 h CYS 73  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf140 disulf ?   ? FA CYS 8  SG  ? ? ? 1_555 FA CYS 74  SG ? ? h CYS 8  h CYS 74  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf141 disulf ?   ? FA CYS 37 SG  ? ? ? 1_555 FA CYS 107 SG ? ? h CYS 37 h CYS 107 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf142 disulf ?   ? FA CYS 41 SG  ? ? ? 1_555 FA CYS 109 SG ? ? h CYS 41 h CYS 109 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf143 disulf ?   ? GA CYS 15 SG  ? ? ? 1_555 GA CYS 32  SG ? ? i CYS 34 i CYS 51  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf144 disulf ?   ? GA CYS 17 SG  ? ? ? 1_555 GA CYS 22  SG ? ? i CYS 36 i CYS 41  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf145 disulf ?   ? GA CYS 27 SG  ? ? ? 1_555 GA CYS 50  SG ? ? i CYS 46 i CYS 69  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf146 disulf ?   ? GA CYS 58 SG  ? ? ? 1_555 GA CYS 70  SG ? ? i CYS 77 i CYS 89  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf147 disulf ?   ? GA CYS 71 SG  ? ? ? 1_555 GA CYS 76  SG ? ? i CYS 90 i CYS 95  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf148 disulf ?   ? HA CYS 15 SG  ? ? ? 1_555 HA CYS 32  SG ? ? j CYS 34 j CYS 51  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf149 disulf ?   ? HA CYS 17 SG  ? ? ? 1_555 HA CYS 22  SG ? ? j CYS 36 j CYS 41  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf150 disulf ?   ? HA CYS 27 SG  ? ? ? 1_555 HA CYS 50  SG ? ? j CYS 46 j CYS 69  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf151 disulf ?   ? HA CYS 58 SG  ? ? ? 1_555 HA CYS 70  SG ? ? j CYS 77 j CYS 89  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf152 disulf ?   ? HA CYS 71 SG  ? ? ? 1_555 HA CYS 76  SG ? ? j CYS 90 j CYS 95  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf153 disulf ?   ? IA CYS 13 SG  ? ? ? 1_555 IA CYS 43  SG ? ? k CYS 11 k CYS 41  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf154 disulf ?   ? IA CYS 33 SG  ? ? ? 1_555 IA CYS 61  SG ? ? k CYS 31 k CYS 59  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf155 disulf ?   ? IA CYS 68 SG  ? ? ? 1_555 IA CYS 87  SG ? ? k CYS 66 k CYS 85  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf156 disulf ?   ? IA CYS 74 SG  ? ? ? 1_555 IA CYS 86  SG ? ? k CYS 72 k CYS 84  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf157 disulf ?   ? IA CYS 88 SG  ? ? ? 1_555 IA CYS 93  SG ? ? k CYS 86 k CYS 91  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf158 disulf ?   ? JA CYS 13 SG  ? ? ? 1_555 JA CYS 43  SG ? ? l CYS 11 l CYS 41  1_555 ? ? ? ? ? ? ? 2.016 ? ?               
disulf159 disulf ?   ? JA CYS 33 SG  ? ? ? 1_555 JA CYS 61  SG ? ? l CYS 31 l CYS 59  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf160 disulf ?   ? JA CYS 68 SG  ? ? ? 1_555 JA CYS 87  SG ? ? l CYS 66 l CYS 85  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf161 disulf ?   ? JA CYS 74 SG  ? ? ? 1_555 JA CYS 86  SG ? ? l CYS 72 l CYS 84  1_555 ? ? ? ? ? ? ? 2.017 ? ?               
disulf162 disulf ?   ? JA CYS 88 SG  ? ? ? 1_555 JA CYS 93  SG ? ? l CYS 86 l CYS 91  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1   covale one ? E  ASN 26 ND2 ? ? ? 1_555 KA NAG .   C1 ? ? E ASN 24 E NAG 201 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale2   covale one ? E  ASN 49 ND2 ? ? ? 1_555 LA NAG .   C1 ? ? E ASN 47 E NAG 202 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale3   covale one ? F  ASN 26 ND2 ? ? ? 1_555 MA NAG .   C1 ? ? F ASN 24 F NAG 201 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale4   covale one ? F  ASN 49 ND2 ? ? ? 1_555 NA NAG .   C1 ? ? F ASN 47 F NAG 202 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale5   covale one ? K  ASN 26 ND2 ? ? ? 1_555 PA NAG .   C1 ? ? K ASN 24 K NAG 201 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale6   covale one ? K  ASN 49 ND2 ? ? ? 1_555 QA NAG .   C1 ? ? K ASN 47 K NAG 202 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale7   covale one ? L  ASN 26 ND2 ? ? ? 1_555 SA NAG .   C1 ? ? L ASN 24 L NAG 201 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale8   covale one ? L  ASN 49 ND2 ? ? ? 1_555 TA NAG .   C1 ? ? L ASN 47 L NAG 202 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale9   covale one ? Q  ASN 26 ND2 ? ? ? 1_555 UA NAG .   C1 ? ? Q ASN 24 Q NAG 201 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale10  covale one ? Q  ASN 49 ND2 ? ? ? 1_555 VA NAG .   C1 ? ? Q ASN 47 Q NAG 202 1_555 ? ? ? ? ? ? ? 1.470 ? N-Glycosylation 
covale11  covale one ? R  ASN 26 ND2 ? ? ? 1_555 WA NAG .   C1 ? ? R ASN 24 R NAG 201 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale12  covale one ? R  ASN 49 ND2 ? ? ? 1_555 XA NAG .   C1 ? ? R ASN 47 R NAG 202 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale13  covale one ? W  ASN 26 ND2 ? ? ? 1_555 ZA NAG .   C1 ? ? W ASN 24 W NAG 201 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale14  covale one ? W  ASN 49 ND2 ? ? ? 1_555 AB NAG .   C1 ? ? W ASN 47 W NAG 202 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale15  covale one ? X  ASN 26 ND2 ? ? ? 1_555 BB NAG .   C1 ? ? X ASN 24 X NAG 201 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale16  covale one ? X  ASN 49 ND2 ? ? ? 1_555 CB NAG .   C1 ? ? X ASN 47 X NAG 202 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale17  covale one ? CA ASN 26 ND2 ? ? ? 1_555 EB NAG .   C1 ? ? e ASN 24 e NAG 201 1_555 ? ? ? ? ? ? ? 1.431 ? N-Glycosylation 
covale18  covale one ? CA ASN 49 ND2 ? ? ? 1_555 FB NAG .   C1 ? ? e ASN 47 e NAG 202 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale19  covale one ? DA ASN 26 ND2 ? ? ? 1_555 HB NAG .   C1 ? ? f ASN 24 f NAG 201 1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale20  covale one ? DA ASN 49 ND2 ? ? ? 1_555 IB NAG .   C1 ? ? f ASN 47 f NAG 202 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale21  covale one ? IA ASN 26 ND2 ? ? ? 1_555 JB NAG .   C1 ? ? k ASN 24 k NAG 201 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale22  covale one ? IA ASN 49 ND2 ? ? ? 1_555 KB NAG .   C1 ? ? k ASN 47 k NAG 202 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale23  covale one ? JA ASN 26 ND2 ? ? ? 1_555 MB NAG .   C1 ? ? l ASN 24 l NAG 201 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale24  covale one ? JA ASN 49 ND2 ? ? ? 1_555 NB NAG .   C1 ? ? l ASN 47 l NAG 202 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 28 A  . ? ALA 28 A PRO 29 A  ? PRO 29 A 1 0.80  
2  PHE 43 A  . ? PHE 43 A PRO 44 A  ? PRO 44 A 1 -0.25 
3  ALA 28 B  . ? ALA 28 B PRO 29 B  ? PRO 29 B 1 -0.33 
4  PHE 43 B  . ? PHE 43 B PRO 44 B  ? PRO 44 B 1 -0.25 
5  ALA 28 G  . ? ALA 28 G PRO 29 G  ? PRO 29 G 1 -1.19 
6  PHE 43 G  . ? PHE 43 G PRO 44 G  ? PRO 44 G 1 -0.57 
7  ALA 28 H  . ? ALA 28 H PRO 29 H  ? PRO 29 H 1 0.49  
8  PHE 43 H  . ? PHE 43 H PRO 44 H  ? PRO 44 H 1 -2.03 
9  ALA 28 M  . ? ALA 28 M PRO 29 M  ? PRO 29 M 1 1.78  
10 PHE 43 M  . ? PHE 43 M PRO 44 M  ? PRO 44 M 1 -1.98 
11 ALA 28 N  . ? ALA 28 N PRO 29 N  ? PRO 29 N 1 0.71  
12 PHE 43 N  . ? PHE 43 N PRO 44 N  ? PRO 44 N 1 -0.13 
13 ALA 28 S  . ? ALA 28 S PRO 29 S  ? PRO 29 S 1 0.15  
14 PHE 43 S  . ? PHE 43 S PRO 44 S  ? PRO 44 S 1 -0.33 
15 ALA 28 T  . ? ALA 28 T PRO 29 T  ? PRO 29 T 1 0.38  
16 PHE 43 T  . ? PHE 43 T PRO 44 T  ? PRO 44 T 1 -1.39 
17 ALA 28 Y  . ? ALA 28 a PRO 29 Y  ? PRO 29 a 1 0.43  
18 PHE 43 Y  . ? PHE 43 a PRO 44 Y  ? PRO 44 a 1 -1.37 
19 ALA 28 Z  . ? ALA 28 b PRO 29 Z  ? PRO 29 b 1 -1.17 
20 PHE 43 Z  . ? PHE 43 b PRO 44 Z  ? PRO 44 b 1 -0.82 
21 ALA 28 EA . ? ALA 28 g PRO 29 EA ? PRO 29 g 1 -1.20 
22 PHE 43 EA . ? PHE 43 g PRO 44 EA ? PRO 44 g 1 -0.65 
23 ALA 28 FA . ? ALA 28 h PRO 29 FA ? PRO 29 h 1 1.00  
24 PHE 43 FA . ? PHE 43 h PRO 44 FA ? PRO 44 h 1 0.58  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 3 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 2 ? 
F  ? 3 ? 
G  ? 2 ? 
H  ? 3 ? 
I  ? 5 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 2 ? 
P  ? 3 ? 
Q  ? 2 ? 
R  ? 3 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 5 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 3 ? 
AC ? 2 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 3 ? 
AG ? 5 ? 
AH ? 2 ? 
AI ? 5 ? 
AJ ? 2 ? 
AK ? 2 ? 
AL ? 3 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 2 ? 
AR ? 3 ? 
AS ? 5 ? 
AT ? 2 ? 
AU ? 5 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 3 ? 
AY ? 2 ? 
AZ ? 3 ? 
BA ? 2 ? 
BB ? 3 ? 
BC ? 2 ? 
BD ? 3 ? 
BE ? 5 ? 
BF ? 2 ? 
BG ? 5 ? 
BH ? 2 ? 
BI ? 2 ? 
BJ ? 3 ? 
BK ? 2 ? 
BL ? 3 ? 
BM ? 2 ? 
BN ? 3 ? 
BO ? 2 ? 
BP ? 3 ? 
BQ ? 5 ? 
BR ? 2 ? 
BS ? 5 ? 
BT ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
J  1 2 ? parallel      
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? parallel      
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
V  1 2 ? parallel      
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? parallel      
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? parallel      
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AJ 1 2 ? parallel      
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AV 1 2 ? parallel      
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? parallel      
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BH 1 2 ? parallel      
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BM 1 2 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BR 1 2 ? parallel      
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BS 3 4 ? anti-parallel 
BS 4 5 ? anti-parallel 
BT 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLN A  9  ? ASN A  16  ? GLN A 9  ASN A 16  
A  2 GLU A  31 ? LYS A  38  ? GLU A 31 LYS A 38  
B  1 ILE A  26 ? ALA A  28  ? ILE A 26 ALA A 28  
B  2 CYS A  74 ? LYS A  87  ? CYS A 74 LYS A 87  
B  3 PRO A  93 ? CYS A  109 ? PRO A 93 CYS A 109 
C  1 CYS B  8  ? ASN B  16  ? CYS B 8  ASN B 16  
C  2 GLU B  31 ? GLY B  39  ? GLU B 31 GLY B 39  
D  1 ILE B  26 ? ALA B  28  ? ILE B 26 ALA B 28  
D  2 CYS B  74 ? LYS B  87  ? CYS B 74 LYS B 87  
D  3 PRO B  93 ? CYS B  109 ? PRO B 93 CYS B 109 
E  1 VAL C  13 ? THR C  16  ? VAL C 32 THR C 35  
E  2 THR C  26 ? GLY C  29  ? THR C 45 GLY C 48  
F  1 GLN C  45 ? GLY C  49  ? GLN C 64 GLY C 68  
F  2 CYS C  32 ? VAL C  37  ? CYS C 51 VAL C 56  
F  3 VAL C  66 ? CYS C  71  ? VAL C 85 CYS C 90  
G  1 VAL D  13 ? THR D  16  ? VAL D 32 THR D 35  
G  2 THR D  26 ? GLY D  29  ? THR D 45 GLY D 48  
H  1 GLN D  45 ? GLY D  49  ? GLN D 64 GLY D 68  
H  2 CYS D  32 ? VAL D  37  ? CYS D 51 VAL D 56  
H  3 VAL D  66 ? CYS D  71  ? VAL D 85 CYS D 90  
I  1 SER E  28 ? ARG E  32  ? SER E 26 ARG E 30  
I  2 GLU E  12 ? ASN E  17  ? GLU E 10 ASN E 15  
I  3 THR E  53 ? LEU E  63  ? THR E 51 LEU E 61  
I  4 LEU E  41 ? SER E  50  ? LEU E 39 SER E 48  
I  5 VAL E  83 ? CYS E  88  ? VAL E 81 CYS E 86  
J  1 CYS E  74 ? ALA E  76  ? CYS E 72 ALA E 74  
J  2 PHE E  97 ? HIS E  99  ? PHE E 95 HIS E 97  
K  1 SER F  28 ? ARG F  32  ? SER F 26 ARG F 30  
K  2 GLU F  12 ? ASN F  17  ? GLU F 10 ASN F 15  
K  3 THR F  53 ? LEU F  63  ? THR F 51 LEU F 61  
K  4 LEU F  41 ? SER F  50  ? LEU F 39 SER F 48  
K  5 VAL F  83 ? CYS F  88  ? VAL F 81 CYS F 86  
L  1 CYS F  74 ? ALA F  76  ? CYS F 72 ALA F 74  
L  2 PHE F  97 ? HIS F  99  ? PHE F 95 HIS F 97  
M  1 CYS G  8  ? ASN G  16  ? CYS G 8  ASN G 16  
M  2 GLU G  31 ? GLY G  39  ? GLU G 31 GLY G 39  
N  1 ILE G  26 ? ALA G  28  ? ILE G 26 ALA G 28  
N  2 CYS G  74 ? LYS G  87  ? CYS G 74 LYS G 87  
N  3 PRO G  93 ? CYS G  109 ? PRO G 93 CYS G 109 
O  1 CYS H  8  ? ASN H  16  ? CYS H 8  ASN H 16  
O  2 GLU H  31 ? GLY H  39  ? GLU H 31 GLY H 39  
P  1 ILE H  26 ? ALA H  28  ? ILE H 26 ALA H 28  
P  2 CYS H  74 ? LYS H  87  ? CYS H 74 LYS H 87  
P  3 PRO H  93 ? CYS H  109 ? PRO H 93 CYS H 109 
Q  1 VAL I  13 ? THR I  16  ? VAL I 32 THR I 35  
Q  2 THR I  26 ? GLY I  29  ? THR I 45 GLY I 48  
R  1 GLN I  45 ? GLY I  49  ? GLN I 64 GLY I 68  
R  2 CYS I  32 ? VAL I  37  ? CYS I 51 VAL I 56  
R  3 VAL I  66 ? CYS I  71  ? VAL I 85 CYS I 90  
S  1 VAL J  13 ? THR J  16  ? VAL J 32 THR J 35  
S  2 THR J  26 ? GLY J  29  ? THR J 45 GLY J 48  
T  1 GLN J  45 ? GLY J  49  ? GLN J 64 GLY J 68  
T  2 CYS J  32 ? VAL J  37  ? CYS J 51 VAL J 56  
T  3 VAL J  66 ? CYS J  71  ? VAL J 85 CYS J 90  
U  1 SER K  28 ? ARG K  32  ? SER K 26 ARG K 30  
U  2 GLU K  12 ? ASN K  17  ? GLU K 10 ASN K 15  
U  3 THR K  53 ? LEU K  63  ? THR K 51 LEU K 61  
U  4 LEU K  41 ? SER K  50  ? LEU K 39 SER K 48  
U  5 VAL K  83 ? CYS K  88  ? VAL K 81 CYS K 86  
V  1 CYS K  74 ? ALA K  76  ? CYS K 72 ALA K 74  
V  2 PHE K  97 ? HIS K  99  ? PHE K 95 HIS K 97  
W  1 SER L  28 ? ARG L  32  ? SER L 26 ARG L 30  
W  2 GLU L  12 ? ASN L  17  ? GLU L 10 ASN L 15  
W  3 THR L  53 ? LEU L  63  ? THR L 51 LEU L 61  
W  4 LEU L  41 ? SER L  50  ? LEU L 39 SER L 48  
W  5 VAL L  83 ? CYS L  88  ? VAL L 81 CYS L 86  
X  1 CYS L  74 ? ALA L  76  ? CYS L 72 ALA L 74  
X  2 PHE L  97 ? HIS L  99  ? PHE L 95 HIS L 97  
Y  1 GLN M  9  ? ASN M  16  ? GLN M 9  ASN M 16  
Y  2 GLU M  31 ? LYS M  38  ? GLU M 31 LYS M 38  
Z  1 ILE M  26 ? ALA M  28  ? ILE M 26 ALA M 28  
Z  2 CYS M  74 ? LYS M  87  ? CYS M 74 LYS M 87  
Z  3 PRO M  93 ? CYS M  109 ? PRO M 93 CYS M 109 
AA 1 GLN N  9  ? ASN N  16  ? GLN N 9  ASN N 16  
AA 2 GLU N  31 ? LYS N  38  ? GLU N 31 LYS N 38  
AB 1 ILE N  26 ? ALA N  28  ? ILE N 26 ALA N 28  
AB 2 CYS N  74 ? LYS N  87  ? CYS N 74 LYS N 87  
AB 3 PRO N  93 ? CYS N  109 ? PRO N 93 CYS N 109 
AC 1 VAL O  13 ? THR O  16  ? VAL O 32 THR O 35  
AC 2 THR O  26 ? GLY O  29  ? THR O 45 GLY O 48  
AD 1 GLN O  45 ? GLY O  49  ? GLN O 64 GLY O 68  
AD 2 CYS O  32 ? VAL O  37  ? CYS O 51 VAL O 56  
AD 3 VAL O  66 ? CYS O  71  ? VAL O 85 CYS O 90  
AE 1 VAL P  13 ? THR P  16  ? VAL P 32 THR P 35  
AE 2 THR P  26 ? GLY P  29  ? THR P 45 GLY P 48  
AF 1 GLN P  45 ? GLY P  49  ? GLN P 64 GLY P 68  
AF 2 CYS P  32 ? VAL P  37  ? CYS P 51 VAL P 56  
AF 3 VAL P  66 ? CYS P  71  ? VAL P 85 CYS P 90  
AG 1 SER Q  28 ? ARG Q  32  ? SER Q 26 ARG Q 30  
AG 2 GLU Q  12 ? ASN Q  17  ? GLU Q 10 ASN Q 15  
AG 3 THR Q  53 ? LEU Q  63  ? THR Q 51 LEU Q 61  
AG 4 LEU Q  41 ? SER Q  50  ? LEU Q 39 SER Q 48  
AG 5 VAL Q  83 ? CYS Q  88  ? VAL Q 81 CYS Q 86  
AH 1 CYS Q  74 ? ALA Q  76  ? CYS Q 72 ALA Q 74  
AH 2 PHE Q  97 ? HIS Q  99  ? PHE Q 95 HIS Q 97  
AI 1 SER R  28 ? ARG R  32  ? SER R 26 ARG R 30  
AI 2 GLU R  12 ? ASN R  17  ? GLU R 10 ASN R 15  
AI 3 THR R  53 ? LEU R  63  ? THR R 51 LEU R 61  
AI 4 LEU R  41 ? SER R  50  ? LEU R 39 SER R 48  
AI 5 VAL R  83 ? CYS R  88  ? VAL R 81 CYS R 86  
AJ 1 CYS R  74 ? ALA R  76  ? CYS R 72 ALA R 74  
AJ 2 PHE R  97 ? HIS R  99  ? PHE R 95 HIS R 97  
AK 1 GLN S  9  ? ASN S  16  ? GLN S 9  ASN S 16  
AK 2 GLU S  31 ? LYS S  38  ? GLU S 31 LYS S 38  
AL 1 ILE S  26 ? ALA S  28  ? ILE S 26 ALA S 28  
AL 2 CYS S  74 ? LYS S  87  ? CYS S 74 LYS S 87  
AL 3 PRO S  93 ? CYS S  109 ? PRO S 93 CYS S 109 
AM 1 CYS T  8  ? ASN T  16  ? CYS T 8  ASN T 16  
AM 2 GLU T  31 ? GLY T  39  ? GLU T 31 GLY T 39  
AN 1 ILE T  26 ? ALA T  28  ? ILE T 26 ALA T 28  
AN 2 CYS T  74 ? LYS T  87  ? CYS T 74 LYS T 87  
AN 3 PRO T  93 ? CYS T  109 ? PRO T 93 CYS T 109 
AO 1 VAL U  13 ? THR U  16  ? VAL U 32 THR U 35  
AO 2 THR U  26 ? GLY U  29  ? THR U 45 GLY U 48  
AP 1 GLN U  45 ? GLY U  49  ? GLN U 64 GLY U 68  
AP 2 CYS U  32 ? VAL U  37  ? CYS U 51 VAL U 56  
AP 3 VAL U  66 ? CYS U  71  ? VAL U 85 CYS U 90  
AQ 1 VAL V  13 ? THR V  16  ? VAL V 32 THR V 35  
AQ 2 THR V  26 ? GLY V  29  ? THR V 45 GLY V 48  
AR 1 GLN V  45 ? GLY V  49  ? GLN V 64 GLY V 68  
AR 2 CYS V  32 ? VAL V  37  ? CYS V 51 VAL V 56  
AR 3 VAL V  66 ? CYS V  71  ? VAL V 85 CYS V 90  
AS 1 SER W  28 ? ARG W  32  ? SER W 26 ARG W 30  
AS 2 GLU W  12 ? ASN W  17  ? GLU W 10 ASN W 15  
AS 3 THR W  53 ? LEU W  63  ? THR W 51 LEU W 61  
AS 4 LEU W  41 ? SER W  50  ? LEU W 39 SER W 48  
AS 5 VAL W  83 ? CYS W  88  ? VAL W 81 CYS W 86  
AT 1 CYS W  74 ? ALA W  76  ? CYS W 72 ALA W 74  
AT 2 PHE W  97 ? HIS W  99  ? PHE W 95 HIS W 97  
AU 1 SER X  28 ? ARG X  32  ? SER X 26 ARG X 30  
AU 2 GLU X  12 ? ASN X  17  ? GLU X 10 ASN X 15  
AU 3 THR X  53 ? LEU X  63  ? THR X 51 LEU X 61  
AU 4 LEU X  41 ? SER X  50  ? LEU X 39 SER X 48  
AU 5 VAL X  83 ? CYS X  88  ? VAL X 81 CYS X 86  
AV 1 CYS X  74 ? ALA X  76  ? CYS X 72 ALA X 74  
AV 2 PHE X  97 ? HIS X  99  ? PHE X 95 HIS X 97  
AW 1 CYS Y  8  ? ASN Y  16  ? CYS a 8  ASN a 16  
AW 2 GLU Y  31 ? GLY Y  39  ? GLU a 31 GLY a 39  
AX 1 ILE Y  26 ? ALA Y  28  ? ILE a 26 ALA a 28  
AX 2 CYS Y  74 ? LYS Y  87  ? CYS a 74 LYS a 87  
AX 3 PRO Y  93 ? CYS Y  109 ? PRO a 93 CYS a 109 
AY 1 GLN Z  9  ? ASN Z  16  ? GLN b 9  ASN b 16  
AY 2 GLU Z  31 ? LYS Z  38  ? GLU b 31 LYS b 38  
AZ 1 ILE Z  26 ? ALA Z  28  ? ILE b 26 ALA b 28  
AZ 2 CYS Z  74 ? LYS Z  87  ? CYS b 74 LYS b 87  
AZ 3 PRO Z  93 ? CYS Z  109 ? PRO b 93 CYS b 109 
BA 1 VAL AA 13 ? THR AA 16  ? VAL c 32 THR c 35  
BA 2 THR AA 26 ? GLY AA 29  ? THR c 45 GLY c 48  
BB 1 GLN AA 45 ? GLY AA 49  ? GLN c 64 GLY c 68  
BB 2 CYS AA 32 ? VAL AA 37  ? CYS c 51 VAL c 56  
BB 3 VAL AA 66 ? CYS AA 71  ? VAL c 85 CYS c 90  
BC 1 VAL BA 13 ? THR BA 16  ? VAL d 32 THR d 35  
BC 2 THR BA 26 ? GLY BA 29  ? THR d 45 GLY d 48  
BD 1 GLN BA 45 ? GLY BA 49  ? GLN d 64 GLY d 68  
BD 2 CYS BA 32 ? VAL BA 37  ? CYS d 51 VAL d 56  
BD 3 VAL BA 66 ? CYS BA 71  ? VAL d 85 CYS d 90  
BE 1 SER CA 28 ? ARG CA 32  ? SER e 26 ARG e 30  
BE 2 GLU CA 12 ? ASN CA 17  ? GLU e 10 ASN e 15  
BE 3 THR CA 53 ? LEU CA 63  ? THR e 51 LEU e 61  
BE 4 LEU CA 41 ? SER CA 50  ? LEU e 39 SER e 48  
BE 5 VAL CA 83 ? CYS CA 88  ? VAL e 81 CYS e 86  
BF 1 CYS CA 74 ? ALA CA 76  ? CYS e 72 ALA e 74  
BF 2 PHE CA 97 ? HIS CA 99  ? PHE e 95 HIS e 97  
BG 1 SER DA 28 ? ARG DA 32  ? SER f 26 ARG f 30  
BG 2 GLU DA 12 ? ASN DA 17  ? GLU f 10 ASN f 15  
BG 3 THR DA 53 ? LEU DA 63  ? THR f 51 LEU f 61  
BG 4 LEU DA 41 ? SER DA 50  ? LEU f 39 SER f 48  
BG 5 VAL DA 83 ? CYS DA 88  ? VAL f 81 CYS f 86  
BH 1 CYS DA 74 ? ALA DA 76  ? CYS f 72 ALA f 74  
BH 2 PHE DA 97 ? HIS DA 99  ? PHE f 95 HIS f 97  
BI 1 GLN EA 9  ? ASN EA 16  ? GLN g 9  ASN g 16  
BI 2 GLU EA 31 ? LYS EA 38  ? GLU g 31 LYS g 38  
BJ 1 ILE EA 26 ? ALA EA 28  ? ILE g 26 ALA g 28  
BJ 2 CYS EA 74 ? LYS EA 87  ? CYS g 74 LYS g 87  
BJ 3 PRO EA 93 ? CYS EA 109 ? PRO g 93 CYS g 109 
BK 1 CYS FA 8  ? ASN FA 16  ? CYS h 8  ASN h 16  
BK 2 GLU FA 31 ? GLY FA 39  ? GLU h 31 GLY h 39  
BL 1 ILE FA 26 ? ALA FA 28  ? ILE h 26 ALA h 28  
BL 2 CYS FA 74 ? LYS FA 87  ? CYS h 74 LYS h 87  
BL 3 PRO FA 93 ? CYS FA 109 ? PRO h 93 CYS h 109 
BM 1 VAL GA 13 ? THR GA 16  ? VAL i 32 THR i 35  
BM 2 THR GA 26 ? GLY GA 29  ? THR i 45 GLY i 48  
BN 1 GLN GA 45 ? GLY GA 49  ? GLN i 64 GLY i 68  
BN 2 CYS GA 32 ? VAL GA 37  ? CYS i 51 VAL i 56  
BN 3 VAL GA 66 ? CYS GA 71  ? VAL i 85 CYS i 90  
BO 1 VAL HA 13 ? THR HA 16  ? VAL j 32 THR j 35  
BO 2 THR HA 26 ? GLY HA 29  ? THR j 45 GLY j 48  
BP 1 GLN HA 45 ? GLY HA 49  ? GLN j 64 GLY j 68  
BP 2 CYS HA 32 ? VAL HA 37  ? CYS j 51 VAL j 56  
BP 3 VAL HA 66 ? CYS HA 71  ? VAL j 85 CYS j 90  
BQ 1 SER IA 28 ? ARG IA 32  ? SER k 26 ARG k 30  
BQ 2 GLU IA 12 ? ASN IA 17  ? GLU k 10 ASN k 15  
BQ 3 THR IA 53 ? LEU IA 63  ? THR k 51 LEU k 61  
BQ 4 LEU IA 41 ? SER IA 50  ? LEU k 39 SER k 48  
BQ 5 VAL IA 83 ? CYS IA 88  ? VAL k 81 CYS k 86  
BR 1 CYS IA 74 ? ALA IA 76  ? CYS k 72 ALA k 74  
BR 2 PHE IA 97 ? HIS IA 99  ? PHE k 95 HIS k 97  
BS 1 SER JA 28 ? ARG JA 32  ? SER l 26 ARG l 30  
BS 2 GLU JA 12 ? ASN JA 17  ? GLU l 10 ASN l 15  
BS 3 THR JA 53 ? LEU JA 63  ? THR l 51 LEU l 61  
BS 4 LEU JA 41 ? SER JA 50  ? LEU l 39 SER l 48  
BS 5 VAL JA 83 ? CYS JA 88  ? VAL l 81 CYS l 86  
BT 1 CYS JA 74 ? ALA JA 76  ? CYS l 72 ALA l 74  
BT 2 PHE JA 97 ? HIS JA 99  ? PHE l 95 HIS l 97  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N GLN A  9  ? N GLN A 9  O LYS A  38  ? O LYS A 38  
B  1 2 N ILE A  27 ? N ILE A 27 O LEU A  85  ? O LEU A 85  
B  2 3 N LYS A  78 ? N LYS A 78 O ALA A  105 ? O ALA A 105 
C  1 2 N GLN B  9  ? N GLN B 9  O LYS B  38  ? O LYS B 38  
D  1 2 N ILE B  27 ? N ILE B 27 O LEU B  85  ? O LEU B 85  
D  2 3 N LYS B  78 ? N LYS B 78 O ALA B  105 ? O ALA B 105 
E  1 2 N CYS C  15 ? N CYS C 34 O CYS C  27  ? O CYS C 46  
F  1 2 O GLN C  45 ? O GLN C 64 N VAL C  37  ? N VAL C 56  
F  2 3 N CYS C  32 ? N CYS C 51 O CYS C  71  ? O CYS C 90  
G  1 2 N CYS D  15 ? N CYS D 34 O CYS D  27  ? O CYS D 46  
H  1 2 O GLN D  45 ? O GLN D 64 N VAL D  37  ? N VAL D 56  
H  2 3 N CYS D  32 ? N CYS D 51 O CYS D  71  ? O CYS D 90  
I  1 2 O GLU E  31 ? O GLU E 29 N CYS E  13  ? N CYS E 11  
I  2 3 N TYR E  16 ? N TYR E 14 O LYS E  59  ? O LYS E 57  
I  3 4 O GLU E  55 ? O GLU E 53 N ARG E  48  ? N ARG E 46  
I  4 5 N TRP E  47 ? N TRP E 45 O TYR E  84  ? O TYR E 82  
J  1 2 N ALA E  76 ? N ALA E 74 O THR E  98  ? O THR E 96  
K  1 2 O GLY F  29 ? O GLY F 27 N TYR F  15  ? N TYR F 13  
K  2 3 N TYR F  16 ? N TYR F 14 O LYS F  59  ? O LYS F 57  
K  3 4 O GLU F  55 ? O GLU F 53 N ARG F  48  ? N ARG F 46  
K  4 5 N TRP F  47 ? N TRP F 45 O TYR F  84  ? O TYR F 82  
L  1 2 N ALA F  76 ? N ALA F 74 O THR F  98  ? O THR F 96  
M  1 2 N GLN G  9  ? N GLN G 9  O LYS G  38  ? O LYS G 38  
N  1 2 N ILE G  27 ? N ILE G 27 O LEU G  85  ? O LEU G 85  
N  2 3 N LYS G  78 ? N LYS G 78 O ALA G  105 ? O ALA G 105 
O  1 2 N GLN H  9  ? N GLN H 9  O LYS H  38  ? O LYS H 38  
P  1 2 N ILE H  27 ? N ILE H 27 O LEU H  85  ? O LEU H 85  
P  2 3 N LYS H  78 ? N LYS H 78 O ALA H  105 ? O ALA H 105 
Q  1 2 N CYS I  15 ? N CYS I 34 O CYS I  27  ? O CYS I 46  
R  1 2 O GLN I  45 ? O GLN I 64 N VAL I  37  ? N VAL I 56  
R  2 3 N CYS I  32 ? N CYS I 51 O CYS I  71  ? O CYS I 90  
S  1 2 N CYS J  15 ? N CYS J 34 O CYS J  27  ? O CYS J 46  
T  1 2 O GLN J  45 ? O GLN J 64 N VAL J  37  ? N VAL J 56  
T  2 3 N CYS J  32 ? N CYS J 51 O CYS J  71  ? O CYS J 90  
U  1 2 O GLY K  29 ? O GLY K 27 N TYR K  15  ? N TYR K 13  
U  2 3 N TYR K  16 ? N TYR K 14 O LYS K  59  ? O LYS K 57  
U  3 4 O GLU K  55 ? O GLU K 53 N ARG K  48  ? N ARG K 46  
U  4 5 N TRP K  47 ? N TRP K 45 O TYR K  84  ? O TYR K 82  
V  1 2 N ALA K  76 ? N ALA K 74 O THR K  98  ? O THR K 96  
W  1 2 O GLY L  29 ? O GLY L 27 N TYR L  15  ? N TYR L 13  
W  2 3 N TYR L  16 ? N TYR L 14 O LYS L  59  ? O LYS L 57  
W  3 4 O GLU L  55 ? O GLU L 53 N ARG L  48  ? N ARG L 46  
W  4 5 N TRP L  47 ? N TRP L 45 O TYR L  84  ? O TYR L 82  
X  1 2 N ALA L  76 ? N ALA L 74 O THR L  98  ? O THR L 96  
Y  1 2 N GLN M  9  ? N GLN M 9  O LYS M  38  ? O LYS M 38  
Z  1 2 N ILE M  27 ? N ILE M 27 O LEU M  85  ? O LEU M 85  
Z  2 3 N THR M  77 ? N THR M 77 O GLU M  106 ? O GLU M 106 
AA 1 2 N GLN N  9  ? N GLN N 9  O LYS N  38  ? O LYS N 38  
AB 1 2 N ILE N  27 ? N ILE N 27 O LEU N  85  ? O LEU N 85  
AB 2 3 N LYS N  78 ? N LYS N 78 O ALA N  105 ? O ALA N 105 
AC 1 2 N CYS O  15 ? N CYS O 34 O CYS O  27  ? O CYS O 46  
AD 1 2 O GLN O  45 ? O GLN O 64 N VAL O  37  ? N VAL O 56  
AD 2 3 N CYS O  32 ? N CYS O 51 O CYS O  71  ? O CYS O 90  
AE 1 2 N CYS P  15 ? N CYS P 34 O CYS P  27  ? O CYS P 46  
AF 1 2 O GLN P  45 ? O GLN P 64 N VAL P  37  ? N VAL P 56  
AF 2 3 N CYS P  32 ? N CYS P 51 O CYS P  71  ? O CYS P 90  
AG 1 2 O GLU Q  31 ? O GLU Q 29 N CYS Q  13  ? N CYS Q 11  
AG 2 3 N TYR Q  16 ? N TYR Q 14 O LYS Q  59  ? O LYS Q 57  
AG 3 4 O GLU Q  55 ? O GLU Q 53 N ARG Q  48  ? N ARG Q 46  
AG 4 5 N TRP Q  47 ? N TRP Q 45 O TYR Q  84  ? O TYR Q 82  
AH 1 2 N ALA Q  76 ? N ALA Q 74 O THR Q  98  ? O THR Q 96  
AI 1 2 O GLY R  29 ? O GLY R 27 N TYR R  15  ? N TYR R 13  
AI 2 3 N TYR R  16 ? N TYR R 14 O LYS R  59  ? O LYS R 57  
AI 3 4 O GLU R  55 ? O GLU R 53 N ARG R  48  ? N ARG R 46  
AI 4 5 N TRP R  47 ? N TRP R 45 O TYR R  84  ? O TYR R 82  
AJ 1 2 N ALA R  76 ? N ALA R 74 O THR R  98  ? O THR R 96  
AK 1 2 N GLN S  9  ? N GLN S 9  O LYS S  38  ? O LYS S 38  
AL 1 2 N ILE S  27 ? N ILE S 27 O LEU S  85  ? O LEU S 85  
AL 2 3 N LYS S  78 ? N LYS S 78 O ALA S  105 ? O ALA S 105 
AM 1 2 N GLN T  9  ? N GLN T 9  O LYS T  38  ? O LYS T 38  
AN 1 2 N ILE T  27 ? N ILE T 27 O LEU T  85  ? O LEU T 85  
AN 2 3 N LYS T  78 ? N LYS T 78 O ALA T  105 ? O ALA T 105 
AO 1 2 N CYS U  15 ? N CYS U 34 O CYS U  27  ? O CYS U 46  
AP 1 2 O GLN U  45 ? O GLN U 64 N VAL U  37  ? N VAL U 56  
AP 2 3 N CYS U  32 ? N CYS U 51 O CYS U  71  ? O CYS U 90  
AQ 1 2 N CYS V  15 ? N CYS V 34 O CYS V  27  ? O CYS V 46  
AR 1 2 O GLN V  45 ? O GLN V 64 N VAL V  37  ? N VAL V 56  
AR 2 3 N CYS V  32 ? N CYS V 51 O CYS V  71  ? O CYS V 90  
AS 1 2 O GLY W  29 ? O GLY W 27 N TYR W  15  ? N TYR W 13  
AS 2 3 N TYR W  16 ? N TYR W 14 O LYS W  59  ? O LYS W 57  
AS 3 4 O GLU W  55 ? O GLU W 53 N ARG W  48  ? N ARG W 46  
AS 4 5 N TRP W  47 ? N TRP W 45 O TYR W  84  ? O TYR W 82  
AT 1 2 N ALA W  76 ? N ALA W 74 O THR W  98  ? O THR W 96  
AU 1 2 O GLY X  29 ? O GLY X 27 N TYR X  15  ? N TYR X 13  
AU 2 3 N TYR X  16 ? N TYR X 14 O LYS X  59  ? O LYS X 57  
AU 3 4 O GLU X  55 ? O GLU X 53 N ARG X  48  ? N ARG X 46  
AU 4 5 N TRP X  47 ? N TRP X 45 O TYR X  84  ? O TYR X 82  
AV 1 2 N ALA X  76 ? N ALA X 74 O THR X  98  ? O THR X 96  
AW 1 2 N GLN Y  9  ? N GLN a 9  O LYS Y  38  ? O LYS a 38  
AX 1 2 N ILE Y  27 ? N ILE a 27 O LEU Y  85  ? O LEU a 85  
AX 2 3 N LYS Y  78 ? N LYS a 78 O ALA Y  105 ? O ALA a 105 
AY 1 2 N GLN Z  9  ? N GLN b 9  O LYS Z  38  ? O LYS b 38  
AZ 1 2 N ILE Z  27 ? N ILE b 27 O LEU Z  85  ? O LEU b 85  
AZ 2 3 N LYS Z  78 ? N LYS b 78 O ALA Z  105 ? O ALA b 105 
BA 1 2 N CYS AA 15 ? N CYS c 34 O CYS AA 27  ? O CYS c 46  
BB 1 2 O GLN AA 45 ? O GLN c 64 N VAL AA 37  ? N VAL c 56  
BB 2 3 N CYS AA 32 ? N CYS c 51 O CYS AA 71  ? O CYS c 90  
BC 1 2 N CYS BA 15 ? N CYS d 34 O CYS BA 27  ? O CYS d 46  
BD 1 2 O GLN BA 45 ? O GLN d 64 N VAL BA 37  ? N VAL d 56  
BD 2 3 N CYS BA 32 ? N CYS d 51 O CYS BA 71  ? O CYS d 90  
BE 1 2 O GLY CA 29 ? O GLY e 27 N TYR CA 15  ? N TYR e 13  
BE 2 3 N TYR CA 16 ? N TYR e 14 O LYS CA 59  ? O LYS e 57  
BE 3 4 O GLU CA 55 ? O GLU e 53 N ARG CA 48  ? N ARG e 46  
BE 4 5 N TRP CA 47 ? N TRP e 45 O TYR CA 84  ? O TYR e 82  
BF 1 2 N ALA CA 76 ? N ALA e 74 O THR CA 98  ? O THR e 96  
BG 1 2 O GLU DA 31 ? O GLU f 29 N CYS DA 13  ? N CYS f 11  
BG 2 3 N TYR DA 16 ? N TYR f 14 O LYS DA 59  ? O LYS f 57  
BG 3 4 O GLU DA 55 ? O GLU f 53 N ARG DA 48  ? N ARG f 46  
BG 4 5 N TRP DA 47 ? N TRP f 45 O TYR DA 84  ? O TYR f 82  
BH 1 2 N ALA DA 76 ? N ALA f 74 O THR DA 98  ? O THR f 96  
BI 1 2 N GLN EA 9  ? N GLN g 9  O LYS EA 38  ? O LYS g 38  
BJ 1 2 N ILE EA 27 ? N ILE g 27 O LEU EA 85  ? O LEU g 85  
BJ 2 3 N LYS EA 78 ? N LYS g 78 O ALA EA 105 ? O ALA g 105 
BK 1 2 N GLN FA 9  ? N GLN h 9  O LYS FA 38  ? O LYS h 38  
BL 1 2 N ILE FA 27 ? N ILE h 27 O LEU FA 85  ? O LEU h 85  
BL 2 3 N THR FA 77 ? N THR h 77 O GLU FA 106 ? O GLU h 106 
BM 1 2 N CYS GA 15 ? N CYS i 34 O CYS GA 27  ? O CYS i 46  
BN 1 2 O GLN GA 45 ? O GLN i 64 N VAL GA 37  ? N VAL i 56  
BN 2 3 N CYS GA 32 ? N CYS i 51 O CYS GA 71  ? O CYS i 90  
BO 1 2 N CYS HA 15 ? N CYS j 34 O CYS HA 27  ? O CYS j 46  
BP 1 2 O GLN HA 45 ? O GLN j 64 N VAL HA 37  ? N VAL j 56  
BP 2 3 N CYS HA 32 ? N CYS j 51 O CYS HA 71  ? O CYS j 90  
BQ 1 2 O GLU IA 31 ? O GLU k 29 N CYS IA 13  ? N CYS k 11  
BQ 2 3 N TYR IA 16 ? N TYR k 14 O LYS IA 59  ? O LYS k 57  
BQ 3 4 O GLU IA 55 ? O GLU k 53 N ARG IA 48  ? N ARG k 46  
BQ 4 5 N TRP IA 47 ? N TRP k 45 O TYR IA 84  ? O TYR k 82  
BR 1 2 N ALA IA 76 ? N ALA k 74 O THR IA 98  ? O THR k 96  
BS 1 2 O GLY JA 29 ? O GLY l 27 N TYR JA 15  ? N TYR l 13  
BS 2 3 N TYR JA 16 ? N TYR l 14 O LYS JA 59  ? O LYS l 57  
BS 3 4 O GLU JA 55 ? O GLU l 53 N ARG JA 48  ? N ARG l 46  
BS 4 5 N TRP JA 47 ? N TRP l 45 O TYR JA 84  ? O TYR l 82  
BT 1 2 N ALA JA 76 ? N ALA l 74 O THR JA 98  ? O THR l 96  
# 
_atom_sites.entry_id                    4FAO 
_atom_sites.fract_transf_matrix[1][1]   0.004620 
_atom_sites.fract_transf_matrix[1][2]   0.002667 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004609 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 6   ? 69.700  -16.308  -4.292  1.00 84.48  ? 6   SER A N   1 
ATOM   2     C  CA  . SER A  1 6   ? 70.374  -17.195  -3.343  1.00 73.86  ? 6   SER A CA  1 
ATOM   3     C  C   . SER A  1 6   ? 71.739  -17.667  -3.872  1.00 75.84  ? 6   SER A C   1 
ATOM   4     O  O   . SER A  1 6   ? 72.597  -18.121  -3.107  1.00 44.67  ? 6   SER A O   1 
ATOM   5     C  CB  . SER A  1 6   ? 69.476  -18.398  -2.963  1.00 26.26  ? 6   SER A CB  1 
ATOM   6     N  N   . HIS A  1 7   ? 71.955  -17.552  -5.178  1.00 85.58  ? 7   HIS A N   1 
ATOM   7     C  CA  . HIS A  1 7   ? 73.153  -18.147  -5.778  1.00 61.12  ? 7   HIS A CA  1 
ATOM   8     C  C   . HIS A  1 7   ? 74.409  -17.331  -5.652  1.00 70.21  ? 7   HIS A C   1 
ATOM   9     O  O   . HIS A  1 7   ? 74.367  -16.128  -5.455  1.00 124.53 ? 7   HIS A O   1 
ATOM   10    C  CB  . HIS A  1 7   ? 72.924  -18.536  -7.230  1.00 58.68  ? 7   HIS A CB  1 
ATOM   11    C  CG  . HIS A  1 7   ? 72.085  -19.765  -7.379  1.00 88.22  ? 7   HIS A CG  1 
ATOM   12    N  ND1 . HIS A  1 7   ? 72.581  -21.033  -7.168  1.00 86.65  ? 7   HIS A ND1 1 
ATOM   13    C  CD2 . HIS A  1 7   ? 70.772  -19.918  -7.677  1.00 93.62  ? 7   HIS A CD2 1 
ATOM   14    C  CE1 . HIS A  1 7   ? 71.617  -21.916  -7.352  1.00 80.19  ? 7   HIS A CE1 1 
ATOM   15    N  NE2 . HIS A  1 7   ? 70.509  -21.265  -7.660  1.00 86.31  ? 7   HIS A NE2 1 
ATOM   16    N  N   . CYS A  1 8   ? 75.533  -18.010  -5.787  1.00 65.63  ? 8   CYS A N   1 
ATOM   17    C  CA  . CYS A  1 8   ? 76.836  -17.431  -5.480  1.00 58.93  ? 8   CYS A CA  1 
ATOM   18    C  C   . CYS A  1 8   ? 77.282  -16.381  -6.499  1.00 65.31  ? 8   CYS A C   1 
ATOM   19    O  O   . CYS A  1 8   ? 77.347  -16.659  -7.699  1.00 77.43  ? 8   CYS A O   1 
ATOM   20    C  CB  . CYS A  1 8   ? 77.885  -18.546  -5.371  1.00 59.93  ? 8   CYS A CB  1 
ATOM   21    S  SG  . CYS A  1 8   ? 79.594  -18.019  -5.267  1.00 81.90  ? 8   CYS A SG  1 
ATOM   22    N  N   . GLN A  1 9   ? 77.615  -15.185  -6.011  1.00 55.37  ? 9   GLN A N   1 
ATOM   23    C  CA  . GLN A  1 9   ? 77.952  -14.066  -6.881  1.00 51.52  ? 9   GLN A CA  1 
ATOM   24    C  C   . GLN A  1 9   ? 78.723  -12.931  -6.202  1.00 59.23  ? 9   GLN A C   1 
ATOM   25    O  O   . GLN A  1 9   ? 78.887  -12.900  -4.967  1.00 67.58  ? 9   GLN A O   1 
ATOM   26    C  CB  . GLN A  1 9   ? 76.673  -13.501  -7.468  1.00 71.22  ? 9   GLN A CB  1 
ATOM   27    C  CG  . GLN A  1 9   ? 75.528  -13.410  -6.447  1.00 72.45  ? 9   GLN A CG  1 
ATOM   28    C  CD  . GLN A  1 9   ? 74.243  -12.820  -7.038  1.00 81.51  ? 9   GLN A CD  1 
ATOM   29    O  OE1 . GLN A  1 9   ? 74.239  -12.289  -8.154  1.00 92.82  ? 9   GLN A OE1 1 
ATOM   30    N  NE2 . GLN A  1 9   ? 73.150  -12.916  -6.289  1.00 84.62  ? 9   GLN A NE2 1 
ATOM   31    N  N   . LYS A  1 10  ? 79.184  -12.002  -7.040  1.00 55.55  ? 10  LYS A N   1 
ATOM   32    C  CA  . LYS A  1 10  ? 79.887  -10.796  -6.614  1.00 44.51  ? 10  LYS A CA  1 
ATOM   33    C  C   . LYS A  1 10  ? 78.857  -9.728   -6.265  1.00 53.32  ? 10  LYS A C   1 
ATOM   34    O  O   . LYS A  1 10  ? 77.889  -9.536   -6.991  1.00 51.55  ? 10  LYS A O   1 
ATOM   35    C  CB  . LYS A  1 10  ? 80.794  -10.265  -7.740  1.00 41.43  ? 10  LYS A CB  1 
ATOM   36    C  CG  . LYS A  1 10  ? 82.094  -9.608   -7.263  1.00 51.91  ? 10  LYS A CG  1 
ATOM   37    C  CD  . LYS A  1 10  ? 82.540  -8.435   -8.121  1.00 43.97  ? 10  LYS A CD  1 
ATOM   38    C  CE  . LYS A  1 10  ? 83.163  -8.849   -9.441  1.00 63.33  ? 10  LYS A CE  1 
ATOM   39    N  NZ  . LYS A  1 10  ? 83.592  -7.666   -10.265 1.00 78.96  ? 10  LYS A NZ  1 
ATOM   40    N  N   . THR A  1 11  ? 79.074  -9.032   -5.154  1.00 59.96  ? 11  THR A N   1 
ATOM   41    C  CA  . THR A  1 11  ? 78.132  -8.041   -4.639  1.00 44.24  ? 11  THR A CA  1 
ATOM   42    C  C   . THR A  1 11  ? 78.845  -6.741   -4.362  1.00 72.35  ? 11  THR A C   1 
ATOM   43    O  O   . THR A  1 11  ? 80.051  -6.738   -4.090  1.00 91.55  ? 11  THR A O   1 
ATOM   44    C  CB  . THR A  1 11  ? 77.558  -8.499   -3.307  1.00 54.58  ? 11  THR A CB  1 
ATOM   45    O  OG1 . THR A  1 11  ? 76.656  -9.564   -3.548  1.00 73.58  ? 11  THR A OG1 1 
ATOM   46    C  CG2 . THR A  1 11  ? 76.810  -7.373   -2.614  1.00 76.53  ? 11  THR A CG2 1 
ATOM   47    N  N   . SER A  1 12  ? 78.107  -5.635   -4.398  1.00 53.06  ? 12  SER A N   1 
ATOM   48    C  CA  . SER A  1 12  ? 78.705  -4.360   -4.055  1.00 48.59  ? 12  SER A CA  1 
ATOM   49    C  C   . SER A  1 12  ? 79.018  -4.300   -2.562  1.00 63.87  ? 12  SER A C   1 
ATOM   50    O  O   . SER A  1 12  ? 78.215  -4.748   -1.746  1.00 58.64  ? 12  SER A O   1 
ATOM   51    C  CB  . SER A  1 12  ? 77.796  -3.215   -4.464  1.00 40.97  ? 12  SER A CB  1 
ATOM   52    O  OG  . SER A  1 12  ? 78.343  -1.971   -4.072  1.00 61.34  ? 12  SER A OG  1 
ATOM   53    N  N   . LEU A  1 13  ? 80.203  -3.791   -2.212  1.00 67.43  ? 13  LEU A N   1 
ATOM   54    C  CA  . LEU A  1 13  ? 80.512  -3.506   -0.819  1.00 48.46  ? 13  LEU A CA  1 
ATOM   55    C  C   . LEU A  1 13  ? 81.305  -2.218   -0.739  1.00 50.39  ? 13  LEU A C   1 
ATOM   56    O  O   . LEU A  1 13  ? 82.528  -2.204   -0.881  1.00 77.27  ? 13  LEU A O   1 
ATOM   57    C  CB  . LEU A  1 13  ? 81.285  -4.657   -0.188  1.00 56.62  ? 13  LEU A CB  1 
ATOM   58    C  CG  . LEU A  1 13  ? 81.649  -4.495   1.288   1.00 51.65  ? 13  LEU A CG  1 
ATOM   59    C  CD1 . LEU A  1 13  ? 80.404  -4.392   2.131   1.00 29.38  ? 13  LEU A CD1 1 
ATOM   60    C  CD2 . LEU A  1 13  ? 82.522  -5.655   1.762   1.00 59.41  ? 13  LEU A CD2 1 
ATOM   61    N  N   . ARG A  1 14  ? 80.591  -1.121   -0.552  1.00 61.67  ? 14  ARG A N   1 
ATOM   62    C  CA  . ARG A  1 14  ? 81.247  0.160    -0.405  1.00 67.85  ? 14  ARG A CA  1 
ATOM   63    C  C   . ARG A  1 14  ? 81.810  0.252    0.999   1.00 58.80  ? 14  ARG A C   1 
ATOM   64    O  O   . ARG A  1 14  ? 81.093  0.462    1.967   1.00 63.51  ? 14  ARG A O   1 
ATOM   65    C  CB  . ARG A  1 14  ? 80.288  1.316    -0.680  1.00 67.36  ? 14  ARG A CB  1 
ATOM   66    C  CG  . ARG A  1 14  ? 79.649  1.294    -2.057  1.00 68.01  ? 14  ARG A CG  1 
ATOM   67    C  CD  . ARG A  1 14  ? 80.688  1.354    -3.142  1.00 77.21  ? 14  ARG A CD  1 
ATOM   68    N  NE  . ARG A  1 14  ? 80.122  1.487    -4.481  1.00 88.20  ? 14  ARG A NE  1 
ATOM   69    C  CZ  . ARG A  1 14  ? 79.515  2.578    -4.935  1.00 82.83  ? 14  ARG A CZ  1 
ATOM   70    N  NH1 . ARG A  1 14  ? 79.351  3.648    -4.148  1.00 56.44  ? 14  ARG A NH1 1 
ATOM   71    N  NH2 . ARG A  1 14  ? 79.055  2.582    -6.180  1.00 73.06  ? 14  ARG A NH2 1 
ATOM   72    N  N   . VAL A  1 15  ? 83.108  0.065    1.109   1.00 44.65  ? 15  VAL A N   1 
ATOM   73    C  CA  . VAL A  1 15  ? 83.746  0.228    2.390   1.00 41.62  ? 15  VAL A CA  1 
ATOM   74    C  C   . VAL A  1 15  ? 84.101  1.695    2.531   1.00 47.22  ? 15  VAL A C   1 
ATOM   75    O  O   . VAL A  1 15  ? 84.648  2.309    1.618   1.00 52.80  ? 15  VAL A O   1 
ATOM   76    C  CB  . VAL A  1 15  ? 85.024  -0.616   2.497   1.00 55.64  ? 15  VAL A CB  1 
ATOM   77    C  CG1 . VAL A  1 15  ? 85.721  -0.358   3.800   1.00 52.09  ? 15  VAL A CG1 1 
ATOM   78    C  CG2 . VAL A  1 15  ? 84.694  -2.066   2.386   1.00 59.43  ? 15  VAL A CG2 1 
ATOM   79    N  N   . ASN A  1 16  ? 83.766  2.247    3.684   1.00 44.06  ? 16  ASN A N   1 
ATOM   80    C  CA  . ASN A  1 16  ? 84.135  3.595    4.037   1.00 48.53  ? 16  ASN A CA  1 
ATOM   81    C  C   . ASN A  1 16  ? 85.227  3.549    5.092   1.00 62.20  ? 16  ASN A C   1 
ATOM   82    O  O   . ASN A  1 16  ? 84.998  3.061    6.198   1.00 76.24  ? 16  ASN A O   1 
ATOM   83    C  CB  . ASN A  1 16  ? 82.907  4.292    4.595   1.00 64.85  ? 16  ASN A CB  1 
ATOM   84    C  CG  . ASN A  1 16  ? 83.166  5.728    4.981   1.00 73.03  ? 16  ASN A CG  1 
ATOM   85    O  OD1 . ASN A  1 16  ? 84.273  6.099    5.385   1.00 83.13  ? 16  ASN A OD1 1 
ATOM   86    N  ND2 . ASN A  1 16  ? 82.131  6.551    4.868   1.00 76.04  ? 16  ASN A ND2 1 
ATOM   87    N  N   . PHE A  1 17  ? 86.410  4.060    4.763   1.00 52.87  ? 17  PHE A N   1 
ATOM   88    C  CA  . PHE A  1 17  ? 87.565  3.936    5.660   1.00 62.30  ? 17  PHE A CA  1 
ATOM   89    C  C   . PHE A  1 17  ? 87.334  4.514    7.042   1.00 72.44  ? 17  PHE A C   1 
ATOM   90    O  O   . PHE A  1 17  ? 87.892  4.011    8.024   1.00 66.69  ? 17  PHE A O   1 
ATOM   91    C  CB  . PHE A  1 17  ? 88.814  4.557    5.048   1.00 60.64  ? 17  PHE A CB  1 
ATOM   92    C  CG  . PHE A  1 17  ? 89.360  3.777    3.907   1.00 54.93  ? 17  PHE A CG  1 
ATOM   93    C  CD1 . PHE A  1 17  ? 89.895  2.528    4.112   1.00 32.06  ? 17  PHE A CD1 1 
ATOM   94    C  CD2 . PHE A  1 17  ? 89.321  4.285    2.625   1.00 62.27  ? 17  PHE A CD2 1 
ATOM   95    C  CE1 . PHE A  1 17  ? 90.384  1.812    3.066   1.00 30.29  ? 17  PHE A CE1 1 
ATOM   96    C  CE2 . PHE A  1 17  ? 89.806  3.566    1.570   1.00 61.33  ? 17  PHE A CE2 1 
ATOM   97    C  CZ  . PHE A  1 17  ? 90.338  2.331    1.784   1.00 38.52  ? 17  PHE A CZ  1 
ATOM   98    N  N   . GLU A  1 18  ? 86.533  5.576    7.110   1.00 64.78  ? 18  GLU A N   1 
ATOM   99    C  CA  . GLU A  1 18  ? 86.146  6.154    8.389   1.00 57.57  ? 18  GLU A CA  1 
ATOM   100   C  C   . GLU A  1 18  ? 85.449  5.108    9.278   1.00 69.82  ? 18  GLU A C   1 
ATOM   101   O  O   . GLU A  1 18  ? 85.695  5.053    10.482  1.00 59.34  ? 18  GLU A O   1 
ATOM   102   C  CB  . GLU A  1 18  ? 85.239  7.359    8.165   1.00 71.65  ? 18  GLU A CB  1 
ATOM   103   C  CG  . GLU A  1 18  ? 85.041  8.233    9.402   1.00 83.30  ? 18  GLU A CG  1 
ATOM   104   C  CD  . GLU A  1 18  ? 84.200  9.473    9.127   1.00 99.03  ? 18  GLU A CD  1 
ATOM   105   O  OE1 . GLU A  1 18  ? 84.306  10.450   9.905   1.00 108.01 ? 18  GLU A OE1 1 
ATOM   106   O  OE2 . GLU A  1 18  ? 83.434  9.464    8.135   1.00 104.11 ? 18  GLU A OE2 1 
ATOM   107   N  N   . ASP A  1 19  ? 84.592  4.277    8.678   1.00 77.65  ? 19  ASP A N   1 
ATOM   108   C  CA  . ASP A  1 19  ? 83.860  3.237    9.408   1.00 62.06  ? 19  ASP A CA  1 
ATOM   109   C  C   . ASP A  1 19  ? 84.770  2.232    10.114  1.00 57.17  ? 19  ASP A C   1 
ATOM   110   O  O   . ASP A  1 19  ? 84.438  1.741    11.193  1.00 64.77  ? 19  ASP A O   1 
ATOM   111   C  CB  . ASP A  1 19  ? 82.906  2.485    8.481   1.00 50.95  ? 19  ASP A CB  1 
ATOM   112   C  CG  . ASP A  1 19  ? 81.643  3.249    8.208   1.00 86.76  ? 19  ASP A CG  1 
ATOM   113   O  OD1 . ASP A  1 19  ? 81.362  4.216    8.952   1.00 102.23 ? 19  ASP A OD1 1 
ATOM   114   O  OD2 . ASP A  1 19  ? 80.926  2.872    7.253   1.00 85.15  ? 19  ASP A OD2 1 
ATOM   115   N  N   . ILE A  1 20  ? 85.907  1.915    9.502   1.00 40.34  ? 20  ILE A N   1 
ATOM   116   C  CA  . ILE A  1 20  ? 86.868  0.999    10.120  1.00 52.99  ? 20  ILE A CA  1 
ATOM   117   C  C   . ILE A  1 20  ? 88.086  1.725    10.690  1.00 59.09  ? 20  ILE A C   1 
ATOM   118   O  O   . ILE A  1 20  ? 89.108  1.097    10.999  1.00 60.26  ? 20  ILE A O   1 
ATOM   119   C  CB  . ILE A  1 20  ? 87.347  -0.137   9.153   1.00 53.03  ? 20  ILE A CB  1 
ATOM   120   C  CG1 . ILE A  1 20  ? 88.005  0.443    7.906   1.00 61.01  ? 20  ILE A CG1 1 
ATOM   121   C  CG2 . ILE A  1 20  ? 86.200  -1.055   8.765   1.00 44.53  ? 20  ILE A CG2 1 
ATOM   122   C  CD1 . ILE A  1 20  ? 88.565  -0.598   6.997   1.00 54.63  ? 20  ILE A CD1 1 
ATOM   123   N  N   . GLY A  1 21  ? 87.975  3.045    10.814  1.00 63.42  ? 21  GLY A N   1 
ATOM   124   C  CA  . GLY A  1 21  ? 88.981  3.849    11.491  1.00 78.59  ? 21  GLY A CA  1 
ATOM   125   C  C   . GLY A  1 21  ? 90.306  3.952    10.770  1.00 68.92  ? 21  GLY A C   1 
ATOM   126   O  O   . GLY A  1 21  ? 91.354  4.104    11.404  1.00 58.17  ? 21  GLY A O   1 
ATOM   127   N  N   . TRP A  1 22  ? 90.262  3.863    9.443   1.00 55.18  ? 22  TRP A N   1 
ATOM   128   C  CA  . TRP A  1 22  ? 91.463  4.037    8.638   1.00 54.78  ? 22  TRP A CA  1 
ATOM   129   C  C   . TRP A  1 22  ? 91.555  5.478    8.103   1.00 64.29  ? 22  TRP A C   1 
ATOM   130   O  O   . TRP A  1 22  ? 92.516  5.869    7.441   1.00 43.74  ? 22  TRP A O   1 
ATOM   131   C  CB  . TRP A  1 22  ? 91.498  3.000    7.519   1.00 58.20  ? 22  TRP A CB  1 
ATOM   132   C  CG  . TRP A  1 22  ? 91.830  1.628    8.012   1.00 60.01  ? 22  TRP A CG  1 
ATOM   133   C  CD1 . TRP A  1 22  ? 91.868  1.213    9.305   1.00 81.88  ? 22  TRP A CD1 1 
ATOM   134   C  CD2 . TRP A  1 22  ? 92.180  0.494    7.220   1.00 45.72  ? 22  TRP A CD2 1 
ATOM   135   N  NE1 . TRP A  1 22  ? 92.218  -0.114   9.370   1.00 75.58  ? 22  TRP A NE1 1 
ATOM   136   C  CE2 . TRP A  1 22  ? 92.416  -0.573   8.099   1.00 49.57  ? 22  TRP A CE2 1 
ATOM   137   C  CE3 . TRP A  1 22  ? 92.328  0.280    5.852   1.00 56.42  ? 22  TRP A CE3 1 
ATOM   138   C  CZ2 . TRP A  1 22  ? 92.803  -1.825   7.654   1.00 55.77  ? 22  TRP A CZ2 1 
ATOM   139   C  CZ3 . TRP A  1 22  ? 92.698  -0.977   5.412   1.00 40.41  ? 22  TRP A CZ3 1 
ATOM   140   C  CH2 . TRP A  1 22  ? 92.926  -2.006   6.307   1.00 41.24  ? 22  TRP A CH2 1 
ATOM   141   N  N   . ASP A  1 23  ? 90.544  6.276    8.423   1.00 84.56  ? 23  ASP A N   1 
ATOM   142   C  CA  . ASP A  1 23  ? 90.519  7.677    8.024   1.00 72.83  ? 23  ASP A CA  1 
ATOM   143   C  C   . ASP A  1 23  ? 91.726  8.385    8.583   1.00 66.64  ? 23  ASP A C   1 
ATOM   144   O  O   . ASP A  1 23  ? 92.057  9.482    8.164   1.00 86.29  ? 23  ASP A O   1 
ATOM   145   C  CB  . ASP A  1 23  ? 89.231  8.363    8.496   1.00 71.76  ? 23  ASP A CB  1 
ATOM   146   C  CG  . ASP A  1 23  ? 88.985  8.199    9.980   1.00 87.30  ? 23  ASP A CG  1 
ATOM   147   O  OD1 . ASP A  1 23  ? 89.325  7.148    10.550  1.00 95.79  ? 23  ASP A OD1 1 
ATOM   148   O  OD2 . ASP A  1 23  ? 88.438  9.128    10.588  1.00 96.13  ? 23  ASP A OD2 1 
ATOM   149   N  N   . SER A  1 24  ? 92.391  7.740    9.531   1.00 58.96  ? 24  SER A N   1 
ATOM   150   C  CA  . SER A  1 24  ? 93.538  8.331    10.213  1.00 61.35  ? 24  SER A CA  1 
ATOM   151   C  C   . SER A  1 24  ? 94.732  8.483    9.286   1.00 65.11  ? 24  SER A C   1 
ATOM   152   O  O   . SER A  1 24  ? 95.565  9.356    9.487   1.00 79.07  ? 24  SER A O   1 
ATOM   153   C  CB  . SER A  1 24  ? 93.947  7.468    11.400  1.00 56.63  ? 24  SER A CB  1 
ATOM   154   O  OG  . SER A  1 24  ? 94.640  6.313    10.962  1.00 69.64  ? 24  SER A OG  1 
ATOM   155   N  N   . TRP A  1 25  ? 94.808  7.630    8.270   1.00 65.49  ? 25  TRP A N   1 
ATOM   156   C  CA  . TRP A  1 25  ? 95.976  7.587    7.403   1.00 60.02  ? 25  TRP A CA  1 
ATOM   157   C  C   . TRP A  1 25  ? 95.658  7.420    5.915   1.00 63.33  ? 25  TRP A C   1 
ATOM   158   O  O   . TRP A  1 25  ? 96.512  7.650    5.075   1.00 71.28  ? 25  TRP A O   1 
ATOM   159   C  CB  . TRP A  1 25  ? 96.927  6.489    7.870   1.00 66.29  ? 25  TRP A CB  1 
ATOM   160   C  CG  . TRP A  1 25  ? 96.351  5.118    7.807   1.00 61.73  ? 25  TRP A CG  1 
ATOM   161   C  CD1 . TRP A  1 25  ? 95.472  4.558    8.683   1.00 81.51  ? 25  TRP A CD1 1 
ATOM   162   C  CD2 . TRP A  1 25  ? 96.618  4.124    6.820   1.00 45.05  ? 25  TRP A CD2 1 
ATOM   163   N  NE1 . TRP A  1 25  ? 95.166  3.277    8.298   1.00 73.71  ? 25  TRP A NE1 1 
ATOM   164   C  CE2 . TRP A  1 25  ? 95.862  2.989    7.155   1.00 62.40  ? 25  TRP A CE2 1 
ATOM   165   C  CE3 . TRP A  1 25  ? 97.419  4.086    5.677   1.00 41.67  ? 25  TRP A CE3 1 
ATOM   166   C  CZ2 . TRP A  1 25  ? 95.886  1.833    6.393   1.00 70.74  ? 25  TRP A CZ2 1 
ATOM   167   C  CZ3 . TRP A  1 25  ? 97.444  2.930    4.922   1.00 37.54  ? 25  TRP A CZ3 1 
ATOM   168   C  CH2 . TRP A  1 25  ? 96.687  1.822    5.284   1.00 54.38  ? 25  TRP A CH2 1 
ATOM   169   N  N   . ILE A  1 26  ? 94.442  7.013    5.579   1.00 54.09  ? 26  ILE A N   1 
ATOM   170   C  CA  . ILE A  1 26  ? 94.023  7.062    4.185   1.00 49.13  ? 26  ILE A CA  1 
ATOM   171   C  C   . ILE A  1 26  ? 93.431  8.436    3.886   1.00 61.07  ? 26  ILE A C   1 
ATOM   172   O  O   . ILE A  1 26  ? 92.378  8.806    4.411   1.00 72.17  ? 26  ILE A O   1 
ATOM   173   C  CB  . ILE A  1 26  ? 92.954  6.011    3.843   1.00 62.66  ? 26  ILE A CB  1 
ATOM   174   C  CG1 . ILE A  1 26  ? 93.370  4.622    4.312   1.00 40.81  ? 26  ILE A CG1 1 
ATOM   175   C  CG2 . ILE A  1 26  ? 92.684  6.015    2.347   1.00 67.78  ? 26  ILE A CG2 1 
ATOM   176   C  CD1 . ILE A  1 26  ? 94.684  4.234    3.831   1.00 43.55  ? 26  ILE A CD1 1 
ATOM   177   N  N   . ILE A  1 27  ? 94.111  9.185    3.034   1.00 54.52  ? 27  ILE A N   1 
ATOM   178   C  CA  . ILE A  1 27  ? 93.662  10.516   2.651   1.00 57.78  ? 27  ILE A CA  1 
ATOM   179   C  C   . ILE A  1 27  ? 92.615  10.420   1.566   1.00 49.54  ? 27  ILE A C   1 
ATOM   180   O  O   . ILE A  1 27  ? 91.642  11.151   1.566   1.00 48.16  ? 27  ILE A O   1 
ATOM   181   C  CB  . ILE A  1 27  ? 94.836  11.352   2.118   1.00 63.33  ? 27  ILE A CB  1 
ATOM   182   C  CG1 . ILE A  1 27  ? 95.947  11.423   3.159   1.00 68.60  ? 27  ILE A CG1 1 
ATOM   183   C  CG2 . ILE A  1 27  ? 94.385  12.739   1.777   1.00 43.40  ? 27  ILE A CG2 1 
ATOM   184   C  CD1 . ILE A  1 27  ? 97.193  12.033   2.635   1.00 73.61  ? 27  ILE A CD1 1 
ATOM   185   N  N   . ALA A  1 28  ? 92.853  9.518    0.626   1.00 58.73  ? 28  ALA A N   1 
ATOM   186   C  CA  . ALA A  1 28  ? 91.904  9.222    -0.436  1.00 43.45  ? 28  ALA A CA  1 
ATOM   187   C  C   . ALA A  1 28  ? 92.043  7.774    -0.944  1.00 51.82  ? 28  ALA A C   1 
ATOM   188   O  O   . ALA A  1 28  ? 93.134  7.198    -0.956  1.00 54.86  ? 28  ALA A O   1 
ATOM   189   C  CB  . ALA A  1 28  ? 92.059  10.201   -1.558  1.00 31.15  ? 28  ALA A CB  1 
ATOM   190   N  N   . PRO A  1 29  ? 90.926  7.180    -1.363  1.00 39.21  ? 29  PRO A N   1 
ATOM   191   C  CA  . PRO A  1 29  ? 89.606  7.799    -1.390  1.00 52.26  ? 29  PRO A CA  1 
ATOM   192   C  C   . PRO A  1 29  ? 89.020  7.799    0.007   1.00 56.96  ? 29  PRO A C   1 
ATOM   193   O  O   . PRO A  1 29  ? 89.707  7.338    0.923   1.00 50.04  ? 29  PRO A O   1 
ATOM   194   C  CB  . PRO A  1 29  ? 88.817  6.848    -2.271  1.00 71.32  ? 29  PRO A CB  1 
ATOM   195   C  CG  . PRO A  1 29  ? 89.437  5.520    -1.976  1.00 43.69  ? 29  PRO A CG  1 
ATOM   196   C  CD  . PRO A  1 29  ? 90.895  5.795    -1.847  1.00 33.40  ? 29  PRO A CD  1 
ATOM   197   N  N   . LYS A  1 30  ? 87.796  8.306    0.177   1.00 50.54  ? 30  LYS A N   1 
ATOM   198   C  CA  . LYS A  1 30  ? 87.168  8.275    1.493   1.00 50.74  ? 30  LYS A CA  1 
ATOM   199   C  C   . LYS A  1 30  ? 86.393  6.973    1.644   1.00 56.10  ? 30  LYS A C   1 
ATOM   200   O  O   . LYS A  1 30  ? 86.271  6.432    2.746   1.00 55.93  ? 30  LYS A O   1 
ATOM   201   C  CB  . LYS A  1 30  ? 86.282  9.492    1.736   1.00 37.97  ? 30  LYS A CB  1 
ATOM   202   C  CG  . LYS A  1 30  ? 87.017  10.841   1.794   1.00 56.37  ? 30  LYS A CG  1 
ATOM   203   C  CD  . LYS A  1 30  ? 88.008  10.948   2.939   1.00 74.14  ? 30  LYS A CD  1 
ATOM   204   C  CE  . LYS A  1 30  ? 88.782  12.263   2.863   1.00 85.02  ? 30  LYS A CE  1 
ATOM   205   N  NZ  . LYS A  1 30  ? 89.935  12.380   3.813   1.00 85.60  ? 30  LYS A NZ  1 
ATOM   206   N  N   . GLU A  1 31  ? 85.887  6.474    0.520   1.00 44.97  ? 31  GLU A N   1 
ATOM   207   C  CA  . GLU A  1 31  ? 85.310  5.135    0.442   1.00 46.58  ? 31  GLU A CA  1 
ATOM   208   C  C   . GLU A  1 31  ? 85.591  4.528    -0.929  1.00 50.75  ? 31  GLU A C   1 
ATOM   209   O  O   . GLU A  1 31  ? 85.873  5.242    -1.896  1.00 61.93  ? 31  GLU A O   1 
ATOM   210   C  CB  . GLU A  1 31  ? 83.800  5.118    0.768   1.00 60.07  ? 31  GLU A CB  1 
ATOM   211   C  CG  . GLU A  1 31  ? 82.855  5.560    -0.352  1.00 82.16  ? 31  GLU A CG  1 
ATOM   212   C  CD  . GLU A  1 31  ? 81.388  5.514    0.063   1.00 107.42 ? 31  GLU A CD  1 
ATOM   213   O  OE1 . GLU A  1 31  ? 80.509  5.332    -0.814  1.00 123.43 ? 31  GLU A OE1 1 
ATOM   214   O  OE2 . GLU A  1 31  ? 81.115  5.664    1.269   1.00 96.90  ? 31  GLU A OE2 1 
ATOM   215   N  N   . TYR A  1 32  ? 85.520  3.205    -1.009  1.00 44.56  ? 32  TYR A N   1 
ATOM   216   C  CA  . TYR A  1 32  ? 85.871  2.521    -2.238  1.00 36.93  ? 32  TYR A CA  1 
ATOM   217   C  C   . TYR A  1 32  ? 85.100  1.238    -2.361  1.00 49.94  ? 32  TYR A C   1 
ATOM   218   O  O   . TYR A  1 32  ? 84.603  0.714    -1.368  1.00 53.22  ? 32  TYR A O   1 
ATOM   219   C  CB  . TYR A  1 32  ? 87.355  2.201    -2.262  1.00 30.54  ? 32  TYR A CB  1 
ATOM   220   C  CG  . TYR A  1 32  ? 87.733  0.907    -1.555  1.00 38.57  ? 32  TYR A CG  1 
ATOM   221   C  CD1 . TYR A  1 32  ? 87.910  0.869    -0.181  1.00 47.34  ? 32  TYR A CD1 1 
ATOM   222   C  CD2 . TYR A  1 32  ? 87.937  -0.269   -2.270  1.00 39.72  ? 32  TYR A CD2 1 
ATOM   223   C  CE1 . TYR A  1 32  ? 88.265  -0.299   0.460   1.00 64.13  ? 32  TYR A CE1 1 
ATOM   224   C  CE2 . TYR A  1 32  ? 88.295  -1.440   -1.634  1.00 42.86  ? 32  TYR A CE2 1 
ATOM   225   C  CZ  . TYR A  1 32  ? 88.456  -1.445   -0.269  1.00 59.36  ? 32  TYR A CZ  1 
ATOM   226   O  OH  . TYR A  1 32  ? 88.820  -2.595   0.377   1.00 44.89  ? 32  TYR A OH  1 
ATOM   227   N  N   . GLU A  1 33  ? 85.025  0.728    -3.586  1.00 50.75  ? 33  GLU A N   1 
ATOM   228   C  CA  . GLU A  1 33  ? 84.309  -0.505   -3.862  1.00 40.99  ? 33  GLU A CA  1 
ATOM   229   C  C   . GLU A  1 33  ? 85.175  -1.702   -3.668  1.00 50.11  ? 33  GLU A C   1 
ATOM   230   O  O   . GLU A  1 33  ? 85.914  -2.077   -4.568  1.00 56.57  ? 33  GLU A O   1 
ATOM   231   C  CB  . GLU A  1 33  ? 83.810  -0.544   -5.297  1.00 54.01  ? 33  GLU A CB  1 
ATOM   232   C  CG  . GLU A  1 33  ? 83.077  -1.826   -5.647  1.00 48.91  ? 33  GLU A CG  1 
ATOM   233   C  CD  . GLU A  1 33  ? 81.714  -1.913   -4.989  1.00 66.57  ? 33  GLU A CD  1 
ATOM   234   O  OE1 . GLU A  1 33  ? 80.707  -1.485   -5.601  1.00 77.57  ? 33  GLU A OE1 1 
ATOM   235   O  OE2 . GLU A  1 33  ? 81.649  -2.404   -3.851  1.00 65.60  ? 33  GLU A OE2 1 
ATOM   236   N  N   . ALA A  1 34  ? 85.090  -2.305   -2.490  1.00 67.31  ? 34  ALA A N   1 
ATOM   237   C  CA  . ALA A  1 34  ? 85.566  -3.662   -2.352  1.00 63.63  ? 34  ALA A CA  1 
ATOM   238   C  C   . ALA A  1 34  ? 84.322  -4.437   -2.669  1.00 77.15  ? 34  ALA A C   1 
ATOM   239   O  O   . ALA A  1 34  ? 83.200  -3.928   -2.552  1.00 120.69 ? 34  ALA A O   1 
ATOM   240   C  CB  . ALA A  1 34  ? 85.985  -3.927   -0.964  1.00 55.30  ? 34  ALA A CB  1 
ATOM   241   N  N   . TYR A  1 35  ? 84.462  -5.664   -3.087  1.00 46.10  ? 35  TYR A N   1 
ATOM   242   C  CA  . TYR A  1 35  ? 83.223  -6.358   -3.304  1.00 64.22  ? 35  TYR A CA  1 
ATOM   243   C  C   . TYR A  1 35  ? 82.981  -7.297   -2.158  1.00 66.69  ? 35  TYR A C   1 
ATOM   244   O  O   . TYR A  1 35  ? 83.779  -7.351   -1.225  1.00 77.64  ? 35  TYR A O   1 
ATOM   245   C  CB  . TYR A  1 35  ? 83.237  -7.065   -4.642  1.00 82.80  ? 35  TYR A CB  1 
ATOM   246   C  CG  . TYR A  1 35  ? 83.150  -6.099   -5.786  1.00 72.76  ? 35  TYR A CG  1 
ATOM   247   C  CD1 . TYR A  1 35  ? 84.272  -5.699   -6.467  1.00 67.73  ? 35  TYR A CD1 1 
ATOM   248   C  CD2 . TYR A  1 35  ? 81.939  -5.574   -6.168  1.00 63.28  ? 35  TYR A CD2 1 
ATOM   249   C  CE1 . TYR A  1 35  ? 84.174  -4.824   -7.512  1.00 62.29  ? 35  TYR A CE1 1 
ATOM   250   C  CE2 . TYR A  1 35  ? 81.839  -4.698   -7.204  1.00 39.43  ? 35  TYR A CE2 1 
ATOM   251   C  CZ  . TYR A  1 35  ? 82.945  -4.325   -7.870  1.00 46.73  ? 35  TYR A CZ  1 
ATOM   252   O  OH  . TYR A  1 35  ? 82.806  -3.435   -8.908  1.00 66.38  ? 35  TYR A OH  1 
ATOM   253   N  N   . GLU A  1 36  ? 81.865  -8.011   -2.215  1.00 50.47  ? 36  GLU A N   1 
ATOM   254   C  CA  . GLU A  1 36  ? 81.597  -9.090   -1.277  1.00 67.09  ? 36  GLU A CA  1 
ATOM   255   C  C   . GLU A  1 36  ? 81.320  -10.338  -2.079  1.00 59.14  ? 36  GLU A C   1 
ATOM   256   O  O   . GLU A  1 36  ? 80.829  -10.268  -3.201  1.00 45.00  ? 36  GLU A O   1 
ATOM   257   C  CB  . GLU A  1 36  ? 80.387  -8.758   -0.410  1.00 76.50  ? 36  GLU A CB  1 
ATOM   258   C  CG  . GLU A  1 36  ? 80.219  -9.658   0.805   1.00 93.79  ? 36  GLU A CG  1 
ATOM   259   C  CD  . GLU A  1 36  ? 79.141  -9.158   1.754   1.00 114.74 ? 36  GLU A CD  1 
ATOM   260   O  OE1 . GLU A  1 36  ? 78.481  -8.147   1.423   1.00 118.26 ? 36  GLU A OE1 1 
ATOM   261   O  OE2 . GLU A  1 36  ? 78.958  -9.772   2.830   1.00 107.55 ? 36  GLU A OE2 1 
ATOM   262   N  N   . CYS A  1 37  ? 81.641  -11.493  -1.526  1.00 49.25  ? 37  CYS A N   1 
ATOM   263   C  CA  . CYS A  1 37  ? 81.252  -12.711  -2.206  1.00 52.37  ? 37  CYS A CA  1 
ATOM   264   C  C   . CYS A  1 37  ? 80.098  -13.349  -1.444  1.00 51.96  ? 37  CYS A C   1 
ATOM   265   O  O   . CYS A  1 37  ? 80.283  -13.910  -0.381  1.00 64.64  ? 37  CYS A O   1 
ATOM   266   C  CB  . CYS A  1 37  ? 82.448  -13.646  -2.396  1.00 51.41  ? 37  CYS A CB  1 
ATOM   267   S  SG  . CYS A  1 37  ? 83.497  -13.209  -3.821  1.00 70.78  ? 37  CYS A SG  1 
ATOM   268   N  N   . LYS A  1 38  ? 78.891  -13.214  -1.977  1.00 54.41  ? 38  LYS A N   1 
ATOM   269   C  CA  . LYS A  1 38  ? 77.700  -13.640  -1.239  1.00 51.03  ? 38  LYS A CA  1 
ATOM   270   C  C   . LYS A  1 38  ? 77.034  -14.791  -1.965  1.00 61.92  ? 38  LYS A C   1 
ATOM   271   O  O   . LYS A  1 38  ? 77.110  -14.872  -3.193  1.00 67.30  ? 38  LYS A O   1 
ATOM   272   C  CB  . LYS A  1 38  ? 76.678  -12.502  -1.149  1.00 48.36  ? 38  LYS A CB  1 
ATOM   273   C  CG  . LYS A  1 38  ? 76.627  -11.715  0.165   1.00 59.21  ? 38  LYS A CG  1 
ATOM   274   C  CD  . LYS A  1 38  ? 75.586  -10.584  0.096   1.00 67.93  ? 38  LYS A CD  1 
ATOM   275   C  CE  . LYS A  1 38  ? 75.663  -9.650   1.298   1.00 87.62  ? 38  LYS A CE  1 
ATOM   276   N  NZ  . LYS A  1 38  ? 75.423  -8.210   0.930   1.00 97.45  ? 38  LYS A NZ  1 
ATOM   277   N  N   . GLY A  1 39  ? 76.367  -15.674  -1.226  1.00 50.30  ? 39  GLY A N   1 
ATOM   278   C  CA  . GLY A  1 39  ? 75.586  -16.707  -1.872  1.00 48.29  ? 39  GLY A CA  1 
ATOM   279   C  C   . GLY A  1 39  ? 76.050  -18.108  -1.615  1.00 56.17  ? 39  GLY A C   1 
ATOM   280   O  O   . GLY A  1 39  ? 77.120  -18.323  -1.040  1.00 82.57  ? 39  GLY A O   1 
ATOM   281   N  N   . GLY A  1 40  ? 75.238  -19.063  -2.056  1.00 48.68  ? 40  GLY A N   1 
ATOM   282   C  CA  . GLY A  1 40  ? 75.489  -20.463  -1.767  1.00 62.31  ? 40  GLY A CA  1 
ATOM   283   C  C   . GLY A  1 40  ? 76.018  -21.241  -2.949  1.00 60.15  ? 40  GLY A C   1 
ATOM   284   O  O   . GLY A  1 40  ? 75.772  -20.901  -4.110  1.00 59.42  ? 40  GLY A O   1 
ATOM   285   N  N   . CYS A  1 41  ? 76.756  -22.296  -2.644  1.00 49.94  ? 41  CYS A N   1 
ATOM   286   C  CA  . CYS A  1 41  ? 77.312  -23.141  -3.682  1.00 60.43  ? 41  CYS A CA  1 
ATOM   287   C  C   . CYS A  1 41  ? 76.416  -24.354  -3.824  1.00 74.01  ? 41  CYS A C   1 
ATOM   288   O  O   . CYS A  1 41  ? 76.570  -25.344  -3.104  1.00 87.26  ? 41  CYS A O   1 
ATOM   289   C  CB  . CYS A  1 41  ? 78.751  -23.533  -3.333  1.00 72.58  ? 41  CYS A CB  1 
ATOM   290   S  SG  . CYS A  1 41  ? 79.830  -22.111  -3.087  1.00 80.23  ? 41  CYS A SG  1 
ATOM   291   N  N   . PHE A  1 42  ? 75.465  -24.257  -4.747  1.00 69.60  ? 42  PHE A N   1 
ATOM   292   C  CA  . PHE A  1 42  ? 74.397  -25.233  -4.824  1.00 75.51  ? 42  PHE A CA  1 
ATOM   293   C  C   . PHE A  1 42  ? 74.613  -26.150  -6.002  1.00 82.20  ? 42  PHE A C   1 
ATOM   294   O  O   . PHE A  1 42  ? 74.907  -25.689  -7.103  1.00 103.18 ? 42  PHE A O   1 
ATOM   295   C  CB  . PHE A  1 42  ? 73.040  -24.532  -4.939  1.00 78.86  ? 42  PHE A CB  1 
ATOM   296   C  CG  . PHE A  1 42  ? 72.654  -23.755  -3.715  1.00 71.20  ? 42  PHE A CG  1 
ATOM   297   C  CD1 . PHE A  1 42  ? 72.433  -22.401  -3.789  1.00 72.64  ? 42  PHE A CD1 1 
ATOM   298   C  CD2 . PHE A  1 42  ? 72.536  -24.380  -2.488  1.00 91.75  ? 42  PHE A CD2 1 
ATOM   299   C  CE1 . PHE A  1 42  ? 72.092  -21.682  -2.668  1.00 92.58  ? 42  PHE A CE1 1 
ATOM   300   C  CE2 . PHE A  1 42  ? 72.194  -23.667  -1.362  1.00 96.87  ? 42  PHE A CE2 1 
ATOM   301   C  CZ  . PHE A  1 42  ? 71.970  -22.316  -1.454  1.00 97.85  ? 42  PHE A CZ  1 
ATOM   302   N  N   . PHE A  1 43  ? 74.461  -27.451  -5.765  1.00 73.38  ? 43  PHE A N   1 
ATOM   303   C  CA  . PHE A  1 43  ? 74.676  -28.445  -6.808  1.00 77.49  ? 43  PHE A CA  1 
ATOM   304   C  C   . PHE A  1 43  ? 73.561  -28.414  -7.844  1.00 80.04  ? 43  PHE A C   1 
ATOM   305   O  O   . PHE A  1 43  ? 72.394  -28.271  -7.486  1.00 78.93  ? 43  PHE A O   1 
ATOM   306   C  CB  . PHE A  1 43  ? 74.802  -29.842  -6.200  1.00 65.67  ? 43  PHE A CB  1 
ATOM   307   C  CG  . PHE A  1 43  ? 75.602  -30.800  -7.040  1.00 69.22  ? 43  PHE A CG  1 
ATOM   308   C  CD1 . PHE A  1 43  ? 76.982  -30.812  -6.974  1.00 78.48  ? 43  PHE A CD1 1 
ATOM   309   C  CD2 . PHE A  1 43  ? 74.974  -31.684  -7.895  1.00 74.24  ? 43  PHE A CD2 1 
ATOM   310   C  CE1 . PHE A  1 43  ? 77.714  -31.679  -7.741  1.00 81.19  ? 43  PHE A CE1 1 
ATOM   311   C  CE2 . PHE A  1 43  ? 75.706  -32.560  -8.659  1.00 69.88  ? 43  PHE A CE2 1 
ATOM   312   C  CZ  . PHE A  1 43  ? 77.073  -32.553  -8.582  1.00 78.61  ? 43  PHE A CZ  1 
ATOM   313   N  N   . PRO A  1 44  ? 73.923  -28.530  -9.135  1.00 86.14  ? 44  PRO A N   1 
ATOM   314   C  CA  . PRO A  1 44  ? 75.303  -28.677  -9.604  1.00 95.42  ? 44  PRO A CA  1 
ATOM   315   C  C   . PRO A  1 44  ? 76.019  -27.339  -9.668  1.00 92.87  ? 44  PRO A C   1 
ATOM   316   O  O   . PRO A  1 44  ? 75.370  -26.304  -9.805  1.00 101.46 ? 44  PRO A O   1 
ATOM   317   C  CB  . PRO A  1 44  ? 75.121  -29.222  -11.014 1.00 89.29  ? 44  PRO A CB  1 
ATOM   318   C  CG  . PRO A  1 44  ? 73.899  -28.553  -11.471 1.00 89.32  ? 44  PRO A CG  1 
ATOM   319   C  CD  . PRO A  1 44  ? 72.986  -28.485  -10.265 1.00 92.36  ? 44  PRO A CD  1 
ATOM   320   N  N   . LEU A  1 45  ? 77.344  -27.370  -9.578  1.00 73.06  ? 45  LEU A N   1 
ATOM   321   C  CA  . LEU A  1 45  ? 78.130  -26.150  -9.497  1.00 63.32  ? 45  LEU A CA  1 
ATOM   322   C  C   . LEU A  1 45  ? 78.403  -25.571  -10.870 1.00 75.85  ? 45  LEU A C   1 
ATOM   323   O  O   . LEU A  1 45  ? 79.106  -26.175  -11.672 1.00 78.25  ? 45  LEU A O   1 
ATOM   324   C  CB  . LEU A  1 45  ? 79.450  -26.402  -8.766  1.00 53.16  ? 45  LEU A CB  1 
ATOM   325   C  CG  . LEU A  1 45  ? 79.296  -26.918  -7.334  1.00 59.73  ? 45  LEU A CG  1 
ATOM   326   C  CD1 . LEU A  1 45  ? 80.637  -27.145  -6.652  1.00 67.06  ? 45  LEU A CD1 1 
ATOM   327   C  CD2 . LEU A  1 45  ? 78.443  -25.965  -6.528  1.00 54.85  ? 45  LEU A CD2 1 
ATOM   328   N  N   . ALA A  1 46  ? 77.850  -24.390  -11.121 1.00 82.99  ? 46  ALA A N   1 
ATOM   329   C  CA  . ALA A  1 46  ? 78.035  -23.691  -12.387 1.00 83.67  ? 46  ALA A CA  1 
ATOM   330   C  C   . ALA A  1 46  ? 79.513  -23.504  -12.739 1.00 79.97  ? 46  ALA A C   1 
ATOM   331   O  O   . ALA A  1 46  ? 80.345  -23.250  -11.864 1.00 68.09  ? 46  ALA A O   1 
ATOM   332   C  CB  . ALA A  1 46  ? 77.335  -22.348  -12.333 1.00 98.40  ? 46  ALA A CB  1 
ATOM   333   N  N   . ASP A  1 47  ? 79.833  -23.612  -14.026 1.00 83.60  ? 47  ASP A N   1 
ATOM   334   C  CA  . ASP A  1 47  ? 81.219  -23.484  -14.479 1.00 74.55  ? 47  ASP A CA  1 
ATOM   335   C  C   . ASP A  1 47  ? 81.819  -22.151  -14.035 1.00 75.73  ? 47  ASP A C   1 
ATOM   336   O  O   . ASP A  1 47  ? 82.998  -22.087  -13.666 1.00 64.47  ? 47  ASP A O   1 
ATOM   337   C  CB  . ASP A  1 47  ? 81.331  -23.610  -16.008 1.00 81.65  ? 47  ASP A CB  1 
ATOM   338   C  CG  . ASP A  1 47  ? 80.721  -24.900  -16.550 1.00 113.97 ? 47  ASP A CG  1 
ATOM   339   O  OD1 . ASP A  1 47  ? 79.544  -24.868  -16.982 1.00 129.22 ? 47  ASP A OD1 1 
ATOM   340   O  OD2 . ASP A  1 47  ? 81.420  -25.941  -16.556 1.00 107.61 ? 47  ASP A OD2 1 
ATOM   341   N  N   . ASP A  1 48  ? 81.010  -21.090  -14.079 1.00 85.94  ? 48  ASP A N   1 
ATOM   342   C  CA  . ASP A  1 48  ? 81.494  -19.739  -13.777 1.00 74.51  ? 48  ASP A CA  1 
ATOM   343   C  C   . ASP A  1 48  ? 81.812  -19.567  -12.296 1.00 62.03  ? 48  ASP A C   1 
ATOM   344   O  O   . ASP A  1 48  ? 82.026  -18.454  -11.822 1.00 64.44  ? 48  ASP A O   1 
ATOM   345   C  CB  . ASP A  1 48  ? 80.527  -18.647  -14.273 1.00 85.85  ? 48  ASP A CB  1 
ATOM   346   C  CG  . ASP A  1 48  ? 79.124  -18.801  -13.719 1.00 109.57 ? 48  ASP A CG  1 
ATOM   347   O  OD1 . ASP A  1 48  ? 78.633  -19.945  -13.644 1.00 136.61 ? 48  ASP A OD1 1 
ATOM   348   O  OD2 . ASP A  1 48  ? 78.510  -17.775  -13.365 1.00 97.14  ? 48  ASP A OD2 1 
ATOM   349   N  N   . VAL A  1 49  ? 81.865  -20.680  -11.577 1.00 63.03  ? 49  VAL A N   1 
ATOM   350   C  CA  . VAL A  1 49  ? 82.236  -20.649  -10.179 1.00 56.14  ? 49  VAL A CA  1 
ATOM   351   C  C   . VAL A  1 49  ? 83.556  -21.386  -9.967  1.00 75.36  ? 49  VAL A C   1 
ATOM   352   O  O   . VAL A  1 49  ? 84.047  -21.518  -8.846  1.00 77.79  ? 49  VAL A O   1 
ATOM   353   C  CB  . VAL A  1 49  ? 81.109  -21.206  -9.326  1.00 52.69  ? 49  VAL A CB  1 
ATOM   354   C  CG1 . VAL A  1 49  ? 81.605  -21.627  -7.991  1.00 71.13  ? 49  VAL A CG1 1 
ATOM   355   C  CG2 . VAL A  1 49  ? 80.055  -20.142  -9.149  1.00 44.81  ? 49  VAL A CG2 1 
ATOM   356   N  N   . THR A  1 50  ? 84.142  -21.842  -11.069 1.00 65.15  ? 50  THR A N   1 
ATOM   357   C  CA  . THR A  1 50  ? 85.496  -22.373  -11.050 1.00 55.02  ? 50  THR A CA  1 
ATOM   358   C  C   . THR A  1 50  ? 85.674  -23.488  -10.028 1.00 60.96  ? 50  THR A C   1 
ATOM   359   O  O   . THR A  1 50  ? 86.733  -23.592  -9.404  1.00 75.16  ? 50  THR A O   1 
ATOM   360   C  CB  . THR A  1 50  ? 86.501  -21.277  -10.652 1.00 70.34  ? 50  THR A CB  1 
ATOM   361   O  OG1 . THR A  1 50  ? 86.012  -19.996  -11.058 1.00 71.75  ? 50  THR A OG1 1 
ATOM   362   C  CG2 . THR A  1 50  ? 87.883  -21.533  -11.270 1.00 84.98  ? 50  THR A CG2 1 
ATOM   363   N  N   . PRO A  1 51  ? 84.658  -24.336  -9.857  1.00 41.90  ? 51  PRO A N   1 
ATOM   364   C  CA  . PRO A  1 51  ? 84.714  -25.318  -8.775  1.00 42.77  ? 51  PRO A CA  1 
ATOM   365   C  C   . PRO A  1 51  ? 85.988  -26.137  -8.853  1.00 45.84  ? 51  PRO A C   1 
ATOM   366   O  O   . PRO A  1 51  ? 86.383  -26.529  -9.945  1.00 50.44  ? 51  PRO A O   1 
ATOM   367   C  CB  . PRO A  1 51  ? 83.503  -26.210  -9.048  1.00 37.84  ? 51  PRO A CB  1 
ATOM   368   C  CG  . PRO A  1 51  ? 83.218  -26.028  -10.498 1.00 61.66  ? 51  PRO A CG  1 
ATOM   369   C  CD  . PRO A  1 51  ? 83.552  -24.599  -10.782 1.00 60.04  ? 51  PRO A CD  1 
ATOM   370   N  N   . THR A  1 52  ? 86.634  -26.354  -7.715  1.00 38.08  ? 52  THR A N   1 
ATOM   371   C  CA  . THR A  1 52  ? 87.770  -27.252  -7.633  1.00 45.32  ? 52  THR A CA  1 
ATOM   372   C  C   . THR A  1 52  ? 87.216  -28.653  -7.500  1.00 54.89  ? 52  THR A C   1 
ATOM   373   O  O   . THR A  1 52  ? 86.047  -28.818  -7.147  1.00 61.67  ? 52  THR A O   1 
ATOM   374   C  CB  . THR A  1 52  ? 88.655  -26.967  -6.389  1.00 53.08  ? 52  THR A CB  1 
ATOM   375   O  OG1 . THR A  1 52  ? 87.939  -27.287  -5.188  1.00 69.92  ? 52  THR A OG1 1 
ATOM   376   C  CG2 . THR A  1 52  ? 89.072  -25.524  -6.341  1.00 40.33  ? 52  THR A CG2 1 
ATOM   377   N  N   . LYS A  1 53  ? 88.043  -29.659  -7.779  1.00 53.93  ? 53  LYS A N   1 
ATOM   378   C  CA  . LYS A  1 53  ? 87.624  -31.041  -7.620  1.00 47.01  ? 53  LYS A CA  1 
ATOM   379   C  C   . LYS A  1 53  ? 87.139  -31.182  -6.203  1.00 60.15  ? 53  LYS A C   1 
ATOM   380   O  O   . LYS A  1 53  ? 86.024  -31.668  -5.951  1.00 68.02  ? 53  LYS A O   1 
ATOM   381   C  CB  . LYS A  1 53  ? 88.791  -31.981  -7.851  1.00 41.17  ? 53  LYS A CB  1 
ATOM   382   C  CG  . LYS A  1 53  ? 88.630  -32.894  -9.054  1.00 50.88  ? 53  LYS A CG  1 
ATOM   383   C  CD  . LYS A  1 53  ? 88.460  -32.134  -10.351 1.00 46.53  ? 53  LYS A CD  1 
ATOM   384   C  CE  . LYS A  1 53  ? 88.547  -33.086  -11.532 1.00 55.31  ? 53  LYS A CE  1 
ATOM   385   N  NZ  . LYS A  1 53  ? 88.363  -32.425  -12.850 1.00 85.52  ? 53  LYS A NZ  1 
ATOM   386   N  N   . HIS A  1 54  ? 87.969  -30.717  -5.275  1.00 47.43  ? 54  HIS A N   1 
ATOM   387   C  CA  . HIS A  1 54  ? 87.646  -30.848  -3.862  1.00 49.57  ? 54  HIS A CA  1 
ATOM   388   C  C   . HIS A  1 54  ? 86.268  -30.279  -3.538  1.00 50.03  ? 54  HIS A C   1 
ATOM   389   O  O   . HIS A  1 54  ? 85.424  -30.941  -2.962  1.00 41.52  ? 54  HIS A O   1 
ATOM   390   C  CB  . HIS A  1 54  ? 88.703  -30.195  -2.991  1.00 25.71  ? 54  HIS A CB  1 
ATOM   391   C  CG  . HIS A  1 54  ? 88.473  -30.403  -1.532  1.00 41.74  ? 54  HIS A CG  1 
ATOM   392   N  ND1 . HIS A  1 54  ? 87.526  -29.694  -0.819  1.00 38.77  ? 54  HIS A ND1 1 
ATOM   393   C  CD2 . HIS A  1 54  ? 89.051  -31.257  -0.655  1.00 28.49  ? 54  HIS A CD2 1 
ATOM   394   C  CE1 . HIS A  1 54  ? 87.547  -30.091  0.441   1.00 57.65  ? 54  HIS A CE1 1 
ATOM   395   N  NE2 . HIS A  1 54  ? 88.462  -31.040  0.566   1.00 42.21  ? 54  HIS A NE2 1 
ATOM   396   N  N   . ALA A  1 55  ? 86.048  -29.041  -3.923  1.00 42.03  ? 55  ALA A N   1 
ATOM   397   C  CA  . ALA A  1 55  ? 84.741  -28.445  -3.783  1.00 52.30  ? 55  ALA A CA  1 
ATOM   398   C  C   . ALA A  1 55  ? 83.632  -29.383  -4.266  1.00 46.71  ? 55  ALA A C   1 
ATOM   399   O  O   . ALA A  1 55  ? 82.617  -29.561  -3.600  1.00 38.89  ? 55  ALA A O   1 
ATOM   400   C  CB  . ALA A  1 55  ? 84.701  -27.136  -4.539  1.00 57.64  ? 55  ALA A CB  1 
ATOM   401   N  N   . ILE A  1 56  ? 83.815  -29.977  -5.429  1.00 32.22  ? 56  ILE A N   1 
ATOM   402   C  CA  . ILE A  1 56  ? 82.814  -30.902  -5.928  1.00 53.70  ? 56  ILE A CA  1 
ATOM   403   C  C   . ILE A  1 56  ? 82.586  -32.032  -4.930  1.00 63.92  ? 56  ILE A C   1 
ATOM   404   O  O   . ILE A  1 56  ? 81.458  -32.250  -4.433  1.00 62.44  ? 56  ILE A O   1 
ATOM   405   C  CB  . ILE A  1 56  ? 83.228  -31.514  -7.266  1.00 33.13  ? 56  ILE A CB  1 
ATOM   406   C  CG1 . ILE A  1 56  ? 83.405  -30.410  -8.309  1.00 31.13  ? 56  ILE A CG1 1 
ATOM   407   C  CG2 . ILE A  1 56  ? 82.180  -32.520  -7.735  1.00 30.80  ? 56  ILE A CG2 1 
ATOM   408   C  CD1 . ILE A  1 56  ? 82.150  -30.071  -9.066  1.00 60.21  ? 56  ILE A CD1 1 
ATOM   409   N  N   . VAL A  1 57  ? 83.659  -32.759  -4.645  1.00 34.34  ? 57  VAL A N   1 
ATOM   410   C  CA  . VAL A  1 57  ? 83.567  -33.866  -3.699  1.00 48.00  ? 57  VAL A CA  1 
ATOM   411   C  C   . VAL A  1 57  ? 82.883  -33.484  -2.387  1.00 56.41  ? 57  VAL A C   1 
ATOM   412   O  O   . VAL A  1 57  ? 81.871  -34.094  -2.007  1.00 55.80  ? 57  VAL A O   1 
ATOM   413   C  CB  . VAL A  1 57  ? 84.935  -34.447  -3.393  1.00 34.34  ? 57  VAL A CB  1 
ATOM   414   C  CG1 . VAL A  1 57  ? 84.856  -35.415  -2.255  1.00 11.80  ? 57  VAL A CG1 1 
ATOM   415   C  CG2 . VAL A  1 57  ? 85.456  -35.135  -4.612  1.00 26.91  ? 57  VAL A CG2 1 
ATOM   416   N  N   . GLN A  1 58  ? 83.433  -32.481  -1.703  1.00 48.25  ? 58  GLN A N   1 
ATOM   417   C  CA  . GLN A  1 58  ? 82.847  -31.978  -0.465  1.00 53.41  ? 58  GLN A CA  1 
ATOM   418   C  C   . GLN A  1 58  ? 81.368  -31.727  -0.662  1.00 56.55  ? 58  GLN A C   1 
ATOM   419   O  O   . GLN A  1 58  ? 80.555  -32.263  0.090   1.00 49.35  ? 58  GLN A O   1 
ATOM   420   C  CB  . GLN A  1 58  ? 83.541  -30.702  0.041   1.00 39.15  ? 58  GLN A CB  1 
ATOM   421   C  CG  . GLN A  1 58  ? 83.003  -30.208  1.394   1.00 15.05  ? 58  GLN A CG  1 
ATOM   422   C  CD  . GLN A  1 58  ? 83.900  -29.207  2.065   1.00 53.49  ? 58  GLN A CD  1 
ATOM   423   O  OE1 . GLN A  1 58  ? 85.106  -29.189  1.841   1.00 63.65  ? 58  GLN A OE1 1 
ATOM   424   N  NE2 . GLN A  1 58  ? 83.316  -28.359  2.895   1.00 86.36  ? 58  GLN A NE2 1 
ATOM   425   N  N   . THR A  1 59  ? 81.013  -30.930  -1.671  1.00 22.01  ? 59  THR A N   1 
ATOM   426   C  CA  . THR A  1 59  ? 79.594  -30.701  -1.963  1.00 37.56  ? 59  THR A CA  1 
ATOM   427   C  C   . THR A  1 59  ? 78.750  -31.984  -1.979  1.00 44.61  ? 59  THR A C   1 
ATOM   428   O  O   . THR A  1 59  ? 77.695  -32.037  -1.331  1.00 38.26  ? 59  THR A O   1 
ATOM   429   C  CB  . THR A  1 59  ? 79.378  -29.901  -3.257  1.00 40.19  ? 59  THR A CB  1 
ATOM   430   O  OG1 . THR A  1 59  ? 79.465  -28.500  -2.956  1.00 46.82  ? 59  THR A OG1 1 
ATOM   431   C  CG2 . THR A  1 59  ? 77.993  -30.204  -3.838  1.00 17.33  ? 59  THR A CG2 1 
ATOM   432   N  N   . LEU A  1 60  ? 79.219  -33.012  -2.695  1.00 36.35  ? 60  LEU A N   1 
ATOM   433   C  CA  . LEU A  1 60  ? 78.529  -34.314  -2.708  1.00 45.26  ? 60  LEU A CA  1 
ATOM   434   C  C   . LEU A  1 60  ? 78.363  -34.945  -1.318  1.00 42.53  ? 60  LEU A C   1 
ATOM   435   O  O   . LEU A  1 60  ? 77.237  -35.246  -0.845  1.00 58.36  ? 60  LEU A O   1 
ATOM   436   C  CB  . LEU A  1 60  ? 79.253  -35.286  -3.630  1.00 37.42  ? 60  LEU A CB  1 
ATOM   437   C  CG  . LEU A  1 60  ? 79.216  -34.917  -5.114  1.00 40.79  ? 60  LEU A CG  1 
ATOM   438   C  CD1 . LEU A  1 60  ? 79.627  -36.103  -5.934  1.00 31.14  ? 60  LEU A CD1 1 
ATOM   439   C  CD2 . LEU A  1 60  ? 77.833  -34.480  -5.542  1.00 48.39  ? 60  LEU A CD2 1 
ATOM   440   N  N   . VAL A  1 61  ? 79.496  -35.144  -0.664  1.00 32.18  ? 61  VAL A N   1 
ATOM   441   C  CA  . VAL A  1 61  ? 79.491  -35.626  0.705   1.00 48.68  ? 61  VAL A CA  1 
ATOM   442   C  C   . VAL A  1 61  ? 78.490  -34.869  1.586   1.00 57.31  ? 61  VAL A C   1 
ATOM   443   O  O   . VAL A  1 61  ? 77.764  -35.483  2.360   1.00 63.39  ? 61  VAL A O   1 
ATOM   444   C  CB  . VAL A  1 61  ? 80.871  -35.534  1.334   1.00 44.37  ? 61  VAL A CB  1 
ATOM   445   C  CG1 . VAL A  1 61  ? 80.798  -36.011  2.766   1.00 28.73  ? 61  VAL A CG1 1 
ATOM   446   C  CG2 . VAL A  1 61  ? 81.857  -36.354  0.530   1.00 30.83  ? 61  VAL A CG2 1 
ATOM   447   N  N   . HIS A  1 62  ? 78.452  -33.545  1.469   1.00 30.05  ? 62  HIS A N   1 
ATOM   448   C  CA  . HIS A  1 62  ? 77.494  -32.744  2.210   1.00 41.40  ? 62  HIS A CA  1 
ATOM   449   C  C   . HIS A  1 62  ? 76.055  -33.135  1.865   1.00 43.78  ? 62  HIS A C   1 
ATOM   450   O  O   . HIS A  1 62  ? 75.188  -33.224  2.743   1.00 49.82  ? 62  HIS A O   1 
ATOM   451   C  CB  . HIS A  1 62  ? 77.698  -31.241  1.957   1.00 48.39  ? 62  HIS A CB  1 
ATOM   452   C  CG  . HIS A  1 62  ? 76.504  -30.410  2.324   1.00 48.84  ? 62  HIS A CG  1 
ATOM   453   N  ND1 . HIS A  1 62  ? 75.503  -30.102  1.426   1.00 55.16  ? 62  HIS A ND1 1 
ATOM   454   C  CD2 . HIS A  1 62  ? 76.128  -29.864  3.504   1.00 41.12  ? 62  HIS A CD2 1 
ATOM   455   C  CE1 . HIS A  1 62  ? 74.570  -29.390  2.031   1.00 59.27  ? 62  HIS A CE1 1 
ATOM   456   N  NE2 . HIS A  1 62  ? 74.925  -29.233  3.294   1.00 68.41  ? 62  HIS A NE2 1 
ATOM   457   N  N   . LEU A  1 63  ? 75.790  -33.339  0.583   1.00 39.86  ? 63  LEU A N   1 
ATOM   458   C  CA  . LEU A  1 63  ? 74.477  -33.802  0.182   1.00 41.11  ? 63  LEU A CA  1 
ATOM   459   C  C   . LEU A  1 63  ? 74.098  -35.056  0.956   1.00 59.80  ? 63  LEU A C   1 
ATOM   460   O  O   . LEU A  1 63  ? 72.922  -35.260  1.263   1.00 58.57  ? 63  LEU A O   1 
ATOM   461   C  CB  . LEU A  1 63  ? 74.459  -34.090  -1.305  1.00 33.21  ? 63  LEU A CB  1 
ATOM   462   C  CG  . LEU A  1 63  ? 74.448  -32.817  -2.122  1.00 34.02  ? 63  LEU A CG  1 
ATOM   463   C  CD1 . LEU A  1 63  ? 74.583  -33.153  -3.570  1.00 52.31  ? 63  LEU A CD1 1 
ATOM   464   C  CD2 . LEU A  1 63  ? 73.153  -32.110  -1.858  1.00 45.92  ? 63  LEU A CD2 1 
ATOM   465   N  N   . LYS A  1 64  ? 75.079  -35.907  1.262   1.00 57.27  ? 64  LYS A N   1 
ATOM   466   C  CA  . LYS A  1 64  ? 74.770  -37.093  2.080   1.00 46.68  ? 64  LYS A CA  1 
ATOM   467   C  C   . LYS A  1 64  ? 74.834  -36.891  3.613   1.00 46.25  ? 64  LYS A C   1 
ATOM   468   O  O   . LYS A  1 64  ? 74.203  -37.617  4.374   1.00 58.66  ? 64  LYS A O   1 
ATOM   469   C  CB  . LYS A  1 64  ? 75.623  -38.307  1.673   1.00 35.29  ? 64  LYS A CB  1 
ATOM   470   C  CG  . LYS A  1 64  ? 75.169  -39.618  2.353   1.00 51.42  ? 64  LYS A CG  1 
ATOM   471   C  CD  . LYS A  1 64  ? 75.877  -40.851  1.823   1.00 59.29  ? 64  LYS A CD  1 
ATOM   472   C  CE  . LYS A  1 64  ? 75.036  -42.115  1.989   1.00 70.56  ? 64  LYS A CE  1 
ATOM   473   N  NZ  . LYS A  1 64  ? 75.586  -43.231  1.168   1.00 84.09  ? 64  LYS A NZ  1 
ATOM   474   N  N   . PHE A  1 65  ? 75.605  -35.922  4.074   1.00 51.85  ? 65  PHE A N   1 
ATOM   475   C  CA  . PHE A  1 65  ? 75.780  -35.748  5.507   1.00 55.09  ? 65  PHE A CA  1 
ATOM   476   C  C   . PHE A  1 65  ? 75.646  -34.288  5.889   1.00 64.13  ? 65  PHE A C   1 
ATOM   477   O  O   . PHE A  1 65  ? 76.534  -33.704  6.509   1.00 60.95  ? 65  PHE A O   1 
ATOM   478   C  CB  . PHE A  1 65  ? 77.131  -36.286  5.940   1.00 47.52  ? 65  PHE A CB  1 
ATOM   479   C  CG  . PHE A  1 65  ? 77.319  -37.740  5.654   1.00 66.76  ? 65  PHE A CG  1 
ATOM   480   C  CD1 . PHE A  1 65  ? 77.733  -38.166  4.409   1.00 76.31  ? 65  PHE A CD1 1 
ATOM   481   C  CD2 . PHE A  1 65  ? 77.100  -38.684  6.635   1.00 73.08  ? 65  PHE A CD2 1 
ATOM   482   C  CE1 . PHE A  1 65  ? 77.917  -39.503  4.146   1.00 67.92  ? 65  PHE A CE1 1 
ATOM   483   C  CE2 . PHE A  1 65  ? 77.294  -40.016  6.374   1.00 71.74  ? 65  PHE A CE2 1 
ATOM   484   C  CZ  . PHE A  1 65  ? 77.702  -40.421  5.125   1.00 62.46  ? 65  PHE A CZ  1 
ATOM   485   N  N   . PRO A  1 66  ? 74.503  -33.703  5.540   1.00 58.08  ? 66  PRO A N   1 
ATOM   486   C  CA  . PRO A  1 66  ? 74.289  -32.267  5.646   1.00 46.08  ? 66  PRO A CA  1 
ATOM   487   C  C   . PRO A  1 66  ? 74.473  -31.757  7.065   1.00 59.15  ? 66  PRO A C   1 
ATOM   488   O  O   . PRO A  1 66  ? 74.435  -30.546  7.256   1.00 94.29  ? 66  PRO A O   1 
ATOM   489   C  CB  . PRO A  1 66  ? 72.837  -32.118  5.212   1.00 41.23  ? 66  PRO A CB  1 
ATOM   490   C  CG  . PRO A  1 66  ? 72.561  -33.306  4.393   1.00 32.03  ? 66  PRO A CG  1 
ATOM   491   C  CD  . PRO A  1 66  ? 73.293  -34.394  5.074   1.00 35.31  ? 66  PRO A CD  1 
ATOM   492   N  N   . THR A  1 67  ? 74.674  -32.646  8.032   1.00 54.50  ? 67  THR A N   1 
ATOM   493   C  CA  . THR A  1 67  ? 74.821  -32.219  9.411   1.00 55.52  ? 67  THR A CA  1 
ATOM   494   C  C   . THR A  1 67  ? 76.263  -32.294  9.864   1.00 61.92  ? 67  THR A C   1 
ATOM   495   O  O   . THR A  1 67  ? 76.645  -31.621  10.819  1.00 81.38  ? 67  THR A O   1 
ATOM   496   C  CB  . THR A  1 67  ? 73.907  -33.024  10.360  1.00 63.01  ? 67  THR A CB  1 
ATOM   497   O  OG1 . THR A  1 67  ? 74.291  -34.399  10.369  1.00 75.87  ? 67  THR A OG1 1 
ATOM   498   C  CG2 . THR A  1 67  ? 72.478  -32.949  9.885   1.00 32.74  ? 67  THR A CG2 1 
ATOM   499   N  N   . LYS A  1 68  ? 77.064  -33.097  9.166   1.00 55.80  ? 68  LYS A N   1 
ATOM   500   C  CA  . LYS A  1 68  ? 78.454  -33.309  9.563   1.00 56.15  ? 68  LYS A CA  1 
ATOM   501   C  C   . LYS A  1 68  ? 79.432  -32.586  8.633   1.00 58.75  ? 68  LYS A C   1 
ATOM   502   O  O   . LYS A  1 68  ? 80.543  -32.241  9.026   1.00 79.89  ? 68  LYS A O   1 
ATOM   503   C  CB  . LYS A  1 68  ? 78.754  -34.803  9.628   1.00 46.86  ? 68  LYS A CB  1 
ATOM   504   C  CG  . LYS A  1 68  ? 77.555  -35.684  10.003  1.00 72.23  ? 68  LYS A CG  1 
ATOM   505   C  CD  . LYS A  1 68  ? 77.387  -35.878  11.515  1.00 93.75  ? 68  LYS A CD  1 
ATOM   506   C  CE  . LYS A  1 68  ? 76.085  -36.621  11.859  1.00 91.58  ? 68  LYS A CE  1 
ATOM   507   N  NZ  . LYS A  1 68  ? 75.962  -37.931  11.152  1.00 84.35  ? 68  LYS A NZ  1 
ATOM   508   N  N   . VAL A  1 69  ? 78.984  -32.324  7.414   1.00 44.31  ? 69  VAL A N   1 
ATOM   509   C  CA  . VAL A  1 69  ? 79.810  -31.738  6.371   1.00 40.42  ? 69  VAL A CA  1 
ATOM   510   C  C   . VAL A  1 69  ? 79.112  -30.537  5.735   1.00 47.99  ? 69  VAL A C   1 
ATOM   511   O  O   . VAL A  1 69  ? 77.927  -30.597  5.424   1.00 53.32  ? 69  VAL A O   1 
ATOM   512   C  CB  . VAL A  1 69  ? 80.126  -32.791  5.286   1.00 44.71  ? 69  VAL A CB  1 
ATOM   513   C  CG1 . VAL A  1 69  ? 80.625  -32.151  4.017   1.00 74.00  ? 69  VAL A CG1 1 
ATOM   514   C  CG2 . VAL A  1 69  ? 81.145  -33.771  5.791   1.00 42.33  ? 69  VAL A CG2 1 
ATOM   515   N  N   . GLY A  1 70  ? 79.842  -29.443  5.535   1.00 35.56  ? 70  GLY A N   1 
ATOM   516   C  CA  . GLY A  1 70  ? 79.230  -28.230  5.020   1.00 52.54  ? 70  GLY A CA  1 
ATOM   517   C  C   . GLY A  1 70  ? 79.375  -27.996  3.529   1.00 55.38  ? 70  GLY A C   1 
ATOM   518   O  O   . GLY A  1 70  ? 80.232  -28.578  2.895   1.00 69.13  ? 70  GLY A O   1 
ATOM   519   N  N   . LYS A  1 71  ? 78.537  -27.135  2.961   1.00 54.79  ? 71  LYS A N   1 
ATOM   520   C  CA  . LYS A  1 71  ? 78.672  -26.770  1.552   1.00 56.04  ? 71  LYS A CA  1 
ATOM   521   C  C   . LYS A  1 71  ? 80.039  -26.141  1.314   1.00 61.22  ? 71  LYS A C   1 
ATOM   522   O  O   . LYS A  1 71  ? 80.757  -25.790  2.253   1.00 53.25  ? 71  LYS A O   1 
ATOM   523   C  CB  . LYS A  1 71  ? 77.593  -25.773  1.122   1.00 39.50  ? 71  LYS A CB  1 
ATOM   524   C  CG  . LYS A  1 71  ? 76.200  -26.046  1.649   1.00 42.01  ? 71  LYS A CG  1 
ATOM   525   C  CD  . LYS A  1 71  ? 75.184  -24.986  1.146   1.00 75.23  ? 71  LYS A CD  1 
ATOM   526   C  CE  . LYS A  1 71  ? 73.738  -25.258  1.588   1.00 99.74  ? 71  LYS A CE  1 
ATOM   527   N  NZ  . LYS A  1 71  ? 73.153  -26.467  0.928   1.00 119.12 ? 71  LYS A NZ  1 
ATOM   528   N  N   . ALA A  1 72  ? 80.406  -25.986  0.053   1.00 57.21  ? 72  ALA A N   1 
ATOM   529   C  CA  . ALA A  1 72  ? 81.605  -25.216  -0.251  1.00 61.24  ? 72  ALA A CA  1 
ATOM   530   C  C   . ALA A  1 72  ? 81.301  -23.759  0.026   1.00 66.07  ? 72  ALA A C   1 
ATOM   531   O  O   . ALA A  1 72  ? 80.130  -23.352  0.008   1.00 58.39  ? 72  ALA A O   1 
ATOM   532   C  CB  . ALA A  1 72  ? 81.999  -25.397  -1.693  1.00 55.27  ? 72  ALA A CB  1 
ATOM   533   N  N   . CYS A  1 73  ? 82.337  -22.964  0.275   1.00 54.81  ? 73  CYS A N   1 
ATOM   534   C  CA  . CYS A  1 73  ? 82.100  -21.549  0.568   1.00 55.83  ? 73  CYS A CA  1 
ATOM   535   C  C   . CYS A  1 73  ? 82.297  -20.675  -0.663  1.00 54.04  ? 73  CYS A C   1 
ATOM   536   O  O   . CYS A  1 73  ? 83.123  -20.992  -1.513  1.00 47.44  ? 73  CYS A O   1 
ATOM   537   C  CB  . CYS A  1 73  ? 82.964  -21.051  1.731   1.00 28.68  ? 73  CYS A CB  1 
ATOM   538   S  SG  . CYS A  1 73  ? 82.327  -19.598  2.583   1.00 102.68 ? 73  CYS A SG  1 
ATOM   539   N  N   . CYS A  1 74  ? 81.516  -19.594  -0.751  1.00 53.33  ? 74  CYS A N   1 
ATOM   540   C  CA  . CYS A  1 74  ? 81.632  -18.617  -1.829  1.00 39.35  ? 74  CYS A CA  1 
ATOM   541   C  C   . CYS A  1 74  ? 82.657  -17.565  -1.436  1.00 46.84  ? 74  CYS A C   1 
ATOM   542   O  O   . CYS A  1 74  ? 82.415  -16.758  -0.545  1.00 69.81  ? 74  CYS A O   1 
ATOM   543   C  CB  . CYS A  1 74  ? 80.281  -17.964  -2.108  1.00 31.55  ? 74  CYS A CB  1 
ATOM   544   S  SG  . CYS A  1 74  ? 80.247  -17.023  -3.619  1.00 75.46  ? 74  CYS A SG  1 
ATOM   545   N  N   . VAL A  1 75  ? 83.811  -17.584  -2.092  1.00 41.49  ? 75  VAL A N   1 
ATOM   546   C  CA  . VAL A  1 75  ? 84.929  -16.746  -1.677  1.00 50.67  ? 75  VAL A CA  1 
ATOM   547   C  C   . VAL A  1 75  ? 85.475  -15.978  -2.864  1.00 56.16  ? 75  VAL A C   1 
ATOM   548   O  O   . VAL A  1 75  ? 85.223  -16.347  -4.022  1.00 54.52  ? 75  VAL A O   1 
ATOM   549   C  CB  . VAL A  1 75  ? 86.077  -17.590  -1.070  1.00 41.52  ? 75  VAL A CB  1 
ATOM   550   C  CG1 . VAL A  1 75  ? 85.694  -18.128  0.296   1.00 31.89  ? 75  VAL A CG1 1 
ATOM   551   C  CG2 . VAL A  1 75  ? 86.449  -18.729  -2.017  1.00 41.08  ? 75  VAL A CG2 1 
ATOM   552   N  N   . PRO A  1 76  ? 86.215  -14.894  -2.581  1.00 51.04  ? 76  PRO A N   1 
ATOM   553   C  CA  . PRO A  1 76  ? 86.909  -14.179  -3.647  1.00 59.70  ? 76  PRO A CA  1 
ATOM   554   C  C   . PRO A  1 76  ? 87.997  -15.098  -4.185  1.00 55.74  ? 76  PRO A C   1 
ATOM   555   O  O   . PRO A  1 76  ? 88.771  -15.618  -3.405  1.00 32.73  ? 76  PRO A O   1 
ATOM   556   C  CB  . PRO A  1 76  ? 87.531  -12.979  -2.915  1.00 41.59  ? 76  PRO A CB  1 
ATOM   557   C  CG  . PRO A  1 76  ? 86.827  -12.888  -1.628  1.00 53.96  ? 76  PRO A CG  1 
ATOM   558   C  CD  . PRO A  1 76  ? 86.470  -14.289  -1.267  1.00 44.74  ? 76  PRO A CD  1 
ATOM   559   N  N   . THR A  1 77  ? 88.032  -15.314  -5.490  1.00 50.06  ? 77  THR A N   1 
ATOM   560   C  CA  . THR A  1 77  ? 89.019  -16.197  -6.084  1.00 27.68  ? 77  THR A CA  1 
ATOM   561   C  C   . THR A  1 77  ? 90.139  -15.425  -6.796  1.00 50.50  ? 77  THR A C   1 
ATOM   562   O  O   . THR A  1 77  ? 91.215  -15.983  -7.033  1.00 45.33  ? 77  THR A O   1 
ATOM   563   C  CB  . THR A  1 77  ? 88.355  -17.199  -7.072  1.00 54.84  ? 77  THR A CB  1 
ATOM   564   O  OG1 . THR A  1 77  ? 87.716  -16.504  -8.158  1.00 61.01  ? 77  THR A OG1 1 
ATOM   565   C  CG2 . THR A  1 77  ? 87.330  -18.025  -6.353  1.00 53.84  ? 77  THR A CG2 1 
ATOM   566   N  N   . LYS A  1 78  ? 89.874  -14.159  -7.145  1.00 51.86  ? 78  LYS A N   1 
ATOM   567   C  CA  . LYS A  1 78  ? 90.862  -13.280  -7.773  1.00 51.12  ? 78  LYS A CA  1 
ATOM   568   C  C   . LYS A  1 78  ? 90.746  -11.882  -7.172  1.00 60.53  ? 78  LYS A C   1 
ATOM   569   O  O   . LYS A  1 78  ? 89.642  -11.411  -6.933  1.00 47.43  ? 78  LYS A O   1 
ATOM   570   C  CB  . LYS A  1 78  ? 90.666  -13.220  -9.294  1.00 42.47  ? 78  LYS A CB  1 
ATOM   571   C  CG  . LYS A  1 78  ? 91.774  -12.479  -10.044 1.00 62.46  ? 78  LYS A CG  1 
ATOM   572   C  CD  . LYS A  1 78  ? 91.500  -12.431  -11.530 1.00 61.57  ? 78  LYS A CD  1 
ATOM   573   C  CE  . LYS A  1 78  ? 92.587  -11.698  -12.288 1.00 80.63  ? 78  LYS A CE  1 
ATOM   574   N  NZ  . LYS A  1 78  ? 92.276  -11.625  -13.751 1.00 100.81 ? 78  LYS A NZ  1 
ATOM   575   N  N   . LEU A  1 79  ? 91.877  -11.214  -6.938  1.00 59.59  ? 79  LEU A N   1 
ATOM   576   C  CA  . LEU A  1 79  ? 91.846  -9.914   -6.278  1.00 51.05  ? 79  LEU A CA  1 
ATOM   577   C  C   . LEU A  1 79  ? 92.565  -8.766   -6.991  1.00 72.03  ? 79  LEU A C   1 
ATOM   578   O  O   . LEU A  1 79  ? 93.782  -8.806   -7.195  1.00 95.47  ? 79  LEU A O   1 
ATOM   579   C  CB  . LEU A  1 79  ? 92.387  -10.046  -4.862  1.00 41.54  ? 79  LEU A CB  1 
ATOM   580   C  CG  . LEU A  1 79  ? 91.452  -10.741  -3.877  1.00 41.04  ? 79  LEU A CG  1 
ATOM   581   C  CD1 . LEU A  1 79  ? 92.085  -10.860  -2.502  1.00 19.57  ? 79  LEU A CD1 1 
ATOM   582   C  CD2 . LEU A  1 79  ? 90.175  -9.962   -3.787  1.00 64.79  ? 79  LEU A CD2 1 
ATOM   583   N  N   . SER A  1 80  ? 91.802  -7.728   -7.334  1.00 63.57  ? 80  SER A N   1 
ATOM   584   C  CA  . SER A  1 80  ? 92.368  -6.487   -7.857  1.00 64.10  ? 80  SER A CA  1 
ATOM   585   C  C   . SER A  1 80  ? 92.882  -5.589   -6.724  1.00 60.47  ? 80  SER A C   1 
ATOM   586   O  O   . SER A  1 80  ? 92.383  -5.625   -5.603  1.00 53.08  ? 80  SER A O   1 
ATOM   587   C  CB  . SER A  1 80  ? 91.329  -5.724   -8.691  1.00 69.83  ? 80  SER A CB  1 
ATOM   588   O  OG  . SER A  1 80  ? 91.095  -6.329   -9.948  1.00 84.43  ? 80  SER A OG  1 
ATOM   589   N  N   . PRO A  1 81  ? 93.890  -4.777   -7.023  1.00 54.17  ? 81  PRO A N   1 
ATOM   590   C  CA  . PRO A  1 81  ? 94.380  -3.734   -6.132  1.00 63.66  ? 81  PRO A CA  1 
ATOM   591   C  C   . PRO A  1 81  ? 93.638  -2.431   -6.394  1.00 62.38  ? 81  PRO A C   1 
ATOM   592   O  O   . PRO A  1 81  ? 92.961  -2.284   -7.420  1.00 52.48  ? 81  PRO A O   1 
ATOM   593   C  CB  . PRO A  1 81  ? 95.806  -3.557   -6.615  1.00 62.19  ? 81  PRO A CB  1 
ATOM   594   C  CG  . PRO A  1 81  ? 95.688  -3.739   -8.086  1.00 38.41  ? 81  PRO A CG  1 
ATOM   595   C  CD  . PRO A  1 81  ? 94.682  -4.849   -8.259  1.00 37.41  ? 81  PRO A CD  1 
ATOM   596   N  N   . ILE A  1 82  ? 93.779  -1.479   -5.481  1.00 53.95  ? 82  ILE A N   1 
ATOM   597   C  CA  . ILE A  1 82  ? 93.245  -0.144   -5.693  1.00 61.87  ? 82  ILE A CA  1 
ATOM   598   C  C   . ILE A  1 82  ? 94.339  0.832    -5.401  1.00 60.67  ? 82  ILE A C   1 
ATOM   599   O  O   . ILE A  1 82  ? 95.365  0.452    -4.858  1.00 62.82  ? 82  ILE A O   1 
ATOM   600   C  CB  . ILE A  1 82  ? 92.096  0.158    -4.746  1.00 45.33  ? 82  ILE A CB  1 
ATOM   601   C  CG1 . ILE A  1 82  ? 92.576  0.077    -3.305  1.00 33.22  ? 82  ILE A CG1 1 
ATOM   602   C  CG2 . ILE A  1 82  ? 91.013  -0.845   -4.949  1.00 34.58  ? 82  ILE A CG2 1 
ATOM   603   C  CD1 . ILE A  1 82  ? 91.539  0.387    -2.309  1.00 34.54  ? 82  ILE A CD1 1 
ATOM   604   N  N   . SER A  1 83  ? 94.119  2.092    -5.744  1.00 52.59  ? 83  SER A N   1 
ATOM   605   C  CA  . SER A  1 83  ? 95.116  3.105    -5.458  1.00 57.83  ? 83  SER A CA  1 
ATOM   606   C  C   . SER A  1 83  ? 94.726  3.877    -4.219  1.00 60.93  ? 83  SER A C   1 
ATOM   607   O  O   . SER A  1 83  ? 93.544  4.150    -4.003  1.00 82.20  ? 83  SER A O   1 
ATOM   608   C  CB  . SER A  1 83  ? 95.255  4.037    -6.644  1.00 59.70  ? 83  SER A CB  1 
ATOM   609   O  OG  . SER A  1 83  ? 95.955  3.389    -7.676  1.00 53.29  ? 83  SER A OG  1 
ATOM   610   N  N   . VAL A  1 84  ? 95.706  4.202    -3.386  1.00 35.96  ? 84  VAL A N   1 
ATOM   611   C  CA  . VAL A  1 84  ? 95.416  5.054    -2.249  1.00 53.12  ? 84  VAL A CA  1 
ATOM   612   C  C   . VAL A  1 84  ? 96.520  6.062    -1.924  1.00 49.84  ? 84  VAL A C   1 
ATOM   613   O  O   . VAL A  1 84  ? 97.714  5.775    -2.047  1.00 61.69  ? 84  VAL A O   1 
ATOM   614   C  CB  . VAL A  1 84  ? 95.032  4.243    -0.998  1.00 51.74  ? 84  VAL A CB  1 
ATOM   615   C  CG1 . VAL A  1 84  ? 94.225  3.036    -1.403  1.00 64.29  ? 84  VAL A CG1 1 
ATOM   616   C  CG2 . VAL A  1 84  ? 96.247  3.815    -0.223  1.00 18.37  ? 84  VAL A CG2 1 
ATOM   617   N  N   . LEU A  1 85  ? 96.082  7.255    -1.532  1.00 41.93  ? 85  LEU A N   1 
ATOM   618   C  CA  . LEU A  1 85  ? 96.954  8.323    -1.100  1.00 53.20  ? 85  LEU A CA  1 
ATOM   619   C  C   . LEU A  1 85  ? 96.902  8.358    0.415   1.00 59.83  ? 85  LEU A C   1 
ATOM   620   O  O   . LEU A  1 85  ? 95.844  8.583    0.998   1.00 58.97  ? 85  LEU A O   1 
ATOM   621   C  CB  . LEU A  1 85  ? 96.438  9.643    -1.669  1.00 53.13  ? 85  LEU A CB  1 
ATOM   622   C  CG  . LEU A  1 85  ? 97.312  10.880   -1.487  1.00 39.94  ? 85  LEU A CG  1 
ATOM   623   C  CD1 . LEU A  1 85  ? 98.651  10.575   -2.041  1.00 40.38  ? 85  LEU A CD1 1 
ATOM   624   C  CD2 . LEU A  1 85  ? 96.737  12.027   -2.231  1.00 27.04  ? 85  LEU A CD2 1 
ATOM   625   N  N   . TYR A  1 86  ? 98.038  8.130    1.058   1.00 41.48  ? 86  TYR A N   1 
ATOM   626   C  CA  . TYR A  1 86  ? 98.058  8.022    2.510   1.00 55.36  ? 86  TYR A CA  1 
ATOM   627   C  C   . TYR A  1 86  ? 99.197  8.777    3.182   1.00 56.20  ? 86  TYR A C   1 
ATOM   628   O  O   . TYR A  1 86  ? 100.191 9.109    2.560   1.00 71.38  ? 86  TYR A O   1 
ATOM   629   C  CB  . TYR A  1 86  ? 98.161  6.570    2.909   1.00 69.51  ? 86  TYR A CB  1 
ATOM   630   C  CG  . TYR A  1 86  ? 99.521  5.995    2.633   1.00 62.50  ? 86  TYR A CG  1 
ATOM   631   C  CD1 . TYR A  1 86  ? 100.483 5.952    3.621   1.00 68.60  ? 86  TYR A CD1 1 
ATOM   632   C  CD2 . TYR A  1 86  ? 99.847  5.492    1.374   1.00 55.35  ? 86  TYR A CD2 1 
ATOM   633   C  CE1 . TYR A  1 86  ? 101.730 5.414    3.371   1.00 78.40  ? 86  TYR A CE1 1 
ATOM   634   C  CE2 . TYR A  1 86  ? 101.093 4.949    1.112   1.00 46.11  ? 86  TYR A CE2 1 
ATOM   635   C  CZ  . TYR A  1 86  ? 102.029 4.919    2.113   1.00 62.83  ? 86  TYR A CZ  1 
ATOM   636   O  OH  . TYR A  1 86  ? 103.271 4.393    1.860   1.00 49.60  ? 86  TYR A OH  1 
ATOM   637   N  N   . LYS A  1 87  ? 99.045  9.029    4.473   1.00 55.37  ? 87  LYS A N   1 
ATOM   638   C  CA  . LYS A  1 87  ? 100.029 9.796    5.212   1.00 57.14  ? 87  LYS A CA  1 
ATOM   639   C  C   . LYS A  1 87  ? 101.235 8.919    5.568   1.00 75.72  ? 87  LYS A C   1 
ATOM   640   O  O   . LYS A  1 87  ? 101.090 7.858    6.163   1.00 64.50  ? 87  LYS A O   1 
ATOM   641   C  CB  . LYS A  1 87  ? 99.415  10.430   6.476   1.00 40.73  ? 87  LYS A CB  1 
ATOM   642   C  CG  . LYS A  1 87  ? 98.597  11.690   6.246   1.00 53.78  ? 87  LYS A CG  1 
ATOM   643   C  CD  . LYS A  1 87  ? 97.852  12.153   7.529   1.00 94.63  ? 87  LYS A CD  1 
ATOM   644   C  CE  . LYS A  1 87  ? 96.792  13.246   7.235   1.00 108.64 ? 87  LYS A CE  1 
ATOM   645   N  NZ  . LYS A  1 87  ? 95.557  13.187   8.099   1.00 95.76  ? 87  LYS A NZ  1 
ATOM   646   N  N   . ASP A  1 88  ? 102.416 9.393    5.176   1.00 95.67  ? 88  ASP A N   1 
ATOM   647   C  CA  . ASP A  1 88  ? 103.713 8.832    5.539   1.00 85.55  ? 88  ASP A CA  1 
ATOM   648   C  C   . ASP A  1 88  ? 103.812 8.563    7.027   1.00 92.78  ? 88  ASP A C   1 
ATOM   649   O  O   . ASP A  1 88  ? 102.913 8.897    7.783   1.00 92.32  ? 88  ASP A O   1 
ATOM   650   C  CB  . ASP A  1 88  ? 104.800 9.840    5.174   1.00 97.21  ? 88  ASP A CB  1 
ATOM   651   C  CG  . ASP A  1 88  ? 106.104 9.185    4.777   1.00 127.54 ? 88  ASP A CG  1 
ATOM   652   O  OD1 . ASP A  1 88  ? 106.445 8.130    5.351   1.00 144.77 ? 88  ASP A OD1 1 
ATOM   653   O  OD2 . ASP A  1 88  ? 106.791 9.732    3.884   1.00 130.67 ? 88  ASP A OD2 1 
ATOM   654   N  N   . ASP A  1 89  ? 104.913 7.957    7.453   1.00 107.02 ? 89  ASP A N   1 
ATOM   655   C  CA  . ASP A  1 89  ? 105.172 7.801    8.875   1.00 100.80 ? 89  ASP A CA  1 
ATOM   656   C  C   . ASP A  1 89  ? 105.463 9.186    9.428   1.00 91.13  ? 89  ASP A C   1 
ATOM   657   O  O   . ASP A  1 89  ? 105.453 9.398    10.636  1.00 91.87  ? 89  ASP A O   1 
ATOM   658   C  CB  . ASP A  1 89  ? 106.352 6.861    9.127   1.00 112.52 ? 89  ASP A CB  1 
ATOM   659   C  CG  . ASP A  1 89  ? 106.050 5.434    8.752   1.00 126.79 ? 89  ASP A CG  1 
ATOM   660   O  OD1 . ASP A  1 89  ? 106.462 5.007    7.648   1.00 124.92 ? 89  ASP A OD1 1 
ATOM   661   O  OD2 . ASP A  1 89  ? 105.397 4.745    9.565   1.00 130.73 ? 89  ASP A OD2 1 
ATOM   662   N  N   . MET A  1 90  ? 105.722 10.131   8.529   1.00 86.80  ? 90  MET A N   1 
ATOM   663   C  CA  . MET A  1 90  ? 105.983 11.504   8.930   1.00 93.72  ? 90  MET A CA  1 
ATOM   664   C  C   . MET A  1 90  ? 105.021 12.449   8.265   1.00 89.67  ? 90  MET A C   1 
ATOM   665   O  O   . MET A  1 90  ? 105.338 13.611   8.018   1.00 75.15  ? 90  MET A O   1 
ATOM   666   C  CB  . MET A  1 90  ? 107.404 11.914   8.599   1.00 101.60 ? 90  MET A CB  1 
ATOM   667   C  CG  . MET A  1 90  ? 108.395 11.437   9.613   1.00 105.16 ? 90  MET A CG  1 
ATOM   668   S  SD  . MET A  1 90  ? 110.008 11.544   8.896   1.00 96.46  ? 90  MET A SD  1 
ATOM   669   C  CE  . MET A  1 90  ? 109.705 10.612   7.375   1.00 131.01 ? 90  MET A CE  1 
ATOM   670   N  N   . GLY A  1 91  ? 103.842 11.927   7.965   1.00 87.01  ? 91  GLY A N   1 
ATOM   671   C  CA  . GLY A  1 91  ? 102.724 12.751   7.546   1.00 88.79  ? 91  GLY A CA  1 
ATOM   672   C  C   . GLY A  1 91  ? 102.853 13.359   6.169   1.00 77.79  ? 91  GLY A C   1 
ATOM   673   O  O   . GLY A  1 91  ? 102.300 14.426   5.892   1.00 79.18  ? 91  GLY A O   1 
ATOM   674   N  N   . VAL A  1 92  ? 103.580 12.671   5.302   1.00 68.18  ? 92  VAL A N   1 
ATOM   675   C  CA  . VAL A  1 92  ? 103.718 13.101   3.924   1.00 60.22  ? 92  VAL A CA  1 
ATOM   676   C  C   . VAL A  1 92  ? 102.769 12.340   3.002   1.00 73.30  ? 92  VAL A C   1 
ATOM   677   O  O   . VAL A  1 92  ? 102.815 11.116   2.914   1.00 91.76  ? 92  VAL A O   1 
ATOM   678   C  CB  . VAL A  1 92  ? 105.128 12.860   3.453   1.00 63.42  ? 92  VAL A CB  1 
ATOM   679   C  CG1 . VAL A  1 92  ? 105.436 13.735   2.270   1.00 73.41  ? 92  VAL A CG1 1 
ATOM   680   C  CG2 . VAL A  1 92  ? 106.081 13.124   4.584   1.00 75.09  ? 92  VAL A CG2 1 
ATOM   681   N  N   . PRO A  1 93  ? 101.896 13.063   2.313   1.00 57.07  ? 93  PRO A N   1 
ATOM   682   C  CA  . PRO A  1 93  ? 101.046 12.379   1.359   1.00 62.01  ? 93  PRO A CA  1 
ATOM   683   C  C   . PRO A  1 93  ? 101.911 11.591   0.388   1.00 58.22  ? 93  PRO A C   1 
ATOM   684   O  O   . PRO A  1 93  ? 102.670 12.169   -0.368  1.00 65.91  ? 93  PRO A O   1 
ATOM   685   C  CB  . PRO A  1 93  ? 100.341 13.537   0.641   1.00 57.91  ? 93  PRO A CB  1 
ATOM   686   C  CG  . PRO A  1 93  ? 100.304 14.602   1.617   1.00 49.96  ? 93  PRO A CG  1 
ATOM   687   C  CD  . PRO A  1 93  ? 101.614 14.500   2.356   1.00 70.30  ? 93  PRO A CD  1 
ATOM   688   N  N   . THR A  1 94  ? 101.807 10.272   0.426   1.00 47.60  ? 94  THR A N   1 
ATOM   689   C  CA  . THR A  1 94  ? 102.433 9.435    -0.587  1.00 66.84  ? 94  THR A CA  1 
ATOM   690   C  C   . THR A  1 94  ? 101.434 8.437    -1.200  1.00 63.47  ? 94  THR A C   1 
ATOM   691   O  O   . THR A  1 94  ? 100.297 8.302    -0.739  1.00 52.08  ? 94  THR A O   1 
ATOM   692   C  CB  . THR A  1 94  ? 103.627 8.689    -0.006  1.00 73.63  ? 94  THR A CB  1 
ATOM   693   O  OG1 . THR A  1 94  ? 103.166 7.624    0.826   1.00 49.42  ? 94  THR A OG1 1 
ATOM   694   C  CG2 . THR A  1 94  ? 104.484 9.640    0.817   1.00 83.48  ? 94  THR A CG2 1 
ATOM   695   N  N   . LEU A  1 95  ? 101.847 7.726    -2.238  1.00 41.98  ? 95  LEU A N   1 
ATOM   696   C  CA  . LEU A  1 95  ? 100.872 6.963    -3.001  1.00 46.32  ? 95  LEU A CA  1 
ATOM   697   C  C   . LEU A  1 95  ? 101.197 5.488    -3.216  1.00 61.18  ? 95  LEU A C   1 
ATOM   698   O  O   . LEU A  1 95  ? 102.169 5.165    -3.892  1.00 84.29  ? 95  LEU A O   1 
ATOM   699   C  CB  . LEU A  1 95  ? 100.687 7.614    -4.367  1.00 47.79  ? 95  LEU A CB  1 
ATOM   700   C  CG  . LEU A  1 95  ? 100.011 6.749    -5.432  1.00 46.75  ? 95  LEU A CG  1 
ATOM   701   C  CD1 . LEU A  1 95  ? 98.582  6.512    -5.040  1.00 89.51  ? 95  LEU A CD1 1 
ATOM   702   C  CD2 . LEU A  1 95  ? 100.079 7.383    -6.796  1.00 35.91  ? 95  LEU A CD2 1 
ATOM   703   N  N   . LYS A  1 96  ? 100.386 4.573    -2.685  1.00 50.69  ? 96  LYS A N   1 
ATOM   704   C  CA  . LYS A  1 96  ? 100.475 3.217    -3.229  1.00 59.16  ? 96  LYS A CA  1 
ATOM   705   C  C   . LYS A  1 96  ? 99.506  3.070    -4.387  1.00 63.19  ? 96  LYS A C   1 
ATOM   706   O  O   . LYS A  1 96  ? 98.289  3.133    -4.207  1.00 68.62  ? 96  LYS A O   1 
ATOM   707   C  CB  . LYS A  1 96  ? 100.305 2.083    -2.202  1.00 39.73  ? 96  LYS A CB  1 
ATOM   708   C  CG  . LYS A  1 96  ? 101.021 0.739    -2.680  1.00 38.46  ? 96  LYS A CG  1 
ATOM   709   C  CD  . LYS A  1 96  ? 102.388 1.025    -3.431  1.00 175.09 ? 96  LYS A CD  1 
ATOM   710   C  CE  . LYS A  1 96  ? 102.450 0.597    -4.945  1.00 82.71  ? 96  LYS A CE  1 
ATOM   711   N  NZ  . LYS A  1 96  ? 103.186 1.549    -5.917  1.00 29.94  ? 96  LYS A NZ  1 
ATOM   712   N  N   . TYR A  1 97  ? 100.065 2.906    -5.579  1.00 35.51  ? 97  TYR A N   1 
ATOM   713   C  CA  . TYR A  1 97  ? 99.272  2.800    -6.784  1.00 42.33  ? 97  TYR A CA  1 
ATOM   714   C  C   . TYR A  1 97  ? 98.745  1.403    -6.917  1.00 48.57  ? 97  TYR A C   1 
ATOM   715   O  O   . TYR A  1 97  ? 97.599  1.211    -7.277  1.00 68.60  ? 97  TYR A O   1 
ATOM   716   C  CB  . TYR A  1 97  ? 100.103 3.166    -8.001  1.00 42.38  ? 97  TYR A CB  1 
ATOM   717   C  CG  . TYR A  1 97  ? 99.403  2.999    -9.321  1.00 38.00  ? 97  TYR A CG  1 
ATOM   718   C  CD1 . TYR A  1 97  ? 98.284  3.742    -9.644  1.00 60.91  ? 97  TYR A CD1 1 
ATOM   719   C  CD2 . TYR A  1 97  ? 99.890  2.136    -10.262 1.00 30.75  ? 97  TYR A CD2 1 
ATOM   720   C  CE1 . TYR A  1 97  ? 97.652  3.587    -10.873 1.00 66.55  ? 97  TYR A CE1 1 
ATOM   721   C  CE2 . TYR A  1 97  ? 99.272  1.970    -11.479 1.00 60.38  ? 97  TYR A CE2 1 
ATOM   722   C  CZ  . TYR A  1 97  ? 98.160  2.687    -11.783 1.00 68.83  ? 97  TYR A CZ  1 
ATOM   723   O  OH  . TYR A  1 97  ? 97.572  2.497    -13.006 1.00 82.35  ? 97  TYR A OH  1 
ATOM   724   N  N   . HIS A  1 98  ? 99.587  0.422    -6.622  1.00 77.27  ? 98  HIS A N   1 
ATOM   725   C  CA  . HIS A  1 98  ? 99.207  -0.991   -6.668  1.00 69.39  ? 98  HIS A CA  1 
ATOM   726   C  C   . HIS A  1 98  ? 99.099  -1.545   -5.251  1.00 70.14  ? 98  HIS A C   1 
ATOM   727   O  O   . HIS A  1 98  ? 99.963  -2.295   -4.809  1.00 104.12 ? 98  HIS A O   1 
ATOM   728   C  CB  . HIS A  1 98  ? 100.227 -1.800   -7.487  1.00 66.42  ? 98  HIS A CB  1 
ATOM   729   C  CG  . HIS A  1 98  ? 99.761  -2.139   -8.871  1.00 108.74 ? 98  HIS A CG  1 
ATOM   730   N  ND1 . HIS A  1 98  ? 99.576  -3.437   -9.295  1.00 136.90 ? 98  HIS A ND1 1 
ATOM   731   C  CD2 . HIS A  1 98  ? 99.429  -1.355   -9.925  1.00 117.25 ? 98  HIS A CD2 1 
ATOM   732   C  CE1 . HIS A  1 98  ? 99.155  -3.439   -10.548 1.00 127.80 ? 98  HIS A CE1 1 
ATOM   733   N  NE2 . HIS A  1 98  ? 99.058  -2.187   -10.954 1.00 114.93 ? 98  HIS A NE2 1 
ATOM   734   N  N   . TYR A  1 99  ? 98.048  -1.150   -4.535  1.00 44.08  ? 99  TYR A N   1 
ATOM   735   C  CA  . TYR A  1 99  ? 97.790  -1.615   -3.163  1.00 40.76  ? 99  TYR A CA  1 
ATOM   736   C  C   . TYR A  1 99  ? 97.050  -2.917   -3.246  1.00 55.41  ? 99  TYR A C   1 
ATOM   737   O  O   . TYR A  1 99  ? 95.843  -2.943   -3.490  1.00 53.58  ? 99  TYR A O   1 
ATOM   738   C  CB  . TYR A  1 99  ? 96.936  -0.617   -2.389  1.00 46.27  ? 99  TYR A CB  1 
ATOM   739   C  CG  . TYR A  1 99  ? 96.863  -0.882   -0.913  1.00 41.31  ? 99  TYR A CG  1 
ATOM   740   C  CD1 . TYR A  1 99  ? 96.040  -0.130   -0.102  1.00 40.15  ? 99  TYR A CD1 1 
ATOM   741   C  CD2 . TYR A  1 99  ? 97.623  -1.882   -0.324  1.00 67.59  ? 99  TYR A CD2 1 
ATOM   742   C  CE1 . TYR A  1 99  ? 95.956  -0.370   1.260   1.00 41.86  ? 99  TYR A CE1 1 
ATOM   743   C  CE2 . TYR A  1 99  ? 97.551  -2.128   1.049   1.00 77.28  ? 99  TYR A CE2 1 
ATOM   744   C  CZ  . TYR A  1 99  ? 96.711  -1.362   1.840   1.00 59.92  ? 99  TYR A CZ  1 
ATOM   745   O  OH  . TYR A  1 99  ? 96.624  -1.585   3.205   1.00 61.76  ? 99  TYR A OH  1 
ATOM   746   N  N   . GLU A  1 100 ? 97.772  -4.006   -3.025  1.00 61.15  ? 100 GLU A N   1 
ATOM   747   C  CA  . GLU A  1 100 ? 97.302  -5.301   -3.488  1.00 55.09  ? 100 GLU A CA  1 
ATOM   748   C  C   . GLU A  1 100 ? 96.175  -5.913   -2.676  1.00 53.50  ? 100 GLU A C   1 
ATOM   749   O  O   . GLU A  1 100 ? 96.145  -5.767   -1.458  1.00 48.50  ? 100 GLU A O   1 
ATOM   750   C  CB  . GLU A  1 100 ? 98.471  -6.275   -3.643  1.00 47.53  ? 100 GLU A CB  1 
ATOM   751   C  CG  . GLU A  1 100 ? 99.334  -6.030   -4.885  1.00 74.96  ? 100 GLU A CG  1 
ATOM   752   C  CD  . GLU A  1 100 ? 98.567  -6.169   -6.204  1.00 92.14  ? 100 GLU A CD  1 
ATOM   753   O  OE1 . GLU A  1 100 ? 97.384  -6.597   -6.186  1.00 107.57 ? 100 GLU A OE1 1 
ATOM   754   O  OE2 . GLU A  1 100 ? 99.156  -5.855   -7.265  1.00 54.12  ? 100 GLU A OE2 1 
ATOM   755   N  N   . GLY A  1 101 ? 95.249  -6.568   -3.385  1.00 60.83  ? 101 GLY A N   1 
ATOM   756   C  CA  . GLY A  1 101 ? 94.230  -7.422   -2.797  1.00 47.01  ? 101 GLY A CA  1 
ATOM   757   C  C   . GLY A  1 101 ? 93.166  -6.755   -1.948  1.00 50.07  ? 101 GLY A C   1 
ATOM   758   O  O   . GLY A  1 101 ? 92.876  -7.227   -0.856  1.00 50.86  ? 101 GLY A O   1 
ATOM   759   N  N   . MET A  1 102 ? 92.572  -5.674   -2.450  1.00 47.28  ? 102 MET A N   1 
ATOM   760   C  CA  . MET A  1 102 ? 91.583  -4.914   -1.681  1.00 44.73  ? 102 MET A CA  1 
ATOM   761   C  C   . MET A  1 102 ? 90.195  -4.966   -2.299  1.00 49.61  ? 102 MET A C   1 
ATOM   762   O  O   . MET A  1 102 ? 89.231  -4.513   -1.713  1.00 53.68  ? 102 MET A O   1 
ATOM   763   C  CB  . MET A  1 102 ? 92.002  -3.455   -1.583  1.00 44.25  ? 102 MET A CB  1 
ATOM   764   C  CG  . MET A  1 102 ? 93.270  -3.218   -0.852  1.00 45.08  ? 102 MET A CG  1 
ATOM   765   S  SD  . MET A  1 102 ? 92.925  -2.980   0.869   1.00 71.06  ? 102 MET A SD  1 
ATOM   766   C  CE  . MET A  1 102 ? 91.749  -1.666   0.857   1.00 46.95  ? 102 MET A CE  1 
ATOM   767   N  N   . SER A  1 103 ? 90.095  -5.491   -3.504  1.00 45.70  ? 103 SER A N   1 
ATOM   768   C  CA  . SER A  1 103 ? 88.822  -5.481   -4.188  1.00 52.73  ? 103 SER A CA  1 
ATOM   769   C  C   . SER A  1 103 ? 88.640  -6.821   -4.862  1.00 73.44  ? 103 SER A C   1 
ATOM   770   O  O   . SER A  1 103 ? 89.614  -7.444   -5.310  1.00 72.64  ? 103 SER A O   1 
ATOM   771   C  CB  . SER A  1 103 ? 88.783  -4.360   -5.220  1.00 45.15  ? 103 SER A CB  1 
ATOM   772   O  OG  . SER A  1 103 ? 87.540  -4.306   -5.874  1.00 67.52  ? 103 SER A OG  1 
ATOM   773   N  N   . VAL A  1 104 ? 87.395  -7.275   -4.931  1.00 65.64  ? 104 VAL A N   1 
ATOM   774   C  CA  . VAL A  1 104 ? 87.129  -8.573   -5.517  1.00 40.84  ? 104 VAL A CA  1 
ATOM   775   C  C   . VAL A  1 104 ? 87.073  -8.547   -7.037  1.00 49.99  ? 104 VAL A C   1 
ATOM   776   O  O   . VAL A  1 104 ? 86.363  -7.753   -7.637  1.00 57.23  ? 104 VAL A O   1 
ATOM   777   C  CB  . VAL A  1 104 ? 85.842  -9.155   -5.005  1.00 36.35  ? 104 VAL A CB  1 
ATOM   778   C  CG1 . VAL A  1 104 ? 85.626  -10.507  -5.633  1.00 50.34  ? 104 VAL A CG1 1 
ATOM   779   C  CG2 . VAL A  1 104 ? 85.904  -9.268   -3.509  1.00 37.29  ? 104 VAL A CG2 1 
ATOM   780   N  N   . ALA A  1 105 ? 87.833  -9.433   -7.660  1.00 52.88  ? 105 ALA A N   1 
ATOM   781   C  CA  . ALA A  1 105 ? 87.843  -9.516   -9.107  1.00 52.01  ? 105 ALA A CA  1 
ATOM   782   C  C   . ALA A  1 105 ? 86.844  -10.545  -9.538  1.00 57.70  ? 105 ALA A C   1 
ATOM   783   O  O   . ALA A  1 105 ? 85.899  -10.218  -10.247 1.00 64.97  ? 105 ALA A O   1 
ATOM   784   C  CB  . ALA A  1 105 ? 89.209  -9.903   -9.608  1.00 38.10  ? 105 ALA A CB  1 
ATOM   785   N  N   . GLU A  1 106 ? 87.073  -11.788  -9.109  1.00 45.91  ? 106 GLU A N   1 
ATOM   786   C  CA  . GLU A  1 106 ? 86.226  -12.917  -9.470  1.00 49.02  ? 106 GLU A CA  1 
ATOM   787   C  C   . GLU A  1 106 ? 85.793  -13.698  -8.219  1.00 61.26  ? 106 GLU A C   1 
ATOM   788   O  O   . GLU A  1 106 ? 86.523  -13.769  -7.233  1.00 42.10  ? 106 GLU A O   1 
ATOM   789   C  CB  . GLU A  1 106 ? 86.969  -13.817  -10.456 1.00 52.70  ? 106 GLU A CB  1 
ATOM   790   C  CG  . GLU A  1 106 ? 87.220  -13.178  -11.810 1.00 63.87  ? 106 GLU A CG  1 
ATOM   791   C  CD  . GLU A  1 106 ? 88.139  -14.003  -12.698 1.00 95.43  ? 106 GLU A CD  1 
ATOM   792   O  OE1 . GLU A  1 106 ? 88.440  -13.548  -13.825 1.00 108.07 ? 106 GLU A OE1 1 
ATOM   793   O  OE2 . GLU A  1 106 ? 88.562  -15.102  -12.271 1.00 92.09  ? 106 GLU A OE2 1 
ATOM   794   N  N   . CYS A  1 107 ? 84.593  -14.266  -8.252  1.00 55.21  ? 107 CYS A N   1 
ATOM   795   C  CA  . CYS A  1 107 ? 84.104  -15.054  -7.127  1.00 41.29  ? 107 CYS A CA  1 
ATOM   796   C  C   . CYS A  1 107 ? 84.195  -16.549  -7.437  1.00 47.27  ? 107 CYS A C   1 
ATOM   797   O  O   . CYS A  1 107 ? 84.492  -16.936  -8.570  1.00 70.56  ? 107 CYS A O   1 
ATOM   798   C  CB  . CYS A  1 107 ? 82.663  -14.651  -6.782  1.00 43.14  ? 107 CYS A CB  1 
ATOM   799   S  SG  . CYS A  1 107 ? 82.504  -13.255  -5.597  1.00 81.81  ? 107 CYS A SG  1 
ATOM   800   N  N   . GLY A  1 108 ? 83.953  -17.397  -6.441  1.00 50.15  ? 108 GLY A N   1 
ATOM   801   C  CA  . GLY A  1 108 ? 83.993  -18.828  -6.703  1.00 64.44  ? 108 GLY A CA  1 
ATOM   802   C  C   . GLY A  1 108 ? 83.734  -19.734  -5.520  1.00 55.11  ? 108 GLY A C   1 
ATOM   803   O  O   . GLY A  1 108 ? 83.521  -19.259  -4.409  1.00 55.24  ? 108 GLY A O   1 
ATOM   804   N  N   . CYS A  1 109 ? 83.762  -21.043  -5.766  1.00 37.49  ? 109 CYS A N   1 
ATOM   805   C  CA  . CYS A  1 109 ? 83.429  -22.028  -4.744  1.00 34.43  ? 109 CYS A CA  1 
ATOM   806   C  C   . CYS A  1 109 ? 84.612  -22.905  -4.430  1.00 34.49  ? 109 CYS A C   1 
ATOM   807   O  O   . CYS A  1 109 ? 85.221  -23.483  -5.322  1.00 49.44  ? 109 CYS A O   1 
ATOM   808   C  CB  . CYS A  1 109 ? 82.232  -22.895  -5.169  1.00 40.11  ? 109 CYS A CB  1 
ATOM   809   S  SG  . CYS A  1 109 ? 80.587  -22.117  -4.980  1.00 72.26  ? 109 CYS A SG  1 
ATOM   810   N  N   . ARG A  1 110 ? 84.923  -23.017  -3.146  1.00 46.89  ? 110 ARG A N   1 
ATOM   811   C  CA  . ARG A  1 110 ? 86.117  -23.736  -2.712  1.00 68.14  ? 110 ARG A CA  1 
ATOM   812   C  C   . ARG A  1 110 ? 85.892  -24.561  -1.425  1.00 74.42  ? 110 ARG A C   1 
ATOM   813   O  O   . ARG A  1 110 ? 86.495  -25.627  -1.269  1.00 91.18  ? 110 ARG A O   1 
ATOM   814   C  CB  . ARG A  1 110 ? 87.286  -22.749  -2.535  1.00 52.14  ? 110 ARG A CB  1 
ATOM   815   C  CG  . ARG A  1 110 ? 87.554  -21.838  -3.736  1.00 13.86  ? 110 ARG A CG  1 
ATOM   816   C  CD  . ARG A  1 110 ? 88.234  -22.599  -4.869  1.00 35.09  ? 110 ARG A CD  1 
ATOM   817   N  NE  . ARG A  1 110 ? 88.647  -21.765  -6.003  1.00 28.81  ? 110 ARG A NE  1 
ATOM   818   C  CZ  . ARG A  1 110 ? 87.908  -21.517  -7.086  1.00 47.17  ? 110 ARG A CZ  1 
ATOM   819   N  NH1 . ARG A  1 110 ? 86.685  -22.017  -7.217  1.00 63.03  ? 110 ARG A NH1 1 
ATOM   820   N  NH2 . ARG A  1 110 ? 88.400  -20.755  -8.048  1.00 61.60  ? 110 ARG A NH2 1 
ATOM   821   O  OXT . ARG A  1 110 ? 85.114  -24.211  -0.518  1.00 49.92  ? 110 ARG A OXT 1 
ATOM   822   N  N   . SER B  1 6   ? 87.126  -25.732  16.868  1.00 38.27  ? 6   SER B N   1 
ATOM   823   C  CA  . SER B  1 6   ? 87.622  -24.643  17.733  1.00 63.46  ? 6   SER B CA  1 
ATOM   824   C  C   . SER B  1 6   ? 87.615  -23.233  17.027  1.00 71.57  ? 6   SER B C   1 
ATOM   825   O  O   . SER B  1 6   ? 86.667  -22.446  17.194  1.00 14.60  ? 6   SER B O   1 
ATOM   826   C  CB  . SER B  1 6   ? 88.987  -25.036  18.392  1.00 16.27  ? 6   SER B CB  1 
ATOM   827   N  N   . HIS B  1 7   ? 88.650  -22.958  16.222  1.00 95.21  ? 7   HIS B N   1 
ATOM   828   C  CA  . HIS B  1 7   ? 88.873  -21.670  15.533  1.00 79.74  ? 7   HIS B CA  1 
ATOM   829   C  C   . HIS B  1 7   ? 88.686  -21.841  14.031  1.00 77.85  ? 7   HIS B C   1 
ATOM   830   O  O   . HIS B  1 7   ? 87.631  -22.299  13.636  1.00 81.45  ? 7   HIS B O   1 
ATOM   831   C  CB  . HIS B  1 7   ? 90.281  -21.164  15.832  1.00 70.03  ? 7   HIS B CB  1 
ATOM   832   C  CG  . HIS B  1 7   ? 91.193  -22.234  16.342  1.00 100.51 ? 7   HIS B CG  1 
ATOM   833   N  ND1 . HIS B  1 7   ? 91.261  -22.581  17.675  1.00 104.76 ? 7   HIS B ND1 1 
ATOM   834   C  CD2 . HIS B  1 7   ? 92.045  -23.063  15.695  1.00 112.91 ? 7   HIS B CD2 1 
ATOM   835   C  CE1 . HIS B  1 7   ? 92.129  -23.565  17.829  1.00 107.81 ? 7   HIS B CE1 1 
ATOM   836   N  NE2 . HIS B  1 7   ? 92.620  -23.875  16.643  1.00 117.34 ? 7   HIS B NE2 1 
ATOM   837   N  N   . CYS B  1 8   ? 89.666  -21.435  13.204  1.00 70.86  ? 8   CYS B N   1 
ATOM   838   C  CA  . CYS B  1 8   ? 89.733  -21.858  11.782  1.00 62.14  ? 8   CYS B CA  1 
ATOM   839   C  C   . CYS B  1 8   ? 90.903  -22.790  11.538  1.00 63.39  ? 8   CYS B C   1 
ATOM   840   O  O   . CYS B  1 8   ? 92.049  -22.418  11.792  1.00 75.39  ? 8   CYS B O   1 
ATOM   841   C  CB  . CYS B  1 8   ? 89.864  -20.688  10.806  1.00 63.98  ? 8   CYS B CB  1 
ATOM   842   S  SG  . CYS B  1 8   ? 90.293  -21.215  9.115   1.00 87.27  ? 8   CYS B SG  1 
ATOM   843   N  N   . GLN B  1 9   ? 90.621  -23.980  11.009  1.00 54.14  ? 9   GLN B N   1 
ATOM   844   C  CA  . GLN B  1 9   ? 91.630  -25.024  10.908  1.00 53.57  ? 9   GLN B CA  1 
ATOM   845   C  C   . GLN B  1 9   ? 91.298  -26.134  9.926   1.00 55.66  ? 9   GLN B C   1 
ATOM   846   O  O   . GLN B  1 9   ? 90.179  -26.211  9.406   1.00 63.60  ? 9   GLN B O   1 
ATOM   847   C  CB  . GLN B  1 9   ? 91.875  -25.636  12.288  1.00 71.30  ? 9   GLN B CB  1 
ATOM   848   C  CG  . GLN B  1 9   ? 90.617  -25.822  13.114  1.00 68.39  ? 9   GLN B CG  1 
ATOM   849   C  CD  . GLN B  1 9   ? 90.885  -26.493  14.449  1.00 79.70  ? 9   GLN B CD  1 
ATOM   850   O  OE1 . GLN B  1 9   ? 91.977  -26.985  14.698  1.00 88.74  ? 9   GLN B OE1 1 
ATOM   851   N  NE2 . GLN B  1 9   ? 89.881  -26.517  15.312  1.00 97.48  ? 9   GLN B NE2 1 
ATOM   852   N  N   . LYS B  1 10  ? 92.296  -26.991  9.697   1.00 60.94  ? 10  LYS B N   1 
ATOM   853   C  CA  . LYS B  1 10  ? 92.186  -28.174  8.838   1.00 55.05  ? 10  LYS B CA  1 
ATOM   854   C  C   . LYS B  1 10  ? 91.646  -29.359  9.664   1.00 49.87  ? 10  LYS B C   1 
ATOM   855   O  O   . LYS B  1 10  ? 92.081  -29.592  10.787  1.00 50.36  ? 10  LYS B O   1 
ATOM   856   C  CB  . LYS B  1 10  ? 93.563  -28.514  8.222   1.00 50.78  ? 10  LYS B CB  1 
ATOM   857   C  CG  . LYS B  1 10  ? 93.528  -29.144  6.803   1.00 58.15  ? 10  LYS B CG  1 
ATOM   858   C  CD  . LYS B  1 10  ? 94.578  -30.285  6.574   1.00 54.78  ? 10  LYS B CD  1 
ATOM   859   C  CE  . LYS B  1 10  ? 96.012  -29.755  6.397   1.00 61.65  ? 10  LYS B CE  1 
ATOM   860   N  NZ  . LYS B  1 10  ? 97.033  -30.834  6.276   1.00 63.01  ? 10  LYS B NZ  1 
ATOM   861   N  N   . THR B  1 11  ? 90.698  -30.099  9.101   1.00 46.55  ? 11  THR B N   1 
ATOM   862   C  CA  . THR B  1 11  ? 90.015  -31.163  9.814   1.00 38.49  ? 11  THR B CA  1 
ATOM   863   C  C   . THR B  1 11  ? 90.049  -32.425  9.006   1.00 71.57  ? 11  THR B C   1 
ATOM   864   O  O   . THR B  1 11  ? 90.121  -32.370  7.781   1.00 88.53  ? 11  THR B O   1 
ATOM   865   C  CB  . THR B  1 11  ? 88.566  -30.817  9.994   1.00 57.31  ? 11  THR B CB  1 
ATOM   866   O  OG1 . THR B  1 11  ? 88.469  -29.790  10.981  1.00 81.43  ? 11  THR B OG1 1 
ATOM   867   C  CG2 . THR B  1 11  ? 87.780  -32.030  10.450  1.00 79.79  ? 11  THR B CG2 1 
ATOM   868   N  N   . SER B  1 12  ? 89.991  -33.572  9.676   1.00 56.02  ? 12  SER B N   1 
ATOM   869   C  CA  . SER B  1 12  ? 89.962  -34.828  8.939   1.00 48.92  ? 12  SER B CA  1 
ATOM   870   C  C   . SER B  1 12  ? 88.627  -34.976  8.219   1.00 67.13  ? 12  SER B C   1 
ATOM   871   O  O   . SER B  1 12  ? 87.577  -34.661  8.786   1.00 66.06  ? 12  SER B O   1 
ATOM   872   C  CB  . SER B  1 12  ? 90.169  -36.008  9.868   1.00 49.05  ? 12  SER B CB  1 
ATOM   873   O  OG  . SER B  1 12  ? 89.946  -37.219  9.168   1.00 67.44  ? 12  SER B OG  1 
ATOM   874   N  N   . LEU B  1 13  ? 88.664  -35.425  6.965   1.00 68.43  ? 13  LEU B N   1 
ATOM   875   C  CA  . LEU B  1 13  ? 87.434  -35.791  6.276   1.00 48.77  ? 13  LEU B CA  1 
ATOM   876   C  C   . LEU B  1 13  ? 87.664  -37.028  5.425   1.00 57.41  ? 13  LEU B C   1 
ATOM   877   O  O   . LEU B  1 13  ? 88.107  -36.952  4.267   1.00 84.08  ? 13  LEU B O   1 
ATOM   878   C  CB  . LEU B  1 13  ? 86.938  -34.646  5.420   1.00 49.24  ? 13  LEU B CB  1 
ATOM   879   C  CG  . LEU B  1 13  ? 85.648  -34.898  4.653   1.00 55.02  ? 13  LEU B CG  1 
ATOM   880   C  CD1 . LEU B  1 13  ? 84.502  -35.143  5.609   1.00 36.41  ? 13  LEU B CD1 1 
ATOM   881   C  CD2 . LEU B  1 13  ? 85.357  -33.686  3.775   1.00 72.79  ? 13  LEU B CD2 1 
ATOM   882   N  N   . ARG B  1 14  ? 87.401  -38.179  6.021   1.00 50.40  ? 14  ARG B N   1 
ATOM   883   C  CA  . ARG B  1 14  ? 87.561  -39.412  5.298   1.00 65.20  ? 14  ARG B CA  1 
ATOM   884   C  C   . ARG B  1 14  ? 86.379  -39.533  4.344   1.00 63.31  ? 14  ARG B C   1 
ATOM   885   O  O   . ARG B  1 14  ? 85.235  -39.791  4.760   1.00 62.60  ? 14  ARG B O   1 
ATOM   886   C  CB  . ARG B  1 14  ? 87.634  -40.605  6.261   1.00 81.90  ? 14  ARG B CB  1 
ATOM   887   C  CG  . ARG B  1 14  ? 88.755  -40.530  7.293   1.00 71.97  ? 14  ARG B CG  1 
ATOM   888   C  CD  . ARG B  1 14  ? 90.083  -40.432  6.606   1.00 76.16  ? 14  ARG B CD  1 
ATOM   889   N  NE  . ARG B  1 14  ? 91.215  -40.498  7.530   1.00 88.75  ? 14  ARG B NE  1 
ATOM   890   C  CZ  . ARG B  1 14  ? 91.602  -41.598  8.172   1.00 87.86  ? 14  ARG B CZ  1 
ATOM   891   N  NH1 . ARG B  1 14  ? 90.916  -42.736  8.029   1.00 79.35  ? 14  ARG B NH1 1 
ATOM   892   N  NH2 . ARG B  1 14  ? 92.666  -41.548  8.974   1.00 66.71  ? 14  ARG B NH2 1 
ATOM   893   N  N   . VAL B  1 15  ? 86.656  -39.314  3.063   1.00 51.85  ? 15  VAL B N   1 
ATOM   894   C  CA  . VAL B  1 15  ? 85.635  -39.495  2.053   1.00 47.43  ? 15  VAL B CA  1 
ATOM   895   C  C   . VAL B  1 15  ? 85.676  -40.907  1.566   1.00 40.03  ? 15  VAL B C   1 
ATOM   896   O  O   . VAL B  1 15  ? 86.740  -41.397  1.225   1.00 57.38  ? 15  VAL B O   1 
ATOM   897   C  CB  . VAL B  1 15  ? 85.856  -38.616  0.846   1.00 56.93  ? 15  VAL B CB  1 
ATOM   898   C  CG1 . VAL B  1 15  ? 84.804  -38.961  -0.200  1.00 53.36  ? 15  VAL B CG1 1 
ATOM   899   C  CG2 . VAL B  1 15  ? 85.804  -37.144  1.243   1.00 45.52  ? 15  VAL B CG2 1 
ATOM   900   N  N   . ASN B  1 16  ? 84.516  -41.557  1.548   1.00 49.04  ? 16  ASN B N   1 
ATOM   901   C  CA  . ASN B  1 16  ? 84.390  -42.935  1.096   1.00 58.50  ? 16  ASN B CA  1 
ATOM   902   C  C   . ASN B  1 16  ? 83.679  -42.891  -0.236  1.00 64.46  ? 16  ASN B C   1 
ATOM   903   O  O   . ASN B  1 16  ? 82.528  -42.493  -0.296  1.00 78.80  ? 16  ASN B O   1 
ATOM   904   C  CB  . ASN B  1 16  ? 83.593  -43.753  2.116   1.00 62.06  ? 16  ASN B CB  1 
ATOM   905   C  CG  . ASN B  1 16  ? 83.417  -45.191  1.706   1.00 70.60  ? 16  ASN B CG  1 
ATOM   906   O  OD1 . ASN B  1 16  ? 83.381  -45.519  0.521   1.00 80.78  ? 16  ASN B OD1 1 
ATOM   907   N  ND2 . ASN B  1 16  ? 83.293  -46.065  2.691   1.00 79.90  ? 16  ASN B ND2 1 
ATOM   908   N  N   . PHE B  1 17  ? 84.364  -43.281  -1.306  1.00 52.08  ? 17  PHE B N   1 
ATOM   909   C  CA  . PHE B  1 17  ? 83.815  -43.160  -2.657  1.00 51.92  ? 17  PHE B CA  1 
ATOM   910   C  C   . PHE B  1 17  ? 82.483  -43.855  -2.841  1.00 64.38  ? 17  PHE B C   1 
ATOM   911   O  O   . PHE B  1 17  ? 81.654  -43.405  -3.629  1.00 57.81  ? 17  PHE B O   1 
ATOM   912   C  CB  . PHE B  1 17  ? 84.795  -43.687  -3.691  1.00 54.43  ? 17  PHE B CB  1 
ATOM   913   C  CG  . PHE B  1 17  ? 85.993  -42.826  -3.868  1.00 54.54  ? 17  PHE B CG  1 
ATOM   914   C  CD1 . PHE B  1 17  ? 85.866  -41.570  -4.422  1.00 43.75  ? 17  PHE B CD1 1 
ATOM   915   C  CD2 . PHE B  1 17  ? 87.250  -43.262  -3.482  1.00 61.47  ? 17  PHE B CD2 1 
ATOM   916   C  CE1 . PHE B  1 17  ? 86.968  -40.754  -4.580  1.00 39.59  ? 17  PHE B CE1 1 
ATOM   917   C  CE2 . PHE B  1 17  ? 88.360  -42.449  -3.646  1.00 70.40  ? 17  PHE B CE2 1 
ATOM   918   C  CZ  . PHE B  1 17  ? 88.217  -41.189  -4.192  1.00 49.65  ? 17  PHE B CZ  1 
ATOM   919   N  N   . GLU B  1 18  ? 82.286  -44.961  -2.131  1.00 62.52  ? 18  GLU B N   1 
ATOM   920   C  CA  . GLU B  1 18  ? 81.002  -45.653  -2.157  1.00 61.87  ? 18  GLU B CA  1 
ATOM   921   C  C   . GLU B  1 18  ? 79.889  -44.710  -1.718  1.00 70.12  ? 18  GLU B C   1 
ATOM   922   O  O   . GLU B  1 18  ? 78.813  -44.710  -2.312  1.00 68.37  ? 18  GLU B O   1 
ATOM   923   C  CB  . GLU B  1 18  ? 81.030  -46.894  -1.260  1.00 76.66  ? 18  GLU B CB  1 
ATOM   924   C  CG  . GLU B  1 18  ? 79.865  -47.866  -1.471  1.00 79.53  ? 18  GLU B CG  1 
ATOM   925   C  CD  . GLU B  1 18  ? 79.996  -49.138  -0.637  1.00 98.81  ? 18  GLU B CD  1 
ATOM   926   O  OE1 . GLU B  1 18  ? 79.360  -50.160  -0.985  1.00 107.98 ? 18  GLU B OE1 1 
ATOM   927   O  OE2 . GLU B  1 18  ? 80.733  -49.113  0.370   1.00 104.62 ? 18  GLU B OE2 1 
ATOM   928   N  N   . ASP B  1 19  ? 80.155  -43.906  -0.685  1.00 80.96  ? 19  ASP B N   1 
ATOM   929   C  CA  . ASP B  1 19  ? 79.171  -42.963  -0.138  1.00 63.30  ? 19  ASP B CA  1 
ATOM   930   C  C   . ASP B  1 19  ? 78.663  -41.952  -1.168  1.00 45.13  ? 19  ASP B C   1 
ATOM   931   O  O   . ASP B  1 19  ? 77.499  -41.610  -1.159  1.00 63.03  ? 19  ASP B O   1 
ATOM   932   C  CB  . ASP B  1 19  ? 79.715  -42.241  1.101   1.00 55.66  ? 19  ASP B CB  1 
ATOM   933   C  CG  . ASP B  1 19  ? 79.675  -43.102  2.358   1.00 85.41  ? 19  ASP B CG  1 
ATOM   934   O  OD1 . ASP B  1 19  ? 78.948  -44.117  2.383   1.00 97.38  ? 19  ASP B OD1 1 
ATOM   935   O  OD2 . ASP B  1 19  ? 80.365  -42.754  3.337   1.00 82.64  ? 19  ASP B OD2 1 
ATOM   936   N  N   . ILE B  1 20  ? 79.530  -41.486  -2.057  1.00 38.39  ? 20  ILE B N   1 
ATOM   937   C  CA  . ILE B  1 20  ? 79.127  -40.586  -3.145  1.00 50.75  ? 20  ILE B CA  1 
ATOM   938   C  C   . ILE B  1 20  ? 78.996  -41.290  -4.515  1.00 56.15  ? 20  ILE B C   1 
ATOM   939   O  O   . ILE B  1 20  ? 78.940  -40.641  -5.570  1.00 39.56  ? 20  ILE B O   1 
ATOM   940   C  CB  . ILE B  1 20  ? 80.072  -39.353  -3.289  1.00 40.04  ? 20  ILE B CB  1 
ATOM   941   C  CG1 . ILE B  1 20  ? 81.512  -39.791  -3.562  1.00 61.53  ? 20  ILE B CG1 1 
ATOM   942   C  CG2 . ILE B  1 20  ? 80.033  -38.502  -2.059  1.00 41.37  ? 20  ILE B CG2 1 
ATOM   943   C  CD1 . ILE B  1 20  ? 82.482  -38.646  -3.774  1.00 47.70  ? 20  ILE B CD1 1 
ATOM   944   N  N   . GLY B  1 21  ? 78.957  -42.615  -4.493  1.00 49.10  ? 21  GLY B N   1 
ATOM   945   C  CA  . GLY B  1 21  ? 78.649  -43.378  -5.686  1.00 74.09  ? 21  GLY B CA  1 
ATOM   946   C  C   . GLY B  1 21  ? 79.734  -43.382  -6.745  1.00 73.26  ? 21  GLY B C   1 
ATOM   947   O  O   . GLY B  1 21  ? 79.480  -43.586  -7.942  1.00 57.77  ? 21  GLY B O   1 
ATOM   948   N  N   . TRP B  1 22  ? 80.962  -43.166  -6.309  1.00 60.11  ? 22  TRP B N   1 
ATOM   949   C  CA  . TRP B  1 22  ? 82.074  -43.240  -7.234  1.00 53.30  ? 22  TRP B CA  1 
ATOM   950   C  C   . TRP B  1 22  ? 82.703  -44.633  -7.220  1.00 62.84  ? 22  TRP B C   1 
ATOM   951   O  O   . TRP B  1 22  ? 83.640  -44.925  -7.962  1.00 58.58  ? 22  TRP B O   1 
ATOM   952   C  CB  . TRP B  1 22  ? 83.094  -42.142  -6.942  1.00 53.46  ? 22  TRP B CB  1 
ATOM   953   C  CG  . TRP B  1 22  ? 82.615  -40.815  -7.388  1.00 60.29  ? 22  TRP B CG  1 
ATOM   954   C  CD1 . TRP B  1 22  ? 81.354  -40.495  -7.807  1.00 81.90  ? 22  TRP B CD1 1 
ATOM   955   C  CD2 . TRP B  1 22  ? 83.379  -39.619  -7.470  1.00 48.31  ? 22  TRP B CD2 1 
ATOM   956   N  NE1 . TRP B  1 22  ? 81.290  -39.169  -8.143  1.00 78.04  ? 22  TRP B NE1 1 
ATOM   957   C  CE2 . TRP B  1 22  ? 82.522  -38.605  -7.938  1.00 55.63  ? 22  TRP B CE2 1 
ATOM   958   C  CE3 . TRP B  1 22  ? 84.706  -39.301  -7.186  1.00 56.12  ? 22  TRP B CE3 1 
ATOM   959   C  CZ2 . TRP B  1 22  ? 82.948  -37.295  -8.120  1.00 60.04  ? 22  TRP B CZ2 1 
ATOM   960   C  CZ3 . TRP B  1 22  ? 85.129  -37.996  -7.378  1.00 52.84  ? 22  TRP B CZ3 1 
ATOM   961   C  CH2 . TRP B  1 22  ? 84.254  -37.014  -7.839  1.00 51.92  ? 22  TRP B CH2 1 
ATOM   962   N  N   . ASP B  1 23  ? 82.166  -45.507  -6.384  1.00 77.78  ? 23  ASP B N   1 
ATOM   963   C  CA  . ASP B  1 23  ? 82.671  -46.868  -6.300  1.00 80.47  ? 23  ASP B CA  1 
ATOM   964   C  C   . ASP B  1 23  ? 82.537  -47.560  -7.650  1.00 76.96  ? 23  ASP B C   1 
ATOM   965   O  O   . ASP B  1 23  ? 83.120  -48.625  -7.882  1.00 81.70  ? 23  ASP B O   1 
ATOM   966   C  CB  . ASP B  1 23  ? 81.923  -47.648  -5.219  1.00 80.37  ? 23  ASP B CB  1 
ATOM   967   C  CG  . ASP B  1 23  ? 80.423  -47.611  -5.405  1.00 87.69  ? 23  ASP B CG  1 
ATOM   968   O  OD1 . ASP B  1 23  ? 79.906  -46.596  -5.902  1.00 91.43  ? 23  ASP B OD1 1 
ATOM   969   O  OD2 . ASP B  1 23  ? 79.753  -48.601  -5.057  1.00 98.15  ? 23  ASP B OD2 1 
ATOM   970   N  N   . SER B  1 24  ? 81.771  -46.933  -8.537  1.00 63.96  ? 24  SER B N   1 
ATOM   971   C  CA  . SER B  1 24  ? 81.496  -47.485  -9.856  1.00 61.71  ? 24  SER B CA  1 
ATOM   972   C  C   . SER B  1 24  ? 82.727  -47.476  -10.742 1.00 63.32  ? 24  SER B C   1 
ATOM   973   O  O   . SER B  1 24  ? 82.837  -48.286  -11.661 1.00 81.90  ? 24  SER B O   1 
ATOM   974   C  CB  . SER B  1 24  ? 80.410  -46.675  -10.547 1.00 62.87  ? 24  SER B CB  1 
ATOM   975   O  OG  . SER B  1 24  ? 80.942  -45.439  -11.001 1.00 73.57  ? 24  SER B OG  1 
ATOM   976   N  N   . TRP B  1 25  ? 83.649  -46.557  -10.480 1.00 59.98  ? 25  TRP B N   1 
ATOM   977   C  CA  . TRP B  1 25  ? 84.819  -46.397  -11.347 1.00 72.46  ? 25  TRP B CA  1 
ATOM   978   C  C   . TRP B  1 25  ? 86.147  -46.191  -10.604 1.00 72.35  ? 25  TRP B C   1 
ATOM   979   O  O   . TRP B  1 25  ? 87.210  -46.355  -11.194 1.00 73.92  ? 25  TRP B O   1 
ATOM   980   C  CB  . TRP B  1 25  ? 84.586  -45.272  -12.357 1.00 70.80  ? 25  TRP B CB  1 
ATOM   981   C  CG  . TRP B  1 25  ? 84.366  -43.946  -11.720 1.00 58.64  ? 25  TRP B CG  1 
ATOM   982   C  CD1 . TRP B  1 25  ? 83.236  -43.512  -11.098 1.00 77.12  ? 25  TRP B CD1 1 
ATOM   983   C  CD2 . TRP B  1 25  ? 85.303  -42.877  -11.643 1.00 38.71  ? 25  TRP B CD2 1 
ATOM   984   N  NE1 . TRP B  1 25  ? 83.413  -42.233  -10.632 1.00 73.78  ? 25  TRP B NE1 1 
ATOM   985   C  CE2 . TRP B  1 25  ? 84.676  -41.820  -10.958 1.00 60.12  ? 25  TRP B CE2 1 
ATOM   986   C  CE3 . TRP B  1 25  ? 86.618  -42.708  -12.090 1.00 44.50  ? 25  TRP B CE3 1 
ATOM   987   C  CZ2 . TRP B  1 25  ? 85.318  -40.606  -10.707 1.00 72.25  ? 25  TRP B CZ2 1 
ATOM   988   C  CZ3 . TRP B  1 25  ? 87.258  -41.501  -11.841 1.00 43.68  ? 25  TRP B CZ3 1 
ATOM   989   C  CH2 . TRP B  1 25  ? 86.604  -40.464  -11.159 1.00 55.21  ? 25  TRP B CH2 1 
ATOM   990   N  N   . ILE B  1 26  ? 86.091  -45.834  -9.323  1.00 52.34  ? 26  ILE B N   1 
ATOM   991   C  CA  . ILE B  1 26  ? 87.302  -45.803  -8.522  1.00 47.73  ? 26  ILE B CA  1 
ATOM   992   C  C   . ILE B  1 26  ? 87.511  -47.185  -7.940  1.00 62.40  ? 26  ILE B C   1 
ATOM   993   O  O   . ILE B  1 26  ? 86.725  -47.641  -7.115  1.00 72.99  ? 26  ILE B O   1 
ATOM   994   C  CB  . ILE B  1 26  ? 87.243  -44.796  -7.351  1.00 65.98  ? 26  ILE B CB  1 
ATOM   995   C  CG1 . ILE B  1 26  ? 86.873  -43.399  -7.833  1.00 45.15  ? 26  ILE B CG1 1 
ATOM   996   C  CG2 . ILE B  1 26  ? 88.584  -44.722  -6.651  1.00 72.49  ? 26  ILE B CG2 1 
ATOM   997   C  CD1 . ILE B  1 26  ? 87.685  -42.958  -8.973  1.00 46.87  ? 26  ILE B CD1 1 
ATOM   998   N  N   . ILE B  1 27  ? 88.572  -47.850  -8.380  1.00 62.60  ? 27  ILE B N   1 
ATOM   999   C  CA  . ILE B  1 27  ? 88.924  -49.169  -7.882  1.00 53.80  ? 27  ILE B CA  1 
ATOM   1000  C  C   . ILE B  1 27  ? 89.644  -49.010  -6.559  1.00 54.63  ? 27  ILE B C   1 
ATOM   1001  O  O   . ILE B  1 27  ? 89.415  -49.769  -5.631  1.00 52.82  ? 27  ILE B O   1 
ATOM   1002  C  CB  . ILE B  1 27  ? 89.843  -49.888  -8.876  1.00 63.21  ? 27  ILE B CB  1 
ATOM   1003  C  CG1 . ILE B  1 27  ? 89.184  -49.919  -10.253 1.00 76.85  ? 27  ILE B CG1 1 
ATOM   1004  C  CG2 . ILE B  1 27  ? 90.179  -51.278  -8.397  1.00 35.82  ? 27  ILE B CG2 1 
ATOM   1005  C  CD1 . ILE B  1 27  ? 90.086  -50.420  -11.348 1.00 82.47  ? 27  ILE B CD1 1 
ATOM   1006  N  N   . ALA B  1 28  ? 90.507  -48.002  -6.478  1.00 54.13  ? 28  ALA B N   1 
ATOM   1007  C  CA  . ALA B  1 28  ? 91.257  -47.726  -5.262  1.00 45.00  ? 28  ALA B CA  1 
ATOM   1008  C  C   . ALA B  1 28  ? 91.711  -46.270  -5.184  1.00 48.77  ? 28  ALA B C   1 
ATOM   1009  O  O   . ALA B  1 28  ? 91.991  -45.630  -6.202  1.00 49.70  ? 28  ALA B O   1 
ATOM   1010  C  CB  . ALA B  1 28  ? 92.461  -48.670  -5.142  1.00 45.92  ? 28  ALA B CB  1 
ATOM   1011  N  N   . PRO B  1 29  ? 91.790  -45.741  -3.963  1.00 43.48  ? 29  PRO B N   1 
ATOM   1012  C  CA  . PRO B  1 29  ? 91.473  -46.438  -2.718  1.00 47.34  ? 29  PRO B CA  1 
ATOM   1013  C  C   . PRO B  1 29  ? 89.974  -46.564  -2.573  1.00 57.67  ? 29  PRO B C   1 
ATOM   1014  O  O   . PRO B  1 29  ? 89.250  -46.104  -3.449  1.00 59.44  ? 29  PRO B O   1 
ATOM   1015  C  CB  . PRO B  1 29  ? 91.968  -45.467  -1.669  1.00 62.56  ? 29  PRO B CB  1 
ATOM   1016  C  CG  . PRO B  1 29  ? 91.720  -44.143  -2.290  1.00 40.29  ? 29  PRO B CG  1 
ATOM   1017  C  CD  . PRO B  1 29  ? 92.104  -44.327  -3.726  1.00 37.57  ? 29  PRO B CD  1 
ATOM   1018  N  N   . LYS B  1 30  ? 89.501  -47.173  -1.492  1.00 57.29  ? 30  LYS B N   1 
ATOM   1019  C  CA  . LYS B  1 30  ? 88.059  -47.261  -1.281  1.00 57.47  ? 30  LYS B CA  1 
ATOM   1020  C  C   . LYS B  1 30  ? 87.612  -46.005  -0.529  1.00 67.24  ? 30  LYS B C   1 
ATOM   1021  O  O   . LYS B  1 30  ? 86.490  -45.528  -0.710  1.00 72.85  ? 30  LYS B O   1 
ATOM   1022  C  CB  . LYS B  1 30  ? 87.657  -48.548  -0.543  1.00 40.30  ? 30  LYS B CB  1 
ATOM   1023  C  CG  . LYS B  1 30  ? 87.931  -49.846  -1.299  1.00 51.42  ? 30  LYS B CG  1 
ATOM   1024  C  CD  . LYS B  1 30  ? 87.170  -49.928  -2.619  1.00 75.21  ? 30  LYS B CD  1 
ATOM   1025  C  CE  . LYS B  1 30  ? 87.528  -51.211  -3.384  1.00 88.96  ? 30  LYS B CE  1 
ATOM   1026  N  NZ  . LYS B  1 30  ? 86.944  -51.319  -4.762  1.00 82.65  ? 30  LYS B NZ  1 
ATOM   1027  N  N   . GLU B  1 31  ? 88.504  -45.476  0.308   1.00 55.01  ? 31  GLU B N   1 
ATOM   1028  C  CA  . GLU B  1 31  ? 88.303  -44.179  0.949   1.00 48.35  ? 31  GLU B CA  1 
ATOM   1029  C  C   . GLU B  1 31  ? 89.645  -43.461  1.096   1.00 41.90  ? 31  GLU B C   1 
ATOM   1030  O  O   . GLU B  1 31  ? 90.701  -44.071  1.053   1.00 58.78  ? 31  GLU B O   1 
ATOM   1031  C  CB  . GLU B  1 31  ? 87.547  -44.284  2.297   1.00 60.86  ? 31  GLU B CB  1 
ATOM   1032  C  CG  . GLU B  1 31  ? 88.382  -44.667  3.517   1.00 86.29  ? 31  GLU B CG  1 
ATOM   1033  C  CD  . GLU B  1 31  ? 87.555  -44.720  4.797   1.00 109.13 ? 31  GLU B CD  1 
ATOM   1034  O  OE1 . GLU B  1 31  ? 88.139  -44.562  5.894   1.00 123.66 ? 31  GLU B OE1 1 
ATOM   1035  O  OE2 . GLU B  1 31  ? 86.322  -44.915  4.699   1.00 98.07  ? 31  GLU B OE2 1 
ATOM   1036  N  N   . TYR B  1 32  ? 89.597  -42.151  1.241   1.00 41.35  ? 32  TYR B N   1 
ATOM   1037  C  CA  . TYR B  1 32  ? 90.811  -41.369  1.278   1.00 41.80  ? 32  TYR B CA  1 
ATOM   1038  C  C   . TYR B  1 32  ? 90.592  -40.111  2.095   1.00 60.50  ? 32  TYR B C   1 
ATOM   1039  O  O   . TYR B  1 32  ? 89.445  -39.669  2.302   1.00 54.70  ? 32  TYR B O   1 
ATOM   1040  C  CB  . TYR B  1 32  ? 91.228  -40.962  -0.126  1.00 34.81  ? 32  TYR B CB  1 
ATOM   1041  C  CG  . TYR B  1 32  ? 90.544  -39.699  -0.638  1.00 42.30  ? 32  TYR B CG  1 
ATOM   1042  C  CD1 . TYR B  1 32  ? 89.268  -39.741  -1.193  1.00 46.06  ? 32  TYR B CD1 1 
ATOM   1043  C  CD2 . TYR B  1 32  ? 91.185  -38.464  -0.580  1.00 42.18  ? 32  TYR B CD2 1 
ATOM   1044  C  CE1 . TYR B  1 32  ? 88.656  -38.590  -1.671  1.00 67.27  ? 32  TYR B CE1 1 
ATOM   1045  C  CE2 . TYR B  1 32  ? 90.580  -37.309  -1.062  1.00 42.99  ? 32  TYR B CE2 1 
ATOM   1046  C  CZ  . TYR B  1 32  ? 89.319  -37.381  -1.602  1.00 62.90  ? 32  TYR B CZ  1 
ATOM   1047  O  OH  . TYR B  1 32  ? 88.720  -36.247  -2.073  1.00 37.68  ? 32  TYR B OH  1 
ATOM   1048  N  N   . GLU B  1 33  ? 91.703  -39.524  2.536   1.00 53.41  ? 33  GLU B N   1 
ATOM   1049  C  CA  . GLU B  1 33  ? 91.652  -38.332  3.371   1.00 48.73  ? 33  GLU B CA  1 
ATOM   1050  C  C   . GLU B  1 33  ? 91.593  -37.085  2.533   1.00 55.62  ? 33  GLU B C   1 
ATOM   1051  O  O   . GLU B  1 33  ? 92.616  -36.610  2.048   1.00 64.04  ? 33  GLU B O   1 
ATOM   1052  C  CB  . GLU B  1 33  ? 92.878  -38.241  4.279   1.00 53.56  ? 33  GLU B CB  1 
ATOM   1053  C  CG  . GLU B  1 33  ? 92.920  -36.984  5.145   1.00 44.47  ? 33  GLU B CG  1 
ATOM   1054  C  CD  . GLU B  1 33  ? 91.899  -37.007  6.259   1.00 68.95  ? 33  GLU B CD  1 
ATOM   1055  O  OE1 . GLU B  1 33  ? 92.217  -37.496  7.367   1.00 78.16  ? 33  GLU B OE1 1 
ATOM   1056  O  OE2 . GLU B  1 33  ? 90.774  -36.533  6.028   1.00 75.98  ? 33  GLU B OE2 1 
ATOM   1057  N  N   . ALA B  1 34  ? 90.402  -36.549  2.342   1.00 62.06  ? 34  ALA B N   1 
ATOM   1058  C  CA  . ALA B  1 34  ? 90.347  -35.188  1.872   1.00 57.43  ? 34  ALA B CA  1 
ATOM   1059  C  C   . ALA B  1 34  ? 90.242  -34.478  3.175   1.00 72.54  ? 34  ALA B C   1 
ATOM   1060  O  O   . ALA B  1 34  ? 89.859  -35.069  4.200   1.00 117.46 ? 34  ALA B O   1 
ATOM   1061  C  CB  . ALA B  1 34  ? 89.134  -34.957  1.056   1.00 65.56  ? 34  ALA B CB  1 
ATOM   1062  N  N   . TYR B  1 35  ? 90.580  -33.214  3.199   1.00 45.32  ? 35  TYR B N   1 
ATOM   1063  C  CA  . TYR B  1 35  ? 90.367  -32.574  4.475   1.00 64.54  ? 35  TYR B CA  1 
ATOM   1064  C  C   . TYR B  1 35  ? 89.109  -31.741  4.440   1.00 64.40  ? 35  TYR B C   1 
ATOM   1065  O  O   . TYR B  1 35  ? 88.420  -31.691  3.420   1.00 69.81  ? 35  TYR B O   1 
ATOM   1066  C  CB  . TYR B  1 35  ? 91.584  -31.779  4.896   1.00 78.59  ? 35  TYR B CB  1 
ATOM   1067  C  CG  . TYR B  1 35  ? 92.734  -32.663  5.279   1.00 73.00  ? 35  TYR B CG  1 
ATOM   1068  C  CD1 . TYR B  1 35  ? 93.737  -32.951  4.383   1.00 65.75  ? 35  TYR B CD1 1 
ATOM   1069  C  CD2 . TYR B  1 35  ? 92.802  -33.229  6.536   1.00 72.07  ? 35  TYR B CD2 1 
ATOM   1070  C  CE1 . TYR B  1 35  ? 94.782  -33.770  4.735   1.00 63.29  ? 35  TYR B CE1 1 
ATOM   1071  C  CE2 . TYR B  1 35  ? 93.847  -34.043  6.897   1.00 55.80  ? 35  TYR B CE2 1 
ATOM   1072  C  CZ  . TYR B  1 35  ? 94.830  -34.313  5.996   1.00 51.71  ? 35  TYR B CZ  1 
ATOM   1073  O  OH  . TYR B  1 35  ? 95.867  -35.131  6.373   1.00 64.79  ? 35  TYR B OH  1 
ATOM   1074  N  N   . GLU B  1 36  ? 88.785  -31.131  5.571   1.00 48.45  ? 36  GLU B N   1 
ATOM   1075  C  CA  . GLU B  1 36  ? 87.729  -30.138  5.617   1.00 72.04  ? 36  GLU B CA  1 
ATOM   1076  C  C   . GLU B  1 36  ? 88.347  -28.847  6.129   1.00 66.30  ? 36  GLU B C   1 
ATOM   1077  O  O   . GLU B  1 36  ? 89.336  -28.887  6.868   1.00 48.44  ? 36  GLU B O   1 
ATOM   1078  C  CB  . GLU B  1 36  ? 86.592  -30.586  6.536   1.00 78.96  ? 36  GLU B CB  1 
ATOM   1079  C  CG  . GLU B  1 36  ? 85.304  -29.778  6.374   1.00 93.94  ? 36  GLU B CG  1 
ATOM   1080  C  CD  . GLU B  1 36  ? 84.138  -30.394  7.122   1.00 119.70 ? 36  GLU B CD  1 
ATOM   1081  O  OE1 . GLU B  1 36  ? 84.355  -31.420  7.817   1.00 120.89 ? 36  GLU B OE1 1 
ATOM   1082  O  OE2 . GLU B  1 36  ? 83.011  -29.849  7.012   1.00 113.84 ? 36  GLU B OE2 1 
ATOM   1083  N  N   . CYS B  1 37  ? 87.800  -27.703  5.721   1.00 54.49  ? 37  CYS B N   1 
ATOM   1084  C  CA  . CYS B  1 37  ? 88.209  -26.443  6.335   1.00 48.16  ? 37  CYS B CA  1 
ATOM   1085  C  C   . CYS B  1 37  ? 87.098  -25.909  7.244   1.00 55.73  ? 37  CYS B C   1 
ATOM   1086  O  O   . CYS B  1 37  ? 86.083  -25.401  6.774   1.00 60.38  ? 37  CYS B O   1 
ATOM   1087  C  CB  . CYS B  1 37  ? 88.645  -25.431  5.286   1.00 46.26  ? 37  CYS B CB  1 
ATOM   1088  S  SG  . CYS B  1 37  ? 90.344  -25.712  4.691   1.00 83.27  ? 37  CYS B SG  1 
ATOM   1089  N  N   . LYS B  1 38  ? 87.292  -26.075  8.551   1.00 62.14  ? 38  LYS B N   1 
ATOM   1090  C  CA  . LYS B  1 38  ? 86.231  -25.833  9.522   1.00 45.36  ? 38  LYS B CA  1 
ATOM   1091  C  C   . LYS B  1 38  ? 86.658  -24.682  10.384  1.00 47.84  ? 38  LYS B C   1 
ATOM   1092  O  O   . LYS B  1 38  ? 87.837  -24.495  10.624  1.00 51.97  ? 38  LYS B O   1 
ATOM   1093  C  CB  . LYS B  1 38  ? 85.991  -27.067  10.421  1.00 45.94  ? 38  LYS B CB  1 
ATOM   1094  C  CG  . LYS B  1 38  ? 84.786  -27.952  10.064  1.00 59.11  ? 38  LYS B CG  1 
ATOM   1095  C  CD  . LYS B  1 38  ? 84.682  -29.159  11.004  1.00 78.43  ? 38  LYS B CD  1 
ATOM   1096  C  CE  . LYS B  1 38  ? 83.611  -30.153  10.558  1.00 94.80  ? 38  LYS B CE  1 
ATOM   1097  N  NZ  . LYS B  1 38  ? 84.030  -31.558  10.824  1.00 86.62  ? 38  LYS B NZ  1 
ATOM   1098  N  N   . GLY B  1 39  ? 85.693  -23.908  10.855  1.00 47.35  ? 39  GLY B N   1 
ATOM   1099  C  CA  . GLY B  1 39  ? 85.985  -22.876  11.823  1.00 56.46  ? 39  GLY B CA  1 
ATOM   1100  C  C   . GLY B  1 39  ? 85.776  -21.455  11.373  1.00 55.35  ? 39  GLY B C   1 
ATOM   1101  O  O   . GLY B  1 39  ? 85.529  -21.178  10.202  1.00 79.24  ? 39  GLY B O   1 
ATOM   1102  N  N   . GLY B  1 40  ? 85.889  -20.545  12.324  1.00 39.93  ? 40  GLY B N   1 
ATOM   1103  C  CA  . GLY B  1 40  ? 85.551  -19.164  12.064  1.00 67.68  ? 40  GLY B CA  1 
ATOM   1104  C  C   . GLY B  1 40  ? 86.769  -18.284  11.919  1.00 62.97  ? 40  GLY B C   1 
ATOM   1105  O  O   . GLY B  1 40  ? 87.834  -18.577  12.449  1.00 57.26  ? 40  GLY B O   1 
ATOM   1106  N  N   . CYS B  1 41  ? 86.604  -17.195  11.186  1.00 51.56  ? 41  CYS B N   1 
ATOM   1107  C  CA  . CYS B  1 41  ? 87.680  -16.264  10.991  1.00 51.73  ? 41  CYS B CA  1 
ATOM   1108  C  C   . CYS B  1 41  ? 87.438  -15.100  11.926  1.00 70.80  ? 41  CYS B C   1 
ATOM   1109  O  O   . CYS B  1 41  ? 86.715  -14.156  11.603  1.00 82.08  ? 41  CYS B O   1 
ATOM   1110  C  CB  . CYS B  1 41  ? 87.720  -15.827  9.537   1.00 70.36  ? 41  CYS B CB  1 
ATOM   1111  S  SG  . CYS B  1 41  ? 87.919  -17.230  8.405   1.00 91.01  ? 41  CYS B SG  1 
ATOM   1112  N  N   . PHE B  1 42  ? 88.050  -15.194  13.101  1.00 71.38  ? 42  PHE B N   1 
ATOM   1113  C  CA  . PHE B  1 42  ? 87.767  -14.291  14.200  1.00 77.28  ? 42  PHE B CA  1 
ATOM   1114  C  C   . PHE B  1 42  ? 88.866  -13.271  14.368  1.00 79.66  ? 42  PHE B C   1 
ATOM   1115  O  O   . PHE B  1 42  ? 90.039  -13.630  14.396  1.00 108.33 ? 42  PHE B O   1 
ATOM   1116  C  CB  . PHE B  1 42  ? 87.587  -15.090  15.496  1.00 75.80  ? 42  PHE B CB  1 
ATOM   1117  C  CG  . PHE B  1 42  ? 86.376  -15.976  15.489  1.00 75.11  ? 42  PHE B CG  1 
ATOM   1118  C  CD1 . PHE B  1 42  ? 86.501  -17.345  15.632  1.00 66.15  ? 42  PHE B CD1 1 
ATOM   1119  C  CD2 . PHE B  1 42  ? 85.101  -15.432  15.311  1.00 101.71 ? 42  PHE B CD2 1 
ATOM   1120  C  CE1 . PHE B  1 42  ? 85.379  -18.160  15.614  1.00 97.89  ? 42  PHE B CE1 1 
ATOM   1121  C  CE2 . PHE B  1 42  ? 83.966  -16.242  15.288  1.00 107.07 ? 42  PHE B CE2 1 
ATOM   1122  C  CZ  . PHE B  1 42  ? 84.103  -17.609  15.439  1.00 106.23 ? 42  PHE B CZ  1 
ATOM   1123  N  N   . PHE B  1 43  ? 88.490  -12.001  14.493  1.00 67.17  ? 43  PHE B N   1 
ATOM   1124  C  CA  . PHE B  1 43  ? 89.485  -10.944  14.621  1.00 75.35  ? 43  PHE B CA  1 
ATOM   1125  C  C   . PHE B  1 43  ? 90.175  -10.978  15.988  1.00 83.67  ? 43  PHE B C   1 
ATOM   1126  O  O   . PHE B  1 43  ? 89.525  -11.232  17.009  1.00 83.70  ? 43  PHE B O   1 
ATOM   1127  C  CB  . PHE B  1 43  ? 88.836  -9.589   14.382  1.00 68.20  ? 43  PHE B CB  1 
ATOM   1128  C  CG  . PHE B  1 43  ? 89.788  -8.536   13.899  1.00 71.77  ? 43  PHE B CG  1 
ATOM   1129  C  CD1 . PHE B  1 43  ? 90.124  -8.455   12.556  1.00 81.01  ? 43  PHE B CD1 1 
ATOM   1130  C  CD2 . PHE B  1 43  ? 90.335  -7.620   14.782  1.00 77.97  ? 43  PHE B CD2 1 
ATOM   1131  C  CE1 . PHE B  1 43  ? 90.998  -7.480   12.103  1.00 90.13  ? 43  PHE B CE1 1 
ATOM   1132  C  CE2 . PHE B  1 43  ? 91.210  -6.638   14.335  1.00 77.59  ? 43  PHE B CE2 1 
ATOM   1133  C  CZ  . PHE B  1 43  ? 91.542  -6.568   12.996  1.00 81.87  ? 43  PHE B CZ  1 
ATOM   1134  N  N   . PRO B  1 44  ? 91.502  -10.746  16.009  1.00 90.18  ? 44  PRO B N   1 
ATOM   1135  C  CA  . PRO B  1 44  ? 92.320  -10.472  14.826  1.00 90.33  ? 44  PRO B CA  1 
ATOM   1136  C  C   . PRO B  1 44  ? 92.694  -11.759  14.107  1.00 92.12  ? 44  PRO B C   1 
ATOM   1137  O  O   . PRO B  1 44  ? 92.768  -12.826  14.713  1.00 97.58  ? 44  PRO B O   1 
ATOM   1138  C  CB  . PRO B  1 44  ? 93.568  -9.832   15.423  1.00 83.56  ? 44  PRO B CB  1 
ATOM   1139  C  CG  . PRO B  1 44  ? 93.729  -10.534  16.716  1.00 85.26  ? 44  PRO B CG  1 
ATOM   1140  C  CD  . PRO B  1 44  ? 92.324  -10.785  17.231  1.00 92.32  ? 44  PRO B CD  1 
ATOM   1141  N  N   . LEU B  1 45  ? 92.930  -11.648  12.810  1.00 78.59  ? 45  LEU B N   1 
ATOM   1142  C  CA  . LEU B  1 45  ? 93.209  -12.809  11.983  1.00 63.65  ? 45  LEU B CA  1 
ATOM   1143  C  C   . LEU B  1 45  ? 94.656  -13.281  12.129  1.00 80.56  ? 45  LEU B C   1 
ATOM   1144  O  O   . LEU B  1 45  ? 95.590  -12.576  11.747  1.00 80.27  ? 45  LEU B O   1 
ATOM   1145  C  CB  . LEU B  1 45  ? 92.887  -12.501  10.513  1.00 40.77  ? 45  LEU B CB  1 
ATOM   1146  C  CG  . LEU B  1 45  ? 91.444  -12.061  10.278  1.00 54.55  ? 45  LEU B CG  1 
ATOM   1147  C  CD1 . LEU B  1 45  ? 91.170  -11.866  8.803   1.00 64.75  ? 45  LEU B CD1 1 
ATOM   1148  C  CD2 . LEU B  1 45  ? 90.478  -13.068  10.859  1.00 54.09  ? 45  LEU B CD2 1 
ATOM   1149  N  N   . ALA B  1 46  ? 94.828  -14.480  12.680  1.00 85.26  ? 46  ALA B N   1 
ATOM   1150  C  CA  . ALA B  1 46  ? 96.147  -15.085  12.840  1.00 80.93  ? 46  ALA B CA  1 
ATOM   1151  C  C   . ALA B  1 46  ? 96.928  -15.138  11.523  1.00 77.38  ? 46  ALA B C   1 
ATOM   1152  O  O   . ALA B  1 46  ? 96.339  -15.342  10.458  1.00 79.50  ? 46  ALA B O   1 
ATOM   1153  C  CB  . ALA B  1 46  ? 95.999  -16.474  13.424  1.00 96.32  ? 46  ALA B CB  1 
ATOM   1154  N  N   . ASP B  1 47  ? 98.248  -14.961  11.593  1.00 80.96  ? 47  ASP B N   1 
ATOM   1155  C  CA  . ASP B  1 47  ? 99.074  -14.967  10.388  1.00 73.35  ? 47  ASP B CA  1 
ATOM   1156  C  C   . ASP B  1 47  ? 98.927  -16.282  9.639   1.00 74.99  ? 47  ASP B C   1 
ATOM   1157  O  O   . ASP B  1 47  ? 98.910  -16.294  8.411   1.00 67.70  ? 47  ASP B O   1 
ATOM   1158  C  CB  . ASP B  1 47  ? 100.546 -14.729  10.716  1.00 76.16  ? 47  ASP B CB  1 
ATOM   1159  C  CG  . ASP B  1 47  ? 100.771 -13.462  11.507  1.00 110.38 ? 47  ASP B CG  1 
ATOM   1160  O  OD1 . ASP B  1 47  ? 100.815 -13.553  12.754  1.00 126.57 ? 47  ASP B OD1 1 
ATOM   1161  O  OD2 . ASP B  1 47  ? 100.907 -12.379  10.891  1.00 105.13 ? 47  ASP B OD2 1 
ATOM   1162  N  N   . ASP B  1 48  ? 98.808  -17.386  10.379  1.00 76.76  ? 48  ASP B N   1 
ATOM   1163  C  CA  . ASP B  1 48  ? 98.774  -18.707  9.759   1.00 64.44  ? 48  ASP B CA  1 
ATOM   1164  C  C   . ASP B  1 48  ? 97.500  -18.958  9.000   1.00 60.31  ? 48  ASP B C   1 
ATOM   1165  O  O   . ASP B  1 48  ? 97.232  -20.077  8.604   1.00 78.18  ? 48  ASP B O   1 
ATOM   1166  C  CB  . ASP B  1 48  ? 99.030  -19.836  10.763  1.00 82.23  ? 48  ASP B CB  1 
ATOM   1167  C  CG  . ASP B  1 48  ? 98.113  -19.781  11.958  1.00 107.53 ? 48  ASP B CG  1 
ATOM   1168  O  OD1 . ASP B  1 48  ? 97.837  -18.669  12.439  1.00 133.70 ? 48  ASP B OD1 1 
ATOM   1169  O  OD2 . ASP B  1 48  ? 97.675  -20.852  12.432  1.00 102.43 ? 48  ASP B OD2 1 
ATOM   1170  N  N   . VAL B  1 49  ? 96.727  -17.908  8.777   1.00 70.81  ? 49  VAL B N   1 
ATOM   1171  C  CA  . VAL B  1 49  ? 95.486  -18.015  8.032   1.00 64.27  ? 49  VAL B CA  1 
ATOM   1172  C  C   . VAL B  1 49  ? 95.580  -17.201  6.749   1.00 78.01  ? 49  VAL B C   1 
ATOM   1173  O  O   . VAL B  1 49  ? 94.628  -17.106  5.987   1.00 85.69  ? 49  VAL B O   1 
ATOM   1174  C  CB  . VAL B  1 49  ? 94.314  -17.595  8.910   1.00 50.92  ? 49  VAL B CB  1 
ATOM   1175  C  CG1 . VAL B  1 49  ? 93.142  -17.193  8.084   1.00 68.28  ? 49  VAL B CG1 1 
ATOM   1176  C  CG2 . VAL B  1 49  ? 93.962  -18.745  9.816   1.00 32.29  ? 49  VAL B CG2 1 
ATOM   1177  N  N   . THR B  1 50  ? 96.756  -16.630  6.512   1.00 65.83  ? 50  THR B N   1 
ATOM   1178  C  CA  . THR B  1 50  ? 97.073  -16.016  5.226   1.00 57.57  ? 50  THR B CA  1 
ATOM   1179  C  C   . THR B  1 50  ? 96.072  -14.939  4.829   1.00 56.66  ? 50  THR B C   1 
ATOM   1180  O  O   . THR B  1 50  ? 95.794  -14.762  3.640   1.00 69.29  ? 50  THR B O   1 
ATOM   1181  C  CB  . THR B  1 50  ? 97.077  -17.082  4.101   1.00 73.89  ? 50  THR B CB  1 
ATOM   1182  O  OG1 . THR B  1 50  ? 97.421  -18.361  4.649   1.00 68.43  ? 50  THR B OG1 1 
ATOM   1183  C  CG2 . THR B  1 50  ? 98.035  -16.703  2.966   1.00 79.83  ? 50  THR B CG2 1 
ATOM   1184  N  N   . PRO B  1 51  ? 95.531  -14.212  5.814   1.00 46.35  ? 51  PRO B N   1 
ATOM   1185  C  CA  . PRO B  1 51  ? 94.437  -13.283  5.492   1.00 52.45  ? 51  PRO B CA  1 
ATOM   1186  C  C   . PRO B  1 51  ? 94.795  -12.386  4.329   1.00 52.76  ? 51  PRO B C   1 
ATOM   1187  O  O   . PRO B  1 51  ? 95.926  -11.888  4.299   1.00 57.15  ? 51  PRO B O   1 
ATOM   1188  C  CB  . PRO B  1 51  ? 94.288  -12.435  6.771   1.00 26.66  ? 51  PRO B CB  1 
ATOM   1189  C  CG  . PRO B  1 51  ? 95.584  -12.622  7.491   1.00 57.52  ? 51  PRO B CG  1 
ATOM   1190  C  CD  . PRO B  1 51  ? 96.047  -14.007  7.174   1.00 49.98  ? 51  PRO B CD  1 
ATOM   1191  N  N   . THR B  1 52  ? 93.868  -12.210  3.387   1.00 40.56  ? 52  THR B N   1 
ATOM   1192  C  CA  . THR B  1 52  ? 94.049  -11.249  2.311   1.00 48.54  ? 52  THR B CA  1 
ATOM   1193  C  C   . THR B  1 52  ? 93.696  -9.892   2.872   1.00 57.44  ? 52  THR B C   1 
ATOM   1194  O  O   . THR B  1 52  ? 93.020  -9.812   3.888   1.00 54.17  ? 52  THR B O   1 
ATOM   1195  C  CB  . THR B  1 52  ? 93.133  -11.543  1.107   1.00 47.37  ? 52  THR B CB  1 
ATOM   1196  O  OG1 . THR B  1 52  ? 91.761  -11.335  1.469   1.00 63.51  ? 52  THR B OG1 1 
ATOM   1197  C  CG2 . THR B  1 52  ? 93.319  -12.955  0.641   1.00 43.76  ? 52  THR B CG2 1 
ATOM   1198  N  N   . LYS B  1 53  ? 94.160  -8.828   2.229   1.00 54.61  ? 53  LYS B N   1 
ATOM   1199  C  CA  . LYS B  1 53  ? 93.707  -7.504   2.603   1.00 47.96  ? 53  LYS B CA  1 
ATOM   1200  C  C   . LYS B  1 53  ? 92.176  -7.488   2.662   1.00 56.83  ? 53  LYS B C   1 
ATOM   1201  O  O   . LYS B  1 53  ? 91.560  -7.106   3.670   1.00 58.56  ? 53  LYS B O   1 
ATOM   1202  C  CB  . LYS B  1 53  ? 94.197  -6.500   1.582   1.00 44.95  ? 53  LYS B CB  1 
ATOM   1203  C  CG  . LYS B  1 53  ? 95.233  -5.504   2.119   1.00 53.43  ? 53  LYS B CG  1 
ATOM   1204  C  CD  . LYS B  1 53  ? 96.467  -6.161   2.650   1.00 45.06  ? 53  LYS B CD  1 
ATOM   1205  C  CE  . LYS B  1 53  ? 97.520  -5.130   2.941   1.00 48.87  ? 53  LYS B CE  1 
ATOM   1206  N  NZ  . LYS B  1 53  ? 98.772  -5.750   3.471   1.00 87.74  ? 53  LYS B NZ  1 
ATOM   1207  N  N   . HIS B  1 54  ? 91.563  -7.928   1.574   1.00 52.10  ? 54  HIS B N   1 
ATOM   1208  C  CA  . HIS B  1 54  ? 90.118  -7.906   1.488   1.00 49.25  ? 54  HIS B CA  1 
ATOM   1209  C  C   . HIS B  1 54  ? 89.482  -8.563   2.680   1.00 54.52  ? 54  HIS B C   1 
ATOM   1210  O  O   . HIS B  1 54  ? 88.595  -7.990   3.299   1.00 46.10  ? 54  HIS B O   1 
ATOM   1211  C  CB  . HIS B  1 54  ? 89.622  -8.606   0.242   1.00 31.52  ? 54  HIS B CB  1 
ATOM   1212  C  CG  . HIS B  1 54  ? 88.141  -8.488   0.054   1.00 45.26  ? 54  HIS B CG  1 
ATOM   1213  N  ND1 . HIS B  1 54  ? 87.244  -9.292   0.722   1.00 36.64  ? 54  HIS B ND1 1 
ATOM   1214  C  CD2 . HIS B  1 54  ? 87.401  -7.656   -0.721  1.00 33.95  ? 54  HIS B CD2 1 
ATOM   1215  C  CE1 . HIS B  1 54  ? 86.017  -8.965   0.358   1.00 52.83  ? 54  HIS B CE1 1 
ATOM   1216  N  NE2 . HIS B  1 54  ? 86.084  -7.981   -0.522  1.00 30.40  ? 54  HIS B NE2 1 
ATOM   1217  N  N   . ALA B  1 55  ? 89.922  -9.778   2.982   1.00 46.31  ? 55  ALA B N   1 
ATOM   1218  C  CA  . ALA B  1 55  ? 89.417  -10.499  4.145   1.00 50.96  ? 55  ALA B CA  1 
ATOM   1219  C  C   . ALA B  1 55  ? 89.472  -9.647   5.410   1.00 53.28  ? 55  ALA B C   1 
ATOM   1220  O  O   . ALA B  1 55  ? 88.553  -9.680   6.228   1.00 42.81  ? 55  ALA B O   1 
ATOM   1221  C  CB  . ALA B  1 55  ? 90.194  -11.760  4.349   1.00 55.14  ? 55  ALA B CB  1 
ATOM   1222  N  N   . ILE B  1 56  ? 90.551  -8.887   5.574   1.00 45.98  ? 56  ILE B N   1 
ATOM   1223  C  CA  . ILE B  1 56  ? 90.692  -8.032   6.748   1.00 48.18  ? 56  ILE B CA  1 
ATOM   1224  C  C   . ILE B  1 56  ? 89.604  -6.973   6.735   1.00 58.36  ? 56  ILE B C   1 
ATOM   1225  O  O   . ILE B  1 56  ? 88.830  -6.830   7.696   1.00 48.43  ? 56  ILE B O   1 
ATOM   1226  C  CB  . ILE B  1 56  ? 92.039  -7.311   6.780   1.00 37.01  ? 56  ILE B CB  1 
ATOM   1227  C  CG1 . ILE B  1 56  ? 93.195  -8.301   6.842   1.00 31.79  ? 56  ILE B CG1 1 
ATOM   1228  C  CG2 . ILE B  1 56  ? 92.101  -6.420   7.991   1.00 35.88  ? 56  ILE B CG2 1 
ATOM   1229  C  CD1 . ILE B  1 56  ? 93.580  -8.647   8.246   1.00 62.28  ? 56  ILE B CD1 1 
ATOM   1230  N  N   . VAL B  1 57  ? 89.547  -6.225   5.637   1.00 38.53  ? 57  VAL B N   1 
ATOM   1231  C  CA  . VAL B  1 57  ? 88.554  -5.166   5.511   1.00 38.57  ? 57  VAL B CA  1 
ATOM   1232  C  C   . VAL B  1 57  ? 87.153  -5.681   5.772   1.00 43.20  ? 57  VAL B C   1 
ATOM   1233  O  O   . VAL B  1 57  ? 86.457  -5.169   6.640   1.00 36.27  ? 57  VAL B O   1 
ATOM   1234  C  CB  . VAL B  1 57  ? 88.613  -4.530   4.133   1.00 36.00  ? 57  VAL B CB  1 
ATOM   1235  C  CG1 . VAL B  1 57  ? 87.466  -3.578   3.938   1.00 10.62  ? 57  VAL B CG1 1 
ATOM   1236  C  CG2 . VAL B  1 57  ? 89.918  -3.804   3.986   1.00 31.47  ? 57  VAL B CG2 1 
ATOM   1237  N  N   . GLN B  1 58  ? 86.750  -6.698   5.012   1.00 48.54  ? 58  GLN B N   1 
ATOM   1238  C  CA  . GLN B  1 58  ? 85.439  -7.311   5.162   1.00 54.97  ? 58  GLN B CA  1 
ATOM   1239  C  C   . GLN B  1 58  ? 85.211  -7.638   6.636   1.00 54.13  ? 58  GLN B C   1 
ATOM   1240  O  O   . GLN B  1 58  ? 84.218  -7.209   7.204   1.00 29.74  ? 58  GLN B O   1 
ATOM   1241  C  CB  . GLN B  1 58  ? 85.266  -8.554   4.258   1.00 31.67  ? 58  GLN B CB  1 
ATOM   1242  C  CG  . GLN B  1 58  ? 83.912  -9.236   4.439   1.00 12.04  ? 58  GLN B CG  1 
ATOM   1243  C  CD  . GLN B  1 58  ? 83.551  -10.178  3.333   1.00 59.43  ? 58  GLN B CD  1 
ATOM   1244  O  OE1 . GLN B  1 58  ? 84.059  -10.064  2.217   1.00 69.95  ? 58  GLN B OE1 1 
ATOM   1245  N  NE2 . GLN B  1 58  ? 82.660  -11.127  3.630   1.00 85.76  ? 58  GLN B NE2 1 
ATOM   1246  N  N   . THR B  1 59  ? 86.136  -8.370   7.260   1.00 27.18  ? 59  THR B N   1 
ATOM   1247  C  CA  . THR B  1 59  ? 86.007  -8.691   8.681   1.00 31.26  ? 59  THR B CA  1 
ATOM   1248  C  C   . THR B  1 59  ? 85.692  -7.466   9.556   1.00 40.70  ? 59  THR B C   1 
ATOM   1249  O  O   . THR B  1 59  ? 84.809  -7.499   10.408  1.00 23.03  ? 59  THR B O   1 
ATOM   1250  C  CB  . THR B  1 59  ? 87.243  -9.420   9.210   1.00 37.10  ? 59  THR B CB  1 
ATOM   1251  O  OG1 . THR B  1 59  ? 87.071  -10.825  8.999   1.00 41.66  ? 59  THR B OG1 1 
ATOM   1252  C  CG2 . THR B  1 59  ? 87.404  -9.170   10.699  1.00 16.88  ? 59  THR B CG2 1 
ATOM   1253  N  N   . LEU B  1 60  ? 86.411  -6.375   9.336   1.00 42.25  ? 60  LEU B N   1 
ATOM   1254  C  CA  . LEU B  1 60  ? 86.140  -5.138   10.078  1.00 38.56  ? 60  LEU B CA  1 
ATOM   1255  C  C   . LEU B  1 60  ? 84.721  -4.605   9.837   1.00 44.97  ? 60  LEU B C   1 
ATOM   1256  O  O   . LEU B  1 60  ? 83.915  -4.446   10.776  1.00 63.11  ? 60  LEU B O   1 
ATOM   1257  C  CB  . LEU B  1 60  ? 87.172  -4.063   9.716   1.00 43.36  ? 60  LEU B CB  1 
ATOM   1258  C  CG  . LEU B  1 60  ? 88.628  -4.319   10.113  1.00 38.08  ? 60  LEU B CG  1 
ATOM   1259  C  CD1 . LEU B  1 60  ? 89.374  -3.048   10.024  1.00 30.22  ? 60  LEU B CD1 1 
ATOM   1260  C  CD2 . LEU B  1 60  ? 88.701  -4.808   11.516  1.00 44.29  ? 60  LEU B CD2 1 
ATOM   1261  N  N   . VAL B  1 61  ? 84.417  -4.311   8.577   1.00 40.02  ? 61  VAL B N   1 
ATOM   1262  C  CA  . VAL B  1 61  ? 83.067  -3.911   8.213   1.00 42.64  ? 61  VAL B CA  1 
ATOM   1263  C  C   . VAL B  1 61  ? 82.006  -4.814   8.882   1.00 60.22  ? 61  VAL B C   1 
ATOM   1264  O  O   . VAL B  1 61  ? 81.009  -4.310   9.374   1.00 60.25  ? 61  VAL B O   1 
ATOM   1265  C  CB  . VAL B  1 61  ? 82.865  -3.938   6.689   1.00 45.50  ? 61  VAL B CB  1 
ATOM   1266  C  CG1 . VAL B  1 61  ? 81.434  -3.541   6.339   1.00 18.02  ? 61  VAL B CG1 1 
ATOM   1267  C  CG2 . VAL B  1 61  ? 83.857  -3.033   6.005   1.00 24.45  ? 61  VAL B CG2 1 
ATOM   1268  N  N   . HIS B  1 62  ? 82.213  -6.135   8.903   1.00 39.69  ? 62  HIS B N   1 
ATOM   1269  C  CA  . HIS B  1 62  ? 81.264  -7.041   9.539   1.00 41.60  ? 62  HIS B CA  1 
ATOM   1270  C  C   . HIS B  1 62  ? 81.166  -6.760   11.028  1.00 41.91  ? 62  HIS B C   1 
ATOM   1271  O  O   . HIS B  1 62  ? 80.084  -6.816   11.602  1.00 43.17  ? 62  HIS B O   1 
ATOM   1272  C  CB  . HIS B  1 62  ? 81.647  -8.504   9.324   1.00 49.11  ? 62  HIS B CB  1 
ATOM   1273  C  CG  . HIS B  1 62  ? 81.030  -9.428   10.326  1.00 47.84  ? 62  HIS B CG  1 
ATOM   1274  N  ND1 . HIS B  1 62  ? 81.645  -9.758   11.517  1.00 74.09  ? 62  HIS B ND1 1 
ATOM   1275  C  CD2 . HIS B  1 62  ? 79.840  -10.062  10.333  1.00 25.41  ? 62  HIS B CD2 1 
ATOM   1276  C  CE1 . HIS B  1 62  ? 80.870  -10.580  12.203  1.00 72.53  ? 62  HIS B CE1 1 
ATOM   1277  N  NE2 . HIS B  1 62  ? 79.765  -10.776  11.507  1.00 66.82  ? 62  HIS B NE2 1 
ATOM   1278  N  N   . LEU B  1 63  ? 82.301  -6.475   11.662  1.00 48.51  ? 63  LEU B N   1 
ATOM   1279  C  CA  . LEU B  1 63  ? 82.265  -6.059   13.064  1.00 46.57  ? 63  LEU B CA  1 
ATOM   1280  C  C   . LEU B  1 63  ? 81.296  -4.918   13.257  1.00 47.53  ? 63  LEU B C   1 
ATOM   1281  O  O   . LEU B  1 63  ? 80.635  -4.836   14.276  1.00 40.83  ? 63  LEU B O   1 
ATOM   1282  C  CB  . LEU B  1 63  ? 83.640  -5.640   13.559  1.00 23.02  ? 63  LEU B CB  1 
ATOM   1283  C  CG  . LEU B  1 63  ? 84.503  -6.851   13.803  1.00 48.55  ? 63  LEU B CG  1 
ATOM   1284  C  CD1 . LEU B  1 63  ? 85.931  -6.418   14.074  1.00 63.42  ? 63  LEU B CD1 1 
ATOM   1285  C  CD2 . LEU B  1 63  ? 83.900  -7.606   14.961  1.00 34.48  ? 63  LEU B CD2 1 
ATOM   1286  N  N   . LYS B  1 64  ? 81.211  -4.024   12.282  1.00 56.43  ? 64  LYS B N   1 
ATOM   1287  C  CA  . LYS B  1 64  ? 80.245  -2.919   12.423  1.00 48.98  ? 64  LYS B CA  1 
ATOM   1288  C  C   . LYS B  1 64  ? 78.832  -3.205   11.901  1.00 39.91  ? 64  LYS B C   1 
ATOM   1289  O  O   . LYS B  1 64  ? 77.881  -2.560   12.304  1.00 42.77  ? 64  LYS B O   1 
ATOM   1290  C  CB  . LYS B  1 64  ? 80.764  -1.618   11.792  1.00 47.85  ? 64  LYS B CB  1 
ATOM   1291  C  CG  . LYS B  1 64  ? 79.900  -0.382   12.087  1.00 49.81  ? 64  LYS B CG  1 
ATOM   1292  C  CD  . LYS B  1 64  ? 80.541  0.920    11.585  1.00 61.95  ? 64  LYS B CD  1 
ATOM   1293  C  CE  . LYS B  1 64  ? 80.039  2.126    12.353  1.00 67.98  ? 64  LYS B CE  1 
ATOM   1294  N  NZ  . LYS B  1 64  ? 80.928  3.290    12.131  1.00 88.26  ? 64  LYS B NZ  1 
ATOM   1295  N  N   . PHE B  1 65  ? 78.692  -4.149   10.987  1.00 44.76  ? 65  PHE B N   1 
ATOM   1296  C  CA  . PHE B  1 65  ? 77.389  -4.400   10.385  1.00 53.37  ? 65  PHE B CA  1 
ATOM   1297  C  C   . PHE B  1 65  ? 77.139  -5.892   10.327  1.00 66.58  ? 65  PHE B C   1 
ATOM   1298  O  O   . PHE B  1 65  ? 76.922  -6.466   9.265   1.00 64.71  ? 65  PHE B O   1 
ATOM   1299  C  CB  . PHE B  1 65  ? 77.307  -3.812   8.984   1.00 54.00  ? 65  PHE B CB  1 
ATOM   1300  C  CG  . PHE B  1 65  ? 77.528  -2.332   8.932   1.00 65.05  ? 65  PHE B CG  1 
ATOM   1301  C  CD1 . PHE B  1 65  ? 78.802  -1.808   8.899   1.00 80.35  ? 65  PHE B CD1 1 
ATOM   1302  C  CD2 . PHE B  1 65  ? 76.468  -1.469   8.899   1.00 62.85  ? 65  PHE B CD2 1 
ATOM   1303  C  CE1 . PHE B  1 65  ? 78.998  -0.456   8.843   1.00 74.71  ? 65  PHE B CE1 1 
ATOM   1304  C  CE2 . PHE B  1 65  ? 76.663  -0.134   8.836   1.00 65.24  ? 65  PHE B CE2 1 
ATOM   1305  C  CZ  . PHE B  1 65  ? 77.928  0.377    8.811   1.00 69.09  ? 65  PHE B CZ  1 
ATOM   1306  N  N   . PRO B  1 66  ? 77.153  -6.522   11.491  1.00 58.86  ? 66  PRO B N   1 
ATOM   1307  C  CA  . PRO B  1 66  ? 77.121  -7.962   11.606  1.00 44.01  ? 66  PRO B CA  1 
ATOM   1308  C  C   . PRO B  1 66  ? 75.886  -8.567   10.976  1.00 50.33  ? 66  PRO B C   1 
ATOM   1309  O  O   . PRO B  1 66  ? 75.794  -9.795   10.911  1.00 94.86  ? 66  PRO B O   1 
ATOM   1310  C  CB  . PRO B  1 66  ? 77.098  -8.166   13.128  1.00 52.67  ? 66  PRO B CB  1 
ATOM   1311  C  CG  . PRO B  1 66  ? 77.722  -6.969   13.697  1.00 40.35  ? 66  PRO B CG  1 
ATOM   1312  C  CD  . PRO B  1 66  ? 77.202  -5.880   12.812  1.00 49.58  ? 66  PRO B CD  1 
ATOM   1313  N  N   . THR B  1 67  ? 74.942  -7.750   10.532  1.00 55.75  ? 67  THR B N   1 
ATOM   1314  C  CA  . THR B  1 67  ? 73.700  -8.286   9.962   1.00 56.62  ? 67  THR B CA  1 
ATOM   1315  C  C   . THR B  1 67  ? 73.659  -8.134   8.451   1.00 62.56  ? 67  THR B C   1 
ATOM   1316  O  O   . THR B  1 67  ? 72.949  -8.861   7.770   1.00 70.07  ? 67  THR B O   1 
ATOM   1317  C  CB  . THR B  1 67  ? 72.460  -7.623   10.567  1.00 61.09  ? 67  THR B CB  1 
ATOM   1318  O  OG1 . THR B  1 67  ? 72.474  -6.221   10.258  1.00 76.24  ? 67  THR B OG1 1 
ATOM   1319  C  CG2 . THR B  1 67  ? 72.437  -7.823   12.083  1.00 44.93  ? 67  THR B CG2 1 
ATOM   1320  N  N   . LYS B  1 68  ? 74.439  -7.195   7.929   1.00 66.78  ? 68  LYS B N   1 
ATOM   1321  C  CA  . LYS B  1 68  ? 74.464  -6.926   6.495   1.00 62.35  ? 68  LYS B CA  1 
ATOM   1322  C  C   . LYS B  1 68  ? 75.724  -7.488   5.800   1.00 65.45  ? 68  LYS B C   1 
ATOM   1323  O  O   . LYS B  1 68  ? 75.736  -7.710   4.591   1.00 78.33  ? 68  LYS B O   1 
ATOM   1324  C  CB  . LYS B  1 68  ? 74.330  -5.419   6.264   1.00 43.97  ? 68  LYS B CB  1 
ATOM   1325  N  N   . VAL B  1 69  ? 76.773  -7.733   6.582   1.00 57.04  ? 69  VAL B N   1 
ATOM   1326  C  CA  . VAL B  1 69  ? 78.072  -8.176   6.068   1.00 56.23  ? 69  VAL B CA  1 
ATOM   1327  C  C   . VAL B  1 69  ? 78.608  -9.367   6.875   1.00 52.09  ? 69  VAL B C   1 
ATOM   1328  O  O   . VAL B  1 69  ? 78.592  -9.354   8.104   1.00 69.42  ? 69  VAL B O   1 
ATOM   1329  C  CB  . VAL B  1 69  ? 79.114  -7.013   6.121   1.00 49.16  ? 69  VAL B CB  1 
ATOM   1330  C  CG1 . VAL B  1 69  ? 80.516  -7.540   5.998   1.00 74.35  ? 69  VAL B CG1 1 
ATOM   1331  C  CG2 . VAL B  1 69  ? 78.851  -6.000   5.031   1.00 39.08  ? 69  VAL B CG2 1 
ATOM   1332  N  N   . GLY B  1 70  ? 79.115  -10.384  6.198   1.00 25.95  ? 70  GLY B N   1 
ATOM   1333  C  CA  . GLY B  1 70  ? 79.466  -11.611  6.892   1.00 59.41  ? 70  GLY B CA  1 
ATOM   1334  C  C   . GLY B  1 70  ? 80.941  -11.748  7.157   1.00 61.76  ? 70  GLY B C   1 
ATOM   1335  O  O   . GLY B  1 70  ? 81.741  -11.042  6.554   1.00 69.84  ? 70  GLY B O   1 
ATOM   1336  N  N   . LYS B  1 71  ? 81.299  -12.666  8.052   1.00 56.09  ? 71  LYS B N   1 
ATOM   1337  C  CA  . LYS B  1 71  ? 82.704  -12.926  8.336   1.00 61.45  ? 71  LYS B CA  1 
ATOM   1338  C  C   . LYS B  1 71  ? 83.386  -13.449  7.069   1.00 65.76  ? 71  LYS B C   1 
ATOM   1339  O  O   . LYS B  1 71  ? 82.705  -13.808  6.096   1.00 53.30  ? 71  LYS B O   1 
ATOM   1340  C  CB  . LYS B  1 71  ? 82.845  -13.949  9.460   1.00 50.05  ? 71  LYS B CB  1 
ATOM   1341  C  CG  . LYS B  1 71  ? 82.015  -13.690  10.706  1.00 35.15  ? 71  LYS B CG  1 
ATOM   1342  C  CD  . LYS B  1 71  ? 82.292  -14.775  11.729  1.00 71.19  ? 71  LYS B CD  1 
ATOM   1343  C  CE  . LYS B  1 71  ? 81.464  -14.599  12.985  1.00 102.57 ? 71  LYS B CE  1 
ATOM   1344  N  NZ  . LYS B  1 71  ? 81.854  -13.412  13.774  1.00 112.48 ? 71  LYS B NZ  1 
ATOM   1345  N  N   . ALA B  1 72  ? 84.720  -13.484  7.067   1.00 57.69  ? 72  ALA B N   1 
ATOM   1346  C  CA  . ALA B  1 72  ? 85.424  -14.171  5.985   1.00 58.33  ? 72  ALA B CA  1 
ATOM   1347  C  C   . ALA B  1 72  ? 85.188  -15.666  6.146   1.00 61.27  ? 72  ALA B C   1 
ATOM   1348  O  O   . ALA B  1 72  ? 84.911  -16.150  7.241   1.00 54.40  ? 72  ALA B O   1 
ATOM   1349  C  CB  . ALA B  1 72  ? 86.909  -13.864  6.004   1.00 47.50  ? 72  ALA B CB  1 
ATOM   1350  N  N   . CYS B  1 73  ? 85.289  -16.411  5.061   1.00 50.88  ? 73  CYS B N   1 
ATOM   1351  C  CA  . CYS B  1 73  ? 85.077  -17.848  5.152   1.00 48.71  ? 73  CYS B CA  1 
ATOM   1352  C  C   . CYS B  1 73  ? 86.391  -18.631  5.293   1.00 58.64  ? 73  CYS B C   1 
ATOM   1353  O  O   . CYS B  1 73  ? 87.435  -18.234  4.785   1.00 59.69  ? 73  CYS B O   1 
ATOM   1354  C  CB  . CYS B  1 73  ? 84.278  -18.364  3.955   1.00 30.83  ? 73  CYS B CB  1 
ATOM   1355  S  SG  . CYS B  1 73  ? 83.415  -19.925  4.266   1.00 104.76 ? 73  CYS B SG  1 
ATOM   1356  N  N   . CYS B  1 74  ? 86.336  -19.748  6.001   1.00 60.44  ? 74  CYS B N   1 
ATOM   1357  C  CA  . CYS B  1 74  ? 87.493  -20.620  6.124   1.00 48.24  ? 74  CYS B CA  1 
ATOM   1358  C  C   . CYS B  1 74  ? 87.469  -21.615  4.966   1.00 45.02  ? 74  CYS B C   1 
ATOM   1359  O  O   . CYS B  1 74  ? 86.634  -22.510  4.906   1.00 66.48  ? 74  CYS B O   1 
ATOM   1360  C  CB  . CYS B  1 74  ? 87.474  -21.345  7.479   1.00 47.83  ? 74  CYS B CB  1 
ATOM   1361  S  SG  . CYS B  1 74  ? 88.987  -22.236  7.934   1.00 80.03  ? 74  CYS B SG  1 
ATOM   1362  N  N   . VAL B  1 75  ? 88.396  -21.445  4.042   1.00 38.63  ? 75  VAL B N   1 
ATOM   1363  C  CA  . VAL B  1 75  ? 88.414  -22.244  2.838   1.00 49.38  ? 75  VAL B CA  1 
ATOM   1364  C  C   . VAL B  1 75  ? 89.768  -22.896  2.608   1.00 56.64  ? 75  VAL B C   1 
ATOM   1365  O  O   . VAL B  1 75  ? 90.778  -22.446  3.159   1.00 56.46  ? 75  VAL B O   1 
ATOM   1366  C  CB  . VAL B  1 75  ? 88.108  -21.367  1.636   1.00 38.28  ? 75  VAL B CB  1 
ATOM   1367  C  CG1 . VAL B  1 75  ? 86.697  -20.855  1.730   1.00 36.68  ? 75  VAL B CG1 1 
ATOM   1368  C  CG2 . VAL B  1 75  ? 89.077  -20.207  1.580   1.00 36.71  ? 75  VAL B CG2 1 
ATOM   1369  N  N   . PRO B  1 76  ? 89.790  -23.963  1.792   1.00 48.16  ? 76  PRO B N   1 
ATOM   1370  C  CA  . PRO B  1 76  ? 91.062  -24.551  1.393   1.00 54.73  ? 76  PRO B CA  1 
ATOM   1371  C  C   . PRO B  1 76  ? 91.787  -23.516  0.541   1.00 60.04  ? 76  PRO B C   1 
ATOM   1372  O  O   . PRO B  1 76  ? 91.194  -22.968  -0.389  1.00 31.61  ? 76  PRO B O   1 
ATOM   1373  C  CB  . PRO B  1 76  ? 90.645  -25.748  0.531   1.00 42.76  ? 76  PRO B CB  1 
ATOM   1374  C  CG  . PRO B  1 76  ? 89.217  -25.972  0.842   1.00 62.53  ? 76  PRO B CG  1 
ATOM   1375  C  CD  . PRO B  1 76  ? 88.656  -24.631  1.141   1.00 44.17  ? 76  PRO B CD  1 
ATOM   1376  N  N   . THR B  1 77  ? 93.043  -23.235  0.879   1.00 60.96  ? 77  THR B N   1 
ATOM   1377  C  CA  . THR B  1 77  ? 93.842  -22.253  0.153   1.00 37.57  ? 77  THR B CA  1 
ATOM   1378  C  C   . THR B  1 77  ? 94.910  -22.897  -0.734  1.00 50.45  ? 77  THR B C   1 
ATOM   1379  O  O   . THR B  1 77  ? 95.388  -22.258  -1.661  1.00 44.37  ? 77  THR B O   1 
ATOM   1380  C  CB  . THR B  1 77  ? 94.514  -21.269  1.118   1.00 55.82  ? 77  THR B CB  1 
ATOM   1381  O  OG1 . THR B  1 77  ? 95.420  -21.975  1.984   1.00 68.39  ? 77  THR B OG1 1 
ATOM   1382  C  CG2 . THR B  1 77  ? 93.458  -20.572  1.952   1.00 56.92  ? 77  THR B CG2 1 
ATOM   1383  N  N   . LYS B  1 78  ? 95.272  -24.153  -0.437  1.00 57.55  ? 78  LYS B N   1 
ATOM   1384  C  CA  . LYS B  1 78  ? 96.208  -24.944  -1.251  1.00 50.07  ? 78  LYS B CA  1 
ATOM   1385  C  C   . LYS B  1 78  ? 95.730  -26.396  -1.378  1.00 59.31  ? 78  LYS B C   1 
ATOM   1386  O  O   . LYS B  1 78  ? 95.231  -26.979  -0.411  1.00 54.83  ? 78  LYS B O   1 
ATOM   1387  C  CB  . LYS B  1 78  ? 97.609  -24.900  -0.636  1.00 47.65  ? 78  LYS B CB  1 
ATOM   1388  C  CG  . LYS B  1 78  ? 98.715  -25.515  -1.503  1.00 66.14  ? 78  LYS B CG  1 
ATOM   1389  C  CD  . LYS B  1 78  ? 100.088 -25.404  -0.832  1.00 53.40  ? 78  LYS B CD  1 
ATOM   1390  C  CE  . LYS B  1 78  ? 101.166 -26.035  -1.675  1.00 75.46  ? 78  LYS B CE  1 
ATOM   1391  N  NZ  . LYS B  1 78  ? 102.468 -26.057  -0.954  1.00 99.73  ? 78  LYS B NZ  1 
ATOM   1392  N  N   . LEU B  1 79  ? 95.886  -26.987  -2.561  1.00 59.86  ? 79  LEU B N   1 
ATOM   1393  C  CA  . LEU B  1 79  ? 95.361  -28.338  -2.782  1.00 57.45  ? 79  LEU B CA  1 
ATOM   1394  C  C   . LEU B  1 79  ? 96.350  -29.393  -3.317  1.00 68.65  ? 79  LEU B C   1 
ATOM   1395  O  O   . LEU B  1 79  ? 96.865  -29.291  -4.428  1.00 83.25  ? 79  LEU B O   1 
ATOM   1396  C  CB  . LEU B  1 79  ? 94.123  -28.283  -3.682  1.00 39.45  ? 79  LEU B CB  1 
ATOM   1397  C  CG  . LEU B  1 79  ? 92.883  -27.667  -3.054  1.00 44.12  ? 79  LEU B CG  1 
ATOM   1398  C  CD1 . LEU B  1 79  ? 91.772  -27.473  -4.091  1.00 14.79  ? 79  LEU B CD1 1 
ATOM   1399  C  CD2 . LEU B  1 79  ? 92.456  -28.540  -1.872  1.00 70.88  ? 79  LEU B CD2 1 
ATOM   1400  N  N   . SER B  1 80  ? 96.582  -30.424  -2.515  1.00 67.52  ? 80  SER B N   1 
ATOM   1401  C  CA  . SER B  1 80  ? 97.307  -31.613  -2.954  1.00 61.12  ? 80  SER B CA  1 
ATOM   1402  C  C   . SER B  1 80  ? 96.433  -32.535  -3.794  1.00 63.16  ? 80  SER B C   1 
ATOM   1403  O  O   . SER B  1 80  ? 95.210  -32.595  -3.623  1.00 70.83  ? 80  SER B O   1 
ATOM   1404  C  CB  . SER B  1 80  ? 97.823  -32.404  -1.748  1.00 61.82  ? 80  SER B CB  1 
ATOM   1405  O  OG  . SER B  1 80  ? 98.927  -31.762  -1.137  1.00 83.92  ? 80  SER B OG  1 
ATOM   1406  N  N   . PRO B  1 81  ? 97.064  -33.275  -4.702  1.00 55.30  ? 81  PRO B N   1 
ATOM   1407  C  CA  . PRO B  1 81  ? 96.451  -34.353  -5.480  1.00 77.08  ? 81  PRO B CA  1 
ATOM   1408  C  C   . PRO B  1 81  ? 96.609  -35.705  -4.779  1.00 65.82  ? 81  PRO B C   1 
ATOM   1409  O  O   . PRO B  1 81  ? 97.447  -35.851  -3.875  1.00 52.49  ? 81  PRO B O   1 
ATOM   1410  C  CB  . PRO B  1 81  ? 97.318  -34.380  -6.725  1.00 65.17  ? 81  PRO B CB  1 
ATOM   1411  C  CG  . PRO B  1 81  ? 98.665  -34.125  -6.166  1.00 41.06  ? 81  PRO B CG  1 
ATOM   1412  C  CD  . PRO B  1 81  ? 98.459  -33.072  -5.098  1.00 34.21  ? 81  PRO B CD  1 
ATOM   1413  N  N   . ILE B  1 82  ? 95.820  -36.685  -5.206  1.00 48.87  ? 82  ILE B N   1 
ATOM   1414  C  CA  . ILE B  1 82  ? 95.975  -38.033  -4.693  1.00 63.90  ? 82  ILE B CA  1 
ATOM   1415  C  C   . ILE B  1 82  ? 96.038  -38.946  -5.875  1.00 66.67  ? 82  ILE B C   1 
ATOM   1416  O  O   . ILE B  1 82  ? 95.766  -38.527  -6.998  1.00 69.89  ? 82  ILE B O   1 
ATOM   1417  C  CB  . ILE B  1 82  ? 94.795  -38.470  -3.846  1.00 43.86  ? 82  ILE B CB  1 
ATOM   1418  C  CG1 . ILE B  1 82  ? 93.533  -38.503  -4.715  1.00 38.53  ? 82  ILE B CG1 1 
ATOM   1419  C  CG2 . ILE B  1 82  ? 94.672  -37.550  -2.661  1.00 33.17  ? 82  ILE B CG2 1 
ATOM   1420  C  CD1 . ILE B  1 82  ? 92.301  -38.948  -4.001  1.00 45.85  ? 82  ILE B CD1 1 
ATOM   1421  N  N   . SER B  1 83  ? 96.396  -40.194  -5.620  1.00 48.61  ? 83  SER B N   1 
ATOM   1422  C  CA  . SER B  1 83  ? 96.503  -41.165  -6.684  1.00 57.75  ? 83  SER B CA  1 
ATOM   1423  C  C   . SER B  1 83  ? 95.295  -42.063  -6.657  1.00 66.60  ? 83  SER B C   1 
ATOM   1424  O  O   . SER B  1 83  ? 94.804  -42.437  -5.586  1.00 84.94  ? 83  SER B O   1 
ATOM   1425  C  CB  . SER B  1 83  ? 97.762  -42.012  -6.517  1.00 64.38  ? 83  SER B CB  1 
ATOM   1426  O  OG  . SER B  1 83  ? 98.909  -41.272  -6.877  1.00 59.55  ? 83  SER B OG  1 
ATOM   1427  N  N   . VAL B  1 84  ? 94.806  -42.410  -7.838  1.00 54.08  ? 84  VAL B N   1 
ATOM   1428  C  CA  . VAL B  1 84  ? 93.679  -43.323  -7.910  1.00 55.73  ? 84  VAL B CA  1 
ATOM   1429  C  C   . VAL B  1 84  ? 93.760  -44.251  -9.112  1.00 49.43  ? 84  VAL B C   1 
ATOM   1430  O  O   . VAL B  1 84  ? 94.224  -43.886  -10.209 1.00 64.82  ? 84  VAL B O   1 
ATOM   1431  C  CB  . VAL B  1 84  ? 92.296  -42.590  -7.864  1.00 57.41  ? 84  VAL B CB  1 
ATOM   1432  C  CG1 . VAL B  1 84  ? 92.348  -41.380  -6.932  1.00 59.76  ? 84  VAL B CG1 1 
ATOM   1433  C  CG2 . VAL B  1 84  ? 91.832  -42.162  -9.250  1.00 32.99  ? 84  VAL B CG2 1 
ATOM   1434  N  N   . LEU B  1 85  ? 93.307  -45.468  -8.859  1.00 37.52  ? 85  LEU B N   1 
ATOM   1435  C  CA  . LEU B  1 85  ? 93.259  -46.528  -9.837  1.00 51.66  ? 85  LEU B CA  1 
ATOM   1436  C  C   . LEU B  1 85  ? 91.808  -46.702  -10.230 1.00 66.74  ? 85  LEU B C   1 
ATOM   1437  O  O   . LEU B  1 85  ? 90.987  -47.056  -9.399  1.00 61.28  ? 85  LEU B O   1 
ATOM   1438  C  CB  . LEU B  1 85  ? 93.770  -47.825  -9.209  1.00 40.33  ? 85  LEU B CB  1 
ATOM   1439  C  CG  . LEU B  1 85  ? 93.912  -49.014  -10.157 1.00 49.61  ? 85  LEU B CG  1 
ATOM   1440  C  CD1 . LEU B  1 85  ? 94.738  -48.643  -11.391 1.00 55.36  ? 85  LEU B CD1 1 
ATOM   1441  C  CD2 . LEU B  1 85  ? 94.549  -50.154  -9.415  1.00 36.65  ? 85  LEU B CD2 1 
ATOM   1442  N  N   . TYR B  1 86  ? 91.491  -46.465  -11.496 1.00 63.63  ? 86  TYR B N   1 
ATOM   1443  C  CA  . TYR B  1 86  ? 90.102  -46.415  -11.923 1.00 61.90  ? 86  TYR B CA  1 
ATOM   1444  C  C   . TYR B  1 86  ? 89.853  -47.131  -13.238 1.00 64.73  ? 86  TYR B C   1 
ATOM   1445  O  O   . TYR B  1 86  ? 90.771  -47.330  -14.031 1.00 78.35  ? 86  TYR B O   1 
ATOM   1446  C  CB  . TYR B  1 86  ? 89.679  -44.963  -12.090 1.00 75.36  ? 86  TYR B CB  1 
ATOM   1447  C  CG  . TYR B  1 86  ? 90.291  -44.311  -13.307 1.00 65.24  ? 86  TYR B CG  1 
ATOM   1448  C  CD1 . TYR B  1 86  ? 89.595  -44.257  -14.510 1.00 70.51  ? 86  TYR B CD1 1 
ATOM   1449  C  CD2 . TYR B  1 86  ? 91.567  -43.760  -13.256 1.00 52.30  ? 86  TYR B CD2 1 
ATOM   1450  C  CE1 . TYR B  1 86  ? 90.142  -43.664  -15.623 1.00 80.06  ? 86  TYR B CE1 1 
ATOM   1451  C  CE2 . TYR B  1 86  ? 92.126  -43.158  -14.365 1.00 51.22  ? 86  TYR B CE2 1 
ATOM   1452  C  CZ  . TYR B  1 86  ? 91.408  -43.115  -15.550 1.00 69.54  ? 86  TYR B CZ  1 
ATOM   1453  O  OH  . TYR B  1 86  ? 91.947  -42.526  -16.673 1.00 54.72  ? 86  TYR B OH  1 
ATOM   1454  N  N   . LYS B  1 87  ? 88.592  -47.484  -13.479 1.00 61.10  ? 87  LYS B N   1 
ATOM   1455  C  CA  . LYS B  1 87  ? 88.219  -48.218  -14.680 1.00 54.03  ? 87  LYS B CA  1 
ATOM   1456  C  C   . LYS B  1 87  ? 88.137  -47.319  -15.900 1.00 78.38  ? 87  LYS B C   1 
ATOM   1457  O  O   . LYS B  1 87  ? 87.426  -46.313  -15.895 1.00 78.82  ? 87  LYS B O   1 
ATOM   1458  C  CB  . LYS B  1 87  ? 86.895  -48.944  -14.475 1.00 45.47  ? 87  LYS B CB  1 
ATOM   1459  C  CG  . LYS B  1 87  ? 86.997  -50.237  -13.660 1.00 60.77  ? 87  LYS B CG  1 
ATOM   1460  C  CD  . LYS B  1 87  ? 85.611  -50.866  -13.372 1.00 92.89  ? 87  LYS B CD  1 
ATOM   1461  C  CE  . LYS B  1 87  ? 85.684  -52.004  -12.325 1.00 105.12 ? 87  LYS B CE  1 
ATOM   1462  N  NZ  . LYS B  1 87  ? 84.499  -52.066  -11.392 1.00 92.12  ? 87  LYS B NZ  1 
ATOM   1463  N  N   . ASP B  1 88  ? 88.885  -47.700  -16.933 1.00 95.70  ? 88  ASP B N   1 
ATOM   1464  C  CA  . ASP B  1 88  ? 88.879  -47.054  -18.243 1.00 93.94  ? 88  ASP B CA  1 
ATOM   1465  C  C   . ASP B  1 88  ? 87.454  -46.869  -18.757 1.00 102.45 ? 88  ASP B C   1 
ATOM   1466  O  O   . ASP B  1 88  ? 86.491  -47.354  -18.141 1.00 89.97  ? 88  ASP B O   1 
ATOM   1467  C  CB  . ASP B  1 88  ? 89.636  -47.944  -19.230 1.00 93.53  ? 88  ASP B CB  1 
ATOM   1468  C  CG  . ASP B  1 88  ? 90.343  -47.159  -20.317 1.00 128.90 ? 88  ASP B CG  1 
ATOM   1469  O  OD1 . ASP B  1 88  ? 89.804  -46.121  -20.762 1.00 144.78 ? 88  ASP B OD1 1 
ATOM   1470  O  OD2 . ASP B  1 88  ? 91.450  -47.587  -20.726 1.00 135.91 ? 88  ASP B OD2 1 
ATOM   1471  N  N   . ASP B  1 89  ? 87.317  -46.180  -19.891 1.00 111.90 ? 89  ASP B N   1 
ATOM   1472  C  CA  . ASP B  1 89  ? 86.033  -46.125  -20.589 1.00 107.86 ? 89  ASP B CA  1 
ATOM   1473  C  C   . ASP B  1 89  ? 85.689  -47.527  -21.103 1.00 96.25  ? 89  ASP B C   1 
ATOM   1474  O  O   . ASP B  1 89  ? 84.548  -47.813  -21.457 1.00 92.72  ? 89  ASP B O   1 
ATOM   1475  C  CB  . ASP B  1 89  ? 86.060  -45.111  -21.742 1.00 112.66 ? 89  ASP B CB  1 
ATOM   1476  C  CG  . ASP B  1 89  ? 86.205  -43.685  -21.259 1.00 121.44 ? 89  ASP B CG  1 
ATOM   1477  O  OD1 . ASP B  1 89  ? 87.338  -43.163  -21.292 1.00 121.87 ? 89  ASP B OD1 1 
ATOM   1478  O  OD2 . ASP B  1 89  ? 85.189  -43.088  -20.840 1.00 124.63 ? 89  ASP B OD2 1 
ATOM   1479  N  N   . MET B  1 90  ? 86.690  -48.399  -21.137 1.00 95.57  ? 90  MET B N   1 
ATOM   1480  C  CA  . MET B  1 90  ? 86.481  -49.772  -21.556 1.00 97.29  ? 90  MET B CA  1 
ATOM   1481  C  C   . MET B  1 90  ? 86.874  -50.740  -20.444 1.00 96.70  ? 90  MET B C   1 
ATOM   1482  O  O   . MET B  1 90  ? 87.301  -51.866  -20.713 1.00 90.39  ? 90  MET B O   1 
ATOM   1483  C  CB  . MET B  1 90  ? 87.264  -50.064  -22.835 1.00 96.05  ? 90  MET B CB  1 
ATOM   1484  N  N   . GLY B  1 91  ? 86.735  -50.292  -19.197 1.00 86.58  ? 91  GLY B N   1 
ATOM   1485  C  CA  . GLY B  1 91  ? 86.944  -51.154  -18.042 1.00 83.66  ? 91  GLY B CA  1 
ATOM   1486  C  C   . GLY B  1 91  ? 88.361  -51.659  -17.799 1.00 80.97  ? 91  GLY B C   1 
ATOM   1487  O  O   . GLY B  1 91  ? 88.556  -52.749  -17.268 1.00 71.91  ? 91  GLY B O   1 
ATOM   1488  N  N   . VAL B  1 92  ? 89.353  -50.860  -18.174 1.00 76.67  ? 92  VAL B N   1 
ATOM   1489  C  CA  . VAL B  1 92  ? 90.744  -51.210  -17.951 1.00 61.72  ? 92  VAL B CA  1 
ATOM   1490  C  C   . VAL B  1 92  ? 91.289  -50.436  -16.757 1.00 79.86  ? 92  VAL B C   1 
ATOM   1491  O  O   . VAL B  1 92  ? 91.284  -49.195  -16.754 1.00 94.99  ? 92  VAL B O   1 
ATOM   1492  C  CB  . VAL B  1 92  ? 91.586  -50.835  -19.161 1.00 76.29  ? 92  VAL B CB  1 
ATOM   1493  C  CG1 . VAL B  1 92  ? 92.900  -51.606  -19.148 1.00 81.76  ? 92  VAL B CG1 1 
ATOM   1494  C  CG2 . VAL B  1 92  ? 90.791  -51.095  -20.431 1.00 80.60  ? 92  VAL B CG2 1 
ATOM   1495  N  N   . PRO B  1 93  ? 91.764  -51.160  -15.733 1.00 67.01  ? 93  PRO B N   1 
ATOM   1496  C  CA  . PRO B  1 93  ? 92.402  -50.473  -14.608 1.00 66.61  ? 93  PRO B CA  1 
ATOM   1497  C  C   . PRO B  1 93  ? 93.524  -49.560  -15.099 1.00 62.55  ? 93  PRO B C   1 
ATOM   1498  O  O   . PRO B  1 93  ? 94.523  -50.043  -15.639 1.00 76.24  ? 93  PRO B O   1 
ATOM   1499  C  CB  . PRO B  1 93  ? 92.975  -51.627  -13.785 1.00 61.16  ? 93  PRO B CB  1 
ATOM   1500  C  CG  . PRO B  1 93  ? 92.096  -52.774  -14.096 1.00 52.17  ? 93  PRO B CG  1 
ATOM   1501  C  CD  . PRO B  1 93  ? 91.763  -52.619  -15.555 1.00 68.83  ? 93  PRO B CD  1 
ATOM   1502  N  N   . THR B  1 94  ? 93.348  -48.255  -14.941 1.00 42.76  ? 94  THR B N   1 
ATOM   1503  C  CA  . THR B  1 94  ? 94.401  -47.312  -15.289 1.00 74.18  ? 94  THR B CA  1 
ATOM   1504  C  C   . THR B  1 94  ? 94.633  -46.350  -14.128 1.00 70.09  ? 94  THR B C   1 
ATOM   1505  O  O   . THR B  1 94  ? 93.839  -46.288  -13.191 1.00 53.01  ? 94  THR B O   1 
ATOM   1506  C  CB  . THR B  1 94  ? 94.061  -46.534  -16.568 1.00 81.07  ? 94  THR B CB  1 
ATOM   1507  O  OG1 . THR B  1 94  ? 92.994  -45.604  -16.296 1.00 55.52  ? 94  THR B OG1 1 
ATOM   1508  C  CG2 . THR B  1 94  ? 93.663  -47.510  -17.701 1.00 77.19  ? 94  THR B CG2 1 
ATOM   1509  N  N   . LEU B  1 95  ? 95.711  -45.582  -14.191 1.00 58.87  ? 95  LEU B N   1 
ATOM   1510  C  CA  . LEU B  1 95  ? 96.115  -44.824  -13.019 1.00 58.73  ? 95  LEU B CA  1 
ATOM   1511  C  C   . LEU B  1 95  ? 96.272  -43.295  -13.215 1.00 66.40  ? 95  LEU B C   1 
ATOM   1512  O  O   . LEU B  1 95  ? 97.144  -42.845  -13.962 1.00 79.90  ? 95  LEU B O   1 
ATOM   1513  C  CB  . LEU B  1 95  ? 97.418  -45.431  -12.491 1.00 49.74  ? 95  LEU B CB  1 
ATOM   1514  C  CG  . LEU B  1 95  ? 98.186  -44.562  -11.507 1.00 59.14  ? 95  LEU B CG  1 
ATOM   1515  C  CD1 . LEU B  1 95  ? 97.359  -44.339  -10.249 1.00 93.55  ? 95  LEU B CD1 1 
ATOM   1516  C  CD2 . LEU B  1 95  ? 99.495  -45.239  -11.195 1.00 37.77  ? 95  LEU B CD2 1 
ATOM   1517  N  N   . LYS B  1 96  ? 95.452  -42.482  -12.547 1.00 53.91  ? 96  LYS B N   1 
ATOM   1518  C  CA  . LYS B  1 96  ? 95.892  -41.101  -12.433 1.00 67.27  ? 96  LYS B CA  1 
ATOM   1519  C  C   . LYS B  1 96  ? 96.725  -40.987  -11.154 1.00 74.06  ? 96  LYS B C   1 
ATOM   1520  O  O   . LYS B  1 96  ? 96.198  -41.132  -10.033 1.00 69.03  ? 96  LYS B O   1 
ATOM   1521  C  CB  . LYS B  1 96  ? 94.774  -40.039  -12.537 1.00 50.40  ? 96  LYS B CB  1 
ATOM   1522  C  CG  . LYS B  1 96  ? 95.328  -38.601  -13.010 1.00 38.79  ? 96  LYS B CG  1 
ATOM   1523  C  CD  . LYS B  1 96  ? 96.451  -38.752  -14.105 1.00 175.24 ? 96  LYS B CD  1 
ATOM   1524  C  CE  . LYS B  1 96  ? 97.884  -38.282  -13.661 1.00 86.96  ? 96  LYS B CE  1 
ATOM   1525  N  NZ  . LYS B  1 96  ? 99.076  -39.101  -14.179 1.00 30.23  ? 96  LYS B NZ  1 
ATOM   1526  N  N   . TYR B  1 97  ? 98.034  -40.787  -11.353 1.00 46.20  ? 97  TYR B N   1 
ATOM   1527  C  CA  . TYR B  1 97  ? 98.966  -40.571  -10.262 1.00 45.46  ? 97  TYR B CA  1 
ATOM   1528  C  C   . TYR B  1 97  ? 98.820  -39.143  -9.660  1.00 59.99  ? 97  TYR B C   1 
ATOM   1529  O  O   . TYR B  1 97  ? 98.789  -38.963  -8.440  1.00 63.60  ? 97  TYR B O   1 
ATOM   1530  C  CB  . TYR B  1 97  ? 100.394 -40.857  -10.757 1.00 42.13  ? 97  TYR B CB  1 
ATOM   1531  C  CG  . TYR B  1 97  ? 101.477 -40.649  -9.711  1.00 53.55  ? 97  TYR B CG  1 
ATOM   1532  C  CD1 . TYR B  1 97  ? 101.547 -41.452  -8.572  1.00 65.38  ? 97  TYR B CD1 1 
ATOM   1533  C  CD2 . TYR B  1 97  ? 102.428 -39.657  -9.860  1.00 41.44  ? 97  TYR B CD2 1 
ATOM   1534  C  CE1 . TYR B  1 97  ? 102.531 -41.260  -7.612  1.00 62.69  ? 97  TYR B CE1 1 
ATOM   1535  C  CE2 . TYR B  1 97  ? 103.407 -39.454  -8.910  1.00 69.18  ? 97  TYR B CE2 1 
ATOM   1536  C  CZ  . TYR B  1 97  ? 103.457 -40.254  -7.790  1.00 76.36  ? 97  TYR B CZ  1 
ATOM   1537  O  OH  . TYR B  1 97  ? 104.447 -40.039  -6.856  1.00 93.61  ? 97  TYR B OH  1 
ATOM   1538  N  N   . HIS B  1 98  ? 98.719  -38.140  -10.525 1.00 75.12  ? 98  HIS B N   1 
ATOM   1539  C  CA  . HIS B  1 98  ? 98.513  -36.765  -10.089 1.00 75.12  ? 98  HIS B CA  1 
ATOM   1540  C  C   . HIS B  1 98  ? 97.063  -36.326  -10.342 1.00 79.13  ? 98  HIS B C   1 
ATOM   1541  O  O   . HIS B  1 98  ? 96.812  -35.519  -11.244 1.00 110.42 ? 98  HIS B O   1 
ATOM   1542  C  CB  . HIS B  1 98  ? 99.509  -35.815  -10.794 1.00 72.17  ? 98  HIS B CB  1 
ATOM   1543  C  CG  . HIS B  1 98  ? 100.677 -35.402  -9.937  1.00 116.25 ? 98  HIS B CG  1 
ATOM   1544  N  ND1 . HIS B  1 98  ? 100.909 -34.089  -9.573  1.00 136.89 ? 98  HIS B ND1 1 
ATOM   1545  C  CD2 . HIS B  1 98  ? 101.675 -36.127  -9.369  1.00 119.05 ? 98  HIS B CD2 1 
ATOM   1546  C  CE1 . HIS B  1 98  ? 101.996 -34.024  -8.821  1.00 126.30 ? 98  HIS B CE1 1 
ATOM   1547  N  NE2 . HIS B  1 98  ? 102.482 -35.246  -8.685  1.00 115.90 ? 98  HIS B NE2 1 
ATOM   1548  N  N   . TYR B  1 99  ? 96.119  -36.858  -9.556  1.00 43.65  ? 99  TYR B N   1 
ATOM   1549  C  CA  . TYR B  1 99  ? 94.707  -36.465  -9.663  1.00 43.42  ? 99  TYR B CA  1 
ATOM   1550  C  C   . TYR B  1 99  ? 94.477  -35.203  -8.864  1.00 61.72  ? 99  TYR B C   1 
ATOM   1551  O  O   . TYR B  1 99  ? 94.371  -35.254  -7.635  1.00 62.30  ? 99  TYR B O   1 
ATOM   1552  C  CB  . TYR B  1 99  ? 93.795  -37.553  -9.127  1.00 50.21  ? 99  TYR B CB  1 
ATOM   1553  C  CG  . TYR B  1 99  ? 92.325  -37.375  -9.463  1.00 49.16  ? 99  TYR B CG  1 
ATOM   1554  C  CD1 . TYR B  1 99  ? 91.369  -38.238  -8.946  1.00 49.21  ? 99  TYR B CD1 1 
ATOM   1555  C  CD2 . TYR B  1 99  ? 91.896  -36.359  -10.294 1.00 70.12  ? 99  TYR B CD2 1 
ATOM   1556  C  CE1 . TYR B  1 99  ? 90.041  -38.087  -9.241  1.00 41.21  ? 99  TYR B CE1 1 
ATOM   1557  C  CE2 . TYR B  1 99  ? 90.555  -36.205  -10.592 1.00 74.56  ? 99  TYR B CE2 1 
ATOM   1558  C  CZ  . TYR B  1 99  ? 89.637  -37.071  -10.062 1.00 55.19  ? 99  TYR B CZ  1 
ATOM   1559  O  OH  . TYR B  1 99  ? 88.303  -36.916  -10.352 1.00 69.01  ? 99  TYR B OH  1 
ATOM   1560  N  N   . GLU B  1 100 ? 94.380  -34.075  -9.561  1.00 54.09  ? 100 GLU B N   1 
ATOM   1561  C  CA  . GLU B  1 100 ? 94.603  -32.804  -8.900  1.00 44.37  ? 100 GLU B CA  1 
ATOM   1562  C  C   . GLU B  1 100 ? 93.466  -32.328  -8.019  1.00 53.94  ? 100 GLU B C   1 
ATOM   1563  O  O   . GLU B  1 100 ? 92.286  -32.538  -8.325  1.00 63.63  ? 100 GLU B O   1 
ATOM   1564  C  CB  . GLU B  1 100 ? 94.990  -31.739  -9.920  1.00 59.49  ? 100 GLU B CB  1 
ATOM   1565  C  CG  . GLU B  1 100 ? 96.432  -31.873  -10.419 1.00 88.34  ? 100 GLU B CG  1 
ATOM   1566  C  CD  . GLU B  1 100 ? 97.470  -31.732  -9.298  1.00 100.33 ? 100 GLU B CD  1 
ATOM   1567  O  OE1 . GLU B  1 100 ? 97.077  -31.327  -8.171  1.00 107.79 ? 100 GLU B OE1 1 
ATOM   1568  O  OE2 . GLU B  1 100 ? 98.672  -32.035  -9.549  1.00 67.17  ? 100 GLU B OE2 1 
ATOM   1569  N  N   . GLY B  1 101 ? 93.846  -31.703  -6.908  1.00 59.45  ? 101 GLY B N   1 
ATOM   1570  C  CA  . GLY B  1 101 ? 92.925  -30.934  -6.087  1.00 58.12  ? 101 GLY B CA  1 
ATOM   1571  C  C   . GLY B  1 101 ? 91.873  -31.729  -5.350  1.00 56.89  ? 101 GLY B C   1 
ATOM   1572  O  O   . GLY B  1 101 ? 90.690  -31.364  -5.363  1.00 71.24  ? 101 GLY B O   1 
ATOM   1573  N  N   . MET B  1 102 ? 92.291  -32.809  -4.702  1.00 35.98  ? 102 MET B N   1 
ATOM   1574  C  CA  . MET B  1 102 ? 91.325  -33.655  -4.027  1.00 50.37  ? 102 MET B CA  1 
ATOM   1575  C  C   . MET B  1 102 ? 91.499  -33.631  -2.526  1.00 61.37  ? 102 MET B C   1 
ATOM   1576  O  O   . MET B  1 102 ? 90.664  -34.144  -1.782  1.00 70.43  ? 102 MET B O   1 
ATOM   1577  C  CB  . MET B  1 102 ? 91.444  -35.080  -4.524  1.00 43.13  ? 102 MET B CB  1 
ATOM   1578  C  CG  . MET B  1 102 ? 91.099  -35.235  -5.972  1.00 47.32  ? 102 MET B CG  1 
ATOM   1579  S  SD  . MET B  1 102 ? 89.364  -35.631  -6.165  1.00 73.01  ? 102 MET B SD  1 
ATOM   1580  C  CE  . MET B  1 102 ? 89.200  -37.039  -5.074  1.00 45.98  ? 102 MET B CE  1 
ATOM   1581  N  N   . SER B  1 103 ? 92.590  -33.042  -2.072  1.00 52.12  ? 103 SER B N   1 
ATOM   1582  C  CA  . SER B  1 103 ? 92.876  -33.073  -0.655  1.00 55.67  ? 103 SER B CA  1 
ATOM   1583  C  C   . SER B  1 103 ? 93.350  -31.709  -0.206  1.00 63.84  ? 103 SER B C   1 
ATOM   1584  O  O   . SER B  1 103 ? 93.972  -30.973  -0.963  1.00 64.56  ? 103 SER B O   1 
ATOM   1585  C  CB  . SER B  1 103 ? 93.924  -34.139  -0.369  1.00 55.03  ? 103 SER B CB  1 
ATOM   1586  O  OG  . SER B  1 103 ? 94.151  -34.261  1.016   1.00 80.18  ? 103 SER B OG  1 
ATOM   1587  N  N   . VAL B  1 104 ? 93.040  -31.345  1.024   1.00 61.82  ? 104 VAL B N   1 
ATOM   1588  C  CA  . VAL B  1 104 ? 93.381  -30.006  1.460   1.00 45.59  ? 104 VAL B CA  1 
ATOM   1589  C  C   . VAL B  1 104 ? 94.798  -29.941  1.943   1.00 47.65  ? 104 VAL B C   1 
ATOM   1590  O  O   . VAL B  1 104 ? 95.225  -30.746  2.765   1.00 60.06  ? 104 VAL B O   1 
ATOM   1591  C  CB  . VAL B  1 104 ? 92.484  -29.526  2.591   1.00 50.47  ? 104 VAL B CB  1 
ATOM   1592  C  CG1 . VAL B  1 104 ? 92.943  -28.160  3.059   1.00 54.74  ? 104 VAL B CG1 1 
ATOM   1593  C  CG2 . VAL B  1 104 ? 91.041  -29.480  2.133   1.00 42.10  ? 104 VAL B CG2 1 
ATOM   1594  N  N   . ALA B  1 105 ? 95.527  -28.963  1.435   1.00 46.65  ? 105 ALA B N   1 
ATOM   1595  C  CA  . ALA B  1 105 ? 96.902  -28.762  1.854   1.00 54.25  ? 105 ALA B CA  1 
ATOM   1596  C  C   . ALA B  1 105 ? 96.952  -27.757  2.991   1.00 63.03  ? 105 ALA B C   1 
ATOM   1597  O  O   . ALA B  1 105 ? 97.363  -28.069  4.107   1.00 77.66  ? 105 ALA B O   1 
ATOM   1598  C  CB  . ALA B  1 105 ? 97.740  -28.281  0.692   1.00 23.54  ? 105 ALA B CB  1 
ATOM   1599  N  N   . GLU B  1 106 ? 96.519  -26.543  2.697   1.00 40.97  ? 106 GLU B N   1 
ATOM   1600  C  CA  . GLU B  1 106 ? 96.549  -25.481  3.678   1.00 52.50  ? 106 GLU B CA  1 
ATOM   1601  C  C   . GLU B  1 106 ? 95.176  -24.804  3.770   1.00 63.70  ? 106 GLU B C   1 
ATOM   1602  O  O   . GLU B  1 106 ? 94.447  -24.744  2.780   1.00 41.80  ? 106 GLU B O   1 
ATOM   1603  C  CB  . GLU B  1 106 ? 97.624  -24.469  3.285   1.00 61.44  ? 106 GLU B CB  1 
ATOM   1604  C  CG  . GLU B  1 106 ? 99.045  -25.019  3.348   1.00 75.12  ? 106 GLU B CG  1 
ATOM   1605  C  CD  . GLU B  1 106 ? 100.085 -24.049  2.780   1.00 100.78 ? 106 GLU B CD  1 
ATOM   1606  O  OE1 . GLU B  1 106 ? 101.295 -24.394  2.764   1.00 110.47 ? 106 GLU B OE1 1 
ATOM   1607  O  OE2 . GLU B  1 106 ? 99.686  -22.943  2.344   1.00 94.14  ? 106 GLU B OE2 1 
ATOM   1608  N  N   . CYS B  1 107 ? 94.828  -24.305  4.956   1.00 52.45  ? 107 CYS B N   1 
ATOM   1609  C  CA  . CYS B  1 107 ? 93.553  -23.640  5.145   1.00 38.26  ? 107 CYS B CA  1 
ATOM   1610  C  C   . CYS B  1 107 ? 93.734  -22.134  5.184   1.00 47.62  ? 107 CYS B C   1 
ATOM   1611  O  O   . CYS B  1 107 ? 94.858  -21.657  5.231   1.00 77.03  ? 107 CYS B O   1 
ATOM   1612  C  CB  . CYS B  1 107 ? 92.858  -24.156  6.408   1.00 38.56  ? 107 CYS B CB  1 
ATOM   1613  S  SG  . CYS B  1 107 ? 91.814  -25.649  6.116   1.00 94.38  ? 107 CYS B SG  1 
ATOM   1614  N  N   . GLY B  1 108 ? 92.646  -21.370  5.150   1.00 45.72  ? 108 GLY B N   1 
ATOM   1615  C  CA  . GLY B  1 108 ? 92.792  -19.925  5.231   1.00 60.81  ? 108 GLY B CA  1 
ATOM   1616  C  C   . GLY B  1 108 ? 91.509  -19.110  5.212   1.00 60.60  ? 108 GLY B C   1 
ATOM   1617  O  O   . GLY B  1 108 ? 90.409  -19.658  5.095   1.00 65.16  ? 108 GLY B O   1 
ATOM   1618  N  N   . CYS B  1 109 ? 91.651  -17.789  5.330   1.00 37.19  ? 109 CYS B N   1 
ATOM   1619  C  CA  . CYS B  1 109 ? 90.499  -16.903  5.409   1.00 38.61  ? 109 CYS B CA  1 
ATOM   1620  C  C   . CYS B  1 109 ? 90.461  -15.997  4.209   1.00 44.71  ? 109 CYS B C   1 
ATOM   1621  O  O   . CYS B  1 109 ? 91.468  -15.368  3.882   1.00 61.75  ? 109 CYS B O   1 
ATOM   1622  C  CB  . CYS B  1 109 ? 90.529  -16.081  6.700   1.00 32.15  ? 109 CYS B CB  1 
ATOM   1623  S  SG  . CYS B  1 109 ? 89.926  -17.004  8.159   1.00 78.90  ? 109 CYS B SG  1 
ATOM   1624  N  N   . ARG B  1 110 ? 89.300  -15.925  3.557   1.00 35.58  ? 110 ARG B N   1 
ATOM   1625  C  CA  . ARG B  1 110 ? 89.177  -15.161  2.322   1.00 61.51  ? 110 ARG B CA  1 
ATOM   1626  C  C   . ARG B  1 110 ? 87.831  -14.424  2.195   1.00 76.57  ? 110 ARG B C   1 
ATOM   1627  O  O   . ARG B  1 110 ? 87.737  -13.330  1.614   1.00 92.17  ? 110 ARG B O   1 
ATOM   1628  C  CB  . ARG B  1 110 ? 89.426  -16.082  1.131   1.00 52.32  ? 110 ARG B CB  1 
ATOM   1629  C  CG  . ARG B  1 110 ? 90.727  -16.892  1.239   1.00 21.16  ? 110 ARG B CG  1 
ATOM   1630  C  CD  . ARG B  1 110 ? 91.938  -16.016  0.915   1.00 34.93  ? 110 ARG B CD  1 
ATOM   1631  N  NE  . ARG B  1 110 ? 93.195  -16.760  0.773   1.00 37.94  ? 110 ARG B NE  1 
ATOM   1632  C  CZ  . ARG B  1 110 ? 94.056  -16.976  1.759   1.00 48.14  ? 110 ARG B CZ  1 
ATOM   1633  N  NH1 . ARG B  1 110 ? 93.789  -16.514  2.967   1.00 68.95  ? 110 ARG B NH1 1 
ATOM   1634  N  NH2 . ARG B  1 110 ? 95.179  -17.650  1.540   1.00 53.56  ? 110 ARG B NH2 1 
ATOM   1635  O  OXT . ARG B  1 110 ? 86.802  -14.890  2.689   1.00 63.91  ? 110 ARG B OXT 1 
ATOM   1636  N  N   . PRO C  2 11  ? 115.167 -8.974   12.331  1.00 134.06 ? 30  PRO C N   1 
ATOM   1637  C  CA  . PRO C  2 11  ? 115.336 -8.100   13.500  1.00 135.03 ? 30  PRO C CA  1 
ATOM   1638  C  C   . PRO C  2 11  ? 114.206 -8.304   14.509  1.00 137.65 ? 30  PRO C C   1 
ATOM   1639  O  O   . PRO C  2 11  ? 113.622 -7.328   14.976  1.00 136.65 ? 30  PRO C O   1 
ATOM   1640  C  CB  . PRO C  2 11  ? 115.254 -6.683   12.901  1.00 123.68 ? 30  PRO C CB  1 
ATOM   1641  C  CG  . PRO C  2 11  ? 115.424 -6.853   11.418  1.00 119.18 ? 30  PRO C CG  1 
ATOM   1642  C  CD  . PRO C  2 11  ? 114.873 -8.213   11.106  1.00 127.63 ? 30  PRO C CD  1 
ATOM   1643  N  N   . LEU C  2 12  ? 113.911 -9.557   14.845  1.00 136.58 ? 31  LEU C N   1 
ATOM   1644  C  CA  . LEU C  2 12  ? 112.734 -9.893   15.649  1.00 127.33 ? 31  LEU C CA  1 
ATOM   1645  C  C   . LEU C  2 12  ? 112.764 -9.383   17.091  1.00 121.22 ? 31  LEU C C   1 
ATOM   1646  O  O   . LEU C  2 12  ? 113.795 -8.939   17.583  1.00 134.10 ? 31  LEU C O   1 
ATOM   1647  C  CB  . LEU C  2 12  ? 112.509 -11.406  15.652  1.00 129.51 ? 31  LEU C CB  1 
ATOM   1648  C  CG  . LEU C  2 12  ? 112.022 -12.072  14.364  1.00 130.72 ? 31  LEU C CG  1 
ATOM   1649  C  CD1 . LEU C  2 12  ? 113.014 -11.881  13.222  1.00 140.51 ? 31  LEU C CD1 1 
ATOM   1650  C  CD2 . LEU C  2 12  ? 111.768 -13.551  14.621  1.00 124.38 ? 31  LEU C CD2 1 
ATOM   1651  N  N   . VAL C  2 13  ? 111.616 -9.472   17.759  1.00 113.32 ? 32  VAL C N   1 
ATOM   1652  C  CA  . VAL C  2 13  ? 111.450 -9.030   19.142  1.00 113.87 ? 32  VAL C CA  1 
ATOM   1653  C  C   . VAL C  2 13  ? 110.505 -9.973   19.902  1.00 122.77 ? 32  VAL C C   1 
ATOM   1654  O  O   . VAL C  2 13  ? 109.793 -10.780  19.298  1.00 122.70 ? 32  VAL C O   1 
ATOM   1655  C  CB  . VAL C  2 13  ? 110.876 -7.611   19.198  1.00 101.16 ? 32  VAL C CB  1 
ATOM   1656  C  CG1 . VAL C  2 13  ? 109.448 -7.620   18.706  1.00 98.01  ? 32  VAL C CG1 1 
ATOM   1657  C  CG2 . VAL C  2 13  ? 110.944 -7.054   20.607  1.00 109.00 ? 32  VAL C CG2 1 
ATOM   1658  N  N   . THR C  2 14  ? 110.497 -9.861   21.227  1.00 124.01 ? 33  THR C N   1 
ATOM   1659  C  CA  . THR C  2 14  ? 109.725 -10.764  22.073  1.00 120.05 ? 33  THR C CA  1 
ATOM   1660  C  C   . THR C  2 14  ? 108.544 -10.053  22.730  1.00 119.16 ? 33  THR C C   1 
ATOM   1661  O  O   . THR C  2 14  ? 108.716 -9.019   23.367  1.00 116.47 ? 33  THR C O   1 
ATOM   1662  C  CB  . THR C  2 14  ? 110.617 -11.391  23.162  1.00 110.83 ? 33  THR C CB  1 
ATOM   1663  O  OG1 . THR C  2 14  ? 111.738 -12.040  22.546  1.00 108.82 ? 33  THR C OG1 1 
ATOM   1664  C  CG2 . THR C  2 14  ? 109.841 -12.402  23.971  1.00 102.50 ? 33  THR C CG2 1 
ATOM   1665  N  N   . CYS C  2 15  ? 107.350 -10.620  22.576  1.00 119.89 ? 34  CYS C N   1 
ATOM   1666  C  CA  . CYS C  2 15  ? 106.124 -10.022  23.099  1.00 107.26 ? 34  CYS C CA  1 
ATOM   1667  C  C   . CYS C  2 15  ? 105.375 -10.948  24.055  1.00 107.96 ? 34  CYS C C   1 
ATOM   1668  O  O   . CYS C  2 15  ? 105.493 -12.182  23.977  1.00 116.76 ? 34  CYS C O   1 
ATOM   1669  C  CB  . CYS C  2 15  ? 105.185 -9.653   21.952  1.00 104.28 ? 34  CYS C CB  1 
ATOM   1670  S  SG  . CYS C  2 15  ? 106.001 -9.242   20.396  1.00 148.72 ? 34  CYS C SG  1 
ATOM   1671  N  N   . THR C  2 16  ? 104.594 -10.339  24.947  1.00 101.53 ? 35  THR C N   1 
ATOM   1672  C  CA  . THR C  2 16  ? 103.698 -11.088  25.823  1.00 114.27 ? 35  THR C CA  1 
ATOM   1673  C  C   . THR C  2 16  ? 102.565 -11.662  24.979  1.00 117.03 ? 35  THR C C   1 
ATOM   1674  O  O   . THR C  2 16  ? 102.118 -11.037  24.015  1.00 107.09 ? 35  THR C O   1 
ATOM   1675  C  CB  . THR C  2 16  ? 103.090 -10.203  26.936  1.00 115.31 ? 35  THR C CB  1 
ATOM   1676  O  OG1 . THR C  2 16  ? 104.096 -9.346   27.485  1.00 125.89 ? 35  THR C OG1 1 
ATOM   1677  C  CG2 . THR C  2 16  ? 102.500 -11.063  28.048  1.00 108.91 ? 35  THR C CG2 1 
ATOM   1678  N  N   . CYS C  2 17  ? 102.098 -12.849  25.340  1.00 118.94 ? 36  CYS C N   1 
ATOM   1679  C  CA  . CYS C  2 17  ? 101.104 -13.526  24.532  1.00 113.30 ? 36  CYS C CA  1 
ATOM   1680  C  C   . CYS C  2 17  ? 99.924  -13.992  25.382  1.00 124.57 ? 36  CYS C C   1 
ATOM   1681  O  O   . CYS C  2 17  ? 99.937  -15.093  25.929  1.00 137.39 ? 36  CYS C O   1 
ATOM   1682  C  CB  . CYS C  2 17  ? 101.751 -14.705  23.795  1.00 116.14 ? 36  CYS C CB  1 
ATOM   1683  S  SG  . CYS C  2 17  ? 100.714 -15.520  22.551  1.00 120.70 ? 36  CYS C SG  1 
ATOM   1684  N  N   . GLU C  2 18  ? 98.905  -13.144  25.495  1.00 118.94 ? 37  GLU C N   1 
ATOM   1685  C  CA  . GLU C  2 18  ? 97.658  -13.518  26.162  1.00 115.15 ? 37  GLU C CA  1 
ATOM   1686  C  C   . GLU C  2 18  ? 96.521  -13.594  25.140  1.00 117.32 ? 37  GLU C C   1 
ATOM   1687  O  O   . GLU C  2 18  ? 95.876  -12.591  24.837  1.00 117.95 ? 37  GLU C O   1 
ATOM   1688  C  CB  . GLU C  2 18  ? 97.321  -12.530  27.283  1.00 111.11 ? 37  GLU C CB  1 
ATOM   1689  C  CG  . GLU C  2 18  ? 98.389  -12.450  28.367  1.00 126.31 ? 37  GLU C CG  1 
ATOM   1690  C  CD  . GLU C  2 18  ? 98.062  -11.443  29.464  1.00 131.85 ? 37  GLU C CD  1 
ATOM   1691  O  OE1 . GLU C  2 18  ? 98.952  -11.165  30.308  1.00 124.68 ? 37  GLU C OE1 1 
ATOM   1692  O  OE2 . GLU C  2 18  ? 96.917  -10.936  29.483  1.00 126.44 ? 37  GLU C OE2 1 
ATOM   1693  N  N   . SER C  2 19  ? 96.287  -14.792  24.610  1.00 117.49 ? 38  SER C N   1 
ATOM   1694  C  CA  . SER C  2 19  ? 95.316  -15.006  23.536  1.00 115.73 ? 38  SER C CA  1 
ATOM   1695  C  C   . SER C  2 19  ? 95.051  -16.496  23.336  1.00 120.51 ? 38  SER C C   1 
ATOM   1696  O  O   . SER C  2 19  ? 95.813  -17.339  23.809  1.00 130.85 ? 38  SER C O   1 
ATOM   1697  C  CB  . SER C  2 19  ? 95.819  -14.387  22.222  1.00 105.05 ? 38  SER C CB  1 
ATOM   1698  O  OG  . SER C  2 19  ? 95.138  -14.910  21.086  1.00 78.31  ? 38  SER C OG  1 
ATOM   1699  N  N   . PRO C  2 20  ? 93.958  -16.826  22.639  1.00 117.28 ? 39  PRO C N   1 
ATOM   1700  C  CA  . PRO C  2 20  ? 93.641  -18.217  22.313  1.00 116.14 ? 39  PRO C CA  1 
ATOM   1701  C  C   . PRO C  2 20  ? 94.672  -18.879  21.395  1.00 119.74 ? 39  PRO C C   1 
ATOM   1702  O  O   . PRO C  2 20  ? 95.068  -20.013  21.654  1.00 121.17 ? 39  PRO C O   1 
ATOM   1703  C  CB  . PRO C  2 20  ? 92.283  -18.111  21.611  1.00 102.02 ? 39  PRO C CB  1 
ATOM   1704  C  CG  . PRO C  2 20  ? 92.154  -16.691  21.210  1.00 102.33 ? 39  PRO C CG  1 
ATOM   1705  C  CD  . PRO C  2 20  ? 92.866  -15.917  22.260  1.00 113.27 ? 39  PRO C CD  1 
ATOM   1706  N  N   . HIS C  2 21  ? 95.100  -18.188  20.346  1.00 109.22 ? 40  HIS C N   1 
ATOM   1707  C  CA  . HIS C  2 21  ? 96.077  -18.758  19.428  1.00 115.70 ? 40  HIS C CA  1 
ATOM   1708  C  C   . HIS C  2 21  ? 97.495  -18.740  20.025  1.00 122.62 ? 40  HIS C C   1 
ATOM   1709  O  O   . HIS C  2 21  ? 98.479  -18.542  19.307  1.00 107.20 ? 40  HIS C O   1 
ATOM   1710  C  CB  . HIS C  2 21  ? 96.068  -17.998  18.101  1.00 117.70 ? 40  HIS C CB  1 
ATOM   1711  C  CG  . HIS C  2 21  ? 94.700  -17.716  17.571  1.00 134.05 ? 40  HIS C CG  1 
ATOM   1712  N  ND1 . HIS C  2 21  ? 94.388  -16.552  16.899  1.00 148.34 ? 40  HIS C ND1 1 
ATOM   1713  C  CD2 . HIS C  2 21  ? 93.562  -18.448  17.605  1.00 144.71 ? 40  HIS C CD2 1 
ATOM   1714  C  CE1 . HIS C  2 21  ? 93.115  -16.577  16.546  1.00 154.19 ? 40  HIS C CE1 1 
ATOM   1715  N  NE2 . HIS C  2 21  ? 92.591  -17.716  16.963  1.00 159.74 ? 40  HIS C NE2 1 
ATOM   1716  N  N   . CYS C  2 22  ? 97.604  -18.954  21.332  1.00 130.88 ? 41  CYS C N   1 
ATOM   1717  C  CA  . CYS C  2 22  ? 98.900  -18.867  22.003  1.00 130.86 ? 41  CYS C CA  1 
ATOM   1718  C  C   . CYS C  2 22  ? 99.536  -20.212  22.319  1.00 127.54 ? 41  CYS C C   1 
ATOM   1719  O  O   . CYS C  2 22  ? 99.015  -20.981  23.121  1.00 121.99 ? 41  CYS C O   1 
ATOM   1720  C  CB  . CYS C  2 22  ? 98.789  -18.046  23.286  1.00 137.12 ? 41  CYS C CB  1 
ATOM   1721  S  SG  . CYS C  2 22  ? 98.876  -16.263  23.016  1.00 202.65 ? 41  CYS C SG  1 
ATOM   1722  N  N   . LYS C  2 23  ? 100.676 -20.475  21.691  1.00 132.46 ? 42  LYS C N   1 
ATOM   1723  C  CA  . LYS C  2 23  ? 101.457 -21.669  21.979  1.00 128.61 ? 42  LYS C CA  1 
ATOM   1724  C  C   . LYS C  2 23  ? 102.548 -21.333  23.004  1.00 131.25 ? 42  LYS C C   1 
ATOM   1725  O  O   . LYS C  2 23  ? 103.739 -21.430  22.710  1.00 144.75 ? 42  LYS C O   1 
ATOM   1726  C  CB  . LYS C  2 23  ? 102.075 -22.231  20.688  1.00 109.25 ? 42  LYS C CB  1 
ATOM   1727  C  CG  . LYS C  2 23  ? 101.064 -22.626  19.596  1.00 108.11 ? 42  LYS C CG  1 
ATOM   1728  C  CD  . LYS C  2 23  ? 101.775 -22.953  18.285  1.00 101.88 ? 42  LYS C CD  1 
ATOM   1729  C  CE  . LYS C  2 23  ? 100.819 -23.378  17.185  1.00 102.64 ? 42  LYS C CE  1 
ATOM   1730  N  NZ  . LYS C  2 23  ? 101.579 -23.847  15.984  1.00 92.03  ? 42  LYS C NZ  1 
ATOM   1731  N  N   . GLY C  2 24  ? 102.136 -20.929  24.203  1.00 112.84 ? 43  GLY C N   1 
ATOM   1732  C  CA  . GLY C  2 24  ? 103.075 -20.539  25.243  1.00 109.26 ? 43  GLY C CA  1 
ATOM   1733  C  C   . GLY C  2 24  ? 102.594 -19.327  26.014  1.00 121.46 ? 43  GLY C C   1 
ATOM   1734  O  O   . GLY C  2 24  ? 101.451 -18.918  25.859  1.00 129.22 ? 43  GLY C O   1 
ATOM   1735  N  N   . PRO C  2 25  ? 103.461 -18.752  26.857  1.00 130.91 ? 44  PRO C N   1 
ATOM   1736  C  CA  . PRO C  2 25  ? 103.169 -17.550  27.643  1.00 128.02 ? 44  PRO C CA  1 
ATOM   1737  C  C   . PRO C  2 25  ? 103.687 -16.290  26.953  1.00 134.20 ? 44  PRO C C   1 
ATOM   1738  O  O   . PRO C  2 25  ? 103.248 -15.179  27.261  1.00 126.79 ? 44  PRO C O   1 
ATOM   1739  C  CB  . PRO C  2 25  ? 103.966 -17.791  28.917  1.00 124.26 ? 44  PRO C CB  1 
ATOM   1740  C  CG  . PRO C  2 25  ? 105.188 -18.486  28.421  1.00 134.69 ? 44  PRO C CG  1 
ATOM   1741  C  CD  . PRO C  2 25  ? 104.759 -19.332  27.233  1.00 139.65 ? 44  PRO C CD  1 
ATOM   1742  N  N   . THR C  2 26  ? 104.635 -16.468  26.040  1.00 138.01 ? 45  THR C N   1 
ATOM   1743  C  CA  . THR C  2 26  ? 105.185 -15.362  25.266  1.00 127.53 ? 45  THR C CA  1 
ATOM   1744  C  C   . THR C  2 26  ? 105.532 -15.867  23.881  1.00 127.03 ? 45  THR C C   1 
ATOM   1745  O  O   . THR C  2 26  ? 105.634 -17.077  23.666  1.00 121.09 ? 45  THR C O   1 
ATOM   1746  C  CB  . THR C  2 26  ? 106.474 -14.817  25.879  1.00 112.06 ? 45  THR C CB  1 
ATOM   1747  O  OG1 . THR C  2 26  ? 107.553 -15.717  25.587  1.00 104.56 ? 45  THR C OG1 1 
ATOM   1748  C  CG2 . THR C  2 26  ? 106.325 -14.657  27.376  1.00 112.57 ? 45  THR C CG2 1 
ATOM   1749  N  N   . CYS C  2 27  ? 105.737 -14.940  22.948  1.00 127.63 ? 46  CYS C N   1 
ATOM   1750  C  CA  . CYS C  2 27  ? 106.045 -15.316  21.571  1.00 121.15 ? 46  CYS C CA  1 
ATOM   1751  C  C   . CYS C  2 27  ? 107.013 -14.330  20.932  1.00 108.69 ? 46  CYS C C   1 
ATOM   1752  O  O   . CYS C  2 27  ? 107.275 -13.271  21.484  1.00 104.38 ? 46  CYS C O   1 
ATOM   1753  C  CB  . CYS C  2 27  ? 104.760 -15.392  20.753  1.00 121.71 ? 46  CYS C CB  1 
ATOM   1754  S  SG  . CYS C  2 27  ? 103.827 -13.845  20.737  1.00 145.04 ? 46  CYS C SG  1 
ATOM   1755  N  N   . ARG C  2 28  ? 107.545 -14.678  19.768  1.00 99.90  ? 47  ARG C N   1 
ATOM   1756  C  CA  . ARG C  2 28  ? 108.458 -13.784  19.060  1.00 99.92  ? 47  ARG C CA  1 
ATOM   1757  C  C   . ARG C  2 28  ? 107.870 -13.342  17.713  1.00 104.22 ? 47  ARG C C   1 
ATOM   1758  O  O   . ARG C  2 28  ? 107.147 -14.101  17.063  1.00 102.14 ? 47  ARG C O   1 
ATOM   1759  C  CB  . ARG C  2 28  ? 109.823 -14.456  18.866  1.00 91.74  ? 47  ARG C CB  1 
ATOM   1760  N  N   . GLY C  2 29  ? 108.173 -12.116  17.296  1.00 102.56 ? 48  GLY C N   1 
ATOM   1761  C  CA  . GLY C  2 29  ? 107.631 -11.600  16.049  1.00 95.22  ? 48  GLY C CA  1 
ATOM   1762  C  C   . GLY C  2 29  ? 108.265 -10.300  15.601  1.00 91.60  ? 48  GLY C C   1 
ATOM   1763  O  O   . GLY C  2 29  ? 109.280 -9.894   16.148  1.00 111.25 ? 48  GLY C O   1 
ATOM   1764  N  N   . ALA C  2 30  ? 107.667 -9.644   14.611  1.00 73.89  ? 49  ALA C N   1 
ATOM   1765  C  CA  . ALA C  2 30  ? 108.211 -8.393   14.087  1.00 66.07  ? 49  ALA C CA  1 
ATOM   1766  C  C   . ALA C  2 30  ? 107.916 -7.227   15.006  1.00 74.37  ? 49  ALA C C   1 
ATOM   1767  O  O   . ALA C  2 30  ? 108.722 -6.316   15.142  1.00 79.00  ? 49  ALA C O   1 
ATOM   1768  C  CB  . ALA C  2 30  ? 107.674 -8.112   12.705  1.00 50.00  ? 49  ALA C CB  1 
ATOM   1769  N  N   . TRP C  2 31  ? 106.742 -7.251   15.618  1.00 86.32  ? 50  TRP C N   1 
ATOM   1770  C  CA  . TRP C  2 31  ? 106.330 -6.199   16.533  1.00 84.34  ? 50  TRP C CA  1 
ATOM   1771  C  C   . TRP C  2 31  ? 105.297 -6.771   17.491  1.00 86.47  ? 50  TRP C C   1 
ATOM   1772  O  O   . TRP C  2 31  ? 104.754 -7.854   17.263  1.00 91.56  ? 50  TRP C O   1 
ATOM   1773  C  CB  . TRP C  2 31  ? 105.762 -4.986   15.771  1.00 79.47  ? 50  TRP C CB  1 
ATOM   1774  C  CG  . TRP C  2 31  ? 104.471 -5.261   15.025  1.00 81.76  ? 50  TRP C CG  1 
ATOM   1775  C  CD1 . TRP C  2 31  ? 103.222 -5.364   15.566  1.00 96.07  ? 50  TRP C CD1 1 
ATOM   1776  C  CD2 . TRP C  2 31  ? 104.308 -5.452   13.613  1.00 81.12  ? 50  TRP C CD2 1 
ATOM   1777  N  NE1 . TRP C  2 31  ? 102.292 -5.612   14.584  1.00 89.20  ? 50  TRP C NE1 1 
ATOM   1778  C  CE2 . TRP C  2 31  ? 102.933 -5.670   13.377  1.00 92.40  ? 50  TRP C CE2 1 
ATOM   1779  C  CE3 . TRP C  2 31  ? 105.188 -5.454   12.526  1.00 76.83  ? 50  TRP C CE3 1 
ATOM   1780  C  CZ2 . TRP C  2 31  ? 102.420 -5.891   12.101  1.00 106.28 ? 50  TRP C CZ2 1 
ATOM   1781  C  CZ3 . TRP C  2 31  ? 104.680 -5.675   11.262  1.00 91.45  ? 50  TRP C CZ3 1 
ATOM   1782  C  CH2 . TRP C  2 31  ? 103.306 -5.893   11.059  1.00 110.35 ? 50  TRP C CH2 1 
ATOM   1783  N  N   . CYS C  2 32  ? 105.031 -6.048   18.568  1.00 79.12  ? 51  CYS C N   1 
ATOM   1784  C  CA  . CYS C  2 32  ? 104.053 -6.503   19.538  1.00 83.38  ? 51  CYS C CA  1 
ATOM   1785  C  C   . CYS C  2 32  ? 102.722 -5.783   19.389  1.00 84.24  ? 51  CYS C C   1 
ATOM   1786  O  O   . CYS C  2 32  ? 102.675 -4.619   18.992  1.00 90.56  ? 51  CYS C O   1 
ATOM   1787  C  CB  . CYS C  2 32  ? 104.596 -6.336   20.948  1.00 86.22  ? 51  CYS C CB  1 
ATOM   1788  S  SG  . CYS C  2 32  ? 105.996 -7.403   21.250  1.00 101.10 ? 51  CYS C SG  1 
ATOM   1789  N  N   . THR C  2 33  ? 101.643 -6.490   19.711  1.00 72.76  ? 52  THR C N   1 
ATOM   1790  C  CA  . THR C  2 33  ? 100.290 -5.966   19.577  1.00 72.71  ? 52  THR C CA  1 
ATOM   1791  C  C   . THR C  2 33  ? 99.484  -6.089   20.865  1.00 78.31  ? 52  THR C C   1 
ATOM   1792  O  O   . THR C  2 33  ? 99.649  -7.030   21.644  1.00 87.31  ? 52  THR C O   1 
ATOM   1793  C  CB  . THR C  2 33  ? 99.499  -6.700   18.479  1.00 79.96  ? 52  THR C CB  1 
ATOM   1794  O  OG1 . THR C  2 33  ? 99.304  -8.067   18.864  1.00 80.03  ? 52  THR C OG1 1 
ATOM   1795  C  CG2 . THR C  2 33  ? 100.233 -6.645   17.157  1.00 88.27  ? 52  THR C CG2 1 
ATOM   1796  N  N   . VAL C  2 34  ? 98.623  -5.104   21.073  1.00 76.99  ? 53  VAL C N   1 
ATOM   1797  C  CA  . VAL C  2 34  ? 97.553  -5.160   22.047  1.00 79.42  ? 53  VAL C CA  1 
ATOM   1798  C  C   . VAL C  2 34  ? 96.314  -4.717   21.290  1.00 79.40  ? 53  VAL C C   1 
ATOM   1799  O  O   . VAL C  2 34  ? 96.278  -3.619   20.728  1.00 97.81  ? 53  VAL C O   1 
ATOM   1800  C  CB  . VAL C  2 34  ? 97.796  -4.214   23.225  1.00 85.11  ? 53  VAL C CB  1 
ATOM   1801  C  CG1 . VAL C  2 34  ? 96.501  -3.986   23.986  1.00 90.75  ? 53  VAL C CG1 1 
ATOM   1802  C  CG2 . VAL C  2 34  ? 98.878  -4.769   24.141  1.00 82.86  ? 53  VAL C CG2 1 
ATOM   1803  N  N   . VAL C  2 35  ? 95.313  -5.584   21.235  1.00 69.29  ? 54  VAL C N   1 
ATOM   1804  C  CA  . VAL C  2 35  ? 94.139  -5.306   20.419  1.00 74.82  ? 54  VAL C CA  1 
ATOM   1805  C  C   . VAL C  2 35  ? 92.821  -5.581   21.152  1.00 72.40  ? 54  VAL C C   1 
ATOM   1806  O  O   . VAL C  2 35  ? 92.645  -6.621   21.791  1.00 69.04  ? 54  VAL C O   1 
ATOM   1807  C  CB  . VAL C  2 35  ? 94.206  -6.040   19.058  1.00 54.11  ? 54  VAL C CB  1 
ATOM   1808  C  CG1 . VAL C  2 35  ? 95.077  -7.259   19.172  1.00 60.88  ? 54  VAL C CG1 1 
ATOM   1809  C  CG2 . VAL C  2 35  ? 92.815  -6.394   18.567  1.00 38.56  ? 54  VAL C CG2 1 
ATOM   1810  N  N   . LEU C  2 36  ? 91.909  -4.622   21.053  1.00 62.72  ? 55  LEU C N   1 
ATOM   1811  C  CA  . LEU C  2 36  ? 90.656  -4.664   21.776  1.00 69.59  ? 55  LEU C CA  1 
ATOM   1812  C  C   . LEU C  2 36  ? 89.486  -4.816   20.806  1.00 77.23  ? 55  LEU C C   1 
ATOM   1813  O  O   . LEU C  2 36  ? 89.332  -4.012   19.880  1.00 81.35  ? 55  LEU C O   1 
ATOM   1814  C  CB  . LEU C  2 36  ? 90.489  -3.368   22.568  1.00 87.04  ? 55  LEU C CB  1 
ATOM   1815  C  CG  . LEU C  2 36  ? 89.885  -3.466   23.972  1.00 87.40  ? 55  LEU C CG  1 
ATOM   1816  C  CD1 . LEU C  2 36  ? 89.221  -2.150   24.365  1.00 79.66  ? 55  LEU C CD1 1 
ATOM   1817  C  CD2 . LEU C  2 36  ? 88.895  -4.618   24.080  1.00 89.56  ? 55  LEU C CD2 1 
ATOM   1818  N  N   . VAL C  2 37  ? 88.643  -5.824   21.031  1.00 66.24  ? 56  VAL C N   1 
ATOM   1819  C  CA  . VAL C  2 37  ? 87.560  -6.107   20.098  1.00 48.85  ? 56  VAL C CA  1 
ATOM   1820  C  C   . VAL C  2 37  ? 86.206  -6.294   20.754  1.00 51.38  ? 56  VAL C C   1 
ATOM   1821  O  O   . VAL C  2 37  ? 86.116  -6.968   21.774  1.00 67.76  ? 56  VAL C O   1 
ATOM   1822  C  CB  . VAL C  2 37  ? 87.863  -7.360   19.295  1.00 49.79  ? 56  VAL C CB  1 
ATOM   1823  C  CG1 . VAL C  2 37  ? 87.064  -7.342   17.998  1.00 42.11  ? 56  VAL C CG1 1 
ATOM   1824  C  CG2 . VAL C  2 37  ? 89.366  -7.467   19.019  1.00 66.53  ? 56  VAL C CG2 1 
ATOM   1825  N  N   . ARG C  2 38  ? 85.157  -5.728   20.136  1.00 55.36  ? 57  ARG C N   1 
ATOM   1826  C  CA  . ARG C  2 38  ? 83.767  -5.759   20.657  1.00 61.87  ? 57  ARG C CA  1 
ATOM   1827  C  C   . ARG C  2 38  ? 82.746  -6.458   19.727  1.00 66.19  ? 57  ARG C C   1 
ATOM   1828  O  O   . ARG C  2 38  ? 81.846  -5.800   19.187  1.00 71.81  ? 57  ARG C O   1 
ATOM   1829  C  CB  . ARG C  2 38  ? 83.273  -4.319   20.964  1.00 58.56  ? 57  ARG C CB  1 
ATOM   1830  C  CG  . ARG C  2 38  ? 81.954  -4.233   21.793  1.00 79.97  ? 57  ARG C CG  1 
ATOM   1831  C  CD  . ARG C  2 38  ? 81.280  -2.831   21.811  1.00 54.26  ? 57  ARG C CD  1 
ATOM   1832  N  NE  . ARG C  2 38  ? 81.913  -1.868   22.715  1.00 90.27  ? 57  ARG C NE  1 
ATOM   1833  C  CZ  . ARG C  2 38  ? 81.437  -0.648   22.978  1.00 107.11 ? 57  ARG C CZ  1 
ATOM   1834  N  NH1 . ARG C  2 38  ? 80.314  -0.238   22.402  1.00 123.77 ? 57  ARG C NH1 1 
ATOM   1835  N  NH2 . ARG C  2 38  ? 82.078  0.168    23.819  1.00 93.06  ? 57  ARG C NH2 1 
ATOM   1836  N  N   . GLU C  2 39  ? 82.856  -7.779   19.547  1.00 74.48  ? 58  GLU C N   1 
ATOM   1837  C  CA  . GLU C  2 39  ? 82.009  -8.474   18.549  1.00 95.68  ? 58  GLU C CA  1 
ATOM   1838  C  C   . GLU C  2 39  ? 80.511  -8.448   18.955  1.00 67.82  ? 58  GLU C C   1 
ATOM   1839  O  O   . GLU C  2 39  ? 80.188  -8.602   20.130  1.00 51.19  ? 58  GLU C O   1 
ATOM   1840  C  CB  . GLU C  2 39  ? 82.513  -9.921   18.248  1.00 22.23  ? 58  GLU C CB  1 
ATOM   1841  C  CG  . GLU C  2 39  ? 83.863  -10.057  17.447  1.00 74.25  ? 58  GLU C CG  1 
ATOM   1842  C  CD  . GLU C  2 39  ? 83.743  -10.645  15.997  1.00 89.77  ? 58  GLU C CD  1 
ATOM   1843  O  OE1 . GLU C  2 39  ? 82.605  -10.808  15.485  1.00 68.04  ? 58  GLU C OE1 1 
ATOM   1844  O  OE2 . GLU C  2 39  ? 84.808  -10.933  15.368  1.00 66.66  ? 58  GLU C OE2 1 
ATOM   1845  N  N   . GLU C  2 40  ? 79.603  -8.241   17.999  1.00 79.94  ? 59  GLU C N   1 
ATOM   1846  C  CA  . GLU C  2 40  ? 78.166  -8.157   18.323  1.00 85.57  ? 59  GLU C CA  1 
ATOM   1847  C  C   . GLU C  2 40  ? 77.754  -8.942   19.569  1.00 64.58  ? 59  GLU C C   1 
ATOM   1848  O  O   . GLU C  2 40  ? 78.218  -10.062  19.786  1.00 61.24  ? 59  GLU C O   1 
ATOM   1849  C  CB  . GLU C  2 40  ? 77.268  -8.597   17.155  1.00 67.92  ? 59  GLU C CB  1 
ATOM   1850  C  CG  . GLU C  2 40  ? 75.810  -8.776   17.610  1.00 46.58  ? 59  GLU C CG  1 
ATOM   1851  C  CD  . GLU C  2 40  ? 74.778  -8.565   16.504  1.00 87.93  ? 59  GLU C CD  1 
ATOM   1852  O  OE1 . GLU C  2 40  ? 73.747  -7.885   16.753  1.00 97.55  ? 59  GLU C OE1 1 
ATOM   1853  O  OE2 . GLU C  2 40  ? 74.993  -9.089   15.392  1.00 70.46  ? 59  GLU C OE2 1 
ATOM   1854  N  N   . GLY C  2 41  ? 76.871  -8.354   20.374  1.00 61.15  ? 60  GLY C N   1 
ATOM   1855  C  CA  . GLY C  2 41  ? 76.352  -9.012   21.567  1.00 80.39  ? 60  GLY C CA  1 
ATOM   1856  C  C   . GLY C  2 41  ? 77.334  -9.191   22.722  1.00 77.17  ? 60  GLY C C   1 
ATOM   1857  O  O   . GLY C  2 41  ? 77.005  -8.931   23.881  1.00 60.49  ? 60  GLY C O   1 
ATOM   1858  N  N   . ARG C  2 42  ? 78.548  -9.633   22.411  1.00 75.97  ? 61  ARG C N   1 
ATOM   1859  C  CA  . ARG C  2 42  ? 79.547  -9.916   23.437  1.00 91.01  ? 61  ARG C CA  1 
ATOM   1860  C  C   . ARG C  2 42  ? 80.284  -8.647   23.968  1.00 82.44  ? 61  ARG C C   1 
ATOM   1861  O  O   . ARG C  2 42  ? 80.434  -7.650   23.269  1.00 75.08  ? 61  ARG C O   1 
ATOM   1862  C  CB  . ARG C  2 42  ? 80.510  -11.024  22.941  1.00 28.68  ? 61  ARG C CB  1 
ATOM   1863  N  N   . HIS C  2 43  ? 80.704  -8.680   25.226  1.00 95.10  ? 62  HIS C N   1 
ATOM   1864  C  CA  . HIS C  2 43  ? 81.505  -7.603   25.789  1.00 98.95  ? 62  HIS C CA  1 
ATOM   1865  C  C   . HIS C  2 43  ? 82.889  -7.658   25.190  1.00 107.95 ? 62  HIS C C   1 
ATOM   1866  O  O   . HIS C  2 43  ? 83.336  -8.709   24.747  1.00 115.86 ? 62  HIS C O   1 
ATOM   1867  C  CB  . HIS C  2 43  ? 81.586  -7.723   27.310  1.00 109.01 ? 62  HIS C CB  1 
ATOM   1868  C  CG  . HIS C  2 43  ? 80.282  -7.472   27.998  1.00 130.39 ? 62  HIS C CG  1 
ATOM   1869  N  ND1 . HIS C  2 43  ? 79.285  -8.423   28.075  1.00 143.66 ? 62  HIS C ND1 1 
ATOM   1870  C  CD2 . HIS C  2 43  ? 79.799  -6.370   28.619  1.00 121.32 ? 62  HIS C CD2 1 
ATOM   1871  C  CE1 . HIS C  2 43  ? 78.249  -7.921   28.722  1.00 135.92 ? 62  HIS C CE1 1 
ATOM   1872  N  NE2 . HIS C  2 43  ? 78.536  -6.677   29.064  1.00 132.25 ? 62  HIS C NE2 1 
ATOM   1873  N  N   . PRO C  2 44  ? 83.570  -6.514   25.161  1.00 109.32 ? 63  PRO C N   1 
ATOM   1874  C  CA  . PRO C  2 44  ? 84.899  -6.400   24.558  1.00 105.03 ? 63  PRO C CA  1 
ATOM   1875  C  C   . PRO C  2 44  ? 85.936  -7.278   25.237  1.00 92.44  ? 63  PRO C C   1 
ATOM   1876  O  O   . PRO C  2 44  ? 85.924  -7.405   26.457  1.00 90.48  ? 63  PRO C O   1 
ATOM   1877  C  CB  . PRO C  2 44  ? 85.240  -4.917   24.740  1.00 95.81  ? 63  PRO C CB  1 
ATOM   1878  C  CG  . PRO C  2 44  ? 84.276  -4.415   25.768  1.00 97.15  ? 63  PRO C CG  1 
ATOM   1879  C  CD  . PRO C  2 44  ? 83.044  -5.211   25.583  1.00 108.03 ? 63  PRO C CD  1 
ATOM   1880  N  N   . GLN C  2 45  ? 86.811  -7.875   24.432  1.00 80.24  ? 64  GLN C N   1 
ATOM   1881  C  CA  . GLN C  2 45  ? 87.914  -8.693   24.924  1.00 85.41  ? 64  GLN C CA  1 
ATOM   1882  C  C   . GLN C  2 45  ? 89.232  -8.140   24.402  1.00 81.52  ? 64  GLN C C   1 
ATOM   1883  O  O   . GLN C  2 45  ? 89.263  -7.514   23.344  1.00 93.76  ? 64  GLN C O   1 
ATOM   1884  C  CB  . GLN C  2 45  ? 87.754  -10.148  24.482  1.00 99.14  ? 64  GLN C CB  1 
ATOM   1885  C  CG  . GLN C  2 45  ? 86.711  -10.927  25.251  1.00 119.33 ? 64  GLN C CG  1 
ATOM   1886  C  CD  . GLN C  2 45  ? 86.529  -12.310  24.690  1.00 137.02 ? 64  GLN C CD  1 
ATOM   1887  O  OE1 . GLN C  2 45  ? 86.981  -12.601  23.583  1.00 129.60 ? 64  GLN C OE1 1 
ATOM   1888  N  NE2 . GLN C  2 45  ? 85.868  -13.178  25.448  1.00 152.02 ? 64  GLN C NE2 1 
ATOM   1889  N  N   . GLU C  2 46  ? 90.315  -8.394   25.133  1.00 73.00  ? 65  GLU C N   1 
ATOM   1890  C  CA  . GLU C  2 46  ? 91.598  -7.744   24.876  1.00 80.51  ? 65  GLU C CA  1 
ATOM   1891  C  C   . GLU C  2 46  ? 92.730  -8.760   24.715  1.00 92.01  ? 65  GLU C C   1 
ATOM   1892  O  O   . GLU C  2 46  ? 93.159  -9.376   25.687  1.00 88.99  ? 65  GLU C O   1 
ATOM   1893  C  CB  . GLU C  2 46  ? 91.907  -6.785   26.030  1.00 78.64  ? 65  GLU C CB  1 
ATOM   1894  C  CG  . GLU C  2 46  ? 93.142  -5.927   25.890  1.00 88.32  ? 65  GLU C CG  1 
ATOM   1895  C  CD  . GLU C  2 46  ? 93.306  -4.993   27.077  1.00 103.43 ? 65  GLU C CD  1 
ATOM   1896  O  OE1 . GLU C  2 46  ? 93.238  -5.475   28.231  1.00 102.19 ? 65  GLU C OE1 1 
ATOM   1897  O  OE2 . GLU C  2 46  ? 93.483  -3.776   26.856  1.00 104.84 ? 65  GLU C OE2 1 
ATOM   1898  N  N   . HIS C  2 47  ? 93.212  -8.934   23.487  1.00 100.99 ? 66  HIS C N   1 
ATOM   1899  C  CA  . HIS C  2 47  ? 94.302  -9.874   23.233  1.00 95.86  ? 66  HIS C CA  1 
ATOM   1900  C  C   . HIS C  2 47  ? 95.642  -9.143   23.191  1.00 89.98  ? 66  HIS C C   1 
ATOM   1901  O  O   . HIS C  2 47  ? 95.697  -7.955   22.869  1.00 96.51  ? 66  HIS C O   1 
ATOM   1902  C  CB  . HIS C  2 47  ? 94.098  -10.618  21.910  1.00 102.15 ? 66  HIS C CB  1 
ATOM   1903  C  CG  . HIS C  2 47  ? 92.711  -11.138  21.711  1.00 108.56 ? 66  HIS C CG  1 
ATOM   1904  N  ND1 . HIS C  2 47  ? 92.340  -11.844  20.589  1.00 111.25 ? 66  HIS C ND1 1 
ATOM   1905  C  CD2 . HIS C  2 47  ? 91.602  -11.045  22.482  1.00 112.18 ? 66  HIS C CD2 1 
ATOM   1906  C  CE1 . HIS C  2 47  ? 91.062  -12.165  20.676  1.00 110.27 ? 66  HIS C CE1 1 
ATOM   1907  N  NE2 . HIS C  2 47  ? 90.591  -11.691  21.815  1.00 112.28 ? 66  HIS C NE2 1 
ATOM   1908  N  N   . ARG C  2 48  ? 96.714  -9.863   23.514  1.00 74.16  ? 67  ARG C N   1 
ATOM   1909  C  CA  . ARG C  2 48  ? 98.071  -9.341   23.428  1.00 76.61  ? 67  ARG C CA  1 
ATOM   1910  C  C   . ARG C  2 48  ? 98.923  -10.375  22.714  1.00 84.84  ? 67  ARG C C   1 
ATOM   1911  O  O   . ARG C  2 48  ? 98.816  -11.567  23.010  1.00 92.33  ? 67  ARG C O   1 
ATOM   1912  C  CB  . ARG C  2 48  ? 98.643  -9.096   24.828  1.00 80.01  ? 67  ARG C CB  1 
ATOM   1913  C  CG  . ARG C  2 48  ? 97.785  -8.210   25.691  1.00 96.31  ? 67  ARG C CG  1 
ATOM   1914  C  CD  . ARG C  2 48  ? 98.075  -8.386   27.159  1.00 95.15  ? 67  ARG C CD  1 
ATOM   1915  N  NE  . ARG C  2 48  ? 97.056  -7.717   27.956  1.00 100.23 ? 67  ARG C NE  1 
ATOM   1916  C  CZ  . ARG C  2 48  ? 97.112  -6.438   28.305  1.00 113.27 ? 67  ARG C CZ  1 
ATOM   1917  N  NH1 . ARG C  2 48  ? 98.149  -5.699   27.934  1.00 113.16 ? 67  ARG C NH1 1 
ATOM   1918  N  NH2 . ARG C  2 48  ? 96.138  -5.900   29.029  1.00 120.61 ? 67  ARG C NH2 1 
ATOM   1919  N  N   . GLY C  2 49  ? 99.773  -9.944   21.783  1.00 75.74  ? 68  GLY C N   1 
ATOM   1920  C  CA  . GLY C  2 49  ? 100.588 -10.903  21.062  1.00 82.10  ? 68  GLY C CA  1 
ATOM   1921  C  C   . GLY C  2 49  ? 101.579 -10.353  20.070  1.00 96.17  ? 68  GLY C C   1 
ATOM   1922  O  O   . GLY C  2 49  ? 102.102 -9.260   20.248  1.00 105.38 ? 68  GLY C O   1 
ATOM   1923  N  N   . CYS C  2 50  ? 101.849 -11.131  19.028  1.00 95.40  ? 69  CYS C N   1 
ATOM   1924  C  CA  . CYS C  2 50  ? 102.839 -10.758  18.028  1.00 81.34  ? 69  CYS C CA  1 
ATOM   1925  C  C   . CYS C  2 50  ? 102.141 -10.182  16.821  1.00 81.93  ? 69  CYS C C   1 
ATOM   1926  O  O   . CYS C  2 50  ? 100.953 -9.858   16.862  1.00 87.03  ? 69  CYS C O   1 
ATOM   1927  C  CB  . CYS C  2 50  ? 103.670 -11.970  17.609  1.00 55.36  ? 69  CYS C CB  1 
ATOM   1928  S  SG  . CYS C  2 50  ? 104.314 -12.911  18.995  1.00 158.70 ? 69  CYS C SG  1 
ATOM   1929  N  N   . GLY C  2 51  ? 102.891 -10.068  15.738  1.00 79.15  ? 70  GLY C N   1 
ATOM   1930  C  CA  . GLY C  2 51  ? 102.351 -9.549   14.502  1.00 93.00  ? 70  GLY C CA  1 
ATOM   1931  C  C   . GLY C  2 51  ? 103.461 -9.219   13.531  1.00 84.70  ? 70  GLY C C   1 
ATOM   1932  O  O   . GLY C  2 51  ? 104.406 -8.515   13.875  1.00 65.66  ? 70  GLY C O   1 
ATOM   1933  N  N   . ASN C  2 52  ? 103.345 -9.730   12.312  1.00 86.41  ? 71  ASN C N   1 
ATOM   1934  C  CA  . ASN C  2 52  ? 104.367 -9.502   11.304  1.00 83.23  ? 71  ASN C CA  1 
ATOM   1935  C  C   . ASN C  2 52  ? 103.770 -9.291   9.927   1.00 77.57  ? 71  ASN C C   1 
ATOM   1936  O  O   . ASN C  2 52  ? 104.492 -9.226   8.935   1.00 74.71  ? 71  ASN C O   1 
ATOM   1937  C  CB  . ASN C  2 52  ? 105.347 -10.681  11.244  1.00 79.67  ? 71  ASN C CB  1 
ATOM   1938  C  CG  . ASN C  2 52  ? 105.167 -11.653  12.389  1.00 81.27  ? 71  ASN C CG  1 
ATOM   1939  O  OD1 . ASN C  2 52  ? 105.954 -11.661  13.329  1.00 85.28  ? 71  ASN C OD1 1 
ATOM   1940  N  ND2 . ASN C  2 52  ? 104.131 -12.480  12.313  1.00 81.02  ? 71  ASN C ND2 1 
ATOM   1941  N  N   . LEU C  2 53  ? 102.453 -9.187   9.853   1.00 82.85  ? 72  LEU C N   1 
ATOM   1942  C  CA  . LEU C  2 53  ? 101.835 -9.223   8.543   1.00 98.51  ? 72  LEU C CA  1 
ATOM   1943  C  C   . LEU C  2 53  ? 101.376 -7.887   7.989   1.00 87.21  ? 72  LEU C C   1 
ATOM   1944  O  O   . LEU C  2 53  ? 101.716 -7.533   6.859   1.00 112.01 ? 72  LEU C O   1 
ATOM   1945  C  CB  . LEU C  2 53  ? 100.711 -10.259  8.499   1.00 124.74 ? 72  LEU C CB  1 
ATOM   1946  C  CG  . LEU C  2 53  ? 101.241 -11.594  7.986   1.00 112.53 ? 72  LEU C CG  1 
ATOM   1947  C  CD1 . LEU C  2 53  ? 100.119 -12.462  7.394   1.00 116.07 ? 72  LEU C CD1 1 
ATOM   1948  C  CD2 . LEU C  2 53  ? 102.344 -11.294  6.961   1.00 39.87  ? 72  LEU C CD2 1 
ATOM   1949  N  N   . HIS C  2 54  ? 100.608 -7.136   8.762   1.00 53.15  ? 73  HIS C N   1 
ATOM   1950  C  CA  . HIS C  2 54  ? 99.961  -5.977   8.163   1.00 74.03  ? 73  HIS C CA  1 
ATOM   1951  C  C   . HIS C  2 54  ? 100.165 -4.712   8.964   1.00 84.94  ? 73  HIS C C   1 
ATOM   1952  O  O   . HIS C  2 54  ? 99.224  -4.216   9.591   1.00 93.54  ? 73  HIS C O   1 
ATOM   1953  C  CB  . HIS C  2 54  ? 98.472  -6.249   7.967   1.00 74.21  ? 73  HIS C CB  1 
ATOM   1954  C  CG  . HIS C  2 54  ? 98.191  -7.500   7.199   1.00 74.93  ? 73  HIS C CG  1 
ATOM   1955  N  ND1 . HIS C  2 54  ? 98.331  -7.576   5.830   1.00 60.26  ? 73  HIS C ND1 1 
ATOM   1956  C  CD2 . HIS C  2 54  ? 97.793  -8.729   7.610   1.00 78.54  ? 73  HIS C CD2 1 
ATOM   1957  C  CE1 . HIS C  2 54  ? 98.026  -8.800   5.430   1.00 73.94  ? 73  HIS C CE1 1 
ATOM   1958  N  NE2 . HIS C  2 54  ? 97.700  -9.519   6.490   1.00 79.53  ? 73  HIS C NE2 1 
ATOM   1959  N  N   . ARG C  2 55  ? 101.387 -4.181   8.919   1.00 70.56  ? 74  ARG C N   1 
ATOM   1960  C  CA  . ARG C  2 55  ? 101.758 -3.041   9.746   1.00 67.60  ? 74  ARG C CA  1 
ATOM   1961  C  C   . ARG C  2 55  ? 100.650 -1.967   9.734   1.00 71.09  ? 74  ARG C C   1 
ATOM   1962  O  O   . ARG C  2 55  ? 100.281 -1.424   10.779  1.00 65.97  ? 74  ARG C O   1 
ATOM   1963  C  CB  . ARG C  2 55  ? 103.101 -2.476   9.281   1.00 71.36  ? 74  ARG C CB  1 
ATOM   1964  C  CG  . ARG C  2 55  ? 103.744 -1.454   10.217  1.00 92.67  ? 74  ARG C CG  1 
ATOM   1965  C  CD  . ARG C  2 55  ? 104.024 -2.046   11.604  1.00 120.71 ? 74  ARG C CD  1 
ATOM   1966  N  NE  . ARG C  2 55  ? 105.238 -1.509   12.235  1.00 126.26 ? 74  ARG C NE  1 
ATOM   1967  C  CZ  . ARG C  2 55  ? 105.336 -1.152   13.516  1.00 109.94 ? 74  ARG C CZ  1 
ATOM   1968  N  NH1 . ARG C  2 55  ? 104.292 -1.251   14.327  1.00 118.31 ? 74  ARG C NH1 1 
ATOM   1969  N  NH2 . ARG C  2 55  ? 106.480 -0.689   13.990  1.00 89.49  ? 74  ARG C NH2 1 
ATOM   1970  N  N   . GLU C  2 56  ? 100.102 -1.689   8.553   1.00 51.91  ? 75  GLU C N   1 
ATOM   1971  C  CA  . GLU C  2 56  ? 99.077  -0.674   8.405   1.00 55.13  ? 75  GLU C CA  1 
ATOM   1972  C  C   . GLU C  2 56  ? 98.016  -0.715   9.506   1.00 69.34  ? 75  GLU C C   1 
ATOM   1973  O  O   . GLU C  2 56  ? 97.619  0.320    10.027  1.00 88.88  ? 75  GLU C O   1 
ATOM   1974  C  CB  . GLU C  2 56  ? 98.407  -0.798   7.032   1.00 84.89  ? 75  GLU C CB  1 
ATOM   1975  C  CG  . GLU C  2 56  ? 97.902  -2.188   6.697   1.00 92.20  ? 75  GLU C CG  1 
ATOM   1976  C  CD  . GLU C  2 56  ? 98.768  -2.857   5.660   1.00 103.89 ? 75  GLU C CD  1 
ATOM   1977  O  OE1 . GLU C  2 56  ? 99.927  -3.218   5.974   1.00 111.49 ? 75  GLU C OE1 1 
ATOM   1978  O  OE2 . GLU C  2 56  ? 98.287  -3.003   4.520   1.00 95.54  ? 75  GLU C OE2 1 
ATOM   1979  N  N   . LEU C  2 57  ? 97.537  -1.900   9.848   1.00 62.09  ? 76  LEU C N   1 
ATOM   1980  C  CA  . LEU C  2 57  ? 96.505  -2.008   10.864  1.00 79.10  ? 76  LEU C CA  1 
ATOM   1981  C  C   . LEU C  2 57  ? 96.750  -1.106   12.079  1.00 74.03  ? 76  LEU C C   1 
ATOM   1982  O  O   . LEU C  2 57  ? 95.796  -0.570   12.650  1.00 82.67  ? 76  LEU C O   1 
ATOM   1983  C  CB  . LEU C  2 57  ? 96.349  -3.462   11.305  1.00 90.78  ? 76  LEU C CB  1 
ATOM   1984  C  CG  . LEU C  2 57  ? 95.320  -4.248   10.494  1.00 83.60  ? 76  LEU C CG  1 
ATOM   1985  C  CD1 . LEU C  2 57  ? 95.242  -5.713   10.959  1.00 65.14  ? 76  LEU C CD1 1 
ATOM   1986  C  CD2 . LEU C  2 57  ? 93.958  -3.553   10.581  1.00 84.59  ? 76  LEU C CD2 1 
ATOM   1987  N  N   . CYS C  2 58  ? 98.021  -0.941   12.455  1.00 57.24  ? 77  CYS C N   1 
ATOM   1988  C  CA  . CYS C  2 58  ? 98.430  -0.161   13.642  1.00 73.74  ? 77  CYS C CA  1 
ATOM   1989  C  C   . CYS C  2 58  ? 98.041  1.315    13.597  1.00 76.51  ? 77  CYS C C   1 
ATOM   1990  O  O   . CYS C  2 58  ? 97.649  1.900    14.620  1.00 77.59  ? 77  CYS C O   1 
ATOM   1991  C  CB  . CYS C  2 58  ? 99.942  -0.253   13.857  1.00 67.26  ? 77  CYS C CB  1 
ATOM   1992  S  SG  . CYS C  2 58  ? 100.561 -1.918   14.217  1.00 87.31  ? 77  CYS C SG  1 
ATOM   1993  N  N   . ARG C  2 59  ? 98.183  1.904    12.408  1.00 71.42  ? 78  ARG C N   1 
ATOM   1994  C  CA  . ARG C  2 59  ? 97.758  3.279    12.127  1.00 58.51  ? 78  ARG C CA  1 
ATOM   1995  C  C   . ARG C  2 59  ? 96.262  3.456    12.362  1.00 66.35  ? 78  ARG C C   1 
ATOM   1996  O  O   . ARG C  2 59  ? 95.786  4.572    12.489  1.00 63.25  ? 78  ARG C O   1 
ATOM   1997  C  CB  . ARG C  2 59  ? 98.068  3.661    10.677  1.00 60.84  ? 78  ARG C CB  1 
ATOM   1998  C  CG  . ARG C  2 59  ? 99.402  3.179    10.157  1.00 80.91  ? 78  ARG C CG  1 
ATOM   1999  C  CD  . ARG C  2 59  ? 100.532 4.129    10.486  1.00 103.58 ? 78  ARG C CD  1 
ATOM   2000  N  NE  . ARG C  2 59  ? 101.485 4.130    9.390   1.00 115.15 ? 78  ARG C NE  1 
ATOM   2001  C  CZ  . ARG C  2 59  ? 101.467 5.006    8.395   1.00 123.28 ? 78  ARG C CZ  1 
ATOM   2002  N  NH1 . ARG C  2 59  ? 100.561 5.980    8.378   1.00 99.20  ? 78  ARG C NH1 1 
ATOM   2003  N  NH2 . ARG C  2 59  ? 102.368 4.917    7.428   1.00 139.38 ? 78  ARG C NH2 1 
ATOM   2004  N  N   . GLY C  2 60  ? 95.518  2.359    12.393  1.00 81.85  ? 79  GLY C N   1 
ATOM   2005  C  CA  . GLY C  2 60  ? 94.099  2.444    12.647  1.00 88.08  ? 79  GLY C CA  1 
ATOM   2006  C  C   . GLY C  2 60  ? 93.802  3.329    13.839  1.00 81.56  ? 79  GLY C C   1 
ATOM   2007  O  O   . GLY C  2 60  ? 94.287  3.096    14.949  1.00 85.89  ? 79  GLY C O   1 
ATOM   2008  N  N   . ARG C  2 61  ? 93.027  4.376    13.590  1.00 60.15  ? 80  ARG C N   1 
ATOM   2009  C  CA  . ARG C  2 61  ? 92.396  5.141    14.655  1.00 56.24  ? 80  ARG C CA  1 
ATOM   2010  C  C   . ARG C  2 61  ? 91.356  4.223    15.290  1.00 75.54  ? 80  ARG C C   1 
ATOM   2011  O  O   . ARG C  2 61  ? 90.670  3.475    14.584  1.00 66.98  ? 80  ARG C O   1 
ATOM   2012  C  CB  . ARG C  2 61  ? 91.727  6.402    14.082  1.00 53.38  ? 80  ARG C CB  1 
ATOM   2013  C  CG  . ARG C  2 61  ? 90.420  6.820    14.755  1.00 55.62  ? 80  ARG C CG  1 
ATOM   2014  C  CD  . ARG C  2 61  ? 89.364  7.231    13.711  1.00 74.17  ? 80  ARG C CD  1 
ATOM   2015  N  NE  . ARG C  2 61  ? 88.008  6.986    14.193  1.00 96.86  ? 80  ARG C NE  1 
ATOM   2016  C  CZ  . ARG C  2 61  ? 86.923  7.028    13.433  1.00 105.50 ? 80  ARG C CZ  1 
ATOM   2017  N  NH1 . ARG C  2 61  ? 87.034  7.306    12.142  1.00 112.76 ? 80  ARG C NH1 1 
ATOM   2018  N  NH2 . ARG C  2 61  ? 85.729  6.785    13.964  1.00 100.53 ? 80  ARG C NH2 1 
ATOM   2019  N  N   . PRO C  2 62  ? 91.241  4.263    16.625  1.00 81.52  ? 81  PRO C N   1 
ATOM   2020  C  CA  . PRO C  2 62  ? 90.317  3.385    17.352  1.00 66.69  ? 81  PRO C CA  1 
ATOM   2021  C  C   . PRO C  2 62  ? 88.863  3.700    17.033  1.00 69.03  ? 81  PRO C C   1 
ATOM   2022  O  O   . PRO C  2 62  ? 88.467  4.868    17.079  1.00 76.33  ? 81  PRO C O   1 
ATOM   2023  C  CB  . PRO C  2 62  ? 90.601  3.707    18.819  1.00 45.04  ? 81  PRO C CB  1 
ATOM   2024  C  CG  . PRO C  2 62  ? 91.931  4.354    18.822  1.00 61.11  ? 81  PRO C CG  1 
ATOM   2025  C  CD  . PRO C  2 62  ? 92.016  5.114    17.536  1.00 70.48  ? 81  PRO C CD  1 
ATOM   2026  N  N   . THR C  2 63  ? 88.090  2.664    16.710  1.00 66.66  ? 82  THR C N   1 
ATOM   2027  C  CA  . THR C  2 63  ? 86.661  2.798    16.414  1.00 71.15  ? 82  THR C CA  1 
ATOM   2028  C  C   . THR C  2 63  ? 85.814  2.367    17.614  1.00 73.80  ? 82  THR C C   1 
ATOM   2029  O  O   . THR C  2 63  ? 86.336  2.105    18.708  1.00 65.41  ? 82  THR C O   1 
ATOM   2030  C  CB  . THR C  2 63  ? 86.233  1.968    15.172  1.00 70.69  ? 82  THR C CB  1 
ATOM   2031  O  OG1 . THR C  2 63  ? 86.594  0.594    15.364  1.00 44.32  ? 82  THR C OG1 1 
ATOM   2032  C  CG2 . THR C  2 63  ? 86.922  2.474    13.932  1.00 95.98  ? 82  THR C CG2 1 
ATOM   2033  N  N   . GLU C  2 64  ? 84.502  2.293    17.396  1.00 72.99  ? 83  GLU C N   1 
ATOM   2034  C  CA  . GLU C  2 64  ? 83.572  1.922    18.454  1.00 65.39  ? 83  GLU C CA  1 
ATOM   2035  C  C   . GLU C  2 64  ? 83.608  0.411    18.733  1.00 77.84  ? 83  GLU C C   1 
ATOM   2036  O  O   . GLU C  2 64  ? 82.893  -0.084   19.597  1.00 91.38  ? 83  GLU C O   1 
ATOM   2037  C  CB  . GLU C  2 64  ? 82.153  2.385    18.099  1.00 52.36  ? 83  GLU C CB  1 
ATOM   2038  C  CG  . GLU C  2 64  ? 81.679  1.967    16.691  1.00 104.77 ? 83  GLU C CG  1 
ATOM   2039  C  CD  . GLU C  2 64  ? 81.710  3.104    15.666  1.00 127.52 ? 83  GLU C CD  1 
ATOM   2040  O  OE1 . GLU C  2 64  ? 82.783  3.342    15.053  1.00 124.28 ? 83  GLU C OE1 1 
ATOM   2041  O  OE2 . GLU C  2 64  ? 80.650  3.747    15.466  1.00 125.33 ? 83  GLU C OE2 1 
ATOM   2042  N  N   . PHE C  2 65  ? 84.449  -0.325   18.017  1.00 74.82  ? 84  PHE C N   1 
ATOM   2043  C  CA  . PHE C  2 65  ? 84.421  -1.768   18.120  1.00 72.41  ? 84  PHE C CA  1 
ATOM   2044  C  C   . PHE C  2 65  ? 85.806  -2.397   18.007  1.00 69.15  ? 84  PHE C C   1 
ATOM   2045  O  O   . PHE C  2 65  ? 85.955  -3.604   18.151  1.00 64.83  ? 84  PHE C O   1 
ATOM   2046  C  CB  . PHE C  2 65  ? 83.466  -2.343   17.076  1.00 84.04  ? 84  PHE C CB  1 
ATOM   2047  C  CG  . PHE C  2 65  ? 83.738  -1.863   15.689  1.00 107.51 ? 84  PHE C CG  1 
ATOM   2048  C  CD1 . PHE C  2 65  ? 82.844  -1.018   15.048  1.00 122.31 ? 84  PHE C CD1 1 
ATOM   2049  C  CD2 . PHE C  2 65  ? 84.909  -2.244   15.023  1.00 102.30 ? 84  PHE C CD2 1 
ATOM   2050  C  CE1 . PHE C  2 65  ? 83.110  -0.558   13.755  1.00 133.62 ? 84  PHE C CE1 1 
ATOM   2051  C  CE2 . PHE C  2 65  ? 85.185  -1.795   13.721  1.00 98.86  ? 84  PHE C CE2 1 
ATOM   2052  C  CZ  . PHE C  2 65  ? 84.284  -0.949   13.086  1.00 113.99 ? 84  PHE C CZ  1 
ATOM   2053  N  N   . VAL C  2 66  ? 86.836  -1.595   17.777  1.00 73.55  ? 85  VAL C N   1 
ATOM   2054  C  CA  . VAL C  2 66  ? 88.182  -2.166   17.725  1.00 74.31  ? 85  VAL C CA  1 
ATOM   2055  C  C   . VAL C  2 66  ? 89.289  -1.155   17.982  1.00 64.16  ? 85  VAL C C   1 
ATOM   2056  O  O   . VAL C  2 66  ? 89.167  0.011    17.625  1.00 64.46  ? 85  VAL C O   1 
ATOM   2057  C  CB  . VAL C  2 66  ? 88.443  -2.854   16.376  1.00 63.87  ? 85  VAL C CB  1 
ATOM   2058  C  CG1 . VAL C  2 66  ? 88.521  -1.809   15.248  1.00 59.66  ? 85  VAL C CG1 1 
ATOM   2059  C  CG2 . VAL C  2 66  ? 89.713  -3.678   16.450  1.00 49.98  ? 85  VAL C CG2 1 
ATOM   2060  N  N   . ASN C  2 67  ? 90.366  -1.618   18.604  1.00 58.48  ? 86  ASN C N   1 
ATOM   2061  C  CA  . ASN C  2 67  ? 91.526  -0.782   18.864  1.00 65.90  ? 86  ASN C CA  1 
ATOM   2062  C  C   . ASN C  2 67  ? 92.789  -1.576   18.659  1.00 70.33  ? 86  ASN C C   1 
ATOM   2063  O  O   . ASN C  2 67  ? 93.101  -2.476   19.432  1.00 85.11  ? 86  ASN C O   1 
ATOM   2064  C  CB  . ASN C  2 67  ? 91.494  -0.237   20.289  1.00 74.71  ? 86  ASN C CB  1 
ATOM   2065  C  CG  . ASN C  2 67  ? 92.519  0.841    20.524  1.00 72.80  ? 86  ASN C CG  1 
ATOM   2066  O  OD1 . ASN C  2 67  ? 93.596  0.837    19.934  1.00 92.54  ? 86  ASN C OD1 1 
ATOM   2067  N  ND2 . ASN C  2 67  ? 92.190  1.774    21.396  1.00 67.20  ? 86  ASN C ND2 1 
ATOM   2068  N  N   . HIS C  2 68  ? 93.511  -1.246   17.601  1.00 78.71  ? 87  HIS C N   1 
ATOM   2069  C  CA  . HIS C  2 68  ? 94.773  -1.893   17.306  1.00 75.98  ? 87  HIS C CA  1 
ATOM   2070  C  C   . HIS C  2 68  ? 95.893  -1.003   17.813  1.00 78.91  ? 87  HIS C C   1 
ATOM   2071  O  O   . HIS C  2 68  ? 95.980  0.179    17.464  1.00 84.42  ? 87  HIS C O   1 
ATOM   2072  C  CB  . HIS C  2 68  ? 94.910  -2.079   15.803  1.00 84.53  ? 87  HIS C CB  1 
ATOM   2073  C  CG  . HIS C  2 68  ? 95.363  -3.443   15.398  1.00 93.90  ? 87  HIS C CG  1 
ATOM   2074  N  ND1 . HIS C  2 68  ? 96.690  -3.775   15.266  1.00 103.55 ? 87  HIS C ND1 1 
ATOM   2075  C  CD2 . HIS C  2 68  ? 94.661  -4.552   15.073  1.00 114.26 ? 87  HIS C CD2 1 
ATOM   2076  C  CE1 . HIS C  2 68  ? 96.791  -5.035   14.888  1.00 114.13 ? 87  HIS C CE1 1 
ATOM   2077  N  NE2 . HIS C  2 68  ? 95.574  -5.530   14.764  1.00 128.89 ? 87  HIS C NE2 1 
ATOM   2078  N  N   . TYR C  2 69  ? 96.745  -1.567   18.654  1.00 67.56  ? 88  TYR C N   1 
ATOM   2079  C  CA  . TYR C  2 69  ? 97.903  -0.837   19.143  1.00 79.20  ? 88  TYR C CA  1 
ATOM   2080  C  C   . TYR C  2 69  ? 99.180  -1.661   19.020  1.00 79.69  ? 88  TYR C C   1 
ATOM   2081  O  O   . TYR C  2 69  ? 99.221  -2.809   19.437  1.00 75.69  ? 88  TYR C O   1 
ATOM   2082  C  CB  . TYR C  2 69  ? 97.703  -0.427   20.598  1.00 90.86  ? 88  TYR C CB  1 
ATOM   2083  C  CG  . TYR C  2 69  ? 98.990  0.025    21.273  1.00 101.15 ? 88  TYR C CG  1 
ATOM   2084  C  CD1 . TYR C  2 69  ? 99.647  -0.797   22.184  1.00 92.38  ? 88  TYR C CD1 1 
ATOM   2085  C  CD2 . TYR C  2 69  ? 99.554  1.274    20.991  1.00 97.75  ? 88  TYR C CD2 1 
ATOM   2086  C  CE1 . TYR C  2 69  ? 100.819 -0.389   22.799  1.00 90.55  ? 88  TYR C CE1 1 
ATOM   2087  C  CE2 . TYR C  2 69  ? 100.722 1.684    21.604  1.00 83.43  ? 88  TYR C CE2 1 
ATOM   2088  C  CZ  . TYR C  2 69  ? 101.348 0.846    22.502  1.00 87.26  ? 88  TYR C CZ  1 
ATOM   2089  O  OH  . TYR C  2 69  ? 102.512 1.241    23.110  1.00 89.33  ? 88  TYR C OH  1 
ATOM   2090  N  N   . CYS C  2 70  ? 100.231 -1.067   18.466  1.00 81.10  ? 89  CYS C N   1 
ATOM   2091  C  CA  . CYS C  2 70  ? 101.483 -1.792   18.280  1.00 75.92  ? 89  CYS C CA  1 
ATOM   2092  C  C   . CYS C  2 70  ? 102.721 -1.032   18.778  1.00 84.10  ? 89  CYS C C   1 
ATOM   2093  O  O   . CYS C  2 70  ? 102.720 0.195    18.866  1.00 85.15  ? 89  CYS C O   1 
ATOM   2094  C  CB  . CYS C  2 70  ? 101.656 -2.144   16.810  1.00 70.96  ? 89  CYS C CB  1 
ATOM   2095  S  SG  . CYS C  2 70  ? 100.164 -2.749   16.029  1.00 107.84 ? 89  CYS C SG  1 
ATOM   2096  N  N   . CYS C  2 71  ? 103.777 -1.780   19.096  1.00 97.87  ? 90  CYS C N   1 
ATOM   2097  C  CA  . CYS C  2 71  ? 105.047 -1.204   19.524  1.00 106.06 ? 90  CYS C CA  1 
ATOM   2098  C  C   . CYS C  2 71  ? 106.154 -2.222   19.282  1.00 104.11 ? 90  CYS C C   1 
ATOM   2099  O  O   . CYS C  2 71  ? 105.873 -3.409   19.113  1.00 94.08  ? 90  CYS C O   1 
ATOM   2100  C  CB  . CYS C  2 71  ? 104.988 -0.840   21.000  1.00 110.40 ? 90  CYS C CB  1 
ATOM   2101  S  SG  . CYS C  2 71  ? 104.714 -2.258   22.064  1.00 117.22 ? 90  CYS C SG  1 
ATOM   2102  N  N   . ASP C  2 72  ? 107.406 -1.762   19.266  1.00 105.46 ? 91  ASP C N   1 
ATOM   2103  C  CA  . ASP C  2 72  ? 108.527 -2.635   18.907  1.00 105.05 ? 91  ASP C CA  1 
ATOM   2104  C  C   . ASP C  2 72  ? 109.732 -2.620   19.843  1.00 98.92  ? 91  ASP C C   1 
ATOM   2105  O  O   . ASP C  2 72  ? 110.864 -2.738   19.392  1.00 105.09 ? 91  ASP C O   1 
ATOM   2106  C  CB  . ASP C  2 72  ? 108.982 -2.382   17.465  1.00 110.22 ? 91  ASP C CB  1 
ATOM   2107  C  CG  . ASP C  2 72  ? 108.664 -0.980   16.988  1.00 120.30 ? 91  ASP C CG  1 
ATOM   2108  O  OD1 . ASP C  2 72  ? 107.530 -0.764   16.499  1.00 123.03 ? 91  ASP C OD1 1 
ATOM   2109  O  OD2 . ASP C  2 72  ? 109.547 -0.099   17.092  1.00 116.20 ? 91  ASP C OD2 1 
ATOM   2110  N  N   . SER C  2 73  ? 109.482 -2.485   21.140  1.00 98.30  ? 92  SER C N   1 
ATOM   2111  C  CA  . SER C  2 73  ? 110.515 -2.710   22.145  1.00 97.32  ? 92  SER C CA  1 
ATOM   2112  C  C   . SER C  2 73  ? 110.235 -4.021   22.879  1.00 107.40 ? 92  SER C C   1 
ATOM   2113  O  O   . SER C  2 73  ? 109.093 -4.468   22.966  1.00 102.72 ? 92  SER C O   1 
ATOM   2114  C  CB  . SER C  2 73  ? 110.623 -1.533   23.130  1.00 85.13  ? 92  SER C CB  1 
ATOM   2115  O  OG  . SER C  2 73  ? 109.423 -1.301   23.842  1.00 92.79  ? 92  SER C OG  1 
ATOM   2116  N  N   . HIS C  2 74  ? 111.283 -4.644   23.397  1.00 117.41 ? 93  HIS C N   1 
ATOM   2117  C  CA  . HIS C  2 74  ? 111.131 -5.920   24.079  1.00 120.16 ? 93  HIS C CA  1 
ATOM   2118  C  C   . HIS C  2 74  ? 109.961 -5.905   25.082  1.00 103.18 ? 93  HIS C C   1 
ATOM   2119  O  O   . HIS C  2 74  ? 109.712 -4.906   25.751  1.00 87.48  ? 93  HIS C O   1 
ATOM   2120  C  CB  . HIS C  2 74  ? 112.451 -6.303   24.754  1.00 123.14 ? 93  HIS C CB  1 
ATOM   2121  C  CG  . HIS C  2 74  ? 112.467 -7.691   25.303  1.00 125.12 ? 93  HIS C CG  1 
ATOM   2122  N  ND1 . HIS C  2 74  ? 112.027 -7.990   26.574  1.00 116.27 ? 93  HIS C ND1 1 
ATOM   2123  C  CD2 . HIS C  2 74  ? 112.871 -8.862   24.756  1.00 131.20 ? 93  HIS C CD2 1 
ATOM   2124  C  CE1 . HIS C  2 74  ? 112.160 -9.287   26.787  1.00 126.03 ? 93  HIS C CE1 1 
ATOM   2125  N  NE2 . HIS C  2 74  ? 112.669 -9.839   25.700  1.00 137.31 ? 93  HIS C NE2 1 
ATOM   2126  N  N   . LEU C  2 75  ? 109.235 -7.016   25.146  1.00 110.08 ? 94  LEU C N   1 
ATOM   2127  C  CA  . LEU C  2 75  ? 108.138 -7.216   26.102  1.00 108.99 ? 94  LEU C CA  1 
ATOM   2128  C  C   . LEU C  2 75  ? 107.243 -5.994   26.362  1.00 100.19 ? 94  LEU C C   1 
ATOM   2129  O  O   . LEU C  2 75  ? 106.605 -5.894   27.404  1.00 85.96  ? 94  LEU C O   1 
ATOM   2130  C  CB  . LEU C  2 75  ? 108.671 -7.782   27.426  1.00 91.25  ? 94  LEU C CB  1 
ATOM   2131  N  N   . CYS C  2 76  ? 107.162 -5.097   25.393  1.00 96.96  ? 95  CYS C N   1 
ATOM   2132  C  CA  . CYS C  2 76  ? 106.483 -3.819   25.577  1.00 100.07 ? 95  CYS C CA  1 
ATOM   2133  C  C   . CYS C  2 76  ? 104.952 -3.846   25.688  1.00 102.27 ? 95  CYS C C   1 
ATOM   2134  O  O   . CYS C  2 76  ? 104.313 -2.787   25.759  1.00 86.40  ? 95  CYS C O   1 
ATOM   2135  C  CB  . CYS C  2 76  ? 106.846 -2.894   24.425  1.00 99.74  ? 95  CYS C CB  1 
ATOM   2136  S  SG  . CYS C  2 76  ? 106.172 -3.430   22.838  1.00 144.74 ? 95  CYS C SG  1 
ATOM   2137  N  N   . ASN C  2 77  ? 104.349 -5.028   25.692  1.00 102.95 ? 96  ASN C N   1 
ATOM   2138  C  CA  . ASN C  2 77  ? 102.892 -5.084   25.748  1.00 98.89  ? 96  ASN C CA  1 
ATOM   2139  C  C   . ASN C  2 77  ? 102.307 -5.758   26.998  1.00 113.87 ? 96  ASN C C   1 
ATOM   2140  O  O   . ASN C  2 77  ? 101.266 -6.408   26.932  1.00 128.49 ? 96  ASN C O   1 
ATOM   2141  C  CB  . ASN C  2 77  ? 102.316 -5.673   24.451  1.00 100.35 ? 96  ASN C CB  1 
ATOM   2142  C  CG  . ASN C  2 77  ? 102.803 -7.080   24.171  1.00 112.56 ? 96  ASN C CG  1 
ATOM   2143  O  OD1 . ASN C  2 77  ? 103.795 -7.531   24.729  1.00 130.16 ? 96  ASN C OD1 1 
ATOM   2144  N  ND2 . ASN C  2 77  ? 102.101 -7.780   23.293  1.00 103.01 ? 96  ASN C ND2 1 
ATOM   2145  N  N   . HIS C  2 78  ? 102.965 -5.589   28.138  1.00 110.71 ? 97  HIS C N   1 
ATOM   2146  C  CA  . HIS C  2 78  ? 102.415 -6.098   29.385  1.00 118.19 ? 97  HIS C CA  1 
ATOM   2147  C  C   . HIS C  2 78  ? 101.609 -5.005   30.094  1.00 126.52 ? 97  HIS C C   1 
ATOM   2148  O  O   . HIS C  2 78  ? 100.385 -4.960   29.985  1.00 98.49  ? 97  HIS C O   1 
ATOM   2149  C  CB  . HIS C  2 78  ? 103.515 -6.655   30.291  1.00 118.21 ? 97  HIS C CB  1 
ATOM   2150  C  CG  . HIS C  2 78  ? 103.007 -7.579   31.353  1.00 139.60 ? 97  HIS C CG  1 
ATOM   2151  N  ND1 . HIS C  2 78  ? 102.310 -8.732   31.062  1.00 148.56 ? 97  HIS C ND1 1 
ATOM   2152  C  CD2 . HIS C  2 78  ? 103.083 -7.517   32.704  1.00 147.22 ? 97  HIS C CD2 1 
ATOM   2153  C  CE1 . HIS C  2 78  ? 101.982 -9.342   32.187  1.00 149.39 ? 97  HIS C CE1 1 
ATOM   2154  N  NE2 . HIS C  2 78  ? 102.438 -8.625   33.198  1.00 149.77 ? 97  HIS C NE2 1 
ATOM   2155  N  N   . ASN C  2 79  ? 102.297 -4.121   30.809  1.00 149.73 ? 98  ASN C N   1 
ATOM   2156  C  CA  . ASN C  2 79  ? 101.640 -3.009   31.493  1.00 161.00 ? 98  ASN C CA  1 
ATOM   2157  C  C   . ASN C  2 79  ? 100.942 -2.063   30.509  1.00 153.27 ? 98  ASN C C   1 
ATOM   2158  O  O   . ASN C  2 79  ? 101.434 -0.960   30.277  1.00 172.05 ? 98  ASN C O   1 
ATOM   2159  C  CB  . ASN C  2 79  ? 102.665 -2.205   32.317  1.00 168.41 ? 98  ASN C CB  1 
ATOM   2160  C  CG  . ASN C  2 79  ? 103.210 -2.975   33.519  1.00 162.54 ? 98  ASN C CG  1 
ATOM   2161  O  OD1 . ASN C  2 79  ? 102.482 -3.714   34.182  1.00 162.96 ? 98  ASN C OD1 1 
ATOM   2162  N  ND2 . ASN C  2 79  ? 104.496 -2.786   33.812  1.00 148.92 ? 98  ASN C ND2 1 
ATOM   2163  N  N   . VAL C  2 80  ? 99.807  -2.473   29.936  1.00 121.40 ? 99  VAL C N   1 
ATOM   2164  C  CA  . VAL C  2 80  ? 99.117  -1.629   28.938  1.00 112.41 ? 99  VAL C CA  1 
ATOM   2165  C  C   . VAL C  2 80  ? 97.713  -2.085   28.485  1.00 103.72 ? 99  VAL C C   1 
ATOM   2166  O  O   . VAL C  2 80  ? 97.559  -3.152   27.896  1.00 95.30  ? 99  VAL C O   1 
ATOM   2167  C  CB  . VAL C  2 80  ? 99.994  -1.426   27.678  1.00 94.56  ? 99  VAL C CB  1 
ATOM   2168  C  CG1 . VAL C  2 80  ? 100.740 -2.715   27.338  1.00 108.84 ? 99  VAL C CG1 1 
ATOM   2169  C  CG2 . VAL C  2 80  ? 99.149  -0.938   26.502  1.00 48.96  ? 99  VAL C CG2 1 
ATOM   2170  N  N   . SER C  2 81  ? 96.702  -1.253   28.735  1.00 101.12 ? 100 SER C N   1 
ATOM   2171  C  CA  . SER C  2 81  ? 95.317  -1.577   28.376  1.00 111.29 ? 100 SER C CA  1 
ATOM   2172  C  C   . SER C  2 81  ? 94.669  -0.445   27.563  1.00 104.51 ? 100 SER C C   1 
ATOM   2173  O  O   . SER C  2 81  ? 95.252  0.615    27.424  1.00 94.62  ? 100 SER C O   1 
ATOM   2174  C  CB  . SER C  2 81  ? 94.493  -1.896   29.626  1.00 117.93 ? 100 SER C CB  1 
ATOM   2175  N  N   . LEU C  2 82  ? 93.469  -0.660   27.027  1.00 107.90 ? 101 LEU C N   1 
ATOM   2176  C  CA  . LEU C  2 82  ? 92.935  0.216    25.976  1.00 95.16  ? 101 LEU C CA  1 
ATOM   2177  C  C   . LEU C  2 82  ? 91.447  0.467    26.101  1.00 80.99  ? 101 LEU C C   1 
ATOM   2178  O  O   . LEU C  2 82  ? 90.776  -0.261   26.829  1.00 84.71  ? 101 LEU C O   1 
ATOM   2179  C  CB  . LEU C  2 82  ? 93.161  -0.449   24.627  1.00 97.36  ? 101 LEU C CB  1 
ATOM   2180  C  CG  . LEU C  2 82  ? 94.536  -0.240   24.032  1.00 87.44  ? 101 LEU C CG  1 
ATOM   2181  C  CD1 . LEU C  2 82  ? 94.783  -1.296   22.995  1.00 84.82  ? 101 LEU C CD1 1 
ATOM   2182  C  CD2 . LEU C  2 82  ? 94.561  1.137    23.426  1.00 106.56 ? 101 LEU C CD2 1 
ATOM   2183  N  N   . VAL C  2 83  ? 90.927  1.472    25.379  1.00 57.24  ? 102 VAL C N   1 
ATOM   2184  C  CA  . VAL C  2 83  ? 89.456  1.647    25.252  1.00 77.17  ? 102 VAL C CA  1 
ATOM   2185  C  C   . VAL C  2 83  ? 88.909  1.892    23.831  1.00 66.29  ? 102 VAL C C   1 
ATOM   2186  O  O   . VAL C  2 83  ? 89.662  1.983    22.862  1.00 64.66  ? 102 VAL C O   1 
ATOM   2187  C  CB  . VAL C  2 83  ? 88.843  2.758    26.184  1.00 55.27  ? 102 VAL C CB  1 
ATOM   2188  C  CG1 . VAL C  2 83  ? 89.275  2.587    27.621  1.00 69.99  ? 102 VAL C CG1 1 
ATOM   2189  C  CG2 . VAL C  2 83  ? 89.155  4.151    25.674  1.00 38.16  ? 102 VAL C CG2 1 
ATOM   2190  N  N   . LEU C  2 84  ? 87.584  2.006    23.743  1.00 47.45  ? 103 LEU C N   1 
ATOM   2191  C  CA  . LEU C  2 84  ? 86.871  2.254    22.495  1.00 62.17  ? 103 LEU C CA  1 
ATOM   2192  C  C   . LEU C  2 84  ? 86.211  3.629    22.488  1.00 74.36  ? 103 LEU C C   1 
ATOM   2193  O  O   . LEU C  2 84  ? 86.780  4.594    22.986  1.00 111.53 ? 103 LEU C O   1 
ATOM   2194  C  CB  . LEU C  2 84  ? 85.810  1.181    22.268  1.00 92.33  ? 103 LEU C CB  1 
ATOM   2195  C  CG  . LEU C  2 84  ? 86.203  -0.080   21.495  1.00 107.25 ? 103 LEU C CG  1 
ATOM   2196  C  CD1 . LEU C  2 84  ? 87.653  -0.577   21.824  1.00 30.16  ? 103 LEU C CD1 1 
ATOM   2197  C  CD2 . LEU C  2 84  ? 85.113  -1.167   21.710  1.00 40.80  ? 103 LEU C CD2 1 
ATOM   2198  N  N   . GLU C  2 85  ? 85.009  3.718    21.929  1.00 70.85  ? 104 GLU C N   1 
ATOM   2199  C  CA  . GLU C  2 85  ? 84.383  5.018    21.693  1.00 83.52  ? 104 GLU C CA  1 
ATOM   2200  C  C   . GLU C  2 85  ? 82.872  4.907    21.402  1.00 87.74  ? 104 GLU C C   1 
ATOM   2201  O  O   . GLU C  2 85  ? 82.026  5.444    22.132  1.00 52.05  ? 104 GLU C O   1 
ATOM   2202  C  CB  . GLU C  2 85  ? 85.112  5.733    20.541  1.00 39.05  ? 104 GLU C CB  1 
ATOM   2203  N  N   . PRO D  2 11  ? 85.256  -28.932  -30.503 1.00 135.57 ? 30  PRO D N   1 
ATOM   2204  C  CA  . PRO D  2 11  ? 84.249  -29.828  -31.083 1.00 134.85 ? 30  PRO D CA  1 
ATOM   2205  C  C   . PRO D  2 11  ? 82.927  -29.718  -30.332 1.00 136.21 ? 30  PRO D C   1 
ATOM   2206  O  O   . PRO D  2 11  ? 82.362  -30.744  -29.966 1.00 137.79 ? 30  PRO D O   1 
ATOM   2207  C  CB  . PRO D  2 11  ? 84.856  -31.227  -30.876 1.00 124.85 ? 30  PRO D CB  1 
ATOM   2208  C  CG  . PRO D  2 11  ? 86.306  -30.998  -30.548 1.00 121.81 ? 30  PRO D CG  1 
ATOM   2209  C  CD  . PRO D  2 11  ? 86.358  -29.671  -29.865 1.00 128.96 ? 30  PRO D CD  1 
ATOM   2210  N  N   . LEU D  2 12  ? 82.443  -28.496  -30.117 1.00 136.58 ? 31  LEU D N   1 
ATOM   2211  C  CA  . LEU D  2 12  ? 81.279  -28.248  -29.255 1.00 129.96 ? 31  LEU D CA  1 
ATOM   2212  C  C   . LEU D  2 12  ? 79.949  -28.794  -29.770 1.00 122.30 ? 31  LEU D C   1 
ATOM   2213  O  O   . LEU D  2 12  ? 79.829  -29.180  -30.926 1.00 132.85 ? 31  LEU D O   1 
ATOM   2214  C  CB  . LEU D  2 12  ? 81.119  -26.753  -28.980 1.00 128.82 ? 31  LEU D CB  1 
ATOM   2215  C  CG  . LEU D  2 12  ? 82.142  -26.074  -28.075 1.00 130.27 ? 31  LEU D CG  1 
ATOM   2216  C  CD1 . LEU D  2 12  ? 83.552  -26.171  -28.654 1.00 145.15 ? 31  LEU D CD1 1 
ATOM   2217  C  CD2 . LEU D  2 12  ? 81.740  -24.630  -27.862 1.00 118.43 ? 31  LEU D CD2 1 
ATOM   2218  N  N   . VAL D  2 13  ? 78.951  -28.799  -28.890 1.00 110.13 ? 32  VAL D N   1 
ATOM   2219  C  CA  . VAL D  2 13  ? 77.616  -29.326  -29.184 1.00 113.40 ? 32  VAL D CA  1 
ATOM   2220  C  C   . VAL D  2 13  ? 76.548  -28.463  -28.507 1.00 120.94 ? 32  VAL D C   1 
ATOM   2221  O  O   . VAL D  2 13  ? 76.860  -27.654  -27.631 1.00 129.55 ? 32  VAL D O   1 
ATOM   2222  C  CB  . VAL D  2 13  ? 77.461  -30.795  -28.713 1.00 99.93  ? 32  VAL D CB  1 
ATOM   2223  C  CG1 . VAL D  2 13  ? 77.493  -30.884  -27.195 1.00 94.26  ? 32  VAL D CG1 1 
ATOM   2224  C  CG2 . VAL D  2 13  ? 76.178  -31.399  -29.254 1.00 109.58 ? 32  VAL D CG2 1 
ATOM   2225  N  N   . THR D  2 14  ? 75.292  -28.638  -28.907 1.00 118.25 ? 33  THR D N   1 
ATOM   2226  C  CA  . THR D  2 14  ? 74.203  -27.813  -28.393 1.00 117.40 ? 33  THR D CA  1 
ATOM   2227  C  C   . THR D  2 14  ? 73.236  -28.607  -27.515 1.00 118.44 ? 33  THR D C   1 
ATOM   2228  O  O   . THR D  2 14  ? 72.739  -29.646  -27.927 1.00 120.55 ? 33  THR D O   1 
ATOM   2229  C  CB  . THR D  2 14  ? 73.426  -27.170  -29.543 1.00 110.75 ? 33  THR D CB  1 
ATOM   2230  O  OG1 . THR D  2 14  ? 74.333  -26.433  -30.370 1.00 106.31 ? 33  THR D OG1 1 
ATOM   2231  C  CG2 . THR D  2 14  ? 72.358  -26.239  -29.007 1.00 105.15 ? 33  THR D CG2 1 
ATOM   2232  N  N   . CYS D  2 15  ? 72.973  -28.109  -26.308 1.00 118.40 ? 34  CYS D N   1 
ATOM   2233  C  CA  . CYS D  2 15  ? 72.130  -28.799  -25.332 1.00 106.52 ? 34  CYS D CA  1 
ATOM   2234  C  C   . CYS D  2 15  ? 70.938  -27.962  -24.887 1.00 108.69 ? 34  CYS D C   1 
ATOM   2235  O  O   . CYS D  2 15  ? 70.990  -26.725  -24.901 1.00 120.01 ? 34  CYS D O   1 
ATOM   2236  C  CB  . CYS D  2 15  ? 72.934  -29.165  -24.082 1.00 102.49 ? 34  CYS D CB  1 
ATOM   2237  S  SG  . CYS D  2 15  ? 74.672  -29.519  -24.346 1.00 143.35 ? 34  CYS D SG  1 
ATOM   2238  N  N   . THR D  2 16  ? 69.874  -28.646  -24.471 1.00 101.11 ? 35  THR D N   1 
ATOM   2239  C  CA  . THR D  2 16  ? 68.719  -27.987  -23.877 1.00 110.49 ? 35  THR D CA  1 
ATOM   2240  C  C   . THR D  2 16  ? 69.119  -27.459  -22.514 1.00 115.95 ? 35  THR D C   1 
ATOM   2241  O  O   . THR D  2 16  ? 69.894  -28.095  -21.805 1.00 111.45 ? 35  THR D O   1 
ATOM   2242  C  CB  . THR D  2 16  ? 67.536  -28.947  -23.695 1.00 113.99 ? 35  THR D CB  1 
ATOM   2243  O  OG1 . THR D  2 16  ? 67.376  -29.741  -24.874 1.00 130.91 ? 35  THR D OG1 1 
ATOM   2244  C  CG2 . THR D  2 16  ? 66.248  -28.172  -23.436 1.00 112.76 ? 35  THR D CG2 1 
ATOM   2245  N  N   . CYS D  2 17  ? 68.586  -26.299  -22.145 1.00 123.08 ? 36  CYS D N   1 
ATOM   2246  C  CA  . CYS D  2 17  ? 68.975  -25.644  -20.903 1.00 118.15 ? 36  CYS D CA  1 
ATOM   2247  C  C   . CYS D  2 17  ? 67.768  -25.273  -20.036 1.00 122.77 ? 36  CYS D C   1 
ATOM   2248  O  O   . CYS D  2 17  ? 67.181  -24.203  -20.188 1.00 131.21 ? 36  CYS D O   1 
ATOM   2249  C  CB  . CYS D  2 17  ? 69.827  -24.404  -21.205 1.00 121.03 ? 36  CYS D CB  1 
ATOM   2250  S  SG  . CYS D  2 17  ? 70.614  -23.651  -19.761 1.00 116.89 ? 36  CYS D SG  1 
ATOM   2251  N  N   . GLU D  2 18  ? 67.403  -26.173  -19.131 1.00 119.36 ? 37  GLU D N   1 
ATOM   2252  C  CA  . GLU D  2 18  ? 66.358  -25.906  -18.159 1.00 113.17 ? 37  GLU D CA  1 
ATOM   2253  C  C   . GLU D  2 18  ? 66.976  -25.876  -16.763 1.00 113.21 ? 37  GLU D C   1 
ATOM   2254  O  O   . GLU D  2 18  ? 67.160  -26.910  -16.124 1.00 106.75 ? 37  GLU D O   1 
ATOM   2255  C  CB  . GLU D  2 18  ? 65.250  -26.959  -18.253 1.00 117.08 ? 37  GLU D CB  1 
ATOM   2256  C  CG  . GLU D  2 18  ? 64.558  -27.013  -19.618 1.00 126.89 ? 37  GLU D CG  1 
ATOM   2257  C  CD  . GLU D  2 18  ? 63.481  -28.082  -19.709 1.00 128.57 ? 37  GLU D CD  1 
ATOM   2258  O  OE1 . GLU D  2 18  ? 63.006  -28.340  -20.835 1.00 124.21 ? 37  GLU D OE1 1 
ATOM   2259  O  OE2 . GLU D  2 18  ? 63.108  -28.659  -18.664 1.00 127.48 ? 37  GLU D OE2 1 
ATOM   2260  N  N   . SER D  2 19  ? 67.304  -24.674  -16.304 1.00 115.41 ? 38  SER D N   1 
ATOM   2261  C  CA  . SER D  2 19  ? 68.001  -24.488  -15.041 1.00 111.28 ? 38  SER D CA  1 
ATOM   2262  C  C   . SER D  2 19  ? 68.022  -23.017  -14.665 1.00 120.28 ? 38  SER D C   1 
ATOM   2263  O  O   . SER D  2 19  ? 67.762  -22.162  -15.510 1.00 129.24 ? 38  SER D O   1 
ATOM   2264  C  CB  . SER D  2 19  ? 69.432  -25.001  -15.163 1.00 101.24 ? 38  SER D CB  1 
ATOM   2265  O  OG  . SER D  2 19  ? 70.257  -24.475  -14.137 1.00 81.88  ? 38  SER D OG  1 
ATOM   2266  N  N   . PRO D  2 20  ? 68.328  -22.715  -13.391 1.00 119.94 ? 39  PRO D N   1 
ATOM   2267  C  CA  . PRO D  2 20  ? 68.480  -21.331  -12.919 1.00 120.12 ? 39  PRO D CA  1 
ATOM   2268  C  C   . PRO D  2 20  ? 69.646  -20.570  -13.570 1.00 119.57 ? 39  PRO D C   1 
ATOM   2269  O  O   . PRO D  2 20  ? 69.476  -19.419  -13.969 1.00 119.15 ? 39  PRO D O   1 
ATOM   2270  C  CB  . PRO D  2 20  ? 68.722  -21.498  -11.414 1.00 103.41 ? 39  PRO D CB  1 
ATOM   2271  C  CG  . PRO D  2 20  ? 69.147  -22.911  -11.245 1.00 96.62  ? 39  PRO D CG  1 
ATOM   2272  C  CD  . PRO D  2 20  ? 68.417  -23.678  -12.283 1.00 108.07 ? 39  PRO D CD  1 
ATOM   2273  N  N   . HIS D  2 21  ? 70.808  -21.200  -13.682 1.00 109.20 ? 40  HIS D N   1 
ATOM   2274  C  CA  . HIS D  2 21  ? 71.958  -20.545  -14.284 1.00 112.65 ? 40  HIS D CA  1 
ATOM   2275  C  C   . HIS D  2 21  ? 71.845  -20.485  -15.805 1.00 119.00 ? 40  HIS D C   1 
ATOM   2276  O  O   . HIS D  2 21  ? 72.850  -20.576  -16.505 1.00 103.46 ? 40  HIS D O   1 
ATOM   2277  C  CB  . HIS D  2 21  ? 73.244  -21.273  -13.896 1.00 114.51 ? 40  HIS D CB  1 
ATOM   2278  C  CG  . HIS D  2 21  ? 73.339  -21.602  -12.440 1.00 133.55 ? 40  HIS D CG  1 
ATOM   2279  N  ND1 . HIS D  2 21  ? 73.945  -22.750  -11.975 1.00 148.47 ? 40  HIS D ND1 1 
ATOM   2280  C  CD2 . HIS D  2 21  ? 72.909  -20.936  -11.344 1.00 147.63 ? 40  HIS D CD2 1 
ATOM   2281  C  CE1 . HIS D  2 21  ? 73.882  -22.779  -10.656 1.00 154.38 ? 40  HIS D CE1 1 
ATOM   2282  N  NE2 . HIS D  2 21  ? 73.258  -21.689  -10.248 1.00 160.66 ? 40  HIS D NE2 1 
ATOM   2283  N  N   . CYS D  2 22  ? 70.628  -20.323  -16.316 1.00 129.88 ? 41  CYS D N   1 
ATOM   2284  C  CA  . CYS D  2 22  ? 70.400  -20.358  -17.762 1.00 132.76 ? 41  CYS D CA  1 
ATOM   2285  C  C   . CYS D  2 22  ? 70.231  -18.986  -18.407 1.00 129.93 ? 41  CYS D C   1 
ATOM   2286  O  O   . CYS D  2 22  ? 69.261  -18.278  -18.139 1.00 119.57 ? 41  CYS D O   1 
ATOM   2287  C  CB  . CYS D  2 22  ? 69.192  -21.237  -18.103 1.00 137.47 ? 41  CYS D CB  1 
ATOM   2288  S  SG  . CYS D  2 22  ? 69.543  -23.010  -18.152 1.00 200.67 ? 41  CYS D SG  1 
ATOM   2289  N  N   . LYS D  2 23  ? 71.181  -18.629  -19.267 1.00 135.59 ? 42  LYS D N   1 
ATOM   2290  C  CA  . LYS D  2 23  ? 71.094  -17.409  -20.054 1.00 128.10 ? 42  LYS D CA  1 
ATOM   2291  C  C   . LYS D  2 23  ? 70.499  -17.731  -21.422 1.00 131.22 ? 42  LYS D C   1 
ATOM   2292  O  O   . LYS D  2 23  ? 71.150  -17.556  -22.450 1.00 144.89 ? 42  LYS D O   1 
ATOM   2293  C  CB  . LYS D  2 23  ? 72.474  -16.758  -20.197 1.00 102.92 ? 42  LYS D CB  1 
ATOM   2294  N  N   . GLY D  2 24  ? 69.257  -18.208  -21.423 1.00 110.38 ? 43  GLY D N   1 
ATOM   2295  C  CA  . GLY D  2 24  ? 68.588  -18.597  -22.653 1.00 115.26 ? 43  GLY D CA  1 
ATOM   2296  C  C   . GLY D  2 24  ? 67.758  -19.866  -22.511 1.00 126.71 ? 43  GLY D C   1 
ATOM   2297  O  O   . GLY D  2 24  ? 67.544  -20.349  -21.401 1.00 127.00 ? 43  GLY D O   1 
ATOM   2298  N  N   . PRO D  2 25  ? 67.272  -20.407  -23.640 1.00 134.97 ? 44  PRO D N   1 
ATOM   2299  C  CA  . PRO D  2 25  ? 66.488  -21.641  -23.662 1.00 125.68 ? 44  PRO D CA  1 
ATOM   2300  C  C   . PRO D  2 25  ? 67.375  -22.826  -23.980 1.00 129.54 ? 44  PRO D C   1 
ATOM   2301  O  O   . PRO D  2 25  ? 67.008  -23.961  -23.690 1.00 123.10 ? 44  PRO D O   1 
ATOM   2302  C  CB  . PRO D  2 25  ? 65.538  -21.402  -24.825 1.00 123.33 ? 44  PRO D CB  1 
ATOM   2303  C  CG  . PRO D  2 25  ? 66.360  -20.627  -25.787 1.00 134.90 ? 44  PRO D CG  1 
ATOM   2304  C  CD  . PRO D  2 25  ? 67.302  -19.769  -24.967 1.00 141.06 ? 44  PRO D CD  1 
ATOM   2305  N  N   . THR D  2 26  ? 68.522  -22.554  -24.592 1.00 133.49 ? 45  THR D N   1 
ATOM   2306  C  CA  . THR D  2 26  ? 69.494  -23.589  -24.919 1.00 128.02 ? 45  THR D CA  1 
ATOM   2307  C  C   . THR D  2 26  ? 70.896  -23.025  -24.766 1.00 125.00 ? 45  THR D C   1 
ATOM   2308  O  O   . THR D  2 26  ? 71.080  -21.809  -24.716 1.00 116.83 ? 45  THR D O   1 
ATOM   2309  C  CB  . THR D  2 26  ? 69.348  -24.083  -26.367 1.00 115.51 ? 45  THR D CB  1 
ATOM   2310  O  OG1 . THR D  2 26  ? 69.957  -23.140  -27.260 1.00 113.13 ? 45  THR D OG1 1 
ATOM   2311  C  CG2 . THR D  2 26  ? 67.886  -24.265  -26.732 1.00 113.57 ? 45  THR D CG2 1 
ATOM   2312  N  N   . CYS D  2 27  ? 71.884  -23.911  -24.711 1.00 125.06 ? 46  CYS D N   1 
ATOM   2313  C  CA  . CYS D  2 27  ? 73.263  -23.480  -24.534 1.00 120.67 ? 46  CYS D CA  1 
ATOM   2314  C  C   . CYS D  2 27  ? 74.233  -24.384  -25.292 1.00 113.62 ? 46  CYS D C   1 
ATOM   2315  O  O   . CYS D  2 27  ? 73.846  -25.438  -25.767 1.00 110.42 ? 46  CYS D O   1 
ATOM   2316  C  CB  . CYS D  2 27  ? 73.611  -23.455  -23.049 1.00 120.37 ? 46  CYS D CB  1 
ATOM   2317  S  SG  . CYS D  2 27  ? 73.395  -25.038  -22.208 1.00 135.28 ? 46  CYS D SG  1 
ATOM   2318  N  N   . ARG D  2 28  ? 75.489  -23.963  -25.411 1.00 105.26 ? 47  ARG D N   1 
ATOM   2319  C  CA  . ARG D  2 28  ? 76.500  -24.756  -26.101 1.00 97.02  ? 47  ARG D CA  1 
ATOM   2320  C  C   . ARG D  2 28  ? 77.616  -25.175  -25.132 1.00 103.27 ? 47  ARG D C   1 
ATOM   2321  O  O   . ARG D  2 28  ? 77.968  -24.429  -24.213 1.00 98.68  ? 47  ARG D O   1 
ATOM   2322  C  CB  . ARG D  2 28  ? 77.064  -23.983  -27.299 1.00 84.67  ? 47  ARG D CB  1 
ATOM   2323  N  N   . GLY D  2 29  ? 78.160  -26.374  -25.330 1.00 101.61 ? 48  GLY D N   1 
ATOM   2324  C  CA  . GLY D  2 29  ? 79.181  -26.897  -24.435 1.00 91.72  ? 48  GLY D CA  1 
ATOM   2325  C  C   . GLY D  2 29  ? 79.859  -28.152  -24.954 1.00 90.87  ? 48  GLY D C   1 
ATOM   2326  O  O   . GLY D  2 29  ? 79.696  -28.514  -26.114 1.00 112.38 ? 48  GLY D O   1 
ATOM   2327  N  N   . ALA D  2 30  ? 80.624  -28.821  -24.097 1.00 73.94  ? 49  ALA D N   1 
ATOM   2328  C  CA  . ALA D  2 30  ? 81.377  -30.008  -24.512 1.00 69.27  ? 49  ALA D CA  1 
ATOM   2329  C  C   . ALA D  2 30  ? 80.491  -31.226  -24.589 1.00 79.53  ? 49  ALA D C   1 
ATOM   2330  O  O   . ALA D  2 30  ? 80.658  -32.080  -25.456 1.00 81.52  ? 49  ALA D O   1 
ATOM   2331  C  CB  . ALA D  2 30  ? 82.523  -30.275  -23.555 1.00 66.95  ? 49  ALA D CB  1 
ATOM   2332  N  N   . TRP D  2 31  ? 79.562  -31.310  -23.648 1.00 94.01  ? 50  TRP D N   1 
ATOM   2333  C  CA  . TRP D  2 31  ? 78.615  -32.406  -23.594 1.00 84.60  ? 50  TRP D CA  1 
ATOM   2334  C  C   . TRP D  2 31  ? 77.361  -31.929  -22.881 1.00 90.82  ? 50  TRP D C   1 
ATOM   2335  O  O   . TRP D  2 31  ? 77.361  -30.876  -22.231 1.00 96.59  ? 50  TRP D O   1 
ATOM   2336  C  CB  . TRP D  2 31  ? 79.223  -33.607  -22.873 1.00 72.30  ? 50  TRP D CB  1 
ATOM   2337  C  CG  . TRP D  2 31  ? 79.495  -33.381  -21.406 1.00 82.96  ? 50  TRP D CG  1 
ATOM   2338  C  CD1 . TRP D  2 31  ? 78.580  -33.386  -20.395 1.00 92.08  ? 50  TRP D CD1 1 
ATOM   2339  C  CD2 . TRP D  2 31  ? 80.770  -33.144  -20.786 1.00 85.01  ? 50  TRP D CD2 1 
ATOM   2340  N  NE1 . TRP D  2 31  ? 79.200  -33.156  -19.189 1.00 87.59  ? 50  TRP D NE1 1 
ATOM   2341  C  CE2 . TRP D  2 31  ? 80.544  -33.009  -19.403 1.00 92.56  ? 50  TRP D CE2 1 
ATOM   2342  C  CE3 . TRP D  2 31  ? 82.077  -33.030  -21.267 1.00 72.89  ? 50  TRP D CE3 1 
ATOM   2343  C  CZ2 . TRP D  2 31  ? 81.574  -32.763  -18.500 1.00 105.37 ? 50  TRP D CZ2 1 
ATOM   2344  C  CZ3 . TRP D  2 31  ? 83.092  -32.791  -20.369 1.00 84.00  ? 50  TRP D CZ3 1 
ATOM   2345  C  CH2 . TRP D  2 31  ? 82.838  -32.657  -19.004 1.00 104.36 ? 50  TRP D CH2 1 
ATOM   2346  N  N   . CYS D  2 32  ? 76.290  -32.703  -23.009 1.00 84.58  ? 51  CYS D N   1 
ATOM   2347  C  CA  . CYS D  2 32  ? 75.022  -32.340  -22.399 1.00 86.84  ? 51  CYS D CA  1 
ATOM   2348  C  C   . CYS D  2 32  ? 74.756  -33.136  -21.138 1.00 82.24  ? 51  CYS D C   1 
ATOM   2349  O  O   . CYS D  2 32  ? 75.169  -34.289  -21.019 1.00 83.62  ? 51  CYS D O   1 
ATOM   2350  C  CB  . CYS D  2 32  ? 73.878  -32.526  -23.384 1.00 86.24  ? 51  CYS D CB  1 
ATOM   2351  S  SG  . CYS D  2 32  ? 73.957  -31.373  -24.735 1.00 96.14  ? 51  CYS D SG  1 
ATOM   2352  N  N   . THR D  2 33  ? 74.058  -32.499  -20.201 1.00 74.89  ? 52  THR D N   1 
ATOM   2353  C  CA  . THR D  2 33  ? 73.803  -33.072  -18.890 1.00 70.97  ? 52  THR D CA  1 
ATOM   2354  C  C   . THR D  2 33  ? 72.333  -33.040  -18.529 1.00 79.94  ? 52  THR D C   1 
ATOM   2355  O  O   . THR D  2 33  ? 71.597  -32.113  -18.892 1.00 88.78  ? 52  THR D O   1 
ATOM   2356  C  CB  . THR D  2 33  ? 74.560  -32.317  -17.767 1.00 85.21  ? 52  THR D CB  1 
ATOM   2357  O  OG1 . THR D  2 33  ? 74.058  -30.979  -17.656 1.00 79.55  ? 52  THR D OG1 1 
ATOM   2358  C  CG2 . THR D  2 33  ? 76.066  -32.277  -18.031 1.00 94.53  ? 52  THR D CG2 1 
ATOM   2359  N  N   . VAL D  2 34  ? 71.924  -34.085  -17.820 1.00 81.24  ? 53  VAL D N   1 
ATOM   2360  C  CA  . VAL D  2 34  ? 70.660  -34.137  -17.116 1.00 78.29  ? 53  VAL D CA  1 
ATOM   2361  C  C   . VAL D  2 34  ? 71.002  -34.616  -15.722 1.00 79.43  ? 53  VAL D C   1 
ATOM   2362  O  O   . VAL D  2 34  ? 71.585  -35.691  -15.554 1.00 102.91 ? 53  VAL D O   1 
ATOM   2363  C  CB  . VAL D  2 34  ? 69.697  -35.118  -17.761 1.00 74.96  ? 53  VAL D CB  1 
ATOM   2364  C  CG1 . VAL D  2 34  ? 68.587  -35.449  -16.797 1.00 86.43  ? 53  VAL D CG1 1 
ATOM   2365  C  CG2 . VAL D  2 34  ? 69.140  -34.519  -19.036 1.00 87.81  ? 53  VAL D CG2 1 
ATOM   2366  N  N   . VAL D  2 35  ? 70.676  -33.809  -14.720 1.00 67.99  ? 54  VAL D N   1 
ATOM   2367  C  CA  . VAL D  2 35  ? 71.075  -34.123  -13.351 1.00 70.67  ? 54  VAL D CA  1 
ATOM   2368  C  C   . VAL D  2 35  ? 69.960  -33.944  -12.326 1.00 66.38  ? 54  VAL D C   1 
ATOM   2369  O  O   . VAL D  2 35  ? 69.270  -32.923  -12.292 1.00 62.24  ? 54  VAL D O   1 
ATOM   2370  C  CB  . VAL D  2 35  ? 72.332  -33.335  -12.922 1.00 65.99  ? 54  VAL D CB  1 
ATOM   2371  C  CG1 . VAL D  2 35  ? 72.488  -32.083  -13.762 1.00 74.23  ? 54  VAL D CG1 1 
ATOM   2372  C  CG2 . VAL D  2 35  ? 72.274  -32.991  -11.439 1.00 49.70  ? 54  VAL D CG2 1 
ATOM   2373  N  N   . LEU D  2 36  ? 69.803  -34.965  -11.494 1.00 68.39  ? 55  LEU D N   1 
ATOM   2374  C  CA  . LEU D  2 36  ? 68.726  -35.019  -10.525 1.00 71.83  ? 55  LEU D CA  1 
ATOM   2375  C  C   . LEU D  2 36  ? 69.278  -34.870  -9.107  1.00 72.24  ? 55  LEU D C   1 
ATOM   2376  O  O   . LEU D  2 36  ? 70.173  -35.616  -8.705  1.00 80.59  ? 55  LEU D O   1 
ATOM   2377  C  CB  . LEU D  2 36  ? 67.999  -36.351  -10.661 1.00 78.15  ? 55  LEU D CB  1 
ATOM   2378  C  CG  . LEU D  2 36  ? 66.474  -36.323  -10.579 1.00 79.70  ? 55  LEU D CG  1 
ATOM   2379  C  CD1 . LEU D  2 36  ? 65.967  -37.665  -10.102 1.00 78.23  ? 55  LEU D CD1 1 
ATOM   2380  C  CD2 . LEU D  2 36  ? 65.987  -35.231  -9.667  1.00 92.15  ? 55  LEU D CD2 1 
ATOM   2381  N  N   . VAL D  2 37  ? 68.740  -33.917  -8.347  1.00 56.11  ? 56  VAL D N   1 
ATOM   2382  C  CA  . VAL D  2 37  ? 69.268  -33.648  -7.021  1.00 49.02  ? 56  VAL D CA  1 
ATOM   2383  C  C   . VAL D  2 37  ? 68.263  -33.485  -5.905  1.00 50.71  ? 56  VAL D C   1 
ATOM   2384  O  O   . VAL D  2 37  ? 67.248  -32.839  -6.073  1.00 73.71  ? 56  VAL D O   1 
ATOM   2385  C  CB  . VAL D  2 37  ? 70.065  -32.366  -7.005  1.00 46.91  ? 56  VAL D CB  1 
ATOM   2386  C  CG1 . VAL D  2 37  ? 71.080  -32.417  -5.872  1.00 46.61  ? 56  VAL D CG1 1 
ATOM   2387  C  CG2 . VAL D  2 37  ? 70.762  -32.181  -8.318  1.00 69.77  ? 56  VAL D CG2 1 
ATOM   2388  N  N   . ARG D  2 38  ? 68.608  -34.030  -4.744  1.00 23.32  ? 57  ARG D N   1 
ATOM   2389  C  CA  . ARG D  2 38  ? 67.952  -33.730  -3.481  1.00 47.90  ? 57  ARG D CA  1 
ATOM   2390  C  C   . ARG D  2 38  ? 68.882  -32.855  -2.650  1.00 62.00  ? 57  ARG D C   1 
ATOM   2391  O  O   . ARG D  2 38  ? 69.915  -33.325  -2.145  1.00 36.16  ? 57  ARG D O   1 
ATOM   2392  C  CB  . ARG D  2 38  ? 67.664  -35.010  -2.675  1.00 31.65  ? 57  ARG D CB  1 
ATOM   2393  C  CG  . ARG D  2 38  ? 66.341  -35.732  -2.939  1.00 51.40  ? 57  ARG D CG  1 
ATOM   2394  C  CD  . ARG D  2 38  ? 65.129  -34.964  -2.395  1.00 90.41  ? 57  ARG D CD  1 
ATOM   2395  N  NE  . ARG D  2 38  ? 64.588  -35.430  -1.112  1.00 83.55  ? 57  ARG D NE  1 
ATOM   2396  C  CZ  . ARG D  2 38  ? 64.544  -36.696  -0.698  1.00 83.31  ? 57  ARG D CZ  1 
ATOM   2397  N  NH1 . ARG D  2 38  ? 65.026  -37.695  -1.449  1.00 66.28  ? 57  ARG D NH1 1 
ATOM   2398  N  NH2 . ARG D  2 38  ? 64.012  -36.957  0.493   1.00 69.23  ? 57  ARG D NH2 1 
ATOM   2399  N  N   . GLU D  2 39  ? 68.519  -31.587  -2.500  1.00 71.73  ? 58  GLU D N   1 
ATOM   2400  C  CA  . GLU D  2 39  ? 69.176  -30.738  -1.510  1.00 65.06  ? 58  GLU D CA  1 
ATOM   2401  C  C   . GLU D  2 39  ? 68.189  -30.435  -0.391  1.00 61.07  ? 58  GLU D C   1 
ATOM   2402  O  O   . GLU D  2 39  ? 67.002  -30.747  -0.500  1.00 39.83  ? 58  GLU D O   1 
ATOM   2403  C  CB  . GLU D  2 39  ? 69.721  -29.435  -2.137  1.00 52.00  ? 58  GLU D CB  1 
ATOM   2404  C  CG  . GLU D  2 39  ? 71.158  -29.580  -2.674  1.00 97.32  ? 58  GLU D CG  1 
ATOM   2405  C  CD  . GLU D  2 39  ? 71.678  -28.385  -3.485  1.00 101.39 ? 58  GLU D CD  1 
ATOM   2406  O  OE1 . GLU D  2 39  ? 72.815  -27.917  -3.185  1.00 95.33  ? 58  GLU D OE1 1 
ATOM   2407  O  OE2 . GLU D  2 39  ? 70.972  -27.952  -4.436  1.00 63.44  ? 58  GLU D OE2 1 
ATOM   2408  N  N   . GLU D  2 40  ? 68.707  -29.896  0.705   1.00 60.32  ? 59  GLU D N   1 
ATOM   2409  C  CA  . GLU D  2 40  ? 67.921  -29.080  1.634   1.00 60.60  ? 59  GLU D CA  1 
ATOM   2410  C  C   . GLU D  2 40  ? 66.692  -29.736  2.274   1.00 53.57  ? 59  GLU D C   1 
ATOM   2411  O  O   . GLU D  2 40  ? 66.027  -29.129  3.112   1.00 103.52 ? 59  GLU D O   1 
ATOM   2412  C  CB  . GLU D  2 40  ? 67.548  -27.725  0.970   1.00 28.62  ? 59  GLU D CB  1 
ATOM   2413  C  CG  . GLU D  2 40  ? 68.648  -27.136  0.030   1.00 104.15 ? 59  GLU D CG  1 
ATOM   2414  C  CD  . GLU D  2 40  ? 70.002  -26.858  0.724   1.00 102.39 ? 59  GLU D CD  1 
ATOM   2415  O  OE1 . GLU D  2 40  ? 70.118  -25.806  1.392   1.00 42.11  ? 59  GLU D OE1 1 
ATOM   2416  O  OE2 . GLU D  2 40  ? 70.949  -27.680  0.594   1.00 113.37 ? 59  GLU D OE2 1 
ATOM   2417  N  N   . GLY D  2 41  ? 66.383  -30.969  1.902   1.00 40.54  ? 60  GLY D N   1 
ATOM   2418  C  CA  . GLY D  2 41  ? 65.247  -31.662  2.492   1.00 36.30  ? 60  GLY D CA  1 
ATOM   2419  C  C   . GLY D  2 41  ? 64.102  -31.639  1.505   1.00 79.99  ? 60  GLY D C   1 
ATOM   2420  O  O   . GLY D  2 41  ? 63.242  -32.534  1.464   1.00 69.04  ? 60  GLY D O   1 
ATOM   2421  N  N   . ARG D  2 42  ? 64.112  -30.592  0.691   1.00 92.19  ? 61  ARG D N   1 
ATOM   2422  C  CA  . ARG D  2 42  ? 63.166  -30.452  -0.393  1.00 96.79  ? 61  ARG D CA  1 
ATOM   2423  C  C   . ARG D  2 42  ? 63.025  -31.743  -1.192  1.00 91.70  ? 61  ARG D C   1 
ATOM   2424  O  O   . ARG D  2 42  ? 63.728  -32.734  -0.983  1.00 81.95  ? 61  ARG D O   1 
ATOM   2425  C  CB  . ARG D  2 42  ? 63.571  -29.294  -1.322  1.00 103.16 ? 61  ARG D CB  1 
ATOM   2426  C  CG  . ARG D  2 42  ? 63.629  -27.924  -0.636  1.00 100.31 ? 61  ARG D CG  1 
ATOM   2427  C  CD  . ARG D  2 42  ? 63.700  -26.780  -1.645  1.00 106.40 ? 61  ARG D CD  1 
ATOM   2428  N  NE  . ARG D  2 42  ? 65.022  -26.622  -2.250  1.00 130.89 ? 61  ARG D NE  1 
ATOM   2429  C  CZ  . ARG D  2 42  ? 65.341  -25.643  -3.094  1.00 145.84 ? 61  ARG D CZ  1 
ATOM   2430  N  NH1 . ARG D  2 42  ? 64.425  -24.743  -3.430  1.00 159.78 ? 61  ARG D NH1 1 
ATOM   2431  N  NH2 . ARG D  2 42  ? 66.568  -25.557  -3.602  1.00 129.10 ? 61  ARG D NH2 1 
ATOM   2432  N  N   . HIS D  2 43  ? 62.070  -31.716  -2.097  1.00 99.40  ? 62  HIS D N   1 
ATOM   2433  C  CA  . HIS D  2 43  ? 61.872  -32.779  -3.050  1.00 97.47  ? 62  HIS D CA  1 
ATOM   2434  C  C   . HIS D  2 43  ? 62.871  -32.615  -4.163  1.00 107.34 ? 62  HIS D C   1 
ATOM   2435  O  O   . HIS D  2 43  ? 63.367  -31.517  -4.399  1.00 120.70 ? 62  HIS D O   1 
ATOM   2436  C  CB  . HIS D  2 43  ? 60.458  -32.710  -3.596  1.00 106.16 ? 62  HIS D CB  1 
ATOM   2437  C  CG  . HIS D  2 43  ? 59.416  -33.042  -2.577  1.00 129.18 ? 62  HIS D CG  1 
ATOM   2438  N  ND1 . HIS D  2 43  ? 59.010  -32.153  -1.602  1.00 141.07 ? 62  HIS D ND1 1 
ATOM   2439  C  CD2 . HIS D  2 43  ? 58.718  -34.180  -2.362  1.00 120.21 ? 62  HIS D CD2 1 
ATOM   2440  C  CE1 . HIS D  2 43  ? 58.096  -32.726  -0.841  1.00 134.62 ? 62  HIS D CE1 1 
ATOM   2441  N  NE2 . HIS D  2 43  ? 57.902  -33.957  -1.281  1.00 131.58 ? 62  HIS D NE2 1 
ATOM   2442  N  N   . PRO D  2 44  ? 63.188  -33.715  -4.843  1.00 108.26 ? 63  PRO D N   1 
ATOM   2443  C  CA  . PRO D  2 44  ? 64.191  -33.731  -5.909  1.00 101.85 ? 63  PRO D CA  1 
ATOM   2444  C  C   . PRO D  2 44  ? 63.833  -32.807  -7.058  1.00 89.81  ? 63  PRO D C   1 
ATOM   2445  O  O   . PRO D  2 44  ? 62.670  -32.716  -7.404  1.00 96.22  ? 63  PRO D O   1 
ATOM   2446  C  CB  . PRO D  2 44  ? 64.200  -35.195  -6.362  1.00 83.11  ? 63  PRO D CB  1 
ATOM   2447  C  CG  . PRO D  2 44  ? 62.972  -35.785  -5.797  1.00 95.74  ? 63  PRO D CG  1 
ATOM   2448  C  CD  . PRO D  2 44  ? 62.697  -35.061  -4.539  1.00 109.58 ? 63  PRO D CD  1 
ATOM   2449  N  N   . GLN D  2 45  ? 64.830  -32.122  -7.612  1.00 75.22  ? 64  GLN D N   1 
ATOM   2450  C  CA  . GLN D  2 45  ? 64.668  -31.273  -8.785  1.00 77.93  ? 64  GLN D CA  1 
ATOM   2451  C  C   . GLN D  2 45  ? 65.635  -31.725  -9.870  1.00 79.10  ? 64  GLN D C   1 
ATOM   2452  O  O   . GLN D  2 45  ? 66.692  -32.273  -9.579  1.00 90.80  ? 64  GLN D O   1 
ATOM   2453  C  CB  . GLN D  2 45  ? 64.949  -29.811  -8.450  1.00 100.34 ? 64  GLN D CB  1 
ATOM   2454  C  CG  . GLN D  2 45  ? 63.869  -29.115  -7.652  1.00 124.85 ? 64  GLN D CG  1 
ATOM   2455  C  CD  . GLN D  2 45  ? 64.294  -27.719  -7.221  1.00 144.14 ? 64  GLN D CD  1 
ATOM   2456  O  OE1 . GLN D  2 45  ? 65.483  -27.361  -7.291  1.00 132.09 ? 64  GLN D OE1 1 
ATOM   2457  N  NE2 . GLN D  2 45  ? 63.325  -26.918  -6.774  1.00 155.45 ? 64  GLN D NE2 1 
ATOM   2458  N  N   . GLU D  2 46  ? 65.284  -31.458  -11.120 1.00 78.11  ? 65  GLU D N   1 
ATOM   2459  C  CA  . GLU D  2 46  ? 65.987  -32.023  -12.266 1.00 75.06  ? 65  GLU D CA  1 
ATOM   2460  C  C   . GLU D  2 46  ? 66.416  -30.938  -13.240 1.00 87.31  ? 65  GLU D C   1 
ATOM   2461  O  O   . GLU D  2 46  ? 65.587  -30.353  -13.927 1.00 84.96  ? 65  GLU D O   1 
ATOM   2462  C  CB  . GLU D  2 46  ? 65.050  -33.000  -12.962 1.00 76.14  ? 65  GLU D CB  1 
ATOM   2463  C  CG  . GLU D  2 46  ? 65.600  -33.749  -14.159 1.00 89.64  ? 65  GLU D CG  1 
ATOM   2464  C  CD  . GLU D  2 46  ? 64.560  -34.714  -14.769 1.00 107.24 ? 65  GLU D CD  1 
ATOM   2465  O  OE1 . GLU D  2 46  ? 63.421  -34.276  -15.069 1.00 103.16 ? 65  GLU D OE1 1 
ATOM   2466  O  OE2 . GLU D  2 46  ? 64.877  -35.914  -14.942 1.00 102.17 ? 65  GLU D OE2 1 
ATOM   2467  N  N   . HIS D  2 47  ? 67.716  -30.670  -13.299 1.00 102.32 ? 66  HIS D N   1 
ATOM   2468  C  CA  . HIS D  2 47  ? 68.246  -29.652  -14.207 1.00 93.60  ? 66  HIS D CA  1 
ATOM   2469  C  C   . HIS D  2 47  ? 68.763  -30.290  -15.495 1.00 86.43  ? 66  HIS D C   1 
ATOM   2470  O  O   . HIS D  2 47  ? 69.163  -31.451  -15.506 1.00 91.34  ? 66  HIS D O   1 
ATOM   2471  C  CB  . HIS D  2 47  ? 69.388  -28.876  -13.554 1.00 101.23 ? 66  HIS D CB  1 
ATOM   2472  C  CG  . HIS D  2 47  ? 69.118  -28.449  -12.145 1.00 105.25 ? 66  HIS D CG  1 
ATOM   2473  N  ND1 . HIS D  2 47  ? 70.027  -27.730  -11.404 1.00 102.21 ? 66  HIS D ND1 1 
ATOM   2474  C  CD2 . HIS D  2 47  ? 68.050  -28.645  -11.339 1.00 112.33 ? 66  HIS D CD2 1 
ATOM   2475  C  CE1 . HIS D  2 47  ? 69.531  -27.496  -10.204 1.00 103.26 ? 66  HIS D CE1 1 
ATOM   2476  N  NE2 . HIS D  2 47  ? 68.333  -28.042  -10.138 1.00 109.87 ? 66  HIS D NE2 1 
ATOM   2477  N  N   . ARG D  2 48  ? 68.751  -29.523  -16.579 1.00 78.18  ? 67  ARG D N   1 
ATOM   2478  C  CA  . ARG D  2 48  ? 69.302  -29.972  -17.857 1.00 83.74  ? 67  ARG D CA  1 
ATOM   2479  C  C   . ARG D  2 48  ? 70.190  -28.863  -18.400 1.00 82.83  ? 67  ARG D C   1 
ATOM   2480  O  O   . ARG D  2 48  ? 69.811  -27.691  -18.356 1.00 88.45  ? 67  ARG D O   1 
ATOM   2481  C  CB  . ARG D  2 48  ? 68.185  -30.262  -18.867 1.00 80.99  ? 67  ARG D CB  1 
ATOM   2482  C  CG  . ARG D  2 48  ? 67.153  -31.240  -18.379 1.00 95.12  ? 67  ARG D CG  1 
ATOM   2483  C  CD  . ARG D  2 48  ? 65.830  -31.086  -19.105 1.00 103.97 ? 67  ARG D CD  1 
ATOM   2484  N  NE  . ARG D  2 48  ? 64.778  -31.834  -18.425 1.00 105.97 ? 67  ARG D NE  1 
ATOM   2485  C  CZ  . ARG D  2 48  ? 64.513  -33.109  -18.655 1.00 108.26 ? 67  ARG D CZ  1 
ATOM   2486  N  NH1 . ARG D  2 48  ? 65.216  -33.766  -19.561 1.00 103.26 ? 67  ARG D NH1 1 
ATOM   2487  N  NH2 . ARG D  2 48  ? 63.548  -33.717  -17.984 1.00 116.90 ? 67  ARG D NH2 1 
ATOM   2488  N  N   . GLY D  2 49  ? 71.363  -29.211  -18.919 1.00 68.20  ? 68  GLY D N   1 
ATOM   2489  C  CA  . GLY D  2 49  ? 72.250  -28.183  -19.424 1.00 84.23  ? 68  GLY D CA  1 
ATOM   2490  C  C   . GLY D  2 49  ? 73.525  -28.637  -20.090 1.00 96.59  ? 68  GLY D C   1 
ATOM   2491  O  O   . GLY D  2 49  ? 73.580  -29.696  -20.702 1.00 98.17  ? 68  GLY D O   1 
ATOM   2492  N  N   . CYS D  2 50  ? 74.553  -27.804  -19.978 1.00 96.85  ? 69  CYS D N   1 
ATOM   2493  C  CA  . CYS D  2 50  ? 75.845  -28.073  -20.602 1.00 83.89  ? 69  CYS D CA  1 
ATOM   2494  C  C   . CYS D  2 50  ? 76.797  -28.690  -19.599 1.00 87.75  ? 69  CYS D C   1 
ATOM   2495  O  O   . CYS D  2 50  ? 76.388  -29.114  -18.517 1.00 101.06 ? 69  CYS D O   1 
ATOM   2496  C  CB  . CYS D  2 50  ? 76.446  -26.776  -21.148 1.00 48.65  ? 69  CYS D CB  1 
ATOM   2497  S  SG  . CYS D  2 50  ? 75.253  -25.853  -22.134 1.00 160.07 ? 69  CYS D SG  1 
ATOM   2498  N  N   . GLY D  2 51  ? 78.071  -28.735  -19.958 1.00 76.43  ? 70  GLY D N   1 
ATOM   2499  C  CA  . GLY D  2 51  ? 79.088  -29.212  -19.043 1.00 90.20  ? 70  GLY D CA  1 
ATOM   2500  C  C   . GLY D  2 51  ? 80.381  -29.412  -19.791 1.00 88.40  ? 70  GLY D C   1 
ATOM   2501  O  O   . GLY D  2 51  ? 80.384  -30.035  -20.852 1.00 78.49  ? 70  GLY D O   1 
ATOM   2502  N  N   . ASN D  2 52  ? 81.476  -28.874  -19.262 1.00 86.05  ? 71  ASN D N   1 
ATOM   2503  C  CA  . ASN D  2 52  ? 82.760  -29.013  -19.932 1.00 79.87  ? 71  ASN D CA  1 
ATOM   2504  C  C   . ASN D  2 52  ? 83.885  -29.229  -18.955 1.00 77.80  ? 71  ASN D C   1 
ATOM   2505  O  O   . ASN D  2 52  ? 85.049  -29.240  -19.345 1.00 75.64  ? 71  ASN D O   1 
ATOM   2506  C  CB  . ASN D  2 52  ? 83.080  -27.782  -20.782 1.00 72.91  ? 71  ASN D CB  1 
ATOM   2507  C  CG  . ASN D  2 52  ? 81.903  -26.858  -20.932 1.00 81.28  ? 71  ASN D CG  1 
ATOM   2508  O  OD1 . ASN D  2 52  ? 81.261  -26.822  -21.982 1.00 83.73  ? 71  ASN D OD1 1 
ATOM   2509  N  ND2 . ASN D  2 52  ? 81.608  -26.096  -19.879 1.00 84.94  ? 71  ASN D ND2 1 
ATOM   2510  N  N   . LEU D  2 53  ? 83.551  -29.403  -17.685 1.00 84.49  ? 72  LEU D N   1 
ATOM   2511  C  CA  . LEU D  2 53  ? 84.596  -29.353  -16.676 1.00 100.36 ? 72  LEU D CA  1 
ATOM   2512  C  C   . LEU D  2 53  ? 85.037  -30.692  -16.125 1.00 83.99  ? 72  LEU D C   1 
ATOM   2513  O  O   . LEU D  2 53  ? 86.227  -30.993  -16.108 1.00 104.68 ? 72  LEU D O   1 
ATOM   2514  C  CB  . LEU D  2 53  ? 84.232  -28.384  -15.544 1.00 126.12 ? 72  LEU D CB  1 
ATOM   2515  C  CG  . LEU D  2 53  ? 84.811  -26.993  -15.807 1.00 112.26 ? 72  LEU D CG  1 
ATOM   2516  C  CD1 . LEU D  2 53  ? 84.980  -26.198  -14.509 1.00 117.54 ? 72  LEU D CD1 1 
ATOM   2517  C  CD2 . LEU D  2 53  ? 86.141  -27.137  -16.556 1.00 38.13  ? 72  LEU D CD2 1 
ATOM   2518  N  N   . HIS D  2 54  ? 84.092  -31.498  -15.670 1.00 54.72  ? 73  HIS D N   1 
ATOM   2519  C  CA  . HIS D  2 54  ? 84.485  -32.674  -14.907 1.00 71.84  ? 73  HIS D CA  1 
ATOM   2520  C  C   . HIS D  2 54  ? 83.832  -33.952  -15.411 1.00 81.85  ? 73  HIS D C   1 
ATOM   2521  O  O   . HIS D  2 54  ? 82.956  -34.524  -14.754 1.00 77.74  ? 73  HIS D O   1 
ATOM   2522  C  CB  . HIS D  2 54  ? 84.197  -32.462  -13.419 1.00 77.44  ? 73  HIS D CB  1 
ATOM   2523  C  CG  . HIS D  2 54  ? 84.775  -31.192  -12.867 1.00 83.01  ? 73  HIS D CG  1 
ATOM   2524  N  ND1 . HIS D  2 54  ? 86.105  -31.064  -12.527 1.00 69.86  ? 73  HIS D ND1 1 
ATOM   2525  C  CD2 . HIS D  2 54  ? 84.202  -29.993  -12.599 1.00 82.67  ? 73  HIS D CD2 1 
ATOM   2526  C  CE1 . HIS D  2 54  ? 86.327  -29.839  -12.082 1.00 72.96  ? 73  HIS D CE1 1 
ATOM   2527  N  NE2 . HIS D  2 54  ? 85.190  -29.168  -12.118 1.00 73.34  ? 73  HIS D NE2 1 
ATOM   2528  N  N   . ARG D  2 55  ? 84.283  -34.403  -16.579 1.00 85.49  ? 74  ARG D N   1 
ATOM   2529  C  CA  . ARG D  2 55  ? 83.703  -35.572  -17.238 1.00 77.15  ? 74  ARG D CA  1 
ATOM   2530  C  C   . ARG D  2 55  ? 83.425  -36.694  -16.237 1.00 65.48  ? 74  ARG D C   1 
ATOM   2531  O  O   . ARG D  2 55  ? 82.350  -37.269  -16.244 1.00 62.46  ? 74  ARG D O   1 
ATOM   2532  C  CB  . ARG D  2 55  ? 84.617  -36.060  -18.372 1.00 82.83  ? 74  ARG D CB  1 
ATOM   2533  C  CG  . ARG D  2 55  ? 83.981  -37.066  -19.341 1.00 93.19  ? 74  ARG D CG  1 
ATOM   2534  C  CD  . ARG D  2 55  ? 82.735  -36.497  -20.013 1.00 117.83 ? 74  ARG D CD  1 
ATOM   2535  N  NE  . ARG D  2 55  ? 82.547  -36.978  -21.385 1.00 122.92 ? 74  ARG D NE  1 
ATOM   2536  C  CZ  . ARG D  2 55  ? 81.381  -37.376  -21.892 1.00 106.79 ? 74  ARG D CZ  1 
ATOM   2537  N  NH1 . ARG D  2 55  ? 80.290  -37.374  -21.148 1.00 109.17 ? 74  ARG D NH1 1 
ATOM   2538  N  NH2 . ARG D  2 55  ? 81.301  -37.782  -23.146 1.00 90.77  ? 74  ARG D NH2 1 
ATOM   2539  N  N   . GLU D  2 56  ? 84.393  -36.981  -15.370 1.00 57.34  ? 75  GLU D N   1 
ATOM   2540  C  CA  . GLU D  2 56  ? 84.272  -38.035  -14.365 1.00 60.96  ? 75  GLU D CA  1 
ATOM   2541  C  C   . GLU D  2 56  ? 82.895  -38.099  -13.695 1.00 67.18  ? 75  GLU D C   1 
ATOM   2542  O  O   . GLU D  2 56  ? 82.350  -39.171  -13.490 1.00 82.29  ? 75  GLU D O   1 
ATOM   2543  C  CB  . GLU D  2 56  ? 85.374  -37.907  -13.303 1.00 74.83  ? 75  GLU D CB  1 
ATOM   2544  C  CG  . GLU D  2 56  ? 85.476  -36.540  -12.654 1.00 88.91  ? 75  GLU D CG  1 
ATOM   2545  C  CD  . GLU D  2 56  ? 86.694  -35.763  -13.114 1.00 100.86 ? 75  GLU D CD  1 
ATOM   2546  O  OE1 . GLU D  2 56  ? 86.746  -35.341  -14.289 1.00 113.64 ? 75  GLU D OE1 1 
ATOM   2547  O  OE2 . GLU D  2 56  ? 87.609  -35.574  -12.294 1.00 91.48  ? 75  GLU D OE2 1 
ATOM   2548  N  N   . LEU D  2 57  ? 82.336  -36.953  -13.349 1.00 60.10  ? 76  LEU D N   1 
ATOM   2549  C  CA  . LEU D  2 57  ? 81.051  -36.931  -12.682 1.00 76.26  ? 76  LEU D CA  1 
ATOM   2550  C  C   . LEU D  2 57  ? 80.005  -37.842  -13.339 1.00 75.70  ? 76  LEU D C   1 
ATOM   2551  O  O   . LEU D  2 57  ? 79.190  -38.451  -12.644 1.00 80.91  ? 76  LEU D O   1 
ATOM   2552  C  CB  . LEU D  2 57  ? 80.534  -35.493  -12.600 1.00 86.42  ? 76  LEU D CB  1 
ATOM   2553  C  CG  . LEU D  2 57  ? 80.975  -34.737  -11.344 1.00 74.51  ? 76  LEU D CG  1 
ATOM   2554  C  CD1 . LEU D  2 57  ? 80.453  -33.324  -11.360 1.00 65.45  ? 76  LEU D CD1 1 
ATOM   2555  C  CD2 . LEU D  2 57  ? 80.494  -35.461  -10.098 1.00 84.22  ? 76  LEU D CD2 1 
ATOM   2556  N  N   . CYS D  2 58  ? 80.029  -37.922  -14.670 1.00 64.64  ? 77  CYS D N   1 
ATOM   2557  C  CA  . CYS D  2 58  ? 79.091  -38.740  -15.452 1.00 64.09  ? 77  CYS D CA  1 
ATOM   2558  C  C   . CYS D  2 58  ? 79.131  -40.234  -15.147 1.00 70.05  ? 77  CYS D C   1 
ATOM   2559  O  O   . CYS D  2 58  ? 78.105  -40.897  -15.148 1.00 72.66  ? 77  CYS D O   1 
ATOM   2560  C  CB  . CYS D  2 58  ? 79.375  -38.569  -16.929 1.00 65.27  ? 77  CYS D CB  1 
ATOM   2561  S  SG  . CYS D  2 58  ? 79.189  -36.898  -17.474 1.00 90.22  ? 77  CYS D SG  1 
ATOM   2562  N  N   . ARG D  2 59  ? 80.332  -40.760  -14.928 1.00 68.28  ? 78  ARG D N   1 
ATOM   2563  C  CA  . ARG D  2 59  ? 80.522  -42.147  -14.506 1.00 62.68  ? 78  ARG D CA  1 
ATOM   2564  C  C   . ARG D  2 59  ? 79.835  -42.432  -13.166 1.00 61.97  ? 78  ARG D C   1 
ATOM   2565  O  O   . ARG D  2 59  ? 79.621  -43.577  -12.798 1.00 59.33  ? 78  ARG D O   1 
ATOM   2566  C  CB  . ARG D  2 59  ? 82.021  -42.457  -14.360 1.00 74.20  ? 78  ARG D CB  1 
ATOM   2567  C  CG  . ARG D  2 59  ? 82.915  -41.910  -15.455 1.00 82.75  ? 78  ARG D CG  1 
ATOM   2568  C  CD  . ARG D  2 59  ? 83.026  -42.853  -16.638 1.00 102.15 ? 78  ARG D CD  1 
ATOM   2569  N  NE  . ARG D  2 59  ? 84.361  -42.770  -17.206 1.00 117.72 ? 78  ARG D NE  1 
ATOM   2570  C  CZ  . ARG D  2 59  ? 85.347  -43.599  -16.891 1.00 124.84 ? 78  ARG D CZ  1 
ATOM   2571  N  NH1 . ARG D  2 59  ? 85.128  -44.592  -16.034 1.00 94.97  ? 78  ARG D NH1 1 
ATOM   2572  N  NH2 . ARG D  2 59  ? 86.545  -43.443  -17.445 1.00 140.80 ? 78  ARG D NH2 1 
ATOM   2573  N  N   . GLY D  2 60  ? 79.522  -41.385  -12.422 1.00 79.36  ? 79  GLY D N   1 
ATOM   2574  C  CA  . GLY D  2 60  ? 78.859  -41.570  -11.157 1.00 89.57  ? 79  GLY D CA  1 
ATOM   2575  C  C   . GLY D  2 60  ? 77.686  -42.523  -11.293 1.00 83.57  ? 79  GLY D C   1 
ATOM   2576  O  O   . GLY D  2 60  ? 76.765  -42.303  -12.091 1.00 90.25  ? 79  GLY D O   1 
ATOM   2577  N  N   . ARG D  2 61  ? 77.739  -43.602  -10.520 1.00 54.82  ? 80  ARG D N   1 
ATOM   2578  C  CA  . ARG D  2 61  ? 76.579  -44.442  -10.287 1.00 49.06  ? 80  ARG D CA  1 
ATOM   2579  C  C   . ARG D  2 61  ? 75.570  -43.639  -9.483  1.00 67.36  ? 80  ARG D C   1 
ATOM   2580  O  O   . ARG D  2 61  ? 75.946  -42.919  -8.573  1.00 66.50  ? 80  ARG D O   1 
ATOM   2581  C  CB  . ARG D  2 61  ? 77.003  -45.675  -9.496  1.00 53.42  ? 80  ARG D CB  1 
ATOM   2582  C  CG  . ARG D  2 61  ? 75.975  -46.171  -8.497  1.00 57.62  ? 80  ARG D CG  1 
ATOM   2583  C  CD  . ARG D  2 61  ? 76.633  -46.669  -7.213  1.00 64.19  ? 80  ARG D CD  1 
ATOM   2584  N  NE  . ARG D  2 61  ? 75.729  -46.523  -6.072  1.00 99.42  ? 80  ARG D NE  1 
ATOM   2585  C  CZ  . ARG D  2 61  ? 76.102  -46.600  -4.797  1.00 106.77 ? 80  ARG D CZ  1 
ATOM   2586  N  NH1 . ARG D  2 61  ? 77.372  -46.826  -4.498  1.00 111.74 ? 80  ARG D NH1 1 
ATOM   2587  N  NH2 . ARG D  2 61  ? 75.209  -46.448  -3.818  1.00 97.82  ? 80  ARG D NH2 1 
ATOM   2588  N  N   . PRO D  2 62  ? 74.278  -43.754  -9.812  1.00 83.33  ? 81  PRO D N   1 
ATOM   2589  C  CA  . PRO D  2 62  ? 73.251  -42.960  -9.122  1.00 77.93  ? 81  PRO D CA  1 
ATOM   2590  C  C   . PRO D  2 62  ? 73.129  -43.323  -7.650  1.00 69.27  ? 81  PRO D C   1 
ATOM   2591  O  O   . PRO D  2 62  ? 73.048  -44.515  -7.338  1.00 62.21  ? 81  PRO D O   1 
ATOM   2592  C  CB  . PRO D  2 62  ? 71.961  -43.339  -9.856  1.00 56.45  ? 81  PRO D CB  1 
ATOM   2593  C  CG  . PRO D  2 62  ? 72.417  -43.871  -11.182 1.00 62.81  ? 81  PRO D CG  1 
ATOM   2594  C  CD  . PRO D  2 62  ? 73.708  -44.568  -10.898 1.00 71.02  ? 81  PRO D CD  1 
ATOM   2595  N  N   . THR D  2 63  ? 73.119  -42.313  -6.778  1.00 54.41  ? 82  THR D N   1 
ATOM   2596  C  CA  . THR D  2 63  ? 72.943  -42.516  -5.346  1.00 56.38  ? 82  THR D CA  1 
ATOM   2597  C  C   . THR D  2 63  ? 71.538  -42.135  -4.917  1.00 62.72  ? 82  THR D C   1 
ATOM   2598  O  O   . THR D  2 63  ? 70.676  -41.837  -5.748  1.00 57.46  ? 82  THR D O   1 
ATOM   2599  C  CB  . THR D  2 63  ? 73.927  -41.682  -4.515  1.00 74.43  ? 82  THR D CB  1 
ATOM   2600  O  OG1 . THR D  2 63  ? 73.735  -40.288  -4.794  1.00 63.34  ? 82  THR D OG1 1 
ATOM   2601  C  CG2 . THR D  2 63  ? 75.352  -42.063  -4.837  1.00 97.52  ? 82  THR D CG2 1 
ATOM   2602  N  N   . GLU D  2 64  ? 71.320  -42.138  -3.608  1.00 65.75  ? 83  GLU D N   1 
ATOM   2603  C  CA  . GLU D  2 64  ? 70.004  -41.863  -3.048  1.00 62.91  ? 83  GLU D CA  1 
ATOM   2604  C  C   . GLU D  2 64  ? 69.660  -40.377  -3.096  1.00 70.17  ? 83  GLU D C   1 
ATOM   2605  O  O   . GLU D  2 64  ? 68.584  -39.963  -2.660  1.00 86.01  ? 83  GLU D O   1 
ATOM   2606  C  CB  . GLU D  2 64  ? 69.902  -42.409  -1.611  1.00 58.80  ? 83  GLU D CB  1 
ATOM   2607  C  CG  . GLU D  2 64  ? 71.045  -41.998  -0.689  1.00 107.55 ? 83  GLU D CG  1 
ATOM   2608  C  CD  . GLU D  2 64  ? 72.063  -43.106  -0.450  1.00 127.59 ? 83  GLU D CD  1 
ATOM   2609  O  OE1 . GLU D  2 64  ? 73.000  -43.262  -1.275  1.00 124.45 ? 83  GLU D OE1 1 
ATOM   2610  O  OE2 . GLU D  2 64  ? 71.925  -43.808  0.579   1.00 125.72 ? 83  GLU D OE2 1 
ATOM   2611  N  N   . PHE D  2 65  ? 70.569  -39.577  -3.639  1.00 75.70  ? 84  PHE D N   1 
ATOM   2612  C  CA  . PHE D  2 65  ? 70.414  -38.127  -3.595  1.00 85.71  ? 84  PHE D CA  1 
ATOM   2613  C  C   . PHE D  2 65  ? 70.923  -37.405  -4.829  1.00 70.74  ? 84  PHE D C   1 
ATOM   2614  O  O   . PHE D  2 65  ? 70.836  -36.183  -4.913  1.00 62.65  ? 84  PHE D O   1 
ATOM   2615  C  CB  . PHE D  2 65  ? 71.091  -37.542  -2.351  1.00 96.08  ? 84  PHE D CB  1 
ATOM   2616  C  CG  . PHE D  2 65  ? 72.509  -37.960  -2.188  1.00 100.88 ? 84  PHE D CG  1 
ATOM   2617  C  CD1 . PHE D  2 65  ? 72.870  -38.839  -1.193  1.00 119.85 ? 84  PHE D CD1 1 
ATOM   2618  C  CD2 . PHE D  2 65  ? 73.475  -37.487  -3.038  1.00 88.91  ? 84  PHE D CD2 1 
ATOM   2619  C  CE1 . PHE D  2 65  ? 74.168  -39.231  -1.051  1.00 127.39 ? 84  PHE D CE1 1 
ATOM   2620  C  CE2 . PHE D  2 65  ? 74.772  -37.873  -2.898  1.00 86.83  ? 84  PHE D CE2 1 
ATOM   2621  C  CZ  . PHE D  2 65  ? 75.123  -38.746  -1.904  1.00 106.67 ? 84  PHE D CZ  1 
ATOM   2622  N  N   . VAL D  2 66  ? 71.465  -38.142  -5.784  1.00 66.17  ? 85  VAL D N   1 
ATOM   2623  C  CA  . VAL D  2 66  ? 71.933  -37.489  -6.993  1.00 67.62  ? 85  VAL D CA  1 
ATOM   2624  C  C   . VAL D  2 66  ? 72.128  -38.441  -8.154  1.00 63.52  ? 85  VAL D C   1 
ATOM   2625  O  O   . VAL D  2 66  ? 72.504  -39.596  -7.966  1.00 67.84  ? 85  VAL D O   1 
ATOM   2626  C  CB  . VAL D  2 66  ? 73.235  -36.726  -6.749  1.00 61.85  ? 85  VAL D CB  1 
ATOM   2627  C  CG1 . VAL D  2 66  ? 74.365  -37.693  -6.502  1.00 48.21  ? 85  VAL D CG1 1 
ATOM   2628  C  CG2 . VAL D  2 66  ? 73.535  -35.817  -7.932  1.00 59.86  ? 85  VAL D CG2 1 
ATOM   2629  N  N   . ASN D  2 67  ? 71.853  -37.941  -9.356  1.00 59.83  ? 86  ASN D N   1 
ATOM   2630  C  CA  . ASN D  2 67  ? 71.998  -38.725  -10.573 1.00 62.91  ? 86  ASN D CA  1 
ATOM   2631  C  C   . ASN D  2 67  ? 72.539  -37.855  -11.684 1.00 72.44  ? 86  ASN D C   1 
ATOM   2632  O  O   . ASN D  2 67  ? 71.853  -36.961  -12.189 1.00 87.38  ? 86  ASN D O   1 
ATOM   2633  C  CB  . ASN D  2 67  ? 70.663  -39.345  -10.997 1.00 75.50  ? 86  ASN D CB  1 
ATOM   2634  C  CG  . ASN D  2 67  ? 70.828  -40.380  -12.076 1.00 79.57  ? 86  ASN D CG  1 
ATOM   2635  O  OD1 . ASN D  2 67  ? 71.743  -40.296  -12.903 1.00 103.12 ? 86  ASN D OD1 1 
ATOM   2636  N  ND2 . ASN D  2 67  ? 69.952  -41.376  -12.073 1.00 69.93  ? 86  ASN D ND2 1 
ATOM   2637  N  N   . HIS D  2 68  ? 73.784  -38.119  -12.050 1.00 85.69  ? 87  HIS D N   1 
ATOM   2638  C  CA  . HIS D  2 68  ? 74.445  -37.382  -13.100 1.00 79.30  ? 87  HIS D CA  1 
ATOM   2639  C  C   . HIS D  2 68  ? 74.362  -38.234  -14.364 1.00 78.18  ? 87  HIS D C   1 
ATOM   2640  O  O   . HIS D  2 68  ? 74.736  -39.409  -14.361 1.00 75.78  ? 87  HIS D O   1 
ATOM   2641  C  CB  . HIS D  2 68  ? 75.889  -37.123  -12.690 1.00 76.54  ? 87  HIS D CB  1 
ATOM   2642  C  CG  . HIS D  2 68  ? 76.336  -35.721  -12.921 1.00 96.61  ? 87  HIS D CG  1 
ATOM   2643  N  ND1 . HIS D  2 68  ? 76.867  -35.302  -14.122 1.00 123.11 ? 87  HIS D ND1 1 
ATOM   2644  C  CD2 . HIS D  2 68  ? 76.348  -34.642  -12.107 1.00 109.11 ? 87  HIS D CD2 1 
ATOM   2645  C  CE1 . HIS D  2 68  ? 77.189  -34.023  -14.039 1.00 123.63 ? 87  HIS D CE1 1 
ATOM   2646  N  NE2 . HIS D  2 68  ? 76.882  -33.598  -12.826 1.00 128.89 ? 87  HIS D NE2 1 
ATOM   2647  N  N   . TYR D  2 69  ? 73.822  -37.653  -15.428 1.00 68.84  ? 88  TYR D N   1 
ATOM   2648  C  CA  . TYR D  2 69  ? 73.744  -38.338  -16.716 1.00 80.95  ? 88  TYR D CA  1 
ATOM   2649  C  C   . TYR D  2 69  ? 74.207  -37.428  -17.857 1.00 84.70  ? 88  TYR D C   1 
ATOM   2650  O  O   . TYR D  2 69  ? 73.772  -36.285  -17.958 1.00 85.54  ? 88  TYR D O   1 
ATOM   2651  C  CB  . TYR D  2 69  ? 72.318  -38.831  -16.993 1.00 88.21  ? 88  TYR D CB  1 
ATOM   2652  C  CG  . TYR D  2 69  ? 72.104  -39.212  -18.436 1.00 88.36  ? 88  TYR D CG  1 
ATOM   2653  C  CD1 . TYR D  2 69  ? 71.438  -38.369  -19.305 1.00 89.67  ? 88  TYR D CD1 1 
ATOM   2654  C  CD2 . TYR D  2 69  ? 72.598  -40.400  -18.935 1.00 89.14  ? 88  TYR D CD2 1 
ATOM   2655  C  CE1 . TYR D  2 69  ? 71.254  -38.712  -20.630 1.00 93.51  ? 88  TYR D CE1 1 
ATOM   2656  C  CE2 . TYR D  2 69  ? 72.422  -40.749  -20.255 1.00 85.10  ? 88  TYR D CE2 1 
ATOM   2657  C  CZ  . TYR D  2 69  ? 71.750  -39.900  -21.102 1.00 84.69  ? 88  TYR D CZ  1 
ATOM   2658  O  OH  . TYR D  2 69  ? 71.568  -40.233  -22.428 1.00 76.31  ? 88  TYR D OH  1 
ATOM   2659  N  N   . CYS D  2 70  ? 75.076  -37.933  -18.729 1.00 81.78  ? 89  CYS D N   1 
ATOM   2660  C  CA  . CYS D  2 70  ? 75.617  -37.103  -19.803 1.00 69.76  ? 89  CYS D CA  1 
ATOM   2661  C  C   . CYS D  2 70  ? 75.593  -37.798  -21.146 1.00 69.25  ? 89  CYS D C   1 
ATOM   2662  O  O   . CYS D  2 70  ? 75.569  -39.013  -21.214 1.00 85.42  ? 89  CYS D O   1 
ATOM   2663  C  CB  . CYS D  2 70  ? 77.050  -36.691  -19.483 1.00 76.28  ? 89  CYS D CB  1 
ATOM   2664  S  SG  . CYS D  2 70  ? 77.315  -36.157  -17.765 1.00 118.89 ? 89  CYS D SG  1 
ATOM   2665  N  N   . CYS D  2 71  ? 75.605  -37.014  -22.217 1.00 84.84  ? 90  CYS D N   1 
ATOM   2666  C  CA  . CYS D  2 71  ? 75.644  -37.547  -23.581 1.00 102.30 ? 90  CYS D CA  1 
ATOM   2667  C  C   . CYS D  2 71  ? 76.146  -36.463  -24.521 1.00 102.62 ? 90  CYS D C   1 
ATOM   2668  O  O   . CYS D  2 71  ? 76.131  -35.289  -24.163 1.00 100.92 ? 90  CYS D O   1 
ATOM   2669  C  CB  . CYS D  2 71  ? 74.261  -37.996  -24.026 1.00 112.25 ? 90  CYS D CB  1 
ATOM   2670  S  SG  . CYS D  2 71  ? 73.075  -36.647  -24.103 1.00 134.48 ? 90  CYS D SG  1 
ATOM   2671  N  N   . ASP D  2 72  ? 76.577  -36.843  -25.721 1.00 106.03 ? 91  ASP D N   1 
ATOM   2672  C  CA  . ASP D  2 72  ? 77.228  -35.883  -26.617 1.00 104.68 ? 91  ASP D CA  1 
ATOM   2673  C  C   . ASP D  2 72  ? 76.740  -35.869  -28.058 1.00 100.21 ? 91  ASP D C   1 
ATOM   2674  O  O   . ASP D  2 72  ? 77.528  -35.678  -28.976 1.00 104.48 ? 91  ASP D O   1 
ATOM   2675  C  CB  . ASP D  2 72  ? 78.750  -36.043  -26.582 1.00 105.73 ? 91  ASP D CB  1 
ATOM   2676  C  CG  . ASP D  2 72  ? 79.181  -37.430  -26.169 1.00 116.55 ? 91  ASP D CG  1 
ATOM   2677  O  OD1 . ASP D  2 72  ? 79.312  -37.675  -24.950 1.00 117.95 ? 91  ASP D OD1 1 
ATOM   2678  O  OD2 . ASP D  2 72  ? 79.394  -38.272  -27.063 1.00 120.61 ? 91  ASP D OD2 1 
ATOM   2679  N  N   . SER D  2 73  ? 75.441  -36.059  -28.251 1.00 96.66  ? 92  SER D N   1 
ATOM   2680  C  CA  . SER D  2 73  ? 74.823  -35.815  -29.547 1.00 92.07  ? 92  SER D CA  1 
ATOM   2681  C  C   . SER D  2 73  ? 73.980  -34.553  -29.454 1.00 103.64 ? 92  SER D C   1 
ATOM   2682  O  O   . SER D  2 73  ? 73.506  -34.198  -28.384 1.00 111.41 ? 92  SER D O   1 
ATOM   2683  C  CB  . SER D  2 73  ? 73.960  -37.003  -29.982 1.00 89.73  ? 92  SER D CB  1 
ATOM   2684  O  OG  . SER D  2 73  ? 72.910  -37.264  -29.064 1.00 94.57  ? 92  SER D OG  1 
ATOM   2685  N  N   . HIS D  2 74  ? 73.792  -33.871  -30.573 1.00 112.28 ? 93  HIS D N   1 
ATOM   2686  C  CA  . HIS D  2 74  ? 73.014  -32.636  -30.593 1.00 115.72 ? 93  HIS D CA  1 
ATOM   2687  C  C   . HIS D  2 74  ? 71.687  -32.745  -29.826 1.00 102.03 ? 93  HIS D C   1 
ATOM   2688  O  O   . HIS D  2 74  ? 71.012  -33.765  -29.876 1.00 96.65  ? 93  HIS D O   1 
ATOM   2689  C  CB  . HIS D  2 74  ? 72.766  -32.215  -32.040 1.00 122.56 ? 93  HIS D CB  1 
ATOM   2690  C  CG  . HIS D  2 74  ? 72.173  -30.854  -32.181 1.00 124.22 ? 93  HIS D CG  1 
ATOM   2691  N  ND1 . HIS D  2 74  ? 70.814  -30.630  -32.160 1.00 113.08 ? 93  HIS D ND1 1 
ATOM   2692  C  CD2 . HIS D  2 74  ? 72.752  -29.643  -32.352 1.00 132.30 ? 93  HIS D CD2 1 
ATOM   2693  C  CE1 . HIS D  2 74  ? 70.581  -29.340  -32.314 1.00 121.25 ? 93  HIS D CE1 1 
ATOM   2694  N  NE2 . HIS D  2 74  ? 71.740  -28.718  -32.431 1.00 135.14 ? 93  HIS D NE2 1 
ATOM   2695  N  N   . LEU D  2 75  ? 71.342  -31.690  -29.100 1.00 105.14 ? 94  LEU D N   1 
ATOM   2696  C  CA  . LEU D  2 75  ? 70.083  -31.587  -28.351 1.00 104.64 ? 94  LEU D CA  1 
ATOM   2697  C  C   . LEU D  2 75  ? 69.620  -32.836  -27.607 1.00 101.02 ? 94  LEU D C   1 
ATOM   2698  O  O   . LEU D  2 75  ? 68.435  -32.966  -27.313 1.00 92.60  ? 94  LEU D O   1 
ATOM   2699  C  CB  . LEU D  2 75  ? 68.956  -31.099  -29.262 1.00 93.13  ? 94  LEU D CB  1 
ATOM   2700  C  CG  . LEU D  2 75  ? 68.768  -29.594  -29.475 1.00 94.98  ? 94  LEU D CG  1 
ATOM   2701  C  CD1 . LEU D  2 75  ? 67.643  -29.331  -30.471 1.00 67.14  ? 94  LEU D CD1 1 
ATOM   2702  C  CD2 . LEU D  2 75  ? 68.499  -28.867  -28.159 1.00 87.03  ? 94  LEU D CD2 1 
ATOM   2703  N  N   . CYS D  2 76  ? 70.554  -33.721  -27.272 1.00 102.65 ? 95  CYS D N   1 
ATOM   2704  C  CA  . CYS D  2 76  ? 70.231  -35.051  -26.752 1.00 97.66  ? 95  CYS D CA  1 
ATOM   2705  C  C   . CYS D  2 76  ? 69.643  -35.106  -25.331 1.00 97.81  ? 95  CYS D C   1 
ATOM   2706  O  O   . CYS D  2 76  ? 69.442  -36.188  -24.789 1.00 89.93  ? 95  CYS D O   1 
ATOM   2707  C  CB  . CYS D  2 76  ? 71.464  -35.946  -26.815 1.00 87.89  ? 95  CYS D CB  1 
ATOM   2708  S  SG  . CYS D  2 76  ? 72.765  -35.423  -25.686 1.00 150.18 ? 95  CYS D SG  1 
ATOM   2709  N  N   . ASN D  2 77  ? 69.359  -33.966  -24.717 1.00 95.36  ? 96  ASN D N   1 
ATOM   2710  C  CA  . ASN D  2 77  ? 68.836  -34.015  -23.358 1.00 91.93  ? 96  ASN D CA  1 
ATOM   2711  C  C   . ASN D  2 77  ? 67.440  -33.427  -23.169 1.00 108.71 ? 96  ASN D C   1 
ATOM   2712  O  O   . ASN D  2 77  ? 67.140  -32.853  -22.126 1.00 125.58 ? 96  ASN D O   1 
ATOM   2713  C  CB  . ASN D  2 77  ? 69.837  -33.419  -22.358 1.00 103.90 ? 96  ASN D CB  1 
ATOM   2714  C  CG  . ASN D  2 77  ? 70.193  -31.977  -22.662 1.00 118.39 ? 96  ASN D CG  1 
ATOM   2715  O  OD1 . ASN D  2 77  ? 69.967  -31.486  -23.767 1.00 135.09 ? 96  ASN D OD1 1 
ATOM   2716  N  ND2 . ASN D  2 77  ? 70.764  -31.292  -21.675 1.00 107.38 ? 96  ASN D ND2 1 
ATOM   2717  N  N   . HIS D  2 78  ? 66.581  -33.586  -24.168 1.00 107.72 ? 97  HIS D N   1 
ATOM   2718  C  CA  . HIS D  2 78  ? 65.195  -33.159  -24.028 1.00 117.07 ? 97  HIS D CA  1 
ATOM   2719  C  C   . HIS D  2 78  ? 64.301  -34.310  -23.547 1.00 126.39 ? 97  HIS D C   1 
ATOM   2720  O  O   . HIS D  2 78  ? 63.977  -34.386  -22.365 1.00 101.22 ? 97  HIS D O   1 
ATOM   2721  C  CB  . HIS D  2 78  ? 64.667  -32.557  -25.331 1.00 118.48 ? 97  HIS D CB  1 
ATOM   2722  C  CG  . HIS D  2 78  ? 63.449  -31.703  -25.144 1.00 143.44 ? 97  HIS D CG  1 
ATOM   2723  N  ND1 . HIS D  2 78  ? 63.443  -30.583  -24.341 1.00 148.50 ? 97  HIS D ND1 1 
ATOM   2724  C  CD2 . HIS D  2 78  ? 62.196  -31.809  -25.648 1.00 151.40 ? 97  HIS D CD2 1 
ATOM   2725  C  CE1 . HIS D  2 78  ? 62.241  -30.033  -24.362 1.00 147.50 ? 97  HIS D CE1 1 
ATOM   2726  N  NE2 . HIS D  2 78  ? 61.466  -30.756  -25.148 1.00 150.93 ? 97  HIS D NE2 1 
ATOM   2727  N  N   . ASN D  2 79  ? 63.911  -35.198  -24.460 1.00 152.36 ? 98  ASN D N   1 
ATOM   2728  C  CA  . ASN D  2 79  ? 63.124  -36.381  -24.110 1.00 162.63 ? 98  ASN D CA  1 
ATOM   2729  C  C   . ASN D  2 79  ? 63.888  -37.336  -23.184 1.00 155.34 ? 98  ASN D C   1 
ATOM   2730  O  O   . ASN D  2 79  ? 64.326  -38.391  -23.630 1.00 172.73 ? 98  ASN D O   1 
ATOM   2731  C  CB  . ASN D  2 79  ? 62.722  -37.149  -25.381 1.00 169.70 ? 98  ASN D CB  1 
ATOM   2732  C  CG  . ASN D  2 79  ? 61.724  -36.399  -26.244 1.00 162.87 ? 98  ASN D CG  1 
ATOM   2733  O  OD1 . ASN D  2 79  ? 60.826  -35.734  -25.736 1.00 162.63 ? 98  ASN D OD1 1 
ATOM   2734  N  ND2 . ASN D  2 79  ? 61.871  -36.518  -27.560 1.00 150.64 ? 98  ASN D ND2 1 
ATOM   2735  N  N   . VAL D  2 80  ? 64.048  -36.988  -21.907 1.00 125.34 ? 99  VAL D N   1 
ATOM   2736  C  CA  . VAL D  2 80  ? 64.822  -37.831  -20.978 1.00 108.95 ? 99  VAL D CA  1 
ATOM   2737  C  C   . VAL D  2 80  ? 64.768  -37.418  -19.495 1.00 104.43 ? 99  VAL D C   1 
ATOM   2738  O  O   . VAL D  2 80  ? 65.207  -36.329  -19.132 1.00 90.47  ? 99  VAL D O   1 
ATOM   2739  C  CB  . VAL D  2 80  ? 66.303  -37.921  -21.421 1.00 87.39  ? 99  VAL D CB  1 
ATOM   2740  C  CG1 . VAL D  2 80  ? 66.775  -36.590  -21.936 1.00 111.17 ? 99  VAL D CG1 1 
ATOM   2741  C  CG2 . VAL D  2 80  ? 67.191  -38.369  -20.288 1.00 46.56  ? 99  VAL D CG2 1 
ATOM   2742  N  N   . SER D  2 81  ? 64.252  -38.306  -18.643 1.00 107.66 ? 100 SER D N   1 
ATOM   2743  C  CA  . SER D  2 81  ? 64.128  -38.032  -17.207 1.00 113.40 ? 100 SER D CA  1 
ATOM   2744  C  C   . SER D  2 81  ? 64.722  -39.161  -16.364 1.00 103.27 ? 100 SER D C   1 
ATOM   2745  O  O   . SER D  2 81  ? 65.157  -40.173  -16.910 1.00 84.68  ? 100 SER D O   1 
ATOM   2746  C  CB  . SER D  2 81  ? 62.657  -37.809  -16.836 1.00 114.10 ? 100 SER D CB  1 
ATOM   2747  O  OG  . SER D  2 81  ? 62.487  -37.673  -15.438 1.00 102.61 ? 100 SER D OG  1 
ATOM   2748  N  N   . LEU D  2 82  ? 64.733  -38.984  -15.039 1.00 106.41 ? 101 LEU D N   1 
ATOM   2749  C  CA  . LEU D  2 82  ? 65.211  -40.023  -14.111 1.00 81.21  ? 101 LEU D CA  1 
ATOM   2750  C  C   . LEU D  2 82  ? 64.439  -40.114  -12.759 1.00 82.90  ? 101 LEU D C   1 
ATOM   2751  O  O   . LEU D  2 82  ? 63.200  -40.328  -12.696 1.00 54.59  ? 101 LEU D O   1 
ATOM   2752  C  CB  . LEU D  2 82  ? 66.725  -39.869  -13.887 1.00 34.60  ? 101 LEU D CB  1 
ATOM   2753  C  CG  . LEU D  2 82  ? 67.443  -38.838  -14.796 1.00 114.66 ? 101 LEU D CG  1 
ATOM   2754  C  CD1 . LEU D  2 82  ? 67.203  -37.442  -14.249 1.00 129.66 ? 101 LEU D CD1 1 
ATOM   2755  C  CD2 . LEU D  2 82  ? 68.983  -39.038  -15.039 1.00 27.20  ? 101 LEU D CD2 1 
ATOM   2756  N  N   . ARG E  3 11  ? 96.530  4.855    -22.576 1.00 78.27  ? 9   ARG E N   1 
ATOM   2757  C  CA  . ARG E  3 11  ? 96.011  5.721    -21.522 1.00 83.97  ? 9   ARG E CA  1 
ATOM   2758  C  C   . ARG E  3 11  ? 97.078  6.394    -20.623 1.00 85.53  ? 9   ARG E C   1 
ATOM   2759  O  O   . ARG E  3 11  ? 97.788  5.717    -19.889 1.00 71.20  ? 9   ARG E O   1 
ATOM   2760  C  CB  . ARG E  3 11  ? 95.008  4.956    -20.672 1.00 59.25  ? 9   ARG E CB  1 
ATOM   2761  C  CG  . ARG E  3 11  ? 94.756  5.666    -19.367 1.00 105.63 ? 9   ARG E CG  1 
ATOM   2762  C  CD  . ARG E  3 11  ? 94.362  7.115    -19.604 1.00 108.31 ? 9   ARG E CD  1 
ATOM   2763  N  NE  . ARG E  3 11  ? 92.944  7.202    -19.898 1.00 102.64 ? 9   ARG E NE  1 
ATOM   2764  C  CZ  . ARG E  3 11  ? 92.031  7.423    -18.971 1.00 88.48  ? 9   ARG E CZ  1 
ATOM   2765  N  NH1 . ARG E  3 11  ? 92.415  7.596    -17.714 1.00 62.43  ? 9   ARG E NH1 1 
ATOM   2766  N  NH2 . ARG E  3 11  ? 90.753  7.475    -19.308 1.00 98.02  ? 9   ARG E NH2 1 
ATOM   2767  N  N   . GLU E  3 12  ? 97.137  7.730    -20.654 1.00 80.40  ? 10  GLU E N   1 
ATOM   2768  C  CA  . GLU E  3 12  ? 98.233  8.503    -20.052 1.00 57.51  ? 10  GLU E CA  1 
ATOM   2769  C  C   . GLU E  3 12  ? 97.799  9.559    -19.032 1.00 55.93  ? 10  GLU E C   1 
ATOM   2770  O  O   . GLU E  3 12  ? 96.691  10.057   -19.086 1.00 67.92  ? 10  GLU E O   1 
ATOM   2771  C  CB  . GLU E  3 12  ? 99.041  9.196    -21.151 1.00 54.14  ? 10  GLU E CB  1 
ATOM   2772  C  CG  . GLU E  3 12  ? 99.626  8.276    -22.207 1.00 77.51  ? 10  GLU E CG  1 
ATOM   2773  C  CD  . GLU E  3 12  ? 100.154 9.026    -23.419 1.00 96.60  ? 10  GLU E CD  1 
ATOM   2774  O  OE1 . GLU E  3 12  ? 101.205 8.608    -23.960 1.00 97.51  ? 10  GLU E OE1 1 
ATOM   2775  O  OE2 . GLU E  3 12  ? 99.510  10.018   -23.832 1.00 98.78  ? 10  GLU E OE2 1 
ATOM   2776  N  N   . CYS E  3 13  ? 98.696  9.914    -18.117 1.00 49.13  ? 11  CYS E N   1 
ATOM   2777  C  CA  . CYS E  3 13  ? 98.434  10.957   -17.124 1.00 45.68  ? 11  CYS E CA  1 
ATOM   2778  C  C   . CYS E  3 13  ? 99.619  11.888   -16.909 1.00 66.61  ? 11  CYS E C   1 
ATOM   2779  O  O   . CYS E  3 13  ? 100.744 11.601   -17.328 1.00 80.81  ? 11  CYS E O   1 
ATOM   2780  C  CB  . CYS E  3 13  ? 98.134  10.343   -15.777 1.00 42.26  ? 11  CYS E CB  1 
ATOM   2781  S  SG  . CYS E  3 13  ? 96.573  9.568    -15.588 1.00 66.45  ? 11  CYS E SG  1 
ATOM   2782  N  N   . ILE E  3 14  ? 99.368  12.989   -16.211 1.00 54.60  ? 12  ILE E N   1 
ATOM   2783  C  CA  . ILE E  3 14  ? 100.440 13.905   -15.851 1.00 64.90  ? 12  ILE E CA  1 
ATOM   2784  C  C   . ILE E  3 14  ? 101.093 13.408   -14.579 1.00 74.97  ? 12  ILE E C   1 
ATOM   2785  O  O   . ILE E  3 14  ? 100.415 13.188   -13.584 1.00 69.02  ? 12  ILE E O   1 
ATOM   2786  C  CB  . ILE E  3 14  ? 99.920  15.329   -15.612 1.00 50.38  ? 12  ILE E CB  1 
ATOM   2787  C  CG1 . ILE E  3 14  ? 99.588  16.022   -16.927 1.00 35.35  ? 12  ILE E CG1 1 
ATOM   2788  C  CG2 . ILE E  3 14  ? 100.916 16.123   -14.875 1.00 53.67  ? 12  ILE E CG2 1 
ATOM   2789  C  CD1 . ILE E  3 14  ? 100.667 16.003   -17.889 1.00 42.55  ? 12  ILE E CD1 1 
ATOM   2790  N  N   . TYR E  3 15  ? 102.404 13.211   -14.615 1.00 61.28  ? 13  TYR E N   1 
ATOM   2791  C  CA  . TYR E  3 15  ? 103.122 12.800   -13.429 1.00 53.84  ? 13  TYR E CA  1 
ATOM   2792  C  C   . TYR E  3 15  ? 103.752 13.985   -12.760 1.00 58.90  ? 13  TYR E C   1 
ATOM   2793  O  O   . TYR E  3 15  ? 104.373 14.810   -13.409 1.00 65.10  ? 13  TYR E O   1 
ATOM   2794  C  CB  . TYR E  3 15  ? 104.227 11.802   -13.752 1.00 60.40  ? 13  TYR E CB  1 
ATOM   2795  C  CG  . TYR E  3 15  ? 104.840 11.215   -12.500 1.00 58.17  ? 13  TYR E CG  1 
ATOM   2796  C  CD1 . TYR E  3 15  ? 104.131 10.324   -11.725 1.00 67.35  ? 13  TYR E CD1 1 
ATOM   2797  C  CD2 . TYR E  3 15  ? 106.108 11.562   -12.078 1.00 58.64  ? 13  TYR E CD2 1 
ATOM   2798  C  CE1 . TYR E  3 15  ? 104.661 9.788    -10.572 1.00 76.05  ? 13  TYR E CE1 1 
ATOM   2799  C  CE2 . TYR E  3 15  ? 106.646 11.023   -10.917 1.00 52.70  ? 13  TYR E CE2 1 
ATOM   2800  C  CZ  . TYR E  3 15  ? 105.909 10.136   -10.173 1.00 58.44  ? 13  TYR E CZ  1 
ATOM   2801  O  OH  . TYR E  3 15  ? 106.392 9.578    -9.018  1.00 70.94  ? 13  TYR E OH  1 
ATOM   2802  N  N   . TYR E  3 16  ? 103.594 14.061   -11.449 1.00 53.53  ? 14  TYR E N   1 
ATOM   2803  C  CA  . TYR E  3 16  ? 104.337 15.014   -10.638 1.00 55.34  ? 14  TYR E CA  1 
ATOM   2804  C  C   . TYR E  3 16  ? 104.452 14.549   -9.186  1.00 54.83  ? 14  TYR E C   1 
ATOM   2805  O  O   . TYR E  3 16  ? 103.519 13.992   -8.616  1.00 48.32  ? 14  TYR E O   1 
ATOM   2806  C  CB  . TYR E  3 16  ? 103.707 16.399   -10.685 1.00 66.94  ? 14  TYR E CB  1 
ATOM   2807  C  CG  . TYR E  3 16  ? 104.484 17.424   -9.902  1.00 61.41  ? 14  TYR E CG  1 
ATOM   2808  C  CD1 . TYR E  3 16  ? 105.356 18.277   -10.537 1.00 65.56  ? 14  TYR E CD1 1 
ATOM   2809  C  CD2 . TYR E  3 16  ? 104.352 17.524   -8.532  1.00 63.19  ? 14  TYR E CD2 1 
ATOM   2810  C  CE1 . TYR E  3 16  ? 106.074 19.207   -9.834  1.00 70.10  ? 14  TYR E CE1 1 
ATOM   2811  C  CE2 . TYR E  3 16  ? 105.063 18.442   -7.822  1.00 77.96  ? 14  TYR E CE2 1 
ATOM   2812  C  CZ  . TYR E  3 16  ? 105.930 19.287   -8.473  1.00 80.88  ? 14  TYR E CZ  1 
ATOM   2813  O  OH  . TYR E  3 16  ? 106.662 20.218   -7.757  1.00 78.74  ? 14  TYR E OH  1 
ATOM   2814  N  N   . ASN E  3 17  ? 105.610 14.789   -8.590  1.00 62.39  ? 15  ASN E N   1 
ATOM   2815  C  CA  . ASN E  3 17  ? 105.841 14.377   -7.221  1.00 62.28  ? 15  ASN E CA  1 
ATOM   2816  C  C   . ASN E  3 17  ? 106.769 15.326   -6.500  1.00 45.26  ? 15  ASN E C   1 
ATOM   2817  O  O   . ASN E  3 17  ? 107.967 15.195   -6.593  1.00 57.68  ? 15  ASN E O   1 
ATOM   2818  C  CB  . ASN E  3 17  ? 106.420 12.962   -7.174  1.00 61.88  ? 15  ASN E CB  1 
ATOM   2819  C  CG  . ASN E  3 17  ? 106.694 12.500   -5.763  1.00 63.90  ? 15  ASN E CG  1 
ATOM   2820  O  OD1 . ASN E  3 17  ? 106.240 13.115   -4.794  1.00 62.68  ? 15  ASN E OD1 1 
ATOM   2821  N  ND2 . ASN E  3 17  ? 107.439 11.415   -5.635  1.00 64.56  ? 15  ASN E ND2 1 
ATOM   2822  N  N   . ALA E  3 18  ? 106.208 16.271   -5.768  1.00 53.95  ? 16  ALA E N   1 
ATOM   2823  C  CA  . ALA E  3 18  ? 107.005 17.253   -5.055  1.00 58.17  ? 16  ALA E CA  1 
ATOM   2824  C  C   . ALA E  3 18  ? 108.003 16.562   -4.177  1.00 49.27  ? 16  ALA E C   1 
ATOM   2825  O  O   . ALA E  3 18  ? 109.156 16.953   -4.107  1.00 75.51  ? 16  ALA E O   1 
ATOM   2826  C  CB  . ALA E  3 18  ? 106.123 18.148   -4.220  1.00 93.99  ? 16  ALA E CB  1 
ATOM   2827  N  N   . ASN E  3 19  ? 107.574 15.517   -3.502  1.00 52.18  ? 17  ASN E N   1 
ATOM   2828  C  CA  . ASN E  3 19  ? 108.480 14.846   -2.586  1.00 63.70  ? 17  ASN E CA  1 
ATOM   2829  C  C   . ASN E  3 19  ? 109.504 13.949   -3.272  1.00 72.53  ? 17  ASN E C   1 
ATOM   2830  O  O   . ASN E  3 19  ? 110.009 13.025   -2.653  1.00 64.70  ? 17  ASN E O   1 
ATOM   2831  C  CB  . ASN E  3 19  ? 107.689 14.028   -1.582  1.00 73.08  ? 17  ASN E CB  1 
ATOM   2832  C  CG  . ASN E  3 19  ? 108.241 14.139   -0.200  1.00 100.60 ? 17  ASN E CG  1 
ATOM   2833  O  OD1 . ASN E  3 19  ? 108.093 15.168   0.458   1.00 128.53 ? 17  ASN E OD1 1 
ATOM   2834  N  ND2 . ASN E  3 19  ? 108.886 13.084   0.257   1.00 96.39  ? 17  ASN E ND2 1 
ATOM   2835  N  N   . TRP E  3 20  ? 109.816 14.228   -4.538  1.00 77.92  ? 18  TRP E N   1 
ATOM   2836  C  CA  . TRP E  3 20  ? 110.623 13.316   -5.354  1.00 68.06  ? 18  TRP E CA  1 
ATOM   2837  C  C   . TRP E  3 20  ? 111.988 13.038   -4.784  1.00 78.25  ? 18  TRP E C   1 
ATOM   2838  O  O   . TRP E  3 20  ? 112.355 11.893   -4.590  1.00 69.95  ? 18  TRP E O   1 
ATOM   2839  C  CB  . TRP E  3 20  ? 110.765 13.797   -6.802  1.00 62.45  ? 18  TRP E CB  1 
ATOM   2840  C  CG  . TRP E  3 20  ? 111.544 15.064   -7.013  1.00 61.40  ? 18  TRP E CG  1 
ATOM   2841  C  CD1 . TRP E  3 20  ? 111.112 16.335   -6.785  1.00 78.53  ? 18  TRP E CD1 1 
ATOM   2842  C  CD2 . TRP E  3 20  ? 112.870 15.184   -7.531  1.00 73.41  ? 18  TRP E CD2 1 
ATOM   2843  N  NE1 . TRP E  3 20  ? 112.085 17.242   -7.116  1.00 73.19  ? 18  TRP E NE1 1 
ATOM   2844  C  CE2 . TRP E  3 20  ? 113.178 16.558   -7.576  1.00 73.28  ? 18  TRP E CE2 1 
ATOM   2845  C  CE3 . TRP E  3 20  ? 113.828 14.270   -7.954  1.00 88.71  ? 18  TRP E CE3 1 
ATOM   2846  C  CZ2 . TRP E  3 20  ? 114.402 17.031   -8.027  1.00 68.40  ? 18  TRP E CZ2 1 
ATOM   2847  C  CZ3 . TRP E  3 20  ? 115.031 14.743   -8.402  1.00 81.58  ? 18  TRP E CZ3 1 
ATOM   2848  C  CH2 . TRP E  3 20  ? 115.309 16.111   -8.438  1.00 69.08  ? 18  TRP E CH2 1 
ATOM   2849  N  N   . GLU E  3 21  ? 112.753 14.084   -4.534  1.00 79.56  ? 19  GLU E N   1 
ATOM   2850  C  CA  . GLU E  3 21  ? 114.077 13.901   -3.985  1.00 73.96  ? 19  GLU E CA  1 
ATOM   2851  C  C   . GLU E  3 21  ? 114.072 12.903   -2.838  1.00 62.51  ? 19  GLU E C   1 
ATOM   2852  O  O   . GLU E  3 21  ? 114.899 12.018   -2.772  1.00 45.40  ? 19  GLU E O   1 
ATOM   2853  C  CB  . GLU E  3 21  ? 114.610 15.226   -3.476  1.00 86.02  ? 19  GLU E CB  1 
ATOM   2854  C  CG  . GLU E  3 21  ? 114.439 16.367   -4.430  1.00 100.30 ? 19  GLU E CG  1 
ATOM   2855  C  CD  . GLU E  3 21  ? 115.612 17.299   -4.376  1.00 103.34 ? 19  GLU E CD  1 
ATOM   2856  O  OE1 . GLU E  3 21  ? 115.390 18.523   -4.318  1.00 106.38 ? 19  GLU E OE1 1 
ATOM   2857  O  OE2 . GLU E  3 21  ? 116.755 16.798   -4.385  1.00 92.53  ? 19  GLU E OE2 1 
ATOM   2858  N  N   . LEU E  3 22  ? 113.142 13.073   -1.916  1.00 67.80  ? 20  LEU E N   1 
ATOM   2859  C  CA  . LEU E  3 22  ? 113.083 12.232   -0.737  1.00 57.86  ? 20  LEU E CA  1 
ATOM   2860  C  C   . LEU E  3 22  ? 112.721 10.774   -1.086  1.00 67.11  ? 20  LEU E C   1 
ATOM   2861  O  O   . LEU E  3 22  ? 113.333 9.827    -0.584  1.00 60.48  ? 20  LEU E O   1 
ATOM   2862  C  CB  . LEU E  3 22  ? 112.051 12.792   0.234   1.00 71.16  ? 20  LEU E CB  1 
ATOM   2863  C  CG  . LEU E  3 22  ? 112.462 12.965   1.686   1.00 93.52  ? 20  LEU E CG  1 
ATOM   2864  C  CD1 . LEU E  3 22  ? 111.322 12.961   2.709   1.00 110.05 ? 20  LEU E CD1 1 
ATOM   2865  C  CD2 . LEU E  3 22  ? 113.707 12.217   2.109   1.00 107.39 ? 20  LEU E CD2 1 
ATOM   2866  N  N   . GLU E  3 23  ? 111.714 10.585   -1.934  1.00 77.65  ? 21  GLU E N   1 
ATOM   2867  C  CA  . GLU E  3 23  ? 111.231 9.239    -2.257  1.00 69.48  ? 21  GLU E CA  1 
ATOM   2868  C  C   . GLU E  3 23  ? 112.029 8.617    -3.399  1.00 68.00  ? 21  GLU E C   1 
ATOM   2869  O  O   . GLU E  3 23  ? 111.738 7.513    -3.817  1.00 51.99  ? 21  GLU E O   1 
ATOM   2870  C  CB  . GLU E  3 23  ? 109.729 9.250    -2.616  1.00 59.18  ? 21  GLU E CB  1 
ATOM   2871  C  CG  . GLU E  3 23  ? 108.782 9.658    -1.477  1.00 75.36  ? 21  GLU E CG  1 
ATOM   2872  C  CD  . GLU E  3 23  ? 107.366 10.003   -1.957  1.00 87.72  ? 21  GLU E CD  1 
ATOM   2873  O  OE1 . GLU E  3 23  ? 107.012 9.623    -3.094  1.00 86.10  ? 21  GLU E OE1 1 
ATOM   2874  O  OE2 . GLU E  3 23  ? 106.608 10.663   -1.204  1.00 95.64  ? 21  GLU E OE2 1 
ATOM   2875  N  N   . ARG E  3 24  ? 113.023 9.334    -3.910  1.00 76.88  ? 22  ARG E N   1 
ATOM   2876  C  CA  . ARG E  3 24  ? 113.827 8.858    -5.031  1.00 62.06  ? 22  ARG E CA  1 
ATOM   2877  C  C   . ARG E  3 24  ? 112.985 8.495    -6.233  1.00 55.48  ? 22  ARG E C   1 
ATOM   2878  O  O   . ARG E  3 24  ? 112.941 7.343    -6.628  1.00 68.66  ? 22  ARG E O   1 
ATOM   2879  C  CB  . ARG E  3 24  ? 114.664 7.657    -4.613  1.00 58.29  ? 22  ARG E CB  1 
ATOM   2880  C  CG  . ARG E  3 24  ? 115.793 8.009    -3.670  1.00 75.15  ? 22  ARG E CG  1 
ATOM   2881  C  CD  . ARG E  3 24  ? 116.757 9.012    -4.324  1.00 85.27  ? 22  ARG E CD  1 
ATOM   2882  N  NE  . ARG E  3 24  ? 117.363 9.915    -3.351  1.00 81.99  ? 22  ARG E NE  1 
ATOM   2883  C  CZ  . ARG E  3 24  ? 118.556 9.734    -2.792  1.00 105.82 ? 22  ARG E CZ  1 
ATOM   2884  N  NH1 . ARG E  3 24  ? 119.298 8.687    -3.118  1.00 119.40 ? 22  ARG E NH1 1 
ATOM   2885  N  NH2 . ARG E  3 24  ? 119.011 10.608   -1.907  1.00 118.17 ? 22  ARG E NH2 1 
ATOM   2886  N  N   . THR E  3 25  ? 112.303 9.478    -6.805  1.00 51.18  ? 23  THR E N   1 
ATOM   2887  C  CA  . THR E  3 25  ? 111.500 9.280    -8.017  1.00 52.26  ? 23  THR E CA  1 
ATOM   2888  C  C   . THR E  3 25  ? 111.632 10.521   -8.883  1.00 47.12  ? 23  THR E C   1 
ATOM   2889  O  O   . THR E  3 25  ? 112.057 11.558   -8.406  1.00 73.63  ? 23  THR E O   1 
ATOM   2890  C  CB  . THR E  3 25  ? 109.974 9.076    -7.741  1.00 35.14  ? 23  THR E CB  1 
ATOM   2891  O  OG1 . THR E  3 25  ? 109.264 10.287   -8.033  1.00 44.40  ? 23  THR E OG1 1 
ATOM   2892  C  CG2 . THR E  3 25  ? 109.711 8.684    -6.309  1.00 28.75  ? 23  THR E CG2 1 
ATOM   2893  N  N   . ASN E  3 26  ? 111.246 10.426   -10.147 1.00 46.65  ? 24  ASN E N   1 
ATOM   2894  C  CA  . ASN E  3 26  ? 111.235 11.586   -11.018 1.00 50.32  ? 24  ASN E CA  1 
ATOM   2895  C  C   . ASN E  3 26  ? 110.377 12.684   -10.426 1.00 66.33  ? 24  ASN E C   1 
ATOM   2896  O  O   . ASN E  3 26  ? 109.564 12.438   -9.533  1.00 74.34  ? 24  ASN E O   1 
ATOM   2897  C  CB  . ASN E  3 26  ? 110.726 11.223   -12.409 1.00 47.65  ? 24  ASN E CB  1 
ATOM   2898  C  CG  . ASN E  3 26  ? 111.736 10.444   -13.209 1.00 55.16  ? 24  ASN E CG  1 
ATOM   2899  O  OD1 . ASN E  3 26  ? 112.765 10.980   -13.581 1.00 60.11  ? 24  ASN E OD1 1 
ATOM   2900  N  ND2 . ASN E  3 26  ? 111.450 9.176    -13.491 1.00 64.07  ? 24  ASN E ND2 1 
ATOM   2901  N  N   . GLN E  3 27  ? 110.551 13.899   -10.929 1.00 47.40  ? 25  GLN E N   1 
ATOM   2902  C  CA  . GLN E  3 27  ? 109.851 15.044   -10.372 1.00 41.87  ? 25  GLN E CA  1 
ATOM   2903  C  C   . GLN E  3 27  ? 108.600 15.408   -11.150 1.00 48.39  ? 25  GLN E C   1 
ATOM   2904  O  O   . GLN E  3 27  ? 107.518 15.492   -10.589 1.00 64.06  ? 25  GLN E O   1 
ATOM   2905  C  CB  . GLN E  3 27  ? 110.772 16.241   -10.326 1.00 70.78  ? 25  GLN E CB  1 
ATOM   2906  C  CG  . GLN E  3 27  ? 110.144 17.406   -9.653  1.00 71.20  ? 25  GLN E CG  1 
ATOM   2907  C  CD  . GLN E  3 27  ? 110.962 18.646   -9.774  1.00 65.77  ? 25  GLN E CD  1 
ATOM   2908  O  OE1 . GLN E  3 27  ? 111.826 18.749   -10.637 1.00 73.94  ? 25  GLN E OE1 1 
ATOM   2909  N  NE2 . GLN E  3 27  ? 110.692 19.609   -8.913  1.00 68.05  ? 25  GLN E NE2 1 
ATOM   2910  N  N   . SER E  3 28  ? 108.753 15.637   -12.446 1.00 39.44  ? 26  SER E N   1 
ATOM   2911  C  CA  . SER E  3 28  ? 107.621 15.939   -13.290 1.00 50.14  ? 26  SER E CA  1 
ATOM   2912  C  C   . SER E  3 28  ? 107.729 15.263   -14.651 1.00 67.86  ? 26  SER E C   1 
ATOM   2913  O  O   . SER E  3 28  ? 108.818 14.964   -15.118 1.00 45.28  ? 26  SER E O   1 
ATOM   2914  C  CB  . SER E  3 28  ? 107.528 17.434   -13.484 1.00 53.91  ? 26  SER E CB  1 
ATOM   2915  O  OG  . SER E  3 28  ? 108.126 17.792   -14.711 1.00 84.58  ? 26  SER E OG  1 
ATOM   2916  N  N   . GLY E  3 29  ? 106.588 15.037   -15.288 1.00 90.11  ? 27  GLY E N   1 
ATOM   2917  C  CA  . GLY E  3 29  ? 106.557 14.424   -16.597 1.00 84.04  ? 27  GLY E CA  1 
ATOM   2918  C  C   . GLY E  3 29  ? 105.204 13.807   -16.852 1.00 76.14  ? 27  GLY E C   1 
ATOM   2919  O  O   . GLY E  3 29  ? 104.185 14.391   -16.525 1.00 80.74  ? 27  GLY E O   1 
ATOM   2920  N  N   . LEU E  3 30  ? 105.195 12.617   -17.432 1.00 68.41  ? 28  LEU E N   1 
ATOM   2921  C  CA  . LEU E  3 30  ? 103.957 11.907   -17.672 1.00 60.33  ? 28  LEU E CA  1 
ATOM   2922  C  C   . LEU E  3 30  ? 104.107 10.422   -17.330 1.00 63.72  ? 28  LEU E C   1 
ATOM   2923  O  O   . LEU E  3 30  ? 105.215 9.942    -17.079 1.00 52.52  ? 28  LEU E O   1 
ATOM   2924  C  CB  . LEU E  3 30  ? 103.509 12.106   -19.112 1.00 48.51  ? 28  LEU E CB  1 
ATOM   2925  C  CG  . LEU E  3 30  ? 104.521 11.767   -20.186 1.00 52.28  ? 28  LEU E CG  1 
ATOM   2926  C  CD1 . LEU E  3 30  ? 104.761 10.281   -20.273 1.00 72.94  ? 28  LEU E CD1 1 
ATOM   2927  C  CD2 . LEU E  3 30  ? 104.010 12.268   -21.479 1.00 38.47  ? 28  LEU E CD2 1 
ATOM   2928  N  N   . GLU E  3 31  ? 102.984 9.705    -17.309 1.00 63.31  ? 29  GLU E N   1 
ATOM   2929  C  CA  . GLU E  3 31  ? 102.968 8.301    -16.892 1.00 62.37  ? 29  GLU E CA  1 
ATOM   2930  C  C   . GLU E  3 31  ? 101.987 7.533    -17.753 1.00 64.15  ? 29  GLU E C   1 
ATOM   2931  O  O   . GLU E  3 31  ? 100.862 7.979    -17.937 1.00 76.15  ? 29  GLU E O   1 
ATOM   2932  C  CB  . GLU E  3 31  ? 102.543 8.189    -15.418 1.00 47.65  ? 29  GLU E CB  1 
ATOM   2933  C  CG  . GLU E  3 31  ? 103.048 6.957    -14.647 1.00 59.18  ? 29  GLU E CG  1 
ATOM   2934  C  CD  . GLU E  3 31  ? 102.503 6.873    -13.208 1.00 76.91  ? 29  GLU E CD  1 
ATOM   2935  O  OE1 . GLU E  3 31  ? 101.466 7.499    -12.907 1.00 86.29  ? 29  GLU E OE1 1 
ATOM   2936  O  OE2 . GLU E  3 31  ? 103.107 6.176    -12.366 1.00 76.24  ? 29  GLU E OE2 1 
ATOM   2937  N  N   . ARG E  3 32  ? 102.414 6.396    -18.296 1.00 64.31  ? 30  ARG E N   1 
ATOM   2938  C  CA  . ARG E  3 32  ? 101.484 5.500    -18.965 1.00 51.78  ? 30  ARG E CA  1 
ATOM   2939  C  C   . ARG E  3 32  ? 100.944 4.527    -17.931 1.00 61.86  ? 30  ARG E C   1 
ATOM   2940  O  O   . ARG E  3 32  ? 101.700 3.973    -17.145 1.00 84.20  ? 30  ARG E O   1 
ATOM   2941  C  CB  . ARG E  3 32  ? 102.135 4.790    -20.153 1.00 43.38  ? 30  ARG E CB  1 
ATOM   2942  C  CG  . ARG E  3 32  ? 102.120 5.617    -21.447 1.00 77.24  ? 30  ARG E CG  1 
ATOM   2943  C  CD  . ARG E  3 32  ? 102.870 4.902    -22.544 1.00 92.71  ? 30  ARG E CD  1 
ATOM   2944  N  NE  . ARG E  3 32  ? 104.017 4.213    -21.962 1.00 107.61 ? 30  ARG E NE  1 
ATOM   2945  C  CZ  . ARG E  3 32  ? 105.232 4.736    -21.876 1.00 91.77  ? 30  ARG E CZ  1 
ATOM   2946  N  NH1 . ARG E  3 32  ? 105.461 5.945    -22.365 1.00 82.24  ? 30  ARG E NH1 1 
ATOM   2947  N  NH2 . ARG E  3 32  ? 106.213 4.047    -21.311 1.00 79.84  ? 30  ARG E NH2 1 
ATOM   2948  N  N   . CYS E  3 33  ? 99.632  4.335    -17.924 1.00 68.25  ? 31  CYS E N   1 
ATOM   2949  C  CA  . CYS E  3 33  ? 98.969  3.662    -16.816 1.00 76.11  ? 31  CYS E CA  1 
ATOM   2950  C  C   . CYS E  3 33  ? 98.863  2.154    -16.980 1.00 90.28  ? 31  CYS E C   1 
ATOM   2951  O  O   . CYS E  3 33  ? 98.106  1.669    -17.809 1.00 96.24  ? 31  CYS E O   1 
ATOM   2952  C  CB  . CYS E  3 33  ? 97.574  4.255    -16.611 1.00 73.78  ? 31  CYS E CB  1 
ATOM   2953  S  SG  . CYS E  3 33  ? 97.577  6.041    -16.369 1.00 105.48 ? 31  CYS E SG  1 
ATOM   2954  N  N   . GLU E  3 34  ? 99.618  1.416    -16.177 1.00 102.08 ? 32  GLU E N   1 
ATOM   2955  C  CA  . GLU E  3 34  ? 99.494  -0.034   -16.152 1.00 101.79 ? 32  GLU E CA  1 
ATOM   2956  C  C   . GLU E  3 34  ? 98.169  -0.393   -15.490 1.00 101.02 ? 32  GLU E C   1 
ATOM   2957  O  O   . GLU E  3 34  ? 97.866  0.100    -14.399 1.00 93.86  ? 32  GLU E O   1 
ATOM   2958  C  CB  . GLU E  3 34  ? 100.663 -0.661   -15.385 1.00 92.77  ? 32  GLU E CB  1 
ATOM   2959  C  CG  . GLU E  3 34  ? 101.975 -0.682   -16.143 1.00 120.08 ? 32  GLU E CG  1 
ATOM   2960  C  CD  . GLU E  3 34  ? 102.439 -2.093   -16.430 1.00 141.91 ? 32  GLU E CD  1 
ATOM   2961  O  OE1 . GLU E  3 34  ? 102.264 -2.965   -15.549 1.00 146.42 ? 32  GLU E OE1 1 
ATOM   2962  O  OE2 . GLU E  3 34  ? 102.968 -2.331   -17.538 1.00 136.82 ? 32  GLU E OE2 1 
ATOM   2963  N  N   . GLY E  3 35  ? 97.377  -1.238   -16.146 1.00 93.35  ? 33  GLY E N   1 
ATOM   2964  C  CA  . GLY E  3 35  ? 96.059  -1.547   -15.632 1.00 97.85  ? 33  GLY E CA  1 
ATOM   2965  C  C   . GLY E  3 35  ? 95.459  -2.872   -16.054 1.00 104.87 ? 33  GLY E C   1 
ATOM   2966  O  O   . GLY E  3 35  ? 95.864  -3.457   -17.055 1.00 106.55 ? 33  GLY E O   1 
ATOM   2967  N  N   . GLU E  3 36  ? 94.466  -3.316   -15.285 1.00 103.33 ? 34  GLU E N   1 
ATOM   2968  C  CA  . GLU E  3 36  ? 93.787  -4.590   -15.489 1.00 113.82 ? 34  GLU E CA  1 
ATOM   2969  C  C   . GLU E  3 36  ? 92.932  -4.626   -16.758 1.00 139.63 ? 34  GLU E C   1 
ATOM   2970  O  O   . GLU E  3 36  ? 92.354  -3.619   -17.157 1.00 142.87 ? 34  GLU E O   1 
ATOM   2971  C  CB  . GLU E  3 36  ? 92.932  -4.927   -14.263 1.00 119.75 ? 34  GLU E CB  1 
ATOM   2972  C  CG  . GLU E  3 36  ? 92.777  -6.421   -14.016 1.00 156.10 ? 34  GLU E CG  1 
ATOM   2973  C  CD  . GLU E  3 36  ? 92.738  -6.765   -12.542 1.00 171.32 ? 34  GLU E CD  1 
ATOM   2974  O  OE1 . GLU E  3 36  ? 92.653  -5.825   -11.723 1.00 182.83 ? 34  GLU E OE1 1 
ATOM   2975  O  OE2 . GLU E  3 36  ? 92.799  -7.969   -12.206 1.00 160.67 ? 34  GLU E OE2 1 
ATOM   2976  N  N   . GLN E  3 37  ? 92.848  -5.807   -17.369 1.00 160.10 ? 35  GLN E N   1 
ATOM   2977  C  CA  . GLN E  3 37  ? 92.204  -5.999   -18.672 1.00 164.46 ? 35  GLN E CA  1 
ATOM   2978  C  C   . GLN E  3 37  ? 90.952  -5.149   -18.891 1.00 155.87 ? 35  GLN E C   1 
ATOM   2979  O  O   . GLN E  3 37  ? 90.964  -4.191   -19.667 1.00 152.33 ? 35  GLN E O   1 
ATOM   2980  C  CB  . GLN E  3 37  ? 91.875  -7.481   -18.894 1.00 156.53 ? 35  GLN E CB  1 
ATOM   2981  N  N   . ASP E  3 38  ? 89.872  -5.514   -18.213 1.00 127.83 ? 36  ASP E N   1 
ATOM   2982  C  CA  . ASP E  3 38  ? 88.605  -4.825   -18.388 1.00 109.58 ? 36  ASP E CA  1 
ATOM   2983  C  C   . ASP E  3 38  ? 88.244  -3.974   -17.169 1.00 119.27 ? 36  ASP E C   1 
ATOM   2984  O  O   . ASP E  3 38  ? 87.085  -3.949   -16.741 1.00 120.25 ? 36  ASP E O   1 
ATOM   2985  C  CB  . ASP E  3 38  ? 87.485  -5.825   -18.691 1.00 108.75 ? 36  ASP E CB  1 
ATOM   2986  N  N   . LYS E  3 39  ? 89.236  -3.287   -16.604 1.00 115.91 ? 37  LYS E N   1 
ATOM   2987  C  CA  . LYS E  3 39  ? 88.989  -2.288   -15.564 1.00 101.15 ? 37  LYS E CA  1 
ATOM   2988  C  C   . LYS E  3 39  ? 89.338  -0.902   -16.114 1.00 88.86  ? 37  LYS E C   1 
ATOM   2989  O  O   . LYS E  3 39  ? 90.143  -0.783   -17.035 1.00 65.02  ? 37  LYS E O   1 
ATOM   2990  C  CB  . LYS E  3 39  ? 89.769  -2.600   -14.271 1.00 89.23  ? 37  LYS E CB  1 
ATOM   2991  C  CG  . LYS E  3 39  ? 89.004  -3.471   -13.247 1.00 78.24  ? 37  LYS E CG  1 
ATOM   2992  C  CD  . LYS E  3 39  ? 89.804  -3.724   -11.971 1.00 83.92  ? 37  LYS E CD  1 
ATOM   2993  N  N   . ARG E  3 40  ? 88.713  0.135    -15.564 1.00 80.46  ? 38  ARG E N   1 
ATOM   2994  C  CA  . ARG E  3 40  ? 88.940  1.499    -16.015 1.00 66.40  ? 38  ARG E CA  1 
ATOM   2995  C  C   . ARG E  3 40  ? 90.238  2.076    -15.444 1.00 77.25  ? 38  ARG E C   1 
ATOM   2996  O  O   . ARG E  3 40  ? 90.798  1.538    -14.490 1.00 75.80  ? 38  ARG E O   1 
ATOM   2997  C  CB  . ARG E  3 40  ? 87.776  2.398    -15.597 1.00 71.35  ? 38  ARG E CB  1 
ATOM   2998  C  CG  . ARG E  3 40  ? 86.379  1.991    -16.070 1.00 62.01  ? 38  ARG E CG  1 
ATOM   2999  C  CD  . ARG E  3 40  ? 85.495  3.241    -16.180 1.00 72.78  ? 38  ARG E CD  1 
ATOM   3000  N  NE  . ARG E  3 40  ? 84.070  2.963    -16.067 1.00 90.58  ? 38  ARG E NE  1 
ATOM   3001  C  CZ  . ARG E  3 40  ? 83.128  3.900    -15.993 1.00 93.05  ? 38  ARG E CZ  1 
ATOM   3002  N  NH1 . ARG E  3 40  ? 83.461  5.179    -16.009 1.00 75.46  ? 38  ARG E NH1 1 
ATOM   3003  N  NH2 . ARG E  3 40  ? 81.849  3.558    -15.902 1.00 95.37  ? 38  ARG E NH2 1 
ATOM   3004  N  N   . LEU E  3 41  ? 90.698  3.188    -16.020 1.00 88.07  ? 39  LEU E N   1 
ATOM   3005  C  CA  . LEU E  3 41  ? 91.886  3.894    -15.526 1.00 69.66  ? 39  LEU E CA  1 
ATOM   3006  C  C   . LEU E  3 41  ? 91.599  5.377    -15.313 1.00 64.70  ? 39  LEU E C   1 
ATOM   3007  O  O   . LEU E  3 41  ? 90.683  5.922    -15.916 1.00 83.92  ? 39  LEU E O   1 
ATOM   3008  C  CB  . LEU E  3 41  ? 93.062  3.707    -16.482 1.00 60.63  ? 39  LEU E CB  1 
ATOM   3009  C  CG  . LEU E  3 41  ? 93.588  2.278    -16.580 1.00 63.06  ? 39  LEU E CG  1 
ATOM   3010  C  CD1 . LEU E  3 41  ? 94.472  2.096    -17.786 1.00 85.80  ? 39  LEU E CD1 1 
ATOM   3011  C  CD2 . LEU E  3 41  ? 94.315  1.904    -15.322 1.00 47.88  ? 39  LEU E CD2 1 
ATOM   3012  N  N   . HIS E  3 42  ? 92.385  6.016    -14.450 1.00 59.89  ? 40  HIS E N   1 
ATOM   3013  C  CA  . HIS E  3 42  ? 92.121  7.385    -14.033 1.00 65.89  ? 40  HIS E CA  1 
ATOM   3014  C  C   . HIS E  3 42  ? 93.383  8.199    -13.792 1.00 64.62  ? 40  HIS E C   1 
ATOM   3015  O  O   . HIS E  3 42  ? 94.476  7.659    -13.746 1.00 60.61  ? 40  HIS E O   1 
ATOM   3016  C  CB  . HIS E  3 42  ? 91.319  7.376    -12.740 1.00 75.75  ? 40  HIS E CB  1 
ATOM   3017  C  CG  . HIS E  3 42  ? 90.081  6.542    -12.799 1.00 68.85  ? 40  HIS E CG  1 
ATOM   3018  N  ND1 . HIS E  3 42  ? 88.853  7.059    -13.137 1.00 71.98  ? 40  HIS E ND1 1 
ATOM   3019  C  CD2 . HIS E  3 42  ? 89.882  5.231    -12.547 1.00 83.14  ? 40  HIS E CD2 1 
ATOM   3020  C  CE1 . HIS E  3 42  ? 87.949  6.100    -13.100 1.00 87.03  ? 40  HIS E CE1 1 
ATOM   3021  N  NE2 . HIS E  3 42  ? 88.547  4.981    -12.744 1.00 88.18  ? 40  HIS E NE2 1 
ATOM   3022  N  N   . CYS E  3 43  ? 93.221  9.507    -13.623 1.00 66.95  ? 41  CYS E N   1 
ATOM   3023  C  CA  . CYS E  3 43  ? 94.336  10.367   -13.236 1.00 48.98  ? 41  CYS E CA  1 
ATOM   3024  C  C   . CYS E  3 43  ? 93.987  11.105   -11.950 1.00 62.55  ? 41  CYS E C   1 
ATOM   3025  O  O   . CYS E  3 43  ? 92.813  11.374   -11.673 1.00 78.52  ? 41  CYS E O   1 
ATOM   3026  C  CB  . CYS E  3 43  ? 94.635  11.374   -14.323 1.00 28.04  ? 41  CYS E CB  1 
ATOM   3027  S  SG  . CYS E  3 43  ? 94.943  10.690   -15.931 1.00 98.05  ? 41  CYS E SG  1 
ATOM   3028  N  N   . TYR E  3 44  ? 95.003  11.428   -11.160 1.00 56.43  ? 42  TYR E N   1 
ATOM   3029  C  CA  . TYR E  3 44  ? 94.782  12.163   -9.933  1.00 59.06  ? 42  TYR E CA  1 
ATOM   3030  C  C   . TYR E  3 44  ? 95.724  13.332   -9.829  1.00 57.28  ? 42  TYR E C   1 
ATOM   3031  O  O   . TYR E  3 44  ? 96.745  13.403   -10.516 1.00 51.24  ? 42  TYR E O   1 
ATOM   3032  C  CB  . TYR E  3 44  ? 94.919  11.276   -8.693  1.00 48.53  ? 42  TYR E CB  1 
ATOM   3033  C  CG  . TYR E  3 44  ? 96.338  11.029   -8.269  1.00 57.04  ? 42  TYR E CG  1 
ATOM   3034  C  CD1 . TYR E  3 44  ? 97.146  10.181   -8.982  1.00 72.58  ? 42  TYR E CD1 1 
ATOM   3035  C  CD2 . TYR E  3 44  ? 96.867  11.635   -7.147  1.00 65.75  ? 42  TYR E CD2 1 
ATOM   3036  C  CE1 . TYR E  3 44  ? 98.447  9.954    -8.602  1.00 89.24  ? 42  TYR E CE1 1 
ATOM   3037  C  CE2 . TYR E  3 44  ? 98.172  11.403   -6.752  1.00 61.58  ? 42  TYR E CE2 1 
ATOM   3038  C  CZ  . TYR E  3 44  ? 98.956  10.566   -7.486  1.00 75.68  ? 42  TYR E CZ  1 
ATOM   3039  O  OH  . TYR E  3 44  ? 100.261 10.329   -7.122  1.00 82.25  ? 42  TYR E OH  1 
ATOM   3040  N  N   . ALA E  3 45  ? 95.326  14.259   -8.970  1.00 59.94  ? 43  ALA E N   1 
ATOM   3041  C  CA  . ALA E  3 45  ? 96.146  15.367   -8.553  1.00 41.93  ? 43  ALA E CA  1 
ATOM   3042  C  C   . ALA E  3 45  ? 95.801  15.633   -7.099  1.00 54.87  ? 43  ALA E C   1 
ATOM   3043  O  O   . ALA E  3 45  ? 94.688  15.356   -6.651  1.00 72.26  ? 43  ALA E O   1 
ATOM   3044  C  CB  . ALA E  3 45  ? 95.873  16.572   -9.384  1.00 23.62  ? 43  ALA E CB  1 
ATOM   3045  N  N   . SER E  3 46  ? 96.775  16.145   -6.360  1.00 57.58  ? 44  SER E N   1 
ATOM   3046  C  CA  . SER E  3 46  ? 96.605  16.467   -4.961  1.00 58.63  ? 44  SER E CA  1 
ATOM   3047  C  C   . SER E  3 46  ? 97.546  17.589   -4.618  1.00 65.20  ? 44  SER E C   1 
ATOM   3048  O  O   . SER E  3 46  ? 98.706  17.601   -5.042  1.00 71.40  ? 44  SER E O   1 
ATOM   3049  C  CB  . SER E  3 46  ? 96.917  15.265   -4.090  1.00 49.49  ? 44  SER E CB  1 
ATOM   3050  O  OG  . SER E  3 46  ? 98.241  14.867   -4.315  1.00 62.18  ? 44  SER E OG  1 
ATOM   3051  N  N   . TRP E  3 47  ? 97.039  18.514   -3.818  1.00 70.88  ? 45  TRP E N   1 
ATOM   3052  C  CA  . TRP E  3 47  ? 97.778  19.711   -3.483  1.00 66.72  ? 45  TRP E CA  1 
ATOM   3053  C  C   . TRP E  3 47  ? 97.380  20.251   -2.119  1.00 68.87  ? 45  TRP E C   1 
ATOM   3054  O  O   . TRP E  3 47  ? 96.342  19.887   -1.590  1.00 80.73  ? 45  TRP E O   1 
ATOM   3055  C  CB  . TRP E  3 47  ? 97.477  20.756   -4.523  1.00 74.26  ? 45  TRP E CB  1 
ATOM   3056  C  CG  . TRP E  3 47  ? 96.034  21.093   -4.611  1.00 72.78  ? 45  TRP E CG  1 
ATOM   3057  C  CD1 . TRP E  3 47  ? 95.410  22.145   -4.034  1.00 83.42  ? 45  TRP E CD1 1 
ATOM   3058  C  CD2 . TRP E  3 47  ? 95.032  20.385   -5.335  1.00 77.97  ? 45  TRP E CD2 1 
ATOM   3059  N  NE1 . TRP E  3 47  ? 94.079  22.146   -4.351  1.00 72.83  ? 45  TRP E NE1 1 
ATOM   3060  C  CE2 . TRP E  3 47  ? 93.825  21.072   -5.155  1.00 68.80  ? 45  TRP E CE2 1 
ATOM   3061  C  CE3 . TRP E  3 47  ? 95.038  19.235   -6.124  1.00 105.16 ? 45  TRP E CE3 1 
ATOM   3062  C  CZ2 . TRP E  3 47  ? 92.637  20.645   -5.720  1.00 88.05  ? 45  TRP E CZ2 1 
ATOM   3063  C  CZ3 . TRP E  3 47  ? 93.853  18.816   -6.692  1.00 102.83 ? 45  TRP E CZ3 1 
ATOM   3064  C  CH2 . TRP E  3 47  ? 92.672  19.516   -6.485  1.00 92.69  ? 45  TRP E CH2 1 
ATOM   3065  N  N   . ARG E  3 48  ? 98.206  21.120   -1.546  1.00 61.20  ? 46  ARG E N   1 
ATOM   3066  C  CA  . ARG E  3 48  ? 97.868  21.768   -0.288  1.00 59.40  ? 46  ARG E CA  1 
ATOM   3067  C  C   . ARG E  3 48  ? 97.333  23.175   -0.573  1.00 79.29  ? 46  ARG E C   1 
ATOM   3068  O  O   . ARG E  3 48  ? 97.643  23.749   -1.607  1.00 74.87  ? 46  ARG E O   1 
ATOM   3069  C  CB  . ARG E  3 48  ? 99.091  21.805   0.618   1.00 29.75  ? 46  ARG E CB  1 
ATOM   3070  C  CG  . ARG E  3 48  ? 99.241  20.592   1.522   1.00 39.79  ? 46  ARG E CG  1 
ATOM   3071  C  CD  . ARG E  3 48  ? 100.704 20.299   1.847   1.00 62.84  ? 46  ARG E CD  1 
ATOM   3072  N  NE  . ARG E  3 48  ? 100.892 19.272   2.877   1.00 88.88  ? 46  ARG E NE  1 
ATOM   3073  C  CZ  . ARG E  3 48  ? 101.926 18.420   2.930   1.00 112.31 ? 46  ARG E CZ  1 
ATOM   3074  N  NH1 . ARG E  3 48  ? 102.888 18.427   2.004   1.00 89.95  ? 46  ARG E NH1 1 
ATOM   3075  N  NH2 . ARG E  3 48  ? 101.998 17.535   3.917   1.00 112.89 ? 46  ARG E NH2 1 
ATOM   3076  N  N   . ASN E  3 49  ? 96.509  23.724   0.316   1.00 97.48  ? 47  ASN E N   1 
ATOM   3077  C  CA  . ASN E  3 49  ? 95.981  25.075   0.112   1.00 101.61 ? 47  ASN E CA  1 
ATOM   3078  C  C   . ASN E  3 49  ? 96.000  25.924   1.374   1.00 123.30 ? 47  ASN E C   1 
ATOM   3079  O  O   . ASN E  3 49  ? 95.082  25.853   2.196   1.00 135.72 ? 47  ASN E O   1 
ATOM   3080  C  CB  . ASN E  3 49  ? 94.565  25.041   -0.450  1.00 109.44 ? 47  ASN E CB  1 
ATOM   3081  C  CG  . ASN E  3 49  ? 94.210  26.304   -1.195  1.00 114.55 ? 47  ASN E CG  1 
ATOM   3082  O  OD1 . ASN E  3 49  ? 94.860  26.636   -2.178  1.00 109.61 ? 47  ASN E OD1 1 
ATOM   3083  N  ND2 . ASN E  3 49  ? 93.180  27.021   -0.729  1.00 137.39 ? 47  ASN E ND2 1 
ATOM   3084  N  N   . SER E  3 50  ? 97.053  26.729   1.513   1.00 123.22 ? 48  SER E N   1 
ATOM   3085  C  CA  . SER E  3 50  ? 97.225  27.606   2.667   1.00 115.01 ? 48  SER E CA  1 
ATOM   3086  C  C   . SER E  3 50  ? 96.634  28.958   2.340   1.00 124.80 ? 48  SER E C   1 
ATOM   3087  O  O   . SER E  3 50  ? 97.354  29.885   1.964   1.00 111.76 ? 48  SER E O   1 
ATOM   3088  C  CB  . SER E  3 50  ? 98.703  27.756   3.034   1.00 96.26  ? 48  SER E CB  1 
ATOM   3089  N  N   . SER E  3 51  ? 95.313  29.049   2.469   1.00 138.03 ? 49  SER E N   1 
ATOM   3090  C  CA  . SER E  3 51  ? 94.588  30.278   2.182   1.00 130.77 ? 49  SER E CA  1 
ATOM   3091  C  C   . SER E  3 51  ? 94.986  30.884   0.836   1.00 117.23 ? 49  SER E C   1 
ATOM   3092  O  O   . SER E  3 51  ? 95.647  31.910   0.783   1.00 104.77 ? 49  SER E O   1 
ATOM   3093  C  CB  . SER E  3 51  ? 94.790  31.292   3.310   1.00 113.24 ? 49  SER E CB  1 
ATOM   3094  N  N   . GLY E  3 52  ? 94.585  30.236   -0.249  1.00 105.85 ? 50  GLY E N   1 
ATOM   3095  C  CA  . GLY E  3 52  ? 94.757  30.802   -1.571  1.00 107.94 ? 50  GLY E CA  1 
ATOM   3096  C  C   . GLY E  3 52  ? 96.057  30.469   -2.274  1.00 115.58 ? 50  GLY E C   1 
ATOM   3097  O  O   . GLY E  3 52  ? 96.115  30.478   -3.504  1.00 86.67  ? 50  GLY E O   1 
ATOM   3098  N  N   . THR E  3 53  ? 97.106  30.190   -1.509  1.00 140.73 ? 51  THR E N   1 
ATOM   3099  C  CA  . THR E  3 53  ? 98.390  29.857   -2.104  1.00 133.86 ? 51  THR E CA  1 
ATOM   3100  C  C   . THR E  3 53  ? 98.470  28.362   -2.320  1.00 123.26 ? 51  THR E C   1 
ATOM   3101  O  O   . THR E  3 53  ? 98.416  27.602   -1.365  1.00 117.52 ? 51  THR E O   1 
ATOM   3102  C  CB  . THR E  3 53  ? 99.549  30.308   -1.215  1.00 132.30 ? 51  THR E CB  1 
ATOM   3103  N  N   . ILE E  3 54  ? 98.596  27.945   -3.578  1.00 102.92 ? 52  ILE E N   1 
ATOM   3104  C  CA  . ILE E  3 54  ? 98.523  26.526   -3.938  1.00 79.72  ? 52  ILE E CA  1 
ATOM   3105  C  C   . ILE E  3 54  ? 99.877  25.854   -4.111  1.00 83.91  ? 52  ILE E C   1 
ATOM   3106  O  O   . ILE E  3 54  ? 100.621 26.178   -5.032  1.00 96.80  ? 52  ILE E O   1 
ATOM   3107  C  CB  . ILE E  3 54  ? 97.793  26.313   -5.271  1.00 68.97  ? 52  ILE E CB  1 
ATOM   3108  C  CG1 . ILE E  3 54  ? 96.433  26.993   -5.270  1.00 84.67  ? 52  ILE E CG1 1 
ATOM   3109  C  CG2 . ILE E  3 54  ? 97.615  24.848   -5.538  1.00 70.80  ? 52  ILE E CG2 1 
ATOM   3110  C  CD1 . ILE E  3 54  ? 95.754  26.981   -6.628  1.00 84.94  ? 52  ILE E CD1 1 
ATOM   3111  N  N   . GLU E  3 55  ? 100.176 24.884   -3.252  1.00 85.28  ? 53  GLU E N   1 
ATOM   3112  C  CA  . GLU E  3 55  ? 101.405 24.099   -3.354  1.00 80.45  ? 53  GLU E CA  1 
ATOM   3113  C  C   . GLU E  3 55  ? 101.084 22.684   -3.824  1.00 80.88  ? 53  GLU E C   1 
ATOM   3114  O  O   . GLU E  3 55  ? 100.360 21.960   -3.148  1.00 87.94  ? 53  GLU E O   1 
ATOM   3115  C  CB  . GLU E  3 55  ? 102.114 24.064   -1.996  1.00 92.56  ? 53  GLU E CB  1 
ATOM   3116  C  CG  . GLU E  3 55  ? 103.273 23.096   -1.905  1.00 125.44 ? 53  GLU E CG  1 
ATOM   3117  C  CD  . GLU E  3 55  ? 103.613 22.732   -0.474  1.00 133.23 ? 53  GLU E CD  1 
ATOM   3118  O  OE1 . GLU E  3 55  ? 103.399 23.580   0.417   1.00 129.48 ? 53  GLU E OE1 1 
ATOM   3119  O  OE2 . GLU E  3 55  ? 104.081 21.593   -0.243  1.00 129.92 ? 53  GLU E OE2 1 
ATOM   3120  N  N   . LEU E  3 56  ? 101.611 22.298   -4.987  1.00 75.73  ? 54  LEU E N   1 
ATOM   3121  C  CA  . LEU E  3 56  ? 101.348 20.977   -5.558  1.00 58.47  ? 54  LEU E CA  1 
ATOM   3122  C  C   . LEU E  3 56  ? 102.033 19.879   -4.766  1.00 61.93  ? 54  LEU E C   1 
ATOM   3123  O  O   . LEU E  3 56  ? 103.120 20.076   -4.245  1.00 84.02  ? 54  LEU E O   1 
ATOM   3124  C  CB  . LEU E  3 56  ? 101.805 20.908   -7.006  1.00 45.01  ? 54  LEU E CB  1 
ATOM   3125  C  CG  . LEU E  3 56  ? 100.794 20.392   -8.028  1.00 44.51  ? 54  LEU E CG  1 
ATOM   3126  C  CD1 . LEU E  3 56  ? 101.451 20.122   -9.361  1.00 56.75  ? 54  LEU E CD1 1 
ATOM   3127  C  CD2 . LEU E  3 56  ? 100.172 19.127   -7.524  1.00 68.48  ? 54  LEU E CD2 1 
ATOM   3128  N  N   . VAL E  3 57  ? 101.394 18.720   -4.674  1.00 60.81  ? 55  VAL E N   1 
ATOM   3129  C  CA  . VAL E  3 57  ? 101.941 17.617   -3.896  1.00 74.55  ? 55  VAL E CA  1 
ATOM   3130  C  C   . VAL E  3 57  ? 102.169 16.364   -4.727  1.00 74.66  ? 55  VAL E C   1 
ATOM   3131  O  O   . VAL E  3 57  ? 103.180 15.693   -4.578  1.00 79.32  ? 55  VAL E O   1 
ATOM   3132  C  CB  . VAL E  3 57  ? 101.071 17.283   -2.659  1.00 60.75  ? 55  VAL E CB  1 
ATOM   3133  C  CG1 . VAL E  3 57  ? 101.439 15.909   -2.089  1.00 40.80  ? 55  VAL E CG1 1 
ATOM   3134  C  CG2 . VAL E  3 57  ? 101.234 18.353   -1.602  1.00 68.03  ? 55  VAL E CG2 1 
ATOM   3135  N  N   . LYS E  3 58  ? 101.236 16.044   -5.607  1.00 67.40  ? 56  LYS E N   1 
ATOM   3136  C  CA  . LYS E  3 58  ? 101.421 14.855   -6.418  1.00 46.67  ? 56  LYS E CA  1 
ATOM   3137  C  C   . LYS E  3 58  ? 100.412 14.757   -7.553  1.00 54.14  ? 56  LYS E C   1 
ATOM   3138  O  O   . LYS E  3 58  ? 99.261  15.088   -7.384  1.00 58.74  ? 56  LYS E O   1 
ATOM   3139  C  CB  . LYS E  3 58  ? 101.304 13.624   -5.534  1.00 43.38  ? 56  LYS E CB  1 
ATOM   3140  C  CG  . LYS E  3 58  ? 102.605 12.963   -5.105  1.00 53.09  ? 56  LYS E CG  1 
ATOM   3141  C  CD  . LYS E  3 58  ? 102.357 11.756   -4.167  1.00 36.30  ? 56  LYS E CD  1 
ATOM   3142  C  CE  . LYS E  3 58  ? 103.621 10.946   -3.885  1.00 52.32  ? 56  LYS E CE  1 
ATOM   3143  N  NZ  . LYS E  3 58  ? 104.670 11.645   -3.065  1.00 57.27  ? 56  LYS E NZ  1 
ATOM   3144  N  N   . LYS E  3 59  ? 100.857 14.290   -8.710  1.00 47.20  ? 57  LYS E N   1 
ATOM   3145  C  CA  . LYS E  3 59  ? 99.979  14.035   -9.829  1.00 32.22  ? 57  LYS E CA  1 
ATOM   3146  C  C   . LYS E  3 59  ? 100.356 12.701   -10.456 1.00 50.00  ? 57  LYS E C   1 
ATOM   3147  O  O   . LYS E  3 59  ? 101.516 12.348   -10.499 1.00 60.09  ? 57  LYS E O   1 
ATOM   3148  C  CB  . LYS E  3 59  ? 100.128 15.128   -10.879 1.00 42.85  ? 57  LYS E CB  1 
ATOM   3149  C  CG  . LYS E  3 59  ? 99.529  16.502   -10.544 1.00 46.96  ? 57  LYS E CG  1 
ATOM   3150  C  CD  . LYS E  3 59  ? 99.318  17.285   -11.846 1.00 46.83  ? 57  LYS E CD  1 
ATOM   3151  C  CE  . LYS E  3 59  ? 99.107  18.751   -11.651 1.00 55.11  ? 57  LYS E CE  1 
ATOM   3152  N  NZ  . LYS E  3 59  ? 99.636  19.485   -12.842 1.00 67.57  ? 57  LYS E NZ  1 
ATOM   3153  N  N   . GLY E  3 60  ? 99.388  11.952   -10.959 1.00 68.87  ? 58  GLY E N   1 
ATOM   3154  C  CA  . GLY E  3 60  ? 99.741  10.679   -11.565 1.00 63.08  ? 58  GLY E CA  1 
ATOM   3155  C  C   . GLY E  3 60  ? 98.584  9.741    -11.873 1.00 63.19  ? 58  GLY E C   1 
ATOM   3156  O  O   . GLY E  3 60  ? 97.427  10.137   -11.870 1.00 55.98  ? 58  GLY E O   1 
ATOM   3157  N  N   . CYS E  3 61  ? 98.898  8.480    -12.151 1.00 61.45  ? 59  CYS E N   1 
ATOM   3158  C  CA  . CYS E  3 61  ? 97.883  7.505    -12.536 1.00 44.02  ? 59  CYS E CA  1 
ATOM   3159  C  C   . CYS E  3 61  ? 97.133  7.023    -11.305 1.00 49.89  ? 59  CYS E C   1 
ATOM   3160  O  O   . CYS E  3 61  ? 97.681  7.055    -10.217 1.00 62.00  ? 59  CYS E O   1 
ATOM   3161  C  CB  . CYS E  3 61  ? 98.532  6.324    -13.258 1.00 31.91  ? 59  CYS E CB  1 
ATOM   3162  S  SG  . CYS E  3 61  ? 98.938  6.609    -14.978 1.00 81.24  ? 59  CYS E SG  1 
ATOM   3163  N  N   . TRP E  3 62  ? 95.888  6.577    -11.484 1.00 58.90  ? 60  TRP E N   1 
ATOM   3164  C  CA  . TRP E  3 62  ? 95.017  6.163    -10.378 1.00 51.48  ? 60  TRP E CA  1 
ATOM   3165  C  C   . TRP E  3 62  ? 94.081  5.051    -10.839 1.00 58.03  ? 60  TRP E C   1 
ATOM   3166  O  O   . TRP E  3 62  ? 93.608  5.072    -11.971 1.00 70.10  ? 60  TRP E O   1 
ATOM   3167  C  CB  . TRP E  3 62  ? 94.220  7.364    -9.871  1.00 42.33  ? 60  TRP E CB  1 
ATOM   3168  C  CG  . TRP E  3 62  ? 93.355  7.144    -8.653  1.00 48.93  ? 60  TRP E CG  1 
ATOM   3169  C  CD1 . TRP E  3 62  ? 92.039  6.816    -8.649  1.00 75.25  ? 60  TRP E CD1 1 
ATOM   3170  C  CD2 . TRP E  3 62  ? 93.727  7.299    -7.274  1.00 43.85  ? 60  TRP E CD2 1 
ATOM   3171  N  NE1 . TRP E  3 62  ? 91.565  6.739    -7.361  1.00 73.24  ? 60  TRP E NE1 1 
ATOM   3172  C  CE2 . TRP E  3 62  ? 92.586  7.029    -6.501  1.00 57.72  ? 60  TRP E CE2 1 
ATOM   3173  C  CE3 . TRP E  3 62  ? 94.911  7.632    -6.622  1.00 44.97  ? 60  TRP E CE3 1 
ATOM   3174  C  CZ2 . TRP E  3 62  ? 92.599  7.072    -5.119  1.00 70.59  ? 60  TRP E CZ2 1 
ATOM   3175  C  CZ3 . TRP E  3 62  ? 94.917  7.673    -5.250  1.00 52.24  ? 60  TRP E CZ3 1 
ATOM   3176  C  CH2 . TRP E  3 62  ? 93.776  7.395    -4.513  1.00 57.97  ? 60  TRP E CH2 1 
ATOM   3177  N  N   . LEU E  3 63  ? 93.797  4.088    -9.968  1.00 51.71  ? 61  LEU E N   1 
ATOM   3178  C  CA  . LEU E  3 63  ? 93.109  2.880    -10.401 1.00 47.46  ? 61  LEU E CA  1 
ATOM   3179  C  C   . LEU E  3 63  ? 91.588  2.876    -10.284 1.00 63.40  ? 61  LEU E C   1 
ATOM   3180  O  O   . LEU E  3 63  ? 91.024  3.377    -9.314  1.00 83.75  ? 61  LEU E O   1 
ATOM   3181  C  CB  . LEU E  3 63  ? 93.669  1.673    -9.659  1.00 47.19  ? 61  LEU E CB  1 
ATOM   3182  C  CG  . LEU E  3 63  ? 94.924  1.045    -10.258 1.00 43.76  ? 61  LEU E CG  1 
ATOM   3183  C  CD1 . LEU E  3 63  ? 95.266  -0.234   -9.538  1.00 29.56  ? 61  LEU E CD1 1 
ATOM   3184  C  CD2 . LEU E  3 63  ? 94.718  0.784    -11.723 1.00 45.31  ? 61  LEU E CD2 1 
ATOM   3185  N  N   . ASP E  3 64  ? 90.944  2.260    -11.273 1.00 55.48  ? 62  ASP E N   1 
ATOM   3186  C  CA  . ASP E  3 64  ? 89.497  2.038    -11.291 1.00 52.45  ? 62  ASP E CA  1 
ATOM   3187  C  C   . ASP E  3 64  ? 88.820  2.301    -9.946  1.00 62.23  ? 62  ASP E C   1 
ATOM   3188  O  O   . ASP E  3 64  ? 88.579  1.395    -9.156  1.00 98.37  ? 62  ASP E O   1 
ATOM   3189  C  CB  . ASP E  3 64  ? 89.189  0.623    -11.783 1.00 73.58  ? 62  ASP E CB  1 
ATOM   3190  C  CG  . ASP E  3 64  ? 87.715  0.398    -12.051 1.00 91.18  ? 62  ASP E CG  1 
ATOM   3191  O  OD1 . ASP E  3 64  ? 86.930  0.288    -11.087 1.00 107.11 ? 62  ASP E OD1 1 
ATOM   3192  O  OD2 . ASP E  3 64  ? 87.342  0.305    -13.233 1.00 80.21  ? 62  ASP E OD2 1 
ATOM   3193  N  N   . ASP E  3 65  ? 88.515  3.559    -9.694  1.00 56.20  ? 63  ASP E N   1 
ATOM   3194  C  CA  . ASP E  3 65  ? 87.815  3.955    -8.490  1.00 76.58  ? 63  ASP E CA  1 
ATOM   3195  C  C   . ASP E  3 65  ? 86.573  4.729    -8.941  1.00 80.88  ? 63  ASP E C   1 
ATOM   3196  O  O   . ASP E  3 65  ? 86.677  5.712    -9.655  1.00 79.33  ? 63  ASP E O   1 
ATOM   3197  C  CB  . ASP E  3 65  ? 88.753  4.792    -7.613  1.00 85.20  ? 63  ASP E CB  1 
ATOM   3198  C  CG  . ASP E  3 65  ? 88.022  5.650    -6.592  1.00 90.39  ? 63  ASP E CG  1 
ATOM   3199  O  OD1 . ASP E  3 65  ? 86.934  5.262    -6.137  1.00 109.40 ? 63  ASP E OD1 1 
ATOM   3200  O  OD2 . ASP E  3 65  ? 88.551  6.717    -6.226  1.00 70.77  ? 63  ASP E OD2 1 
ATOM   3201  N  N   . PHE E  3 66  ? 85.396  4.258    -8.546  1.00 91.31  ? 64  PHE E N   1 
ATOM   3202  C  CA  . PHE E  3 66  ? 84.125  4.796    -9.044  1.00 73.31  ? 64  PHE E CA  1 
ATOM   3203  C  C   . PHE E  3 66  ? 83.924  6.280    -8.790  1.00 67.90  ? 64  PHE E C   1 
ATOM   3204  O  O   . PHE E  3 66  ? 83.073  6.902    -9.409  1.00 84.01  ? 64  PHE E O   1 
ATOM   3205  C  CB  . PHE E  3 66  ? 82.953  4.047    -8.422  1.00 65.69  ? 64  PHE E CB  1 
ATOM   3206  C  CG  . PHE E  3 66  ? 82.793  4.302    -6.957  1.00 58.76  ? 64  PHE E CG  1 
ATOM   3207  C  CD1 . PHE E  3 66  ? 82.078  5.392    -6.515  1.00 40.47  ? 64  PHE E CD1 1 
ATOM   3208  C  CD2 . PHE E  3 66  ? 83.370  3.458    -6.018  1.00 77.52  ? 64  PHE E CD2 1 
ATOM   3209  C  CE1 . PHE E  3 66  ? 81.930  5.639    -5.167  1.00 48.55  ? 64  PHE E CE1 1 
ATOM   3210  C  CE2 . PHE E  3 66  ? 83.226  3.708    -4.670  1.00 79.72  ? 64  PHE E CE2 1 
ATOM   3211  C  CZ  . PHE E  3 66  ? 82.503  4.804    -4.249  1.00 60.73  ? 64  PHE E CZ  1 
ATOM   3212  N  N   . ASN E  3 67  ? 84.683  6.844    -7.864  1.00 61.02  ? 65  ASN E N   1 
ATOM   3213  C  CA  . ASN E  3 67  ? 84.552  8.256    -7.563  1.00 63.88  ? 65  ASN E CA  1 
ATOM   3214  C  C   . ASN E  3 67  ? 84.919  9.101    -8.779  1.00 64.17  ? 65  ASN E C   1 
ATOM   3215  O  O   . ASN E  3 67  ? 84.473  10.234   -8.928  1.00 77.39  ? 65  ASN E O   1 
ATOM   3216  C  CB  . ASN E  3 67  ? 85.435  8.613    -6.377  1.00 77.95  ? 65  ASN E CB  1 
ATOM   3217  C  CG  . ASN E  3 67  ? 84.874  8.124    -5.072  1.00 79.17  ? 65  ASN E CG  1 
ATOM   3218  O  OD1 . ASN E  3 67  ? 85.437  7.223    -4.433  1.00 75.85  ? 65  ASN E OD1 1 
ATOM   3219  N  ND2 . ASN E  3 67  ? 83.753  8.721    -4.656  1.00 55.67  ? 65  ASN E ND2 1 
ATOM   3220  N  N   . CYS E  3 68  ? 85.732  8.533    -9.658  1.00 69.64  ? 66  CYS E N   1 
ATOM   3221  C  CA  . CYS E  3 68  ? 86.233  9.254    -10.820 1.00 75.69  ? 66  CYS E CA  1 
ATOM   3222  C  C   . CYS E  3 68  ? 85.420  8.903    -12.054 1.00 88.02  ? 66  CYS E C   1 
ATOM   3223  O  O   . CYS E  3 68  ? 85.610  9.477    -13.122 1.00 104.12 ? 66  CYS E O   1 
ATOM   3224  C  CB  . CYS E  3 68  ? 87.699  8.894    -11.083 1.00 77.15  ? 66  CYS E CB  1 
ATOM   3225  S  SG  . CYS E  3 68  ? 88.783  8.873    -9.646  1.00 80.50  ? 66  CYS E SG  1 
ATOM   3226  N  N   . TYR E  3 69  ? 84.516  7.947    -11.908 1.00 81.08  ? 67  TYR E N   1 
ATOM   3227  C  CA  . TYR E  3 69  ? 83.783  7.436    -13.058 1.00 87.69  ? 67  TYR E CA  1 
ATOM   3228  C  C   . TYR E  3 69  ? 83.152  8.567    -13.882 1.00 99.64  ? 67  TYR E C   1 
ATOM   3229  O  O   . TYR E  3 69  ? 82.494  9.461    -13.346 1.00 91.73  ? 67  TYR E O   1 
ATOM   3230  C  CB  . TYR E  3 69  ? 82.733  6.394    -12.628 1.00 87.01  ? 67  TYR E CB  1 
ATOM   3231  C  CG  . TYR E  3 69  ? 83.234  4.961    -12.477 1.00 66.57  ? 67  TYR E CG  1 
ATOM   3232  C  CD1 . TYR E  3 69  ? 84.451  4.572    -12.982 1.00 75.90  ? 67  TYR E CD1 1 
ATOM   3233  C  CD2 . TYR E  3 69  ? 82.472  4.001    -11.831 1.00 78.90  ? 67  TYR E CD2 1 
ATOM   3234  C  CE1 . TYR E  3 69  ? 84.901  3.273    -12.841 1.00 85.22  ? 67  TYR E CE1 1 
ATOM   3235  C  CE2 . TYR E  3 69  ? 82.915  2.702    -11.694 1.00 84.15  ? 67  TYR E CE2 1 
ATOM   3236  C  CZ  . TYR E  3 69  ? 84.125  2.346    -12.201 1.00 83.29  ? 67  TYR E CZ  1 
ATOM   3237  O  OH  . TYR E  3 69  ? 84.564  1.054    -12.064 1.00 97.73  ? 67  TYR E OH  1 
ATOM   3238  N  N   . ASP E  3 70  ? 83.388  8.519    -15.189 1.00 107.39 ? 68  ASP E N   1 
ATOM   3239  C  CA  . ASP E  3 70  ? 82.784  9.434    -16.152 1.00 115.52 ? 68  ASP E CA  1 
ATOM   3240  C  C   . ASP E  3 70  ? 82.775  10.869   -15.690 1.00 107.43 ? 68  ASP E C   1 
ATOM   3241  O  O   . ASP E  3 70  ? 81.739  11.516   -15.678 1.00 120.29 ? 68  ASP E O   1 
ATOM   3242  C  CB  . ASP E  3 70  ? 81.364  9.006    -16.495 1.00 142.85 ? 68  ASP E CB  1 
ATOM   3243  C  CG  . ASP E  3 70  ? 80.873  9.620    -17.786 1.00 168.00 ? 68  ASP E CG  1 
ATOM   3244  O  OD1 . ASP E  3 70  ? 81.223  9.087    -18.859 1.00 176.39 ? 68  ASP E OD1 1 
ATOM   3245  O  OD2 . ASP E  3 70  ? 80.144  10.631   -17.731 1.00 175.10 ? 68  ASP E OD2 1 
ATOM   3246  N  N   . ARG E  3 71  ? 83.949  11.362   -15.329 1.00 98.41  ? 69  ARG E N   1 
ATOM   3247  C  CA  . ARG E  3 71  ? 84.119  12.737   -14.883 1.00 82.45  ? 69  ARG E CA  1 
ATOM   3248  C  C   . ARG E  3 71  ? 85.217  13.434   -15.693 1.00 80.02  ? 69  ARG E C   1 
ATOM   3249  O  O   . ARG E  3 71  ? 86.394  13.147   -15.536 1.00 45.78  ? 69  ARG E O   1 
ATOM   3250  C  CB  . ARG E  3 71  ? 84.443  12.749   -13.392 1.00 63.85  ? 69  ARG E CB  1 
ATOM   3251  C  CG  . ARG E  3 71  ? 84.679  14.113   -12.819 1.00 102.41 ? 69  ARG E CG  1 
ATOM   3252  C  CD  . ARG E  3 71  ? 85.176  13.981   -11.409 1.00 107.79 ? 69  ARG E CD  1 
ATOM   3253  N  NE  . ARG E  3 71  ? 84.265  13.172   -10.615 1.00 93.32  ? 69  ARG E NE  1 
ATOM   3254  C  CZ  . ARG E  3 71  ? 83.413  13.682   -9.736  1.00 96.90  ? 69  ARG E CZ  1 
ATOM   3255  N  NH1 . ARG E  3 71  ? 83.380  15.002   -9.552  1.00 82.12  ? 69  ARG E NH1 1 
ATOM   3256  N  NH2 . ARG E  3 71  ? 82.608  12.879   -9.038  1.00 76.81  ? 69  ARG E NH2 1 
ATOM   3257  N  N   . GLN E  3 72  ? 84.828  14.356   -16.561 1.00 107.50 ? 70  GLN E N   1 
ATOM   3258  C  CA  . GLN E  3 72  ? 85.756  14.906   -17.548 1.00 115.76 ? 70  GLN E CA  1 
ATOM   3259  C  C   . GLN E  3 72  ? 86.914  15.738   -16.979 1.00 95.04  ? 70  GLN E C   1 
ATOM   3260  O  O   . GLN E  3 72  ? 88.047  15.633   -17.439 1.00 63.13  ? 70  GLN E O   1 
ATOM   3261  C  CB  . GLN E  3 72  ? 84.991  15.725   -18.590 1.00 141.11 ? 70  GLN E CB  1 
ATOM   3262  C  CG  . GLN E  3 72  ? 83.909  14.956   -19.313 1.00 152.22 ? 70  GLN E CG  1 
ATOM   3263  C  CD  . GLN E  3 72  ? 84.439  13.778   -20.107 1.00 143.32 ? 70  GLN E CD  1 
ATOM   3264  O  OE1 . GLN E  3 72  ? 85.652  13.600   -20.236 1.00 117.08 ? 70  GLN E OE1 1 
ATOM   3265  N  NE2 . GLN E  3 72  ? 83.528  12.965   -20.648 1.00 142.74 ? 70  GLN E NE2 1 
ATOM   3266  N  N   . GLU E  3 73  ? 86.625  16.583   -15.999 1.00 100.16 ? 71  GLU E N   1 
ATOM   3267  C  CA  . GLU E  3 73  ? 87.639  17.467   -15.448 1.00 86.71  ? 71  GLU E CA  1 
ATOM   3268  C  C   . GLU E  3 73  ? 88.065  17.057   -14.048 1.00 86.50  ? 71  GLU E C   1 
ATOM   3269  O  O   . GLU E  3 73  ? 87.319  16.412   -13.326 1.00 80.13  ? 71  GLU E O   1 
ATOM   3270  C  CB  . GLU E  3 73  ? 87.134  18.910   -15.435 1.00 88.25  ? 71  GLU E CB  1 
ATOM   3271  C  CG  . GLU E  3 73  ? 87.315  19.637   -16.764 1.00 128.10 ? 71  GLU E CG  1 
ATOM   3272  C  CD  . GLU E  3 73  ? 86.123  19.500   -17.692 1.00 139.46 ? 71  GLU E CD  1 
ATOM   3273  O  OE1 . GLU E  3 73  ? 84.996  19.801   -17.248 1.00 143.19 ? 71  GLU E OE1 1 
ATOM   3274  O  OE2 . GLU E  3 73  ? 86.317  19.106   -18.864 1.00 133.90 ? 71  GLU E OE2 1 
ATOM   3275  N  N   . CYS E  3 74  ? 89.269  17.447   -13.655 1.00 91.41  ? 72  CYS E N   1 
ATOM   3276  C  CA  . CYS E  3 74  ? 89.787  17.040   -12.359 1.00 101.06 ? 72  CYS E CA  1 
ATOM   3277  C  C   . CYS E  3 74  ? 89.353  18.006   -11.284 1.00 88.27  ? 72  CYS E C   1 
ATOM   3278  O  O   . CYS E  3 74  ? 89.920  19.074   -11.161 1.00 82.04  ? 72  CYS E O   1 
ATOM   3279  C  CB  . CYS E  3 74  ? 91.308  16.958   -12.391 1.00 111.59 ? 72  CYS E CB  1 
ATOM   3280  S  SG  . CYS E  3 74  ? 91.998  15.967   -11.057 1.00 82.68  ? 72  CYS E SG  1 
ATOM   3281  N  N   . VAL E  3 75  ? 88.345  17.635   -10.504 1.00 99.49  ? 73  VAL E N   1 
ATOM   3282  C  CA  . VAL E  3 75  ? 87.813  18.551   -9.509  1.00 91.80  ? 73  VAL E CA  1 
ATOM   3283  C  C   . VAL E  3 75  ? 87.651  17.928   -8.142  1.00 87.45  ? 73  VAL E C   1 
ATOM   3284  O  O   . VAL E  3 75  ? 87.205  16.788   -8.014  1.00 107.10 ? 73  VAL E O   1 
ATOM   3285  C  CB  . VAL E  3 75  ? 86.459  19.110   -9.922  1.00 79.30  ? 73  VAL E CB  1 
ATOM   3286  C  CG1 . VAL E  3 75  ? 86.052  20.180   -8.959  1.00 80.05  ? 73  VAL E CG1 1 
ATOM   3287  C  CG2 . VAL E  3 75  ? 86.519  19.662   -11.331 1.00 82.03  ? 73  VAL E CG2 1 
ATOM   3288  N  N   . ALA E  3 76  ? 87.999  18.711   -7.126  1.00 61.76  ? 74  ALA E N   1 
ATOM   3289  C  CA  . ALA E  3 76  ? 87.992  18.267   -5.742  1.00 76.37  ? 74  ALA E CA  1 
ATOM   3290  C  C   . ALA E  3 76  ? 86.690  18.663   -5.106  1.00 89.66  ? 74  ALA E C   1 
ATOM   3291  O  O   . ALA E  3 76  ? 86.171  19.724   -5.403  1.00 119.93 ? 74  ALA E O   1 
ATOM   3292  C  CB  . ALA E  3 76  ? 89.135  18.897   -4.988  1.00 80.16  ? 74  ALA E CB  1 
ATOM   3293  N  N   . THR E  3 77  ? 86.175  17.829   -4.211  1.00 87.13  ? 75  THR E N   1 
ATOM   3294  C  CA  . THR E  3 77  ? 84.836  18.035   -3.698  1.00 72.28  ? 75  THR E CA  1 
ATOM   3295  C  C   . THR E  3 77  ? 84.772  18.268   -2.197  1.00 79.14  ? 75  THR E C   1 
ATOM   3296  O  O   . THR E  3 77  ? 83.796  18.797   -1.696  1.00 115.44 ? 75  THR E O   1 
ATOM   3297  C  CB  . THR E  3 77  ? 83.919  16.867   -4.084  1.00 87.41  ? 75  THR E CB  1 
ATOM   3298  O  OG1 . THR E  3 77  ? 84.403  15.659   -3.498  1.00 86.41  ? 75  THR E OG1 1 
ATOM   3299  C  CG2 . THR E  3 77  ? 83.877  16.692   -5.587  1.00 96.25  ? 75  THR E CG2 1 
ATOM   3300  N  N   . GLU E  3 78  ? 85.809  17.881   -1.476  1.00 80.10  ? 76  GLU E N   1 
ATOM   3301  C  CA  . GLU E  3 78  ? 85.830  18.053   -0.025  1.00 85.25  ? 76  GLU E CA  1 
ATOM   3302  C  C   . GLU E  3 78  ? 85.715  19.524   0.412   1.00 100.90 ? 76  GLU E C   1 
ATOM   3303  O  O   . GLU E  3 78  ? 86.167  20.426   -0.291  1.00 104.58 ? 76  GLU E O   1 
ATOM   3304  C  CB  . GLU E  3 78  ? 87.098  17.422   0.545   1.00 90.10  ? 76  GLU E CB  1 
ATOM   3305  C  CG  . GLU E  3 78  ? 87.241  15.964   0.226   1.00 96.92  ? 76  GLU E CG  1 
ATOM   3306  C  CD  . GLU E  3 78  ? 86.480  15.083   1.202   1.00 114.41 ? 76  GLU E CD  1 
ATOM   3307  O  OE1 . GLU E  3 78  ? 86.025  13.986   0.799   1.00 119.02 ? 76  GLU E OE1 1 
ATOM   3308  O  OE2 . GLU E  3 78  ? 86.349  15.486   2.376   1.00 111.04 ? 76  GLU E OE2 1 
ATOM   3309  N  N   . GLU E  3 79  ? 85.118  19.757   1.580   1.00 108.44 ? 77  GLU E N   1 
ATOM   3310  C  CA  . GLU E  3 79  ? 84.863  21.115   2.059   1.00 111.64 ? 77  GLU E CA  1 
ATOM   3311  C  C   . GLU E  3 79  ? 86.154  21.868   2.344   1.00 114.12 ? 77  GLU E C   1 
ATOM   3312  O  O   . GLU E  3 79  ? 86.549  22.745   1.580   1.00 106.80 ? 77  GLU E O   1 
ATOM   3313  C  CB  . GLU E  3 79  ? 83.974  21.095   3.304   1.00 108.05 ? 77  GLU E CB  1 
ATOM   3314  N  N   . ASN E  3 80  ? 86.804  21.529   3.451   1.00 114.18 ? 78  ASN E N   1 
ATOM   3315  C  CA  . ASN E  3 80  ? 88.089  22.125   3.792   1.00 117.95 ? 78  ASN E CA  1 
ATOM   3316  C  C   . ASN E  3 80  ? 89.056  21.071   4.308   1.00 96.47  ? 78  ASN E C   1 
ATOM   3317  O  O   . ASN E  3 80  ? 89.055  20.751   5.492   1.00 88.59  ? 78  ASN E O   1 
ATOM   3318  C  CB  . ASN E  3 80  ? 87.919  23.235   4.824   1.00 127.07 ? 78  ASN E CB  1 
ATOM   3319  C  CG  . ASN E  3 80  ? 89.199  23.990   5.068   1.00 135.61 ? 78  ASN E CG  1 
ATOM   3320  O  OD1 . ASN E  3 80  ? 89.961  24.253   4.140   1.00 142.40 ? 78  ASN E OD1 1 
ATOM   3321  N  ND2 . ASN E  3 80  ? 89.454  24.333   6.323   1.00 135.51 ? 78  ASN E ND2 1 
ATOM   3322  N  N   . PRO E  3 81  ? 89.880  20.521   3.408   1.00 72.17  ? 79  PRO E N   1 
ATOM   3323  C  CA  . PRO E  3 81  ? 90.792  19.430   3.734   1.00 81.85  ? 79  PRO E CA  1 
ATOM   3324  C  C   . PRO E  3 81  ? 92.230  19.855   3.949   1.00 83.64  ? 79  PRO E C   1 
ATOM   3325  O  O   . PRO E  3 81  ? 92.706  20.807   3.336   1.00 102.69 ? 79  PRO E O   1 
ATOM   3326  C  CB  . PRO E  3 81  ? 90.718  18.552   2.485   1.00 83.23  ? 79  PRO E CB  1 
ATOM   3327  C  CG  . PRO E  3 81  ? 90.321  19.495   1.371   1.00 68.04  ? 79  PRO E CG  1 
ATOM   3328  C  CD  . PRO E  3 81  ? 89.862  20.787   1.963   1.00 61.44  ? 79  PRO E CD  1 
ATOM   3329  N  N   . GLN E  3 82  ? 92.906  19.135   4.835   1.00 76.32  ? 80  GLN E N   1 
ATOM   3330  C  CA  . GLN E  3 82  ? 94.358  19.146   4.921   1.00 68.23  ? 80  GLN E CA  1 
ATOM   3331  C  C   . GLN E  3 82  ? 94.937  19.066   3.504   1.00 78.02  ? 80  GLN E C   1 
ATOM   3332  O  O   . GLN E  3 82  ? 95.536  20.032   3.015   1.00 72.93  ? 80  GLN E O   1 
ATOM   3333  C  CB  . GLN E  3 82  ? 94.816  17.946   5.765   1.00 102.24 ? 80  GLN E CB  1 
ATOM   3334  C  CG  . GLN E  3 82  ? 93.671  16.952   6.169   1.00 159.44 ? 80  GLN E CG  1 
ATOM   3335  C  CD  . GLN E  3 82  ? 93.493  15.744   5.227   1.00 122.80 ? 80  GLN E CD  1 
ATOM   3336  O  OE1 . GLN E  3 82  ? 94.282  14.793   5.251   1.00 112.08 ? 80  GLN E OE1 1 
ATOM   3337  N  NE2 . GLN E  3 82  ? 92.435  15.771   4.423   1.00 77.64  ? 80  GLN E NE2 1 
ATOM   3338  N  N   . VAL E  3 83  ? 94.731  17.916   2.853   1.00 84.47  ? 81  VAL E N   1 
ATOM   3339  C  CA  . VAL E  3 83  ? 95.183  17.667   1.481   1.00 62.33  ? 81  VAL E CA  1 
ATOM   3340  C  C   . VAL E  3 83  ? 94.020  17.642   0.498   1.00 54.05  ? 81  VAL E C   1 
ATOM   3341  O  O   . VAL E  3 83  ? 93.064  16.899   0.658   1.00 63.23  ? 81  VAL E O   1 
ATOM   3342  C  CB  . VAL E  3 83  ? 95.937  16.329   1.345   1.00 60.04  ? 81  VAL E CB  1 
ATOM   3343  C  CG1 . VAL E  3 83  ? 96.359  16.113   -0.101  1.00 60.65  ? 81  VAL E CG1 1 
ATOM   3344  C  CG2 . VAL E  3 83  ? 97.142  16.287   2.267   1.00 59.73  ? 81  VAL E CG2 1 
ATOM   3345  N  N   . TYR E  3 84  ? 94.093  18.469   -0.525  1.00 62.80  ? 82  TYR E N   1 
ATOM   3346  C  CA  . TYR E  3 84  ? 93.052  18.483   -1.528  1.00 65.09  ? 82  TYR E CA  1 
ATOM   3347  C  C   . TYR E  3 84  ? 93.382  17.370   -2.502  1.00 65.75  ? 82  TYR E C   1 
ATOM   3348  O  O   . TYR E  3 84  ? 94.553  17.169   -2.849  1.00 85.21  ? 82  TYR E O   1 
ATOM   3349  C  CB  . TYR E  3 84  ? 92.987  19.843   -2.231  1.00 74.32  ? 82  TYR E CB  1 
ATOM   3350  C  CG  . TYR E  3 84  ? 92.559  21.007   -1.351  1.00 78.26  ? 82  TYR E CG  1 
ATOM   3351  C  CD1 . TYR E  3 84  ? 91.671  21.957   -1.809  1.00 88.39  ? 82  TYR E CD1 1 
ATOM   3352  C  CD2 . TYR E  3 84  ? 93.054  21.154   -0.069  1.00 109.02 ? 82  TYR E CD2 1 
ATOM   3353  C  CE1 . TYR E  3 84  ? 91.284  23.023   -1.011  1.00 108.13 ? 82  TYR E CE1 1 
ATOM   3354  C  CE2 . TYR E  3 84  ? 92.671  22.214   0.736   1.00 118.08 ? 82  TYR E CE2 1 
ATOM   3355  C  CZ  . TYR E  3 84  ? 91.786  23.143   0.263   1.00 108.91 ? 82  TYR E CZ  1 
ATOM   3356  O  OH  . TYR E  3 84  ? 91.414  24.194   1.071   1.00 95.53  ? 82  TYR E OH  1 
ATOM   3357  N  N   . PHE E  3 85  ? 92.355  16.633   -2.915  1.00 66.10  ? 83  PHE E N   1 
ATOM   3358  C  CA  . PHE E  3 85  ? 92.504  15.511   -3.842  1.00 55.76  ? 83  PHE E CA  1 
ATOM   3359  C  C   . PHE E  3 85  ? 91.437  15.573   -4.923  1.00 54.87  ? 83  PHE E C   1 
ATOM   3360  O  O   . PHE E  3 85  ? 90.313  16.013   -4.677  1.00 58.73  ? 83  PHE E O   1 
ATOM   3361  C  CB  . PHE E  3 85  ? 92.394  14.172   -3.101  1.00 47.53  ? 83  PHE E CB  1 
ATOM   3362  C  CG  . PHE E  3 85  ? 92.477  12.967   -4.000  1.00 50.53  ? 83  PHE E CG  1 
ATOM   3363  C  CD1 . PHE E  3 85  ? 93.677  12.294   -4.174  1.00 68.46  ? 83  PHE E CD1 1 
ATOM   3364  C  CD2 . PHE E  3 85  ? 91.361  12.505   -4.674  1.00 45.19  ? 83  PHE E CD2 1 
ATOM   3365  C  CE1 . PHE E  3 85  ? 93.765  11.187   -5.006  1.00 66.48  ? 83  PHE E CE1 1 
ATOM   3366  C  CE2 . PHE E  3 85  ? 91.446  11.402   -5.511  1.00 66.65  ? 83  PHE E CE2 1 
ATOM   3367  C  CZ  . PHE E  3 85  ? 92.652  10.743   -5.673  1.00 70.60  ? 83  PHE E CZ  1 
ATOM   3368  N  N   . CYS E  3 86  ? 91.790  15.125   -6.121  1.00 51.92  ? 84  CYS E N   1 
ATOM   3369  C  CA  . CYS E  3 86  ? 90.817  15.006   -7.190  1.00 51.53  ? 84  CYS E CA  1 
ATOM   3370  C  C   . CYS E  3 86  ? 91.245  13.976   -8.223  1.00 66.96  ? 84  CYS E C   1 
ATOM   3371  O  O   . CYS E  3 86  ? 92.421  13.828   -8.511  1.00 63.45  ? 84  CYS E O   1 
ATOM   3372  C  CB  . CYS E  3 86  ? 90.600  16.354   -7.866  1.00 51.22  ? 84  CYS E CB  1 
ATOM   3373  S  SG  . CYS E  3 86  ? 91.728  16.724   -9.200  1.00 72.45  ? 84  CYS E SG  1 
ATOM   3374  N  N   . CYS E  3 87  ? 90.283  13.261   -8.782  1.00 85.92  ? 85  CYS E N   1 
ATOM   3375  C  CA  . CYS E  3 87  ? 90.584  12.334   -9.854  1.00 72.19  ? 85  CYS E CA  1 
ATOM   3376  C  C   . CYS E  3 87  ? 89.646  12.534   -11.029 1.00 65.32  ? 85  CYS E C   1 
ATOM   3377  O  O   . CYS E  3 87  ? 88.649  13.237   -10.924 1.00 85.21  ? 85  CYS E O   1 
ATOM   3378  C  CB  . CYS E  3 87  ? 90.518  10.896   -9.356  1.00 67.99  ? 85  CYS E CB  1 
ATOM   3379  S  SG  . CYS E  3 87  ? 89.022  10.501   -8.459  1.00 95.01  ? 85  CYS E SG  1 
ATOM   3380  N  N   . CYS E  3 88  ? 89.976  11.900   -12.146 1.00 48.75  ? 86  CYS E N   1 
ATOM   3381  C  CA  . CYS E  3 88  ? 89.244  12.084   -13.382 1.00 55.79  ? 86  CYS E CA  1 
ATOM   3382  C  C   . CYS E  3 88  ? 89.553  10.992   -14.404 1.00 77.88  ? 86  CYS E C   1 
ATOM   3383  O  O   . CYS E  3 88  ? 90.413  10.146   -14.183 1.00 93.67  ? 86  CYS E O   1 
ATOM   3384  C  CB  . CYS E  3 88  ? 89.629  13.413   -13.974 1.00 68.00  ? 86  CYS E CB  1 
ATOM   3385  S  SG  . CYS E  3 88  ? 91.409  13.544   -14.327 1.00 71.23  ? 86  CYS E SG  1 
ATOM   3386  N  N   . GLU E  3 89  ? 88.860  11.037   -15.536 1.00 63.97  ? 87  GLU E N   1 
ATOM   3387  C  CA  . GLU E  3 89  ? 88.966  10.006   -16.556 1.00 56.39  ? 87  GLU E CA  1 
ATOM   3388  C  C   . GLU E  3 89  ? 89.194  10.684   -17.893 1.00 71.34  ? 87  GLU E C   1 
ATOM   3389  O  O   . GLU E  3 89  ? 88.454  11.579   -18.272 1.00 98.63  ? 87  GLU E O   1 
ATOM   3390  C  CB  . GLU E  3 89  ? 87.673  9.187    -16.590 1.00 73.74  ? 87  GLU E CB  1 
ATOM   3391  C  CG  . GLU E  3 89  ? 87.794  7.781    -17.142 1.00 92.80  ? 87  GLU E CG  1 
ATOM   3392  C  CD  . GLU E  3 89  ? 86.538  6.953    -16.897 1.00 104.13 ? 87  GLU E CD  1 
ATOM   3393  O  OE1 . GLU E  3 89  ? 85.561  7.520    -16.353 1.00 105.55 ? 87  GLU E OE1 1 
ATOM   3394  O  OE2 . GLU E  3 89  ? 86.527  5.744    -17.246 1.00 88.48  ? 87  GLU E OE2 1 
ATOM   3395  N  N   . GLY E  3 90  ? 90.231  10.275   -18.607 1.00 83.80  ? 88  GLY E N   1 
ATOM   3396  C  CA  . GLY E  3 90  ? 90.548  10.865   -19.897 1.00 77.97  ? 88  GLY E CA  1 
ATOM   3397  C  C   . GLY E  3 90  ? 91.975  11.351   -19.909 1.00 71.29  ? 88  GLY E C   1 
ATOM   3398  O  O   . GLY E  3 90  ? 92.406  11.996   -18.966 1.00 80.64  ? 88  GLY E O   1 
ATOM   3399  N  N   . ASN E  3 91  ? 92.708  11.039   -20.971 1.00 66.55  ? 89  ASN E N   1 
ATOM   3400  C  CA  . ASN E  3 91  ? 94.127  11.366   -21.056 1.00 63.59  ? 89  ASN E CA  1 
ATOM   3401  C  C   . ASN E  3 91  ? 94.489  12.787   -20.638 1.00 68.03  ? 89  ASN E C   1 
ATOM   3402  O  O   . ASN E  3 91  ? 93.956  13.751   -21.163 1.00 80.84  ? 89  ASN E O   1 
ATOM   3403  C  CB  . ASN E  3 91  ? 94.642  11.093   -22.460 1.00 69.29  ? 89  ASN E CB  1 
ATOM   3404  C  CG  . ASN E  3 91  ? 94.774  9.630    -22.744 1.00 77.51  ? 89  ASN E CG  1 
ATOM   3405  O  OD1 . ASN E  3 91  ? 94.171  8.814    -22.067 1.00 77.96  ? 89  ASN E OD1 1 
ATOM   3406  N  ND2 . ASN E  3 91  ? 95.572  9.283    -23.746 1.00 92.80  ? 89  ASN E ND2 1 
ATOM   3407  N  N   . PHE E  3 92  ? 95.406  12.900   -19.687 1.00 72.44  ? 90  PHE E N   1 
ATOM   3408  C  CA  . PHE E  3 92  ? 95.922  14.185   -19.219 1.00 72.47  ? 90  PHE E CA  1 
ATOM   3409  C  C   . PHE E  3 92  ? 94.866  15.076   -18.580 1.00 73.57  ? 90  PHE E C   1 
ATOM   3410  O  O   . PHE E  3 92  ? 95.034  16.288   -18.484 1.00 91.29  ? 90  PHE E O   1 
ATOM   3411  C  CB  . PHE E  3 92  ? 96.649  14.924   -20.344 1.00 60.83  ? 90  PHE E CB  1 
ATOM   3412  C  CG  . PHE E  3 92  ? 97.782  14.149   -20.929 1.00 65.02  ? 90  PHE E CG  1 
ATOM   3413  C  CD1 . PHE E  3 92  ? 98.711  13.550   -20.120 1.00 70.83  ? 90  PHE E CD1 1 
ATOM   3414  C  CD2 . PHE E  3 92  ? 97.896  13.988   -22.287 1.00 83.29  ? 90  PHE E CD2 1 
ATOM   3415  C  CE1 . PHE E  3 92  ? 99.734  12.826   -20.659 1.00 82.03  ? 90  PHE E CE1 1 
ATOM   3416  C  CE2 . PHE E  3 92  ? 98.924  13.257   -22.822 1.00 79.81  ? 90  PHE E CE2 1 
ATOM   3417  C  CZ  . PHE E  3 92  ? 99.836  12.678   -22.011 1.00 71.93  ? 90  PHE E CZ  1 
ATOM   3418  N  N   . CYS E  3 93  ? 93.782  14.473   -18.127 1.00 69.39  ? 91  CYS E N   1 
ATOM   3419  C  CA  . CYS E  3 93  ? 92.715  15.247   -17.537 1.00 84.05  ? 91  CYS E CA  1 
ATOM   3420  C  C   . CYS E  3 93  ? 93.203  15.951   -16.277 1.00 87.79  ? 91  CYS E C   1 
ATOM   3421  O  O   . CYS E  3 93  ? 92.537  16.872   -15.790 1.00 110.86 ? 91  CYS E O   1 
ATOM   3422  C  CB  . CYS E  3 93  ? 91.533  14.349   -17.232 1.00 94.02  ? 91  CYS E CB  1 
ATOM   3423  S  SG  . CYS E  3 93  ? 91.985  12.994   -16.188 1.00 107.18 ? 91  CYS E SG  1 
ATOM   3424  N  N   . ASN E  3 94  ? 94.367  15.539   -15.763 1.00 54.93  ? 92  ASN E N   1 
ATOM   3425  C  CA  . ASN E  3 94  ? 94.906  16.148   -14.538 1.00 46.92  ? 92  ASN E CA  1 
ATOM   3426  C  C   . ASN E  3 94  ? 95.914  17.264   -14.761 1.00 55.13  ? 92  ASN E C   1 
ATOM   3427  O  O   . ASN E  3 94  ? 96.580  17.714   -13.830 1.00 59.21  ? 92  ASN E O   1 
ATOM   3428  C  CB  . ASN E  3 94  ? 95.448  15.113   -13.538 1.00 38.64  ? 92  ASN E CB  1 
ATOM   3429  C  CG  . ASN E  3 94  ? 96.631  14.356   -14.064 1.00 57.19  ? 92  ASN E CG  1 
ATOM   3430  O  OD1 . ASN E  3 94  ? 96.940  14.419   -15.246 1.00 69.23  ? 92  ASN E OD1 1 
ATOM   3431  N  ND2 . ASN E  3 94  ? 97.298  13.621   -13.192 1.00 62.32  ? 92  ASN E ND2 1 
ATOM   3432  N  N   . GLU E  3 95  ? 96.012  17.728   -15.996 1.00 68.86  ? 93  GLU E N   1 
ATOM   3433  C  CA  . GLU E  3 95  ? 96.874  18.856   -16.295 1.00 77.23  ? 93  GLU E CA  1 
ATOM   3434  C  C   . GLU E  3 95  ? 96.493  20.041   -15.426 1.00 88.48  ? 93  GLU E C   1 
ATOM   3435  O  O   . GLU E  3 95  ? 97.334  20.583   -14.716 1.00 107.07 ? 93  GLU E O   1 
ATOM   3436  C  CB  . GLU E  3 95  ? 96.790  19.220   -17.774 1.00 87.47  ? 93  GLU E CB  1 
ATOM   3437  C  CG  . GLU E  3 95  ? 97.403  20.559   -18.122 1.00 111.37 ? 93  GLU E CG  1 
ATOM   3438  C  CD  . GLU E  3 95  ? 98.856  20.692   -17.684 1.00 132.05 ? 93  GLU E CD  1 
ATOM   3439  O  OE1 . GLU E  3 95  ? 99.348  19.829   -16.929 1.00 139.49 ? 93  GLU E OE1 1 
ATOM   3440  O  OE2 . GLU E  3 95  ? 99.506  21.676   -18.093 1.00 134.57 ? 93  GLU E OE2 1 
ATOM   3441  N  N   . ARG E  3 96  ? 95.222  20.430   -15.484 1.00 80.49  ? 94  ARG E N   1 
ATOM   3442  C  CA  . ARG E  3 96  ? 94.688  21.520   -14.672 1.00 74.91  ? 94  ARG E CA  1 
ATOM   3443  C  C   . ARG E  3 96  ? 93.648  20.970   -13.698 1.00 65.87  ? 94  ARG E C   1 
ATOM   3444  O  O   . ARG E  3 96  ? 92.975  19.989   -13.997 1.00 72.86  ? 94  ARG E O   1 
ATOM   3445  C  CB  . ARG E  3 96  ? 94.103  22.630   -15.566 1.00 75.15  ? 94  ARG E CB  1 
ATOM   3446  C  CG  . ARG E  3 96  ? 93.156  22.140   -16.683 1.00 83.08  ? 94  ARG E CG  1 
ATOM   3447  C  CD  . ARG E  3 96  ? 93.587  22.532   -18.122 1.00 103.64 ? 94  ARG E CD  1 
ATOM   3448  N  NE  . ARG E  3 96  ? 94.160  21.421   -18.903 1.00 125.95 ? 94  ARG E NE  1 
ATOM   3449  C  CZ  . ARG E  3 96  ? 93.468  20.387   -19.395 1.00 114.98 ? 94  ARG E CZ  1 
ATOM   3450  N  NH1 . ARG E  3 96  ? 92.162  20.299   -19.179 1.00 114.11 ? 94  ARG E NH1 1 
ATOM   3451  N  NH2 . ARG E  3 96  ? 94.081  19.426   -20.093 1.00 74.55  ? 94  ARG E NH2 1 
ATOM   3452  N  N   . PHE E  3 97  ? 93.534  21.586   -12.527 1.00 47.74  ? 95  PHE E N   1 
ATOM   3453  C  CA  . PHE E  3 97  ? 92.589  21.144   -11.515 1.00 57.66  ? 95  PHE E CA  1 
ATOM   3454  C  C   . PHE E  3 97  ? 91.994  22.317   -10.758 1.00 80.61  ? 95  PHE E C   1 
ATOM   3455  O  O   . PHE E  3 97  ? 92.571  23.390   -10.770 1.00 101.71 ? 95  PHE E O   1 
ATOM   3456  C  CB  . PHE E  3 97  ? 93.279  20.227   -10.539 1.00 56.73  ? 95  PHE E CB  1 
ATOM   3457  C  CG  . PHE E  3 97  ? 94.413  20.864   -9.824  1.00 78.36  ? 95  PHE E CG  1 
ATOM   3458  C  CD1 . PHE E  3 97  ? 94.240  21.392   -8.558  1.00 79.26  ? 95  PHE E CD1 1 
ATOM   3459  C  CD2 . PHE E  3 97  ? 95.662  20.930   -10.414 1.00 80.30  ? 95  PHE E CD2 1 
ATOM   3460  C  CE1 . PHE E  3 97  ? 95.295  21.977   -7.894  1.00 64.88  ? 95  PHE E CE1 1 
ATOM   3461  C  CE2 . PHE E  3 97  ? 96.715  21.510   -9.764  1.00 53.99  ? 95  PHE E CE2 1 
ATOM   3462  C  CZ  . PHE E  3 97  ? 96.533  22.036   -8.501  1.00 48.31  ? 95  PHE E CZ  1 
ATOM   3463  N  N   . THR E  3 98  ? 90.847  22.115   -10.108 1.00 89.12  ? 96  THR E N   1 
ATOM   3464  C  CA  . THR E  3 98  ? 90.166  23.181   -9.371  1.00 85.82  ? 96  THR E CA  1 
ATOM   3465  C  C   . THR E  3 98  ? 89.428  22.670   -8.133  1.00 83.96  ? 96  THR E C   1 
ATOM   3466  O  O   . THR E  3 98  ? 89.458  21.483   -7.844  1.00 85.20  ? 96  THR E O   1 
ATOM   3467  C  CB  . THR E  3 98  ? 89.157  23.912   -10.258 1.00 89.56  ? 96  THR E CB  1 
ATOM   3468  O  OG1 . THR E  3 98  ? 88.281  22.957   -10.837 1.00 69.16  ? 96  THR E OG1 1 
ATOM   3469  C  CG2 . THR E  3 98  ? 89.848  24.654   -11.381 1.00 113.75 ? 96  THR E CG2 1 
ATOM   3470  N  N   . HIS E  3 99  ? 88.755  23.570   -7.413  1.00 86.01  ? 97  HIS E N   1 
ATOM   3471  C  CA  . HIS E  3 99  ? 88.069  23.228   -6.158  1.00 102.21 ? 97  HIS E CA  1 
ATOM   3472  C  C   . HIS E  3 99  ? 86.636  23.752   -6.084  1.00 115.51 ? 97  HIS E C   1 
ATOM   3473  O  O   . HIS E  3 99  ? 86.398  24.911   -6.393  1.00 139.23 ? 97  HIS E O   1 
ATOM   3474  C  CB  . HIS E  3 99  ? 88.850  23.783   -4.961  1.00 103.32 ? 97  HIS E CB  1 
ATOM   3475  C  CG  . HIS E  3 99  ? 88.169  23.581   -3.641  1.00 101.65 ? 97  HIS E CG  1 
ATOM   3476  N  ND1 . HIS E  3 99  ? 88.300  22.428   -2.901  1.00 112.94 ? 97  HIS E ND1 1 
ATOM   3477  C  CD2 . HIS E  3 99  ? 87.353  24.388   -2.927  1.00 103.82 ? 97  HIS E CD2 1 
ATOM   3478  C  CE1 . HIS E  3 99  ? 87.594  22.531   -1.790  1.00 100.17 ? 97  HIS E CE1 1 
ATOM   3479  N  NE2 . HIS E  3 99  ? 87.008  23.710   -1.782  1.00 95.05  ? 97  HIS E NE2 1 
ATOM   3480  N  N   . LEU E  3 100 ? 85.695  22.904   -5.662  1.00 108.29 ? 98  LEU E N   1 
ATOM   3481  C  CA  . LEU E  3 100 ? 84.314  23.333   -5.402  1.00 115.84 ? 98  LEU E CA  1 
ATOM   3482  C  C   . LEU E  3 100 ? 83.421  22.268   -4.764  1.00 107.11 ? 98  LEU E C   1 
ATOM   3483  O  O   . LEU E  3 100 ? 82.931  21.375   -5.446  1.00 85.24  ? 98  LEU E O   1 
ATOM   3484  C  CB  . LEU E  3 100 ? 83.652  23.871   -6.670  1.00 127.05 ? 98  LEU E CB  1 
ATOM   3485  C  CG  . LEU E  3 100 ? 83.373  22.935   -7.842  1.00 121.20 ? 98  LEU E CG  1 
ATOM   3486  C  CD1 . LEU E  3 100 ? 81.878  22.811   -8.061  1.00 91.99  ? 98  LEU E CD1 1 
ATOM   3487  C  CD2 . LEU E  3 100 ? 84.064  23.446   -9.106  1.00 132.59 ? 98  LEU E CD2 1 
ATOM   3488  N  N   . PRO E  3 101 ? 83.179  22.388   -3.449  1.00 105.29 ? 99  PRO E N   1 
ATOM   3489  C  CA  . PRO E  3 101 ? 82.466  21.398   -2.624  1.00 116.09 ? 99  PRO E CA  1 
ATOM   3490  C  C   . PRO E  3 101 ? 81.007  21.160   -3.011  1.00 107.67 ? 99  PRO E C   1 
ATOM   3491  O  O   . PRO E  3 101 ? 80.422  20.171   -2.552  1.00 91.77  ? 99  PRO E O   1 
ATOM   3492  C  CB  . PRO E  3 101 ? 82.553  21.987   -1.210  1.00 115.52 ? 99  PRO E CB  1 
ATOM   3493  C  CG  . PRO E  3 101 ? 82.841  23.428   -1.411  1.00 105.35 ? 99  PRO E CG  1 
ATOM   3494  C  CD  . PRO E  3 101 ? 83.656  23.529   -2.653  1.00 86.81  ? 99  PRO E CD  1 
ATOM   3495  N  N   . ARG F  3 11  ? 113.422 -42.239  -3.425  1.00 89.48  ? 9   ARG F N   1 
ATOM   3496  C  CA  . ARG F  3 11  ? 112.323 -43.185  -3.211  1.00 93.00  ? 9   ARG F CA  1 
ATOM   3497  C  C   . ARG F  3 11  ? 111.801 -43.893  -4.489  1.00 93.04  ? 9   ARG F C   1 
ATOM   3498  O  O   . ARG F  3 11  ? 111.262 -43.246  -5.394  1.00 80.60  ? 9   ARG F O   1 
ATOM   3499  C  CB  . ARG F  3 11  ? 111.174 -42.498  -2.485  1.00 65.47  ? 9   ARG F CB  1 
ATOM   3500  C  CG  . ARG F  3 11  ? 109.896 -43.305  -2.594  1.00 101.68 ? 9   ARG F CG  1 
ATOM   3501  C  CD  . ARG F  3 11  ? 110.111 -44.747  -2.134  1.00 99.30  ? 9   ARG F CD  1 
ATOM   3502  N  NE  . ARG F  3 11  ? 110.002 -44.835  -0.685  1.00 102.81 ? 9   ARG F NE  1 
ATOM   3503  C  CZ  . ARG F  3 11  ? 108.872 -45.120  -0.048  1.00 99.38  ? 9   ARG F CZ  1 
ATOM   3504  N  NH1 . ARG F  3 11  ? 107.769 -45.374  -0.742  1.00 83.00  ? 9   ARG F NH1 1 
ATOM   3505  N  NH2 . ARG F  3 11  ? 108.842 -45.163  1.278   1.00 101.99 ? 9   ARG F NH2 1 
ATOM   3506  N  N   . GLU F  3 12  ? 111.927 -45.223  -4.525  1.00 90.19  ? 10  GLU F N   1 
ATOM   3507  C  CA  . GLU F  3 12  ? 111.726 -46.022  -5.748  1.00 76.49  ? 10  GLU F CA  1 
ATOM   3508  C  C   . GLU F  3 12  ? 110.689 -47.153  -5.612  1.00 70.89  ? 10  GLU F C   1 
ATOM   3509  O  O   . GLU F  3 12  ? 110.471 -47.671  -4.523  1.00 80.62  ? 10  GLU F O   1 
ATOM   3510  C  CB  . GLU F  3 12  ? 113.074 -46.619  -6.213  1.00 61.66  ? 10  GLU F CB  1 
ATOM   3511  N  N   . CYS F  3 13  ? 110.076 -47.541  -6.732  1.00 60.43  ? 11  CYS F N   1 
ATOM   3512  C  CA  . CYS F  3 13  ? 109.087 -48.626  -6.755  1.00 56.56  ? 11  CYS F CA  1 
ATOM   3513  C  C   . CYS F  3 13  ? 109.279 -49.551  -7.941  1.00 68.23  ? 11  CYS F C   1 
ATOM   3514  O  O   . CYS F  3 13  ? 109.984 -49.230  -8.895  1.00 76.12  ? 11  CYS F O   1 
ATOM   3515  C  CB  . CYS F  3 13  ? 107.661 -48.067  -6.836  1.00 45.76  ? 11  CYS F CB  1 
ATOM   3516  S  SG  . CYS F  3 13  ? 107.034 -47.320  -5.308  1.00 92.98  ? 11  CYS F SG  1 
ATOM   3517  N  N   . ILE F  3 14  ? 108.609 -50.690  -7.896  1.00 62.87  ? 12  ILE F N   1 
ATOM   3518  C  CA  . ILE F  3 14  ? 108.586 -51.588  -9.036  1.00 64.07  ? 12  ILE F CA  1 
ATOM   3519  C  C   . ILE F  3 14  ? 107.513 -51.163  -10.017 1.00 82.41  ? 12  ILE F C   1 
ATOM   3520  O  O   . ILE F  3 14  ? 106.334 -51.052  -9.652  1.00 64.42  ? 12  ILE F O   1 
ATOM   3521  C  CB  . ILE F  3 14  ? 108.274 -53.016  -8.594  1.00 69.28  ? 12  ILE F CB  1 
ATOM   3522  C  CG1 . ILE F  3 14  ? 109.493 -53.618  -7.903  1.00 64.06  ? 12  ILE F CG1 1 
ATOM   3523  C  CG2 . ILE F  3 14  ? 107.875 -53.863  -9.784  1.00 75.22  ? 12  ILE F CG2 1 
ATOM   3524  C  CD1 . ILE F  3 14  ? 110.722 -53.542  -8.727  1.00 51.14  ? 12  ILE F CD1 1 
ATOM   3525  N  N   . TYR F  3 15  ? 107.919 -50.921  -11.259 1.00 72.61  ? 13  TYR F N   1 
ATOM   3526  C  CA  . TYR F  3 15  ? 106.962 -50.558  -12.296 1.00 77.62  ? 13  TYR F CA  1 
ATOM   3527  C  C   . TYR F  3 15  ? 106.530 -51.764  -13.111 1.00 75.40  ? 13  TYR F C   1 
ATOM   3528  O  O   . TYR F  3 15  ? 107.364 -52.560  -13.560 1.00 65.62  ? 13  TYR F O   1 
ATOM   3529  C  CB  . TYR F  3 15  ? 107.519 -49.489  -13.247 1.00 73.13  ? 13  TYR F CB  1 
ATOM   3530  C  CG  . TYR F  3 15  ? 106.444 -48.956  -14.182 1.00 75.31  ? 13  TYR F CG  1 
ATOM   3531  C  CD1 . TYR F  3 15  ? 105.472 -48.091  -13.711 1.00 71.98  ? 13  TYR F CD1 1 
ATOM   3532  C  CD2 . TYR F  3 15  ? 106.382 -49.345  -15.525 1.00 75.70  ? 13  TYR F CD2 1 
ATOM   3533  C  CE1 . TYR F  3 15  ? 104.475 -47.612  -14.538 1.00 83.81  ? 13  TYR F CE1 1 
ATOM   3534  C  CE2 . TYR F  3 15  ? 105.381 -48.862  -16.371 1.00 59.51  ? 13  TYR F CE2 1 
ATOM   3535  C  CZ  . TYR F  3 15  ? 104.430 -47.993  -15.861 1.00 73.33  ? 13  TYR F CZ  1 
ATOM   3536  O  OH  . TYR F  3 15  ? 103.406 -47.493  -16.643 1.00 87.30  ? 13  TYR F OH  1 
ATOM   3537  N  N   . TYR F  3 16  ? 105.222 -51.887  -13.309 1.00 56.13  ? 14  TYR F N   1 
ATOM   3538  C  CA  . TYR F  3 16  ? 104.685 -52.881  -14.231 1.00 59.75  ? 14  TYR F CA  1 
ATOM   3539  C  C   . TYR F  3 16  ? 103.306 -52.496  -14.740 1.00 66.40  ? 14  TYR F C   1 
ATOM   3540  O  O   . TYR F  3 16  ? 102.446 -52.033  -13.981 1.00 74.77  ? 14  TYR F O   1 
ATOM   3541  C  CB  . TYR F  3 16  ? 104.609 -54.260  -13.585 1.00 67.23  ? 14  TYR F CB  1 
ATOM   3542  C  CG  . TYR F  3 16  ? 104.141 -55.330  -14.552 1.00 69.35  ? 14  TYR F CG  1 
ATOM   3543  C  CD1 . TYR F  3 16  ? 105.049 -56.168  -15.198 1.00 68.04  ? 14  TYR F CD1 1 
ATOM   3544  C  CD2 . TYR F  3 16  ? 102.789 -55.487  -14.836 1.00 76.96  ? 14  TYR F CD2 1 
ATOM   3545  C  CE1 . TYR F  3 16  ? 104.620 -57.134  -16.088 1.00 67.23  ? 14  TYR F CE1 1 
ATOM   3546  C  CE2 . TYR F  3 16  ? 102.349 -56.454  -15.720 1.00 85.92  ? 14  TYR F CE2 1 
ATOM   3547  C  CZ  . TYR F  3 16  ? 103.268 -57.273  -16.342 1.00 88.30  ? 14  TYR F CZ  1 
ATOM   3548  O  OH  . TYR F  3 16  ? 102.825 -58.230  -17.225 1.00 93.25  ? 14  TYR F OH  1 
ATOM   3549  N  N   . ASN F  3 17  ? 103.085 -52.701  -16.031 1.00 71.36  ? 15  ASN F N   1 
ATOM   3550  C  CA  . ASN F  3 17  ? 101.793 -52.378  -16.622 1.00 71.09  ? 15  ASN F CA  1 
ATOM   3551  C  C   . ASN F  3 17  ? 101.413 -53.359  -17.717 1.00 64.51  ? 15  ASN F C   1 
ATOM   3552  O  O   . ASN F  3 17  ? 101.836 -53.216  -18.861 1.00 70.90  ? 15  ASN F O   1 
ATOM   3553  C  CB  . ASN F  3 17  ? 101.809 -50.963  -17.190 1.00 71.17  ? 15  ASN F CB  1 
ATOM   3554  C  CG  . ASN F  3 17  ? 100.512 -50.599  -17.855 1.00 70.54  ? 15  ASN F CG  1 
ATOM   3555  O  OD1 . ASN F  3 17  ? 99.487  -51.286  -17.674 1.00 60.44  ? 15  ASN F OD1 1 
ATOM   3556  N  ND2 . ASN F  3 17  ? 100.536 -49.511  -18.633 1.00 66.73  ? 15  ASN F ND2 1 
ATOM   3557  N  N   . ALA F  3 18  ? 100.620 -54.361  -17.364 1.00 71.02  ? 16  ALA F N   1 
ATOM   3558  C  CA  . ALA F  3 18  ? 100.199 -55.353  -18.335 1.00 69.71  ? 16  ALA F CA  1 
ATOM   3559  C  C   . ALA F  3 18  ? 99.607  -54.651  -19.554 1.00 64.47  ? 16  ALA F C   1 
ATOM   3560  O  O   . ALA F  3 18  ? 99.946  -54.958  -20.695 1.00 75.11  ? 16  ALA F O   1 
ATOM   3561  C  CB  . ALA F  3 18  ? 99.186  -56.281  -17.712 1.00 97.60  ? 16  ALA F CB  1 
ATOM   3562  N  N   . ASN F  3 19  ? 98.731  -53.688  -19.314 1.00 54.70  ? 17  ASN F N   1 
ATOM   3563  C  CA  . ASN F  3 19  ? 98.076  -53.038  -20.431 1.00 67.49  ? 17  ASN F CA  1 
ATOM   3564  C  C   . ASN F  3 19  ? 98.979  -52.129  -21.259 1.00 82.96  ? 17  ASN F C   1 
ATOM   3565  O  O   . ASN F  3 19  ? 98.479  -51.252  -21.981 1.00 89.92  ? 17  ASN F O   1 
ATOM   3566  C  CB  . ASN F  3 19  ? 96.875  -52.252  -19.956 1.00 71.10  ? 17  ASN F CB  1 
ATOM   3567  C  CG  . ASN F  3 19  ? 95.714  -52.417  -20.872 1.00 103.57 ? 17  ASN F CG  1 
ATOM   3568  O  OD1 . ASN F  3 19  ? 95.088  -53.482  -20.913 1.00 134.93 ? 17  ASN F OD1 1 
ATOM   3569  N  ND2 . ASN F  3 19  ? 95.423  -51.382  -21.638 1.00 96.75  ? 17  ASN F ND2 1 
ATOM   3570  N  N   . TRP F  3 20  ? 100.293 -52.347  -21.182 1.00 72.22  ? 18  TRP F N   1 
ATOM   3571  C  CA  . TRP F  3 20  ? 101.249 -51.353  -21.699 1.00 82.78  ? 18  TRP F CA  1 
ATOM   3572  C  C   . TRP F  3 20  ? 101.053 -51.050  -23.172 1.00 90.99  ? 18  TRP F C   1 
ATOM   3573  O  O   . TRP F  3 20  ? 100.881 -49.885  -23.564 1.00 75.51  ? 18  TRP F O   1 
ATOM   3574  C  CB  . TRP F  3 20  ? 102.711 -51.749  -21.438 1.00 70.55  ? 18  TRP F CB  1 
ATOM   3575  C  CG  . TRP F  3 20  ? 103.165 -52.984  -22.145 1.00 61.67  ? 18  TRP F CG  1 
ATOM   3576  C  CD1 . TRP F  3 20  ? 102.870 -54.268  -21.811 1.00 80.71  ? 18  TRP F CD1 1 
ATOM   3577  C  CD2 . TRP F  3 20  ? 104.027 -53.055  -23.293 1.00 78.20  ? 18  TRP F CD2 1 
ATOM   3578  N  NE1 . TRP F  3 20  ? 103.491 -55.142  -22.679 1.00 76.72  ? 18  TRP F NE1 1 
ATOM   3579  C  CE2 . TRP F  3 20  ? 104.205 -54.420  -23.599 1.00 62.59  ? 18  TRP F CE2 1 
ATOM   3580  C  CE3 . TRP F  3 20  ? 104.671 -52.097  -24.089 1.00 104.83 ? 18  TRP F CE3 1 
ATOM   3581  C  CZ2 . TRP F  3 20  ? 104.997 -54.850  -24.659 1.00 65.00  ? 18  TRP F CZ2 1 
ATOM   3582  C  CZ3 . TRP F  3 20  ? 105.459 -52.535  -25.156 1.00 91.25  ? 18  TRP F CZ3 1 
ATOM   3583  C  CH2 . TRP F  3 20  ? 105.614 -53.895  -25.421 1.00 73.42  ? 18  TRP F CH2 1 
ATOM   3584  N  N   . GLU F  3 21  ? 101.081 -52.102  -23.983 1.00 90.59  ? 19  GLU F N   1 
ATOM   3585  C  CA  . GLU F  3 21  ? 100.917 -51.936  -25.415 1.00 86.83  ? 19  GLU F CA  1 
ATOM   3586  C  C   . GLU F  3 21  ? 99.774  -50.966  -25.670 1.00 78.19  ? 19  GLU F C   1 
ATOM   3587  O  O   . GLU F  3 21  ? 99.901  -49.991  -26.433 1.00 63.67  ? 19  GLU F O   1 
ATOM   3588  C  CB  . GLU F  3 21  ? 100.589 -53.276  -26.056 1.00 85.87  ? 19  GLU F CB  1 
ATOM   3589  C  CG  . GLU F  3 21  ? 101.502 -54.383  -25.644 1.00 101.10 ? 19  GLU F CG  1 
ATOM   3590  C  CD  . GLU F  3 21  ? 101.784 -55.302  -26.799 1.00 109.02 ? 19  GLU F CD  1 
ATOM   3591  O  OE1 . GLU F  3 21  ? 101.719 -56.541  -26.610 1.00 103.82 ? 19  GLU F OE1 1 
ATOM   3592  O  OE2 . GLU F  3 21  ? 102.060 -54.768  -27.900 1.00 108.62 ? 19  GLU F OE2 1 
ATOM   3593  N  N   . LEU F  3 22  ? 98.656  -51.228  -25.001 1.00 72.29  ? 20  LEU F N   1 
ATOM   3594  C  CA  . LEU F  3 22  ? 97.451  -50.484  -25.301 1.00 71.18  ? 20  LEU F CA  1 
ATOM   3595  C  C   . LEU F  3 22  ? 97.590  -49.020  -24.885 1.00 66.77  ? 20  LEU F C   1 
ATOM   3596  O  O   . LEU F  3 22  ? 97.222  -48.134  -25.648 1.00 73.18  ? 20  LEU F O   1 
ATOM   3597  C  CB  . LEU F  3 22  ? 96.253  -51.165  -24.645 1.00 79.28  ? 20  LEU F CB  1 
ATOM   3598  C  CG  . LEU F  3 22  ? 94.926  -50.721  -25.243 1.00 101.02 ? 20  LEU F CG  1 
ATOM   3599  C  CD1 . LEU F  3 22  ? 94.947  -50.668  -26.777 1.00 100.58 ? 20  LEU F CD1 1 
ATOM   3600  C  CD2 . LEU F  3 22  ? 93.727  -51.491  -24.662 1.00 112.40 ? 20  LEU F CD2 1 
ATOM   3601  N  N   . GLU F  3 23  ? 98.145  -48.780  -23.694 1.00 69.43  ? 21  GLU F N   1 
ATOM   3602  C  CA  . GLU F  3 23  ? 98.250  -47.424  -23.143 1.00 74.80  ? 21  GLU F CA  1 
ATOM   3603  C  C   . GLU F  3 23  ? 99.542  -46.713  -23.594 1.00 79.58  ? 21  GLU F C   1 
ATOM   3604  O  O   . GLU F  3 23  ? 99.825  -45.577  -23.175 1.00 63.00  ? 21  GLU F O   1 
ATOM   3605  C  CB  . GLU F  3 23  ? 98.179  -47.443  -21.606 1.00 69.18  ? 21  GLU F CB  1 
ATOM   3606  C  CG  . GLU F  3 23  ? 96.872  -47.949  -21.020 1.00 81.41  ? 21  GLU F CG  1 
ATOM   3607  C  CD  . GLU F  3 23  ? 96.946  -48.233  -19.517 1.00 89.57  ? 21  GLU F CD  1 
ATOM   3608  O  OE1 . GLU F  3 23  ? 97.870  -47.720  -18.848 1.00 84.30  ? 21  GLU F OE1 1 
ATOM   3609  O  OE2 . GLU F  3 23  ? 96.070  -48.974  -19.007 1.00 99.24  ? 21  GLU F OE2 1 
ATOM   3610  N  N   . ARG F  3 24  ? 100.324 -47.378  -24.447 1.00 83.03  ? 22  ARG F N   1 
ATOM   3611  C  CA  . ARG F  3 24  ? 101.606 -46.829  -24.890 1.00 73.38  ? 22  ARG F CA  1 
ATOM   3612  C  C   . ARG F  3 24  ? 102.468 -46.412  -23.698 1.00 64.34  ? 22  ARG F C   1 
ATOM   3613  O  O   . ARG F  3 24  ? 102.692 -45.234  -23.485 1.00 71.51  ? 22  ARG F O   1 
ATOM   3614  C  CB  . ARG F  3 24  ? 101.389 -45.631  -25.821 1.00 64.06  ? 22  ARG F CB  1 
ATOM   3615  C  CG  . ARG F  3 24  ? 100.749 -45.978  -27.142 1.00 72.96  ? 22  ARG F CG  1 
ATOM   3616  C  CD  . ARG F  3 24  ? 101.635 -46.923  -27.883 1.00 94.19  ? 22  ARG F CD  1 
ATOM   3617  N  NE  . ARG F  3 24  ? 100.877 -47.855  -28.711 1.00 93.44  ? 22  ARG F NE  1 
ATOM   3618  C  CZ  . ARG F  3 24  ? 100.665 -47.695  -30.012 1.00 108.09 ? 22  ARG F CZ  1 
ATOM   3619  N  NH1 . ARG F  3 24  ? 101.143 -46.625  -30.638 1.00 122.29 ? 22  ARG F NH1 1 
ATOM   3620  N  NH2 . ARG F  3 24  ? 99.975  -48.605  -30.685 1.00 114.19 ? 22  ARG F NH2 1 
ATOM   3621  N  N   . THR F  3 25  ? 102.918 -47.381  -22.906 1.00 61.68  ? 23  THR F N   1 
ATOM   3622  C  CA  . THR F  3 25  ? 103.853 -47.136  -21.803 1.00 47.95  ? 23  THR F CA  1 
ATOM   3623  C  C   . THR F  3 25  ? 104.777 -48.335  -21.703 1.00 63.67  ? 23  THR F C   1 
ATOM   3624  O  O   . THR F  3 25  ? 104.499 -49.406  -22.278 1.00 75.38  ? 23  THR F O   1 
ATOM   3625  C  CB  . THR F  3 25  ? 103.154 -47.025  -20.439 1.00 51.06  ? 23  THR F CB  1 
ATOM   3626  O  OG1 . THR F  3 25  ? 103.287 -48.269  -19.722 1.00 50.88  ? 23  THR F OG1 1 
ATOM   3627  C  CG2 . THR F  3 25  ? 101.673 -46.652  -20.601 1.00 40.59  ? 23  THR F CG2 1 
ATOM   3628  N  N   . ASN F  3 26  ? 105.869 -48.177  -20.959 1.00 66.98  ? 24  ASN F N   1 
ATOM   3629  C  CA  . ASN F  3 26  ? 106.758 -49.309  -20.708 1.00 61.51  ? 24  ASN F CA  1 
ATOM   3630  C  C   . ASN F  3 26  ? 106.001 -50.459  -20.052 1.00 73.91  ? 24  ASN F C   1 
ATOM   3631  O  O   . ASN F  3 26  ? 104.895 -50.288  -19.506 1.00 73.16  ? 24  ASN F O   1 
ATOM   3632  C  CB  . ASN F  3 26  ? 107.952 -48.897  -19.852 1.00 50.17  ? 24  ASN F CB  1 
ATOM   3633  C  CG  . ASN F  3 26  ? 108.933 -48.025  -20.612 1.00 57.61  ? 24  ASN F CG  1 
ATOM   3634  O  OD1 . ASN F  3 26  ? 109.590 -48.495  -21.532 1.00 75.15  ? 24  ASN F OD1 1 
ATOM   3635  N  ND2 . ASN F  3 26  ? 109.040 -46.754  -20.226 1.00 63.33  ? 24  ASN F ND2 1 
ATOM   3636  N  N   . GLN F  3 27  ? 106.604 -51.636  -20.108 1.00 64.08  ? 25  GLN F N   1 
ATOM   3637  C  CA  . GLN F  3 27  ? 105.965 -52.836  -19.571 1.00 66.42  ? 25  GLN F CA  1 
ATOM   3638  C  C   . GLN F  3 27  ? 106.377 -53.142  -18.136 1.00 68.03  ? 25  GLN F C   1 
ATOM   3639  O  O   . GLN F  3 27  ? 105.541 -53.153  -17.223 1.00 69.40  ? 25  GLN F O   1 
ATOM   3640  C  CB  . GLN F  3 27  ? 106.288 -54.049  -20.425 1.00 76.93  ? 25  GLN F CB  1 
ATOM   3641  C  CG  . GLN F  3 27  ? 105.514 -55.249  -19.971 1.00 70.36  ? 25  GLN F CG  1 
ATOM   3642  C  CD  . GLN F  3 27  ? 105.843 -56.451  -20.782 1.00 74.16  ? 25  GLN F CD  1 
ATOM   3643  O  OE1 . GLN F  3 27  ? 106.887 -56.495  -21.448 1.00 88.57  ? 25  GLN F OE1 1 
ATOM   3644  N  NE2 . GLN F  3 27  ? 104.957 -57.446  -20.750 1.00 58.54  ? 25  GLN F NE2 1 
ATOM   3645  N  N   . SER F  3 28  ? 107.666 -53.406  -17.945 1.00 54.56  ? 26  SER F N   1 
ATOM   3646  C  CA  . SER F  3 28  ? 108.166 -53.625  -16.609 1.00 60.75  ? 26  SER F CA  1 
ATOM   3647  C  C   . SER F  3 28  ? 109.482 -52.884  -16.372 1.00 85.50  ? 26  SER F C   1 
ATOM   3648  O  O   . SER F  3 28  ? 110.207 -52.544  -17.312 1.00 64.47  ? 26  SER F O   1 
ATOM   3649  C  CB  . SER F  3 28  ? 108.403 -55.092  -16.418 1.00 54.04  ? 26  SER F CB  1 
ATOM   3650  O  OG  . SER F  3 28  ? 109.783 -55.336  -16.635 1.00 92.14  ? 26  SER F OG  1 
ATOM   3651  N  N   . GLY F  3 29  ? 109.797 -52.660  -15.102 1.00 103.57 ? 27  GLY F N   1 
ATOM   3652  C  CA  . GLY F  3 29  ? 111.022 -51.985  -14.719 1.00 92.31  ? 27  GLY F CA  1 
ATOM   3653  C  C   . GLY F  3 29  ? 110.849 -51.373  -13.349 1.00 88.86  ? 27  GLY F C   1 
ATOM   3654  O  O   . GLY F  3 29  ? 110.274 -51.992  -12.453 1.00 91.23  ? 27  GLY F O   1 
ATOM   3655  N  N   . LEU F  3 30  ? 111.330 -50.147  -13.189 1.00 82.31  ? 28  LEU F N   1 
ATOM   3656  C  CA  . LEU F  3 30  ? 111.176 -49.431  -11.925 1.00 78.12  ? 28  LEU F CA  1 
ATOM   3657  C  C   . LEU F  3 30  ? 110.805 -47.946  -12.123 1.00 64.72  ? 28  LEU F C   1 
ATOM   3658  O  O   . LEU F  3 30  ? 110.847 -47.435  -13.240 1.00 66.36  ? 28  LEU F O   1 
ATOM   3659  C  CB  . LEU F  3 30  ? 112.450 -49.592  -11.090 1.00 68.22  ? 28  LEU F CB  1 
ATOM   3660  C  CG  . LEU F  3 30  ? 113.749 -49.213  -11.785 1.00 70.96  ? 28  LEU F CG  1 
ATOM   3661  C  CD1 . LEU F  3 30  ? 113.833 -47.682  -11.993 1.00 82.34  ? 28  LEU F CD1 1 
ATOM   3662  C  CD2 . LEU F  3 30  ? 114.923 -49.723  -10.968 1.00 65.62  ? 28  LEU F CD2 1 
ATOM   3663  N  N   . GLU F  3 31  ? 110.451 -47.262  -11.038 1.00 53.53  ? 29  GLU F N   1 
ATOM   3664  C  CA  . GLU F  3 31  ? 109.968 -45.893  -11.140 1.00 64.39  ? 29  GLU F CA  1 
ATOM   3665  C  C   . GLU F  3 31  ? 110.498 -45.095  -9.960  1.00 68.80  ? 29  GLU F C   1 
ATOM   3666  O  O   . GLU F  3 31  ? 110.390 -45.538  -8.821  1.00 75.59  ? 29  GLU F O   1 
ATOM   3667  C  CB  . GLU F  3 31  ? 108.421 -45.876  -11.150 1.00 56.01  ? 29  GLU F CB  1 
ATOM   3668  C  CG  . GLU F  3 31  ? 107.769 -44.635  -11.790 1.00 66.34  ? 29  GLU F CG  1 
ATOM   3669  C  CD  . GLU F  3 31  ? 106.250 -44.637  -11.677 1.00 79.91  ? 29  GLU F CD  1 
ATOM   3670  O  OE1 . GLU F  3 31  ? 105.719 -45.337  -10.795 1.00 87.19  ? 29  GLU F OE1 1 
ATOM   3671  O  OE2 . GLU F  3 31  ? 105.578 -43.941  -12.466 1.00 81.42  ? 29  GLU F OE2 1 
ATOM   3672  N  N   . ARG F  3 32  ? 111.092 -43.932  -10.224 1.00 67.27  ? 30  ARG F N   1 
ATOM   3673  C  CA  . ARG F  3 32  ? 111.442 -43.011  -9.139  1.00 60.13  ? 30  ARG F CA  1 
ATOM   3674  C  C   . ARG F  3 32  ? 110.247 -42.085  -8.888  1.00 74.63  ? 30  ARG F C   1 
ATOM   3675  O  O   . ARG F  3 32  ? 109.680 -41.522  -9.833  1.00 97.64  ? 30  ARG F O   1 
ATOM   3676  C  CB  . ARG F  3 32  ? 112.702 -42.211  -9.472  1.00 46.77  ? 30  ARG F CB  1 
ATOM   3677  N  N   . CYS F  3 33  ? 109.853 -41.932  -7.624  1.00 72.01  ? 31  CYS F N   1 
ATOM   3678  C  CA  . CYS F  3 33  ? 108.555 -41.325  -7.304  1.00 83.48  ? 31  CYS F CA  1 
ATOM   3679  C  C   . CYS F  3 33  ? 108.575 -39.804  -7.166  1.00 97.35  ? 31  CYS F C   1 
ATOM   3680  O  O   . CYS F  3 33  ? 109.100 -39.283  -6.183  1.00 101.43 ? 31  CYS F O   1 
ATOM   3681  C  CB  . CYS F  3 33  ? 107.985 -41.943  -6.020  1.00 74.93  ? 31  CYS F CB  1 
ATOM   3682  S  SG  . CYS F  3 33  ? 107.844 -43.736  -6.060  1.00 107.71 ? 31  CYS F SG  1 
ATOM   3683  N  N   . GLU F  3 34  ? 107.992 -39.095  -8.134  1.00 104.30 ? 32  GLU F N   1 
ATOM   3684  C  CA  . GLU F  3 34  ? 107.856 -37.642  -8.020  1.00 103.75 ? 32  GLU F CA  1 
ATOM   3685  C  C   . GLU F  3 34  ? 106.847 -37.342  -6.908  1.00 106.53 ? 32  GLU F C   1 
ATOM   3686  O  O   . GLU F  3 34  ? 105.746 -37.883  -6.914  1.00 101.64 ? 32  GLU F O   1 
ATOM   3687  C  CB  . GLU F  3 34  ? 107.405 -37.024  -9.348  1.00 82.20  ? 32  GLU F CB  1 
ATOM   3688  N  N   . GLY F  3 35  ? 107.218 -36.501  -5.945  1.00 100.99 ? 33  GLY F N   1 
ATOM   3689  C  CA  . GLY F  3 35  ? 106.353 -36.265  -4.805  1.00 95.97  ? 33  GLY F CA  1 
ATOM   3690  C  C   . GLY F  3 35  ? 106.522 -34.926  -4.119  1.00 102.65 ? 33  GLY F C   1 
ATOM   3691  O  O   . GLY F  3 35  ? 107.575 -34.303  -4.220  1.00 105.24 ? 33  GLY F O   1 
ATOM   3692  N  N   . GLU F  3 36  ? 105.475 -34.510  -3.403  1.00 106.17 ? 34  GLU F N   1 
ATOM   3693  C  CA  . GLU F  3 36  ? 105.411 -33.226  -2.698  1.00 114.65 ? 34  GLU F CA  1 
ATOM   3694  C  C   . GLU F  3 36  ? 106.382 -33.134  -1.520  1.00 140.31 ? 34  GLU F C   1 
ATOM   3695  O  O   . GLU F  3 36  ? 106.660 -34.134  -0.856  1.00 143.90 ? 34  GLU F O   1 
ATOM   3696  C  CB  . GLU F  3 36  ? 103.984 -32.974  -2.206  1.00 114.53 ? 34  GLU F CB  1 
ATOM   3697  N  N   . GLN F  3 37  ? 106.872 -31.920  -1.260  1.00 156.47 ? 35  GLN F N   1 
ATOM   3698  C  CA  . GLN F  3 37  ? 107.950 -31.681  -0.290  1.00 163.40 ? 35  GLN F CA  1 
ATOM   3699  C  C   . GLN F  3 37  ? 107.862 -32.542  0.973   1.00 156.42 ? 35  GLN F C   1 
ATOM   3700  O  O   . GLN F  3 37  ? 108.656 -33.474  1.166   1.00 151.79 ? 35  GLN F O   1 
ATOM   3701  C  CB  . GLN F  3 37  ? 108.019 -30.194  0.087   1.00 153.86 ? 35  GLN F CB  1 
ATOM   3702  N  N   . ASP F  3 38  ? 106.896 -32.224  1.829   1.00 130.60 ? 36  ASP F N   1 
ATOM   3703  C  CA  . ASP F  3 38  ? 106.750 -32.924  3.098   1.00 115.00 ? 36  ASP F CA  1 
ATOM   3704  C  C   . ASP F  3 38  ? 105.532 -33.860  3.115   1.00 117.92 ? 36  ASP F C   1 
ATOM   3705  O  O   . ASP F  3 38  ? 104.812 -33.942  4.114   1.00 115.85 ? 36  ASP F O   1 
ATOM   3706  C  CB  . ASP F  3 38  ? 106.691 -31.920  4.256   1.00 106.73 ? 36  ASP F CB  1 
ATOM   3707  N  N   . LYS F  3 39  ? 105.299 -34.553  2.003   1.00 112.66 ? 37  LYS F N   1 
ATOM   3708  C  CA  . LYS F  3 39  ? 104.282 -35.600  1.955   1.00 100.33 ? 37  LYS F CA  1 
ATOM   3709  C  C   . LYS F  3 39  ? 104.975 -36.959  1.775   1.00 92.96  ? 37  LYS F C   1 
ATOM   3710  O  O   . LYS F  3 39  ? 106.102 -37.031  1.270   1.00 76.13  ? 37  LYS F O   1 
ATOM   3711  C  CB  . LYS F  3 39  ? 103.247 -35.331  0.843   1.00 87.28  ? 37  LYS F CB  1 
ATOM   3712  C  CG  . LYS F  3 39  ? 102.027 -34.499  1.290   1.00 76.65  ? 37  LYS F CG  1 
ATOM   3713  C  CD  . LYS F  3 39  ? 101.010 -34.270  0.166   1.00 88.15  ? 37  LYS F CD  1 
ATOM   3714  C  CE  . LYS F  3 39  ? 99.683  -33.744  0.719   1.00 99.17  ? 37  LYS F CE  1 
ATOM   3715  N  NZ  . LYS F  3 39  ? 98.499  -34.548  0.259   1.00 100.16 ? 37  LYS F NZ  1 
ATOM   3716  N  N   . ARG F  3 40  ? 104.319 -38.030  2.211   1.00 77.56  ? 38  ARG F N   1 
ATOM   3717  C  CA  . ARG F  3 40  ? 104.903 -39.366  2.096   1.00 73.73  ? 38  ARG F CA  1 
ATOM   3718  C  C   . ARG F  3 40  ? 104.757 -39.937  0.682   1.00 77.84  ? 38  ARG F C   1 
ATOM   3719  O  O   . ARG F  3 40  ? 103.994 -39.419  -0.133  1.00 81.41  ? 38  ARG F O   1 
ATOM   3720  C  CB  . ARG F  3 40  ? 104.262 -40.344  3.095   1.00 77.07  ? 38  ARG F CB  1 
ATOM   3721  C  CG  . ARG F  3 40  ? 104.263 -39.914  4.561   1.00 68.06  ? 38  ARG F CG  1 
ATOM   3722  C  CD  . ARG F  3 40  ? 104.213 -41.156  5.455   1.00 77.56  ? 38  ARG F CD  1 
ATOM   3723  N  NE  . ARG F  3 40  ? 103.690 -40.888  6.801   1.00 96.87  ? 38  ARG F NE  1 
ATOM   3724  C  CZ  . ARG F  3 40  ? 103.387 -41.836  7.693   1.00 95.97  ? 38  ARG F CZ  1 
ATOM   3725  N  NH1 . ARG F  3 40  ? 103.553 -43.117  7.386   1.00 87.85  ? 38  ARG F NH1 1 
ATOM   3726  N  NH2 . ARG F  3 40  ? 102.917 -41.510  8.894   1.00 87.96  ? 38  ARG F NH2 1 
ATOM   3727  N  N   . LEU F  3 41  ? 105.475 -41.024  0.410   1.00 83.39  ? 39  LEU F N   1 
ATOM   3728  C  CA  . LEU F  3 41  ? 105.368 -41.731  -0.867  1.00 72.77  ? 39  LEU F CA  1 
ATOM   3729  C  C   . LEU F  3 41  ? 105.141 -43.234  -0.649  1.00 78.49  ? 39  LEU F C   1 
ATOM   3730  O  O   . LEU F  3 41  ? 105.491 -43.779  0.403   1.00 90.33  ? 39  LEU F O   1 
ATOM   3731  C  CB  . LEU F  3 41  ? 106.606 -41.480  -1.734  1.00 60.48  ? 39  LEU F CB  1 
ATOM   3732  C  CG  . LEU F  3 41  ? 106.774 -40.016  -2.184  1.00 72.00  ? 39  LEU F CG  1 
ATOM   3733  C  CD1 . LEU F  3 41  ? 108.164 -39.722  -2.714  1.00 89.35  ? 39  LEU F CD1 1 
ATOM   3734  C  CD2 . LEU F  3 41  ? 105.748 -39.651  -3.231  1.00 63.67  ? 39  LEU F CD2 1 
ATOM   3735  N  N   . HIS F  3 42  ? 104.555 -43.896  -1.646  1.00 76.07  ? 40  HIS F N   1 
ATOM   3736  C  CA  . HIS F  3 42  ? 104.165 -45.294  -1.514  1.00 66.50  ? 40  HIS F CA  1 
ATOM   3737  C  C   . HIS F  3 42  ? 104.318 -46.102  -2.800  1.00 68.48  ? 40  HIS F C   1 
ATOM   3738  O  O   . HIS F  3 42  ? 104.539 -45.555  -3.873  1.00 63.44  ? 40  HIS F O   1 
ATOM   3739  C  CB  . HIS F  3 42  ? 102.717 -45.365  -1.097  1.00 66.29  ? 40  HIS F CB  1 
ATOM   3740  C  CG  . HIS F  3 42  ? 102.395 -44.536  0.100   1.00 74.32  ? 40  HIS F CG  1 
ATOM   3741  N  ND1 . HIS F  3 42  ? 102.381 -45.055  1.376   1.00 78.18  ? 40  HIS F ND1 1 
ATOM   3742  C  CD2 . HIS F  3 42  ? 102.049 -43.231  0.216   1.00 82.15  ? 40  HIS F CD2 1 
ATOM   3743  C  CE1 . HIS F  3 42  ? 102.046 -44.103  2.228   1.00 96.40  ? 40  HIS F CE1 1 
ATOM   3744  N  NE2 . HIS F  3 42  ? 101.842 -42.986  1.550   1.00 92.61  ? 40  HIS F NE2 1 
ATOM   3745  N  N   . CYS F  3 43  ? 104.185 -47.418  -2.679  1.00 69.37  ? 41  CYS F N   1 
ATOM   3746  C  CA  . CYS F  3 43  ? 104.162 -48.299  -3.840  1.00 54.51  ? 41  CYS F CA  1 
ATOM   3747  C  C   . CYS F  3 43  ? 102.857 -49.089  -3.871  1.00 68.13  ? 41  CYS F C   1 
ATOM   3748  O  O   . CYS F  3 43  ? 102.277 -49.409  -2.826  1.00 76.24  ? 41  CYS F O   1 
ATOM   3749  C  CB  . CYS F  3 43  ? 105.336 -49.272  -3.807  1.00 45.11  ? 41  CYS F CB  1 
ATOM   3750  S  SG  . CYS F  3 43  ? 106.971 -48.512  -3.659  1.00 114.02 ? 41  CYS F SG  1 
ATOM   3751  N  N   . TYR F  3 44  ? 102.387 -49.401  -5.072  1.00 67.39  ? 42  TYR F N   1 
ATOM   3752  C  CA  . TYR F  3 44  ? 101.191 -50.213  -5.209  1.00 69.35  ? 42  TYR F CA  1 
ATOM   3753  C  C   . TYR F  3 44  ? 101.404 -51.373  -6.166  1.00 71.23  ? 42  TYR F C   1 
ATOM   3754  O  O   . TYR F  3 44  ? 102.335 -51.399  -7.006  1.00 59.97  ? 42  TYR F O   1 
ATOM   3755  C  CB  . TYR F  3 44  ? 99.989  -49.391  -5.675  1.00 55.35  ? 42  TYR F CB  1 
ATOM   3756  C  CG  . TYR F  3 44  ? 99.972  -49.146  -7.167  1.00 68.74  ? 42  TYR F CG  1 
ATOM   3757  C  CD1 . TYR F  3 44  ? 100.836 -48.227  -7.747  1.00 73.77  ? 42  TYR F CD1 1 
ATOM   3758  C  CD2 . TYR F  3 44  ? 99.095  -49.835  -7.996  1.00 68.13  ? 42  TYR F CD2 1 
ATOM   3759  C  CE1 . TYR F  3 44  ? 100.832 -47.996  -9.110  1.00 88.18  ? 42  TYR F CE1 1 
ATOM   3760  C  CE2 . TYR F  3 44  ? 99.083  -49.608  -9.369  1.00 77.38  ? 42  TYR F CE2 1 
ATOM   3761  C  CZ  . TYR F  3 44  ? 99.958  -48.685  -9.918  1.00 88.64  ? 42  TYR F CZ  1 
ATOM   3762  O  OH  . TYR F  3 44  ? 99.972  -48.443  -11.273 1.00 93.32  ? 42  TYR F OH  1 
ATOM   3763  N  N   . ALA F  3 45  ? 100.508 -52.336  -6.004  1.00 61.75  ? 43  ALA F N   1 
ATOM   3764  C  CA  . ALA F  3 45  ? 100.396 -53.459  -6.898  1.00 53.00  ? 43  ALA F CA  1 
ATOM   3765  C  C   . ALA F  3 45  ? 98.916  -53.797  -6.984  1.00 65.73  ? 43  ALA F C   1 
ATOM   3766  O  O   . ALA F  3 45  ? 98.155  -53.562  -6.042  1.00 86.55  ? 43  ALA F O   1 
ATOM   3767  C  CB  . ALA F  3 45  ? 101.164 -54.626  -6.366  1.00 51.72  ? 43  ALA F CB  1 
ATOM   3768  N  N   . SER F  3 46  ? 98.512  -54.337  -8.126  1.00 63.63  ? 44  SER F N   1 
ATOM   3769  C  CA  . SER F  3 46  ? 97.133  -54.707  -8.361  1.00 64.73  ? 44  SER F CA  1 
ATOM   3770  C  C   . SER F  3 46  ? 97.125  -55.815  -9.384  1.00 73.35  ? 44  SER F C   1 
ATOM   3771  O  O   . SER F  3 46  ? 97.858  -55.774  -10.385 1.00 79.56  ? 44  SER F O   1 
ATOM   3772  C  CB  . SER F  3 46  ? 96.347  -53.528  -8.908  1.00 63.65  ? 44  SER F CB  1 
ATOM   3773  O  OG  . SER F  3 46  ? 96.921  -53.107  -10.138 1.00 81.65  ? 44  SER F OG  1 
ATOM   3774  N  N   . TRP F  3 47  ? 96.266  -56.793  -9.133  1.00 78.75  ? 45  TRP F N   1 
ATOM   3775  C  CA  . TRP F  3 47  ? 96.233  -58.007  -9.930  1.00 70.52  ? 45  TRP F CA  1 
ATOM   3776  C  C   . TRP F  3 47  ? 94.845  -58.621  -9.903  1.00 72.20  ? 45  TRP F C   1 
ATOM   3777  O  O   . TRP F  3 47  ? 94.037  -58.298  -9.037  1.00 79.69  ? 45  TRP F O   1 
ATOM   3778  C  CB  . TRP F  3 47  ? 97.222  -59.017  -9.363  1.00 77.65  ? 45  TRP F CB  1 
ATOM   3779  C  CG  . TRP F  3 47  ? 96.933  -59.395  -7.939  1.00 83.16  ? 45  TRP F CG  1 
ATOM   3780  C  CD1 . TRP F  3 47  ? 96.272  -60.502  -7.505  1.00 90.80  ? 45  TRP F CD1 1 
ATOM   3781  C  CD2 . TRP F  3 47  ? 97.298  -58.661  -6.765  1.00 89.39  ? 45  TRP F CD2 1 
ATOM   3782  N  NE1 . TRP F  3 47  ? 96.210  -60.511  -6.133  1.00 93.25  ? 45  TRP F NE1 1 
ATOM   3783  C  CE2 . TRP F  3 47  ? 96.833  -59.391  -5.654  1.00 84.11  ? 45  TRP F CE2 1 
ATOM   3784  C  CE3 . TRP F  3 47  ? 97.985  -57.461  -6.545  1.00 109.01 ? 45  TRP F CE3 1 
ATOM   3785  C  CZ2 . TRP F  3 47  ? 97.019  -58.961  -4.345  1.00 96.82  ? 45  TRP F CZ2 1 
ATOM   3786  C  CZ3 . TRP F  3 47  ? 98.174  -57.034  -5.243  1.00 112.57 ? 45  TRP F CZ3 1 
ATOM   3787  C  CH2 . TRP F  3 47  ? 97.690  -57.784  -4.159  1.00 108.07 ? 45  TRP F CH2 1 
ATOM   3788  N  N   . ARG F  3 48  ? 94.576  -59.512  -10.853 1.00 65.87  ? 46  ARG F N   1 
ATOM   3789  C  CA  . ARG F  3 48  ? 93.308  -60.226  -10.890 1.00 72.00  ? 46  ARG F CA  1 
ATOM   3790  C  C   . ARG F  3 48  ? 93.519  -61.609  -10.291 1.00 87.12  ? 46  ARG F C   1 
ATOM   3791  O  O   . ARG F  3 48  ? 94.653  -62.101  -10.281 1.00 75.69  ? 46  ARG F O   1 
ATOM   3792  C  CB  . ARG F  3 48  ? 92.774  -60.296  -12.326 1.00 59.61  ? 46  ARG F CB  1 
ATOM   3793  C  CG  . ARG F  3 48  ? 91.917  -59.084  -12.733 1.00 57.39  ? 46  ARG F CG  1 
ATOM   3794  C  CD  . ARG F  3 48  ? 92.017  -58.798  -14.218 1.00 59.27  ? 46  ARG F CD  1 
ATOM   3795  N  NE  . ARG F  3 48  ? 90.996  -57.847  -14.653 1.00 96.56  ? 46  ARG F NE  1 
ATOM   3796  C  CZ  . ARG F  3 48  ? 91.163  -56.948  -15.628 1.00 117.72 ? 46  ARG F CZ  1 
ATOM   3797  N  NH1 . ARG F  3 48  ? 92.328  -56.869  -16.283 1.00 101.38 ? 46  ARG F NH1 1 
ATOM   3798  N  NH2 . ARG F  3 48  ? 90.163  -56.119  -15.946 1.00 110.78 ? 46  ARG F NH2 1 
ATOM   3799  N  N   . ASN F  3 49  ? 92.454  -62.220  -9.759  1.00 105.66 ? 47  ASN F N   1 
ATOM   3800  C  CA  . ASN F  3 49  ? 92.562  -63.572  -9.191  1.00 111.48 ? 47  ASN F CA  1 
ATOM   3801  C  C   . ASN F  3 49  ? 91.401  -64.469  -9.567  1.00 122.88 ? 47  ASN F C   1 
ATOM   3802  O  O   . ASN F  3 49  ? 90.335  -64.432  -8.942  1.00 136.60 ? 47  ASN F O   1 
ATOM   3803  C  CB  . ASN F  3 49  ? 92.716  -63.545  -7.669  1.00 114.69 ? 47  ASN F CB  1 
ATOM   3804  C  CG  . ASN F  3 49  ? 93.426  -64.774  -7.138  1.00 115.98 ? 47  ASN F CG  1 
ATOM   3805  O  OD1 . ASN F  3 49  ? 94.552  -65.048  -7.533  1.00 103.98 ? 47  ASN F OD1 1 
ATOM   3806  N  ND2 . ASN F  3 49  ? 92.775  -65.515  -6.235  1.00 140.15 ? 47  ASN F ND2 1 
ATOM   3807  N  N   . SER F  3 50  ? 91.630  -65.278  -10.593 1.00 117.73 ? 48  SER F N   1 
ATOM   3808  C  CA  . SER F  3 50  ? 90.617  -66.190  -11.089 1.00 122.95 ? 48  SER F CA  1 
ATOM   3809  C  C   . SER F  3 50  ? 90.787  -67.555  -10.433 1.00 129.03 ? 48  SER F C   1 
ATOM   3810  O  O   . SER F  3 50  ? 91.341  -68.486  -11.027 1.00 109.41 ? 48  SER F O   1 
ATOM   3811  C  CB  . SER F  3 50  ? 90.702  -66.288  -12.612 1.00 106.87 ? 48  SER F CB  1 
ATOM   3812  O  OG  . SER F  3 50  ? 90.833  -64.987  -13.169 1.00 85.11  ? 48  SER F OG  1 
ATOM   3813  N  N   . SER F  3 51  ? 90.308  -67.651  -9.196  1.00 137.60 ? 49  SER F N   1 
ATOM   3814  C  CA  . SER F  3 51  ? 90.425  -68.868  -8.414  1.00 129.35 ? 49  SER F CA  1 
ATOM   3815  C  C   . SER F  3 51  ? 91.858  -69.401  -8.425  1.00 122.32 ? 49  SER F C   1 
ATOM   3816  O  O   . SER F  3 51  ? 92.134  -70.414  -9.062  1.00 118.36 ? 49  SER F O   1 
ATOM   3817  C  CB  . SER F  3 51  ? 89.459  -69.932  -8.940  1.00 114.22 ? 49  SER F CB  1 
ATOM   3818  N  N   . GLY F  3 52  ? 92.764  -68.708  -7.731  1.00 111.71 ? 50  GLY F N   1 
ATOM   3819  C  CA  . GLY F  3 52  ? 94.124  -69.190  -7.519  1.00 112.16 ? 50  GLY F CA  1 
ATOM   3820  C  C   . GLY F  3 52  ? 95.152  -68.813  -8.576  1.00 117.31 ? 50  GLY F C   1 
ATOM   3821  O  O   . GLY F  3 52  ? 96.351  -68.741  -8.300  1.00 74.49  ? 50  GLY F O   1 
ATOM   3822  N  N   . THR F  3 53  ? 94.686  -68.580  -9.797  1.00 144.89 ? 51  THR F N   1 
ATOM   3823  C  CA  . THR F  3 53  ? 95.575  -68.193  -10.884 1.00 140.39 ? 51  THR F CA  1 
ATOM   3824  C  C   . THR F  3 53  ? 95.731  -66.667  -10.908 1.00 133.34 ? 51  THR F C   1 
ATOM   3825  O  O   . THR F  3 53  ? 94.755  -65.928  -11.102 1.00 123.22 ? 51  THR F O   1 
ATOM   3826  C  CB  . THR F  3 53  ? 95.072  -68.749  -12.241 1.00 132.66 ? 51  THR F CB  1 
ATOM   3827  O  OG1 . THR F  3 53  ? 96.186  -69.117  -13.059 1.00 79.46  ? 51  THR F OG1 1 
ATOM   3828  C  CG2 . THR F  3 53  ? 94.157  -67.754  -12.973 1.00 132.09 ? 51  THR F CG2 1 
ATOM   3829  N  N   . ILE F  3 54  ? 96.959  -66.201  -10.682 1.00 115.45 ? 52  ILE F N   1 
ATOM   3830  C  CA  . ILE F  3 54  ? 97.216  -64.769  -10.508 1.00 94.92  ? 52  ILE F CA  1 
ATOM   3831  C  C   . ILE F  3 54  ? 97.712  -64.090  -11.777 1.00 91.07  ? 52  ILE F C   1 
ATOM   3832  O  O   . ILE F  3 54  ? 98.810  -64.377  -12.261 1.00 97.58  ? 52  ILE F O   1 
ATOM   3833  C  CB  . ILE F  3 54  ? 98.271  -64.488  -9.403  1.00 84.87  ? 52  ILE F CB  1 
ATOM   3834  C  CG1 . ILE F  3 54  ? 97.935  -65.215  -8.100  1.00 89.95  ? 52  ILE F CG1 1 
ATOM   3835  C  CG2 . ILE F  3 54  ? 98.370  -62.995  -9.151  1.00 86.53  ? 52  ILE F CG2 1 
ATOM   3836  C  CD1 . ILE F  3 54  ? 99.062  -65.189  -7.085  1.00 81.66  ? 52  ILE F CD1 1 
ATOM   3837  N  N   . GLU F  3 55  ? 96.911  -63.170  -12.298 1.00 84.31  ? 53  GLU F N   1 
ATOM   3838  C  CA  . GLU F  3 55  ? 97.331  -62.357  -13.433 1.00 92.02  ? 53  GLU F CA  1 
ATOM   3839  C  C   . GLU F  3 55  ? 97.646  -60.917  -12.974 1.00 89.78  ? 53  GLU F C   1 
ATOM   3840  O  O   . GLU F  3 55  ? 96.775  -60.223  -12.440 1.00 98.58  ? 53  GLU F O   1 
ATOM   3841  C  CB  . GLU F  3 55  ? 96.245  -62.386  -14.521 1.00 95.50  ? 53  GLU F CB  1 
ATOM   3842  C  CG  . GLU F  3 55  ? 96.452  -61.400  -15.666 1.00 123.85 ? 53  GLU F CG  1 
ATOM   3843  C  CD  . GLU F  3 55  ? 95.151  -61.075  -16.375 1.00 136.23 ? 53  GLU F CD  1 
ATOM   3844  O  OE1 . GLU F  3 55  ? 94.282  -61.974  -16.434 1.00 133.21 ? 53  GLU F OE1 1 
ATOM   3845  O  OE2 . GLU F  3 55  ? 94.996  -59.921  -16.853 1.00 136.74 ? 53  GLU F OE2 1 
ATOM   3846  N  N   . LEU F  3 56  ? 98.889  -60.475  -13.167 1.00 78.00  ? 54  LEU F N   1 
ATOM   3847  C  CA  . LEU F  3 56  ? 99.277  -59.117  -12.770 1.00 70.81  ? 54  LEU F CA  1 
ATOM   3848  C  C   . LEU F  3 56  ? 98.600  -58.064  -13.643 1.00 73.02  ? 54  LEU F C   1 
ATOM   3849  O  O   . LEU F  3 56  ? 98.369  -58.287  -14.829 1.00 95.92  ? 54  LEU F O   1 
ATOM   3850  C  CB  . LEU F  3 56  ? 100.800 -58.930  -12.838 1.00 58.92  ? 54  LEU F CB  1 
ATOM   3851  C  CG  . LEU F  3 56  ? 101.485 -58.366  -11.587 1.00 53.29  ? 54  LEU F CG  1 
ATOM   3852  C  CD1 . LEU F  3 56  ? 102.952 -58.046  -11.854 1.00 48.12  ? 54  LEU F CD1 1 
ATOM   3853  C  CD2 . LEU F  3 56  ? 100.746 -57.140  -11.068 1.00 64.13  ? 54  LEU F CD2 1 
ATOM   3854  N  N   . VAL F  3 57  ? 98.290  -56.912  -13.063 1.00 65.88  ? 55  VAL F N   1 
ATOM   3855  C  CA  . VAL F  3 57  ? 97.649  -55.851  -13.825 1.00 72.29  ? 55  VAL F CA  1 
ATOM   3856  C  C   . VAL F  3 57  ? 98.432  -54.553  -13.802 1.00 78.51  ? 55  VAL F C   1 
ATOM   3857  O  O   . VAL F  3 57  ? 98.525  -53.876  -14.827 1.00 88.51  ? 55  VAL F O   1 
ATOM   3858  C  CB  . VAL F  3 57  ? 96.227  -55.588  -13.338 1.00 71.20  ? 55  VAL F CB  1 
ATOM   3859  C  CG1 . VAL F  3 57  ? 95.745  -54.233  -13.845 1.00 60.09  ? 55  VAL F CG1 1 
ATOM   3860  C  CG2 . VAL F  3 57  ? 95.300  -56.720  -13.794 1.00 76.54  ? 55  VAL F CG2 1 
ATOM   3861  N  N   . LYS F  3 58  ? 98.993  -54.204  -12.645 1.00 77.23  ? 56  LYS F N   1 
ATOM   3862  C  CA  . LYS F  3 58  ? 99.767  -52.964  -12.544 1.00 73.83  ? 56  LYS F CA  1 
ATOM   3863  C  C   . LYS F  3 58  ? 100.597 -52.862  -11.261 1.00 69.87  ? 56  LYS F C   1 
ATOM   3864  O  O   . LYS F  3 58  ? 100.158 -53.263  -10.197 1.00 69.15  ? 56  LYS F O   1 
ATOM   3865  C  CB  . LYS F  3 58  ? 98.837  -51.745  -12.670 1.00 56.65  ? 56  LYS F CB  1 
ATOM   3866  C  CG  . LYS F  3 58  ? 98.786  -51.113  -14.063 1.00 55.93  ? 56  LYS F CG  1 
ATOM   3867  C  CD  . LYS F  3 58  ? 97.731  -50.006  -14.104 1.00 59.06  ? 56  LYS F CD  1 
ATOM   3868  C  CE  . LYS F  3 58  ? 97.755  -49.189  -15.400 1.00 62.34  ? 56  LYS F CE  1 
ATOM   3869  N  NZ  . LYS F  3 58  ? 97.317  -49.961  -16.609 1.00 60.43  ? 56  LYS F NZ  1 
ATOM   3870  N  N   . LYS F  3 59  ? 101.800 -52.316  -11.375 1.00 61.87  ? 57  LYS F N   1 
ATOM   3871  C  CA  . LYS F  3 59  ? 102.624 -51.997  -10.213 1.00 56.72  ? 57  LYS F CA  1 
ATOM   3872  C  C   . LYS F  3 59  ? 103.247 -50.613  -10.418 1.00 72.20  ? 57  LYS F C   1 
ATOM   3873  O  O   . LYS F  3 59  ? 103.594 -50.234  -11.538 1.00 76.34  ? 57  LYS F O   1 
ATOM   3874  C  CB  . LYS F  3 59  ? 103.749 -53.028  -10.047 1.00 54.45  ? 57  LYS F CB  1 
ATOM   3875  C  CG  . LYS F  3 59  ? 103.327 -54.401  -9.579  1.00 56.69  ? 57  LYS F CG  1 
ATOM   3876  C  CD  . LYS F  3 59  ? 104.554 -55.150  -9.078  1.00 57.69  ? 57  LYS F CD  1 
ATOM   3877  C  CE  . LYS F  3 59  ? 104.334 -56.643  -8.966  1.00 53.10  ? 57  LYS F CE  1 
ATOM   3878  N  NZ  . LYS F  3 59  ? 105.657 -57.295  -9.115  1.00 81.77  ? 57  LYS F NZ  1 
ATOM   3879  N  N   . GLY F  3 60  ? 103.420 -49.855  -9.347  1.00 80.15  ? 58  GLY F N   1 
ATOM   3880  C  CA  . GLY F  3 60  ? 104.091 -48.575  -9.519  1.00 77.49  ? 58  GLY F CA  1 
ATOM   3881  C  C   . GLY F  3 60  ? 103.989 -47.629  -8.340  1.00 73.42  ? 58  GLY F C   1 
ATOM   3882  O  O   . GLY F  3 60  ? 103.625 -48.040  -7.237  1.00 64.15  ? 58  GLY F O   1 
ATOM   3883  N  N   . CYS F  3 61  ? 104.299 -46.354  -8.571  1.00 64.71  ? 59  CYS F N   1 
ATOM   3884  C  CA  . CYS F  3 61  ? 104.324 -45.371  -7.491  1.00 48.84  ? 59  CYS F CA  1 
ATOM   3885  C  C   . CYS F  3 61  ? 102.929 -44.953  -7.115  1.00 51.69  ? 59  CYS F C   1 
ATOM   3886  O  O   . CYS F  3 61  ? 102.047 -45.011  -7.946  1.00 69.55  ? 59  CYS F O   1 
ATOM   3887  C  CB  . CYS F  3 61  ? 105.144 -44.150  -7.895  1.00 49.23  ? 59  CYS F CB  1 
ATOM   3888  S  SG  . CYS F  3 61  ? 106.965 -44.368  -7.787  1.00 106.63 ? 59  CYS F SG  1 
ATOM   3889  N  N   . TRP F  3 62  ? 102.744 -44.532  -5.864  1.00 63.92  ? 60  TRP F N   1 
ATOM   3890  C  CA  . TRP F  3 62  ? 101.428 -44.175  -5.325  1.00 65.44  ? 60  TRP F CA  1 
ATOM   3891  C  C   . TRP F  3 62  ? 101.581 -43.054  -4.294  1.00 66.03  ? 60  TRP F C   1 
ATOM   3892  O  O   . TRP F  3 62  ? 102.557 -43.027  -3.540  1.00 62.99  ? 60  TRP F O   1 
ATOM   3893  C  CB  . TRP F  3 62  ? 100.766 -45.413  -4.703  1.00 57.49  ? 60  TRP F CB  1 
ATOM   3894  C  CG  . TRP F  3 62  ? 99.339  -45.255  -4.194  1.00 53.55  ? 60  TRP F CG  1 
ATOM   3895  C  CD1 . TRP F  3 62  ? 98.960  -44.946  -2.925  1.00 69.57  ? 60  TRP F CD1 1 
ATOM   3896  C  CD2 . TRP F  3 62  ? 98.131  -45.467  -4.929  1.00 50.15  ? 60  TRP F CD2 1 
ATOM   3897  N  NE1 . TRP F  3 62  ? 97.595  -44.932  -2.824  1.00 77.98  ? 60  TRP F NE1 1 
ATOM   3898  C  CE2 . TRP F  3 62  ? 97.058  -45.252  -4.040  1.00 72.01  ? 60  TRP F CE2 1 
ATOM   3899  C  CE3 . TRP F  3 62  ? 97.850  -45.814  -6.248  1.00 58.17  ? 60  TRP F CE3 1 
ATOM   3900  C  CZ2 . TRP F  3 62  ? 95.720  -45.361  -4.431  1.00 80.70  ? 60  TRP F CZ2 1 
ATOM   3901  C  CZ3 . TRP F  3 62  ? 96.521  -45.928  -6.634  1.00 74.72  ? 60  TRP F CZ3 1 
ATOM   3902  C  CH2 . TRP F  3 62  ? 95.471  -45.696  -5.727  1.00 73.35  ? 60  TRP F CH2 1 
ATOM   3903  N  N   . LEU F  3 63  ? 100.614 -42.139  -4.257  1.00 66.71  ? 61  LEU F N   1 
ATOM   3904  C  CA  . LEU F  3 63  ? 100.748 -40.917  -3.461  1.00 57.10  ? 61  LEU F CA  1 
ATOM   3905  C  C   . LEU F  3 63  ? 100.192 -40.938  -2.041  1.00 65.14  ? 61  LEU F C   1 
ATOM   3906  O  O   . LEU F  3 63  ? 99.129  -41.492  -1.770  1.00 78.99  ? 61  LEU F O   1 
ATOM   3907  C  CB  . LEU F  3 63  ? 100.123 -39.750  -4.201  1.00 52.64  ? 61  LEU F CB  1 
ATOM   3908  C  CG  . LEU F  3 63  ? 101.013 -39.144  -5.269  1.00 50.93  ? 61  LEU F CG  1 
ATOM   3909  C  CD1 . LEU F  3 63  ? 100.344 -37.903  -5.841  1.00 47.41  ? 61  LEU F CD1 1 
ATOM   3910  C  CD2 . LEU F  3 63  ? 102.352 -38.818  -4.649  1.00 44.86  ? 61  LEU F CD2 1 
ATOM   3911  N  N   . ASP F  3 64  ? 100.927 -40.278  -1.155  1.00 66.00  ? 62  ASP F N   1 
ATOM   3912  C  CA  . ASP F  3 64  ? 100.538 -40.085  0.238   1.00 68.21  ? 62  ASP F CA  1 
ATOM   3913  C  C   . ASP F  3 64  ? 99.072  -40.417  0.521   1.00 66.66  ? 62  ASP F C   1 
ATOM   3914  O  O   . ASP F  3 64  ? 98.203  -39.553  0.501   1.00 87.77  ? 62  ASP F O   1 
ATOM   3915  C  CB  . ASP F  3 64  ? 100.861 -38.646  0.668   1.00 78.47  ? 62  ASP F CB  1 
ATOM   3916  C  CG  . ASP F  3 64  ? 100.713 -38.433  2.163   1.00 94.83  ? 62  ASP F CG  1 
ATOM   3917  O  OD1 . ASP F  3 64  ? 99.562  -38.418  2.654   1.00 111.48 ? 62  ASP F OD1 1 
ATOM   3918  O  OD2 . ASP F  3 64  ? 101.748 -38.262  2.845   1.00 76.37  ? 62  ASP F OD2 1 
ATOM   3919  N  N   . ASP F  3 65  ? 98.815  -41.686  0.787   1.00 66.76  ? 63  ASP F N   1 
ATOM   3920  C  CA  . ASP F  3 65  ? 97.481  -42.161  1.114   1.00 76.74  ? 63  ASP F CA  1 
ATOM   3921  C  C   . ASP F  3 65  ? 97.631  -42.927  2.421   1.00 77.23  ? 63  ASP F C   1 
ATOM   3922  O  O   . ASP F  3 65  ? 98.422  -43.859  2.518   1.00 80.18  ? 63  ASP F O   1 
ATOM   3923  C  CB  . ASP F  3 65  ? 96.945  -43.028  -0.042  1.00 87.96  ? 63  ASP F CB  1 
ATOM   3924  C  CG  . ASP F  3 65  ? 95.788  -43.923  0.362   1.00 91.28  ? 63  ASP F CG  1 
ATOM   3925  O  OD1 . ASP F  3 65  ? 95.026  -43.551  1.272   1.00 105.72 ? 63  ASP F OD1 1 
ATOM   3926  O  OD2 . ASP F  3 65  ? 95.640  -45.009  -0.242  1.00 80.69  ? 63  ASP F OD2 1 
ATOM   3927  N  N   . PHE F  3 66  ? 96.899  -42.500  3.439   1.00 79.15  ? 64  PHE F N   1 
ATOM   3928  C  CA  . PHE F  3 66  ? 97.037  -43.043  4.791   1.00 73.02  ? 64  PHE F CA  1 
ATOM   3929  C  C   . PHE F  3 66  ? 96.802  -44.558  4.919   1.00 75.09  ? 64  PHE F C   1 
ATOM   3930  O  O   . PHE F  3 66  ? 97.198  -45.172  5.910   1.00 83.71  ? 64  PHE F O   1 
ATOM   3931  C  CB  . PHE F  3 66  ? 96.062  -42.332  5.730   1.00 67.89  ? 64  PHE F CB  1 
ATOM   3932  C  CG  . PHE F  3 66  ? 94.629  -42.684  5.475   1.00 56.35  ? 64  PHE F CG  1 
ATOM   3933  C  CD1 . PHE F  3 66  ? 94.063  -43.791  6.055   1.00 52.22  ? 64  PHE F CD1 1 
ATOM   3934  C  CD2 . PHE F  3 66  ? 93.862  -41.930  4.621   1.00 78.46  ? 64  PHE F CD2 1 
ATOM   3935  C  CE1 . PHE F  3 66  ? 92.750  -44.124  5.807   1.00 58.88  ? 64  PHE F CE1 1 
ATOM   3936  C  CE2 . PHE F  3 66  ? 92.547  -42.267  4.371   1.00 80.85  ? 64  PHE F CE2 1 
ATOM   3937  C  CZ  . PHE F  3 66  ? 91.995  -43.361  4.967   1.00 59.68  ? 64  PHE F CZ  1 
ATOM   3938  N  N   . ASN F  3 67  ? 96.118  -45.151  3.948   1.00 68.97  ? 65  ASN F N   1 
ATOM   3939  C  CA  . ASN F  3 67  ? 95.884  -46.586  3.960   1.00 63.03  ? 65  ASN F CA  1 
ATOM   3940  C  C   . ASN F  3 67  ? 97.194  -47.355  3.917   1.00 64.41  ? 65  ASN F C   1 
ATOM   3941  O  O   . ASN F  3 67  ? 97.267  -48.498  4.365   1.00 81.74  ? 65  ASN F O   1 
ATOM   3942  C  CB  . ASN F  3 67  ? 95.009  -46.996  2.777   1.00 77.58  ? 65  ASN F CB  1 
ATOM   3943  C  CG  . ASN F  3 67  ? 93.553  -46.582  2.952   1.00 83.58  ? 65  ASN F CG  1 
ATOM   3944  O  OD1 . ASN F  3 67  ? 93.077  -45.661  2.279   1.00 82.24  ? 65  ASN F OD1 1 
ATOM   3945  N  ND2 . ASN F  3 67  ? 92.832  -47.271  3.848   1.00 61.85  ? 65  ASN F ND2 1 
ATOM   3946  N  N   . CYS F  3 68  ? 98.233  -46.723  3.381   1.00 74.15  ? 66  CYS F N   1 
ATOM   3947  C  CA  . CYS F  3 68  ? 99.533  -47.374  3.220   1.00 88.86  ? 66  CYS F CA  1 
ATOM   3948  C  C   . CYS F  3 68  ? 100.479 -47.002  4.352   1.00 96.53  ? 66  CYS F C   1 
ATOM   3949  O  O   . CYS F  3 68  ? 101.584 -47.544  4.458   1.00 113.02 ? 66  CYS F O   1 
ATOM   3950  C  CB  . CYS F  3 68  ? 100.174 -46.977  1.883   1.00 84.44  ? 66  CYS F CB  1 
ATOM   3951  S  SG  . CYS F  3 68  ? 99.062  -46.990  0.450   1.00 101.88 ? 66  CYS F SG  1 
ATOM   3952  N  N   . TYR F  3 69  ? 100.043 -46.067  5.189   1.00 86.16  ? 67  TYR F N   1 
ATOM   3953  C  CA  . TYR F  3 69  ? 100.905 -45.502  6.225   1.00 94.06  ? 67  TYR F CA  1 
ATOM   3954  C  C   . TYR F  3 69  ? 101.582 -46.579  7.079   1.00 102.31 ? 67  TYR F C   1 
ATOM   3955  O  O   . TYR F  3 69  ? 100.929 -47.502  7.573   1.00 95.13  ? 67  TYR F O   1 
ATOM   3956  C  CB  . TYR F  3 69  ? 100.128 -44.508  7.109   1.00 92.13  ? 67  TYR F CB  1 
ATOM   3957  C  CG  . TYR F  3 69  ? 100.065 -43.078  6.591   1.00 70.20  ? 67  TYR F CG  1 
ATOM   3958  C  CD1 . TYR F  3 69  ? 100.845 -42.668  5.526   1.00 71.66  ? 67  TYR F CD1 1 
ATOM   3959  C  CD2 . TYR F  3 69  ? 99.230  -42.145  7.184   1.00 77.59  ? 67  TYR F CD2 1 
ATOM   3960  C  CE1 . TYR F  3 69  ? 100.789 -41.374  5.060   1.00 81.69  ? 67  TYR F CE1 1 
ATOM   3961  C  CE2 . TYR F  3 69  ? 99.170  -40.849  6.726   1.00 87.37  ? 67  TYR F CE2 1 
ATOM   3962  C  CZ  . TYR F  3 69  ? 99.955  -40.466  5.664   1.00 89.55  ? 67  TYR F CZ  1 
ATOM   3963  O  OH  . TYR F  3 69  ? 99.906  -39.167  5.200   1.00 104.87 ? 67  TYR F OH  1 
ATOM   3964  N  N   . ASP F  3 70  ? 102.896 -46.449  7.226   1.00 104.78 ? 68  ASP F N   1 
ATOM   3965  C  CA  . ASP F  3 70  ? 103.683 -47.341  8.058   1.00 117.71 ? 68  ASP F CA  1 
ATOM   3966  C  C   . ASP F  3 70  ? 103.305 -48.823  7.901   1.00 112.21 ? 68  ASP F C   1 
ATOM   3967  O  O   . ASP F  3 70  ? 102.979 -49.504  8.872   1.00 119.91 ? 68  ASP F O   1 
ATOM   3968  C  CB  . ASP F  3 70  ? 103.600 -46.904  9.523   1.00 136.53 ? 68  ASP F CB  1 
ATOM   3969  C  CG  . ASP F  3 70  ? 104.758 -47.438  10.350  1.00 170.87 ? 68  ASP F CG  1 
ATOM   3970  O  OD1 . ASP F  3 70  ? 105.863 -46.846  10.297  1.00 176.08 ? 68  ASP F OD1 1 
ATOM   3971  O  OD2 . ASP F  3 70  ? 104.569 -48.460  11.043  1.00 184.48 ? 68  ASP F OD2 1 
ATOM   3972  N  N   . ARG F  3 71  ? 103.365 -49.317  6.671   1.00 95.87  ? 69  ARG F N   1 
ATOM   3973  C  CA  . ARG F  3 71  ? 103.030 -50.702  6.397   1.00 85.41  ? 69  ARG F CA  1 
ATOM   3974  C  C   . ARG F  3 71  ? 104.147 -51.341  5.566   1.00 91.27  ? 69  ARG F C   1 
ATOM   3975  O  O   . ARG F  3 71  ? 104.346 -50.993  4.401   1.00 64.12  ? 69  ARG F O   1 
ATOM   3976  C  CB  . ARG F  3 71  ? 101.678 -50.780  5.684   1.00 71.86  ? 69  ARG F CB  1 
ATOM   3977  C  CG  . ARG F  3 71  ? 101.290 -52.181  5.241   1.00 106.64 ? 69  ARG F CG  1 
ATOM   3978  C  CD  . ARG F  3 71  ? 100.065 -52.128  4.364   1.00 104.88 ? 69  ARG F CD  1 
ATOM   3979  N  NE  . ARG F  3 71  ? 98.999  -51.394  5.025   1.00 90.56  ? 69  ARG F NE  1 
ATOM   3980  C  CZ  . ARG F  3 71  ? 97.954  -51.971  5.612   1.00 97.23  ? 69  ARG F CZ  1 
ATOM   3981  N  NH1 . ARG F  3 71  ? 97.832  -53.296  5.604   1.00 74.69  ? 69  ARG F NH1 1 
ATOM   3982  N  NH2 . ARG F  3 71  ? 97.018  -51.225  6.198   1.00 94.91  ? 69  ARG F NH2 1 
ATOM   3983  N  N   . GLN F  3 72  ? 104.878 -52.271  6.172   1.00 110.35 ? 70  GLN F N   1 
ATOM   3984  C  CA  . GLN F  3 72  ? 106.124 -52.746  5.583   1.00 115.74 ? 70  GLN F CA  1 
ATOM   3985  C  C   . GLN F  3 72  ? 105.940 -53.585  4.318   1.00 99.03  ? 70  GLN F C   1 
ATOM   3986  O  O   . GLN F  3 72  ? 106.693 -53.438  3.356   1.00 86.84  ? 70  GLN F O   1 
ATOM   3987  C  CB  . GLN F  3 72  ? 106.954 -53.515  6.617   1.00 136.89 ? 70  GLN F CB  1 
ATOM   3988  C  CG  . GLN F  3 72  ? 107.304 -52.719  7.864   1.00 146.74 ? 70  GLN F CG  1 
ATOM   3989  C  CD  . GLN F  3 72  ? 108.192 -51.524  7.576   1.00 138.75 ? 70  GLN F CD  1 
ATOM   3990  O  OE1 . GLN F  3 72  ? 108.665 -51.337  6.452   1.00 113.67 ? 70  GLN F OE1 1 
ATOM   3991  N  NE2 . GLN F  3 72  ? 108.425 -50.706  8.598   1.00 141.22 ? 70  GLN F NE2 1 
ATOM   3992  N  N   . GLU F  3 73  ? 104.954 -54.475  4.318   1.00 103.13 ? 71  GLU F N   1 
ATOM   3993  C  CA  . GLU F  3 73  ? 104.767 -55.377  3.178   1.00 95.36  ? 71  GLU F CA  1 
ATOM   3994  C  C   . GLU F  3 73  ? 103.526 -55.002  2.384   1.00 98.65  ? 71  GLU F C   1 
ATOM   3995  O  O   . GLU F  3 73  ? 102.583 -54.389  2.923   1.00 88.50  ? 71  GLU F O   1 
ATOM   3996  C  CB  . GLU F  3 73  ? 104.696 -56.851  3.622   1.00 83.20  ? 71  GLU F CB  1 
ATOM   3997  C  CG  . GLU F  3 73  ? 106.052 -57.521  3.820   1.00 123.99 ? 71  GLU F CG  1 
ATOM   3998  C  CD  . GLU F  3 73  ? 106.592 -57.361  5.229   1.00 140.01 ? 71  GLU F CD  1 
ATOM   3999  O  OE1 . GLU F  3 73  ? 105.847 -57.699  6.179   1.00 137.01 ? 71  GLU F OE1 1 
ATOM   4000  O  OE2 . GLU F  3 73  ? 107.753 -56.903  5.381   1.00 139.42 ? 71  GLU F OE2 1 
ATOM   4001  N  N   . CYS F  3 74  ? 103.524 -55.373  1.104   1.00 99.35  ? 72  CYS F N   1 
ATOM   4002  C  CA  . CYS F  3 74  ? 102.400 -55.036  0.235   1.00 110.06 ? 72  CYS F CA  1 
ATOM   4003  C  C   . CYS F  3 74  ? 101.285 -56.066  0.357   1.00 95.65  ? 72  CYS F C   1 
ATOM   4004  O  O   . CYS F  3 74  ? 101.357 -57.140  -0.245  1.00 84.59  ? 72  CYS F O   1 
ATOM   4005  C  CB  . CYS F  3 74  ? 102.850 -54.911  -1.225  1.00 115.02 ? 72  CYS F CB  1 
ATOM   4006  S  SG  . CYS F  3 74  ? 101.652 -54.000  -2.270  1.00 105.03 ? 72  CYS F SG  1 
ATOM   4007  N  N   . VAL F  3 75  ? 100.253 -55.744  1.130   1.00 96.81  ? 73  VAL F N   1 
ATOM   4008  C  CA  . VAL F  3 75  ? 99.200  -56.713  1.354   1.00 91.40  ? 73  VAL F CA  1 
ATOM   4009  C  C   . VAL F  3 75  ? 97.817  -56.155  1.107   1.00 90.57  ? 73  VAL F C   1 
ATOM   4010  O  O   . VAL F  3 75  ? 97.506  -55.036  1.514   1.00 114.87 ? 73  VAL F O   1 
ATOM   4011  C  CB  . VAL F  3 75  ? 99.261  -57.281  2.767   1.00 84.45  ? 73  VAL F CB  1 
ATOM   4012  C  CG1 . VAL F  3 75  ? 98.279  -58.415  2.905   1.00 87.75  ? 73  VAL F CG1 1 
ATOM   4013  C  CG2 . VAL F  3 75  ? 100.654 -57.769  3.068   1.00 79.72  ? 73  VAL F CG2 1 
ATOM   4014  N  N   . ALA F  3 76  ? 96.995  -56.959  0.441   1.00 69.92  ? 74  ALA F N   1 
ATOM   4015  C  CA  . ALA F  3 76  ? 95.624  -56.604  0.093   1.00 80.47  ? 74  ALA F CA  1 
ATOM   4016  C  C   . ALA F  3 76  ? 94.669  -57.048  1.195   1.00 94.20  ? 74  ALA F C   1 
ATOM   4017  O  O   . ALA F  3 76  ? 94.873  -58.098  1.795   1.00 125.62 ? 74  ALA F O   1 
ATOM   4018  C  CB  . ALA F  3 76  ? 95.244  -57.254  -1.227  1.00 76.57  ? 74  ALA F CB  1 
ATOM   4019  N  N   . THR F  3 77  ? 93.618  -56.271  1.449   1.00 85.07  ? 75  THR F N   1 
ATOM   4020  C  CA  . THR F  3 77  ? 92.759  -56.541  2.602   1.00 84.23  ? 75  THR F CA  1 
ATOM   4021  C  C   . THR F  3 77  ? 91.304  -56.836  2.254   1.00 93.32  ? 75  THR F C   1 
ATOM   4022  O  O   . THR F  3 77  ? 90.576  -57.391  3.072   1.00 116.72 ? 75  THR F O   1 
ATOM   4023  C  CB  . THR F  3 77  ? 92.803  -55.385  3.602   1.00 95.18  ? 75  THR F CB  1 
ATOM   4024  O  OG1 . THR F  3 77  ? 92.272  -54.202  2.983   1.00 91.37  ? 75  THR F OG1 1 
ATOM   4025  C  CG2 . THR F  3 77  ? 94.251  -55.140  4.071   1.00 96.57  ? 75  THR F CG2 1 
ATOM   4026  N  N   . GLU F  3 78  ? 90.882  -56.470  1.048   1.00 89.17  ? 76  GLU F N   1 
ATOM   4027  C  CA  . GLU F  3 78  ? 89.499  -56.700  0.617   1.00 89.65  ? 76  GLU F CA  1 
ATOM   4028  C  C   . GLU F  3 78  ? 89.136  -58.182  0.609   1.00 104.00 ? 76  GLU F C   1 
ATOM   4029  O  O   . GLU F  3 78  ? 89.999  -59.035  0.382   1.00 101.91 ? 76  GLU F O   1 
ATOM   4030  C  CB  . GLU F  3 78  ? 89.262  -56.091  -0.766  1.00 94.48  ? 76  GLU F CB  1 
ATOM   4031  C  CG  . GLU F  3 78  ? 89.531  -54.597  -0.836  1.00 104.10 ? 76  GLU F CG  1 
ATOM   4032  C  CD  . GLU F  3 78  ? 88.360  -53.780  -0.337  1.00 116.01 ? 76  GLU F CD  1 
ATOM   4033  O  OE1 . GLU F  3 78  ? 88.598  -52.678  0.213   1.00 116.62 ? 76  GLU F OE1 1 
ATOM   4034  O  OE2 . GLU F  3 78  ? 87.207  -54.242  -0.505  1.00 111.16 ? 76  GLU F OE2 1 
ATOM   4035  N  N   . GLU F  3 79  ? 87.858  -58.479  0.850   1.00 111.54 ? 77  GLU F N   1 
ATOM   4036  C  CA  . GLU F  3 79  ? 87.386  -59.862  0.961   1.00 114.36 ? 77  GLU F CA  1 
ATOM   4037  C  C   . GLU F  3 79  ? 87.499  -60.605  -0.361  1.00 116.21 ? 77  GLU F C   1 
ATOM   4038  O  O   . GLU F  3 79  ? 88.375  -61.455  -0.528  1.00 115.37 ? 77  GLU F O   1 
ATOM   4039  C  CB  . GLU F  3 79  ? 85.946  -59.916  1.468   1.00 107.53 ? 77  GLU F CB  1 
ATOM   4040  N  N   . ASN F  3 80  ? 86.609  -60.291  -1.295  1.00 109.54 ? 78  ASN F N   1 
ATOM   4041  C  CA  . ASN F  3 80  ? 86.671  -60.887  -2.623  1.00 120.18 ? 78  ASN F CA  1 
ATOM   4042  C  C   . ASN F  3 80  ? 86.411  -59.835  -3.688  1.00 98.81  ? 78  ASN F C   1 
ATOM   4043  O  O   . ASN F  3 80  ? 85.270  -59.521  -4.007  1.00 91.99  ? 78  ASN F O   1 
ATOM   4044  C  CB  . ASN F  3 80  ? 85.689  -62.062  -2.761  1.00 133.59 ? 78  ASN F CB  1 
ATOM   4045  C  CG  . ASN F  3 80  ? 85.858  -62.821  -4.075  1.00 138.96 ? 78  ASN F CG  1 
ATOM   4046  O  OD1 . ASN F  3 80  ? 86.979  -63.039  -4.546  1.00 143.95 ? 78  ASN F OD1 1 
ATOM   4047  N  ND2 . ASN F  3 80  ? 84.740  -63.215  -4.676  1.00 130.09 ? 78  ASN F ND2 1 
ATOM   4048  N  N   . PRO F  3 81  ? 87.482  -59.277  -4.241  1.00 79.68  ? 79  PRO F N   1 
ATOM   4049  C  CA  . PRO F  3 81  ? 87.369  -58.200  -5.223  1.00 92.80  ? 79  PRO F CA  1 
ATOM   4050  C  C   . PRO F  3 81  ? 87.575  -58.627  -6.679  1.00 86.09  ? 79  PRO F C   1 
ATOM   4051  O  O   . PRO F  3 81  ? 88.355  -59.521  -6.972  1.00 97.75  ? 79  PRO F O   1 
ATOM   4052  C  CB  . PRO F  3 81  ? 88.500  -57.246  -4.805  1.00 90.80  ? 79  PRO F CB  1 
ATOM   4053  C  CG  . PRO F  3 81  ? 89.509  -58.123  -4.093  1.00 72.27  ? 79  PRO F CG  1 
ATOM   4054  C  CD  . PRO F  3 81  ? 88.874  -59.477  -3.819  1.00 67.69  ? 79  PRO F CD  1 
ATOM   4055  N  N   . GLN F  3 82  ? 86.843  -57.981  -7.575  1.00 72.43  ? 80  GLN F N   1 
ATOM   4056  C  CA  . GLN F  3 82  ? 87.191  -57.919  -8.981  1.00 61.20  ? 80  GLN F CA  1 
ATOM   4057  C  C   . GLN F  3 82  ? 88.709  -57.731  -9.134  1.00 82.95  ? 80  GLN F C   1 
ATOM   4058  O  O   . GLN F  3 82  ? 89.411  -58.627  -9.605  1.00 84.38  ? 80  GLN F O   1 
ATOM   4059  C  CB  . GLN F  3 82  ? 86.452  -56.731  -9.625  1.00 100.53 ? 80  GLN F CB  1 
ATOM   4060  C  CG  . GLN F  3 82  ? 85.733  -55.759  -8.616  1.00 165.12 ? 80  GLN F CG  1 
ATOM   4061  C  CD  . GLN F  3 82  ? 86.541  -54.488  -8.217  1.00 121.57 ? 80  GLN F CD  1 
ATOM   4062  O  OE1 . GLN F  3 82  ? 86.683  -53.555  -9.010  1.00 106.10 ? 80  GLN F OE1 1 
ATOM   4063  N  NE2 . GLN F  3 82  ? 87.035  -54.450  -6.972  1.00 82.21  ? 80  GLN F NE2 1 
ATOM   4064  N  N   . VAL F  3 83  ? 89.210  -56.557  -8.735  1.00 92.96  ? 81  VAL F N   1 
ATOM   4065  C  CA  . VAL F  3 83  ? 90.646  -56.234  -8.807  1.00 73.37  ? 81  VAL F CA  1 
ATOM   4066  C  C   . VAL F  3 83  ? 91.284  -56.161  -7.423  1.00 63.21  ? 81  VAL F C   1 
ATOM   4067  O  O   . VAL F  3 83  ? 90.856  -55.404  -6.553  1.00 75.82  ? 81  VAL F O   1 
ATOM   4068  C  CB  . VAL F  3 83  ? 90.922  -54.874  -9.504  1.00 67.23  ? 81  VAL F CB  1 
ATOM   4069  C  CG1 . VAL F  3 83  ? 92.408  -54.587  -9.513  1.00 72.43  ? 81  VAL F CG1 1 
ATOM   4070  C  CG2 . VAL F  3 83  ? 90.385  -54.860  -10.914 1.00 62.32  ? 81  VAL F CG2 1 
ATOM   4071  N  N   . TYR F  3 84  ? 92.323  -56.950  -7.225  1.00 66.75  ? 82  TYR F N   1 
ATOM   4072  C  CA  . TYR F  3 84  ? 93.035  -56.946  -5.957  1.00 78.63  ? 82  TYR F CA  1 
ATOM   4073  C  C   . TYR F  3 84  ? 93.980  -55.758  -5.986  1.00 73.99  ? 82  TYR F C   1 
ATOM   4074  O  O   . TYR F  3 84  ? 94.629  -55.495  -7.008  1.00 82.07  ? 82  TYR F O   1 
ATOM   4075  C  CB  . TYR F  3 84  ? 93.779  -58.290  -5.711  1.00 72.29  ? 82  TYR F CB  1 
ATOM   4076  C  CG  . TYR F  3 84  ? 92.855  -59.513  -5.531  1.00 91.88  ? 82  TYR F CG  1 
ATOM   4077  C  CD1 . TYR F  3 84  ? 93.073  -60.447  -4.521  1.00 90.89  ? 82  TYR F CD1 1 
ATOM   4078  C  CD2 . TYR F  3 84  ? 91.755  -59.715  -6.368  1.00 116.15 ? 82  TYR F CD2 1 
ATOM   4079  C  CE1 . TYR F  3 84  ? 92.233  -61.551  -4.362  1.00 109.09 ? 82  TYR F CE1 1 
ATOM   4080  C  CE2 . TYR F  3 84  ? 90.911  -60.814  -6.215  1.00 121.80 ? 82  TYR F CE2 1 
ATOM   4081  C  CZ  . TYR F  3 84  ? 91.149  -61.729  -5.215  1.00 116.81 ? 82  TYR F CZ  1 
ATOM   4082  O  OH  . TYR F  3 84  ? 90.294  -62.816  -5.085  1.00 105.38 ? 82  TYR F OH  1 
ATOM   4083  N  N   . PHE F  3 85  ? 94.027  -55.025  -4.878  1.00 76.54  ? 83  PHE F N   1 
ATOM   4084  C  CA  . PHE F  3 85  ? 94.924  -53.881  -4.747  1.00 64.45  ? 83  PHE F CA  1 
ATOM   4085  C  C   . PHE F  3 85  ? 95.657  -53.915  -3.424  1.00 61.06  ? 83  PHE F C   1 
ATOM   4086  O  O   . PHE F  3 85  ? 95.142  -54.407  -2.426  1.00 80.23  ? 83  PHE F O   1 
ATOM   4087  C  CB  . PHE F  3 85  ? 94.127  -52.586  -4.815  1.00 62.25  ? 83  PHE F CB  1 
ATOM   4088  C  CG  . PHE F  3 85  ? 94.951  -51.354  -4.641  1.00 45.89  ? 83  PHE F CG  1 
ATOM   4089  C  CD1 . PHE F  3 85  ? 95.395  -50.644  -5.746  1.00 71.86  ? 83  PHE F CD1 1 
ATOM   4090  C  CD2 . PHE F  3 85  ? 95.258  -50.887  -3.381  1.00 47.31  ? 83  PHE F CD2 1 
ATOM   4091  C  CE1 . PHE F  3 85  ? 96.151  -49.484  -5.602  1.00 80.90  ? 83  PHE F CE1 1 
ATOM   4092  C  CE2 . PHE F  3 85  ? 96.020  -49.726  -3.223  1.00 80.86  ? 83  PHE F CE2 1 
ATOM   4093  C  CZ  . PHE F  3 85  ? 96.467  -49.021  -4.338  1.00 82.40  ? 83  PHE F CZ  1 
ATOM   4094  N  N   . CYS F  3 86  ? 96.854  -53.360  -3.413  1.00 55.92  ? 84  CYS F N   1 
ATOM   4095  C  CA  . CYS F  3 86  ? 97.609  -53.226  -2.176  1.00 64.10  ? 84  CYS F CA  1 
ATOM   4096  C  C   . CYS F  3 86  ? 98.661  -52.118  -2.320  1.00 81.83  ? 84  CYS F C   1 
ATOM   4097  O  O   . CYS F  3 86  ? 99.247  -51.906  -3.397  1.00 73.11  ? 84  CYS F O   1 
ATOM   4098  C  CB  . CYS F  3 86  ? 98.286  -54.555  -1.801  1.00 54.22  ? 84  CYS F CB  1 
ATOM   4099  S  SG  . CYS F  3 86  ? 99.869  -54.885  -2.688  1.00 65.78  ? 84  CYS F SG  1 
ATOM   4100  N  N   . CYS F  3 87  ? 98.899  -51.402  -1.232  1.00 94.44  ? 85  CYS F N   1 
ATOM   4101  C  CA  . CYS F  3 87  ? 99.979  -50.426  -1.222  1.00 80.46  ? 85  CYS F CA  1 
ATOM   4102  C  C   . CYS F  3 87  ? 100.855 -50.599  0.010   1.00 77.38  ? 85  CYS F C   1 
ATOM   4103  O  O   . CYS F  3 87  ? 100.519 -51.344  0.937   1.00 98.37  ? 85  CYS F O   1 
ATOM   4104  C  CB  . CYS F  3 87  ? 99.430  -49.004  -1.295  1.00 67.17  ? 85  CYS F CB  1 
ATOM   4105  S  SG  . CYS F  3 87  ? 98.083  -48.672  -0.135  1.00 104.19 ? 85  CYS F SG  1 
ATOM   4106  N  N   . CYS F  3 88  ? 101.981 -49.900  0.009   1.00 63.39  ? 86  CYS F N   1 
ATOM   4107  C  CA  . CYS F  3 88  ? 102.974 -50.042  1.066   1.00 71.24  ? 86  CYS F CA  1 
ATOM   4108  C  C   . CYS F  3 88  ? 103.987 -48.902  1.063   1.00 83.51  ? 86  CYS F C   1 
ATOM   4109  O  O   . CYS F  3 88  ? 103.985 -48.048  0.171   1.00 102.23 ? 86  CYS F O   1 
ATOM   4110  C  CB  . CYS F  3 88  ? 103.717 -51.359  0.896   1.00 74.01  ? 86  CYS F CB  1 
ATOM   4111  S  SG  . CYS F  3 88  ? 104.531 -51.478  -0.684  1.00 86.56  ? 86  CYS F SG  1 
ATOM   4112  N  N   . GLU F  3 89  ? 104.865 -48.908  2.062   1.00 72.81  ? 87  GLU F N   1 
ATOM   4113  C  CA  . GLU F  3 89  ? 105.833 -47.831  2.246   1.00 76.30  ? 87  GLU F CA  1 
ATOM   4114  C  C   . GLU F  3 89  ? 107.224 -48.420  2.370   1.00 76.59  ? 87  GLU F C   1 
ATOM   4115  O  O   . GLU F  3 89  ? 107.445 -49.323  3.174   1.00 95.99  ? 87  GLU F O   1 
ATOM   4116  C  CB  . GLU F  3 89  ? 105.484 -47.039  3.510   1.00 83.77  ? 87  GLU F CB  1 
ATOM   4117  C  CG  . GLU F  3 89  ? 106.001 -45.606  3.544   1.00 96.95  ? 87  GLU F CG  1 
ATOM   4118  C  CD  . GLU F  3 89  ? 105.334 -44.789  4.648   1.00 103.43 ? 87  GLU F CD  1 
ATOM   4119  O  OE1 . GLU F  3 89  ? 104.567 -45.399  5.435   1.00 98.63  ? 87  GLU F OE1 1 
ATOM   4120  O  OE2 . GLU F  3 89  ? 105.571 -43.552  4.721   1.00 83.33  ? 87  GLU F OE2 1 
ATOM   4121  N  N   . GLY F  3 90  ? 108.157 -47.926  1.567   1.00 79.77  ? 88  GLY F N   1 
ATOM   4122  C  CA  . GLY F  3 90  ? 109.514 -48.451  1.582   1.00 88.07  ? 88  GLY F CA  1 
ATOM   4123  C  C   . GLY F  3 90  ? 109.965 -48.949  0.225   1.00 79.17  ? 88  GLY F C   1 
ATOM   4124  O  O   . GLY F  3 90  ? 109.216 -49.633  -0.479  1.00 78.70  ? 88  GLY F O   1 
ATOM   4125  N  N   . ASN F  3 91  ? 111.197 -48.612  -0.141  1.00 70.57  ? 89  ASN F N   1 
ATOM   4126  C  CA  . ASN F  3 91  ? 111.687 -48.922  -1.485  1.00 79.92  ? 89  ASN F CA  1 
ATOM   4127  C  C   . ASN F  3 91  ? 111.426 -50.358  -1.962  1.00 79.81  ? 89  ASN F C   1 
ATOM   4128  O  O   . ASN F  3 91  ? 111.774 -51.324  -1.292  1.00 75.88  ? 89  ASN F O   1 
ATOM   4129  C  CB  . ASN F  3 91  ? 113.168 -48.559  -1.623  1.00 76.31  ? 89  ASN F CB  1 
ATOM   4130  C  CG  . ASN F  3 91  ? 113.392 -47.063  -1.686  1.00 88.96  ? 89  ASN F CG  1 
ATOM   4131  O  OD1 . ASN F  3 91  ? 112.517 -46.279  -1.291  1.00 86.97  ? 89  ASN F OD1 1 
ATOM   4132  N  ND2 . ASN F  3 91  ? 114.563 -46.652  -2.197  1.00 95.88  ? 89  ASN F ND2 1 
ATOM   4133  N  N   . PHE F  3 92  ? 110.790 -50.475  -3.123  1.00 84.17  ? 90  PHE F N   1 
ATOM   4134  C  CA  . PHE F  3 92  ? 110.519 -51.767  -3.750  1.00 77.40  ? 90  PHE F CA  1 
ATOM   4135  C  C   . PHE F  3 92  ? 109.686 -52.711  -2.907  1.00 78.03  ? 90  PHE F C   1 
ATOM   4136  O  O   . PHE F  3 92  ? 109.696 -53.923  -3.127  1.00 84.90  ? 90  PHE F O   1 
ATOM   4137  C  CB  . PHE F  3 92  ? 111.818 -52.438  -4.139  1.00 55.63  ? 90  PHE F CB  1 
ATOM   4138  C  CG  . PHE F  3 92  ? 112.659 -51.609  -5.047  1.00 73.91  ? 90  PHE F CG  1 
ATOM   4139  C  CD1 . PHE F  3 92  ? 112.093 -50.999  -6.156  1.00 78.38  ? 90  PHE F CD1 1 
ATOM   4140  C  CD2 . PHE F  3 92  ? 114.014 -51.415  -4.784  1.00 89.93  ? 90  PHE F CD2 1 
ATOM   4141  C  CE1 . PHE F  3 92  ? 112.865 -50.219  -7.002  1.00 96.71  ? 90  PHE F CE1 1 
ATOM   4142  C  CE2 . PHE F  3 92  ? 114.796 -50.639  -5.625  1.00 94.10  ? 90  PHE F CE2 1 
ATOM   4143  C  CZ  . PHE F  3 92  ? 114.221 -50.036  -6.737  1.00 95.44  ? 90  PHE F CZ  1 
ATOM   4144  N  N   . CYS F  3 93  ? 108.946 -52.152  -1.959  1.00 73.98  ? 91  CYS F N   1 
ATOM   4145  C  CA  . CYS F  3 93  ? 108.091 -52.965  -1.116  1.00 84.63  ? 91  CYS F CA  1 
ATOM   4146  C  C   . CYS F  3 93  ? 107.030 -53.722  -1.927  1.00 85.02  ? 91  CYS F C   1 
ATOM   4147  O  O   . CYS F  3 93  ? 106.415 -54.666  -1.423  1.00 107.79 ? 91  CYS F O   1 
ATOM   4148  C  CB  . CYS F  3 93  ? 107.431 -52.090  -0.060  1.00 97.30  ? 91  CYS F CB  1 
ATOM   4149  S  SG  . CYS F  3 93  ? 106.436 -50.764  -0.762  1.00 134.56 ? 91  CYS F SG  1 
ATOM   4150  N  N   . ASN F  3 94  ? 106.819 -53.317  -3.177  1.00 63.59  ? 92  ASN F N   1 
ATOM   4151  C  CA  . ASN F  3 94  ? 105.828 -53.982  -4.027  1.00 59.53  ? 92  ASN F CA  1 
ATOM   4152  C  C   . ASN F  3 94  ? 106.416 -55.057  -4.968  1.00 71.08  ? 92  ASN F C   1 
ATOM   4153  O  O   . ASN F  3 94  ? 105.742 -55.523  -5.895  1.00 73.30  ? 92  ASN F O   1 
ATOM   4154  C  CB  . ASN F  3 94  ? 104.987 -52.961  -4.811  1.00 48.61  ? 92  ASN F CB  1 
ATOM   4155  C  CG  . ASN F  3 94  ? 105.812 -52.175  -5.832  1.00 77.23  ? 92  ASN F CG  1 
ATOM   4156  O  OD1 . ASN F  3 94  ? 107.053 -52.187  -5.808  1.00 72.48  ? 92  ASN F OD1 1 
ATOM   4157  N  ND2 . ASN F  3 94  ? 105.118 -51.481  -6.733  1.00 86.49  ? 92  ASN F ND2 1 
ATOM   4158  N  N   . GLU F  3 95  ? 107.661 -55.460  -4.721  1.00 74.15  ? 93  GLU F N   1 
ATOM   4159  C  CA  . GLU F  3 95  ? 108.252 -56.569  -5.468  1.00 86.73  ? 93  GLU F CA  1 
ATOM   4160  C  C   . GLU F  3 95  ? 107.365 -57.804  -5.342  1.00 93.64  ? 93  GLU F C   1 
ATOM   4161  O  O   . GLU F  3 95  ? 106.949 -58.383  -6.345  1.00 109.50 ? 93  GLU F O   1 
ATOM   4162  C  CB  . GLU F  3 95  ? 109.679 -56.884  -4.984  1.00 86.28  ? 93  GLU F CB  1 
ATOM   4163  N  N   . ARG F  3 96  ? 107.083 -58.202  -4.103  1.00 79.91  ? 94  ARG F N   1 
ATOM   4164  C  CA  . ARG F  3 96  ? 106.211 -59.342  -3.841  1.00 86.05  ? 94  ARG F CA  1 
ATOM   4165  C  C   . ARG F  3 96  ? 104.956 -58.830  -3.117  1.00 81.86  ? 94  ARG F C   1 
ATOM   4166  O  O   . ARG F  3 96  ? 105.013 -57.823  -2.399  1.00 84.30  ? 94  ARG F O   1 
ATOM   4167  C  CB  . ARG F  3 96  ? 106.945 -60.445  -3.038  1.00 73.24  ? 94  ARG F CB  1 
ATOM   4168  N  N   . PHE F  3 97  ? 103.823 -59.504  -3.324  1.00 57.97  ? 95  PHE F N   1 
ATOM   4169  C  CA  . PHE F  3 97  ? 102.567 -59.117  -2.681  1.00 66.14  ? 95  PHE F CA  1 
ATOM   4170  C  C   . PHE F  3 97  ? 101.759 -60.360  -2.327  1.00 88.28  ? 95  PHE F C   1 
ATOM   4171  O  O   . PHE F  3 97  ? 102.031 -61.445  -2.861  1.00 102.06 ? 95  PHE F O   1 
ATOM   4172  C  CB  . PHE F  3 97  ? 101.746 -58.218  -3.607  1.00 74.76  ? 95  PHE F CB  1 
ATOM   4173  C  CG  . PHE F  3 97  ? 101.399 -58.863  -4.921  1.00 90.44  ? 95  PHE F CG  1 
ATOM   4174  C  CD1 . PHE F  3 97  ? 100.152 -59.455  -5.112  1.00 77.81  ? 95  PHE F CD1 1 
ATOM   4175  C  CD2 . PHE F  3 97  ? 102.327 -58.891  -5.964  1.00 90.00  ? 95  PHE F CD2 1 
ATOM   4176  C  CE1 . PHE F  3 97  ? 99.835  -60.057  -6.323  1.00 69.20  ? 95  PHE F CE1 1 
ATOM   4177  C  CE2 . PHE F  3 97  ? 102.022 -59.491  -7.179  1.00 72.72  ? 95  PHE F CE2 1 
ATOM   4178  C  CZ  . PHE F  3 97  ? 100.776 -60.079  -7.362  1.00 65.09  ? 95  PHE F CZ  1 
ATOM   4179  N  N   . THR F  3 98  ? 100.770 -60.202  -1.442  1.00 97.54  ? 96  THR F N   1 
ATOM   4180  C  CA  . THR F  3 98  ? 99.936  -61.321  -0.988  1.00 92.09  ? 96  THR F CA  1 
ATOM   4181  C  C   . THR F  3 98  ? 98.523  -60.875  -0.644  1.00 88.69  ? 96  THR F C   1 
ATOM   4182  O  O   . THR F  3 98  ? 98.193  -59.702  -0.800  1.00 91.56  ? 96  THR F O   1 
ATOM   4183  C  CB  . THR F  3 98  ? 100.544 -62.021  0.242   1.00 96.29  ? 96  THR F CB  1 
ATOM   4184  O  OG1 . THR F  3 98  ? 100.755 -61.060  1.286   1.00 79.35  ? 96  THR F OG1 1 
ATOM   4185  C  CG2 . THR F  3 98  ? 101.876 -62.687  -0.118  1.00 110.82 ? 96  THR F CG2 1 
ATOM   4186  N  N   . HIS F  3 99  ? 97.703  -61.809  -0.160  1.00 90.70  ? 97  HIS F N   1 
ATOM   4187  C  CA  . HIS F  3 99  ? 96.293  -61.529  0.153   1.00 107.81 ? 97  HIS F CA  1 
ATOM   4188  C  C   . HIS F  3 99  ? 95.857  -62.080  1.519   1.00 120.78 ? 97  HIS F C   1 
ATOM   4189  O  O   . HIS F  3 99  ? 96.149  -63.230  1.842   1.00 144.53 ? 97  HIS F O   1 
ATOM   4190  C  CB  . HIS F  3 99  ? 95.390  -62.112  -0.946  1.00 108.11 ? 97  HIS F CB  1 
ATOM   4191  C  CG  . HIS F  3 99  ? 93.922  -61.996  -0.659  1.00 104.19 ? 97  HIS F CG  1 
ATOM   4192  N  ND1 . HIS F  3 99  ? 93.180  -60.888  -1.008  1.00 111.50 ? 97  HIS F ND1 1 
ATOM   4193  C  CD2 . HIS F  3 99  ? 93.056  -62.853  -0.067  1.00 107.75 ? 97  HIS F CD2 1 
ATOM   4194  C  CE1 . HIS F  3 99  ? 91.925  -61.062  -0.636  1.00 103.42 ? 97  HIS F CE1 1 
ATOM   4195  N  NE2 . HIS F  3 99  ? 91.822  -62.246  -0.060  1.00 108.86 ? 97  HIS F NE2 1 
ATOM   4196  N  N   . LEU F  3 100 ? 95.160  -61.263  2.313   1.00 107.49 ? 98  LEU F N   1 
ATOM   4197  C  CA  . LEU F  3 100 ? 94.544  -61.734  3.564   1.00 118.35 ? 98  LEU F CA  1 
ATOM   4198  C  C   . LEU F  3 100 ? 93.611  -60.708  4.232   1.00 113.58 ? 98  LEU F C   1 
ATOM   4199  O  O   . LEU F  3 100 ? 94.077  -59.767  4.879   1.00 89.26  ? 98  LEU F O   1 
ATOM   4200  C  CB  . LEU F  3 100 ? 95.599  -62.235  4.558   1.00 123.20 ? 98  LEU F CB  1 
ATOM   4201  C  CG  . LEU F  3 100 ? 96.600  -61.254  5.163   1.00 117.07 ? 98  LEU F CG  1 
ATOM   4202  C  CD1 . LEU F  3 100 ? 96.405  -61.169  6.659   1.00 91.13  ? 98  LEU F CD1 1 
ATOM   4203  C  CD2 . LEU F  3 100 ? 98.017  -61.688  4.844   1.00 128.21 ? 98  LEU F CD2 1 
ATOM   4204  N  N   . PRO F  3 101 ? 92.281  -60.912  4.093   1.00 111.63 ? 99  PRO F N   1 
ATOM   4205  C  CA  . PRO F  3 101 ? 91.236  -59.972  4.538   1.00 120.08 ? 99  PRO F CA  1 
ATOM   4206  C  C   . PRO F  3 101 ? 91.172  -59.726  6.051   1.00 113.60 ? 99  PRO F C   1 
ATOM   4207  O  O   . PRO F  3 101 ? 90.439  -58.822  6.484   1.00 96.37  ? 99  PRO F O   1 
ATOM   4208  C  CB  . PRO F  3 101 ? 89.938  -60.638  4.060   1.00 119.50 ? 99  PRO F CB  1 
ATOM   4209  C  CG  . PRO F  3 101 ? 90.283  -62.081  3.885   1.00 102.07 ? 99  PRO F CG  1 
ATOM   4210  C  CD  . PRO F  3 101 ? 91.705  -62.112  3.451   1.00 87.74  ? 99  PRO F CD  1 
ATOM   4211  N  N   . SER G  1 6   ? 86.351  23.842   -12.833 1.00 74.81  ? 6   SER G N   1 
ATOM   4212  C  CA  . SER G  1 6   ? 85.572  24.776   -13.638 1.00 89.72  ? 6   SER G CA  1 
ATOM   4213  C  C   . SER G  1 6   ? 84.855  24.056   -14.800 1.00 77.21  ? 6   SER G C   1 
ATOM   4214  O  O   . SER G  1 6   ? 85.051  22.854   -15.015 1.00 22.84  ? 6   SER G O   1 
ATOM   4215  C  CB  . SER G  1 6   ? 86.436  25.965   -14.101 1.00 18.03  ? 6   SER G CB  1 
ATOM   4216  N  N   . HIS G  1 7   ? 84.044  24.822   -15.535 1.00 97.44  ? 7   HIS G N   1 
ATOM   4217  C  CA  . HIS G  1 7   ? 82.987  24.340   -16.434 1.00 64.90  ? 7   HIS G CA  1 
ATOM   4218  C  C   . HIS G  1 7   ? 83.394  24.363   -17.885 1.00 64.05  ? 7   HIS G C   1 
ATOM   4219  O  O   . HIS G  1 7   ? 84.402  23.783   -18.233 1.00 90.88  ? 7   HIS G O   1 
ATOM   4220  C  CB  . HIS G  1 7   ? 81.827  25.293   -16.298 1.00 77.05  ? 7   HIS G CB  1 
ATOM   4221  C  CG  . HIS G  1 7   ? 82.263  26.701   -16.053 1.00 93.32  ? 7   HIS G CG  1 
ATOM   4222  N  ND1 . HIS G  1 7   ? 82.612  27.161   -14.801 1.00 110.41 ? 7   HIS G ND1 1 
ATOM   4223  C  CD2 . HIS G  1 7   ? 82.450  27.737   -16.900 1.00 110.11 ? 7   HIS G CD2 1 
ATOM   4224  C  CE1 . HIS G  1 7   ? 82.969  28.429   -14.884 1.00 129.00 ? 7   HIS G CE1 1 
ATOM   4225  N  NE2 . HIS G  1 7   ? 82.879  28.803   -16.147 1.00 135.31 ? 7   HIS G NE2 1 
ATOM   4226  N  N   . CYS G  1 8   ? 82.582  25.007   -18.731 1.00 64.71  ? 8   CYS G N   1 
ATOM   4227  C  CA  . CYS G  1 8   ? 82.933  25.268   -20.142 1.00 63.77  ? 8   CYS G CA  1 
ATOM   4228  C  C   . CYS G  1 8   ? 83.134  26.759   -20.401 1.00 66.34  ? 8   CYS G C   1 
ATOM   4229  O  O   . CYS G  1 8   ? 82.235  27.558   -20.161 1.00 73.90  ? 8   CYS G O   1 
ATOM   4230  C  CB  . CYS G  1 8   ? 81.874  24.737   -21.113 1.00 60.53  ? 8   CYS G CB  1 
ATOM   4231  S  SG  . CYS G  1 8   ? 82.100  25.328   -22.789 1.00 77.22  ? 8   CYS G SG  1 
ATOM   4232  N  N   . GLN G  1 9   ? 84.301  27.127   -20.921 1.00 59.55  ? 9   GLN G N   1 
ATOM   4233  C  CA  . GLN G  1 9   ? 84.674  28.524   -21.018 1.00 56.51  ? 9   GLN G CA  1 
ATOM   4234  C  C   . GLN G  1 9   ? 85.829  28.830   -21.978 1.00 56.98  ? 9   GLN G C   1 
ATOM   4235  O  O   . GLN G  1 9   ? 86.525  27.926   -22.442 1.00 63.29  ? 9   GLN G O   1 
ATOM   4236  C  CB  . GLN G  1 9   ? 85.034  29.038   -19.621 1.00 77.84  ? 9   GLN G CB  1 
ATOM   4237  C  CG  . GLN G  1 9   ? 85.893  28.091   -18.782 1.00 56.66  ? 9   GLN G CG  1 
ATOM   4238  C  CD  . GLN G  1 9   ? 86.281  28.696   -17.431 1.00 72.97  ? 9   GLN G CD  1 
ATOM   4239  O  OE1 . GLN G  1 9   ? 86.147  29.903   -17.203 1.00 82.24  ? 9   GLN G OE1 1 
ATOM   4240  N  NE2 . GLN G  1 9   ? 86.763  27.855   -16.531 1.00 89.53  ? 9   GLN G NE2 1 
ATOM   4241  N  N   . LYS G  1 10  ? 86.019  30.126   -22.249 1.00 57.80  ? 10  LYS G N   1 
ATOM   4242  C  CA  . LYS G  1 10  ? 87.121  30.650   -23.057 1.00 41.44  ? 10  LYS G CA  1 
ATOM   4243  C  C   . LYS G  1 10  ? 88.368  30.835   -22.216 1.00 48.46  ? 10  LYS G C   1 
ATOM   4244  O  O   . LYS G  1 10  ? 88.311  31.391   -21.133 1.00 49.53  ? 10  LYS G O   1 
ATOM   4245  C  CB  . LYS G  1 10  ? 86.759  32.002   -23.642 1.00 41.83  ? 10  LYS G CB  1 
ATOM   4246  C  CG  . LYS G  1 10  ? 87.341  32.261   -25.050 1.00 60.52  ? 10  LYS G CG  1 
ATOM   4247  C  CD  . LYS G  1 10  ? 87.720  33.751   -25.314 1.00 58.44  ? 10  LYS G CD  1 
ATOM   4248  C  CE  . LYS G  1 10  ? 86.524  34.661   -25.562 1.00 58.47  ? 10  LYS G CE  1 
ATOM   4249  N  NZ  . LYS G  1 10  ? 86.962  36.066   -25.700 1.00 68.58  ? 10  LYS G NZ  1 
ATOM   4250  N  N   . THR G  1 11  ? 89.500  30.378   -22.739 1.00 56.15  ? 11  THR G N   1 
ATOM   4251  C  CA  . THR G  1 11  ? 90.755  30.341   -22.002 1.00 49.73  ? 11  THR G CA  1 
ATOM   4252  C  C   . THR G  1 11  ? 91.850  31.029   -22.787 1.00 73.09  ? 11  THR G C   1 
ATOM   4253  O  O   . THR G  1 11  ? 91.804  31.042   -24.017 1.00 89.75  ? 11  THR G O   1 
ATOM   4254  C  CB  . THR G  1 11  ? 91.203  28.900   -21.802 1.00 58.91  ? 11  THR G CB  1 
ATOM   4255  O  OG1 . THR G  1 11  ? 90.354  28.285   -20.838 1.00 70.09  ? 11  THR G OG1 1 
ATOM   4256  C  CG2 . THR G  1 11  ? 92.650  28.845   -21.304 1.00 86.99  ? 11  THR G CG2 1 
ATOM   4257  N  N   . SER G  1 12  ? 92.842  31.590   -22.096 1.00 48.49  ? 12  SER G N   1 
ATOM   4258  C  CA  . SER G  1 12  ? 93.943  32.210   -22.817 1.00 48.76  ? 12  SER G CA  1 
ATOM   4259  C  C   . SER G  1 12  ? 94.765  31.147   -23.519 1.00 65.87  ? 12  SER G C   1 
ATOM   4260  O  O   . SER G  1 12  ? 95.011  30.090   -22.943 1.00 66.50  ? 12  SER G O   1 
ATOM   4261  C  CB  . SER G  1 12  ? 94.840  32.994   -21.881 1.00 49.24  ? 12  SER G CB  1 
ATOM   4262  O  OG  . SER G  1 12  ? 95.974  33.474   -22.581 1.00 66.48  ? 12  SER G OG  1 
ATOM   4263  N  N   . LEU G  1 13  ? 95.172  31.408   -24.763 1.00 67.25  ? 13  LEU G N   1 
ATOM   4264  C  CA  . LEU G  1 13  ? 96.132  30.527   -25.422 1.00 50.61  ? 13  LEU G CA  1 
ATOM   4265  C  C   . LEU G  1 13  ? 97.089  31.335   -26.262 1.00 55.07  ? 13  LEU G C   1 
ATOM   4266  O  O   . LEU G  1 13  ? 96.805  31.644   -27.436 1.00 82.76  ? 13  LEU G O   1 
ATOM   4267  C  CB  . LEU G  1 13  ? 95.420  29.499   -26.286 1.00 51.43  ? 13  LEU G CB  1 
ATOM   4268  C  CG  . LEU G  1 13  ? 96.331  28.541   -27.040 1.00 56.13  ? 13  LEU G CG  1 
ATOM   4269  C  CD1 . LEU G  1 13  ? 97.143  27.707   -26.067 1.00 38.33  ? 13  LEU G CD1 1 
ATOM   4270  C  CD2 . LEU G  1 13  ? 95.476  27.643   -27.920 1.00 69.17  ? 13  LEU G CD2 1 
ATOM   4271  N  N   . ARG G  1 14  ? 98.206  31.715   -25.650 1.00 53.19  ? 14  ARG G N   1 
ATOM   4272  C  CA  . ARG G  1 14  ? 99.188  32.515   -26.360 1.00 66.58  ? 14  ARG G CA  1 
ATOM   4273  C  C   . ARG G  1 14  ? 99.939  31.581   -27.292 1.00 59.36  ? 14  ARG G C   1 
ATOM   4274  O  O   . ARG G  1 14  ? 100.743 30.766   -26.856 1.00 66.35  ? 14  ARG G O   1 
ATOM   4275  C  CB  . ARG G  1 14  ? 100.139 33.236   -25.399 1.00 72.31  ? 14  ARG G CB  1 
ATOM   4276  C  CG  . ARG G  1 14  ? 99.466  34.162   -24.401 1.00 65.66  ? 14  ARG G CG  1 
ATOM   4277  C  CD  . ARG G  1 14  ? 98.693  35.220   -25.109 1.00 68.48  ? 14  ARG G CD  1 
ATOM   4278  N  NE  . ARG G  1 14  ? 98.141  36.224   -24.206 1.00 82.98  ? 14  ARG G NE  1 
ATOM   4279  C  CZ  . ARG G  1 14  ? 98.868  37.127   -23.553 1.00 87.44  ? 14  ARG G CZ  1 
ATOM   4280  N  NH1 . ARG G  1 14  ? 100.196 37.135   -23.668 1.00 77.38  ? 14  ARG G NH1 1 
ATOM   4281  N  NH2 . ARG G  1 14  ? 98.262  38.019   -22.772 1.00 78.72  ? 14  ARG G NH2 1 
ATOM   4282  N  N   . VAL G  1 15  ? 99.642  31.674   -28.579 1.00 57.42  ? 15  VAL G N   1 
ATOM   4283  C  CA  . VAL G  1 15  ? 100.341 30.873   -29.563 1.00 45.11  ? 15  VAL G CA  1 
ATOM   4284  C  C   . VAL G  1 15  ? 101.511 31.666   -30.047 1.00 49.56  ? 15  VAL G C   1 
ATOM   4285  O  O   . VAL G  1 15  ? 101.358 32.824   -30.430 1.00 60.05  ? 15  VAL G O   1 
ATOM   4286  C  CB  . VAL G  1 15  ? 99.482  30.569   -30.785 1.00 58.87  ? 15  VAL G CB  1 
ATOM   4287  C  CG1 . VAL G  1 15  ? 100.326 29.879   -31.838 1.00 50.25  ? 15  VAL G CG1 1 
ATOM   4288  C  CG2 . VAL G  1 15  ? 98.271  29.722   -30.391 1.00 53.29  ? 15  VAL G CG2 1 
ATOM   4289  N  N   . ASN G  1 16  ? 102.681 31.035   -30.013 1.00 61.49  ? 16  ASN G N   1 
ATOM   4290  C  CA  . ASN G  1 16  ? 103.931 31.636   -30.457 1.00 62.06  ? 16  ASN G CA  1 
ATOM   4291  C  C   . ASN G  1 16  ? 104.284 30.972   -31.781 1.00 70.00  ? 16  ASN G C   1 
ATOM   4292  O  O   . ASN G  1 16  ? 104.579 29.777   -31.823 1.00 74.92  ? 16  ASN G O   1 
ATOM   4293  C  CB  . ASN G  1 16  ? 105.012 31.407   -29.394 1.00 57.08  ? 16  ASN G CB  1 
ATOM   4294  C  CG  . ASN G  1 16  ? 106.366 31.920   -29.807 1.00 75.80  ? 16  ASN G CG  1 
ATOM   4295  O  OD1 . ASN G  1 16  ? 106.685 32.006   -30.996 1.00 91.18  ? 16  ASN G OD1 1 
ATOM   4296  N  ND2 . ASN G  1 16  ? 107.189 32.258   -28.820 1.00 87.02  ? 16  ASN G ND2 1 
ATOM   4297  N  N   . PHE G  1 17  ? 104.217 31.736   -32.866 1.00 53.30  ? 17  PHE G N   1 
ATOM   4298  C  CA  . PHE G  1 17  ? 104.460 31.186   -34.200 1.00 60.75  ? 17  PHE G CA  1 
ATOM   4299  C  C   . PHE G  1 17  ? 105.777 30.419   -34.342 1.00 69.94  ? 17  PHE G C   1 
ATOM   4300  O  O   . PHE G  1 17  ? 105.850 29.453   -35.098 1.00 63.58  ? 17  PHE G O   1 
ATOM   4301  C  CB  . PHE G  1 17  ? 104.418 32.285   -35.251 1.00 64.30  ? 17  PHE G CB  1 
ATOM   4302  C  CG  . PHE G  1 17  ? 103.067 32.863   -35.456 1.00 56.84  ? 17  PHE G CG  1 
ATOM   4303  C  CD1 . PHE G  1 17  ? 102.079 32.092   -36.025 1.00 47.02  ? 17  PHE G CD1 1 
ATOM   4304  C  CD2 . PHE G  1 17  ? 102.784 34.175   -35.093 1.00 59.58  ? 17  PHE G CD2 1 
ATOM   4305  C  CE1 . PHE G  1 17  ? 100.812 32.600   -36.218 1.00 42.28  ? 17  PHE G CE1 1 
ATOM   4306  C  CE2 . PHE G  1 17  ? 101.533 34.694   -35.282 1.00 68.66  ? 17  PHE G CE2 1 
ATOM   4307  C  CZ  . PHE G  1 17  ? 100.535 33.901   -35.844 1.00 56.11  ? 17  PHE G CZ  1 
ATOM   4308  N  N   . GLU G  1 18  ? 106.819 30.867   -33.645 1.00 58.40  ? 18  GLU G N   1 
ATOM   4309  C  CA  . GLU G  1 18  ? 108.070 30.133   -33.631 1.00 60.91  ? 18  GLU G CA  1 
ATOM   4310  C  C   . GLU G  1 18  ? 107.823 28.694   -33.180 1.00 68.90  ? 18  GLU G C   1 
ATOM   4311  O  O   . GLU G  1 18  ? 108.387 27.757   -33.743 1.00 65.43  ? 18  GLU G O   1 
ATOM   4312  C  CB  . GLU G  1 18  ? 109.092 30.812   -32.715 1.00 72.54  ? 18  GLU G CB  1 
ATOM   4313  C  CG  . GLU G  1 18  ? 110.539 30.325   -32.911 1.00 72.07  ? 18  GLU G CG  1 
ATOM   4314  C  CD  . GLU G  1 18  ? 111.535 31.086   -32.052 1.00 97.25  ? 18  GLU G CD  1 
ATOM   4315  O  OE1 . GLU G  1 18  ? 112.746 31.073   -32.360 1.00 107.23 ? 18  GLU G OE1 1 
ATOM   4316  O  OE2 . GLU G  1 18  ? 111.095 31.704   -31.062 1.00 110.28 ? 18  GLU G OE2 1 
ATOM   4317  N  N   . ASP G  1 19  ? 106.968 28.524   -32.172 1.00 77.05  ? 19  ASP G N   1 
ATOM   4318  C  CA  . ASP G  1 19  ? 106.682 27.201   -31.608 1.00 72.38  ? 19  ASP G CA  1 
ATOM   4319  C  C   . ASP G  1 19  ? 106.110 26.220   -32.635 1.00 60.74  ? 19  ASP G C   1 
ATOM   4320  O  O   . ASP G  1 19  ? 106.407 25.020   -32.578 1.00 67.73  ? 19  ASP G O   1 
ATOM   4321  C  CB  . ASP G  1 19  ? 105.744 27.305   -30.395 1.00 65.50  ? 19  ASP G CB  1 
ATOM   4322  C  CG  . ASP G  1 19  ? 106.471 27.710   -29.114 1.00 92.83  ? 19  ASP G CG  1 
ATOM   4323  O  OD1 . ASP G  1 19  ? 107.726 27.609   -29.059 1.00 101.39 ? 19  ASP G OD1 1 
ATOM   4324  O  OD2 . ASP G  1 19  ? 105.773 28.120   -28.155 1.00 84.53  ? 19  ASP G OD2 1 
ATOM   4325  N  N   . ILE G  1 20  ? 105.288 26.722   -33.559 1.00 44.38  ? 20  ILE G N   1 
ATOM   4326  C  CA  . ILE G  1 20  ? 104.744 25.880   -34.636 1.00 50.97  ? 20  ILE G CA  1 
ATOM   4327  C  C   . ILE G  1 20  ? 105.411 26.143   -35.983 1.00 60.69  ? 20  ILE G C   1 
ATOM   4328  O  O   . ILE G  1 20  ? 104.862 25.789   -37.041 1.00 54.53  ? 20  ILE G O   1 
ATOM   4329  C  CB  . ILE G  1 20  ? 103.217 26.017   -34.832 1.00 34.32  ? 20  ILE G CB  1 
ATOM   4330  C  CG1 . ILE G  1 20  ? 102.868 27.458   -35.176 1.00 58.64  ? 20  ILE G CG1 1 
ATOM   4331  C  CG2 . ILE G  1 20  ? 102.451 25.539   -33.600 1.00 37.22  ? 20  ILE G CG2 1 
ATOM   4332  C  CD1 . ILE G  1 20  ? 101.401 27.683   -35.378 1.00 59.60  ? 20  ILE G CD1 1 
ATOM   4333  N  N   . GLY G  1 21  ? 106.583 26.774   -35.939 1.00 56.75  ? 21  GLY G N   1 
ATOM   4334  C  CA  . GLY G  1 21  ? 107.430 26.907   -37.114 1.00 78.17  ? 21  GLY G CA  1 
ATOM   4335  C  C   . GLY G  1 21  ? 106.888 27.805   -38.211 1.00 76.56  ? 21  GLY G C   1 
ATOM   4336  O  O   . GLY G  1 21  ? 107.207 27.647   -39.403 1.00 64.98  ? 21  GLY G O   1 
ATOM   4337  N  N   . TRP G  1 22  ? 106.065 28.763   -37.809 1.00 67.07  ? 22  TRP G N   1 
ATOM   4338  C  CA  . TRP G  1 22  ? 105.536 29.729   -38.754 1.00 52.72  ? 22  TRP G CA  1 
ATOM   4339  C  C   . TRP G  1 22  ? 106.369 30.998   -38.738 1.00 63.80  ? 22  TRP G C   1 
ATOM   4340  O  O   . TRP G  1 22  ? 106.109 31.947   -39.486 1.00 50.64  ? 22  TRP G O   1 
ATOM   4341  C  CB  . TRP G  1 22  ? 104.072 30.014   -38.456 1.00 53.21  ? 22  TRP G CB  1 
ATOM   4342  C  CG  . TRP G  1 22  ? 103.197 28.889   -38.893 1.00 63.52  ? 22  TRP G CG  1 
ATOM   4343  C  CD1 . TRP G  1 22  ? 103.593 27.625   -39.264 1.00 81.54  ? 22  TRP G CD1 1 
ATOM   4344  C  CD2 . TRP G  1 22  ? 101.780 28.920   -39.030 1.00 52.38  ? 22  TRP G CD2 1 
ATOM   4345  N  NE1 . TRP G  1 22  ? 102.501 26.871   -39.609 1.00 76.57  ? 22  TRP G NE1 1 
ATOM   4346  C  CE2 . TRP G  1 22  ? 101.373 27.642   -39.474 1.00 60.33  ? 22  TRP G CE2 1 
ATOM   4347  C  CE3 . TRP G  1 22  ? 100.807 29.903   -38.817 1.00 56.40  ? 22  TRP G CE3 1 
ATOM   4348  C  CZ2 . TRP G  1 22  ? 100.025 27.322   -39.705 1.00 61.43  ? 22  TRP G CZ2 1 
ATOM   4349  C  CZ3 . TRP G  1 22  ? 99.465  29.583   -39.047 1.00 47.92  ? 22  TRP G CZ3 1 
ATOM   4350  C  CH2 . TRP G  1 22  ? 99.090  28.304   -39.483 1.00 42.88  ? 22  TRP G CH2 1 
ATOM   4351  N  N   . ASP G  1 23  ? 107.385 31.003   -37.880 1.00 77.39  ? 23  ASP G N   1 
ATOM   4352  C  CA  . ASP G  1 23  ? 108.297 32.132   -37.788 1.00 76.62  ? 23  ASP G CA  1 
ATOM   4353  C  C   . ASP G  1 23  ? 108.999 32.341   -39.124 1.00 80.90  ? 23  ASP G C   1 
ATOM   4354  O  O   . ASP G  1 23  ? 109.622 33.378   -39.359 1.00 94.14  ? 23  ASP G O   1 
ATOM   4355  C  CB  . ASP G  1 23  ? 109.318 31.913   -36.672 1.00 76.13  ? 23  ASP G CB  1 
ATOM   4356  C  CG  . ASP G  1 23  ? 110.095 30.614   -36.828 1.00 94.46  ? 23  ASP G CG  1 
ATOM   4357  O  OD1 . ASP G  1 23  ? 109.510 29.625   -37.317 1.00 96.41  ? 23  ASP G OD1 1 
ATOM   4358  O  OD2 . ASP G  1 23  ? 111.290 30.578   -36.452 1.00 104.05 ? 23  ASP G OD2 1 
ATOM   4359  N  N   . SER G  1 24  ? 108.886 31.347   -40.001 1.00 71.06  ? 24  SER G N   1 
ATOM   4360  C  CA  . SER G  1 24  ? 109.515 31.396   -41.315 1.00 65.53  ? 24  SER G CA  1 
ATOM   4361  C  C   . SER G  1 24  ? 108.903 32.461   -42.215 1.00 66.00  ? 24  SER G C   1 
ATOM   4362  O  O   . SER G  1 24  ? 109.564 32.980   -43.111 1.00 80.28  ? 24  SER G O   1 
ATOM   4363  C  CB  . SER G  1 24  ? 109.386 30.044   -42.006 1.00 59.25  ? 24  SER G CB  1 
ATOM   4364  O  OG  . SER G  1 24  ? 108.048 29.813   -42.417 1.00 65.03  ? 24  SER G OG  1 
ATOM   4365  N  N   . TRP G  1 25  ? 107.638 32.787   -41.980 1.00 59.37  ? 25  TRP G N   1 
ATOM   4366  C  CA  . TRP G  1 25  ? 106.919 33.676   -42.887 1.00 69.99  ? 25  TRP G CA  1 
ATOM   4367  C  C   . TRP G  1 25  ? 106.027 34.691   -42.166 1.00 81.46  ? 25  TRP G C   1 
ATOM   4368  O  O   . TRP G  1 25  ? 105.635 35.687   -42.775 1.00 85.61  ? 25  TRP G O   1 
ATOM   4369  C  CB  . TRP G  1 25  ? 106.102 32.867   -43.905 1.00 70.05  ? 25  TRP G CB  1 
ATOM   4370  C  CG  . TRP G  1 25  ? 105.062 31.994   -43.264 1.00 60.69  ? 25  TRP G CG  1 
ATOM   4371  C  CD1 . TRP G  1 25  ? 105.276 30.820   -42.597 1.00 79.80  ? 25  TRP G CD1 1 
ATOM   4372  C  CD2 . TRP G  1 25  ? 103.654 32.232   -43.218 1.00 39.25  ? 25  TRP G CD2 1 
ATOM   4373  N  NE1 . TRP G  1 25  ? 104.082 30.313   -42.137 1.00 86.21  ? 25  TRP G NE1 1 
ATOM   4374  C  CE2 . TRP G  1 25  ? 103.070 31.160   -42.507 1.00 68.52  ? 25  TRP G CE2 1 
ATOM   4375  C  CE3 . TRP G  1 25  ? 102.828 33.242   -43.713 1.00 38.56  ? 25  TRP G CE3 1 
ATOM   4376  C  CZ2 . TRP G  1 25  ? 101.696 31.070   -42.279 1.00 70.41  ? 25  TRP G CZ2 1 
ATOM   4377  C  CZ3 . TRP G  1 25  ? 101.472 33.164   -43.485 1.00 44.72  ? 25  TRP G CZ3 1 
ATOM   4378  C  CH2 . TRP G  1 25  ? 100.914 32.081   -42.774 1.00 62.73  ? 25  TRP G CH2 1 
ATOM   4379  N  N   . ILE G  1 26  ? 105.699 34.450   -40.890 1.00 67.78  ? 26  ILE G N   1 
ATOM   4380  C  CA  . ILE G  1 26  ? 105.023 35.478   -40.094 1.00 55.63  ? 26  ILE G CA  1 
ATOM   4381  C  C   . ILE G  1 26  ? 106.078 36.395   -39.501 1.00 65.66  ? 26  ILE G C   1 
ATOM   4382  O  O   . ILE G  1 26  ? 106.874 35.975   -38.663 1.00 68.37  ? 26  ILE G O   1 
ATOM   4383  C  CB  . ILE G  1 26  ? 104.201 34.907   -38.931 1.00 66.71  ? 26  ILE G CB  1 
ATOM   4384  C  CG1 . ILE G  1 26  ? 103.231 33.833   -39.419 1.00 50.42  ? 26  ILE G CG1 1 
ATOM   4385  C  CG2 . ILE G  1 26  ? 103.445 36.029   -38.241 1.00 74.94  ? 26  ILE G CG2 1 
ATOM   4386  C  CD1 . ILE G  1 26  ? 102.420 34.265   -40.597 1.00 52.51  ? 26  ILE G CD1 1 
ATOM   4387  N  N   . ILE G  1 27  ? 106.088 37.640   -39.954 1.00 62.09  ? 27  ILE G N   1 
ATOM   4388  C  CA  . ILE G  1 27  ? 107.035 38.627   -39.463 1.00 65.45  ? 27  ILE G CA  1 
ATOM   4389  C  C   . ILE G  1 27  ? 106.507 39.210   -38.163 1.00 67.46  ? 27  ILE G C   1 
ATOM   4390  O  O   . ILE G  1 27  ? 107.278 39.470   -37.232 1.00 65.77  ? 27  ILE G O   1 
ATOM   4391  C  CB  . ILE G  1 27  ? 107.215 39.764   -40.473 1.00 73.08  ? 27  ILE G CB  1 
ATOM   4392  C  CG1 . ILE G  1 27  ? 107.585 39.181   -41.836 1.00 78.57  ? 27  ILE G CG1 1 
ATOM   4393  C  CG2 . ILE G  1 27  ? 108.267 40.780   -39.982 1.00 50.95  ? 27  ILE G CG2 1 
ATOM   4394  C  CD1 . ILE G  1 27  ? 107.556 40.214   -42.940 1.00 89.08  ? 27  ILE G CD1 1 
ATOM   4395  N  N   . ALA G  1 28  ? 105.192 39.414   -38.113 1.00 58.47  ? 28  ALA G N   1 
ATOM   4396  C  CA  . ALA G  1 28  ? 104.525 39.905   -36.912 1.00 47.42  ? 28  ALA G CA  1 
ATOM   4397  C  C   . ALA G  1 28  ? 103.042 39.504   -36.860 1.00 54.31  ? 28  ALA G C   1 
ATOM   4398  O  O   . ALA G  1 28  ? 102.359 39.377   -37.891 1.00 51.08  ? 28  ALA G O   1 
ATOM   4399  C  CB  . ALA G  1 28  ? 104.673 41.418   -36.789 1.00 42.92  ? 28  ALA G CB  1 
ATOM   4400  N  N   . PRO G  1 29  ? 102.532 39.299   -35.643 1.00 55.09  ? 29  PRO G N   1 
ATOM   4401  C  CA  . PRO G  1 29  ? 103.274 39.402   -34.383 1.00 56.80  ? 29  PRO G CA  1 
ATOM   4402  C  C   . PRO G  1 29  ? 104.158 38.191   -34.202 1.00 57.82  ? 29  PRO G C   1 
ATOM   4403  O  O   . PRO G  1 29  ? 104.143 37.305   -35.056 1.00 53.89  ? 29  PRO G O   1 
ATOM   4404  C  CB  . PRO G  1 29  ? 102.166 39.353   -33.340 1.00 62.73  ? 29  PRO G CB  1 
ATOM   4405  C  CG  . PRO G  1 29  ? 101.138 38.492   -33.967 1.00 42.63  ? 29  PRO G CG  1 
ATOM   4406  C  CD  . PRO G  1 29  ? 101.140 38.874   -35.424 1.00 42.20  ? 29  PRO G CD  1 
ATOM   4407  N  N   . LYS G  1 30  ? 104.916 38.144   -33.113 1.00 55.54  ? 30  LYS G N   1 
ATOM   4408  C  CA  . LYS G  1 30  ? 105.732 36.967   -32.856 1.00 55.77  ? 30  LYS G CA  1 
ATOM   4409  C  C   . LYS G  1 30  ? 104.894 35.952   -32.099 1.00 64.82  ? 30  LYS G C   1 
ATOM   4410  O  O   . LYS G  1 30  ? 105.085 34.746   -32.258 1.00 72.97  ? 30  LYS G O   1 
ATOM   4411  C  CB  . LYS G  1 30  ? 107.010 37.301   -32.095 1.00 44.48  ? 30  LYS G CB  1 
ATOM   4412  C  CG  . LYS G  1 30  ? 107.994 38.204   -32.852 1.00 63.20  ? 30  LYS G CG  1 
ATOM   4413  C  CD  . LYS G  1 30  ? 108.519 37.580   -34.144 1.00 79.64  ? 30  LYS G CD  1 
ATOM   4414  C  CE  . LYS G  1 30  ? 109.420 38.564   -34.907 1.00 89.98  ? 30  LYS G CE  1 
ATOM   4415  N  NZ  . LYS G  1 30  ? 109.806 38.098   -36.278 1.00 86.40  ? 30  LYS G NZ  1 
ATOM   4416  N  N   . GLU G  1 31  ? 103.965 36.441   -31.280 1.00 45.61  ? 31  GLU G N   1 
ATOM   4417  C  CA  . GLU G  1 31  ? 102.954 35.580   -30.671 1.00 45.75  ? 31  GLU G CA  1 
ATOM   4418  C  C   . GLU G  1 31  ? 101.649 36.344   -30.559 1.00 50.68  ? 31  GLU G C   1 
ATOM   4419  O  O   . GLU G  1 31  ? 101.634 37.573   -30.603 1.00 68.12  ? 31  GLU G O   1 
ATOM   4420  C  CB  . GLU G  1 31  ? 103.391 35.003   -29.310 1.00 60.67  ? 31  GLU G CB  1 
ATOM   4421  C  CG  . GLU G  1 31  ? 103.216 35.918   -28.097 1.00 86.64  ? 31  GLU G CG  1 
ATOM   4422  C  CD  . GLU G  1 31  ? 103.684 35.264   -26.794 1.00 109.10 ? 31  GLU G CD  1 
ATOM   4423  O  OE1 . GLU G  1 31  ? 103.233 35.706   -25.712 1.00 121.60 ? 31  GLU G OE1 1 
ATOM   4424  O  OE2 . GLU G  1 31  ? 104.495 34.307   -26.855 1.00 97.43  ? 31  GLU G OE2 1 
ATOM   4425  N  N   . TYR G  1 32  ? 100.548 35.611   -30.444 1.00 50.65  ? 32  TYR G N   1 
ATOM   4426  C  CA  . TYR G  1 32  ? 99.229  36.230   -30.425 1.00 48.33  ? 32  TYR G CA  1 
ATOM   4427  C  C   . TYR G  1 32  ? 98.245  35.386   -29.621 1.00 58.21  ? 32  TYR G C   1 
ATOM   4428  O  O   . TYR G  1 32  ? 98.444  34.189   -29.418 1.00 39.69  ? 32  TYR G O   1 
ATOM   4429  C  CB  . TYR G  1 32  ? 98.691  36.380   -31.840 1.00 40.21  ? 32  TYR G CB  1 
ATOM   4430  C  CG  . TYR G  1 32  ? 97.971  35.132   -32.347 1.00 50.09  ? 32  TYR G CG  1 
ATOM   4431  C  CD1 . TYR G  1 32  ? 98.687  34.053   -32.882 1.00 45.27  ? 32  TYR G CD1 1 
ATOM   4432  C  CD2 . TYR G  1 32  ? 96.565  35.038   -32.293 1.00 43.57  ? 32  TYR G CD2 1 
ATOM   4433  C  CE1 . TYR G  1 32  ? 98.028  32.929   -33.355 1.00 67.67  ? 32  TYR G CE1 1 
ATOM   4434  C  CE2 . TYR G  1 32  ? 95.895  33.919   -32.763 1.00 41.92  ? 32  TYR G CE2 1 
ATOM   4435  C  CZ  . TYR G  1 32  ? 96.629  32.866   -33.291 1.00 68.45  ? 32  TYR G CZ  1 
ATOM   4436  O  OH  . TYR G  1 32  ? 95.948  31.759   -33.757 1.00 38.65  ? 32  TYR G OH  1 
ATOM   4437  N  N   . GLU G  1 33  ? 97.170  36.032   -29.186 1.00 54.73  ? 33  GLU G N   1 
ATOM   4438  C  CA  . GLU G  1 33  ? 96.176  35.390   -28.361 1.00 37.26  ? 33  GLU G CA  1 
ATOM   4439  C  C   . GLU G  1 33  ? 95.177  34.711   -29.239 1.00 54.95  ? 33  GLU G C   1 
ATOM   4440  O  O   . GLU G  1 33  ? 94.249  35.348   -29.740 1.00 64.58  ? 33  GLU G O   1 
ATOM   4441  C  CB  . GLU G  1 33  ? 95.438  36.423   -27.503 1.00 54.92  ? 33  GLU G CB  1 
ATOM   4442  C  CG  . GLU G  1 33  ? 94.326  35.833   -26.638 1.00 59.39  ? 33  GLU G CG  1 
ATOM   4443  C  CD  . GLU G  1 33  ? 94.862  34.975   -25.490 1.00 75.58  ? 33  GLU G CD  1 
ATOM   4444  O  OE1 . GLU G  1 33  ? 95.100  35.521   -24.381 1.00 81.37  ? 33  GLU G OE1 1 
ATOM   4445  O  OE2 . GLU G  1 33  ? 95.039  33.755   -25.696 1.00 66.21  ? 33  GLU G OE2 1 
ATOM   4446  N  N   . ALA G  1 34  ? 95.353  33.416   -29.438 1.00 66.11  ? 34  ALA G N   1 
ATOM   4447  C  CA  . ALA G  1 34  ? 94.224  32.646   -29.910 1.00 64.59  ? 34  ALA G CA  1 
ATOM   4448  C  C   . ALA G  1 34  ? 93.608  32.206   -28.611 1.00 78.60  ? 34  ALA G C   1 
ATOM   4449  O  O   . ALA G  1 34  ? 94.281  32.193   -27.558 1.00 122.50 ? 34  ALA G O   1 
ATOM   4450  C  CB  . ALA G  1 34  ? 94.682  31.483   -30.696 1.00 63.58  ? 34  ALA G CB  1 
ATOM   4451  N  N   . TYR G  1 35  ? 92.344  31.850   -28.615 1.00 42.57  ? 35  TYR G N   1 
ATOM   4452  C  CA  . TYR G  1 35  ? 91.898  31.341   -27.340 1.00 66.55  ? 35  TYR G CA  1 
ATOM   4453  C  C   . TYR G  1 35  ? 91.851  29.833   -27.359 1.00 66.87  ? 35  TYR G C   1 
ATOM   4454  O  O   . TYR G  1 35  ? 92.177  29.224   -28.377 1.00 71.80  ? 35  TYR G O   1 
ATOM   4455  C  CB  . TYR G  1 35  ? 90.587  31.969   -26.929 1.00 81.86  ? 35  TYR G CB  1 
ATOM   4456  C  CG  . TYR G  1 35  ? 90.758  33.412   -26.566 1.00 72.87  ? 35  TYR G CG  1 
ATOM   4457  C  CD1 . TYR G  1 35  ? 90.490  34.407   -27.472 1.00 68.08  ? 35  TYR G CD1 1 
ATOM   4458  C  CD2 . TYR G  1 35  ? 91.212  33.776   -25.313 1.00 69.21  ? 35  TYR G CD2 1 
ATOM   4459  C  CE1 . TYR G  1 35  ? 90.653  35.724   -27.133 1.00 67.87  ? 35  TYR G CE1 1 
ATOM   4460  C  CE2 . TYR G  1 35  ? 91.373  35.093   -24.964 1.00 50.65  ? 35  TYR G CE2 1 
ATOM   4461  C  CZ  . TYR G  1 35  ? 91.102  36.060   -25.875 1.00 51.64  ? 35  TYR G CZ  1 
ATOM   4462  O  OH  . TYR G  1 35  ? 91.276  37.373   -25.510 1.00 59.30  ? 35  TYR G OH  1 
ATOM   4463  N  N   . GLU G  1 36  ? 91.490  29.239   -26.225 1.00 56.87  ? 36  GLU G N   1 
ATOM   4464  C  CA  . GLU G  1 36  ? 91.189  27.820   -26.166 1.00 71.86  ? 36  GLU G CA  1 
ATOM   4465  C  C   . GLU G  1 36  ? 89.762  27.685   -25.675 1.00 58.63  ? 36  GLU G C   1 
ATOM   4466  O  O   . GLU G  1 36  ? 89.281  28.543   -24.950 1.00 49.06  ? 36  GLU G O   1 
ATOM   4467  C  CB  . GLU G  1 36  ? 92.153  27.101   -25.219 1.00 76.91  ? 36  GLU G CB  1 
ATOM   4468  C  CG  . GLU G  1 36  ? 92.137  25.580   -25.349 1.00 93.41  ? 36  GLU G CG  1 
ATOM   4469  C  CD  . GLU G  1 36  ? 93.260  24.911   -24.568 1.00 118.96 ? 36  GLU G CD  1 
ATOM   4470  O  OE1 . GLU G  1 36  ? 94.009  25.638   -23.871 1.00 121.11 ? 36  GLU G OE1 1 
ATOM   4471  O  OE2 . GLU G  1 36  ? 93.389  23.662   -24.651 1.00 113.67 ? 36  GLU G OE2 1 
ATOM   4472  N  N   . CYS G  1 37  ? 89.072  26.627   -26.083 1.00 55.98  ? 37  CYS G N   1 
ATOM   4473  C  CA  . CYS G  1 37  ? 87.768  26.307   -25.479 1.00 53.87  ? 37  CYS G CA  1 
ATOM   4474  C  C   . CYS G  1 37  ? 87.861  25.085   -24.555 1.00 54.12  ? 37  CYS G C   1 
ATOM   4475  O  O   . CYS G  1 37  ? 87.930  23.948   -25.015 1.00 60.41  ? 37  CYS G O   1 
ATOM   4476  C  CB  . CYS G  1 37  ? 86.678  26.146   -26.542 1.00 50.88  ? 37  CYS G CB  1 
ATOM   4477  S  SG  . CYS G  1 37  ? 86.059  27.761   -27.186 1.00 86.01  ? 37  CYS G SG  1 
ATOM   4478  N  N   . LYS G  1 38  ? 87.906  25.346   -23.249 1.00 63.89  ? 38  LYS G N   1 
ATOM   4479  C  CA  . LYS G  1 38  ? 88.215  24.310   -22.262 1.00 45.82  ? 38  LYS G CA  1 
ATOM   4480  C  C   . LYS G  1 38  ? 86.993  24.092   -21.411 1.00 51.54  ? 38  LYS G C   1 
ATOM   4481  O  O   . LYS G  1 38  ? 86.213  25.000   -21.182 1.00 57.14  ? 38  LYS G O   1 
ATOM   4482  C  CB  . LYS G  1 38  ? 89.370  24.733   -21.335 1.00 40.63  ? 38  LYS G CB  1 
ATOM   4483  C  CG  . LYS G  1 38  ? 90.765  24.195   -21.673 1.00 61.67  ? 38  LYS G CG  1 
ATOM   4484  C  CD  . LYS G  1 38  ? 91.840  24.758   -20.706 1.00 85.77  ? 38  LYS G CD  1 
ATOM   4485  C  CE  . LYS G  1 38  ? 93.276  24.375   -21.110 1.00 96.09  ? 38  LYS G CE  1 
ATOM   4486  N  NZ  . LYS G  1 38  ? 94.256  25.484   -20.849 1.00 82.02  ? 38  LYS G NZ  1 
ATOM   4487  N  N   . GLY G  1 39  ? 86.819  22.879   -20.934 1.00 50.10  ? 39  GLY G N   1 
ATOM   4488  C  CA  . GLY G  1 39  ? 85.760  22.631   -19.988 1.00 55.50  ? 39  GLY G CA  1 
ATOM   4489  C  C   . GLY G  1 39  ? 84.689  21.688   -20.457 1.00 59.37  ? 39  GLY G C   1 
ATOM   4490  O  O   . GLY G  1 39  ? 84.647  21.308   -21.626 1.00 82.53  ? 39  GLY G O   1 
ATOM   4491  N  N   . GLY G  1 40  ? 83.816  21.321   -19.528 1.00 48.23  ? 40  GLY G N   1 
ATOM   4492  C  CA  . GLY G  1 40  ? 82.819  20.306   -19.788 1.00 63.83  ? 40  GLY G CA  1 
ATOM   4493  C  C   . GLY G  1 40  ? 81.442  20.885   -19.972 1.00 62.96  ? 40  GLY G C   1 
ATOM   4494  O  O   . GLY G  1 40  ? 81.120  21.955   -19.467 1.00 59.58  ? 40  GLY G O   1 
ATOM   4495  N  N   . CYS G  1 41  ? 80.617  20.166   -20.710 1.00 59.21  ? 41  CYS G N   1 
ATOM   4496  C  CA  . CYS G  1 41  ? 79.258  20.607   -20.929 1.00 56.31  ? 41  CYS G CA  1 
ATOM   4497  C  C   . CYS G  1 41  ? 78.356  19.806   -20.011 1.00 72.33  ? 41  CYS G C   1 
ATOM   4498  O  O   . CYS G  1 41  ? 77.920  18.695   -20.340 1.00 83.73  ? 41  CYS G O   1 
ATOM   4499  C  CB  . CYS G  1 41  ? 78.902  20.429   -22.394 1.00 71.64  ? 41  CYS G CB  1 
ATOM   4500  S  SG  . CYS G  1 41  ? 80.079  21.320   -23.463 1.00 86.14  ? 41  CYS G SG  1 
ATOM   4501  N  N   . PHE G  1 42  ? 78.107  20.385   -18.841 1.00 72.40  ? 42  PHE G N   1 
ATOM   4502  C  CA  . PHE G  1 42  ? 77.468  19.676   -17.744 1.00 77.69  ? 42  PHE G CA  1 
ATOM   4503  C  C   . PHE G  1 42  ? 76.023  20.077   -17.613 1.00 78.56  ? 42  PHE G C   1 
ATOM   4504  O  O   . PHE G  1 42  ? 75.710  21.255   -17.610 1.00 104.56 ? 42  PHE G O   1 
ATOM   4505  C  CB  . PHE G  1 42  ? 78.214  19.954   -16.435 1.00 77.06  ? 42  PHE G CB  1 
ATOM   4506  C  CG  . PHE G  1 42  ? 79.603  19.377   -16.403 1.00 81.01  ? 42  PHE G CG  1 
ATOM   4507  C  CD1 . PHE G  1 42  ? 80.703  20.196   -16.225 1.00 70.18  ? 42  PHE G CD1 1 
ATOM   4508  C  CD2 . PHE G  1 42  ? 79.808  18.000   -16.587 1.00 106.19 ? 42  PHE G CD2 1 
ATOM   4509  C  CE1 . PHE G  1 42  ? 81.985  19.662   -16.217 1.00 97.14  ? 42  PHE G CE1 1 
ATOM   4510  C  CE2 . PHE G  1 42  ? 81.097  17.449   -16.577 1.00 109.69 ? 42  PHE G CE2 1 
ATOM   4511  C  CZ  . PHE G  1 42  ? 82.187  18.284   -16.392 1.00 106.30 ? 42  PHE G CZ  1 
ATOM   4512  N  N   . PHE G  1 43  ? 75.142  19.095   -17.499 1.00 69.98  ? 43  PHE G N   1 
ATOM   4513  C  CA  . PHE G  1 43  ? 73.720  19.381   -17.395 1.00 75.54  ? 43  PHE G CA  1 
ATOM   4514  C  C   . PHE G  1 43  ? 73.375  20.004   -16.036 1.00 84.40  ? 43  PHE G C   1 
ATOM   4515  O  O   . PHE G  1 43  ? 73.919  19.594   -15.005 1.00 79.50  ? 43  PHE G O   1 
ATOM   4516  C  CB  . PHE G  1 43  ? 72.906  18.106   -17.623 1.00 65.40  ? 43  PHE G CB  1 
ATOM   4517  C  CG  . PHE G  1 43  ? 71.512  18.357   -18.121 1.00 71.20  ? 43  PHE G CG  1 
ATOM   4518  C  CD1 . PHE G  1 43  ? 71.285  18.588   -19.466 1.00 83.37  ? 43  PHE G CD1 1 
ATOM   4519  C  CD2 . PHE G  1 43  ? 70.433  18.363   -17.252 1.00 70.71  ? 43  PHE G CD2 1 
ATOM   4520  C  CE1 . PHE G  1 43  ? 70.012  18.825   -19.936 1.00 88.98  ? 43  PHE G CE1 1 
ATOM   4521  C  CE2 . PHE G  1 43  ? 69.164  18.601   -17.716 1.00 65.30  ? 43  PHE G CE2 1 
ATOM   4522  C  CZ  . PHE G  1 43  ? 68.953  18.833   -19.059 1.00 81.36  ? 43  PHE G CZ  1 
ATOM   4523  N  N   . PRO G  1 44  ? 72.480  21.013   -16.035 1.00 90.28  ? 44  PRO G N   1 
ATOM   4524  C  CA  . PRO G  1 44  ? 71.836  21.550   -17.238 1.00 94.48  ? 44  PRO G CA  1 
ATOM   4525  C  C   . PRO G  1 44  ? 72.743  22.527   -17.969 1.00 93.37  ? 44  PRO G C   1 
ATOM   4526  O  O   . PRO G  1 44  ? 73.616  23.133   -17.355 1.00 102.97 ? 44  PRO G O   1 
ATOM   4527  C  CB  . PRO G  1 44  ? 70.628  22.288   -16.674 1.00 84.40  ? 44  PRO G CB  1 
ATOM   4528  C  CG  . PRO G  1 44  ? 71.112  22.791   -15.368 1.00 81.52  ? 44  PRO G CG  1 
ATOM   4529  C  CD  . PRO G  1 44  ? 72.042  21.732   -14.826 1.00 88.42  ? 44  PRO G CD  1 
ATOM   4530  N  N   . LEU G  1 45  ? 72.525  22.681   -19.268 1.00 76.23  ? 45  LEU G N   1 
ATOM   4531  C  CA  . LEU G  1 45  ? 73.398  23.497   -20.082 1.00 63.80  ? 45  LEU G CA  1 
ATOM   4532  C  C   . LEU G  1 45  ? 73.037  24.971   -19.965 1.00 78.00  ? 45  LEU G C   1 
ATOM   4533  O  O   . LEU G  1 45  ? 71.953  25.384   -20.359 1.00 81.98  ? 45  LEU G O   1 
ATOM   4534  C  CB  . LEU G  1 45  ? 73.351  23.031   -21.538 1.00 46.79  ? 45  LEU G CB  1 
ATOM   4535  C  CG  . LEU G  1 45  ? 73.746  21.564   -21.725 1.00 54.98  ? 45  LEU G CG  1 
ATOM   4536  C  CD1 . LEU G  1 45  ? 73.719  21.152   -23.184 1.00 66.23  ? 45  LEU G CD1 1 
ATOM   4537  C  CD2 . LEU G  1 45  ? 75.114  21.285   -21.126 1.00 53.53  ? 45  LEU G CD2 1 
ATOM   4538  N  N   . ALA G  1 46  ? 73.958  25.755   -19.416 1.00 82.46  ? 46  ALA G N   1 
ATOM   4539  C  CA  . ALA G  1 46  ? 73.781  27.196   -19.284 1.00 82.86  ? 46  ALA G CA  1 
ATOM   4540  C  C   . ALA G  1 46  ? 73.462  27.870   -20.621 1.00 76.23  ? 46  ALA G C   1 
ATOM   4541  O  O   . ALA G  1 46  ? 74.010  27.489   -21.657 1.00 67.43  ? 46  ALA G O   1 
ATOM   4542  C  CB  . ALA G  1 46  ? 75.032  27.812   -18.670 1.00 100.46 ? 46  ALA G CB  1 
ATOM   4543  N  N   . ASP G  1 47  ? 72.590  28.881   -20.591 1.00 78.22  ? 47  ASP G N   1 
ATOM   4544  C  CA  . ASP G  1 47  ? 72.206  29.597   -21.807 1.00 69.00  ? 47  ASP G CA  1 
ATOM   4545  C  C   . ASP G  1 47  ? 73.420  30.174   -22.547 1.00 75.76  ? 47  ASP G C   1 
ATOM   4546  O  O   . ASP G  1 47  ? 73.455  30.185   -23.782 1.00 57.68  ? 47  ASP G O   1 
ATOM   4547  C  CB  . ASP G  1 47  ? 71.229  30.726   -21.499 1.00 73.84  ? 47  ASP G CB  1 
ATOM   4548  C  CG  . ASP G  1 47  ? 70.017  30.267   -20.719 1.00 109.54 ? 47  ASP G CG  1 
ATOM   4549  O  OD1 . ASP G  1 47  ? 70.040  30.364   -19.471 1.00 125.96 ? 47  ASP G OD1 1 
ATOM   4550  O  OD2 . ASP G  1 47  ? 69.032  29.832   -21.354 1.00 105.98 ? 47  ASP G OD2 1 
ATOM   4551  N  N   . ASP G  1 48  ? 74.407  30.663   -21.791 1.00 85.57  ? 48  ASP G N   1 
ATOM   4552  C  CA  . ASP G  1 48  ? 75.582  31.309   -22.383 1.00 67.72  ? 48  ASP G CA  1 
ATOM   4553  C  C   . ASP G  1 48  ? 76.487  30.321   -23.102 1.00 61.85  ? 48  ASP G C   1 
ATOM   4554  O  O   . ASP G  1 48  ? 77.604  30.646   -23.478 1.00 68.86  ? 48  ASP G O   1 
ATOM   4555  C  CB  . ASP G  1 48  ? 76.372  32.135   -21.357 1.00 80.28  ? 48  ASP G CB  1 
ATOM   4556  C  CG  . ASP G  1 48  ? 76.819  31.325   -20.162 1.00 107.63 ? 48  ASP G CG  1 
ATOM   4557  O  OD1 . ASP G  1 48  ? 76.020  30.508   -19.667 1.00 136.35 ? 48  ASP G OD1 1 
ATOM   4558  O  OD2 . ASP G  1 48  ? 77.968  31.512   -19.706 1.00 95.52  ? 48  ASP G OD2 1 
ATOM   4559  N  N   . VAL G  1 49  ? 75.986  29.113   -23.308 1.00 68.79  ? 49  VAL G N   1 
ATOM   4560  C  CA  . VAL G  1 49  ? 76.737  28.109   -24.033 1.00 62.72  ? 49  VAL G CA  1 
ATOM   4561  C  C   . VAL G  1 49  ? 76.030  27.755   -25.342 1.00 74.51  ? 49  VAL G C   1 
ATOM   4562  O  O   . VAL G  1 49  ? 76.478  26.906   -26.105 1.00 72.34  ? 49  VAL G O   1 
ATOM   4563  C  CB  . VAL G  1 49  ? 76.988  26.903   -23.149 1.00 52.13  ? 49  VAL G CB  1 
ATOM   4564  C  CG1 . VAL G  1 49  ? 77.307  25.696   -23.977 1.00 73.32  ? 49  VAL G CG1 1 
ATOM   4565  C  CG2 . VAL G  1 49  ? 78.129  27.208   -22.198 1.00 27.21  ? 49  VAL G CG2 1 
ATOM   4566  N  N   . THR G  1 50  ? 74.932  28.453   -25.609 1.00 64.67  ? 50  THR G N   1 
ATOM   4567  C  CA  . THR G  1 50  ? 74.276  28.385   -26.907 1.00 56.79  ? 50  THR G CA  1 
ATOM   4568  C  C   . THR G  1 50  ? 73.884  26.961   -27.292 1.00 59.78  ? 50  THR G C   1 
ATOM   4569  O  O   . THR G  1 50  ? 73.922  26.609   -28.469 1.00 70.16  ? 50  THR G O   1 
ATOM   4570  C  CB  . THR G  1 50  ? 75.199  28.934   -28.014 1.00 66.98  ? 50  THR G CB  1 
ATOM   4571  O  OG1 . THR G  1 50  ? 76.066  29.935   -27.470 1.00 69.51  ? 50  THR G OG1 1 
ATOM   4572  C  CG2 . THR G  1 50  ? 74.397  29.513   -29.169 1.00 72.87  ? 50  THR G CG2 1 
ATOM   4573  N  N   . PRO G  1 51  ? 73.476  26.141   -26.310 1.00 47.32  ? 51  PRO G N   1 
ATOM   4574  C  CA  . PRO G  1 51  ? 73.275  24.727   -26.622 1.00 42.82  ? 51  PRO G CA  1 
ATOM   4575  C  C   . PRO G  1 51  ? 72.366  24.566   -27.809 1.00 39.16  ? 51  PRO G C   1 
ATOM   4576  O  O   . PRO G  1 51  ? 71.378  25.279   -27.901 1.00 44.03  ? 51  PRO G O   1 
ATOM   4577  C  CB  . PRO G  1 51  ? 72.608  24.177   -25.355 1.00 19.83  ? 51  PRO G CB  1 
ATOM   4578  C  CG  . PRO G  1 51  ? 72.066  25.356   -24.664 1.00 41.15  ? 51  PRO G CG  1 
ATOM   4579  C  CD  . PRO G  1 51  ? 72.995  26.469   -24.961 1.00 47.73  ? 51  PRO G CD  1 
ATOM   4580  N  N   . THR G  1 52  ? 72.728  23.671   -28.719 1.00 41.23  ? 52  THR G N   1 
ATOM   4581  C  CA  . THR G  1 52  ? 71.836  23.244   -29.795 1.00 53.71  ? 52  THR G CA  1 
ATOM   4582  C  C   . THR G  1 52  ? 70.867  22.211   -29.249 1.00 57.07  ? 52  THR G C   1 
ATOM   4583  O  O   . THR G  1 52  ? 71.149  21.572   -28.233 1.00 45.31  ? 52  THR G O   1 
ATOM   4584  C  CB  . THR G  1 52  ? 72.601  22.606   -31.001 1.00 46.74  ? 52  THR G CB  1 
ATOM   4585  O  OG1 . THR G  1 52  ? 73.167  21.340   -30.637 1.00 52.80  ? 52  THR G OG1 1 
ATOM   4586  C  CG2 . THR G  1 52  ? 73.693  23.505   -31.457 1.00 50.45  ? 52  THR G CG2 1 
ATOM   4587  N  N   . LYS G  1 53  ? 69.726  22.040   -29.915 1.00 56.84  ? 53  LYS G N   1 
ATOM   4588  C  CA  . LYS G  1 53  ? 68.804  20.981   -29.522 1.00 49.76  ? 53  LYS G CA  1 
ATOM   4589  C  C   . LYS G  1 53  ? 69.596  19.703   -29.428 1.00 56.44  ? 53  LYS G C   1 
ATOM   4590  O  O   . LYS G  1 53  ? 69.586  19.018   -28.407 1.00 61.15  ? 53  LYS G O   1 
ATOM   4591  C  CB  . LYS G  1 53  ? 67.689  20.805   -30.541 1.00 41.30  ? 53  LYS G CB  1 
ATOM   4592  C  CG  . LYS G  1 53  ? 66.298  21.205   -30.039 1.00 41.75  ? 53  LYS G CG  1 
ATOM   4593  C  CD  . LYS G  1 53  ? 66.228  22.661   -29.636 1.00 44.45  ? 53  LYS G CD  1 
ATOM   4594  C  CE  . LYS G  1 53  ? 64.820  23.076   -29.379 1.00 56.97  ? 53  LYS G CE  1 
ATOM   4595  N  NZ  . LYS G  1 53  ? 64.705  24.483   -28.866 1.00 82.94  ? 53  LYS G NZ  1 
ATOM   4596  N  N   . HIS G  1 54  ? 70.307  19.389   -30.499 1.00 47.91  ? 54  HIS G N   1 
ATOM   4597  C  CA  . HIS G  1 54  ? 71.027  18.140   -30.552 1.00 38.06  ? 54  HIS G CA  1 
ATOM   4598  C  C   . HIS G  1 54  ? 71.929  17.964   -29.357 1.00 46.99  ? 54  HIS G C   1 
ATOM   4599  O  O   . HIS G  1 54  ? 71.941  16.918   -28.744 1.00 35.51  ? 54  HIS G O   1 
ATOM   4600  C  CB  . HIS G  1 54  ? 71.850  18.045   -31.808 1.00 28.74  ? 54  HIS G CB  1 
ATOM   4601  C  CG  . HIS G  1 54  ? 72.562  16.732   -31.953 1.00 50.27  ? 54  HIS G CG  1 
ATOM   4602  N  ND1 . HIS G  1 54  ? 73.700  16.409   -31.238 1.00 29.51  ? 54  HIS G ND1 1 
ATOM   4603  C  CD2 . HIS G  1 54  ? 72.289  15.659   -32.734 1.00 38.12  ? 54  HIS G CD2 1 
ATOM   4604  C  CE1 . HIS G  1 54  ? 74.104  15.203   -31.592 1.00 49.78  ? 54  HIS G CE1 1 
ATOM   4605  N  NE2 . HIS G  1 54  ? 73.259  14.722   -32.488 1.00 35.59  ? 54  HIS G NE2 1 
ATOM   4606  N  N   . ALA G  1 55  ? 72.703  18.991   -29.047 1.00 48.98  ? 55  ALA G N   1 
ATOM   4607  C  CA  . ALA G  1 55  ? 73.581  18.945   -27.889 1.00 51.78  ? 55  ALA G CA  1 
ATOM   4608  C  C   . ALA G  1 55  ? 72.798  18.561   -26.641 1.00 55.14  ? 55  ALA G C   1 
ATOM   4609  O  O   . ALA G  1 55  ? 73.269  17.784   -25.812 1.00 35.47  ? 55  ALA G O   1 
ATOM   4610  C  CB  . ALA G  1 55  ? 74.242  20.284   -27.695 1.00 59.28  ? 55  ALA G CB  1 
ATOM   4611  N  N   . ILE G  1 56  ? 71.600  19.120   -26.504 1.00 51.11  ? 56  ILE G N   1 
ATOM   4612  C  CA  . ILE G  1 56  ? 70.758  18.792   -25.362 1.00 53.83  ? 56  ILE G CA  1 
ATOM   4613  C  C   . ILE G  1 56  ? 70.429  17.306   -25.354 1.00 54.78  ? 56  ILE G C   1 
ATOM   4614  O  O   . ILE G  1 56  ? 70.734  16.585   -24.401 1.00 48.99  ? 56  ILE G O   1 
ATOM   4615  C  CB  . ILE G  1 56  ? 69.434  19.564   -25.381 1.00 40.15  ? 56  ILE G CB  1 
ATOM   4616  C  CG1 . ILE G  1 56  ? 69.674  21.081   -25.328 1.00 28.83  ? 56  ILE G CG1 1 
ATOM   4617  C  CG2 . ILE G  1 56  ? 68.573  19.103   -24.222 1.00 38.30  ? 56  ILE G CG2 1 
ATOM   4618  C  CD1 . ILE G  1 56  ? 69.714  21.647   -23.930 1.00 62.18  ? 56  ILE G CD1 1 
ATOM   4619  N  N   . VAL G  1 57  ? 69.795  16.854   -26.426 1.00 38.36  ? 57  VAL G N   1 
ATOM   4620  C  CA  . VAL G  1 57  ? 69.451  15.442   -26.560 1.00 46.82  ? 57  VAL G CA  1 
ATOM   4621  C  C   . VAL G  1 57  ? 70.645  14.517   -26.272 1.00 54.35  ? 57  VAL G C   1 
ATOM   4622  O  O   . VAL G  1 57  ? 70.579  13.661   -25.386 1.00 38.66  ? 57  VAL G O   1 
ATOM   4623  C  CB  . VAL G  1 57  ? 68.907  15.152   -27.963 1.00 36.20  ? 57  VAL G CB  1 
ATOM   4624  C  CG1 . VAL G  1 57  ? 68.723  13.682   -28.166 1.00 7.12   ? 57  VAL G CG1 1 
ATOM   4625  C  CG2 . VAL G  1 57  ? 67.620  15.865   -28.151 1.00 23.75  ? 57  VAL G CG2 1 
ATOM   4626  N  N   . GLN G  1 58  ? 71.729  14.688   -27.028 1.00 51.76  ? 58  GLN G N   1 
ATOM   4627  C  CA  . GLN G  1 58  ? 72.928  13.891   -26.820 1.00 52.50  ? 58  GLN G CA  1 
ATOM   4628  C  C   . GLN G  1 58  ? 73.289  13.892   -25.351 1.00 49.13  ? 58  GLN G C   1 
ATOM   4629  O  O   . GLN G  1 58  ? 73.456  12.832   -24.773 1.00 35.81  ? 58  GLN G O   1 
ATOM   4630  C  CB  . GLN G  1 58  ? 74.115  14.373   -27.667 1.00 41.67  ? 58  GLN G CB  1 
ATOM   4631  C  CG  . GLN G  1 58  ? 75.396  13.521   -27.490 1.00 15.84  ? 58  GLN G CG  1 
ATOM   4632  C  CD  . GLN G  1 58  ? 76.445  13.760   -28.575 1.00 56.01  ? 58  GLN G CD  1 
ATOM   4633  O  OE1 . GLN G  1 58  ? 76.130  14.115   -29.712 1.00 64.84  ? 58  GLN G OE1 1 
ATOM   4634  N  NE2 . GLN G  1 58  ? 77.701  13.557   -28.222 1.00 81.52  ? 58  GLN G NE2 1 
ATOM   4635  N  N   . THR G  1 59  ? 73.391  15.074   -24.743 1.00 23.12  ? 59  THR G N   1 
ATOM   4636  C  CA  . THR G  1 59  ? 73.708  15.162   -23.313 1.00 35.36  ? 59  THR G CA  1 
ATOM   4637  C  C   . THR G  1 59  ? 72.817  14.262   -22.425 1.00 43.45  ? 59  THR G C   1 
ATOM   4638  O  O   . THR G  1 59  ? 73.295  13.534   -21.549 1.00 29.48  ? 59  THR G O   1 
ATOM   4639  C  CB  . THR G  1 59  ? 73.669  16.608   -22.805 1.00 38.23  ? 59  THR G CB  1 
ATOM   4640  O  OG1 . THR G  1 59  ? 74.964  17.209   -22.971 1.00 51.99  ? 59  THR G OG1 1 
ATOM   4641  C  CG2 . THR G  1 59  ? 73.308  16.613   -21.333 1.00 17.16  ? 59  THR G CG2 1 
ATOM   4642  N  N   . LEU G  1 60  ? 71.514  14.295   -22.662 1.00 46.91  ? 60  LEU G N   1 
ATOM   4643  C  CA  . LEU G  1 60  ? 70.599  13.423   -21.920 1.00 38.47  ? 60  LEU G CA  1 
ATOM   4644  C  C   . LEU G  1 60  ? 70.916  11.945   -22.148 1.00 46.21  ? 60  LEU G C   1 
ATOM   4645  O  O   . LEU G  1 60  ? 71.164  11.167   -21.200 1.00 56.81  ? 60  LEU G O   1 
ATOM   4646  C  CB  . LEU G  1 60  ? 69.155  13.706   -22.345 1.00 42.53  ? 60  LEU G CB  1 
ATOM   4647  C  CG  . LEU G  1 60  ? 68.576  15.066   -21.962 1.00 44.70  ? 60  LEU G CG  1 
ATOM   4648  C  CD1 . LEU G  1 60  ? 67.082  15.009   -22.081 1.00 34.33  ? 60  LEU G CD1 1 
ATOM   4649  C  CD2 . LEU G  1 60  ? 68.957  15.426   -20.545 1.00 47.89  ? 60  LEU G CD2 1 
ATOM   4650  N  N   . VAL G  1 61  ? 70.894  11.550   -23.418 1.00 36.99  ? 61  VAL G N   1 
ATOM   4651  C  CA  . VAL G  1 61  ? 71.259  10.189   -23.772 1.00 52.85  ? 61  VAL G CA  1 
ATOM   4652  C  C   . VAL G  1 61  ? 72.539  9.733    -23.058 1.00 58.70  ? 61  VAL G C   1 
ATOM   4653  O  O   . VAL G  1 61  ? 72.586  8.622    -22.534 1.00 50.63  ? 61  VAL G O   1 
ATOM   4654  C  CB  . VAL G  1 61  ? 71.432  10.039   -25.284 1.00 49.15  ? 61  VAL G CB  1 
ATOM   4655  C  CG1 . VAL G  1 61  ? 71.929  8.620    -25.634 1.00 27.08  ? 61  VAL G CG1 1 
ATOM   4656  C  CG2 . VAL G  1 61  ? 70.124  10.372   -25.979 1.00 30.08  ? 61  VAL G CG2 1 
ATOM   4657  N  N   . HIS G  1 62  ? 73.560  10.591   -23.039 1.00 35.01  ? 62  HIS G N   1 
ATOM   4658  C  CA  . HIS G  1 62  ? 74.801  10.294   -22.353 1.00 39.15  ? 62  HIS G CA  1 
ATOM   4659  C  C   . HIS G  1 62  ? 74.584  10.086   -20.873 1.00 43.43  ? 62  HIS G C   1 
ATOM   4660  O  O   . HIS G  1 62  ? 75.192  9.197    -20.283 1.00 51.79  ? 62  HIS G O   1 
ATOM   4661  C  CB  . HIS G  1 62  ? 75.837  11.397   -22.539 1.00 51.97  ? 62  HIS G CB  1 
ATOM   4662  C  CG  . HIS G  1 62  ? 76.930  11.353   -21.515 1.00 48.48  ? 62  HIS G CG  1 
ATOM   4663  N  ND1 . HIS G  1 62  ? 76.862  12.048   -20.327 1.00 66.91  ? 62  HIS G ND1 1 
ATOM   4664  C  CD2 . HIS G  1 62  ? 78.094  10.664   -21.481 1.00 34.32  ? 62  HIS G CD2 1 
ATOM   4665  C  CE1 . HIS G  1 62  ? 77.949  11.807   -19.614 1.00 72.61  ? 62  HIS G CE1 1 
ATOM   4666  N  NE2 . HIS G  1 62  ? 78.708  10.961   -20.288 1.00 65.14  ? 62  HIS G NE2 1 
ATOM   4667  N  N   . LEU G  1 63  ? 73.743  10.908   -20.255 1.00 44.03  ? 63  LEU G N   1 
ATOM   4668  C  CA  . LEU G  1 63  ? 73.383  10.648   -18.853 1.00 46.37  ? 63  LEU G CA  1 
ATOM   4669  C  C   . LEU G  1 63  ? 72.899  9.217    -18.658 1.00 57.22  ? 63  LEU G C   1 
ATOM   4670  O  O   . LEU G  1 63  ? 73.194  8.593    -17.650 1.00 46.80  ? 63  LEU G O   1 
ATOM   4671  C  CB  . LEU G  1 63  ? 72.309  11.606   -18.369 1.00 39.16  ? 63  LEU G CB  1 
ATOM   4672  C  CG  . LEU G  1 63  ? 72.867  12.999   -18.146 1.00 59.60  ? 63  LEU G CG  1 
ATOM   4673  C  CD1 . LEU G  1 63  ? 71.743  14.012   -17.928 1.00 64.51  ? 63  LEU G CD1 1 
ATOM   4674  C  CD2 . LEU G  1 63  ? 73.831  12.934   -16.966 1.00 46.28  ? 63  LEU G CD2 1 
ATOM   4675  N  N   . LYS G  1 64  ? 72.156  8.687    -19.622 1.00 58.51  ? 64  LYS G N   1 
ATOM   4676  C  CA  . LYS G  1 64  ? 71.744  7.290    -19.476 1.00 48.26  ? 64  LYS G CA  1 
ATOM   4677  C  C   . LYS G  1 64  ? 72.764  6.227    -19.949 1.00 46.18  ? 64  LYS G C   1 
ATOM   4678  O  O   . LYS G  1 64  ? 72.721  5.084    -19.503 1.00 53.70  ? 64  LYS G O   1 
ATOM   4679  C  CB  . LYS G  1 64  ? 70.377  7.037    -20.141 1.00 56.84  ? 64  LYS G CB  1 
ATOM   4680  C  CG  . LYS G  1 64  ? 69.774  5.631    -19.862 1.00 48.34  ? 64  LYS G CG  1 
ATOM   4681  C  CD  . LYS G  1 64  ? 68.360  5.496    -20.378 1.00 55.01  ? 64  LYS G CD  1 
ATOM   4682  C  CE  . LYS G  1 64  ? 67.572  4.480    -19.573 1.00 70.88  ? 64  LYS G CE  1 
ATOM   4683  N  NZ  . LYS G  1 64  ? 66.113  4.569    -19.823 1.00 82.06  ? 64  LYS G NZ  1 
ATOM   4684  N  N   . PHE G  1 65  ? 73.651  6.575    -20.873 1.00 49.53  ? 65  PHE G N   1 
ATOM   4685  C  CA  . PHE G  1 65  ? 74.563  5.583    -21.454 1.00 51.76  ? 65  PHE G CA  1 
ATOM   4686  C  C   . PHE G  1 65  ? 75.976  6.113    -21.501 1.00 64.45  ? 65  PHE G C   1 
ATOM   4687  O  O   . PHE G  1 65  ? 76.605  6.160    -22.567 1.00 62.62  ? 65  PHE G O   1 
ATOM   4688  C  CB  . PHE G  1 65  ? 74.130  5.214    -22.863 1.00 56.49  ? 65  PHE G CB  1 
ATOM   4689  C  CG  . PHE G  1 65  ? 72.762  4.627    -22.930 1.00 70.48  ? 65  PHE G CG  1 
ATOM   4690  C  CD1 . PHE G  1 65  ? 71.644  5.446    -22.960 1.00 78.77  ? 65  PHE G CD1 1 
ATOM   4691  C  CD2 . PHE G  1 65  ? 72.592  3.262    -22.961 1.00 68.09  ? 65  PHE G CD2 1 
ATOM   4692  C  CE1 . PHE G  1 65  ? 70.384  4.909    -23.015 1.00 73.38  ? 65  PHE G CE1 1 
ATOM   4693  C  CE2 . PHE G  1 65  ? 71.346  2.728    -23.025 1.00 75.10  ? 65  PHE G CE2 1 
ATOM   4694  C  CZ  . PHE G  1 65  ? 70.236  3.552    -23.049 1.00 75.95  ? 65  PHE G CZ  1 
ATOM   4695  N  N   . PRO G  1 66  ? 76.485  6.501    -20.331 1.00 60.44  ? 66  PRO G N   1 
ATOM   4696  C  CA  . PRO G  1 66  ? 77.726  7.246    -20.180 1.00 51.62  ? 66  PRO G CA  1 
ATOM   4697  C  C   . PRO G  1 66  ? 78.913  6.518    -20.786 1.00 61.95  ? 66  PRO G C   1 
ATOM   4698  O  O   . PRO G  1 66  ? 79.994  7.090    -20.874 1.00 89.58  ? 66  PRO G O   1 
ATOM   4699  C  CB  . PRO G  1 66  ? 77.878  7.326    -18.659 1.00 49.46  ? 66  PRO G CB  1 
ATOM   4700  C  CG  . PRO G  1 66  ? 76.509  7.219    -18.131 1.00 42.92  ? 66  PRO G CG  1 
ATOM   4701  C  CD  . PRO G  1 66  ? 75.881  6.205    -19.024 1.00 45.86  ? 66  PRO G CD  1 
ATOM   4702  N  N   . THR G  1 67  ? 78.720  5.272    -21.199 1.00 65.96  ? 67  THR G N   1 
ATOM   4703  C  CA  . THR G  1 67  ? 79.823  4.499    -21.753 1.00 57.36  ? 67  THR G CA  1 
ATOM   4704  C  C   . THR G  1 67  ? 79.714  4.369    -23.265 1.00 69.44  ? 67  THR G C   1 
ATOM   4705  O  O   . THR G  1 67  ? 80.726  4.134    -23.928 1.00 76.58  ? 67  THR G O   1 
ATOM   4706  C  CB  . THR G  1 67  ? 79.895  3.113    -21.127 1.00 61.99  ? 67  THR G CB  1 
ATOM   4707  O  OG1 . THR G  1 67  ? 78.687  2.381    -21.422 1.00 82.22  ? 67  THR G OG1 1 
ATOM   4708  C  CG2 . THR G  1 67  ? 80.078  3.249    -19.634 1.00 41.13  ? 67  THR G CG2 1 
ATOM   4709  N  N   . LYS G  1 68  ? 78.501  4.535    -23.806 1.00 61.23  ? 68  LYS G N   1 
ATOM   4710  C  CA  . LYS G  1 68  ? 78.281  4.385    -25.240 1.00 56.12  ? 68  LYS G CA  1 
ATOM   4711  C  C   . LYS G  1 68  ? 78.111  5.725    -25.948 1.00 66.74  ? 68  LYS G C   1 
ATOM   4712  O  O   . LYS G  1 68  ? 78.319  5.831    -27.163 1.00 80.54  ? 68  LYS G O   1 
ATOM   4713  C  CB  . LYS G  1 68  ? 77.072  3.503    -25.495 1.00 40.79  ? 68  LYS G CB  1 
ATOM   4714  N  N   . VAL G  1 69  ? 77.752  6.746    -25.173 1.00 53.72  ? 69  VAL G N   1 
ATOM   4715  C  CA  . VAL G  1 69  ? 77.493  8.088    -25.702 1.00 55.26  ? 69  VAL G CA  1 
ATOM   4716  C  C   . VAL G  1 69  ? 78.245  9.170    -24.903 1.00 54.46  ? 69  VAL G C   1 
ATOM   4717  O  O   . VAL G  1 69  ? 78.263  9.129    -23.678 1.00 65.90  ? 69  VAL G O   1 
ATOM   4718  C  CB  . VAL G  1 69  ? 75.976  8.377    -25.685 1.00 50.19  ? 69  VAL G CB  1 
ATOM   4719  C  CG1 . VAL G  1 69  ? 75.693  9.862    -25.873 1.00 72.15  ? 69  VAL G CG1 1 
ATOM   4720  C  CG2 . VAL G  1 69  ? 75.282  7.548    -26.733 1.00 43.09  ? 69  VAL G CG2 1 
ATOM   4721  N  N   . GLY G  1 70  ? 78.860  10.137   -25.581 1.00 35.71  ? 70  GLY G N   1 
ATOM   4722  C  CA  . GLY G  1 70  ? 79.706  11.086   -24.884 1.00 54.76  ? 70  GLY G CA  1 
ATOM   4723  C  C   . GLY G  1 70  ? 79.040  12.414   -24.641 1.00 52.95  ? 70  GLY G C   1 
ATOM   4724  O  O   . GLY G  1 70  ? 78.040  12.709   -25.279 1.00 74.20  ? 70  GLY G O   1 
ATOM   4725  N  N   . LYS G  1 71  ? 79.600  13.217   -23.739 1.00 35.51  ? 71  LYS G N   1 
ATOM   4726  C  CA  . LYS G  1 71  ? 79.103  14.569   -23.515 1.00 57.84  ? 71  LYS G CA  1 
ATOM   4727  C  C   . LYS G  1 71  ? 79.207  15.412   -24.785 1.00 58.44  ? 71  LYS G C   1 
ATOM   4728  O  O   . LYS G  1 71  ? 79.856  15.025   -25.748 1.00 49.95  ? 71  LYS G O   1 
ATOM   4729  C  CB  . LYS G  1 71  ? 79.868  15.252   -22.388 1.00 52.80  ? 71  LYS G CB  1 
ATOM   4730  C  CG  . LYS G  1 71  ? 80.041  14.430   -21.111 1.00 38.79  ? 71  LYS G CG  1 
ATOM   4731  C  CD  . LYS G  1 71  ? 80.794  15.241   -20.064 1.00 71.69  ? 71  LYS G CD  1 
ATOM   4732  C  CE  . LYS G  1 71  ? 81.081  14.450   -18.798 1.00 99.45  ? 71  LYS G CE  1 
ATOM   4733  N  NZ  . LYS G  1 71  ? 79.875  14.199   -17.999 1.00 109.69 ? 71  LYS G NZ  1 
ATOM   4734  N  N   . ALA G  1 72  ? 78.549  16.559   -24.799 1.00 43.82  ? 72  ALA G N   1 
ATOM   4735  C  CA  . ALA G  1 72  ? 78.753  17.467   -25.906 1.00 57.22  ? 72  ALA G CA  1 
ATOM   4736  C  C   . ALA G  1 72  ? 80.139  18.055   -25.714 1.00 65.26  ? 72  ALA G C   1 
ATOM   4737  O  O   . ALA G  1 72  ? 80.656  18.067   -24.587 1.00 48.71  ? 72  ALA G O   1 
ATOM   4738  C  CB  . ALA G  1 72  ? 77.710  18.563   -25.897 1.00 59.64  ? 72  ALA G CB  1 
ATOM   4739  N  N   . CYS G  1 73  ? 80.744  18.546   -26.796 1.00 52.82  ? 73  CYS G N   1 
ATOM   4740  C  CA  . CYS G  1 73  ? 82.079  19.114   -26.700 1.00 45.97  ? 73  CYS G CA  1 
ATOM   4741  C  C   . CYS G  1 73  ? 82.056  20.638   -26.576 1.00 52.70  ? 73  CYS G C   1 
ATOM   4742  O  O   . CYS G  1 73  ? 81.192  21.299   -27.133 1.00 57.71  ? 73  CYS G O   1 
ATOM   4743  C  CB  . CYS G  1 73  ? 82.939  18.680   -27.887 1.00 30.64  ? 73  CYS G CB  1 
ATOM   4744  S  SG  . CYS G  1 73  ? 84.736  18.721   -27.546 1.00 110.84 ? 73  CYS G SG  1 
ATOM   4745  N  N   . CYS G  1 74  ? 83.001  21.191   -25.831 1.00 48.31  ? 74  CYS G N   1 
ATOM   4746  C  CA  . CYS G  1 74  ? 83.146  22.633   -25.746 1.00 45.06  ? 74  CYS G CA  1 
ATOM   4747  C  C   . CYS G  1 74  ? 84.044  23.127   -26.888 1.00 49.94  ? 74  CYS G C   1 
ATOM   4748  O  O   . CYS G  1 74  ? 85.253  22.878   -26.919 1.00 72.62  ? 74  CYS G O   1 
ATOM   4749  C  CB  . CYS G  1 74  ? 83.728  23.015   -24.385 1.00 52.08  ? 74  CYS G CB  1 
ATOM   4750  S  SG  . CYS G  1 74  ? 83.663  24.772   -23.952 1.00 78.36  ? 74  CYS G SG  1 
ATOM   4751  N  N   . VAL G  1 75  ? 83.442  23.829   -27.832 1.00 41.20  ? 75  VAL G N   1 
ATOM   4752  C  CA  . VAL G  1 75  ? 84.148  24.238   -29.034 1.00 47.47  ? 75  VAL G CA  1 
ATOM   4753  C  C   . VAL G  1 75  ? 84.007  25.722   -29.306 1.00 53.47  ? 75  VAL G C   1 
ATOM   4754  O  O   . VAL G  1 75  ? 83.099  26.379   -28.772 1.00 58.34  ? 75  VAL G O   1 
ATOM   4755  C  CB  . VAL G  1 75  ? 83.586  23.504   -30.231 1.00 36.40  ? 75  VAL G CB  1 
ATOM   4756  C  CG1 . VAL G  1 75  ? 83.873  22.039   -30.110 1.00 33.63  ? 75  VAL G CG1 1 
ATOM   4757  C  CG2 . VAL G  1 75  ? 82.094  23.700   -30.283 1.00 46.63  ? 75  VAL G CG2 1 
ATOM   4758  N  N   . PRO G  1 76  ? 84.906  26.260   -30.140 1.00 46.03  ? 76  PRO G N   1 
ATOM   4759  C  CA  . PRO G  1 76  ? 84.771  27.658   -30.533 1.00 66.51  ? 76  PRO G CA  1 
ATOM   4760  C  C   . PRO G  1 76  ? 83.533  27.743   -31.407 1.00 64.64  ? 76  PRO G C   1 
ATOM   4761  O  O   . PRO G  1 76  ? 83.443  26.960   -32.356 1.00 39.37  ? 76  PRO G O   1 
ATOM   4762  C  CB  . PRO G  1 76  ? 86.044  27.922   -31.362 1.00 43.77  ? 76  PRO G CB  1 
ATOM   4763  C  CG  . PRO G  1 76  ? 86.965  26.858   -30.994 1.00 57.13  ? 76  PRO G CG  1 
ATOM   4764  C  CD  . PRO G  1 76  ? 86.096  25.656   -30.735 1.00 42.64  ? 76  PRO G CD  1 
ATOM   4765  N  N   . THR G  1 77  ? 82.612  28.650   -31.073 1.00 57.33  ? 77  THR G N   1 
ATOM   4766  C  CA  . THR G  1 77  ? 81.375  28.838   -31.817 1.00 31.97  ? 77  THR G CA  1 
ATOM   4767  C  C   . THR G  1 77  ? 81.381  30.091   -32.716 1.00 49.35  ? 77  THR G C   1 
ATOM   4768  O  O   . THR G  1 77  ? 80.622  30.150   -33.684 1.00 45.81  ? 77  THR G O   1 
ATOM   4769  C  CB  . THR G  1 77  ? 80.174  28.897   -30.862 1.00 53.18  ? 77  THR G CB  1 
ATOM   4770  O  OG1 . THR G  1 77  ? 80.270  30.057   -30.023 1.00 59.82  ? 77  THR G OG1 1 
ATOM   4771  C  CG2 . THR G  1 77  ? 80.140  27.655   -30.005 1.00 51.43  ? 77  THR G CG2 1 
ATOM   4772  N  N   . LYS G  1 78  ? 82.226  31.079   -32.394 1.00 54.99  ? 78  LYS G N   1 
ATOM   4773  C  CA  . LYS G  1 78  ? 82.447  32.262   -33.244 1.00 47.66  ? 78  LYS G CA  1 
ATOM   4774  C  C   . LYS G  1 78  ? 83.937  32.617   -33.338 1.00 60.50  ? 78  LYS G C   1 
ATOM   4775  O  O   . LYS G  1 78  ? 84.675  32.530   -32.350 1.00 55.89  ? 78  LYS G O   1 
ATOM   4776  C  CB  . LYS G  1 78  ? 81.675  33.463   -32.713 1.00 36.91  ? 78  LYS G CB  1 
ATOM   4777  N  N   . LEU G  1 79  ? 84.383  33.040   -34.518 1.00 59.41  ? 79  LEU G N   1 
ATOM   4778  C  CA  . LEU G  1 79  ? 85.812  33.288   -34.723 1.00 56.28  ? 79  LEU G CA  1 
ATOM   4779  C  C   . LEU G  1 79  ? 86.220  34.673   -35.267 1.00 68.29  ? 79  LEU G C   1 
ATOM   4780  O  O   . LEU G  1 79  ? 85.902  35.048   -36.401 1.00 82.50  ? 79  LEU G O   1 
ATOM   4781  C  CB  . LEU G  1 79  ? 86.403  32.191   -35.613 1.00 41.00  ? 79  LEU G CB  1 
ATOM   4782  C  CG  . LEU G  1 79  ? 86.548  30.833   -34.944 1.00 46.24  ? 79  LEU G CG  1 
ATOM   4783  C  CD1 . LEU G  1 79  ? 87.058  29.820   -35.941 1.00 39.82  ? 79  LEU G CD1 1 
ATOM   4784  C  CD2 . LEU G  1 79  ? 87.489  30.952   -33.743 1.00 68.57  ? 79  LEU G CD2 1 
ATOM   4785  N  N   . SER G  1 80  ? 86.962  35.413   -34.452 1.00 68.38  ? 80  SER G N   1 
ATOM   4786  C  CA  . SER G  1 80  ? 87.599  36.651   -34.896 1.00 64.62  ? 80  SER G CA  1 
ATOM   4787  C  C   . SER G  1 80  ? 88.849  36.371   -35.720 1.00 68.52  ? 80  SER G C   1 
ATOM   4788  O  O   . SER G  1 80  ? 89.521  35.348   -35.529 1.00 71.55  ? 80  SER G O   1 
ATOM   4789  C  CB  . SER G  1 80  ? 87.986  37.519   -33.698 1.00 55.37  ? 80  SER G CB  1 
ATOM   4790  O  OG  . SER G  1 80  ? 86.849  38.123   -33.124 1.00 84.65  ? 80  SER G OG  1 
ATOM   4791  N  N   . PRO G  1 81  ? 89.170  37.288   -36.637 1.00 56.61  ? 81  PRO G N   1 
ATOM   4792  C  CA  . PRO G  1 81  ? 90.427  37.322   -37.386 1.00 70.21  ? 81  PRO G CA  1 
ATOM   4793  C  C   . PRO G  1 81  ? 91.481  38.148   -36.656 1.00 58.47  ? 81  PRO G C   1 
ATOM   4794  O  O   . PRO G  1 81  ? 91.181  38.904   -35.743 1.00 48.17  ? 81  PRO G O   1 
ATOM   4795  C  CB  . PRO G  1 81  ? 90.038  38.084   -38.642 1.00 60.10  ? 81  PRO G CB  1 
ATOM   4796  C  CG  . PRO G  1 81  ? 89.099  39.081   -38.127 1.00 37.34  ? 81  PRO G CG  1 
ATOM   4797  C  CD  . PRO G  1 81  ? 88.272  38.363   -37.066 1.00 27.19  ? 81  PRO G CD  1 
ATOM   4798  N  N   . ILE G  1 82  ? 92.725  38.005   -37.070 1.00 52.72  ? 82  ILE G N   1 
ATOM   4799  C  CA  . ILE G  1 82  ? 93.784  38.855   -36.546 1.00 69.70  ? 82  ILE G CA  1 
ATOM   4800  C  C   . ILE G  1 82  ? 94.574  39.377   -37.713 1.00 68.30  ? 82  ILE G C   1 
ATOM   4801  O  O   . ILE G  1 82  ? 94.411  38.906   -38.844 1.00 65.16  ? 82  ILE G O   1 
ATOM   4802  C  CB  . ILE G  1 82  ? 94.763  38.088   -35.669 1.00 51.65  ? 82  ILE G CB  1 
ATOM   4803  C  CG1 . ILE G  1 82  ? 95.484  37.044   -36.525 1.00 41.75  ? 82  ILE G CG1 1 
ATOM   4804  C  CG2 . ILE G  1 82  ? 94.017  37.478   -34.484 1.00 40.60  ? 82  ILE G CG2 1 
ATOM   4805  C  CD1 . ILE G  1 82  ? 96.440  36.200   -35.764 1.00 55.37  ? 82  ILE G CD1 1 
ATOM   4806  N  N   . SER G  1 83  ? 95.440  40.341   -37.436 1.00 54.67  ? 83  SER G N   1 
ATOM   4807  C  CA  . SER G  1 83  ? 96.243  40.929   -38.492 1.00 62.27  ? 83  SER G CA  1 
ATOM   4808  C  C   . SER G  1 83  ? 97.629  40.366   -38.426 1.00 62.54  ? 83  SER G C   1 
ATOM   4809  O  O   . SER G  1 83  ? 98.154  40.112   -37.342 1.00 83.50  ? 83  SER G O   1 
ATOM   4810  C  CB  . SER G  1 83  ? 96.282  42.446   -38.375 1.00 65.55  ? 83  SER G CB  1 
ATOM   4811  O  OG  . SER G  1 83  ? 95.023  42.976   -38.758 1.00 61.83  ? 83  SER G OG  1 
ATOM   4812  N  N   . VAL G  1 84  ? 98.213  40.134   -39.591 1.00 50.35  ? 84  VAL G N   1 
ATOM   4813  C  CA  . VAL G  1 84  ? 99.584  39.657   -39.625 1.00 58.04  ? 84  VAL G CA  1 
ATOM   4814  C  C   . VAL G  1 84  ? 100.346 40.208   -40.824 1.00 55.53  ? 84  VAL G C   1 
ATOM   4815  O  O   . VAL G  1 84  ? 99.817  40.375   -41.934 1.00 75.48  ? 84  VAL G O   1 
ATOM   4816  C  CB  . VAL G  1 84  ? 99.688  38.114   -39.575 1.00 54.17  ? 84  VAL G CB  1 
ATOM   4817  C  CG1 . VAL G  1 84  ? 98.636  37.532   -38.644 1.00 60.55  ? 84  VAL G CG1 1 
ATOM   4818  C  CG2 . VAL G  1 84  ? 99.532  37.527   -40.960 1.00 41.23  ? 84  VAL G CG2 1 
ATOM   4819  N  N   . LEU G  1 85  ? 101.594 40.523   -40.553 1.00 38.36  ? 85  LEU G N   1 
ATOM   4820  C  CA  . LEU G  1 85  ? 102.529 40.968   -41.546 1.00 56.09  ? 85  LEU G CA  1 
ATOM   4821  C  C   . LEU G  1 85  ? 103.437 39.788   -41.889 1.00 75.32  ? 85  LEU G C   1 
ATOM   4822  O  O   . LEU G  1 85  ? 104.147 39.272   -41.022 1.00 73.46  ? 85  LEU G O   1 
ATOM   4823  C  CB  . LEU G  1 85  ? 103.373 42.083   -40.944 1.00 51.46  ? 85  LEU G CB  1 
ATOM   4824  C  CG  . LEU G  1 85  ? 104.365 42.807   -41.858 1.00 54.18  ? 85  LEU G CG  1 
ATOM   4825  C  CD1 . LEU G  1 85  ? 103.677 43.281   -43.124 1.00 57.40  ? 85  LEU G CD1 1 
ATOM   4826  C  CD2 . LEU G  1 85  ? 104.927 43.995   -41.126 1.00 47.32  ? 85  LEU G CD2 1 
ATOM   4827  N  N   . TYR G  1 86  ? 103.430 39.370   -43.150 1.00 68.56  ? 86  TYR G N   1 
ATOM   4828  C  CA  . TYR G  1 86  ? 104.135 38.152   -43.543 1.00 70.24  ? 86  TYR G CA  1 
ATOM   4829  C  C   . TYR G  1 86  ? 104.924 38.288   -44.843 1.00 64.97  ? 86  TYR G C   1 
ATOM   4830  O  O   . TYR G  1 86  ? 104.644 39.171   -45.654 1.00 82.49  ? 86  TYR G O   1 
ATOM   4831  C  CB  . TYR G  1 86  ? 103.128 37.033   -43.706 1.00 72.87  ? 86  TYR G CB  1 
ATOM   4832  C  CG  . TYR G  1 86  ? 102.280 37.195   -44.939 1.00 68.20  ? 86  TYR G CG  1 
ATOM   4833  C  CD1 . TYR G  1 86  ? 102.653 36.603   -46.146 1.00 77.53  ? 86  TYR G CD1 1 
ATOM   4834  C  CD2 . TYR G  1 86  ? 101.110 37.947   -44.906 1.00 53.08  ? 86  TYR G CD2 1 
ATOM   4835  C  CE1 . TYR G  1 86  ? 101.869 36.743   -47.280 1.00 90.20  ? 86  TYR G CE1 1 
ATOM   4836  C  CE2 . TYR G  1 86  ? 100.319 38.095   -46.037 1.00 50.16  ? 86  TYR G CE2 1 
ATOM   4837  C  CZ  . TYR G  1 86  ? 100.700 37.490   -47.217 1.00 70.63  ? 86  TYR G CZ  1 
ATOM   4838  O  OH  . TYR G  1 86  ? 99.920  37.630   -48.338 1.00 49.88  ? 86  TYR G OH  1 
ATOM   4839  N  N   . LYS G  1 87  ? 105.894 37.401   -45.043 1.00 52.24  ? 87  LYS G N   1 
ATOM   4840  C  CA  . LYS G  1 87  ? 106.725 37.467   -46.243 1.00 63.13  ? 87  LYS G CA  1 
ATOM   4841  C  C   . LYS G  1 87  ? 105.996 36.928   -47.470 1.00 86.84  ? 87  LYS G C   1 
ATOM   4842  O  O   . LYS G  1 87  ? 105.417 35.830   -47.438 1.00 79.45  ? 87  LYS G O   1 
ATOM   4843  C  CB  . LYS G  1 87  ? 108.065 36.740   -46.050 1.00 53.31  ? 87  LYS G CB  1 
ATOM   4844  C  CG  . LYS G  1 87  ? 109.113 37.525   -45.235 1.00 70.05  ? 87  LYS G CG  1 
ATOM   4845  C  CD  . LYS G  1 87  ? 110.354 36.670   -44.878 1.00 95.67  ? 87  LYS G CD  1 
ATOM   4846  C  CE  . LYS G  1 87  ? 111.251 37.328   -43.800 1.00 101.97 ? 87  LYS G CE  1 
ATOM   4847  N  NZ  . LYS G  1 87  ? 111.910 36.339   -42.852 1.00 90.32  ? 87  LYS G NZ  1 
ATOM   4848  N  N   . ASP G  1 88  ? 106.031 37.732   -48.535 1.00 102.33 ? 88  ASP G N   1 
ATOM   4849  C  CA  . ASP G  1 88  ? 105.501 37.393   -49.857 1.00 99.74  ? 88  ASP G CA  1 
ATOM   4850  C  C   . ASP G  1 88  ? 106.103 36.088   -50.358 1.00 103.29 ? 88  ASP G C   1 
ATOM   4851  O  O   . ASP G  1 88  ? 107.021 35.549   -49.733 1.00 97.04  ? 88  ASP G O   1 
ATOM   4852  C  CB  . ASP G  1 88  ? 105.884 38.499   -50.845 1.00 95.04  ? 88  ASP G CB  1 
ATOM   4853  C  CG  . ASP G  1 88  ? 104.874 38.672   -51.965 1.00 127.66 ? 88  ASP G CG  1 
ATOM   4854  O  OD1 . ASP G  1 88  ? 104.283 37.662   -52.417 1.00 146.22 ? 88  ASP G OD1 1 
ATOM   4855  O  OD2 . ASP G  1 88  ? 104.671 39.833   -52.391 1.00 130.82 ? 88  ASP G OD2 1 
ATOM   4856  N  N   . ASP G  1 89  ? 105.600 35.590   -51.489 1.00 111.03 ? 89  ASP G N   1 
ATOM   4857  C  CA  . ASP G  1 89  ? 106.212 34.439   -52.147 1.00 103.89 ? 89  ASP G CA  1 
ATOM   4858  C  C   . ASP G  1 89  ? 107.581 34.878   -52.650 1.00 93.20  ? 89  ASP G C   1 
ATOM   4859  O  O   . ASP G  1 89  ? 108.429 34.051   -53.003 1.00 91.90  ? 89  ASP G O   1 
ATOM   4860  C  CB  . ASP G  1 89  ? 105.343 33.916   -53.301 1.00 114.66 ? 89  ASP G CB  1 
ATOM   4861  C  CG  . ASP G  1 89  ? 104.029 33.284   -52.818 1.00 128.96 ? 89  ASP G CG  1 
ATOM   4862  O  OD1 . ASP G  1 89  ? 102.973 33.967   -52.862 1.00 122.97 ? 89  ASP G OD1 1 
ATOM   4863  O  OD2 . ASP G  1 89  ? 104.053 32.100   -52.397 1.00 129.38 ? 89  ASP G OD2 1 
ATOM   4864  N  N   . MET G  1 90  ? 107.791 36.190   -52.671 1.00 90.39  ? 90  MET G N   1 
ATOM   4865  C  CA  . MET G  1 90  ? 109.078 36.742   -53.072 1.00 101.10 ? 90  MET G CA  1 
ATOM   4866  C  C   . MET G  1 90  ? 109.677 37.599   -51.956 1.00 99.22  ? 90  MET G C   1 
ATOM   4867  O  O   . MET G  1 90  ? 110.469 38.516   -52.212 1.00 86.60  ? 90  MET G O   1 
ATOM   4868  C  CB  . MET G  1 90  ? 108.956 37.543   -54.371 1.00 102.10 ? 90  MET G CB  1 
ATOM   4869  N  N   . GLY G  1 91  ? 109.284 37.292   -50.719 1.00 89.69  ? 91  GLY G N   1 
ATOM   4870  C  CA  . GLY G  1 91  ? 109.911 37.885   -49.549 1.00 92.63  ? 91  GLY G CA  1 
ATOM   4871  C  C   . GLY G  1 91  ? 109.620 39.359   -49.348 1.00 87.95  ? 91  GLY G C   1 
ATOM   4872  O  O   . GLY G  1 91  ? 110.449 40.118   -48.847 1.00 78.39  ? 91  GLY G O   1 
ATOM   4873  N  N   . VAL G  1 92  ? 108.426 39.767   -49.740 1.00 91.85  ? 92  VAL G N   1 
ATOM   4874  C  CA  . VAL G  1 92  ? 108.015 41.142   -49.559 1.00 84.10  ? 92  VAL G CA  1 
ATOM   4875  C  C   . VAL G  1 92  ? 107.054 41.205   -48.377 1.00 89.17  ? 92  VAL G C   1 
ATOM   4876  O  O   . VAL G  1 92  ? 106.008 40.543   -48.388 1.00 92.89  ? 92  VAL G O   1 
ATOM   4877  C  CB  . VAL G  1 92  ? 107.290 41.658   -50.805 1.00 88.64  ? 92  VAL G CB  1 
ATOM   4878  C  CG1 . VAL G  1 92  ? 107.267 43.173   -50.806 1.00 92.22  ? 92  VAL G CG1 1 
ATOM   4879  C  CG2 . VAL G  1 92  ? 107.959 41.115   -52.057 1.00 87.83  ? 92  VAL G CG2 1 
ATOM   4880  N  N   . PRO G  1 93  ? 107.405 41.997   -47.348 1.00 75.37  ? 93  PRO G N   1 
ATOM   4881  C  CA  . PRO G  1 93  ? 106.463 42.196   -46.241 1.00 67.94  ? 93  PRO G CA  1 
ATOM   4882  C  C   . PRO G  1 93  ? 105.107 42.688   -46.761 1.00 62.63  ? 93  PRO G C   1 
ATOM   4883  O  O   . PRO G  1 93  ? 105.013 43.790   -47.314 1.00 70.92  ? 93  PRO G O   1 
ATOM   4884  C  CB  . PRO G  1 93  ? 107.140 43.290   -45.404 1.00 68.31  ? 93  PRO G CB  1 
ATOM   4885  C  CG  . PRO G  1 93  ? 108.581 43.181   -45.716 1.00 57.32  ? 93  PRO G CG  1 
ATOM   4886  C  CD  . PRO G  1 93  ? 108.640 42.782   -47.174 1.00 72.10  ? 93  PRO G CD  1 
ATOM   4887  N  N   . THR G  1 94  ? 104.076 41.867   -46.609 1.00 48.06  ? 94  THR G N   1 
ATOM   4888  C  CA  . THR G  1 94  ? 102.736 42.273   -46.990 1.00 73.70  ? 94  THR G CA  1 
ATOM   4889  C  C   . THR G  1 94  ? 101.781 41.966   -45.837 1.00 72.89  ? 94  THR G C   1 
ATOM   4890  O  O   . THR G  1 94  ? 102.139 41.263   -44.886 1.00 45.91  ? 94  THR G O   1 
ATOM   4891  C  CB  . THR G  1 94  ? 102.271 41.567   -48.271 1.00 81.60  ? 94  THR G CB  1 
ATOM   4892  O  OG1 . THR G  1 94  ? 102.015 40.176   -47.982 1.00 58.34  ? 94  THR G OG1 1 
ATOM   4893  C  CG2 . THR G  1 94  ? 103.328 41.725   -49.393 1.00 74.84  ? 94  THR G CG2 1 
ATOM   4894  N  N   . LEU G  1 95  ? 100.561 42.480   -45.921 1.00 63.37  ? 95  LEU G N   1 
ATOM   4895  C  CA  . LEU G  1 95  ? 99.688  42.445   -44.767 1.00 54.85  ? 95  LEU G CA  1 
ATOM   4896  C  C   . LEU G  1 95  ? 98.312  41.789   -44.998 1.00 64.54  ? 95  LEU G C   1 
ATOM   4897  O  O   . LEU G  1 95  ? 97.512  42.300   -45.782 1.00 82.12  ? 95  LEU G O   1 
ATOM   4898  C  CB  . LEU G  1 95  ? 99.510  43.882   -44.279 1.00 50.31  ? 95  LEU G CB  1 
ATOM   4899  C  CG  . LEU G  1 95  ? 98.337  44.062   -43.316 1.00 64.65  ? 95  LEU G CG  1 
ATOM   4900  C  CD1 . LEU G  1 95  ? 98.557  43.234   -42.069 1.00 97.39  ? 95  LEU G CD1 1 
ATOM   4901  C  CD2 . LEU G  1 95  ? 98.177  45.512   -42.948 1.00 43.51  ? 95  LEU G CD2 1 
ATOM   4902  N  N   . LYS G  1 96  ? 98.014  40.675   -44.318 1.00 52.95  ? 96  LYS G N   1 
ATOM   4903  C  CA  . LYS G  1 96  ? 96.600  40.318   -44.229 1.00 66.88  ? 96  LYS G CA  1 
ATOM   4904  C  C   . LYS G  1 96  ? 96.057  40.982   -42.973 1.00 71.70  ? 96  LYS G C   1 
ATOM   4905  O  O   . LYS G  1 96  ? 96.463  40.658   -41.849 1.00 72.77  ? 96  LYS G O   1 
ATOM   4906  C  CB  . LYS G  1 96  ? 96.272  38.803   -44.308 1.00 45.60  ? 96  LYS G CB  1 
ATOM   4907  C  CG  . LYS G  1 96  ? 94.766  38.497   -44.790 1.00 33.49  ? 96  LYS G CG  1 
ATOM   4908  C  CD  . LYS G  1 96  ? 94.319  39.486   -45.936 1.00 175.14 ? 96  LYS G CD  1 
ATOM   4909  C  CE  . LYS G  1 96  ? 93.180  40.490   -45.554 1.00 84.89  ? 96  LYS G CE  1 
ATOM   4910  N  NZ  . LYS G  1 96  ? 93.418  41.913   -46.092 1.00 37.36  ? 96  LYS G NZ  1 
ATOM   4911  N  N   . TYR G  1 97  ? 95.179  41.957   -43.193 1.00 49.56  ? 97  TYR G N   1 
ATOM   4912  C  CA  . TYR G  1 97  ? 94.519  42.660   -42.115 1.00 45.41  ? 97  TYR G CA  1 
ATOM   4913  C  C   . TYR G  1 97  ? 93.387  41.805   -41.529 1.00 59.03  ? 97  TYR G C   1 
ATOM   4914  O  O   . TYR G  1 97  ? 93.248  41.710   -40.306 1.00 67.13  ? 97  TYR G O   1 
ATOM   4915  C  CB  . TYR G  1 97  ? 94.015  44.014   -42.633 1.00 47.30  ? 97  TYR G CB  1 
ATOM   4916  C  CG  . TYR G  1 97  ? 93.260  44.840   -41.618 1.00 49.97  ? 97  TYR G CG  1 
ATOM   4917  C  CD1 . TYR G  1 97  ? 93.887  45.336   -40.476 1.00 60.13  ? 97  TYR G CD1 1 
ATOM   4918  C  CD2 . TYR G  1 97  ? 91.918  45.125   -41.803 1.00 49.84  ? 97  TYR G CD2 1 
ATOM   4919  C  CE1 . TYR G  1 97  ? 93.190  46.087   -39.541 1.00 60.33  ? 97  TYR G CE1 1 
ATOM   4920  C  CE2 . TYR G  1 97  ? 91.209  45.877   -40.880 1.00 73.93  ? 97  TYR G CE2 1 
ATOM   4921  C  CZ  . TYR G  1 97  ? 91.847  46.356   -39.755 1.00 77.19  ? 97  TYR G CZ  1 
ATOM   4922  O  OH  . TYR G  1 97  ? 91.119  47.105   -38.858 1.00 93.91  ? 97  TYR G OH  1 
ATOM   4923  N  N   . HIS G  1 98  ? 92.596  41.182   -42.406 1.00 80.98  ? 98  HIS G N   1 
ATOM   4924  C  CA  . HIS G  1 98  ? 91.513  40.295   -41.997 1.00 79.32  ? 98  HIS G CA  1 
ATOM   4925  C  C   . HIS G  1 98  ? 91.911  38.837   -42.238 1.00 78.67  ? 98  HIS G C   1 
ATOM   4926  O  O   . HIS G  1 98  ? 91.384  38.186   -43.144 1.00 111.74 ? 98  HIS G O   1 
ATOM   4927  C  CB  . HIS G  1 98  ? 90.211  40.657   -42.737 1.00 72.94  ? 98  HIS G CB  1 
ATOM   4928  C  CG  . HIS G  1 98  ? 89.234  41.423   -41.900 1.00 110.20 ? 98  HIS G CG  1 
ATOM   4929  N  ND1 . HIS G  1 98  ? 87.987  40.933   -41.570 1.00 135.64 ? 98  HIS G ND1 1 
ATOM   4930  C  CD2 . HIS G  1 98  ? 89.328  42.640   -41.311 1.00 114.61 ? 98  HIS G CD2 1 
ATOM   4931  C  CE1 . HIS G  1 98  ? 87.351  41.819   -40.822 1.00 128.43 ? 98  HIS G CE1 1 
ATOM   4932  N  NE2 . HIS G  1 98  ? 88.143  42.863   -40.649 1.00 120.77 ? 98  HIS G NE2 1 
ATOM   4933  N  N   . TYR G  1 99  ? 92.855  38.339   -41.438 1.00 39.95  ? 99  TYR G N   1 
ATOM   4934  C  CA  . TYR G  1 99  ? 93.237  36.919   -41.491 1.00 49.38  ? 99  TYR G CA  1 
ATOM   4935  C  C   . TYR G  1 99  ? 92.244  36.042   -40.725 1.00 60.83  ? 99  TYR G C   1 
ATOM   4936  O  O   . TYR G  1 99  ? 92.302  35.946   -39.492 1.00 63.64  ? 99  TYR G O   1 
ATOM   4937  C  CB  . TYR G  1 99  ? 94.633  36.715   -40.910 1.00 54.96  ? 99  TYR G CB  1 
ATOM   4938  C  CG  . TYR G  1 99  ? 95.256  35.359   -41.224 1.00 56.28  ? 99  TYR G CG  1 
ATOM   4939  C  CD1 . TYR G  1 99  ? 96.483  35.003   -40.688 1.00 45.23  ? 99  TYR G CD1 1 
ATOM   4940  C  CD2 . TYR G  1 99  ? 94.630  34.448   -42.066 1.00 74.46  ? 99  TYR G CD2 1 
ATOM   4941  C  CE1 . TYR G  1 99  ? 97.062  33.785   -40.968 1.00 38.51  ? 99  TYR G CE1 1 
ATOM   4942  C  CE2 . TYR G  1 99  ? 95.216  33.215   -42.353 1.00 77.45  ? 99  TYR G CE2 1 
ATOM   4943  C  CZ  . TYR G  1 99  ? 96.433  32.892   -41.796 1.00 55.27  ? 99  TYR G CZ  1 
ATOM   4944  O  OH  . TYR G  1 99  ? 97.029  31.676   -42.061 1.00 62.18  ? 99  TYR G OH  1 
ATOM   4945  N  N   . GLU G  1 100 ? 91.347  35.386   -41.451 1.00 54.67  ? 100 GLU G N   1 
ATOM   4946  C  CA  . GLU G  1 100 ? 90.150  34.861   -40.804 1.00 55.08  ? 100 GLU G CA  1 
ATOM   4947  C  C   . GLU G  1 100 ? 90.318  33.625   -39.901 1.00 61.25  ? 100 GLU G C   1 
ATOM   4948  O  O   . GLU G  1 100 ? 91.081  32.699   -40.199 1.00 51.88  ? 100 GLU G O   1 
ATOM   4949  C  CB  . GLU G  1 100 ? 89.047  34.641   -41.833 1.00 54.87  ? 100 GLU G CB  1 
ATOM   4950  C  CG  . GLU G  1 100 ? 88.446  35.947   -42.351 1.00 84.70  ? 100 GLU G CG  1 
ATOM   4951  C  CD  . GLU G  1 100 ? 87.732  36.757   -41.270 1.00 100.03 ? 100 GLU G CD  1 
ATOM   4952  O  OE1 . GLU G  1 100 ? 87.543  36.239   -40.128 1.00 106.07 ? 100 GLU G OE1 1 
ATOM   4953  O  OE2 . GLU G  1 100 ? 87.363  37.919   -41.587 1.00 74.03  ? 100 GLU G OE2 1 
ATOM   4954  N  N   . GLY G  1 101 ? 89.591  33.645   -38.784 1.00 70.44  ? 101 GLY G N   1 
ATOM   4955  C  CA  . GLY G  1 101 ? 89.383  32.470   -37.956 1.00 52.16  ? 101 GLY G CA  1 
ATOM   4956  C  C   . GLY G  1 101 ? 90.580  32.010   -37.176 1.00 50.30  ? 101 GLY G C   1 
ATOM   4957  O  O   . GLY G  1 101 ? 90.875  30.821   -37.145 1.00 64.73  ? 101 GLY G O   1 
ATOM   4958  N  N   . MET G  1 102 ? 91.262  32.941   -36.526 1.00 43.05  ? 102 MET G N   1 
ATOM   4959  C  CA  . MET G  1 102 ? 92.492  32.597   -35.822 1.00 52.45  ? 102 MET G CA  1 
ATOM   4960  C  C   . MET G  1 102 ? 92.348  32.763   -34.331 1.00 57.81  ? 102 MET G C   1 
ATOM   4961  O  O   . MET G  1 102 ? 93.208  32.340   -33.558 1.00 63.47  ? 102 MET G O   1 
ATOM   4962  C  CB  . MET G  1 102 ? 93.641  33.473   -36.301 1.00 48.41  ? 102 MET G CB  1 
ATOM   4963  C  CG  . MET G  1 102 ? 94.027  33.257   -37.745 1.00 50.39  ? 102 MET G CG  1 
ATOM   4964  S  SD  . MET G  1 102 ? 95.246  31.951   -37.895 1.00 73.63  ? 102 MET G SD  1 
ATOM   4965  C  CE  . MET G  1 102 ? 96.524  32.566   -36.815 1.00 48.30  ? 102 MET G CE  1 
ATOM   4966  N  N   . SER G  1 103 ? 91.266  33.402   -33.924 1.00 50.15  ? 103 SER G N   1 
ATOM   4967  C  CA  . SER G  1 103 ? 91.091  33.681   -32.514 1.00 62.90  ? 103 SER G CA  1 
ATOM   4968  C  C   . SER G  1 103 ? 89.674  33.359   -32.093 1.00 70.53  ? 103 SER G C   1 
ATOM   4969  O  O   . SER G  1 103 ? 88.731  33.537   -32.858 1.00 64.49  ? 103 SER G O   1 
ATOM   4970  C  CB  . SER G  1 103 ? 91.416  35.145   -32.225 1.00 54.69  ? 103 SER G CB  1 
ATOM   4971  O  OG  . SER G  1 103 ? 91.372  35.413   -30.837 1.00 73.66  ? 103 SER G OG  1 
ATOM   4972  N  N   . VAL G  1 104 ? 89.517  32.871   -30.874 1.00 66.61  ? 104 VAL G N   1 
ATOM   4973  C  CA  . VAL G  1 104 ? 88.190  32.502   -30.434 1.00 46.97  ? 104 VAL G CA  1 
ATOM   4974  C  C   . VAL G  1 104 ? 87.395  33.699   -29.979 1.00 52.51  ? 104 VAL G C   1 
ATOM   4975  O  O   . VAL G  1 104 ? 87.851  34.505   -29.152 1.00 58.18  ? 104 VAL G O   1 
ATOM   4976  C  CB  . VAL G  1 104 ? 88.234  31.497   -29.292 1.00 53.09  ? 104 VAL G CB  1 
ATOM   4977  C  CG1 . VAL G  1 104 ? 86.813  31.172   -28.825 1.00 53.32  ? 104 VAL G CG1 1 
ATOM   4978  C  CG2 . VAL G  1 104 ? 88.969  30.247   -29.736 1.00 46.86  ? 104 VAL G CG2 1 
ATOM   4979  N  N   . ALA G  1 105 ? 86.184  33.797   -30.510 1.00 47.76  ? 105 ALA G N   1 
ATOM   4980  C  CA  . ALA G  1 105 ? 85.286  34.873   -30.122 1.00 56.05  ? 105 ALA G CA  1 
ATOM   4981  C  C   . ALA G  1 105 ? 84.371  34.428   -28.993 1.00 62.19  ? 105 ALA G C   1 
ATOM   4982  O  O   . ALA G  1 105 ? 84.382  34.995   -27.893 1.00 67.91  ? 105 ALA G O   1 
ATOM   4983  C  CB  . ALA G  1 105 ? 84.477  35.303   -31.301 1.00 34.16  ? 105 ALA G CB  1 
ATOM   4984  N  N   . GLU G  1 106 ? 83.577  33.404   -29.287 1.00 49.39  ? 106 GLU G N   1 
ATOM   4985  C  CA  . GLU G  1 106 ? 82.629  32.858   -28.325 1.00 57.35  ? 106 GLU G CA  1 
ATOM   4986  C  C   . GLU G  1 106 ? 82.800  31.338   -28.210 1.00 65.38  ? 106 GLU G C   1 
ATOM   4987  O  O   . GLU G  1 106 ? 83.198  30.677   -29.175 1.00 45.50  ? 106 GLU G O   1 
ATOM   4988  C  CB  . GLU G  1 106 ? 81.201  33.227   -28.736 1.00 51.62  ? 106 GLU G CB  1 
ATOM   4989  C  CG  . GLU G  1 106 ? 80.916  34.723   -28.666 1.00 74.13  ? 106 GLU G CG  1 
ATOM   4990  C  CD  . GLU G  1 106 ? 79.574  35.121   -29.289 1.00 100.01 ? 106 GLU G CD  1 
ATOM   4991  O  OE1 . GLU G  1 106 ? 79.261  36.338   -29.324 1.00 112.09 ? 106 GLU G OE1 1 
ATOM   4992  O  OE2 . GLU G  1 106 ? 78.831  34.223   -29.746 1.00 96.67  ? 106 GLU G OE2 1 
ATOM   4993  N  N   . CYS G  1 107 ? 82.524  30.791   -27.025 1.00 54.04  ? 107 CYS G N   1 
ATOM   4994  C  CA  . CYS G  1 107 ? 82.616  29.349   -26.822 1.00 40.41  ? 107 CYS G CA  1 
ATOM   4995  C  C   . CYS G  1 107 ? 81.225  28.728   -26.782 1.00 47.72  ? 107 CYS G C   1 
ATOM   4996  O  O   . CYS G  1 107 ? 80.231  29.440   -26.738 1.00 78.65  ? 107 CYS G O   1 
ATOM   4997  C  CB  . CYS G  1 107 ? 83.399  29.028   -25.544 1.00 37.65  ? 107 CYS G CB  1 
ATOM   4998  S  SG  . CYS G  1 107 ? 85.213  28.958   -25.761 1.00 80.57  ? 107 CYS G SG  1 
ATOM   4999  N  N   . GLY G  1 108 ? 81.136  27.404   -26.812 1.00 48.64  ? 108 GLY G N   1 
ATOM   5000  C  CA  . GLY G  1 108 ? 79.826  26.776   -26.733 1.00 62.40  ? 108 GLY G CA  1 
ATOM   5001  C  C   . GLY G  1 108 ? 79.811  25.256   -26.720 1.00 58.15  ? 108 GLY G C   1 
ATOM   5002  O  O   . GLY G  1 108 ? 80.857  24.611   -26.796 1.00 58.65  ? 108 GLY G O   1 
ATOM   5003  N  N   . CYS G  1 109 ? 78.613  24.684   -26.619 1.00 37.88  ? 109 CYS G N   1 
ATOM   5004  C  CA  . CYS G  1 109 ? 78.443  23.230   -26.549 1.00 37.73  ? 109 CYS G CA  1 
ATOM   5005  C  C   . CYS G  1 109 ? 77.713  22.685   -27.750 1.00 41.41  ? 109 CYS G C   1 
ATOM   5006  O  O   . CYS G  1 109 ? 76.636  23.167   -28.097 1.00 60.08  ? 109 CYS G O   1 
ATOM   5007  C  CB  . CYS G  1 109 ? 77.705  22.828   -25.274 1.00 32.42  ? 109 CYS G CB  1 
ATOM   5008  S  SG  . CYS G  1 109 ? 78.785  22.843   -23.779 1.00 85.23  ? 109 CYS G SG  1 
ATOM   5009  N  N   . ARG G  1 110 ? 78.290  21.672   -28.384 1.00 36.26  ? 110 ARG G N   1 
ATOM   5010  C  CA  . ARG G  1 110 ? 77.726  21.177   -29.631 1.00 62.27  ? 110 ARG G CA  1 
ATOM   5011  C  C   . ARG G  1 110 ? 77.796  19.653   -29.757 1.00 71.27  ? 110 ARG G C   1 
ATOM   5012  O  O   . ARG G  1 110 ? 76.925  19.023   -30.366 1.00 88.39  ? 110 ARG G O   1 
ATOM   5013  C  CB  . ARG G  1 110 ? 78.417  21.864   -30.812 1.00 57.69  ? 110 ARG G CB  1 
ATOM   5014  C  CG  . ARG G  1 110 ? 78.398  23.408   -30.756 1.00 22.11  ? 110 ARG G CG  1 
ATOM   5015  C  CD  . ARG G  1 110 ? 77.011  23.958   -31.093 1.00 23.06  ? 110 ARG G CD  1 
ATOM   5016  N  NE  . ARG G  1 110 ? 76.986  25.406   -31.269 1.00 23.69  ? 110 ARG G NE  1 
ATOM   5017  C  CZ  . ARG G  1 110 ? 76.725  26.274   -30.302 1.00 48.03  ? 110 ARG G CZ  1 
ATOM   5018  N  NH1 . ARG G  1 110 ? 76.462  25.843   -29.080 1.00 70.82  ? 110 ARG G NH1 1 
ATOM   5019  N  NH2 . ARG G  1 110 ? 76.716  27.575   -30.558 1.00 62.10  ? 110 ARG G NH2 1 
ATOM   5020  O  OXT . ARG G  1 110 ? 78.710  19.012   -29.238 1.00 57.27  ? 110 ARG G OXT 1 
ATOM   5021  N  N   . SER H  1 6   ? 87.189  5.277    -36.067 1.00 81.43  ? 6   SER H N   1 
ATOM   5022  C  CA  . SER H  1 6   ? 88.636  5.459    -36.058 1.00 91.59  ? 6   SER H CA  1 
ATOM   5023  C  C   . SER H  1 6   ? 89.001  6.938    -35.897 1.00 89.67  ? 6   SER H C   1 
ATOM   5024  O  O   . SER H  1 6   ? 89.348  7.419    -34.801 1.00 43.10  ? 6   SER H O   1 
ATOM   5025  C  CB  . SER H  1 6   ? 89.237  4.906    -37.359 1.00 81.62  ? 6   SER H CB  1 
ATOM   5026  N  N   . HIS H  1 7   ? 88.931  7.650    -37.016 1.00 95.23  ? 7   HIS H N   1 
ATOM   5027  C  CA  . HIS H  1 7   ? 89.219  9.071    -37.054 1.00 70.17  ? 7   HIS H CA  1 
ATOM   5028  C  C   . HIS H  1 7   ? 87.969  9.812    -36.620 1.00 77.18  ? 7   HIS H C   1 
ATOM   5029  O  O   . HIS H  1 7   ? 87.373  9.468    -35.617 1.00 110.27 ? 7   HIS H O   1 
ATOM   5030  C  CB  . HIS H  1 7   ? 89.612  9.495    -38.472 1.00 81.90  ? 7   HIS H CB  1 
ATOM   5031  C  CG  . HIS H  1 7   ? 91.066  9.309    -38.791 1.00 99.18  ? 7   HIS H CG  1 
ATOM   5032  N  ND1 . HIS H  1 7   ? 91.989  10.328   -38.677 1.00 104.58 ? 7   HIS H ND1 1 
ATOM   5033  C  CD2 . HIS H  1 7   ? 91.750  8.229    -39.241 1.00 95.31  ? 7   HIS H CD2 1 
ATOM   5034  C  CE1 . HIS H  1 7   ? 93.180  9.880    -39.035 1.00 104.95 ? 7   HIS H CE1 1 
ATOM   5035  N  NE2 . HIS H  1 7   ? 93.063  8.608    -39.376 1.00 95.42  ? 7   HIS H NE2 1 
ATOM   5036  N  N   . CYS H  1 8   ? 87.561  10.807   -37.397 1.00 62.24  ? 8   CYS H N   1 
ATOM   5037  C  CA  . CYS H  1 8   ? 86.393  11.614   -37.081 1.00 49.05  ? 8   CYS H CA  1 
ATOM   5038  C  C   . CYS H  1 8   ? 85.282  11.441   -38.107 1.00 58.81  ? 8   CYS H C   1 
ATOM   5039  O  O   . CYS H  1 8   ? 85.496  11.625   -39.303 1.00 75.45  ? 8   CYS H O   1 
ATOM   5040  C  CB  . CYS H  1 8   ? 86.780  13.088   -37.020 1.00 63.41  ? 8   CYS H CB  1 
ATOM   5041  S  SG  . CYS H  1 8   ? 85.366  14.238   -37.002 1.00 98.04  ? 8   CYS H SG  1 
ATOM   5042  N  N   . GLN H  1 9   ? 84.082  11.133   -37.631 1.00 46.88  ? 9   GLN H N   1 
ATOM   5043  C  CA  . GLN H  1 9   ? 82.994  10.766   -38.523 1.00 58.13  ? 9   GLN H CA  1 
ATOM   5044  C  C   . GLN H  1 9   ? 81.586  10.807   -37.890 1.00 63.70  ? 9   GLN H C   1 
ATOM   5045  O  O   . GLN H  1 9   ? 81.431  10.941   -36.661 1.00 69.10  ? 9   GLN H O   1 
ATOM   5046  C  CB  . GLN H  1 9   ? 83.260  9.366    -39.079 1.00 74.38  ? 9   GLN H CB  1 
ATOM   5047  C  CG  . GLN H  1 9   ? 83.761  8.367    -38.026 1.00 63.64  ? 9   GLN H CG  1 
ATOM   5048  C  CD  . GLN H  1 9   ? 83.908  6.956    -38.569 1.00 80.99  ? 9   GLN H CD  1 
ATOM   5049  O  OE1 . GLN H  1 9   ? 83.431  6.634    -39.668 1.00 91.08  ? 9   GLN H OE1 1 
ATOM   5050  N  NE2 . GLN H  1 9   ? 84.569  6.099    -37.798 1.00 95.59  ? 9   GLN H NE2 1 
ATOM   5051  N  N   . LYS H  1 10  ? 80.573  10.679   -38.752 1.00 52.66  ? 10  LYS H N   1 
ATOM   5052  C  CA  . LYS H  1 10  ? 79.178  10.666   -38.350 1.00 42.80  ? 10  LYS H CA  1 
ATOM   5053  C  C   . LYS H  1 10  ? 78.819  9.236    -37.980 1.00 53.48  ? 10  LYS H C   1 
ATOM   5054  O  O   . LYS H  1 10  ? 79.182  8.309    -38.682 1.00 51.11  ? 10  LYS H O   1 
ATOM   5055  C  CB  . LYS H  1 10  ? 78.284  11.135   -39.510 1.00 45.91  ? 10  LYS H CB  1 
ATOM   5056  C  CG  . LYS H  1 10  ? 77.019  11.882   -39.092 1.00 46.23  ? 10  LYS H CG  1 
ATOM   5057  C  CD  . LYS H  1 10  ? 75.815  11.556   -39.986 1.00 52.06  ? 10  LYS H CD  1 
ATOM   5058  C  CE  . LYS H  1 10  ? 75.854  12.263   -41.342 1.00 65.64  ? 10  LYS H CE  1 
ATOM   5059  N  NZ  . LYS H  1 10  ? 74.664  11.923   -42.196 1.00 74.16  ? 10  LYS H NZ  1 
ATOM   5060  N  N   . THR H  1 11  ? 78.095  9.067    -36.879 1.00 61.72  ? 11  THR H N   1 
ATOM   5061  C  CA  . THR H  1 11  ? 77.741  7.751    -36.342 1.00 48.71  ? 11  THR H CA  1 
ATOM   5062  C  C   . THR H  1 11  ? 76.246  7.654    -36.099 1.00 76.56  ? 11  THR H C   1 
ATOM   5063  O  O   . THR H  1 11  ? 75.584  8.679    -35.864 1.00 92.00  ? 11  THR H O   1 
ATOM   5064  C  CB  . THR H  1 11  ? 78.411  7.548    -34.996 1.00 57.78  ? 11  THR H CB  1 
ATOM   5065  O  OG1 . THR H  1 11  ? 79.800  7.327    -35.216 1.00 73.04  ? 11  THR H OG1 1 
ATOM   5066  C  CG2 . THR H  1 11  ? 77.812  6.352    -34.254 1.00 80.63  ? 11  THR H CG2 1 
ATOM   5067  N  N   . SER H  1 12  ? 75.701  6.438    -36.136 1.00 56.47  ? 12  SER H N   1 
ATOM   5068  C  CA  . SER H  1 12  ? 74.284  6.294    -35.831 1.00 53.38  ? 12  SER H CA  1 
ATOM   5069  C  C   . SER H  1 12  ? 74.031  6.563    -34.352 1.00 64.12  ? 12  SER H C   1 
ATOM   5070  O  O   . SER H  1 12  ? 74.831  6.147    -33.512 1.00 65.53  ? 12  SER H O   1 
ATOM   5071  C  CB  . SER H  1 12  ? 73.783  4.913    -36.199 1.00 46.58  ? 12  SER H CB  1 
ATOM   5072  O  OG  . SER H  1 12  ? 72.450  4.755    -35.738 1.00 63.73  ? 12  SER H OG  1 
ATOM   5073  N  N   . LEU H  1 13  ? 72.953  7.285    -34.037 1.00 61.80  ? 13  LEU H N   1 
ATOM   5074  C  CA  . LEU H  1 13  ? 72.523  7.408    -32.651 1.00 46.39  ? 13  LEU H CA  1 
ATOM   5075  C  C   . LEU H  1 13  ? 71.015  7.391    -32.594 1.00 55.70  ? 13  LEU H C   1 
ATOM   5076  O  O   . LEU H  1 13  ? 70.351  8.431    -32.767 1.00 86.20  ? 13  LEU H O   1 
ATOM   5077  C  CB  . LEU H  1 13  ? 73.065  8.690    -32.020 1.00 60.63  ? 13  LEU H CB  1 
ATOM   5078  C  CG  . LEU H  1 13  ? 72.685  8.974    -30.562 1.00 54.81  ? 13  LEU H CG  1 
ATOM   5079  C  CD1 . LEU H  1 13  ? 73.152  7.873    -29.664 1.00 26.72  ? 13  LEU H CD1 1 
ATOM   5080  C  CD2 . LEU H  1 13  ? 73.273  10.314   -30.117 1.00 61.93  ? 13  LEU H CD2 1 
ATOM   5081  N  N   . ARG H  1 14  ? 70.462  6.202    -32.398 1.00 58.10  ? 14  ARG H N   1 
ATOM   5082  C  CA  . ARG H  1 14  ? 69.015  6.081    -32.282 1.00 68.43  ? 14  ARG H CA  1 
ATOM   5083  C  C   . ARG H  1 14  ? 68.589  6.563    -30.900 1.00 60.68  ? 14  ARG H C   1 
ATOM   5084  O  O   . ARG H  1 14  ? 68.786  5.887    -29.897 1.00 56.99  ? 14  ARG H O   1 
ATOM   5085  C  CB  . ARG H  1 14  ? 68.538  4.652    -32.541 1.00 61.60  ? 14  ARG H CB  1 
ATOM   5086  C  CG  . ARG H  1 14  ? 68.955  4.102    -33.885 1.00 64.84  ? 14  ARG H CG  1 
ATOM   5087  C  CD  . ARG H  1 14  ? 68.424  4.933    -35.020 1.00 79.26  ? 14  ARG H CD  1 
ATOM   5088  N  NE  . ARG H  1 14  ? 68.687  4.352    -36.335 1.00 85.99  ? 14  ARG H NE  1 
ATOM   5089  C  CZ  . ARG H  1 14  ? 68.091  3.258    -36.797 1.00 85.11  ? 14  ARG H CZ  1 
ATOM   5090  N  NH1 . ARG H  1 14  ? 67.220  2.593    -36.036 1.00 73.25  ? 14  ARG H NH1 1 
ATOM   5091  N  NH2 . ARG H  1 14  ? 68.388  2.824    -38.015 1.00 69.51  ? 14  ARG H NH2 1 
ATOM   5092  N  N   . VAL H  1 15  ? 68.026  7.761    -30.849 1.00 56.26  ? 15  VAL H N   1 
ATOM   5093  C  CA  . VAL H  1 15  ? 67.534  8.281    -29.594 1.00 40.97  ? 15  VAL H CA  1 
ATOM   5094  C  C   . VAL H  1 15  ? 66.114  7.835    -29.453 1.00 41.59  ? 15  VAL H C   1 
ATOM   5095  O  O   . VAL H  1 15  ? 65.318  7.979    -30.372 1.00 58.26  ? 15  VAL H O   1 
ATOM   5096  C  CB  . VAL H  1 15  ? 67.569  9.809    -29.543 1.00 50.28  ? 15  VAL H CB  1 
ATOM   5097  C  CG1 . VAL H  1 15  ? 66.923  10.292   -28.277 1.00 46.54  ? 15  VAL H CG1 1 
ATOM   5098  C  CG2 . VAL H  1 15  ? 68.999  10.315   -29.625 1.00 50.49  ? 15  VAL H CG2 1 
ATOM   5099  N  N   . ASN H  1 16  ? 65.811  7.271    -28.296 1.00 40.69  ? 16  ASN H N   1 
ATOM   5100  C  CA  . ASN H  1 16  ? 64.466  6.843    -27.975 1.00 51.17  ? 16  ASN H CA  1 
ATOM   5101  C  C   . ASN H  1 16  ? 63.884  7.811    -26.971 1.00 64.21  ? 16  ASN H C   1 
ATOM   5102  O  O   . ASN H  1 16  ? 64.381  7.903    -25.859 1.00 79.21  ? 16  ASN H O   1 
ATOM   5103  C  CB  . ASN H  1 16  ? 64.527  5.443    -27.380 1.00 63.99  ? 16  ASN H CB  1 
ATOM   5104  C  CG  . ASN H  1 16  ? 63.175  4.896    -27.007 1.00 71.84  ? 16  ASN H CG  1 
ATOM   5105  O  OD1 . ASN H  1 16  ? 62.270  5.632    -26.611 1.00 81.81  ? 16  ASN H OD1 1 
ATOM   5106  N  ND2 . ASN H  1 16  ? 63.035  3.581    -27.116 1.00 80.18  ? 16  ASN H ND2 1 
ATOM   5107  N  N   . PHE H  1 17  ? 62.839  8.537    -27.355 1.00 51.11  ? 17  PHE H N   1 
ATOM   5108  C  CA  . PHE H  1 17  ? 62.294  9.579    -26.495 1.00 54.28  ? 17  PHE H CA  1 
ATOM   5109  C  C   . PHE H  1 17  ? 61.903  9.102    -25.106 1.00 70.05  ? 17  PHE H C   1 
ATOM   5110  O  O   . PHE H  1 17  ? 62.029  9.845    -24.130 1.00 74.00  ? 17  PHE H O   1 
ATOM   5111  C  CB  . PHE H  1 17  ? 61.119  10.255   -27.159 1.00 49.34  ? 17  PHE H CB  1 
ATOM   5112  C  CG  . PHE H  1 17  ? 61.509  11.126   -28.300 1.00 55.27  ? 17  PHE H CG  1 
ATOM   5113  C  CD1 . PHE H  1 17  ? 62.240  12.282   -28.092 1.00 40.34  ? 17  PHE H CD1 1 
ATOM   5114  C  CD2 . PHE H  1 17  ? 61.143  10.795   -29.585 1.00 67.20  ? 17  PHE H CD2 1 
ATOM   5115  C  CE1 . PHE H  1 17  ? 62.597  13.082   -29.144 1.00 30.43  ? 17  PHE H CE1 1 
ATOM   5116  C  CE2 . PHE H  1 17  ? 61.494  11.601   -30.643 1.00 71.51  ? 17  PHE H CE2 1 
ATOM   5117  C  CZ  . PHE H  1 17  ? 62.224  12.748   -30.421 1.00 46.11  ? 17  PHE H CZ  1 
ATOM   5118  N  N   . GLU H  1 18  ? 61.428  7.867    -25.016 1.00 62.53  ? 18  GLU H N   1 
ATOM   5119  C  CA  . GLU H  1 18  ? 61.111  7.275    -23.724 1.00 62.94  ? 18  GLU H CA  1 
ATOM   5120  C  C   . GLU H  1 18  ? 62.339  7.291    -22.808 1.00 67.34  ? 18  GLU H C   1 
ATOM   5121  O  O   . GLU H  1 18  ? 62.239  7.599    -21.624 1.00 55.49  ? 18  GLU H O   1 
ATOM   5122  C  CB  . GLU H  1 18  ? 60.593  5.848    -23.911 1.00 73.55  ? 18  GLU H CB  1 
ATOM   5123  C  CG  . GLU H  1 18  ? 59.921  5.260    -22.682 1.00 79.44  ? 18  GLU H CG  1 
ATOM   5124  C  CD  . GLU H  1 18  ? 59.350  3.875    -22.939 1.00 101.39 ? 18  GLU H CD  1 
ATOM   5125  O  OE1 . GLU H  1 18  ? 58.476  3.429    -22.163 1.00 113.71 ? 18  GLU H OE1 1 
ATOM   5126  O  OE2 . GLU H  1 18  ? 59.776  3.228    -23.920 1.00 106.61 ? 18  GLU H OE2 1 
ATOM   5127  N  N   . ASP H  1 19  ? 63.502  6.974    -23.370 1.00 78.47  ? 19  ASP H N   1 
ATOM   5128  C  CA  . ASP H  1 19  ? 64.748  6.914    -22.602 1.00 63.07  ? 19  ASP H CA  1 
ATOM   5129  C  C   . ASP H  1 19  ? 65.085  8.230    -21.907 1.00 53.08  ? 19  ASP H C   1 
ATOM   5130  O  O   . ASP H  1 19  ? 65.597  8.213    -20.796 1.00 62.25  ? 19  ASP H O   1 
ATOM   5131  C  CB  . ASP H  1 19  ? 65.931  6.467    -23.483 1.00 61.93  ? 19  ASP H CB  1 
ATOM   5132  C  CG  . ASP H  1 19  ? 65.972  4.967    -23.712 1.00 88.23  ? 19  ASP H CG  1 
ATOM   5133  O  OD1 . ASP H  1 19  ? 65.288  4.205    -22.985 1.00 99.34  ? 19  ASP H OD1 1 
ATOM   5134  O  OD2 . ASP H  1 19  ? 66.712  4.555    -24.629 1.00 89.43  ? 19  ASP H OD2 1 
ATOM   5135  N  N   . ILE H  1 20  ? 64.817  9.359    -22.566 1.00 45.46  ? 20  ILE H N   1 
ATOM   5136  C  CA  . ILE H  1 20  ? 65.054  10.673   -21.964 1.00 47.13  ? 20  ILE H CA  1 
ATOM   5137  C  C   . ILE H  1 20  ? 63.766  11.321   -21.464 1.00 55.10  ? 20  ILE H C   1 
ATOM   5138  O  O   . ILE H  1 20  ? 63.734  12.512   -21.205 1.00 60.26  ? 20  ILE H O   1 
ATOM   5139  C  CB  . ILE H  1 20  ? 65.789  11.645   -22.918 1.00 50.62  ? 20  ILE H CB  1 
ATOM   5140  C  CG1 . ILE H  1 20  ? 64.964  11.909   -24.186 1.00 62.16  ? 20  ILE H CG1 1 
ATOM   5141  C  CG2 . ILE H  1 20  ? 67.174  11.114   -23.247 1.00 41.78  ? 20  ILE H CG2 1 
ATOM   5142  C  CD1 . ILE H  1 20  ? 65.592  12.932   -25.130 1.00 52.53  ? 20  ILE H CD1 1 
ATOM   5143  N  N   . GLY H  1 21  ? 62.706  10.531   -21.330 1.00 61.44  ? 21  GLY H N   1 
ATOM   5144  C  CA  . GLY H  1 21  ? 61.477  11.001   -20.706 1.00 79.57  ? 21  GLY H CA  1 
ATOM   5145  C  C   . GLY H  1 21  ? 60.695  12.059   -21.471 1.00 73.71  ? 21  GLY H C   1 
ATOM   5146  O  O   . GLY H  1 21  ? 59.970  12.873   -20.896 1.00 57.52  ? 21  GLY H O   1 
ATOM   5147  N  N   . TRP H  1 22  ? 60.837  12.052   -22.785 1.00 63.03  ? 22  TRP H N   1 
ATOM   5148  C  CA  . TRP H  1 22  ? 60.055  12.941   -23.613 1.00 43.67  ? 22  TRP H CA  1 
ATOM   5149  C  C   . TRP H  1 22  ? 58.833  12.210   -24.163 1.00 52.60  ? 22  TRP H C   1 
ATOM   5150  O  O   . TRP H  1 22  ? 58.041  12.764   -24.893 1.00 48.36  ? 22  TRP H O   1 
ATOM   5151  C  CB  . TRP H  1 22  ? 60.933  13.489   -24.731 1.00 57.96  ? 22  TRP H CB  1 
ATOM   5152  C  CG  . TRP H  1 22  ? 61.904  14.510   -24.243 1.00 63.17  ? 22  TRP H CG  1 
ATOM   5153  C  CD1 . TRP H  1 22  ? 62.198  14.798   -22.949 1.00 84.22  ? 22  TRP H CD1 1 
ATOM   5154  C  CD2 . TRP H  1 22  ? 62.687  15.401   -25.037 1.00 47.38  ? 22  TRP H CD2 1 
ATOM   5155  N  NE1 . TRP H  1 22  ? 63.126  15.810   -22.884 1.00 72.55  ? 22  TRP H NE1 1 
ATOM   5156  C  CE2 . TRP H  1 22  ? 63.442  16.193   -24.156 1.00 48.63  ? 22  TRP H CE2 1 
ATOM   5157  C  CE3 . TRP H  1 22  ? 62.826  15.605   -26.408 1.00 54.41  ? 22  TRP H CE3 1 
ATOM   5158  C  CZ2 . TRP H  1 22  ? 64.318  17.170   -24.602 1.00 55.46  ? 22  TRP H CZ2 1 
ATOM   5159  C  CZ3 . TRP H  1 22  ? 63.702  16.583   -26.852 1.00 40.17  ? 22  TRP H CZ3 1 
ATOM   5160  C  CH2 . TRP H  1 22  ? 64.434  17.347   -25.951 1.00 43.17  ? 22  TRP H CH2 1 
ATOM   5161  N  N   . ASP H  1 23  ? 58.674  10.951   -23.794 1.00 74.53  ? 23  ASP H N   1 
ATOM   5162  C  CA  . ASP H  1 23  ? 57.521  10.177   -24.231 1.00 75.93  ? 23  ASP H CA  1 
ATOM   5163  C  C   . ASP H  1 23  ? 56.248  10.803   -23.715 1.00 65.96  ? 23  ASP H C   1 
ATOM   5164  O  O   . ASP H  1 23  ? 55.155  10.467   -24.156 1.00 80.86  ? 23  ASP H O   1 
ATOM   5165  C  CB  . ASP H  1 23  ? 57.632  8.729    -23.741 1.00 85.84  ? 23  ASP H CB  1 
ATOM   5166  C  CG  . ASP H  1 23  ? 57.868  8.628    -22.242 1.00 96.15  ? 23  ASP H CG  1 
ATOM   5167  O  OD1 . ASP H  1 23  ? 58.494  9.542    -21.662 1.00 93.67  ? 23  ASP H OD1 1 
ATOM   5168  O  OD2 . ASP H  1 23  ? 57.428  7.625    -21.643 1.00 103.37 ? 23  ASP H OD2 1 
ATOM   5169  N  N   . SER H  1 24  ? 56.406  11.716   -22.770 1.00 57.02  ? 24  SER H N   1 
ATOM   5170  C  CA  . SER H  1 24  ? 55.279  12.405   -22.155 1.00 59.28  ? 24  SER H CA  1 
ATOM   5171  C  C   . SER H  1 24  ? 54.542  13.296   -23.146 1.00 55.96  ? 24  SER H C   1 
ATOM   5172  O  O   . SER H  1 24  ? 53.357  13.541   -22.995 1.00 62.78  ? 24  SER H O   1 
ATOM   5173  C  CB  . SER H  1 24  ? 55.747  13.249   -20.959 1.00 53.21  ? 24  SER H CB  1 
ATOM   5174  O  OG  . SER H  1 24  ? 56.409  14.431   -21.381 1.00 70.31  ? 24  SER H OG  1 
ATOM   5175  N  N   . TRP H  1 25  ? 55.249  13.778   -24.159 1.00 59.32  ? 25  TRP H N   1 
ATOM   5176  C  CA  . TRP H  1 25  ? 54.693  14.780   -25.054 1.00 59.95  ? 25  TRP H CA  1 
ATOM   5177  C  C   . TRP H  1 25  ? 55.027  14.560   -26.521 1.00 62.32  ? 25  TRP H C   1 
ATOM   5178  O  O   . TRP H  1 25  ? 54.390  15.128   -27.384 1.00 72.49  ? 25  TRP H O   1 
ATOM   5179  C  CB  . TRP H  1 25  ? 55.115  16.179   -24.618 1.00 61.44  ? 25  TRP H CB  1 
ATOM   5180  C  CG  . TRP H  1 25  ? 56.576  16.412   -24.651 1.00 52.63  ? 25  TRP H CG  1 
ATOM   5181  C  CD1 . TRP H  1 25  ? 57.486  16.004   -23.732 1.00 74.71  ? 25  TRP H CD1 1 
ATOM   5182  C  CD2 . TRP H  1 25  ? 57.303  17.138   -25.643 1.00 48.49  ? 25  TRP H CD2 1 
ATOM   5183  N  NE1 . TRP H  1 25  ? 58.745  16.417   -24.092 1.00 79.37  ? 25  TRP H NE1 1 
ATOM   5184  C  CE2 . TRP H  1 25  ? 58.657  17.123   -25.261 1.00 69.53  ? 25  TRP H CE2 1 
ATOM   5185  C  CE3 . TRP H  1 25  ? 56.941  17.809   -26.814 1.00 45.15  ? 25  TRP H CE3 1 
ATOM   5186  C  CZ2 . TRP H  1 25  ? 59.651  17.742   -26.014 1.00 72.48  ? 25  TRP H CZ2 1 
ATOM   5187  C  CZ3 . TRP H  1 25  ? 57.925  18.424   -27.559 1.00 43.08  ? 25  TRP H CZ3 1 
ATOM   5188  C  CH2 . TRP H  1 25  ? 59.266  18.387   -27.158 1.00 56.00  ? 25  TRP H CH2 1 
ATOM   5189  N  N   . ILE H  1 26  ? 56.020  13.739   -26.814 1.00 59.73  ? 26  ILE H N   1 
ATOM   5190  C  CA  . ILE H  1 26  ? 56.248  13.341   -28.195 1.00 47.83  ? 26  ILE H CA  1 
ATOM   5191  C  C   . ILE H  1 26  ? 55.391  12.125   -28.459 1.00 50.22  ? 26  ILE H C   1 
ATOM   5192  O  O   . ILE H  1 26  ? 55.590  11.074   -27.860 1.00 71.77  ? 26  ILE H O   1 
ATOM   5193  C  CB  . ILE H  1 26  ? 57.731  12.976   -28.491 1.00 65.90  ? 26  ILE H CB  1 
ATOM   5194  C  CG1 . ILE H  1 26  ? 58.685  14.080   -28.040 1.00 46.92  ? 26  ILE H CG1 1 
ATOM   5195  C  CG2 . ILE H  1 26  ? 57.930  12.710   -29.976 1.00 67.60  ? 26  ILE H CG2 1 
ATOM   5196  C  CD1 . ILE H  1 26  ? 58.256  15.424   -28.479 1.00 46.54  ? 26  ILE H CD1 1 
ATOM   5197  N  N   . ILE H  1 27  ? 54.429  12.268   -29.355 1.00 46.37  ? 27  ILE H N   1 
ATOM   5198  C  CA  . ILE H  1 27  ? 53.556  11.163   -29.730 1.00 49.26  ? 27  ILE H CA  1 
ATOM   5199  C  C   . ILE H  1 27  ? 54.239  10.313   -30.770 1.00 51.11  ? 27  ILE H C   1 
ATOM   5200  O  O   . ILE H  1 27  ? 54.188  9.091    -30.711 1.00 54.78  ? 27  ILE H O   1 
ATOM   5201  C  CB  . ILE H  1 27  ? 52.246  11.691   -30.319 1.00 60.90  ? 27  ILE H CB  1 
ATOM   5202  C  CG1 . ILE H  1 27  ? 51.581  12.646   -29.325 1.00 77.85  ? 27  ILE H CG1 1 
ATOM   5203  C  CG2 . ILE H  1 27  ? 51.320  10.566   -30.653 1.00 26.61  ? 27  ILE H CG2 1 
ATOM   5204  C  CD1 . ILE H  1 27  ? 50.394  13.379   -29.870 1.00 71.24  ? 27  ILE H CD1 1 
ATOM   5205  N  N   . ALA H  1 28  ? 54.886  10.975   -31.725 1.00 61.68  ? 28  ALA H N   1 
ATOM   5206  C  CA  . ALA H  1 28  ? 55.680  10.303   -32.759 1.00 44.80  ? 28  ALA H CA  1 
ATOM   5207  C  C   . ALA H  1 28  ? 56.839  11.171   -33.257 1.00 43.91  ? 28  ALA H C   1 
ATOM   5208  O  O   . ALA H  1 28  ? 56.730  12.392   -33.291 1.00 62.56  ? 28  ALA H O   1 
ATOM   5209  C  CB  . ALA H  1 28  ? 54.799  9.906    -33.906 1.00 42.01  ? 28  ALA H CB  1 
ATOM   5210  N  N   . PRO H  1 29  ? 57.957  10.547   -33.635 1.00 39.32  ? 29  PRO H N   1 
ATOM   5211  C  CA  . PRO H  1 29  ? 58.149  9.098    -33.617 1.00 65.09  ? 29  PRO H CA  1 
ATOM   5212  C  C   . PRO H  1 29  ? 58.420  8.643    -32.196 1.00 66.70  ? 29  PRO H C   1 
ATOM   5213  O  O   . PRO H  1 29  ? 58.425  9.505    -31.292 1.00 41.22  ? 29  PRO H O   1 
ATOM   5214  C  CB  . PRO H  1 29  ? 59.406  8.912    -34.461 1.00 67.93  ? 29  PRO H CB  1 
ATOM   5215  C  CG  . PRO H  1 29  ? 60.198  10.141   -34.165 1.00 42.97  ? 29  PRO H CG  1 
ATOM   5216  C  CD  . PRO H  1 29  ? 59.180  11.250   -34.056 1.00 36.66  ? 29  PRO H CD  1 
ATOM   5217  N  N   . LYS H  1 30  ? 58.628  7.336    -32.000 1.00 56.44  ? 30  LYS H N   1 
ATOM   5218  C  CA  . LYS H  1 30  ? 58.950  6.847    -30.670 1.00 51.93  ? 30  LYS H CA  1 
ATOM   5219  C  C   . LYS H  1 30  ? 60.455  6.910    -30.483 1.00 65.55  ? 30  LYS H C   1 
ATOM   5220  O  O   . LYS H  1 30  ? 60.939  7.184    -29.383 1.00 67.36  ? 30  LYS H O   1 
ATOM   5221  C  CB  . LYS H  1 30  ? 58.408  5.446    -30.442 1.00 42.18  ? 30  LYS H CB  1 
ATOM   5222  C  CG  . LYS H  1 30  ? 56.865  5.356    -30.389 1.00 64.93  ? 30  LYS H CG  1 
ATOM   5223  C  CD  . LYS H  1 30  ? 56.218  6.216    -29.290 1.00 78.40  ? 30  LYS H CD  1 
ATOM   5224  C  CE  . LYS H  1 30  ? 54.694  6.150    -29.386 1.00 87.18  ? 30  LYS H CE  1 
ATOM   5225  N  NZ  . LYS H  1 30  ? 53.997  7.108    -28.484 1.00 89.77  ? 30  LYS H NZ  1 
ATOM   5226  N  N   . GLU H  1 31  ? 61.189  6.679    -31.571 1.00 60.80  ? 31  GLU H N   1 
ATOM   5227  C  CA  . GLU H  1 31  ? 62.638  6.926    -31.608 1.00 45.25  ? 31  GLU H CA  1 
ATOM   5228  C  C   . GLU H  1 31  ? 63.043  7.463    -32.978 1.00 51.57  ? 31  GLU H C   1 
ATOM   5229  O  O   . GLU H  1 31  ? 62.301  7.324    -33.956 1.00 66.51  ? 31  GLU H O   1 
ATOM   5230  C  CB  . GLU H  1 31  ? 63.449  5.674    -31.244 1.00 54.57  ? 31  GLU H CB  1 
ATOM   5231  C  CG  . GLU H  1 31  ? 63.584  4.600    -32.332 1.00 84.59  ? 31  GLU H CG  1 
ATOM   5232  C  CD  . GLU H  1 31  ? 64.413  3.399    -31.867 1.00 111.46 ? 31  GLU H CD  1 
ATOM   5233  O  OE1 . GLU H  1 31  ? 65.062  2.746    -32.716 1.00 126.05 ? 31  GLU H OE1 1 
ATOM   5234  O  OE2 . GLU H  1 31  ? 64.418  3.109    -30.648 1.00 98.74  ? 31  GLU H OE2 1 
ATOM   5235  N  N   . TYR H  1 32  ? 64.210  8.091    -33.051 1.00 48.84  ? 32  TYR H N   1 
ATOM   5236  C  CA  . TYR H  1 32  ? 64.636  8.718    -34.293 1.00 39.36  ? 32  TYR H CA  1 
ATOM   5237  C  C   . TYR H  1 32  ? 66.124  8.743    -34.373 1.00 48.37  ? 32  TYR H C   1 
ATOM   5238  O  O   . TYR H  1 32  ? 66.804  8.647    -33.362 1.00 47.08  ? 32  TYR H O   1 
ATOM   5239  C  CB  . TYR H  1 32  ? 64.141  10.147   -34.382 1.00 37.29  ? 32  TYR H CB  1 
ATOM   5240  C  CG  . TYR H  1 32  ? 65.018  11.164   -33.666 1.00 39.36  ? 32  TYR H CG  1 
ATOM   5241  C  CD1 . TYR H  1 32  ? 64.923  11.367   -32.296 1.00 43.64  ? 32  TYR H CD1 1 
ATOM   5242  C  CD2 . TYR H  1 32  ? 65.912  11.947   -34.374 1.00 45.00  ? 32  TYR H CD2 1 
ATOM   5243  C  CE1 . TYR H  1 32  ? 65.697  12.304   -31.660 1.00 59.20  ? 32  TYR H CE1 1 
ATOM   5244  C  CE2 . TYR H  1 32  ? 66.692  12.882   -33.741 1.00 45.50  ? 32  TYR H CE2 1 
ATOM   5245  C  CZ  . TYR H  1 32  ? 66.585  13.053   -32.390 1.00 55.84  ? 32  TYR H CZ  1 
ATOM   5246  O  OH  . TYR H  1 32  ? 67.384  13.992   -31.788 1.00 31.31  ? 32  TYR H OH  1 
ATOM   5247  N  N   . GLU H  1 33  ? 66.625  8.888    -35.590 1.00 51.79  ? 33  GLU H N   1 
ATOM   5248  C  CA  . GLU H  1 33  ? 68.056  8.929    -35.821 1.00 43.35  ? 33  GLU H CA  1 
ATOM   5249  C  C   . GLU H  1 33  ? 68.603  10.331   -35.641 1.00 57.10  ? 33  GLU H C   1 
ATOM   5250  O  O   . GLU H  1 33  ? 68.533  11.164   -36.552 1.00 57.37  ? 33  GLU H O   1 
ATOM   5251  C  CB  . GLU H  1 33  ? 68.371  8.468    -37.233 1.00 52.95  ? 33  GLU H CB  1 
ATOM   5252  C  CG  . GLU H  1 33  ? 69.848  8.560    -37.575 1.00 57.99  ? 33  GLU H CG  1 
ATOM   5253  C  CD  . GLU H  1 33  ? 70.659  7.480    -36.900 1.00 71.54  ? 33  GLU H CD  1 
ATOM   5254  O  OE1 . GLU H  1 33  ? 70.817  6.378    -37.477 1.00 74.64  ? 33  GLU H OE1 1 
ATOM   5255  O  OE2 . GLU H  1 33  ? 71.132  7.736    -35.781 1.00 74.94  ? 33  GLU H OE2 1 
ATOM   5256  N  N   . ALA H  1 34  ? 69.129  10.605   -34.457 1.00 63.56  ? 34  ALA H N   1 
ATOM   5257  C  CA  . ALA H  1 34  ? 69.992  11.756   -34.330 1.00 65.83  ? 34  ALA H CA  1 
ATOM   5258  C  C   . ALA H  1 34  ? 71.325  11.136   -34.621 1.00 81.75  ? 34  ALA H C   1 
ATOM   5259  O  O   . ALA H  1 34  ? 71.498  9.912    -34.489 1.00 123.27 ? 34  ALA H O   1 
ATOM   5260  C  CB  . ALA H  1 34  ? 69.960  12.282   -32.946 1.00 61.40  ? 34  ALA H CB  1 
ATOM   5261  N  N   . TYR H  1 35  ? 72.296  11.914   -35.035 1.00 44.21  ? 35  TYR H N   1 
ATOM   5262  C  CA  . TYR H  1 35  ? 73.545  11.219   -35.207 1.00 63.20  ? 35  TYR H CA  1 
ATOM   5263  C  C   . TYR H  1 35  ? 74.436  11.526   -34.032 1.00 70.45  ? 35  TYR H C   1 
ATOM   5264  O  O   . TYR H  1 35  ? 74.016  12.228   -33.115 1.00 77.55  ? 35  TYR H O   1 
ATOM   5265  C  CB  . TYR H  1 35  ? 74.182  11.549   -36.542 1.00 81.36  ? 35  TYR H CB  1 
ATOM   5266  C  CG  . TYR H  1 35  ? 73.443  10.929   -37.692 1.00 72.84  ? 35  TYR H CG  1 
ATOM   5267  C  CD1 . TYR H  1 35  ? 72.547  11.659   -38.437 1.00 68.50  ? 35  TYR H CD1 1 
ATOM   5268  C  CD2 . TYR H  1 35  ? 73.635  9.607    -38.024 1.00 67.13  ? 35  TYR H CD2 1 
ATOM   5269  C  CE1 . TYR H  1 35  ? 71.876  11.092   -39.490 1.00 62.77  ? 35  TYR H CE1 1 
ATOM   5270  C  CE2 . TYR H  1 35  ? 72.960  9.034    -39.072 1.00 54.09  ? 35  TYR H CE2 1 
ATOM   5271  C  CZ  . TYR H  1 35  ? 72.082  9.782    -39.806 1.00 47.00  ? 35  TYR H CZ  1 
ATOM   5272  O  OH  . TYR H  1 35  ? 71.400  9.210    -40.861 1.00 54.90  ? 35  TYR H OH  1 
ATOM   5273  N  N   . GLU H  1 36  ? 75.640  10.960   -34.044 1.00 67.55  ? 36  GLU H N   1 
ATOM   5274  C  CA  . GLU H  1 36  ? 76.698  11.316   -33.093 1.00 75.09  ? 36  GLU H CA  1 
ATOM   5275  C  C   . GLU H  1 36  ? 77.931  11.735   -33.873 1.00 61.32  ? 36  GLU H C   1 
ATOM   5276  O  O   . GLU H  1 36  ? 78.188  11.245   -34.969 1.00 49.62  ? 36  GLU H O   1 
ATOM   5277  C  CB  . GLU H  1 36  ? 77.052  10.127   -32.198 1.00 78.96  ? 36  GLU H CB  1 
ATOM   5278  C  CG  . GLU H  1 36  ? 77.887  10.482   -30.982 1.00 92.04  ? 36  GLU H CG  1 
ATOM   5279  C  CD  . GLU H  1 36  ? 78.002  9.328    -29.998 1.00 113.51 ? 36  GLU H CD  1 
ATOM   5280  O  OE1 . GLU H  1 36  ? 77.517  8.218    -30.308 1.00 116.97 ? 36  GLU H OE1 1 
ATOM   5281  O  OE2 . GLU H  1 36  ? 78.576  9.532    -28.910 1.00 107.51 ? 36  GLU H OE2 1 
ATOM   5282  N  N   . CYS H  1 37  ? 78.705  12.651   -33.329 1.00 53.71  ? 37  CYS H N   1 
ATOM   5283  C  CA  . CYS H  1 37  ? 79.970  12.953   -33.977 1.00 53.23  ? 37  CYS H CA  1 
ATOM   5284  C  C   . CYS H  1 37  ? 81.106  12.320   -33.163 1.00 59.79  ? 37  CYS H C   1 
ATOM   5285  O  O   . CYS H  1 37  ? 81.465  12.810   -32.089 1.00 64.32  ? 37  CYS H O   1 
ATOM   5286  C  CB  . CYS H  1 37  ? 80.145  14.464   -34.190 1.00 43.26  ? 37  CYS H CB  1 
ATOM   5287  S  SG  . CYS H  1 37  ? 79.294  15.093   -35.658 1.00 80.08  ? 37  CYS H SG  1 
ATOM   5288  N  N   . LYS H  1 38  ? 81.641  11.206   -33.668 1.00 63.28  ? 38  LYS H N   1 
ATOM   5289  C  CA  . LYS H  1 38  ? 82.623  10.418   -32.914 1.00 45.27  ? 38  LYS H CA  1 
ATOM   5290  C  C   . LYS H  1 38  ? 83.950  10.479   -33.607 1.00 53.13  ? 38  LYS H C   1 
ATOM   5291  O  O   . LYS H  1 38  ? 84.011  10.592   -34.825 1.00 55.52  ? 38  LYS H O   1 
ATOM   5292  C  CB  . LYS H  1 38  ? 82.215  8.941    -32.810 1.00 39.81  ? 38  LYS H CB  1 
ATOM   5293  C  CG  . LYS H  1 38  ? 81.565  8.508    -31.482 1.00 58.23  ? 38  LYS H CG  1 
ATOM   5294  C  CD  . LYS H  1 38  ? 81.098  7.052    -31.535 1.00 76.56  ? 38  LYS H CD  1 
ATOM   5295  C  CE  . LYS H  1 38  ? 80.192  6.675    -30.351 1.00 95.72  ? 38  LYS H CE  1 
ATOM   5296  N  NZ  . LYS H  1 38  ? 79.100  5.688    -30.710 1.00 96.57  ? 38  LYS H NZ  1 
ATOM   5297  N  N   . GLY H  1 39  ? 85.019  10.394   -32.828 1.00 49.65  ? 39  GLY H N   1 
ATOM   5298  C  CA  . GLY H  1 39  ? 86.336  10.304   -33.412 1.00 56.86  ? 39  GLY H CA  1 
ATOM   5299  C  C   . GLY H  1 39  ? 87.276  11.460   -33.160 1.00 60.63  ? 39  GLY H C   1 
ATOM   5300  O  O   . GLY H  1 39  ? 86.901  12.491   -32.615 1.00 78.65  ? 39  GLY H O   1 
ATOM   5301  N  N   . GLY H  1 40  ? 88.520  11.272   -33.571 1.00 54.47  ? 40  GLY H N   1 
ATOM   5302  C  CA  . GLY H  1 40  ? 89.552  12.234   -33.287 1.00 61.05  ? 40  GLY H CA  1 
ATOM   5303  C  C   . GLY H  1 40  ? 89.933  13.063   -34.489 1.00 59.50  ? 40  GLY H C   1 
ATOM   5304  O  O   . GLY H  1 40  ? 89.744  12.674   -35.643 1.00 54.05  ? 40  GLY H O   1 
ATOM   5305  N  N   . CYS H  1 41  ? 90.485  14.230   -34.205 1.00 56.37  ? 41  CYS H N   1 
ATOM   5306  C  CA  . CYS H  1 41  ? 90.920  15.126   -35.249 1.00 60.60  ? 41  CYS H CA  1 
ATOM   5307  C  C   . CYS H  1 41  ? 92.421  15.008   -35.337 1.00 71.34  ? 41  CYS H C   1 
ATOM   5308  O  O   . CYS H  1 41  ? 93.154  15.671   -34.602 1.00 84.51  ? 41  CYS H O   1 
ATOM   5309  C  CB  . CYS H  1 41  ? 90.482  16.556   -34.925 1.00 73.34  ? 41  CYS H CB  1 
ATOM   5310  S  SG  . CYS H  1 41  ? 88.670  16.764   -34.691 1.00 77.16  ? 41  CYS H SG  1 
ATOM   5311  N  N   . PHE H  1 42  ? 92.868  14.131   -36.225 1.00 69.00  ? 42  PHE H N   1 
ATOM   5312  C  CA  . PHE H  1 42  ? 94.261  13.747   -36.252 1.00 74.69  ? 42  PHE H CA  1 
ATOM   5313  C  C   . PHE H  1 42  ? 94.944  14.374   -37.440 1.00 83.27  ? 42  PHE H C   1 
ATOM   5314  O  O   . PHE H  1 42  ? 94.422  14.325   -38.555 1.00 106.80 ? 42  PHE H O   1 
ATOM   5315  C  CB  . PHE H  1 42  ? 94.380  12.231   -36.333 1.00 80.81  ? 42  PHE H CB  1 
ATOM   5316  C  CG  . PHE H  1 42  ? 93.893  11.522   -35.109 1.00 75.73  ? 42  PHE H CG  1 
ATOM   5317  C  CD1 . PHE H  1 42  ? 92.859  10.605   -35.193 1.00 76.07  ? 42  PHE H CD1 1 
ATOM   5318  C  CD2 . PHE H  1 42  ? 94.462  11.776   -33.873 1.00 92.31  ? 42  PHE H CD2 1 
ATOM   5319  C  CE1 . PHE H  1 42  ? 92.403  9.949    -34.063 1.00 97.05  ? 42  PHE H CE1 1 
ATOM   5320  C  CE2 . PHE H  1 42  ? 94.011  11.124   -32.738 1.00 98.55  ? 42  PHE H CE2 1 
ATOM   5321  C  CZ  . PHE H  1 42  ? 92.981  10.210   -32.832 1.00 100.31 ? 42  PHE H CZ  1 
ATOM   5322  N  N   . PHE H  1 43  ? 96.116  14.954   -37.202 1.00 67.34  ? 43  PHE H N   1 
ATOM   5323  C  CA  . PHE H  1 43  ? 96.853  15.624   -38.260 1.00 66.74  ? 43  PHE H CA  1 
ATOM   5324  C  C   . PHE H  1 43  ? 97.446  14.626   -39.253 1.00 76.89  ? 43  PHE H C   1 
ATOM   5325  O  O   . PHE H  1 43  ? 97.884  13.537   -38.873 1.00 81.37  ? 43  PHE H O   1 
ATOM   5326  C  CB  . PHE H  1 43  ? 97.935  16.500   -37.652 1.00 65.14  ? 43  PHE H CB  1 
ATOM   5327  C  CG  . PHE H  1 43  ? 98.342  17.655   -38.513 1.00 72.43  ? 43  PHE H CG  1 
ATOM   5328  C  CD1 . PHE H  1 43  ? 97.626  18.834   -38.486 1.00 78.11  ? 43  PHE H CD1 1 
ATOM   5329  C  CD2 . PHE H  1 43  ? 99.455  17.575   -39.327 1.00 80.67  ? 43  PHE H CD2 1 
ATOM   5330  C  CE1 . PHE H  1 43  ? 98.000  19.908   -39.268 1.00 86.27  ? 43  PHE H CE1 1 
ATOM   5331  C  CE2 . PHE H  1 43  ? 99.836  18.651   -40.109 1.00 79.54  ? 43  PHE H CE2 1 
ATOM   5332  C  CZ  . PHE H  1 43  ? 99.108  19.816   -40.078 1.00 82.43  ? 43  PHE H CZ  1 
ATOM   5333  N  N   . PRO H  1 44  ? 97.425  14.980   -40.542 1.00 83.91  ? 44  PRO H N   1 
ATOM   5334  C  CA  . PRO H  1 44  ? 96.840  16.221   -41.041 1.00 92.18  ? 44  PRO H CA  1 
ATOM   5335  C  C   . PRO H  1 44  ? 95.310  16.101   -41.140 1.00 100.96 ? 44  PRO H C   1 
ATOM   5336  O  O   . PRO H  1 44  ? 94.768  14.992   -41.256 1.00 105.29 ? 44  PRO H O   1 
ATOM   5337  C  CB  . PRO H  1 44  ? 97.451  16.336   -42.430 1.00 85.05  ? 44  PRO H CB  1 
ATOM   5338  C  CG  . PRO H  1 44  ? 97.540  14.921   -42.878 1.00 83.38  ? 44  PRO H CG  1 
ATOM   5339  C  CD  . PRO H  1 44  ? 97.892  14.125   -41.644 1.00 89.55  ? 44  PRO H CD  1 
ATOM   5340  N  N   . LEU H  1 45  ? 94.626  17.243   -41.095 1.00 83.39  ? 45  LEU H N   1 
ATOM   5341  C  CA  . LEU H  1 45  ? 93.169  17.276   -41.051 1.00 62.72  ? 45  LEU H CA  1 
ATOM   5342  C  C   . LEU H  1 45  ? 92.561  17.164   -42.435 1.00 77.86  ? 45  LEU H C   1 
ATOM   5343  O  O   . LEU H  1 45  ? 92.725  18.060   -43.255 1.00 81.63  ? 45  LEU H O   1 
ATOM   5344  C  CB  . LEU H  1 45  ? 92.684  18.560   -40.365 1.00 46.20  ? 45  LEU H CB  1 
ATOM   5345  C  CG  . LEU H  1 45  ? 93.166  18.734   -38.913 1.00 56.63  ? 45  LEU H CG  1 
ATOM   5346  C  CD1 . LEU H  1 45  ? 92.647  20.002   -38.263 1.00 63.21  ? 45  LEU H CD1 1 
ATOM   5347  C  CD2 . LEU H  1 45  ? 92.815  17.511   -38.045 1.00 50.77  ? 45  LEU H CD2 1 
ATOM   5348  N  N   . ALA H  1 46  ? 91.851  16.063   -42.680 1.00 87.33  ? 46  ALA H N   1 
ATOM   5349  C  CA  . ALA H  1 46  ? 91.213  15.804   -43.974 1.00 81.48  ? 46  ALA H CA  1 
ATOM   5350  C  C   . ALA H  1 46  ? 90.301  16.936   -44.374 1.00 70.47  ? 46  ALA H C   1 
ATOM   5351  O  O   . ALA H  1 46  ? 89.655  17.529   -43.524 1.00 66.24  ? 46  ALA H O   1 
ATOM   5352  C  CB  . ALA H  1 46  ? 90.427  14.516   -43.913 1.00 98.99  ? 46  ALA H CB  1 
ATOM   5353  N  N   . ASP H  1 47  ? 90.242  17.227   -45.670 1.00 79.45  ? 47  ASP H N   1 
ATOM   5354  C  CA  . ASP H  1 47  ? 89.407  18.324   -46.172 1.00 74.96  ? 47  ASP H CA  1 
ATOM   5355  C  C   . ASP H  1 47  ? 87.947  18.138   -45.756 1.00 73.72  ? 47  ASP H C   1 
ATOM   5356  O  O   . ASP H  1 47  ? 87.268  19.105   -45.427 1.00 65.48  ? 47  ASP H O   1 
ATOM   5357  C  CB  . ASP H  1 47  ? 89.490  18.453   -47.704 1.00 77.44  ? 47  ASP H CB  1 
ATOM   5358  C  CG  . ASP H  1 47  ? 90.918  18.605   -48.215 1.00 112.56 ? 47  ASP H CG  1 
ATOM   5359  O  OD1 . ASP H  1 47  ? 91.522  17.584   -48.622 1.00 125.48 ? 47  ASP H OD1 1 
ATOM   5360  O  OD2 . ASP H  1 47  ? 91.432  19.748   -48.220 1.00 109.28 ? 47  ASP H OD2 1 
ATOM   5361  N  N   . ASP H  1 48  ? 87.469  16.894   -45.766 1.00 84.54  ? 48  ASP H N   1 
ATOM   5362  C  CA  . ASP H  1 48  ? 86.058  16.609   -45.495 1.00 69.16  ? 48  ASP H CA  1 
ATOM   5363  C  C   . ASP H  1 48  ? 85.691  16.829   -44.037 1.00 59.96  ? 48  ASP H C   1 
ATOM   5364  O  O   . ASP H  1 48  ? 84.622  16.444   -43.589 1.00 71.23  ? 48  ASP H O   1 
ATOM   5365  C  CB  . ASP H  1 48  ? 85.657  15.194   -45.953 1.00 85.70  ? 48  ASP H CB  1 
ATOM   5366  C  CG  . ASP H  1 48  ? 86.533  14.106   -45.362 1.00 108.63 ? 48  ASP H CG  1 
ATOM   5367  O  OD1 . ASP H  1 48  ? 87.766  14.301   -45.293 1.00 134.30 ? 48  ASP H OD1 1 
ATOM   5368  O  OD2 . ASP H  1 48  ? 85.983  13.052   -44.976 1.00 99.62  ? 48  ASP H OD2 1 
ATOM   5369  N  N   . VAL H  1 49  ? 86.576  17.474   -43.298 1.00 69.20  ? 49  VAL H N   1 
ATOM   5370  C  CA  . VAL H  1 49  ? 86.305  17.800   -41.907 1.00 61.23  ? 49  VAL H CA  1 
ATOM   5371  C  C   . VAL H  1 49  ? 86.241  19.323   -41.722 1.00 73.02  ? 49  VAL H C   1 
ATOM   5372  O  O   . VAL H  1 49  ? 86.080  19.834   -40.619 1.00 67.52  ? 49  VAL H O   1 
ATOM   5373  C  CB  . VAL H  1 49  ? 87.349  17.141   -41.004 1.00 55.85  ? 49  VAL H CB  1 
ATOM   5374  C  CG1 . VAL H  1 49  ? 87.437  17.834   -39.692 1.00 74.60  ? 49  VAL H CG1 1 
ATOM   5375  C  CG2 . VAL H  1 49  ? 86.993  15.690   -40.798 1.00 37.21  ? 49  VAL H CG2 1 
ATOM   5376  N  N   . THR H  1 50  ? 86.356  20.038   -42.835 1.00 63.55  ? 50  THR H N   1 
ATOM   5377  C  CA  . THR H  1 50  ? 86.083  21.457   -42.864 1.00 50.31  ? 50  THR H CA  1 
ATOM   5378  C  C   . THR H  1 50  ? 86.906  22.202   -41.837 1.00 60.59  ? 50  THR H C   1 
ATOM   5379  O  O   . THR H  1 50  ? 86.436  23.184   -41.262 1.00 76.49  ? 50  THR H O   1 
ATOM   5380  C  CB  . THR H  1 50  ? 84.615  21.729   -42.521 1.00 67.10  ? 50  THR H CB  1 
ATOM   5381  O  OG1 . THR H  1 50  ? 83.814  20.614   -42.920 1.00 72.05  ? 50  THR H OG1 1 
ATOM   5382  C  CG2 . THR H  1 50  ? 84.117  23.010   -43.195 1.00 80.56  ? 50  THR H CG2 1 
ATOM   5383  N  N   . PRO H  1 51  ? 88.147  21.767   -41.614 1.00 49.08  ? 51  PRO H N   1 
ATOM   5384  C  CA  . PRO H  1 51  ? 88.933  22.408   -40.555 1.00 48.07  ? 51  PRO H CA  1 
ATOM   5385  C  C   . PRO H  1 51  ? 88.938  23.928   -40.683 1.00 46.34  ? 51  PRO H C   1 
ATOM   5386  O  O   . PRO H  1 51  ? 89.068  24.459   -41.795 1.00 41.19  ? 51  PRO H O   1 
ATOM   5387  C  CB  . PRO H  1 51  ? 90.346  21.861   -40.786 1.00 36.42  ? 51  PRO H CB  1 
ATOM   5388  C  CG  . PRO H  1 51  ? 90.372  21.464   -42.235 1.00 61.41  ? 51  PRO H CG  1 
ATOM   5389  C  CD  . PRO H  1 51  ? 88.985  20.951   -42.507 1.00 60.80  ? 51  PRO H CD  1 
ATOM   5390  N  N   . THR H  1 52  ? 88.760  24.612   -39.554 1.00 45.87  ? 52  THR H N   1 
ATOM   5391  C  CA  . THR H  1 52  ? 88.937  26.062   -39.490 1.00 54.45  ? 52  THR H CA  1 
ATOM   5392  C  C   . THR H  1 52  ? 90.416  26.334   -39.335 1.00 63.50  ? 52  THR H C   1 
ATOM   5393  O  O   . THR H  1 52  ? 91.180  25.441   -38.933 1.00 61.30  ? 52  THR H O   1 
ATOM   5394  C  CB  . THR H  1 52  ? 88.224  26.691   -38.278 1.00 47.18  ? 52  THR H CB  1 
ATOM   5395  O  OG1 . THR H  1 52  ? 88.835  26.239   -37.056 1.00 64.53  ? 52  THR H OG1 1 
ATOM   5396  C  CG2 . THR H  1 52  ? 86.787  26.301   -38.273 1.00 41.59  ? 52  THR H CG2 1 
ATOM   5397  N  N   . LYS H  1 53  ? 90.831  27.558   -39.647 1.00 51.46  ? 53  LYS H N   1 
ATOM   5398  C  CA  . LYS H  1 53  ? 92.228  27.922   -39.446 1.00 50.38  ? 53  LYS H CA  1 
ATOM   5399  C  C   . LYS H  1 53  ? 92.563  27.598   -38.009 1.00 60.30  ? 53  LYS H C   1 
ATOM   5400  O  O   . LYS H  1 53  ? 93.519  26.858   -37.718 1.00 56.79  ? 53  LYS H O   1 
ATOM   5401  C  CB  . LYS H  1 53  ? 92.449  29.407   -39.702 1.00 48.49  ? 53  LYS H CB  1 
ATOM   5402  C  CG  . LYS H  1 53  ? 93.365  29.724   -40.890 1.00 50.13  ? 53  LYS H CG  1 
ATOM   5403  C  CD  . LYS H  1 53  ? 92.791  29.201   -42.197 1.00 58.70  ? 53  LYS H CD  1 
ATOM   5404  C  CE  . LYS H  1 53  ? 93.581  29.716   -43.386 1.00 60.46  ? 53  LYS H CE  1 
ATOM   5405  N  NZ  . LYS H  1 53  ? 93.082  29.203   -44.709 1.00 86.91  ? 53  LYS H NZ  1 
ATOM   5406  N  N   . HIS H  1 54  ? 91.736  28.128   -37.111 1.00 53.00  ? 54  HIS H N   1 
ATOM   5407  C  CA  . HIS H  1 54  ? 91.974  27.951   -35.692 1.00 49.07  ? 54  HIS H CA  1 
ATOM   5408  C  C   . HIS H  1 54  ? 92.192  26.487   -35.333 1.00 52.40  ? 54  HIS H C   1 
ATOM   5409  O  O   . HIS H  1 54  ? 93.202  26.137   -34.728 1.00 38.36  ? 54  HIS H O   1 
ATOM   5410  C  CB  . HIS H  1 54  ? 90.855  28.535   -34.860 1.00 22.96  ? 54  HIS H CB  1 
ATOM   5411  C  CG  . HIS H  1 54  ? 91.122  28.473   -33.387 1.00 47.57  ? 54  HIS H CG  1 
ATOM   5412  N  ND1 . HIS H  1 54  ? 91.000  27.305   -32.652 1.00 41.07  ? 54  HIS H ND1 1 
ATOM   5413  C  CD2 . HIS H  1 54  ? 91.513  29.437   -32.512 1.00 24.83  ? 54  HIS H CD2 1 
ATOM   5414  C  CE1 . HIS H  1 54  ? 91.291  27.562   -31.386 1.00 51.73  ? 54  HIS H CE1 1 
ATOM   5415  N  NE2 . HIS H  1 54  ? 91.607  28.846   -31.275 1.00 35.89  ? 54  HIS H NE2 1 
ATOM   5416  N  N   . ALA H  1 55  ? 91.245  25.636   -35.707 1.00 42.05  ? 55  ALA H N   1 
ATOM   5417  C  CA  . ALA H  1 55  ? 91.429  24.205   -35.534 1.00 53.16  ? 55  ALA H CA  1 
ATOM   5418  C  C   . ALA H  1 55  ? 92.822  23.740   -35.969 1.00 58.31  ? 55  ALA H C   1 
ATOM   5419  O  O   . ALA H  1 55  ? 93.452  22.934   -35.278 1.00 47.76  ? 55  ALA H O   1 
ATOM   5420  C  CB  . ALA H  1 55  ? 90.380  23.464   -36.300 1.00 59.05  ? 55  ALA H CB  1 
ATOM   5421  N  N   . ILE H  1 56  ? 93.295  24.239   -37.110 1.00 47.30  ? 56  ILE H N   1 
ATOM   5422  C  CA  . ILE H  1 56  ? 94.612  23.859   -37.588 1.00 54.10  ? 56  ILE H CA  1 
ATOM   5423  C  C   . ILE H  1 56  ? 95.667  24.277   -36.573 1.00 62.35  ? 56  ILE H C   1 
ATOM   5424  O  O   . ILE H  1 56  ? 96.452  23.451   -36.043 1.00 56.00  ? 56  ILE H O   1 
ATOM   5425  C  CB  . ILE H  1 56  ? 94.940  24.524   -38.924 1.00 33.74  ? 56  ILE H CB  1 
ATOM   5426  C  CG1 . ILE H  1 56  ? 93.942  24.095   -39.991 1.00 28.47  ? 56  ILE H CG1 1 
ATOM   5427  C  CG2 . ILE H  1 56  ? 96.360  24.124   -39.369 1.00 37.29  ? 56  ILE H CG2 1 
ATOM   5428  C  CD1 . ILE H  1 56  ? 94.377  22.812   -40.723 1.00 67.00  ? 56  ILE H CD1 1 
ATOM   5429  N  N   . VAL H  1 57  ? 95.679  25.573   -36.298 1.00 24.66  ? 57  VAL H N   1 
ATOM   5430  C  CA  . VAL H  1 57  ? 96.663  26.102   -35.361 1.00 48.93  ? 57  VAL H CA  1 
ATOM   5431  C  C   . VAL H  1 57  ? 96.663  25.309   -34.059 1.00 60.14  ? 57  VAL H C   1 
ATOM   5432  O  O   . VAL H  1 57  ? 97.697  24.737   -33.672 1.00 53.03  ? 57  VAL H O   1 
ATOM   5433  C  CB  . VAL H  1 57  ? 96.443  27.598   -35.085 1.00 37.63  ? 57  VAL H CB  1 
ATOM   5434  C  CG1 . VAL H  1 57  ? 97.291  28.089   -33.924 1.00 15.33  ? 57  VAL H CG1 1 
ATOM   5435  C  CG2 . VAL H  1 57  ? 96.776  28.371   -36.319 1.00 29.39  ? 57  VAL H CG2 1 
ATOM   5436  N  N   . GLN H  1 58  ? 95.502  25.263   -33.405 1.00 52.01  ? 58  GLN H N   1 
ATOM   5437  C  CA  . GLN H  1 58  ? 95.356  24.547   -32.153 1.00 51.35  ? 58  GLN H CA  1 
ATOM   5438  C  C   . GLN H  1 58  ? 95.957  23.168   -32.295 1.00 50.75  ? 58  GLN H C   1 
ATOM   5439  O  O   . GLN H  1 58  ? 96.829  22.797   -31.514 1.00 43.25  ? 58  GLN H O   1 
ATOM   5440  C  CB  . GLN H  1 58  ? 93.893  24.465   -31.699 1.00 33.43  ? 58  GLN H CB  1 
ATOM   5441  C  CG  . GLN H  1 58  ? 93.721  23.749   -30.341 1.00 19.51  ? 58  GLN H CG  1 
ATOM   5442  C  CD  . GLN H  1 58  ? 92.397  24.020   -29.665 1.00 54.47  ? 58  GLN H CD  1 
ATOM   5443  O  OE1 . GLN H  1 58  ? 91.758  25.045   -29.901 1.00 62.17  ? 58  GLN H OE1 1 
ATOM   5444  N  NE2 . GLN H  1 58  ? 91.973  23.094   -28.816 1.00 81.94  ? 58  GLN H NE2 1 
ATOM   5445  N  N   . THR H  1 59  ? 95.517  22.424   -33.305 1.00 15.22  ? 59  THR H N   1 
ATOM   5446  C  CA  . THR H  1 59  ? 96.056  21.091   -33.533 1.00 32.02  ? 59  THR H CA  1 
ATOM   5447  C  C   . THR H  1 59  ? 97.592  21.046   -33.500 1.00 47.51  ? 59  THR H C   1 
ATOM   5448  O  O   . THR H  1 59  ? 98.183  20.179   -32.814 1.00 36.84  ? 59  THR H O   1 
ATOM   5449  C  CB  . THR H  1 59  ? 95.538  20.474   -34.833 1.00 36.70  ? 59  THR H CB  1 
ATOM   5450  O  OG1 . THR H  1 59  ? 94.299  19.784   -34.579 1.00 35.14  ? 59  THR H OG1 1 
ATOM   5451  C  CG2 . THR H  1 59  ? 96.564  19.484   -35.362 1.00 13.71  ? 59  THR H CG2 1 
ATOM   5452  N  N   . LEU H  1 60  ? 98.234  21.977   -34.216 1.00 39.38  ? 60  LEU H N   1 
ATOM   5453  C  CA  . LEU H  1 60  ? 99.699  22.060   -34.216 1.00 36.24  ? 60  LEU H CA  1 
ATOM   5454  C  C   . LEU H  1 60  ? 100.256 22.289   -32.810 1.00 46.70  ? 60  LEU H C   1 
ATOM   5455  O  O   . LEU H  1 60  ? 101.075 21.492   -32.277 1.00 59.47  ? 60  LEU H O   1 
ATOM   5456  C  CB  . LEU H  1 60  ? 100.165 23.168   -35.150 1.00 41.58  ? 60  LEU H CB  1 
ATOM   5457  C  CG  . LEU H  1 60  ? 99.920  22.934   -36.639 1.00 43.63  ? 60  LEU H CG  1 
ATOM   5458  C  CD1 . LEU H  1 60  ? 100.745 23.910   -37.432 1.00 36.99  ? 60  LEU H CD1 1 
ATOM   5459  C  CD2 . LEU H  1 60  ? 100.297 21.520   -37.032 1.00 45.51  ? 60  LEU H CD2 1 
ATOM   5460  N  N   . VAL H  1 61  ? 99.809  23.383   -32.200 1.00 45.88  ? 61  VAL H N   1 
ATOM   5461  C  CA  . VAL H  1 61  ? 100.205 23.684   -30.827 1.00 54.30  ? 61  VAL H CA  1 
ATOM   5462  C  C   . VAL H  1 61  ? 100.087 22.451   -29.925 1.00 59.07  ? 61  VAL H C   1 
ATOM   5463  O  O   . VAL H  1 61  ? 100.998 22.159   -29.151 1.00 59.35  ? 61  VAL H O   1 
ATOM   5464  C  CB  . VAL H  1 61  ? 99.409  24.842   -30.248 1.00 43.52  ? 61  VAL H CB  1 
ATOM   5465  C  CG1 . VAL H  1 61  ? 99.787  25.043   -28.797 1.00 24.16  ? 61  VAL H CG1 1 
ATOM   5466  C  CG2 . VAL H  1 61  ? 99.686  26.093   -31.066 1.00 30.95  ? 61  VAL H CG2 1 
ATOM   5467  N  N   . HIS H  1 62  ? 98.983  21.719   -30.051 1.00 34.47  ? 62  HIS H N   1 
ATOM   5468  C  CA  . HIS H  1 62  ? 98.792  20.490   -29.300 1.00 45.33  ? 62  HIS H CA  1 
ATOM   5469  C  C   . HIS H  1 62  ? 99.873  19.447   -29.584 1.00 49.55  ? 62  HIS H C   1 
ATOM   5470  O  O   . HIS H  1 62  ? 100.380 18.770   -28.667 1.00 52.90  ? 62  HIS H O   1 
ATOM   5471  C  CB  . HIS H  1 62  ? 97.430  19.880   -29.589 1.00 41.40  ? 62  HIS H CB  1 
ATOM   5472  C  CG  . HIS H  1 62  ? 97.337  18.447   -29.188 1.00 47.26  ? 62  HIS H CG  1 
ATOM   5473  N  ND1 . HIS H  1 62  ? 97.661  17.415   -30.043 1.00 53.64  ? 62  HIS H ND1 1 
ATOM   5474  C  CD2 . HIS H  1 62  ? 96.998  17.871   -28.011 1.00 46.72  ? 62  HIS H CD2 1 
ATOM   5475  C  CE1 . HIS H  1 62  ? 97.502  16.262   -29.418 1.00 62.81  ? 62  HIS H CE1 1 
ATOM   5476  N  NE2 . HIS H  1 62  ? 97.110  16.510   -28.180 1.00 73.69  ? 62  HIS H NE2 1 
ATOM   5477  N  N   . LEU H  1 63  ? 100.214 19.292   -30.855 1.00 48.70  ? 63  LEU H N   1 
ATOM   5478  C  CA  . LEU H  1 63  ? 101.361 18.455   -31.198 1.00 48.48  ? 63  LEU H CA  1 
ATOM   5479  C  C   . LEU H  1 63  ? 102.616 18.828   -30.402 1.00 61.82  ? 63  LEU H C   1 
ATOM   5480  O  O   . LEU H  1 63  ? 103.411 17.956   -30.048 1.00 54.84  ? 63  LEU H O   1 
ATOM   5481  C  CB  . LEU H  1 63  ? 101.662 18.539   -32.685 1.00 33.18  ? 63  LEU H CB  1 
ATOM   5482  C  CG  . LEU H  1 63  ? 100.607 17.834   -33.525 1.00 40.54  ? 63  LEU H CG  1 
ATOM   5483  C  CD1 . LEU H  1 63  ? 100.810 18.095   -34.996 1.00 40.56  ? 63  LEU H CD1 1 
ATOM   5484  C  CD2 . LEU H  1 63  ? 100.674 16.356   -33.223 1.00 47.68  ? 63  LEU H CD2 1 
ATOM   5485  N  N   . LYS H  1 64  ? 102.814 20.115   -30.126 1.00 55.70  ? 64  LYS H N   1 
ATOM   5486  C  CA  . LYS H  1 64  ? 103.968 20.463   -29.300 1.00 39.08  ? 64  LYS H CA  1 
ATOM   5487  C  C   . LYS H  1 64  ? 103.734 20.455   -27.778 1.00 46.66  ? 64  LYS H C   1 
ATOM   5488  O  O   . LYS H  1 64  ? 104.682 20.348   -27.013 1.00 58.96  ? 64  LYS H O   1 
ATOM   5489  C  CB  . LYS H  1 64  ? 104.552 21.804   -29.726 1.00 48.12  ? 64  LYS H CB  1 
ATOM   5490  C  CG  . LYS H  1 64  ? 105.894 22.126   -29.041 1.00 65.07  ? 64  LYS H CG  1 
ATOM   5491  C  CD  . LYS H  1 64  ? 106.559 23.378   -29.609 1.00 64.57  ? 64  LYS H CD  1 
ATOM   5492  C  CE  . LYS H  1 64  ? 108.059 23.341   -29.377 1.00 71.34  ? 64  LYS H CE  1 
ATOM   5493  N  NZ  . LYS H  1 64  ? 108.710 24.413   -30.169 1.00 95.29  ? 64  LYS H NZ  1 
ATOM   5494  N  N   . PHE H  1 65  ? 102.491 20.595   -27.336 1.00 47.01  ? 65  PHE H N   1 
ATOM   5495  C  CA  . PHE H  1 65  ? 102.206 20.696   -25.912 1.00 51.27  ? 65  PHE H CA  1 
ATOM   5496  C  C   . PHE H  1 65  ? 100.994 19.846   -25.568 1.00 69.96  ? 65  PHE H C   1 
ATOM   5497  O  O   . PHE H  1 65  ? 99.978  20.342   -25.037 1.00 66.73  ? 65  PHE H O   1 
ATOM   5498  C  CB  . PHE H  1 65  ? 101.936 22.140   -25.510 1.00 54.90  ? 65  PHE H CB  1 
ATOM   5499  C  CG  . PHE H  1 65  ? 103.063 23.071   -25.791 1.00 64.75  ? 65  PHE H CG  1 
ATOM   5500  C  CD1 . PHE H  1 65  ? 103.212 23.638   -27.038 1.00 75.95  ? 65  PHE H CD1 1 
ATOM   5501  C  CD2 . PHE H  1 65  ? 103.960 23.398   -24.803 1.00 73.20  ? 65  PHE H CD2 1 
ATOM   5502  C  CE1 . PHE H  1 65  ? 104.249 24.498   -27.297 1.00 71.90  ? 65  PHE H CE1 1 
ATOM   5503  C  CE2 . PHE H  1 65  ? 104.988 24.261   -25.057 1.00 74.76  ? 65  PHE H CE2 1 
ATOM   5504  C  CZ  . PHE H  1 65  ? 105.133 24.809   -26.308 1.00 68.82  ? 65  PHE H CZ  1 
ATOM   5505  N  N   . PRO H  1 66  ? 101.101 18.549   -25.857 1.00 61.33  ? 66  PRO H N   1 
ATOM   5506  C  CA  . PRO H  1 66  ? 100.000 17.584   -25.737 1.00 51.89  ? 66  PRO H CA  1 
ATOM   5507  C  C   . PRO H  1 66  ? 99.442  17.460   -24.318 1.00 51.09  ? 66  PRO H C   1 
ATOM   5508  O  O   . PRO H  1 66  ? 98.457  16.773   -24.128 1.00 78.07  ? 66  PRO H O   1 
ATOM   5509  C  CB  . PRO H  1 66  ? 100.640 16.273   -26.173 1.00 44.28  ? 66  PRO H CB  1 
ATOM   5510  C  CG  . PRO H  1 66  ? 101.823 16.695   -26.980 1.00 40.17  ? 66  PRO H CG  1 
ATOM   5511  C  CD  . PRO H  1 66  ? 102.340 17.922   -26.321 1.00 20.45  ? 66  PRO H CD  1 
ATOM   5512  N  N   . THR H  1 67  ? 100.053 18.123   -23.350 1.00 48.67  ? 67  THR H N   1 
ATOM   5513  C  CA  . THR H  1 67  ? 99.557  18.091   -21.999 1.00 48.90  ? 67  THR H CA  1 
ATOM   5514  C  C   . THR H  1 67  ? 98.864  19.389   -21.622 1.00 68.48  ? 67  THR H C   1 
ATOM   5515  O  O   . THR H  1 67  ? 98.041  19.396   -20.705 1.00 91.27  ? 67  THR H O   1 
ATOM   5516  C  CB  . THR H  1 67  ? 100.685 17.805   -21.015 1.00 62.64  ? 67  THR H CB  1 
ATOM   5517  O  OG1 . THR H  1 67  ? 101.626 18.887   -21.014 1.00 77.87  ? 67  THR H OG1 1 
ATOM   5518  C  CG2 . THR H  1 67  ? 101.393 16.553   -21.436 1.00 47.59  ? 67  THR H CG2 1 
ATOM   5519  N  N   . LYS H  1 68  ? 99.169  20.478   -22.327 1.00 47.26  ? 68  LYS H N   1 
ATOM   5520  C  CA  . LYS H  1 68  ? 98.605  21.765   -21.962 1.00 57.43  ? 68  LYS H CA  1 
ATOM   5521  C  C   . LYS H  1 68  ? 97.509  22.185   -22.942 1.00 62.45  ? 68  LYS H C   1 
ATOM   5522  O  O   . LYS H  1 68  ? 96.605  22.967   -22.603 1.00 86.25  ? 68  LYS H O   1 
ATOM   5523  C  CB  . LYS H  1 68  ? 99.716  22.814   -21.868 1.00 57.59  ? 68  LYS H CB  1 
ATOM   5524  C  CG  . LYS H  1 68  ? 101.072 22.254   -21.465 1.00 65.70  ? 68  LYS H CG  1 
ATOM   5525  C  CD  . LYS H  1 68  ? 101.271 22.273   -19.967 1.00 93.45  ? 68  LYS H CD  1 
ATOM   5526  C  CE  . LYS H  1 68  ? 102.571 21.567   -19.574 1.00 96.65  ? 68  LYS H CE  1 
ATOM   5527  N  NZ  . LYS H  1 68  ? 103.766 22.129   -20.270 1.00 85.22  ? 68  LYS H NZ  1 
ATOM   5528  N  N   . VAL H  1 69  ? 97.591  21.639   -24.150 1.00 43.39  ? 69  VAL H N   1 
ATOM   5529  C  CA  . VAL H  1 69  ? 96.671  22.000   -25.233 1.00 60.35  ? 69  VAL H CA  1 
ATOM   5530  C  C   . VAL H  1 69  ? 96.003  20.766   -25.878 1.00 56.71  ? 69  VAL H C   1 
ATOM   5531  O  O   . VAL H  1 69  ? 96.674  19.801   -26.204 1.00 56.42  ? 69  VAL H O   1 
ATOM   5532  C  CB  . VAL H  1 69  ? 97.410  22.840   -26.313 1.00 47.05  ? 69  VAL H CB  1 
ATOM   5533  C  CG1 . VAL H  1 69  ? 96.620  22.899   -27.601 1.00 73.39  ? 69  VAL H CG1 1 
ATOM   5534  C  CG2 . VAL H  1 69  ? 97.669  24.236   -25.804 1.00 40.75  ? 69  VAL H CG2 1 
ATOM   5535  N  N   . GLY H  1 70  ? 94.691  20.791   -26.075 1.00 33.77  ? 70  GLY H N   1 
ATOM   5536  C  CA  . GLY H  1 70  ? 94.028  19.597   -26.553 1.00 54.10  ? 70  GLY H CA  1 
ATOM   5537  C  C   . GLY H  1 70  ? 93.786  19.573   -28.044 1.00 62.99  ? 70  GLY H C   1 
ATOM   5538  O  O   . GLY H  1 70  ? 93.893  20.607   -28.700 1.00 75.66  ? 70  GLY H O   1 
ATOM   5539  N  N   . LYS H  1 71  ? 93.439  18.401   -28.582 1.00 51.77  ? 71  LYS H N   1 
ATOM   5540  C  CA  . LYS H  1 71  ? 93.099  18.292   -30.002 1.00 48.30  ? 71  LYS H CA  1 
ATOM   5541  C  C   . LYS H  1 71  ? 91.852  19.102   -30.301 1.00 56.24  ? 71  LYS H C   1 
ATOM   5542  O  O   . LYS H  1 71  ? 91.124  19.517   -29.401 1.00 53.66  ? 71  LYS H O   1 
ATOM   5543  C  CB  . LYS H  1 71  ? 92.846  16.844   -30.405 1.00 42.27  ? 71  LYS H CB  1 
ATOM   5544  C  CG  . LYS H  1 71  ? 93.854  15.835   -29.896 1.00 53.40  ? 71  LYS H CG  1 
ATOM   5545  C  CD  . LYS H  1 71  ? 93.476  14.412   -30.332 1.00 76.74  ? 71  LYS H CD  1 
ATOM   5546  C  CE  . LYS H  1 71  ? 94.479  13.361   -29.842 1.00 105.53 ? 71  LYS H CE  1 
ATOM   5547  N  NZ  . LYS H  1 71  ? 95.827  13.525   -30.474 1.00 120.54 ? 71  LYS H NZ  1 
ATOM   5548  N  N   . ALA H  1 72  ? 91.581  19.324   -31.572 1.00 51.48  ? 72  ALA H N   1 
ATOM   5549  C  CA  . ALA H  1 72  ? 90.300  19.923   -31.918 1.00 53.76  ? 72  ALA H CA  1 
ATOM   5550  C  C   . ALA H  1 72  ? 89.212  18.902   -31.644 1.00 62.39  ? 72  ALA H C   1 
ATOM   5551  O  O   . ALA H  1 72  ? 89.475  17.698   -31.637 1.00 65.10  ? 72  ALA H O   1 
ATOM   5552  C  CB  . ALA H  1 72  ? 90.283  20.337   -33.373 1.00 52.37  ? 72  ALA H CB  1 
ATOM   5553  N  N   . CYS H  1 73  ? 87.987  19.361   -31.426 1.00 51.87  ? 73  CYS H N   1 
ATOM   5554  C  CA  . CYS H  1 73  ? 86.897  18.424   -31.164 1.00 53.00  ? 73  CYS H CA  1 
ATOM   5555  C  C   . CYS H  1 73  ? 86.069  18.082   -32.401 1.00 57.18  ? 73  CYS H C   1 
ATOM   5556  O  O   . CYS H  1 73  ? 85.893  18.913   -33.288 1.00 51.61  ? 73  CYS H O   1 
ATOM   5557  C  CB  . CYS H  1 73  ? 85.986  18.927   -30.056 1.00 26.72  ? 73  CYS H CB  1 
ATOM   5558  S  SG  . CYS H  1 73  ? 85.077  17.611   -29.220 1.00 107.36 ? 73  CYS H SG  1 
ATOM   5559  N  N   . CYS H  1 74  ? 85.575  16.845   -32.452 1.00 57.25  ? 74  CYS H N   1 
ATOM   5560  C  CA  . CYS H  1 74  ? 84.734  16.400   -33.553 1.00 44.53  ? 74  CYS H CA  1 
ATOM   5561  C  C   . CYS H  1 74  ? 83.291  16.717   -33.206 1.00 53.70  ? 74  CYS H C   1 
ATOM   5562  O  O   . CYS H  1 74  ? 82.697  16.068   -32.344 1.00 77.30  ? 74  CYS H O   1 
ATOM   5563  C  CB  . CYS H  1 74  ? 84.894  14.902   -33.797 1.00 29.08  ? 74  CYS H CB  1 
ATOM   5564  S  SG  . CYS H  1 74  ? 84.185  14.369   -35.349 1.00 83.51  ? 74  CYS H SG  1 
ATOM   5565  N  N   . VAL H  1 75  ? 82.725  17.716   -33.876 1.00 45.73  ? 75  VAL H N   1 
ATOM   5566  C  CA  . VAL H  1 75  ? 81.403  18.214   -33.521 1.00 48.22  ? 75  VAL H CA  1 
ATOM   5567  C  C   . VAL H  1 75  ? 80.482  18.223   -34.731 1.00 55.90  ? 75  VAL H C   1 
ATOM   5568  O  O   . VAL H  1 75  ? 80.943  18.179   -35.879 1.00 63.68  ? 75  VAL H O   1 
ATOM   5569  C  CB  . VAL H  1 75  ? 81.512  19.648   -32.967 1.00 35.33  ? 75  VAL H CB  1 
ATOM   5570  C  CG1 . VAL H  1 75  ? 82.177  19.660   -31.617 1.00 27.52  ? 75  VAL H CG1 1 
ATOM   5571  C  CG2 . VAL H  1 75  ? 82.323  20.504   -33.919 1.00 44.20  ? 75  VAL H CG2 1 
ATOM   5572  N  N   . PRO H  1 76  ? 79.170  18.280   -34.483 1.00 45.48  ? 76  PRO H N   1 
ATOM   5573  C  CA  . PRO H  1 76  ? 78.222  18.473   -35.579 1.00 56.31  ? 76  PRO H CA  1 
ATOM   5574  C  C   . PRO H  1 76  ? 78.433  19.874   -36.144 1.00 57.80  ? 76  PRO H C   1 
ATOM   5575  O  O   . PRO H  1 76  ? 78.437  20.829   -35.382 1.00 27.88  ? 76  PRO H O   1 
ATOM   5576  C  CB  . PRO H  1 76  ? 76.855  18.384   -34.887 1.00 41.62  ? 76  PRO H CB  1 
ATOM   5577  C  CG  . PRO H  1 76  ? 77.114  17.776   -33.578 1.00 57.61  ? 76  PRO H CG  1 
ATOM   5578  C  CD  . PRO H  1 76  ? 78.496  18.196   -33.187 1.00 42.74  ? 76  PRO H CD  1 
ATOM   5579  N  N   . THR H  1 77  ? 78.627  19.988   -37.453 1.00 61.37  ? 77  THR H N   1 
ATOM   5580  C  CA  . THR H  1 77  ? 78.881  21.273   -38.091 1.00 24.79  ? 77  THR H CA  1 
ATOM   5581  C  C   . THR H  1 77  ? 77.665  21.782   -38.868 1.00 45.52  ? 77  THR H C   1 
ATOM   5582  O  O   . THR H  1 77  ? 77.591  22.975   -39.168 1.00 46.24  ? 77  THR H O   1 
ATOM   5583  C  CB  . THR H  1 77  ? 80.088  21.190   -39.035 1.00 49.38  ? 77  THR H CB  1 
ATOM   5584  O  OG1 . THR H  1 77  ? 79.825  20.262   -40.099 1.00 62.52  ? 77  THR H OG1 1 
ATOM   5585  C  CG2 . THR H  1 77  ? 81.304  20.735   -38.270 1.00 49.66  ? 77  THR H CG2 1 
ATOM   5586  N  N   . LYS H  1 78  ? 76.724  20.885   -39.186 1.00 45.25  ? 78  LYS H N   1 
ATOM   5587  C  CA  . LYS H  1 78  ? 75.468  21.249   -39.848 1.00 51.45  ? 78  LYS H CA  1 
ATOM   5588  C  C   . LYS H  1 78  ? 74.325  20.433   -39.234 1.00 60.87  ? 78  LYS H C   1 
ATOM   5589  O  O   . LYS H  1 78  ? 74.503  19.256   -38.938 1.00 59.05  ? 78  LYS H O   1 
ATOM   5590  C  CB  . LYS H  1 78  ? 75.561  21.015   -41.369 1.00 43.76  ? 78  LYS H CB  1 
ATOM   5591  C  CG  . LYS H  1 78  ? 74.372  21.516   -42.184 1.00 57.20  ? 78  LYS H CG  1 
ATOM   5592  C  CD  . LYS H  1 78  ? 74.547  21.230   -43.667 1.00 53.68  ? 78  LYS H CD  1 
ATOM   5593  C  CE  . LYS H  1 78  ? 73.357  21.735   -44.464 1.00 83.17  ? 78  LYS H CE  1 
ATOM   5594  N  NZ  . LYS H  1 78  ? 73.485  21.410   -45.910 1.00 102.44 ? 78  LYS H NZ  1 
ATOM   5595  N  N   . LEU H  1 79  ? 73.152  21.040   -39.048 1.00 62.88  ? 79  LEU H N   1 
ATOM   5596  C  CA  . LEU H  1 79  ? 72.031  20.327   -38.413 1.00 54.26  ? 79  LEU H CA  1 
ATOM   5597  C  C   . LEU H  1 79  ? 70.673  20.300   -39.138 1.00 66.86  ? 79  LEU H C   1 
ATOM   5598  O  O   . LEU H  1 79  ? 70.029  21.335   -39.338 1.00 83.89  ? 79  LEU H O   1 
ATOM   5599  C  CB  . LEU H  1 79  ? 71.819  20.857   -37.009 1.00 39.25  ? 79  LEU H CB  1 
ATOM   5600  C  CG  . LEU H  1 79  ? 72.906  20.478   -36.017 1.00 40.19  ? 79  LEU H CG  1 
ATOM   5601  C  CD1 . LEU H  1 79  ? 72.663  21.154   -34.674 1.00 20.68  ? 79  LEU H CD1 1 
ATOM   5602  C  CD2 . LEU H  1 79  ? 72.945  18.974   -35.869 1.00 62.92  ? 79  LEU H CD2 1 
ATOM   5603  N  N   . SER H  1 80  ? 70.238  19.095   -39.492 1.00 61.86  ? 80  SER H N   1 
ATOM   5604  C  CA  . SER H  1 80  ? 68.914  18.880   -40.062 1.00 68.84  ? 80  SER H CA  1 
ATOM   5605  C  C   . SER H  1 80  ? 67.859  18.865   -38.961 1.00 65.52  ? 80  SER H C   1 
ATOM   5606  O  O   . SER H  1 80  ? 68.145  18.499   -37.818 1.00 52.75  ? 80  SER H O   1 
ATOM   5607  C  CB  . SER H  1 80  ? 68.861  17.560   -40.853 1.00 68.40  ? 80  SER H CB  1 
ATOM   5608  O  OG  . SER H  1 80  ? 69.466  17.678   -42.134 1.00 83.79  ? 80  SER H OG  1 
ATOM   5609  N  N   . PRO H  1 81  ? 66.630  19.271   -39.308 1.00 60.63  ? 81  PRO H N   1 
ATOM   5610  C  CA  . PRO H  1 81  ? 65.463  19.173   -38.433 1.00 64.27  ? 81  PRO H CA  1 
ATOM   5611  C  C   . PRO H  1 81  ? 64.760  17.847   -38.657 1.00 60.64  ? 81  PRO H C   1 
ATOM   5612  O  O   . PRO H  1 81  ? 65.036  17.165   -39.648 1.00 55.70  ? 81  PRO H O   1 
ATOM   5613  C  CB  . PRO H  1 81  ? 64.569  20.275   -38.968 1.00 59.69  ? 81  PRO H CB  1 
ATOM   5614  C  CG  . PRO H  1 81  ? 64.834  20.227   -40.450 1.00 41.13  ? 81  PRO H CG  1 
ATOM   5615  C  CD  . PRO H  1 81  ? 66.297  19.926   -40.589 1.00 34.83  ? 81  PRO H CD  1 
ATOM   5616  N  N   . ILE H  1 82  ? 63.855  17.484   -37.758 1.00 51.94  ? 82  ILE H N   1 
ATOM   5617  C  CA  . ILE H  1 82  ? 63.020  16.314   -37.972 1.00 55.46  ? 82  ILE H CA  1 
ATOM   5618  C  C   . ILE H  1 82  ? 61.613  16.717   -37.685 1.00 58.32  ? 82  ILE H C   1 
ATOM   5619  O  O   . ILE H  1 82  ? 61.378  17.773   -37.114 1.00 61.03  ? 82  ILE H O   1 
ATOM   5620  C  CB  . ILE H  1 82  ? 63.370  15.206   -37.014 1.00 42.21  ? 82  ILE H CB  1 
ATOM   5621  C  CG1 . ILE H  1 82  ? 63.145  15.675   -35.581 1.00 39.80  ? 82  ILE H CG1 1 
ATOM   5622  C  CG2 . ILE H  1 82  ? 64.811  14.823   -37.194 1.00 35.48  ? 82  ILE H CG2 1 
ATOM   5623  C  CD1 . ILE H  1 82  ? 63.451  14.635   -34.532 1.00 34.89  ? 82  ILE H CD1 1 
ATOM   5624  N  N   . SER H  1 83  ? 60.673  15.869   -38.066 1.00 53.14  ? 83  SER H N   1 
ATOM   5625  C  CA  . SER H  1 83  ? 59.274  16.162   -37.836 1.00 57.14  ? 83  SER H CA  1 
ATOM   5626  C  C   . SER H  1 83  ? 58.795  15.440   -36.601 1.00 54.01  ? 83  SER H C   1 
ATOM   5627  O  O   . SER H  1 83  ? 59.183  14.312   -36.358 1.00 78.84  ? 83  SER H O   1 
ATOM   5628  C  CB  . SER H  1 83  ? 58.447  15.757   -39.049 1.00 60.14  ? 83  SER H CB  1 
ATOM   5629  O  OG  . SER H  1 83  ? 58.649  16.685   -40.099 1.00 54.85  ? 83  SER H OG  1 
ATOM   5630  N  N   . VAL H  1 84  ? 57.974  16.100   -35.801 1.00 43.24  ? 84  VAL H N   1 
ATOM   5631  C  CA  . VAL H  1 84  ? 57.393  15.436   -34.652 1.00 52.30  ? 84  VAL H CA  1 
ATOM   5632  C  C   . VAL H  1 84  ? 55.937  15.826   -34.398 1.00 50.62  ? 84  VAL H C   1 
ATOM   5633  O  O   . VAL H  1 84  ? 55.526  16.985   -34.599 1.00 64.08  ? 84  VAL H O   1 
ATOM   5634  C  CB  . VAL H  1 84  ? 58.259  15.603   -33.380 1.00 44.37  ? 84  VAL H CB  1 
ATOM   5635  C  CG1 . VAL H  1 84  ? 59.705  15.530   -33.742 1.00 54.35  ? 84  VAL H CG1 1 
ATOM   5636  C  CG2 . VAL H  1 84  ? 57.971  16.911   -32.670 1.00 18.19  ? 84  VAL H CG2 1 
ATOM   5637  N  N   . LEU H  1 85  ? 55.174  14.827   -33.967 1.00 35.28  ? 85  LEU H N   1 
ATOM   5638  C  CA  . LEU H  1 85  ? 53.795  15.000   -33.588 1.00 57.00  ? 85  LEU H CA  1 
ATOM   5639  C  C   . LEU H  1 85  ? 53.738  14.976   -32.070 1.00 64.44  ? 85  LEU H C   1 
ATOM   5640  O  O   . LEU H  1 85  ? 54.127  13.978   -31.465 1.00 54.73  ? 85  LEU H O   1 
ATOM   5641  C  CB  . LEU H  1 85  ? 52.991  13.844   -34.161 1.00 45.96  ? 85  LEU H CB  1 
ATOM   5642  C  CG  . LEU H  1 85  ? 51.490  13.919   -34.014 1.00 38.33  ? 85  LEU H CG  1 
ATOM   5643  C  CD1 . LEU H  1 85  ? 51.015  15.247   -34.569 1.00 41.41  ? 85  LEU H CD1 1 
ATOM   5644  C  CD2 . LEU H  1 85  ? 50.891  12.749   -34.731 1.00 16.29  ? 85  LEU H CD2 1 
ATOM   5645  N  N   . TYR H  1 86  ? 53.264  16.064   -31.459 1.00 43.02  ? 86  TYR H N   1 
ATOM   5646  C  CA  . TYR H  1 86  ? 53.338  16.197   -30.013 1.00 51.95  ? 86  TYR H CA  1 
ATOM   5647  C  C   . TYR H  1 86  ? 52.092  16.772   -29.388 1.00 57.31  ? 86  TYR H C   1 
ATOM   5648  O  O   . TYR H  1 86  ? 51.301  17.423   -30.054 1.00 81.45  ? 86  TYR H O   1 
ATOM   5649  C  CB  . TYR H  1 86  ? 54.512  17.082   -29.641 1.00 72.17  ? 86  TYR H CB  1 
ATOM   5650  C  CG  . TYR H  1 86  ? 54.286  18.524   -29.956 1.00 56.44  ? 86  TYR H CG  1 
ATOM   5651  C  CD1 . TYR H  1 86  ? 53.801  19.387   -28.993 1.00 69.62  ? 86  TYR H CD1 1 
ATOM   5652  C  CD2 . TYR H  1 86  ? 54.555  19.029   -31.217 1.00 43.36  ? 86  TYR H CD2 1 
ATOM   5653  C  CE1 . TYR H  1 86  ? 53.596  20.725   -29.272 1.00 81.24  ? 86  TYR H CE1 1 
ATOM   5654  C  CE2 . TYR H  1 86  ? 54.354  20.374   -31.509 1.00 39.80  ? 86  TYR H CE2 1 
ATOM   5655  C  CZ  . TYR H  1 86  ? 53.874  21.211   -30.530 1.00 58.97  ? 86  TYR H CZ  1 
ATOM   5656  O  OH  . TYR H  1 86  ? 53.658  22.535   -30.799 1.00 44.17  ? 86  TYR H OH  1 
ATOM   5657  N  N   . LYS H  1 87  ? 51.926  16.548   -28.091 1.00 55.84  ? 87  LYS H N   1 
ATOM   5658  C  CA  . LYS H  1 87  ? 50.729  17.009   -27.397 1.00 58.69  ? 87  LYS H CA  1 
ATOM   5659  C  C   . LYS H  1 87  ? 50.818  18.506   -27.076 1.00 78.16  ? 87  LYS H C   1 
ATOM   5660  O  O   . LYS H  1 87  ? 51.769  18.961   -26.456 1.00 73.76  ? 87  LYS H O   1 
ATOM   5661  C  CB  . LYS H  1 87  ? 50.441  16.183   -26.124 1.00 37.37  ? 87  LYS H CB  1 
ATOM   5662  C  CG  . LYS H  1 87  ? 49.830  14.794   -26.354 1.00 44.25  ? 87  LYS H CG  1 
ATOM   5663  C  CD  . LYS H  1 87  ? 49.791  13.948   -25.054 1.00 94.19  ? 87  LYS H CD  1 
ATOM   5664  C  CE  . LYS H  1 87  ? 49.458  12.462   -25.328 1.00 105.13 ? 87  LYS H CE  1 
ATOM   5665  N  NZ  . LYS H  1 87  ? 50.161  11.471   -24.435 1.00 95.54  ? 87  LYS H NZ  1 
ATOM   5666  N  N   . ASP H  1 88  ? 49.813  19.250   -27.528 1.00 95.62  ? 88  ASP H N   1 
ATOM   5667  C  CA  . ASP H  1 88  ? 49.596  20.656   -27.198 1.00 84.19  ? 88  ASP H CA  1 
ATOM   5668  C  C   . ASP H  1 88  ? 49.743  20.933   -25.701 1.00 90.02  ? 88  ASP H C   1 
ATOM   5669  O  O   . ASP H  1 88  ? 49.947  20.021   -24.910 1.00 82.09  ? 88  ASP H O   1 
ATOM   5670  C  CB  . ASP H  1 88  ? 48.173  21.021   -27.622 1.00 95.48  ? 88  ASP H CB  1 
ATOM   5671  C  CG  . ASP H  1 88  ? 48.036  22.447   -28.064 1.00 125.91 ? 88  ASP H CG  1 
ATOM   5672  O  OD1 . ASP H  1 88  ? 48.718  23.321   -27.488 1.00 148.51 ? 88  ASP H OD1 1 
ATOM   5673  O  OD2 . ASP H  1 88  ? 47.236  22.690   -28.994 1.00 125.05 ? 88  ASP H OD2 1 
ATOM   5674  N  N   . ASP H  1 89  ? 49.635  22.201   -25.311 1.00 110.05 ? 89  ASP H N   1 
ATOM   5675  C  CA  . ASP H  1 89  ? 49.572  22.557   -23.894 1.00 106.57 ? 89  ASP H CA  1 
ATOM   5676  C  C   . ASP H  1 89  ? 48.222  22.124   -23.356 1.00 92.06  ? 89  ASP H C   1 
ATOM   5677  O  O   . ASP H  1 89  ? 47.996  22.083   -22.146 1.00 92.90  ? 89  ASP H O   1 
ATOM   5678  C  CB  . ASP H  1 89  ? 49.754  24.059   -23.676 1.00 109.32 ? 89  ASP H CB  1 
ATOM   5679  C  CG  . ASP H  1 89  ? 51.139  24.532   -24.020 1.00 121.21 ? 89  ASP H CG  1 
ATOM   5680  O  OD1 . ASP H  1 89  ? 51.311  25.057   -25.133 1.00 120.65 ? 89  ASP H OD1 1 
ATOM   5681  O  OD2 . ASP H  1 89  ? 52.051  24.377   -23.183 1.00 125.36 ? 89  ASP H OD2 1 
ATOM   5682  N  N   . MET H  1 90  ? 47.322  21.808   -24.276 1.00 88.35  ? 90  MET H N   1 
ATOM   5683  C  CA  . MET H  1 90  ? 46.025  21.265   -23.913 1.00 97.67  ? 90  MET H CA  1 
ATOM   5684  C  C   . MET H  1 90  ? 45.766  19.921   -24.559 1.00 90.52  ? 90  MET H C   1 
ATOM   5685  O  O   . MET H  1 90  ? 44.630  19.594   -24.853 1.00 90.32  ? 90  MET H O   1 
ATOM   5686  C  CB  . MET H  1 90  ? 44.916  22.222   -24.295 1.00 103.40 ? 90  MET H CB  1 
ATOM   5687  C  CG  . MET H  1 90  ? 44.791  23.385   -23.363 1.00 111.29 ? 90  MET H CG  1 
ATOM   5688  S  SD  . MET H  1 90  ? 43.888  24.684   -24.218 1.00 92.91  ? 90  MET H SD  1 
ATOM   5689  C  CE  . MET H  1 90  ? 44.896  24.843   -25.673 1.00 121.32 ? 90  MET H CE  1 
ATOM   5690  N  N   . GLY H  1 91  ? 46.828  19.154   -24.782 1.00 81.71  ? 91  GLY H N   1 
ATOM   5691  C  CA  . GLY H  1 91  ? 46.717  17.763   -25.179 1.00 81.97  ? 91  GLY H CA  1 
ATOM   5692  C  C   . GLY H  1 91  ? 46.160  17.510   -26.566 1.00 73.40  ? 91  GLY H C   1 
ATOM   5693  O  O   . GLY H  1 91  ? 45.523  16.486   -26.829 1.00 78.66  ? 91  GLY H O   1 
ATOM   5694  N  N   . VAL H  1 92  ? 46.403  18.445   -27.461 1.00 64.28  ? 92  VAL H N   1 
ATOM   5695  C  CA  . VAL H  1 92  ? 45.985  18.303   -28.836 1.00 53.89  ? 92  VAL H CA  1 
ATOM   5696  C  C   . VAL H  1 92  ? 47.160  17.902   -29.704 1.00 71.30  ? 92  VAL H C   1 
ATOM   5697  O  O   . VAL H  1 92  ? 48.187  18.586   -29.744 1.00 92.18  ? 92  VAL H O   1 
ATOM   5698  C  CB  . VAL H  1 92  ? 45.489  19.623   -29.358 1.00 66.28  ? 92  VAL H CB  1 
ATOM   5699  C  CG1 . VAL H  1 92  ? 44.639  19.398   -30.575 1.00 66.28  ? 92  VAL H CG1 1 
ATOM   5700  C  CG2 . VAL H  1 92  ? 44.741  20.357   -28.256 1.00 77.16  ? 92  VAL H CG2 1 
ATOM   5701  N  N   . PRO H  1 93  ? 47.019  16.787   -30.413 1.00 62.74  ? 93  PRO H N   1 
ATOM   5702  C  CA  . PRO H  1 93  ? 48.076  16.377   -31.330 1.00 63.97  ? 93  PRO H CA  1 
ATOM   5703  C  C   . PRO H  1 93  ? 48.343  17.461   -32.340 1.00 59.18  ? 93  PRO H C   1 
ATOM   5704  O  O   . PRO H  1 93  ? 47.475  17.720   -33.170 1.00 65.45  ? 93  PRO H O   1 
ATOM   5705  C  CB  . PRO H  1 93  ? 47.459  15.180   -32.036 1.00 54.48  ? 93  PRO H CB  1 
ATOM   5706  C  CG  . PRO H  1 93  ? 46.521  14.619   -31.055 1.00 52.07  ? 93  PRO H CG  1 
ATOM   5707  C  CD  . PRO H  1 93  ? 45.938  15.795   -30.341 1.00 67.05  ? 93  PRO H CD  1 
ATOM   5708  N  N   . THR H  1 94  ? 49.510  18.093   -32.262 1.00 48.17  ? 94  THR H N   1 
ATOM   5709  C  CA  . THR H  1 94  ? 49.905  19.079   -33.263 1.00 66.67  ? 94  THR H CA  1 
ATOM   5710  C  C   . THR H  1 94  ? 51.289  18.743   -33.833 1.00 63.96  ? 94  THR H C   1 
ATOM   5711  O  O   . THR H  1 94  ? 51.980  17.845   -33.340 1.00 53.03  ? 94  THR H O   1 
ATOM   5712  C  CB  . THR H  1 94  ? 49.888  20.508   -32.699 1.00 67.93  ? 94  THR H CB  1 
ATOM   5713  O  OG1 . THR H  1 94  ? 50.973  20.669   -31.797 1.00 35.19  ? 94  THR H OG1 1 
ATOM   5714  C  CG2 . THR H  1 94  ? 48.589  20.790   -31.948 1.00 85.50  ? 94  THR H CG2 1 
ATOM   5715  N  N   . LEU H  1 95  ? 51.707  19.455   -34.870 1.00 45.62  ? 95  LEU H N   1 
ATOM   5716  C  CA  . LEU H  1 95  ? 52.892  19.021   -35.592 1.00 47.30  ? 95  LEU H CA  1 
ATOM   5717  C  C   . LEU H  1 95  ? 53.957  20.080   -35.799 1.00 57.55  ? 95  LEU H C   1 
ATOM   5718  O  O   . LEU H  1 95  ? 53.711  21.055   -36.498 1.00 74.54  ? 95  LEU H O   1 
ATOM   5719  C  CB  . LEU H  1 95  ? 52.471  18.502   -36.962 1.00 47.05  ? 95  LEU H CB  1 
ATOM   5720  C  CG  . LEU H  1 95  ? 53.580  18.357   -37.999 1.00 47.02  ? 95  LEU H CG  1 
ATOM   5721  C  CD1 . LEU H  1 95  ? 54.537  17.287   -37.538 1.00 89.00  ? 95  LEU H CD1 1 
ATOM   5722  C  CD2 . LEU H  1 95  ? 53.020  18.019   -39.356 1.00 36.02  ? 95  LEU H CD2 1 
ATOM   5723  N  N   . LYS H  1 96  ? 55.154  19.893   -35.239 1.00 47.05  ? 96  LYS H N   1 
ATOM   5724  C  CA  . LYS H  1 96  ? 56.272  20.673   -35.789 1.00 56.24  ? 96  LYS H CA  1 
ATOM   5725  C  C   . LYS H  1 96  ? 56.948  19.891   -36.899 1.00 62.00  ? 96  LYS H C   1 
ATOM   5726  O  O   . LYS H  1 96  ? 57.539  18.850   -36.666 1.00 65.00  ? 96  LYS H O   1 
ATOM   5727  C  CB  . LYS H  1 96  ? 57.287  21.192   -34.759 1.00 39.94  ? 96  LYS H CB  1 
ATOM   5728  C  CG  . LYS H  1 96  ? 58.037  22.497   -35.245 1.00 27.92  ? 96  LYS H CG  1 
ATOM   5729  C  CD  . LYS H  1 96  ? 57.102  23.480   -36.025 1.00 175.10 ? 96  LYS H CD  1 
ATOM   5730  C  CE  . LYS H  1 96  ? 57.476  23.713   -37.523 1.00 76.68  ? 96  LYS H CE  1 
ATOM   5731  N  NZ  . LYS H  1 96  ? 56.284  23.865   -38.480 1.00 29.29  ? 96  LYS H NZ  1 
ATOM   5732  N  N   . TYR H  1 97  ? 56.812  20.396   -38.116 1.00 47.50  ? 97  TYR H N   1 
ATOM   5733  C  CA  . TYR H  1 97  ? 57.359  19.748   -39.289 1.00 40.55  ? 97  TYR H CA  1 
ATOM   5734  C  C   . TYR H  1 97  ? 58.832  20.056   -39.389 1.00 49.28  ? 97  TYR H C   1 
ATOM   5735  O  O   . TYR H  1 97  ? 59.613  19.185   -39.708 1.00 64.66  ? 97  TYR H O   1 
ATOM   5736  C  CB  . TYR H  1 97  ? 56.639  20.241   -40.535 1.00 42.67  ? 97  TYR H CB  1 
ATOM   5737  C  CG  . TYR H  1 97  ? 57.195  19.724   -41.834 1.00 39.48  ? 97  TYR H CG  1 
ATOM   5738  C  CD1 . TYR H  1 97  ? 57.162  18.383   -42.137 1.00 52.12  ? 97  TYR H CD1 1 
ATOM   5739  C  CD2 . TYR H  1 97  ? 57.703  20.589   -42.778 1.00 29.58  ? 97  TYR H CD2 1 
ATOM   5740  C  CE1 . TYR H  1 97  ? 57.647  17.923   -43.336 1.00 58.10  ? 97  TYR H CE1 1 
ATOM   5741  C  CE2 . TYR H  1 97  ? 58.193  20.139   -43.969 1.00 50.44  ? 97  TYR H CE2 1 
ATOM   5742  C  CZ  . TYR H  1 97  ? 58.169  18.814   -44.246 1.00 64.37  ? 97  TYR H CZ  1 
ATOM   5743  O  OH  . TYR H  1 97  ? 58.672  18.393   -45.450 1.00 88.02  ? 97  TYR H OH  1 
ATOM   5744  N  N   . HIS H  1 98  ? 59.206  21.305   -39.121 1.00 79.93  ? 98  HIS H N   1 
ATOM   5745  C  CA  . HIS H  1 98  ? 60.608  21.751   -39.133 1.00 75.10  ? 98  HIS H CA  1 
ATOM   5746  C  C   . HIS H  1 98  ? 61.105  22.000   -37.699 1.00 76.21  ? 98  HIS H C   1 
ATOM   5747  O  O   . HIS H  1 98  ? 61.298  23.146   -37.279 1.00 103.02 ? 98  HIS H O   1 
ATOM   5748  C  CB  . HIS H  1 98  ? 60.776  23.025   -39.986 1.00 72.76  ? 98  HIS H CB  1 
ATOM   5749  C  CG  . HIS H  1 98  ? 61.365  22.778   -41.344 1.00 108.03 ? 98  HIS H CG  1 
ATOM   5750  N  ND1 . HIS H  1 98  ? 62.577  23.305   -41.738 1.00 135.03 ? 98  HIS H ND1 1 
ATOM   5751  C  CD2 . HIS H  1 98  ? 60.912  22.061   -42.398 1.00 117.20 ? 98  HIS H CD2 1 
ATOM   5752  C  CE1 . HIS H  1 98  ? 62.845  22.924   -42.974 1.00 123.98 ? 98  HIS H CE1 1 
ATOM   5753  N  NE2 . HIS H  1 98  ? 61.851  22.167   -43.398 1.00 115.63 ? 98  HIS H NE2 1 
ATOM   5754  N  N   . TYR H  1 99  ? 61.289  20.918   -36.947 1.00 44.74  ? 99  TYR H N   1 
ATOM   5755  C  CA  . TYR H  1 99  ? 61.787  20.985   -35.574 1.00 40.22  ? 99  TYR H CA  1 
ATOM   5756  C  C   . TYR H  1 99  ? 63.291  21.038   -35.637 1.00 62.96  ? 99  TYR H C   1 
ATOM   5757  O  O   . TYR H  1 99  ? 63.960  20.010   -35.824 1.00 62.22  ? 99  TYR H O   1 
ATOM   5758  C  CB  . TYR H  1 99  ? 61.384  19.743   -34.787 1.00 47.00  ? 99  TYR H CB  1 
ATOM   5759  C  CG  . TYR H  1 99  ? 61.608  19.860   -33.299 1.00 45.17  ? 99  TYR H CG  1 
ATOM   5760  C  CD1 . TYR H  1 99  ? 61.344  18.805   -32.458 1.00 43.89  ? 99  TYR H CD1 1 
ATOM   5761  C  CD2 . TYR H  1 99  ? 62.072  21.033   -32.738 1.00 66.71  ? 99  TYR H CD2 1 
ATOM   5762  C  CE1 . TYR H  1 99  ? 61.538  18.911   -31.109 1.00 38.24  ? 99  TYR H CE1 1 
ATOM   5763  C  CE2 . TYR H  1 99  ? 62.272  21.142   -31.378 1.00 67.27  ? 99  TYR H CE2 1 
ATOM   5764  C  CZ  . TYR H  1 99  ? 62.000  20.082   -30.571 1.00 48.97  ? 99  TYR H CZ  1 
ATOM   5765  O  OH  . TYR H  1 99  ? 62.204  20.194   -29.218 1.00 59.63  ? 99  TYR H OH  1 
ATOM   5766  N  N   . GLU H  1 100 ? 63.833  22.236   -35.466 1.00 69.62  ? 100 GLU H N   1 
ATOM   5767  C  CA  . GLU H  1 100 ? 65.205  22.488   -35.898 1.00 51.63  ? 100 GLU H CA  1 
ATOM   5768  C  C   . GLU H  1 100 ? 66.265  21.897   -35.017 1.00 48.53  ? 100 GLU H C   1 
ATOM   5769  O  O   . GLU H  1 100 ? 66.100  21.809   -33.807 1.00 51.21  ? 100 GLU H O   1 
ATOM   5770  C  CB  . GLU H  1 100 ? 65.451  23.973   -36.102 1.00 40.90  ? 100 GLU H CB  1 
ATOM   5771  C  CG  . GLU H  1 100 ? 64.752  24.519   -37.338 1.00 78.98  ? 100 GLU H CG  1 
ATOM   5772  C  CD  . GLU H  1 100 ? 65.293  23.931   -38.625 1.00 88.91  ? 100 GLU H CD  1 
ATOM   5773  O  OE1 . GLU H  1 100 ? 66.298  23.185   -38.565 1.00 99.42  ? 100 GLU H OE1 1 
ATOM   5774  O  OE2 . GLU H  1 100 ? 64.714  24.226   -39.694 1.00 54.61  ? 100 GLU H OE2 1 
ATOM   5775  N  N   . GLY H  1 101 ? 67.341  21.468   -35.670 1.00 62.23  ? 101 GLY H N   1 
ATOM   5776  C  CA  . GLY H  1 101 ? 68.575  21.071   -35.012 1.00 57.52  ? 101 GLY H CA  1 
ATOM   5777  C  C   . GLY H  1 101 ? 68.550  19.821   -34.148 1.00 54.63  ? 101 GLY H C   1 
ATOM   5778  O  O   . GLY H  1 101 ? 69.040  19.829   -33.017 1.00 53.71  ? 101 GLY H O   1 
ATOM   5779  N  N   . MET H  1 102 ? 68.008  18.732   -34.680 1.00 49.50  ? 102 MET H N   1 
ATOM   5780  C  CA  . MET H  1 102 ? 67.839  17.527   -33.880 1.00 49.37  ? 102 MET H CA  1 
ATOM   5781  C  C   . MET H  1 102 ? 68.648  16.371   -34.421 1.00 48.58  ? 102 MET H C   1 
ATOM   5782  O  O   . MET H  1 102 ? 68.797  15.350   -33.765 1.00 57.70  ? 102 MET H O   1 
ATOM   5783  C  CB  . MET H  1 102 ? 66.365  17.128   -33.840 1.00 51.30  ? 102 MET H CB  1 
ATOM   5784  C  CG  . MET H  1 102 ? 65.483  18.082   -33.090 1.00 47.99  ? 102 MET H CG  1 
ATOM   5785  S  SD  . MET H  1 102 ? 65.528  17.680   -31.344 1.00 61.23  ? 102 MET H SD  1 
ATOM   5786  C  CE  . MET H  1 102 ? 64.879  16.036   -31.336 1.00 45.84  ? 102 MET H CE  1 
ATOM   5787  N  N   . SER H  1 103 ? 69.155  16.523   -35.632 1.00 43.38  ? 103 SER H N   1 
ATOM   5788  C  CA  . SER H  1 103 ? 69.867  15.429   -36.274 1.00 53.33  ? 103 SER H CA  1 
ATOM   5789  C  C   . SER H  1 103 ? 71.116  15.954   -36.934 1.00 75.32  ? 103 SER H C   1 
ATOM   5790  O  O   . SER H  1 103 ? 71.133  17.078   -37.444 1.00 87.96  ? 103 SER H O   1 
ATOM   5791  C  CB  . SER H  1 103 ? 68.989  14.783   -37.329 1.00 53.17  ? 103 SER H CB  1 
ATOM   5792  O  OG  . SER H  1 103 ? 69.672  13.723   -37.955 1.00 74.25  ? 103 SER H OG  1 
ATOM   5793  N  N   . VAL H  1 104 ? 72.168  15.154   -36.935 1.00 62.64  ? 104 VAL H N   1 
ATOM   5794  C  CA  . VAL H  1 104 ? 73.412  15.637   -37.497 1.00 37.47  ? 104 VAL H CA  1 
ATOM   5795  C  C   . VAL H  1 104 ? 73.427  15.527   -39.007 1.00 47.43  ? 104 VAL H C   1 
ATOM   5796  O  O   . VAL H  1 104 ? 73.100  14.487   -39.576 1.00 52.15  ? 104 VAL H O   1 
ATOM   5797  C  CB  . VAL H  1 104 ? 74.599  14.880   -36.948 1.00 45.98  ? 104 VAL H CB  1 
ATOM   5798  C  CG1 . VAL H  1 104 ? 75.874  15.389   -37.580 1.00 52.55  ? 104 VAL H CG1 1 
ATOM   5799  C  CG2 . VAL H  1 104 ? 74.655  15.038   -35.454 1.00 45.78  ? 104 VAL H CG2 1 
ATOM   5800  N  N   . ALA H  1 105 ? 73.814  16.616   -39.653 1.00 47.61  ? 105 ALA H N   1 
ATOM   5801  C  CA  . ALA H  1 105 ? 73.922  16.627   -41.095 1.00 49.16  ? 105 ALA H CA  1 
ATOM   5802  C  C   . ALA H  1 105 ? 75.352  16.325   -41.498 1.00 49.69  ? 105 ALA H C   1 
ATOM   5803  O  O   . ALA H  1 105 ? 75.622  15.337   -42.181 1.00 56.94  ? 105 ALA H O   1 
ATOM   5804  C  CB  . ALA H  1 105 ? 73.493  17.961   -41.633 1.00 26.88  ? 105 ALA H CB  1 
ATOM   5805  N  N   . GLU H  1 106 ? 76.262  17.186   -41.058 1.00 36.63  ? 106 GLU H N   1 
ATOM   5806  C  CA  . GLU H  1 106 ? 77.670  17.081   -41.397 1.00 55.86  ? 106 GLU H CA  1 
ATOM   5807  C  C   . GLU H  1 106 ? 78.517  17.148   -40.117 1.00 64.97  ? 106 GLU H C   1 
ATOM   5808  O  O   . GLU H  1 106 ? 78.133  17.794   -39.146 1.00 42.07  ? 106 GLU H O   1 
ATOM   5809  C  CB  . GLU H  1 106 ? 78.052  18.186   -42.394 1.00 55.27  ? 106 GLU H CB  1 
ATOM   5810  C  CG  . GLU H  1 106 ? 77.380  18.033   -43.753 1.00 64.26  ? 106 GLU H CG  1 
ATOM   5811  C  CD  . GLU H  1 106 ? 77.647  19.194   -44.671 1.00 92.96  ? 106 GLU H CD  1 
ATOM   5812  O  OE1 . GLU H  1 106 ? 77.119  19.183   -45.804 1.00 111.14 ? 106 GLU H OE1 1 
ATOM   5813  O  OE2 . GLU H  1 106 ? 78.384  20.115   -44.258 1.00 91.23  ? 106 GLU H OE2 1 
ATOM   5814  N  N   . CYS H  1 107 ? 79.649  16.446   -40.104 1.00 59.12  ? 107 CYS H N   1 
ATOM   5815  C  CA  . CYS H  1 107 ? 80.540  16.467   -38.949 1.00 38.12  ? 107 CYS H CA  1 
ATOM   5816  C  C   . CYS H  1 107 ? 81.742  17.351   -39.231 1.00 47.32  ? 107 CYS H C   1 
ATOM   5817  O  O   . CYS H  1 107 ? 81.939  17.775   -40.373 1.00 82.79  ? 107 CYS H O   1 
ATOM   5818  C  CB  . CYS H  1 107 ? 80.968  15.043   -38.594 1.00 37.66  ? 107 CYS H CB  1 
ATOM   5819  S  SG  . CYS H  1 107 ? 79.807  14.225   -37.433 1.00 90.88  ? 107 CYS H SG  1 
ATOM   5820  N  N   . GLY H  1 108 ? 82.549  17.648   -38.217 1.00 44.26  ? 108 GLY H N   1 
ATOM   5821  C  CA  . GLY H  1 108 ? 83.746  18.438   -38.473 1.00 66.32  ? 108 GLY H CA  1 
ATOM   5822  C  C   . GLY H  1 108 ? 84.657  18.709   -37.298 1.00 53.81  ? 108 GLY H C   1 
ATOM   5823  O  O   . GLY H  1 108 ? 84.380  18.293   -36.179 1.00 56.81  ? 108 GLY H O   1 
ATOM   5824  N  N   . CYS H  1 109 ? 85.752  19.414   -37.560 1.00 29.23  ? 109 CYS H N   1 
ATOM   5825  C  CA  . CYS H  1 109 ? 86.748  19.683   -36.524 1.00 43.31  ? 109 CYS H CA  1 
ATOM   5826  C  C   . CYS H  1 109 ? 86.829  21.165   -36.231 1.00 43.40  ? 109 CYS H C   1 
ATOM   5827  O  O   . CYS H  1 109 ? 86.969  21.979   -37.146 1.00 54.58  ? 109 CYS H O   1 
ATOM   5828  C  CB  . CYS H  1 109 ? 88.142  19.147   -36.907 1.00 37.16  ? 109 CYS H CB  1 
ATOM   5829  S  SG  . CYS H  1 109 ? 88.354  17.377   -36.603 1.00 76.28  ? 109 CYS H SG  1 
ATOM   5830  N  N   . ARG H  1 110 ? 86.751  21.511   -34.951 1.00 34.97  ? 110 ARG H N   1 
ATOM   5831  C  CA  . ARG H  1 110 ? 86.711  22.908   -34.562 1.00 58.90  ? 110 ARG H CA  1 
ATOM   5832  C  C   . ARG H  1 110 ? 87.525  23.205   -33.286 1.00 71.89  ? 110 ARG H C   1 
ATOM   5833  O  O   . ARG H  1 110 ? 88.119  24.285   -33.137 1.00 89.15  ? 110 ARG H O   1 
ATOM   5834  C  CB  . ARG H  1 110 ? 85.249  23.345   -34.420 1.00 50.19  ? 110 ARG H CB  1 
ATOM   5835  C  CG  . ARG H  1 110 ? 84.376  23.031   -35.643 1.00 24.18  ? 110 ARG H CG  1 
ATOM   5836  C  CD  . ARG H  1 110 ? 84.679  23.990   -36.798 1.00 40.59  ? 110 ARG H CD  1 
ATOM   5837  N  NE  . ARG H  1 110 ? 83.766  23.884   -37.942 1.00 29.28  ? 110 ARG H NE  1 
ATOM   5838  C  CZ  . ARG H  1 110 ? 83.996  23.129   -39.016 1.00 52.84  ? 110 ARG H CZ  1 
ATOM   5839  N  NH1 . ARG H  1 110 ? 85.100  22.390   -39.091 1.00 69.37  ? 110 ARG H NH1 1 
ATOM   5840  N  NH2 . ARG H  1 110 ? 83.122  23.106   -40.014 1.00 60.80  ? 110 ARG H NH2 1 
ATOM   5841  O  OXT . ARG H  1 110 ? 87.636  22.378   -32.376 1.00 47.69  ? 110 ARG H OXT 1 
ATOM   5842  N  N   . PRO I  2 11  ? 58.365  40.124   -20.947 1.00 135.24 ? 30  PRO I N   1 
ATOM   5843  C  CA  . PRO I  2 11  ? 57.510  39.844   -19.786 1.00 136.49 ? 30  PRO I CA  1 
ATOM   5844  C  C   . PRO I  2 11  ? 58.261  39.034   -18.729 1.00 137.43 ? 30  PRO I C   1 
ATOM   5845  O  O   . PRO I  2 11  ? 57.725  38.048   -18.226 1.00 138.13 ? 30  PRO I O   1 
ATOM   5846  C  CB  . PRO I  2 11  ? 56.368  38.998   -20.379 1.00 124.54 ? 30  PRO I CB  1 
ATOM   5847  C  CG  . PRO I  2 11  ? 56.462  39.163   -21.870 1.00 118.19 ? 30  PRO I CG  1 
ATOM   5848  C  CD  . PRO I  2 11  ? 57.905  39.425   -22.160 1.00 128.11 ? 30  PRO I CD  1 
ATOM   5849  N  N   . LEU I  2 12  ? 59.478  39.453   -18.396 1.00 135.39 ? 31  LEU I N   1 
ATOM   5850  C  CA  . LEU I  2 12  ? 60.367  38.681   -17.517 1.00 129.28 ? 31  LEU I CA  1 
ATOM   5851  C  C   . LEU I  2 12  ? 59.878  38.492   -16.072 1.00 123.77 ? 31  LEU I C   1 
ATOM   5852  O  O   . LEU I  2 12  ? 58.929  39.135   -15.628 1.00 133.54 ? 31  LEU I O   1 
ATOM   5853  C  CB  . LEU I  2 12  ? 61.774  39.293   -17.501 1.00 128.22 ? 31  LEU I CB  1 
ATOM   5854  C  CG  . LEU I  2 12  ? 62.624  39.191   -18.767 1.00 127.40 ? 31  LEU I CG  1 
ATOM   5855  C  CD1 . LEU I  2 12  ? 61.956  39.876   -19.957 1.00 139.85 ? 31  LEU I CD1 1 
ATOM   5856  C  CD2 . LEU I  2 12  ? 63.986  39.788   -18.502 1.00 119.14 ? 31  LEU I CD2 1 
ATOM   5857  N  N   . VAL I  2 13  ? 60.559  37.607   -15.349 1.00 113.30 ? 32  VAL I N   1 
ATOM   5858  C  CA  . VAL I  2 13  ? 60.223  37.263   -13.971 1.00 110.72 ? 32  VAL I CA  1 
ATOM   5859  C  C   . VAL I  2 13  ? 61.499  37.004   -13.171 1.00 115.80 ? 32  VAL I C   1 
ATOM   5860  O  O   . VAL I  2 13  ? 62.576  36.834   -13.743 1.00 124.74 ? 32  VAL I O   1 
ATOM   5861  C  CB  . VAL I  2 13  ? 59.324  36.007   -13.908 1.00 104.90 ? 32  VAL I CB  1 
ATOM   5862  C  CG1 . VAL I  2 13  ? 60.097  34.767   -14.352 1.00 100.30 ? 32  VAL I CG1 1 
ATOM   5863  C  CG2 . VAL I  2 13  ? 58.768  35.809   -12.505 1.00 113.88 ? 32  VAL I CG2 1 
ATOM   5864  N  N   . THR I  2 14  ? 61.372  36.969   -11.849 1.00 118.42 ? 33  THR I N   1 
ATOM   5865  C  CA  . THR I  2 14  ? 62.522  36.833   -10.964 1.00 124.35 ? 33  THR I CA  1 
ATOM   5866  C  C   . THR I  2 14  ? 62.546  35.463   -10.266 1.00 121.32 ? 33  THR I C   1 
ATOM   5867  O  O   . THR I  2 14  ? 61.567  35.062   -9.641  1.00 117.18 ? 33  THR I O   1 
ATOM   5868  C  CB  . THR I  2 14  ? 62.549  37.973   -9.903  1.00 111.87 ? 33  THR I CB  1 
ATOM   5869  O  OG1 . THR I  2 14  ? 62.480  39.252   -10.552 1.00 100.88 ? 33  THR I OG1 1 
ATOM   5870  C  CG2 . THR I  2 14  ? 63.817  37.895   -9.067  1.00 109.72 ? 33  THR I CG2 1 
ATOM   5871  N  N   . CYS I  2 15  ? 63.670  34.757   -10.370 1.00 118.76 ? 34  CYS I N   1 
ATOM   5872  C  CA  . CYS I  2 15  ? 63.803  33.420   -9.797  1.00 105.51 ? 34  CYS I CA  1 
ATOM   5873  C  C   . CYS I  2 15  ? 64.973  33.307   -8.826  1.00 110.89 ? 34  CYS I C   1 
ATOM   5874  O  O   . CYS I  2 15  ? 65.968  34.048   -8.929  1.00 121.50 ? 34  CYS I O   1 
ATOM   5875  C  CB  . CYS I  2 15  ? 64.008  32.397   -10.907 1.00 104.97 ? 34  CYS I CB  1 
ATOM   5876  S  SG  . CYS I  2 15  ? 63.235  32.819   -12.488 1.00 148.23 ? 34  CYS I SG  1 
ATOM   5877  N  N   . THR I  2 16  ? 64.851  32.361   -7.895  1.00 103.72 ? 35  THR I N   1 
ATOM   5878  C  CA  . THR I  2 16  ? 65.933  32.051   -6.967  1.00 112.95 ? 35  THR I CA  1 
ATOM   5879  C  C   . THR I  2 16  ? 67.042  31.371   -7.751  1.00 114.80 ? 35  THR I C   1 
ATOM   5880  O  O   . THR I  2 16  ? 66.774  30.613   -8.679  1.00 104.81 ? 35  THR I O   1 
ATOM   5881  C  CB  . THR I  2 16  ? 65.481  31.108   -5.827  1.00 117.24 ? 35  THR I CB  1 
ATOM   5882  O  OG1 . THR I  2 16  ? 64.203  31.515   -5.321  1.00 126.90 ? 35  THR I OG1 1 
ATOM   5883  C  CG2 . THR I  2 16  ? 66.501  31.120   -4.693  1.00 114.99 ? 35  THR I CG2 1 
ATOM   5884  N  N   . CYS I  2 17  ? 68.287  31.638   -7.374  1.00 121.60 ? 36  CYS I N   1 
ATOM   5885  C  CA  . CYS I  2 17  ? 69.426  31.125   -8.125  1.00 117.89 ? 36  CYS I CA  1 
ATOM   5886  C  C   . CYS I  2 17  ? 70.437  30.407   -7.234  1.00 122.53 ? 36  CYS I C   1 
ATOM   5887  O  O   . CYS I  2 17  ? 71.359  31.028   -6.705  1.00 132.15 ? 36  CYS I O   1 
ATOM   5888  C  CB  . CYS I  2 17  ? 70.111  32.264   -8.893  1.00 118.01 ? 36  CYS I CB  1 
ATOM   5889  S  SG  . CYS I  2 17  ? 71.393  31.741   -10.072 1.00 123.62 ? 36  CYS I SG  1 
ATOM   5890  N  N   . GLU I  2 18  ? 70.253  29.098   -7.074  1.00 122.50 ? 37  GLU I N   1 
ATOM   5891  C  CA  . GLU I  2 18  ? 71.211  28.260   -6.356  1.00 119.07 ? 37  GLU I CA  1 
ATOM   5892  C  C   . GLU I  2 18  ? 71.892  27.301   -7.331  1.00 115.59 ? 37  GLU I C   1 
ATOM   5893  O  O   . GLU I  2 18  ? 71.381  26.218   -7.613  1.00 114.39 ? 37  GLU I O   1 
ATOM   5894  C  CB  . GLU I  2 18  ? 70.525  27.487   -5.222  1.00 115.94 ? 37  GLU I CB  1 
ATOM   5895  N  N   . SER I  2 19  ? 73.046  27.716   -7.848  1.00 114.97 ? 38  SER I N   1 
ATOM   5896  C  CA  . SER I  2 19  ? 73.763  26.969   -8.883  1.00 114.77 ? 38  SER I CA  1 
ATOM   5897  C  C   . SER I  2 19  ? 75.166  27.535   -9.084  1.00 116.80 ? 38  SER I C   1 
ATOM   5898  O  O   . SER I  2 19  ? 75.455  28.654   -8.664  1.00 124.28 ? 38  SER I O   1 
ATOM   5899  C  CB  . SER I  2 19  ? 72.992  27.014   -10.211 1.00 106.46 ? 38  SER I CB  1 
ATOM   5900  O  OG  . SER I  2 19  ? 73.827  26.689   -11.316 1.00 86.64  ? 38  SER I OG  1 
ATOM   5901  N  N   . PRO I  2 20  ? 76.048  26.753   -9.721  1.00 115.93 ? 39  PRO I N   1 
ATOM   5902  C  CA  . PRO I  2 20  ? 77.406  27.210   -10.023 1.00 117.14 ? 39  PRO I CA  1 
ATOM   5903  C  C   . PRO I  2 20  ? 77.446  28.403   -10.988 1.00 120.23 ? 39  PRO I C   1 
ATOM   5904  O  O   . PRO I  2 20  ? 78.205  29.345   -10.758 1.00 119.35 ? 39  PRO I O   1 
ATOM   5905  C  CB  . PRO I  2 20  ? 78.060  25.969   -10.644 1.00 104.52 ? 39  PRO I CB  1 
ATOM   5906  C  CG  . PRO I  2 20  ? 76.932  25.094   -11.057 1.00 102.35 ? 39  PRO I CG  1 
ATOM   5907  C  CD  . PRO I  2 20  ? 75.869  25.330   -10.047 1.00 112.55 ? 39  PRO I CD  1 
ATOM   5908  N  N   . HIS I  2 21  ? 76.642  28.369   -12.046 1.00 111.24 ? 40  HIS I N   1 
ATOM   5909  C  CA  . HIS I  2 21  ? 76.629  29.455   -13.023 1.00 116.05 ? 40  HIS I CA  1 
ATOM   5910  C  C   . HIS I  2 21  ? 75.854  30.675   -12.498 1.00 123.50 ? 40  HIS I C   1 
ATOM   5911  O  O   . HIS I  2 21  ? 75.182  31.378   -13.264 1.00 107.06 ? 40  HIS I O   1 
ATOM   5912  C  CB  . HIS I  2 21  ? 76.010  28.981   -14.344 1.00 117.85 ? 40  HIS I CB  1 
ATOM   5913  C  CG  . HIS I  2 21  ? 76.508  27.645   -14.810 1.00 135.78 ? 40  HIS I CG  1 
ATOM   5914  N  ND1 . HIS I  2 21  ? 75.700  26.731   -15.455 1.00 147.02 ? 40  HIS I ND1 1 
ATOM   5915  C  CD2 . HIS I  2 21  ? 77.734  27.074   -14.732 1.00 145.50 ? 40  HIS I CD2 1 
ATOM   5916  C  CE1 . HIS I  2 21  ? 76.405  25.652   -15.752 1.00 150.56 ? 40  HIS I CE1 1 
ATOM   5917  N  NE2 . HIS I  2 21  ? 77.641  25.834   -15.323 1.00 156.44 ? 40  HIS I NE2 1 
ATOM   5918  N  N   . CYS I  2 22  ? 75.948  30.928   -11.195 1.00 133.28 ? 41  CYS I N   1 
ATOM   5919  C  CA  . CYS I  2 22  ? 75.163  31.994   -10.575 1.00 131.12 ? 41  CYS I CA  1 
ATOM   5920  C  C   . CYS I  2 22  ? 75.959  33.244   -10.290 1.00 125.45 ? 41  CYS I C   1 
ATOM   5921  O  O   . CYS I  2 22  ? 76.875  33.232   -9.471  1.00 119.07 ? 41  CYS I O   1 
ATOM   5922  C  CB  . CYS I  2 22  ? 74.508  31.514   -9.281  1.00 137.26 ? 41  CYS I CB  1 
ATOM   5923  S  SG  . CYS I  2 22  ? 72.981  30.597   -9.541  1.00 200.58 ? 41  CYS I SG  1 
ATOM   5924  N  N   . LYS I  2 23  ? 75.583  34.323   -10.968 1.00 132.72 ? 42  LYS I N   1 
ATOM   5925  C  CA  . LYS I  2 23  ? 76.162  35.638   -10.723 1.00 130.95 ? 42  LYS I CA  1 
ATOM   5926  C  C   . LYS I  2 23  ? 75.268  36.410   -9.750  1.00 129.67 ? 42  LYS I C   1 
ATOM   5927  O  O   . LYS I  2 23  ? 74.710  37.449   -10.100 1.00 142.76 ? 42  LYS I O   1 
ATOM   5928  C  CB  . LYS I  2 23  ? 76.335  36.413   -12.045 1.00 111.23 ? 42  LYS I CB  1 
ATOM   5929  C  CG  . LYS I  2 23  ? 77.255  35.739   -13.084 1.00 106.60 ? 42  LYS I CG  1 
ATOM   5930  C  CD  . LYS I  2 23  ? 77.173  36.427   -14.444 1.00 95.45  ? 42  LYS I CD  1 
ATOM   5931  N  N   . GLY I  2 24  ? 75.129  35.887   -8.534  1.00 112.37 ? 43  GLY I N   1 
ATOM   5932  C  CA  . GLY I  2 24  ? 74.285  36.501   -7.524  1.00 112.90 ? 43  GLY I CA  1 
ATOM   5933  C  C   . GLY I  2 24  ? 73.487  35.479   -6.735  1.00 124.71 ? 43  GLY I C   1 
ATOM   5934  O  O   . GLY I  2 24  ? 73.736  34.280   -6.847  1.00 125.93 ? 43  GLY I O   1 
ATOM   5935  N  N   . PRO I  2 25  ? 72.526  35.950   -5.920  1.00 133.60 ? 44  PRO I N   1 
ATOM   5936  C  CA  . PRO I  2 25  ? 71.640  35.100   -5.121  1.00 126.37 ? 44  PRO I CA  1 
ATOM   5937  C  C   . PRO I  2 25  ? 70.316  34.861   -5.835  1.00 132.70 ? 44  PRO I C   1 
ATOM   5938  O  O   . PRO I  2 25  ? 69.604  33.912   -5.515  1.00 127.80 ? 44  PRO I O   1 
ATOM   5939  C  CB  . PRO I  2 25  ? 71.386  35.959   -3.887  1.00 122.22 ? 44  PRO I CB  1 
ATOM   5940  C  CG  . PRO I  2 25  ? 71.331  37.342   -4.443  1.00 131.98 ? 44  PRO I CG  1 
ATOM   5941  C  CD  . PRO I  2 25  ? 72.321  37.375   -5.605  1.00 139.52 ? 44  PRO I CD  1 
ATOM   5942  N  N   . THR I  2 26  ? 69.984  35.739   -6.776  1.00 137.19 ? 45  THR I N   1 
ATOM   5943  C  CA  . THR I  2 26  ? 68.774  35.603   -7.571  1.00 127.05 ? 45  THR I CA  1 
ATOM   5944  C  C   . THR I  2 26  ? 69.050  36.104   -8.976  1.00 127.97 ? 45  THR I C   1 
ATOM   5945  O  O   . THR I  2 26  ? 70.024  36.828   -9.199  1.00 119.82 ? 45  THR I O   1 
ATOM   5946  C  CB  . THR I  2 26  ? 67.617  36.415   -6.987  1.00 107.29 ? 45  THR I CB  1 
ATOM   5947  N  N   . CYS I  2 27  ? 68.189  35.727   -9.919  1.00 129.15 ? 46  CYS I N   1 
ATOM   5948  C  CA  . CYS I  2 27  ? 68.376  36.127   -11.311 1.00 121.71 ? 46  CYS I CA  1 
ATOM   5949  C  C   . CYS I  2 27  ? 67.042  36.393   -11.985 1.00 114.16 ? 46  CYS I C   1 
ATOM   5950  O  O   . CYS I  2 27  ? 65.997  36.070   -11.434 1.00 107.05 ? 46  CYS I O   1 
ATOM   5951  C  CB  . CYS I  2 27  ? 69.130  35.045   -12.072 1.00 119.46 ? 46  CYS I CB  1 
ATOM   5952  S  SG  . CYS I  2 27  ? 68.317  33.442   -12.038 1.00 138.88 ? 46  CYS I SG  1 
ATOM   5953  N  N   . ARG I  2 28  ? 67.080  36.981   -13.178 1.00 108.47 ? 47  ARG I N   1 
ATOM   5954  C  CA  . ARG I  2 28  ? 65.857  37.266   -13.931 1.00 100.57 ? 47  ARG I CA  1 
ATOM   5955  C  C   . ARG I  2 28  ? 65.829  36.486   -15.248 1.00 102.20 ? 47  ARG I C   1 
ATOM   5956  O  O   . ARG I  2 28  ? 66.875  36.232   -15.850 1.00 98.11  ? 47  ARG I O   1 
ATOM   5957  C  CB  . ARG I  2 28  ? 65.708  38.772   -14.177 1.00 89.07  ? 47  ARG I CB  1 
ATOM   5958  N  N   . GLY I  2 29  ? 64.634  36.094   -15.687 1.00 105.13 ? 48  GLY I N   1 
ATOM   5959  C  CA  . GLY I  2 29  ? 64.498  35.298   -16.897 1.00 97.33  ? 48  GLY I CA  1 
ATOM   5960  C  C   . GLY I  2 29  ? 63.066  35.119   -17.361 1.00 88.98  ? 48  GLY I C   1 
ATOM   5961  O  O   . GLY I  2 29  ? 62.170  35.775   -16.865 1.00 108.77 ? 48  GLY I O   1 
ATOM   5962  N  N   . ALA I  2 30  ? 62.853  34.225   -18.317 1.00 78.12  ? 49  ALA I N   1 
ATOM   5963  C  CA  . ALA I  2 30  ? 61.521  34.002   -18.875 1.00 75.25  ? 49  ALA I CA  1 
ATOM   5964  C  C   . ALA I  2 30  ? 60.661  33.154   -17.947 1.00 82.59  ? 49  ALA I C   1 
ATOM   5965  O  O   . ALA I  2 30  ? 59.454  33.357   -17.837 1.00 77.68  ? 49  ALA I O   1 
ATOM   5966  C  CB  . ALA I  2 30  ? 61.628  33.338   -20.244 1.00 65.71  ? 49  ALA I CB  1 
ATOM   5967  N  N   . TRP I  2 31  ? 61.297  32.184   -17.303 1.00 94.36  ? 50  TRP I N   1 
ATOM   5968  C  CA  . TRP I  2 31  ? 60.616  31.310   -16.366 1.00 91.35  ? 50  TRP I CA  1 
ATOM   5969  C  C   . TRP I  2 31  ? 61.631  30.763   -15.383 1.00 91.86  ? 50  TRP I C   1 
ATOM   5970  O  O   . TRP I  2 31  ? 62.833  30.817   -15.629 1.00 96.77  ? 50  TRP I O   1 
ATOM   5971  C  CB  . TRP I  2 31  ? 59.916  30.161   -17.098 1.00 80.16  ? 50  TRP I CB  1 
ATOM   5972  C  CG  . TRP I  2 31  ? 60.847  29.192   -17.764 1.00 83.05  ? 50  TRP I CG  1 
ATOM   5973  C  CD1 . TRP I  2 31  ? 61.575  28.203   -17.161 1.00 94.00  ? 50  TRP I CD1 1 
ATOM   5974  C  CD2 . TRP I  2 31  ? 61.130  29.101   -19.164 1.00 85.31  ? 50  TRP I CD2 1 
ATOM   5975  N  NE1 . TRP I  2 31  ? 62.302  27.508   -18.100 1.00 89.61  ? 50  TRP I NE1 1 
ATOM   5976  C  CE2 . TRP I  2 31  ? 62.045  28.037   -19.338 1.00 93.12  ? 50  TRP I CE2 1 
ATOM   5977  C  CE3 . TRP I  2 31  ? 60.706  29.817   -20.287 1.00 74.96  ? 50  TRP I CE3 1 
ATOM   5978  C  CZ2 . TRP I  2 31  ? 62.543  27.677   -20.589 1.00 100.45 ? 50  TRP I CZ2 1 
ATOM   5979  C  CZ3 . TRP I  2 31  ? 61.200  29.455   -21.528 1.00 89.52  ? 50  TRP I CZ3 1 
ATOM   5980  C  CH2 . TRP I  2 31  ? 62.110  28.397   -21.669 1.00 102.96 ? 50  TRP I CH2 1 
ATOM   5981  N  N   . CYS I  2 32  ? 61.141  30.234   -14.271 1.00 85.07  ? 51  CYS I N   1 
ATOM   5982  C  CA  . CYS I  2 32  ? 62.012  29.675   -13.254 1.00 86.94  ? 51  CYS I CA  1 
ATOM   5983  C  C   . CYS I  2 32  ? 62.111  28.153   -13.351 1.00 88.27  ? 51  CYS I C   1 
ATOM   5984  O  O   . CYS I  2 32  ? 61.173  27.480   -13.793 1.00 90.88  ? 51  CYS I O   1 
ATOM   5985  C  CB  . CYS I  2 32  ? 61.544  30.108   -11.872 1.00 84.27  ? 51  CYS I CB  1 
ATOM   5986  S  SG  . CYS I  2 32  ? 61.625  31.879   -11.691 1.00 101.85 ? 51  CYS I SG  1 
ATOM   5987  N  N   . THR I  2 33  ? 63.260  27.624   -12.938 1.00 80.61  ? 52  THR I N   1 
ATOM   5988  C  CA  . THR I  2 33  ? 63.551  26.198   -13.035 1.00 77.41  ? 52  THR I CA  1 
ATOM   5989  C  C   . THR I  2 33  ? 64.059  25.639   -11.722 1.00 80.94  ? 52  THR I C   1 
ATOM   5990  O  O   . THR I  2 33  ? 64.744  26.317   -10.947 1.00 85.07  ? 52  THR I O   1 
ATOM   5991  C  CB  . THR I  2 33  ? 64.632  25.903   -14.092 1.00 85.73  ? 52  THR I CB  1 
ATOM   5992  O  OG1 . THR I  2 33  ? 65.877  26.510   -13.694 1.00 74.43  ? 52  THR I OG1 1 
ATOM   5993  C  CG2 . THR I  2 33  ? 64.200  26.425   -15.463 1.00 91.62  ? 52  THR I CG2 1 
ATOM   5994  N  N   . VAL I  2 34  ? 63.690  24.389   -11.492 1.00 76.66  ? 53  VAL I N   1 
ATOM   5995  C  CA  . VAL I  2 34  ? 64.280  23.561   -10.465 1.00 79.11  ? 53  VAL I CA  1 
ATOM   5996  C  C   . VAL I  2 34  ? 64.580  22.252   -11.168 1.00 82.44  ? 53  VAL I C   1 
ATOM   5997  O  O   . VAL I  2 34  ? 63.682  21.625   -11.753 1.00 101.27 ? 53  VAL I O   1 
ATOM   5998  C  CB  . VAL I  2 34  ? 63.316  23.315   -9.295  1.00 85.91  ? 53  VAL I CB  1 
ATOM   5999  C  CG1 . VAL I  2 34  ? 63.785  22.135   -8.459  1.00 92.80  ? 53  VAL I CG1 1 
ATOM   6000  C  CG2 . VAL I  2 34  ? 63.194  24.558   -8.439  1.00 89.46  ? 53  VAL I CG2 1 
ATOM   6001  N  N   . VAL I  2 35  ? 65.843  21.848   -11.143 1.00 69.26  ? 54  VAL I N   1 
ATOM   6002  C  CA  . VAL I  2 35  ? 66.252  20.677   -11.906 1.00 75.74  ? 54  VAL I CA  1 
ATOM   6003  C  C   . VAL I  2 35  ? 67.161  19.748   -11.122 1.00 71.93  ? 54  VAL I C   1 
ATOM   6004  O  O   . VAL I  2 35  ? 68.138  20.174   -10.503 1.00 73.31  ? 54  VAL I O   1 
ATOM   6005  C  CB  . VAL I  2 35  ? 66.890  21.058   -13.269 1.00 61.59  ? 54  VAL I CB  1 
ATOM   6006  C  CG1 . VAL I  2 35  ? 67.448  22.465   -13.236 1.00 61.60  ? 54  VAL I CG1 1 
ATOM   6007  C  CG2 . VAL I  2 35  ? 67.949  20.050   -13.655 1.00 41.90  ? 54  VAL I CG2 1 
ATOM   6008  N  N   . LEU I  2 36  ? 66.818  18.468   -11.170 1.00 69.76  ? 55  LEU I N   1 
ATOM   6009  C  CA  . LEU I  2 36  ? 67.504  17.446   -10.399 1.00 72.95  ? 55  LEU I CA  1 
ATOM   6010  C  C   . LEU I  2 36  ? 68.290  16.512   -11.319 1.00 76.56  ? 55  LEU I C   1 
ATOM   6011  O  O   . LEU I  2 36  ? 67.729  15.941   -12.261 1.00 84.36  ? 55  LEU I O   1 
ATOM   6012  C  CB  . LEU I  2 36  ? 66.473  16.637   -9.618  1.00 80.47  ? 55  LEU I CB  1 
ATOM   6013  C  CG  . LEU I  2 36  ? 66.852  16.250   -8.196  1.00 82.55  ? 55  LEU I CG  1 
ATOM   6014  C  CD1 . LEU I  2 36  ? 66.087  15.007   -7.776  1.00 74.84  ? 55  LEU I CD1 1 
ATOM   6015  C  CD2 . LEU I  2 36  ? 68.352  16.036   -8.074  1.00 91.17  ? 55  LEU I CD2 1 
ATOM   6016  N  N   . VAL I  2 37  ? 69.580  16.336   -11.040 1.00 64.27  ? 56  VAL I N   1 
ATOM   6017  C  CA  . VAL I  2 37  ? 70.418  15.528   -11.922 1.00 54.05  ? 56  VAL I CA  1 
ATOM   6018  C  C   . VAL I  2 37  ? 71.294  14.523   -11.172 1.00 55.93  ? 56  VAL I C   1 
ATOM   6019  O  O   . VAL I  2 37  ? 71.909  14.880   -10.185 1.00 77.69  ? 56  VAL I O   1 
ATOM   6020  C  CB  . VAL I  2 37  ? 71.333  16.432   -12.750 1.00 50.10  ? 56  VAL I CB  1 
ATOM   6021  C  CG1 . VAL I  2 37  ? 71.762  15.707   -14.026 1.00 46.74  ? 56  VAL I CG1 1 
ATOM   6022  C  CG2 . VAL I  2 37  ? 70.633  17.760   -13.068 1.00 64.54  ? 56  VAL I CG2 1 
ATOM   6023  N  N   . ARG I  2 38  ? 71.372  13.275   -11.629 1.00 59.49  ? 57  ARG I N   1 
ATOM   6024  C  CA  . ARG I  2 38  ? 72.306  12.306   -11.029 1.00 77.89  ? 57  ARG I CA  1 
ATOM   6025  C  C   . ARG I  2 38  ? 73.422  11.803   -11.984 1.00 73.53  ? 57  ARG I C   1 
ATOM   6026  O  O   . ARG I  2 38  ? 73.326  10.704   -12.529 1.00 80.04  ? 57  ARG I O   1 
ATOM   6027  C  CB  . ARG I  2 38  ? 71.529  11.119   -10.443 1.00 81.56  ? 57  ARG I CB  1 
ATOM   6028  N  N   . GLU I  2 39  ? 74.484  12.586   -12.180 1.00 70.99  ? 58  GLU I N   1 
ATOM   6029  C  CA  . GLU I  2 39  ? 75.533  12.171   -13.120 1.00 98.03  ? 58  GLU I CA  1 
ATOM   6030  C  C   . GLU I  2 39  ? 76.171  10.866   -12.609 1.00 113.66 ? 58  GLU I C   1 
ATOM   6031  O  O   . GLU I  2 39  ? 75.940  10.472   -11.465 1.00 118.82 ? 58  GLU I O   1 
ATOM   6032  C  CB  . GLU I  2 39  ? 76.558  13.300   -13.402 1.00 17.28  ? 58  GLU I CB  1 
ATOM   6033  C  CG  . GLU I  2 39  ? 76.816  13.583   -14.951 1.00 117.84 ? 58  GLU I CG  1 
ATOM   6034  C  CD  . GLU I  2 39  ? 76.391  15.006   -15.472 1.00 106.59 ? 58  GLU I CD  1 
ATOM   6035  O  OE1 . GLU I  2 39  ? 76.150  15.915   -14.643 1.00 111.01 ? 58  GLU I OE1 1 
ATOM   6036  O  OE2 . GLU I  2 39  ? 76.305  15.224   -16.718 1.00 52.93  ? 58  GLU I OE2 1 
ATOM   6037  N  N   . GLU I  2 40  ? 76.932  10.177   -13.458 1.00 122.95 ? 59  GLU I N   1 
ATOM   6038  C  CA  . GLU I  2 40  ? 77.489  8.869    -13.091 1.00 99.55  ? 59  GLU I CA  1 
ATOM   6039  C  C   . GLU I  2 40  ? 78.337  8.900    -11.821 1.00 92.09  ? 59  GLU I C   1 
ATOM   6040  O  O   . GLU I  2 40  ? 79.084  9.851    -11.580 1.00 117.25 ? 59  GLU I O   1 
ATOM   6041  C  CB  . GLU I  2 40  ? 78.299  8.238    -14.237 1.00 56.65  ? 59  GLU I CB  1 
ATOM   6042  C  CG  . GLU I  2 40  ? 79.083  6.993    -13.787 1.00 75.37  ? 59  GLU I CG  1 
ATOM   6043  C  CD  . GLU I  2 40  ? 79.266  5.917    -14.869 1.00 100.49 ? 59  GLU I CD  1 
ATOM   6044  O  OE1 . GLU I  2 40  ? 78.803  4.772    -14.646 1.00 122.39 ? 59  GLU I OE1 1 
ATOM   6045  O  OE2 . GLU I  2 40  ? 79.894  6.194    -15.920 1.00 63.49  ? 59  GLU I OE2 1 
ATOM   6046  N  N   . GLY I  2 41  ? 78.227  7.838    -11.027 1.00 55.18  ? 60  GLY I N   1 
ATOM   6047  C  CA  . GLY I  2 41  ? 78.906  7.758    -9.746  1.00 85.87  ? 60  GLY I CA  1 
ATOM   6048  C  C   . GLY I  2 41  ? 78.291  8.694    -8.720  1.00 114.68 ? 60  GLY I C   1 
ATOM   6049  O  O   . GLY I  2 41  ? 77.734  8.253    -7.710  1.00 122.29 ? 60  GLY I O   1 
ATOM   6050  N  N   . ARG I  2 42  ? 78.387  9.993    -8.995  1.00 122.30 ? 61  ARG I N   1 
ATOM   6051  C  CA  . ARG I  2 42  ? 77.896  11.018   -8.085  1.00 98.32  ? 61  ARG I CA  1 
ATOM   6052  C  C   . ARG I  2 42  ? 76.501  10.688   -7.559  1.00 93.93  ? 61  ARG I C   1 
ATOM   6053  O  O   . ARG I  2 42  ? 75.781  9.832    -8.088  1.00 97.21  ? 61  ARG I O   1 
ATOM   6054  C  CB  . ARG I  2 42  ? 77.876  12.412   -8.753  1.00 87.38  ? 61  ARG I CB  1 
ATOM   6055  C  CG  . ARG I  2 42  ? 79.175  12.896   -9.450  1.00 66.89  ? 61  ARG I CG  1 
ATOM   6056  C  CD  . ARG I  2 42  ? 79.154  14.432   -9.719  1.00 65.80  ? 61  ARG I CD  1 
ATOM   6057  N  NE  . ARG I  2 42  ? 79.128  15.196   -8.461  1.00 110.06 ? 61  ARG I NE  1 
ATOM   6058  C  CZ  . ARG I  2 42  ? 80.134  15.935   -7.982  1.00 111.23 ? 61  ARG I CZ  1 
ATOM   6059  N  NH1 . ARG I  2 42  ? 81.263  16.051   -8.667  1.00 102.89 ? 61  ARG I NH1 1 
ATOM   6060  N  NH2 . ARG I  2 42  ? 80.014  16.575   -6.815  1.00 84.22  ? 61  ARG I NH2 1 
ATOM   6061  N  N   . HIS I  2 43  ? 76.153  11.372   -6.484  1.00 94.11  ? 62  HIS I N   1 
ATOM   6062  C  CA  . HIS I  2 43  ? 74.800  11.440   -5.990  1.00 100.83 ? 62  HIS I CA  1 
ATOM   6063  C  C   . HIS I  2 43  ? 74.111  12.612   -6.659  1.00 108.27 ? 62  HIS I C   1 
ATOM   6064  O  O   . HIS I  2 43  ? 74.768  13.539   -7.115  1.00 114.19 ? 62  HIS I O   1 
ATOM   6065  C  CB  . HIS I  2 43  ? 74.825  11.631   -4.482  1.00 107.97 ? 62  HIS I CB  1 
ATOM   6066  C  CG  . HIS I  2 43  ? 75.287  10.419   -3.745  1.00 127.72 ? 62  HIS I CG  1 
ATOM   6067  N  ND1 . HIS I  2 43  ? 76.617  10.080   -3.637  1.00 140.89 ? 62  HIS I ND1 1 
ATOM   6068  C  CD2 . HIS I  2 43  ? 74.595  9.445    -3.110  1.00 123.13 ? 62  HIS I CD2 1 
ATOM   6069  C  CE1 . HIS I  2 43  ? 76.727  8.957    -2.952  1.00 135.09 ? 62  HIS I CE1 1 
ATOM   6070  N  NE2 . HIS I  2 43  ? 75.515  8.551    -2.621  1.00 131.93 ? 62  HIS I NE2 1 
ATOM   6071  N  N   . PRO I  2 44  ? 72.777  12.565   -6.736  1.00 113.15 ? 63  PRO I N   1 
ATOM   6072  C  CA  . PRO I  2 44  ? 71.984  13.624   -7.368  1.00 108.19 ? 63  PRO I CA  1 
ATOM   6073  C  C   . PRO I  2 44  ? 72.151  14.997   -6.716  1.00 95.56  ? 63  PRO I C   1 
ATOM   6074  O  O   . PRO I  2 44  ? 72.222  15.100   -5.492  1.00 89.00  ? 63  PRO I O   1 
ATOM   6075  C  CB  . PRO I  2 44  ? 70.542  13.130   -7.199  1.00 95.48  ? 63  PRO I CB  1 
ATOM   6076  C  CG  . PRO I  2 44  ? 70.607  12.067   -6.148  1.00 97.17  ? 63  PRO I CG  1 
ATOM   6077  C  CD  . PRO I  2 44  ? 71.939  11.432   -6.314  1.00 109.74 ? 63  PRO I CD  1 
ATOM   6078  N  N   . GLN I  2 45  ? 72.209  16.033   -7.549  1.00 82.56  ? 64  GLN I N   1 
ATOM   6079  C  CA  . GLN I  2 45  ? 72.308  17.416   -7.099  1.00 78.40  ? 64  GLN I CA  1 
ATOM   6080  C  C   . GLN I  2 45  ? 71.166  18.200   -7.708  1.00 80.31  ? 64  GLN I C   1 
ATOM   6081  O  O   . GLN I  2 45  ? 70.657  17.849   -8.775  1.00 94.85  ? 64  GLN I O   1 
ATOM   6082  C  CB  . GLN I  2 45  ? 73.634  18.047   -7.531  1.00 101.87 ? 64  GLN I CB  1 
ATOM   6083  C  CG  . GLN I  2 45  ? 74.852  17.573   -6.767  1.00 122.06 ? 64  GLN I CG  1 
ATOM   6084  C  CD  . GLN I  2 45  ? 76.136  18.131   -7.336  1.00 135.52 ? 64  GLN I CD  1 
ATOM   6085  O  OE1 . GLN I  2 45  ? 76.166  18.631   -8.457  1.00 127.09 ? 64  GLN I OE1 1 
ATOM   6086  N  NE2 . GLN I  2 45  ? 77.205  18.052   -6.563  1.00 151.51 ? 64  GLN I NE2 1 
ATOM   6087  N  N   . GLU I  2 46  ? 70.778  19.278   -7.038  1.00 77.20  ? 65  GLU I N   1 
ATOM   6088  C  CA  . GLU I  2 46  ? 69.555  19.999   -7.384  1.00 83.79  ? 65  GLU I CA  1 
ATOM   6089  C  C   . GLU I  2 46  ? 69.839  21.481   -7.587  1.00 92.81  ? 65  GLU I C   1 
ATOM   6090  O  O   . GLU I  2 46  ? 70.125  22.203   -6.633  1.00 90.52  ? 65  GLU I O   1 
ATOM   6091  C  CB  . GLU I  2 46  ? 68.477  19.803   -6.298  1.00 71.40  ? 65  GLU I CB  1 
ATOM   6092  N  N   . HIS I  2 47  ? 69.757  21.934   -8.833  1.00 96.74  ? 66  HIS I N   1 
ATOM   6093  C  CA  . HIS I  2 47  ? 69.973  23.345   -9.133  1.00 92.26  ? 66  HIS I CA  1 
ATOM   6094  C  C   . HIS I  2 47  ? 68.649  24.095   -9.207  1.00 85.40  ? 66  HIS I C   1 
ATOM   6095  O  O   . HIS I  2 47  ? 67.615  23.499   -9.511  1.00 98.36  ? 66  HIS I O   1 
ATOM   6096  C  CB  . HIS I  2 47  ? 70.718  23.503   -10.460 1.00 103.47 ? 66  HIS I CB  1 
ATOM   6097  C  CG  . HIS I  2 47  ? 71.905  22.600   -10.603 1.00 114.06 ? 66  HIS I CG  1 
ATOM   6098  N  ND1 . HIS I  2 47  ? 72.743  22.641   -11.699 1.00 112.76 ? 66  HIS I ND1 1 
ATOM   6099  C  CD2 . HIS I  2 47  ? 72.396  21.633   -9.791  1.00 116.57 ? 66  HIS I CD2 1 
ATOM   6100  C  CE1 . HIS I  2 47  ? 73.696  21.737   -11.557 1.00 107.87 ? 66  HIS I CE1 1 
ATOM   6101  N  NE2 . HIS I  2 47  ? 73.509  21.113   -10.407 1.00 114.32 ? 66  HIS I NE2 1 
ATOM   6102  N  N   . ARG I  2 48  ? 68.688  25.399   -8.933  1.00 71.47  ? 67  ARG I N   1 
ATOM   6103  C  CA  . ARG I  2 48  ? 67.523  26.274   -9.092  1.00 79.69  ? 67  ARG I CA  1 
ATOM   6104  C  C   . ARG I  2 48  ? 67.943  27.514   -9.855  1.00 78.04  ? 67  ARG I C   1 
ATOM   6105  O  O   . ARG I  2 48  ? 68.983  28.087   -9.558  1.00 87.54  ? 67  ARG I O   1 
ATOM   6106  C  CB  . ARG I  2 48  ? 66.968  26.684   -7.725  1.00 82.71  ? 67  ARG I CB  1 
ATOM   6107  C  CG  . ARG I  2 48  ? 66.646  25.507   -6.832  1.00 95.15  ? 67  ARG I CG  1 
ATOM   6108  C  CD  . ARG I  2 48  ? 66.597  25.892   -5.381  1.00 97.14  ? 67  ARG I CD  1 
ATOM   6109  N  NE  . ARG I  2 48  ? 66.551  24.691   -4.558  1.00 106.54 ? 67  ARG I NE  1 
ATOM   6110  C  CZ  . ARG I  2 48  ? 65.428  24.079   -4.196  1.00 117.61 ? 67  ARG I CZ  1 
ATOM   6111  N  NH1 . ARG I  2 48  ? 64.255  24.569   -4.575  1.00 113.80 ? 67  ARG I NH1 1 
ATOM   6112  N  NH2 . ARG I  2 48  ? 65.475  22.983   -3.446  1.00 125.95 ? 67  ARG I NH2 1 
ATOM   6113  N  N   . GLY I  2 49  ? 67.154  27.936   -10.835 1.00 71.26  ? 68  GLY I N   1 
ATOM   6114  C  CA  . GLY I  2 49  ? 67.544  29.103   -11.603 1.00 88.10  ? 68  GLY I CA  1 
ATOM   6115  C  C   . GLY I  2 49  ? 66.561  29.630   -12.627 1.00 98.94  ? 68  GLY I C   1 
ATOM   6116  O  O   . GLY I  2 49  ? 65.352  29.503   -12.478 1.00 96.97  ? 68  GLY I O   1 
ATOM   6117  N  N   . CYS I  2 50  ? 67.102  30.252   -13.668 1.00 98.69  ? 69  CYS I N   1 
ATOM   6118  C  CA  . CYS I  2 50  ? 66.288  30.871   -14.701 1.00 78.81  ? 69  CYS I CA  1 
ATOM   6119  C  C   . CYS I  2 50  ? 66.189  29.920   -15.867 1.00 85.65  ? 69  CYS I C   1 
ATOM   6120  O  O   . CYS I  2 50  ? 66.547  28.744   -15.755 1.00 97.26  ? 69  CYS I O   1 
ATOM   6121  C  CB  . CYS I  2 50  ? 66.907  32.198   -15.160 1.00 50.41  ? 69  CYS I CB  1 
ATOM   6122  S  SG  . CYS I  2 50  ? 67.327  33.323   -13.812 1.00 155.82 ? 69  CYS I SG  1 
ATOM   6123  N  N   . GLY I  2 51  ? 65.708  30.438   -16.989 1.00 79.47  ? 70  GLY I N   1 
ATOM   6124  C  CA  . GLY I  2 51  ? 65.601  29.654   -18.199 1.00 92.40  ? 70  GLY I CA  1 
ATOM   6125  C  C   . GLY I  2 51  ? 64.772  30.411   -19.205 1.00 89.80  ? 70  GLY I C   1 
ATOM   6126  O  O   . GLY I  2 51  ? 63.692  30.905   -18.868 1.00 72.66  ? 70  GLY I O   1 
ATOM   6127  N  N   . ASN I  2 52  ? 65.283  30.518   -20.431 1.00 91.72  ? 71  ASN I N   1 
ATOM   6128  C  CA  . ASN I  2 52  ? 64.571  31.224   -21.495 1.00 84.95  ? 71  ASN I CA  1 
ATOM   6129  C  C   . ASN I  2 52  ? 64.752  30.562   -22.848 1.00 80.80  ? 71  ASN I C   1 
ATOM   6130  O  O   . ASN I  2 52  ? 64.328  31.108   -23.864 1.00 82.82  ? 71  ASN I O   1 
ATOM   6131  C  CB  . ASN I  2 52  ? 65.027  32.685   -21.596 1.00 73.18  ? 71  ASN I CB  1 
ATOM   6132  C  CG  . ASN I  2 52  ? 65.929  33.088   -20.454 1.00 84.39  ? 71  ASN I CG  1 
ATOM   6133  O  OD1 . ASN I  2 52  ? 65.507  33.796   -19.541 1.00 84.40  ? 71  ASN I OD1 1 
ATOM   6134  N  ND2 . ASN I  2 52  ? 67.182  32.627   -20.491 1.00 90.77  ? 71  ASN I ND2 1 
ATOM   6135  N  N   . LEU I  2 53  ? 65.378  29.392   -22.871 1.00 83.17  ? 72  LEU I N   1 
ATOM   6136  C  CA  . LEU I  2 53  ? 65.763  28.820   -24.150 1.00 96.85  ? 72  LEU I CA  1 
ATOM   6137  C  C   . LEU I  2 53  ? 64.890  27.695   -24.692 1.00 88.97  ? 72  LEU I C   1 
ATOM   6138  O  O   . LEU I  2 53  ? 64.435  27.754   -25.835 1.00 111.01 ? 72  LEU I O   1 
ATOM   6139  C  CB  . LEU I  2 53  ? 67.230  28.407   -24.133 1.00 120.41 ? 72  LEU I CB  1 
ATOM   6140  C  CG  . LEU I  2 53  ? 68.091  29.551   -24.652 1.00 109.37 ? 72  LEU I CG  1 
ATOM   6141  C  CD1 . LEU I  2 53  ? 69.428  29.070   -25.226 1.00 113.41 ? 72  LEU I CD1 1 
ATOM   6142  C  CD2 . LEU I  2 53  ? 67.272  30.266   -25.703 1.00 49.52  ? 72  LEU I CD2 1 
ATOM   6143  N  N   . HIS I  2 54  ? 64.654  26.667   -23.892 1.00 61.19  ? 73  HIS I N   1 
ATOM   6144  C  CA  . HIS I  2 54  ? 64.009  25.488   -24.438 1.00 70.84  ? 73  HIS I CA  1 
ATOM   6145  C  C   . HIS I  2 54  ? 62.807  25.017   -23.635 1.00 82.68  ? 73  HIS I C   1 
ATOM   6146  O  O   . HIS I  2 54  ? 62.882  24.004   -22.939 1.00 88.19  ? 73  HIS I O   1 
ATOM   6147  C  CB  . HIS I  2 54  ? 65.034  24.384   -24.556 1.00 72.60  ? 73  HIS I CB  1 
ATOM   6148  C  CG  . HIS I  2 54  ? 66.261  24.785   -25.314 1.00 78.51  ? 73  HIS I CG  1 
ATOM   6149  N  ND1 . HIS I  2 54  ? 66.288  24.885   -26.688 1.00 67.56  ? 73  HIS I ND1 1 
ATOM   6150  C  CD2 . HIS I  2 54  ? 67.508  25.099   -24.889 1.00 79.01  ? 73  HIS I CD2 1 
ATOM   6151  C  CE1 . HIS I  2 54  ? 67.498  25.243   -27.077 1.00 71.27  ? 73  HIS I CE1 1 
ATOM   6152  N  NE2 . HIS I  2 54  ? 68.258  25.379   -26.005 1.00 76.44  ? 73  HIS I NE2 1 
ATOM   6153  N  N   . ARG I  2 55  ? 61.695  25.742   -23.765 1.00 76.70  ? 74  ARG I N   1 
ATOM   6154  C  CA  . ARG I  2 55  ? 60.511  25.505   -22.948 1.00 69.83  ? 74  ARG I CA  1 
ATOM   6155  C  C   . ARG I  2 55  ? 60.184  24.019   -22.891 1.00 64.59  ? 74  ARG I C   1 
ATOM   6156  O  O   . ARG I  2 55  ? 59.949  23.465   -21.820 1.00 59.26  ? 74  ARG I O   1 
ATOM   6157  C  CB  . ARG I  2 55  ? 59.329  26.318   -23.479 1.00 69.79  ? 74  ARG I CB  1 
ATOM   6158  C  CG  . ARG I  2 55  ? 58.107  26.391   -22.559 1.00 90.52  ? 74  ARG I CG  1 
ATOM   6159  C  CD  . ARG I  2 55  ? 58.442  26.967   -21.177 1.00 119.96 ? 74  ARG I CD  1 
ATOM   6160  N  NE  . ARG I  2 55  ? 57.328  27.709   -20.576 1.00 124.47 ? 74  ARG I NE  1 
ATOM   6161  C  CZ  . ARG I  2 55  ? 56.961  27.634   -19.295 1.00 108.23 ? 74  ARG I CZ  1 
ATOM   6162  N  NH1 . ARG I  2 55  ? 57.595  26.842   -18.445 1.00 114.21 ? 74  ARG I NH1 1 
ATOM   6163  N  NH2 . ARG I  2 55  ? 55.949  28.352   -18.855 1.00 94.51  ? 74  ARG I NH2 1 
ATOM   6164  N  N   . GLU I  2 56  ? 60.193  23.376   -24.049 1.00 51.74  ? 75  GLU I N   1 
ATOM   6165  C  CA  . GLU I  2 56  ? 59.927  21.942   -24.137 1.00 63.13  ? 75  GLU I CA  1 
ATOM   6166  C  C   . GLU I  2 56  ? 60.511  21.094   -22.995 1.00 71.94  ? 75  GLU I C   1 
ATOM   6167  O  O   . GLU I  2 56  ? 59.828  20.215   -22.470 1.00 82.24  ? 75  GLU I O   1 
ATOM   6168  C  CB  . GLU I  2 56  ? 60.430  21.392   -25.477 1.00 90.00  ? 75  GLU I CB  1 
ATOM   6169  C  CG  . GLU I  2 56  ? 61.896  21.706   -25.800 1.00 97.90  ? 75  GLU I CG  1 
ATOM   6170  C  CD  . GLU I  2 56  ? 62.017  22.762   -26.884 1.00 105.66 ? 75  GLU I CD  1 
ATOM   6171  O  OE1 . GLU I  2 56  ? 61.687  23.948   -26.625 1.00 107.67 ? 75  GLU I OE1 1 
ATOM   6172  O  OE2 . GLU I  2 56  ? 62.423  22.386   -28.003 1.00 98.58  ? 75  GLU I OE2 1 
ATOM   6173  N  N   . LEU I  2 57  ? 61.774  21.329   -22.641 1.00 63.77  ? 76  LEU I N   1 
ATOM   6174  C  CA  . LEU I  2 57  ? 62.407  20.565   -21.576 1.00 80.41  ? 76  LEU I CA  1 
ATOM   6175  C  C   . LEU I  2 57  ? 61.476  20.342   -20.369 1.00 80.14  ? 76  LEU I C   1 
ATOM   6176  O  O   . LEU I  2 57  ? 61.489  19.263   -19.754 1.00 84.35  ? 76  LEU I O   1 
ATOM   6177  C  CB  . LEU I  2 57  ? 63.716  21.229   -21.140 1.00 86.52  ? 76  LEU I CB  1 
ATOM   6178  C  CG  . LEU I  2 57  ? 64.947  20.744   -21.896 1.00 74.32  ? 76  LEU I CG  1 
ATOM   6179  C  CD1 . LEU I  2 57  ? 66.193  21.493   -21.435 1.00 61.76  ? 76  LEU I CD1 1 
ATOM   6180  C  CD2 . LEU I  2 57  ? 65.114  19.245   -21.691 1.00 82.64  ? 76  LEU I CD2 1 
ATOM   6181  N  N   . CYS I  2 58  ? 60.668  21.357   -20.052 1.00 62.97  ? 77  CYS I N   1 
ATOM   6182  C  CA  . CYS I  2 58  ? 59.757  21.331   -18.898 1.00 74.44  ? 77  CYS I CA  1 
ATOM   6183  C  C   . CYS I  2 58  ? 58.708  20.215   -18.948 1.00 79.13  ? 77  CYS I C   1 
ATOM   6184  O  O   . CYS I  2 58  ? 58.399  19.585   -17.927 1.00 92.07  ? 77  CYS I O   1 
ATOM   6185  C  CB  . CYS I  2 58  ? 59.048  22.679   -18.743 1.00 68.86  ? 77  CYS I CB  1 
ATOM   6186  S  SG  . CYS I  2 58  ? 60.131  24.104   -18.429 1.00 85.73  ? 77  CYS I SG  1 
ATOM   6187  N  N   . ARG I  2 59  ? 58.146  19.999   -20.133 1.00 59.48  ? 78  ARG I N   1 
ATOM   6188  C  CA  . ARG I  2 59  ? 57.240  18.889   -20.370 1.00 54.71  ? 78  ARG I CA  1 
ATOM   6189  C  C   . ARG I  2 59  ? 57.895  17.531   -20.072 1.00 68.02  ? 78  ARG I C   1 
ATOM   6190  O  O   . ARG I  2 59  ? 57.215  16.517   -19.960 1.00 63.18  ? 78  ARG I O   1 
ATOM   6191  C  CB  . ARG I  2 59  ? 56.814  18.895   -21.827 1.00 67.90  ? 78  ARG I CB  1 
ATOM   6192  C  CG  . ARG I  2 59  ? 56.520  20.255   -22.384 1.00 84.35  ? 78  ARG I CG  1 
ATOM   6193  C  CD  . ARG I  2 59  ? 55.087  20.677   -22.125 1.00 104.25 ? 78  ARG I CD  1 
ATOM   6194  N  NE  . ARG I  2 59  ? 54.593  21.454   -23.251 1.00 115.59 ? 78  ARG I NE  1 
ATOM   6195  C  CZ  . ARG I  2 59  ? 53.883  20.942   -24.244 1.00 121.27 ? 78  ARG I CZ  1 
ATOM   6196  N  NH1 . ARG I  2 59  ? 53.560  19.655   -24.224 1.00 99.30  ? 78  ARG I NH1 1 
ATOM   6197  N  NH2 . ARG I  2 59  ? 53.485  21.719   -25.242 1.00 137.27 ? 78  ARG I NH2 1 
ATOM   6198  N  N   . GLY I  2 60  ? 59.218  17.499   -19.980 1.00 84.03  ? 79  GLY I N   1 
ATOM   6199  C  CA  . GLY I  2 60  ? 59.897  16.261   -19.671 1.00 88.54  ? 79  GLY I CA  1 
ATOM   6200  C  C   . GLY I  2 60  ? 59.266  15.569   -18.481 1.00 80.42  ? 79  GLY I C   1 
ATOM   6201  O  O   . GLY I  2 60  ? 59.173  16.143   -17.391 1.00 85.78  ? 79  GLY I O   1 
ATOM   6202  N  N   . ARG I  2 61  ? 58.799  14.344   -18.706 1.00 60.03  ? 80  ARG I N   1 
ATOM   6203  C  CA  . ARG I  2 61  ? 58.462  13.433   -17.620 1.00 53.60  ? 80  ARG I CA  1 
ATOM   6204  C  C   . ARG I  2 61  ? 59.765  13.060   -16.923 1.00 74.72  ? 80  ARG I C   1 
ATOM   6205  O  O   . ARG I  2 61  ? 60.792  12.861   -17.574 1.00 74.52  ? 80  ARG I O   1 
ATOM   6206  C  CB  . ARG I  2 61  ? 57.786  12.182   -18.176 1.00 50.56  ? 80  ARG I CB  1 
ATOM   6207  C  CG  . ARG I  2 61  ? 58.160  10.891   -17.455 1.00 60.84  ? 80  ARG I CG  1 
ATOM   6208  C  CD  . ARG I  2 61  ? 58.347  9.715    -18.423 1.00 73.27  ? 80  ARG I CD  1 
ATOM   6209  N  NE  . ARG I  2 61  ? 59.251  8.704    -17.868 1.00 99.73  ? 80  ARG I NE  1 
ATOM   6210  C  CZ  . ARG I  2 61  ? 59.801  7.717    -18.573 1.00 107.60 ? 80  ARG I CZ  1 
ATOM   6211  N  NH1 . ARG I  2 61  ? 59.534  7.602    -19.868 1.00 113.70 ? 80  ARG I NH1 1 
ATOM   6212  N  NH2 . ARG I  2 61  ? 60.620  6.847    -17.986 1.00 95.70  ? 80  ARG I NH2 1 
ATOM   6213  N  N   . PRO I  2 62  ? 59.740  12.980   -15.593 1.00 79.76  ? 81  PRO I N   1 
ATOM   6214  C  CA  . PRO I  2 62  ? 60.957  12.694   -14.827 1.00 75.16  ? 81  PRO I CA  1 
ATOM   6215  C  C   . PRO I  2 62  ? 61.488  11.287   -15.085 1.00 72.62  ? 81  PRO I C   1 
ATOM   6216  O  O   . PRO I  2 62  ? 60.715  10.325   -15.026 1.00 74.75  ? 81  PRO I O   1 
ATOM   6217  C  CB  . PRO I  2 62  ? 60.481  12.802   -13.378 1.00 59.54  ? 81  PRO I CB  1 
ATOM   6218  C  CG  . PRO I  2 62  ? 59.241  13.623   -13.443 1.00 61.46  ? 81  PRO I CG  1 
ATOM   6219  C  CD  . PRO I  2 62  ? 58.589  13.237   -14.720 1.00 62.34  ? 81  PRO I CD  1 
ATOM   6220  N  N   . THR I  2 63  ? 62.785  11.178   -15.367 1.00 59.76  ? 82  THR I N   1 
ATOM   6221  C  CA  . THR I  2 63  ? 63.428  9.884    -15.580 1.00 68.26  ? 82  THR I CA  1 
ATOM   6222  C  C   . THR I  2 63  ? 64.215  9.440    -14.346 1.00 72.94  ? 82  THR I C   1 
ATOM   6223  O  O   . THR I  2 63  ? 64.108  10.037   -13.269 1.00 66.90  ? 82  THR I O   1 
ATOM   6224  C  CB  . THR I  2 63  ? 64.376  9.896    -16.802 1.00 74.15  ? 82  THR I CB  1 
ATOM   6225  O  OG1 . THR I  2 63  ? 65.399  10.878   -16.606 1.00 57.30  ? 82  THR I OG1 1 
ATOM   6226  C  CG2 . THR I  2 63  ? 63.613  10.219   -18.068 1.00 94.08  ? 82  THR I CG2 1 
ATOM   6227  N  N   . GLU I  2 64  ? 65.007  8.383    -14.513 1.00 73.69  ? 83  GLU I N   1 
ATOM   6228  C  CA  . GLU I  2 64  ? 65.788  7.826    -13.414 1.00 66.72  ? 83  GLU I CA  1 
ATOM   6229  C  C   . GLU I  2 64  ? 67.037  8.656    -13.122 1.00 77.02  ? 83  GLU I C   1 
ATOM   6230  O  O   . GLU I  2 64  ? 67.812  8.326    -12.221 1.00 90.22  ? 83  GLU I O   1 
ATOM   6231  C  CB  . GLU I  2 64  ? 66.164  6.362    -13.704 1.00 61.92  ? 83  GLU I CB  1 
ATOM   6232  C  CG  . GLU I  2 64  ? 66.790  6.118    -15.089 1.00 107.22 ? 83  GLU I CG  1 
ATOM   6233  C  CD  . GLU I  2 64  ? 65.828  5.493    -16.106 1.00 126.07 ? 83  GLU I CD  1 
ATOM   6234  O  OE1 . GLU I  2 64  ? 65.071  6.240    -16.778 1.00 123.93 ? 83  GLU I OE1 1 
ATOM   6235  O  OE2 . GLU I  2 64  ? 65.851  4.250    -16.244 1.00 121.20 ? 83  GLU I OE2 1 
ATOM   6236  N  N   . PHE I  2 65  ? 67.227  9.741    -13.870 1.00 79.73  ? 84  PHE I N   1 
ATOM   6237  C  CA  . PHE I  2 65  ? 68.468  10.507   -13.776 1.00 84.76  ? 84  PHE I CA  1 
ATOM   6238  C  C   . PHE I  2 65  ? 68.246  12.022   -13.918 1.00 70.77  ? 84  PHE I C   1 
ATOM   6239  O  O   . PHE I  2 65  ? 69.170  12.810   -13.781 1.00 64.80  ? 84  PHE I O   1 
ATOM   6240  C  CB  . PHE I  2 65  ? 69.513  9.976    -14.791 1.00 90.11  ? 84  PHE I CB  1 
ATOM   6241  C  CG  . PHE I  2 65  ? 68.996  9.884    -16.200 1.00 109.08 ? 84  PHE I CG  1 
ATOM   6242  C  CD1 . PHE I  2 65  ? 68.774  8.657    -16.795 1.00 121.69 ? 84  PHE I CD1 1 
ATOM   6243  C  CD2 . PHE I  2 65  ? 68.706  11.043   -16.927 1.00 102.05 ? 84  PHE I CD2 1 
ATOM   6244  C  CE1 . PHE I  2 65  ? 68.274  8.589    -18.092 1.00 133.05 ? 84  PHE I CE1 1 
ATOM   6245  C  CE2 . PHE I  2 65  ? 68.207  10.983   -18.230 1.00 91.76  ? 84  PHE I CE2 1 
ATOM   6246  C  CZ  . PHE I  2 65  ? 67.993  9.761    -18.812 1.00 111.63 ? 84  PHE I CZ  1 
ATOM   6247  N  N   . VAL I  2 66  ? 67.023  12.451   -14.181 1.00 62.98  ? 85  VAL I N   1 
ATOM   6248  C  CA  . VAL I  2 66  ? 66.809  13.883   -14.324 1.00 65.35  ? 85  VAL I CA  1 
ATOM   6249  C  C   . VAL I  2 66  ? 65.360  14.288   -14.140 1.00 65.18  ? 85  VAL I C   1 
ATOM   6250  O  O   . VAL I  2 66  ? 64.442  13.569   -14.523 1.00 67.74  ? 85  VAL I O   1 
ATOM   6251  C  CB  . VAL I  2 66  ? 67.308  14.409   -15.683 1.00 59.44  ? 85  VAL I CB  1 
ATOM   6252  C  CG1 . VAL I  2 66  ? 66.400  13.929   -16.816 1.00 54.60  ? 85  VAL I CG1 1 
ATOM   6253  C  CG2 . VAL I  2 66  ? 67.368  15.912   -15.665 1.00 58.07  ? 85  VAL I CG2 1 
ATOM   6254  N  N   . ASN I  2 67  ? 65.170  15.452   -13.540 1.00 60.56  ? 86  ASN I N   1 
ATOM   6255  C  CA  . ASN I  2 67  ? 63.844  16.008   -13.347 1.00 68.28  ? 86  ASN I CA  1 
ATOM   6256  C  C   . ASN I  2 67  ? 63.847  17.513   -13.613 1.00 78.20  ? 86  ASN I C   1 
ATOM   6257  O  O   . ASN I  2 67  ? 64.418  18.303   -12.853 1.00 86.27  ? 86  ASN I O   1 
ATOM   6258  C  CB  . ASN I  2 67  ? 63.346  15.718   -11.935 1.00 75.71  ? 86  ASN I CB  1 
ATOM   6259  C  CG  . ASN I  2 67  ? 61.877  16.039   -11.758 1.00 78.48  ? 86  ASN I CG  1 
ATOM   6260  O  OD1 . ASN I  2 67  ? 61.329  16.923   -12.417 1.00 92.35  ? 86  ASN I OD1 1 
ATOM   6261  N  ND2 . ASN I  2 67  ? 61.230  15.319   -10.857 1.00 72.92  ? 86  ASN I ND2 1 
ATOM   6262  N  N   . HIS I  2 68  ? 63.214  17.898   -14.711 1.00 85.89  ? 87  HIS I N   1 
ATOM   6263  C  CA  . HIS I  2 68  ? 63.102  19.288   -15.078 1.00 76.63  ? 87  HIS I CA  1 
ATOM   6264  C  C   . HIS I  2 68  ? 61.744  19.769   -14.626 1.00 79.85  ? 87  HIS I C   1 
ATOM   6265  O  O   . HIS I  2 68  ? 60.719  19.195   -15.013 1.00 77.93  ? 87  HIS I O   1 
ATOM   6266  C  CB  . HIS I  2 68  ? 63.228  19.429   -16.586 1.00 79.44  ? 87  HIS I CB  1 
ATOM   6267  C  CG  . HIS I  2 68  ? 64.146  20.526   -17.011 1.00 97.96  ? 87  HIS I CG  1 
ATOM   6268  N  ND1 . HIS I  2 68  ? 63.727  21.828   -17.178 1.00 110.60 ? 87  HIS I ND1 1 
ATOM   6269  C  CD2 . HIS I  2 68  ? 65.466  20.518   -17.305 1.00 116.55 ? 87  HIS I CD2 1 
ATOM   6270  C  CE1 . HIS I  2 68  ? 64.747  22.574   -17.555 1.00 114.99 ? 87  HIS I CE1 1 
ATOM   6271  N  NE2 . HIS I  2 68  ? 65.816  21.804   -17.637 1.00 129.58 ? 87  HIS I NE2 1 
ATOM   6272  N  N   . TYR I  2 69  ? 61.741  20.804   -13.787 1.00 70.57  ? 88  TYR I N   1 
ATOM   6273  C  CA  . TYR I  2 69  ? 60.500  21.438   -13.347 1.00 79.40  ? 88  TYR I CA  1 
ATOM   6274  C  C   . TYR I  2 69  ? 60.519  22.953   -13.536 1.00 81.67  ? 88  TYR I C   1 
ATOM   6275  O  O   . TYR I  2 69  ? 61.481  23.615   -13.145 1.00 77.98  ? 88  TYR I O   1 
ATOM   6276  C  CB  . TYR I  2 69  ? 60.230  21.117   -11.886 1.00 86.86  ? 88  TYR I CB  1 
ATOM   6277  C  CG  . TYR I  2 69  ? 59.150  21.985   -11.278 1.00 98.38  ? 88  TYR I CG  1 
ATOM   6278  C  CD1 . TYR I  2 69  ? 59.473  23.003   -10.390 1.00 90.52  ? 88  TYR I CD1 1 
ATOM   6279  C  CD2 . TYR I  2 69  ? 57.803  21.791   -11.595 1.00 99.83  ? 88  TYR I CD2 1 
ATOM   6280  C  CE1 . TYR I  2 69  ? 58.490  23.798   -9.827  1.00 89.70  ? 88  TYR I CE1 1 
ATOM   6281  C  CE2 . TYR I  2 69  ? 56.814  22.585   -11.035 1.00 89.70  ? 88  TYR I CE2 1 
ATOM   6282  C  CZ  . TYR I  2 69  ? 57.169  23.585   -10.154 1.00 87.33  ? 88  TYR I CZ  1 
ATOM   6283  O  OH  . TYR I  2 69  ? 56.205  24.378   -9.597  1.00 86.17  ? 88  TYR I OH  1 
ATOM   6284  N  N   . CYS I  2 70  ? 59.457  23.503   -14.122 1.00 79.78  ? 89  CYS I N   1 
ATOM   6285  C  CA  . CYS I  2 70  ? 59.406  24.943   -14.380 1.00 79.83  ? 89  CYS I CA  1 
ATOM   6286  C  C   . CYS I  2 70  ? 58.098  25.605   -13.935 1.00 82.64  ? 89  CYS I C   1 
ATOM   6287  O  O   . CYS I  2 70  ? 57.067  24.947   -13.814 1.00 87.54  ? 89  CYS I O   1 
ATOM   6288  C  CB  . CYS I  2 70  ? 59.642  25.232   -15.862 1.00 75.39  ? 89  CYS I CB  1 
ATOM   6289  S  SG  . CYS I  2 70  ? 60.993  24.320   -16.591 1.00 112.47 ? 89  CYS I SG  1 
ATOM   6290  N  N   . CYS I  2 71  ? 58.156  26.914   -13.705 1.00 89.66  ? 90  CYS I N   1 
ATOM   6291  C  CA  . CYS I  2 71  ? 56.986  27.691   -13.323 1.00 104.55 ? 90  CYS I CA  1 
ATOM   6292  C  C   . CYS I  2 71  ? 57.254  29.161   -13.628 1.00 108.04 ? 90  CYS I C   1 
ATOM   6293  O  O   . CYS I  2 71  ? 58.405  29.550   -13.808 1.00 107.93 ? 90  CYS I O   1 
ATOM   6294  C  CB  . CYS I  2 71  ? 56.686  27.502   -11.838 1.00 110.54 ? 90  CYS I CB  1 
ATOM   6295  S  SG  . CYS I  2 71  ? 58.018  28.053   -10.741 1.00 115.96 ? 90  CYS I SG  1 
ATOM   6296  N  N   . ASP I  2 72  ? 56.206  29.982   -13.677 1.00 106.42 ? 91  ASP I N   1 
ATOM   6297  C  CA  . ASP I  2 72  ? 56.379  31.383   -14.070 1.00 107.05 ? 91  ASP I CA  1 
ATOM   6298  C  C   . ASP I  2 72  ? 55.695  32.442   -13.179 1.00 110.19 ? 91  ASP I C   1 
ATOM   6299  O  O   . ASP I  2 72  ? 55.200  33.454   -13.682 1.00 117.74 ? 91  ASP I O   1 
ATOM   6300  C  CB  . ASP I  2 72  ? 55.985  31.573   -15.536 1.00 102.08 ? 91  ASP I CB  1 
ATOM   6301  C  CG  . ASP I  2 72  ? 55.001  30.542   -15.997 1.00 113.45 ? 91  ASP I CG  1 
ATOM   6302  O  OD1 . ASP I  2 72  ? 55.455  29.453   -16.402 1.00 118.72 ? 91  ASP I OD1 1 
ATOM   6303  O  OD2 . ASP I  2 72  ? 53.783  30.810   -15.938 1.00 115.06 ? 91  ASP I OD2 1 
ATOM   6304  N  N   . SER I  2 73  ? 55.680  32.221   -11.866 1.00 103.80 ? 92  SER I N   1 
ATOM   6305  C  CA  . SER I  2 73  ? 55.275  33.264   -10.926 1.00 93.98  ? 92  SER I CA  1 
ATOM   6306  C  C   . SER I  2 73  ? 56.512  33.749   -10.201 1.00 104.99 ? 92  SER I C   1 
ATOM   6307  O  O   . SER I  2 73  ? 57.481  33.014   -10.069 1.00 110.99 ? 92  SER I O   1 
ATOM   6308  C  CB  . SER I  2 73  ? 54.256  32.732   -9.922  1.00 83.16  ? 92  SER I CB  1 
ATOM   6309  N  N   . HIS I  2 74  ? 56.490  34.986   -9.731  1.00 108.23 ? 93  HIS I N   1 
ATOM   6310  C  CA  . HIS I  2 74  ? 57.645  35.548   -9.037  1.00 111.71 ? 93  HIS I CA  1 
ATOM   6311  C  C   . HIS I  2 74  ? 58.238  34.589   -7.984  1.00 101.43 ? 93  HIS I C   1 
ATOM   6312  O  O   . HIS I  2 74  ? 57.504  33.899   -7.285  1.00 92.44  ? 93  HIS I O   1 
ATOM   6313  C  CB  . HIS I  2 74  ? 57.255  36.886   -8.403  1.00 120.33 ? 93  HIS I CB  1 
ATOM   6314  C  CG  . HIS I  2 74  ? 58.409  37.661   -7.841  1.00 129.83 ? 93  HIS I CG  1 
ATOM   6315  N  ND1 . HIS I  2 74  ? 58.844  37.519   -6.539  1.00 123.00 ? 93  HIS I ND1 1 
ATOM   6316  C  CD2 . HIS I  2 74  ? 59.208  38.601   -8.402  1.00 136.05 ? 93  HIS I CD2 1 
ATOM   6317  C  CE1 . HIS I  2 74  ? 59.866  38.329   -6.325  1.00 124.12 ? 93  HIS I CE1 1 
ATOM   6318  N  NE2 . HIS I  2 74  ? 60.108  38.996   -7.440  1.00 136.40 ? 93  HIS I NE2 1 
ATOM   6319  N  N   . LEU I  2 75  ? 59.568  34.549   -7.900  1.00 107.27 ? 94  LEU I N   1 
ATOM   6320  C  CA  . LEU I  2 75  ? 60.314  33.774   -6.893  1.00 106.83 ? 94  LEU I CA  1 
ATOM   6321  C  C   . LEU I  2 75  ? 59.772  32.376   -6.580  1.00 105.69 ? 94  LEU I C   1 
ATOM   6322  O  O   . LEU I  2 75  ? 60.024  31.835   -5.503  1.00 96.15  ? 94  LEU I O   1 
ATOM   6323  C  CB  . LEU I  2 75  ? 60.470  34.573   -5.592  1.00 89.05  ? 94  LEU I CB  1 
ATOM   6324  N  N   . CYS I  2 76  ? 59.075  31.782   -7.542  1.00 103.68 ? 95  CYS I N   1 
ATOM   6325  C  CA  . CYS I  2 76  ? 58.327  30.541   -7.325  1.00 103.30 ? 95  CYS I CA  1 
ATOM   6326  C  C   . CYS I  2 76  ? 59.155  29.266   -7.124  1.00 97.77  ? 95  CYS I C   1 
ATOM   6327  O  O   . CYS I  2 76  ? 58.591  28.176   -7.001  1.00 87.55  ? 95  CYS I O   1 
ATOM   6328  C  CB  . CYS I  2 76  ? 57.358  30.313   -8.490  1.00 100.57 ? 95  CYS I CB  1 
ATOM   6329  S  SG  . CYS I  2 76  ? 58.197  29.957   -10.062 1.00 145.26 ? 95  CYS I SG  1 
ATOM   6330  N  N   . ASN I  2 77  ? 60.477  29.381   -7.095  1.00 97.81  ? 96  ASN I N   1 
ATOM   6331  C  CA  . ASN I  2 77  ? 61.294  28.176   -6.980  1.00 98.31  ? 96  ASN I CA  1 
ATOM   6332  C  C   . ASN I  2 77  ? 62.149  28.082   -5.717  1.00 111.21 ? 96  ASN I C   1 
ATOM   6333  O  O   . ASN I  2 77  ? 63.253  27.551   -5.737  1.00 125.48 ? 96  ASN I O   1 
ATOM   6334  C  CB  . ASN I  2 77  ? 62.123  27.943   -8.253  1.00 101.21 ? 96  ASN I CB  1 
ATOM   6335  C  CG  . ASN I  2 77  ? 63.055  29.090   -8.572  1.00 116.58 ? 96  ASN I CG  1 
ATOM   6336  O  OD1 . ASN I  2 77  ? 62.906  30.200   -8.060  1.00 133.09 ? 96  ASN I OD1 1 
ATOM   6337  N  ND2 . ASN I  2 77  ? 64.026  28.825   -9.436  1.00 108.44 ? 96  ASN I ND2 1 
ATOM   6338  N  N   . HIS I  2 78  ? 61.627  28.586   -4.609  1.00 112.72 ? 97  HIS I N   1 
ATOM   6339  C  CA  . HIS I  2 78  ? 62.325  28.444   -3.337  1.00 120.99 ? 97  HIS I CA  1 
ATOM   6340  C  C   . HIS I  2 78  ? 61.828  27.201   -2.580  1.00 127.05 ? 97  HIS I C   1 
ATOM   6341  O  O   . HIS I  2 78  ? 62.470  26.145   -2.621  1.00 94.08  ? 97  HIS I O   1 
ATOM   6342  C  CB  . HIS I  2 78  ? 62.183  29.711   -2.484  1.00 120.67 ? 97  HIS I CB  1 
ATOM   6343  C  CG  . HIS I  2 78  ? 63.210  29.819   -1.401  1.00 140.35 ? 97  HIS I CG  1 
ATOM   6344  N  ND1 . HIS I  2 78  ? 64.565  29.820   -1.663  1.00 144.63 ? 97  HIS I ND1 1 
ATOM   6345  C  CD2 . HIS I  2 78  ? 63.086  29.911   -0.055  1.00 147.48 ? 97  HIS I CD2 1 
ATOM   6346  C  CE1 . HIS I  2 78  ? 65.231  29.915   -0.525  1.00 146.95 ? 97  HIS I CE1 1 
ATOM   6347  N  NE2 . HIS I  2 78  ? 64.357  29.972   0.466   1.00 152.88 ? 97  HIS I NE2 1 
ATOM   6348  N  N   . ASN I  2 79  ? 60.687  27.334   -1.899  1.00 152.81 ? 98  ASN I N   1 
ATOM   6349  C  CA  . ASN I  2 79  ? 60.060  26.215   -1.187  1.00 161.64 ? 98  ASN I CA  1 
ATOM   6350  C  C   . ASN I  2 79  ? 59.640  25.087   -2.140  1.00 154.22 ? 98  ASN I C   1 
ATOM   6351  O  O   . ASN I  2 79  ? 58.447  24.910   -2.392  1.00 169.16 ? 98  ASN I O   1 
ATOM   6352  C  CB  . ASN I  2 79  ? 58.820  26.692   -0.403  1.00 166.24 ? 98  ASN I CB  1 
ATOM   6353  C  CG  . ASN I  2 79  ? 59.162  27.607   0.769   1.00 159.69 ? 98  ASN I CG  1 
ATOM   6354  O  OD1 . ASN I  2 79  ? 60.164  27.415   1.455   1.00 158.49 ? 98  ASN I OD1 1 
ATOM   6355  N  ND2 . ASN I  2 79  ? 58.314  28.602   1.008   1.00 147.96 ? 98  ASN I ND2 1 
ATOM   6356  N  N   . VAL I  2 80  ? 60.602  24.323   -2.663  1.00 128.72 ? 99  VAL I N   1 
ATOM   6357  C  CA  . VAL I  2 80  ? 60.282  23.263   -3.633  1.00 112.91 ? 99  VAL I CA  1 
ATOM   6358  C  C   . VAL I  2 80  ? 61.443  22.323   -3.990  1.00 104.17 ? 99  VAL I C   1 
ATOM   6359  O  O   . VAL I  2 80  ? 62.451  22.760   -4.541  1.00 93.25  ? 99  VAL I O   1 
ATOM   6360  C  CB  . VAL I  2 80  ? 59.707  23.859   -4.942  1.00 93.81  ? 99  VAL I CB  1 
ATOM   6361  C  CG1 . VAL I  2 80  ? 60.426  25.150   -5.305  1.00 102.63 ? 99  VAL I CG1 1 
ATOM   6362  C  CG2 . VAL I  2 80  ? 59.799  22.846   -6.077  1.00 56.66  ? 99  VAL I CG2 1 
ATOM   6363  N  N   . SER I  2 81  ? 61.282  21.031   -3.693  1.00 106.21 ? 100 SER I N   1 
ATOM   6364  C  CA  . SER I  2 81  ? 62.306  20.018   -3.990  1.00 113.32 ? 100 SER I CA  1 
ATOM   6365  C  C   . SER I  2 81  ? 61.724  18.824   -4.754  1.00 102.29 ? 100 SER I C   1 
ATOM   6366  O  O   . SER I  2 81  ? 60.520  18.734   -4.941  1.00 96.43  ? 100 SER I O   1 
ATOM   6367  C  CB  . SER I  2 81  ? 62.994  19.545   -2.708  1.00 114.98 ? 100 SER I CB  1 
ATOM   6368  N  N   . LEU I  2 82  ? 62.567  17.897   -5.185  1.00 83.54  ? 101 LEU I N   1 
ATOM   6369  C  CA  . LEU I  2 82  ? 62.105  16.897   -6.143  1.00 76.46  ? 101 LEU I CA  1 
ATOM   6370  C  C   . LEU I  2 82  ? 62.612  15.471   -5.915  1.00 93.11  ? 101 LEU I C   1 
ATOM   6371  O  O   . LEU I  2 82  ? 63.659  15.267   -5.285  1.00 98.25  ? 101 LEU I O   1 
ATOM   6372  C  CB  . LEU I  2 82  ? 62.467  17.355   -7.553  1.00 76.44  ? 101 LEU I CB  1 
ATOM   6373  C  CG  . LEU I  2 82  ? 61.396  18.248   -8.157  1.00 75.36  ? 101 LEU I CG  1 
ATOM   6374  C  CD1 . LEU I  2 82  ? 61.921  19.050   -9.331  1.00 62.64  ? 101 LEU I CD1 1 
ATOM   6375  C  CD2 . LEU I  2 82  ? 60.235  17.360   -8.576  1.00 100.85 ? 101 LEU I CD2 1 
ATOM   6376  N  N   . VAL I  2 83  ? 61.854  14.495   -6.431  1.00 83.43  ? 102 VAL I N   1 
ATOM   6377  C  CA  . VAL I  2 83  ? 62.242  13.073   -6.415  1.00 82.51  ? 102 VAL I CA  1 
ATOM   6378  C  C   . VAL I  2 83  ? 62.631  12.588   -7.821  1.00 88.50  ? 102 VAL I C   1 
ATOM   6379  O  O   . VAL I  2 83  ? 62.583  13.363   -8.778  1.00 81.85  ? 102 VAL I O   1 
ATOM   6380  C  CB  . VAL I  2 83  ? 61.124  12.162   -5.841  1.00 35.28  ? 102 VAL I CB  1 
ATOM   6381  N  N   . LEU I  2 84  ? 63.014  11.315   -7.942  1.00 99.92  ? 103 LEU I N   1 
ATOM   6382  C  CA  . LEU I  2 84  ? 63.504  10.761   -9.214  1.00 98.08  ? 103 LEU I CA  1 
ATOM   6383  C  C   . LEU I  2 84  ? 62.811  9.459    -9.627  1.00 95.14  ? 103 LEU I C   1 
ATOM   6384  O  O   . LEU I  2 84  ? 61.747  9.499    -10.242 1.00 117.60 ? 103 LEU I O   1 
ATOM   6385  C  CB  . LEU I  2 84  ? 65.022  10.544   -9.179  1.00 94.26  ? 103 LEU I CB  1 
ATOM   6386  C  CG  . LEU I  2 84  ? 65.995  11.678   -9.516  1.00 64.35  ? 103 LEU I CG  1 
ATOM   6387  C  CD1 . LEU I  2 84  ? 67.028  11.172   -10.519 1.00 47.73  ? 103 LEU I CD1 1 
ATOM   6388  C  CD2 . LEU I  2 84  ? 65.275  12.885   -10.072 1.00 75.23  ? 103 LEU I CD2 1 
ATOM   6389  N  N   . GLU I  2 85  ? 63.413  8.313    -9.299  1.00 75.22  ? 104 GLU I N   1 
ATOM   6390  C  CA  . GLU I  2 85  ? 62.829  7.014    -9.663  1.00 84.86  ? 104 GLU I CA  1 
ATOM   6391  C  C   . GLU I  2 85  ? 63.107  5.858    -8.709  1.00 77.69  ? 104 GLU I C   1 
ATOM   6392  O  O   . GLU I  2 85  ? 63.264  4.716    -9.148  1.00 76.80  ? 104 GLU I O   1 
ATOM   6393  C  CB  . GLU I  2 85  ? 63.250  6.618    -11.077 1.00 97.03  ? 104 GLU I CB  1 
ATOM   6394  C  CG  . GLU I  2 85  ? 62.483  7.350    -12.162 1.00 104.45 ? 104 GLU I CG  1 
ATOM   6395  C  CD  . GLU I  2 85  ? 60.978  7.137    -12.058 1.00 108.87 ? 104 GLU I CD  1 
ATOM   6396  O  OE1 . GLU I  2 85  ? 60.497  6.682    -10.988 1.00 89.61  ? 104 GLU I OE1 1 
ATOM   6397  O  OE2 . GLU I  2 85  ? 60.278  7.425    -13.055 1.00 115.82 ? 104 GLU I OE2 1 
ATOM   6398  N  N   . PRO J  2 11  ? 92.051  24.931   -62.215 1.00 134.01 ? 30  PRO J N   1 
ATOM   6399  C  CA  . PRO J  2 11  ? 93.360  24.533   -62.753 1.00 134.87 ? 30  PRO J CA  1 
ATOM   6400  C  C   . PRO J  2 11  ? 93.942  23.355   -61.981 1.00 136.18 ? 30  PRO J C   1 
ATOM   6401  O  O   . PRO J  2 11  ? 95.106  23.412   -61.589 1.00 134.65 ? 30  PRO J O   1 
ATOM   6402  C  CB  . PRO J  2 11  ? 94.235  25.773   -62.517 1.00 124.60 ? 30  PRO J CB  1 
ATOM   6403  C  CG  . PRO J  2 11  ? 93.281  26.893   -62.202 1.00 122.38 ? 30  PRO J CG  1 
ATOM   6404  C  CD  . PRO J  2 11  ? 92.093  26.250   -61.564 1.00 127.29 ? 30  PRO J CD  1 
ATOM   6405  N  N   . LEU J  2 12  ? 93.145  22.307   -61.778 1.00 134.96 ? 31  LEU J N   1 
ATOM   6406  C  CA  . LEU J  2 12  ? 93.508  21.197   -60.888 1.00 125.78 ? 31  LEU J CA  1 
ATOM   6407  C  C   . LEU J  2 12  ? 94.675  20.341   -61.372 1.00 121.04 ? 31  LEU J C   1 
ATOM   6408  O  O   . LEU J  2 12  ? 95.095  20.437   -62.523 1.00 135.36 ? 31  LEU J O   1 
ATOM   6409  C  CB  . LEU J  2 12  ? 92.298  20.295   -60.621 1.00 127.21 ? 31  LEU J CB  1 
ATOM   6410  C  CG  . LEU J  2 12  ? 91.153  20.828   -59.752 1.00 129.37 ? 31  LEU J CG  1 
ATOM   6411  C  CD1 . LEU J  2 12  ? 90.500  22.078   -60.352 1.00 141.44 ? 31  LEU J CD1 1 
ATOM   6412  C  CD2 . LEU J  2 12  ? 90.116  19.743   -59.542 1.00 119.34 ? 31  LEU J CD2 1 
ATOM   6413  N  N   . VAL J  2 13  ? 95.178  19.496   -60.475 1.00 110.74 ? 32  VAL J N   1 
ATOM   6414  C  CA  . VAL J  2 13  ? 96.313  18.611   -60.749 1.00 115.25 ? 32  VAL J CA  1 
ATOM   6415  C  C   . VAL J  2 13  ? 96.107  17.246   -60.073 1.00 119.55 ? 32  VAL J C   1 
ATOM   6416  O  O   . VAL J  2 13  ? 95.237  17.104   -59.209 1.00 122.70 ? 32  VAL J O   1 
ATOM   6417  C  CB  . VAL J  2 13  ? 97.651  19.234   -60.266 1.00 105.22 ? 32  VAL J CB  1 
ATOM   6418  C  CG1 . VAL J  2 13  ? 97.682  19.334   -58.741 1.00 97.66  ? 32  VAL J CG1 1 
ATOM   6419  C  CG2 . VAL J  2 13  ? 98.854  18.437   -60.789 1.00 108.14 ? 32  VAL J CG2 1 
ATOM   6420  N  N   . THR J  2 14  ? 96.906  16.253   -60.461 1.00 118.15 ? 33  THR J N   1 
ATOM   6421  C  CA  . THR J  2 14  ? 96.752  14.895   -59.946 1.00 115.95 ? 33  THR J CA  1 
ATOM   6422  C  C   . THR J  2 14  ? 97.914  14.493   -59.046 1.00 118.35 ? 33  THR J C   1 
ATOM   6423  O  O   . THR J  2 14  ? 99.068  14.618   -59.433 1.00 121.94 ? 33  THR J O   1 
ATOM   6424  C  CB  . THR J  2 14  ? 96.627  13.880   -61.090 1.00 110.12 ? 33  THR J CB  1 
ATOM   6425  O  OG1 . THR J  2 14  ? 95.544  14.258   -61.945 1.00 111.59 ? 33  THR J OG1 1 
ATOM   6426  C  CG2 . THR J  2 14  ? 96.357  12.497   -60.544 1.00 102.85 ? 33  THR J CG2 1 
ATOM   6427  N  N   . CYS J  2 15  ? 97.601  14.006   -57.847 1.00 118.20 ? 34  CYS J N   1 
ATOM   6428  C  CA  . CYS J  2 15  ? 98.613  13.651   -56.851 1.00 108.99 ? 34  CYS J CA  1 
ATOM   6429  C  C   . CYS J  2 15  ? 98.505  12.194   -56.403 1.00 109.15 ? 34  CYS J C   1 
ATOM   6430  O  O   . CYS J  2 15  ? 97.426  11.593   -56.459 1.00 120.74 ? 34  CYS J O   1 
ATOM   6431  C  CB  . CYS J  2 15  ? 98.500  14.550   -55.615 1.00 104.76 ? 34  CYS J CB  1 
ATOM   6432  S  SG  . CYS J  2 15  ? 97.876  16.224   -55.898 1.00 139.94 ? 34  CYS J SG  1 
ATOM   6433  N  N   . THR J  2 16  ? 99.629  11.640   -55.946 1.00 104.46 ? 35  THR J N   1 
ATOM   6434  C  CA  . THR J  2 16  ? 99.654  10.305   -55.360 1.00 111.78 ? 35  THR J CA  1 
ATOM   6435  C  C   . THR J  2 16  ? 98.973  10.389   -54.010 1.00 116.77 ? 35  THR J C   1 
ATOM   6436  O  O   . THR J  2 16  ? 99.108  11.392   -53.309 1.00 112.37 ? 35  THR J O   1 
ATOM   6437  C  CB  . THR J  2 16  ? 101.089 9.784    -55.144 1.00 112.70 ? 35  THR J CB  1 
ATOM   6438  O  OG1 . THR J  2 16  ? 101.885 10.037   -56.306 1.00 128.67 ? 35  THR J OG1 1 
ATOM   6439  C  CG2 . THR J  2 16  ? 101.074 8.297    -54.872 1.00 106.19 ? 35  THR J CG2 1 
ATOM   6440  N  N   . CYS J  2 17  ? 98.247  9.339    -53.642 1.00 121.07 ? 36  CYS J N   1 
ATOM   6441  C  CA  . CYS J  2 17  ? 97.458  9.358    -52.416 1.00 114.87 ? 36  CYS J CA  1 
ATOM   6442  C  C   . CYS J  2 17  ? 97.731  8.153    -51.516 1.00 124.75 ? 36  CYS J C   1 
ATOM   6443  O  O   . CYS J  2 17  ? 97.084  7.114    -51.642 1.00 134.67 ? 36  CYS J O   1 
ATOM   6444  C  CB  . CYS J  2 17  ? 95.970  9.438    -52.758 1.00 116.15 ? 36  CYS J CB  1 
ATOM   6445  S  SG  . CYS J  2 17  ? 94.898  9.716    -51.345 1.00 120.91 ? 36  CYS J SG  1 
ATOM   6446  N  N   . GLU J  2 18  ? 98.696  8.300    -50.612 1.00 125.05 ? 37  GLU J N   1 
ATOM   6447  C  CA  . GLU J  2 18  ? 99.005  7.268    -49.626 1.00 119.24 ? 37  GLU J CA  1 
ATOM   6448  C  C   . GLU J  2 18  ? 98.631  7.789    -48.241 1.00 116.74 ? 37  GLU J C   1 
ATOM   6449  O  O   . GLU J  2 18  ? 99.415  8.479    -47.583 1.00 111.80 ? 37  GLU J O   1 
ATOM   6450  C  CB  . GLU J  2 18  ? 100.488 6.858    -49.692 1.00 113.61 ? 37  GLU J CB  1 
ATOM   6451  C  CG  . GLU J  2 18  ? 100.914 6.282    -51.041 1.00 121.63 ? 37  GLU J CG  1 
ATOM   6452  C  CD  . GLU J  2 18  ? 102.381 5.904    -51.095 1.00 127.58 ? 37  GLU J CD  1 
ATOM   6453  O  OE1 . GLU J  2 18  ? 102.878 5.593    -52.201 1.00 125.76 ? 37  GLU J OE1 1 
ATOM   6454  O  OE2 . GLU J  2 18  ? 103.036 5.913    -50.034 1.00 126.26 ? 37  GLU J OE2 1 
ATOM   6455  N  N   . SER J  2 19  ? 97.417  7.464    -47.815 1.00 115.92 ? 38  SER J N   1 
ATOM   6456  C  CA  . SER J  2 19  ? 96.882  7.977    -46.562 1.00 115.38 ? 38  SER J CA  1 
ATOM   6457  C  C   . SER J  2 19  ? 95.599  7.245    -46.192 1.00 121.12 ? 38  SER J C   1 
ATOM   6458  O  O   . SER J  2 19  ? 95.013  6.571    -47.036 1.00 133.65 ? 38  SER J O   1 
ATOM   6459  C  CB  . SER J  2 19  ? 96.610  9.473    -46.688 1.00 99.61  ? 38  SER J CB  1 
ATOM   6460  O  OG  . SER J  2 19  ? 95.746  9.909    -45.659 1.00 75.95  ? 38  SER J OG  1 
ATOM   6461  N  N   . PRO J  2 20  ? 95.165  7.363    -44.926 1.00 114.85 ? 39  PRO J N   1 
ATOM   6462  C  CA  . PRO J  2 20  ? 93.909  6.757    -44.475 1.00 116.54 ? 39  PRO J CA  1 
ATOM   6463  C  C   . PRO J  2 20  ? 92.665  7.344    -45.151 1.00 118.52 ? 39  PRO J C   1 
ATOM   6464  O  O   . PRO J  2 20  ? 91.772  6.599    -45.554 1.00 114.97 ? 39  PRO J O   1 
ATOM   6465  C  CB  . PRO J  2 20  ? 93.901  7.049    -42.970 1.00 107.50 ? 39  PRO J CB  1 
ATOM   6466  C  CG  . PRO J  2 20  ? 94.898  8.133    -42.771 1.00 100.56 ? 39  PRO J CG  1 
ATOM   6467  C  CD  . PRO J  2 20  ? 95.935  7.917    -43.802 1.00 109.85 ? 39  PRO J CD  1 
ATOM   6468  N  N   . HIS J  2 21  ? 92.611  8.663    -45.277 1.00 114.83 ? 40  HIS J N   1 
ATOM   6469  C  CA  . HIS J  2 21  ? 91.467  9.322    -45.895 1.00 117.68 ? 40  HIS J CA  1 
ATOM   6470  C  C   . HIS J  2 21  ? 91.500  9.192    -47.422 1.00 120.94 ? 40  HIS J C   1 
ATOM   6471  O  O   . HIS J  2 21  ? 91.088  10.100   -48.139 1.00 101.55 ? 40  HIS J O   1 
ATOM   6472  C  CB  . HIS J  2 21  ? 91.432  10.803   -45.504 1.00 114.40 ? 40  HIS J CB  1 
ATOM   6473  C  CG  . HIS J  2 21  ? 91.638  11.055   -44.042 1.00 131.14 ? 40  HIS J CG  1 
ATOM   6474  N  ND1 . HIS J  2 21  ? 92.314  12.159   -43.569 1.00 146.50 ? 40  HIS J ND1 1 
ATOM   6475  C  CD2 . HIS J  2 21  ? 91.253  10.355   -42.949 1.00 145.44 ? 40  HIS J CD2 1 
ATOM   6476  C  CE1 . HIS J  2 21  ? 92.341  12.128   -42.249 1.00 152.87 ? 40  HIS J CE1 1 
ATOM   6477  N  NE2 . HIS J  2 21  ? 91.705  11.043   -41.847 1.00 158.10 ? 40  HIS J NE2 1 
ATOM   6478  N  N   . CYS J  2 22  ? 91.987  8.062    -47.920 1.00 129.52 ? 41  CYS J N   1 
ATOM   6479  C  CA  . CYS J  2 22  ? 92.157  7.892    -49.360 1.00 130.65 ? 41  CYS J CA  1 
ATOM   6480  C  C   . CYS J  2 22  ? 91.068  7.037    -49.997 1.00 130.86 ? 41  CYS J C   1 
ATOM   6481  O  O   . CYS J  2 22  ? 90.940  5.849    -49.696 1.00 125.98 ? 41  CYS J O   1 
ATOM   6482  C  CB  . CYS J  2 22  ? 93.536  7.300    -49.685 1.00 138.63 ? 41  CYS J CB  1 
ATOM   6483  S  SG  . CYS J  2 22  ? 94.897  8.494    -49.721 1.00 198.76 ? 41  CYS J SG  1 
ATOM   6484  N  N   . LYS J  2 23  ? 90.292  7.652    -50.886 1.00 134.83 ? 42  LYS J N   1 
ATOM   6485  C  CA  . LYS J  2 23  ? 89.305  6.937    -51.688 1.00 128.25 ? 42  LYS J CA  1 
ATOM   6486  C  C   . LYS J  2 23  ? 89.906  6.575    -53.049 1.00 132.53 ? 42  LYS J C   1 
ATOM   6487  O  O   . LYS J  2 23  ? 89.425  7.031    -54.087 1.00 144.83 ? 42  LYS J O   1 
ATOM   6488  C  CB  . LYS J  2 23  ? 88.044  7.787    -51.874 1.00 105.47 ? 42  LYS J CB  1 
ATOM   6489  N  N   . GLY J  2 24  ? 90.963  5.762    -53.033 1.00 114.72 ? 43  GLY J N   1 
ATOM   6490  C  CA  . GLY J  2 24  ? 91.668  5.396    -54.247 1.00 114.45 ? 43  GLY J CA  1 
ATOM   6491  C  C   . GLY J  2 24  ? 93.174  5.339    -54.063 1.00 125.09 ? 43  GLY J C   1 
ATOM   6492  O  O   . GLY J  2 24  ? 93.666  5.434    -52.940 1.00 125.49 ? 43  GLY J O   1 
ATOM   6493  N  N   . PRO J  2 25  ? 93.915  5.166    -55.171 1.00 135.33 ? 44  PRO J N   1 
ATOM   6494  C  CA  . PRO J  2 25  ? 95.380  5.135    -55.170 1.00 125.48 ? 44  PRO J CA  1 
ATOM   6495  C  C   . PRO J  2 25  ? 95.949  6.511    -55.496 1.00 135.08 ? 44  PRO J C   1 
ATOM   6496  O  O   . PRO J  2 25  ? 97.112  6.784    -55.202 1.00 125.38 ? 44  PRO J O   1 
ATOM   6497  C  CB  . PRO J  2 25  ? 95.687  4.177    -56.310 1.00 121.11 ? 44  PRO J CB  1 
ATOM   6498  C  CG  . PRO J  2 25  ? 94.600  4.468    -57.301 1.00 135.85 ? 44  PRO J CG  1 
ATOM   6499  C  CD  . PRO J  2 25  ? 93.368  4.844    -56.501 1.00 139.92 ? 44  PRO J CD  1 
ATOM   6500  N  N   . THR J  2 26  ? 95.127  7.358    -56.115 1.00 141.79 ? 45  THR J N   1 
ATOM   6501  C  CA  . THR J  2 26  ? 95.511  8.725    -56.456 1.00 128.78 ? 45  THR J CA  1 
ATOM   6502  C  C   . THR J  2 26  ? 94.302  9.624    -56.326 1.00 121.69 ? 45  THR J C   1 
ATOM   6503  O  O   . THR J  2 26  ? 93.170  9.150    -56.292 1.00 113.32 ? 45  THR J O   1 
ATOM   6504  C  CB  . THR J  2 26  ? 96.020  8.847    -57.906 1.00 114.20 ? 45  THR J CB  1 
ATOM   6505  O  OG1 . THR J  2 26  ? 94.906  8.847    -58.810 1.00 100.88 ? 45  THR J OG1 1 
ATOM   6506  C  CG2 . THR J  2 26  ? 96.959  7.705    -58.242 1.00 117.43 ? 45  THR J CG2 1 
ATOM   6507  N  N   . CYS J  2 27  ? 94.545  10.926   -56.272 1.00 124.36 ? 46  CYS J N   1 
ATOM   6508  C  CA  . CYS J  2 27  ? 93.456  11.881   -56.126 1.00 121.72 ? 46  CYS J CA  1 
ATOM   6509  C  C   . CYS J  2 27  ? 93.741  13.164   -56.897 1.00 111.28 ? 46  CYS J C   1 
ATOM   6510  O  O   . CYS J  2 27  ? 94.846  13.359   -57.383 1.00 107.82 ? 46  CYS J O   1 
ATOM   6511  C  CB  . CYS J  2 27  ? 93.226  12.188   -54.647 1.00 122.75 ? 46  CYS J CB  1 
ATOM   6512  S  SG  . CYS J  2 27  ? 94.687  12.806   -53.768 1.00 135.33 ? 46  CYS J SG  1 
ATOM   6513  N  N   . ARG J  2 28  ? 92.742  14.032   -57.016 1.00 102.87 ? 47  ARG J N   1 
ATOM   6514  C  CA  . ARG J  2 28  ? 92.921  15.304   -57.706 1.00 99.67  ? 47  ARG J CA  1 
ATOM   6515  C  C   . ARG J  2 28  ? 92.708  16.477   -56.747 1.00 98.24  ? 47  ARG J C   1 
ATOM   6516  O  O   . ARG J  2 28  ? 91.901  16.387   -55.825 1.00 94.49  ? 47  ARG J O   1 
ATOM   6517  C  CB  . ARG J  2 28  ? 91.977  15.404   -58.912 1.00 95.27  ? 47  ARG J CB  1 
ATOM   6518  C  CG  . ARG J  2 28  ? 92.275  14.432   -60.056 1.00 90.91  ? 47  ARG J CG  1 
ATOM   6519  C  CD  . ARG J  2 28  ? 91.521  14.836   -61.318 1.00 100.78 ? 47  ARG J CD  1 
ATOM   6520  N  NE  . ARG J  2 28  ? 91.699  16.255   -61.625 1.00 119.19 ? 47  ARG J NE  1 
ATOM   6521  C  CZ  . ARG J  2 28  ? 92.685  16.743   -62.373 1.00 121.11 ? 47  ARG J CZ  1 
ATOM   6522  N  NH1 . ARG J  2 28  ? 93.583  15.925   -62.903 1.00 118.44 ? 47  ARG J NH1 1 
ATOM   6523  N  NH2 . ARG J  2 28  ? 92.772  18.050   -62.596 1.00 111.71 ? 47  ARG J NH2 1 
ATOM   6524  N  N   . GLY J  2 29  ? 93.434  17.572   -56.955 1.00 97.78  ? 48  GLY J N   1 
ATOM   6525  C  CA  . GLY J  2 29  ? 93.332  18.716   -56.064 1.00 89.23  ? 48  GLY J CA  1 
ATOM   6526  C  C   . GLY J  2 29  ? 94.050  19.945   -56.575 1.00 88.16  ? 48  GLY J C   1 
ATOM   6527  O  O   . GLY J  2 29  ? 94.453  19.987   -57.733 1.00 110.85 ? 48  GLY J O   1 
ATOM   6528  N  N   . ALA J  2 30  ? 94.220  20.944   -55.712 1.00 71.92  ? 49  ALA J N   1 
ATOM   6529  C  CA  . ALA J  2 30  ? 94.867  22.203   -56.102 1.00 72.91  ? 49  ALA J CA  1 
ATOM   6530  C  C   . ALA J  2 30  ? 96.383  22.086   -56.151 1.00 78.69  ? 49  ALA J C   1 
ATOM   6531  O  O   . ALA J  2 30  ? 97.060  22.670   -56.998 1.00 78.10  ? 49  ALA J O   1 
ATOM   6532  C  CB  . ALA J  2 30  ? 94.471  23.319   -55.152 1.00 66.46  ? 49  ALA J CB  1 
ATOM   6533  N  N   . TRP J  2 31  ? 96.912  21.335   -55.208 1.00 90.13  ? 50  TRP J N   1 
ATOM   6534  C  CA  . TRP J  2 31  ? 98.329  21.092   -55.160 1.00 84.52  ? 50  TRP J CA  1 
ATOM   6535  C  C   . TRP J  2 31  ? 98.540  19.771   -54.441 1.00 92.19  ? 50  TRP J C   1 
ATOM   6536  O  O   . TRP J  2 31  ? 97.621  19.245   -53.804 1.00 100.42 ? 50  TRP J O   1 
ATOM   6537  C  CB  . TRP J  2 31  ? 99.035  22.235   -54.434 1.00 74.76  ? 50  TRP J CB  1 
ATOM   6538  C  CG  . TRP J  2 31  ? 98.682  22.358   -52.978 1.00 81.46  ? 50  TRP J CG  1 
ATOM   6539  C  CD1 . TRP J  2 31  ? 99.136  21.579   -51.954 1.00 91.23  ? 50  TRP J CD1 1 
ATOM   6540  C  CD2 . TRP J  2 31  ? 97.822  23.334   -52.385 1.00 84.20  ? 50  TRP J CD2 1 
ATOM   6541  N  NE1 . TRP J  2 31  ? 98.602  21.996   -50.761 1.00 82.42  ? 50  TRP J NE1 1 
ATOM   6542  C  CE2 . TRP J  2 31  ? 97.795  23.076   -50.995 1.00 91.50  ? 50  TRP J CE2 1 
ATOM   6543  C  CE3 . TRP J  2 31  ? 97.065  24.395   -52.892 1.00 73.91  ? 50  TRP J CE3 1 
ATOM   6544  C  CZ2 . TRP J  2 31  ? 97.039  23.838   -50.106 1.00 108.14 ? 50  TRP J CZ2 1 
ATOM   6545  C  CZ3 . TRP J  2 31  ? 96.317  25.154   -52.011 1.00 92.74  ? 50  TRP J CZ3 1 
ATOM   6546  C  CH2 . TRP J  2 31  ? 96.306  24.870   -50.631 1.00 112.09 ? 50  TRP J CH2 1 
ATOM   6547  N  N   . CYS J  2 32  ? 99.746  19.231   -54.548 1.00 87.15  ? 51  CYS J N   1 
ATOM   6548  C  CA  . CYS J  2 32  ? 100.073 17.971   -53.900 1.00 87.51  ? 51  CYS J CA  1 
ATOM   6549  C  C   . CYS J  2 32  ? 100.879 18.180   -52.633 1.00 77.82  ? 51  CYS J C   1 
ATOM   6550  O  O   . CYS J  2 32  ? 101.654 19.145   -52.513 1.00 84.20  ? 51  CYS J O   1 
ATOM   6551  C  CB  . CYS J  2 32  ? 100.817 17.050   -54.858 1.00 91.85  ? 51  CYS J CB  1 
ATOM   6552  S  SG  . CYS J  2 32  ? 99.823  16.593   -56.279 1.00 98.14  ? 51  CYS J SG  1 
ATOM   6553  N  N   . THR J  2 33  ? 100.685 17.259   -51.697 1.00 61.16  ? 52  THR J N   1 
ATOM   6554  C  CA  . THR J  2 33  ? 101.308 17.339   -50.389 1.00 72.77  ? 52  THR J CA  1 
ATOM   6555  C  C   . THR J  2 33  ? 102.053 16.058   -50.010 1.00 79.31  ? 52  THR J C   1 
ATOM   6556  O  O   . THR J  2 33  ? 101.659 14.941   -50.367 1.00 89.28  ? 52  THR J O   1 
ATOM   6557  C  CB  . THR J  2 33  ? 100.270 17.621   -49.267 1.00 86.74  ? 52  THR J CB  1 
ATOM   6558  O  OG1 . THR J  2 33  ? 99.376  16.505   -49.140 1.00 85.28  ? 52  THR J OG1 1 
ATOM   6559  C  CG2 . THR J  2 33  ? 99.477  18.891   -49.546 1.00 90.53  ? 52  THR J CG2 1 
ATOM   6560  N  N   . VAL J  2 34  ? 103.140 16.254   -49.279 1.00 75.25  ? 53  VAL J N   1 
ATOM   6561  C  CA  . VAL J  2 34  ? 103.806 15.202   -48.547 1.00 79.50  ? 53  VAL J CA  1 
ATOM   6562  C  C   . VAL J  2 34  ? 103.999 15.764   -47.152 1.00 80.05  ? 53  VAL J C   1 
ATOM   6563  O  O   . VAL J  2 34  ? 104.612 16.823   -46.972 1.00 97.17  ? 53  VAL J O   1 
ATOM   6564  C  CB  . VAL J  2 34  ? 105.170 14.872   -49.165 1.00 88.04  ? 53  VAL J CB  1 
ATOM   6565  C  CG1 . VAL J  2 34  ? 106.043 14.100   -48.180 1.00 88.40  ? 53  VAL J CG1 1 
ATOM   6566  C  CG2 . VAL J  2 34  ? 104.984 14.092   -50.459 1.00 96.53  ? 53  VAL J CG2 1 
ATOM   6567  N  N   . VAL J  2 35  ? 103.451 15.079   -46.160 1.00 64.74  ? 54  VAL J N   1 
ATOM   6568  C  CA  . VAL J  2 35  ? 103.509 15.601   -44.805 1.00 66.67  ? 54  VAL J CA  1 
ATOM   6569  C  C   . VAL J  2 35  ? 103.918 14.562   -43.762 1.00 71.52  ? 54  VAL J C   1 
ATOM   6570  O  O   . VAL J  2 35  ? 103.384 13.443   -43.717 1.00 74.66  ? 54  VAL J O   1 
ATOM   6571  C  CB  . VAL J  2 35  ? 102.191 16.266   -44.413 1.00 58.98  ? 54  VAL J CB  1 
ATOM   6572  C  CG1 . VAL J  2 35  ? 101.055 15.738   -45.268 1.00 64.05  ? 54  VAL J CG1 1 
ATOM   6573  C  CG2 . VAL J  2 35  ? 101.915 16.061   -42.941 1.00 46.70  ? 54  VAL J CG2 1 
ATOM   6574  N  N   . LEU J  2 36  ? 104.876 14.953   -42.927 1.00 70.30  ? 55  LEU J N   1 
ATOM   6575  C  CA  . LEU J  2 36  ? 105.456 14.063   -41.935 1.00 76.82  ? 55  LEU J CA  1 
ATOM   6576  C  C   . LEU J  2 36  ? 105.005 14.461   -40.518 1.00 74.42  ? 55  LEU J C   1 
ATOM   6577  O  O   . LEU J  2 36  ? 105.171 15.619   -40.113 1.00 78.44  ? 55  LEU J O   1 
ATOM   6578  C  CB  . LEU J  2 36  ? 106.985 14.106   -42.046 1.00 82.97  ? 55  LEU J CB  1 
ATOM   6579  C  CG  . LEU J  2 36  ? 107.770 12.793   -41.933 1.00 77.34  ? 55  LEU J CG  1 
ATOM   6580  C  CD1 . LEU J  2 36  ? 109.156 13.074   -41.408 1.00 66.76  ? 55  LEU J CD1 1 
ATOM   6581  C  CD2 . LEU J  2 36  ? 107.074 11.798   -41.036 1.00 90.54  ? 55  LEU J CD2 1 
ATOM   6582  N  N   . VAL J  2 37  ? 104.444 13.508   -39.768 1.00 46.27  ? 56  VAL J N   1 
ATOM   6583  C  CA  . VAL J  2 37  ? 103.930 13.823   -38.447 1.00 39.55  ? 56  VAL J CA  1 
ATOM   6584  C  C   . VAL J  2 37  ? 104.336 12.895   -37.332 1.00 49.59  ? 56  VAL J C   1 
ATOM   6585  O  O   . VAL J  2 37  ? 104.293 11.684   -37.481 1.00 74.74  ? 56  VAL J O   1 
ATOM   6586  C  CB  . VAL J  2 37  ? 102.425 13.806   -38.440 1.00 48.44  ? 56  VAL J CB  1 
ATOM   6587  C  CG1 . VAL J  2 37  ? 101.919 14.671   -37.302 1.00 51.75  ? 56  VAL J CG1 1 
ATOM   6588  C  CG2 . VAL J  2 37  ? 101.906 14.313   -39.756 1.00 73.74  ? 56  VAL J CG2 1 
ATOM   6589  N  N   . ARG J  2 38  ? 104.666 13.483   -36.189 1.00 52.46  ? 57  ARG J N   1 
ATOM   6590  C  CA  . ARG J  2 38  ? 105.010 12.730   -34.995 1.00 68.99  ? 57  ARG J CA  1 
ATOM   6591  C  C   . ARG J  2 38  ? 103.829 12.866   -34.061 1.00 71.31  ? 57  ARG J C   1 
ATOM   6592  O  O   . ARG J  2 38  ? 103.822 13.729   -33.186 1.00 78.74  ? 57  ARG J O   1 
ATOM   6593  C  CB  . ARG J  2 38  ? 106.289 13.298   -34.355 1.00 53.14  ? 57  ARG J CB  1 
ATOM   6594  C  CG  . ARG J  2 38  ? 106.767 12.604   -33.071 1.00 68.95  ? 57  ARG J CG  1 
ATOM   6595  C  CD  . ARG J  2 38  ? 107.913 11.629   -33.339 1.00 88.44  ? 57  ARG J CD  1 
ATOM   6596  N  NE  . ARG J  2 38  ? 108.617 11.190   -32.129 1.00 95.70  ? 57  ARG J NE  1 
ATOM   6597  C  CZ  . ARG J  2 38  ? 109.696 11.789   -31.626 1.00 112.36 ? 57  ARG J CZ  1 
ATOM   6598  N  NH1 . ARG J  2 38  ? 110.203 12.876   -32.206 1.00 100.97 ? 57  ARG J NH1 1 
ATOM   6599  N  NH2 . ARG J  2 38  ? 110.270 11.303   -30.535 1.00 115.47 ? 57  ARG J NH2 1 
ATOM   6600  N  N   . GLU J  2 39  ? 102.803 12.045   -34.253 1.00 74.40  ? 58  GLU J N   1 
ATOM   6601  C  CA  . GLU J  2 39  ? 101.613 12.224   -33.428 1.00 90.24  ? 58  GLU J CA  1 
ATOM   6602  C  C   . GLU J  2 39  ? 101.679 11.420   -32.141 1.00 111.03 ? 58  GLU J C   1 
ATOM   6603  O  O   . GLU J  2 39  ? 102.111 10.268   -32.135 1.00 107.53 ? 58  GLU J O   1 
ATOM   6604  C  CB  . GLU J  2 39  ? 100.312 11.948   -34.190 1.00 71.32  ? 58  GLU J CB  1 
ATOM   6605  C  CG  . GLU J  2 39  ? 99.125  12.732   -33.613 1.00 83.18  ? 58  GLU J CG  1 
ATOM   6606  C  CD  . GLU J  2 39  ? 97.997  12.940   -34.616 1.00 97.52  ? 58  GLU J CD  1 
ATOM   6607  O  OE1 . GLU J  2 39  ? 98.061  12.277   -35.687 1.00 91.55  ? 58  GLU J OE1 1 
ATOM   6608  O  OE2 . GLU J  2 39  ? 97.066  13.761   -34.333 1.00 76.41  ? 58  GLU J OE2 1 
ATOM   6609  N  N   . GLU J  2 40  ? 101.266 12.064   -31.055 1.00 125.25 ? 59  GLU J N   1 
ATOM   6610  C  CA  . GLU J  2 40  ? 101.212 11.447   -29.733 1.00 127.72 ? 59  GLU J CA  1 
ATOM   6611  C  C   . GLU J  2 40  ? 102.049 10.183   -29.582 1.00 94.51  ? 59  GLU J C   1 
ATOM   6612  O  O   . GLU J  2 40  ? 101.594 9.085    -29.891 1.00 48.95  ? 59  GLU J O   1 
ATOM   6613  C  CB  . GLU J  2 40  ? 99.763  11.173   -29.333 1.00 143.69 ? 59  GLU J CB  1 
ATOM   6614  C  CG  . GLU J  2 40  ? 98.931  10.485   -30.402 1.00 134.72 ? 59  GLU J CG  1 
ATOM   6615  C  CD  . GLU J  2 40  ? 97.445  10.749   -30.226 1.00 117.39 ? 59  GLU J CD  1 
ATOM   6616  O  OE1 . GLU J  2 40  ? 96.638  9.952    -30.736 1.00 106.79 ? 59  GLU J OE1 1 
ATOM   6617  O  OE2 . GLU J  2 40  ? 97.085  11.755   -29.574 1.00 100.56 ? 59  GLU J OE2 1 
ATOM   6618  N  N   . GLY J  2 41  ? 103.280 10.377   -29.113 1.00 95.42  ? 60  GLY J N   1 
ATOM   6619  C  CA  . GLY J  2 41  ? 104.179 9.314    -28.705 1.00 64.72  ? 60  GLY J CA  1 
ATOM   6620  C  C   . GLY J  2 41  ? 104.754 8.535    -29.858 1.00 87.15  ? 60  GLY J C   1 
ATOM   6621  O  O   . GLY J  2 41  ? 105.966 8.265    -29.941 1.00 76.85  ? 60  GLY J O   1 
ATOM   6622  N  N   . ARG J  2 42  ? 103.863 8.177    -30.766 1.00 94.98  ? 61  ARG J N   1 
ATOM   6623  C  CA  . ARG J  2 42  ? 104.201 7.224    -31.800 1.00 106.09 ? 61  ARG J CA  1 
ATOM   6624  C  C   . ARG J  2 42  ? 105.426 7.660    -32.611 1.00 101.72 ? 61  ARG J C   1 
ATOM   6625  O  O   . ARG J  2 42  ? 105.899 8.792    -32.514 1.00 108.66 ? 61  ARG J O   1 
ATOM   6626  C  CB  . ARG J  2 42  ? 102.978 6.947    -32.695 1.00 82.65  ? 61  ARG J CB  1 
ATOM   6627  C  CG  . ARG J  2 42  ? 101.815 6.223    -31.993 1.00 37.34  ? 61  ARG J CG  1 
ATOM   6628  C  CD  . ARG J  2 42  ? 100.695 5.864    -32.977 1.00 41.41  ? 61  ARG J CD  1 
ATOM   6629  N  N   . HIS J  2 43  ? 105.958 6.730    -33.383 1.00 102.60 ? 62  HIS J N   1 
ATOM   6630  C  CA  . HIS J  2 43  ? 106.974 7.061    -34.358 1.00 101.76 ? 62  HIS J CA  1 
ATOM   6631  C  C   . HIS J  2 43  ? 106.316 7.849    -35.485 1.00 108.48 ? 62  HIS J C   1 
ATOM   6632  O  O   . HIS J  2 43  ? 105.126 7.704    -35.745 1.00 114.94 ? 62  HIS J O   1 
ATOM   6633  C  CB  . HIS J  2 43  ? 107.633 5.788    -34.893 1.00 102.45 ? 62  HIS J CB  1 
ATOM   6634  N  N   . PRO J  2 44  ? 107.092 8.702    -36.150 1.00 108.77 ? 63  PRO J N   1 
ATOM   6635  C  CA  . PRO J  2 44  ? 106.610 9.540    -37.249 1.00 101.68 ? 63  PRO J CA  1 
ATOM   6636  C  C   . PRO J  2 44  ? 106.027 8.742    -38.413 1.00 96.28  ? 63  PRO J C   1 
ATOM   6637  O  O   . PRO J  2 44  ? 106.584 7.714    -38.779 1.00 104.51 ? 63  PRO J O   1 
ATOM   6638  C  CB  . PRO J  2 44  ? 107.869 10.294   -37.691 1.00 83.67  ? 63  PRO J CB  1 
ATOM   6639  C  CG  . PRO J  2 44  ? 109.000 9.550    -37.105 1.00 94.71  ? 63  PRO J CG  1 
ATOM   6640  C  CD  . PRO J  2 44  ? 108.494 8.985    -35.830 1.00 110.08 ? 63  PRO J CD  1 
ATOM   6641  N  N   . GLN J  2 45  ? 104.914 9.221    -38.970 1.00 81.65  ? 64  GLN J N   1 
ATOM   6642  C  CA  . GLN J  2 45  ? 104.293 8.626    -40.153 1.00 75.71  ? 64  GLN J CA  1 
ATOM   6643  C  C   . GLN J  2 45  ? 104.219 9.668    -41.270 1.00 77.33  ? 64  GLN J C   1 
ATOM   6644  O  O   . GLN J  2 45  ? 104.174 10.871   -41.010 1.00 92.94  ? 64  GLN J O   1 
ATOM   6645  C  CB  . GLN J  2 45  ? 102.898 8.089    -39.826 1.00 89.31  ? 64  GLN J CB  1 
ATOM   6646  N  N   . GLU J  2 46  ? 104.186 9.207    -42.512 1.00 67.67  ? 65  GLU J N   1 
ATOM   6647  C  CA  . GLU J  2 46  ? 104.337 10.094   -43.648 1.00 73.62  ? 65  GLU J CA  1 
ATOM   6648  C  C   . GLU J  2 46  ? 103.192 9.907    -44.630 1.00 89.77  ? 65  GLU J C   1 
ATOM   6649  O  O   . GLU J  2 46  ? 103.120 8.887    -45.305 1.00 87.24  ? 65  GLU J O   1 
ATOM   6650  C  CB  . GLU J  2 46  ? 105.680 9.797    -44.319 1.00 76.74  ? 65  GLU J CB  1 
ATOM   6651  C  CG  . GLU J  2 46  ? 106.076 10.681   -45.490 1.00 89.30  ? 65  GLU J CG  1 
ATOM   6652  C  CD  . GLU J  2 46  ? 107.431 10.283   -46.090 1.00 104.69 ? 65  GLU J CD  1 
ATOM   6653  O  OE1 . GLU J  2 46  ? 107.642 9.080    -46.368 1.00 99.51  ? 65  GLU J OE1 1 
ATOM   6654  O  OE2 . GLU J  2 46  ? 108.293 11.172   -46.275 1.00 104.68 ? 65  GLU J OE2 1 
ATOM   6655  N  N   . HIS J  2 47  ? 102.299 10.892   -44.713 1.00 100.71 ? 66  HIS J N   1 
ATOM   6656  C  CA  . HIS J  2 47  ? 101.187 10.825   -45.657 1.00 89.28  ? 66  HIS J CA  1 
ATOM   6657  C  C   . HIS J  2 47  ? 101.504 11.581   -46.954 1.00 82.08  ? 66  HIS J C   1 
ATOM   6658  O  O   . HIS J  2 47  ? 102.302 12.522   -46.966 1.00 82.67  ? 66  HIS J O   1 
ATOM   6659  C  CB  . HIS J  2 47  ? 99.914  11.402   -45.036 1.00 106.08 ? 66  HIS J CB  1 
ATOM   6660  C  CG  . HIS J  2 47  ? 99.660  10.962   -43.627 1.00 111.11 ? 66  HIS J CG  1 
ATOM   6661  N  ND1 . HIS J  2 47  ? 98.550  11.365   -42.915 1.00 110.96 ? 66  HIS J ND1 1 
ATOM   6662  C  CD2 . HIS J  2 47  ? 100.368 10.161   -42.799 1.00 111.57 ? 66  HIS J CD2 1 
ATOM   6663  C  CE1 . HIS J  2 47  ? 98.587  10.833   -41.709 1.00 109.18 ? 66  HIS J CE1 1 
ATOM   6664  N  NE2 . HIS J  2 47  ? 99.680  10.099   -41.613 1.00 110.84 ? 66  HIS J NE2 1 
ATOM   6665  N  N   . ARG J  2 48  ? 100.872 11.169   -48.047 1.00 74.87  ? 67  ARG J N   1 
ATOM   6666  C  CA  . ARG J  2 48  ? 100.970 11.886   -49.323 1.00 76.04  ? 67  ARG J CA  1 
ATOM   6667  C  C   . ARG J  2 48  ? 99.567  12.070   -49.884 1.00 81.01  ? 67  ARG J C   1 
ATOM   6668  O  O   . ARG J  2 48  ? 98.751  11.145   -49.830 1.00 86.80  ? 67  ARG J O   1 
ATOM   6669  C  CB  . ARG J  2 48  ? 101.801 11.093   -50.323 1.00 79.48  ? 67  ARG J CB  1 
ATOM   6670  C  CG  . ARG J  2 48  ? 103.146 10.675   -49.787 1.00 101.11 ? 67  ARG J CG  1 
ATOM   6671  C  CD  . ARG J  2 48  ? 103.713 9.461    -50.502 1.00 103.03 ? 67  ARG J CD  1 
ATOM   6672  N  NE  . ARG J  2 48  ? 104.891 8.962    -49.798 1.00 107.23 ? 67  ARG J NE  1 
ATOM   6673  C  CZ  . ARG J  2 48  ? 106.124 9.398    -50.018 1.00 114.06 ? 67  ARG J CZ  1 
ATOM   6674  N  NH1 . ARG J  2 48  ? 106.334 10.337   -50.931 1.00 110.96 ? 67  ARG J NH1 1 
ATOM   6675  N  NH2 . ARG J  2 48  ? 107.139 8.894    -49.329 1.00 120.75 ? 67  ARG J NH2 1 
ATOM   6676  N  N   . GLY J  2 49  ? 99.273  13.248   -50.420 1.00 67.18  ? 68  GLY J N   1 
ATOM   6677  C  CA  . GLY J  2 49  ? 97.939  13.482   -50.927 1.00 83.24  ? 68  GLY J CA  1 
ATOM   6678  C  C   . GLY J  2 49  ? 97.683  14.806   -51.603 1.00 99.34  ? 68  GLY J C   1 
ATOM   6679  O  O   . GLY J  2 49  ? 98.581  15.394   -52.205 1.00 99.65  ? 68  GLY J O   1 
ATOM   6680  N  N   . CYS J  2 50  ? 96.435  15.261   -51.512 1.00 98.19  ? 69  CYS J N   1 
ATOM   6681  C  CA  . CYS J  2 50  ? 96.013  16.496   -52.155 1.00 80.56  ? 69  CYS J CA  1 
ATOM   6682  C  C   . CYS J  2 50  ? 95.994  17.621   -51.145 1.00 82.63  ? 69  CYS J C   1 
ATOM   6683  O  O   . CYS J  2 50  ? 96.484  17.478   -50.030 1.00 90.55  ? 69  CYS J O   1 
ATOM   6684  C  CB  . CYS J  2 50  ? 94.625  16.331   -52.768 1.00 54.06  ? 69  CYS J CB  1 
ATOM   6685  S  SG  . CYS J  2 50  ? 94.442  14.829   -53.746 1.00 163.13 ? 69  CYS J SG  1 
ATOM   6686  N  N   . GLY J  2 51  ? 95.422  18.745   -51.545 1.00 80.34  ? 70  GLY J N   1 
ATOM   6687  C  CA  . GLY J  2 51  ? 95.284  19.873   -50.651 1.00 94.17  ? 70  GLY J CA  1 
ATOM   6688  C  C   . GLY J  2 51  ? 94.792  21.062   -51.434 1.00 86.82  ? 70  GLY J C   1 
ATOM   6689  O  O   . GLY J  2 51  ? 95.310  21.344   -52.512 1.00 69.45  ? 70  GLY J O   1 
ATOM   6690  N  N   . ASN J  2 52  ? 93.781  21.745   -50.909 1.00 80.21  ? 71  ASN J N   1 
ATOM   6691  C  CA  . ASN J  2 52  ? 93.247  22.899   -51.596 1.00 73.47  ? 71  ASN J CA  1 
ATOM   6692  C  C   . ASN J  2 52  ? 92.816  23.956   -50.619 1.00 77.60  ? 71  ASN J C   1 
ATOM   6693  O  O   . ASN J  2 52  ? 92.195  24.948   -51.008 1.00 82.23  ? 71  ASN J O   1 
ATOM   6694  C  CB  . ASN J  2 52  ? 92.044  22.521   -52.469 1.00 77.39  ? 71  ASN J CB  1 
ATOM   6695  C  CG  . ASN J  2 52  ? 91.864  21.024   -52.613 1.00 82.15  ? 71  ASN J CG  1 
ATOM   6696  O  OD1 . ASN J  2 52  ? 92.167  20.454   -53.656 1.00 84.28  ? 71  ASN J OD1 1 
ATOM   6697  N  ND2 . ASN J  2 52  ? 91.362  20.382   -51.568 1.00 87.04  ? 71  ASN J ND2 1 
ATOM   6698  N  N   . LEU J  2 53  ? 93.126  23.758   -49.346 1.00 78.83  ? 72  LEU J N   1 
ATOM   6699  C  CA  . LEU J  2 53  ? 92.530  24.635   -48.344 1.00 99.73  ? 72  LEU J CA  1 
ATOM   6700  C  C   . LEU J  2 53  ? 93.428  25.704   -47.761 1.00 90.11  ? 72  LEU J C   1 
ATOM   6701  O  O   . LEU J  2 53  ? 93.057  26.888   -47.736 1.00 112.66 ? 72  LEU J O   1 
ATOM   6702  C  CB  . LEU J  2 53  ? 91.866  23.836   -47.224 1.00 125.13 ? 72  LEU J CB  1 
ATOM   6703  C  CG  . LEU J  2 53  ? 90.382  23.654   -47.524 1.00 120.38 ? 72  LEU J CG  1 
ATOM   6704  C  CD1 . LEU J  2 53  ? 89.571  23.397   -46.235 1.00 119.01 ? 72  LEU J CD1 1 
ATOM   6705  C  CD2 . LEU J  2 53  ? 89.886  24.896   -48.308 1.00 33.33  ? 72  LEU J CD2 1 
ATOM   6706  N  N   . HIS J  2 54  ? 94.601  25.306   -47.285 1.00 56.10  ? 73  HIS J N   1 
ATOM   6707  C  CA  . HIS J  2 54  ? 95.403  26.261   -46.538 1.00 76.19  ? 73  HIS J CA  1 
ATOM   6708  C  C   . HIS J  2 54  ? 96.841  26.393   -47.024 1.00 80.95  ? 73  HIS J C   1 
ATOM   6709  O  O   . HIS J  2 54  ? 97.775  25.974   -46.342 1.00 81.84  ? 73  HIS J O   1 
ATOM   6710  C  CB  . HIS J  2 54  ? 95.344  25.920   -45.056 1.00 74.00  ? 73  HIS J CB  1 
ATOM   6711  C  CG  . HIS J  2 54  ? 93.949  25.776   -44.538 1.00 72.53  ? 73  HIS J CG  1 
ATOM   6712  N  ND1 . HIS J  2 54  ? 93.149  26.856   -44.239 1.00 65.81  ? 73  HIS J ND1 1 
ATOM   6713  C  CD2 . HIS J  2 54  ? 93.204  24.678   -44.284 1.00 79.42  ? 73  HIS J CD2 1 
ATOM   6714  C  CE1 . HIS J  2 54  ? 91.973  26.431   -43.815 1.00 74.06  ? 73  HIS J CE1 1 
ATOM   6715  N  NE2 . HIS J  2 54  ? 91.980  25.112   -43.834 1.00 81.66  ? 73  HIS J NE2 1 
ATOM   6716  N  N   . ARG J  2 55  ? 97.007  27.004   -48.195 1.00 81.52  ? 74  ARG J N   1 
ATOM   6717  C  CA  . ARG J  2 55  ? 98.315  27.104   -48.834 1.00 72.09  ? 74  ARG J CA  1 
ATOM   6718  C  C   . ARG J  2 55  ? 99.373  27.438   -47.804 1.00 62.94  ? 74  ARG J C   1 
ATOM   6719  O  O   . ARG J  2 55  ? 100.391 26.796   -47.767 1.00 56.89  ? 74  ARG J O   1 
ATOM   6720  C  CB  . ARG J  2 55  ? 98.312  28.143   -49.964 1.00 79.71  ? 74  ARG J CB  1 
ATOM   6721  N  N   . GLU J  2 56  ? 99.109  28.422   -46.947 1.00 67.38  ? 75  GLU J N   1 
ATOM   6722  C  CA  . GLU J  2 56  ? 100.077 28.874   -45.934 1.00 66.75  ? 75  GLU J CA  1 
ATOM   6723  C  C   . GLU J  2 56  ? 100.841 27.749   -45.244 1.00 62.86  ? 75  GLU J C   1 
ATOM   6724  O  O   . GLU J  2 56  ? 102.037 27.844   -45.019 1.00 69.98  ? 75  GLU J O   1 
ATOM   6725  C  CB  . GLU J  2 56  ? 99.394  29.752   -44.879 1.00 78.17  ? 75  GLU J CB  1 
ATOM   6726  C  CG  . GLU J  2 56  ? 98.160  29.143   -44.275 1.00 87.77  ? 75  GLU J CG  1 
ATOM   6727  C  CD  . GLU J  2 56  ? 96.886  29.794   -44.774 1.00 101.40 ? 75  GLU J CD  1 
ATOM   6728  O  OE1 . GLU J  2 56  ? 96.527  29.619   -45.965 1.00 110.55 ? 75  GLU J OE1 1 
ATOM   6729  O  OE2 . GLU J  2 56  ? 96.241  30.488   -43.964 1.00 94.25  ? 75  GLU J OE2 1 
ATOM   6730  N  N   . LEU J  2 57  ? 100.139 26.684   -44.896 1.00 68.25  ? 76  LEU J N   1 
ATOM   6731  C  CA  . LEU J  2 57  ? 100.773 25.560   -44.224 1.00 81.29  ? 76  LEU J CA  1 
ATOM   6732  C  C   . LEU J  2 57  ? 102.114 25.159   -44.848 1.00 76.96  ? 76  LEU J C   1 
ATOM   6733  O  O   . LEU J  2 57  ? 103.050 24.798   -44.134 1.00 77.64  ? 76  LEU J O   1 
ATOM   6734  C  CB  . LEU J  2 57  ? 99.820  24.369   -44.186 1.00 80.15  ? 76  LEU J CB  1 
ATOM   6735  C  CG  . LEU J  2 57  ? 98.924  24.390   -42.961 1.00 73.15  ? 76  LEU J CG  1 
ATOM   6736  C  CD1 . LEU J  2 57  ? 97.963  23.222   -43.011 1.00 67.08  ? 76  LEU J CD1 1 
ATOM   6737  C  CD2 . LEU J  2 57  ? 99.791  24.354   -41.705 1.00 83.69  ? 76  LEU J CD2 1 
ATOM   6738  N  N   . CYS J  2 58  ? 102.197 25.233   -46.176 1.00 69.24  ? 77  CYS J N   1 
ATOM   6739  C  CA  . CYS J  2 58  ? 103.395 24.837   -46.939 1.00 71.84  ? 77  CYS J CA  1 
ATOM   6740  C  C   . CYS J  2 58  ? 104.647 25.638   -46.617 1.00 69.15  ? 77  CYS J C   1 
ATOM   6741  O  O   . CYS J  2 58  ? 105.745 25.094   -46.586 1.00 76.63  ? 77  CYS J O   1 
ATOM   6742  C  CB  . CYS J  2 58  ? 103.141 24.936   -48.439 1.00 67.34  ? 77  CYS J CB  1 
ATOM   6743  S  SG  . CYS J  2 58  ? 101.819 23.866   -49.013 1.00 95.35  ? 77  CYS J SG  1 
ATOM   6744  N  N   . ARG J  2 59  ? 104.476 26.936   -46.407 1.00 65.02  ? 78  ARG J N   1 
ATOM   6745  C  CA  . ARG J  2 59  ? 105.574 27.805   -45.996 1.00 60.60  ? 78  ARG J CA  1 
ATOM   6746  C  C   . ARG J  2 59  ? 106.126 27.369   -44.636 1.00 65.79  ? 78  ARG J C   1 
ATOM   6747  O  O   . ARG J  2 59  ? 107.213 27.775   -44.238 1.00 63.85  ? 78  ARG J O   1 
ATOM   6748  C  CB  . ARG J  2 59  ? 105.096 29.257   -45.891 1.00 72.42  ? 78  ARG J CB  1 
ATOM   6749  C  CG  . ARG J  2 59  ? 104.155 29.706   -46.988 1.00 84.94  ? 78  ARG J CG  1 
ATOM   6750  C  CD  . ARG J  2 59  ? 104.908 30.285   -48.157 1.00 102.11 ? 78  ARG J CD  1 
ATOM   6751  N  NE  . ARG J  2 59  ? 104.144 31.383   -48.732 1.00 121.24 ? 78  ARG J NE  1 
ATOM   6752  C  CZ  . ARG J  2 59  ? 104.337 32.660   -48.427 1.00 125.49 ? 78  ARG J CZ  1 
ATOM   6753  N  NH1 . ARG J  2 59  ? 105.298 32.999   -47.571 1.00 95.36  ? 78  ARG J NH1 1 
ATOM   6754  N  NH2 . ARG J  2 59  ? 103.578 33.596   -48.992 1.00 139.13 ? 78  ARG J NH2 1 
ATOM   6755  N  N   . GLY J  2 60  ? 105.366 26.563   -43.907 1.00 83.65  ? 79  GLY J N   1 
ATOM   6756  C  CA  . GLY J  2 60  ? 105.828 26.094   -42.621 1.00 89.39  ? 79  GLY J CA  1 
ATOM   6757  C  C   . GLY J  2 60  ? 107.249 25.581   -42.713 1.00 79.24  ? 79  GLY J C   1 
ATOM   6758  O  O   . GLY J  2 60  ? 107.543 24.672   -43.494 1.00 85.26  ? 79  GLY J O   1 
ATOM   6759  N  N   . ARG J  2 61  ? 108.133 26.194   -41.934 1.00 52.59  ? 80  ARG J N   1 
ATOM   6760  C  CA  . ARG J  2 61  ? 109.454 25.633   -41.680 1.00 56.69  ? 80  ARG J CA  1 
ATOM   6761  C  C   . ARG J  2 61  ? 109.290 24.356   -40.863 1.00 72.71  ? 80  ARG J C   1 
ATOM   6762  O  O   . ARG J  2 61  ? 108.462 24.308   -39.958 1.00 64.72  ? 80  ARG J O   1 
ATOM   6763  C  CB  . ARG J  2 61  ? 110.307 26.636   -40.907 1.00 52.06  ? 80  ARG J CB  1 
ATOM   6764  C  CG  . ARG J  2 61  ? 111.260 26.025   -39.903 1.00 56.10  ? 80  ARG J CG  1 
ATOM   6765  C  CD  . ARG J  2 61  ? 111.312 26.847   -38.618 1.00 68.44  ? 80  ARG J CD  1 
ATOM   6766  N  NE  . ARG J  2 61  ? 111.613 26.002   -37.466 1.00 100.66 ? 80  ARG J NE  1 
ATOM   6767  C  CZ  . ARG J  2 61  ? 111.473 26.375   -36.198 1.00 106.17 ? 80  ARG J CZ  1 
ATOM   6768  N  NH1 . ARG J  2 61  ? 111.033 27.594   -35.909 1.00 101.97 ? 80  ARG J NH1 1 
ATOM   6769  N  NH2 . ARG J  2 61  ? 111.772 25.521   -35.220 1.00 101.73 ? 80  ARG J NH2 1 
ATOM   6770  N  N   . PRO J  2 62  ? 110.076 23.310   -41.180 1.00 81.95  ? 81  PRO J N   1 
ATOM   6771  C  CA  . PRO J  2 62  ? 109.916 22.020   -40.495 1.00 78.59  ? 81  PRO J CA  1 
ATOM   6772  C  C   . PRO J  2 62  ? 110.275 22.102   -39.025 1.00 74.57  ? 81  PRO J C   1 
ATOM   6773  O  O   . PRO J  2 62  ? 111.341 22.625   -38.701 1.00 63.71  ? 81  PRO J O   1 
ATOM   6774  C  CB  . PRO J  2 62  ? 110.905 21.109   -41.223 1.00 45.79  ? 81  PRO J CB  1 
ATOM   6775  C  CG  . PRO J  2 62  ? 111.101 21.756   -42.544 1.00 52.97  ? 81  PRO J CG  1 
ATOM   6776  C  CD  . PRO J  2 62  ? 111.061 23.223   -42.266 1.00 61.03  ? 81  PRO J CD  1 
ATOM   6777  N  N   . THR J  2 63  ? 109.390 21.595   -38.162 1.00 71.75  ? 82  THR J N   1 
ATOM   6778  C  CA  . THR J  2 63  ? 109.623 21.552   -36.717 1.00 68.72  ? 82  THR J CA  1 
ATOM   6779  C  C   . THR J  2 63  ? 110.029 20.163   -36.256 1.00 64.79  ? 82  THR J C   1 
ATOM   6780  O  O   . THR J  2 63  ? 110.269 19.275   -37.069 1.00 68.12  ? 82  THR J O   1 
ATOM   6781  C  CB  . THR J  2 63  ? 108.386 21.970   -35.912 1.00 73.11  ? 82  THR J CB  1 
ATOM   6782  O  OG1 . THR J  2 63  ? 107.313 21.069   -36.187 1.00 57.97  ? 82  THR J OG1 1 
ATOM   6783  C  CG2 . THR J  2 63  ? 107.967 23.375   -36.277 1.00 94.73  ? 82  THR J CG2 1 
ATOM   6784  N  N   . GLU J  2 64  ? 110.103 19.981   -34.945 1.00 64.87  ? 83  GLU J N   1 
ATOM   6785  C  CA  . GLU J  2 64  ? 110.552 18.715   -34.384 1.00 66.98  ? 83  GLU J CA  1 
ATOM   6786  C  C   . GLU J  2 64  ? 109.459 17.648   -34.440 1.00 74.83  ? 83  GLU J C   1 
ATOM   6787  O  O   . GLU J  2 64  ? 109.662 16.514   -34.006 1.00 85.23  ? 83  GLU J O   1 
ATOM   6788  C  CB  . GLU J  2 64  ? 111.045 18.920   -32.946 1.00 59.95  ? 83  GLU J CB  1 
ATOM   6789  C  CG  . GLU J  2 64  ? 110.076 19.677   -32.041 1.00 106.32 ? 83  GLU J CG  1 
ATOM   6790  C  CD  . GLU J  2 64  ? 110.486 21.116   -31.787 1.00 126.84 ? 83  GLU J CD  1 
ATOM   6791  O  OE1 . GLU J  2 64  ? 110.158 21.989   -32.627 1.00 127.89 ? 83  GLU J OE1 1 
ATOM   6792  O  OE2 . GLU J  2 64  ? 111.127 21.367   -30.739 1.00 124.03 ? 83  GLU J OE2 1 
ATOM   6793  N  N   . PHE J  2 65  ? 108.305 18.015   -34.993 1.00 79.97  ? 84  PHE J N   1 
ATOM   6794  C  CA  . PHE J  2 65  ? 107.133 17.135   -34.983 1.00 87.20  ? 84  PHE J CA  1 
ATOM   6795  C  C   . PHE J  2 65  ? 106.254 17.219   -36.231 1.00 75.39  ? 84  PHE J C   1 
ATOM   6796  O  O   . PHE J  2 65  ? 105.240 16.529   -36.337 1.00 63.34  ? 84  PHE J O   1 
ATOM   6797  C  CB  . PHE J  2 65  ? 106.272 17.421   -33.762 1.00 97.05  ? 84  PHE J CB  1 
ATOM   6798  C  CG  . PHE J  2 65  ? 105.894 18.857   -33.622 1.00 103.63 ? 84  PHE J CG  1 
ATOM   6799  C  CD1 . PHE J  2 65  ? 106.445 19.635   -32.618 1.00 126.37 ? 84  PHE J CD1 1 
ATOM   6800  C  CD2 . PHE J  2 65  ? 105.004 19.433   -34.496 1.00 81.89  ? 84  PHE J CD2 1 
ATOM   6801  C  CE1 . PHE J  2 65  ? 106.106 20.957   -32.485 1.00 129.80 ? 84  PHE J CE1 1 
ATOM   6802  C  CE2 . PHE J  2 65  ? 104.663 20.746   -34.367 1.00 82.95  ? 84  PHE J CE2 1 
ATOM   6803  C  CZ  . PHE J  2 65  ? 105.213 21.514   -33.360 1.00 106.92 ? 84  PHE J CZ  1 
ATOM   6804  N  N   . VAL J  2 66  ? 106.631 18.056   -37.180 1.00 70.69  ? 85  VAL J N   1 
ATOM   6805  C  CA  . VAL J  2 66  ? 105.873 18.091   -38.404 1.00 65.25  ? 85  VAL J CA  1 
ATOM   6806  C  C   . VAL J  2 66  ? 106.626 18.731   -39.570 1.00 66.06  ? 85  VAL J C   1 
ATOM   6807  O  O   . VAL J  2 66  ? 107.421 19.647   -39.388 1.00 53.87  ? 85  VAL J O   1 
ATOM   6808  C  CB  . VAL J  2 66  ? 104.543 18.788   -38.184 1.00 54.28  ? 85  VAL J CB  1 
ATOM   6809  C  CG1 . VAL J  2 66  ? 104.756 20.261   -37.938 1.00 55.90  ? 85  VAL J CG1 1 
ATOM   6810  C  CG2 . VAL J  2 66  ? 103.653 18.576   -39.388 1.00 66.67  ? 85  VAL J CG2 1 
ATOM   6811  N  N   . ASN J  2 67  ? 106.371 18.214   -40.768 1.00 67.34  ? 86  ASN J N   1 
ATOM   6812  C  CA  . ASN J  2 67  ? 106.952 18.753   -41.984 1.00 62.54  ? 86  ASN J CA  1 
ATOM   6813  C  C   . ASN J  2 67  ? 105.926 18.763   -43.101 1.00 73.24  ? 86  ASN J C   1 
ATOM   6814  O  O   . ASN J  2 67  ? 105.512 17.719   -43.610 1.00 84.10  ? 86  ASN J O   1 
ATOM   6815  C  CB  . ASN J  2 67  ? 108.176 17.944   -42.404 1.00 76.35  ? 86  ASN J CB  1 
ATOM   6816  C  CG  . ASN J  2 67  ? 108.994 18.635   -43.485 1.00 82.08  ? 86  ASN J CG  1 
ATOM   6817  O  OD1 . ASN J  2 67  ? 108.462 19.365   -44.326 1.00 97.15  ? 86  ASN J OD1 1 
ATOM   6818  N  ND2 . ASN J  2 67  ? 110.298 18.402   -43.466 1.00 77.56  ? 86  ASN J ND2 1 
ATOM   6819  N  N   . HIS J  2 68  ? 105.508 19.962   -43.465 1.00 84.22  ? 87  HIS J N   1 
ATOM   6820  C  CA  . HIS J  2 68  ? 104.572 20.140   -44.541 1.00 77.66  ? 87  HIS J CA  1 
ATOM   6821  C  C   . HIS J  2 68  ? 105.368 20.501   -45.792 1.00 80.05  ? 87  HIS J C   1 
ATOM   6822  O  O   . HIS J  2 68  ? 106.156 21.454   -45.794 1.00 77.62  ? 87  HIS J O   1 
ATOM   6823  C  CB  . HIS J  2 68  ? 103.596 21.244   -44.167 1.00 74.40  ? 87  HIS J CB  1 
ATOM   6824  C  CG  . HIS J  2 68  ? 102.166 20.898   -44.432 1.00 101.99 ? 87  HIS J CG  1 
ATOM   6825  N  ND1 . HIS J  2 68  ? 101.552 21.142   -45.645 1.00 124.62 ? 87  HIS J ND1 1 
ATOM   6826  C  CD2 . HIS J  2 68  ? 101.221 20.338   -43.640 1.00 114.24 ? 87  HIS J CD2 1 
ATOM   6827  C  CE1 . HIS J  2 68  ? 100.291 20.744   -45.590 1.00 123.61 ? 87  HIS J CE1 1 
ATOM   6828  N  NE2 . HIS J  2 68  ? 100.065 20.251   -44.385 1.00 131.53 ? 87  HIS J NE2 1 
ATOM   6829  N  N   . TYR J  2 69  ? 105.183 19.716   -46.847 1.00 71.24  ? 88  TYR J N   1 
ATOM   6830  C  CA  . TYR J  2 69  ? 105.810 20.017   -48.133 1.00 81.94  ? 88  TYR J CA  1 
ATOM   6831  C  C   . TYR J  2 69  ? 104.812 19.948   -49.288 1.00 83.82  ? 88  TYR J C   1 
ATOM   6832  O  O   . TYR J  2 69  ? 104.056 18.983   -49.398 1.00 85.82  ? 88  TYR J O   1 
ATOM   6833  C  CB  . TYR J  2 69  ? 106.959 19.048   -48.406 1.00 91.95  ? 88  TYR J CB  1 
ATOM   6834  C  CG  . TYR J  2 69  ? 107.408 19.069   -49.848 1.00 95.50  ? 88  TYR J CG  1 
ATOM   6835  C  CD1 . TYR J  2 69  ? 107.036 18.061   -50.728 1.00 90.20  ? 88  TYR J CD1 1 
ATOM   6836  C  CD2 . TYR J  2 69  ? 108.184 20.112   -50.337 1.00 95.67  ? 88  TYR J CD2 1 
ATOM   6837  C  CE1 . TYR J  2 69  ? 107.441 18.085   -52.049 1.00 92.29  ? 88  TYR J CE1 1 
ATOM   6838  C  CE2 . TYR J  2 69  ? 108.592 20.145   -51.656 1.00 84.99  ? 88  TYR J CE2 1 
ATOM   6839  C  CZ  . TYR J  2 69  ? 108.217 19.132   -52.506 1.00 86.20  ? 88  TYR J CZ  1 
ATOM   6840  O  OH  . TYR J  2 69  ? 108.621 19.167   -53.818 1.00 83.19  ? 88  TYR J OH  1 
ATOM   6841  N  N   . CYS J  2 70  ? 104.819 20.949   -50.164 1.00 79.55  ? 89  CYS J N   1 
ATOM   6842  C  CA  . CYS J  2 70  ? 103.848 20.976   -51.257 1.00 73.92  ? 89  CYS J CA  1 
ATOM   6843  C  C   . CYS J  2 70  ? 104.464 21.301   -52.599 1.00 74.10  ? 89  CYS J C   1 
ATOM   6844  O  O   . CYS J  2 70  ? 105.521 21.916   -52.662 1.00 87.87  ? 89  CYS J O   1 
ATOM   6845  C  CB  . CYS J  2 70  ? 102.749 21.984   -50.951 1.00 78.85  ? 89  CYS J CB  1 
ATOM   6846  S  SG  . CYS J  2 70  ? 102.117 21.874   -49.254 1.00 115.87 ? 89  CYS J SG  1 
ATOM   6847  N  N   . CYS J  2 71  ? 103.793 20.889   -53.672 1.00 87.78  ? 90  CYS J N   1 
ATOM   6848  C  CA  . CYS J  2 71  ? 104.255 21.188   -55.036 1.00 104.50 ? 90  CYS J CA  1 
ATOM   6849  C  C   . CYS J  2 71  ? 103.089 21.068   -56.003 1.00 101.59 ? 90  CYS J C   1 
ATOM   6850  O  O   . CYS J  2 71  ? 102.081 20.470   -55.665 1.00 98.76  ? 90  CYS J O   1 
ATOM   6851  C  CB  . CYS J  2 71  ? 105.368 20.234   -55.459 1.00 112.53 ? 90  CYS J CB  1 
ATOM   6852  S  SG  . CYS J  2 71  ? 104.854 18.512   -55.506 1.00 127.33 ? 90  CYS J SG  1 
ATOM   6853  N  N   . ASP J  2 72  ? 103.218 21.621   -57.204 1.00 103.60 ? 91  ASP J N   1 
ATOM   6854  C  CA  . ASP J  2 72  ? 102.071 21.673   -58.121 1.00 108.03 ? 91  ASP J CA  1 
ATOM   6855  C  C   . ASP J  2 72  ? 102.328 21.225   -59.570 1.00 106.56 ? 91  ASP J C   1 
ATOM   6856  O  O   . ASP J  2 72  ? 101.769 21.786   -60.510 1.00 108.09 ? 91  ASP J O   1 
ATOM   6857  C  CB  . ASP J  2 72  ? 101.401 23.060   -58.093 1.00 108.68 ? 91  ASP J CB  1 
ATOM   6858  C  CG  . ASP J  2 72  ? 102.354 24.164   -57.678 1.00 117.54 ? 91  ASP J CG  1 
ATOM   6859  O  OD1 . ASP J  2 72  ? 102.480 24.413   -56.457 1.00 117.27 ? 91  ASP J OD1 1 
ATOM   6860  O  OD2 . ASP J  2 72  ? 102.968 24.788   -58.570 1.00 121.65 ? 91  ASP J OD2 1 
ATOM   6861  N  N   . SER J  2 73  ? 103.168 20.212   -59.747 1.00 104.03 ? 92  SER J N   1 
ATOM   6862  C  CA  . SER J  2 73  ? 103.307 19.564   -61.045 1.00 92.39  ? 92  SER J CA  1 
ATOM   6863  C  C   . SER J  2 73  ? 102.672 18.194   -60.942 1.00 106.93 ? 92  SER J C   1 
ATOM   6864  O  O   . SER J  2 73  ? 102.606 17.617   -59.861 1.00 110.88 ? 92  SER J O   1 
ATOM   6865  C  CB  . SER J  2 73  ? 104.773 19.417   -61.435 1.00 80.88  ? 92  SER J CB  1 
ATOM   6866  N  N   . HIS J  2 74  ? 102.204 17.671   -62.066 1.00 115.54 ? 93  HIS J N   1 
ATOM   6867  C  CA  . HIS J  2 74  ? 101.552 16.364   -62.087 1.00 117.98 ? 93  HIS J CA  1 
ATOM   6868  C  C   . HIS J  2 74  ? 102.320 15.288   -61.289 1.00 105.22 ? 93  HIS J C   1 
ATOM   6869  O  O   . HIS J  2 74  ? 103.543 15.230   -61.333 1.00 95.81  ? 93  HIS J O   1 
ATOM   6870  C  CB  . HIS J  2 74  ? 101.345 15.916   -63.535 1.00 122.10 ? 93  HIS J CB  1 
ATOM   6871  C  CG  . HIS J  2 74  ? 100.490 14.697   -63.676 1.00 127.05 ? 93  HIS J CG  1 
ATOM   6872  N  ND1 . HIS J  2 74  ? 101.005 13.416   -63.642 1.00 109.68 ? 93  HIS J ND1 1 
ATOM   6873  C  CD2 . HIS J  2 74  ? 99.154  14.563   -63.857 1.00 134.10 ? 93  HIS J CD2 1 
ATOM   6874  C  CE1 . HIS J  2 74  ? 100.022 12.548   -63.795 1.00 119.24 ? 93  HIS J CE1 1 
ATOM   6875  N  NE2 . HIS J  2 74  ? 98.888  13.217   -63.927 1.00 137.39 ? 93  HIS J NE2 1 
ATOM   6876  N  N   . LEU J  2 75  ? 101.581 14.463   -60.548 1.00 108.37 ? 94  LEU J N   1 
ATOM   6877  C  CA  . LEU J  2 75  ? 102.120 13.330   -59.788 1.00 101.81 ? 94  LEU J CA  1 
ATOM   6878  C  C   . LEU J  2 75  ? 103.434 13.572   -59.042 1.00 103.28 ? 94  LEU J C   1 
ATOM   6879  O  O   . LEU J  2 75  ? 104.167 12.627   -58.731 1.00 91.81  ? 94  LEU J O   1 
ATOM   6880  C  CB  . LEU J  2 75  ? 102.254 12.105   -60.690 1.00 94.82  ? 94  LEU J CB  1 
ATOM   6881  C  CG  . LEU J  2 75  ? 101.146 11.070   -60.532 1.00 85.76  ? 94  LEU J CG  1 
ATOM   6882  C  CD1 . LEU J  2 75  ? 101.625 9.683    -60.957 1.00 62.00  ? 94  LEU J CD1 1 
ATOM   6883  C  CD2 . LEU J  2 75  ? 100.700 11.049   -59.089 1.00 92.70  ? 94  LEU J CD2 1 
ATOM   6884  N  N   . CYS J  2 76  ? 103.703 14.830   -58.715 1.00 102.82 ? 95  CYS J N   1 
ATOM   6885  C  CA  . CYS J  2 76  ? 104.999 15.237   -58.176 1.00 98.77  ? 95  CYS J CA  1 
ATOM   6886  C  C   . CYS J  2 76  ? 105.350 14.740   -56.760 1.00 94.56  ? 95  CYS J C   1 
ATOM   6887  O  O   . CYS J  2 76  ? 106.394 15.087   -56.226 1.00 84.18  ? 95  CYS J O   1 
ATOM   6888  C  CB  . CYS J  2 76  ? 105.115 16.762   -58.232 1.00 95.25  ? 95  CYS J CB  1 
ATOM   6889  S  SG  . CYS J  2 76  ? 103.988 17.639   -57.125 1.00 151.89 ? 95  CYS J SG  1 
ATOM   6890  N  N   . ASN J  2 77  ? 104.501 13.929   -56.146 1.00 97.42  ? 96  ASN J N   1 
ATOM   6891  C  CA  . ASN J  2 77  ? 104.767 13.533   -54.771 1.00 93.41  ? 96  ASN J CA  1 
ATOM   6892  C  C   . ASN J  2 77  ? 104.971 12.040   -54.577 1.00 108.97 ? 96  ASN J C   1 
ATOM   6893  O  O   . ASN J  2 77  ? 104.624 11.485   -53.539 1.00 123.26 ? 96  ASN J O   1 
ATOM   6894  C  CB  . ASN J  2 77  ? 103.712 14.102   -53.803 1.00 103.46 ? 96  ASN J CB  1 
ATOM   6895  C  CG  . ASN J  2 77  ? 102.290 13.658   -54.129 1.00 116.89 ? 96  ASN J CG  1 
ATOM   6896  O  OD1 . ASN J  2 77  ? 102.012 13.184   -55.223 1.00 134.39 ? 96  ASN J OD1 1 
ATOM   6897  N  ND2 . ASN J  2 77  ? 101.382 13.825   -53.172 1.00 109.46 ? 96  ASN J ND2 1 
ATOM   6898  N  N   . HIS J  2 78  ? 105.551 11.389   -55.574 1.00 108.31 ? 97  HIS J N   1 
ATOM   6899  C  CA  . HIS J  2 78  ? 105.898 9.985    -55.418 1.00 120.34 ? 97  HIS J CA  1 
ATOM   6900  C  C   . HIS J  2 78  ? 107.335 9.829    -54.907 1.00 128.79 ? 97  HIS J C   1 
ATOM   6901  O  O   . HIS J  2 78  ? 107.546 9.617    -53.713 1.00 108.16 ? 97  HIS J O   1 
ATOM   6902  C  CB  . HIS J  2 78  ? 105.687 9.215    -56.719 1.00 119.48 ? 97  HIS J CB  1 
ATOM   6903  C  CG  . HIS J  2 78  ? 105.576 7.738    -56.525 1.00 137.41 ? 97  HIS J CG  1 
ATOM   6904  N  ND1 . HIS J  2 78  ? 104.614 7.167    -55.720 1.00 143.36 ? 97  HIS J ND1 1 
ATOM   6905  C  CD2 . HIS J  2 78  ? 106.313 6.715    -57.017 1.00 148.53 ? 97  HIS J CD2 1 
ATOM   6906  C  CE1 . HIS J  2 78  ? 104.758 5.854    -55.730 1.00 147.50 ? 97  HIS J CE1 1 
ATOM   6907  N  NE2 . HIS J  2 78  ? 105.782 5.554    -56.510 1.00 155.17 ? 97  HIS J NE2 1 
ATOM   6908  N  N   . ASN J  2 79  ? 108.313 9.937    -55.805 1.00 149.32 ? 98  ASN J N   1 
ATOM   6909  C  CA  . ASN J  2 79  ? 109.724 9.874    -55.428 1.00 162.00 ? 98  ASN J CA  1 
ATOM   6910  C  C   . ASN J  2 79  ? 110.136 11.029   -54.496 1.00 156.40 ? 98  ASN J C   1 
ATOM   6911  O  O   . ASN J  2 79  ? 110.822 11.947   -54.938 1.00 173.91 ? 98  ASN J O   1 
ATOM   6912  C  CB  . ASN J  2 79  ? 110.616 9.906    -56.685 1.00 170.27 ? 98  ASN J CB  1 
ATOM   6913  C  CG  . ASN J  2 79  ? 110.497 8.649    -57.545 1.00 163.15 ? 98  ASN J CG  1 
ATOM   6914  O  OD1 . ASN J  2 79  ? 110.358 7.540    -57.033 1.00 161.75 ? 98  ASN J OD1 1 
ATOM   6915  N  ND2 . ASN J  2 79  ? 110.572 8.824    -58.862 1.00 149.80 ? 98  ASN J ND2 1 
ATOM   6916  N  N   . VAL J  2 80  ? 109.738 10.990   -53.221 1.00 126.03 ? 99  VAL J N   1 
ATOM   6917  C  CA  . VAL J  2 80  ? 110.046 12.091   -52.289 1.00 111.63 ? 99  VAL J CA  1 
ATOM   6918  C  C   . VAL J  2 80  ? 109.701 11.843   -50.802 1.00 105.49 ? 99  VAL J C   1 
ATOM   6919  O  O   . VAL J  2 80  ? 108.535 11.669   -50.453 1.00 96.92  ? 99  VAL J O   1 
ATOM   6920  C  CB  . VAL J  2 80  ? 109.371 13.414   -52.755 1.00 89.65  ? 99  VAL J CB  1 
ATOM   6921  C  CG1 . VAL J  2 80  ? 107.983 13.147   -53.298 1.00 104.18 ? 99  VAL J CG1 1 
ATOM   6922  C  CG2 . VAL J  2 80  ? 109.321 14.424   -51.628 1.00 58.42  ? 99  VAL J CG2 1 
ATOM   6923  N  N   . SER J  2 81  ? 110.711 11.861   -49.929 1.00 106.93 ? 100 SER J N   1 
ATOM   6924  C  CA  . SER J  2 81  ? 110.510 11.623   -48.493 1.00 110.54 ? 100 SER J CA  1 
ATOM   6925  C  C   . SER J  2 81  ? 111.225 12.634   -47.612 1.00 102.84 ? 100 SER J C   1 
ATOM   6926  O  O   . SER J  2 81  ? 111.809 13.588   -48.123 1.00 94.90  ? 100 SER J O   1 
ATOM   6927  C  CB  . SER J  2 81  ? 110.999 10.230   -48.112 1.00 112.80 ? 100 SER J CB  1 
ATOM   6928  O  OG  . SER J  2 81  ? 109.900 9.347    -48.010 1.00 95.67  ? 100 SER J OG  1 
ATOM   6929  N  N   . LEU J  2 82  ? 111.236 12.372   -46.297 1.00 99.67  ? 101 LEU J N   1 
ATOM   6930  C  CA  . LEU J  2 82  ? 111.916 13.249   -45.324 1.00 89.16  ? 101 LEU J CA  1 
ATOM   6931  C  C   . LEU J  2 82  ? 112.661 12.612   -44.081 1.00 80.44  ? 101 LEU J C   1 
ATOM   6932  O  O   . LEU J  2 82  ? 112.687 11.384   -43.814 1.00 44.43  ? 101 LEU J O   1 
ATOM   6933  C  CB  . LEU J  2 82  ? 110.950 14.374   -44.882 1.00 37.45  ? 101 LEU J CB  1 
ATOM   6934  C  CG  . LEU J  2 82  ? 109.894 14.922   -45.886 1.00 73.74  ? 101 LEU J CG  1 
ATOM   6935  C  CD1 . LEU J  2 82  ? 108.931 15.927   -45.252 1.00 28.95  ? 101 LEU J CD1 1 
ATOM   6936  C  CD2 . LEU J  2 82  ? 110.466 15.557   -47.144 1.00 66.69  ? 101 LEU J CD2 1 
ATOM   6937  N  N   . ARG K  3 11  ? 88.219  55.880   -35.280 1.00 83.84  ? 9   ARG K N   1 
ATOM   6938  C  CA  . ARG K  3 11  ? 89.601  55.452   -35.023 1.00 95.05  ? 9   ARG K CA  1 
ATOM   6939  C  C   . ARG K  3 11  ? 90.551  55.379   -36.261 1.00 92.65  ? 9   ARG K C   1 
ATOM   6940  O  O   . ARG K  3 11  ? 90.346  54.584   -37.178 1.00 73.18  ? 9   ARG K O   1 
ATOM   6941  C  CB  . ARG K  3 11  ? 89.606  54.129   -34.278 1.00 68.38  ? 9   ARG K CB  1 
ATOM   6942  C  CG  . ARG K  3 11  ? 90.964  53.462   -34.377 1.00 105.56 ? 9   ARG K CG  1 
ATOM   6943  C  CD  . ARG K  3 11  ? 92.074  54.392   -33.881 1.00 100.69 ? 9   ARG K CD  1 
ATOM   6944  N  NE  . ARG K  3 11  ? 92.166  54.341   -32.429 1.00 108.15 ? 9   ARG K NE  1 
ATOM   6945  C  CZ  . ARG K  3 11  ? 92.966  53.507   -31.779 1.00 97.35  ? 9   ARG K CZ  1 
ATOM   6946  N  NH1 . ARG K  3 11  ? 93.744  52.695   -32.471 1.00 74.60  ? 9   ARG K NH1 1 
ATOM   6947  N  NH2 . ARG K  3 11  ? 92.992  53.488   -30.452 1.00 101.20 ? 9   ARG K NH2 1 
ATOM   6948  N  N   . GLU K  3 12  ? 91.615  56.186   -36.245 1.00 91.86  ? 10  GLU K N   1 
ATOM   6949  C  CA  . GLU K  3 12  ? 92.435  56.456   -37.440 1.00 80.92  ? 10  GLU K CA  1 
ATOM   6950  C  C   . GLU K  3 12  ? 93.932  56.164   -37.272 1.00 80.82  ? 10  GLU K C   1 
ATOM   6951  O  O   . GLU K  3 12  ? 94.465  56.215   -36.160 1.00 95.19  ? 10  GLU K O   1 
ATOM   6952  C  CB  . GLU K  3 12  ? 92.280  57.924   -37.869 1.00 70.13  ? 10  GLU K CB  1 
ATOM   6953  C  CG  . GLU K  3 12  ? 90.831  58.367   -38.155 1.00 74.08  ? 10  GLU K CG  1 
ATOM   6954  C  CD  . GLU K  3 12  ? 90.714  59.880   -38.332 1.00 100.49 ? 10  GLU K CD  1 
ATOM   6955  O  OE1 . GLU K  3 12  ? 89.992  60.363   -39.241 1.00 94.32  ? 10  GLU K OE1 1 
ATOM   6956  O  OE2 . GLU K  3 12  ? 91.365  60.599   -37.550 1.00 114.08 ? 10  GLU K OE2 1 
ATOM   6957  N  N   . CYS K  3 13  ? 94.610  55.878   -38.385 1.00 71.75  ? 11  CYS K N   1 
ATOM   6958  C  CA  . CYS K  3 13  ? 96.046  55.583   -38.369 1.00 67.37  ? 11  CYS K CA  1 
ATOM   6959  C  C   . CYS K  3 13  ? 96.775  56.263   -39.513 1.00 71.32  ? 11  CYS K C   1 
ATOM   6960  O  O   . CYS K  3 13  ? 96.170  56.733   -40.484 1.00 72.92  ? 11  CYS K O   1 
ATOM   6961  C  CB  . CYS K  3 13  ? 96.301  54.077   -38.474 1.00 65.03  ? 11  CYS K CB  1 
ATOM   6962  S  SG  . CYS K  3 13  ? 96.003  53.141   -36.956 1.00 85.00  ? 11  CYS K SG  1 
ATOM   6963  N  N   . ILE K  3 14  ? 98.091  56.287   -39.405 1.00 69.35  ? 12  ILE K N   1 
ATOM   6964  C  CA  . ILE K  3 14  ? 98.914  56.754   -40.502 1.00 71.74  ? 12  ILE K CA  1 
ATOM   6965  C  C   . ILE K  3 14  ? 99.142  55.621   -41.485 1.00 92.50  ? 12  ILE K C   1 
ATOM   6966  O  O   . ILE K  3 14  ? 99.637  54.537   -41.104 1.00 67.21  ? 12  ILE K O   1 
ATOM   6967  C  CB  . ILE K  3 14  ? 100.272 57.227   -39.993 1.00 72.66  ? 12  ILE K CB  1 
ATOM   6968  C  CG1 . ILE K  3 14  ? 100.103 58.573   -39.292 1.00 74.07  ? 12  ILE K CG1 1 
ATOM   6969  C  CG2 . ILE K  3 14  ? 101.267 57.318   -41.143 1.00 75.71  ? 12  ILE K CG2 1 
ATOM   6970  C  CD1 . ILE K  3 14  ? 99.388  59.566   -40.123 1.00 75.56  ? 12  ILE K CD1 1 
ATOM   6971  N  N   . TYR K  3 15  ? 98.777  55.870   -42.743 1.00 78.95  ? 13  TYR K N   1 
ATOM   6972  C  CA  . TYR K  3 15  ? 99.000  54.885   -43.792 1.00 81.91  ? 13  TYR K CA  1 
ATOM   6973  C  C   . TYR K  3 15  ? 100.262 55.153   -44.556 1.00 82.61  ? 13  TYR K C   1 
ATOM   6974  O  O   . TYR K  3 15  ? 100.501 56.278   -44.970 1.00 70.83  ? 13  TYR K O   1 
ATOM   6975  C  CB  . TYR K  3 15  ? 97.851  54.837   -44.799 1.00 78.01  ? 13  TYR K CB  1 
ATOM   6976  C  CG  . TYR K  3 15  ? 97.987  53.647   -45.737 1.00 77.54  ? 13  TYR K CG  1 
ATOM   6977  C  CD1 . TYR K  3 15  ? 97.725  52.350   -45.284 1.00 71.22  ? 13  TYR K CD1 1 
ATOM   6978  C  CD2 . TYR K  3 15  ? 98.397  53.813   -47.064 1.00 77.00  ? 13  TYR K CD2 1 
ATOM   6979  C  CE1 . TYR K  3 15  ? 97.863  51.254   -46.118 1.00 86.18  ? 13  TYR K CE1 1 
ATOM   6980  C  CE2 . TYR K  3 15  ? 98.533  52.708   -47.915 1.00 66.76  ? 13  TYR K CE2 1 
ATOM   6981  C  CZ  . TYR K  3 15  ? 98.263  51.432   -47.428 1.00 76.74  ? 13  TYR K CZ  1 
ATOM   6982  O  OH  . TYR K  3 15  ? 98.388  50.310   -48.225 1.00 87.97  ? 13  TYR K OH  1 
ATOM   6983  N  N   . TYR K  3 16  ? 101.054 54.107   -44.757 1.00 67.47  ? 14  TYR K N   1 
ATOM   6984  C  CA  . TYR K  3 16  ? 102.202 54.198   -45.642 1.00 68.29  ? 14  TYR K CA  1 
ATOM   6985  C  C   . TYR K  3 16  ? 102.593 52.822   -46.150 1.00 66.33  ? 14  TYR K C   1 
ATOM   6986  O  O   . TYR K  3 16  ? 102.576 51.843   -45.404 1.00 75.77  ? 14  TYR K O   1 
ATOM   6987  C  CB  . TYR K  3 16  ? 103.399 54.873   -44.958 1.00 69.94  ? 14  TYR K CB  1 
ATOM   6988  C  CG  . TYR K  3 16  ? 104.593 55.022   -45.873 1.00 70.95  ? 14  TYR K CG  1 
ATOM   6989  C  CD1 . TYR K  3 16  ? 104.861 56.220   -46.488 1.00 73.19  ? 14  TYR K CD1 1 
ATOM   6990  C  CD2 . TYR K  3 16  ? 105.436 53.945   -46.135 1.00 78.45  ? 14  TYR K CD2 1 
ATOM   6991  C  CE1 . TYR K  3 16  ? 105.937 56.355   -47.332 1.00 77.05  ? 14  TYR K CE1 1 
ATOM   6992  C  CE2 . TYR K  3 16  ? 106.518 54.067   -46.973 1.00 82.82  ? 14  TYR K CE2 1 
ATOM   6993  C  CZ  . TYR K  3 16  ? 106.765 55.272   -47.569 1.00 91.61  ? 14  TYR K CZ  1 
ATOM   6994  O  OH  . TYR K  3 16  ? 107.851 55.386   -48.412 1.00 99.93  ? 14  TYR K OH  1 
ATOM   6995  N  N   . ASN K  3 17  ? 102.959 52.760   -47.425 1.00 76.59  ? 15  ASN K N   1 
ATOM   6996  C  CA  . ASN K  3 17  ? 103.381 51.507   -48.033 1.00 73.83  ? 15  ASN K CA  1 
ATOM   6997  C  C   . ASN K  3 17  ? 104.470 51.713   -49.080 1.00 65.98  ? 15  ASN K C   1 
ATOM   6998  O  O   . ASN K  3 17  ? 104.183 52.011   -50.237 1.00 66.47  ? 15  ASN K O   1 
ATOM   6999  C  CB  . ASN K  3 17  ? 102.187 50.794   -48.665 1.00 66.17  ? 15  ASN K CB  1 
ATOM   7000  C  CG  . ASN K  3 17  ? 102.584 49.497   -49.318 1.00 71.17  ? 15  ASN K CG  1 
ATOM   7001  O  OD1 . ASN K  3 17  ? 103.665 48.951   -49.044 1.00 62.94  ? 15  ASN K OD1 1 
ATOM   7002  N  ND2 . ASN K  3 17  ? 101.721 48.990   -50.186 1.00 72.42  ? 15  ASN K ND2 1 
ATOM   7003  N  N   . ALA K  3 18  ? 105.722 51.550   -48.676 1.00 75.47  ? 16  ALA K N   1 
ATOM   7004  C  CA  . ALA K  3 18  ? 106.831 51.709   -49.610 1.00 77.11  ? 16  ALA K CA  1 
ATOM   7005  C  C   . ALA K  3 18  ? 106.589 50.857   -50.856 1.00 66.19  ? 16  ALA K C   1 
ATOM   7006  O  O   . ALA K  3 18  ? 106.690 51.320   -51.993 1.00 77.05  ? 16  ALA K O   1 
ATOM   7007  C  CB  . ALA K  3 18  ? 108.140 51.316   -48.942 1.00 98.82  ? 16  ALA K CB  1 
ATOM   7008  N  N   . ASN K  3 19  ? 106.252 49.601   -50.640 1.00 64.02  ? 17  ASN K N   1 
ATOM   7009  C  CA  . ASN K  3 19  ? 106.051 48.734   -51.776 1.00 72.83  ? 17  ASN K CA  1 
ATOM   7010  C  C   . ASN K  3 19  ? 104.798 49.043   -52.599 1.00 85.03  ? 17  ASN K C   1 
ATOM   7011  O  O   . ASN K  3 19  ? 104.275 48.156   -53.290 1.00 90.14  ? 17  ASN K O   1 
ATOM   7012  C  CB  . ASN K  3 19  ? 106.001 47.288   -51.314 1.00 80.30  ? 17  ASN K CB  1 
ATOM   7013  C  CG  . ASN K  3 19  ? 106.781 46.383   -52.222 1.00 110.66 ? 17  ASN K CG  1 
ATOM   7014  O  OD1 . ASN K  3 19  ? 108.026 46.402   -52.224 1.00 132.58 ? 17  ASN K OD1 1 
ATOM   7015  N  ND2 . ASN K  3 19  ? 106.063 45.589   -53.017 1.00 101.86 ? 17  ASN K ND2 1 
ATOM   7016  N  N   . TRP K  3 20  ? 104.313 50.281   -52.535 1.00 73.18  ? 18  TRP K N   1 
ATOM   7017  C  CA  . TRP K  3 20  ? 102.993 50.568   -53.101 1.00 85.12  ? 18  TRP K CA  1 
ATOM   7018  C  C   . TRP K  3 20  ? 102.895 50.244   -54.589 1.00 100.09 ? 18  TRP K C   1 
ATOM   7019  O  O   . TRP K  3 20  ? 102.015 49.448   -54.995 1.00 78.12  ? 18  TRP K O   1 
ATOM   7020  C  CB  . TRP K  3 20  ? 102.557 52.019   -52.855 1.00 77.70  ? 18  TRP K CB  1 
ATOM   7021  C  CG  . TRP K  3 20  ? 103.402 53.060   -53.519 1.00 68.32  ? 18  TRP K CG  1 
ATOM   7022  C  CD1 . TRP K  3 20  ? 104.646 53.469   -53.133 1.00 80.72  ? 18  TRP K CD1 1 
ATOM   7023  C  CD2 . TRP K  3 20  ? 103.054 53.849   -54.663 1.00 74.83  ? 18  TRP K CD2 1 
ATOM   7024  N  NE1 . TRP K  3 20  ? 105.101 54.471   -53.965 1.00 77.36  ? 18  TRP K NE1 1 
ATOM   7025  C  CE2 . TRP K  3 20  ? 104.148 54.729   -54.914 1.00 71.82  ? 18  TRP K CE2 1 
ATOM   7026  C  CE3 . TRP K  3 20  ? 101.930 53.910   -55.494 1.00 93.94  ? 18  TRP K CE3 1 
ATOM   7027  C  CZ2 . TRP K  3 20  ? 104.151 55.659   -55.965 1.00 73.66  ? 18  TRP K CZ2 1 
ATOM   7028  C  CZ3 . TRP K  3 20  ? 101.930 54.841   -56.544 1.00 99.13  ? 18  TRP K CZ3 1 
ATOM   7029  C  CH2 . TRP K  3 20  ? 103.043 55.705   -56.766 1.00 78.22  ? 18  TRP K CH2 1 
ATOM   7030  N  N   . GLU K  3 21  ? 103.783 50.860   -55.388 1.00 96.11  ? 19  GLU K N   1 
ATOM   7031  C  CA  . GLU K  3 21  ? 103.786 50.646   -56.834 1.00 86.96  ? 19  GLU K CA  1 
ATOM   7032  C  C   . GLU K  3 21  ? 103.592 49.151   -57.140 1.00 83.34  ? 19  GLU K C   1 
ATOM   7033  O  O   . GLU K  3 21  ? 102.712 48.733   -57.916 1.00 72.50  ? 19  GLU K O   1 
ATOM   7034  C  CB  . GLU K  3 21  ? 105.102 51.103   -57.430 1.00 83.94  ? 19  GLU K CB  1 
ATOM   7035  C  CG  . GLU K  3 21  ? 105.555 52.435   -56.957 1.00 100.86 ? 19  GLU K CG  1 
ATOM   7036  C  CD  . GLU K  3 21  ? 106.230 53.197   -58.075 1.00 113.70 ? 19  GLU K CD  1 
ATOM   7037  O  OE1 . GLU K  3 21  ? 107.319 53.796   -57.856 1.00 116.32 ? 19  GLU K OE1 1 
ATOM   7038  O  OE2 . GLU K  3 21  ? 105.657 53.180   -59.189 1.00 115.97 ? 19  GLU K OE2 1 
ATOM   7039  N  N   . LEU K  3 22  ? 104.417 48.337   -56.507 1.00 66.74  ? 20  LEU K N   1 
ATOM   7040  C  CA  . LEU K  3 22  ? 104.376 46.929   -56.780 1.00 68.40  ? 20  LEU K CA  1 
ATOM   7041  C  C   . LEU K  3 22  ? 103.015 46.309   -56.415 1.00 72.69  ? 20  LEU K C   1 
ATOM   7042  O  O   . LEU K  3 22  ? 102.440 45.585   -57.227 1.00 76.86  ? 20  LEU K O   1 
ATOM   7043  C  CB  . LEU K  3 22  ? 105.542 46.244   -56.065 1.00 79.42  ? 20  LEU K CB  1 
ATOM   7044  C  CG  . LEU K  3 22  ? 105.870 44.873   -56.649 1.00 101.18 ? 20  LEU K CG  1 
ATOM   7045  C  CD1 . LEU K  3 22  ? 105.875 44.875   -58.184 1.00 107.13 ? 20  LEU K CD1 1 
ATOM   7046  C  CD2 . LEU K  3 22  ? 107.112 44.212   -56.035 1.00 109.28 ? 20  LEU K CD2 1 
ATOM   7047  N  N   . GLU K  3 23  ? 102.502 46.602   -55.214 1.00 79.13  ? 21  GLU K N   1 
ATOM   7048  C  CA  . GLU K  3 23  ? 101.260 45.966   -54.720 1.00 83.47  ? 21  GLU K CA  1 
ATOM   7049  C  C   . GLU K  3 23  ? 99.991  46.698   -55.203 1.00 81.93  ? 21  GLU K C   1 
ATOM   7050  O  O   . GLU K  3 23  ? 98.853  46.307   -54.842 1.00 55.89  ? 21  GLU K O   1 
ATOM   7051  C  CB  . GLU K  3 23  ? 101.235 45.861   -53.178 1.00 74.55  ? 21  GLU K CB  1 
ATOM   7052  C  CG  . GLU K  3 23  ? 102.328 45.012   -52.553 1.00 84.51  ? 21  GLU K CG  1 
ATOM   7053  C  CD  . GLU K  3 23  ? 102.493 45.251   -51.047 1.00 93.64  ? 21  GLU K CD  1 
ATOM   7054  O  OE1 . GLU K  3 23  ? 101.564 45.807   -50.410 1.00 79.38  ? 21  GLU K OE1 1 
ATOM   7055  O  OE2 . GLU K  3 23  ? 103.565 44.882   -50.507 1.00 106.78 ? 21  GLU K OE2 1 
ATOM   7056  N  N   . ARG K  3 24  ? 100.186 47.756   -56.002 1.00 79.35  ? 22  ARG K N   1 
ATOM   7057  C  CA  . ARG K  3 24  ? 99.066  48.565   -56.500 1.00 80.68  ? 22  ARG K CA  1 
ATOM   7058  C  C   . ARG K  3 24  ? 98.206  49.092   -55.354 1.00 77.16  ? 22  ARG K C   1 
ATOM   7059  O  O   . ARG K  3 24  ? 97.045  48.678   -55.205 1.00 77.73  ? 22  ARG K O   1 
ATOM   7060  C  CB  . ARG K  3 24  ? 98.182  47.739   -57.453 1.00 72.70  ? 22  ARG K CB  1 
ATOM   7061  C  CG  . ARG K  3 24  ? 98.839  47.424   -58.788 1.00 79.82  ? 22  ARG K CG  1 
ATOM   7062  C  CD  . ARG K  3 24  ? 99.215  48.723   -59.483 1.00 94.79  ? 22  ARG K CD  1 
ATOM   7063  N  NE  . ARG K  3 24  ? 100.434 48.601   -60.281 1.00 96.36  ? 22  ARG K NE  1 
ATOM   7064  C  CZ  . ARG K  3 24  ? 100.453 48.362   -61.590 1.00 110.64 ? 22  ARG K CZ  1 
ATOM   7065  N  NH1 . ARG K  3 24  ? 99.312  48.214   -62.255 1.00 119.36 ? 22  ARG K NH1 1 
ATOM   7066  N  NH2 . ARG K  3 24  ? 101.614 48.273   -62.235 1.00 118.02 ? 22  ARG K NH2 1 
ATOM   7067  N  N   . THR K  3 25  ? 98.783  49.970   -54.528 1.00 65.65  ? 23  THR K N   1 
ATOM   7068  C  CA  . THR K  3 25  ? 98.052  50.600   -53.417 1.00 61.75  ? 23  THR K CA  1 
ATOM   7069  C  C   . THR K  3 25  ? 98.581  51.996   -53.251 1.00 64.16  ? 23  THR K C   1 
ATOM   7070  O  O   . THR K  3 25  ? 99.672  52.320   -53.750 1.00 75.10  ? 23  THR K O   1 
ATOM   7071  C  CB  . THR K  3 25  ? 98.270  49.919   -52.026 1.00 60.54  ? 23  THR K CB  1 
ATOM   7072  O  OG1 . THR K  3 25  ? 99.236  50.675   -51.268 1.00 62.02  ? 23  THR K OG1 1 
ATOM   7073  C  CG2 . THR K  3 25  ? 98.713  48.441   -52.149 1.00 58.52  ? 23  THR K CG2 1 
ATOM   7074  N  N   . ASN K  3 26  ? 97.835  52.819   -52.519 1.00 65.04  ? 24  ASN K N   1 
ATOM   7075  C  CA  . ASN K  3 26  ? 98.320  54.163   -52.222 1.00 68.35  ? 24  ASN K CA  1 
ATOM   7076  C  C   . ASN K  3 26  ? 99.686  54.128   -51.535 1.00 75.80  ? 24  ASN K C   1 
ATOM   7077  O  O   . ASN K  3 26  ? 100.123 53.084   -51.017 1.00 72.00  ? 24  ASN K O   1 
ATOM   7078  C  CB  . ASN K  3 26  ? 97.317  54.947   -51.381 1.00 68.15  ? 24  ASN K CB  1 
ATOM   7079  C  CG  . ASN K  3 26  ? 96.096  55.370   -52.175 1.00 68.53  ? 24  ASN K CG  1 
ATOM   7080  O  OD1 . ASN K  3 26  ? 96.186  56.228   -53.058 1.00 72.00  ? 24  ASN K OD1 1 
ATOM   7081  N  ND2 . ASN K  3 26  ? 94.939  54.764   -51.858 1.00 67.37  ? 24  ASN K ND2 1 
ATOM   7082  N  N   . GLN K  3 27  ? 100.357 55.276   -51.537 1.00 70.07  ? 25  GLN K N   1 
ATOM   7083  C  CA  . GLN K  3 27  ? 101.695 55.354   -50.974 1.00 70.75  ? 25  GLN K CA  1 
ATOM   7084  C  C   . GLN K  3 27  ? 101.689 55.845   -49.543 1.00 71.33  ? 25  GLN K C   1 
ATOM   7085  O  O   . GLN K  3 27  ? 102.163 55.153   -48.635 1.00 70.25  ? 25  GLN K O   1 
ATOM   7086  C  CB  . GLN K  3 27  ? 102.584 56.268   -51.796 1.00 78.21  ? 25  GLN K CB  1 
ATOM   7087  C  CG  . GLN K  3 27  ? 104.028 56.192   -51.334 1.00 73.49  ? 25  GLN K CG  1 
ATOM   7088  C  CD  . GLN K  3 27  ? 104.918 57.172   -52.058 1.00 75.84  ? 25  GLN K CD  1 
ATOM   7089  O  OE1 . GLN K  3 27  ? 104.436 58.110   -52.699 1.00 88.95  ? 25  GLN K OE1 1 
ATOM   7090  N  NE2 . GLN K  3 27  ? 106.229 56.963   -51.962 1.00 76.23  ? 25  GLN K NE2 1 
ATOM   7091  N  N   . SER K  3 28  ? 101.177 57.048   -49.343 1.00 73.11  ? 26  SER K N   1 
ATOM   7092  C  CA  . SER K  3 28  ? 101.097 57.565   -47.999 1.00 73.75  ? 26  SER K CA  1 
ATOM   7093  C  C   . SER K  3 28  ? 99.775  58.293   -47.779 1.00 95.15  ? 26  SER K C   1 
ATOM   7094  O  O   . SER K  3 28  ? 99.114  58.724   -48.721 1.00 75.00  ? 26  SER K O   1 
ATOM   7095  C  CB  . SER K  3 28  ? 102.254 58.508   -47.733 1.00 75.93  ? 26  SER K CB  1 
ATOM   7096  O  OG  . SER K  3 28  ? 101.821 59.838   -47.943 1.00 95.47  ? 26  SER K OG  1 
ATOM   7097  N  N   . GLY K  3 29  ? 99.399  58.443   -46.519 1.00 107.06 ? 27  GLY K N   1 
ATOM   7098  C  CA  . GLY K  3 29  ? 98.172  59.129   -46.170 1.00 91.14  ? 27  GLY K CA  1 
ATOM   7099  C  C   . GLY K  3 29  ? 97.692  58.614   -44.833 1.00 94.79  ? 27  GLY K C   1 
ATOM   7100  O  O   . GLY K  3 29  ? 98.487  58.425   -43.906 1.00 98.55  ? 27  GLY K O   1 
ATOM   7101  N  N   . LEU K  3 30  ? 96.394  58.362   -44.728 1.00 80.17  ? 28  LEU K N   1 
ATOM   7102  C  CA  . LEU K  3 30  ? 95.839  57.851   -43.483 1.00 75.72  ? 28  LEU K CA  1 
ATOM   7103  C  C   . LEU K  3 30  ? 94.790  56.782   -43.741 1.00 69.28  ? 28  LEU K C   1 
ATOM   7104  O  O   . LEU K  3 30  ? 94.393  56.567   -44.880 1.00 68.90  ? 28  LEU K O   1 
ATOM   7105  C  CB  . LEU K  3 30  ? 95.256  59.019   -42.682 1.00 74.17  ? 28  LEU K CB  1 
ATOM   7106  C  CG  . LEU K  3 30  ? 94.276  59.962   -43.390 1.00 74.66  ? 28  LEU K CG  1 
ATOM   7107  C  CD1 . LEU K  3 30  ? 92.930  59.237   -43.655 1.00 84.64  ? 28  LEU K CD1 1 
ATOM   7108  C  CD2 . LEU K  3 30  ? 94.064  61.215   -42.553 1.00 76.78  ? 28  LEU K CD2 1 
ATOM   7109  N  N   . GLU K  3 31  ? 94.330  56.126   -42.683 1.00 67.93  ? 29  GLU K N   1 
ATOM   7110  C  CA  . GLU K  3 31  ? 93.422  54.981   -42.838 1.00 68.63  ? 29  GLU K CA  1 
ATOM   7111  C  C   . GLU K  3 31  ? 92.423  54.953   -41.692 1.00 74.62  ? 29  GLU K C   1 
ATOM   7112  O  O   . GLU K  3 31  ? 92.814  55.019   -40.524 1.00 86.43  ? 29  GLU K O   1 
ATOM   7113  C  CB  . GLU K  3 31  ? 94.219  53.662   -42.864 1.00 63.85  ? 29  GLU K CB  1 
ATOM   7114  C  CG  . GLU K  3 31  ? 93.516  52.479   -43.533 1.00 73.85  ? 29  GLU K CG  1 
ATOM   7115  C  CD  . GLU K  3 31  ? 94.293  51.148   -43.395 1.00 85.64  ? 29  GLU K CD  1 
ATOM   7116  O  OE1 . GLU K  3 31  ? 95.156  51.030   -42.490 1.00 89.27  ? 29  GLU K OE1 1 
ATOM   7117  O  OE2 . GLU K  3 31  ? 94.036  50.212   -44.192 1.00 80.21  ? 29  GLU K OE2 1 
ATOM   7118  N  N   . ARG K  3 32  ? 91.136  54.873   -42.015 1.00 73.43  ? 30  ARG K N   1 
ATOM   7119  C  CA  . ARG K  3 32  ? 90.131  54.686   -40.974 1.00 69.80  ? 30  ARG K CA  1 
ATOM   7120  C  C   . ARG K  3 32  ? 89.972  53.168   -40.744 1.00 66.40  ? 30  ARG K C   1 
ATOM   7121  O  O   . ARG K  3 32  ? 89.844  52.395   -41.697 1.00 84.92  ? 30  ARG K O   1 
ATOM   7122  C  CB  . ARG K  3 32  ? 88.812  55.393   -41.346 1.00 66.62  ? 30  ARG K CB  1 
ATOM   7123  N  N   . CYS K  3 33  ? 90.009  52.737   -39.486 1.00 73.60  ? 31  CYS K N   1 
ATOM   7124  C  CA  . CYS K  3 33  ? 90.126  51.298   -39.165 1.00 88.24  ? 31  CYS K CA  1 
ATOM   7125  C  C   . CYS K  3 33  ? 88.807  50.534   -39.064 1.00 94.14  ? 31  CYS K C   1 
ATOM   7126  O  O   . CYS K  3 33  ? 88.053  50.699   -38.103 1.00 93.69  ? 31  CYS K O   1 
ATOM   7127  C  CB  . CYS K  3 33  ? 90.926  51.102   -37.870 1.00 76.61  ? 31  CYS K CB  1 
ATOM   7128  S  SG  . CYS K  3 33  ? 92.509  52.005   -37.874 1.00 122.06 ? 31  CYS K SG  1 
ATOM   7129  N  N   . GLU K  3 34  ? 88.535  49.692   -40.054 1.00 105.79 ? 32  GLU K N   1 
ATOM   7130  C  CA  . GLU K  3 34  ? 87.357  48.832   -40.002 1.00 104.05 ? 32  GLU K CA  1 
ATOM   7131  C  C   . GLU K  3 34  ? 87.595  47.791   -38.918 1.00 106.61 ? 32  GLU K C   1 
ATOM   7132  O  O   . GLU K  3 34  ? 88.625  47.126   -38.920 1.00 104.50 ? 32  GLU K O   1 
ATOM   7133  C  CB  . GLU K  3 34  ? 87.121  48.148   -41.350 1.00 86.35  ? 32  GLU K CB  1 
ATOM   7134  N  N   . GLY K  3 35  ? 86.658  47.650   -37.984 1.00 99.90  ? 33  GLY K N   1 
ATOM   7135  C  CA  . GLY K  3 35  ? 86.877  46.764   -36.853 1.00 95.34  ? 33  GLY K CA  1 
ATOM   7136  C  C   . GLY K  3 35  ? 85.623  46.207   -36.205 1.00 106.78 ? 33  GLY K C   1 
ATOM   7137  O  O   . GLY K  3 35  ? 84.537  46.784   -36.339 1.00 104.09 ? 33  GLY K O   1 
ATOM   7138  N  N   . GLU K  3 36  ? 85.797  45.091   -35.489 1.00 106.99 ? 34  GLU K N   1 
ATOM   7139  C  CA  . GLU K  3 36  ? 84.718  44.351   -34.836 1.00 110.98 ? 34  GLU K CA  1 
ATOM   7140  C  C   . GLU K  3 36  ? 84.093  45.108   -33.666 1.00 140.82 ? 34  GLU K C   1 
ATOM   7141  O  O   . GLU K  3 36  ? 84.783  45.834   -32.951 1.00 145.20 ? 34  GLU K O   1 
ATOM   7142  C  CB  . GLU K  3 36  ? 85.240  43.002   -34.349 1.00 114.14 ? 34  GLU K CB  1 
ATOM   7143  N  N   . GLN K  3 37  ? 82.788  44.906   -33.469 1.00 160.13 ? 35  GLN K N   1 
ATOM   7144  C  CA  . GLN K  3 37  ? 81.985  45.683   -32.515 1.00 163.02 ? 35  GLN K CA  1 
ATOM   7145  C  C   . GLN K  3 37  ? 82.719  46.028   -31.220 1.00 156.24 ? 35  GLN K C   1 
ATOM   7146  O  O   . GLN K  3 37  ? 83.083  47.186   -30.993 1.00 153.54 ? 35  GLN K O   1 
ATOM   7147  C  CB  . GLN K  3 37  ? 80.671  44.961   -32.197 1.00 154.71 ? 35  GLN K CB  1 
ATOM   7148  N  N   . ASP K  3 38  ? 82.933  45.024   -30.376 1.00 128.05 ? 36  ASP K N   1 
ATOM   7149  C  CA  . ASP K  3 38  ? 83.560  45.250   -29.083 1.00 112.23 ? 36  ASP K CA  1 
ATOM   7150  C  C   . ASP K  3 38  ? 84.986  44.697   -29.024 1.00 119.00 ? 36  ASP K C   1 
ATOM   7151  O  O   . ASP K  3 38  ? 85.388  44.101   -28.012 1.00 118.26 ? 36  ASP K O   1 
ATOM   7152  C  CB  . ASP K  3 38  ? 82.707  44.653   -27.960 1.00 107.98 ? 36  ASP K CB  1 
ATOM   7153  N  N   . LYS K  3 39  ? 85.740  44.883   -30.110 1.00 111.08 ? 37  LYS K N   1 
ATOM   7154  C  CA  . LYS K  3 39  ? 87.173  44.568   -30.110 1.00 103.64 ? 37  LYS K CA  1 
ATOM   7155  C  C   . LYS K  3 39  ? 87.975  45.871   -30.245 1.00 95.71  ? 37  LYS K C   1 
ATOM   7156  O  O   . LYS K  3 39  ? 87.481  46.866   -30.779 1.00 80.39  ? 37  LYS K O   1 
ATOM   7157  C  CB  . LYS K  3 39  ? 87.545  43.549   -31.213 1.00 93.10  ? 37  LYS K CB  1 
ATOM   7158  C  CG  . LYS K  3 39  ? 87.528  42.052   -30.782 1.00 68.65  ? 37  LYS K CG  1 
ATOM   7159  N  N   . ARG K  3 40  ? 89.205  45.880   -29.745 1.00 86.28  ? 38  ARG K N   1 
ATOM   7160  C  CA  . ARG K  3 40  ? 90.026  47.088   -29.813 1.00 77.40  ? 38  ARG K CA  1 
ATOM   7161  C  C   . ARG K  3 40  ? 90.630  47.278   -31.206 1.00 79.07  ? 38  ARG K C   1 
ATOM   7162  O  O   . ARG K  3 40  ? 90.585  46.377   -32.051 1.00 82.01  ? 38  ARG K O   1 
ATOM   7163  C  CB  . ARG K  3 40  ? 91.161  47.037   -28.780 1.00 82.38  ? 38  ARG K CB  1 
ATOM   7164  C  CG  . ARG K  3 40  ? 90.753  46.762   -27.333 1.00 75.38  ? 38  ARG K CG  1 
ATOM   7165  C  CD  . ARG K  3 40  ? 91.823  47.318   -26.400 1.00 82.67  ? 38  ARG K CD  1 
ATOM   7166  N  NE  . ARG K  3 40  ? 91.823  46.712   -25.071 1.00 93.33  ? 38  ARG K NE  1 
ATOM   7167  C  CZ  . ARG K  3 40  ? 92.743  46.965   -24.143 1.00 97.38  ? 38  ARG K CZ  1 
ATOM   7168  N  NH1 . ARG K  3 40  ? 93.738  47.809   -24.401 1.00 92.90  ? 38  ARG K NH1 1 
ATOM   7169  N  NH2 . ARG K  3 40  ? 92.675  46.376   -22.958 1.00 93.71  ? 38  ARG K NH2 1 
ATOM   7170  N  N   . LEU K  3 41  ? 91.221  48.448   -31.426 1.00 81.62  ? 39  LEU K N   1 
ATOM   7171  C  CA  . LEU K  3 41  ? 91.923  48.732   -32.677 1.00 75.20  ? 39  LEU K CA  1 
ATOM   7172  C  C   . LEU K  3 41  ? 93.309  49.293   -32.403 1.00 75.48  ? 39  LEU K C   1 
ATOM   7173  O  O   . LEU K  3 41  ? 93.557  49.827   -31.327 1.00 92.89  ? 39  LEU K O   1 
ATOM   7174  C  CB  . LEU K  3 41  ? 91.110  49.689   -33.561 1.00 64.40  ? 39  LEU K CB  1 
ATOM   7175  C  CG  . LEU K  3 41  ? 89.786  49.082   -34.058 1.00 77.94  ? 39  LEU K CG  1 
ATOM   7176  C  CD1 . LEU K  3 41  ? 88.867  50.154   -34.654 1.00 91.60  ? 39  LEU K CD1 1 
ATOM   7177  C  CD2 . LEU K  3 41  ? 90.017  47.935   -35.053 1.00 66.90  ? 39  LEU K CD2 1 
ATOM   7178  N  N   . HIS K  3 42  ? 94.205  49.170   -33.381 1.00 75.33  ? 40  HIS K N   1 
ATOM   7179  C  CA  . HIS K  3 42  ? 95.599  49.576   -33.204 1.00 72.65  ? 40  HIS K CA  1 
ATOM   7180  C  C   . HIS K  3 42  ? 96.247  50.166   -34.458 1.00 69.87  ? 40  HIS K C   1 
ATOM   7181  O  O   . HIS K  3 42  ? 95.668  50.142   -35.553 1.00 64.07  ? 40  HIS K O   1 
ATOM   7182  C  CB  . HIS K  3 42  ? 96.416  48.380   -32.760 1.00 73.38  ? 40  HIS K CB  1 
ATOM   7183  C  CG  . HIS K  3 42  ? 95.833  47.652   -31.590 1.00 79.10  ? 40  HIS K CG  1 
ATOM   7184  N  ND1 . HIS K  3 42  ? 96.219  47.906   -30.291 1.00 84.36  ? 40  HIS K ND1 1 
ATOM   7185  C  CD2 . HIS K  3 42  ? 94.906  46.669   -31.522 1.00 88.58  ? 40  HIS K CD2 1 
ATOM   7186  C  CE1 . HIS K  3 42  ? 95.557  47.109   -29.473 1.00 96.64  ? 40  HIS K CE1 1 
ATOM   7187  N  NE2 . HIS K  3 42  ? 94.753  46.349   -30.194 1.00 99.90  ? 40  HIS K NE2 1 
ATOM   7188  N  N   . CYS K  3 43  ? 97.450  50.708   -34.281 1.00 68.70  ? 41  CYS K N   1 
ATOM   7189  C  CA  . CYS K  3 43  ? 98.262  51.201   -35.403 1.00 68.02  ? 41  CYS K CA  1 
ATOM   7190  C  C   . CYS K  3 43  ? 99.612  50.485   -35.392 1.00 77.17  ? 41  CYS K C   1 
ATOM   7191  O  O   . CYS K  3 43  ? 100.126 50.111   -34.328 1.00 82.28  ? 41  CYS K O   1 
ATOM   7192  C  CB  . CYS K  3 43  ? 98.495  52.722   -35.345 1.00 63.73  ? 41  CYS K CB  1 
ATOM   7193  S  SG  . CYS K  3 43  ? 97.007  53.745   -35.290 1.00 115.59 ? 41  CYS K SG  1 
ATOM   7194  N  N   . TYR K  3 44  ? 100.186 50.291   -36.576 1.00 75.58  ? 42  TYR K N   1 
ATOM   7195  C  CA  . TYR K  3 44  ? 101.499 49.667   -36.674 1.00 70.69  ? 42  TYR K CA  1 
ATOM   7196  C  C   . TYR K  3 44  ? 102.385 50.466   -37.594 1.00 71.33  ? 42  TYR K C   1 
ATOM   7197  O  O   . TYR K  3 44  ? 101.913 51.249   -38.449 1.00 63.03  ? 42  TYR K O   1 
ATOM   7198  C  CB  . TYR K  3 44  ? 101.421 48.211   -37.180 1.00 64.37  ? 42  TYR K CB  1 
ATOM   7199  C  CG  . TYR K  3 44  ? 101.268 48.085   -38.688 1.00 74.32  ? 42  TYR K CG  1 
ATOM   7200  C  CD1 . TYR K  3 44  ? 100.047 48.343   -39.306 1.00 78.30  ? 42  TYR K CD1 1 
ATOM   7201  C  CD2 . TYR K  3 44  ? 102.340 47.712   -39.489 1.00 71.99  ? 42  TYR K CD2 1 
ATOM   7202  C  CE1 . TYR K  3 44  ? 99.898  48.239   -40.674 1.00 89.80  ? 42  TYR K CE1 1 
ATOM   7203  C  CE2 . TYR K  3 44  ? 102.197 47.606   -40.869 1.00 80.35  ? 42  TYR K CE2 1 
ATOM   7204  C  CZ  . TYR K  3 44  ? 100.967 47.871   -41.452 1.00 91.68  ? 42  TYR K CZ  1 
ATOM   7205  O  OH  . TYR K  3 44  ? 100.787 47.781   -42.815 1.00 96.70  ? 42  TYR K OH  1 
ATOM   7206  N  N   . ALA K  3 45  ? 103.679 50.241   -37.391 1.00 67.89  ? 43  ALA K N   1 
ATOM   7207  C  CA  . ALA K  3 45  ? 104.727 50.739   -38.264 1.00 63.74  ? 43  ALA K CA  1 
ATOM   7208  C  C   . ALA K  3 45  ? 105.760 49.642   -38.343 1.00 63.18  ? 43  ALA K C   1 
ATOM   7209  O  O   . ALA K  3 45  ? 105.915 48.844   -37.406 1.00 88.68  ? 43  ALA K O   1 
ATOM   7210  C  CB  . ALA K  3 45  ? 105.338 51.976   -37.701 1.00 65.94  ? 43  ALA K CB  1 
ATOM   7211  N  N   . SER K  3 46  ? 106.455 49.587   -39.469 1.00 63.08  ? 44  SER K N   1 
ATOM   7212  C  CA  . SER K  3 46  ? 107.510 48.611   -39.666 1.00 69.09  ? 44  SER K CA  1 
ATOM   7213  C  C   . SER K  3 46  ? 108.505 49.200   -40.631 1.00 76.36  ? 44  SER K C   1 
ATOM   7214  O  O   . SER K  3 46  ? 108.120 49.819   -41.638 1.00 81.80  ? 44  SER K O   1 
ATOM   7215  C  CB  . SER K  3 46  ? 106.953 47.330   -40.254 1.00 62.40  ? 44  SER K CB  1 
ATOM   7216  O  OG  . SER K  3 46  ? 106.384 47.634   -41.512 1.00 80.44  ? 44  SER K OG  1 
ATOM   7217  N  N   . TRP K  3 47  ? 109.781 48.978   -40.324 1.00 76.82  ? 45  TRP K N   1 
ATOM   7218  C  CA  . TRP K  3 47  ? 110.865 49.576   -41.080 1.00 72.27  ? 45  TRP K CA  1 
ATOM   7219  C  C   . TRP K  3 47  ? 112.113 48.711   -41.030 1.00 69.32  ? 45  TRP K C   1 
ATOM   7220  O  O   . TRP K  3 47  ? 112.239 47.849   -40.181 1.00 81.83  ? 45  TRP K O   1 
ATOM   7221  C  CB  . TRP K  3 47  ? 111.191 50.931   -40.479 1.00 82.92  ? 45  TRP K CB  1 
ATOM   7222  C  CG  . TRP K  3 47  ? 111.618 50.837   -39.045 1.00 85.14  ? 45  TRP K CG  1 
ATOM   7223  C  CD1 . TRP K  3 47  ? 112.898 50.812   -38.568 1.00 86.45  ? 45  TRP K CD1 1 
ATOM   7224  C  CD2 . TRP K  3 47  ? 110.763 50.753   -37.902 1.00 88.08  ? 45  TRP K CD2 1 
ATOM   7225  N  NE1 . TRP K  3 47  ? 112.891 50.731   -37.198 1.00 86.28  ? 45  TRP K NE1 1 
ATOM   7226  C  CE2 . TRP K  3 47  ? 111.593 50.696   -36.763 1.00 83.08  ? 45  TRP K CE2 1 
ATOM   7227  C  CE3 . TRP K  3 47  ? 109.376 50.730   -37.730 1.00 106.82 ? 45  TRP K CE3 1 
ATOM   7228  C  CZ2 . TRP K  3 47  ? 111.082 50.610   -35.470 1.00 94.63  ? 45  TRP K CZ2 1 
ATOM   7229  C  CZ3 . TRP K  3 47  ? 108.868 50.645   -36.445 1.00 111.88 ? 45  TRP K CZ3 1 
ATOM   7230  C  CH2 . TRP K  3 47  ? 109.721 50.585   -35.331 1.00 106.03 ? 45  TRP K CH2 1 
ATOM   7231  N  N   . ARG K  3 48  ? 113.041 48.954   -41.946 1.00 71.18  ? 46  ARG K N   1 
ATOM   7232  C  CA  . ARG K  3 48  ? 114.327 48.260   -41.941 1.00 72.66  ? 46  ARG K CA  1 
ATOM   7233  C  C   . ARG K  3 48  ? 115.383 49.164   -41.291 1.00 86.51  ? 46  ARG K C   1 
ATOM   7234  O  O   . ARG K  3 48  ? 115.239 50.391   -41.289 1.00 80.84  ? 46  ARG K O   1 
ATOM   7235  C  CB  . ARG K  3 48  ? 114.728 47.859   -43.374 1.00 66.61  ? 46  ARG K CB  1 
ATOM   7236  C  CG  . ARG K  3 48  ? 114.189 46.502   -43.840 1.00 64.32  ? 46  ARG K CG  1 
ATOM   7237  C  CD  . ARG K  3 48  ? 113.983 46.463   -45.356 1.00 64.24  ? 46  ARG K CD  1 
ATOM   7238  N  NE  . ARG K  3 48  ? 113.687 45.106   -45.819 1.00 99.01  ? 46  ARG K NE  1 
ATOM   7239  C  CZ  . ARG K  3 48  ? 112.839 44.804   -46.806 1.00 116.09 ? 46  ARG K CZ  1 
ATOM   7240  N  NH1 . ARG K  3 48  ? 112.186 45.769   -47.452 1.00 96.33  ? 46  ARG K NH1 1 
ATOM   7241  N  NH2 . ARG K  3 48  ? 112.641 43.527   -47.144 1.00 110.77 ? 46  ARG K NH2 1 
ATOM   7242  N  N   . ASN K  3 49  ? 116.432 48.569   -40.724 1.00 114.72 ? 47  ASN K N   1 
ATOM   7243  C  CA  . ASN K  3 49  ? 117.498 49.362   -40.111 1.00 119.52 ? 47  ASN K CA  1 
ATOM   7244  C  C   . ASN K  3 49  ? 118.888 48.840   -40.450 1.00 134.06 ? 47  ASN K C   1 
ATOM   7245  O  O   . ASN K  3 49  ? 119.393 47.905   -39.816 1.00 143.94 ? 47  ASN K O   1 
ATOM   7246  C  CB  . ASN K  3 49  ? 117.320 49.458   -38.595 1.00 117.60 ? 47  ASN K CB  1 
ATOM   7247  C  CG  . ASN K  3 49  ? 117.992 50.682   -38.016 1.00 126.81 ? 47  ASN K CG  1 
ATOM   7248  O  OD1 . ASN K  3 49  ? 117.656 51.802   -38.381 1.00 118.79 ? 47  ASN K OD1 1 
ATOM   7249  N  ND2 . ASN K  3 49  ? 118.969 50.468   -37.128 1.00 153.34 ? 47  ASN K ND2 1 
ATOM   7250  N  N   . SER K  3 50  ? 119.496 49.457   -41.456 1.00 119.96 ? 48  SER K N   1 
ATOM   7251  C  CA  . SER K  3 50  ? 120.822 49.068   -41.903 1.00 116.46 ? 48  SER K CA  1 
ATOM   7252  C  C   . SER K  3 50  ? 121.863 49.920   -41.197 1.00 121.52 ? 48  SER K C   1 
ATOM   7253  O  O   . SER K  3 50  ? 122.395 50.875   -41.765 1.00 106.01 ? 48  SER K O   1 
ATOM   7254  C  CB  . SER K  3 50  ? 120.925 49.204   -43.422 1.00 103.39 ? 48  SER K CB  1 
ATOM   7255  O  OG  . SER K  3 50  ? 119.732 48.721   -44.032 1.00 102.82 ? 48  SER K OG  1 
ATOM   7256  N  N   . SER K  3 51  ? 122.135 49.561   -39.946 1.00 131.68 ? 49  SER K N   1 
ATOM   7257  C  CA  . SER K  3 51  ? 123.090 50.277   -39.121 1.00 126.59 ? 49  SER K CA  1 
ATOM   7258  C  C   . SER K  3 51  ? 122.800 51.761   -39.115 1.00 122.11 ? 49  SER K C   1 
ATOM   7259  O  O   . SER K  3 51  ? 123.562 52.533   -39.696 1.00 123.19 ? 49  SER K O   1 
ATOM   7260  C  CB  . SER K  3 51  ? 124.515 50.046   -39.622 1.00 114.53 ? 49  SER K CB  1 
ATOM   7261  N  N   . GLY K  3 52  ? 121.699 52.155   -38.473 1.00 108.51 ? 50  GLY K N   1 
ATOM   7262  C  CA  . GLY K  3 52  ? 121.399 53.569   -38.255 1.00 117.22 ? 50  GLY K CA  1 
ATOM   7263  C  C   . GLY K  3 52  ? 120.601 54.297   -39.332 1.00 120.49 ? 50  GLY K C   1 
ATOM   7264  O  O   . GLY K  3 52  ? 119.924 55.291   -39.050 1.00 84.92  ? 50  GLY K O   1 
ATOM   7265  N  N   . THR K  3 53  ? 120.691 53.818   -40.571 1.00 144.64 ? 51  THR K N   1 
ATOM   7266  C  CA  . THR K  3 53  ? 119.913 54.391   -41.663 1.00 135.25 ? 51  THR K CA  1 
ATOM   7267  C  C   . THR K  3 53  ? 118.540 53.715   -41.733 1.00 129.09 ? 51  THR K C   1 
ATOM   7268  O  O   . THR K  3 53  ? 118.432 52.498   -41.949 1.00 124.99 ? 51  THR K O   1 
ATOM   7269  C  CB  . THR K  3 53  ? 120.662 54.329   -43.021 1.00 128.32 ? 51  THR K CB  1 
ATOM   7270  O  OG1 . THR K  3 53  ? 121.319 53.068   -43.165 1.00 126.75 ? 51  THR K OG1 1 
ATOM   7271  C  CG2 . THR K  3 53  ? 121.707 55.443   -43.106 1.00 129.33 ? 51  THR K CG2 1 
ATOM   7272  N  N   . ILE K  3 54  ? 117.492 54.510   -41.527 1.00 112.13 ? 52  ILE K N   1 
ATOM   7273  C  CA  . ILE K  3 54  ? 116.131 53.974   -41.415 1.00 94.29  ? 52  ILE K CA  1 
ATOM   7274  C  C   . ILE K  3 54  ? 115.336 54.064   -42.714 1.00 86.32  ? 52  ILE K C   1 
ATOM   7275  O  O   . ILE K  3 54  ? 115.023 55.156   -43.195 1.00 93.83  ? 52  ILE K O   1 
ATOM   7276  C  CB  . ILE K  3 54  ? 115.302 54.694   -40.320 1.00 79.63  ? 52  ILE K CB  1 
ATOM   7277  C  CG1 . ILE K  3 54  ? 116.054 54.751   -38.989 1.00 89.14  ? 52  ILE K CG1 1 
ATOM   7278  C  CG2 . ILE K  3 54  ? 113.983 53.989   -40.118 1.00 74.98  ? 52  ILE K CG2 1 
ATOM   7279  C  CD1 . ILE K  3 54  ? 115.378 55.637   -37.948 1.00 82.79  ? 52  ILE K CD1 1 
ATOM   7280  N  N   . GLU K  3 55  ? 114.994 52.908   -43.266 1.00 79.42  ? 53  GLU K N   1 
ATOM   7281  C  CA  . GLU K  3 55  ? 114.125 52.854   -44.433 1.00 87.11  ? 53  GLU K CA  1 
ATOM   7282  C  C   . GLU K  3 55  ? 112.723 52.357   -44.036 1.00 89.27  ? 53  GLU K C   1 
ATOM   7283  O  O   . GLU K  3 55  ? 112.571 51.236   -43.536 1.00 95.30  ? 53  GLU K O   1 
ATOM   7284  C  CB  . GLU K  3 55  ? 114.749 51.950   -45.502 1.00 97.42  ? 53  GLU K CB  1 
ATOM   7285  C  CG  . GLU K  3 55  ? 113.831 51.606   -46.669 1.00 122.99 ? 53  GLU K CG  1 
ATOM   7286  C  CD  . GLU K  3 55  ? 114.261 50.333   -47.378 1.00 134.23 ? 53  GLU K CD  1 
ATOM   7287  O  OE1 . GLU K  3 55  ? 115.485 50.067   -47.407 1.00 134.88 ? 53  GLU K OE1 1 
ATOM   7288  O  OE2 . GLU K  3 55  ? 113.379 49.598   -47.891 1.00 131.90 ? 53  GLU K OE2 1 
ATOM   7289  N  N   . LEU K  3 56  ? 111.705 53.194   -44.252 1.00 84.79  ? 54  LEU K N   1 
ATOM   7290  C  CA  . LEU K  3 56  ? 110.327 52.830   -43.918 1.00 76.00  ? 54  LEU K CA  1 
ATOM   7291  C  C   . LEU K  3 56  ? 109.788 51.724   -44.836 1.00 70.15  ? 54  LEU K C   1 
ATOM   7292  O  O   . LEU K  3 56  ? 110.095 51.686   -46.025 1.00 91.31  ? 54  LEU K O   1 
ATOM   7293  C  CB  . LEU K  3 56  ? 109.419 54.057   -44.004 1.00 72.14  ? 54  LEU K CB  1 
ATOM   7294  C  CG  . LEU K  3 56  ? 108.517 54.309   -42.792 1.00 71.82  ? 54  LEU K CG  1 
ATOM   7295  C  CD1 . LEU K  3 56  ? 107.472 55.368   -43.142 1.00 72.92  ? 54  LEU K CD1 1 
ATOM   7296  C  CD2 . LEU K  3 56  ? 107.836 53.022   -42.310 1.00 70.52  ? 54  LEU K CD2 1 
ATOM   7297  N  N   . VAL K  3 57  ? 108.974 50.831   -44.289 1.00 66.83  ? 55  VAL K N   1 
ATOM   7298  C  CA  . VAL K  3 57  ? 108.427 49.741   -45.084 1.00 74.09  ? 55  VAL K CA  1 
ATOM   7299  C  C   . VAL K  3 57  ? 106.901 49.747   -45.118 1.00 82.24  ? 55  VAL K C   1 
ATOM   7300  O  O   . VAL K  3 57  ? 106.310 49.513   -46.177 1.00 86.12  ? 55  VAL K O   1 
ATOM   7301  C  CB  . VAL K  3 57  ? 108.944 48.383   -44.586 1.00 72.65  ? 55  VAL K CB  1 
ATOM   7302  C  CG1 . VAL K  3 57  ? 108.079 47.248   -45.111 1.00 61.06  ? 55  VAL K CG1 1 
ATOM   7303  C  CG2 . VAL K  3 57  ? 110.408 48.207   -44.989 1.00 75.45  ? 55  VAL K CG2 1 
ATOM   7304  N  N   . LYS K  3 58  ? 106.267 50.018   -43.974 1.00 79.77  ? 56  LYS K N   1 
ATOM   7305  C  CA  . LYS K  3 58  ? 104.802 50.012   -43.920 1.00 71.51  ? 56  LYS K CA  1 
ATOM   7306  C  C   . LYS K  3 58  ? 104.229 50.612   -42.639 1.00 69.22  ? 56  LYS K C   1 
ATOM   7307  O  O   . LYS K  3 58  ? 104.742 50.368   -41.559 1.00 70.49  ? 56  LYS K O   1 
ATOM   7308  C  CB  . LYS K  3 58  ? 104.268 48.586   -44.092 1.00 60.59  ? 56  LYS K CB  1 
ATOM   7309  C  CG  . LYS K  3 58  ? 103.854 48.248   -45.511 1.00 59.98  ? 56  LYS K CG  1 
ATOM   7310  C  CD  . LYS K  3 58  ? 103.480 46.782   -45.604 1.00 67.59  ? 56  LYS K CD  1 
ATOM   7311  C  CE  . LYS K  3 58  ? 102.764 46.421   -46.920 1.00 72.98  ? 56  LYS K CE  1 
ATOM   7312  N  NZ  . LYS K  3 58  ? 103.676 46.486   -48.100 1.00 67.33  ? 56  LYS K NZ  1 
ATOM   7313  N  N   . LYS K  3 59  ? 103.162 51.393   -42.772 1.00 64.08  ? 57  LYS K N   1 
ATOM   7314  C  CA  . LYS K  3 59  ? 102.422 51.908   -41.623 1.00 64.41  ? 57  LYS K CA  1 
ATOM   7315  C  C   . LYS K  3 59  ? 100.936 51.724   -41.885 1.00 80.20  ? 57  LYS K C   1 
ATOM   7316  O  O   . LYS K  3 59  ? 100.487 51.844   -43.027 1.00 89.62  ? 57  LYS K O   1 
ATOM   7317  C  CB  . LYS K  3 59  ? 102.700 53.397   -41.414 1.00 66.87  ? 57  LYS K CB  1 
ATOM   7318  C  CG  . LYS K  3 59  ? 104.083 53.737   -40.900 1.00 68.11  ? 57  LYS K CG  1 
ATOM   7319  C  CD  . LYS K  3 59  ? 104.050 55.160   -40.374 1.00 70.49  ? 57  LYS K CD  1 
ATOM   7320  C  CE  . LYS K  3 59  ? 105.426 55.801   -40.201 1.00 72.16  ? 57  LYS K CE  1 
ATOM   7321  N  NZ  . LYS K  3 59  ? 105.276 57.298   -40.347 1.00 74.58  ? 57  LYS K NZ  1 
ATOM   7322  N  N   . GLY K  3 60  ? 100.154 51.450   -40.847 1.00 86.52  ? 58  GLY K N   1 
ATOM   7323  C  CA  . GLY K  3 60  ? 98.721  51.326   -41.072 1.00 84.36  ? 58  GLY K CA  1 
ATOM   7324  C  C   . GLY K  3 60  ? 97.931  50.745   -39.922 1.00 75.32  ? 58  GLY K C   1 
ATOM   7325  O  O   . GLY K  3 60  ? 98.432  50.663   -38.802 1.00 60.58  ? 58  GLY K O   1 
ATOM   7326  N  N   . CYS K  3 61  ? 96.692  50.341   -40.200 1.00 65.30  ? 59  CYS K N   1 
ATOM   7327  C  CA  . CYS K  3 61  ? 95.799  49.856   -39.152 1.00 58.38  ? 59  CYS K CA  1 
ATOM   7328  C  C   . CYS K  3 61  ? 96.176  48.432   -38.782 1.00 60.68  ? 59  CYS K C   1 
ATOM   7329  O  O   . CYS K  3 61  ? 96.758  47.722   -39.598 1.00 77.13  ? 59  CYS K O   1 
ATOM   7330  C  CB  . CYS K  3 61  ? 94.346  49.920   -39.603 1.00 57.98  ? 59  CYS K CB  1 
ATOM   7331  S  SG  . CYS K  3 61  ? 93.599  51.576   -39.540 1.00 103.19 ? 59  CYS K SG  1 
ATOM   7332  N  N   . TRP K  3 62  ? 95.842  48.016   -37.557 1.00 72.72  ? 60  TRP K N   1 
ATOM   7333  C  CA  . TRP K  3 62  ? 96.210  46.690   -37.031 1.00 62.99  ? 60  TRP K CA  1 
ATOM   7334  C  C   . TRP K  3 62  ? 95.165  46.203   -36.028 1.00 59.48  ? 60  TRP K C   1 
ATOM   7335  O  O   . TRP K  3 62  ? 94.628  46.968   -35.231 1.00 60.07  ? 60  TRP K O   1 
ATOM   7336  C  CB  . TRP K  3 62  ? 97.590  46.769   -36.378 1.00 55.51  ? 60  TRP K CB  1 
ATOM   7337  C  CG  . TRP K  3 62  ? 98.182  45.468   -35.864 1.00 58.03  ? 60  TRP K CG  1 
ATOM   7338  C  CD1 . TRP K  3 62  ? 98.076  44.966   -34.597 1.00 77.81  ? 60  TRP K CD1 1 
ATOM   7339  C  CD2 . TRP K  3 62  ? 99.030  44.560   -36.578 1.00 52.34  ? 60  TRP K CD2 1 
ATOM   7340  N  NE1 . TRP K  3 62  ? 98.789  43.801   -34.486 1.00 77.97  ? 60  TRP K NE1 1 
ATOM   7341  C  CE2 . TRP K  3 62  ? 99.387  43.532   -35.688 1.00 71.73  ? 60  TRP K CE2 1 
ATOM   7342  C  CE3 . TRP K  3 62  ? 99.525  44.520   -37.876 1.00 61.61  ? 60  TRP K CE3 1 
ATOM   7343  C  CZ2 . TRP K  3 62  ? 100.207 42.465   -36.065 1.00 77.26  ? 60  TRP K CZ2 1 
ATOM   7344  C  CZ3 . TRP K  3 62  ? 100.340 43.456   -38.249 1.00 73.16  ? 60  TRP K CZ3 1 
ATOM   7345  C  CH2 . TRP K  3 62  ? 100.671 42.447   -37.348 1.00 68.58  ? 60  TRP K CH2 1 
ATOM   7346  N  N   . LEU K  3 63  ? 94.883  44.916   -36.055 1.00 63.52  ? 61  LEU K N   1 
ATOM   7347  C  CA  . LEU K  3 63  ? 93.740  44.389   -35.306 1.00 65.41  ? 61  LEU K CA  1 
ATOM   7348  C  C   . LEU K  3 63  ? 93.996  43.931   -33.873 1.00 68.35  ? 61  LEU K C   1 
ATOM   7349  O  O   . LEU K  3 63  ? 95.045  43.353   -33.562 1.00 81.11  ? 61  LEU K O   1 
ATOM   7350  C  CB  . LEU K  3 63  ? 93.089  43.240   -36.076 1.00 56.76  ? 61  LEU K CB  1 
ATOM   7351  C  CG  . LEU K  3 63  ? 92.182  43.727   -37.196 1.00 56.38  ? 61  LEU K CG  1 
ATOM   7352  C  CD1 . LEU K  3 63  ? 91.468  42.539   -37.806 1.00 57.00  ? 61  LEU K CD1 1 
ATOM   7353  C  CD2 . LEU K  3 63  ? 91.195  44.746   -36.635 1.00 51.52  ? 61  LEU K CD2 1 
ATOM   7354  N  N   . ASP K  3 64  ? 92.992  44.166   -33.030 1.00 60.70  ? 62  ASP K N   1 
ATOM   7355  C  CA  . ASP K  3 64  ? 92.996  43.753   -31.632 1.00 65.07  ? 62  ASP K CA  1 
ATOM   7356  C  C   . ASP K  3 64  ? 94.048  42.674   -31.299 1.00 75.42  ? 62  ASP K C   1 
ATOM   7357  O  O   . ASP K  3 64  ? 93.765  41.466   -31.277 1.00 98.25  ? 62  ASP K O   1 
ATOM   7358  C  CB  . ASP K  3 64  ? 91.590  43.292   -31.234 1.00 79.16  ? 62  ASP K CB  1 
ATOM   7359  C  CG  . ASP K  3 64  ? 91.459  43.034   -29.745 1.00 96.74  ? 62  ASP K CG  1 
ATOM   7360  O  OD1 . ASP K  3 64  ? 92.026  42.023   -29.259 1.00 113.51 ? 62  ASP K OD1 1 
ATOM   7361  O  OD2 . ASP K  3 64  ? 90.779  43.836   -29.067 1.00 71.94  ? 62  ASP K OD2 1 
ATOM   7362  N  N   . ASP K  3 65  ? 95.267  43.127   -31.037 1.00 66.82  ? 63  ASP K N   1 
ATOM   7363  C  CA  . ASP K  3 65  ? 96.352  42.240   -30.672 1.00 79.43  ? 63  ASP K CA  1 
ATOM   7364  C  C   . ASP K  3 65  ? 96.877  42.761   -29.334 1.00 83.44  ? 63  ASP K C   1 
ATOM   7365  O  O   . ASP K  3 65  ? 97.220  43.943   -29.198 1.00 73.59  ? 63  ASP K O   1 
ATOM   7366  C  CB  . ASP K  3 65  ? 97.405  42.231   -31.790 1.00 86.73  ? 63  ASP K CB  1 
ATOM   7367  C  CG  . ASP K  3 65  ? 98.754  41.704   -31.337 1.00 93.76  ? 63  ASP K CG  1 
ATOM   7368  O  OD1 . ASP K  3 65  ? 98.812  40.857   -30.422 1.00 110.02 ? 63  ASP K OD1 1 
ATOM   7369  O  OD2 . ASP K  3 65  ? 99.771  42.142   -31.909 1.00 84.13  ? 63  ASP K OD2 1 
ATOM   7370  N  N   . PHE K  3 66  ? 96.877  41.881   -28.337 1.00 91.66  ? 64  PHE K N   1 
ATOM   7371  C  CA  . PHE K  3 66  ? 97.199  42.245   -26.957 1.00 79.25  ? 64  PHE K CA  1 
ATOM   7372  C  C   . PHE K  3 66  ? 98.599  42.822   -26.777 1.00 74.67  ? 64  PHE K C   1 
ATOM   7373  O  O   . PHE K  3 66  ? 98.860  43.506   -25.789 1.00 88.01  ? 64  PHE K O   1 
ATOM   7374  C  CB  . PHE K  3 66  ? 97.073  41.024   -26.047 1.00 76.00  ? 64  PHE K CB  1 
ATOM   7375  C  CG  . PHE K  3 66  ? 98.143  39.998   -26.280 1.00 64.63  ? 64  PHE K CG  1 
ATOM   7376  C  CD1 . PHE K  3 66  ? 99.380  40.105   -25.657 1.00 48.62  ? 64  PHE K CD1 1 
ATOM   7377  C  CD2 . PHE K  3 66  ? 97.923  38.952   -27.150 1.00 75.36  ? 64  PHE K CD2 1 
ATOM   7378  C  CE1 . PHE K  3 66  ? 100.365 39.168   -25.875 1.00 54.50  ? 64  PHE K CE1 1 
ATOM   7379  C  CE2 . PHE K  3 66  ? 98.908  38.023   -27.376 1.00 82.70  ? 64  PHE K CE2 1 
ATOM   7380  C  CZ  . PHE K  3 66  ? 100.134 38.129   -26.733 1.00 60.74  ? 64  PHE K CZ  1 
ATOM   7381  N  N   . ASN K  3 67  ? 99.509  42.513   -27.696 1.00 58.60  ? 65  ASN K N   1 
ATOM   7382  C  CA  . ASN K  3 67  ? 100.834 43.106   -27.642 1.00 69.84  ? 65  ASN K CA  1 
ATOM   7383  C  C   . ASN K  3 67  ? 100.798 44.652   -27.639 1.00 72.09  ? 65  ASN K C   1 
ATOM   7384  O  O   . ASN K  3 67  ? 101.706 45.313   -27.123 1.00 85.44  ? 65  ASN K O   1 
ATOM   7385  C  CB  . ASN K  3 67  ? 101.683 42.593   -28.796 1.00 75.67  ? 65  ASN K CB  1 
ATOM   7386  C  CG  . ASN K  3 67  ? 102.093 41.155   -28.618 1.00 78.02  ? 65  ASN K CG  1 
ATOM   7387  O  OD1 . ASN K  3 67  ? 101.577 40.277   -29.307 1.00 84.78  ? 65  ASN K OD1 1 
ATOM   7388  N  ND2 . ASN K  3 67  ? 103.046 40.902   -27.708 1.00 54.84  ? 65  ASN K ND2 1 
ATOM   7389  N  N   . CYS K  3 68  ? 99.737  45.222   -28.199 1.00 68.69  ? 66  CYS K N   1 
ATOM   7390  C  CA  . CYS K  3 68  ? 99.649  46.663   -28.355 1.00 85.37  ? 66  CYS K CA  1 
ATOM   7391  C  C   . CYS K  3 68  ? 98.818  47.241   -27.229 1.00 98.90  ? 66  CYS K C   1 
ATOM   7392  O  O   . CYS K  3 68  ? 98.714  48.464   -27.087 1.00 112.12 ? 66  CYS K O   1 
ATOM   7393  C  CB  . CYS K  3 68  ? 99.001  47.015   -29.700 1.00 85.98  ? 66  CYS K CB  1 
ATOM   7394  S  SG  . CYS K  3 68  ? 99.613  46.106   -31.143 1.00 103.99 ? 66  CYS K SG  1 
ATOM   7395  N  N   . TYR K  3 69  ? 98.219  46.357   -26.435 1.00 84.16  ? 67  TYR K N   1 
ATOM   7396  C  CA  . TYR K  3 69  ? 97.239  46.788   -25.444 1.00 94.53  ? 67  TYR K CA  1 
ATOM   7397  C  C   . TYR K  3 69  ? 97.787  47.893   -24.552 1.00 102.79 ? 67  TYR K C   1 
ATOM   7398  O  O   . TYR K  3 69  ? 98.896  47.782   -24.028 1.00 84.89  ? 67  TYR K O   1 
ATOM   7399  C  CB  . TYR K  3 69  ? 96.748  45.616   -24.592 1.00 91.66  ? 67  TYR K CB  1 
ATOM   7400  C  CG  . TYR K  3 69  ? 95.579  44.833   -25.169 1.00 74.87  ? 67  TYR K CG  1 
ATOM   7401  C  CD1 . TYR K  3 69  ? 94.836  45.322   -26.235 1.00 77.08  ? 67  TYR K CD1 1 
ATOM   7402  C  CD2 . TYR K  3 69  ? 95.217  43.600   -24.632 1.00 85.33  ? 67  TYR K CD2 1 
ATOM   7403  C  CE1 . TYR K  3 69  ? 93.764  44.599   -26.754 1.00 84.59  ? 67  TYR K CE1 1 
ATOM   7404  C  CE2 . TYR K  3 69  ? 94.155  42.870   -25.144 1.00 93.61  ? 67  TYR K CE2 1 
ATOM   7405  C  CZ  . TYR K  3 69  ? 93.431  43.376   -26.201 1.00 95.60  ? 67  TYR K CZ  1 
ATOM   7406  O  OH  . TYR K  3 69  ? 92.374  42.655   -26.706 1.00 106.71 ? 67  TYR K OH  1 
ATOM   7407  N  N   . ASP K  3 70  ? 96.989  48.952   -24.413 1.00 111.69 ? 68  ASP K N   1 
ATOM   7408  C  CA  . ASP K  3 70  ? 97.283  50.087   -23.551 1.00 117.41 ? 68  ASP K CA  1 
ATOM   7409  C  C   . ASP K  3 70  ? 98.736  50.554   -23.647 1.00 112.26 ? 68  ASP K C   1 
ATOM   7410  O  O   . ASP K  3 70  ? 99.446  50.645   -22.646 1.00 120.67 ? 68  ASP K O   1 
ATOM   7411  C  CB  . ASP K  3 70  ? 96.896  49.765   -22.107 1.00 135.70 ? 68  ASP K CB  1 
ATOM   7412  C  CG  . ASP K  3 70  ? 96.717  51.007   -21.267 1.00 167.89 ? 68  ASP K CG  1 
ATOM   7413  O  OD1 . ASP K  3 70  ? 95.632  51.624   -21.341 1.00 176.27 ? 68  ASP K OD1 1 
ATOM   7414  O  OD2 . ASP K  3 70  ? 97.662  51.369   -20.535 1.00 180.46 ? 68  ASP K OD2 1 
ATOM   7415  N  N   . ARG K  3 71  ? 99.171  50.859   -24.862 1.00 96.28  ? 69  ARG K N   1 
ATOM   7416  C  CA  . ARG K  3 71  ? 100.533 51.319   -25.085 1.00 85.87  ? 69  ARG K CA  1 
ATOM   7417  C  C   . ARG K  3 71  ? 100.539 52.625   -25.902 1.00 90.79  ? 69  ARG K C   1 
ATOM   7418  O  O   . ARG K  3 71  ? 100.248 52.621   -27.099 1.00 64.82  ? 69  ARG K O   1 
ATOM   7419  C  CB  . ARG K  3 71  ? 101.340 50.217   -25.778 1.00 73.04  ? 69  ARG K CB  1 
ATOM   7420  C  CG  . ARG K  3 71  ? 102.743 50.641   -26.195 1.00 105.99 ? 69  ARG K CG  1 
ATOM   7421  C  CD  . ARG K  3 71  ? 103.384 49.582   -27.056 1.00 105.51 ? 69  ARG K CD  1 
ATOM   7422  N  NE  . ARG K  3 71  ? 103.290 48.277   -26.422 1.00 94.47  ? 69  ARG K NE  1 
ATOM   7423  C  CZ  . ARG K  3 71  ? 104.303 47.682   -25.802 1.00 97.92  ? 69  ARG K CZ  1 
ATOM   7424  N  NH1 . ARG K  3 71  ? 105.490 48.290   -25.747 1.00 75.29  ? 69  ARG K NH1 1 
ATOM   7425  N  NH2 . ARG K  3 71  ? 104.130 46.480   -25.247 1.00 94.17  ? 69  ARG K NH2 1 
ATOM   7426  N  N   . GLN K  3 72  ? 100.875 53.736   -25.249 1.00 111.75 ? 70  GLN K N   1 
ATOM   7427  C  CA  . GLN K  3 72  ? 100.661 55.060   -25.830 1.00 114.77 ? 70  GLN K CA  1 
ATOM   7428  C  C   . GLN K  3 72  ? 101.522 55.362   -27.053 1.00 100.12 ? 70  GLN K C   1 
ATOM   7429  O  O   . GLN K  3 72  ? 101.017 55.906   -28.034 1.00 80.70  ? 70  GLN K O   1 
ATOM   7430  C  CB  . GLN K  3 72  ? 100.842 56.151   -24.775 1.00 134.16 ? 70  GLN K CB  1 
ATOM   7431  N  N   . GLU K  3 73  ? 102.809 55.019   -27.002 1.00 99.88  ? 71  GLU K N   1 
ATOM   7432  C  CA  . GLU K  3 73  ? 103.711 55.315   -28.120 1.00 90.47  ? 71  GLU K CA  1 
ATOM   7433  C  C   . GLU K  3 73  ? 104.072 54.065   -28.929 1.00 98.12  ? 71  GLU K C   1 
ATOM   7434  O  O   . GLU K  3 73  ? 103.995 52.927   -28.425 1.00 90.39  ? 71  GLU K O   1 
ATOM   7435  C  CB  . GLU K  3 73  ? 104.976 56.030   -27.633 1.00 80.77  ? 71  GLU K CB  1 
ATOM   7436  N  N   . CYS K  3 74  ? 104.454 54.276   -30.188 1.00 97.93  ? 72  CYS K N   1 
ATOM   7437  C  CA  . CYS K  3 74  ? 104.770 53.153   -31.062 1.00 109.27 ? 72  CYS K CA  1 
ATOM   7438  C  C   . CYS K  3 74  ? 106.231 52.736   -30.905 1.00 97.72  ? 72  CYS K C   1 
ATOM   7439  O  O   . CYS K  3 74  ? 107.134 53.358   -31.464 1.00 85.69  ? 72  CYS K O   1 
ATOM   7440  C  CB  . CYS K  3 74  ? 104.452 53.478   -32.525 1.00 115.32 ? 72  CYS K CB  1 
ATOM   7441  S  SG  . CYS K  3 74  ? 104.292 51.974   -33.550 1.00 100.97 ? 72  CYS K SG  1 
ATOM   7442  N  N   . VAL K  3 75  ? 106.468 51.676   -30.145 1.00 103.95 ? 73  VAL K N   1 
ATOM   7443  C  CA  . VAL K  3 75  ? 107.840 51.273   -29.877 1.00 97.19  ? 73  VAL K CA  1 
ATOM   7444  C  C   . VAL K  3 75  ? 108.104 49.785   -30.117 1.00 96.86  ? 73  VAL K C   1 
ATOM   7445  O  O   . VAL K  3 75  ? 107.305 48.922   -29.728 1.00 112.21 ? 73  VAL K O   1 
ATOM   7446  C  CB  . VAL K  3 75  ? 108.243 51.618   -28.447 1.00 87.25  ? 73  VAL K CB  1 
ATOM   7447  C  CG1 . VAL K  3 75  ? 109.718 51.355   -28.259 1.00 88.77  ? 73  VAL K CG1 1 
ATOM   7448  C  CG2 . VAL K  3 75  ? 107.908 53.057   -28.141 1.00 69.39  ? 73  VAL K CG2 1 
ATOM   7449  N  N   . ALA K  3 76  ? 109.243 49.513   -30.753 1.00 77.86  ? 74  ALA K N   1 
ATOM   7450  C  CA  . ALA K  3 76  ? 109.654 48.169   -31.124 1.00 75.98  ? 74  ALA K CA  1 
ATOM   7451  C  C   . ALA K  3 76  ? 110.488 47.596   -30.005 1.00 95.12  ? 74  ALA K C   1 
ATOM   7452  O  O   . ALA K  3 76  ? 111.259 48.318   -29.376 1.00 123.73 ? 74  ALA K O   1 
ATOM   7453  C  CB  . ALA K  3 76  ? 110.460 48.213   -32.408 1.00 74.98  ? 74  ALA K CB  1 
ATOM   7454  N  N   . THR K  3 77  ? 110.356 46.295   -29.769 1.00 86.18  ? 75  THR K N   1 
ATOM   7455  C  CA  . THR K  3 77  ? 110.993 45.676   -28.607 1.00 84.68  ? 75  THR K CA  1 
ATOM   7456  C  C   . THR K  3 77  ? 112.031 44.598   -28.934 1.00 92.12  ? 75  THR K C   1 
ATOM   7457  O  O   . THR K  3 77  ? 112.859 44.263   -28.091 1.00 115.53 ? 75  THR K O   1 
ATOM   7458  C  CB  . THR K  3 77  ? 109.937 45.095   -27.650 1.00 94.87  ? 75  THR K CB  1 
ATOM   7459  O  OG1 . THR K  3 77  ? 109.189 44.059   -28.314 1.00 93.31  ? 75  THR K OG1 1 
ATOM   7460  C  CG2 . THR K  3 77  ? 108.984 46.199   -27.194 1.00 99.40  ? 75  THR K CG2 1 
ATOM   7461  N  N   . GLU K  3 78  ? 111.980 44.056   -30.148 1.00 89.05  ? 76  GLU K N   1 
ATOM   7462  C  CA  . GLU K  3 78  ? 112.908 43.007   -30.565 1.00 85.16  ? 76  GLU K CA  1 
ATOM   7463  C  C   . GLU K  3 78  ? 114.368 43.487   -30.513 1.00 107.15 ? 76  GLU K C   1 
ATOM   7464  O  O   . GLU K  3 78  ? 114.656 44.679   -30.727 1.00 104.93 ? 76  GLU K O   1 
ATOM   7465  C  CB  . GLU K  3 78  ? 112.557 42.519   -31.974 1.00 85.94  ? 76  GLU K CB  1 
ATOM   7466  C  CG  . GLU K  3 78  ? 111.153 41.974   -32.109 1.00 98.68  ? 76  GLU K CG  1 
ATOM   7467  C  CD  . GLU K  3 78  ? 111.039 40.538   -31.648 1.00 115.85 ? 76  GLU K CD  1 
ATOM   7468  O  OE1 . GLU K  3 78  ? 109.962 40.162   -31.140 1.00 117.19 ? 76  GLU K OE1 1 
ATOM   7469  O  OE2 . GLU K  3 78  ? 112.024 39.784   -31.803 1.00 117.04 ? 76  GLU K OE2 1 
ATOM   7470  N  N   . GLU K  3 79  ? 115.282 42.555   -30.229 1.00 114.95 ? 77  GLU K N   1 
ATOM   7471  C  CA  . GLU K  3 79  ? 116.707 42.876   -30.084 1.00 116.04 ? 77  GLU K CA  1 
ATOM   7472  C  C   . GLU K  3 79  ? 117.311 43.403   -31.391 1.00 115.51 ? 77  GLU K C   1 
ATOM   7473  O  O   . GLU K  3 79  ? 117.533 44.609   -31.548 1.00 105.53 ? 77  GLU K O   1 
ATOM   7474  C  CB  . GLU K  3 79  ? 117.492 41.659   -29.577 1.00 106.98 ? 77  GLU K CB  1 
ATOM   7475  N  N   . ASN K  3 80  ? 117.574 42.491   -32.321 1.00 113.42 ? 78  ASN K N   1 
ATOM   7476  C  CA  . ASN K  3 80  ? 118.086 42.865   -33.636 1.00 118.44 ? 78  ASN K CA  1 
ATOM   7477  C  C   . ASN K  3 80  ? 117.375 42.087   -34.735 1.00 102.21 ? 78  ASN K C   1 
ATOM   7478  O  O   . ASN K  3 80  ? 117.728 40.935   -35.046 1.00 94.81  ? 78  ASN K O   1 
ATOM   7479  C  CB  . ASN K  3 80  ? 119.595 42.640   -33.723 1.00 130.81 ? 78  ASN K CB  1 
ATOM   7480  C  CG  . ASN K  3 80  ? 120.191 43.187   -35.008 1.00 136.96 ? 78  ASN K CG  1 
ATOM   7481  O  OD1 . ASN K  3 80  ? 119.794 44.254   -35.486 1.00 140.92 ? 78  ASN K OD1 1 
ATOM   7482  N  ND2 . ASN K  3 80  ? 121.147 42.452   -35.580 1.00 134.20 ? 78  ASN K ND2 1 
ATOM   7483  N  N   . PRO K  3 81  ? 116.351 42.710   -35.315 1.00 78.53  ? 79  PRO K N   1 
ATOM   7484  C  CA  . PRO K  3 81  ? 115.511 42.060   -36.328 1.00 89.89  ? 79  PRO K CA  1 
ATOM   7485  C  C   . PRO K  3 81  ? 115.800 42.481   -37.774 1.00 88.05  ? 79  PRO K C   1 
ATOM   7486  O  O   . PRO K  3 81  ? 116.188 43.615   -38.047 1.00 99.89  ? 79  PRO K O   1 
ATOM   7487  C  CB  . PRO K  3 81  ? 114.097 42.495   -35.927 1.00 86.43  ? 79  PRO K CB  1 
ATOM   7488  C  CG  . PRO K  3 81  ? 114.308 43.821   -35.171 1.00 78.64  ? 79  PRO K CG  1 
ATOM   7489  C  CD  . PRO K  3 81  ? 115.785 43.988   -34.864 1.00 64.37  ? 79  PRO K CD  1 
ATOM   7490  N  N   . GLN K  3 82  ? 115.623 41.531   -38.684 1.00 76.13  ? 80  GLN K N   1 
ATOM   7491  C  CA  . GLN K  3 82  ? 115.478 41.807   -40.102 1.00 68.68  ? 80  GLN K CA  1 
ATOM   7492  C  C   . GLN K  3 82  ? 114.540 43.001   -40.277 1.00 88.96  ? 80  GLN K C   1 
ATOM   7493  O  O   . GLN K  3 82  ? 114.972 44.083   -40.692 1.00 91.16  ? 80  GLN K O   1 
ATOM   7494  C  CB  . GLN K  3 82  ? 114.869 40.576   -40.791 1.00 102.58 ? 80  GLN K CB  1 
ATOM   7495  C  CG  . GLN K  3 82  ? 114.405 39.434   -39.817 1.00 159.28 ? 80  GLN K CG  1 
ATOM   7496  C  CD  . GLN K  3 82  ? 112.907 39.462   -39.437 1.00 121.93 ? 80  GLN K CD  1 
ATOM   7497  O  OE1 . GLN K  3 82  ? 112.042 39.089   -40.234 1.00 108.78 ? 80  GLN K OE1 1 
ATOM   7498  N  NE2 . GLN K  3 82  ? 112.614 39.876   -38.203 1.00 79.76  ? 80  GLN K NE2 1 
ATOM   7499  N  N   . VAL K  3 83  ? 113.258 42.799   -39.946 1.00 92.47  ? 81  VAL K N   1 
ATOM   7500  C  CA  . VAL K  3 83  ? 112.244 43.859   -40.013 1.00 72.14  ? 81  VAL K CA  1 
ATOM   7501  C  C   . VAL K  3 83  ? 111.793 44.335   -38.633 1.00 59.40  ? 81  VAL K C   1 
ATOM   7502  O  O   . VAL K  3 83  ? 111.318 43.559   -37.809 1.00 73.60  ? 81  VAL K O   1 
ATOM   7503  C  CB  . VAL K  3 83  ? 111.009 43.381   -40.747 1.00 70.82  ? 81  VAL K CB  1 
ATOM   7504  C  CG1 . VAL K  3 83  ? 109.951 44.490   -40.759 1.00 79.74  ? 81  VAL K CG1 1 
ATOM   7505  C  CG2 . VAL K  3 83  ? 111.384 42.933   -42.150 1.00 66.26  ? 81  VAL K CG2 1 
ATOM   7506  N  N   . TYR K  3 84  ? 111.956 45.619   -38.379 1.00 64.15  ? 82  TYR K N   1 
ATOM   7507  C  CA  . TYR K  3 84  ? 111.518 46.189   -37.117 1.00 75.71  ? 82  TYR K CA  1 
ATOM   7508  C  C   . TYR K  3 84  ? 110.001 46.392   -37.204 1.00 79.65  ? 82  TYR K C   1 
ATOM   7509  O  O   . TYR K  3 84  ? 109.466 46.852   -38.232 1.00 89.32  ? 82  TYR K O   1 
ATOM   7510  C  CB  . TYR K  3 84  ? 112.258 47.517   -36.800 1.00 78.72  ? 82  TYR K CB  1 
ATOM   7511  C  CG  . TYR K  3 84  ? 113.772 47.397   -36.594 1.00 92.86  ? 82  TYR K CG  1 
ATOM   7512  C  CD1 . TYR K  3 84  ? 114.421 48.094   -35.572 1.00 98.43  ? 82  TYR K CD1 1 
ATOM   7513  C  CD2 . TYR K  3 84  ? 114.552 46.592   -37.426 1.00 111.17 ? 82  TYR K CD2 1 
ATOM   7514  C  CE1 . TYR K  3 84  ? 115.807 47.990   -35.388 1.00 107.93 ? 82  TYR K CE1 1 
ATOM   7515  C  CE2 . TYR K  3 84  ? 115.931 46.484   -37.248 1.00 118.94 ? 82  TYR K CE2 1 
ATOM   7516  C  CZ  . TYR K  3 84  ? 116.551 47.182   -36.232 1.00 109.69 ? 82  TYR K CZ  1 
ATOM   7517  O  OH  . TYR K  3 84  ? 117.912 47.065   -36.075 1.00 95.82  ? 82  TYR K OH  1 
ATOM   7518  N  N   . PHE K  3 85  ? 109.312 46.030   -36.128 1.00 77.40  ? 83  PHE K N   1 
ATOM   7519  C  CA  . PHE K  3 85  ? 107.875 46.219   -36.049 1.00 64.50  ? 83  PHE K CA  1 
ATOM   7520  C  C   . PHE K  3 85  ? 107.471 46.851   -34.728 1.00 64.71  ? 83  PHE K C   1 
ATOM   7521  O  O   . PHE K  3 85  ? 108.132 46.661   -33.708 1.00 79.90  ? 83  PHE K O   1 
ATOM   7522  C  CB  . PHE K  3 85  ? 107.184 44.881   -36.161 1.00 57.04  ? 83  PHE K CB  1 
ATOM   7523  C  CG  . PHE K  3 85  ? 105.694 44.955   -36.037 1.00 56.28  ? 83  PHE K CG  1 
ATOM   7524  C  CD1 . PHE K  3 85  ? 104.897 45.000   -37.176 1.00 75.68  ? 83  PHE K CD1 1 
ATOM   7525  C  CD2 . PHE K  3 85  ? 105.087 44.955   -34.791 1.00 55.95  ? 83  PHE K CD2 1 
ATOM   7526  C  CE1 . PHE K  3 85  ? 103.520 45.039   -37.078 1.00 81.28  ? 83  PHE K CE1 1 
ATOM   7527  C  CE2 . PHE K  3 85  ? 103.707 44.998   -34.684 1.00 77.87  ? 83  PHE K CE2 1 
ATOM   7528  C  CZ  . PHE K  3 85  ? 102.920 45.039   -35.829 1.00 84.32  ? 83  PHE K CZ  1 
ATOM   7529  N  N   . CYS K  3 86  ? 106.372 47.592   -34.748 1.00 60.22  ? 84  CYS K N   1 
ATOM   7530  C  CA  . CYS K  3 86  ? 105.808 48.131   -33.518 1.00 60.68  ? 84  CYS K CA  1 
ATOM   7531  C  C   . CYS K  3 86  ? 104.325 48.444   -33.708 1.00 84.10  ? 84  CYS K C   1 
ATOM   7532  O  O   . CYS K  3 86  ? 103.873 48.849   -34.799 1.00 76.41  ? 84  CYS K O   1 
ATOM   7533  C  CB  . CYS K  3 86  ? 106.565 49.395   -33.084 1.00 62.92  ? 84  CYS K CB  1 
ATOM   7534  S  SG  . CYS K  3 86  ? 106.035 50.947   -33.883 1.00 67.44  ? 84  CYS K SG  1 
ATOM   7535  N  N   . CYS K  3 87  ? 103.558 48.256   -32.644 1.00 95.00  ? 85  CYS K N   1 
ATOM   7536  C  CA  . CYS K  3 87  ? 102.163 48.668   -32.673 1.00 81.93  ? 85  CYS K CA  1 
ATOM   7537  C  C   . CYS K  3 87  ? 101.801 49.487   -31.443 1.00 82.02  ? 85  CYS K C   1 
ATOM   7538  O  O   . CYS K  3 87  ? 102.572 49.564   -30.479 1.00 105.71 ? 85  CYS K O   1 
ATOM   7539  C  CB  . CYS K  3 87  ? 101.248 47.464   -32.806 1.00 64.81  ? 85  CYS K CB  1 
ATOM   7540  S  SG  . CYS K  3 87  ? 101.591 46.165   -31.635 1.00 100.47 ? 85  CYS K SG  1 
ATOM   7541  N  N   . CYS K  3 88  ? 100.623 50.101   -31.486 1.00 63.40  ? 86  CYS K N   1 
ATOM   7542  C  CA  . CYS K  3 88  ? 100.191 51.005   -30.431 1.00 70.36  ? 86  CYS K CA  1 
ATOM   7543  C  C   . CYS K  3 88  ? 98.681  51.275   -30.496 1.00 90.26  ? 86  CYS K C   1 
ATOM   7544  O  O   . CYS K  3 88  ? 97.990  50.836   -31.425 1.00 102.18 ? 86  CYS K O   1 
ATOM   7545  C  CB  . CYS K  3 88  ? 100.944 52.312   -30.556 1.00 64.37  ? 86  CYS K CB  1 
ATOM   7546  S  SG  . CYS K  3 88  ? 100.635 53.063   -32.144 1.00 96.50  ? 86  CYS K SG  1 
ATOM   7547  N  N   . GLU K  3 89  ? 98.184  52.011   -29.504 1.00 81.15  ? 87  GLU K N   1 
ATOM   7548  C  CA  . GLU K  3 89  ? 96.756  52.278   -29.358 1.00 72.03  ? 87  GLU K CA  1 
ATOM   7549  C  C   . GLU K  3 89  ? 96.547  53.778   -29.215 1.00 76.09  ? 87  GLU K C   1 
ATOM   7550  O  O   . GLU K  3 89  ? 97.192  54.430   -28.389 1.00 92.21  ? 87  GLU K O   1 
ATOM   7551  C  CB  . GLU K  3 89  ? 96.223  51.549   -28.125 1.00 80.58  ? 87  GLU K CB  1 
ATOM   7552  C  CG  . GLU K  3 89  ? 94.734  51.228   -28.144 1.00 97.14  ? 87  GLU K CG  1 
ATOM   7553  C  CD  . GLU K  3 89  ? 94.349  50.192   -27.072 1.00 106.57 ? 87  GLU K CD  1 
ATOM   7554  O  OE1 . GLU K  3 89  ? 95.240  49.794   -26.289 1.00 105.52 ? 87  GLU K OE1 1 
ATOM   7555  O  OE2 . GLU K  3 89  ? 93.165  49.773   -27.010 1.00 88.01  ? 87  GLU K OE2 1 
ATOM   7556  N  N   . GLY K  3 90  ? 95.661  54.328   -30.036 1.00 84.06  ? 88  GLY K N   1 
ATOM   7557  C  CA  . GLY K  3 90  ? 95.390  55.753   -30.011 1.00 84.16  ? 88  GLY K CA  1 
ATOM   7558  C  C   . GLY K  3 90  ? 95.611  56.381   -31.367 1.00 81.34  ? 88  GLY K C   1 
ATOM   7559  O  O   . GLY K  3 90  ? 96.599  56.090   -32.043 1.00 82.10  ? 88  GLY K O   1 
ATOM   7560  N  N   . ASN K  3 91  ? 94.692  57.255   -31.762 1.00 78.12  ? 89  ASN K N   1 
ATOM   7561  C  CA  . ASN K  3 91  ? 94.752  57.866   -33.084 1.00 79.93  ? 89  ASN K CA  1 
ATOM   7562  C  C   . ASN K  3 91  ? 96.118  58.416   -33.492 1.00 76.84  ? 89  ASN K C   1 
ATOM   7563  O  O   . ASN K  3 91  ? 96.709  59.228   -32.787 1.00 74.67  ? 89  ASN K O   1 
ATOM   7564  C  CB  . ASN K  3 91  ? 93.680  58.945   -33.224 1.00 79.13  ? 89  ASN K CB  1 
ATOM   7565  C  CG  . ASN K  3 91  ? 92.290  58.360   -33.349 1.00 90.35  ? 89  ASN K CG  1 
ATOM   7566  O  OD1 . ASN K  3 91  ? 92.072  57.199   -32.969 1.00 87.20  ? 89  ASN K OD1 1 
ATOM   7567  N  ND2 . ASN K  3 91  ? 91.340  59.149   -33.895 1.00 86.64  ? 89  ASN K ND2 1 
ATOM   7568  N  N   . PHE K  3 92  ? 96.608  57.950   -34.638 1.00 83.98  ? 90  PHE K N   1 
ATOM   7569  C  CA  . PHE K  3 92  ? 97.871  58.428   -35.214 1.00 86.55  ? 90  PHE K CA  1 
ATOM   7570  C  C   . PHE K  3 92  ? 99.102  58.182   -34.344 1.00 87.36  ? 90  PHE K C   1 
ATOM   7571  O  O   . PHE K  3 92  ? 100.150 58.822   -34.532 1.00 86.34  ? 90  PHE K O   1 
ATOM   7572  C  CB  . PHE K  3 92  ? 97.765  59.903   -35.569 1.00 75.27  ? 90  PHE K CB  1 
ATOM   7573  C  CG  . PHE K  3 92  ? 96.660  60.197   -36.518 1.00 79.12  ? 90  PHE K CG  1 
ATOM   7574  C  CD1 . PHE K  3 92  ? 96.475  59.401   -37.643 1.00 84.84  ? 90  PHE K CD1 1 
ATOM   7575  C  CD2 . PHE K  3 92  ? 95.776  61.250   -36.279 1.00 93.27  ? 90  PHE K CD2 1 
ATOM   7576  C  CE1 . PHE K  3 92  ? 95.439  59.664   -38.526 1.00 99.87  ? 90  PHE K CE1 1 
ATOM   7577  C  CE2 . PHE K  3 92  ? 94.737  61.528   -37.160 1.00 91.01  ? 90  PHE K CE2 1 
ATOM   7578  C  CZ  . PHE K  3 92  ? 94.569  60.740   -38.286 1.00 96.38  ? 90  PHE K CZ  1 
ATOM   7579  N  N   . CYS K  3 93  ? 98.978  57.241   -33.412 1.00 81.81  ? 91  CYS K N   1 
ATOM   7580  C  CA  . CYS K  3 93  ? 100.079 56.908   -32.533 1.00 90.85  ? 91  CYS K CA  1 
ATOM   7581  C  C   . CYS K  3 93  ? 101.302 56.398   -33.310 1.00 94.57  ? 91  CYS K C   1 
ATOM   7582  O  O   . CYS K  3 93  ? 102.411 56.343   -32.769 1.00 116.79 ? 91  CYS K O   1 
ATOM   7583  C  CB  . CYS K  3 93  ? 99.624  55.877   -31.507 1.00 96.15  ? 91  CYS K CB  1 
ATOM   7584  S  SG  . CYS K  3 93  ? 99.045  54.342   -32.258 1.00 133.49 ? 91  CYS K SG  1 
ATOM   7585  N  N   . ASN K  3 94  ? 101.110 56.030   -34.575 1.00 73.70  ? 92  ASN K N   1 
ATOM   7586  C  CA  . ASN K  3 94  ? 102.231 55.560   -35.395 1.00 69.89  ? 92  ASN K CA  1 
ATOM   7587  C  C   . ASN K  3 94  ? 102.866 56.645   -36.271 1.00 72.00  ? 92  ASN K C   1 
ATOM   7588  O  O   . ASN K  3 94  ? 103.653 56.325   -37.161 1.00 77.01  ? 92  ASN K O   1 
ATOM   7589  C  CB  . ASN K  3 94  ? 101.840 54.341   -36.243 1.00 67.75  ? 92  ASN K CB  1 
ATOM   7590  C  CG  . ASN K  3 94  ? 100.763 54.655   -37.292 1.00 82.24  ? 92  ASN K CG  1 
ATOM   7591  O  OD1 . ASN K  3 94  ? 100.139 55.721   -37.279 1.00 75.55  ? 92  ASN K OD1 1 
ATOM   7592  N  ND2 . ASN K  3 94  ? 100.540 53.710   -38.203 1.00 85.71  ? 92  ASN K ND2 1 
ATOM   7593  N  N   . GLU K  3 95  ? 102.539 57.917   -36.018 1.00 73.95  ? 93  GLU K N   1 
ATOM   7594  C  CA  . GLU K  3 95  ? 103.197 59.014   -36.729 1.00 88.31  ? 93  GLU K CA  1 
ATOM   7595  C  C   . GLU K  3 95  ? 104.702 58.904   -36.553 1.00 94.22  ? 93  GLU K C   1 
ATOM   7596  O  O   . GLU K  3 95  ? 105.446 58.863   -37.539 1.00 112.25 ? 93  GLU K O   1 
ATOM   7597  C  CB  . GLU K  3 95  ? 102.708 60.384   -36.248 1.00 89.44  ? 93  GLU K CB  1 
ATOM   7598  N  N   . ARG K  3 96  ? 105.145 58.853   -35.297 1.00 83.04  ? 94  ARG K N   1 
ATOM   7599  C  CA  . ARG K  3 96  ? 106.570 58.690   -34.989 1.00 88.02  ? 94  ARG K CA  1 
ATOM   7600  C  C   . ARG K  3 96  ? 106.782 57.368   -34.256 1.00 78.95  ? 94  ARG K C   1 
ATOM   7601  O  O   . ARG K  3 96  ? 105.889 56.890   -33.551 1.00 78.10  ? 94  ARG K O   1 
ATOM   7602  C  CB  . ARG K  3 96  ? 107.121 59.873   -34.172 1.00 81.82  ? 94  ARG K CB  1 
ATOM   7603  N  N   . PHE K  3 97  ? 107.959 56.775   -34.442 1.00 75.05  ? 95  PHE K N   1 
ATOM   7604  C  CA  . PHE K  3 97  ? 108.273 55.486   -33.832 1.00 74.52  ? 95  PHE K CA  1 
ATOM   7605  C  C   . PHE K  3 97  ? 109.741 55.439   -33.427 1.00 87.20  ? 95  PHE K C   1 
ATOM   7606  O  O   . PHE K  3 97  ? 110.541 56.232   -33.921 1.00 95.28  ? 95  PHE K O   1 
ATOM   7607  C  CB  . PHE K  3 97  ? 107.955 54.333   -34.796 1.00 73.22  ? 95  PHE K CB  1 
ATOM   7608  C  CG  . PHE K  3 97  ? 108.730 54.389   -36.091 1.00 89.96  ? 95  PHE K CG  1 
ATOM   7609  C  CD1 . PHE K  3 97  ? 109.885 53.625   -36.262 1.00 77.69  ? 95  PHE K CD1 1 
ATOM   7610  C  CD2 . PHE K  3 97  ? 108.305 55.210   -37.135 1.00 91.67  ? 95  PHE K CD2 1 
ATOM   7611  C  CE1 . PHE K  3 97  ? 110.592 53.670   -37.448 1.00 71.86  ? 95  PHE K CE1 1 
ATOM   7612  C  CE2 . PHE K  3 97  ? 109.008 55.264   -38.323 1.00 73.37  ? 95  PHE K CE2 1 
ATOM   7613  C  CZ  . PHE K  3 97  ? 110.154 54.488   -38.483 1.00 72.89  ? 95  PHE K CZ  1 
ATOM   7614  N  N   . THR K  3 98  ? 110.090 54.506   -32.541 1.00 97.29  ? 96  THR K N   1 
ATOM   7615  C  CA  . THR K  3 98  ? 111.465 54.373   -32.051 1.00 91.90  ? 96  THR K CA  1 
ATOM   7616  C  C   . THR K  3 98  ? 111.816 52.926   -31.702 1.00 93.42  ? 96  THR K C   1 
ATOM   7617  O  O   . THR K  3 98  ? 110.977 52.024   -31.871 1.00 102.42 ? 96  THR K O   1 
ATOM   7618  C  CB  . THR K  3 98  ? 111.707 55.254   -30.812 1.00 92.86  ? 96  THR K CB  1 
ATOM   7619  O  OG1 . THR K  3 98  ? 110.741 54.948   -29.803 1.00 77.72  ? 96  THR K OG1 1 
ATOM   7620  C  CG2 . THR K  3 98  ? 111.588 56.721   -31.165 1.00 103.99 ? 96  THR K CG2 1 
ATOM   7621  N  N   . HIS K  3 99  ? 113.038 52.712   -31.202 1.00 81.65  ? 97  HIS K N   1 
ATOM   7622  C  CA  . HIS K  3 99  ? 113.517 51.357   -30.895 1.00 105.96 ? 97  HIS K CA  1 
ATOM   7623  C  C   . HIS K  3 99  ? 114.150 51.250   -29.505 1.00 123.24 ? 97  HIS K C   1 
ATOM   7624  O  O   . HIS K  3 99  ? 114.949 52.112   -29.135 1.00 141.38 ? 97  HIS K O   1 
ATOM   7625  C  CB  . HIS K  3 99  ? 114.535 50.911   -31.956 1.00 105.61 ? 97  HIS K CB  1 
ATOM   7626  C  CG  . HIS K  3 99  ? 115.186 49.594   -31.662 1.00 105.02 ? 97  HIS K CG  1 
ATOM   7627  N  ND1 . HIS K  3 99  ? 114.629 48.387   -32.033 1.00 117.31 ? 97  HIS K ND1 1 
ATOM   7628  C  CD2 . HIS K  3 99  ? 116.348 49.294   -31.034 1.00 99.57  ? 97  HIS K CD2 1 
ATOM   7629  C  CE1 . HIS K  3 99  ? 115.420 47.400   -31.647 1.00 109.55 ? 97  HIS K CE1 1 
ATOM   7630  N  NE2 . HIS K  3 99  ? 116.469 47.924   -31.037 1.00 109.00 ? 97  HIS K NE2 1 
ATOM   7631  N  N   . LEU K  3 100 ? 113.799 50.202   -28.747 1.00 116.54 ? 98  LEU K N   1 
ATOM   7632  C  CA  . LEU K  3 100 ? 114.472 49.894   -27.469 1.00 120.09 ? 98  LEU K CA  1 
ATOM   7633  C  C   . LEU K  3 100 ? 114.053 48.552   -26.842 1.00 112.39 ? 98  LEU K C   1 
ATOM   7634  O  O   . LEU K  3 100 ? 112.968 48.446   -26.268 1.00 94.30  ? 98  LEU K O   1 
ATOM   7635  C  CB  . LEU K  3 100 ? 114.312 51.039   -26.454 1.00 124.71 ? 98  LEU K CB  1 
ATOM   7636  C  CG  . LEU K  3 100 ? 112.938 51.394   -25.890 1.00 117.07 ? 98  LEU K CG  1 
ATOM   7637  C  CD1 . LEU K  3 100 ? 112.917 51.162   -24.396 1.00 91.50  ? 98  LEU K CD1 1 
ATOM   7638  C  CD2 . LEU K  3 100 ? 112.613 52.841   -26.199 1.00 124.65 ? 98  LEU K CD2 1 
ATOM   7639  N  N   . PRO K  3 101 ? 114.932 47.531   -26.939 1.00 112.26 ? 99  PRO K N   1 
ATOM   7640  C  CA  . PRO K  3 101 ? 114.665 46.143   -26.518 1.00 118.63 ? 99  PRO K CA  1 
ATOM   7641  C  C   . PRO K  3 101 ? 114.451 45.946   -25.015 1.00 108.67 ? 99  PRO K C   1 
ATOM   7642  O  O   . PRO K  3 101 ? 113.999 44.862   -24.618 1.00 93.92  ? 99  PRO K O   1 
ATOM   7643  C  CB  . PRO K  3 101 ? 115.921 45.385   -26.976 1.00 116.69 ? 99  PRO K CB  1 
ATOM   7644  C  CG  . PRO K  3 101 ? 116.980 46.427   -27.114 1.00 100.56 ? 99  PRO K CG  1 
ATOM   7645  C  CD  . PRO K  3 101 ? 116.273 47.679   -27.540 1.00 92.80  ? 99  PRO K CD  1 
ATOM   7646  N  N   . ARG L  3 11  ? 58.405  15.697   -55.002 1.00 79.48  ? 9   ARG L N   1 
ATOM   7647  C  CA  . ARG L  3 11  ? 57.856  14.875   -53.913 1.00 91.46  ? 9   ARG L CA  1 
ATOM   7648  C  C   . ARG L  3 11  ? 56.639  15.463   -53.111 1.00 89.97  ? 9   ARG L C   1 
ATOM   7649  O  O   . ARG L  3 11  ? 56.759  16.457   -52.386 1.00 71.56  ? 9   ARG L O   1 
ATOM   7650  C  CB  . ARG L  3 11  ? 58.973  14.441   -52.960 1.00 70.05  ? 9   ARG L CB  1 
ATOM   7651  C  CG  . ARG L  3 11  ? 58.420  13.895   -51.661 1.00 101.22 ? 9   ARG L CG  1 
ATOM   7652  C  CD  . ARG L  3 11  ? 57.431  12.782   -51.939 1.00 103.78 ? 9   ARG L CD  1 
ATOM   7653  N  NE  . ARG L  3 11  ? 58.132  11.530   -52.166 1.00 104.87 ? 9   ARG L NE  1 
ATOM   7654  C  CZ  . ARG L  3 11  ? 58.367  10.653   -51.204 1.00 96.19  ? 9   ARG L CZ  1 
ATOM   7655  N  NH1 . ARG L  3 11  ? 57.933  10.905   -49.977 1.00 76.50  ? 9   ARG L NH1 1 
ATOM   7656  N  NH2 . ARG L  3 11  ? 59.028  9.533    -51.464 1.00 101.14 ? 9   ARG L NH2 1 
ATOM   7657  N  N   . GLU L  3 12  ? 55.484  14.800   -53.218 1.00 86.42  ? 10  GLU L N   1 
ATOM   7658  C  CA  . GLU L  3 12  ? 54.204  15.331   -52.714 1.00 63.41  ? 10  GLU L CA  1 
ATOM   7659  C  C   . GLU L  3 12  ? 53.451  14.416   -51.741 1.00 62.36  ? 10  GLU L C   1 
ATOM   7660  O  O   . GLU L  3 12  ? 53.615  13.203   -51.758 1.00 79.14  ? 10  GLU L O   1 
ATOM   7661  C  CB  . GLU L  3 12  ? 53.267  15.626   -53.885 1.00 57.83  ? 10  GLU L CB  1 
ATOM   7662  C  CG  . GLU L  3 12  ? 53.838  16.543   -54.964 1.00 76.95  ? 10  GLU L CG  1 
ATOM   7663  C  CD  . GLU L  3 12  ? 53.006  16.546   -56.248 1.00 96.00  ? 10  GLU L CD  1 
ATOM   7664  O  OE1 . GLU L  3 12  ? 52.818  17.627   -56.839 1.00 100.52 ? 10  GLU L OE1 1 
ATOM   7665  O  OE2 . GLU L  3 12  ? 52.548  15.471   -56.681 1.00 104.20 ? 10  GLU L OE2 1 
ATOM   7666  N  N   . CYS L  3 13  ? 52.605  15.008   -50.907 1.00 48.21  ? 11  CYS L N   1 
ATOM   7667  C  CA  . CYS L  3 13  ? 51.826  14.251   -49.932 1.00 47.21  ? 11  CYS L CA  1 
ATOM   7668  C  C   . CYS L  3 13  ? 50.392  14.746   -49.845 1.00 64.35  ? 11  CYS L C   1 
ATOM   7669  O  O   . CYS L  3 13  ? 50.064  15.821   -50.319 1.00 80.91  ? 11  CYS L O   1 
ATOM   7670  C  CB  . CYS L  3 13  ? 52.437  14.352   -48.535 1.00 47.77  ? 11  CYS L CB  1 
ATOM   7671  S  SG  . CYS L  3 13  ? 53.907  13.404   -48.252 1.00 68.32  ? 11  CYS L SG  1 
ATOM   7672  N  N   . ILE L  3 14  ? 49.542  13.960   -49.208 1.00 58.81  ? 12  ILE L N   1 
ATOM   7673  C  CA  . ILE L  3 14  ? 48.192  14.377   -48.941 1.00 59.96  ? 12  ILE L CA  1 
ATOM   7674  C  C   . ILE L  3 14  ? 48.186  15.215   -47.679 1.00 72.58  ? 12  ILE L C   1 
ATOM   7675  O  O   . ILE L  3 14  ? 48.666  14.775   -46.631 1.00 66.08  ? 12  ILE L O   1 
ATOM   7676  C  CB  . ILE L  3 14  ? 47.297  13.166   -48.739 1.00 55.73  ? 12  ILE L CB  1 
ATOM   7677  C  CG1 . ILE L  3 14  ? 47.028  12.512   -50.082 1.00 41.34  ? 12  ILE L CG1 1 
ATOM   7678  C  CG2 . ILE L  3 14  ? 46.009  13.561   -48.068 1.00 69.82  ? 12  ILE L CG2 1 
ATOM   7679  C  CD1 . ILE L  3 14  ? 46.617  13.455   -51.133 1.00 33.86  ? 12  ILE L CD1 1 
ATOM   7680  N  N   . TYR L  3 15  ? 47.657  16.429   -47.784 1.00 56.93  ? 13  TYR L N   1 
ATOM   7681  C  CA  . TYR L  3 15  ? 47.517  17.283   -46.622 1.00 54.75  ? 13  TYR L CA  1 
ATOM   7682  C  C   . TYR L  3 15  ? 46.130  17.194   -46.036 1.00 67.28  ? 13  TYR L C   1 
ATOM   7683  O  O   . TYR L  3 15  ? 45.147  17.236   -46.758 1.00 69.20  ? 13  TYR L O   1 
ATOM   7684  C  CB  . TYR L  3 15  ? 47.804  18.739   -46.952 1.00 54.82  ? 13  TYR L CB  1 
ATOM   7685  C  CG  . TYR L  3 15  ? 47.886  19.598   -45.712 1.00 57.58  ? 13  TYR L CG  1 
ATOM   7686  C  CD1 . TYR L  3 15  ? 48.988  19.525   -44.872 1.00 66.29  ? 13  TYR L CD1 1 
ATOM   7687  C  CD2 . TYR L  3 15  ? 46.866  20.468   -45.367 1.00 59.56  ? 13  TYR L CD2 1 
ATOM   7688  C  CE1 . TYR L  3 15  ? 49.079  20.294   -43.728 1.00 77.43  ? 13  TYR L CE1 1 
ATOM   7689  C  CE2 . TYR L  3 15  ? 46.950  21.250   -44.213 1.00 57.15  ? 13  TYR L CE2 1 
ATOM   7690  C  CZ  . TYR L  3 15  ? 48.063  21.154   -43.401 1.00 63.84  ? 13  TYR L CZ  1 
ATOM   7691  O  OH  . TYR L  3 15  ? 48.174  21.905   -42.255 1.00 69.06  ? 13  TYR L OH  1 
ATOM   7692  N  N   . TYR L  3 16  ? 46.062  17.070   -44.717 1.00 59.11  ? 14  TYR L N   1 
ATOM   7693  C  CA  . TYR L  3 16  ? 44.812  17.193   -43.999 1.00 46.39  ? 14  TYR L CA  1 
ATOM   7694  C  C   . TYR L  3 16  ? 45.063  17.595   -42.554 1.00 50.84  ? 14  TYR L C   1 
ATOM   7695  O  O   . TYR L  3 16  ? 46.007  17.136   -41.918 1.00 60.54  ? 14  TYR L O   1 
ATOM   7696  C  CB  . TYR L  3 16  ? 44.009  15.898   -44.053 1.00 60.86  ? 14  TYR L CB  1 
ATOM   7697  C  CG  . TYR L  3 16  ? 42.661  16.016   -43.376 1.00 64.63  ? 14  TYR L CG  1 
ATOM   7698  C  CD1 . TYR L  3 16  ? 41.506  16.257   -44.112 1.00 65.99  ? 14  TYR L CD1 1 
ATOM   7699  C  CD2 . TYR L  3 16  ? 42.546  15.913   -42.004 1.00 68.47  ? 14  TYR L CD2 1 
ATOM   7700  C  CE1 . TYR L  3 16  ? 40.280  16.387   -43.497 1.00 59.70  ? 14  TYR L CE1 1 
ATOM   7701  C  CE2 . TYR L  3 16  ? 41.329  16.047   -41.383 1.00 83.72  ? 14  TYR L CE2 1 
ATOM   7702  C  CZ  . TYR L  3 16  ? 40.201  16.284   -42.132 1.00 77.49  ? 14  TYR L CZ  1 
ATOM   7703  O  OH  . TYR L  3 16  ? 38.987  16.418   -41.509 1.00 77.03  ? 14  TYR L OH  1 
ATOM   7704  N  N   . ASN L  3 17  ? 44.206  18.458   -42.035 1.00 50.64  ? 15  ASN L N   1 
ATOM   7705  C  CA  . ASN L  3 17  ? 44.309  18.874   -40.652 1.00 59.23  ? 15  ASN L CA  1 
ATOM   7706  C  C   . ASN L  3 17  ? 42.932  19.160   -40.058 1.00 51.08  ? 15  ASN L C   1 
ATOM   7707  O  O   . ASN L  3 17  ? 42.390  20.234   -40.240 1.00 65.64  ? 15  ASN L O   1 
ATOM   7708  C  CB  . ASN L  3 17  ? 45.209  20.102   -40.550 1.00 62.68  ? 15  ASN L CB  1 
ATOM   7709  C  CG  . ASN L  3 17  ? 45.350  20.603   -39.144 1.00 58.68  ? 15  ASN L CG  1 
ATOM   7710  O  OD1 . ASN L  3 17  ? 45.065  19.889   -38.190 1.00 53.05  ? 15  ASN L OD1 1 
ATOM   7711  N  ND2 . ASN L  3 17  ? 45.794  21.841   -39.005 1.00 62.59  ? 15  ASN L ND2 1 
ATOM   7712  N  N   . ALA L  3 18  ? 42.370  18.194   -39.345 1.00 56.34  ? 16  ALA L N   1 
ATOM   7713  C  CA  . ALA L  3 18  ? 41.078  18.363   -38.707 1.00 50.77  ? 16  ALA L CA  1 
ATOM   7714  C  C   . ALA L  3 18  ? 41.078  19.604   -37.843 1.00 50.69  ? 16  ALA L C   1 
ATOM   7715  O  O   . ALA L  3 18  ? 40.151  20.393   -37.876 1.00 74.98  ? 16  ALA L O   1 
ATOM   7716  C  CB  . ALA L  3 18  ? 40.762  17.161   -37.868 1.00 90.38  ? 16  ALA L CB  1 
ATOM   7717  N  N   . ASN L  3 19  ? 42.129  19.791   -37.070 1.00 51.18  ? 17  ASN L N   1 
ATOM   7718  C  CA  . ASN L  3 19  ? 42.175  20.932   -36.195 1.00 53.41  ? 17  ASN L CA  1 
ATOM   7719  C  C   . ASN L  3 19  ? 42.414  22.267   -36.907 1.00 67.98  ? 17  ASN L C   1 
ATOM   7720  O  O   . ASN L  3 19  ? 42.849  23.227   -36.289 1.00 76.62  ? 17  ASN L O   1 
ATOM   7721  C  CB  . ASN L  3 19  ? 43.218  20.699   -35.121 1.00 65.04  ? 17  ASN L CB  1 
ATOM   7722  C  CG  . ASN L  3 19  ? 42.744  21.146   -33.770 1.00 109.97 ? 17  ASN L CG  1 
ATOM   7723  O  OD1 . ASN L  3 19  ? 41.927  20.469   -33.145 1.00 134.22 ? 17  ASN L OD1 1 
ATOM   7724  N  ND2 . ASN L  3 19  ? 43.229  22.306   -33.310 1.00 113.97 ? 17  ASN L ND2 1 
ATOM   7725  N  N   . TRP L  3 20  ? 42.095  22.343   -38.193 1.00 67.47  ? 18  TRP L N   1 
ATOM   7726  C  CA  . TRP L  3 20  ? 42.502  23.492   -38.995 1.00 69.49  ? 18  TRP L CA  1 
ATOM   7727  C  C   . TRP L  3 20  ? 41.983  24.823   -38.502 1.00 81.66  ? 18  TRP L C   1 
ATOM   7728  O  O   . TRP L  3 20  ? 42.746  25.763   -38.296 1.00 68.01  ? 18  TRP L O   1 
ATOM   7729  C  CB  . TRP L  3 20  ? 42.121  23.316   -40.457 1.00 63.39  ? 18  TRP L CB  1 
ATOM   7730  C  CG  . TRP L  3 20  ? 40.662  23.305   -40.751 1.00 51.95  ? 18  TRP L CG  1 
ATOM   7731  C  CD1 . TRP L  3 20  ? 39.818  22.281   -40.552 1.00 74.40  ? 18  TRP L CD1 1 
ATOM   7732  C  CD2 . TRP L  3 20  ? 39.891  24.351   -41.355 1.00 66.24  ? 18  TRP L CD2 1 
ATOM   7733  N  NE1 . TRP L  3 20  ? 38.561  22.614   -40.972 1.00 74.76  ? 18  TRP L NE1 1 
ATOM   7734  C  CE2 . TRP L  3 20  ? 38.584  23.885   -41.472 1.00 61.13  ? 18  TRP L CE2 1 
ATOM   7735  C  CE3 . TRP L  3 20  ? 40.182  25.638   -41.800 1.00 97.75  ? 18  TRP L CE3 1 
ATOM   7736  C  CZ2 . TRP L  3 20  ? 37.566  24.652   -42.010 1.00 61.18  ? 18  TRP L CZ2 1 
ATOM   7737  C  CZ3 . TRP L  3 20  ? 39.165  26.399   -42.337 1.00 88.15  ? 18  TRP L CZ3 1 
ATOM   7738  C  CH2 . TRP L  3 20  ? 37.876  25.902   -42.435 1.00 68.83  ? 18  TRP L CH2 1 
ATOM   7739  N  N   . GLU L  3 21  ? 40.675  24.912   -38.338 1.00 85.10  ? 19  GLU L N   1 
ATOM   7740  C  CA  . GLU L  3 21  ? 40.083  26.144   -37.862 1.00 76.38  ? 19  GLU L CA  1 
ATOM   7741  C  C   . GLU L  3 21  ? 40.850  26.676   -36.665 1.00 62.44  ? 19  GLU L C   1 
ATOM   7742  O  O   . GLU L  3 21  ? 41.150  27.846   -36.587 1.00 48.82  ? 19  GLU L O   1 
ATOM   7743  C  CB  . GLU L  3 21  ? 38.643  25.909   -37.452 1.00 83.40  ? 19  GLU L CB  1 
ATOM   7744  C  CG  . GLU L  3 21  ? 37.843  25.105   -38.416 1.00 97.12  ? 19  GLU L CG  1 
ATOM   7745  C  CD  . GLU L  3 21  ? 36.433  25.587   -38.457 1.00 99.64  ? 19  GLU L CD  1 
ATOM   7746  O  OE1 . GLU L  3 21  ? 35.503  24.755   -38.447 1.00 100.82 ? 19  GLU L OE1 1 
ATOM   7747  O  OE2 . GLU L  3 21  ? 36.269  26.818   -38.490 1.00 92.51  ? 19  GLU L OE2 1 
ATOM   7748  N  N   . LEU L  3 22  ? 41.156  25.800   -35.725 1.00 62.96  ? 20  LEU L N   1 
ATOM   7749  C  CA  . LEU L  3 22  ? 41.781  26.213   -34.496 1.00 57.30  ? 20  LEU L CA  1 
ATOM   7750  C  C   . LEU L  3 22  ? 43.225  26.701   -34.718 1.00 64.68  ? 20  LEU L C   1 
ATOM   7751  O  O   . LEU L  3 22  ? 43.637  27.723   -34.164 1.00 58.12  ? 20  LEU L O   1 
ATOM   7752  C  CB  . LEU L  3 22  ? 41.711  25.072   -33.489 1.00 60.31  ? 20  LEU L CB  1 
ATOM   7753  C  CG  . LEU L  3 22  ? 41.953  25.549   -32.068 1.00 97.59  ? 20  LEU L CG  1 
ATOM   7754  C  CD1 . LEU L  3 22  ? 41.168  26.830   -31.729 1.00 111.02 ? 20  LEU L CD1 1 
ATOM   7755  C  CD2 . LEU L  3 22  ? 41.800  24.453   -31.031 1.00 107.45 ? 20  LEU L CD2 1 
ATOM   7756  N  N   . GLU L  3 23  ? 43.986  25.978   -35.537 1.00 75.72  ? 21  GLU L N   1 
ATOM   7757  C  CA  . GLU L  3 23  ? 45.405  26.291   -35.776 1.00 67.65  ? 21  GLU L CA  1 
ATOM   7758  C  C   . GLU L  3 23  ? 45.575  27.255   -36.944 1.00 60.77  ? 21  GLU L C   1 
ATOM   7759  O  O   . GLU L  3 23  ? 46.674  27.576   -37.337 1.00 47.07  ? 21  GLU L O   1 
ATOM   7760  C  CB  . GLU L  3 23  ? 46.220  25.009   -36.044 1.00 62.44  ? 21  GLU L CB  1 
ATOM   7761  C  CG  . GLU L  3 23  ? 46.299  24.013   -34.869 1.00 74.94  ? 21  GLU L CG  1 
ATOM   7762  C  CD  . GLU L  3 23  ? 46.855  22.645   -35.252 1.00 76.64  ? 21  GLU L CD  1 
ATOM   7763  O  OE1 . GLU L  3 23  ? 47.437  22.496   -36.342 1.00 75.76  ? 21  GLU L OE1 1 
ATOM   7764  O  OE2 . GLU L  3 23  ? 46.706  21.706   -34.453 1.00 87.66  ? 21  GLU L OE2 1 
ATOM   7765  N  N   . ARG L  3 24  ? 44.473  27.709   -37.505 1.00 69.47  ? 22  ARG L N   1 
ATOM   7766  C  CA  . ARG L  3 24  ? 44.543  28.598   -38.636 1.00 64.32  ? 22  ARG L CA  1 
ATOM   7767  C  C   . ARG L  3 24  ? 45.415  28.031   -39.731 1.00 61.03  ? 22  ARG L C   1 
ATOM   7768  O  O   . ARG L  3 24  ? 46.442  28.618   -40.045 1.00 63.48  ? 22  ARG L O   1 
ATOM   7769  C  CB  . ARG L  3 24  ? 45.082  29.950   -38.206 1.00 64.25  ? 22  ARG L CB  1 
ATOM   7770  C  CG  . ARG L  3 24  ? 44.121  30.750   -37.336 1.00 79.65  ? 22  ARG L CG  1 
ATOM   7771  C  CD  . ARG L  3 24  ? 42.805  31.027   -38.057 1.00 85.40  ? 22  ARG L CD  1 
ATOM   7772  N  NE  . ARG L  3 24  ? 41.681  31.075   -37.131 1.00 61.03  ? 22  ARG L NE  1 
ATOM   7773  C  CZ  . ARG L  3 24  ? 41.163  32.183   -36.638 1.00 85.44  ? 22  ARG L CZ  1 
ATOM   7774  N  NH1 . ARG L  3 24  ? 41.652  33.353   -36.983 1.00 114.54 ? 22  ARG L NH1 1 
ATOM   7775  N  NH2 . ARG L  3 24  ? 40.153  32.115   -35.802 1.00 102.64 ? 22  ARG L NH2 1 
ATOM   7776  N  N   . THR L  3 25  ? 45.002  26.895   -40.305 1.00 49.95  ? 23  THR L N   1 
ATOM   7777  C  CA  . THR L  3 25  ? 45.673  26.316   -41.472 1.00 43.45  ? 23  THR L CA  1 
ATOM   7778  C  C   . THR L  3 25  ? 44.649  25.757   -42.402 1.00 41.18  ? 23  THR L C   1 
ATOM   7779  O  O   . THR L  3 25  ? 43.514  25.597   -41.999 1.00 68.05  ? 23  THR L O   1 
ATOM   7780  C  CB  . THR L  3 25  ? 46.572  25.139   -41.103 1.00 40.82  ? 23  THR L CB  1 
ATOM   7781  O  OG1 . THR L  3 25  ? 45.919  23.907   -41.434 1.00 47.94  ? 23  THR L OG1 1 
ATOM   7782  C  CG2 . THR L  3 25  ? 46.873  25.155   -39.636 1.00 20.15  ? 23  THR L CG2 1 
ATOM   7783  N  N   . ASN L  3 26  ? 45.054  25.434   -43.631 1.00 45.69  ? 24  ASN L N   1 
ATOM   7784  C  CA  . ASN L  3 26  ? 44.155  24.790   -44.578 1.00 59.13  ? 24  ASN L CA  1 
ATOM   7785  C  C   . ASN L  3 26  ? 43.617  23.489   -44.009 1.00 56.70  ? 24  ASN L C   1 
ATOM   7786  O  O   . ASN L  3 26  ? 44.199  22.943   -43.080 1.00 45.97  ? 24  ASN L O   1 
ATOM   7787  C  CB  . ASN L  3 26  ? 44.836  24.543   -45.919 1.00 46.61  ? 24  ASN L CB  1 
ATOM   7788  C  CG  . ASN L  3 26  ? 44.982  25.794   -46.734 1.00 47.95  ? 24  ASN L CG  1 
ATOM   7789  O  OD1 . ASN L  3 26  ? 44.002  26.373   -47.183 1.00 64.98  ? 24  ASN L OD1 1 
ATOM   7790  N  ND2 . ASN L  3 26  ? 46.213  26.219   -46.934 1.00 55.70  ? 24  ASN L ND2 1 
ATOM   7791  N  N   . GLN L  3 27  ? 42.502  23.014   -44.566 1.00 44.21  ? 25  GLN L N   1 
ATOM   7792  C  CA  . GLN L  3 27  ? 41.840  21.816   -44.072 1.00 54.72  ? 25  GLN L CA  1 
ATOM   7793  C  C   . GLN L  3 27  ? 42.283  20.547   -44.796 1.00 55.90  ? 25  GLN L C   1 
ATOM   7794  O  O   . GLN L  3 27  ? 42.779  19.613   -44.174 1.00 72.63  ? 25  GLN L O   1 
ATOM   7795  C  CB  . GLN L  3 27  ? 40.326  21.945   -44.158 1.00 69.35  ? 25  GLN L CB  1 
ATOM   7796  C  CG  . GLN L  3 27  ? 39.645  20.788   -43.490 1.00 67.32  ? 25  GLN L CG  1 
ATOM   7797  C  CD  . GLN L  3 27  ? 38.189  20.774   -43.735 1.00 63.55  ? 25  GLN L CD  1 
ATOM   7798  O  OE1 . GLN L  3 27  ? 37.713  21.413   -44.664 1.00 70.69  ? 25  GLN L OE1 1 
ATOM   7799  N  NE2 . GLN L  3 27  ? 37.453  20.050   -42.902 1.00 68.50  ? 25  GLN L NE2 1 
ATOM   7800  N  N   . SER L  3 28  ? 42.103  20.512   -46.106 1.00 34.27  ? 26  SER L N   1 
ATOM   7801  C  CA  . SER L  3 28  ? 42.519  19.372   -46.885 1.00 49.51  ? 26  SER L CA  1 
ATOM   7802  C  C   . SER L  3 28  ? 43.117  19.805   -48.211 1.00 70.76  ? 26  SER L C   1 
ATOM   7803  O  O   . SER L  3 28  ? 42.836  20.883   -48.716 1.00 54.63  ? 26  SER L O   1 
ATOM   7804  C  CB  . SER L  3 28  ? 41.335  18.444   -47.139 1.00 57.81  ? 26  SER L CB  1 
ATOM   7805  O  OG  . SER L  3 28  ? 40.793  18.674   -48.428 1.00 86.68  ? 26  SER L OG  1 
ATOM   7806  N  N   . GLY L  3 29  ? 43.937  18.939   -48.782 1.00 94.05  ? 27  GLY L N   1 
ATOM   7807  C  CA  . GLY L  3 29  ? 44.546  19.207   -50.065 1.00 86.50  ? 27  GLY L CA  1 
ATOM   7808  C  C   . GLY L  3 29  ? 45.810  18.396   -50.206 1.00 69.33  ? 27  GLY L C   1 
ATOM   7809  O  O   . GLY L  3 29  ? 45.853  17.237   -49.836 1.00 64.49  ? 27  GLY L O   1 
ATOM   7810  N  N   . LEU L  3 30  ? 46.848  19.021   -50.737 1.00 64.78  ? 28  LEU L N   1 
ATOM   7811  C  CA  . LEU L  3 30  ? 48.151  18.384   -50.841 1.00 60.76  ? 28  LEU L CA  1 
ATOM   7812  C  C   . LEU L  3 30  ? 49.298  19.298   -50.418 1.00 50.63  ? 28  LEU L C   1 
ATOM   7813  O  O   . LEU L  3 30  ? 49.105  20.482   -50.185 1.00 44.59  ? 28  LEU L O   1 
ATOM   7814  C  CB  . LEU L  3 30  ? 48.377  17.889   -52.257 1.00 61.09  ? 28  LEU L CB  1 
ATOM   7815  C  CG  . LEU L  3 30  ? 48.178  18.893   -53.379 1.00 63.56  ? 28  LEU L CG  1 
ATOM   7816  C  CD1 . LEU L  3 30  ? 49.334  19.833   -53.418 1.00 73.12  ? 28  LEU L CD1 1 
ATOM   7817  C  CD2 . LEU L  3 30  ? 48.051  18.195   -54.712 1.00 58.91  ? 28  LEU L CD2 1 
ATOM   7818  N  N   . GLU L  3 31  ? 50.495  18.732   -50.312 1.00 56.39  ? 29  GLU L N   1 
ATOM   7819  C  CA  . GLU L  3 31  ? 51.664  19.472   -49.818 1.00 62.85  ? 29  GLU L CA  1 
ATOM   7820  C  C   . GLU L  3 31  ? 52.909  19.051   -50.577 1.00 67.45  ? 29  GLU L C   1 
ATOM   7821  O  O   . GLU L  3 31  ? 53.171  17.858   -50.702 1.00 77.46  ? 29  GLU L O   1 
ATOM   7822  C  CB  . GLU L  3 31  ? 51.886  19.186   -48.330 1.00 41.63  ? 29  GLU L CB  1 
ATOM   7823  C  CG  . GLU L  3 31  ? 52.612  20.282   -47.562 1.00 62.21  ? 29  GLU L CG  1 
ATOM   7824  C  CD  . GLU L  3 31  ? 52.850  19.920   -46.093 1.00 81.38  ? 29  GLU L CD  1 
ATOM   7825  O  OE1 . GLU L  3 31  ? 52.838  18.709   -45.763 1.00 85.98  ? 29  GLU L OE1 1 
ATOM   7826  O  OE2 . GLU L  3 31  ? 53.057  20.847   -45.272 1.00 76.84  ? 29  GLU L OE2 1 
ATOM   7827  N  N   . ARG L  3 32  ? 53.670  20.010   -51.100 1.00 64.21  ? 30  ARG L N   1 
ATOM   7828  C  CA  . ARG L  3 32  ? 54.965  19.666   -51.691 1.00 56.80  ? 30  ARG L CA  1 
ATOM   7829  C  C   . ARG L  3 32  ? 56.005  19.762   -50.597 1.00 67.93  ? 30  ARG L C   1 
ATOM   7830  O  O   . ARG L  3 32  ? 56.037  20.738   -49.851 1.00 88.95  ? 30  ARG L O   1 
ATOM   7831  C  CB  . ARG L  3 32  ? 55.324  20.551   -52.884 1.00 48.17  ? 30  ARG L CB  1 
ATOM   7832  C  CG  . ARG L  3 32  ? 54.689  20.090   -54.197 1.00 78.03  ? 30  ARG L CG  1 
ATOM   7833  C  CD  . ARG L  3 32  ? 54.976  21.076   -55.310 1.00 91.96  ? 30  ARG L CD  1 
ATOM   7834  N  NE  . ARG L  3 32  ? 54.902  22.436   -54.794 1.00 104.99 ? 30  ARG L NE  1 
ATOM   7835  C  CZ  . ARG L  3 32  ? 53.805  23.183   -54.809 1.00 94.29  ? 30  ARG L CZ  1 
ATOM   7836  N  NH1 . ARG L  3 32  ? 52.680  22.705   -55.341 1.00 80.56  ? 30  ARG L NH1 1 
ATOM   7837  N  NH2 . ARG L  3 32  ? 53.838  24.409   -54.296 1.00 84.73  ? 30  ARG L NH2 1 
ATOM   7838  N  N   . CYS L  3 33  ? 56.845  18.740   -50.488 1.00 72.26  ? 31  CYS L N   1 
ATOM   7839  C  CA  . CYS L  3 33  ? 57.698  18.573   -49.311 1.00 76.28  ? 31  CYS L CA  1 
ATOM   7840  C  C   . CYS L  3 33  ? 59.052  19.283   -49.372 1.00 93.64  ? 31  CYS L C   1 
ATOM   7841  O  O   . CYS L  3 33  ? 59.954  18.851   -50.086 1.00 89.39  ? 31  CYS L O   1 
ATOM   7842  C  CB  . CYS L  3 33  ? 57.919  17.086   -49.060 1.00 73.33  ? 31  CYS L CB  1 
ATOM   7843  S  SG  . CYS L  3 33  ? 56.383  16.131   -48.912 1.00 105.30 ? 31  CYS L SG  1 
ATOM   7844  N  N   . GLU L  3 34  ? 59.193  20.368   -48.612 1.00 108.68 ? 32  GLU L N   1 
ATOM   7845  C  CA  . GLU L  3 34  ? 60.479  21.048   -48.501 1.00 103.81 ? 32  GLU L CA  1 
ATOM   7846  C  C   . GLU L  3 34  ? 61.440  20.129   -47.737 1.00 105.26 ? 32  GLU L C   1 
ATOM   7847  O  O   . GLU L  3 34  ? 61.108  19.597   -46.666 1.00 92.27  ? 32  GLU L O   1 
ATOM   7848  C  CB  . GLU L  3 34  ? 60.326  22.411   -47.809 1.00 81.14  ? 32  GLU L CB  1 
ATOM   7849  N  N   . GLY L  3 35  ? 62.624  19.919   -48.300 1.00 101.92 ? 33  GLY L N   1 
ATOM   7850  C  CA  . GLY L  3 35  ? 63.559  18.986   -47.705 1.00 101.63 ? 33  GLY L CA  1 
ATOM   7851  C  C   . GLY L  3 35  ? 65.024  19.176   -48.054 1.00 105.16 ? 33  GLY L C   1 
ATOM   7852  O  O   . GLY L  3 35  ? 65.365  19.794   -49.068 1.00 102.00 ? 33  GLY L O   1 
ATOM   7853  N  N   . GLU L  3 36  ? 65.881  18.611   -47.202 1.00 108.99 ? 34  GLU L N   1 
ATOM   7854  C  CA  . GLU L  3 36  ? 67.338  18.710   -47.312 1.00 117.33 ? 34  GLU L CA  1 
ATOM   7855  C  C   . GLU L  3 36  ? 67.910  17.974   -48.532 1.00 141.82 ? 34  GLU L C   1 
ATOM   7856  O  O   . GLU L  3 36  ? 67.400  16.927   -48.938 1.00 145.24 ? 34  GLU L O   1 
ATOM   7857  C  CB  . GLU L  3 36  ? 68.001  18.190   -46.026 1.00 117.69 ? 34  GLU L CB  1 
ATOM   7858  N  N   . GLN L  3 37  ? 68.987  18.526   -49.090 1.00 162.38 ? 35  GLN L N   1 
ATOM   7859  C  CA  . GLN L  3 37  ? 69.583  18.042   -50.340 1.00 164.59 ? 35  GLN L CA  1 
ATOM   7860  C  C   . GLN L  3 37  ? 69.545  16.522   -50.514 1.00 154.58 ? 35  GLN L C   1 
ATOM   7861  O  O   . GLN L  3 37  ? 68.782  15.994   -51.323 1.00 149.65 ? 35  GLN L O   1 
ATOM   7862  C  CB  . GLN L  3 37  ? 71.023  18.551   -50.475 1.00 155.71 ? 35  GLN L CB  1 
ATOM   7863  N  N   . ASP L  3 38  ? 70.375  15.825   -49.752 1.00 126.08 ? 36  ASP L N   1 
ATOM   7864  C  CA  . ASP L  3 38  ? 70.487  14.378   -49.865 1.00 112.97 ? 36  ASP L CA  1 
ATOM   7865  C  C   . ASP L  3 38  ? 69.862  13.634   -48.677 1.00 115.43 ? 36  ASP L C   1 
ATOM   7866  O  O   . ASP L  3 38  ? 70.418  12.651   -48.182 1.00 110.88 ? 36  ASP L O   1 
ATOM   7867  C  CB  . ASP L  3 38  ? 71.960  13.972   -49.996 1.00 118.64 ? 36  ASP L CB  1 
ATOM   7868  C  CG  . ASP L  3 38  ? 72.410  13.818   -51.433 1.00 128.09 ? 36  ASP L CG  1 
ATOM   7869  O  OD1 . ASP L  3 38  ? 71.535  13.716   -52.326 1.00 128.58 ? 36  ASP L OD1 1 
ATOM   7870  O  OD2 . ASP L  3 38  ? 73.646  13.781   -51.653 1.00 98.86  ? 36  ASP L OD2 1 
ATOM   7871  N  N   . LYS L  3 39  ? 68.715  14.109   -48.210 1.00 115.33 ? 37  LYS L N   1 
ATOM   7872  C  CA  . LYS L  3 39  ? 67.950  13.379   -47.206 1.00 102.15 ? 37  LYS L CA  1 
ATOM   7873  C  C   . LYS L  3 39  ? 66.632  12.917   -47.837 1.00 92.61  ? 37  LYS L C   1 
ATOM   7874  O  O   . LYS L  3 39  ? 66.175  13.487   -48.834 1.00 71.68  ? 37  LYS L O   1 
ATOM   7875  C  CB  . LYS L  3 39  ? 67.711  14.232   -45.951 1.00 85.87  ? 37  LYS L CB  1 
ATOM   7876  N  N   . ARG L  3 40  ? 66.033  11.871   -47.276 1.00 78.42  ? 38  ARG L N   1 
ATOM   7877  C  CA  . ARG L  3 40  ? 64.796  11.328   -47.828 1.00 68.24  ? 38  ARG L CA  1 
ATOM   7878  C  C   . ARG L  3 40  ? 63.594  12.125   -47.358 1.00 75.11  ? 38  ARG L C   1 
ATOM   7879  O  O   . ARG L  3 40  ? 63.700  12.916   -46.430 1.00 83.18  ? 38  ARG L O   1 
ATOM   7880  C  CB  . ARG L  3 40  ? 64.594  9.873    -47.402 1.00 75.61  ? 38  ARG L CB  1 
ATOM   7881  C  CG  . ARG L  3 40  ? 65.711  8.894    -47.758 1.00 75.50  ? 38  ARG L CG  1 
ATOM   7882  C  CD  . ARG L  3 40  ? 65.156  7.469    -47.860 1.00 72.04  ? 38  ARG L CD  1 
ATOM   7883  N  NE  . ARG L  3 40  ? 66.174  6.451    -47.649 1.00 85.43  ? 38  ARG L NE  1 
ATOM   7884  C  CZ  . ARG L  3 40  ? 65.906  5.159    -47.584 1.00 90.42  ? 38  ARG L CZ  1 
ATOM   7885  N  NH1 . ARG L  3 40  ? 64.652  4.753    -47.713 1.00 82.85  ? 38  ARG L NH1 1 
ATOM   7886  N  NH2 . ARG L  3 40  ? 66.882  4.280    -47.392 1.00 96.03  ? 38  ARG L NH2 1 
ATOM   7887  N  N   . LEU L  3 41  ? 62.444  11.887   -47.984 1.00 85.39  ? 39  LEU L N   1 
ATOM   7888  C  CA  . LEU L  3 41  ? 61.179  12.522   -47.592 1.00 69.58  ? 39  LEU L CA  1 
ATOM   7889  C  C   . LEU L  3 41  ? 60.065  11.500   -47.455 1.00 64.16  ? 39  LEU L C   1 
ATOM   7890  O  O   . LEU L  3 41  ? 60.122  10.432   -48.053 1.00 82.95  ? 39  LEU L O   1 
ATOM   7891  C  CB  . LEU L  3 41  ? 60.769  13.592   -48.598 1.00 63.59  ? 39  LEU L CB  1 
ATOM   7892  C  CG  . LEU L  3 41  ? 61.739  14.772   -48.667 1.00 75.31  ? 39  LEU L CG  1 
ATOM   7893  C  CD1 . LEU L  3 41  ? 61.531  15.587   -49.940 1.00 97.52  ? 39  LEU L CD1 1 
ATOM   7894  C  CD2 . LEU L  3 41  ? 61.589  15.639   -47.425 1.00 57.83  ? 39  LEU L CD2 1 
ATOM   7895  N  N   . HIS L  3 42  ? 59.048  11.836   -46.670 1.00 63.04  ? 40  HIS L N   1 
ATOM   7896  C  CA  . HIS L  3 42  ? 58.008  10.868   -46.311 1.00 64.24  ? 40  HIS L CA  1 
ATOM   7897  C  C   . HIS L  3 42  ? 56.632  11.501   -46.167 1.00 65.48  ? 40  HIS L C   1 
ATOM   7898  O  O   . HIS L  3 42  ? 56.498  12.729   -46.139 1.00 64.15  ? 40  HIS L O   1 
ATOM   7899  C  CB  . HIS L  3 42  ? 58.342  10.211   -44.977 1.00 74.21  ? 40  HIS L CB  1 
ATOM   7900  C  CG  . HIS L  3 42  ? 59.715  9.632    -44.907 1.00 70.30  ? 40  HIS L CG  1 
ATOM   7901  N  ND1 . HIS L  3 42  ? 59.965  8.300    -45.142 1.00 72.76  ? 40  HIS L ND1 1 
ATOM   7902  C  CD2 . HIS L  3 42  ? 60.909  10.197   -44.615 1.00 79.20  ? 40  HIS L CD2 1 
ATOM   7903  C  CE1 . HIS L  3 42  ? 61.256  8.070    -45.008 1.00 94.13  ? 40  HIS L CE1 1 
ATOM   7904  N  NE2 . HIS L  3 42  ? 61.852  9.206    -44.689 1.00 93.85  ? 40  HIS L NE2 1 
ATOM   7905  N  N   . CYS L  3 43  ? 55.609  10.655   -46.053 1.00 61.26  ? 41  CYS L N   1 
ATOM   7906  C  CA  . CYS L  3 43  ? 54.246  11.126   -45.788 1.00 54.43  ? 41  CYS L CA  1 
ATOM   7907  C  C   . CYS L  3 43  ? 53.728  10.479   -44.519 1.00 61.55  ? 41  CYS L C   1 
ATOM   7908  O  O   . CYS L  3 43  ? 54.090  9.353    -44.202 1.00 73.81  ? 41  CYS L O   1 
ATOM   7909  C  CB  . CYS L  3 43  ? 53.291  10.800   -46.942 1.00 32.31  ? 41  CYS L CB  1 
ATOM   7910  S  SG  . CYS L  3 43  ? 53.778  11.410   -48.544 1.00 87.96  ? 41  CYS L SG  1 
ATOM   7911  N  N   . TYR L  3 44  ? 52.875  11.185   -43.792 1.00 60.89  ? 42  TYR L N   1 
ATOM   7912  C  CA  . TYR L  3 44  ? 52.288  10.621   -42.590 1.00 59.75  ? 42  TYR L CA  1 
ATOM   7913  C  C   . TYR L  3 44  ? 50.799  10.796   -42.594 1.00 66.52  ? 42  TYR L C   1 
ATOM   7914  O  O   . TYR L  3 44  ? 50.236  11.632   -43.325 1.00 69.84  ? 42  TYR L O   1 
ATOM   7915  C  CB  . TYR L  3 44  ? 52.854  11.260   -41.318 1.00 57.16  ? 42  TYR L CB  1 
ATOM   7916  C  CG  . TYR L  3 44  ? 52.260  12.613   -40.973 1.00 62.49  ? 42  TYR L CG  1 
ATOM   7917  C  CD1 . TYR L  3 44  ? 52.595  13.742   -41.698 1.00 76.48  ? 42  TYR L CD1 1 
ATOM   7918  C  CD2 . TYR L  3 44  ? 51.379  12.761   -39.920 1.00 59.84  ? 42  TYR L CD2 1 
ATOM   7919  C  CE1 . TYR L  3 44  ? 52.061  14.982   -41.392 1.00 89.49  ? 42  TYR L CE1 1 
ATOM   7920  C  CE2 . TYR L  3 44  ? 50.841  14.000   -39.607 1.00 66.49  ? 42  TYR L CE2 1 
ATOM   7921  C  CZ  . TYR L  3 44  ? 51.186  15.107   -40.345 1.00 78.59  ? 42  TYR L CZ  1 
ATOM   7922  O  OH  . TYR L  3 44  ? 50.658  16.344   -40.050 1.00 80.28  ? 42  TYR L OH  1 
ATOM   7923  N  N   . ALA L  3 45  ? 50.179  9.989    -41.749 1.00 64.61  ? 43  ALA L N   1 
ATOM   7924  C  CA  . ALA L  3 45  ? 48.785  10.113   -41.435 1.00 47.13  ? 43  ALA L CA  1 
ATOM   7925  C  C   . ALA L  3 45  ? 48.649  9.738    -39.972 1.00 49.59  ? 43  ALA L C   1 
ATOM   7926  O  O   . ALA L  3 45  ? 49.455  8.991    -39.437 1.00 68.77  ? 43  ALA L O   1 
ATOM   7927  C  CB  . ALA L  3 45  ? 47.999  9.214    -42.291 1.00 28.38  ? 43  ALA L CB  1 
ATOM   7928  N  N   . SER L  3 46  ? 47.647  10.303   -39.324 1.00 48.54  ? 44  SER L N   1 
ATOM   7929  C  CA  . SER L  3 46  ? 47.369  10.027   -37.933 1.00 61.56  ? 44  SER L CA  1 
ATOM   7930  C  C   . SER L  3 46  ? 45.878  10.238   -37.686 1.00 72.07  ? 44  SER L C   1 
ATOM   7931  O  O   . SER L  3 46  ? 45.270  11.192   -38.205 1.00 71.10  ? 44  SER L O   1 
ATOM   7932  C  CB  . SER L  3 46  ? 48.191  10.933   -37.023 1.00 46.71  ? 44  SER L CB  1 
ATOM   7933  O  OG  . SER L  3 46  ? 47.789  12.267   -37.206 1.00 73.52  ? 44  SER L OG  1 
ATOM   7934  N  N   . TRP L  3 47  ? 45.310  9.343    -36.880 1.00 68.45  ? 45  TRP L N   1 
ATOM   7935  C  CA  . TRP L  3 47  ? 43.881  9.318    -36.652 1.00 67.65  ? 45  TRP L CA  1 
ATOM   7936  C  C   . TRP L  3 47  ? 43.555  8.754    -35.286 1.00 69.46  ? 45  TRP L C   1 
ATOM   7937  O  O   . TRP L  3 47  ? 44.399  8.151    -34.655 1.00 82.34  ? 45  TRP L O   1 
ATOM   7938  C  CB  . TRP L  3 47  ? 43.211  8.463    -37.720 1.00 80.42  ? 45  TRP L CB  1 
ATOM   7939  C  CG  . TRP L  3 47  ? 43.701  7.058    -37.742 1.00 79.93  ? 45  TRP L CG  1 
ATOM   7940  C  CD1 . TRP L  3 47  ? 43.110  5.985    -37.168 1.00 80.37  ? 45  TRP L CD1 1 
ATOM   7941  C  CD2 . TRP L  3 47  ? 44.889  6.571    -38.377 1.00 84.86  ? 45  TRP L CD2 1 
ATOM   7942  N  NE1 . TRP L  3 47  ? 43.851  4.859    -37.404 1.00 78.40  ? 45  TRP L NE1 1 
ATOM   7943  C  CE2 . TRP L  3 47  ? 44.948  5.194    -38.146 1.00 71.26  ? 45  TRP L CE2 1 
ATOM   7944  C  CE3 . TRP L  3 47  ? 45.907  7.171    -39.122 1.00 109.76 ? 45  TRP L CE3 1 
ATOM   7945  C  CZ2 . TRP L  3 47  ? 45.981  4.407    -38.621 1.00 84.89  ? 45  TRP L CZ2 1 
ATOM   7946  C  CZ3 . TRP L  3 47  ? 46.936  6.380    -39.598 1.00 107.44 ? 45  TRP L CZ3 1 
ATOM   7947  C  CH2 . TRP L  3 47  ? 46.964  5.018    -39.342 1.00 93.92  ? 45  TRP L CH2 1 
ATOM   7948  N  N   . ARG L  3 48  ? 42.325  8.957    -34.826 1.00 68.49  ? 46  ARG L N   1 
ATOM   7949  C  CA  . ARG L  3 48  ? 41.873  8.338    -33.586 1.00 65.99  ? 46  ARG L CA  1 
ATOM   7950  C  C   . ARG L  3 48  ? 41.014  7.124    -33.927 1.00 78.85  ? 46  ARG L C   1 
ATOM   7951  O  O   . ARG L  3 48  ? 40.498  7.034    -35.032 1.00 72.20  ? 46  ARG L O   1 
ATOM   7952  C  CB  . ARG L  3 48  ? 41.117  9.345    -32.726 1.00 47.01  ? 46  ARG L CB  1 
ATOM   7953  C  CG  . ARG L  3 48  ? 42.024  10.180   -31.816 1.00 51.07  ? 46  ARG L CG  1 
ATOM   7954  C  CD  . ARG L  3 48  ? 41.483  11.596   -31.586 1.00 63.87  ? 46  ARG L CD  1 
ATOM   7955  N  NE  . ARG L  3 48  ? 42.163  12.297   -30.496 1.00 82.58  ? 46  ARG L NE  1 
ATOM   7956  C  CZ  . ARG L  3 48  ? 42.321  13.619   -30.440 1.00 110.98 ? 46  ARG L CZ  1 
ATOM   7957  N  NH1 . ARG L  3 48  ? 41.856  14.399   -31.415 1.00 100.74 ? 46  ARG L NH1 1 
ATOM   7958  N  NH2 . ARG L  3 48  ? 42.957  14.167   -29.410 1.00 110.77 ? 46  ARG L NH2 1 
ATOM   7959  N  N   . ASN L  3 49  ? 40.895  6.171    -33.006 1.00 101.50 ? 47  ASN L N   1 
ATOM   7960  C  CA  . ASN L  3 49  ? 40.059  4.992    -33.240 1.00 101.64 ? 47  ASN L CA  1 
ATOM   7961  C  C   . ASN L  3 49  ? 39.252  4.600    -32.022 1.00 117.25 ? 47  ASN L C   1 
ATOM   7962  O  O   . ASN L  3 49  ? 39.742  3.900    -31.143 1.00 135.64 ? 47  ASN L O   1 
ATOM   7963  C  CB  . ASN L  3 49  ? 40.889  3.799    -33.705 1.00 109.48 ? 47  ASN L CB  1 
ATOM   7964  C  CG  . ASN L  3 49  ? 40.076  2.806    -34.498 1.00 114.80 ? 47  ASN L CG  1 
ATOM   7965  O  OD1 . ASN L  3 49  ? 39.506  3.162    -35.524 1.00 114.42 ? 47  ASN L OD1 1 
ATOM   7966  N  ND2 . ASN L  3 49  ? 40.014  1.556    -34.032 1.00 138.20 ? 47  ASN L ND2 1 
ATOM   7967  N  N   . SER L  3 50  ? 38.009  5.062    -31.980 1.00 117.40 ? 48  SER L N   1 
ATOM   7968  C  CA  . SER L  3 50  ? 37.108  4.758    -30.880 1.00 114.45 ? 48  SER L CA  1 
ATOM   7969  C  C   . SER L  3 50  ? 36.305  3.509    -31.213 1.00 126.17 ? 48  SER L C   1 
ATOM   7970  O  O   . SER L  3 50  ? 35.147  3.584    -31.625 1.00 114.74 ? 48  SER L O   1 
ATOM   7971  C  CB  . SER L  3 50  ? 36.179  5.937    -30.606 1.00 96.72  ? 48  SER L CB  1 
ATOM   7972  N  N   . SER L  3 51  ? 36.943  2.359    -31.042 1.00 136.11 ? 49  SER L N   1 
ATOM   7973  C  CA  . SER L  3 51  ? 36.318  1.082    -31.327 1.00 125.74 ? 49  SER L CA  1 
ATOM   7974  C  C   . SER L  3 51  ? 35.692  1.077    -32.711 1.00 115.55 ? 49  SER L C   1 
ATOM   7975  O  O   . SER L  3 51  ? 34.475  1.128    -32.846 1.00 115.83 ? 49  SER L O   1 
ATOM   7976  C  CB  . SER L  3 51  ? 35.271  0.767    -30.262 1.00 111.67 ? 49  SER L CB  1 
ATOM   7977  O  OG  . SER L  3 51  ? 35.819  0.952    -28.968 1.00 86.38  ? 49  SER L OG  1 
ATOM   7978  N  N   . GLY L  3 52  ? 36.534  1.038    -33.738 1.00 104.67 ? 50  GLY L N   1 
ATOM   7979  C  CA  . GLY L  3 52  ? 36.073  0.841    -35.101 1.00 110.97 ? 50  GLY L CA  1 
ATOM   7980  C  C   . GLY L  3 52  ? 35.688  2.091    -35.866 1.00 116.73 ? 50  GLY L C   1 
ATOM   7981  O  O   . GLY L  3 52  ? 35.755  2.117    -37.092 1.00 85.00  ? 50  GLY L O   1 
ATOM   7982  N  N   . THR L  3 53  ? 35.268  3.127    -35.151 1.00 143.35 ? 51  THR L N   1 
ATOM   7983  C  CA  . THR L  3 53  ? 34.922  4.390    -35.792 1.00 138.96 ? 51  THR L CA  1 
ATOM   7984  C  C   . THR L  3 53  ? 36.170  5.267    -35.939 1.00 125.03 ? 51  THR L C   1 
ATOM   7985  O  O   . THR L  3 53  ? 36.777  5.666    -34.951 1.00 115.69 ? 51  THR L O   1 
ATOM   7986  C  CB  . THR L  3 53  ? 33.805  5.131    -35.023 1.00 127.65 ? 51  THR L CB  1 
ATOM   7987  O  OG1 . THR L  3 53  ? 34.116  5.160    -33.626 1.00 100.65 ? 51  THR L OG1 1 
ATOM   7988  C  CG2 . THR L  3 53  ? 32.476  4.428    -35.211 1.00 79.79  ? 51  THR L CG2 1 
ATOM   7989  N  N   . ILE L  3 54  ? 36.550  5.553    -37.179 1.00 106.44 ? 52  ILE L N   1 
ATOM   7990  C  CA  . ILE L  3 54  ? 37.797  6.249    -37.461 1.00 77.41  ? 52  ILE L CA  1 
ATOM   7991  C  C   . ILE L  3 54  ? 37.625  7.749    -37.693 1.00 80.85  ? 52  ILE L C   1 
ATOM   7992  O  O   . ILE L  3 54  ? 37.022  8.170    -38.669 1.00 97.34  ? 52  ILE L O   1 
ATOM   7993  C  CB  . ILE L  3 54  ? 38.458  5.699    -38.725 1.00 72.16  ? 52  ILE L CB  1 
ATOM   7994  C  CG1 . ILE L  3 54  ? 38.573  4.183    -38.680 1.00 82.43  ? 52  ILE L CG1 1 
ATOM   7995  C  CG2 . ILE L  3 54  ? 39.825  6.313    -38.900 1.00 84.37  ? 52  ILE L CG2 1 
ATOM   7996  C  CD1 . ILE L  3 54  ? 39.014  3.575    -40.006 1.00 85.93  ? 52  ILE L CD1 1 
ATOM   7997  N  N   . GLU L  3 55  ? 38.195  8.556    -36.813 1.00 83.57  ? 53  GLU L N   1 
ATOM   7998  C  CA  . GLU L  3 55  ? 38.207  10.000   -36.987 1.00 80.13  ? 53  GLU L CA  1 
ATOM   7999  C  C   . GLU L  3 55  ? 39.623  10.450   -37.380 1.00 86.28  ? 53  GLU L C   1 
ATOM   8000  O  O   . GLU L  3 55  ? 40.581  10.209   -36.641 1.00 88.87  ? 53  GLU L O   1 
ATOM   8001  C  CB  . GLU L  3 55  ? 37.748  10.670   -35.687 1.00 93.25  ? 53  GLU L CB  1 
ATOM   8002  C  CG  . GLU L  3 55  ? 37.961  12.180   -35.615 1.00 125.13 ? 53  GLU L CG  1 
ATOM   8003  C  CD  . GLU L  3 55  ? 38.010  12.697   -34.181 1.00 136.58 ? 53  GLU L CD  1 
ATOM   8004  O  OE1 . GLU L  3 55  ? 37.350  12.086   -33.311 1.00 139.19 ? 53  GLU L OE1 1 
ATOM   8005  O  OE2 . GLU L  3 55  ? 38.719  13.699   -33.923 1.00 129.23 ? 53  GLU L OE2 1 
ATOM   8006  N  N   . LEU L  3 56  ? 39.753  11.086   -38.547 1.00 84.77  ? 54  LEU L N   1 
ATOM   8007  C  CA  . LEU L  3 56  ? 41.048  11.580   -39.036 1.00 60.85  ? 54  LEU L CA  1 
ATOM   8008  C  C   . LEU L  3 56  ? 41.550  12.778   -38.240 1.00 63.86  ? 54  LEU L C   1 
ATOM   8009  O  O   . LEU L  3 56  ? 40.769  13.617   -37.806 1.00 86.37  ? 54  LEU L O   1 
ATOM   8010  C  CB  . LEU L  3 56  ? 40.951  11.975   -40.499 1.00 46.03  ? 54  LEU L CB  1 
ATOM   8011  C  CG  . LEU L  3 56  ? 42.011  11.384   -41.423 1.00 41.17  ? 54  LEU L CG  1 
ATOM   8012  C  CD1 . LEU L  3 56  ? 41.969  12.061   -42.770 1.00 49.17  ? 54  LEU L CD1 1 
ATOM   8013  C  CD2 . LEU L  3 56  ? 43.383  11.512   -40.817 1.00 60.55  ? 54  LEU L CD2 1 
ATOM   8014  N  N   . VAL L  3 57  ? 42.860  12.860   -38.046 1.00 60.87  ? 55  VAL L N   1 
ATOM   8015  C  CA  . VAL L  3 57  ? 43.424  13.928   -37.236 1.00 71.43  ? 55  VAL L CA  1 
ATOM   8016  C  C   . VAL L  3 57  ? 44.412  14.766   -38.031 1.00 77.10  ? 55  VAL L C   1 
ATOM   8017  O  O   . VAL L  3 57  ? 44.408  15.987   -37.926 1.00 88.90  ? 55  VAL L O   1 
ATOM   8018  C  CB  . VAL L  3 57  ? 44.069  13.397   -35.929 1.00 60.30  ? 55  VAL L CB  1 
ATOM   8019  C  CG1 . VAL L  3 57  ? 44.976  14.440   -35.316 1.00 53.93  ? 55  VAL L CG1 1 
ATOM   8020  C  CG2 . VAL L  3 57  ? 42.990  12.997   -34.932 1.00 68.61  ? 55  VAL L CG2 1 
ATOM   8021  N  N   . LYS L  3 58  ? 45.248  14.126   -38.838 1.00 66.98  ? 56  LYS L N   1 
ATOM   8022  C  CA  . LYS L  3 58  ? 46.230  14.886   -39.602 1.00 48.45  ? 56  LYS L CA  1 
ATOM   8023  C  C   . LYS L  3 58  ? 46.893  14.043   -40.695 1.00 55.06  ? 56  LYS L C   1 
ATOM   8024  O  O   . LYS L  3 58  ? 47.184  12.880   -40.503 1.00 59.56  ? 56  LYS L O   1 
ATOM   8025  C  CB  . LYS L  3 58  ? 47.303  15.467   -38.660 1.00 44.16  ? 56  LYS L CB  1 
ATOM   8026  C  CG  . LYS L  3 58  ? 47.123  16.929   -38.254 1.00 54.81  ? 56  LYS L CG  1 
ATOM   8027  C  CD  . LYS L  3 58  ? 48.155  17.361   -37.212 1.00 39.63  ? 56  LYS L CD  1 
ATOM   8028  C  CE  . LYS L  3 58  ? 48.153  18.876   -37.007 1.00 52.36  ? 56  LYS L CE  1 
ATOM   8029  N  NZ  . LYS L  3 58  ? 46.948  19.384   -36.312 1.00 62.40  ? 56  LYS L NZ  1 
ATOM   8030  N  N   . LYS L  3 59  ? 47.126  14.640   -41.851 1.00 51.76  ? 57  LYS L N   1 
ATOM   8031  C  CA  . LYS L  3 59  ? 47.927  14.016   -42.888 1.00 37.28  ? 57  LYS L CA  1 
ATOM   8032  C  C   . LYS L  3 59  ? 48.892  15.051   -43.458 1.00 58.25  ? 57  LYS L C   1 
ATOM   8033  O  O   . LYS L  3 59  ? 48.581  16.240   -43.496 1.00 56.46  ? 57  LYS L O   1 
ATOM   8034  C  CB  . LYS L  3 59  ? 47.048  13.506   -44.001 1.00 35.88  ? 57  LYS L CB  1 
ATOM   8035  C  CG  . LYS L  3 59  ? 46.202  12.306   -43.673 1.00 46.83  ? 57  LYS L CG  1 
ATOM   8036  C  CD  . LYS L  3 59  ? 45.694  11.724   -44.996 1.00 52.52  ? 57  LYS L CD  1 
ATOM   8037  C  CE  . LYS L  3 59  ? 44.535  10.780   -44.857 1.00 54.71  ? 57  LYS L CE  1 
ATOM   8038  N  NZ  . LYS L  3 59  ? 43.770  10.804   -46.136 1.00 67.52  ? 57  LYS L NZ  1 
ATOM   8039  N  N   . GLY L  3 60  ? 50.069  14.617   -43.898 1.00 75.83  ? 58  GLY L N   1 
ATOM   8040  C  CA  . GLY L  3 60  ? 51.001  15.583   -44.462 1.00 74.46  ? 58  GLY L CA  1 
ATOM   8041  C  C   . GLY L  3 60  ? 52.422  15.115   -44.681 1.00 61.66  ? 58  GLY L C   1 
ATOM   8042  O  O   . GLY L  3 60  ? 52.685  13.925   -44.654 1.00 47.09  ? 58  GLY L O   1 
ATOM   8043  N  N   . CYS L  3 61  ? 53.338  16.056   -44.902 1.00 59.52  ? 59  CYS L N   1 
ATOM   8044  C  CA  . CYS L  3 61  ? 54.737  15.712   -45.163 1.00 50.84  ? 59  CYS L CA  1 
ATOM   8045  C  C   . CYS L  3 61  ? 55.466  15.382   -43.872 1.00 54.16  ? 59  CYS L C   1 
ATOM   8046  O  O   . CYS L  3 61  ? 55.087  15.862   -42.819 1.00 70.76  ? 59  CYS L O   1 
ATOM   8047  C  CB  . CYS L  3 61  ? 55.446  16.859   -45.871 1.00 34.53  ? 59  CYS L CB  1 
ATOM   8048  S  SG  . CYS L  3 61  ? 55.070  16.993   -47.620 1.00 87.34  ? 59  CYS L SG  1 
ATOM   8049  N  N   . TRP L  3 62  ? 56.517  14.574   -43.955 1.00 55.93  ? 60  TRP L N   1 
ATOM   8050  C  CA  . TRP L  3 62  ? 57.252  14.123   -42.769 1.00 54.51  ? 60  TRP L CA  1 
ATOM   8051  C  C   . TRP L  3 62  ? 58.719  13.906   -43.138 1.00 55.98  ? 60  TRP L C   1 
ATOM   8052  O  O   . TRP L  3 62  ? 59.031  13.497   -44.255 1.00 63.61  ? 60  TRP L O   1 
ATOM   8053  C  CB  . TRP L  3 62  ? 56.623  12.837   -42.250 1.00 54.62  ? 60  TRP L CB  1 
ATOM   8054  C  CG  . TRP L  3 62  ? 57.191  12.240   -41.003 1.00 51.83  ? 60  TRP L CG  1 
ATOM   8055  C  CD1 . TRP L  3 62  ? 58.166  11.292   -40.921 1.00 73.43  ? 60  TRP L CD1 1 
ATOM   8056  C  CD2 . TRP L  3 62  ? 56.766  12.495   -39.659 1.00 52.41  ? 60  TRP L CD2 1 
ATOM   8057  N  NE1 . TRP L  3 62  ? 58.395  10.957   -39.606 1.00 79.84  ? 60  TRP L NE1 1 
ATOM   8058  C  CE2 . TRP L  3 62  ? 57.546  11.682   -38.812 1.00 67.14  ? 60  TRP L CE2 1 
ATOM   8059  C  CE3 . TRP L  3 62  ? 55.813  13.339   -39.088 1.00 52.96  ? 60  TRP L CE3 1 
ATOM   8060  C  CZ2 . TRP L  3 62  ? 57.401  11.690   -37.429 1.00 70.74  ? 60  TRP L CZ2 1 
ATOM   8061  C  CZ3 . TRP L  3 62  ? 55.677  13.348   -37.716 1.00 57.94  ? 60  TRP L CZ3 1 
ATOM   8062  C  CH2 . TRP L  3 62  ? 56.465  12.528   -36.903 1.00 58.12  ? 60  TRP L CH2 1 
ATOM   8063  N  N   . LEU L  3 63  ? 59.620  14.184   -42.209 1.00 50.31  ? 61  LEU L N   1 
ATOM   8064  C  CA  . LEU L  3 63  ? 61.035  14.251   -42.547 1.00 48.29  ? 61  LEU L CA  1 
ATOM   8065  C  C   . LEU L  3 63  ? 61.846  12.976   -42.333 1.00 64.84  ? 61  LEU L C   1 
ATOM   8066  O  O   . LEU L  3 63  ? 61.639  12.240   -41.366 1.00 82.94  ? 61  LEU L O   1 
ATOM   8067  C  CB  . LEU L  3 63  ? 61.688  15.381   -41.776 1.00 44.57  ? 61  LEU L CB  1 
ATOM   8068  C  CG  . LEU L  3 63  ? 61.496  16.744   -42.401 1.00 37.29  ? 61  LEU L CG  1 
ATOM   8069  C  CD1 . LEU L  3 63  ? 62.296  17.744   -41.624 1.00 26.71  ? 61  LEU L CD1 1 
ATOM   8070  C  CD2 . LEU L  3 63  ? 61.933  16.690   -43.849 1.00 48.71  ? 61  LEU L CD2 1 
ATOM   8071  N  N   . ASP L  3 64  ? 62.796  12.756   -43.239 1.00 59.59  ? 62  ASP L N   1 
ATOM   8072  C  CA  . ASP L  3 64  ? 63.737  11.638   -43.179 1.00 64.12  ? 62  ASP L CA  1 
ATOM   8073  C  C   . ASP L  3 64  ? 63.814  10.930   -41.811 1.00 71.84  ? 62  ASP L C   1 
ATOM   8074  O  O   . ASP L  3 64  ? 64.686  11.212   -40.985 1.00 95.95  ? 62  ASP L O   1 
ATOM   8075  C  CB  . ASP L  3 64  ? 65.123  12.119   -43.609 1.00 78.45  ? 62  ASP L CB  1 
ATOM   8076  C  CG  . ASP L  3 64  ? 66.103  10.987   -43.773 1.00 95.16  ? 62  ASP L CG  1 
ATOM   8077  O  OD1 . ASP L  3 64  ? 66.508  10.382   -42.750 1.00 109.54 ? 62  ASP L OD1 1 
ATOM   8078  O  OD2 . ASP L  3 64  ? 66.471  10.718   -44.933 1.00 78.14  ? 62  ASP L OD2 1 
ATOM   8079  N  N   . ASP L  3 65  ? 62.891  10.006   -41.591 1.00 61.87  ? 63  ASP L N   1 
ATOM   8080  C  CA  . ASP L  3 65  ? 62.831  9.239    -40.367 1.00 72.55  ? 63  ASP L CA  1 
ATOM   8081  C  C   . ASP L  3 65  ? 62.845  7.776    -40.783 1.00 79.49  ? 63  ASP L C   1 
ATOM   8082  O  O   . ASP L  3 65  ? 62.005  7.338    -41.558 1.00 76.23  ? 63  ASP L O   1 
ATOM   8083  C  CB  . ASP L  3 65  ? 61.563  9.608    -39.595 1.00 86.38  ? 63  ASP L CB  1 
ATOM   8084  C  CG  . ASP L  3 65  ? 61.166  8.562    -38.569 1.00 97.79  ? 63  ASP L CG  1 
ATOM   8085  O  OD1 . ASP L  3 65  ? 62.069  7.890    -38.028 1.00 112.28 ? 63  ASP L OD1 1 
ATOM   8086  O  OD2 . ASP L  3 65  ? 59.945  8.418    -38.298 1.00 79.76  ? 63  ASP L OD2 1 
ATOM   8087  N  N   . PHE L  3 66  ? 63.828  7.035    -40.281 1.00 94.28  ? 64  PHE L N   1 
ATOM   8088  C  CA  . PHE L  3 66  ? 64.118  5.669    -40.729 1.00 71.21  ? 64  PHE L CA  1 
ATOM   8089  C  C   . PHE L  3 66  ? 62.977  4.710    -40.533 1.00 64.95  ? 64  PHE L C   1 
ATOM   8090  O  O   . PHE L  3 66  ? 62.946  3.649    -41.149 1.00 83.31  ? 64  PHE L O   1 
ATOM   8091  C  CB  . PHE L  3 66  ? 65.335  5.115    -39.999 1.00 62.96  ? 64  PHE L CB  1 
ATOM   8092  C  CG  . PHE L  3 66  ? 65.108  4.874    -38.544 1.00 47.23  ? 64  PHE L CG  1 
ATOM   8093  C  CD1 . PHE L  3 66  ? 64.584  3.691    -38.115 1.00 42.97  ? 64  PHE L CD1 1 
ATOM   8094  C  CD2 . PHE L  3 66  ? 65.433  5.832    -37.606 1.00 70.52  ? 64  PHE L CD2 1 
ATOM   8095  C  CE1 . PHE L  3 66  ? 64.371  3.465    -36.776 1.00 59.29  ? 64  PHE L CE1 1 
ATOM   8096  C  CE2 . PHE L  3 66  ? 65.221  5.608    -36.269 1.00 76.65  ? 64  PHE L CE2 1 
ATOM   8097  C  CZ  . PHE L  3 66  ? 64.691  4.423    -35.854 1.00 59.60  ? 64  PHE L CZ  1 
ATOM   8098  N  N   . ASN L  3 67  ? 62.048  5.067    -39.659 1.00 61.39  ? 65  ASN L N   1 
ATOM   8099  C  CA  . ASN L  3 67  ? 60.874  4.236    -39.442 1.00 69.76  ? 65  ASN L CA  1 
ATOM   8100  C  C   . ASN L  3 67  ? 60.040  4.070    -40.713 1.00 63.75  ? 65  ASN L C   1 
ATOM   8101  O  O   . ASN L  3 67  ? 59.346  3.078    -40.895 1.00 80.18  ? 65  ASN L O   1 
ATOM   8102  C  CB  . ASN L  3 67  ? 60.021  4.808    -38.311 1.00 78.05  ? 65  ASN L CB  1 
ATOM   8103  C  CG  . ASN L  3 67  ? 60.660  4.619    -36.951 1.00 76.29  ? 65  ASN L CG  1 
ATOM   8104  O  OD1 . ASN L  3 67  ? 61.101  5.581    -36.333 1.00 81.34  ? 65  ASN L OD1 1 
ATOM   8105  N  ND2 . ASN L  3 67  ? 60.716  3.372    -36.479 1.00 51.98  ? 65  ASN L ND2 1 
ATOM   8106  N  N   . CYS L  3 68  ? 60.130  5.045    -41.602 1.00 67.62  ? 66  CYS L N   1 
ATOM   8107  C  CA  . CYS L  3 68  ? 59.367  5.028    -42.839 1.00 79.11  ? 66  CYS L CA  1 
ATOM   8108  C  C   . CYS L  3 68  ? 60.184  4.484    -44.007 1.00 91.01  ? 66  CYS L C   1 
ATOM   8109  O  O   . CYS L  3 68  ? 59.670  4.286    -45.101 1.00 106.10 ? 66  CYS L O   1 
ATOM   8110  C  CB  . CYS L  3 68  ? 58.909  6.447    -43.164 1.00 82.12  ? 66  CYS L CB  1 
ATOM   8111  S  SG  . CYS L  3 68  ? 58.315  7.377    -41.732 1.00 95.69  ? 66  CYS L SG  1 
ATOM   8112  N  N   . TYR L  3 69  ? 61.463  4.251    -43.768 1.00 82.90  ? 67  TYR L N   1 
ATOM   8113  C  CA  . TYR L  3 69  ? 62.366  3.874    -44.829 1.00 85.36  ? 67  TYR L CA  1 
ATOM   8114  C  C   . TYR L  3 69  ? 61.827  2.711    -45.646 1.00 99.67  ? 67  TYR L C   1 
ATOM   8115  O  O   . TYR L  3 69  ? 61.388  1.704    -45.094 1.00 94.52  ? 67  TYR L O   1 
ATOM   8116  C  CB  . TYR L  3 69  ? 63.746  3.548    -44.256 1.00 86.57  ? 67  TYR L CB  1 
ATOM   8117  C  CG  . TYR L  3 69  ? 64.662  4.754    -44.085 1.00 73.77  ? 67  TYR L CG  1 
ATOM   8118  C  CD1 . TYR L  3 69  ? 64.346  5.991    -44.629 1.00 70.65  ? 67  TYR L CD1 1 
ATOM   8119  C  CD2 . TYR L  3 69  ? 65.862  4.639    -43.398 1.00 89.28  ? 67  TYR L CD2 1 
ATOM   8120  C  CE1 . TYR L  3 69  ? 65.196  7.081    -44.479 1.00 78.30  ? 67  TYR L CE1 1 
ATOM   8121  C  CE2 . TYR L  3 69  ? 66.718  5.728    -43.244 1.00 95.27  ? 67  TYR L CE2 1 
ATOM   8122  C  CZ  . TYR L  3 69  ? 66.378  6.943    -43.786 1.00 91.52  ? 67  TYR L CZ  1 
ATOM   8123  O  OH  . TYR L  3 69  ? 67.229  8.014    -43.628 1.00 103.85 ? 67  TYR L OH  1 
ATOM   8124  N  N   . ASP L  3 70  ? 61.857  2.883    -46.966 1.00 109.78 ? 68  ASP L N   1 
ATOM   8125  C  CA  . ASP L  3 70  ? 61.472  1.856    -47.933 1.00 118.90 ? 68  ASP L CA  1 
ATOM   8126  C  C   . ASP L  3 70  ? 60.199  1.101    -47.539 1.00 111.96 ? 68  ASP L C   1 
ATOM   8127  O  O   . ASP L  3 70  ? 60.190  -0.124   -47.459 1.00 123.02 ? 68  ASP L O   1 
ATOM   8128  C  CB  . ASP L  3 70  ? 62.635  0.886    -48.177 1.00 137.98 ? 68  ASP L CB  1 
ATOM   8129  C  CG  . ASP L  3 70  ? 62.494  0.121    -49.484 1.00 168.20 ? 68  ASP L CG  1 
ATOM   8130  O  OD1 . ASP L  3 70  ? 62.823  0.690    -50.549 1.00 171.71 ? 68  ASP L OD1 1 
ATOM   8131  O  OD2 . ASP L  3 70  ? 62.061  -1.051   -49.446 1.00 181.19 ? 68  ASP L OD2 1 
ATOM   8132  N  N   . ARG L  3 71  ? 59.127  1.845    -47.297 1.00 100.09 ? 69  ARG L N   1 
ATOM   8133  C  CA  . ARG L  3 71  ? 57.848  1.257    -46.912 1.00 87.95  ? 69  ARG L CA  1 
ATOM   8134  C  C   . ARG L  3 71  ? 56.723  1.788    -47.808 1.00 88.75  ? 69  ARG L C   1 
ATOM   8135  O  O   . ARG L  3 71  ? 56.336  2.941    -47.705 1.00 50.70  ? 69  ARG L O   1 
ATOM   8136  C  CB  . ARG L  3 71  ? 57.560  1.563    -45.446 1.00 69.85  ? 69  ARG L CB  1 
ATOM   8137  C  CG  . ARG L  3 71  ? 56.208  1.069    -44.970 1.00 104.53 ? 69  ARG L CG  1 
ATOM   8138  C  CD  . ARG L  3 71  ? 55.926  1.578    -43.570 1.00 104.41 ? 69  ARG L CD  1 
ATOM   8139  N  NE  . ARG L  3 71  ? 57.028  1.251    -42.678 1.00 94.92  ? 69  ARG L NE  1 
ATOM   8140  C  CZ  . ARG L  3 71  ? 56.997  0.266    -41.789 1.00 95.20  ? 69  ARG L CZ  1 
ATOM   8141  N  NH1 . ARG L  3 71  ? 55.903  -0.481   -41.663 1.00 69.08  ? 69  ARG L NH1 1 
ATOM   8142  N  NH2 . ARG L  3 71  ? 58.059  0.035    -41.021 1.00 91.62  ? 69  ARG L NH2 1 
ATOM   8143  N  N   . GLN L  3 72  ? 56.201  0.936    -48.682 1.00 114.44 ? 70  GLN L N   1 
ATOM   8144  C  CA  . GLN L  3 72  ? 55.339  1.387    -49.772 1.00 113.40 ? 70  GLN L CA  1 
ATOM   8145  C  C   . GLN L  3 72  ? 53.986  1.916    -49.319 1.00 93.85  ? 70  GLN L C   1 
ATOM   8146  O  O   . GLN L  3 72  ? 53.504  2.904    -49.857 1.00 80.32  ? 70  GLN L O   1 
ATOM   8147  C  CB  . GLN L  3 72  ? 55.141  0.271    -50.808 1.00 139.86 ? 70  GLN L CB  1 
ATOM   8148  C  CG  . GLN L  3 72  ? 56.425  -0.263   -51.430 1.00 149.73 ? 70  GLN L CG  1 
ATOM   8149  C  CD  . GLN L  3 72  ? 57.177  0.789    -52.218 1.00 141.85 ? 70  GLN L CD  1 
ATOM   8150  O  OE1 . GLN L  3 72  ? 56.703  1.920    -52.387 1.00 118.67 ? 70  GLN L OE1 1 
ATOM   8151  N  NE2 . GLN L  3 72  ? 58.363  0.425    -52.701 1.00 140.31 ? 70  GLN L NE2 1 
ATOM   8152  N  N   . GLU L  3 73  ? 53.365  1.255    -48.348 1.00 100.98 ? 71  GLU L N   1 
ATOM   8153  C  CA  . GLU L  3 73  ? 52.032  1.655    -47.896 1.00 92.84  ? 71  GLU L CA  1 
ATOM   8154  C  C   . GLU L  3 73  ? 52.067  2.301    -46.511 1.00 89.90  ? 71  GLU L C   1 
ATOM   8155  O  O   . GLU L  3 73  ? 52.988  2.093    -45.730 1.00 82.25  ? 71  GLU L O   1 
ATOM   8156  C  CB  . GLU L  3 73  ? 51.058  0.467    -47.924 1.00 78.20  ? 71  GLU L CB  1 
ATOM   8157  N  N   . CYS L  3 74  ? 51.058  3.098    -46.208 1.00 92.65  ? 72  CYS L N   1 
ATOM   8158  C  CA  . CYS L  3 74  ? 51.035  3.794    -44.939 1.00 103.19 ? 72  CYS L CA  1 
ATOM   8159  C  C   . CYS L  3 74  ? 50.368  2.936    -43.889 1.00 89.95  ? 72  CYS L C   1 
ATOM   8160  O  O   . CYS L  3 74  ? 49.153  2.883    -43.824 1.00 76.41  ? 72  CYS L O   1 
ATOM   8161  C  CB  . CYS L  3 74  ? 50.291  5.120    -45.074 1.00 113.01 ? 72  CYS L CB  1 
ATOM   8162  S  SG  . CYS L  3 74  ? 50.630  6.266    -43.744 1.00 84.90  ? 72  CYS L SG  1 
ATOM   8163  N  N   . VAL L  3 75  ? 51.163  2.274    -43.055 1.00 102.09 ? 73  VAL L N   1 
ATOM   8164  C  CA  . VAL L  3 75  ? 50.601  1.376    -42.049 1.00 94.72  ? 73  VAL L CA  1 
ATOM   8165  C  C   . VAL L  3 75  ? 51.122  1.609    -40.637 1.00 91.72  ? 73  VAL L C   1 
ATOM   8166  O  O   . VAL L  3 75  ? 52.317  1.832    -40.428 1.00 109.62 ? 73  VAL L O   1 
ATOM   8167  C  CB  . VAL L  3 75  ? 50.838  -0.079   -42.415 1.00 82.24  ? 73  VAL L CB  1 
ATOM   8168  C  CG1 . VAL L  3 75  ? 50.091  -0.978   -41.460 1.00 84.32  ? 73  VAL L CG1 1 
ATOM   8169  C  CG2 . VAL L  3 75  ? 50.388  -0.330   -43.842 1.00 77.97  ? 73  VAL L CG2 1 
ATOM   8170  N  N   . ALA L  3 76  ? 50.198  1.547    -39.680 1.00 71.37  ? 74  ALA L N   1 
ATOM   8171  C  CA  . ALA L  3 76  ? 50.482  1.798    -38.271 1.00 77.22  ? 74  ALA L CA  1 
ATOM   8172  C  C   . ALA L  3 76  ? 50.790  0.494    -37.589 1.00 93.32  ? 74  ALA L C   1 
ATOM   8173  O  O   . ALA L  3 76  ? 50.186  -0.524   -37.904 1.00 126.00 ? 74  ALA L O   1 
ATOM   8174  C  CB  . ALA L  3 76  ? 49.301  2.448    -37.601 1.00 74.41  ? 74  ALA L CB  1 
ATOM   8175  N  N   . THR L  3 77  ? 51.708  0.528    -36.633 1.00 88.28  ? 75  THR L N   1 
ATOM   8176  C  CA  . THR L  3 77  ? 52.228  -0.701   -36.051 1.00 86.65  ? 75  THR L CA  1 
ATOM   8177  C  C   . THR L  3 77  ? 51.949  -0.866   -34.546 1.00 93.00  ? 75  THR L C   1 
ATOM   8178  O  O   . THR L  3 77  ? 52.004  -1.976   -34.019 1.00 120.75 ? 75  THR L O   1 
ATOM   8179  C  CB  . THR L  3 77  ? 53.751  -0.865   -36.349 1.00 93.77  ? 75  THR L CB  1 
ATOM   8180  O  OG1 . THR L  3 77  ? 54.499  0.200    -35.744 1.00 86.54  ? 75  THR L OG1 1 
ATOM   8181  C  CG2 . THR L  3 77  ? 54.007  -0.865   -37.849 1.00 92.86  ? 75  THR L CG2 1 
ATOM   8182  N  N   . GLU L  3 78  ? 51.649  0.232    -33.863 1.00 85.39  ? 76  GLU L N   1 
ATOM   8183  C  CA  . GLU L  3 78  ? 51.416  0.202    -32.420 1.00 85.78  ? 76  GLU L CA  1 
ATOM   8184  C  C   . GLU L  3 78  ? 50.212  -0.665   -32.048 1.00 100.80 ? 76  GLU L C   1 
ATOM   8185  O  O   . GLU L  3 78  ? 49.261  -0.793   -32.821 1.00 108.30 ? 76  GLU L O   1 
ATOM   8186  C  CB  . GLU L  3 78  ? 51.229  1.628    -31.892 1.00 96.16  ? 76  GLU L CB  1 
ATOM   8187  C  CG  . GLU L  3 78  ? 52.409  2.550    -32.162 1.00 101.30 ? 76  GLU L CG  1 
ATOM   8188  C  CD  . GLU L  3 78  ? 53.499  2.393    -31.128 1.00 113.73 ? 76  GLU L CD  1 
ATOM   8189  O  OE1 . GLU L  3 78  ? 54.683  2.591    -31.477 1.00 113.19 ? 76  GLU L OE1 1 
ATOM   8190  O  OE2 . GLU L  3 78  ? 53.164  2.076    -29.965 1.00 111.27 ? 76  GLU L OE2 1 
ATOM   8191  N  N   . GLU L  3 79  ? 50.253  -1.258   -30.861 1.00 107.26 ? 77  GLU L N   1 
ATOM   8192  C  CA  . GLU L  3 79  ? 49.217  -2.193   -30.451 1.00 111.60 ? 77  GLU L CA  1 
ATOM   8193  C  C   . GLU L  3 79  ? 47.870  -1.493   -30.280 1.00 115.27 ? 77  GLU L C   1 
ATOM   8194  O  O   . GLU L  3 79  ? 46.966  -1.641   -31.110 1.00 105.72 ? 77  GLU L O   1 
ATOM   8195  C  CB  . GLU L  3 79  ? 49.628  -2.905   -29.164 1.00 110.34 ? 77  GLU L CB  1 
ATOM   8196  N  N   . ASN L  3 80  ? 47.739  -0.735   -29.197 1.00 112.01 ? 78  ASN L N   1 
ATOM   8197  C  CA  . ASN L  3 80  ? 46.528  0.037    -28.954 1.00 117.75 ? 78  ASN L CA  1 
ATOM   8198  C  C   . ASN L  3 80  ? 46.867  1.431    -28.449 1.00 100.35 ? 78  ASN L C   1 
ATOM   8199  O  O   . ASN L  3 80  ? 47.050  1.638    -27.251 1.00 94.40  ? 78  ASN L O   1 
ATOM   8200  C  CB  . ASN L  3 80  ? 45.602  -0.673   -27.966 1.00 128.40 ? 78  ASN L CB  1 
ATOM   8201  C  CG  . ASN L  3 80  ? 44.254  0.017    -27.829 1.00 136.00 ? 78  ASN L CG  1 
ATOM   8202  O  OD1 . ASN L  3 80  ? 43.671  0.480    -28.813 1.00 141.25 ? 78  ASN L OD1 1 
ATOM   8203  N  ND2 . ASN L  3 80  ? 43.756  0.096    -26.603 1.00 134.77 ? 78  ASN L ND2 1 
ATOM   8204  N  N   . PRO L  3 81  ? 46.957  2.393    -29.374 1.00 79.41  ? 79  PRO L N   1 
ATOM   8205  C  CA  . PRO L  3 81  ? 47.347  3.760    -29.057 1.00 80.51  ? 79  PRO L CA  1 
ATOM   8206  C  C   . PRO L  3 81  ? 46.193  4.746    -28.951 1.00 84.53  ? 79  PRO L C   1 
ATOM   8207  O  O   . PRO L  3 81  ? 45.165  4.604    -29.619 1.00 98.51  ? 79  PRO L O   1 
ATOM   8208  C  CB  . PRO L  3 81  ? 48.219  4.135    -30.250 1.00 79.15  ? 79  PRO L CB  1 
ATOM   8209  C  CG  . PRO L  3 81  ? 47.757  3.240    -31.369 1.00 65.63  ? 79  PRO L CG  1 
ATOM   8210  C  CD  . PRO L  3 81  ? 46.854  2.190    -30.825 1.00 65.45  ? 79  PRO L CD  1 
ATOM   8211  N  N   . GLN L  3 82  ? 46.386  5.739    -28.088 1.00 79.71  ? 80  GLN L N   1 
ATOM   8212  C  CA  . GLN L  3 82  ? 45.589  6.961    -28.075 1.00 70.39  ? 80  GLN L CA  1 
ATOM   8213  C  C   . GLN L  3 82  ? 45.449  7.487    -29.511 1.00 75.99  ? 80  GLN L C   1 
ATOM   8214  O  O   . GLN L  3 82  ? 44.360  7.507    -30.078 1.00 71.70  ? 80  GLN L O   1 
ATOM   8215  C  CB  . GLN L  3 82  ? 46.290  7.999    -27.186 1.00 100.37 ? 80  GLN L CB  1 
ATOM   8216  C  CG  . GLN L  3 82  ? 47.714  7.576    -26.678 1.00 159.02 ? 80  GLN L CG  1 
ATOM   8217  C  CD  . GLN L  3 82  ? 48.904  8.058    -27.545 1.00 124.62 ? 80  GLN L CD  1 
ATOM   8218  O  OE1 . GLN L  3 82  ? 49.295  9.234    -27.504 1.00 111.09 ? 80  GLN L OE1 1 
ATOM   8219  N  NE2 . GLN L  3 82  ? 49.502  7.131    -28.298 1.00 82.02  ? 80  GLN L NE2 1 
ATOM   8220  N  N   . VAL L  3 83  ? 46.570  7.892    -30.098 1.00 81.32  ? 81  VAL L N   1 
ATOM   8221  C  CA  . VAL L  3 83  ? 46.613  8.372    -31.475 1.00 62.41  ? 81  VAL L CA  1 
ATOM   8222  C  C   . VAL L  3 83  ? 47.334  7.388    -32.381 1.00 53.75  ? 81  VAL L C   1 
ATOM   8223  O  O   . VAL L  3 83  ? 48.479  7.026    -32.143 1.00 68.47  ? 81  VAL L O   1 
ATOM   8224  C  CB  . VAL L  3 83  ? 47.372  9.702    -31.582 1.00 63.80  ? 81  VAL L CB  1 
ATOM   8225  C  CG1 . VAL L  3 83  ? 47.410  10.176   -33.031 1.00 68.88  ? 81  VAL L CG1 1 
ATOM   8226  C  CG2 . VAL L  3 83  ? 46.748  10.737   -30.695 1.00 62.08  ? 81  VAL L CG2 1 
ATOM   8227  N  N   . TYR L  3 84  ? 46.666  6.956    -33.429 1.00 57.07  ? 82  TYR L N   1 
ATOM   8228  C  CA  . TYR L  3 84  ? 47.287  6.061    -34.386 1.00 69.73  ? 82  TYR L CA  1 
ATOM   8229  C  C   . TYR L  3 84  ? 48.138  6.918    -35.318 1.00 67.98  ? 82  TYR L C   1 
ATOM   8230  O  O   . TYR L  3 84  ? 47.721  8.008    -35.717 1.00 86.44  ? 82  TYR L O   1 
ATOM   8231  C  CB  . TYR L  3 84  ? 46.221  5.245    -35.155 1.00 79.10  ? 82  TYR L CB  1 
ATOM   8232  C  CG  . TYR L  3 84  ? 45.399  4.270    -34.298 1.00 88.40  ? 82  TYR L CG  1 
ATOM   8233  C  CD1 . TYR L  3 84  ? 45.106  2.986    -34.746 1.00 92.14  ? 82  TYR L CD1 1 
ATOM   8234  C  CD2 . TYR L  3 84  ? 44.923  4.637    -33.046 1.00 109.71 ? 82  TYR L CD2 1 
ATOM   8235  C  CE1 . TYR L  3 84  ? 44.367  2.108    -33.977 1.00 102.14 ? 82  TYR L CE1 1 
ATOM   8236  C  CE2 . TYR L  3 84  ? 44.186  3.761    -32.273 1.00 114.20 ? 82  TYR L CE2 1 
ATOM   8237  C  CZ  . TYR L  3 84  ? 43.913  2.502    -32.743 1.00 106.84 ? 82  TYR L CZ  1 
ATOM   8238  O  OH  . TYR L  3 84  ? 43.174  1.641    -31.970 1.00 98.23  ? 82  TYR L OH  1 
ATOM   8239  N  N   . PHE L  3 85  ? 49.335  6.437    -35.637 1.00 69.77  ? 83  PHE L N   1 
ATOM   8240  C  CA  . PHE L  3 85  ? 50.252  7.135    -36.535 1.00 51.51  ? 83  PHE L CA  1 
ATOM   8241  C  C   . PHE L  3 85  ? 50.816  6.173    -37.564 1.00 55.94  ? 83  PHE L C   1 
ATOM   8242  O  O   . PHE L  3 85  ? 50.983  4.982    -37.287 1.00 73.41  ? 83  PHE L O   1 
ATOM   8243  C  CB  . PHE L  3 85  ? 51.407  7.749    -35.753 1.00 46.28  ? 83  PHE L CB  1 
ATOM   8244  C  CG  . PHE L  3 85  ? 52.425  8.447    -36.614 1.00 47.53  ? 83  PHE L CG  1 
ATOM   8245  C  CD1 . PHE L  3 85  ? 52.372  9.815    -36.801 1.00 67.77  ? 83  PHE L CD1 1 
ATOM   8246  C  CD2 . PHE L  3 85  ? 53.437  7.742    -37.233 1.00 42.87  ? 83  PHE L CD2 1 
ATOM   8247  C  CE1 . PHE L  3 85  ? 53.303  10.455   -37.589 1.00 70.04  ? 83  PHE L CE1 1 
ATOM   8248  C  CE2 . PHE L  3 85  ? 54.374  8.378    -38.022 1.00 57.23  ? 83  PHE L CE2 1 
ATOM   8249  C  CZ  . PHE L  3 85  ? 54.308  9.734    -38.197 1.00 70.70  ? 83  PHE L CZ  1 
ATOM   8250  N  N   . CYS L  3 86  ? 51.112  6.688    -38.751 1.00 50.47  ? 84  CYS L N   1 
ATOM   8251  C  CA  . CYS L  3 86  ? 51.794  5.895    -39.760 1.00 62.18  ? 84  CYS L CA  1 
ATOM   8252  C  C   . CYS L  3 86  ? 52.512  6.784    -40.761 1.00 77.46  ? 84  CYS L C   1 
ATOM   8253  O  O   . CYS L  3 86  ? 52.028  7.865    -41.099 1.00 58.60  ? 84  CYS L O   1 
ATOM   8254  C  CB  . CYS L  3 86  ? 50.817  4.982    -40.485 1.00 54.35  ? 84  CYS L CB  1 
ATOM   8255  S  SG  . CYS L  3 86  ? 49.993  5.725    -41.896 1.00 65.90  ? 84  CYS L SG  1 
ATOM   8256  N  N   . CYS L  3 87  ? 53.676  6.330    -41.220 1.00 92.68  ? 85  CYS L N   1 
ATOM   8257  C  CA  . CYS L  3 87  ? 54.402  7.040    -42.259 1.00 74.62  ? 85  CYS L CA  1 
ATOM   8258  C  C   . CYS L  3 87  ? 54.826  6.111    -43.372 1.00 64.80  ? 85  CYS L C   1 
ATOM   8259  O  O   . CYS L  3 87  ? 54.762  4.895    -43.230 1.00 94.98  ? 85  CYS L O   1 
ATOM   8260  C  CB  . CYS L  3 87  ? 55.606  7.782    -41.690 1.00 63.75  ? 85  CYS L CB  1 
ATOM   8261  S  SG  . CYS L  3 87  ? 56.669  6.814    -40.680 1.00 93.90  ? 85  CYS L SG  1 
ATOM   8262  N  N   . CYS L  3 88  ? 55.248  6.698    -44.482 1.00 46.51  ? 86  CYS L N   1 
ATOM   8263  C  CA  . CYS L  3 88  ? 55.566  5.950    -45.687 1.00 62.58  ? 86  CYS L CA  1 
ATOM   8264  C  C   . CYS L  3 88  ? 56.409  6.768    -46.671 1.00 85.75  ? 86  CYS L C   1 
ATOM   8265  O  O   . CYS L  3 88  ? 56.665  7.958    -46.458 1.00 101.75 ? 86  CYS L O   1 
ATOM   8266  C  CB  . CYS L  3 88  ? 54.279  5.493    -46.369 1.00 67.02  ? 86  CYS L CB  1 
ATOM   8267  S  SG  . CYS L  3 88  ? 53.179  6.816    -46.846 1.00 74.67  ? 86  CYS L SG  1 
ATOM   8268  N  N   . GLU L  3 89  ? 56.822  6.122    -47.757 1.00 73.91  ? 87  GLU L N   1 
ATOM   8269  C  CA  . GLU L  3 89  ? 57.688  6.735    -48.753 1.00 66.39  ? 87  GLU L CA  1 
ATOM   8270  C  C   . GLU L  3 89  ? 57.072  6.535    -50.135 1.00 70.67  ? 87  GLU L C   1 
ATOM   8271  O  O   . GLU L  3 89  ? 56.730  5.421    -50.525 1.00 91.05  ? 87  GLU L O   1 
ATOM   8272  C  CB  . GLU L  3 89  ? 59.078  6.100    -48.671 1.00 77.85  ? 87  GLU L CB  1 
ATOM   8273  C  CG  . GLU L  3 89  ? 60.231  6.943    -49.168 1.00 90.77  ? 87  GLU L CG  1 
ATOM   8274  C  CD  . GLU L  3 89  ? 61.580  6.338    -48.784 1.00 101.84 ? 87  GLU L CD  1 
ATOM   8275  O  OE1 . GLU L  3 89  ? 61.582  5.236    -48.197 1.00 101.21 ? 87  GLU L OE1 1 
ATOM   8276  O  OE2 . GLU L  3 89  ? 62.637  6.953    -49.057 1.00 90.62  ? 87  GLU L OE2 1 
ATOM   8277  N  N   . GLY L  3 90  ? 56.920  7.625    -50.871 1.00 81.51  ? 88  GLY L N   1 
ATOM   8278  C  CA  . GLY L  3 90  ? 56.354  7.571    -52.203 1.00 83.37  ? 88  GLY L CA  1 
ATOM   8279  C  C   . GLY L  3 90  ? 55.198  8.531    -52.313 1.00 75.10  ? 88  GLY L C   1 
ATOM   8280  O  O   . GLY L  3 90  ? 54.390  8.616    -51.398 1.00 83.22  ? 88  GLY L O   1 
ATOM   8281  N  N   . ASN L  3 91  ? 55.114  9.248    -53.428 1.00 61.64  ? 89  ASN L N   1 
ATOM   8282  C  CA  . ASN L  3 91  ? 54.069  10.248   -53.619 1.00 68.49  ? 89  ASN L CA  1 
ATOM   8283  C  C   . ASN L  3 91  ? 52.643  9.792    -53.289 1.00 73.34  ? 89  ASN L C   1 
ATOM   8284  O  O   . ASN L  3 91  ? 52.152  8.801    -53.810 1.00 74.02  ? 89  ASN L O   1 
ATOM   8285  C  CB  . ASN L  3 91  ? 54.119  10.816   -55.034 1.00 74.09  ? 89  ASN L CB  1 
ATOM   8286  C  CG  . ASN L  3 91  ? 55.294  11.743   -55.242 1.00 86.10  ? 89  ASN L CG  1 
ATOM   8287  O  OD1 . ASN L  3 91  ? 56.277  11.683   -54.505 1.00 92.50  ? 89  ASN L OD1 1 
ATOM   8288  N  ND2 . ASN L  3 91  ? 55.202  12.612   -56.250 1.00 90.06  ? 89  ASN L ND2 1 
ATOM   8289  N  N   . PHE L  3 92  ? 51.988  10.540   -52.413 1.00 80.23  ? 90  PHE L N   1 
ATOM   8290  C  CA  . PHE L  3 92  ? 50.605  10.286   -52.022 1.00 69.98  ? 90  PHE L CA  1 
ATOM   8291  C  C   . PHE L  3 92  ? 50.370  8.932    -51.377 1.00 69.24  ? 90  PHE L C   1 
ATOM   8292  O  O   . PHE L  3 92  ? 49.246  8.451    -51.334 1.00 83.36  ? 90  PHE L O   1 
ATOM   8293  C  CB  . PHE L  3 92  ? 49.678  10.485   -53.205 1.00 48.79  ? 90  PHE L CB  1 
ATOM   8294  C  CG  . PHE L  3 92  ? 49.781  11.840   -53.810 1.00 63.97  ? 90  PHE L CG  1 
ATOM   8295  C  CD1 . PHE L  3 92  ? 49.733  12.972   -53.016 1.00 76.44  ? 90  PHE L CD1 1 
ATOM   8296  C  CD2 . PHE L  3 92  ? 49.956  11.989   -55.165 1.00 78.80  ? 90  PHE L CD2 1 
ATOM   8297  C  CE1 . PHE L  3 92  ? 49.840  14.221   -53.569 1.00 84.43  ? 90  PHE L CE1 1 
ATOM   8298  C  CE2 . PHE L  3 92  ? 50.062  13.241   -55.725 1.00 87.81  ? 90  PHE L CE2 1 
ATOM   8299  C  CZ  . PHE L  3 92  ? 50.006  14.359   -54.926 1.00 84.29  ? 90  PHE L CZ  1 
ATOM   8300  N  N   . CYS L  3 93  ? 51.426  8.338    -50.846 1.00 65.99  ? 91  CYS L N   1 
ATOM   8301  C  CA  . CYS L  3 93  ? 51.314  7.054    -50.179 1.00 82.73  ? 91  CYS L CA  1 
ATOM   8302  C  C   . CYS L  3 93  ? 50.392  7.106    -48.966 1.00 82.64  ? 91  CYS L C   1 
ATOM   8303  O  O   . CYS L  3 93  ? 49.981  6.069    -48.455 1.00 103.78 ? 91  CYS L O   1 
ATOM   8304  C  CB  . CYS L  3 93  ? 52.694  6.557    -49.762 1.00 98.60  ? 91  CYS L CB  1 
ATOM   8305  S  SG  . CYS L  3 93  ? 53.558  7.668    -48.653 1.00 119.38 ? 91  CYS L SG  1 
ATOM   8306  N  N   . ASN L  3 94  ? 50.070  8.311    -48.505 1.00 66.27  ? 92  ASN L N   1 
ATOM   8307  C  CA  . ASN L  3 94  ? 49.183  8.478    -47.347 1.00 55.68  ? 92  ASN L CA  1 
ATOM   8308  C  C   . ASN L  3 94  ? 47.732  8.753    -47.716 1.00 57.46  ? 92  ASN L C   1 
ATOM   8309  O  O   . ASN L  3 94  ? 46.940  9.142    -46.867 1.00 63.79  ? 92  ASN L O   1 
ATOM   8310  C  CB  . ASN L  3 94  ? 49.700  9.537    -46.342 1.00 52.92  ? 92  ASN L CB  1 
ATOM   8311  C  CG  . ASN L  3 94  ? 49.719  10.945   -46.910 1.00 58.58  ? 92  ASN L CG  1 
ATOM   8312  O  OD1 . ASN L  3 94  ? 49.532  11.148   -48.101 1.00 61.29  ? 92  ASN L OD1 1 
ATOM   8313  N  ND2 . ASN L  3 94  ? 49.957  11.923   -46.052 1.00 70.73  ? 92  ASN L ND2 1 
ATOM   8314  N  N   . GLU L  3 95  ? 47.380  8.540    -48.977 1.00 68.64  ? 93  GLU L N   1 
ATOM   8315  C  CA  . GLU L  3 95  ? 45.987  8.641    -49.388 1.00 81.35  ? 93  GLU L CA  1 
ATOM   8316  C  C   . GLU L  3 95  ? 45.122  7.717    -48.537 1.00 92.20  ? 93  GLU L C   1 
ATOM   8317  O  O   . GLU L  3 95  ? 44.173  8.161    -47.886 1.00 109.52 ? 93  GLU L O   1 
ATOM   8318  C  CB  . GLU L  3 95  ? 45.832  8.320    -50.876 1.00 86.99  ? 93  GLU L CB  1 
ATOM   8319  C  CG  . GLU L  3 95  ? 44.394  8.136    -51.338 1.00 109.83 ? 93  GLU L CG  1 
ATOM   8320  C  CD  . GLU L  3 95  ? 43.481  9.318    -51.005 1.00 131.69 ? 93  GLU L CD  1 
ATOM   8321  O  OE1 . GLU L  3 95  ? 43.883  10.213   -50.229 1.00 139.20 ? 93  GLU L OE1 1 
ATOM   8322  O  OE2 . GLU L  3 95  ? 42.344  9.343    -51.525 1.00 135.19 ? 93  GLU L OE2 1 
ATOM   8323  N  N   . ARG L  3 96  ? 45.463  6.432    -48.541 1.00 83.10  ? 94  ARG L N   1 
ATOM   8324  C  CA  . ARG L  3 96  ? 44.771  5.443    -47.732 1.00 73.23  ? 94  ARG L CA  1 
ATOM   8325  C  C   . ARG L  3 96  ? 45.721  4.898    -46.678 1.00 64.05  ? 94  ARG L C   1 
ATOM   8326  O  O   . ARG L  3 96  ? 46.919  4.810    -46.900 1.00 71.07  ? 94  ARG L O   1 
ATOM   8327  C  CB  . ARG L  3 96  ? 44.239  4.321    -48.622 1.00 71.95  ? 94  ARG L CB  1 
ATOM   8328  N  N   . PHE L  3 97  ? 45.185  4.544    -45.521 1.00 55.67  ? 95  PHE L N   1 
ATOM   8329  C  CA  . PHE L  3 97  ? 45.987  3.978    -44.441 1.00 66.52  ? 95  PHE L CA  1 
ATOM   8330  C  C   . PHE L  3 97  ? 45.240  2.856    -43.700 1.00 88.11  ? 95  PHE L C   1 
ATOM   8331  O  O   . PHE L  3 97  ? 44.022  2.770    -43.795 1.00 101.05 ? 95  PHE L O   1 
ATOM   8332  C  CB  . PHE L  3 97  ? 46.350  5.070    -43.458 1.00 67.58  ? 95  PHE L CB  1 
ATOM   8333  C  CG  . PHE L  3 97  ? 45.160  5.731    -42.830 1.00 80.96  ? 95  PHE L CG  1 
ATOM   8334  C  CD1 . PHE L  3 97  ? 44.719  5.340    -41.575 1.00 72.68  ? 95  PHE L CD1 1 
ATOM   8335  C  CD2 . PHE L  3 97  ? 44.485  6.742    -43.497 1.00 77.78  ? 95  PHE L CD2 1 
ATOM   8336  C  CE1 . PHE L  3 97  ? 43.641  5.943    -41.000 1.00 57.06  ? 95  PHE L CE1 1 
ATOM   8337  C  CE2 . PHE L  3 97  ? 43.411  7.355    -42.927 1.00 50.42  ? 95  PHE L CE2 1 
ATOM   8338  C  CZ  . PHE L  3 97  ? 42.987  6.956    -41.676 1.00 46.96  ? 95  PHE L CZ  1 
ATOM   8339  N  N   . THR L  3 98  ? 45.968  2.011    -42.962 1.00 97.55  ? 96  THR L N   1 
ATOM   8340  C  CA  . THR L  3 98  ? 45.385  0.872    -42.236 1.00 85.67  ? 96  THR L CA  1 
ATOM   8341  C  C   . THR L  3 98  ? 46.140  0.562    -40.933 1.00 86.58  ? 96  THR L C   1 
ATOM   8342  O  O   . THR L  3 98  ? 47.122  1.220    -40.604 1.00 89.33  ? 96  THR L O   1 
ATOM   8343  C  CB  . THR L  3 98  ? 45.352  -0.411   -43.112 1.00 91.52  ? 96  THR L CB  1 
ATOM   8344  O  OG1 . THR L  3 98  ? 46.670  -0.727   -43.569 1.00 78.61  ? 96  THR L OG1 1 
ATOM   8345  C  CG2 . THR L  3 98  ? 44.461  -0.227   -44.325 1.00 109.71 ? 96  THR L CG2 1 
ATOM   8346  N  N   . HIS L  3 99  ? 45.693  -0.458   -40.206 1.00 91.10  ? 97  HIS L N   1 
ATOM   8347  C  CA  . HIS L  3 99  ? 46.296  -0.824   -38.919 1.00 99.39  ? 97  HIS L CA  1 
ATOM   8348  C  C   . HIS L  3 99  ? 46.616  -2.316   -38.789 1.00 119.82 ? 97  HIS L C   1 
ATOM   8349  O  O   . HIS L  3 99  ? 45.790  -3.162   -39.131 1.00 144.26 ? 97  HIS L O   1 
ATOM   8350  C  CB  . HIS L  3 99  ? 45.344  -0.435   -37.801 1.00 100.60 ? 97  HIS L CB  1 
ATOM   8351  C  CG  . HIS L  3 99  ? 45.786  -0.880   -36.443 1.00 104.41 ? 97  HIS L CG  1 
ATOM   8352  N  ND1 . HIS L  3 99  ? 46.633  -0.135   -35.655 1.00 112.44 ? 97  HIS L ND1 1 
ATOM   8353  C  CD2 . HIS L  3 99  ? 45.480  -1.984   -35.722 1.00 106.71 ? 97  HIS L CD2 1 
ATOM   8354  C  CE1 . HIS L  3 99  ? 46.836  -0.761   -34.510 1.00 102.84 ? 97  HIS L CE1 1 
ATOM   8355  N  NE2 . HIS L  3 99  ? 46.149  -1.886   -34.525 1.00 99.19  ? 97  HIS L NE2 1 
ATOM   8356  N  N   . LEU L  3 100 ? 47.805  -2.637   -38.283 1.00 112.91 ? 98  LEU L N   1 
ATOM   8357  C  CA  . LEU L  3 100 ? 48.164  -4.028   -37.967 1.00 121.36 ? 98  LEU L CA  1 
ATOM   8358  C  C   . LEU L  3 100 ? 49.506  -4.172   -37.216 1.00 111.64 ? 98  LEU L C   1 
ATOM   8359  O  O   . LEU L  3 100 ? 50.583  -4.107   -37.817 1.00 88.56  ? 98  LEU L O   1 
ATOM   8360  C  CB  . LEU L  3 100 ? 48.126  -4.918   -39.220 1.00 126.05 ? 98  LEU L CB  1 
ATOM   8361  C  CG  . LEU L  3 100 ? 49.136  -4.687   -40.345 1.00 119.75 ? 98  LEU L CG  1 
ATOM   8362  C  CD1 . LEU L  3 100 ? 50.069  -5.882   -40.468 1.00 93.51  ? 98  LEU L CD1 1 
ATOM   8363  C  CD2 . LEU L  3 100 ? 48.424  -4.422   -41.661 1.00 122.37 ? 98  LEU L CD2 1 
ATOM   8364  N  N   . PRO L  3 101 ? 49.433  -4.386   -35.890 1.00 105.65 ? 99  PRO L N   1 
ATOM   8365  C  CA  . PRO L  3 101 ? 50.589  -4.451   -34.979 1.00 115.99 ? 99  PRO L CA  1 
ATOM   8366  C  C   . PRO L  3 101 ? 51.594  -5.580   -35.268 1.00 112.64 ? 99  PRO L C   1 
ATOM   8367  O  O   . PRO L  3 101 ? 52.700  -5.562   -34.704 1.00 96.37  ? 99  PRO L O   1 
ATOM   8368  C  CB  . PRO L  3 101 ? 49.940  -4.648   -33.602 1.00 113.16 ? 99  PRO L CB  1 
ATOM   8369  C  CG  . PRO L  3 101 ? 48.590  -5.196   -33.885 1.00 103.94 ? 99  PRO L CG  1 
ATOM   8370  C  CD  . PRO L  3 101 ? 48.160  -4.586   -35.178 1.00 89.38  ? 99  PRO L CD  1 
ATOM   8371  N  N   . SER M  1 6   ? 84.722  3.926    60.924  1.00 53.51  ? 6   SER M N   1 
ATOM   8372  C  CA  . SER M  1 6   ? 85.923  4.254    61.713  1.00 105.79 ? 6   SER M CA  1 
ATOM   8373  C  C   . SER M  1 6   ? 86.116  5.769    61.983  1.00 94.98  ? 6   SER M C   1 
ATOM   8374  O  O   . SER M  1 6   ? 86.197  6.198    63.140  1.00 64.12  ? 6   SER M O   1 
ATOM   8375  C  CB  . SER M  1 6   ? 87.201  3.613    61.100  1.00 45.24  ? 6   SER M CB  1 
ATOM   8376  N  N   . HIS M  1 7   ? 86.180  6.570    60.920  1.00 84.54  ? 7   HIS M N   1 
ATOM   8377  C  CA  . HIS M  1 7   ? 86.484  7.996    61.039  1.00 64.29  ? 7   HIS M CA  1 
ATOM   8378  C  C   . HIS M  1 7   ? 85.254  8.829    61.324  1.00 83.48  ? 7   HIS M C   1 
ATOM   8379  O  O   . HIS M  1 7   ? 84.474  8.488    62.188  1.00 116.85 ? 7   HIS M O   1 
ATOM   8380  C  CB  . HIS M  1 7   ? 87.137  8.502    59.762  1.00 94.64  ? 7   HIS M CB  1 
ATOM   8381  C  CG  . HIS M  1 7   ? 88.528  7.996    59.562  1.00 112.66 ? 7   HIS M CG  1 
ATOM   8382  N  ND1 . HIS M  1 7   ? 89.605  8.485    60.270  1.00 98.99  ? 7   HIS M ND1 1 
ATOM   8383  C  CD2 . HIS M  1 7   ? 89.021  7.043    58.739  1.00 126.42 ? 7   HIS M CD2 1 
ATOM   8384  C  CE1 . HIS M  1 7   ? 90.702  7.856    59.891  1.00 99.67  ? 7   HIS M CE1 1 
ATOM   8385  N  NE2 . HIS M  1 7   ? 90.375  6.974    58.963  1.00 122.60 ? 7   HIS M NE2 1 
ATOM   8386  N  N   . CYS M  1 8   ? 85.071  9.918    60.586  1.00 68.57  ? 8   CYS M N   1 
ATOM   8387  C  CA  . CYS M  1 8   ? 83.915  10.790   60.809  1.00 56.09  ? 8   CYS M CA  1 
ATOM   8388  C  C   . CYS M  1 8   ? 82.905  10.740   59.674  1.00 59.26  ? 8   CYS M C   1 
ATOM   8389  O  O   . CYS M  1 8   ? 83.252  10.969   58.517  1.00 72.97  ? 8   CYS M O   1 
ATOM   8390  C  CB  . CYS M  1 8   ? 84.369  12.231   61.005  1.00 63.53  ? 8   CYS M CB  1 
ATOM   8391  S  SG  . CYS M  1 8   ? 83.031  13.446   60.970  1.00 88.93  ? 8   CYS M SG  1 
ATOM   8392  N  N   . GLN M  1 9   ? 81.648  10.477   60.010  1.00 48.84  ? 9   GLN M N   1 
ATOM   8393  C  CA  . GLN M  1 9   ? 80.632  10.242   58.994  1.00 46.04  ? 9   GLN M CA  1 
ATOM   8394  C  C   . GLN M  1 9   ? 79.198  10.340   59.500  1.00 54.70  ? 9   GLN M C   1 
ATOM   8395  O  O   . GLN M  1 9   ? 78.943  10.392   60.718  1.00 68.79  ? 9   GLN M O   1 
ATOM   8396  C  CB  . GLN M  1 9   ? 80.852  8.865    58.385  1.00 71.38  ? 9   GLN M CB  1 
ATOM   8397  C  CG  . GLN M  1 9   ? 81.221  7.784    59.421  1.00 74.60  ? 9   GLN M CG  1 
ATOM   8398  C  CD  . GLN M  1 9   ? 81.343  6.385    58.816  1.00 81.89  ? 9   GLN M CD  1 
ATOM   8399  O  OE1 . GLN M  1 9   ? 80.998  6.169    57.654  1.00 97.51  ? 9   GLN M OE1 1 
ATOM   8400  N  NE2 . GLN M  1 9   ? 81.832  5.434    59.603  1.00 84.71  ? 9   GLN M NE2 1 
ATOM   8401  N  N   . LYS M  1 10  ? 78.272  10.364   58.540  1.00 58.49  ? 10  LYS M N   1 
ATOM   8402  C  CA  . LYS M  1 10  ? 76.827  10.377   58.801  1.00 55.84  ? 10  LYS M CA  1 
ATOM   8403  C  C   . LYS M  1 10  ? 76.325  8.946    59.086  1.00 53.34  ? 10  LYS M C   1 
ATOM   8404  O  O   . LYS M  1 10  ? 76.695  8.008    58.400  1.00 51.34  ? 10  LYS M O   1 
ATOM   8405  C  CB  . LYS M  1 10  ? 76.069  10.990   57.599  1.00 40.74  ? 10  LYS M CB  1 
ATOM   8406  C  CG  . LYS M  1 10  ? 74.821  11.802   57.964  1.00 50.38  ? 10  LYS M CG  1 
ATOM   8407  C  CD  . LYS M  1 10  ? 73.662  11.623   56.964  1.00 53.01  ? 10  LYS M CD  1 
ATOM   8408  C  CE  . LYS M  1 10  ? 73.841  12.398   55.665  1.00 64.29  ? 10  LYS M CE  1 
ATOM   8409  N  NZ  . LYS M  1 10  ? 72.702  12.185   54.697  1.00 63.32  ? 10  LYS M NZ  1 
ATOM   8410  N  N   . THR M  1 11  ? 75.483  8.788    60.098  1.00 55.60  ? 11  THR M N   1 
ATOM   8411  C  CA  . THR M  1 11  ? 74.992  7.473    60.516  1.00 51.20  ? 11  THR M CA  1 
ATOM   8412  C  C   . THR M  1 11  ? 73.479  7.476    60.604  1.00 73.75  ? 11  THR M C   1 
ATOM   8413  O  O   . THR M  1 11  ? 72.862  8.526    60.819  1.00 88.15  ? 11  THR M O   1 
ATOM   8414  C  CB  . THR M  1 11  ? 75.528  7.122    61.905  1.00 59.25  ? 11  THR M CB  1 
ATOM   8415  O  OG1 . THR M  1 11  ? 76.915  6.841    61.792  1.00 77.58  ? 11  THR M OG1 1 
ATOM   8416  C  CG2 . THR M  1 11  ? 74.829  5.917    62.494  1.00 68.29  ? 11  THR M CG2 1 
ATOM   8417  N  N   . SER M  1 12  ? 72.869  6.308    60.455  1.00 46.86  ? 12  SER M N   1 
ATOM   8418  C  CA  . SER M  1 12  ? 71.436  6.237    60.637  1.00 44.67  ? 12  SER M CA  1 
ATOM   8419  C  C   . SER M  1 12  ? 71.050  6.410    62.098  1.00 60.61  ? 12  SER M C   1 
ATOM   8420  O  O   . SER M  1 12  ? 71.701  5.867    62.980  1.00 62.49  ? 12  SER M O   1 
ATOM   8421  C  CB  . SER M  1 12  ? 70.897  4.922    60.131  1.00 49.75  ? 12  SER M CB  1 
ATOM   8422  O  OG  . SER M  1 12  ? 69.525  4.812    60.456  1.00 63.54  ? 12  SER M OG  1 
ATOM   8423  N  N   . LEU M  1 13  ? 70.002  7.186    62.356  1.00 62.54  ? 13  LEU M N   1 
ATOM   8424  C  CA  . LEU M  1 13  ? 69.456  7.265    63.698  1.00 49.35  ? 13  LEU M CA  1 
ATOM   8425  C  C   . LEU M  1 13  ? 67.948  7.356    63.589  1.00 58.27  ? 13  LEU M C   1 
ATOM   8426  O  O   . LEU M  1 13  ? 67.368  8.446    63.425  1.00 85.39  ? 13  LEU M O   1 
ATOM   8427  C  CB  . LEU M  1 13  ? 70.019  8.474    64.453  1.00 58.55  ? 13  LEU M CB  1 
ATOM   8428  C  CG  . LEU M  1 13  ? 69.542  8.691    65.891  1.00 45.78  ? 13  LEU M CG  1 
ATOM   8429  C  CD1 . LEU M  1 13  ? 69.964  7.523    66.748  1.00 20.90  ? 13  LEU M CD1 1 
ATOM   8430  C  CD2 . LEU M  1 13  ? 70.079  9.994    66.456  1.00 55.59  ? 13  LEU M CD2 1 
ATOM   8431  N  N   . ARG M  1 14  ? 67.303  6.202    63.647  1.00 57.60  ? 14  ARG M N   1 
ATOM   8432  C  CA  . ARG M  1 14  ? 65.851  6.181    63.625  1.00 65.11  ? 14  ARG M CA  1 
ATOM   8433  C  C   . ARG M  1 14  ? 65.353  6.608    64.991  1.00 64.06  ? 14  ARG M C   1 
ATOM   8434  O  O   . ARG M  1 14  ? 65.441  5.844    65.968  1.00 69.56  ? 14  ARG M O   1 
ATOM   8435  C  CB  . ARG M  1 14  ? 65.319  4.795    63.266  1.00 69.97  ? 14  ARG M CB  1 
ATOM   8436  C  CG  . ARG M  1 14  ? 65.807  4.261    61.931  1.00 68.66  ? 14  ARG M CG  1 
ATOM   8437  C  CD  . ARG M  1 14  ? 65.418  5.190    60.814  1.00 78.58  ? 14  ARG M CD  1 
ATOM   8438  N  NE  . ARG M  1 14  ? 65.721  4.681    59.475  1.00 87.41  ? 14  ARG M NE  1 
ATOM   8439  C  CZ  . ARG M  1 14  ? 65.092  3.664    58.892  1.00 80.24  ? 14  ARG M CZ  1 
ATOM   8440  N  NH1 . ARG M  1 14  ? 64.144  2.999    59.546  1.00 70.18  ? 14  ARG M NH1 1 
ATOM   8441  N  NH2 . ARG M  1 14  ? 65.423  3.299    57.661  1.00 61.62  ? 14  ARG M NH2 1 
ATOM   8442  N  N   . VAL M  1 15  ? 64.860  7.843    65.066  1.00 47.50  ? 15  VAL M N   1 
ATOM   8443  C  CA  . VAL M  1 15  ? 64.273  8.321    66.301  1.00 36.70  ? 15  VAL M CA  1 
ATOM   8444  C  C   . VAL M  1 15  ? 62.813  7.927    66.314  1.00 45.18  ? 15  VAL M C   1 
ATOM   8445  O  O   . VAL M  1 15  ? 62.111  8.141    65.331  1.00 64.09  ? 15  VAL M O   1 
ATOM   8446  C  CB  . VAL M  1 15  ? 64.382  9.824    66.426  1.00 48.54  ? 15  VAL M CB  1 
ATOM   8447  C  CG1 . VAL M  1 15  ? 63.633  10.296   67.671  1.00 56.61  ? 15  VAL M CG1 1 
ATOM   8448  C  CG2 . VAL M  1 15  ? 65.832  10.226   66.478  1.00 52.57  ? 15  VAL M CG2 1 
ATOM   8449  N  N   . ASN M  1 16  ? 62.368  7.328    67.412  1.00 38.29  ? 16  ASN M N   1 
ATOM   8450  C  CA  . ASN M  1 16  ? 60.975  6.969    67.580  1.00 49.18  ? 16  ASN M CA  1 
ATOM   8451  C  C   . ASN M  1 16  ? 60.365  7.913    68.606  1.00 63.09  ? 16  ASN M C   1 
ATOM   8452  O  O   . ASN M  1 16  ? 60.780  7.939    69.764  1.00 72.74  ? 16  ASN M O   1 
ATOM   8453  C  CB  . ASN M  1 16  ? 60.878  5.524    68.051  1.00 65.44  ? 16  ASN M CB  1 
ATOM   8454  C  CG  . ASN M  1 16  ? 59.454  5.065    68.276  1.00 70.74  ? 16  ASN M CG  1 
ATOM   8455  O  OD1 . ASN M  1 16  ? 58.563  5.856    68.584  1.00 82.14  ? 16  ASN M OD1 1 
ATOM   8456  N  ND2 . ASN M  1 16  ? 59.238  3.770    68.139  1.00 74.01  ? 16  ASN M ND2 1 
ATOM   8457  N  N   . PHE M  1 17  ? 59.388  8.702    68.184  1.00 53.04  ? 17  PHE M N   1 
ATOM   8458  C  CA  . PHE M  1 17  ? 58.878  9.755    69.047  1.00 59.96  ? 17  PHE M CA  1 
ATOM   8459  C  C   . PHE M  1 17  ? 58.335  9.219    70.354  1.00 64.73  ? 17  PHE M C   1 
ATOM   8460  O  O   . PHE M  1 17  ? 58.396  9.896    71.375  1.00 69.52  ? 17  PHE M O   1 
ATOM   8461  C  CB  . PHE M  1 17  ? 57.819  10.586   68.332  1.00 59.74  ? 17  PHE M CB  1 
ATOM   8462  C  CG  . PHE M  1 17  ? 58.372  11.474   67.257  1.00 56.28  ? 17  PHE M CG  1 
ATOM   8463  C  CD1 . PHE M  1 17  ? 59.166  12.556   67.584  1.00 41.56  ? 17  PHE M CD1 1 
ATOM   8464  C  CD2 . PHE M  1 17  ? 58.088  11.235   65.926  1.00 64.89  ? 17  PHE M CD2 1 
ATOM   8465  C  CE1 . PHE M  1 17  ? 59.669  13.371   66.617  1.00 29.27  ? 17  PHE M CE1 1 
ATOM   8466  C  CE2 . PHE M  1 17  ? 58.584  12.052   64.954  1.00 66.63  ? 17  PHE M CE2 1 
ATOM   8467  C  CZ  . PHE M  1 17  ? 59.376  13.123   65.300  1.00 43.75  ? 17  PHE M CZ  1 
ATOM   8468  N  N   . GLU M  1 18  ? 57.809  8.003    70.321  1.00 49.95  ? 18  GLU M N   1 
ATOM   8469  C  CA  . GLU M  1 18  ? 57.290  7.390    71.528  1.00 56.34  ? 18  GLU M CA  1 
ATOM   8470  C  C   . GLU M  1 18  ? 58.407  7.264    72.551  1.00 66.77  ? 18  GLU M C   1 
ATOM   8471  O  O   . GLU M  1 18  ? 58.195  7.501    73.740  1.00 56.01  ? 18  GLU M O   1 
ATOM   8472  C  CB  . GLU M  1 18  ? 56.693  6.024    71.214  1.00 74.27  ? 18  GLU M CB  1 
ATOM   8473  C  CG  . GLU M  1 18  ? 55.844  5.438    72.327  1.00 77.91  ? 18  GLU M CG  1 
ATOM   8474  C  CD  . GLU M  1 18  ? 55.191  4.134    71.923  1.00 98.44  ? 18  GLU M CD  1 
ATOM   8475  O  OE1 . GLU M  1 18  ? 54.205  3.733    72.581  1.00 106.20 ? 18  GLU M OE1 1 
ATOM   8476  O  OE2 . GLU M  1 18  ? 55.671  3.513    70.948  1.00 105.85 ? 18  GLU M OE2 1 
ATOM   8477  N  N   . ASP M  1 19  ? 59.602  6.914    72.076  1.00 78.15  ? 19  ASP M N   1 
ATOM   8478  C  CA  . ASP M  1 19  ? 60.777  6.729    72.941  1.00 66.48  ? 19  ASP M CA  1 
ATOM   8479  C  C   . ASP M  1 19  ? 61.171  7.982    73.727  1.00 58.72  ? 19  ASP M C   1 
ATOM   8480  O  O   . ASP M  1 19  ? 61.650  7.876    74.853  1.00 67.59  ? 19  ASP M O   1 
ATOM   8481  C  CB  . ASP M  1 19  ? 61.991  6.244    72.135  1.00 66.08  ? 19  ASP M CB  1 
ATOM   8482  C  CG  . ASP M  1 19  ? 61.960  4.732    71.842  1.00 88.97  ? 19  ASP M CG  1 
ATOM   8483  O  OD1 . ASP M  1 19  ? 61.157  4.012    72.471  1.00 96.83  ? 19  ASP M OD1 1 
ATOM   8484  O  OD2 . ASP M  1 19  ? 62.759  4.261    70.991  1.00 82.03  ? 19  ASP M OD2 1 
ATOM   8485  N  N   . ILE M  1 20  ? 60.986  9.159    73.130  1.00 45.71  ? 20  ILE M N   1 
ATOM   8486  C  CA  . ILE M  1 20  ? 61.233  10.409   73.836  1.00 50.45  ? 20  ILE M CA  1 
ATOM   8487  C  C   . ILE M  1 20  ? 59.948  11.107   74.288  1.00 57.68  ? 20  ILE M C   1 
ATOM   8488  O  O   . ILE M  1 20  ? 59.965  12.296   74.645  1.00 68.92  ? 20  ILE M O   1 
ATOM   8489  C  CB  . ILE M  1 20  ? 62.099  11.385   73.003  1.00 52.90  ? 20  ILE M CB  1 
ATOM   8490  C  CG1 . ILE M  1 20  ? 61.433  11.720   71.672  1.00 55.91  ? 20  ILE M CG1 1 
ATOM   8491  C  CG2 . ILE M  1 20  ? 63.485  10.808   72.772  1.00 49.97  ? 20  ILE M CG2 1 
ATOM   8492  C  CD1 . ILE M  1 20  ? 62.200  12.744   70.876  1.00 57.67  ? 20  ILE M CD1 1 
ATOM   8493  N  N   . GLY M  1 21  ? 58.840  10.370   74.272  1.00 53.99  ? 21  GLY M N   1 
ATOM   8494  C  CA  . GLY M  1 21  ? 57.571  10.870   74.791  1.00 81.56  ? 21  GLY M CA  1 
ATOM   8495  C  C   . GLY M  1 21  ? 56.909  12.011   74.033  1.00 70.90  ? 21  GLY M C   1 
ATOM   8496  O  O   . GLY M  1 21  ? 56.150  12.801   74.593  1.00 50.81  ? 21  GLY M O   1 
ATOM   8497  N  N   . TRP M  1 22  ? 57.195  12.092   72.745  1.00 61.64  ? 22  TRP M N   1 
ATOM   8498  C  CA  . TRP M  1 22  ? 56.580  13.096   71.913  1.00 52.01  ? 22  TRP M CA  1 
ATOM   8499  C  C   . TRP M  1 22  ? 55.358  12.515   71.225  1.00 64.24  ? 22  TRP M C   1 
ATOM   8500  O  O   . TRP M  1 22  ? 54.654  13.224   70.511  1.00 61.74  ? 22  TRP M O   1 
ATOM   8501  C  CB  . TRP M  1 22  ? 57.600  13.622   70.912  1.00 60.30  ? 22  TRP M CB  1 
ATOM   8502  C  CG  . TRP M  1 22  ? 58.573  14.554   71.544  1.00 62.73  ? 22  TRP M CG  1 
ATOM   8503  C  CD1 . TRP M  1 22  ? 58.740  14.774   72.874  1.00 82.66  ? 22  TRP M CD1 1 
ATOM   8504  C  CD2 . TRP M  1 22  ? 59.496  15.409   70.879  1.00 47.30  ? 22  TRP M CD2 1 
ATOM   8505  N  NE1 . TRP M  1 22  ? 59.713  15.715   73.084  1.00 74.93  ? 22  TRP M NE1 1 
ATOM   8506  C  CE2 . TRP M  1 22  ? 60.191  16.127   71.870  1.00 54.79  ? 22  TRP M CE2 1 
ATOM   8507  C  CE3 . TRP M  1 22  ? 59.798  15.649   69.538  1.00 52.01  ? 22  TRP M CE3 1 
ATOM   8508  C  CZ2 . TRP M  1 22  ? 61.166  17.073   71.567  1.00 60.41  ? 22  TRP M CZ2 1 
ATOM   8509  C  CZ3 . TRP M  1 22  ? 60.777  16.584   69.235  1.00 49.83  ? 22  TRP M CZ3 1 
ATOM   8510  C  CH2 . TRP M  1 22  ? 61.446  17.288   70.247  1.00 49.76  ? 22  TRP M CH2 1 
ATOM   8511  N  N   . ASP M  1 23  ? 55.097  11.230   71.464  1.00 74.95  ? 23  ASP M N   1 
ATOM   8512  C  CA  . ASP M  1 23  ? 53.941  10.551   70.886  1.00 71.65  ? 23  ASP M CA  1 
ATOM   8513  C  C   . ASP M  1 23  ? 52.659  11.253   71.320  1.00 72.49  ? 23  ASP M C   1 
ATOM   8514  O  O   . ASP M  1 23  ? 51.592  11.052   70.743  1.00 88.30  ? 23  ASP M O   1 
ATOM   8515  C  CB  . ASP M  1 23  ? 53.923  9.078    71.299  1.00 76.39  ? 23  ASP M CB  1 
ATOM   8516  C  CG  . ASP M  1 23  ? 53.998  8.893    72.804  1.00 91.60  ? 23  ASP M CG  1 
ATOM   8517  O  OD1 . ASP M  1 23  ? 54.637  9.726    73.480  1.00 91.45  ? 23  ASP M OD1 1 
ATOM   8518  O  OD2 . ASP M  1 23  ? 53.415  7.916    73.316  1.00 100.83 ? 23  ASP M OD2 1 
ATOM   8519  N  N   . SER M  1 24  ? 52.786  12.094   72.338  1.00 65.24  ? 24  SER M N   1 
ATOM   8520  C  CA  . SER M  1 24  ? 51.659  12.821   72.898  1.00 61.40  ? 24  SER M CA  1 
ATOM   8521  C  C   . SER M  1 24  ? 51.075  13.832   71.914  1.00 60.24  ? 24  SER M C   1 
ATOM   8522  O  O   . SER M  1 24  ? 49.898  14.176   71.992  1.00 73.70  ? 24  SER M O   1 
ATOM   8523  C  CB  . SER M  1 24  ? 52.099  13.545   74.173  1.00 52.54  ? 24  SER M CB  1 
ATOM   8524  O  OG  . SER M  1 24  ? 52.876  14.682   73.850  1.00 63.73  ? 24  SER M OG  1 
ATOM   8525  N  N   . TRP M  1 25  ? 51.897  14.309   70.990  1.00 63.08  ? 25  TRP M N   1 
ATOM   8526  C  CA  . TRP M  1 25  ? 51.480  15.394   70.106  1.00 69.37  ? 25  TRP M CA  1 
ATOM   8527  C  C   . TRP M  1 25  ? 51.934  15.233   68.639  1.00 68.54  ? 25  TRP M C   1 
ATOM   8528  O  O   . TRP M  1 25  ? 51.414  15.906   67.748  1.00 72.45  ? 25  TRP M O   1 
ATOM   8529  C  CB  . TRP M  1 25  ? 51.919  16.747   70.682  1.00 61.28  ? 25  TRP M CB  1 
ATOM   8530  C  CG  . TRP M  1 25  ? 53.406  16.883   70.803  1.00 59.76  ? 25  TRP M CG  1 
ATOM   8531  C  CD1 . TRP M  1 25  ? 54.212  16.317   71.754  1.00 74.16  ? 25  TRP M CD1 1 
ATOM   8532  C  CD2 . TRP M  1 25  ? 54.269  17.622   69.932  1.00 51.01  ? 25  TRP M CD2 1 
ATOM   8533  N  NE1 . TRP M  1 25  ? 55.524  16.655   71.525  1.00 78.83  ? 25  TRP M NE1 1 
ATOM   8534  C  CE2 . TRP M  1 25  ? 55.588  17.455   70.413  1.00 71.13  ? 25  TRP M CE2 1 
ATOM   8535  C  CE3 . TRP M  1 25  ? 54.058  18.398   68.784  1.00 34.98  ? 25  TRP M CE3 1 
ATOM   8536  C  CZ2 . TRP M  1 25  ? 56.686  18.046   69.793  1.00 65.99  ? 25  TRP M CZ2 1 
ATOM   8537  C  CZ3 . TRP M  1 25  ? 55.136  18.977   68.173  1.00 40.64  ? 25  TRP M CZ3 1 
ATOM   8538  C  CH2 . TRP M  1 25  ? 56.442  18.804   68.681  1.00 60.97  ? 25  TRP M CH2 1 
ATOM   8539  N  N   . ILE M  1 26  ? 52.894  14.351   68.388  1.00 41.15  ? 26  ILE M N   1 
ATOM   8540  C  CA  . ILE M  1 26  ? 53.231  14.024   67.022  1.00 39.50  ? 26  ILE M CA  1 
ATOM   8541  C  C   . ILE M  1 26  ? 52.348  12.874   66.597  1.00 56.73  ? 26  ILE M C   1 
ATOM   8542  O  O   . ILE M  1 26  ? 52.453  11.773   67.135  1.00 75.32  ? 26  ILE M O   1 
ATOM   8543  C  CB  . ILE M  1 26  ? 54.698  13.594   66.848  1.00 62.98  ? 26  ILE M CB  1 
ATOM   8544  C  CG1 . ILE M  1 26  ? 55.640  14.624   67.464  1.00 40.51  ? 26  ILE M CG1 1 
ATOM   8545  C  CG2 . ILE M  1 26  ? 55.024  13.365   65.368  1.00 67.77  ? 26  ILE M CG2 1 
ATOM   8546  C  CD1 . ILE M  1 26  ? 55.385  15.975   67.008  1.00 39.34  ? 26  ILE M CD1 1 
ATOM   8547  N  N   . ILE M  1 27  ? 51.475  13.135   65.633  1.00 47.58  ? 27  ILE M N   1 
ATOM   8548  C  CA  . ILE M  1 27  ? 50.580  12.120   65.119  1.00 48.80  ? 27  ILE M CA  1 
ATOM   8549  C  C   . ILE M  1 27  ? 51.327  11.287   64.094  1.00 58.04  ? 27  ILE M C   1 
ATOM   8550  O  O   . ILE M  1 27  ? 51.225  10.047   64.066  1.00 57.59  ? 27  ILE M O   1 
ATOM   8551  C  CB  . ILE M  1 27  ? 49.356  12.761   64.469  1.00 54.44  ? 27  ILE M CB  1 
ATOM   8552  C  CG1 . ILE M  1 27  ? 48.680  13.712   65.452  1.00 68.48  ? 27  ILE M CG1 1 
ATOM   8553  C  CG2 . ILE M  1 27  ? 48.365  11.707   64.026  1.00 40.33  ? 27  ILE M CG2 1 
ATOM   8554  C  CD1 . ILE M  1 27  ? 47.572  14.531   64.842  1.00 67.60  ? 27  ILE M CD1 1 
ATOM   8555  N  N   . ALA M  1 28  ? 52.081  11.983   63.250  1.00 56.47  ? 28  ALA M N   1 
ATOM   8556  C  CA  . ALA M  1 28  ? 52.898  11.337   62.232  1.00 48.88  ? 28  ALA M CA  1 
ATOM   8557  C  C   . ALA M  1 28  ? 54.165  12.135   61.902  1.00 54.97  ? 28  ALA M C   1 
ATOM   8558  O  O   . ALA M  1 28  ? 54.154  13.364   61.908  1.00 50.79  ? 28  ALA M O   1 
ATOM   8559  C  CB  . ALA M  1 28  ? 52.082  11.098   60.987  1.00 39.94  ? 28  ALA M CB  1 
ATOM   8560  N  N   . PRO M  1 29  ? 55.267  11.427   61.612  1.00 48.32  ? 29  PRO M N   1 
ATOM   8561  C  CA  . PRO M  1 29  ? 55.350  9.968    61.549  1.00 54.10  ? 29  PRO M CA  1 
ATOM   8562  C  C   . PRO M  1 29  ? 55.477  9.409    62.949  1.00 51.80  ? 29  PRO M C   1 
ATOM   8563  O  O   . PRO M  1 29  ? 55.452  10.186   63.890  1.00 41.31  ? 29  PRO M O   1 
ATOM   8564  C  CB  . PRO M  1 29  ? 56.639  9.747    60.785  1.00 71.06  ? 29  PRO M CB  1 
ATOM   8565  C  CG  . PRO M  1 29  ? 57.473  10.917   61.195  1.00 43.21  ? 29  PRO M CG  1 
ATOM   8566  C  CD  . PRO M  1 29  ? 56.555  12.058   61.293  1.00 35.96  ? 29  PRO M CD  1 
ATOM   8567  N  N   . LYS M  1 30  ? 55.601  8.094    63.088  1.00 51.15  ? 30  LYS M N   1 
ATOM   8568  C  CA  . LYS M  1 30  ? 55.750  7.523    64.410  1.00 49.02  ? 30  LYS M CA  1 
ATOM   8569  C  C   . LYS M  1 30  ? 57.230  7.439    64.711  1.00 60.44  ? 30  LYS M C   1 
ATOM   8570  O  O   . LYS M  1 30  ? 57.646  7.576    65.866  1.00 66.28  ? 30  LYS M O   1 
ATOM   8571  C  CB  . LYS M  1 30  ? 55.083  6.155    64.515  1.00 46.61  ? 30  LYS M CB  1 
ATOM   8572  C  CG  . LYS M  1 30  ? 53.537  6.137    64.402  1.00 56.62  ? 30  LYS M CG  1 
ATOM   8573  C  CD  . LYS M  1 30  ? 52.838  6.952    65.482  1.00 77.78  ? 30  LYS M CD  1 
ATOM   8574  C  CE  . LYS M  1 30  ? 51.324  7.024    65.240  1.00 86.94  ? 30  LYS M CE  1 
ATOM   8575  N  NZ  . LYS M  1 30  ? 50.591  7.991    66.129  1.00 81.43  ? 30  LYS M NZ  1 
ATOM   8576  N  N   . GLU M  1 31  ? 58.021  7.220    63.663  1.00 46.38  ? 31  GLU M N   1 
ATOM   8577  C  CA  . GLU M  1 31  ? 59.469  7.360    63.762  1.00 48.94  ? 31  GLU M CA  1 
ATOM   8578  C  C   . GLU M  1 31  ? 60.025  7.945    62.471  1.00 51.69  ? 31  GLU M C   1 
ATOM   8579  O  O   . GLU M  1 31  ? 59.382  7.870    61.425  1.00 47.91  ? 31  GLU M O   1 
ATOM   8580  C  CB  . GLU M  1 31  ? 60.157  6.036    64.134  1.00 55.04  ? 31  GLU M CB  1 
ATOM   8581  C  CG  . GLU M  1 31  ? 60.350  5.033    62.998  1.00 76.88  ? 31  GLU M CG  1 
ATOM   8582  C  CD  . GLU M  1 31  ? 61.035  3.749    63.460  1.00 110.36 ? 31  GLU M CD  1 
ATOM   8583  O  OE1 . GLU M  1 31  ? 61.695  3.097    62.624  1.00 127.55 ? 31  GLU M OE1 1 
ATOM   8584  O  OE2 . GLU M  1 31  ? 60.915  3.387    64.653  1.00 102.93 ? 31  GLU M OE2 1 
ATOM   8585  N  N   . TYR M  1 32  ? 61.214  8.544    62.553  1.00 50.06  ? 32  TYR M N   1 
ATOM   8586  C  CA  . TYR M  1 32  ? 61.819  9.200    61.402  1.00 24.50  ? 32  TYR M CA  1 
ATOM   8587  C  C   . TYR M  1 32  ? 63.313  9.124    61.452  1.00 49.49  ? 32  TYR M C   1 
ATOM   8588  O  O   . TYR M  1 32  ? 63.904  8.892    62.512  1.00 61.49  ? 32  TYR M O   1 
ATOM   8589  C  CB  . TYR M  1 32  ? 61.436  10.653   61.372  1.00 32.40  ? 32  TYR M CB  1 
ATOM   8590  C  CG  . TYR M  1 32  ? 62.292  11.553   62.224  1.00 38.72  ? 32  TYR M CG  1 
ATOM   8591  C  CD1 . TYR M  1 32  ? 62.083  11.664   63.593  1.00 46.99  ? 32  TYR M CD1 1 
ATOM   8592  C  CD2 . TYR M  1 32  ? 63.289  12.328   61.651  1.00 42.37  ? 32  TYR M CD2 1 
ATOM   8593  C  CE1 . TYR M  1 32  ? 62.861  12.509   64.367  1.00 67.07  ? 32  TYR M CE1 1 
ATOM   8594  C  CE2 . TYR M  1 32  ? 64.067  13.175   62.418  1.00 42.67  ? 32  TYR M CE2 1 
ATOM   8595  C  CZ  . TYR M  1 32  ? 63.849  13.257   63.768  1.00 57.76  ? 32  TYR M CZ  1 
ATOM   8596  O  OH  . TYR M  1 32  ? 64.623  14.087   64.519  1.00 41.09  ? 32  TYR M OH  1 
ATOM   8597  N  N   . GLU M  1 33  ? 63.925  9.348    60.298  1.00 43.77  ? 33  GLU M N   1 
ATOM   8598  C  CA  . GLU M  1 33  ? 65.368  9.292    60.199  1.00 40.88  ? 33  GLU M CA  1 
ATOM   8599  C  C   . GLU M  1 33  ? 65.984  10.630   60.530  1.00 53.94  ? 33  GLU M C   1 
ATOM   8600  O  O   . GLU M  1 33  ? 66.028  11.523   59.684  1.00 58.34  ? 33  GLU M O   1 
ATOM   8601  C  CB  . GLU M  1 33  ? 65.792  8.864    58.800  1.00 47.61  ? 33  GLU M CB  1 
ATOM   8602  C  CG  . GLU M  1 33  ? 67.294  8.830    58.599  1.00 51.09  ? 33  GLU M CG  1 
ATOM   8603  C  CD  . GLU M  1 33  ? 67.951  7.681    59.304  1.00 67.52  ? 33  GLU M CD  1 
ATOM   8604  O  OE1 . GLU M  1 33  ? 68.121  6.628    58.667  1.00 72.76  ? 33  GLU M OE1 1 
ATOM   8605  O  OE2 . GLU M  1 33  ? 68.306  7.827    60.490  1.00 80.96  ? 33  GLU M OE2 1 
ATOM   8606  N  N   . ALA M  1 34  ? 66.441  10.782   61.767  1.00 65.43  ? 34  ALA M N   1 
ATOM   8607  C  CA  . ALA M  1 34  ? 67.374  11.852   62.047  1.00 62.22  ? 34  ALA M CA  1 
ATOM   8608  C  C   . ALA M  1 34  ? 68.678  11.140   61.844  1.00 74.82  ? 34  ALA M C   1 
ATOM   8609  O  O   . ALA M  1 34  ? 68.754  9.908    61.930  1.00 120.91 ? 34  ALA M O   1 
ATOM   8610  C  CB  . ALA M  1 34  ? 67.246  12.330   63.457  1.00 55.49  ? 34  ALA M CB  1 
ATOM   8611  N  N   . TYR M  1 35  ? 69.729  11.857   61.554  1.00 44.18  ? 35  TYR M N   1 
ATOM   8612  C  CA  . TYR M  1 35  ? 70.953  11.102   61.477  1.00 66.37  ? 35  TYR M CA  1 
ATOM   8613  C  C   . TYR M  1 35  ? 71.767  11.294   62.735  1.00 71.50  ? 35  TYR M C   1 
ATOM   8614  O  O   . TYR M  1 35  ? 71.340  12.004   63.640  1.00 82.73  ? 35  TYR M O   1 
ATOM   8615  C  CB  . TYR M  1 35  ? 71.721  11.482   60.240  1.00 85.91  ? 35  TYR M CB  1 
ATOM   8616  C  CG  . TYR M  1 35  ? 71.053  10.986   59.002  1.00 73.70  ? 35  TYR M CG  1 
ATOM   8617  C  CD1 . TYR M  1 35  ? 70.253  11.814   58.242  1.00 68.71  ? 35  TYR M CD1 1 
ATOM   8618  C  CD2 . TYR M  1 35  ? 71.221  9.684    58.596  1.00 63.22  ? 35  TYR M CD2 1 
ATOM   8619  C  CE1 . TYR M  1 35  ? 69.654  11.354   57.102  1.00 66.33  ? 35  TYR M CE1 1 
ATOM   8620  C  CE2 . TYR M  1 35  ? 70.627  9.216    57.459  1.00 52.26  ? 35  TYR M CE2 1 
ATOM   8621  C  CZ  . TYR M  1 35  ? 69.842  10.045   56.713  1.00 54.71  ? 35  TYR M CZ  1 
ATOM   8622  O  OH  . TYR M  1 35  ? 69.245  9.552    55.570  1.00 60.20  ? 35  TYR M OH  1 
ATOM   8623  N  N   . GLU M  1 36  ? 72.913  10.630   62.804  1.00 55.99  ? 36  GLU M N   1 
ATOM   8624  C  CA  . GLU M  1 36  ? 73.877  10.880   63.864  1.00 73.27  ? 36  GLU M CA  1 
ATOM   8625  C  C   . GLU M  1 36  ? 75.191  11.296   63.217  1.00 66.02  ? 36  GLU M C   1 
ATOM   8626  O  O   . GLU M  1 36  ? 75.485  10.887   62.098  1.00 50.88  ? 36  GLU M O   1 
ATOM   8627  C  CB  . GLU M  1 36  ? 74.068  9.622    64.712  1.00 73.32  ? 36  GLU M CB  1 
ATOM   8628  C  CG  . GLU M  1 36  ? 74.801  9.870    66.029  1.00 96.59  ? 36  GLU M CG  1 
ATOM   8629  C  CD  . GLU M  1 36  ? 74.769  8.657    66.950  1.00 117.49 ? 36  GLU M CD  1 
ATOM   8630  O  OE1 . GLU M  1 36  ? 74.235  7.612    66.519  1.00 119.61 ? 36  GLU M OE1 1 
ATOM   8631  O  OE2 . GLU M  1 36  ? 75.272  8.746    68.097  1.00 111.89 ? 36  GLU M OE2 1 
ATOM   8632  N  N   . CYS M  1 37  ? 75.980  12.123   63.886  1.00 55.65  ? 37  CYS M N   1 
ATOM   8633  C  CA  . CYS M  1 37  ? 77.321  12.369   63.370  1.00 52.07  ? 37  CYS M CA  1 
ATOM   8634  C  C   . CYS M  1 37  ? 78.337  11.637   64.234  1.00 53.37  ? 37  CYS M C   1 
ATOM   8635  O  O   . CYS M  1 37  ? 78.654  12.066   65.340  1.00 68.44  ? 37  CYS M O   1 
ATOM   8636  C  CB  . CYS M  1 37  ? 77.616  13.861   63.269  1.00 49.34  ? 37  CYS M CB  1 
ATOM   8637  S  SG  . CYS M  1 37  ? 76.932  14.609   61.797  1.00 75.89  ? 37  CYS M SG  1 
ATOM   8638  N  N   . LYS M  1 38  ? 78.818  10.507   63.731  1.00 54.94  ? 38  LYS M N   1 
ATOM   8639  C  CA  . LYS M  1 38  ? 79.686  9.630    64.528  1.00 55.80  ? 38  LYS M CA  1 
ATOM   8640  C  C   . LYS M  1 38  ? 81.117  9.632    63.992  1.00 62.43  ? 38  LYS M C   1 
ATOM   8641  O  O   . LYS M  1 38  ? 81.344  9.807    62.791  1.00 68.39  ? 38  LYS M O   1 
ATOM   8642  C  CB  . LYS M  1 38  ? 79.167  8.181    64.506  1.00 51.13  ? 38  LYS M CB  1 
ATOM   8643  C  CG  . LYS M  1 38  ? 78.342  7.723    65.722  1.00 66.33  ? 38  LYS M CG  1 
ATOM   8644  C  CD  . LYS M  1 38  ? 77.866  6.261    65.568  1.00 74.13  ? 38  LYS M CD  1 
ATOM   8645  C  CE  . LYS M  1 38  ? 76.847  5.884    66.644  1.00 90.80  ? 38  LYS M CE  1 
ATOM   8646  N  NZ  . LYS M  1 38  ? 75.727  5.032    66.118  1.00 91.86  ? 38  LYS M NZ  1 
ATOM   8647  N  N   . GLY M  1 39  ? 82.086  9.420    64.871  1.00 45.58  ? 39  GLY M N   1 
ATOM   8648  C  CA  . GLY M  1 39  ? 83.440  9.272    64.396  1.00 53.86  ? 39  GLY M CA  1 
ATOM   8649  C  C   . GLY M  1 39  ? 84.420  10.347   64.802  1.00 63.46  ? 39  GLY M C   1 
ATOM   8650  O  O   . GLY M  1 39  ? 84.037  11.389   65.347  1.00 79.39  ? 39  GLY M O   1 
ATOM   8651  N  N   . GLY M  1 40  ? 85.694  10.081   64.524  1.00 49.68  ? 40  GLY M N   1 
ATOM   8652  C  CA  . GLY M  1 40  ? 86.763  10.961   64.940  1.00 59.02  ? 40  GLY M CA  1 
ATOM   8653  C  C   . GLY M  1 40  ? 87.289  11.835   63.819  1.00 67.25  ? 40  GLY M C   1 
ATOM   8654  O  O   . GLY M  1 40  ? 87.178  11.494   62.627  1.00 65.20  ? 40  GLY M O   1 
ATOM   8655  N  N   . CYS M  1 41  ? 87.858  12.974   64.209  1.00 61.38  ? 41  CYS M N   1 
ATOM   8656  C  CA  . CYS M  1 41  ? 88.464  13.900   63.269  1.00 52.10  ? 41  CYS M CA  1 
ATOM   8657  C  C   . CYS M  1 41  ? 89.964  13.703   63.329  1.00 73.71  ? 41  CYS M C   1 
ATOM   8658  O  O   . CYS M  1 41  ? 90.646  14.307   64.154  1.00 84.76  ? 41  CYS M O   1 
ATOM   8659  C  CB  . CYS M  1 41  ? 88.090  15.323   63.629  1.00 62.14  ? 41  CYS M CB  1 
ATOM   8660  S  SG  . CYS M  1 41  ? 86.319  15.594   63.635  1.00 88.33  ? 41  CYS M SG  1 
ATOM   8661  N  N   . PHE M  1 42  ? 90.459  12.832   62.453  1.00 77.83  ? 42  PHE M N   1 
ATOM   8662  C  CA  . PHE M  1 42  ? 91.834  12.352   62.509  1.00 75.14  ? 42  PHE M CA  1 
ATOM   8663  C  C   . PHE M  1 42  ? 92.668  12.981   61.419  1.00 81.51  ? 42  PHE M C   1 
ATOM   8664  O  O   . PHE M  1 42  ? 92.263  13.035   60.254  1.00 104.87 ? 42  PHE M O   1 
ATOM   8665  C  CB  . PHE M  1 42  ? 91.874  10.833   62.359  1.00 81.02  ? 42  PHE M CB  1 
ATOM   8666  C  CG  . PHE M  1 42  ? 91.205  10.095   63.482  1.00 78.02  ? 42  PHE M CG  1 
ATOM   8667  C  CD1 . PHE M  1 42  ? 90.134  9.256    63.243  1.00 79.60  ? 42  PHE M CD1 1 
ATOM   8668  C  CD2 . PHE M  1 42  ? 91.644  10.248   64.776  1.00 92.92  ? 42  PHE M CD2 1 
ATOM   8669  C  CE1 . PHE M  1 42  ? 89.522  8.587    64.276  1.00 97.18  ? 42  PHE M CE1 1 
ATOM   8670  C  CE2 . PHE M  1 42  ? 91.039  9.577    65.809  1.00 95.09  ? 42  PHE M CE2 1 
ATOM   8671  C  CZ  . PHE M  1 42  ? 89.980  8.749    65.560  1.00 97.36  ? 42  PHE M CZ  1 
ATOM   8672  N  N   . PHE M  1 43  ? 93.844  13.452   61.806  1.00 72.50  ? 43  PHE M N   1 
ATOM   8673  C  CA  . PHE M  1 43  ? 94.711  14.152   60.874  1.00 77.04  ? 43  PHE M CA  1 
ATOM   8674  C  C   . PHE M  1 43  ? 95.333  13.187   59.870  1.00 87.05  ? 43  PHE M C   1 
ATOM   8675  O  O   . PHE M  1 43  ? 95.707  12.070   60.236  1.00 87.37  ? 43  PHE M O   1 
ATOM   8676  C  CB  . PHE M  1 43  ? 95.802  14.905   61.625  1.00 59.43  ? 43  PHE M CB  1 
ATOM   8677  C  CG  . PHE M  1 43  ? 96.340  16.086   60.877  1.00 69.64  ? 43  PHE M CG  1 
ATOM   8678  C  CD1 . PHE M  1 43  ? 95.675  17.299   60.895  1.00 83.15  ? 43  PHE M CD1 1 
ATOM   8679  C  CD2 . PHE M  1 43  ? 97.504  15.989   60.155  1.00 73.03  ? 43  PHE M CD2 1 
ATOM   8680  C  CE1 . PHE M  1 43  ? 96.173  18.386   60.209  1.00 87.01  ? 43  PHE M CE1 1 
ATOM   8681  C  CE2 . PHE M  1 43  ? 98.005  17.078   59.468  1.00 67.26  ? 43  PHE M CE2 1 
ATOM   8682  C  CZ  . PHE M  1 43  ? 97.347  18.269   59.496  1.00 76.54  ? 43  PHE M CZ  1 
ATOM   8683  N  N   . PRO M  1 44  ? 95.427  13.608   58.595  1.00 92.77  ? 44  PRO M N   1 
ATOM   8684  C  CA  . PRO M  1 44  ? 94.938  14.901   58.109  1.00 96.74  ? 44  PRO M CA  1 
ATOM   8685  C  C   . PRO M  1 44  ? 93.422  14.887   57.860  1.00 94.48  ? 44  PRO M C   1 
ATOM   8686  O  O   . PRO M  1 44  ? 92.830  13.833   57.613  1.00 96.63  ? 44  PRO M O   1 
ATOM   8687  C  CB  . PRO M  1 44  ? 95.687  15.061   56.792  1.00 90.98  ? 44  PRO M CB  1 
ATOM   8688  C  CG  . PRO M  1 44  ? 95.796  13.668   56.287  1.00 88.07  ? 44  PRO M CG  1 
ATOM   8689  C  CD  . PRO M  1 44  ? 96.000  12.804   57.502  1.00 88.65  ? 44  PRO M CD  1 
ATOM   8690  N  N   . LEU M  1 45  ? 92.805  16.059   57.926  1.00 76.19  ? 45  LEU M N   1 
ATOM   8691  C  CA  . LEU M  1 45  ? 91.359  16.158   57.835  1.00 60.52  ? 45  LEU M CA  1 
ATOM   8692  C  C   . LEU M  1 45  ? 90.884  16.163   56.382  1.00 77.63  ? 45  LEU M C   1 
ATOM   8693  O  O   . LEU M  1 45  ? 91.177  17.079   55.614  1.00 86.46  ? 45  LEU M O   1 
ATOM   8694  C  CB  . LEU M  1 45  ? 90.874  17.412   58.556  1.00 45.73  ? 45  LEU M CB  1 
ATOM   8695  C  CG  . LEU M  1 45  ? 91.252  17.490   60.027  1.00 59.01  ? 45  LEU M CG  1 
ATOM   8696  C  CD1 . LEU M  1 45  ? 90.733  18.766   60.685  1.00 68.82  ? 45  LEU M CD1 1 
ATOM   8697  C  CD2 . LEU M  1 45  ? 90.739  16.258   60.731  1.00 49.58  ? 45  LEU M CD2 1 
ATOM   8698  N  N   . ALA M  1 46  ? 90.136  15.135   56.017  1.00 75.92  ? 46  ALA M N   1 
ATOM   8699  C  CA  . ALA M  1 46  ? 89.614  14.998   54.670  1.00 75.15  ? 46  ALA M CA  1 
ATOM   8700  C  C   . ALA M  1 46  ? 88.815  16.220   54.249  1.00 79.40  ? 46  ALA M C   1 
ATOM   8701  O  O   . ALA M  1 46  ? 88.126  16.818   55.073  1.00 79.10  ? 46  ALA M O   1 
ATOM   8702  C  CB  . ALA M  1 46  ? 88.749  13.768   54.596  1.00 93.79  ? 46  ALA M CB  1 
ATOM   8703  N  N   . ASP M  1 47  ? 88.887  16.577   52.965  1.00 84.79  ? 47  ASP M N   1 
ATOM   8704  C  CA  . ASP M  1 47  ? 88.172  17.748   52.459  1.00 74.82  ? 47  ASP M CA  1 
ATOM   8705  C  C   . ASP M  1 47  ? 86.685  17.620   52.748  1.00 72.46  ? 47  ASP M C   1 
ATOM   8706  O  O   . ASP M  1 47  ? 86.030  18.592   53.147  1.00 68.50  ? 47  ASP M O   1 
ATOM   8707  C  CB  . ASP M  1 47  ? 88.403  17.959   50.958  1.00 71.17  ? 47  ASP M CB  1 
ATOM   8708  C  CG  . ASP M  1 47  ? 89.868  18.075   50.604  1.00 111.48 ? 47  ASP M CG  1 
ATOM   8709  O  OD1 . ASP M  1 47  ? 90.469  17.044   50.225  1.00 130.50 ? 47  ASP M OD1 1 
ATOM   8710  O  OD2 . ASP M  1 47  ? 90.423  19.190   50.707  1.00 110.13 ? 47  ASP M OD2 1 
ATOM   8711  N  N   . ASP M  1 48  ? 86.153  16.418   52.567  1.00 77.50  ? 48  ASP M N   1 
ATOM   8712  C  CA  . ASP M  1 48  ? 84.711  16.212   52.714  1.00 72.03  ? 48  ASP M CA  1 
ATOM   8713  C  C   . ASP M  1 48  ? 84.242  16.365   54.151  1.00 58.80  ? 48  ASP M C   1 
ATOM   8714  O  O   . ASP M  1 48  ? 83.135  15.964   54.490  1.00 69.45  ? 48  ASP M O   1 
ATOM   8715  C  CB  . ASP M  1 48  ? 84.261  14.860   52.140  1.00 87.39  ? 48  ASP M CB  1 
ATOM   8716  C  CG  . ASP M  1 48  ? 85.020  13.687   52.729  1.00 110.63 ? 48  ASP M CG  1 
ATOM   8717  O  OD1 . ASP M  1 48  ? 86.246  13.810   52.917  1.00 135.74 ? 48  ASP M OD1 1 
ATOM   8718  O  OD2 . ASP M  1 48  ? 84.398  12.636   52.999  1.00 100.55 ? 48  ASP M OD2 1 
ATOM   8719  N  N   . VAL M  1 49  ? 85.083  16.963   54.989  1.00 66.46  ? 49  VAL M N   1 
ATOM   8720  C  CA  . VAL M  1 49  ? 84.718  17.226   56.371  1.00 63.27  ? 49  VAL M CA  1 
ATOM   8721  C  C   . VAL M  1 49  ? 84.728  18.731   56.635  1.00 79.83  ? 49  VAL M C   1 
ATOM   8722  O  O   . VAL M  1 49  ? 84.504  19.189   57.758  1.00 86.26  ? 49  VAL M O   1 
ATOM   8723  C  CB  . VAL M  1 49  ? 85.622  16.448   57.333  1.00 53.51  ? 49  VAL M CB  1 
ATOM   8724  C  CG1 . VAL M  1 49  ? 85.590  17.048   58.698  1.00 69.89  ? 49  VAL M CG1 1 
ATOM   8725  C  CG2 . VAL M  1 49  ? 85.173  15.001   57.391  1.00 29.64  ? 49  VAL M CG2 1 
ATOM   8726  N  N   . THR M  1 50  ? 84.963  19.497   55.573  1.00 62.68  ? 50  THR M N   1 
ATOM   8727  C  CA  . THR M  1 50  ? 84.765  20.935   55.616  1.00 50.50  ? 50  THR M CA  1 
ATOM   8728  C  C   . THR M  1 50  ? 85.528  21.576   56.764  1.00 60.27  ? 50  THR M C   1 
ATOM   8729  O  O   . THR M  1 50  ? 85.054  22.547   57.354  1.00 72.13  ? 50  THR M O   1 
ATOM   8730  C  CB  . THR M  1 50  ? 83.286  21.290   55.852  1.00 69.74  ? 50  THR M CB  1 
ATOM   8731  O  OG1 . THR M  1 50  ? 82.435  20.275   55.306  1.00 75.66  ? 50  THR M OG1 1 
ATOM   8732  C  CG2 . THR M  1 50  ? 82.945  22.645   55.238  1.00 85.59  ? 50  THR M CG2 1 
ATOM   8733  N  N   . PRO M  1 51  ? 86.719  21.052   57.079  1.00 51.36  ? 51  PRO M N   1 
ATOM   8734  C  CA  . PRO M  1 51  ? 87.432  21.579   58.240  1.00 50.46  ? 51  PRO M CA  1 
ATOM   8735  C  C   . PRO M  1 51  ? 87.511  23.102   58.192  1.00 51.78  ? 51  PRO M C   1 
ATOM   8736  O  O   . PRO M  1 51  ? 87.763  23.662   57.114  1.00 40.85  ? 51  PRO M O   1 
ATOM   8737  C  CB  . PRO M  1 51  ? 88.839  20.975   58.091  1.00 35.95  ? 51  PRO M CB  1 
ATOM   8738  C  CG  . PRO M  1 51  ? 88.964  20.644   56.644  1.00 55.54  ? 51  PRO M CG  1 
ATOM   8739  C  CD  . PRO M  1 51  ? 87.587  20.214   56.238  1.00 59.05  ? 51  PRO M CD  1 
ATOM   8740  N  N   . THR M  1 52  ? 87.253  23.754   59.331  1.00 46.90  ? 52  THR M N   1 
ATOM   8741  C  CA  . THR M  1 52  ? 87.530  25.179   59.495  1.00 44.17  ? 52  THR M CA  1 
ATOM   8742  C  C   . THR M  1 52  ? 89.006  25.346   59.824  1.00 60.90  ? 52  THR M C   1 
ATOM   8743  O  O   . THR M  1 52  ? 89.680  24.393   60.237  1.00 62.37  ? 52  THR M O   1 
ATOM   8744  C  CB  . THR M  1 52  ? 86.744  25.779   60.651  1.00 40.66  ? 52  THR M CB  1 
ATOM   8745  O  OG1 . THR M  1 52  ? 87.254  25.278   61.891  1.00 71.86  ? 52  THR M OG1 1 
ATOM   8746  C  CG2 . THR M  1 52  ? 85.308  25.411   60.542  1.00 36.41  ? 52  THR M CG2 1 
ATOM   8747  N  N   . LYS M  1 53  ? 89.520  26.552   59.634  1.00 54.73  ? 53  LYS M N   1 
ATOM   8748  C  CA  . LYS M  1 53  ? 90.902  26.804   59.991  1.00 51.74  ? 53  LYS M CA  1 
ATOM   8749  C  C   . LYS M  1 53  ? 91.062  26.404   61.441  1.00 61.46  ? 53  LYS M C   1 
ATOM   8750  O  O   . LYS M  1 53  ? 91.993  25.667   61.809  1.00 71.04  ? 53  LYS M O   1 
ATOM   8751  C  CB  . LYS M  1 53  ? 91.251  28.277   59.839  1.00 41.90  ? 53  LYS M CB  1 
ATOM   8752  C  CG  . LYS M  1 53  ? 92.273  28.577   58.759  1.00 44.73  ? 53  LYS M CG  1 
ATOM   8753  C  CD  . LYS M  1 53  ? 91.805  28.109   57.389  1.00 48.79  ? 53  LYS M CD  1 
ATOM   8754  C  CE  . LYS M  1 53  ? 92.715  28.660   56.302  1.00 60.34  ? 53  LYS M CE  1 
ATOM   8755  N  NZ  . LYS M  1 53  ? 92.308  28.224   54.927  1.00 86.05  ? 53  LYS M NZ  1 
ATOM   8756  N  N   . HIS M  1 54  ? 90.131  26.869   62.266  1.00 41.29  ? 54  HIS M N   1 
ATOM   8757  C  CA  . HIS M  1 54  ? 90.251  26.637   63.683  1.00 44.66  ? 54  HIS M CA  1 
ATOM   8758  C  C   . HIS M  1 54  ? 90.417  25.157   63.974  1.00 59.96  ? 54  HIS M C   1 
ATOM   8759  O  O   . HIS M  1 54  ? 91.379  24.739   64.629  1.00 52.90  ? 54  HIS M O   1 
ATOM   8760  C  CB  . HIS M  1 54  ? 89.051  27.157   64.420  1.00 22.94  ? 54  HIS M CB  1 
ATOM   8761  C  CG  . HIS M  1 54  ? 89.179  27.033   65.903  1.00 49.00  ? 54  HIS M CG  1 
ATOM   8762  N  ND1 . HIS M  1 54  ? 88.966  25.841   66.564  1.00 34.13  ? 54  HIS M ND1 1 
ATOM   8763  C  CD2 . HIS M  1 54  ? 89.519  27.942   66.852  1.00 38.08  ? 54  HIS M CD2 1 
ATOM   8764  C  CE1 . HIS M  1 54  ? 89.158  26.027   67.859  1.00 62.64  ? 54  HIS M CE1 1 
ATOM   8765  N  NE2 . HIS M  1 54  ? 89.496  27.292   68.060  1.00 47.97  ? 54  HIS M NE2 1 
ATOM   8766  N  N   . ALA M  1 55  ? 89.469  24.370   63.478  1.00 53.87  ? 55  ALA M N   1 
ATOM   8767  C  CA  . ALA M  1 55  ? 89.537  22.920   63.575  1.00 45.60  ? 55  ALA M CA  1 
ATOM   8768  C  C   . ALA M  1 55  ? 90.946  22.389   63.238  1.00 56.34  ? 55  ALA M C   1 
ATOM   8769  O  O   . ALA M  1 55  ? 91.516  21.590   63.981  1.00 47.98  ? 55  ALA M O   1 
ATOM   8770  C  CB  . ALA M  1 55  ? 88.496  22.304   62.682  1.00 30.98  ? 55  ALA M CB  1 
ATOM   8771  N  N   . ILE M  1 56  ? 91.517  22.840   62.131  1.00 45.13  ? 56  ILE M N   1 
ATOM   8772  C  CA  . ILE M  1 56  ? 92.868  22.421   61.794  1.00 50.24  ? 56  ILE M CA  1 
ATOM   8773  C  C   . ILE M  1 56  ? 93.810  22.737   62.951  1.00 57.75  ? 56  ILE M C   1 
ATOM   8774  O  O   . ILE M  1 56  ? 94.473  21.846   63.505  1.00 58.18  ? 56  ILE M O   1 
ATOM   8775  C  CB  . ILE M  1 56  ? 93.393  23.131   60.529  1.00 40.62  ? 56  ILE M CB  1 
ATOM   8776  C  CG1 . ILE M  1 56  ? 92.489  22.866   59.324  1.00 36.13  ? 56  ILE M CG1 1 
ATOM   8777  C  CG2 . ILE M  1 56  ? 94.818  22.672   60.227  1.00 43.08  ? 56  ILE M CG2 1 
ATOM   8778  C  CD1 . ILE M  1 56  ? 92.864  21.588   58.577  1.00 67.54  ? 56  ILE M CD1 1 
ATOM   8779  N  N   . VAL M  1 57  ? 93.853  24.012   63.324  1.00 27.61  ? 57  VAL M N   1 
ATOM   8780  C  CA  . VAL M  1 57  ? 94.795  24.440   64.346  1.00 52.06  ? 57  VAL M CA  1 
ATOM   8781  C  C   . VAL M  1 57  ? 94.649  23.621   65.616  1.00 57.94  ? 57  VAL M C   1 
ATOM   8782  O  O   . VAL M  1 57  ? 95.617  23.013   66.092  1.00 58.21  ? 57  VAL M O   1 
ATOM   8783  C  CB  . VAL M  1 57  ? 94.622  25.918   64.687  1.00 48.16  ? 57  VAL M CB  1 
ATOM   8784  C  CG1 . VAL M  1 57  ? 95.434  26.277   65.943  1.00 27.79  ? 57  VAL M CG1 1 
ATOM   8785  C  CG2 . VAL M  1 57  ? 95.057  26.760   63.510  1.00 35.83  ? 57  VAL M CG2 1 
ATOM   8786  N  N   . GLN M  1 58  ? 93.437  23.615   66.160  1.00 42.77  ? 58  GLN M N   1 
ATOM   8787  C  CA  . GLN M  1 58  ? 93.153  22.825   67.341  1.00 54.23  ? 58  GLN M CA  1 
ATOM   8788  C  C   . GLN M  1 58  ? 93.678  21.403   67.142  1.00 63.28  ? 58  GLN M C   1 
ATOM   8789  O  O   . GLN M  1 58  ? 94.509  20.921   67.919  1.00 48.29  ? 58  GLN M O   1 
ATOM   8790  C  CB  . GLN M  1 58  ? 91.666  22.825   67.678  1.00 30.41  ? 58  GLN M CB  1 
ATOM   8791  C  CG  . GLN M  1 58  ? 91.323  22.039   68.934  1.00 26.42  ? 58  GLN M CG  1 
ATOM   8792  C  CD  . GLN M  1 58  ? 89.937  22.347   69.503  1.00 64.40  ? 58  GLN M CD  1 
ATOM   8793  O  OE1 . GLN M  1 58  ? 89.371  23.427   69.291  1.00 62.37  ? 58  GLN M OE1 1 
ATOM   8794  N  NE2 . GLN M  1 58  ? 89.385  21.387   70.235  1.00 83.67  ? 58  GLN M NE2 1 
ATOM   8795  N  N   . THR M  1 59  ? 93.230  20.740   66.088  1.00 26.87  ? 59  THR M N   1 
ATOM   8796  C  CA  . THR M  1 59  ? 93.735  19.401   65.819  1.00 35.54  ? 59  THR M CA  1 
ATOM   8797  C  C   . THR M  1 59  ? 95.263  19.288   66.000  1.00 51.24  ? 59  THR M C   1 
ATOM   8798  O  O   . THR M  1 59  ? 95.743  18.350   66.670  1.00 49.68  ? 59  THR M O   1 
ATOM   8799  C  CB  . THR M  1 59  ? 93.286  18.880   64.428  1.00 41.84  ? 59  THR M CB  1 
ATOM   8800  O  OG1 . THR M  1 59  ? 92.002  18.241   64.538  1.00 42.44  ? 59  THR M OG1 1 
ATOM   8801  C  CG2 . THR M  1 59  ? 94.268  17.870   63.901  1.00 28.05  ? 59  THR M CG2 1 
ATOM   8802  N  N   . LEU M  1 60  ? 96.021  20.233   65.431  1.00 38.20  ? 60  LEU M N   1 
ATOM   8803  C  CA  . LEU M  1 60  ? 97.491  20.206   65.555  1.00 45.63  ? 60  LEU M CA  1 
ATOM   8804  C  C   . LEU M  1 60  ? 97.921  20.324   67.015  1.00 49.51  ? 60  LEU M C   1 
ATOM   8805  O  O   . LEU M  1 60  ? 98.665  19.472   67.568  1.00 61.69  ? 60  LEU M O   1 
ATOM   8806  C  CB  . LEU M  1 60  ? 98.141  21.313   64.722  1.00 41.43  ? 60  LEU M CB  1 
ATOM   8807  C  CG  . LEU M  1 60  ? 98.032  21.165   63.202  1.00 49.53  ? 60  LEU M CG  1 
ATOM   8808  C  CD1 . LEU M  1 60  ? 98.974  22.130   62.543  1.00 46.86  ? 60  LEU M CD1 1 
ATOM   8809  C  CD2 . LEU M  1 60  ? 98.346  19.744   62.754  1.00 46.70  ? 60  LEU M CD2 1 
ATOM   8810  N  N   . VAL M  1 61  ? 97.431  21.376   67.651  1.00 30.44  ? 61  VAL M N   1 
ATOM   8811  C  CA  . VAL M  1 61  ? 97.725  21.595   69.053  1.00 52.71  ? 61  VAL M CA  1 
ATOM   8812  C  C   . VAL M  1 61  ? 97.485  20.336   69.887  1.00 61.25  ? 61  VAL M C   1 
ATOM   8813  O  O   . VAL M  1 61  ? 98.325  19.948   70.718  1.00 50.94  ? 61  VAL M O   1 
ATOM   8814  C  CB  . VAL M  1 61  ? 96.889  22.735   69.615  1.00 42.98  ? 61  VAL M CB  1 
ATOM   8815  C  CG1 . VAL M  1 61  ? 97.178  22.895   71.075  1.00 31.54  ? 61  VAL M CG1 1 
ATOM   8816  C  CG2 . VAL M  1 61  ? 97.211  24.016   68.892  1.00 36.05  ? 61  VAL M CG2 1 
ATOM   8817  N  N   . HIS M  1 62  ? 96.331  19.710   69.662  1.00 38.69  ? 62  HIS M N   1 
ATOM   8818  C  CA  . HIS M  1 62  ? 96.016  18.418   70.265  1.00 44.91  ? 62  HIS M CA  1 
ATOM   8819  C  C   . HIS M  1 62  ? 97.077  17.339   69.982  1.00 51.88  ? 62  HIS M C   1 
ATOM   8820  O  O   . HIS M  1 62  ? 97.467  16.591   70.886  1.00 55.13  ? 62  HIS M O   1 
ATOM   8821  C  CB  . HIS M  1 62  ? 94.655  17.902   69.801  1.00 41.48  ? 62  HIS M CB  1 
ATOM   8822  C  CG  . HIS M  1 62  ? 94.431  16.449   70.112  1.00 51.69  ? 62  HIS M CG  1 
ATOM   8823  N  ND1 . HIS M  1 62  ? 94.716  15.444   69.212  1.00 68.59  ? 62  HIS M ND1 1 
ATOM   8824  C  CD2 . HIS M  1 62  ? 93.975  15.831   71.229  1.00 43.90  ? 62  HIS M CD2 1 
ATOM   8825  C  CE1 . HIS M  1 62  ? 94.438  14.273   69.756  1.00 65.31  ? 62  HIS M CE1 1 
ATOM   8826  N  NE2 . HIS M  1 62  ? 93.987  14.480   70.981  1.00 64.58  ? 62  HIS M NE2 1 
ATOM   8827  N  N   . LEU M  1 63  ? 97.518  17.228   68.734  1.00 38.06  ? 63  LEU M N   1 
ATOM   8828  C  CA  . LEU M  1 63  ? 98.607  16.325   68.448  1.00 44.57  ? 63  LEU M CA  1 
ATOM   8829  C  C   . LEU M  1 63  ? 99.784  16.565   69.383  1.00 53.34  ? 63  LEU M C   1 
ATOM   8830  O  O   . LEU M  1 63  ? 100.461 15.612   69.762  1.00 47.90  ? 63  LEU M O   1 
ATOM   8831  C  CB  . LEU M  1 63  ? 99.045  16.481   67.009  1.00 45.66  ? 63  LEU M CB  1 
ATOM   8832  C  CG  . LEU M  1 63  ? 98.005  15.911   66.055  1.00 49.32  ? 63  LEU M CG  1 
ATOM   8833  C  CD1 . LEU M  1 63  ? 98.369  16.215   64.612  1.00 60.19  ? 63  LEU M CD1 1 
ATOM   8834  C  CD2 . LEU M  1 63  ? 97.951  14.420   66.297  1.00 55.42  ? 63  LEU M CD2 1 
ATOM   8835  N  N   . LYS M  1 64  ? 100.032 17.827   69.755  1.00 49.30  ? 64  LYS M N   1 
ATOM   8836  C  CA  . LYS M  1 64  ? 101.124 18.079   70.710  1.00 52.58  ? 64  LYS M CA  1 
ATOM   8837  C  C   . LYS M  1 64  ? 100.751 17.981   72.187  1.00 46.53  ? 64  LYS M C   1 
ATOM   8838  O  O   . LYS M  1 64  ? 101.609 17.743   73.030  1.00 61.55  ? 64  LYS M O   1 
ATOM   8839  C  CB  . LYS M  1 64  ? 101.824 19.423   70.466  1.00 54.32  ? 64  LYS M CB  1 
ATOM   8840  C  CG  . LYS M  1 64  ? 103.137 19.596   71.281  1.00 52.15  ? 64  LYS M CG  1 
ATOM   8841  C  CD  . LYS M  1 64  ? 103.925 20.818   70.839  1.00 60.94  ? 64  LYS M CD  1 
ATOM   8842  C  CE  . LYS M  1 64  ? 105.410 20.696   71.200  1.00 80.66  ? 64  LYS M CE  1 
ATOM   8843  N  NZ  . LYS M  1 64  ? 106.232 21.744   70.494  1.00 97.37  ? 64  LYS M NZ  1 
ATOM   8844  N  N   . PHE M  1 65  ? 99.487  18.209   72.506  1.00 53.30  ? 65  PHE M N   1 
ATOM   8845  C  CA  . PHE M  1 65  ? 99.059  18.252   73.904  1.00 61.27  ? 65  PHE M CA  1 
ATOM   8846  C  C   . PHE M  1 65  ? 97.810  17.429   74.113  1.00 69.83  ? 65  PHE M C   1 
ATOM   8847  O  O   . PHE M  1 65  ? 96.786  17.937   74.562  1.00 64.49  ? 65  PHE M O   1 
ATOM   8848  C  CB  . PHE M  1 65  ? 98.806  19.692   74.342  1.00 56.65  ? 65  PHE M CB  1 
ATOM   8849  C  CG  . PHE M  1 65  ? 100.025 20.568   74.241  1.00 74.97  ? 65  PHE M CG  1 
ATOM   8850  C  CD1 . PHE M  1 65  ? 100.346 21.184   73.044  1.00 80.54  ? 65  PHE M CD1 1 
ATOM   8851  C  CD2 . PHE M  1 65  ? 100.847 20.771   75.332  1.00 69.80  ? 65  PHE M CD2 1 
ATOM   8852  C  CE1 . PHE M  1 65  ? 101.455 21.984   72.937  1.00 71.90  ? 65  PHE M CE1 1 
ATOM   8853  C  CE2 . PHE M  1 65  ? 101.947 21.563   75.225  1.00 78.08  ? 65  PHE M CE2 1 
ATOM   8854  C  CZ  . PHE M  1 65  ? 102.253 22.174   74.023  1.00 75.80  ? 65  PHE M CZ  1 
ATOM   8855  N  N   . PRO M  1 66  ? 97.905  16.140   73.797  1.00 63.77  ? 66  PRO M N   1 
ATOM   8856  C  CA  . PRO M  1 66  ? 96.730  15.275   73.717  1.00 48.11  ? 66  PRO M CA  1 
ATOM   8857  C  C   . PRO M  1 66  ? 96.013  15.161   75.049  1.00 57.50  ? 66  PRO M C   1 
ATOM   8858  O  O   . PRO M  1 66  ? 94.956  14.538   75.084  1.00 93.52  ? 66  PRO M O   1 
ATOM   8859  C  CB  . PRO M  1 66  ? 97.324  13.921   73.311  1.00 54.71  ? 66  PRO M CB  1 
ATOM   8860  C  CG  . PRO M  1 66  ? 98.646  14.265   72.685  1.00 57.82  ? 66  PRO M CG  1 
ATOM   8861  C  CD  . PRO M  1 66  ? 99.150  15.433   73.471  1.00 36.48  ? 66  PRO M CD  1 
ATOM   8862  N  N   . THR M  1 67  ? 96.572  15.729   76.114  1.00 56.15  ? 67  THR M N   1 
ATOM   8863  C  CA  . THR M  1 67  ? 95.953  15.628   77.430  1.00 56.02  ? 67  THR M CA  1 
ATOM   8864  C  C   . THR M  1 67  ? 95.281  16.923   77.833  1.00 62.11  ? 67  THR M C   1 
ATOM   8865  O  O   . THR M  1 67  ? 94.390  16.934   78.662  1.00 75.20  ? 67  THR M O   1 
ATOM   8866  C  CB  . THR M  1 67  ? 96.955  15.209   78.522  1.00 53.08  ? 67  THR M CB  1 
ATOM   8867  O  OG1 . THR M  1 67  ? 97.985  16.194   78.635  1.00 54.81  ? 67  THR M OG1 1 
ATOM   8868  C  CG2 . THR M  1 67  ? 97.561  13.878   78.169  1.00 46.73  ? 67  THR M CG2 1 
ATOM   8869  N  N   . LYS M  1 68  ? 95.706  18.024   77.239  1.00 69.95  ? 68  LYS M N   1 
ATOM   8870  C  CA  . LYS M  1 68  ? 95.178  19.341   77.611  1.00 66.31  ? 68  LYS M CA  1 
ATOM   8871  C  C   . LYS M  1 68  ? 94.179  19.885   76.562  1.00 69.21  ? 68  LYS M C   1 
ATOM   8872  O  O   . LYS M  1 68  ? 93.321  20.713   76.858  1.00 75.23  ? 68  LYS M O   1 
ATOM   8873  C  CB  . LYS M  1 68  ? 96.342  20.326   77.842  1.00 43.66  ? 68  LYS M CB  1 
ATOM   8874  N  N   . VAL M  1 69  ? 94.287  19.394   75.335  1.00 67.32  ? 69  VAL M N   1 
ATOM   8875  C  CA  . VAL M  1 69  ? 93.503  19.902   74.211  1.00 48.58  ? 69  VAL M CA  1 
ATOM   8876  C  C   . VAL M  1 69  ? 92.883  18.722   73.464  1.00 55.50  ? 69  VAL M C   1 
ATOM   8877  O  O   . VAL M  1 69  ? 93.559  17.705   73.218  1.00 69.38  ? 69  VAL M O   1 
ATOM   8878  C  CB  . VAL M  1 69  ? 94.415  20.700   73.258  1.00 51.91  ? 69  VAL M CB  1 
ATOM   8879  C  CG1 . VAL M  1 69  ? 93.787  20.855   71.907  1.00 74.37  ? 69  VAL M CG1 1 
ATOM   8880  C  CG2 . VAL M  1 69  ? 94.735  22.042   73.853  1.00 44.78  ? 69  VAL M CG2 1 
ATOM   8881  N  N   . GLY M  1 70  ? 91.606  18.845   73.106  1.00 36.15  ? 70  GLY M N   1 
ATOM   8882  C  CA  . GLY M  1 70  ? 90.891  17.730   72.504  1.00 48.54  ? 70  GLY M CA  1 
ATOM   8883  C  C   . GLY M  1 70  ? 90.790  17.787   70.994  1.00 62.19  ? 70  GLY M C   1 
ATOM   8884  O  O   . GLY M  1 70  ? 90.984  18.856   70.417  1.00 78.05  ? 70  GLY M O   1 
ATOM   8885  N  N   . LYS M  1 71  ? 90.492  16.650   70.353  1.00 56.89  ? 71  LYS M N   1 
ATOM   8886  C  CA  . LYS M  1 71  ? 90.298  16.611   68.898  1.00 61.26  ? 71  LYS M CA  1 
ATOM   8887  C  C   . LYS M  1 71  ? 89.129  17.524   68.536  1.00 62.40  ? 71  LYS M C   1 
ATOM   8888  O  O   . LYS M  1 71  ? 88.359  17.944   69.412  1.00 44.55  ? 71  LYS M O   1 
ATOM   8889  C  CB  . LYS M  1 71  ? 90.005  15.190   68.392  1.00 52.36  ? 71  LYS M CB  1 
ATOM   8890  C  CG  . LYS M  1 71  ? 90.892  14.085   68.927  1.00 51.21  ? 71  LYS M CG  1 
ATOM   8891  C  CD  . LYS M  1 71  ? 90.449  12.736   68.381  1.00 67.55  ? 71  LYS M CD  1 
ATOM   8892  C  CE  . LYS M  1 71  ? 91.360  11.600   68.864  1.00 103.77 ? 71  LYS M CE  1 
ATOM   8893  N  NZ  . LYS M  1 71  ? 92.764  11.679   68.339  1.00 118.46 ? 71  LYS M NZ  1 
ATOM   8894  N  N   . ALA M  1 72  ? 88.994  17.846   67.254  1.00 57.16  ? 72  ALA M N   1 
ATOM   8895  C  CA  . ALA M  1 72  ? 87.799  18.549   66.816  1.00 58.18  ? 72  ALA M CA  1 
ATOM   8896  C  C   . ALA M  1 72  ? 86.640  17.566   66.897  1.00 65.30  ? 72  ALA M C   1 
ATOM   8897  O  O   . ALA M  1 72  ? 86.831  16.350   66.836  1.00 53.11  ? 72  ALA M O   1 
ATOM   8898  C  CB  . ALA M  1 72  ? 87.959  19.046   65.408  1.00 56.00  ? 72  ALA M CB  1 
ATOM   8899  N  N   . CYS M  1 73  ? 85.429  18.080   67.029  1.00 60.06  ? 73  CYS M N   1 
ATOM   8900  C  CA  . CYS M  1 73  ? 84.288  17.183   67.155  1.00 61.53  ? 73  CYS M CA  1 
ATOM   8901  C  C   . CYS M  1 73  ? 83.569  16.969   65.828  1.00 57.25  ? 73  CYS M C   1 
ATOM   8902  O  O   . CYS M  1 73  ? 83.561  17.838   64.970  1.00 52.43  ? 73  CYS M O   1 
ATOM   8903  C  CB  . CYS M  1 73  ? 83.313  17.667   68.234  1.00 44.42  ? 73  CYS M CB  1 
ATOM   8904  S  SG  . CYS M  1 73  ? 82.209  16.352   68.842  1.00 93.85  ? 73  CYS M SG  1 
ATOM   8905  N  N   . CYS M  1 74  ? 82.981  15.792   65.668  1.00 52.19  ? 74  CYS M N   1 
ATOM   8906  C  CA  . CYS M  1 74  ? 82.232  15.482   64.470  1.00 43.24  ? 74  CYS M CA  1 
ATOM   8907  C  C   . CYS M  1 74  ? 80.786  15.895   64.719  1.00 48.66  ? 74  CYS M C   1 
ATOM   8908  O  O   . CYS M  1 74  ? 80.075  15.281   65.522  1.00 69.62  ? 74  CYS M O   1 
ATOM   8909  C  CB  . CYS M  1 74  ? 82.345  13.984   64.138  1.00 39.42  ? 74  CYS M CB  1 
ATOM   8910  S  SG  . CYS M  1 74  ? 81.713  13.526   62.512  1.00 83.53  ? 74  CYS M SG  1 
ATOM   8911  N  N   . VAL M  1 75  ? 80.352  16.943   64.031  1.00 41.77  ? 75  VAL M N   1 
ATOM   8912  C  CA  . VAL M  1 75  ? 79.031  17.509   64.272  1.00 50.53  ? 75  VAL M CA  1 
ATOM   8913  C  C   . VAL M  1 75  ? 78.235  17.651   62.987  1.00 52.36  ? 75  VAL M C   1 
ATOM   8914  O  O   . VAL M  1 75  ? 78.803  17.671   61.891  1.00 57.61  ? 75  VAL M O   1 
ATOM   8915  C  CB  . VAL M  1 75  ? 79.140  18.898   64.918  1.00 38.35  ? 75  VAL M CB  1 
ATOM   8916  C  CG1 . VAL M  1 75  ? 79.690  18.789   66.325  1.00 41.47  ? 75  VAL M CG1 1 
ATOM   8917  C  CG2 . VAL M  1 75  ? 80.041  19.772   64.083  1.00 44.70  ? 75  VAL M CG2 1 
ATOM   8918  N  N   . PRO M  1 76  ? 76.908  17.746   63.118  1.00 44.78  ? 76  PRO M N   1 
ATOM   8919  C  CA  . PRO M  1 76  ? 76.080  18.076   61.961  1.00 56.53  ? 76  PRO M CA  1 
ATOM   8920  C  C   . PRO M  1 76  ? 76.440  19.484   61.499  1.00 54.27  ? 76  PRO M C   1 
ATOM   8921  O  O   . PRO M  1 76  ? 76.425  20.413   62.303  1.00 35.95  ? 76  PRO M O   1 
ATOM   8922  C  CB  . PRO M  1 76  ? 74.652  18.052   62.531  1.00 48.11  ? 76  PRO M CB  1 
ATOM   8923  C  CG  . PRO M  1 76  ? 74.744  17.316   63.812  1.00 60.45  ? 76  PRO M CG  1 
ATOM   8924  C  CD  . PRO M  1 76  ? 76.113  17.598   64.345  1.00 49.19  ? 76  PRO M CD  1 
ATOM   8925  N  N   . THR M  1 77  ? 76.769  19.633   60.223  1.00 45.44  ? 77  THR M N   1 
ATOM   8926  C  CA  . THR M  1 77  ? 77.130  20.930   59.695  1.00 24.31  ? 77  THR M CA  1 
ATOM   8927  C  C   . THR M  1 77  ? 76.037  21.558   58.832  1.00 45.81  ? 77  THR M C   1 
ATOM   8928  O  O   . THR M  1 77  ? 76.068  22.763   58.587  1.00 48.06  ? 77  THR M O   1 
ATOM   8929  C  CB  . THR M  1 77  ? 78.402  20.842   58.877  1.00 53.78  ? 77  THR M CB  1 
ATOM   8930  O  OG1 . THR M  1 77  ? 78.190  19.970   57.765  1.00 69.97  ? 77  THR M OG1 1 
ATOM   8931  C  CG2 . THR M  1 77  ? 79.520  20.288   59.726  1.00 55.67  ? 77  THR M CG2 1 
ATOM   8932  N  N   . LYS M  1 78  ? 75.087  20.746   58.363  1.00 49.39  ? 78  LYS M N   1 
ATOM   8933  C  CA  . LYS M  1 78  ? 73.923  21.248   57.623  1.00 57.86  ? 78  LYS M CA  1 
ATOM   8934  C  C   . LYS M  1 78  ? 72.672  20.498   58.066  1.00 63.98  ? 78  LYS M C   1 
ATOM   8935  O  O   . LYS M  1 78  ? 72.748  19.289   58.277  1.00 59.93  ? 78  LYS M O   1 
ATOM   8936  C  CB  . LYS M  1 78  ? 74.130  21.077   56.112  1.00 45.11  ? 78  LYS M CB  1 
ATOM   8937  C  CG  . LYS M  1 78  ? 73.039  21.719   55.257  1.00 64.10  ? 78  LYS M CG  1 
ATOM   8938  C  CD  . LYS M  1 78  ? 73.282  21.479   53.783  1.00 57.08  ? 78  LYS M CD  1 
ATOM   8939  C  CE  . LYS M  1 78  ? 72.249  22.179   52.921  1.00 76.10  ? 78  LYS M CE  1 
ATOM   8940  N  NZ  . LYS M  1 78  ? 72.493  21.929   51.471  1.00 98.69  ? 78  LYS M NZ  1 
ATOM   8941  N  N   . LEU M  1 79  ? 71.530  21.186   58.196  1.00 53.31  ? 79  LEU M N   1 
ATOM   8942  C  CA  . LEU M  1 79  ? 70.319  20.503   58.681  1.00 56.13  ? 79  LEU M CA  1 
ATOM   8943  C  C   . LEU M  1 79  ? 69.049  20.594   57.818  1.00 70.37  ? 79  LEU M C   1 
ATOM   8944  O  O   . LEU M  1 79  ? 68.507  21.682   57.597  1.00 94.45  ? 79  LEU M O   1 
ATOM   8945  C  CB  . LEU M  1 79  ? 69.995  20.939   60.114  1.00 43.76  ? 79  LEU M CB  1 
ATOM   8946  C  CG  . LEU M  1 79  ? 70.923  20.421   61.206  1.00 38.61  ? 79  LEU M CG  1 
ATOM   8947  C  CD1 . LEU M  1 79  ? 70.564  20.983   62.552  1.00 27.15  ? 79  LEU M CD1 1 
ATOM   8948  C  CD2 . LEU M  1 79  ? 70.836  18.937   61.254  1.00 63.93  ? 79  LEU M CD2 1 
ATOM   8949  N  N   . SER M  1 80  ? 68.560  19.438   57.374  1.00 58.88  ? 80  SER M N   1 
ATOM   8950  C  CA  . SER M  1 80  ? 67.267  19.341   56.695  1.00 63.88  ? 80  SER M CA  1 
ATOM   8951  C  C   . SER M  1 80  ? 66.107  19.309   57.686  1.00 60.92  ? 80  SER M C   1 
ATOM   8952  O  O   . SER M  1 80  ? 66.266  18.828   58.808  1.00 55.95  ? 80  SER M O   1 
ATOM   8953  C  CB  . SER M  1 80  ? 67.200  18.078   55.832  1.00 66.03  ? 80  SER M CB  1 
ATOM   8954  O  OG  . SER M  1 80  ? 67.926  18.224   54.627  1.00 79.83  ? 80  SER M OG  1 
ATOM   8955  N  N   . PRO M  1 81  ? 64.930  19.809   57.263  1.00 51.38  ? 81  PRO M N   1 
ATOM   8956  C  CA  . PRO M  1 81  ? 63.683  19.755   58.020  1.00 65.78  ? 81  PRO M CA  1 
ATOM   8957  C  C   . PRO M  1 81  ? 62.899  18.501   57.644  1.00 63.97  ? 81  PRO M C   1 
ATOM   8958  O  O   . PRO M  1 81  ? 63.181  17.879   56.624  1.00 51.67  ? 81  PRO M O   1 
ATOM   8959  C  CB  . PRO M  1 81  ? 62.932  20.964   57.490  1.00 53.54  ? 81  PRO M CB  1 
ATOM   8960  C  CG  . PRO M  1 81  ? 63.301  20.966   56.065  1.00 33.12  ? 81  PRO M CG  1 
ATOM   8961  C  CD  . PRO M  1 81  ? 64.738  20.530   55.995  1.00 32.21  ? 81  PRO M CD  1 
ATOM   8962  N  N   . ILE M  1 82  ? 61.918  18.131   58.453  1.00 44.86  ? 82  ILE M N   1 
ATOM   8963  C  CA  . ILE M  1 82  ? 61.062  17.049   58.081  1.00 47.44  ? 82  ILE M CA  1 
ATOM   8964  C  C   . ILE M  1 82  ? 59.675  17.539   58.257  1.00 54.58  ? 82  ILE M C   1 
ATOM   8965  O  O   . ILE M  1 82  ? 59.478  18.575   58.858  1.00 52.83  ? 82  ILE M O   1 
ATOM   8966  C  CB  . ILE M  1 82  ? 61.240  15.903   59.004  1.00 42.40  ? 82  ILE M CB  1 
ATOM   8967  C  CG1 . ILE M  1 82  ? 60.964  16.349   60.434  1.00 39.49  ? 82  ILE M CG1 1 
ATOM   8968  C  CG2 . ILE M  1 82  ? 62.614  15.404   58.891  1.00 23.16  ? 82  ILE M CG2 1 
ATOM   8969  C  CD1 . ILE M  1 82  ? 60.989  15.205   61.424  1.00 44.72  ? 82  ILE M CD1 1 
ATOM   8970  N  N   . SER M  1 83  ? 58.712  16.787   57.743  1.00 51.98  ? 83  SER M N   1 
ATOM   8971  C  CA  . SER M  1 83  ? 57.319  17.163   57.886  1.00 55.52  ? 83  SER M CA  1 
ATOM   8972  C  C   . SER M  1 83  ? 56.701  16.411   59.036  1.00 57.59  ? 83  SER M C   1 
ATOM   8973  O  O   . SER M  1 83  ? 57.007  15.243   59.243  1.00 82.10  ? 83  SER M O   1 
ATOM   8974  C  CB  . SER M  1 83  ? 56.557  16.875   56.601  1.00 56.82  ? 83  SER M CB  1 
ATOM   8975  O  OG  . SER M  1 83  ? 56.848  17.848   55.625  1.00 50.74  ? 83  SER M OG  1 
ATOM   8976  N  N   . VAL M  1 84  ? 55.850  17.083   59.801  1.00 42.01  ? 84  VAL M N   1 
ATOM   8977  C  CA  . VAL M  1 84  ? 55.125  16.395   60.854  1.00 57.02  ? 84  VAL M CA  1 
ATOM   8978  C  C   . VAL M  1 84  ? 53.692  16.893   61.046  1.00 52.03  ? 84  VAL M C   1 
ATOM   8979  O  O   . VAL M  1 84  ? 53.398  18.083   60.901  1.00 61.06  ? 84  VAL M O   1 
ATOM   8980  C  CB  . VAL M  1 84  ? 55.888  16.417   62.184  1.00 49.11  ? 84  VAL M CB  1 
ATOM   8981  C  CG1 . VAL M  1 84  ? 57.358  16.325   61.920  1.00 49.66  ? 84  VAL M CG1 1 
ATOM   8982  C  CG2 . VAL M  1 84  ? 55.607  17.669   62.936  1.00 25.78  ? 84  VAL M CG2 1 
ATOM   8983  N  N   . LEU M  1 85  ? 52.816  15.941   61.350  1.00 48.99  ? 85  LEU M N   1 
ATOM   8984  C  CA  . LEU M  1 85  ? 51.416  16.182   61.583  1.00 47.91  ? 85  LEU M CA  1 
ATOM   8985  C  C   . LEU M  1 85  ? 51.254  16.048   63.074  1.00 57.31  ? 85  LEU M C   1 
ATOM   8986  O  O   . LEU M  1 85  ? 51.485  14.978   63.631  1.00 61.13  ? 85  LEU M O   1 
ATOM   8987  C  CB  . LEU M  1 85  ? 50.581  15.126   60.858  1.00 43.05  ? 85  LEU M CB  1 
ATOM   8988  C  CG  . LEU M  1 85  ? 49.073  15.302   60.854  1.00 33.42  ? 85  LEU M CG  1 
ATOM   8989  C  CD1 . LEU M  1 85  ? 48.759  16.643   60.316  1.00 27.16  ? 85  LEU M CD1 1 
ATOM   8990  C  CD2 . LEU M  1 85  ? 48.424  14.220   60.015  1.00 34.75  ? 85  LEU M CD2 1 
ATOM   8991  N  N   . TYR M  1 86  ? 50.859  17.135   63.722  1.00 44.53  ? 86  TYR M N   1 
ATOM   8992  C  CA  . TYR M  1 86  ? 50.756  17.159   65.171  1.00 47.19  ? 86  TYR M CA  1 
ATOM   8993  C  C   . TYR M  1 86  ? 49.481  17.793   65.722  1.00 60.82  ? 86  TYR M C   1 
ATOM   8994  O  O   . TYR M  1 86  ? 48.786  18.559   65.034  1.00 82.63  ? 86  TYR M O   1 
ATOM   8995  C  CB  . TYR M  1 86  ? 51.920  17.940   65.707  1.00 67.98  ? 86  TYR M CB  1 
ATOM   8996  C  CG  . TYR M  1 86  ? 51.806  19.416   65.444  1.00 59.08  ? 86  TYR M CG  1 
ATOM   8997  C  CD1 . TYR M  1 86  ? 51.274  20.262   66.396  1.00 69.44  ? 86  TYR M CD1 1 
ATOM   8998  C  CD2 . TYR M  1 86  ? 52.229  19.964   64.245  1.00 44.44  ? 86  TYR M CD2 1 
ATOM   8999  C  CE1 . TYR M  1 86  ? 51.183  21.609   66.171  1.00 78.83  ? 86  TYR M CE1 1 
ATOM   9000  C  CE2 . TYR M  1 86  ? 52.146  21.311   64.004  1.00 43.45  ? 86  TYR M CE2 1 
ATOM   9001  C  CZ  . TYR M  1 86  ? 51.621  22.137   64.963  1.00 65.68  ? 86  TYR M CZ  1 
ATOM   9002  O  OH  . TYR M  1 86  ? 51.529  23.495   64.696  1.00 49.36  ? 86  TYR M OH  1 
ATOM   9003  N  N   . LYS M  1 87  ? 49.191  17.502   66.986  1.00 53.37  ? 87  LYS M N   1 
ATOM   9004  C  CA  . LYS M  1 87  ? 47.958  17.979   67.588  1.00 59.26  ? 87  LYS M CA  1 
ATOM   9005  C  C   . LYS M  1 87  ? 48.080  19.442   67.995  1.00 72.50  ? 87  LYS M C   1 
ATOM   9006  O  O   . LYS M  1 87  ? 48.978  19.806   68.731  1.00 58.48  ? 87  LYS M O   1 
ATOM   9007  C  CB  . LYS M  1 87  ? 47.536  17.096   68.778  1.00 47.15  ? 87  LYS M CB  1 
ATOM   9008  C  CG  . LYS M  1 87  ? 46.832  15.767   68.417  1.00 50.91  ? 87  LYS M CG  1 
ATOM   9009  C  CD  . LYS M  1 87  ? 46.582  14.873   69.652  1.00 86.19  ? 87  LYS M CD  1 
ATOM   9010  C  CE  . LYS M  1 87  ? 46.185  13.432   69.259  1.00 106.12 ? 87  LYS M CE  1 
ATOM   9011  N  NZ  . LYS M  1 87  ? 46.759  12.356   70.150  1.00 91.40  ? 87  LYS M NZ  1 
ATOM   9012  N  N   . ASP M  1 88  ? 47.162  20.263   67.486  1.00 101.20 ? 88  ASP M N   1 
ATOM   9013  C  CA  . ASP M  1 88  ? 46.984  21.668   67.878  1.00 93.90  ? 88  ASP M CA  1 
ATOM   9014  C  C   . ASP M  1 88  ? 47.010  21.843   69.398  1.00 92.30  ? 88  ASP M C   1 
ATOM   9015  O  O   . ASP M  1 88  ? 47.069  20.878   70.150  1.00 89.89  ? 88  ASP M O   1 
ATOM   9016  C  CB  . ASP M  1 88  ? 45.623  22.161   67.348  1.00 104.42 ? 88  ASP M CB  1 
ATOM   9017  C  CG  . ASP M  1 88  ? 45.614  23.642   66.989  1.00 127.06 ? 88  ASP M CG  1 
ATOM   9018  O  OD1 . ASP M  1 88  ? 46.290  24.434   67.673  1.00 144.07 ? 88  ASP M OD1 1 
ATOM   9019  O  OD2 . ASP M  1 88  ? 44.915  24.018   66.020  1.00 128.75 ? 88  ASP M OD2 1 
ATOM   9020  N  N   . ASP M  1 89  ? 46.959  23.083   69.854  1.00 102.34 ? 89  ASP M N   1 
ATOM   9021  C  CA  . ASP M  1 89  ? 46.793  23.334   71.273  1.00 100.01 ? 89  ASP M CA  1 
ATOM   9022  C  C   . ASP M  1 89  ? 45.382  22.934   71.655  1.00 92.90  ? 89  ASP M C   1 
ATOM   9023  O  O   . ASP M  1 89  ? 45.057  22.813   72.833  1.00 96.19  ? 89  ASP M O   1 
ATOM   9024  C  CB  . ASP M  1 89  ? 47.031  24.807   71.601  1.00 116.08 ? 89  ASP M CB  1 
ATOM   9025  C  CG  . ASP M  1 89  ? 48.473  25.229   71.398  1.00 124.97 ? 89  ASP M CG  1 
ATOM   9026  O  OD1 . ASP M  1 89  ? 48.785  25.804   70.330  1.00 121.26 ? 89  ASP M OD1 1 
ATOM   9027  O  OD2 . ASP M  1 89  ? 49.288  24.995   72.313  1.00 122.70 ? 89  ASP M OD2 1 
ATOM   9028  N  N   . MET M  1 90  ? 44.542  22.729   70.646  1.00 88.65  ? 90  MET M N   1 
ATOM   9029  C  CA  . MET M  1 90  ? 43.179  22.296   70.881  1.00 92.52  ? 90  MET M CA  1 
ATOM   9030  C  C   . MET M  1 90  ? 42.901  21.022   70.138  1.00 86.75  ? 90  MET M C   1 
ATOM   9031  O  O   . MET M  1 90  ? 41.767  20.747   69.774  1.00 99.34  ? 90  MET M O   1 
ATOM   9032  C  CB  . MET M  1 90  ? 42.182  23.376   70.491  1.00 103.17 ? 90  MET M CB  1 
ATOM   9033  C  CG  . MET M  1 90  ? 42.072  24.442   71.540  1.00 101.81 ? 90  MET M CG  1 
ATOM   9034  S  SD  . MET M  1 90  ? 41.406  25.894   70.830  1.00 97.05  ? 90  MET M SD  1 
ATOM   9035  C  CE  . MET M  1 90  ? 42.421  26.028   69.349  1.00 125.62 ? 90  MET M CE  1 
ATOM   9036  N  N   . GLY M  1 91  ? 43.951  20.247   69.917  1.00 77.28  ? 91  GLY M N   1 
ATOM   9037  C  CA  . GLY M  1 91  ? 43.819  18.873   69.458  1.00 81.94  ? 91  GLY M CA  1 
ATOM   9038  C  C   . GLY M  1 91  ? 43.414  18.726   68.014  1.00 75.48  ? 91  GLY M C   1 
ATOM   9039  O  O   . GLY M  1 91  ? 42.780  17.741   67.634  1.00 83.04  ? 91  GLY M O   1 
ATOM   9040  N  N   . VAL M  1 92  ? 43.773  19.719   67.214  1.00 62.83  ? 92  VAL M N   1 
ATOM   9041  C  CA  . VAL M  1 92  ? 43.467  19.697   65.799  1.00 62.73  ? 92  VAL M CA  1 
ATOM   9042  C  C   . VAL M  1 92  ? 44.686  19.235   65.014  1.00 68.86  ? 92  VAL M C   1 
ATOM   9043  O  O   . VAL M  1 92  ? 45.750  19.841   65.076  1.00 84.08  ? 92  VAL M O   1 
ATOM   9044  C  CB  . VAL M  1 92  ? 43.041  21.084   65.308  1.00 62.68  ? 92  VAL M CB  1 
ATOM   9045  C  CG1 . VAL M  1 92  ? 42.259  20.980   64.011  1.00 73.41  ? 92  VAL M CG1 1 
ATOM   9046  C  CG2 . VAL M  1 92  ? 42.244  21.772   66.365  1.00 60.35  ? 92  VAL M CG2 1 
ATOM   9047  N  N   . PRO M  1 93  ? 44.537  18.151   64.268  1.00 56.37  ? 93  PRO M N   1 
ATOM   9048  C  CA  . PRO M  1 93  ? 45.641  17.760   63.410  1.00 63.78  ? 93  PRO M CA  1 
ATOM   9049  C  C   . PRO M  1 93  ? 46.026  18.928   62.516  1.00 64.75  ? 93  PRO M C   1 
ATOM   9050  O  O   . PRO M  1 93  ? 45.234  19.345   61.661  1.00 67.26  ? 93  PRO M O   1 
ATOM   9051  C  CB  . PRO M  1 93  ? 45.043  16.629   62.571  1.00 62.74  ? 93  PRO M CB  1 
ATOM   9052  C  CG  . PRO M  1 93  ? 43.960  16.096   63.388  1.00 62.15  ? 93  PRO M CG  1 
ATOM   9053  C  CD  . PRO M  1 93  ? 43.380  17.263   64.113  1.00 70.98  ? 93  PRO M CD  1 
ATOM   9054  N  N   . THR M  1 94  ? 47.227  19.465   62.726  1.00 52.13  ? 94  THR M N   1 
ATOM   9055  C  CA  . THR M  1 94  ? 47.772  20.461   61.809  1.00 70.80  ? 94  THR M CA  1 
ATOM   9056  C  C   . THR M  1 94  ? 49.192  20.098   61.370  1.00 60.24  ? 94  THR M C   1 
ATOM   9057  O  O   . THR M  1 94  ? 49.801  19.194   61.919  1.00 53.96  ? 94  THR M O   1 
ATOM   9058  C  CB  . THR M  1 94  ? 47.781  21.826   62.440  1.00 70.76  ? 94  THR M CB  1 
ATOM   9059  O  OG1 . THR M  1 94  ? 48.815  21.859   63.403  1.00 33.08  ? 94  THR M OG1 1 
ATOM   9060  C  CG2 . THR M  1 94  ? 46.450  22.104   63.130  1.00 78.45  ? 94  THR M CG2 1 
ATOM   9061  N  N   . LEU M  1 95  ? 49.729  20.805   60.386  1.00 47.58  ? 95  LEU M N   1 
ATOM   9062  C  CA  . LEU M  1 95  ? 50.943  20.326   59.728  1.00 51.85  ? 95  LEU M CA  1 
ATOM   9063  C  C   . LEU M  1 95  ? 52.102  21.320   59.679  1.00 59.82  ? 95  LEU M C   1 
ATOM   9064  O  O   . LEU M  1 95  ? 51.995  22.359   59.035  1.00 79.89  ? 95  LEU M O   1 
ATOM   9065  C  CB  . LEU M  1 95  ? 50.614  19.872   58.294  1.00 45.83  ? 95  LEU M CB  1 
ATOM   9066  C  CG  . LEU M  1 95  ? 51.810  19.732   57.352  1.00 43.34  ? 95  LEU M CG  1 
ATOM   9067  C  CD1 . LEU M  1 95  ? 52.670  18.581   57.801  1.00 88.77  ? 95  LEU M CD1 1 
ATOM   9068  C  CD2 . LEU M  1 95  ? 51.357  19.519   55.945  1.00 41.64  ? 95  LEU M CD2 1 
ATOM   9069  N  N   . LYS M  1 96  ? 53.226  21.015   60.325  1.00 49.99  ? 96  LYS M N   1 
ATOM   9070  C  CA  . LYS M  1 96  ? 54.439  21.744   59.928  1.00 60.77  ? 96  LYS M CA  1 
ATOM   9071  C  C   . LYS M  1 96  ? 55.156  20.989   58.842  1.00 56.83  ? 96  LYS M C   1 
ATOM   9072  O  O   . LYS M  1 96  ? 55.642  19.892   59.064  1.00 60.37  ? 96  LYS M O   1 
ATOM   9073  C  CB  . LYS M  1 96  ? 55.416  22.082   61.065  1.00 44.01  ? 96  LYS M CB  1 
ATOM   9074  C  CG  . LYS M  1 96  ? 56.294  23.356   60.735  1.00 34.45  ? 96  LYS M CG  1 
ATOM   9075  C  CD  . LYS M  1 96  ? 55.464  24.443   59.931  1.00 174.65 ? 96  LYS M CD  1 
ATOM   9076  C  CE  . LYS M  1 96  ? 55.970  24.721   58.478  1.00 79.83  ? 96  LYS M CE  1 
ATOM   9077  N  NZ  . LYS M  1 96  ? 54.895  24.984   57.421  1.00 33.26  ? 96  LYS M NZ  1 
ATOM   9078  N  N   . TYR M  1 97  ? 55.195  21.595   57.666  1.00 31.89  ? 97  TYR M N   1 
ATOM   9079  C  CA  . TYR M  1 97  ? 55.778  20.986   56.501  1.00 39.86  ? 97  TYR M CA  1 
ATOM   9080  C  C   . TYR M  1 97  ? 57.256  21.198   56.547  1.00 54.26  ? 97  TYR M C   1 
ATOM   9081  O  O   . TYR M  1 97  ? 58.024  20.284   56.268  1.00 66.82  ? 97  TYR M O   1 
ATOM   9082  C  CB  . TYR M  1 97  ? 55.223  21.612   55.240  1.00 40.52  ? 97  TYR M CB  1 
ATOM   9083  C  CG  . TYR M  1 97  ? 55.825  21.107   53.953  1.00 44.00  ? 97  TYR M CG  1 
ATOM   9084  C  CD1 . TYR M  1 97  ? 55.740  19.766   53.574  1.00 61.37  ? 97  TYR M CD1 1 
ATOM   9085  C  CD2 . TYR M  1 97  ? 56.427  21.979   53.087  1.00 30.41  ? 97  TYR M CD2 1 
ATOM   9086  C  CE1 . TYR M  1 97  ? 56.284  19.323   52.369  1.00 55.04  ? 97  TYR M CE1 1 
ATOM   9087  C  CE2 . TYR M  1 97  ? 56.968  21.541   51.888  1.00 63.25  ? 97  TYR M CE2 1 
ATOM   9088  C  CZ  . TYR M  1 97  ? 56.896  20.224   51.535  1.00 56.44  ? 97  TYR M CZ  1 
ATOM   9089  O  OH  . TYR M  1 97  ? 57.438  19.844   50.342  1.00 66.34  ? 97  TYR M OH  1 
ATOM   9090  N  N   . HIS M  1 98  ? 57.662  22.409   56.903  1.00 78.95  ? 98  HIS M N   1 
ATOM   9091  C  CA  . HIS M  1 98  ? 59.082  22.732   57.043  1.00 72.70  ? 98  HIS M CA  1 
ATOM   9092  C  C   . HIS M  1 98  ? 59.458  22.841   58.520  1.00 74.45  ? 98  HIS M C   1 
ATOM   9093  O  O   . HIS M  1 98  ? 59.637  23.941   59.034  1.00 109.07 ? 98  HIS M O   1 
ATOM   9094  C  CB  . HIS M  1 98  ? 59.414  24.037   56.305  1.00 64.30  ? 98  HIS M CB  1 
ATOM   9095  C  CG  . HIS M  1 98  ? 60.103  23.833   54.990  1.00 107.00 ? 98  HIS M CG  1 
ATOM   9096  N  ND1 . HIS M  1 98  ? 61.379  24.292   54.738  1.00 133.56 ? 98  HIS M ND1 1 
ATOM   9097  C  CD2 . HIS M  1 98  ? 59.699  23.214   53.855  1.00 116.63 ? 98  HIS M CD2 1 
ATOM   9098  C  CE1 . HIS M  1 98  ? 61.729  23.968   53.506  1.00 126.42 ? 98  HIS M CE1 1 
ATOM   9099  N  NE2 . HIS M  1 98  ? 60.727  23.313   52.948  1.00 115.77 ? 98  HIS M NE2 1 
ATOM   9100  N  N   . TYR M  1 99  ? 59.558  21.703   59.203  1.00 39.90  ? 99  TYR M N   1 
ATOM   9101  C  CA  . TYR M  1 99  ? 59.907  21.666   60.625  1.00 39.91  ? 99  TYR M CA  1 
ATOM   9102  C  C   . TYR M  1 99  ? 61.402  21.635   60.706  1.00 58.72  ? 99  TYR M C   1 
ATOM   9103  O  O   . TYR M  1 99  ? 62.016  20.589   60.522  1.00 62.66  ? 99  TYR M O   1 
ATOM   9104  C  CB  . TYR M  1 99  ? 59.360  20.410   61.314  1.00 55.53  ? 99  TYR M CB  1 
ATOM   9105  C  CG  . TYR M  1 99  ? 59.454  20.417   62.834  1.00 51.59  ? 99  TYR M CG  1 
ATOM   9106  C  CD1 . TYR M  1 99  ? 59.118  19.298   63.578  1.00 50.93  ? 99  TYR M CD1 1 
ATOM   9107  C  CD2 . TYR M  1 99  ? 59.854  21.546   63.524  1.00 73.25  ? 99  TYR M CD2 1 
ATOM   9108  C  CE1 . TYR M  1 99  ? 59.199  19.297   64.961  1.00 36.54  ? 99  TYR M CE1 1 
ATOM   9109  C  CE2 . TYR M  1 99  ? 59.928  21.551   64.914  1.00 74.87  ? 99  TYR M CE2 1 
ATOM   9110  C  CZ  . TYR M  1 99  ? 59.595  20.419   65.620  1.00 53.02  ? 99  TYR M CZ  1 
ATOM   9111  O  OH  . TYR M  1 99  ? 59.666  20.399   66.992  1.00 59.00  ? 99  TYR M OH  1 
ATOM   9112  N  N   . GLU M  1 100 ? 61.993  22.782   61.006  1.00 63.91  ? 100 GLU M N   1 
ATOM   9113  C  CA  . GLU M  1 100 ? 63.408  22.972   60.725  1.00 55.82  ? 100 GLU M CA  1 
ATOM   9114  C  C   . GLU M  1 100 ? 64.346  22.250   61.659  1.00 50.42  ? 100 GLU M C   1 
ATOM   9115  O  O   . GLU M  1 100 ? 64.076  22.132   62.861  1.00 45.33  ? 100 GLU M O   1 
ATOM   9116  C  CB  . GLU M  1 100 ? 63.756  24.460   60.661  1.00 54.46  ? 100 GLU M CB  1 
ATOM   9117  C  CG  . GLU M  1 100 ? 63.265  25.160   59.396  1.00 78.35  ? 100 GLU M CG  1 
ATOM   9118  C  CD  . GLU M  1 100 ? 63.880  24.593   58.133  1.00 90.97  ? 100 GLU M CD  1 
ATOM   9119  O  OE1 . GLU M  1 100 ? 64.813  23.766   58.256  1.00 103.61 ? 100 GLU M OE1 1 
ATOM   9120  O  OE2 . GLU M  1 100 ? 63.432  24.975   57.024  1.00 57.98  ? 100 GLU M OE2 1 
ATOM   9121  N  N   . GLY M  1 101 ? 65.439  21.769   61.062  1.00 57.78  ? 101 GLY M N   1 
ATOM   9122  C  CA  . GLY M  1 101 ? 66.602  21.264   61.772  1.00 51.16  ? 101 GLY M CA  1 
ATOM   9123  C  C   . GLY M  1 101 ? 66.424  19.984   62.555  1.00 45.76  ? 101 GLY M C   1 
ATOM   9124  O  O   . GLY M  1 101 ? 66.853  19.898   63.687  1.00 61.11  ? 101 GLY M O   1 
ATOM   9125  N  N   . MET M  1 102 ? 65.808  18.980   61.953  1.00 33.64  ? 102 MET M N   1 
ATOM   9126  C  CA  . MET M  1 102 ? 65.526  17.739   62.655  1.00 35.84  ? 102 MET M CA  1 
ATOM   9127  C  C   . MET M  1 102 ? 66.308  16.577   62.085  1.00 53.15  ? 102 MET M C   1 
ATOM   9128  O  O   . MET M  1 102 ? 66.354  15.506   62.676  1.00 74.37  ? 102 MET M O   1 
ATOM   9129  C  CB  . MET M  1 102 ? 64.048  17.399   62.561  1.00 42.69  ? 102 MET M CB  1 
ATOM   9130  C  CG  . MET M  1 102 ? 63.159  18.376   63.252  1.00 53.63  ? 102 MET M CG  1 
ATOM   9131  S  SD  . MET M  1 102 ? 63.064  17.891   64.956  1.00 67.25  ? 102 MET M SD  1 
ATOM   9132  C  CE  . MET M  1 102 ? 62.381  16.261   64.804  1.00 47.89  ? 102 MET M CE  1 
ATOM   9133  N  N   . SER M  1 103 ? 66.908  16.770   60.923  1.00 45.24  ? 103 SER M N   1 
ATOM   9134  C  CA  . SER M  1 103 ? 67.620  15.680   60.281  1.00 54.29  ? 103 SER M CA  1 
ATOM   9135  C  C   . SER M  1 103 ? 68.966  16.143   59.761  1.00 68.04  ? 103 SER M C   1 
ATOM   9136  O  O   . SER M  1 103 ? 69.110  17.279   59.313  1.00 69.44  ? 103 SER M O   1 
ATOM   9137  C  CB  . SER M  1 103 ? 66.791  15.130   59.134  1.00 50.63  ? 103 SER M CB  1 
ATOM   9138  O  OG  . SER M  1 103 ? 67.405  14.004   58.550  1.00 75.54  ? 103 SER M OG  1 
ATOM   9139  N  N   . VAL M  1 104 ? 69.955  15.264   59.815  1.00 57.67  ? 104 VAL M N   1 
ATOM   9140  C  CA  . VAL M  1 104 ? 71.282  15.671   59.429  1.00 40.33  ? 104 VAL M CA  1 
ATOM   9141  C  C   . VAL M  1 104 ? 71.421  15.642   57.933  1.00 49.04  ? 104 VAL M C   1 
ATOM   9142  O  O   . VAL M  1 104 ? 71.090  14.655   57.292  1.00 52.73  ? 104 VAL M O   1 
ATOM   9143  C  CB  . VAL M  1 104 ? 72.373  14.796   60.049  1.00 43.80  ? 104 VAL M CB  1 
ATOM   9144  C  CG1 . VAL M  1 104 ? 73.736  15.254   59.556  1.00 48.74  ? 104 VAL M CG1 1 
ATOM   9145  C  CG2 . VAL M  1 104 ? 72.309  14.862   61.567  1.00 40.39  ? 104 VAL M CG2 1 
ATOM   9146  N  N   . ALA M  1 105 ? 71.927  16.740   57.386  1.00 50.92  ? 105 ALA M N   1 
ATOM   9147  C  CA  . ALA M  1 105 ? 72.221  16.837   55.964  1.00 42.78  ? 105 ALA M CA  1 
ATOM   9148  C  C   . ALA M  1 105 ? 73.657  16.454   55.689  1.00 55.71  ? 105 ALA M C   1 
ATOM   9149  O  O   . ALA M  1 105 ? 73.927  15.509   54.959  1.00 61.97  ? 105 ALA M O   1 
ATOM   9150  C  CB  . ALA M  1 105 ? 72.006  18.228   55.507  1.00 28.70  ? 105 ALA M CB  1 
ATOM   9151  N  N   . GLU M  1 106 ? 74.574  17.219   56.271  1.00 50.93  ? 106 GLU M N   1 
ATOM   9152  C  CA  . GLU M  1 106 ? 76.001  17.024   56.064  1.00 55.10  ? 106 GLU M CA  1 
ATOM   9153  C  C   . GLU M  1 106 ? 76.730  16.995   57.413  1.00 64.48  ? 106 GLU M C   1 
ATOM   9154  O  O   . GLU M  1 106 ? 76.315  17.644   58.375  1.00 47.65  ? 106 GLU M O   1 
ATOM   9155  C  CB  . GLU M  1 106 ? 76.562  18.138   55.163  1.00 59.91  ? 106 GLU M CB  1 
ATOM   9156  C  CG  . GLU M  1 106 ? 76.010  18.131   53.736  1.00 72.43  ? 106 GLU M CG  1 
ATOM   9157  C  CD  . GLU M  1 106 ? 76.418  19.350   52.912  1.00 94.68  ? 106 GLU M CD  1 
ATOM   9158  O  OE1 . GLU M  1 106 ? 76.000  19.440   51.732  1.00 106.38 ? 106 GLU M OE1 1 
ATOM   9159  O  OE2 . GLU M  1 106 ? 77.148  20.217   53.439  1.00 89.09  ? 106 GLU M OE2 1 
ATOM   9160  N  N   . CYS M  1 107 ? 77.814  16.229   57.481  1.00 60.60  ? 107 CYS M N   1 
ATOM   9161  C  CA  . CYS M  1 107 ? 78.585  16.115   58.711  1.00 41.76  ? 107 CYS M CA  1 
ATOM   9162  C  C   . CYS M  1 107 ? 79.866  16.897   58.575  1.00 48.37  ? 107 CYS M C   1 
ATOM   9163  O  O   . CYS M  1 107 ? 80.184  17.365   57.483  1.00 80.82  ? 107 CYS M O   1 
ATOM   9164  C  CB  . CYS M  1 107 ? 78.881  14.647   59.025  1.00 43.16  ? 107 CYS M CB  1 
ATOM   9165  S  SG  . CYS M  1 107 ? 77.593  13.822   60.045  1.00 79.86  ? 107 CYS M SG  1 
ATOM   9166  N  N   . GLY M  1 108 ? 80.605  17.059   59.668  1.00 48.57  ? 108 GLY M N   1 
ATOM   9167  C  CA  . GLY M  1 108 ? 81.872  17.770   59.570  1.00 65.23  ? 108 GLY M CA  1 
ATOM   9168  C  C   . GLY M  1 108 ? 82.676  17.911   60.843  1.00 57.58  ? 108 GLY M C   1 
ATOM   9169  O  O   . GLY M  1 108 ? 82.258  17.435   61.899  1.00 61.09  ? 108 GLY M O   1 
ATOM   9170  N  N   . CYS M  1 109 ? 83.830  18.574   60.734  1.00 41.41  ? 109 CYS M N   1 
ATOM   9171  C  CA  . CYS M  1 109 ? 84.738  18.755   61.871  1.00 49.06  ? 109 CYS M CA  1 
ATOM   9172  C  C   . CYS M  1 109 ? 84.894  20.221   62.244  1.00 48.14  ? 109 CYS M C   1 
ATOM   9173  O  O   . CYS M  1 109 ? 85.185  21.058   61.383  1.00 50.13  ? 109 CYS M O   1 
ATOM   9174  C  CB  . CYS M  1 109 ? 86.123  18.127   61.599  1.00 39.29  ? 109 CYS M CB  1 
ATOM   9175  S  SG  . CYS M  1 109 ? 86.197  16.298   61.729  1.00 78.87  ? 109 CYS M SG  1 
ATOM   9176  N  N   . ARG M  1 110 ? 84.723  20.516   63.534  1.00 51.97  ? 110 ARG M N   1 
ATOM   9177  C  CA  . ARG M  1 110 ? 84.705  21.895   64.010  1.00 64.53  ? 110 ARG M CA  1 
ATOM   9178  C  C   . ARG M  1 110 ? 85.380  22.042   65.377  1.00 76.13  ? 110 ARG M C   1 
ATOM   9179  O  O   . ARG M  1 110 ? 86.019  23.059   65.644  1.00 94.20  ? 110 ARG M O   1 
ATOM   9180  C  CB  . ARG M  1 110 ? 83.260  22.404   64.051  1.00 50.72  ? 110 ARG M CB  1 
ATOM   9181  C  CG  . ARG M  1 110 ? 82.477  22.185   62.737  1.00 18.67  ? 110 ARG M CG  1 
ATOM   9182  C  CD  . ARG M  1 110 ? 82.911  23.226   61.693  1.00 46.37  ? 110 ARG M CD  1 
ATOM   9183  N  NE  . ARG M  1 110 ? 82.110  23.242   60.462  1.00 31.17  ? 110 ARG M NE  1 
ATOM   9184  C  CZ  . ARG M  1 110 ? 82.397  22.524   59.378  1.00 50.63  ? 110 ARG M CZ  1 
ATOM   9185  N  NH1 . ARG M  1 110 ? 83.451  21.712   59.359  1.00 69.90  ? 110 ARG M NH1 1 
ATOM   9186  N  NH2 . ARG M  1 110 ? 81.625  22.608   58.311  1.00 64.86  ? 110 ARG M NH2 1 
ATOM   9187  O  OXT . ARG M  1 110 ? 85.329  21.155   66.238  1.00 64.17  ? 110 ARG M OXT 1 
ATOM   9188  N  N   . HIS N  1 7   ? 79.535  21.242   82.306  1.00 52.25  ? 7   HIS N N   1 
ATOM   9189  C  CA  . HIS N  1 7   ? 78.684  21.825   81.241  1.00 99.68  ? 7   HIS N CA  1 
ATOM   9190  C  C   . HIS N  1 7   ? 79.519  22.522   80.154  1.00 101.18 ? 7   HIS N C   1 
ATOM   9191  O  O   . HIS N  1 7   ? 80.737  22.379   80.138  1.00 117.35 ? 7   HIS N O   1 
ATOM   9192  C  CB  . HIS N  1 7   ? 77.587  22.762   81.794  1.00 31.30  ? 7   HIS N CB  1 
ATOM   9193  N  N   . CYS N  1 8   ? 78.870  23.295   79.279  1.00 69.90  ? 8   CYS N N   1 
ATOM   9194  C  CA  . CYS N  1 8   ? 79.450  23.695   77.981  1.00 64.10  ? 8   CYS N CA  1 
ATOM   9195  C  C   . CYS N  1 8   ? 79.716  25.190   77.819  1.00 64.54  ? 8   CYS N C   1 
ATOM   9196  O  O   . CYS N  1 8   ? 78.796  25.994   77.957  1.00 63.50  ? 8   CYS N O   1 
ATOM   9197  C  CB  . CYS N  1 8   ? 78.525  23.247   76.832  1.00 73.12  ? 8   CYS N CB  1 
ATOM   9198  S  SG  . CYS N  1 8   ? 78.900  23.943   75.156  1.00 95.17  ? 8   CYS N SG  1 
ATOM   9199  N  N   . GLN N  1 9   ? 80.955  25.544   77.462  1.00 61.10  ? 9   GLN N N   1 
ATOM   9200  C  CA  . GLN N  1 9   ? 81.381  26.945   77.428  1.00 62.04  ? 9   GLN N CA  1 
ATOM   9201  C  C   . GLN N  1 9   ? 82.628  27.211   76.573  1.00 64.24  ? 9   GLN N C   1 
ATOM   9202  O  O   . GLN N  1 9   ? 83.309  26.268   76.100  1.00 68.60  ? 9   GLN N O   1 
ATOM   9203  C  CB  . GLN N  1 9   ? 81.620  27.439   78.867  1.00 70.74  ? 9   GLN N CB  1 
ATOM   9204  C  CG  . GLN N  1 9   ? 82.294  26.392   79.754  1.00 70.22  ? 9   GLN N CG  1 
ATOM   9205  C  CD  . GLN N  1 9   ? 82.564  26.919   81.143  1.00 85.51  ? 9   GLN N CD  1 
ATOM   9206  O  OE1 . GLN N  1 9   ? 82.383  28.116   81.404  1.00 85.81  ? 9   GLN N OE1 1 
ATOM   9207  N  NE2 . GLN N  1 9   ? 82.996  26.032   82.051  1.00 99.78  ? 9   GLN N NE2 1 
ATOM   9208  N  N   . LYS N  1 10  ? 82.911  28.508   76.399  1.00 58.80  ? 10  LYS N N   1 
ATOM   9209  C  CA  . LYS N  1 10  ? 84.127  29.003   75.748  1.00 49.46  ? 10  LYS N CA  1 
ATOM   9210  C  C   . LYS N  1 10  ? 85.295  29.055   76.747  1.00 55.53  ? 10  LYS N C   1 
ATOM   9211  O  O   . LYS N  1 10  ? 85.132  29.506   77.880  1.00 55.57  ? 10  LYS N O   1 
ATOM   9212  C  CB  . LYS N  1 10  ? 83.884  30.401   75.165  1.00 41.22  ? 10  LYS N CB  1 
ATOM   9213  C  CG  . LYS N  1 10  ? 84.612  30.684   73.841  1.00 56.05  ? 10  LYS N CG  1 
ATOM   9214  C  CD  . LYS N  1 10  ? 85.118  32.142   73.720  1.00 59.71  ? 10  LYS N CD  1 
ATOM   9215  C  CE  . LYS N  1 10  ? 84.006  33.139   73.365  1.00 66.04  ? 10  LYS N CE  1 
ATOM   9216  N  NZ  . LYS N  1 10  ? 84.497  34.553   73.317  1.00 69.19  ? 10  LYS N NZ  1 
ATOM   9217  N  N   . THR N  1 11  ? 86.469  28.600   76.317  1.00 59.26  ? 11  THR N N   1 
ATOM   9218  C  CA  . THR N  1 11  ? 87.645  28.502   77.179  1.00 46.32  ? 11  THR N CA  1 
ATOM   9219  C  C   . THR N  1 11  ? 88.839  29.169   76.526  1.00 69.29  ? 11  THR N C   1 
ATOM   9220  O  O   . THR N  1 11  ? 88.926  29.241   75.296  1.00 86.10  ? 11  THR N O   1 
ATOM   9221  C  CB  . THR N  1 11  ? 88.011  27.038   77.396  1.00 64.03  ? 11  THR N CB  1 
ATOM   9222  O  OG1 . THR N  1 11  ? 87.015  26.432   78.226  1.00 72.21  ? 11  THR N OG1 1 
ATOM   9223  C  CG2 . THR N  1 11  ? 89.414  26.903   78.031  1.00 83.40  ? 11  THR N CG2 1 
ATOM   9224  N  N   . SER N  1 12  ? 89.772  29.651   77.333  1.00 54.42  ? 12  SER N N   1 
ATOM   9225  C  CA  . SER N  1 12  ? 90.971  30.221   76.749  1.00 55.68  ? 12  SER N CA  1 
ATOM   9226  C  C   . SER N  1 12  ? 91.796  29.108   76.093  1.00 72.56  ? 12  SER N C   1 
ATOM   9227  O  O   . SER N  1 12  ? 91.912  28.000   76.641  1.00 69.79  ? 12  SER N O   1 
ATOM   9228  C  CB  . SER N  1 12  ? 91.793  30.954   77.804  1.00 53.47  ? 12  SER N CB  1 
ATOM   9229  O  OG  . SER N  1 12  ? 93.039  31.383   77.272  1.00 71.49  ? 12  SER N OG  1 
ATOM   9230  N  N   . LEU N  1 13  ? 92.335  29.395   74.906  1.00 78.12  ? 13  LEU N N   1 
ATOM   9231  C  CA  . LEU N  1 13  ? 93.330  28.520   74.294  1.00 63.70  ? 13  LEU N CA  1 
ATOM   9232  C  C   . LEU N  1 13  ? 94.427  29.363   73.620  1.00 63.97  ? 13  LEU N C   1 
ATOM   9233  O  O   . LEU N  1 13  ? 94.318  29.759   72.449  1.00 88.47  ? 13  LEU N O   1 
ATOM   9234  C  CB  . LEU N  1 13  ? 92.658  27.565   73.306  1.00 46.75  ? 13  LEU N CB  1 
ATOM   9235  C  CG  . LEU N  1 13  ? 93.600  26.559   72.657  1.00 56.99  ? 13  LEU N CG  1 
ATOM   9236  C  CD1 . LEU N  1 13  ? 94.260  25.651   73.685  1.00 39.49  ? 13  LEU N CD1 1 
ATOM   9237  C  CD2 . LEU N  1 13  ? 92.829  25.734   71.668  1.00 70.25  ? 13  LEU N CD2 1 
ATOM   9238  N  N   . ARG N  1 14  ? 95.464  29.679   74.376  1.00 55.72  ? 14  ARG N N   1 
ATOM   9239  C  CA  . ARG N  1 14  ? 96.576  30.403   73.800  1.00 74.83  ? 14  ARG N CA  1 
ATOM   9240  C  C   . ARG N  1 14  ? 97.367  29.443   72.908  1.00 68.02  ? 14  ARG N C   1 
ATOM   9241  O  O   . ARG N  1 14  ? 98.110  28.567   73.392  1.00 65.32  ? 14  ARG N O   1 
ATOM   9242  C  CB  . ARG N  1 14  ? 97.478  31.013   74.891  1.00 80.73  ? 14  ARG N CB  1 
ATOM   9243  C  CG  . ARG N  1 14  ? 96.749  31.941   75.866  1.00 74.44  ? 14  ARG N CG  1 
ATOM   9244  C  CD  . ARG N  1 14  ? 96.063  33.055   75.122  1.00 81.08  ? 14  ARG N CD  1 
ATOM   9245  N  NE  . ARG N  1 14  ? 95.475  34.076   75.994  1.00 92.56  ? 14  ARG N NE  1 
ATOM   9246  C  CZ  . ARG N  1 14  ? 96.169  34.931   76.750  1.00 93.13  ? 14  ARG N CZ  1 
ATOM   9247  N  NH1 . ARG N  1 14  ? 97.504  34.875   76.787  1.00 80.65  ? 14  ARG N NH1 1 
ATOM   9248  N  NH2 . ARG N  1 14  ? 95.523  35.838   77.487  1.00 76.17  ? 14  ARG N NH2 1 
ATOM   9249  N  N   . VAL N  1 15  ? 97.189  29.598   71.602  1.00 56.48  ? 15  VAL N N   1 
ATOM   9250  C  CA  . VAL N  1 15  ? 97.990  28.834   70.663  1.00 49.08  ? 15  VAL N CA  1 
ATOM   9251  C  C   . VAL N  1 15  ? 99.272  29.579   70.367  1.00 60.02  ? 15  VAL N C   1 
ATOM   9252  O  O   . VAL N  1 15  ? 99.255  30.778   70.052  1.00 61.53  ? 15  VAL N O   1 
ATOM   9253  C  CB  . VAL N  1 15  ? 97.280  28.621   69.338  1.00 63.30  ? 15  VAL N CB  1 
ATOM   9254  C  CG1 . VAL N  1 15  ? 98.228  27.897   68.358  1.00 53.97  ? 15  VAL N CG1 1 
ATOM   9255  C  CG2 . VAL N  1 15  ? 95.972  27.852   69.556  1.00 60.84  ? 15  VAL N CG2 1 
ATOM   9256  N  N   . ASN N  1 16  ? 100.379 28.857   70.478  1.00 63.95  ? 16  ASN N N   1 
ATOM   9257  C  CA  . ASN N  1 16  ? 101.687 29.407   70.179  1.00 67.12  ? 16  ASN N CA  1 
ATOM   9258  C  C   . ASN N  1 16  ? 102.151 28.787   68.873  1.00 77.80  ? 16  ASN N C   1 
ATOM   9259  O  O   . ASN N  1 16  ? 102.407 27.571   68.807  1.00 80.22  ? 16  ASN N O   1 
ATOM   9260  C  CB  . ASN N  1 16  ? 102.660 29.056   71.303  1.00 69.60  ? 16  ASN N CB  1 
ATOM   9261  C  CG  . ASN N  1 16  ? 104.044 29.605   71.066  1.00 80.06  ? 16  ASN N CG  1 
ATOM   9262  O  OD1 . ASN N  1 16  ? 104.478 29.784   69.925  1.00 88.74  ? 16  ASN N OD1 1 
ATOM   9263  N  ND2 . ASN N  1 16  ? 104.754 29.878   72.150  1.00 92.19  ? 16  ASN N ND2 1 
ATOM   9264  N  N   . PHE N  1 17  ? 102.255 29.610   67.834  1.00 53.09  ? 17  PHE N N   1 
ATOM   9265  C  CA  . PHE N  1 17  ? 102.601 29.094   66.510  1.00 66.80  ? 17  PHE N CA  1 
ATOM   9266  C  C   . PHE N  1 17  ? 103.856 28.208   66.481  1.00 76.92  ? 17  PHE N C   1 
ATOM   9267  O  O   . PHE N  1 17  ? 103.883 27.188   65.768  1.00 63.57  ? 17  PHE N O   1 
ATOM   9268  C  CB  . PHE N  1 17  ? 102.720 30.231   65.502  1.00 65.01  ? 17  PHE N CB  1 
ATOM   9269  C  CG  . PHE N  1 17  ? 101.410 30.858   65.167  1.00 62.19  ? 17  PHE N CG  1 
ATOM   9270  C  CD1 . PHE N  1 17  ? 100.433 30.120   64.518  1.00 47.61  ? 17  PHE N CD1 1 
ATOM   9271  C  CD2 . PHE N  1 17  ? 101.152 32.180   65.508  1.00 64.08  ? 17  PHE N CD2 1 
ATOM   9272  C  CE1 . PHE N  1 17  ? 99.228  30.679   64.220  1.00 45.65  ? 17  PHE N CE1 1 
ATOM   9273  C  CE2 . PHE N  1 17  ? 99.944  32.740   65.218  1.00 71.81  ? 17  PHE N CE2 1 
ATOM   9274  C  CZ  . PHE N  1 17  ? 98.968  31.982   64.573  1.00 55.24  ? 17  PHE N CZ  1 
ATOM   9275  N  N   . GLU N  1 18  ? 104.877 28.593   67.254  1.00 63.43  ? 18  GLU N N   1 
ATOM   9276  C  CA  . GLU N  1 18  ? 106.093 27.793   67.375  1.00 63.90  ? 18  GLU N CA  1 
ATOM   9277  C  C   . GLU N  1 18  ? 105.738 26.348   67.744  1.00 76.87  ? 18  GLU N C   1 
ATOM   9278  O  O   . GLU N  1 18  ? 106.340 25.392   67.222  1.00 57.38  ? 18  GLU N O   1 
ATOM   9279  C  CB  . GLU N  1 18  ? 107.035 28.391   68.423  1.00 71.81  ? 18  GLU N CB  1 
ATOM   9280  C  CG  . GLU N  1 18  ? 108.450 27.830   68.398  1.00 70.22  ? 18  GLU N CG  1 
ATOM   9281  C  CD  . GLU N  1 18  ? 109.379 28.549   69.363  1.00 101.39 ? 18  GLU N CD  1 
ATOM   9282  O  OE1 . GLU N  1 18  ? 110.614 28.472   69.178  1.00 115.87 ? 18  GLU N OE1 1 
ATOM   9283  O  OE2 . GLU N  1 18  ? 108.878 29.190   70.312  1.00 110.75 ? 18  GLU N OE2 1 
ATOM   9284  N  N   . ASP N  1 19  ? 104.750 26.198   68.633  1.00 83.48  ? 19  ASP N N   1 
ATOM   9285  C  CA  . ASP N  1 19  ? 104.345 24.878   69.137  1.00 81.03  ? 19  ASP N CA  1 
ATOM   9286  C  C   . ASP N  1 19  ? 103.817 23.974   68.014  1.00 69.41  ? 19  ASP N C   1 
ATOM   9287  O  O   . ASP N  1 19  ? 104.002 22.746   68.055  1.00 63.48  ? 19  ASP N O   1 
ATOM   9288  C  CB  . ASP N  1 19  ? 103.299 24.996   70.267  1.00 69.24  ? 19  ASP N CB  1 
ATOM   9289  C  CG  . ASP N  1 19  ? 103.922 25.286   71.634  1.00 89.73  ? 19  ASP N CG  1 
ATOM   9290  O  OD1 . ASP N  1 19  ? 105.141 25.050   71.811  1.00 96.68  ? 19  ASP N OD1 1 
ATOM   9291  O  OD2 . ASP N  1 19  ? 103.190 25.746   72.536  1.00 84.32  ? 19  ASP N OD2 1 
ATOM   9292  N  N   . ILE N  1 20  ? 103.159 24.578   67.016  1.00 50.24  ? 20  ILE N N   1 
ATOM   9293  C  CA  . ILE N  1 20  ? 102.687 23.786   65.876  1.00 54.10  ? 20  ILE N CA  1 
ATOM   9294  C  C   . ILE N  1 20  ? 103.529 24.004   64.623  1.00 64.32  ? 20  ILE N C   1 
ATOM   9295  O  O   . ILE N  1 20  ? 103.094 23.670   63.508  1.00 57.52  ? 20  ILE N O   1 
ATOM   9296  C  CB  . ILE N  1 20  ? 101.189 24.020   65.540  1.00 49.15  ? 20  ILE N CB  1 
ATOM   9297  C  CG1 . ILE N  1 20  ? 100.926 25.481   65.206  1.00 63.48  ? 20  ILE N CG1 1 
ATOM   9298  C  CG2 . ILE N  1 20  ? 100.293 23.556   66.687  1.00 44.61  ? 20  ILE N CG2 1 
ATOM   9299  C  CD1 . ILE N  1 20  ? 99.480  25.758   64.853  1.00 51.26  ? 20  ILE N CD1 1 
ATOM   9300  N  N   . GLY N  1 21  ? 104.728 24.560   64.815  1.00 67.99  ? 21  GLY N N   1 
ATOM   9301  C  CA  . GLY N  1 21  ? 105.688 24.733   63.739  1.00 78.08  ? 21  GLY N CA  1 
ATOM   9302  C  C   . GLY N  1 21  ? 105.249 25.700   62.646  1.00 81.12  ? 21  GLY N C   1 
ATOM   9303  O  O   . GLY N  1 21  ? 105.644 25.569   61.483  1.00 72.49  ? 21  GLY N O   1 
ATOM   9304  N  N   . TRP N  1 22  ? 104.424 26.674   63.004  1.00 53.74  ? 22  TRP N N   1 
ATOM   9305  C  CA  . TRP N  1 22  ? 104.072 27.707   62.054  1.00 53.53  ? 22  TRP N CA  1 
ATOM   9306  C  C   . TRP N  1 22  ? 104.980 28.941   62.196  1.00 70.23  ? 22  TRP N C   1 
ATOM   9307  O  O   . TRP N  1 22  ? 104.867 29.938   61.452  1.00 57.52  ? 22  TRP N O   1 
ATOM   9308  C  CB  . TRP N  1 22  ? 102.601 28.060   62.196  1.00 56.82  ? 22  TRP N CB  1 
ATOM   9309  C  CG  . TRP N  1 22  ? 101.719 27.003   61.625  1.00 70.01  ? 22  TRP N CG  1 
ATOM   9310  C  CD1 . TRP N  1 22  ? 102.087 25.742   61.238  1.00 84.70  ? 22  TRP N CD1 1 
ATOM   9311  C  CD2 . TRP N  1 22  ? 100.323 27.114   61.358  1.00 54.60  ? 22  TRP N CD2 1 
ATOM   9312  N  NE1 . TRP N  1 22  ? 100.999 25.060   60.756  1.00 73.51  ? 22  TRP N NE1 1 
ATOM   9313  C  CE2 . TRP N  1 22  ? 99.904  25.877   60.818  1.00 44.50  ? 22  TRP N CE2 1 
ATOM   9314  C  CE3 . TRP N  1 22  ? 99.382  28.138   61.532  1.00 54.43  ? 22  TRP N CE3 1 
ATOM   9315  C  CZ2 . TRP N  1 22  ? 98.585  25.638   60.442  1.00 60.51  ? 22  TRP N CZ2 1 
ATOM   9316  C  CZ3 . TRP N  1 22  ? 98.065  27.902   61.163  1.00 46.79  ? 22  TRP N CZ3 1 
ATOM   9317  C  CH2 . TRP N  1 22  ? 97.679  26.656   60.622  1.00 56.41  ? 22  TRP N CH2 1 
ATOM   9318  N  N   . ASP N  1 23  ? 105.896 28.861   63.151  1.00 66.73  ? 23  ASP N N   1 
ATOM   9319  C  CA  . ASP N  1 23  ? 106.826 29.939   63.378  1.00 77.33  ? 23  ASP N CA  1 
ATOM   9320  C  C   . ASP N  1 23  ? 107.684 30.161   62.128  1.00 85.16  ? 23  ASP N C   1 
ATOM   9321  O  O   . ASP N  1 23  ? 108.382 31.180   61.993  1.00 96.87  ? 23  ASP N O   1 
ATOM   9322  C  CB  . ASP N  1 23  ? 107.700 29.620   64.586  1.00 85.20  ? 23  ASP N CB  1 
ATOM   9323  C  CG  . ASP N  1 23  ? 108.419 28.301   64.452  1.00 96.13  ? 23  ASP N CG  1 
ATOM   9324  O  OD1 . ASP N  1 23  ? 107.828 27.376   63.859  1.00 89.85  ? 23  ASP N OD1 1 
ATOM   9325  O  OD2 . ASP N  1 23  ? 109.572 28.190   64.939  1.00 108.32 ? 23  ASP N OD2 1 
ATOM   9326  N  N   . SER N  1 24  ? 107.623 29.200   61.212  1.00 67.67  ? 24  SER N N   1 
ATOM   9327  C  CA  . SER N  1 24  ? 108.376 29.281   59.966  1.00 71.85  ? 24  SER N CA  1 
ATOM   9328  C  C   . SER N  1 24  ? 107.888 30.393   59.028  1.00 68.36  ? 24  SER N C   1 
ATOM   9329  O  O   . SER N  1 24  ? 108.653 30.880   58.197  1.00 80.35  ? 24  SER N O   1 
ATOM   9330  C  CB  . SER N  1 24  ? 108.262 27.963   59.224  1.00 66.39  ? 24  SER N CB  1 
ATOM   9331  O  OG  . SER N  1 24  ? 106.966 27.876   58.648  1.00 75.05  ? 24  SER N OG  1 
ATOM   9332  N  N   . TRP N  1 25  ? 106.624 30.779   59.152  1.00 61.34  ? 25  TRP N N   1 
ATOM   9333  C  CA  . TRP N  1 25  ? 106.061 31.742   58.230  1.00 70.57  ? 25  TRP N CA  1 
ATOM   9334  C  C   . TRP N  1 25  ? 105.132 32.765   58.892  1.00 78.01  ? 25  TRP N C   1 
ATOM   9335  O  O   . TRP N  1 25  ? 104.806 33.788   58.279  1.00 82.01  ? 25  TRP N O   1 
ATOM   9336  C  CB  . TRP N  1 25  ? 105.337 31.008   57.108  1.00 72.88  ? 25  TRP N CB  1 
ATOM   9337  C  CG  . TRP N  1 25  ? 104.202 30.176   57.604  1.00 64.76  ? 25  TRP N CG  1 
ATOM   9338  C  CD1 . TRP N  1 25  ? 104.284 28.966   58.223  1.00 78.82  ? 25  TRP N CD1 1 
ATOM   9339  C  CD2 . TRP N  1 25  ? 102.815 30.494   57.521  1.00 52.71  ? 25  TRP N CD2 1 
ATOM   9340  N  NE1 . TRP N  1 25  ? 103.026 28.504   58.532  1.00 81.16  ? 25  TRP N NE1 1 
ATOM   9341  C  CE2 . TRP N  1 25  ? 102.104 29.420   58.116  1.00 58.20  ? 25  TRP N CE2 1 
ATOM   9342  C  CE3 . TRP N  1 25  ? 102.107 31.571   56.996  1.00 51.83  ? 25  TRP N CE3 1 
ATOM   9343  C  CZ2 . TRP N  1 25  ? 100.715 29.385   58.195  1.00 61.42  ? 25  TRP N CZ2 1 
ATOM   9344  C  CZ3 . TRP N  1 25  ? 100.715 31.548   57.077  1.00 62.95  ? 25  TRP N CZ3 1 
ATOM   9345  C  CH2 . TRP N  1 25  ? 100.030 30.449   57.673  1.00 66.46  ? 25  TRP N CH2 1 
ATOM   9346  N  N   . ILE N  1 26  ? 104.695 32.501   60.125  1.00 61.61  ? 26  ILE N N   1 
ATOM   9347  C  CA  . ILE N  1 26  ? 103.965 33.531   60.866  1.00 56.91  ? 26  ILE N CA  1 
ATOM   9348  C  C   . ILE N  1 26  ? 104.990 34.369   61.601  1.00 76.22  ? 26  ILE N C   1 
ATOM   9349  O  O   . ILE N  1 26  ? 105.707 33.862   62.496  1.00 75.66  ? 26  ILE N O   1 
ATOM   9350  C  CB  . ILE N  1 26  ? 102.988 32.973   61.917  1.00 67.81  ? 26  ILE N CB  1 
ATOM   9351  C  CG1 . ILE N  1 26  ? 102.040 31.936   61.305  1.00 51.68  ? 26  ILE N CG1 1 
ATOM   9352  C  CG2 . ILE N  1 26  ? 102.230 34.128   62.581  1.00 66.67  ? 26  ILE N CG2 1 
ATOM   9353  C  CD1 . ILE N  1 26  ? 101.445 32.397   60.040  1.00 56.03  ? 26  ILE N CD1 1 
ATOM   9354  N  N   . ILE N  1 27  ? 105.073 35.641   61.209  1.00 71.42  ? 27  ILE N N   1 
ATOM   9355  C  CA  . ILE N  1 27  ? 106.018 36.565   61.821  1.00 68.24  ? 27  ILE N CA  1 
ATOM   9356  C  C   . ILE N  1 27  ? 105.383 37.107   63.094  1.00 73.05  ? 27  ILE N C   1 
ATOM   9357  O  O   . ILE N  1 27  ? 106.064 37.212   64.129  1.00 65.17  ? 27  ILE N O   1 
ATOM   9358  C  CB  . ILE N  1 27  ? 106.373 37.721   60.876  1.00 76.96  ? 27  ILE N CB  1 
ATOM   9359  C  CG1 . ILE N  1 27  ? 106.852 37.171   59.527  1.00 77.27  ? 27  ILE N CG1 1 
ATOM   9360  C  CG2 . ILE N  1 27  ? 107.434 38.648   61.522  1.00 69.49  ? 27  ILE N CG2 1 
ATOM   9361  C  CD1 . ILE N  1 27  ? 107.002 38.240   58.455  1.00 87.32  ? 27  ILE N CD1 1 
ATOM   9362  N  N   . ALA N  1 28  ? 104.087 37.433   63.008  1.00 60.89  ? 28  ALA N N   1 
ATOM   9363  C  CA  . ALA N  1 28  ? 103.328 37.921   64.149  1.00 59.69  ? 28  ALA N CA  1 
ATOM   9364  C  C   . ALA N  1 28  ? 101.846 37.577   64.028  1.00 60.16  ? 28  ALA N C   1 
ATOM   9365  O  O   . ALA N  1 28  ? 101.272 37.536   62.925  1.00 64.22  ? 28  ALA N O   1 
ATOM   9366  C  CB  . ALA N  1 28  ? 103.506 39.409   64.307  1.00 61.61  ? 28  ALA N CB  1 
ATOM   9367  N  N   . PRO N  1 29  ? 101.202 37.331   65.175  1.00 64.91  ? 29  PRO N N   1 
ATOM   9368  C  CA  . PRO N  1 29  ? 101.811 37.384   66.513  1.00 60.34  ? 29  PRO N CA  1 
ATOM   9369  C  C   . PRO N  1 29  ? 102.627 36.138   66.741  1.00 61.51  ? 29  PRO N C   1 
ATOM   9370  O  O   . PRO N  1 29  ? 102.616 35.283   65.848  1.00 64.54  ? 29  PRO N O   1 
ATOM   9371  C  CB  . PRO N  1 29  ? 100.593 37.312   67.429  1.00 76.39  ? 29  PRO N CB  1 
ATOM   9372  C  CG  . PRO N  1 29  ? 99.621  36.447   66.658  1.00 51.58  ? 29  PRO N CG  1 
ATOM   9373  C  CD  . PRO N  1 29  ? 99.790  36.907   65.224  1.00 51.81  ? 29  PRO N CD  1 
ATOM   9374  N  N   . LYS N  1 30  ? 103.272 36.009   67.901  1.00 58.88  ? 30  LYS N N   1 
ATOM   9375  C  CA  . LYS N  1 30  ? 103.975 34.768   68.217  1.00 59.30  ? 30  LYS N CA  1 
ATOM   9376  C  C   . LYS N  1 30  ? 103.012 33.739   68.836  1.00 72.63  ? 30  LYS N C   1 
ATOM   9377  O  O   . LYS N  1 30  ? 103.166 32.511   68.641  1.00 68.53  ? 30  LYS N O   1 
ATOM   9378  C  CB  . LYS N  1 30  ? 105.161 35.023   69.118  1.00 62.42  ? 30  LYS N CB  1 
ATOM   9379  C  CG  . LYS N  1 30  ? 106.246 35.876   68.482  1.00 72.29  ? 30  LYS N CG  1 
ATOM   9380  C  CD  . LYS N  1 30  ? 106.853 35.285   67.194  1.00 87.87  ? 30  LYS N CD  1 
ATOM   9381  C  CE  . LYS N  1 30  ? 107.918 36.263   66.603  1.00 100.28 ? 30  LYS N CE  1 
ATOM   9382  N  NZ  . LYS N  1 30  ? 108.447 35.882   65.249  1.00 99.59  ? 30  LYS N NZ  1 
ATOM   9383  N  N   . GLU N  1 31  ? 102.026 34.243   69.583  1.00 55.35  ? 31  GLU N N   1 
ATOM   9384  C  CA  . GLU N  1 31  ? 100.909 33.406   70.023  1.00 55.16  ? 31  GLU N CA  1 
ATOM   9385  C  C   . GLU N  1 31  ? 99.657  34.255   70.029  1.00 57.53  ? 31  GLU N C   1 
ATOM   9386  O  O   . GLU N  1 31  ? 99.741  35.484   70.017  1.00 73.59  ? 31  GLU N O   1 
ATOM   9387  C  CB  . GLU N  1 31  ? 101.151 32.749   71.392  1.00 73.80  ? 31  GLU N CB  1 
ATOM   9388  C  CG  . GLU N  1 31  ? 100.981 33.669   72.616  1.00 96.56  ? 31  GLU N CG  1 
ATOM   9389  C  CD  . GLU N  1 31  ? 101.279 32.947   73.944  1.00 116.93 ? 31  GLU N CD  1 
ATOM   9390  O  OE1 . GLU N  1 31  ? 100.717 33.356   74.984  1.00 131.82 ? 31  GLU N OE1 1 
ATOM   9391  O  OE2 . GLU N  1 31  ? 102.077 31.976   73.951  1.00 98.70  ? 31  GLU N OE2 1 
ATOM   9392  N  N   . TYR N  1 32  ? 98.498  33.600   70.015  1.00 54.54  ? 32  TYR N N   1 
ATOM   9393  C  CA  . TYR N  1 32  ? 97.216  34.303   69.893  1.00 47.67  ? 32  TYR N CA  1 
ATOM   9394  C  C   . TYR N  1 32  ? 96.120  33.485   70.571  1.00 68.16  ? 32  TYR N C   1 
ATOM   9395  O  O   . TYR N  1 32  ? 96.244  32.249   70.784  1.00 60.15  ? 32  TYR N O   1 
ATOM   9396  C  CB  . TYR N  1 32  ? 96.840  34.515   68.423  1.00 45.68  ? 32  TYR N CB  1 
ATOM   9397  C  CG  . TYR N  1 32  ? 96.145  33.312   67.791  1.00 43.99  ? 32  TYR N CG  1 
ATOM   9398  C  CD1 . TYR N  1 32  ? 96.877  32.217   67.307  1.00 43.44  ? 32  TYR N CD1 1 
ATOM   9399  C  CD2 . TYR N  1 32  ? 94.754  33.267   67.696  1.00 41.02  ? 32  TYR N CD2 1 
ATOM   9400  C  CE1 . TYR N  1 32  ? 96.233  31.131   66.738  1.00 70.87  ? 32  TYR N CE1 1 
ATOM   9401  C  CE2 . TYR N  1 32  ? 94.090  32.183   67.113  1.00 40.54  ? 32  TYR N CE2 1 
ATOM   9402  C  CZ  . TYR N  1 32  ? 94.833  31.113   66.641  1.00 72.97  ? 32  TYR N CZ  1 
ATOM   9403  O  OH  . TYR N  1 32  ? 94.191  30.018   66.078  1.00 46.92  ? 32  TYR N OH  1 
ATOM   9404  N  N   . GLU N  1 33  ? 95.035  34.181   70.892  1.00 58.12  ? 33  GLU N N   1 
ATOM   9405  C  CA  . GLU N  1 33  ? 93.921  33.552   71.578  1.00 55.28  ? 33  GLU N CA  1 
ATOM   9406  C  C   . GLU N  1 33  ? 92.956  32.911   70.604  1.00 58.61  ? 33  GLU N C   1 
ATOM   9407  O  O   . GLU N  1 33  ? 92.093  33.580   70.047  1.00 68.55  ? 33  GLU N O   1 
ATOM   9408  C  CB  . GLU N  1 33  ? 93.161  34.568   72.448  1.00 60.35  ? 33  GLU N CB  1 
ATOM   9409  C  CG  . GLU N  1 33  ? 91.916  33.972   73.150  1.00 60.59  ? 33  GLU N CG  1 
ATOM   9410  C  CD  . GLU N  1 33  ? 92.260  33.042   74.318  1.00 79.60  ? 33  GLU N CD  1 
ATOM   9411  O  OE1 . GLU N  1 33  ? 92.333  33.526   75.469  1.00 86.90  ? 33  GLU N OE1 1 
ATOM   9412  O  OE2 . GLU N  1 33  ? 92.455  31.830   74.092  1.00 83.28  ? 33  GLU N OE2 1 
ATOM   9413  N  N   . ALA N  1 34  ? 93.093  31.613   70.391  1.00 73.45  ? 34  ALA N N   1 
ATOM   9414  C  CA  . ALA N  1 34  ? 92.001  30.892   69.770  1.00 68.31  ? 34  ALA N CA  1 
ATOM   9415  C  C   . ALA N  1 34  ? 91.246  30.439   70.979  1.00 76.40  ? 34  ALA N C   1 
ATOM   9416  O  O   . ALA N  1 34  ? 91.809  30.318   72.080  1.00 120.11 ? 34  ALA N O   1 
ATOM   9417  C  CB  . ALA N  1 34  ? 92.520  29.695   68.999  1.00 70.34  ? 34  ALA N CB  1 
ATOM   9418  N  N   . TYR N  1 35  ? 89.974  30.171   70.835  1.00 51.52  ? 35  TYR N N   1 
ATOM   9419  C  CA  . TYR N  1 35  ? 89.369  29.606   72.014  1.00 72.77  ? 35  TYR N CA  1 
ATOM   9420  C  C   . TYR N  1 35  ? 89.245  28.110   71.908  1.00 73.73  ? 35  TYR N C   1 
ATOM   9421  O  O   . TYR N  1 35  ? 89.637  27.526   70.904  1.00 81.66  ? 35  TYR N O   1 
ATOM   9422  C  CB  . TYR N  1 35  ? 88.047  30.267   72.315  1.00 82.21  ? 35  TYR N CB  1 
ATOM   9423  C  CG  . TYR N  1 35  ? 88.240  31.688   72.758  1.00 80.05  ? 35  TYR N CG  1 
ATOM   9424  C  CD1 . TYR N  1 35  ? 88.129  32.730   71.860  1.00 72.86  ? 35  TYR N CD1 1 
ATOM   9425  C  CD2 . TYR N  1 35  ? 88.560  31.986   74.072  1.00 73.22  ? 35  TYR N CD2 1 
ATOM   9426  C  CE1 . TYR N  1 35  ? 88.309  34.037   72.262  1.00 73.40  ? 35  TYR N CE1 1 
ATOM   9427  C  CE2 . TYR N  1 35  ? 88.745  33.284   74.481  1.00 62.66  ? 35  TYR N CE2 1 
ATOM   9428  C  CZ  . TYR N  1 35  ? 88.621  34.314   73.573  1.00 61.35  ? 35  TYR N CZ  1 
ATOM   9429  O  OH  . TYR N  1 35  ? 88.807  35.626   73.979  1.00 63.19  ? 35  TYR N OH  1 
ATOM   9430  N  N   . GLU N  1 36  ? 88.743  27.494   72.970  1.00 68.39  ? 36  GLU N N   1 
ATOM   9431  C  CA  . GLU N  1 36  ? 88.384  26.082   72.947  1.00 75.44  ? 36  GLU N CA  1 
ATOM   9432  C  C   . GLU N  1 36  ? 86.886  26.005   73.281  1.00 70.14  ? 36  GLU N C   1 
ATOM   9433  O  O   . GLU N  1 36  ? 86.335  26.881   73.968  1.00 48.87  ? 36  GLU N O   1 
ATOM   9434  C  CB  . GLU N  1 36  ? 89.231  25.282   73.956  1.00 73.10  ? 36  GLU N CB  1 
ATOM   9435  C  CG  . GLU N  1 36  ? 89.155  23.770   73.791  1.00 90.11  ? 36  GLU N CG  1 
ATOM   9436  C  CD  . GLU N  1 36  ? 90.178  23.039   74.656  1.00 119.30 ? 36  GLU N CD  1 
ATOM   9437  O  OE1 . GLU N  1 36  ? 90.868  23.710   75.461  1.00 119.75 ? 36  GLU N OE1 1 
ATOM   9438  O  OE2 . GLU N  1 36  ? 90.294  21.795   74.526  1.00 117.68 ? 36  GLU N OE2 1 
ATOM   9439  N  N   . CYS N  1 37  ? 86.204  24.988   72.773  1.00 62.66  ? 37  CYS N N   1 
ATOM   9440  C  CA  . CYS N  1 37  ? 84.848  24.750   73.233  1.00 48.66  ? 37  CYS N CA  1 
ATOM   9441  C  C   . CYS N  1 37  ? 84.843  23.497   74.108  1.00 59.61  ? 37  CYS N C   1 
ATOM   9442  O  O   . CYS N  1 37  ? 84.974  22.380   73.613  1.00 63.09  ? 37  CYS N O   1 
ATOM   9443  C  CB  . CYS N  1 37  ? 83.888  24.662   72.055  1.00 49.72  ? 37  CYS N CB  1 
ATOM   9444  S  SG  . CYS N  1 37  ? 83.438  26.308   71.378  1.00 75.27  ? 37  CYS N SG  1 
ATOM   9445  N  N   . LYS N  1 38  ? 84.745  23.704   75.421  1.00 66.59  ? 38  LYS N N   1 
ATOM   9446  C  CA  . LYS N  1 38  ? 84.900  22.611   76.381  1.00 47.64  ? 38  LYS N CA  1 
ATOM   9447  C  C   . LYS N  1 38  ? 83.576  22.417   77.075  1.00 60.27  ? 38  LYS N C   1 
ATOM   9448  O  O   . LYS N  1 38  ? 82.817  23.376   77.262  1.00 56.59  ? 38  LYS N O   1 
ATOM   9449  C  CB  . LYS N  1 38  ? 85.955  22.945   77.449  1.00 42.17  ? 38  LYS N CB  1 
ATOM   9450  C  CG  . LYS N  1 38  ? 87.345  22.365   77.237  1.00 65.17  ? 38  LYS N CG  1 
ATOM   9451  C  CD  . LYS N  1 38  ? 88.330  22.785   78.350  1.00 75.09  ? 38  LYS N CD  1 
ATOM   9452  N  N   . GLY N  1 39  ? 83.297  21.180   77.468  1.00 57.80  ? 39  GLY N N   1 
ATOM   9453  C  CA  . GLY N  1 39  ? 82.144  20.925   78.307  1.00 59.31  ? 39  GLY N CA  1 
ATOM   9454  C  C   . GLY N  1 39  ? 81.084  20.061   77.685  1.00 64.86  ? 39  GLY N C   1 
ATOM   9455  O  O   . GLY N  1 39  ? 81.126  19.738   76.493  1.00 82.89  ? 39  GLY N O   1 
ATOM   9456  N  N   . GLY N  1 40  ? 80.118  19.684   78.511  1.00 63.76  ? 40  GLY N N   1 
ATOM   9457  C  CA  . GLY N  1 40  ? 79.091  18.745   78.100  1.00 67.38  ? 40  GLY N CA  1 
ATOM   9458  C  C   . GLY N  1 40  ? 77.765  19.404   77.795  1.00 67.54  ? 40  GLY N C   1 
ATOM   9459  O  O   . GLY N  1 40  ? 77.440  20.496   78.290  1.00 64.47  ? 40  GLY N O   1 
ATOM   9460  N  N   . CYS N  1 41  ? 76.993  18.729   76.962  1.00 58.01  ? 41  CYS N N   1 
ATOM   9461  C  CA  . CYS N  1 41  ? 75.686  19.218   76.607  1.00 56.94  ? 41  CYS N CA  1 
ATOM   9462  C  C   . CYS N  1 41  ? 74.685  18.423   77.413  1.00 74.47  ? 41  CYS N C   1 
ATOM   9463  O  O   . CYS N  1 41  ? 74.272  17.330   77.016  1.00 87.06  ? 41  CYS N O   1 
ATOM   9464  C  CB  . CYS N  1 41  ? 75.474  19.057   75.110  1.00 69.04  ? 41  CYS N CB  1 
ATOM   9465  S  SG  . CYS N  1 41  ? 76.718  19.987   74.155  1.00 104.98 ? 41  CYS N SG  1 
ATOM   9466  N  N   . PHE N  1 42  ? 74.314  18.977   78.561  1.00 73.15  ? 42  PHE N N   1 
ATOM   9467  C  CA  . PHE N  1 42  ? 73.522  18.251   79.537  1.00 74.73  ? 42  PHE N CA  1 
ATOM   9468  C  C   . PHE N  1 42  ? 72.109  18.757   79.556  1.00 81.11  ? 42  PHE N C   1 
ATOM   9469  O  O   . PHE N  1 42  ? 71.872  19.970   79.586  1.00 105.39 ? 42  PHE N O   1 
ATOM   9470  C  CB  . PHE N  1 42  ? 74.129  18.415   80.922  1.00 85.61  ? 42  PHE N CB  1 
ATOM   9471  C  CG  . PHE N  1 42  ? 75.488  17.798   81.060  1.00 83.86  ? 42  PHE N CG  1 
ATOM   9472  C  CD1 . PHE N  1 42  ? 76.593  18.579   81.385  1.00 78.83  ? 42  PHE N CD1 1 
ATOM   9473  C  CD2 . PHE N  1 42  ? 75.658  16.433   80.851  1.00 93.40  ? 42  PHE N CD2 1 
ATOM   9474  C  CE1 . PHE N  1 42  ? 77.844  17.999   81.516  1.00 104.66 ? 42  PHE N CE1 1 
ATOM   9475  C  CE2 . PHE N  1 42  ? 76.900  15.841   80.975  1.00 100.30 ? 42  PHE N CE2 1 
ATOM   9476  C  CZ  . PHE N  1 42  ? 77.998  16.620   81.309  1.00 108.92 ? 42  PHE N CZ  1 
ATOM   9477  N  N   . PHE N  1 43  ? 71.167  17.823   79.551  1.00 78.43  ? 43  PHE N N   1 
ATOM   9478  C  CA  . PHE N  1 43  ? 69.752  18.183   79.512  1.00 81.50  ? 43  PHE N CA  1 
ATOM   9479  C  C   . PHE N  1 43  ? 69.284  18.769   80.846  1.00 85.10  ? 43  PHE N C   1 
ATOM   9480  O  O   . PHE N  1 43  ? 69.682  18.287   81.915  1.00 86.36  ? 43  PHE N O   1 
ATOM   9481  C  CB  . PHE N  1 43  ? 68.908  16.970   79.136  1.00 66.45  ? 43  PHE N CB  1 
ATOM   9482  C  CG  . PHE N  1 43  ? 67.606  17.323   78.500  1.00 71.39  ? 43  PHE N CG  1 
ATOM   9483  C  CD1 . PHE N  1 43  ? 67.539  17.606   77.144  1.00 84.09  ? 43  PHE N CD1 1 
ATOM   9484  C  CD2 . PHE N  1 43  ? 66.446  17.375   79.251  1.00 76.73  ? 43  PHE N CD2 1 
ATOM   9485  C  CE1 . PHE N  1 43  ? 66.333  17.931   76.540  1.00 87.82  ? 43  PHE N CE1 1 
ATOM   9486  C  CE2 . PHE N  1 43  ? 65.240  17.697   78.656  1.00 74.23  ? 43  PHE N CE2 1 
ATOM   9487  C  CZ  . PHE N  1 43  ? 65.183  17.973   77.295  1.00 76.56  ? 43  PHE N CZ  1 
ATOM   9488  N  N   . PRO N  1 44  ? 68.453  19.823   80.788  1.00 113.03 ? 44  PRO N N   1 
ATOM   9489  C  CA  . PRO N  1 44  ? 67.980  20.434   79.542  1.00 117.35 ? 44  PRO N CA  1 
ATOM   9490  C  C   . PRO N  1 44  ? 69.027  21.382   78.958  1.00 119.11 ? 44  PRO N C   1 
ATOM   9491  O  O   . PRO N  1 44  ? 69.864  21.910   79.693  1.00 124.63 ? 44  PRO N O   1 
ATOM   9492  C  CB  . PRO N  1 44  ? 66.745  21.224   79.997  1.00 112.70 ? 44  PRO N CB  1 
ATOM   9493  C  CG  . PRO N  1 44  ? 67.097  21.659   81.388  1.00 114.43 ? 44  PRO N CG  1 
ATOM   9494  C  CD  . PRO N  1 44  ? 67.927  20.524   81.976  1.00 118.59 ? 44  PRO N CD  1 
ATOM   9495  N  N   . LEU N  1 45  ? 68.982  21.594   77.647  1.00 81.31  ? 45  LEU N N   1 
ATOM   9496  C  CA  . LEU N  1 45  ? 69.980  22.430   76.983  1.00 63.68  ? 45  LEU N CA  1 
ATOM   9497  C  C   . LEU N  1 45  ? 69.651  23.912   77.122  1.00 82.68  ? 45  LEU N C   1 
ATOM   9498  O  O   . LEU N  1 45  ? 68.628  24.390   76.605  1.00 90.16  ? 45  LEU N O   1 
ATOM   9499  C  CB  . LEU N  1 45  ? 70.101  22.056   75.503  1.00 54.69  ? 45  LEU N CB  1 
ATOM   9500  C  CG  . LEU N  1 45  ? 70.434  20.574   75.276  1.00 67.73  ? 45  LEU N CG  1 
ATOM   9501  C  CD1 . LEU N  1 45  ? 70.538  20.186   73.794  1.00 69.71  ? 45  LEU N CD1 1 
ATOM   9502  C  CD2 . LEU N  1 45  ? 71.708  20.229   76.003  1.00 49.40  ? 45  LEU N CD2 1 
ATOM   9503  N  N   . ALA N  1 46  ? 70.524  24.632   77.822  1.00 80.35  ? 46  ALA N N   1 
ATOM   9504  C  CA  . ALA N  1 46  ? 70.390  26.075   77.996  1.00 78.85  ? 46  ALA N CA  1 
ATOM   9505  C  C   . ALA N  1 46  ? 70.237  26.816   76.661  1.00 81.54  ? 46  ALA N C   1 
ATOM   9506  O  O   . ALA N  1 46  ? 70.881  26.464   75.660  1.00 79.42  ? 46  ALA N O   1 
ATOM   9507  C  CB  . ALA N  1 46  ? 71.592  26.603   78.742  1.00 94.10  ? 46  ALA N CB  1 
ATOM   9508  N  N   . ASP N  1 47  ? 69.399  27.850   76.648  1.00 81.52  ? 47  ASP N N   1 
ATOM   9509  C  CA  . ASP N  1 47  ? 69.186  28.622   75.426  1.00 79.47  ? 47  ASP N CA  1 
ATOM   9510  C  C   . ASP N  1 47  ? 70.518  29.122   74.852  1.00 77.17  ? 47  ASP N C   1 
ATOM   9511  O  O   . ASP N  1 47  ? 70.727  29.095   73.636  1.00 71.91  ? 47  ASP N O   1 
ATOM   9512  C  CB  . ASP N  1 47  ? 68.236  29.807   75.659  1.00 83.21  ? 47  ASP N CB  1 
ATOM   9513  C  CG  . ASP N  1 47  ? 66.912  29.392   76.266  1.00 111.91 ? 47  ASP N CG  1 
ATOM   9514  O  OD1 . ASP N  1 47  ? 66.787  29.470   77.510  1.00 127.40 ? 47  ASP N OD1 1 
ATOM   9515  O  OD2 . ASP N  1 47  ? 66.000  29.002   75.503  1.00 105.34 ? 47  ASP N OD2 1 
ATOM   9516  N  N   . ASP N  1 48  ? 71.424  29.566   75.721  1.00 78.21  ? 48  ASP N N   1 
ATOM   9517  C  CA  . ASP N  1 48  ? 72.664  30.189   75.257  1.00 72.50  ? 48  ASP N CA  1 
ATOM   9518  C  C   . ASP N  1 48  ? 73.598  29.192   74.594  1.00 61.47  ? 48  ASP N C   1 
ATOM   9519  O  O   . ASP N  1 48  ? 74.764  29.482   74.347  1.00 68.28  ? 48  ASP N O   1 
ATOM   9520  C  CB  . ASP N  1 48  ? 73.376  30.943   76.385  1.00 89.34  ? 48  ASP N CB  1 
ATOM   9521  C  CG  . ASP N  1 48  ? 73.639  30.071   77.596  1.00 112.77 ? 48  ASP N CG  1 
ATOM   9522  O  OD1 . ASP N  1 48  ? 72.746  29.275   77.954  1.00 134.32 ? 48  ASP N OD1 1 
ATOM   9523  O  OD2 . ASP N  1 48  ? 74.739  30.183   78.191  1.00 106.36 ? 48  ASP N OD2 1 
ATOM   9524  N  N   . VAL N  1 49  ? 73.065  28.020   74.289  1.00 62.60  ? 49  VAL N N   1 
ATOM   9525  C  CA  . VAL N  1 49  ? 73.835  27.007   73.600  1.00 62.21  ? 49  VAL N CA  1 
ATOM   9526  C  C   . VAL N  1 49  ? 73.235  26.732   72.218  1.00 80.94  ? 49  VAL N C   1 
ATOM   9527  O  O   . VAL N  1 49  ? 73.701  25.859   71.470  1.00 84.08  ? 49  VAL N O   1 
ATOM   9528  C  CB  . VAL N  1 49  ? 73.931  25.746   74.459  1.00 57.45  ? 49  VAL N CB  1 
ATOM   9529  C  CG1 . VAL N  1 49  ? 74.284  24.543   73.622  1.00 76.75  ? 49  VAL N CG1 1 
ATOM   9530  C  CG2 . VAL N  1 49  ? 74.965  25.951   75.526  1.00 39.64  ? 49  VAL N CG2 1 
ATOM   9531  N  N   . THR N  1 50  ? 72.201  27.498   71.879  1.00 65.36  ? 50  THR N N   1 
ATOM   9532  C  CA  . THR N  1 50  ? 71.688  27.523   70.515  1.00 54.12  ? 50  THR N CA  1 
ATOM   9533  C  C   . THR N  1 50  ? 71.304  26.136   70.018  1.00 59.10  ? 50  THR N C   1 
ATOM   9534  O  O   . THR N  1 50  ? 71.445  25.847   68.819  1.00 66.57  ? 50  THR N O   1 
ATOM   9535  C  CB  . THR N  1 50  ? 72.766  28.056   69.535  1.00 79.52  ? 50  THR N CB  1 
ATOM   9536  O  OG1 . THR N  1 50  ? 73.645  28.980   70.209  1.00 72.68  ? 50  THR N OG1 1 
ATOM   9537  C  CG2 . THR N  1 50  ? 72.115  28.705   68.306  1.00 86.93  ? 50  THR N CG2 1 
ATOM   9538  N  N   . PRO N  1 51  ? 70.812  25.275   70.927  1.00 52.22  ? 51  PRO N N   1 
ATOM   9539  C  CA  . PRO N  1 51  ? 70.564  23.882   70.534  1.00 54.41  ? 51  PRO N CA  1 
ATOM   9540  C  C   . PRO N  1 51  ? 69.748  23.789   69.253  1.00 42.95  ? 51  PRO N C   1 
ATOM   9541  O  O   . PRO N  1 51  ? 68.778  24.525   69.089  1.00 46.55  ? 51  PRO N O   1 
ATOM   9542  C  CB  . PRO N  1 51  ? 69.776  23.308   71.726  1.00 38.76  ? 51  PRO N CB  1 
ATOM   9543  C  CG  . PRO N  1 51  ? 69.233  24.490   72.437  1.00 57.81  ? 51  PRO N CG  1 
ATOM   9544  C  CD  . PRO N  1 51  ? 70.250  25.573   72.255  1.00 49.94  ? 51  PRO N CD  1 
ATOM   9545  N  N   . THR N  1 52  ? 70.170  22.924   68.343  1.00 27.33  ? 52  THR N N   1 
ATOM   9546  C  CA  . THR N  1 52  ? 69.372  22.624   67.165  1.00 52.58  ? 52  THR N CA  1 
ATOM   9547  C  C   . THR N  1 52  ? 68.305  21.623   67.580  1.00 64.49  ? 52  THR N C   1 
ATOM   9548  O  O   . THR N  1 52  ? 68.449  20.950   68.615  1.00 55.09  ? 52  THR N O   1 
ATOM   9549  C  CB  . THR N  1 52  ? 70.215  22.014   66.016  1.00 49.08  ? 52  THR N CB  1 
ATOM   9550  O  OG1 . THR N  1 52  ? 70.655  20.697   66.369  1.00 67.90  ? 52  THR N OG1 1 
ATOM   9551  C  CG2 . THR N  1 52  ? 71.412  22.872   65.732  1.00 44.22  ? 52  THR N CG2 1 
ATOM   9552  N  N   . LYS N  1 53  ? 67.232  21.535   66.794  1.00 57.65  ? 53  LYS N N   1 
ATOM   9553  C  CA  . LYS N  1 53  ? 66.223  20.522   67.043  1.00 44.52  ? 53  LYS N CA  1 
ATOM   9554  C  C   . LYS N  1 53  ? 66.948  19.193   67.168  1.00 59.32  ? 53  LYS N C   1 
ATOM   9555  O  O   . LYS N  1 53  ? 66.794  18.470   68.156  1.00 68.52  ? 53  LYS N O   1 
ATOM   9556  C  CB  . LYS N  1 53  ? 65.234  20.461   65.886  1.00 44.39  ? 53  LYS N CB  1 
ATOM   9557  C  CG  . LYS N  1 53  ? 63.823  20.900   66.224  1.00 49.46  ? 53  LYS N CG  1 
ATOM   9558  C  CD  . LYS N  1 53  ? 63.748  22.312   66.716  1.00 47.00  ? 53  LYS N CD  1 
ATOM   9559  C  CE  . LYS N  1 53  ? 62.305  22.707   66.896  1.00 56.94  ? 53  LYS N CE  1 
ATOM   9560  N  NZ  . LYS N  1 53  ? 62.167  24.077   67.467  1.00 95.40  ? 53  LYS N NZ  1 
ATOM   9561  N  N   . HIS N  1 54  ? 67.768  18.885   66.169  1.00 56.19  ? 54  HIS N N   1 
ATOM   9562  C  CA  . HIS N  1 54  ? 68.426  17.592   66.115  1.00 45.98  ? 54  HIS N CA  1 
ATOM   9563  C  C   . HIS N  1 54  ? 69.189  17.319   67.393  1.00 49.41  ? 54  HIS N C   1 
ATOM   9564  O  O   . HIS N  1 54  ? 69.048  16.261   67.972  1.00 39.15  ? 54  HIS N O   1 
ATOM   9565  C  CB  . HIS N  1 54  ? 69.364  17.516   64.929  1.00 34.60  ? 54  HIS N CB  1 
ATOM   9566  C  CG  . HIS N  1 54  ? 70.035  16.189   64.792  1.00 51.34  ? 54  HIS N CG  1 
ATOM   9567  N  ND1 . HIS N  1 54  ? 71.074  15.785   65.615  1.00 36.71  ? 54  HIS N ND1 1 
ATOM   9568  C  CD2 . HIS N  1 54  ? 69.806  15.168   63.931  1.00 35.43  ? 54  HIS N CD2 1 
ATOM   9569  C  CE1 . HIS N  1 54  ? 71.456  14.573   65.254  1.00 57.62  ? 54  HIS N CE1 1 
ATOM   9570  N  NE2 . HIS N  1 54  ? 70.707  14.179   64.235  1.00 46.26  ? 54  HIS N NE2 1 
ATOM   9571  N  N   . ALA N  1 55  ? 69.998  18.280   67.824  1.00 46.84  ? 55  ALA N N   1 
ATOM   9572  C  CA  . ALA N  1 55  ? 70.720  18.166   69.084  1.00 49.84  ? 55  ALA N CA  1 
ATOM   9573  C  C   . ALA N  1 55  ? 69.790  17.797   70.233  1.00 55.35  ? 55  ALA N C   1 
ATOM   9574  O  O   . ALA N  1 55  ? 70.135  16.962   71.070  1.00 51.46  ? 55  ALA N O   1 
ATOM   9575  C  CB  . ALA N  1 55  ? 71.432  19.444   69.394  1.00 54.65  ? 55  ALA N CB  1 
ATOM   9576  N  N   . ILE N  1 56  ? 68.620  18.423   70.289  1.00 46.76  ? 56  ILE N N   1 
ATOM   9577  C  CA  . ILE N  1 56  ? 67.643  18.066   71.316  1.00 53.31  ? 56  ILE N CA  1 
ATOM   9578  C  C   . ILE N  1 56  ? 67.273  16.594   71.208  1.00 56.86  ? 56  ILE N C   1 
ATOM   9579  O  O   . ILE N  1 56  ? 67.455  15.816   72.155  1.00 46.49  ? 56  ILE N O   1 
ATOM   9580  C  CB  . ILE N  1 56  ? 66.357  18.881   71.178  1.00 39.85  ? 56  ILE N CB  1 
ATOM   9581  C  CG1 . ILE N  1 56  ? 66.658  20.366   71.326  1.00 40.38  ? 56  ILE N CG1 1 
ATOM   9582  C  CG2 . ILE N  1 56  ? 65.365  18.453   72.228  1.00 32.95  ? 56  ILE N CG2 1 
ATOM   9583  C  CD1 . ILE N  1 56  ? 66.612  20.835   72.755  1.00 65.73  ? 56  ILE N CD1 1 
ATOM   9584  N  N   . VAL N  1 57  ? 66.750  16.220   70.045  1.00 37.66  ? 57  VAL N N   1 
ATOM   9585  C  CA  . VAL N  1 57  ? 66.343  14.838   69.811  1.00 49.96  ? 57  VAL N CA  1 
ATOM   9586  C  C   . VAL N  1 57  ? 67.438  13.851   70.185  1.00 47.33  ? 57  VAL N C   1 
ATOM   9587  O  O   . VAL N  1 57  ? 67.220  12.958   70.997  1.00 49.74  ? 57  VAL N O   1 
ATOM   9588  C  CB  . VAL N  1 57  ? 65.929  14.593   68.357  1.00 44.69  ? 57  VAL N CB  1 
ATOM   9589  C  CG1 . VAL N  1 57  ? 65.684  13.115   68.129  1.00 22.32  ? 57  VAL N CG1 1 
ATOM   9590  C  CG2 . VAL N  1 57  ? 64.689  15.393   68.047  1.00 36.42  ? 57  VAL N CG2 1 
ATOM   9591  N  N   . GLN N  1 58  ? 68.610  14.012   69.586  1.00 39.81  ? 58  GLN N N   1 
ATOM   9592  C  CA  . GLN N  1 58  ? 69.740  13.138   69.865  1.00 59.43  ? 58  GLN N CA  1 
ATOM   9593  C  C   . GLN N  1 58  ? 69.990  13.053   71.368  1.00 57.87  ? 58  GLN N C   1 
ATOM   9594  O  O   . GLN N  1 58  ? 70.020  11.960   71.920  1.00 42.09  ? 58  GLN N O   1 
ATOM   9595  C  CB  . GLN N  1 58  ? 71.012  13.586   69.123  1.00 43.83  ? 58  GLN N CB  1 
ATOM   9596  C  CG  . GLN N  1 58  ? 72.257  12.753   69.476  1.00 22.79  ? 58  GLN N CG  1 
ATOM   9597  C  CD  . GLN N  1 58  ? 73.380  12.904   68.468  1.00 61.72  ? 58  GLN N CD  1 
ATOM   9598  O  OE1 . GLN N  1 58  ? 73.171  13.316   67.322  1.00 63.20  ? 58  GLN N OE1 1 
ATOM   9599  N  NE2 . GLN N  1 58  ? 74.586  12.566   68.895  1.00 87.53  ? 58  GLN N NE2 1 
ATOM   9600  N  N   . THR N  1 59  ? 70.170  14.194   72.028  1.00 24.79  ? 59  THR N N   1 
ATOM   9601  C  CA  . THR N  1 59  ? 70.279  14.199   73.483  1.00 37.33  ? 59  THR N CA  1 
ATOM   9602  C  C   . THR N  1 59  ? 69.228  13.329   74.194  1.00 54.32  ? 59  THR N C   1 
ATOM   9603  O  O   . THR N  1 59  ? 69.602  12.517   75.052  1.00 43.81  ? 59  THR N O   1 
ATOM   9604  C  CB  . THR N  1 59  ? 70.224  15.614   74.059  1.00 49.54  ? 59  THR N CB  1 
ATOM   9605  O  OG1 . THR N  1 59  ? 71.538  16.161   74.026  1.00 50.52  ? 59  THR N OG1 1 
ATOM   9606  C  CG2 . THR N  1 59  ? 69.736  15.590   75.518  1.00 24.77  ? 59  THR N CG2 1 
ATOM   9607  N  N   . LEU N  1 60  ? 67.935  13.489   73.864  1.00 37.79  ? 60  LEU N N   1 
ATOM   9608  C  CA  . LEU N  1 60  ? 66.896  12.598   74.421  1.00 41.49  ? 60  LEU N CA  1 
ATOM   9609  C  C   . LEU N  1 60  ? 67.149  11.087   74.176  1.00 45.76  ? 60  LEU N C   1 
ATOM   9610  O  O   . LEU N  1 60  ? 67.282  10.266   75.117  1.00 52.33  ? 60  LEU N O   1 
ATOM   9611  C  CB  . LEU N  1 60  ? 65.519  12.976   73.884  1.00 42.91  ? 60  LEU N CB  1 
ATOM   9612  C  CG  . LEU N  1 60  ? 64.975  14.337   74.305  1.00 48.25  ? 60  LEU N CG  1 
ATOM   9613  C  CD1 . LEU N  1 60  ? 63.488  14.408   73.971  1.00 35.98  ? 60  LEU N CD1 1 
ATOM   9614  C  CD2 . LEU N  1 60  ? 65.213  14.555   75.791  1.00 44.26  ? 60  LEU N CD2 1 
ATOM   9615  N  N   . VAL N  1 61  ? 67.204  10.725   72.904  1.00 35.29  ? 61  VAL N N   1 
ATOM   9616  C  CA  . VAL N  1 61  ? 67.558  9.377    72.539  1.00 46.66  ? 61  VAL N CA  1 
ATOM   9617  C  C   . VAL N  1 61  ? 68.726  8.860    73.371  1.00 56.69  ? 61  VAL N C   1 
ATOM   9618  O  O   . VAL N  1 61  ? 68.691  7.735    73.865  1.00 62.69  ? 61  VAL N O   1 
ATOM   9619  C  CB  . VAL N  1 61  ? 67.919  9.281    71.065  1.00 47.85  ? 61  VAL N CB  1 
ATOM   9620  C  CG1 . VAL N  1 61  ? 68.348  7.854    70.727  1.00 33.95  ? 61  VAL N CG1 1 
ATOM   9621  C  CG2 . VAL N  1 61  ? 66.729  9.700    70.227  1.00 33.50  ? 61  VAL N CG2 1 
ATOM   9622  N  N   . HIS N  1 62  ? 69.756  9.677    73.536  1.00 35.37  ? 62  HIS N N   1 
ATOM   9623  C  CA  . HIS N  1 62  ? 70.916  9.273    74.336  1.00 50.41  ? 62  HIS N CA  1 
ATOM   9624  C  C   . HIS N  1 62  ? 70.533  9.004    75.768  1.00 46.33  ? 62  HIS N C   1 
ATOM   9625  O  O   . HIS N  1 62  ? 71.023  8.054    76.358  1.00 48.35  ? 62  HIS N O   1 
ATOM   9626  C  CB  . HIS N  1 62  ? 72.030  10.318   74.307  1.00 54.75  ? 62  HIS N CB  1 
ATOM   9627  C  CG  . HIS N  1 62  ? 73.006  10.187   75.434  1.00 42.97  ? 62  HIS N CG  1 
ATOM   9628  N  ND1 . HIS N  1 62  ? 72.832  10.820   76.647  1.00 65.09  ? 62  HIS N ND1 1 
ATOM   9629  C  CD2 . HIS N  1 62  ? 74.163  9.500    75.534  1.00 37.05  ? 62  HIS N CD2 1 
ATOM   9630  C  CE1 . HIS N  1 62  ? 73.844  10.530   77.445  1.00 66.80  ? 62  HIS N CE1 1 
ATOM   9631  N  NE2 . HIS N  1 62  ? 74.664  9.726    76.796  1.00 65.25  ? 62  HIS N NE2 1 
ATOM   9632  N  N   . LEU N  1 63  ? 69.678  9.853    76.335  1.00 48.89  ? 63  LEU N N   1 
ATOM   9633  C  CA  . LEU N  1 63  ? 69.154  9.574    77.665  1.00 54.30  ? 63  LEU N CA  1 
ATOM   9634  C  C   . LEU N  1 63  ? 68.606  8.138    77.748  1.00 60.67  ? 63  LEU N C   1 
ATOM   9635  O  O   . LEU N  1 63  ? 68.724  7.455    78.782  1.00 46.43  ? 63  LEU N O   1 
ATOM   9636  C  CB  . LEU N  1 63  ? 68.075  10.578   78.028  1.00 28.05  ? 63  LEU N CB  1 
ATOM   9637  C  CG  . LEU N  1 63  ? 68.709  11.917   78.363  1.00 57.66  ? 63  LEU N CG  1 
ATOM   9638  C  CD1 . LEU N  1 63  ? 67.634  12.986   78.548  1.00 68.67  ? 63  LEU N CD1 1 
ATOM   9639  C  CD2 . LEU N  1 63  ? 69.577  11.780   79.600  1.00 41.79  ? 63  LEU N CD2 1 
ATOM   9640  N  N   . LYS N  1 64  ? 68.010  7.663    76.659  1.00 57.76  ? 64  LYS N N   1 
ATOM   9641  C  CA  . LYS N  1 64  ? 67.477  6.292    76.715  1.00 50.73  ? 64  LYS N CA  1 
ATOM   9642  C  C   . LYS N  1 64  ? 68.462  5.206    76.309  1.00 51.44  ? 64  LYS N C   1 
ATOM   9643  O  O   . LYS N  1 64  ? 68.306  4.051    76.688  1.00 57.88  ? 64  LYS N O   1 
ATOM   9644  C  CB  . LYS N  1 64  ? 66.190  6.135    75.888  1.00 53.49  ? 64  LYS N CB  1 
ATOM   9645  C  CG  . LYS N  1 64  ? 65.476  4.782    76.082  1.00 54.34  ? 64  LYS N CG  1 
ATOM   9646  C  CD  . LYS N  1 64  ? 64.102  4.757    75.422  1.00 59.72  ? 64  LYS N CD  1 
ATOM   9647  C  CE  . LYS N  1 64  ? 63.202  3.725    76.044  1.00 70.37  ? 64  LYS N CE  1 
ATOM   9648  N  NZ  . LYS N  1 64  ? 61.790  3.928    75.626  1.00 84.40  ? 64  LYS N NZ  1 
ATOM   9649  N  N   . PHE N  1 65  ? 69.459  5.558    75.509  1.00 60.64  ? 65  PHE N N   1 
ATOM   9650  C  CA  . PHE N  1 65  ? 70.393  4.551    74.988  1.00 61.49  ? 65  PHE N CA  1 
ATOM   9651  C  C   . PHE N  1 65  ? 71.824  5.025    75.125  1.00 66.19  ? 65  PHE N C   1 
ATOM   9652  O  O   . PHE N  1 65  ? 72.562  5.128    74.147  1.00 64.23  ? 65  PHE N O   1 
ATOM   9653  C  CB  . PHE N  1 65  ? 70.086  4.243    73.528  1.00 57.08  ? 65  PHE N CB  1 
ATOM   9654  C  CG  . PHE N  1 65  ? 68.702  3.728    73.308  1.00 68.07  ? 65  PHE N CG  1 
ATOM   9655  C  CD1 . PHE N  1 65  ? 67.635  4.597    73.196  1.00 74.69  ? 65  PHE N CD1 1 
ATOM   9656  C  CD2 . PHE N  1 65  ? 68.469  2.373    73.213  1.00 70.11  ? 65  PHE N CD2 1 
ATOM   9657  C  CE1 . PHE N  1 65  ? 66.364  4.119    72.989  1.00 76.99  ? 65  PHE N CE1 1 
ATOM   9658  C  CE2 . PHE N  1 65  ? 67.203  1.892    73.004  1.00 73.29  ? 65  PHE N CE2 1 
ATOM   9659  C  CZ  . PHE N  1 65  ? 66.146  2.766    72.893  1.00 75.31  ? 65  PHE N CZ  1 
ATOM   9660  N  N   . PRO N  1 66  ? 72.222  5.306    76.363  1.00 63.59  ? 66  PRO N N   1 
ATOM   9661  C  CA  . PRO N  1 66  ? 73.479  6.009    76.642  1.00 46.04  ? 66  PRO N CA  1 
ATOM   9662  C  C   . PRO N  1 66  ? 74.689  5.245    76.154  1.00 51.49  ? 66  PRO N C   1 
ATOM   9663  O  O   . PRO N  1 66  ? 75.801  5.743    76.246  1.00 81.99  ? 66  PRO N O   1 
ATOM   9664  C  CB  . PRO N  1 66  ? 73.492  6.097    78.173  1.00 51.15  ? 66  PRO N CB  1 
ATOM   9665  C  CG  . PRO N  1 66  ? 72.023  5.954    78.581  1.00 53.97  ? 66  PRO N CG  1 
ATOM   9666  C  CD  . PRO N  1 66  ? 71.465  4.980    77.588  1.00 42.65  ? 66  PRO N CD  1 
ATOM   9667  N  N   . THR N  1 67  ? 74.474  4.034    75.653  1.00 73.06  ? 67  THR N N   1 
ATOM   9668  C  CA  . THR N  1 67  ? 75.585  3.190    75.195  1.00 72.96  ? 67  THR N CA  1 
ATOM   9669  C  C   . THR N  1 67  ? 75.667  3.123    73.670  1.00 71.21  ? 67  THR N C   1 
ATOM   9670  O  O   . THR N  1 67  ? 76.727  2.838    73.116  1.00 79.35  ? 67  THR N O   1 
ATOM   9671  C  CB  . THR N  1 67  ? 75.497  1.754    75.769  1.00 66.45  ? 67  THR N CB  1 
ATOM   9672  O  OG1 . THR N  1 67  ? 74.299  1.116    75.296  1.00 70.73  ? 67  THR N OG1 1 
ATOM   9673  C  CG2 . THR N  1 67  ? 75.492  1.797    77.300  1.00 45.87  ? 67  THR N CG2 1 
ATOM   9674  N  N   . LYS N  1 68  ? 74.549  3.399    73.001  1.00 63.26  ? 68  LYS N N   1 
ATOM   9675  C  CA  . LYS N  1 68  ? 74.478  3.297    71.547  1.00 60.22  ? 68  LYS N CA  1 
ATOM   9676  C  C   . LYS N  1 68  ? 74.467  4.683    70.886  1.00 68.57  ? 68  LYS N C   1 
ATOM   9677  O  O   . LYS N  1 68  ? 74.808  4.831    69.710  1.00 82.02  ? 68  LYS N O   1 
ATOM   9678  C  CB  . LYS N  1 68  ? 73.234  2.495    71.142  1.00 51.45  ? 68  LYS N CB  1 
ATOM   9679  C  CG  . LYS N  1 68  ? 72.808  1.432    72.167  1.00 74.06  ? 68  LYS N CG  1 
ATOM   9680  C  CD  . LYS N  1 68  ? 73.518  0.086    71.963  1.00 94.12  ? 68  LYS N CD  1 
ATOM   9681  C  CE  . LYS N  1 68  ? 73.171  -0.921   73.069  1.00 95.23  ? 68  LYS N CE  1 
ATOM   9682  N  NZ  . LYS N  1 68  ? 71.693  -1.110   73.261  1.00 83.81  ? 68  LYS N NZ  1 
ATOM   9683  N  N   . VAL N  1 69  ? 74.089  5.697    71.660  1.00 59.09  ? 69  VAL N N   1 
ATOM   9684  C  CA  . VAL N  1 69  ? 73.910  7.057    71.144  1.00 57.37  ? 69  VAL N CA  1 
ATOM   9685  C  C   . VAL N  1 69  ? 74.583  8.071    72.076  1.00 53.81  ? 69  VAL N C   1 
ATOM   9686  O  O   . VAL N  1 69  ? 74.410  8.012    73.295  1.00 62.84  ? 69  VAL N O   1 
ATOM   9687  C  CB  . VAL N  1 69  ? 72.386  7.414    71.000  1.00 53.16  ? 69  VAL N CB  1 
ATOM   9688  C  CG1 . VAL N  1 69  ? 72.183  8.911    70.819  1.00 75.53  ? 69  VAL N CG1 1 
ATOM   9689  C  CG2 . VAL N  1 69  ? 71.752  6.667    69.862  1.00 38.62  ? 69  VAL N CG2 1 
ATOM   9690  N  N   . GLY N  1 70  ? 75.328  9.014    71.511  1.00 42.33  ? 70  GLY N N   1 
ATOM   9691  C  CA  . GLY N  1 70  ? 76.123  9.914    72.330  1.00 56.20  ? 70  GLY N CA  1 
ATOM   9692  C  C   . GLY N  1 70  ? 75.497  11.268   72.541  1.00 55.36  ? 70  GLY N C   1 
ATOM   9693  O  O   . GLY N  1 70  ? 74.612  11.654   71.782  1.00 73.51  ? 70  GLY N O   1 
ATOM   9694  N  N   . LYS N  1 71  ? 75.952  11.987   73.565  1.00 40.73  ? 71  LYS N N   1 
ATOM   9695  C  CA  . LYS N  1 71  ? 75.495  13.355   73.793  1.00 55.92  ? 71  LYS N CA  1 
ATOM   9696  C  C   . LYS N  1 71  ? 75.797  14.231   72.561  1.00 69.02  ? 71  LYS N C   1 
ATOM   9697  O  O   . LYS N  1 71  ? 76.558  13.844   71.661  1.00 58.96  ? 71  LYS N O   1 
ATOM   9698  C  CB  . LYS N  1 71  ? 76.161  13.968   75.026  1.00 57.17  ? 71  LYS N CB  1 
ATOM   9699  C  CG  . LYS N  1 71  ? 76.263  13.068   76.254  1.00 55.20  ? 71  LYS N CG  1 
ATOM   9700  C  CD  . LYS N  1 71  ? 77.021  13.782   77.384  1.00 74.28  ? 71  LYS N CD  1 
ATOM   9701  C  CE  . LYS N  1 71  ? 77.093  12.954   78.662  1.00 99.57  ? 71  LYS N CE  1 
ATOM   9702  N  NZ  . LYS N  1 71  ? 75.757  12.709   79.290  1.00 116.17 ? 71  LYS N NZ  1 
ATOM   9703  N  N   . ALA N  1 72  ? 75.195  15.413   72.506  1.00 62.45  ? 72  ALA N N   1 
ATOM   9704  C  CA  . ALA N  1 72  ? 75.568  16.352   71.464  1.00 60.54  ? 72  ALA N CA  1 
ATOM   9705  C  C   . ALA N  1 72  ? 76.955  16.858   71.829  1.00 68.66  ? 72  ALA N C   1 
ATOM   9706  O  O   . ALA N  1 72  ? 77.356  16.801   73.003  1.00 62.23  ? 72  ALA N O   1 
ATOM   9707  C  CB  . ALA N  1 72  ? 74.573  17.506   71.397  1.00 62.45  ? 72  ALA N CB  1 
ATOM   9708  N  N   . CYS N  1 73  ? 77.692  17.350   70.838  1.00 60.54  ? 73  CYS N N   1 
ATOM   9709  C  CA  . CYS N  1 73  ? 79.037  17.851   71.101  1.00 54.13  ? 73  CYS N CA  1 
ATOM   9710  C  C   . CYS N  1 73  ? 79.072  19.374   71.274  1.00 56.33  ? 73  CYS N C   1 
ATOM   9711  O  O   . CYS N  1 73  ? 78.287  20.090   70.657  1.00 56.94  ? 73  CYS N O   1 
ATOM   9712  C  CB  . CYS N  1 73  ? 80.002  17.400   70.006  1.00 33.57  ? 73  CYS N CB  1 
ATOM   9713  S  SG  . CYS N  1 73  ? 81.736  17.359   70.538  1.00 114.81 ? 73  CYS N SG  1 
ATOM   9714  N  N   . CYS N  1 74  ? 79.972  19.857   72.132  1.00 54.54  ? 74  CYS N N   1 
ATOM   9715  C  CA  . CYS N  1 74  ? 80.165  21.296   72.315  1.00 47.41  ? 74  CYS N CA  1 
ATOM   9716  C  C   . CYS N  1 74  ? 81.192  21.820   71.326  1.00 42.59  ? 74  CYS N C   1 
ATOM   9717  O  O   . CYS N  1 74  ? 82.378  21.534   71.425  1.00 70.56  ? 74  CYS N O   1 
ATOM   9718  C  CB  . CYS N  1 74  ? 80.610  21.609   73.735  1.00 51.17  ? 74  CYS N CB  1 
ATOM   9719  S  SG  . CYS N  1 74  ? 80.562  23.361   74.112  1.00 82.50  ? 74  CYS N SG  1 
ATOM   9720  N  N   . VAL N  1 75  ? 80.721  22.576   70.352  1.00 39.65  ? 75  VAL N N   1 
ATOM   9721  C  CA  . VAL N  1 75  ? 81.558  22.988   69.232  1.00 49.53  ? 75  VAL N CA  1 
ATOM   9722  C  C   . VAL N  1 75  ? 81.513  24.490   69.028  1.00 57.97  ? 75  VAL N C   1 
ATOM   9723  O  O   . VAL N  1 75  ? 80.591  25.171   69.492  1.00 62.49  ? 75  VAL N O   1 
ATOM   9724  C  CB  . VAL N  1 75  ? 81.090  22.334   67.922  1.00 37.32  ? 75  VAL N CB  1 
ATOM   9725  C  CG1 . VAL N  1 75  ? 81.333  20.837   67.953  1.00 39.15  ? 75  VAL N CG1 1 
ATOM   9726  C  CG2 . VAL N  1 75  ? 79.633  22.615   67.710  1.00 34.70  ? 75  VAL N CG2 1 
ATOM   9727  N  N   . PRO N  1 76  ? 82.516  25.025   68.327  1.00 58.29  ? 76  PRO N N   1 
ATOM   9728  C  CA  . PRO N  1 76  ? 82.469  26.453   67.982  1.00 60.93  ? 76  PRO N CA  1 
ATOM   9729  C  C   . PRO N  1 76  ? 81.344  26.642   66.970  1.00 60.55  ? 76  PRO N C   1 
ATOM   9730  O  O   . PRO N  1 76  ? 81.273  25.928   65.972  1.00 43.20  ? 76  PRO N O   1 
ATOM   9731  C  CB  . PRO N  1 76  ? 83.840  26.724   67.336  1.00 41.37  ? 76  PRO N CB  1 
ATOM   9732  C  CG  . PRO N  1 76  ? 84.680  25.536   67.699  1.00 68.31  ? 76  PRO N CG  1 
ATOM   9733  C  CD  . PRO N  1 76  ? 83.732  24.366   67.827  1.00 48.83  ? 76  PRO N CD  1 
ATOM   9734  N  N   . THR N  1 77  ? 80.456  27.586   67.243  1.00 56.15  ? 77  THR N N   1 
ATOM   9735  C  CA  . THR N  1 77  ? 79.305  27.814   66.383  1.00 36.41  ? 77  THR N CA  1 
ATOM   9736  C  C   . THR N  1 77  ? 79.429  29.099   65.541  1.00 52.42  ? 77  THR N C   1 
ATOM   9737  O  O   . THR N  1 77  ? 78.739  29.253   64.523  1.00 48.84  ? 77  THR N O   1 
ATOM   9738  C  CB  . THR N  1 77  ? 78.019  27.866   67.212  1.00 59.46  ? 77  THR N CB  1 
ATOM   9739  O  OG1 . THR N  1 77  ? 78.097  28.953   68.145  1.00 68.87  ? 77  THR N OG1 1 
ATOM   9740  C  CG2 . THR N  1 77  ? 77.818  26.560   67.966  1.00 52.70  ? 77  THR N CG2 1 
ATOM   9741  N  N   . LYS N  1 78  ? 80.303  30.015   65.971  1.00 59.25  ? 78  LYS N N   1 
ATOM   9742  C  CA  . LYS N  1 78  ? 80.655  31.221   65.195  1.00 56.61  ? 78  LYS N CA  1 
ATOM   9743  C  C   . LYS N  1 78  ? 82.178  31.477   65.253  1.00 61.61  ? 78  LYS N C   1 
ATOM   9744  O  O   . LYS N  1 78  ? 82.813  31.279   66.297  1.00 60.32  ? 78  LYS N O   1 
ATOM   9745  C  CB  . LYS N  1 78  ? 79.880  32.445   65.709  1.00 42.84  ? 78  LYS N CB  1 
ATOM   9746  N  N   . LEU N  1 79  ? 82.768  31.916   64.146  1.00 56.67  ? 79  LEU N N   1 
ATOM   9747  C  CA  . LEU N  1 79  ? 84.221  32.115   64.136  1.00 53.97  ? 79  LEU N CA  1 
ATOM   9748  C  C   . LEU N  1 79  ? 84.732  33.496   63.698  1.00 67.98  ? 79  LEU N C   1 
ATOM   9749  O  O   . LEU N  1 79  ? 84.530  33.934   62.560  1.00 84.10  ? 79  LEU N O   1 
ATOM   9750  C  CB  . LEU N  1 79  ? 84.902  31.030   63.294  1.00 40.76  ? 79  LEU N CB  1 
ATOM   9751  C  CG  . LEU N  1 79  ? 84.882  29.623   63.872  1.00 44.89  ? 79  LEU N CG  1 
ATOM   9752  C  CD1 . LEU N  1 79  ? 85.458  28.640   62.876  1.00 30.22  ? 79  LEU N CD1 1 
ATOM   9753  C  CD2 . LEU N  1 79  ? 85.667  29.611   65.175  1.00 75.27  ? 79  LEU N CD2 1 
ATOM   9754  N  N   . SER N  1 80  ? 85.431  34.161   64.610  1.00 67.14  ? 80  SER N N   1 
ATOM   9755  C  CA  . SER N  1 80  ? 86.166  35.380   64.279  1.00 67.77  ? 80  SER N CA  1 
ATOM   9756  C  C   . SER N  1 80  ? 87.515  35.094   63.610  1.00 70.16  ? 80  SER N C   1 
ATOM   9757  O  O   . SER N  1 80  ? 88.164  34.063   63.870  1.00 69.14  ? 80  SER N O   1 
ATOM   9758  C  CB  . SER N  1 80  ? 86.415  36.217   65.536  1.00 66.10  ? 80  SER N CB  1 
ATOM   9759  O  OG  . SER N  1 80  ? 85.232  36.868   65.973  1.00 81.02  ? 80  SER N OG  1 
ATOM   9760  N  N   . PRO N  1 81  ? 87.953  36.024   62.758  1.00 58.70  ? 81  PRO N N   1 
ATOM   9761  C  CA  . PRO N  1 81  ? 89.274  36.015   62.130  1.00 73.09  ? 81  PRO N CA  1 
ATOM   9762  C  C   . PRO N  1 81  ? 90.266  36.799   62.974  1.00 63.65  ? 81  PRO N C   1 
ATOM   9763  O  O   . PRO N  1 81  ? 89.879  37.605   63.832  1.00 49.93  ? 81  PRO N O   1 
ATOM   9764  C  CB  . PRO N  1 81  ? 89.038  36.821   60.866  1.00 65.69  ? 81  PRO N CB  1 
ATOM   9765  C  CG  . PRO N  1 81  ? 88.101  37.891   61.345  1.00 44.52  ? 81  PRO N CG  1 
ATOM   9766  C  CD  . PRO N  1 81  ? 87.165  37.184   62.320  1.00 35.09  ? 81  PRO N CD  1 
ATOM   9767  N  N   . ILE N  1 82  ? 91.545  36.582   62.709  1.00 55.43  ? 82  ILE N N   1 
ATOM   9768  C  CA  . ILE N  1 82  ? 92.582  37.348   63.373  1.00 71.23  ? 82  ILE N CA  1 
ATOM   9769  C  C   . ILE N  1 82  ? 93.496  37.881   62.307  1.00 68.25  ? 82  ILE N C   1 
ATOM   9770  O  O   . ILE N  1 82  ? 93.393  37.507   61.139  1.00 69.41  ? 82  ILE N O   1 
ATOM   9771  C  CB  . ILE N  1 82  ? 93.416  36.490   64.325  1.00 49.69  ? 82  ILE N CB  1 
ATOM   9772  C  CG1 . ILE N  1 82  ? 94.145  35.420   63.515  1.00 48.11  ? 82  ILE N CG1 1 
ATOM   9773  C  CG2 . ILE N  1 82  ? 92.510  35.874   65.395  1.00 38.81  ? 82  ILE N CG2 1 
ATOM   9774  C  CD1 . ILE N  1 82  ? 95.044  34.536   64.335  1.00 61.20  ? 82  ILE N CD1 1 
ATOM   9775  N  N   . SER N  1 83  ? 94.395  38.759   62.713  1.00 54.32  ? 83  SER N N   1 
ATOM   9776  C  CA  . SER N  1 83  ? 95.303  39.361   61.767  1.00 68.60  ? 83  SER N CA  1 
ATOM   9777  C  C   . SER N  1 83  ? 96.664  38.743   61.966  1.00 68.11  ? 83  SER N C   1 
ATOM   9778  O  O   . SER N  1 83  ? 97.082  38.494   63.102  1.00 84.40  ? 83  SER N O   1 
ATOM   9779  C  CB  . SER N  1 83  ? 95.364  40.885   61.960  1.00 75.41  ? 83  SER N CB  1 
ATOM   9780  O  OG  . SER N  1 83  ? 94.198  41.521   61.432  1.00 52.69  ? 83  SER N OG  1 
ATOM   9781  N  N   . VAL N  1 84  ? 97.352  38.471   60.861  1.00 60.45  ? 84  VAL N N   1 
ATOM   9782  C  CA  . VAL N  1 84  ? 98.716  37.950   60.956  1.00 62.25  ? 84  VAL N CA  1 
ATOM   9783  C  C   . VAL N  1 84  ? 99.620  38.492   59.862  1.00 59.10  ? 84  VAL N C   1 
ATOM   9784  O  O   . VAL N  1 84  ? 99.213  38.711   58.703  1.00 79.74  ? 84  VAL N O   1 
ATOM   9785  C  CB  . VAL N  1 84  ? 98.762  36.418   60.932  1.00 52.92  ? 84  VAL N CB  1 
ATOM   9786  C  CG1 . VAL N  1 84  ? 97.585  35.834   61.716  1.00 63.12  ? 84  VAL N CG1 1 
ATOM   9787  C  CG2 . VAL N  1 84  ? 98.715  35.928   59.505  1.00 47.72  ? 84  VAL N CG2 1 
ATOM   9788  N  N   . LEU N  1 85  ? 100.851 38.733   60.269  1.00 54.41  ? 85  LEU N N   1 
ATOM   9789  C  CA  . LEU N  1 85  ? 101.905 39.189   59.387  1.00 56.95  ? 85  LEU N CA  1 
ATOM   9790  C  C   . LEU N  1 85  ? 102.800 37.996   59.088  1.00 82.76  ? 85  LEU N C   1 
ATOM   9791  O  O   . LEU N  1 85  ? 103.422 37.434   60.002  1.00 78.15  ? 85  LEU N O   1 
ATOM   9792  C  CB  . LEU N  1 85  ? 102.743 40.218   60.122  1.00 59.85  ? 85  LEU N CB  1 
ATOM   9793  C  CG  . LEU N  1 85  ? 103.844 40.915   59.321  1.00 62.93  ? 85  LEU N CG  1 
ATOM   9794  C  CD1 . LEU N  1 85  ? 103.227 41.488   58.050  1.00 62.31  ? 85  LEU N CD1 1 
ATOM   9795  C  CD2 . LEU N  1 85  ? 104.500 42.022   60.149  1.00 65.71  ? 85  LEU N CD2 1 
ATOM   9796  N  N   . TYR N  1 86  ? 102.886 37.612   57.817  1.00 73.95  ? 86  TYR N N   1 
ATOM   9797  C  CA  . TYR N  1 86  ? 103.567 36.366   57.453  1.00 71.55  ? 86  TYR N CA  1 
ATOM   9798  C  C   . TYR N  1 86  ? 104.477 36.508   56.244  1.00 70.19  ? 86  TYR N C   1 
ATOM   9799  O  O   . TYR N  1 86  ? 104.317 37.442   55.445  1.00 84.72  ? 86  TYR N O   1 
ATOM   9800  C  CB  . TYR N  1 86  ? 102.540 35.292   57.145  1.00 77.35  ? 86  TYR N CB  1 
ATOM   9801  C  CG  . TYR N  1 86  ? 101.827 35.529   55.839  1.00 72.17  ? 86  TYR N CG  1 
ATOM   9802  C  CD1 . TYR N  1 86  ? 102.311 34.978   54.651  1.00 74.86  ? 86  TYR N CD1 1 
ATOM   9803  C  CD2 . TYR N  1 86  ? 100.677 36.314   55.790  1.00 57.34  ? 86  TYR N CD2 1 
ATOM   9804  C  CE1 . TYR N  1 86  ? 101.658 35.184   53.456  1.00 88.70  ? 86  TYR N CE1 1 
ATOM   9805  C  CE2 . TYR N  1 86  ? 100.017 36.533   54.597  1.00 59.78  ? 86  TYR N CE2 1 
ATOM   9806  C  CZ  . TYR N  1 86  ? 100.506 35.963   53.430  1.00 78.75  ? 86  TYR N CZ  1 
ATOM   9807  O  OH  . TYR N  1 86  ? 99.858  36.170   52.228  1.00 50.63  ? 86  TYR N OH  1 
ATOM   9808  N  N   . LYS N  1 87  ? 105.413 35.562   56.107  1.00 63.11  ? 87  LYS N N   1 
ATOM   9809  C  CA  . LYS N  1 87  ? 106.403 35.612   55.027  1.00 71.48  ? 87  LYS N CA  1 
ATOM   9810  C  C   . LYS N  1 87  ? 105.805 35.154   53.697  1.00 91.49  ? 87  LYS N C   1 
ATOM   9811  O  O   . LYS N  1 87  ? 105.227 34.072   53.610  1.00 81.11  ? 87  LYS N O   1 
ATOM   9812  C  CB  . LYS N  1 87  ? 107.646 34.799   55.371  1.00 67.21  ? 87  LYS N CB  1 
ATOM   9813  N  N   . ASP N  1 88  ? 105.938 36.016   52.684  1.00 114.66 ? 88  ASP N N   1 
ATOM   9814  C  CA  . ASP N  1 88  ? 105.529 35.753   51.301  1.00 106.32 ? 88  ASP N CA  1 
ATOM   9815  C  C   . ASP N  1 88  ? 106.099 34.416   50.831  1.00 106.76 ? 88  ASP N C   1 
ATOM   9816  O  O   . ASP N  1 88  ? 106.873 33.763   51.556  1.00 89.69  ? 88  ASP N O   1 
ATOM   9817  C  CB  . ASP N  1 88  ? 106.071 36.873   50.395  1.00 101.94 ? 88  ASP N CB  1 
ATOM   9818  C  CG  . ASP N  1 88  ? 105.181 37.155   49.196  1.00 129.75 ? 88  ASP N CG  1 
ATOM   9819  O  OD1 . ASP N  1 88  ? 104.597 36.199   48.638  1.00 145.30 ? 88  ASP N OD1 1 
ATOM   9820  O  OD2 . ASP N  1 88  ? 105.070 38.343   48.813  1.00 132.01 ? 88  ASP N OD2 1 
ATOM   9821  N  N   . ASP N  1 89  ? 105.717 34.008   49.621  1.00 122.12 ? 89  ASP N N   1 
ATOM   9822  C  CA  . ASP N  1 89  ? 106.361 32.869   48.980  1.00 115.17 ? 89  ASP N CA  1 
ATOM   9823  C  C   . ASP N  1 89  ? 107.797 33.270   48.653  1.00 112.34 ? 89  ASP N C   1 
ATOM   9824  O  O   . ASP N  1 89  ? 108.655 32.419   48.391  1.00 111.46 ? 89  ASP N O   1 
ATOM   9825  C  CB  . ASP N  1 89  ? 105.616 32.452   47.713  1.00 121.02 ? 89  ASP N CB  1 
ATOM   9826  C  CG  . ASP N  1 89  ? 104.246 31.881   48.010  1.00 135.98 ? 89  ASP N CG  1 
ATOM   9827  O  OD1 . ASP N  1 89  ? 103.245 32.622   47.867  1.00 134.39 ? 89  ASP N OD1 1 
ATOM   9828  O  OD2 . ASP N  1 89  ? 104.173 30.692   48.395  1.00 137.69 ? 89  ASP N OD2 1 
ATOM   9829  N  N   . MET N  1 90  ? 108.063 34.574   48.680  1.00 93.35  ? 90  MET N N   1 
ATOM   9830  C  CA  . MET N  1 90  ? 109.427 35.051   48.473  1.00 108.21 ? 90  MET N CA  1 
ATOM   9831  C  C   . MET N  1 90  ? 109.960 35.833   49.673  1.00 106.45 ? 90  MET N C   1 
ATOM   9832  O  O   . MET N  1 90  ? 110.818 36.733   49.526  1.00 98.29  ? 90  MET N O   1 
ATOM   9833  C  CB  . MET N  1 90  ? 109.511 35.893   47.202  1.00 115.81 ? 90  MET N CB  1 
ATOM   9834  C  CG  . MET N  1 90  ? 109.498 35.076   45.926  1.00 115.14 ? 90  MET N CG  1 
ATOM   9835  S  SD  . MET N  1 90  ? 108.974 36.109   44.541  1.00 128.65 ? 90  MET N SD  1 
ATOM   9836  C  CE  . MET N  1 90  ? 107.407 36.718   45.174  1.00 117.32 ? 90  MET N CE  1 
ATOM   9837  N  N   . GLY N  1 91  ? 109.436 35.488   50.851  1.00 94.43  ? 91  GLY N N   1 
ATOM   9838  C  CA  . GLY N  1 91  ? 109.920 36.029   52.108  1.00 91.67  ? 91  GLY N CA  1 
ATOM   9839  C  C   . GLY N  1 91  ? 109.671 37.516   52.303  1.00 94.68  ? 91  GLY N C   1 
ATOM   9840  O  O   . GLY N  1 91  ? 110.510 38.232   52.874  1.00 97.81  ? 91  GLY N O   1 
ATOM   9841  N  N   . VAL N  1 92  ? 108.527 37.991   51.824  1.00 77.13  ? 92  VAL N N   1 
ATOM   9842  C  CA  . VAL N  1 92  ? 108.172 39.388   51.994  1.00 72.98  ? 92  VAL N CA  1 
ATOM   9843  C  C   . VAL N  1 92  ? 107.099 39.473   53.074  1.00 84.72  ? 92  VAL N C   1 
ATOM   9844  O  O   . VAL N  1 92  ? 106.018 38.877   52.940  1.00 86.39  ? 92  VAL N O   1 
ATOM   9845  C  CB  . VAL N  1 92  ? 107.606 39.975   50.696  1.00 83.39  ? 92  VAL N CB  1 
ATOM   9846  C  CG1 . VAL N  1 92  ? 107.631 41.484   50.744  1.00 87.56  ? 92  VAL N CG1 1 
ATOM   9847  C  CG2 . VAL N  1 92  ? 108.387 39.463   49.514  1.00 79.95  ? 92  VAL N CG2 1 
ATOM   9848  N  N   . PRO N  1 93  ? 107.385 40.219   54.152  1.00 81.28  ? 93  PRO N N   1 
ATOM   9849  C  CA  . PRO N  1 93  ? 106.337 40.408   55.167  1.00 68.46  ? 93  PRO N CA  1 
ATOM   9850  C  C   . PRO N  1 93  ? 105.066 40.976   54.536  1.00 65.89  ? 93  PRO N C   1 
ATOM   9851  O  O   . PRO N  1 93  ? 105.068 42.113   54.038  1.00 74.05  ? 93  PRO N O   1 
ATOM   9852  C  CB  . PRO N  1 93  ? 106.958 41.437   56.119  1.00 73.35  ? 93  PRO N CB  1 
ATOM   9853  C  CG  . PRO N  1 93  ? 108.463 41.283   55.929  1.00 74.73  ? 93  PRO N CG  1 
ATOM   9854  C  CD  . PRO N  1 93  ? 108.624 40.960   54.467  1.00 75.04  ? 93  PRO N CD  1 
ATOM   9855  N  N   . THR N  1 94  ? 104.003 40.185   54.528  1.00 62.61  ? 94  THR N N   1 
ATOM   9856  C  CA  . THR N  1 94  ? 102.719 40.677   54.041  1.00 78.65  ? 94  THR N CA  1 
ATOM   9857  C  C   . THR N  1 94  ? 101.626 40.387   55.074  1.00 75.84  ? 94  THR N C   1 
ATOM   9858  O  O   . THR N  1 94  ? 101.841 39.652   56.050  1.00 58.25  ? 94  THR N O   1 
ATOM   9859  C  CB  . THR N  1 94  ? 102.339 40.058   52.678  1.00 84.30  ? 94  THR N CB  1 
ATOM   9860  O  OG1 . THR N  1 94  ? 101.968 38.683   52.865  1.00 57.49  ? 94  THR N OG1 1 
ATOM   9861  C  CG2 . THR N  1 94  ? 103.510 40.159   51.685  1.00 84.35  ? 94  THR N CG2 1 
ATOM   9862  N  N   . LEU N  1 95  ? 100.444 40.947   54.862  1.00 58.08  ? 95  LEU N N   1 
ATOM   9863  C  CA  . LEU N  1 95  ? 99.467  40.932   55.932  1.00 56.52  ? 95  LEU N CA  1 
ATOM   9864  C  C   . LEU N  1 95  ? 98.088  40.370   55.566  1.00 68.76  ? 95  LEU N C   1 
ATOM   9865  O  O   . LEU N  1 95  ? 97.373  40.979   54.756  1.00 90.38  ? 95  LEU N O   1 
ATOM   9866  C  CB  . LEU N  1 95  ? 99.311  42.359   56.464  1.00 54.18  ? 95  LEU N CB  1 
ATOM   9867  C  CG  . LEU N  1 95  ? 98.041  42.564   57.290  1.00 69.30  ? 95  LEU N CG  1 
ATOM   9868  C  CD1 . LEU N  1 95  ? 98.066  41.697   58.546  1.00 95.28  ? 95  LEU N CD1 1 
ATOM   9869  C  CD2 . LEU N  1 95  ? 97.923  44.028   57.645  1.00 55.02  ? 95  LEU N CD2 1 
ATOM   9870  N  N   . LYS N  1 96  ? 97.684  39.240   56.158  1.00 54.91  ? 96  LYS N N   1 
ATOM   9871  C  CA  . LYS N  1 96  ? 96.254  38.942   56.087  1.00 69.04  ? 96  LYS N CA  1 
ATOM   9872  C  C   . LYS N  1 96  ? 95.604  39.570   57.317  1.00 72.04  ? 96  LYS N C   1 
ATOM   9873  O  O   . LYS N  1 96  ? 95.857  39.160   58.460  1.00 72.76  ? 96  LYS N O   1 
ATOM   9874  C  CB  . LYS N  1 96  ? 95.878  37.448   55.887  1.00 55.17  ? 96  LYS N CB  1 
ATOM   9875  C  CG  . LYS N  1 96  ? 94.422  37.244   55.248  1.00 43.25  ? 96  LYS N CG  1 
ATOM   9876  C  CD  . LYS N  1 96  ? 94.134  38.305   54.122  1.00 173.99 ? 96  LYS N CD  1 
ATOM   9877  C  CE  . LYS N  1 96  ? 92.971  39.304   54.437  1.00 84.05  ? 96  LYS N CE  1 
ATOM   9878  N  NZ  . LYS N  1 96  ? 93.242  40.760   54.023  1.00 41.81  ? 96  LYS N NZ  1 
ATOM   9879  N  N   . TYR N  1 97  ? 94.808  40.604   57.058  1.00 56.28  ? 97  TYR N N   1 
ATOM   9880  C  CA  . TYR N  1 97  ? 94.082  41.297   58.097  1.00 52.08  ? 97  TYR N CA  1 
ATOM   9881  C  C   . TYR N  1 97  ? 92.842  40.495   58.505  1.00 61.85  ? 97  TYR N C   1 
ATOM   9882  O  O   . TYR N  1 97  ? 92.567  40.354   59.693  1.00 69.48  ? 97  TYR N O   1 
ATOM   9883  C  CB  . TYR N  1 97  ? 93.714  42.685   57.599  1.00 49.69  ? 97  TYR N CB  1 
ATOM   9884  C  CG  . TYR N  1 97  ? 92.880  43.500   58.562  1.00 61.52  ? 97  TYR N CG  1 
ATOM   9885  C  CD1 . TYR N  1 97  ? 93.412  43.941   59.779  1.00 64.23  ? 97  TYR N CD1 1 
ATOM   9886  C  CD2 . TYR N  1 97  ? 91.560  43.856   58.246  1.00 53.23  ? 97  TYR N CD2 1 
ATOM   9887  C  CE1 . TYR N  1 97  ? 92.651  44.711   60.665  1.00 60.07  ? 97  TYR N CE1 1 
ATOM   9888  C  CE2 . TYR N  1 97  ? 90.794  44.619   59.123  1.00 72.76  ? 97  TYR N CE2 1 
ATOM   9889  C  CZ  . TYR N  1 97  ? 91.346  45.044   60.330  1.00 77.83  ? 97  TYR N CZ  1 
ATOM   9890  O  OH  . TYR N  1 97  ? 90.588  45.797   61.201  1.00 94.46  ? 97  TYR N OH  1 
ATOM   9891  N  N   . HIS N  1 98  ? 92.112  39.972   57.520  1.00 78.55  ? 98  HIS N N   1 
ATOM   9892  C  CA  . HIS N  1 98  ? 90.963  39.109   57.780  1.00 79.02  ? 98  HIS N CA  1 
ATOM   9893  C  C   . HIS N  1 98  ? 91.292  37.621   57.535  1.00 83.88  ? 98  HIS N C   1 
ATOM   9894  O  O   . HIS N  1 98  ? 90.821  37.024   56.554  1.00 113.03 ? 98  HIS N O   1 
ATOM   9895  C  CB  . HIS N  1 98  ? 89.759  39.552   56.940  1.00 68.22  ? 98  HIS N CB  1 
ATOM   9896  C  CG  . HIS N  1 98  ? 88.735  40.336   57.710  1.00 113.74 ? 98  HIS N CG  1 
ATOM   9897  N  ND1 . HIS N  1 98  ? 87.432  39.906   57.878  1.00 138.28 ? 98  HIS N ND1 1 
ATOM   9898  C  CD2 . HIS N  1 98  ? 88.821  41.525   58.355  1.00 116.72 ? 98  HIS N CD2 1 
ATOM   9899  C  CE1 . HIS N  1 98  ? 86.761  40.796   58.589  1.00 127.01 ? 98  HIS N CE1 1 
ATOM   9900  N  NE2 . HIS N  1 98  ? 87.581  41.788   58.891  1.00 120.53 ? 98  HIS N NE2 1 
ATOM   9901  N  N   . TYR N  1 99  ? 92.103  37.032   58.422  1.00 41.87  ? 99  TYR N N   1 
ATOM   9902  C  CA  . TYR N  1 99  ? 92.446  35.607   58.310  1.00 52.10  ? 99  TYR N CA  1 
ATOM   9903  C  C   . TYR N  1 99  ? 91.341  34.768   58.936  1.00 66.34  ? 99  TYR N C   1 
ATOM   9904  O  O   . TYR N  1 99  ? 91.271  34.610   60.160  1.00 74.05  ? 99  TYR N O   1 
ATOM   9905  C  CB  . TYR N  1 99  ? 93.775  35.308   59.003  1.00 56.78  ? 99  TYR N CB  1 
ATOM   9906  C  CG  . TYR N  1 99  ? 94.361  33.942   58.715  1.00 49.87  ? 99  TYR N CG  1 
ATOM   9907  C  CD1 . TYR N  1 99  ? 95.513  33.525   59.357  1.00 52.80  ? 99  TYR N CD1 1 
ATOM   9908  C  CD2 . TYR N  1 99  ? 93.779  33.084   57.796  1.00 70.00  ? 99  TYR N CD2 1 
ATOM   9909  C  CE1 . TYR N  1 99  ? 96.070  32.293   59.101  1.00 48.92  ? 99  TYR N CE1 1 
ATOM   9910  C  CE2 . TYR N  1 99  ? 94.327  31.844   57.528  1.00 73.35  ? 99  TYR N CE2 1 
ATOM   9911  C  CZ  . TYR N  1 99  ? 95.473  31.452   58.189  1.00 65.98  ? 99  TYR N CZ  1 
ATOM   9912  O  OH  . TYR N  1 99  ? 96.042  30.215   57.954  1.00 76.01  ? 99  TYR N OH  1 
ATOM   9913  N  N   . GLU N  1 100 ? 90.480  34.221   58.097  1.00 50.49  ? 100 GLU N N   1 
ATOM   9914  C  CA  . GLU N  1 100 ? 89.217  33.752   58.615  1.00 45.08  ? 100 GLU N CA  1 
ATOM   9915  C  C   . GLU N  1 100 ? 89.253  32.495   59.471  1.00 53.21  ? 100 GLU N C   1 
ATOM   9916  O  O   . GLU N  1 100 ? 90.031  31.582   59.227  1.00 59.34  ? 100 GLU N O   1 
ATOM   9917  C  CB  . GLU N  1 100 ? 88.233  33.590   57.469  1.00 63.36  ? 100 GLU N CB  1 
ATOM   9918  C  CG  . GLU N  1 100 ? 87.743  34.927   56.923  1.00 89.46  ? 100 GLU N CG  1 
ATOM   9919  C  CD  . GLU N  1 100 ? 86.942  35.731   57.953  1.00 100.65 ? 100 GLU N CD  1 
ATOM   9920  O  OE1 . GLU N  1 100 ? 86.634  35.186   59.049  1.00 109.64 ? 100 GLU N OE1 1 
ATOM   9921  O  OE2 . GLU N  1 100 ? 86.625  36.910   57.657  1.00 63.93  ? 100 GLU N OE2 1 
ATOM   9922  N  N   . GLY N  1 101 ? 88.397  32.478   60.486  1.00 66.75  ? 101 GLY N N   1 
ATOM   9923  C  CA  . GLY N  1 101 ? 88.073  31.267   61.228  1.00 59.47  ? 101 GLY N CA  1 
ATOM   9924  C  C   . GLY N  1 101 ? 89.170  30.734   62.118  1.00 51.87  ? 101 GLY N C   1 
ATOM   9925  O  O   . GLY N  1 101 ? 89.443  29.531   62.112  1.00 71.78  ? 101 GLY N O   1 
ATOM   9926  N  N   . MET N  1 102 ? 89.799  31.611   62.891  1.00 31.31  ? 102 MET N N   1 
ATOM   9927  C  CA  . MET N  1 102 ? 90.943  31.182   63.686  1.00 55.61  ? 102 MET N CA  1 
ATOM   9928  C  C   . MET N  1 102 ? 90.645  31.285   65.164  1.00 64.67  ? 102 MET N C   1 
ATOM   9929  O  O   . MET N  1 102 ? 91.400  30.798   66.006  1.00 70.12  ? 102 MET N O   1 
ATOM   9930  C  CB  . MET N  1 102 ? 92.170  32.046   63.376  1.00 54.02  ? 102 MET N CB  1 
ATOM   9931  C  CG  . MET N  1 102 ? 92.695  31.909   61.965  1.00 51.68  ? 102 MET N CG  1 
ATOM   9932  S  SD  . MET N  1 102 ? 93.812  30.530   61.838  1.00 76.33  ? 102 MET N SD  1 
ATOM   9933  C  CE  . MET N  1 102 ? 95.018  30.968   63.103  1.00 52.98  ? 102 MET N CE  1 
ATOM   9934  N  N   . SER N  1 103 ? 89.555  31.952   65.490  1.00 55.72  ? 103 SER N N   1 
ATOM   9935  C  CA  . SER N  1 103 ? 89.271  32.178   66.887  1.00 62.68  ? 103 SER N CA  1 
ATOM   9936  C  C   . SER N  1 103 ? 87.803  31.959   67.150  1.00 76.30  ? 103 SER N C   1 
ATOM   9937  O  O   . SER N  1 103 ? 86.959  32.281   66.312  1.00 68.55  ? 103 SER N O   1 
ATOM   9938  C  CB  . SER N  1 103 ? 89.651  33.596   67.260  1.00 59.84  ? 103 SER N CB  1 
ATOM   9939  O  OG  . SER N  1 103 ? 89.441  33.802   68.638  1.00 85.33  ? 103 SER N OG  1 
ATOM   9940  N  N   . VAL N  1 104 ? 87.490  31.412   68.318  1.00 78.04  ? 104 VAL N N   1 
ATOM   9941  C  CA  . VAL N  1 104 ? 86.101  31.095   68.613  1.00 55.71  ? 104 VAL N CA  1 
ATOM   9942  C  C   . VAL N  1 104 ? 85.300  32.316   69.023  1.00 48.58  ? 104 VAL N C   1 
ATOM   9943  O  O   . VAL N  1 104 ? 85.704  33.091   69.893  1.00 54.03  ? 104 VAL N O   1 
ATOM   9944  C  CB  . VAL N  1 104 ? 85.974  30.022   69.690  1.00 59.95  ? 104 VAL N CB  1 
ATOM   9945  C  CG1 . VAL N  1 104 ? 84.493  29.737   69.949  1.00 57.21  ? 104 VAL N CG1 1 
ATOM   9946  C  CG2 . VAL N  1 104 ? 86.730  28.759   69.260  1.00 53.20  ? 104 VAL N CG2 1 
ATOM   9947  N  N   . ALA N  1 105 ? 84.152  32.474   68.385  1.00 46.75  ? 105 ALA N N   1 
ATOM   9948  C  CA  . ALA N  1 105 ? 83.265  33.576   68.705  1.00 58.14  ? 105 ALA N CA  1 
ATOM   9949  C  C   . ALA N  1 105 ? 82.249  33.112   69.729  1.00 61.64  ? 105 ALA N C   1 
ATOM   9950  O  O   . ALA N  1 105 ? 82.209  33.604   70.865  1.00 68.47  ? 105 ALA N O   1 
ATOM   9951  C  CB  . ALA N  1 105 ? 82.558  34.073   67.442  1.00 27.85  ? 105 ALA N CB  1 
ATOM   9952  N  N   . GLU N  1 106 ? 81.433  32.152   69.309  1.00 37.98  ? 106 GLU N N   1 
ATOM   9953  C  CA  . GLU N  1 106 ? 80.363  31.633   70.136  1.00 47.88  ? 106 GLU N CA  1 
ATOM   9954  C  C   . GLU N  1 106 ? 80.424  30.109   70.188  1.00 67.12  ? 106 GLU N C   1 
ATOM   9955  O  O   . GLU N  1 106 ? 80.841  29.472   69.213  1.00 56.43  ? 106 GLU N O   1 
ATOM   9956  C  CB  . GLU N  1 106 ? 79.025  32.085   69.559  1.00 61.03  ? 106 GLU N CB  1 
ATOM   9957  C  CG  . GLU N  1 106 ? 78.800  33.590   69.623  1.00 77.01  ? 106 GLU N CG  1 
ATOM   9958  C  CD  . GLU N  1 106 ? 77.531  34.048   68.909  1.00 95.52  ? 106 GLU N CD  1 
ATOM   9959  O  OE1 . GLU N  1 106 ? 77.253  35.268   68.910  1.00 111.41 ? 106 GLU N OE1 1 
ATOM   9960  O  OE2 . GLU N  1 106 ? 76.819  33.198   68.341  1.00 82.81  ? 106 GLU N OE2 1 
ATOM   9961  N  N   . CYS N  1 107 ? 80.021  29.523   71.320  1.00 62.45  ? 107 CYS N N   1 
ATOM   9962  C  CA  . CYS N  1 107 ? 80.030  28.062   71.459  1.00 44.77  ? 107 CYS N CA  1 
ATOM   9963  C  C   . CYS N  1 107 ? 78.610  27.521   71.303  1.00 47.29  ? 107 CYS N C   1 
ATOM   9964  O  O   . CYS N  1 107 ? 77.649  28.291   71.256  1.00 75.81  ? 107 CYS N O   1 
ATOM   9965  C  CB  . CYS N  1 107 ? 80.652  27.642   72.800  1.00 39.46  ? 107 CYS N CB  1 
ATOM   9966  S  SG  . CYS N  1 107 ? 82.465  27.428   72.770  1.00 91.85  ? 107 CYS N SG  1 
ATOM   9967  N  N   . GLY N  1 108 ? 78.464  26.207   71.212  1.00 48.16  ? 108 GLY N N   1 
ATOM   9968  C  CA  . GLY N  1 108 ? 77.130  25.625   71.114  1.00 66.71  ? 108 GLY N CA  1 
ATOM   9969  C  C   . GLY N  1 108 ? 77.015  24.102   71.059  1.00 63.00  ? 108 GLY N C   1 
ATOM   9970  O  O   . GLY N  1 108 ? 78.021  23.382   71.064  1.00 67.04  ? 108 GLY N O   1 
ATOM   9971  N  N   . CYS N  1 109 ? 75.779  23.606   71.009  1.00 38.03  ? 109 CYS N N   1 
ATOM   9972  C  CA  . CYS N  1 109 ? 75.548  22.168   71.054  1.00 43.67  ? 109 CYS N CA  1 
ATOM   9973  C  C   . CYS N  1 109 ? 74.943  21.721   69.758  1.00 49.99  ? 109 CYS N C   1 
ATOM   9974  O  O   . CYS N  1 109 ? 73.952  22.301   69.318  1.00 66.96  ? 109 CYS N O   1 
ATOM   9975  C  CB  . CYS N  1 109 ? 74.642  21.773   72.229  1.00 29.89  ? 109 CYS N CB  1 
ATOM   9976  S  SG  . CYS N  1 109 ? 75.569  21.646   73.810  1.00 93.83  ? 109 CYS N SG  1 
ATOM   9977  N  N   . ARG N  1 110 ? 75.530  20.692   69.146  1.00 44.97  ? 110 ARG N N   1 
ATOM   9978  C  CA  . ARG N  1 110 ? 75.077  20.244   67.828  1.00 65.16  ? 110 ARG N CA  1 
ATOM   9979  C  C   . ARG N  1 110 ? 75.103  18.717   67.658  1.00 78.54  ? 110 ARG N C   1 
ATOM   9980  O  O   . ARG N  1 110 ? 74.252  18.155   66.947  1.00 91.18  ? 110 ARG N O   1 
ATOM   9981  C  CB  . ARG N  1 110 ? 75.896  20.927   66.728  1.00 54.57  ? 110 ARG N CB  1 
ATOM   9982  C  CG  . ARG N  1 110 ? 75.945  22.454   66.831  1.00 29.70  ? 110 ARG N CG  1 
ATOM   9983  C  CD  . ARG N  1 110 ? 74.627  23.112   66.390  1.00 33.41  ? 110 ARG N CD  1 
ATOM   9984  N  NE  . ARG N  1 110 ? 74.687  24.586   66.306  1.00 38.24  ? 110 ARG N NE  1 
ATOM   9985  C  CZ  . ARG N  1 110 ? 74.383  25.424   67.297  1.00 42.60  ? 110 ARG N CZ  1 
ATOM   9986  N  NH1 . ARG N  1 110 ? 74.001  24.960   68.476  1.00 63.15  ? 110 ARG N NH1 1 
ATOM   9987  N  NH2 . ARG N  1 110 ? 74.460  26.726   67.107  1.00 39.63  ? 110 ARG N NH2 1 
ATOM   9988  O  OXT . ARG N  1 110 ? 75.954  18.014   68.223  1.00 62.92  ? 110 ARG N OXT 1 
ATOM   9989  N  N   . PRO O  2 11  ? 56.423  39.917   76.819  1.00 136.73 ? 30  PRO O N   1 
ATOM   9990  C  CA  . PRO O  2 11  ? 55.496  39.610   77.917  1.00 135.54 ? 30  PRO O CA  1 
ATOM   9991  C  C   . PRO O  2 11  ? 56.132  38.669   78.931  1.00 137.72 ? 30  PRO O C   1 
ATOM   9992  O  O   . PRO O  2 11  ? 55.506  37.680   79.313  1.00 132.90 ? 30  PRO O O   1 
ATOM   9993  C  CB  . PRO O  2 11  ? 54.342  38.883   77.213  1.00 125.98 ? 30  PRO O CB  1 
ATOM   9994  C  CG  . PRO O  2 11  ? 54.526  39.150   75.741  1.00 122.30 ? 30  PRO O CG  1 
ATOM   9995  C  CD  . PRO O  2 11  ? 55.990  39.328   75.541  1.00 126.71 ? 30  PRO O CD  1 
ATOM   9996  N  N   . LEU O  2 12  ? 57.353  38.985   79.362  1.00 139.61 ? 31  LEU O N   1 
ATOM   9997  C  CA  . LEU O  2 12  ? 58.159  38.084   80.196  1.00 130.70 ? 31  LEU O CA  1 
ATOM   9998  C  C   . LEU O  2 12  ? 57.604  37.823   81.601  1.00 122.73 ? 31  LEU O C   1 
ATOM   9999  O  O   . LEU O  2 12  ? 56.706  38.514   82.074  1.00 131.78 ? 31  LEU O O   1 
ATOM   10000 C  CB  . LEU O  2 12  ? 59.604  38.594   80.305  1.00 128.94 ? 31  LEU O CB  1 
ATOM   10001 C  CG  . LEU O  2 12  ? 60.517  38.515   79.076  1.00 128.50 ? 31  LEU O CG  1 
ATOM   10002 C  CD1 . LEU O  2 12  ? 59.967  39.336   77.912  1.00 140.60 ? 31  LEU O CD1 1 
ATOM   10003 C  CD2 . LEU O  2 12  ? 61.925  38.969   79.444  1.00 116.01 ? 31  LEU O CD2 1 
ATOM   10004 N  N   . VAL O  2 13  ? 58.174  36.819   82.259  1.00 114.38 ? 32  VAL O N   1 
ATOM   10005 C  CA  . VAL O  2 13  ? 57.766  36.407   83.598  1.00 113.95 ? 32  VAL O CA  1 
ATOM   10006 C  C   . VAL O  2 13  ? 58.993  35.981   84.421  1.00 122.86 ? 32  VAL O C   1 
ATOM   10007 O  O   . VAL O  2 13  ? 60.081  35.759   83.875  1.00 121.71 ? 32  VAL O O   1 
ATOM   10008 C  CB  . VAL O  2 13  ? 56.765  35.233   83.535  1.00 105.09 ? 32  VAL O CB  1 
ATOM   10009 C  CG1 . VAL O  2 13  ? 57.456  33.969   82.999  1.00 99.47  ? 32  VAL O CG1 1 
ATOM   10010 C  CG2 . VAL O  2 13  ? 56.140  34.980   84.908  1.00 108.34 ? 32  VAL O CG2 1 
ATOM   10011 N  N   . THR O  2 14  ? 58.810  35.862   85.734  1.00 142.58 ? 33  THR O N   1 
ATOM   10012 C  CA  . THR O  2 14  ? 59.915  35.550   86.635  1.00 142.86 ? 33  THR O CA  1 
ATOM   10013 C  C   . THR O  2 14  ? 59.800  34.137   87.224  1.00 140.68 ? 33  THR O C   1 
ATOM   10014 O  O   . THR O  2 14  ? 58.763  33.769   87.773  1.00 141.50 ? 33  THR O O   1 
ATOM   10015 C  CB  . THR O  2 14  ? 60.002  36.593   87.775  1.00 141.38 ? 33  THR O CB  1 
ATOM   10016 O  OG1 . THR O  2 14  ? 60.063  37.917   87.220  1.00 137.15 ? 33  THR O OG1 1 
ATOM   10017 C  CG2 . THR O  2 14  ? 61.234  36.340   88.633  1.00 134.60 ? 33  THR O CG2 1 
ATOM   10018 N  N   . CYS O  2 15  ? 60.872  33.357   87.112  1.00 129.21 ? 34  CYS O N   1 
ATOM   10019 C  CA  . CYS O  2 15  ? 60.882  31.970   87.574  1.00 121.59 ? 34  CYS O CA  1 
ATOM   10020 C  C   . CYS O  2 15  ? 61.984  31.696   88.590  1.00 126.14 ? 34  CYS O C   1 
ATOM   10021 O  O   . CYS O  2 15  ? 63.038  32.351   88.582  1.00 134.15 ? 34  CYS O O   1 
ATOM   10022 C  CB  . CYS O  2 15  ? 61.089  31.023   86.394  1.00 114.47 ? 34  CYS O CB  1 
ATOM   10023 S  SG  . CYS O  2 15  ? 60.380  31.614   84.856  1.00 157.53 ? 34  CYS O SG  1 
ATOM   10024 N  N   . THR O  2 16  ? 61.737  30.711   89.453  1.00 110.77 ? 35  THR O N   1 
ATOM   10025 C  CA  . THR O  2 16  ? 62.757  30.216   90.370  1.00 114.94 ? 35  THR O CA  1 
ATOM   10026 C  C   . THR O  2 16  ? 63.837  29.508   89.557  1.00 114.81 ? 35  THR O C   1 
ATOM   10027 O  O   . THR O  2 16  ? 63.552  28.879   88.538  1.00 101.49 ? 35  THR O O   1 
ATOM   10028 C  CB  . THR O  2 16  ? 62.178  29.232   91.409  1.00 116.28 ? 35  THR O CB  1 
ATOM   10029 O  OG1 . THR O  2 16  ? 60.931  29.732   91.909  1.00 123.80 ? 35  THR O OG1 1 
ATOM   10030 C  CG2 . THR O  2 16  ? 63.151  29.044   92.567  1.00 111.96 ? 35  THR O CG2 1 
ATOM   10031 N  N   . CYS O  2 17  ? 65.077  29.618   90.012  1.00 121.50 ? 36  CYS O N   1 
ATOM   10032 C  CA  . CYS O  2 17  ? 66.197  29.083   89.262  1.00 114.99 ? 36  CYS O CA  1 
ATOM   10033 C  C   . CYS O  2 17  ? 67.103  28.225   90.140  1.00 120.22 ? 36  CYS O C   1 
ATOM   10034 O  O   . CYS O  2 17  ? 68.031  28.727   90.772  1.00 130.59 ? 36  CYS O O   1 
ATOM   10035 C  CB  . CYS O  2 17  ? 66.987  30.230   88.621  1.00 117.62 ? 36  CYS O CB  1 
ATOM   10036 S  SG  . CYS O  2 17  ? 68.282  29.705   87.468  1.00 134.63 ? 36  CYS O SG  1 
ATOM   10037 N  N   . GLU O  2 18  ? 66.820  26.927   90.183  1.00 130.64 ? 37  GLU O N   1 
ATOM   10038 C  CA  . GLU O  2 18  ? 67.689  25.966   90.863  1.00 130.95 ? 37  GLU O CA  1 
ATOM   10039 C  C   . GLU O  2 18  ? 68.348  25.031   89.837  1.00 129.30 ? 37  GLU O C   1 
ATOM   10040 O  O   . GLU O  2 18  ? 67.767  24.010   89.452  1.00 127.45 ? 37  GLU O O   1 
ATOM   10041 C  CB  . GLU O  2 18  ? 66.900  25.163   91.904  1.00 125.58 ? 37  GLU O CB  1 
ATOM   10042 N  N   . SER O  2 19  ? 69.553  25.395   89.395  1.00 117.44 ? 38  SER O N   1 
ATOM   10043 C  CA  . SER O  2 19  ? 70.247  24.675   88.327  1.00 114.82 ? 38  SER O CA  1 
ATOM   10044 C  C   . SER O  2 19  ? 71.686  25.144   88.221  1.00 121.04 ? 38  SER O C   1 
ATOM   10045 O  O   . SER O  2 19  ? 72.033  26.197   88.745  1.00 130.28 ? 38  SER O O   1 
ATOM   10046 C  CB  . SER O  2 19  ? 69.546  24.887   86.981  1.00 104.41 ? 38  SER O CB  1 
ATOM   10047 N  N   . PRO O  2 20  ? 72.533  24.354   87.546  1.00 161.95 ? 39  PRO O N   1 
ATOM   10048 C  CA  . PRO O  2 20  ? 73.936  24.724   87.330  1.00 166.59 ? 39  PRO O CA  1 
ATOM   10049 C  C   . PRO O  2 20  ? 74.102  25.979   86.473  1.00 169.38 ? 39  PRO O C   1 
ATOM   10050 O  O   . PRO O  2 20  ? 74.918  26.840   86.822  1.00 180.06 ? 39  PRO O O   1 
ATOM   10051 C  CB  . PRO O  2 20  ? 74.517  23.500   86.611  1.00 159.76 ? 39  PRO O CB  1 
ATOM   10052 C  CG  . PRO O  2 20  ? 73.337  22.754   86.088  1.00 161.94 ? 39  PRO O CG  1 
ATOM   10053 C  CD  . PRO O  2 20  ? 72.247  22.992   87.073  1.00 166.58 ? 39  PRO O CD  1 
ATOM   10054 N  N   . HIS O  2 21  ? 73.350  26.082   85.377  1.00 114.53 ? 40  HIS O N   1 
ATOM   10055 C  CA  . HIS O  2 21  ? 73.443  27.251   84.496  1.00 119.08 ? 40  HIS O CA  1 
ATOM   10056 C  C   . HIS O  2 21  ? 72.736  28.484   85.088  1.00 128.26 ? 40  HIS O C   1 
ATOM   10057 O  O   . HIS O  2 21  ? 72.153  29.287   84.351  1.00 111.92 ? 40  HIS O O   1 
ATOM   10058 C  CB  . HIS O  2 21  ? 72.880  26.931   83.107  1.00 108.60 ? 40  HIS O CB  1 
ATOM   10059 N  N   . CYS O  2 22  ? 72.799  28.633   86.413  1.00 134.27 ? 41  CYS O N   1 
ATOM   10060 C  CA  . CYS O  2 22  ? 72.098  29.715   87.104  1.00 129.36 ? 41  CYS O CA  1 
ATOM   10061 C  C   . CYS O  2 22  ? 72.995  30.874   87.516  1.00 127.63 ? 41  CYS O C   1 
ATOM