data_4GDK
# 
_entry.id   4GDK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GDK         
RCSB  RCSB074048   
WWPDB D_1000074048 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4GDL 
_pdbx_database_related.details        'The structure of the same complex in a different space group.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4GDK 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Otomo, C.'    1 
'Metlagel, Z.' 2 
'Takaesu, G.'  3 
'Otomo, T.'    4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            20 
_citation.page_first                59 
_citation.page_last                 66 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23202584 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2431 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Otomo, C.'    1 
primary 'Metlagel, Z.' 2 
primary 'Takaesu, G.'  3 
primary 'Otomo, T.'    4 
# 
_cell.length_a           43.757 
_cell.length_b           113.153 
_cell.length_c           210.685 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4GDK 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4GDK 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ubiquitin-like protein ATG12'   10282.029 2  ? ? ? ? 
2 polymer     man 'Autophagy protein 5'            32489.195 2  ? ? ? ? 
3 polymer     man 'Autophagy-related protein 16-1' 4657.435  2  ? ? ? ? 
4 non-polymer syn 'SODIUM ION'                     22.990    2  ? ? ? ? 
5 water       nat water                            18.015    76 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Autophagy-related protein 12, APG12-like' 
2 'APG5-like, Apoptosis-specific protein'    
3 'APG16-like 1'                             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKL
VLHYCKSQAWG
;
;GSKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKL
VLHYCKSQAWG
;
A,D ? 
2 'polypeptide(L)' no no 
;MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWH
YPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQND
RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
;
;MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWH
YPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQND
RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
;
B,E ? 
3 'polypeptide(L)' no no SHMPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL SHMPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   LYS n 
1 5   LYS n 
1 6   ILE n 
1 7   ASP n 
1 8   ILE n 
1 9   LEU n 
1 10  LEU n 
1 11  LYS n 
1 12  ALA n 
1 13  VAL n 
1 14  GLY n 
1 15  ASP n 
1 16  THR n 
1 17  PRO n 
1 18  ILE n 
1 19  MET n 
1 20  LYS n 
1 21  THR n 
1 22  LYS n 
1 23  LYS n 
1 24  TRP n 
1 25  ALA n 
1 26  VAL n 
1 27  GLU n 
1 28  ARG n 
1 29  THR n 
1 30  ARG n 
1 31  THR n 
1 32  ILE n 
1 33  GLN n 
1 34  GLY n 
1 35  LEU n 
1 36  ILE n 
1 37  ASP n 
1 38  PHE n 
1 39  ILE n 
1 40  LYS n 
1 41  LYS n 
1 42  PHE n 
1 43  LEU n 
1 44  LYS n 
1 45  LEU n 
1 46  VAL n 
1 47  ALA n 
1 48  SER n 
1 49  GLU n 
1 50  GLN n 
1 51  LEU n 
1 52  PHE n 
1 53  ILE n 
1 54  TYR n 
1 55  VAL n 
1 56  ASN n 
1 57  GLN n 
1 58  SER n 
1 59  PHE n 
1 60  ALA n 
1 61  PRO n 
1 62  SER n 
1 63  PRO n 
1 64  ASP n 
1 65  GLN n 
1 66  GLU n 
1 67  VAL n 
1 68  GLY n 
1 69  THR n 
1 70  LEU n 
1 71  TYR n 
1 72  GLU n 
1 73  CYS n 
1 74  PHE n 
1 75  GLY n 
1 76  SER n 
1 77  ASP n 
1 78  GLY n 
1 79  LYS n 
1 80  LEU n 
1 81  VAL n 
1 82  LEU n 
1 83  HIS n 
1 84  TYR n 
1 85  CYS n 
1 86  LYS n 
1 87  SER n 
1 88  GLN n 
1 89  ALA n 
1 90  TRP n 
1 91  GLY n 
2 1   MET n 
2 2   THR n 
2 3   ASP n 
2 4   ASP n 
2 5   LYS n 
2 6   ASP n 
2 7   VAL n 
2 8   LEU n 
2 9   ARG n 
2 10  ASP n 
2 11  VAL n 
2 12  TRP n 
2 13  PHE n 
2 14  GLY n 
2 15  ARG n 
2 16  ILE n 
2 17  PRO n 
2 18  THR n 
2 19  CYS n 
2 20  PHE n 
2 21  THR n 
2 22  LEU n 
2 23  TYR n 
2 24  GLN n 
2 25  ASP n 
2 26  GLU n 
2 27  ILE n 
2 28  THR n 
2 29  GLU n 
2 30  ARG n 
2 31  GLU n 
2 32  ALA n 
2 33  GLU n 
2 34  PRO n 
2 35  TYR n 
2 36  TYR n 
2 37  LEU n 
2 38  LEU n 
2 39  LEU n 
2 40  PRO n 
2 41  ARG n 
2 42  VAL n 
2 43  SER n 
2 44  TYR n 
2 45  LEU n 
2 46  THR n 
2 47  LEU n 
2 48  VAL n 
2 49  THR n 
2 50  ASP n 
2 51  LYS n 
2 52  VAL n 
2 53  LYS n 
2 54  LYS n 
2 55  HIS n 
2 56  PHE n 
2 57  GLN n 
2 58  LYS n 
2 59  VAL n 
2 60  MET n 
2 61  ARG n 
2 62  GLN n 
2 63  GLU n 
2 64  ASP n 
2 65  ILE n 
2 66  SER n 
2 67  GLU n 
2 68  ILE n 
2 69  TRP n 
2 70  PHE n 
2 71  GLU n 
2 72  TYR n 
2 73  GLU n 
2 74  GLY n 
2 75  THR n 
2 76  PRO n 
2 77  LEU n 
2 78  LYS n 
2 79  TRP n 
2 80  HIS n 
2 81  TYR n 
2 82  PRO n 
2 83  ILE n 
2 84  GLY n 
2 85  LEU n 
2 86  LEU n 
2 87  PHE n 
2 88  ASP n 
2 89  LEU n 
2 90  LEU n 
2 91  ALA n 
2 92  SER n 
2 93  SER n 
2 94  SER n 
2 95  ALA n 
2 96  LEU n 
2 97  PRO n 
2 98  TRP n 
2 99  ASN n 
2 100 ILE n 
2 101 THR n 
2 102 VAL n 
2 103 HIS n 
2 104 PHE n 
2 105 LYS n 
2 106 SER n 
2 107 PHE n 
2 108 PRO n 
2 109 GLU n 
2 110 LYS n 
2 111 ASP n 
2 112 LEU n 
2 113 LEU n 
2 114 HIS n 
2 115 CYS n 
2 116 PRO n 
2 117 SER n 
2 118 LYS n 
2 119 ASP n 
2 120 ALA n 
2 121 ILE n 
2 122 GLU n 
2 123 ALA n 
2 124 HIS n 
2 125 PHE n 
2 126 MET n 
2 127 SER n 
2 128 CYS n 
2 129 MET n 
2 130 LYS n 
2 131 GLU n 
2 132 ALA n 
2 133 ASP n 
2 134 ALA n 
2 135 LEU n 
2 136 LYS n 
2 137 HIS n 
2 138 LYS n 
2 139 SER n 
2 140 GLN n 
2 141 VAL n 
2 142 ILE n 
2 143 ASN n 
2 144 GLU n 
2 145 MET n 
2 146 GLN n 
2 147 LYS n 
2 148 LYS n 
2 149 ASP n 
2 150 HIS n 
2 151 LYS n 
2 152 GLN n 
2 153 LEU n 
2 154 TRP n 
2 155 MET n 
2 156 GLY n 
2 157 LEU n 
2 158 GLN n 
2 159 ASN n 
2 160 ASP n 
2 161 ARG n 
2 162 PHE n 
2 163 ASP n 
2 164 GLN n 
2 165 PHE n 
2 166 TRP n 
2 167 ALA n 
2 168 ILE n 
2 169 ASN n 
2 170 ARG n 
2 171 LYS n 
2 172 LEU n 
2 173 MET n 
2 174 GLU n 
2 175 TYR n 
2 176 PRO n 
2 177 ALA n 
2 178 GLU n 
2 179 GLU n 
2 180 ASN n 
2 181 GLY n 
2 182 PHE n 
2 183 ARG n 
2 184 TYR n 
2 185 ILE n 
2 186 PRO n 
2 187 PHE n 
2 188 ARG n 
2 189 ILE n 
2 190 TYR n 
2 191 GLN n 
2 192 THR n 
2 193 THR n 
2 194 THR n 
2 195 GLU n 
2 196 ARG n 
2 197 PRO n 
2 198 PHE n 
2 199 ILE n 
2 200 GLN n 
2 201 LYS n 
2 202 LEU n 
2 203 PHE n 
2 204 ARG n 
2 205 PRO n 
2 206 VAL n 
2 207 ALA n 
2 208 ALA n 
2 209 ASP n 
2 210 GLY n 
2 211 GLN n 
2 212 LEU n 
2 213 HIS n 
2 214 THR n 
2 215 LEU n 
2 216 GLY n 
2 217 ASP n 
2 218 LEU n 
2 219 LEU n 
2 220 LYS n 
2 221 GLU n 
2 222 VAL n 
2 223 CYS n 
2 224 PRO n 
2 225 SER n 
2 226 ALA n 
2 227 ILE n 
2 228 ASP n 
2 229 PRO n 
2 230 GLU n 
2 231 ASP n 
2 232 GLY n 
2 233 GLU n 
2 234 LYS n 
2 235 LYS n 
2 236 ASN n 
2 237 GLN n 
2 238 VAL n 
2 239 MET n 
2 240 ILE n 
2 241 HIS n 
2 242 GLY n 
2 243 ILE n 
2 244 GLU n 
2 245 PRO n 
2 246 MET n 
2 247 LEU n 
2 248 GLU n 
2 249 THR n 
2 250 PRO n 
2 251 LEU n 
2 252 GLN n 
2 253 TRP n 
2 254 LEU n 
2 255 SER n 
2 256 GLU n 
2 257 HIS n 
2 258 LEU n 
2 259 SER n 
2 260 TYR n 
2 261 PRO n 
2 262 ASP n 
2 263 ASN n 
2 264 PHE n 
2 265 LEU n 
2 266 HIS n 
2 267 ILE n 
2 268 SER n 
2 269 ILE n 
2 270 ILE n 
2 271 PRO n 
2 272 GLN n 
2 273 PRO n 
2 274 THR n 
2 275 ASP n 
3 1   SER n 
3 2   HIS n 
3 3   MET n 
3 4   PRO n 
3 5   ARG n 
3 6   TRP n 
3 7   LYS n 
3 8   ARG n 
3 9   HIS n 
3 10  ILE n 
3 11  SER n 
3 12  GLU n 
3 13  GLN n 
3 14  LEU n 
3 15  ARG n 
3 16  ARG n 
3 17  ARG n 
3 18  ASP n 
3 19  ARG n 
3 20  LEU n 
3 21  GLN n 
3 22  ARG n 
3 23  GLN n 
3 24  ALA n 
3 25  PHE n 
3 26  GLU n 
3 27  GLU n 
3 28  ILE n 
3 29  ILE n 
3 30  LEU n 
3 31  GLN n 
3 32  TYR n 
3 33  ASN n 
3 34  LYS n 
3 35  LEU n 
3 36  LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'APG12, APG12L, ATG12'              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pACYC Duet-1' ? ? 
2 1 sample ? ? ? human ? 'APG5L, ASP, ATG5'                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pACYC Duet-1' ? ? 
3 1 sample ? ? ? human ? 'APG16L, ATG16L1, UNQ9393/PRO34307' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET            ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATG12_HUMAN O94817 1 
;KKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVL
HYCKSQAWG
;
52 ? 
2 UNP ATG5_HUMAN  Q9H1Y0 2 
;MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWH
YPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQND
RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
;
1  ? 
3 UNP A16L1_HUMAN Q676U5 3 PRWKRHISEQLRRRDRLQRQAFEEIILQYNKLL 11 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GDK A 3 ? 91  ? O94817 52 ? 140 ? 52 140 
2 2 4GDK B 1 ? 275 ? Q9H1Y0 1  ? 275 ? 1  275 
3 3 4GDK C 4 ? 36  ? Q676U5 11 ? 43  ? 11 43  
4 1 4GDK D 3 ? 91  ? O94817 52 ? 140 ? 52 140 
5 2 4GDK E 1 ? 275 ? Q9H1Y0 1  ? 275 ? 1  275 
6 3 4GDK F 4 ? 36  ? Q676U5 11 ? 43  ? 11 43  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GDK GLY A 1 ? UNP O94817 ? ? 'EXPRESSION TAG' 50 1  
1 4GDK SER A 2 ? UNP O94817 ? ? 'EXPRESSION TAG' 51 2  
3 4GDK SER C 1 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 8  3  
3 4GDK HIS C 2 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 9  4  
3 4GDK MET C 3 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 10 5  
4 4GDK GLY D 1 ? UNP O94817 ? ? 'EXPRESSION TAG' 50 6  
4 4GDK SER D 2 ? UNP O94817 ? ? 'EXPRESSION TAG' 51 7  
6 4GDK SER F 1 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 8  8  
6 4GDK HIS F 2 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 9  9  
6 4GDK MET F 3 ? UNP Q676U5 ? ? 'EXPRESSION TAG' 10 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4GDK 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.26 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
;PROTEIN: 10 MG/ML in 0.01M HEPES pH 7.0, 0.3 M NaCl, 0.001 M DTT; RESERVOIR: 0.1M Hepes pH7.5, 0.2 M lithium citrate, 20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-08-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
# 
_reflns.entry_id                     4GDK 
_reflns.d_resolution_high            2.700 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   29676 
_reflns.pdbx_Rmerge_I_obs            0.100 
_reflns.pdbx_netI_over_sigmaI        9.600 
_reflns.pdbx_chi_squared             1.002 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.700 2.800  ? ? ? 0.636 ? ? 1.016 6.100 ? 2866 100.000 1  1 
2.800 2.910  ? ? ? 0.494 ? ? 1.028 7.100 ? 2940 100.000 2  1 
2.910 3.040  ? ? ? 0.349 ? ? 0.993 7.300 ? 2885 100.000 3  1 
3.040 3.200  ? ? ? 0.233 ? ? 1.024 7.300 ? 2938 100.000 4  1 
3.200 3.400  ? ? ? 0.162 ? ? 1.000 7.300 ? 2949 100.000 5  1 
3.400 3.660  ? ? ? 0.122 ? ? 1.034 7.200 ? 2950 100.000 6  1 
3.660 4.030  ? ? ? 0.097 ? ? 0.953 7.000 ? 2950 99.900  7  1 
4.030 4.620  ? ? ? 0.077 ? ? 1.009 6.800 ? 2963 100.000 8  1 
4.620 5.810  ? ? ? 0.076 ? ? 0.985 6.800 ? 3031 100.000 9  1 
5.810 50.000 ? ? ? 0.056 ? ? 0.981 6.600 ? 3204 99.600  10 1 
# 
_refine.entry_id                                 4GDK 
_refine.ls_d_res_high                            2.7000 
_refine.ls_d_res_low                             44.0580 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.5000 
_refine.ls_number_reflns_obs                     29598 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1796 
_refine.ls_R_factor_R_work                       0.1756 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2361 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 6.7600 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               67.2963 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8291 
_refine.B_iso_max                                152.090 
_refine.B_iso_min                                29.790 
_refine.pdbx_overall_phase_error                 23.5000 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6469 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               6547 
_refine_hist.d_res_high                       2.7000 
_refine_hist.d_res_low                        44.0580 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           6655 0.003  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          9009 0.661  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     960  0.049  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1137 0.003  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 2516 11.391 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.6999 2.7674  14 94.0000  1821 . 0.2435 0.2957 . 132 . 1953 . . 'X-RAY DIFFRACTION' 
2.7674 2.8422  14 100.0000 1927 . 0.2411 0.3039 . 140 . 2067 . . 'X-RAY DIFFRACTION' 
2.8422 2.9258  14 100.0000 1963 . 0.2394 0.3327 . 142 . 2105 . . 'X-RAY DIFFRACTION' 
2.9258 3.0202  14 100.0000 1903 . 0.2343 0.2766 . 137 . 2040 . . 'X-RAY DIFFRACTION' 
3.0202 3.1281  14 100.0000 1988 . 0.2289 0.2932 . 145 . 2133 . . 'X-RAY DIFFRACTION' 
3.1281 3.2533  14 100.0000 1927 . 0.2129 0.3120 . 139 . 2066 . . 'X-RAY DIFFRACTION' 
3.2533 3.4014  14 100.0000 1985 . 0.2083 0.2762 . 144 . 2129 . . 'X-RAY DIFFRACTION' 
3.4014 3.5806  14 100.0000 1949 . 0.1983 0.2264 . 141 . 2090 . . 'X-RAY DIFFRACTION' 
3.5806 3.8048  14 100.0000 1963 . 0.1753 0.2476 . 143 . 2106 . . 'X-RAY DIFFRACTION' 
3.8048 4.0984  14 100.0000 1975 . 0.1614 0.2335 . 144 . 2119 . . 'X-RAY DIFFRACTION' 
4.0984 4.5105  14 100.0000 2003 . 0.1379 0.2014 . 144 . 2147 . . 'X-RAY DIFFRACTION' 
4.5105 5.1623  14 100.0000 1999 . 0.1299 0.1970 . 145 . 2144 . . 'X-RAY DIFFRACTION' 
5.1623 6.5006  14 100.0000 2044 . 0.1667 0.2330 . 148 . 2192 . . 'X-RAY DIFFRACTION' 
6.5006 44.0639 14 100.0000 2151 . 0.1661 0.1963 . 156 . 2307 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4GDK 
_struct.title                     
'Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment of Atg16L1' 
_struct.pdbx_descriptor           'Atg12, Atg5, Atg16L1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GDK 
_struct_keywords.text            
;protein-protein conjugate, protein-protein complex, ubiquitin-like protein, autophagy, E3 ligase, ubiquitin-like fold, structural protein, isopeptide bond, Cytoplasm and autophagosomal membranes, PROTEIN BINDING
;
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 31  ? LEU A 43  ? THR A 80  LEU A 92  1 ? 13 
HELX_P HELX_P2  2  GLU A 66  ? GLY A 75  ? GLU A 115 GLY A 124 1 ? 10 
HELX_P HELX_P3  3  ASP B 4   ? PHE B 13  ? ASP B 4   PHE B 13  1 ? 10 
HELX_P HELX_P4  4  TYR B 44  ? THR B 49  ? TYR B 44  THR B 49  1 ? 6  
HELX_P HELX_P5  5  THR B 49  ? LYS B 58  ? THR B 49  LYS B 58  1 ? 10 
HELX_P HELX_P6  6  VAL B 59  ? MET B 60  ? VAL B 59  MET B 60  5 ? 2  
HELX_P HELX_P7  7  ARG B 61  ? ILE B 65  ? ARG B 61  ILE B 65  5 ? 5  
HELX_P HELX_P8  8  PRO B 82  ? SER B 92  ? PRO B 82  SER B 92  1 ? 11 
HELX_P HELX_P9  9  SER B 117 ? LYS B 138 ? SER B 117 LYS B 138 1 ? 22 
HELX_P HELX_P10 10 GLN B 146 ? ASN B 159 ? GLN B 146 ASN B 159 1 ? 14 
HELX_P HELX_P11 11 ARG B 161 ? ARG B 170 ? ARG B 161 ARG B 170 1 ? 10 
HELX_P HELX_P12 12 LYS B 171 ? GLU B 174 ? LYS B 171 GLU B 174 5 ? 4  
HELX_P HELX_P13 13 THR B 214 ? CYS B 223 ? THR B 214 CYS B 223 1 ? 10 
HELX_P HELX_P14 14 PRO B 224 ? ILE B 227 ? PRO B 224 ILE B 227 5 ? 4  
HELX_P HELX_P15 15 PRO B 250 ? LEU B 258 ? PRO B 250 LEU B 258 1 ? 9  
HELX_P HELX_P16 16 PRO C 4   ? ARG C 22  ? PRO C 11  ARG C 29  1 ? 19 
HELX_P HELX_P17 17 ARG C 22  ? LEU C 35  ? ARG C 29  LEU C 42  1 ? 14 
HELX_P HELX_P18 18 THR D 31  ? LEU D 43  ? THR D 80  LEU D 92  1 ? 13 
HELX_P HELX_P19 19 GLU D 66  ? GLY D 75  ? GLU D 115 GLY D 124 1 ? 10 
HELX_P HELX_P20 20 ASP E 4   ? PHE E 13  ? ASP E 4   PHE E 13  1 ? 10 
HELX_P HELX_P21 21 TYR E 44  ? THR E 49  ? TYR E 44  THR E 49  1 ? 6  
HELX_P HELX_P22 22 THR E 49  ? LYS E 58  ? THR E 49  LYS E 58  1 ? 10 
HELX_P HELX_P23 23 PRO E 82  ? ALA E 91  ? PRO E 82  ALA E 91  1 ? 10 
HELX_P HELX_P24 24 SER E 117 ? LYS E 138 ? SER E 117 LYS E 138 1 ? 22 
HELX_P HELX_P25 25 SER E 139 ? GLU E 144 ? SER E 139 GLU E 144 1 ? 6  
HELX_P HELX_P26 26 GLN E 146 ? ASN E 159 ? GLN E 146 ASN E 159 1 ? 14 
HELX_P HELX_P27 27 ARG E 161 ? ARG E 170 ? ARG E 161 ARG E 170 1 ? 10 
HELX_P HELX_P28 28 LYS E 171 ? GLU E 174 ? LYS E 171 GLU E 174 5 ? 4  
HELX_P HELX_P29 29 THR E 214 ? CYS E 223 ? THR E 214 CYS E 223 1 ? 10 
HELX_P HELX_P30 30 PRO E 250 ? LEU E 258 ? PRO E 250 LEU E 258 1 ? 9  
HELX_P HELX_P31 31 PRO F 4   ? GLN F 21  ? PRO F 11  GLN F 28  1 ? 18 
HELX_P HELX_P32 32 GLN F 21  ? LEU F 35  ? GLN F 28  LEU F 42  1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ALA 95 O   ? ? ? 1_555 H NA  .   NA ? ? E ALA 95  E NA  301 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc2  metalc ? ? E ASN 99 OD1 ? ? ? 1_555 H NA  .   NA ? ? E ASN 99  E NA  301 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc3  metalc ? ? B ASN 99 OD1 ? ? ? 1_555 G NA  .   NA ? ? B ASN 99  B NA  301 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc4  metalc ? ? G NA  .  NA  ? ? ? 1_555 J HOH .   O  ? ? B NA  301 B HOH 438 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc5  metalc ? ? B PRO 97 O   ? ? ? 1_555 G NA  .   NA ? ? B PRO 97  B NA  301 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc6  metalc ? ? H NA  .  NA  ? ? ? 1_555 M HOH .   O  ? ? E NA  301 E HOH 413 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc7  metalc ? ? G NA  .  NA  ? ? ? 1_555 J HOH .   O  ? ? B NA  301 B HOH 424 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc8  metalc ? ? G NA  .  NA  ? ? ? 1_555 J HOH .   O  ? ? B NA  301 B HOH 437 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc9  metalc ? ? B ALA 95 O   ? ? ? 1_555 G NA  .   NA ? ? B ALA 95  B NA  301 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc10 metalc ? ? H NA  .  NA  ? ? ? 1_555 M HOH .   O  ? ? E NA  301 E HOH 407 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc11 metalc ? ? E PRO 97 O   ? ? ? 1_555 H NA  .   NA ? ? E PRO 97  E NA  301 1_555 ? ? ? ? ? ? ? 2.522 ? 
covale1  covale ? ? A GLY 91 C   ? ? ? 1_555 B LYS 130 NZ ? ? A GLY 140 B LYS 130 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2  covale ? ? D GLY 91 C   ? ? ? 1_555 E LYS 130 NZ ? ? D GLY 140 E LYS 130 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 14 A . ? GLY 63 A ASP 15 A ? ASP 64 A 1 -1.74 
2 LEU 96 B . ? LEU 96 B PRO 97 B ? PRO 97 B 1 -7.79 
3 GLY 14 D . ? GLY 63 D ASP 15 D ? ASP 64 D 1 -2.64 
4 LEU 96 E . ? LEU 96 E PRO 97 E ? PRO 97 E 1 -5.84 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 5 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 23  ? GLU A 27  ? LYS A 72  GLU A 76  
A 2 LYS A 5   ? ALA A 12  ? LYS A 54  ALA A 61  
A 3 LYS A 79  ? CYS A 85  ? LYS A 128 CYS A 134 
A 4 PHE A 52  ? VAL A 55  ? PHE A 101 VAL A 104 
B 1 TYR B 35  ? PRO B 40  ? TYR B 35  PRO B 40  
B 2 ARG B 15  ? LEU B 22  ? ARG B 15  LEU B 22  
B 3 TRP B 98  ? HIS B 103 ? TRP B 98  HIS B 103 
B 4 TRP B 69  ? TYR B 72  ? TRP B 69  TYR B 72  
B 5 THR B 75  ? PRO B 76  ? THR B 75  PRO B 76  
C 1 PHE B 198 ? ILE B 199 ? PHE B 198 ILE B 199 
C 2 PHE B 187 ? TYR B 190 ? PHE B 187 TYR B 190 
C 3 LEU B 265 ? PRO B 271 ? LEU B 265 PRO B 271 
C 4 ASN B 236 ? MET B 239 ? ASN B 236 MET B 239 
D 1 LYS D 23  ? VAL D 26  ? LYS D 72  VAL D 75  
D 2 ILE D 6   ? ALA D 12  ? ILE D 55  ALA D 61  
D 3 LEU D 80  ? CYS D 85  ? LEU D 129 CYS D 134 
D 4 PHE D 52  ? VAL D 55  ? PHE D 101 VAL D 104 
E 1 TYR E 35  ? PRO E 40  ? TYR E 35  PRO E 40  
E 2 ARG E 15  ? LEU E 22  ? ARG E 15  LEU E 22  
E 3 TRP E 98  ? HIS E 103 ? TRP E 98  HIS E 103 
E 4 TRP E 69  ? TYR E 72  ? TRP E 69  TYR E 72  
E 5 THR E 75  ? PRO E 76  ? THR E 75  PRO E 76  
F 1 PHE E 187 ? GLN E 191 ? PHE E 187 GLN E 191 
F 2 LEU E 265 ? PRO E 271 ? LEU E 265 PRO E 271 
F 3 ASN E 236 ? MET E 239 ? ASN E 236 MET E 239 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 26  ? O VAL A 75  N ILE A 6   ? N ILE A 55  
A 2 3 N ASP A 7   ? N ASP A 56  O LEU A 80  ? O LEU A 129 
A 3 4 O CYS A 85  ? O CYS A 134 N PHE A 52  ? N PHE A 101 
B 1 2 O TYR B 35  ? O TYR B 35  N PHE B 20  ? N PHE B 20  
B 2 3 N CYS B 19  ? N CYS B 19  O TRP B 98  ? O TRP B 98  
B 3 4 O THR B 101 ? O THR B 101 N GLU B 71  ? N GLU B 71  
B 4 5 N TYR B 72  ? N TYR B 72  O THR B 75  ? O THR B 75  
C 1 2 O ILE B 199 ? O ILE B 199 N ILE B 189 ? N ILE B 189 
C 2 3 N TYR B 190 ? N TYR B 190 O ILE B 267 ? O ILE B 267 
C 3 4 O ILE B 270 ? O ILE B 270 N GLN B 237 ? N GLN B 237 
D 1 2 O TRP D 24  ? O TRP D 73  N ILE D 8   ? N ILE D 57  
D 2 3 N LEU D 9   ? N LEU D 58  O LEU D 82  ? O LEU D 131 
D 3 4 O CYS D 85  ? O CYS D 134 N PHE D 52  ? N PHE D 101 
E 1 2 O TYR E 35  ? O TYR E 35  N PHE E 20  ? N PHE E 20  
E 2 3 N CYS E 19  ? N CYS E 19  O TRP E 98  ? O TRP E 98  
E 3 4 O HIS E 103 ? O HIS E 103 N TRP E 69  ? N TRP E 69  
E 4 5 N TYR E 72  ? N TYR E 72  O THR E 75  ? O THR E 75  
F 1 2 N TYR E 190 ? N TYR E 190 O ILE E 267 ? O ILE E 267 
F 2 3 O ILE E 270 ? O ILE E 270 N GLN E 237 ? N GLN E 237 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA B 301' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA E 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ALA B 95 ? ALA B 95  . ? 1_555 ? 
2  AC1 6 PRO B 97 ? PRO B 97  . ? 1_555 ? 
3  AC1 6 ASN B 99 ? ASN B 99  . ? 1_555 ? 
4  AC1 6 HOH J .  ? HOH B 424 . ? 1_555 ? 
5  AC1 6 HOH J .  ? HOH B 437 . ? 1_555 ? 
6  AC1 6 HOH J .  ? HOH B 438 . ? 1_555 ? 
7  AC2 5 ALA E 95 ? ALA E 95  . ? 1_555 ? 
8  AC2 5 PRO E 97 ? PRO E 97  . ? 1_555 ? 
9  AC2 5 ASN E 99 ? ASN E 99  . ? 1_555 ? 
10 AC2 5 HOH M .  ? HOH E 407 . ? 1_555 ? 
11 AC2 5 HOH M .  ? HOH E 413 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4GDK 
_atom_sites.fract_transf_matrix[1][1]   0.022853 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008838 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004746 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? -11.641 20.960  24.726  1.00 91.40  ? 53  LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? -11.050 20.062  25.712  1.00 93.34  ? 53  LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? -10.457 18.801  25.081  1.00 93.87  ? 53  LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? -10.485 17.724  25.680  1.00 91.76  ? 53  LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? -12.075 19.686  26.785  1.00 95.04  ? 53  LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? -12.022 20.570  28.018  1.00 97.07  ? 53  LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? -10.618 20.588  28.604  1.00 99.84  ? 53  LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? -10.583 21.284  29.952  1.00 103.85 ? 53  LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? -11.384 20.549  30.971  1.00 104.74 ? 53  LYS A NZ  1 
ATOM   10   N  N   . LYS A 1 5   ? -9.927  18.944  23.870  1.00 94.67  ? 54  LYS A N   1 
ATOM   11   C  CA  . LYS A 1 5   ? -9.216  17.856  23.203  1.00 90.37  ? 54  LYS A CA  1 
ATOM   12   C  C   . LYS A 1 5   ? -7.802  18.290  22.838  1.00 91.16  ? 54  LYS A C   1 
ATOM   13   O  O   . LYS A 1 5   ? -7.492  19.480  22.842  1.00 96.92  ? 54  LYS A O   1 
ATOM   14   C  CB  . LYS A 1 5   ? -9.959  17.401  21.946  1.00 86.13  ? 54  LYS A CB  1 
ATOM   15   C  CG  . LYS A 1 5   ? -11.146 16.496  22.213  1.00 82.02  ? 54  LYS A CG  1 
ATOM   16   C  CD  . LYS A 1 5   ? -11.732 15.968  20.915  1.00 79.13  ? 54  LYS A CD  1 
ATOM   17   C  CE  . LYS A 1 5   ? -12.900 15.035  21.181  1.00 78.94  ? 54  LYS A CE  1 
ATOM   18   N  NZ  . LYS A 1 5   ? -13.480 14.501  19.919  1.00 81.39  ? 54  LYS A NZ  1 
ATOM   19   N  N   . ILE A 1 6   ? -6.944  17.324  22.529  1.00 86.34  ? 55  ILE A N   1 
ATOM   20   C  CA  . ILE A 1 6   ? -5.570  17.629  22.149  1.00 85.72  ? 55  ILE A CA  1 
ATOM   21   C  C   . ILE A 1 6   ? -5.154  16.873  20.896  1.00 82.51  ? 55  ILE A C   1 
ATOM   22   O  O   . ILE A 1 6   ? -5.688  15.804  20.593  1.00 78.94  ? 55  ILE A O   1 
ATOM   23   C  CB  . ILE A 1 6   ? -4.577  17.295  23.272  1.00 87.78  ? 55  ILE A CB  1 
ATOM   24   C  CG1 . ILE A 1 6   ? -4.628  15.805  23.596  1.00 85.96  ? 55  ILE A CG1 1 
ATOM   25   C  CG2 . ILE A 1 6   ? -4.861  18.131  24.514  1.00 91.11  ? 55  ILE A CG2 1 
ATOM   26   C  CD1 . ILE A 1 6   ? -3.816  15.434  24.795  1.00 88.35  ? 55  ILE A CD1 1 
ATOM   27   N  N   . ASP A 1 7   ? -4.187  17.434  20.178  1.00 81.75  ? 56  ASP A N   1 
ATOM   28   C  CA  . ASP A 1 7   ? -3.707  16.844  18.936  1.00 78.42  ? 56  ASP A CA  1 
ATOM   29   C  C   . ASP A 1 7   ? -2.623  15.804  19.171  1.00 72.97  ? 56  ASP A C   1 
ATOM   30   O  O   . ASP A 1 7   ? -1.674  16.031  19.924  1.00 73.05  ? 56  ASP A O   1 
ATOM   31   C  CB  . ASP A 1 7   ? -3.189  17.930  17.996  1.00 81.86  ? 56  ASP A CB  1 
ATOM   32   C  CG  . ASP A 1 7   ? -4.282  18.867  17.540  1.00 88.35  ? 56  ASP A CG  1 
ATOM   33   O  OD1 . ASP A 1 7   ? -4.028  20.089  17.465  1.00 94.67  ? 56  ASP A OD1 1 
ATOM   34   O  OD2 . ASP A 1 7   ? -5.398  18.376  17.263  1.00 86.81  ? 56  ASP A OD2 1 
ATOM   35   N  N   . ILE A 1 8   ? -2.773  14.659  18.518  1.00 70.41  ? 57  ILE A N   1 
ATOM   36   C  CA  . ILE A 1 8   ? -1.781  13.601  18.604  1.00 73.84  ? 57  ILE A CA  1 
ATOM   37   C  C   . ILE A 1 8   ? -1.280  13.222  17.217  1.00 75.55  ? 57  ILE A C   1 
ATOM   38   O  O   . ILE A 1 8   ? -2.066  12.900  16.329  1.00 80.00  ? 57  ILE A O   1 
ATOM   39   C  CB  . ILE A 1 8   ? -2.345  12.352  19.300  1.00 73.60  ? 57  ILE A CB  1 
ATOM   40   C  CG1 . ILE A 1 8   ? -2.718  12.673  20.746  1.00 71.89  ? 57  ILE A CG1 1 
ATOM   41   C  CG2 . ILE A 1 8   ? -1.332  11.222  19.262  1.00 74.97  ? 57  ILE A CG2 1 
ATOM   42   C  CD1 . ILE A 1 8   ? -3.110  11.463  21.545  1.00 70.18  ? 57  ILE A CD1 1 
ATOM   43   N  N   . LEU A 1 9   ? 0.033   13.277  17.034  1.00 73.99  ? 58  LEU A N   1 
ATOM   44   C  CA  . LEU A 1 9   ? 0.641   12.854  15.782  1.00 72.74  ? 58  LEU A CA  1 
ATOM   45   C  C   . LEU A 1 9   ? 1.327   11.508  15.985  1.00 72.49  ? 58  LEU A C   1 
ATOM   46   O  O   . LEU A 1 9   ? 2.285   11.399  16.749  1.00 73.31  ? 58  LEU A O   1 
ATOM   47   C  CB  . LEU A 1 9   ? 1.639   13.901  15.286  1.00 68.89  ? 58  LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 9   ? 2.397   13.535  14.012  1.00 69.34  ? 58  LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 9   ? 1.426   13.273  12.873  1.00 70.42  ? 58  LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 9   ? 3.385   14.628  13.643  1.00 67.56  ? 58  LEU A CD2 1 
ATOM   51   N  N   . LEU A 1 10  ? 0.822   10.483  15.307  1.00 72.08  ? 59  LEU A N   1 
ATOM   52   C  CA  . LEU A 1 10  ? 1.351   9.133   15.446  1.00 67.78  ? 59  LEU A CA  1 
ATOM   53   C  C   . LEU A 1 10  ? 2.426   8.844   14.404  1.00 70.49  ? 59  LEU A C   1 
ATOM   54   O  O   . LEU A 1 10  ? 2.176   8.919   13.201  1.00 71.77  ? 59  LEU A O   1 
ATOM   55   C  CB  . LEU A 1 10  ? 0.222   8.108   15.326  1.00 60.58  ? 59  LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 10  ? -0.930  8.224   16.328  1.00 67.72  ? 59  LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 10  ? -2.043  7.245   15.988  1.00 69.19  ? 59  LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 10  ? -0.435  7.987   17.742  1.00 59.05  ? 59  LEU A CD2 1 
ATOM   59   N  N   . LYS A 1 11  ? 3.623   8.513   14.875  1.00 72.93  ? 60  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 11  ? 4.720   8.135   13.994  1.00 73.10  ? 60  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 11  ? 5.085   6.670   14.216  1.00 74.66  ? 60  LYS A C   1 
ATOM   62   O  O   . LYS A 1 11  ? 5.002   6.171   15.334  1.00 80.61  ? 60  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 11  ? 5.933   9.030   14.244  1.00 71.07  ? 60  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 11  ? 5.664   10.507  14.013  1.00 70.87  ? 60  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 11  ? 6.950   11.311  14.063  1.00 71.60  ? 60  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 11  ? 6.712   12.759  13.674  1.00 73.30  ? 60  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 11  ? 7.988   13.518  13.628  1.00 77.80  ? 60  LYS A NZ  1 
ATOM   68   N  N   . ALA A 1 12  ? 5.490   5.983   13.153  1.00 72.17  ? 61  ALA A N   1 
ATOM   69   C  CA  . ALA A 1 12  ? 5.760   4.550   13.234  1.00 65.45  ? 61  ALA A CA  1 
ATOM   70   C  C   . ALA A 1 12  ? 7.247   4.216   13.288  1.00 65.61  ? 61  ALA A C   1 
ATOM   71   O  O   . ALA A 1 12  ? 8.071   4.877   12.656  1.00 71.76  ? 61  ALA A O   1 
ATOM   72   C  CB  . ALA A 1 12  ? 5.101   3.823   12.072  1.00 60.71  ? 61  ALA A CB  1 
ATOM   73   N  N   . VAL A 1 13  ? 7.578   3.185   14.054  1.00 66.06  ? 62  VAL A N   1 
ATOM   74   C  CA  . VAL A 1 13  ? 8.927   2.641   14.073  1.00 70.44  ? 62  VAL A CA  1 
ATOM   75   C  C   . VAL A 1 13  ? 8.836   1.164   13.702  1.00 81.02  ? 62  VAL A C   1 
ATOM   76   O  O   . VAL A 1 13  ? 8.348   0.352   14.491  1.00 79.52  ? 62  VAL A O   1 
ATOM   77   C  CB  . VAL A 1 13  ? 9.582   2.791   15.461  1.00 67.05  ? 62  VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 13  ? 11.057  2.425   15.396  1.00 67.87  ? 62  VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 13  ? 9.413   4.209   15.983  1.00 63.61  ? 62  VAL A CG2 1 
ATOM   80   N  N   . GLY A 1 14  ? 9.295   0.827   12.496  1.00 90.15  ? 63  GLY A N   1 
ATOM   81   C  CA  . GLY A 1 14  ? 9.137   -0.509  11.940  1.00 94.25  ? 63  GLY A CA  1 
ATOM   82   C  C   . GLY A 1 14  ? 9.675   -1.623  12.819  1.00 102.21 ? 63  GLY A C   1 
ATOM   83   O  O   . GLY A 1 14  ? 10.434  -1.366  13.755  1.00 104.29 ? 63  GLY A O   1 
ATOM   84   N  N   . ASP A 1 15  ? 9.281   -2.863  12.536  1.00 104.59 ? 64  ASP A N   1 
ATOM   85   C  CA  . ASP A 1 15  ? 8.345   -3.170  11.461  1.00 106.03 ? 64  ASP A CA  1 
ATOM   86   C  C   . ASP A 1 15  ? 6.926   -3.286  11.995  1.00 103.31 ? 64  ASP A C   1 
ATOM   87   O  O   . ASP A 1 15  ? 6.519   -4.341  12.481  1.00 106.49 ? 64  ASP A O   1 
ATOM   88   C  CB  . ASP A 1 15  ? 8.731   -4.479  10.776  1.00 113.64 ? 64  ASP A CB  1 
ATOM   89   C  CG  . ASP A 1 15  ? 10.000  -4.358  9.964   1.00 120.49 ? 64  ASP A CG  1 
ATOM   90   O  OD1 . ASP A 1 15  ? 10.178  -3.320  9.292   1.00 123.10 ? 64  ASP A OD1 1 
ATOM   91   O  OD2 . ASP A 1 15  ? 10.819  -5.301  9.998   1.00 122.03 ? 64  ASP A OD2 1 
ATOM   92   N  N   . THR A 1 16  ? 6.181   -2.191  11.913  1.00 96.85  ? 65  THR A N   1 
ATOM   93   C  CA  . THR A 1 16  ? 4.785   -2.182  12.315  1.00 89.16  ? 65  THR A CA  1 
ATOM   94   C  C   . THR A 1 16  ? 3.967   -1.634  11.158  1.00 89.73  ? 65  THR A C   1 
ATOM   95   O  O   . THR A 1 16  ? 4.477   -0.851  10.354  1.00 92.37  ? 65  THR A O   1 
ATOM   96   C  CB  . THR A 1 16  ? 4.561   -1.291  13.549  1.00 83.95  ? 65  THR A CB  1 
ATOM   97   O  OG1 . THR A 1 16  ? 4.511   0.083   13.147  1.00 81.15  ? 65  THR A OG1 1 
ATOM   98   C  CG2 . THR A 1 16  ? 5.684   -1.479  14.553  1.00 82.07  ? 65  THR A CG2 1 
ATOM   99   N  N   . PRO A 1 17  ? 2.700   -2.055  11.053  1.00 88.35  ? 66  PRO A N   1 
ATOM   100  C  CA  . PRO A 1 17  ? 1.815   -1.486  10.031  1.00 88.52  ? 66  PRO A CA  1 
ATOM   101  C  C   . PRO A 1 17  ? 1.655   0.019   10.237  1.00 85.20  ? 66  PRO A C   1 
ATOM   102  O  O   . PRO A 1 17  ? 1.626   0.472   11.381  1.00 84.81  ? 66  PRO A O   1 
ATOM   103  C  CB  . PRO A 1 17  ? 0.487   -2.202  10.287  1.00 89.49  ? 66  PRO A CB  1 
ATOM   104  C  CG  . PRO A 1 17  ? 0.870   -3.481  10.950  1.00 87.88  ? 66  PRO A CG  1 
ATOM   105  C  CD  . PRO A 1 17  ? 2.059   -3.152  11.796  1.00 86.27  ? 66  PRO A CD  1 
ATOM   106  N  N   . ILE A 1 18  ? 1.566   0.781   9.150   1.00 81.83  ? 67  ILE A N   1 
ATOM   107  C  CA  . ILE A 1 18  ? 1.461   2.235   9.251   1.00 77.15  ? 67  ILE A CA  1 
ATOM   108  C  C   . ILE A 1 18  ? 0.003   2.688   9.298   1.00 76.74  ? 67  ILE A C   1 
ATOM   109  O  O   . ILE A 1 18  ? -0.861  2.111   8.639   1.00 75.78  ? 67  ILE A O   1 
ATOM   110  C  CB  . ILE A 1 18  ? 2.165   2.948   8.074   1.00 74.49  ? 67  ILE A CB  1 
ATOM   111  C  CG1 . ILE A 1 18  ? 3.441   2.205   7.664   1.00 75.61  ? 67  ILE A CG1 1 
ATOM   112  C  CG2 . ILE A 1 18  ? 2.466   4.399   8.430   1.00 67.63  ? 67  ILE A CG2 1 
ATOM   113  C  CD1 . ILE A 1 18  ? 4.554   2.271   8.688   1.00 74.10  ? 67  ILE A CD1 1 
ATOM   114  N  N   . MET A 1 19  ? -0.264  3.721   10.088  1.00 76.48  ? 68  MET A N   1 
ATOM   115  C  CA  . MET A 1 19  ? -1.595  4.305   10.161  1.00 75.32  ? 68  MET A CA  1 
ATOM   116  C  C   . MET A 1 19  ? -1.847  5.148   8.923   1.00 75.44  ? 68  MET A C   1 
ATOM   117  O  O   . MET A 1 19  ? -0.935  5.808   8.423   1.00 74.07  ? 68  MET A O   1 
ATOM   118  C  CB  . MET A 1 19  ? -1.726  5.182   11.408  1.00 72.67  ? 68  MET A CB  1 
ATOM   119  C  CG  . MET A 1 19  ? -1.656  4.424   12.722  1.00 73.90  ? 68  MET A CG  1 
ATOM   120  S  SD  . MET A 1 19  ? -3.236  3.694   13.188  1.00 77.81  ? 68  MET A SD  1 
ATOM   121  C  CE  . MET A 1 19  ? -4.215  5.162   13.515  1.00 63.21  ? 68  MET A CE  1 
ATOM   122  N  N   . LYS A 1 20  ? -3.080  5.117   8.428   1.00 77.30  ? 69  LYS A N   1 
ATOM   123  C  CA  . LYS A 1 20  ? -3.478  5.999   7.339   1.00 83.25  ? 69  LYS A CA  1 
ATOM   124  C  C   . LYS A 1 20  ? -3.652  7.406   7.884   1.00 81.93  ? 69  LYS A C   1 
ATOM   125  O  O   . LYS A 1 20  ? -2.949  8.335   7.483   1.00 80.53  ? 69  LYS A O   1 
ATOM   126  C  CB  . LYS A 1 20  ? -4.783  5.524   6.701   1.00 88.12  ? 69  LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 20  ? -4.621  4.378   5.723   1.00 91.79  ? 69  LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 20  ? -5.955  4.002   5.104   1.00 94.29  ? 69  LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 20  ? -6.550  5.155   4.314   1.00 94.17  ? 69  LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 20  ? -5.710  5.502   3.135   1.00 96.24  ? 69  LYS A NZ  1 
ATOM   131  N  N   . THR A 1 21  ? -4.597  7.552   8.805   1.00 81.81  ? 70  THR A N   1 
ATOM   132  C  CA  . THR A 1 21  ? -4.802  8.815   9.494   1.00 81.23  ? 70  THR A CA  1 
ATOM   133  C  C   . THR A 1 21  ? -3.831  8.900   10.665  1.00 80.70  ? 70  THR A C   1 
ATOM   134  O  O   . THR A 1 21  ? -3.923  8.120   11.611  1.00 82.80  ? 70  THR A O   1 
ATOM   135  C  CB  . THR A 1 21  ? -6.244  8.944   10.012  1.00 79.10  ? 70  THR A CB  1 
ATOM   136  O  OG1 . THR A 1 21  ? -7.165  8.661   8.951   1.00 76.03  ? 70  THR A OG1 1 
ATOM   137  C  CG2 . THR A 1 21  ? -6.496  10.349  10.542  1.00 78.65  ? 70  THR A CG2 1 
ATOM   138  N  N   . LYS A 1 22  ? -2.897  9.842   10.589  1.00 77.85  ? 71  LYS A N   1 
ATOM   139  C  CA  . LYS A 1 22  ? -1.863  9.979   11.609  1.00 75.12  ? 71  LYS A CA  1 
ATOM   140  C  C   . LYS A 1 22  ? -2.161  11.098  12.605  1.00 72.85  ? 71  LYS A C   1 
ATOM   141  O  O   . LYS A 1 22  ? -1.705  11.056  13.747  1.00 71.76  ? 71  LYS A O   1 
ATOM   142  C  CB  . LYS A 1 22  ? -0.497  10.201  10.956  1.00 77.12  ? 71  LYS A CB  1 
ATOM   143  C  CG  . LYS A 1 22  ? -0.084  9.085   10.015  1.00 79.48  ? 71  LYS A CG  1 
ATOM   144  C  CD  . LYS A 1 22  ? 1.268   9.359   9.385   1.00 81.67  ? 71  LYS A CD  1 
ATOM   145  C  CE  . LYS A 1 22  ? 1.704   8.197   8.509   1.00 84.37  ? 71  LYS A CE  1 
ATOM   146  N  NZ  . LYS A 1 22  ? 0.699   7.900   7.452   1.00 87.23  ? 71  LYS A NZ  1 
ATOM   147  N  N   . LYS A 1 23  ? -2.923  12.096  12.168  1.00 72.96  ? 72  LYS A N   1 
ATOM   148  C  CA  . LYS A 1 23  ? -3.316  13.197  13.043  1.00 73.27  ? 72  LYS A CA  1 
ATOM   149  C  C   . LYS A 1 23  ? -4.694  12.938  13.648  1.00 70.36  ? 72  LYS A C   1 
ATOM   150  O  O   . LYS A 1 23  ? -5.675  12.755  12.925  1.00 70.78  ? 72  LYS A O   1 
ATOM   151  C  CB  . LYS A 1 23  ? -3.329  14.522  12.278  1.00 81.19  ? 72  LYS A CB  1 
ATOM   152  C  CG  . LYS A 1 23  ? -1.998  14.918  11.646  1.00 86.61  ? 72  LYS A CG  1 
ATOM   153  C  CD  . LYS A 1 23  ? -2.113  16.270  10.938  1.00 89.73  ? 72  LYS A CD  1 
ATOM   154  C  CE  . LYS A 1 23  ? -0.773  16.734  10.386  1.00 88.49  ? 72  LYS A CE  1 
ATOM   155  N  NZ  . LYS A 1 23  ? -0.838  18.128  9.869   1.00 89.78  ? 72  LYS A NZ  1 
ATOM   156  N  N   . TRP A 1 24  ? -4.766  12.931  14.976  1.00 68.17  ? 73  TRP A N   1 
ATOM   157  C  CA  . TRP A 1 24  ? -6.016  12.650  15.675  1.00 67.67  ? 73  TRP A CA  1 
ATOM   158  C  C   . TRP A 1 24  ? -6.318  13.676  16.765  1.00 67.72  ? 73  TRP A C   1 
ATOM   159  O  O   . TRP A 1 24  ? -5.409  14.194  17.413  1.00 66.90  ? 73  TRP A O   1 
ATOM   160  C  CB  . TRP A 1 24  ? -5.982  11.248  16.289  1.00 67.33  ? 73  TRP A CB  1 
ATOM   161  C  CG  . TRP A 1 24  ? -6.023  10.137  15.286  1.00 72.89  ? 73  TRP A CG  1 
ATOM   162  C  CD1 . TRP A 1 24  ? -4.957  9.464   14.761  1.00 74.60  ? 73  TRP A CD1 1 
ATOM   163  C  CD2 . TRP A 1 24  ? -7.193  9.561   14.690  1.00 75.64  ? 73  TRP A CD2 1 
ATOM   164  N  NE1 . TRP A 1 24  ? -5.390  8.508   13.874  1.00 75.06  ? 73  TRP A NE1 1 
ATOM   165  C  CE2 . TRP A 1 24  ? -6.759  8.547   13.812  1.00 75.84  ? 73  TRP A CE2 1 
ATOM   166  C  CE3 . TRP A 1 24  ? -8.565  9.806   14.813  1.00 76.81  ? 73  TRP A CE3 1 
ATOM   167  C  CZ2 . TRP A 1 24  ? -7.646  7.779   13.062  1.00 77.16  ? 73  TRP A CZ2 1 
ATOM   168  C  CZ3 . TRP A 1 24  ? -9.444  9.044   14.067  1.00 78.92  ? 73  TRP A CZ3 1 
ATOM   169  C  CH2 . TRP A 1 24  ? -8.981  8.042   13.202  1.00 79.55  ? 73  TRP A CH2 1 
ATOM   170  N  N   . ALA A 1 25  ? -7.603  13.963  16.960  1.00 67.63  ? 74  ALA A N   1 
ATOM   171  C  CA  . ALA A 1 25  ? -8.051  14.822  18.051  1.00 66.85  ? 74  ALA A CA  1 
ATOM   172  C  C   . ALA A 1 25  ? -8.621  13.955  19.169  1.00 72.33  ? 74  ALA A C   1 
ATOM   173  O  O   . ALA A 1 25  ? -9.682  13.349  19.016  1.00 77.38  ? 74  ALA A O   1 
ATOM   174  C  CB  . ALA A 1 25  ? -9.092  15.810  17.561  1.00 64.52  ? 74  ALA A CB  1 
ATOM   175  N  N   . VAL A 1 26  ? -7.916  13.902  20.293  1.00 72.24  ? 75  VAL A N   1 
ATOM   176  C  CA  . VAL A 1 26  ? -8.219  12.929  21.339  1.00 72.84  ? 75  VAL A CA  1 
ATOM   177  C  C   . VAL A 1 26  ? -8.625  13.580  22.662  1.00 75.12  ? 75  VAL A C   1 
ATOM   178  O  O   . VAL A 1 26  ? -8.144  14.660  23.006  1.00 74.18  ? 75  VAL A O   1 
ATOM   179  C  CB  . VAL A 1 26  ? -7.006  12.006  21.580  1.00 67.63  ? 75  VAL A CB  1 
ATOM   180  C  CG1 . VAL A 1 26  ? -7.407  10.795  22.391  1.00 64.66  ? 75  VAL A CG1 1 
ATOM   181  C  CG2 . VAL A 1 26  ? -6.412  11.572  20.251  1.00 67.66  ? 75  VAL A CG2 1 
ATOM   182  N  N   . GLU A 1 27  ? -9.520  12.918  23.390  1.00 78.68  ? 76  GLU A N   1 
ATOM   183  C  CA  . GLU A 1 27  ? -9.895  13.341  24.735  1.00 83.11  ? 76  GLU A CA  1 
ATOM   184  C  C   . GLU A 1 27  ? -8.687  13.341  25.665  1.00 79.62  ? 76  GLU A C   1 
ATOM   185  O  O   . GLU A 1 27  ? -7.849  12.441  25.608  1.00 79.20  ? 76  GLU A O   1 
ATOM   186  C  CB  . GLU A 1 27  ? -10.988 12.430  25.302  1.00 88.00  ? 76  GLU A CB  1 
ATOM   187  C  CG  . GLU A 1 27  ? -12.387 12.756  24.808  1.00 96.32  ? 76  GLU A CG  1 
ATOM   188  C  CD  . GLU A 1 27  ? -12.882 14.099  25.313  1.00 105.49 ? 76  GLU A CD  1 
ATOM   189  O  OE1 . GLU A 1 27  ? -13.775 14.689  24.667  1.00 108.10 ? 76  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A 1 27  ? -12.381 14.566  26.360  1.00 108.26 ? 76  GLU A OE2 1 
ATOM   191  N  N   . ARG A 1 28  ? -8.604  14.353  26.523  1.00 77.04  ? 77  ARG A N   1 
ATOM   192  C  CA  . ARG A 1 28  ? -7.475  14.491  27.435  1.00 70.85  ? 77  ARG A CA  1 
ATOM   193  C  C   . ARG A 1 28  ? -7.440  13.364  28.463  1.00 65.72  ? 77  ARG A C   1 
ATOM   194  O  O   . ARG A 1 28  ? -6.377  13.010  28.970  1.00 64.04  ? 77  ARG A O   1 
ATOM   195  C  CB  . ARG A 1 28  ? -7.521  15.848  28.140  1.00 71.35  ? 77  ARG A CB  1 
ATOM   196  C  CG  . ARG A 1 28  ? -7.692  17.027  27.197  1.00 75.08  ? 77  ARG A CG  1 
ATOM   197  C  CD  . ARG A 1 28  ? -7.763  18.345  27.951  1.00 80.91  ? 77  ARG A CD  1 
ATOM   198  N  NE  . ARG A 1 28  ? -6.442  18.838  28.337  1.00 85.63  ? 77  ARG A NE  1 
ATOM   199  C  CZ  . ARG A 1 28  ? -5.770  19.777  27.677  1.00 87.46  ? 77  ARG A CZ  1 
ATOM   200  N  NH1 . ARG A 1 28  ? -6.293  20.336  26.592  1.00 89.98  ? 77  ARG A NH1 1 
ATOM   201  N  NH2 . ARG A 1 28  ? -4.573  20.163  28.103  1.00 84.29  ? 77  ARG A NH2 1 
ATOM   202  N  N   . THR A 1 29  ? -8.603  12.795  28.761  1.00 65.36  ? 78  THR A N   1 
ATOM   203  C  CA  . THR A 1 29  ? -8.700  11.758  29.780  1.00 63.98  ? 78  THR A CA  1 
ATOM   204  C  C   . THR A 1 29  ? -8.447  10.362  29.235  1.00 66.80  ? 78  THR A C   1 
ATOM   205  O  O   . THR A 1 29  ? -8.395  9.396   29.999  1.00 68.56  ? 78  THR A O   1 
ATOM   206  C  CB  . THR A 1 29  ? -10.074 11.755  30.465  1.00 62.53  ? 78  THR A CB  1 
ATOM   207  O  OG1 . THR A 1 29  ? -11.103 11.719  29.467  1.00 66.13  ? 78  THR A OG1 1 
ATOM   208  C  CG2 . THR A 1 29  ? -10.239 12.992  31.327  1.00 59.04  ? 78  THR A CG2 1 
ATOM   209  N  N   . ARG A 1 30  ? -8.306  10.243  27.919  1.00 66.03  ? 79  ARG A N   1 
ATOM   210  C  CA  . ARG A 1 30  ? -8.025  8.940   27.337  1.00 66.88  ? 79  ARG A CA  1 
ATOM   211  C  C   . ARG A 1 30  ? -6.641  8.488   27.760  1.00 63.50  ? 79  ARG A C   1 
ATOM   212  O  O   . ARG A 1 30  ? -5.693  9.266   27.741  1.00 62.60  ? 79  ARG A O   1 
ATOM   213  C  CB  . ARG A 1 30  ? -8.122  8.961   25.814  1.00 72.81  ? 79  ARG A CB  1 
ATOM   214  C  CG  . ARG A 1 30  ? -7.900  7.586   25.204  1.00 76.20  ? 79  ARG A CG  1 
ATOM   215  C  CD  . ARG A 1 30  ? -8.078  7.608   23.713  1.00 83.83  ? 79  ARG A CD  1 
ATOM   216  N  NE  . ARG A 1 30  ? -9.431  8.001   23.344  1.00 93.85  ? 79  ARG A NE  1 
ATOM   217  C  CZ  . ARG A 1 30  ? -10.387 7.145   23.004  1.00 99.02  ? 79  ARG A CZ  1 
ATOM   218  N  NH1 . ARG A 1 30  ? -10.133 5.842   22.981  1.00 98.41  ? 79  ARG A NH1 1 
ATOM   219  N  NH2 . ARG A 1 30  ? -11.593 7.590   22.682  1.00 102.66 ? 79  ARG A NH2 1 
ATOM   220  N  N   . THR A 1 31  ? -6.530  7.228   28.151  1.00 61.01  ? 80  THR A N   1 
ATOM   221  C  CA  . THR A 1 31  ? -5.260  6.702   28.613  1.00 58.08  ? 80  THR A CA  1 
ATOM   222  C  C   . THR A 1 31  ? -4.439  6.167   27.454  1.00 65.19  ? 80  THR A C   1 
ATOM   223  O  O   . THR A 1 31  ? -4.929  6.051   26.328  1.00 64.95  ? 80  THR A O   1 
ATOM   224  C  CB  . THR A 1 31  ? -5.468  5.581   29.631  1.00 57.15  ? 80  THR A CB  1 
ATOM   225  O  OG1 . THR A 1 31  ? -6.167  4.498   29.003  1.00 56.08  ? 80  THR A OG1 1 
ATOM   226  C  CG2 . THR A 1 31  ? -6.274  6.095   30.816  1.00 47.93  ? 80  THR A CG2 1 
ATOM   227  N  N   . ILE A 1 32  ? -3.181  5.851   27.739  1.00 65.45  ? 81  ILE A N   1 
ATOM   228  C  CA  . ILE A 1 32  ? -2.298  5.250   26.751  1.00 60.35  ? 81  ILE A CA  1 
ATOM   229  C  C   . ILE A 1 32  ? -2.880  3.927   26.261  1.00 61.19  ? 81  ILE A C   1 
ATOM   230  O  O   . ILE A 1 32  ? -2.901  3.661   25.061  1.00 62.13  ? 81  ILE A O   1 
ATOM   231  C  CB  . ILE A 1 32  ? -0.891  5.022   27.339  1.00 56.54  ? 81  ILE A CB  1 
ATOM   232  C  CG1 . ILE A 1 32  ? -0.180  6.362   27.536  1.00 53.54  ? 81  ILE A CG1 1 
ATOM   233  C  CG2 . ILE A 1 32  ? -0.063  4.124   26.438  1.00 54.82  ? 81  ILE A CG2 1 
ATOM   234  C  CD1 . ILE A 1 32  ? 0.181   7.048   26.238  1.00 55.60  ? 81  ILE A CD1 1 
ATOM   235  N  N   . GLN A 1 33  ? -3.372  3.109   27.190  1.00 59.06  ? 82  GLN A N   1 
ATOM   236  C  CA  . GLN A 1 33  ? -3.898  1.794   26.831  1.00 58.48  ? 82  GLN A CA  1 
ATOM   237  C  C   . GLN A 1 33  ? -5.125  1.892   25.927  1.00 61.64  ? 82  GLN A C   1 
ATOM   238  O  O   . GLN A 1 33  ? -5.254  1.141   24.958  1.00 61.61  ? 82  GLN A O   1 
ATOM   239  C  CB  . GLN A 1 33  ? -4.218  0.969   28.077  1.00 47.46  ? 82  GLN A CB  1 
ATOM   240  C  CG  . GLN A 1 33  ? -4.690  -0.438  27.762  1.00 48.33  ? 82  GLN A CG  1 
ATOM   241  C  CD  . GLN A 1 33  ? -3.679  -1.224  26.944  1.00 57.91  ? 82  GLN A CD  1 
ATOM   242  O  OE1 . GLN A 1 33  ? -3.927  -1.560  25.784  1.00 58.76  ? 82  GLN A OE1 1 
ATOM   243  N  NE2 . GLN A 1 33  ? -2.534  -1.523  27.548  1.00 56.70  ? 82  GLN A NE2 1 
ATOM   244  N  N   . GLY A 1 34  ? -6.021  2.822   26.243  1.00 63.80  ? 83  GLY A N   1 
ATOM   245  C  CA  . GLY A 1 34  ? -7.185  3.066   25.410  1.00 63.16  ? 83  GLY A CA  1 
ATOM   246  C  C   . GLY A 1 34  ? -6.779  3.585   24.043  1.00 63.61  ? 83  GLY A C   1 
ATOM   247  O  O   . GLY A 1 34  ? -7.509  3.437   23.059  1.00 67.89  ? 83  GLY A O   1 
ATOM   248  N  N   . LEU A 1 35  ? -5.601  4.194   23.983  1.00 61.83  ? 84  LEU A N   1 
ATOM   249  C  CA  . LEU A 1 35  ? -5.061  4.690   22.726  1.00 62.95  ? 84  LEU A CA  1 
ATOM   250  C  C   . LEU A 1 35  ? -4.365  3.560   21.975  1.00 67.01  ? 84  LEU A C   1 
ATOM   251  O  O   . LEU A 1 35  ? -4.386  3.522   20.744  1.00 66.24  ? 84  LEU A O   1 
ATOM   252  C  CB  . LEU A 1 35  ? -4.091  5.842   22.980  1.00 63.07  ? 84  LEU A CB  1 
ATOM   253  C  CG  . LEU A 1 35  ? -3.699  6.708   21.786  1.00 67.32  ? 84  LEU A CG  1 
ATOM   254  C  CD1 . LEU A 1 35  ? -4.918  7.410   21.206  1.00 68.66  ? 84  LEU A CD1 1 
ATOM   255  C  CD2 . LEU A 1 35  ? -2.651  7.716   22.210  1.00 65.98  ? 84  LEU A CD2 1 
ATOM   256  N  N   . ILE A 1 36  ? -3.754  2.642   22.722  1.00 66.24  ? 85  ILE A N   1 
ATOM   257  C  CA  . ILE A 1 36  ? -3.120  1.466   22.133  1.00 64.24  ? 85  ILE A CA  1 
ATOM   258  C  C   . ILE A 1 36  ? -4.156  0.589   21.442  1.00 68.58  ? 85  ILE A C   1 
ATOM   259  O  O   . ILE A 1 36  ? -3.964  0.158   20.304  1.00 71.16  ? 85  ILE A O   1 
ATOM   260  C  CB  . ILE A 1 36  ? -2.382  0.621   23.192  1.00 62.42  ? 85  ILE A CB  1 
ATOM   261  C  CG1 . ILE A 1 36  ? -1.142  1.352   23.701  1.00 63.14  ? 85  ILE A CG1 1 
ATOM   262  C  CG2 . ILE A 1 36  ? -1.969  -0.720  22.617  1.00 65.38  ? 85  ILE A CG2 1 
ATOM   263  C  CD1 . ILE A 1 36  ? -0.353  0.565   24.727  1.00 61.03  ? 85  ILE A CD1 1 
ATOM   264  N  N   . ASP A 1 37  ? -5.260  0.335   22.137  1.00 71.06  ? 86  ASP A N   1 
ATOM   265  C  CA  . ASP A 1 37  ? -6.328  -0.508  21.614  1.00 73.99  ? 86  ASP A CA  1 
ATOM   266  C  C   . ASP A 1 37  ? -7.012  0.150   20.419  1.00 76.03  ? 86  ASP A C   1 
ATOM   267  O  O   . ASP A 1 37  ? -7.526  -0.528  19.528  1.00 78.88  ? 86  ASP A O   1 
ATOM   268  C  CB  . ASP A 1 37  ? -7.348  -0.810  22.712  1.00 74.33  ? 86  ASP A CB  1 
ATOM   269  C  CG  . ASP A 1 37  ? -6.718  -1.471  23.925  1.00 73.87  ? 86  ASP A CG  1 
ATOM   270  O  OD1 . ASP A 1 37  ? -5.749  -2.239  23.747  1.00 75.50  ? 86  ASP A OD1 1 
ATOM   271  O  OD2 . ASP A 1 37  ? -7.189  -1.219  25.054  1.00 72.64  ? 86  ASP A OD2 1 
ATOM   272  N  N   . PHE A 1 38  ? -7.015  1.477   20.413  1.00 75.75  ? 87  PHE A N   1 
ATOM   273  C  CA  . PHE A 1 38  ? -7.535  2.242   19.289  1.00 76.06  ? 87  PHE A CA  1 
ATOM   274  C  C   . PHE A 1 38  ? -6.671  2.007   18.058  1.00 73.07  ? 87  PHE A C   1 
ATOM   275  O  O   . PHE A 1 38  ? -7.180  1.875   16.946  1.00 77.01  ? 87  PHE A O   1 
ATOM   276  C  CB  . PHE A 1 38  ? -7.562  3.732   19.641  1.00 80.84  ? 87  PHE A CB  1 
ATOM   277  C  CG  . PHE A 1 38  ? -7.861  4.632   18.473  1.00 79.00  ? 87  PHE A CG  1 
ATOM   278  C  CD1 . PHE A 1 38  ? -9.167  4.860   18.075  1.00 80.95  ? 87  PHE A CD1 1 
ATOM   279  C  CD2 . PHE A 1 38  ? -6.837  5.263   17.787  1.00 80.76  ? 87  PHE A CD2 1 
ATOM   280  C  CE1 . PHE A 1 38  ? -9.446  5.690   17.006  1.00 85.02  ? 87  PHE A CE1 1 
ATOM   281  C  CE2 . PHE A 1 38  ? -7.108  6.093   16.716  1.00 85.80  ? 87  PHE A CE2 1 
ATOM   282  C  CZ  . PHE A 1 38  ? -8.415  6.308   16.325  1.00 87.14  ? 87  PHE A CZ  1 
ATOM   283  N  N   . ILE A 1 39  ? -5.361  1.950   18.266  1.00 70.16  ? 88  ILE A N   1 
ATOM   284  C  CA  . ILE A 1 39  ? -4.417  1.783   17.170  1.00 70.33  ? 88  ILE A CA  1 
ATOM   285  C  C   . ILE A 1 39  ? -4.371  0.340   16.674  1.00 75.55  ? 88  ILE A C   1 
ATOM   286  O  O   . ILE A 1 39  ? -4.313  0.096   15.467  1.00 78.71  ? 88  ILE A O   1 
ATOM   287  C  CB  . ILE A 1 39  ? -3.005  2.247   17.573  1.00 71.65  ? 88  ILE A CB  1 
ATOM   288  C  CG1 . ILE A 1 39  ? -3.012  3.746   17.869  1.00 73.82  ? 88  ILE A CG1 1 
ATOM   289  C  CG2 . ILE A 1 39  ? -2.001  1.945   16.475  1.00 71.97  ? 88  ILE A CG2 1 
ATOM   290  C  CD1 . ILE A 1 39  ? -1.691  4.276   18.377  1.00 73.40  ? 88  ILE A CD1 1 
ATOM   291  N  N   . LYS A 1 40  ? -4.406  -0.610  17.604  1.00 72.63  ? 89  LYS A N   1 
ATOM   292  C  CA  . LYS A 1 40  ? -4.357  -2.027  17.250  1.00 72.17  ? 89  LYS A CA  1 
ATOM   293  C  C   . LYS A 1 40  ? -5.424  -2.421  16.230  1.00 74.02  ? 89  LYS A C   1 
ATOM   294  O  O   . LYS A 1 40  ? -5.167  -3.229  15.340  1.00 78.13  ? 89  LYS A O   1 
ATOM   295  C  CB  . LYS A 1 40  ? -4.492  -2.906  18.493  1.00 72.50  ? 89  LYS A CB  1 
ATOM   296  C  CG  . LYS A 1 40  ? -3.247  -2.996  19.351  1.00 71.53  ? 89  LYS A CG  1 
ATOM   297  C  CD  . LYS A 1 40  ? -3.388  -4.134  20.343  1.00 71.26  ? 89  LYS A CD  1 
ATOM   298  C  CE  . LYS A 1 40  ? -2.249  -4.157  21.336  1.00 73.49  ? 89  LYS A CE  1 
ATOM   299  N  NZ  . LYS A 1 40  ? -2.412  -5.281  22.302  1.00 76.42  ? 89  LYS A NZ  1 
ATOM   300  N  N   . LYS A 1 41  ? -6.617  -1.847  16.360  1.00 71.11  ? 90  LYS A N   1 
ATOM   301  C  CA  . LYS A 1 41  ? -7.710  -2.158  15.445  1.00 70.00  ? 90  LYS A CA  1 
ATOM   302  C  C   . LYS A 1 41  ? -7.437  -1.654  14.031  1.00 73.73  ? 90  LYS A C   1 
ATOM   303  O  O   . LYS A 1 41  ? -7.863  -2.268  13.053  1.00 77.94  ? 90  LYS A O   1 
ATOM   304  C  CB  . LYS A 1 41  ? -9.030  -1.590  15.963  1.00 66.04  ? 90  LYS A CB  1 
ATOM   305  C  CG  . LYS A 1 41  ? -9.498  -2.225  17.252  1.00 67.14  ? 90  LYS A CG  1 
ATOM   306  C  CD  . LYS A 1 41  ? -10.855 -1.696  17.671  1.00 68.40  ? 90  LYS A CD  1 
ATOM   307  C  CE  . LYS A 1 41  ? -11.256 -2.266  19.015  1.00 69.04  ? 90  LYS A CE  1 
ATOM   308  N  NZ  . LYS A 1 41  ? -10.210 -1.987  20.039  1.00 73.21  ? 90  LYS A NZ  1 
ATOM   309  N  N   . PHE A 1 42  ? -6.731  -0.535  13.926  1.00 74.85  ? 91  PHE A N   1 
ATOM   310  C  CA  . PHE A 1 42  ? -6.353  -0.003  12.623  1.00 78.33  ? 91  PHE A CA  1 
ATOM   311  C  C   . PHE A 1 42  ? -5.231  -0.817  12.003  1.00 78.77  ? 91  PHE A C   1 
ATOM   312  O  O   . PHE A 1 42  ? -5.202  -1.026  10.794  1.00 82.08  ? 91  PHE A O   1 
ATOM   313  C  CB  . PHE A 1 42  ? -5.915  1.455   12.737  1.00 81.49  ? 91  PHE A CB  1 
ATOM   314  C  CG  . PHE A 1 42  ? -7.030  2.437   12.555  1.00 85.19  ? 91  PHE A CG  1 
ATOM   315  C  CD1 . PHE A 1 42  ? -7.527  2.712   11.291  1.00 89.36  ? 91  PHE A CD1 1 
ATOM   316  C  CD2 . PHE A 1 42  ? -7.575  3.094   13.642  1.00 84.65  ? 91  PHE A CD2 1 
ATOM   317  C  CE1 . PHE A 1 42  ? -8.554  3.620   11.118  1.00 89.01  ? 91  PHE A CE1 1 
ATOM   318  C  CE2 . PHE A 1 42  ? -8.601  4.002   13.476  1.00 85.50  ? 91  PHE A CE2 1 
ATOM   319  C  CZ  . PHE A 1 42  ? -9.092  4.265   12.214  1.00 85.41  ? 91  PHE A CZ  1 
ATOM   320  N  N   . LEU A 1 43  ? -4.305  -1.271  12.839  1.00 80.86  ? 92  LEU A N   1 
ATOM   321  C  CA  . LEU A 1 43  ? -3.144  -2.009  12.358  1.00 82.90  ? 92  LEU A CA  1 
ATOM   322  C  C   . LEU A 1 43  ? -3.423  -3.506  12.279  1.00 84.44  ? 92  LEU A C   1 
ATOM   323  O  O   . LEU A 1 43  ? -2.510  -4.298  12.038  1.00 88.94  ? 92  LEU A O   1 
ATOM   324  C  CB  . LEU A 1 43  ? -1.931  -1.744  13.252  1.00 83.04  ? 92  LEU A CB  1 
ATOM   325  C  CG  . LEU A 1 43  ? -1.536  -0.282  13.468  1.00 78.40  ? 92  LEU A CG  1 
ATOM   326  C  CD1 . LEU A 1 43  ? -0.173  -0.197  14.134  1.00 79.67  ? 92  LEU A CD1 1 
ATOM   327  C  CD2 . LEU A 1 43  ? -1.548  0.486   12.159  1.00 75.84  ? 92  LEU A CD2 1 
ATOM   328  N  N   . LYS A 1 44  ? -4.685  -3.879  12.482  1.00 78.51  ? 93  LYS A N   1 
ATOM   329  C  CA  . LYS A 1 44  ? -5.115  -5.274  12.411  1.00 77.82  ? 93  LYS A CA  1 
ATOM   330  C  C   . LYS A 1 44  ? -4.326  -6.148  13.381  1.00 80.25  ? 93  LYS A C   1 
ATOM   331  O  O   . LYS A 1 44  ? -3.896  -7.248  13.038  1.00 83.17  ? 93  LYS A O   1 
ATOM   332  C  CB  . LYS A 1 44  ? -4.992  -5.810  10.980  1.00 78.76  ? 93  LYS A CB  1 
ATOM   333  C  CG  . LYS A 1 44  ? -5.564  -4.873  9.924   1.00 77.45  ? 93  LYS A CG  1 
ATOM   334  C  CD  . LYS A 1 44  ? -5.285  -5.362  8.512   1.00 75.81  ? 93  LYS A CD  1 
ATOM   335  C  CE  . LYS A 1 44  ? -5.619  -4.280  7.498   1.00 76.30  ? 93  LYS A CE  1 
ATOM   336  N  NZ  . LYS A 1 44  ? -5.492  -4.750  6.091   1.00 80.77  ? 93  LYS A NZ  1 
ATOM   337  N  N   . LEU A 1 45  ? -4.133  -5.643  14.594  1.00 79.51  ? 94  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 45  ? -3.408  -6.374  15.622  1.00 82.18  ? 94  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 45  ? -4.372  -6.903  16.676  1.00 86.00  ? 94  LEU A C   1 
ATOM   340  O  O   . LEU A 1 45  ? -5.301  -6.206  17.088  1.00 87.87  ? 94  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 45  ? -2.352  -5.476  16.269  1.00 82.36  ? 94  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 45  ? -1.211  -5.028  15.353  1.00 84.32  ? 94  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 45  ? -0.380  -3.937  16.010  1.00 83.69  ? 94  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 45  ? -0.335  -6.215  14.975  1.00 86.51  ? 94  LEU A CD2 1 
ATOM   345  N  N   . VAL A 1 46  ? -4.152  -8.140  17.106  1.00 86.45  ? 95  VAL A N   1 
ATOM   346  C  CA  . VAL A 1 46  ? -5.000  -8.755  18.118  1.00 84.81  ? 95  VAL A CA  1 
ATOM   347  C  C   . VAL A 1 46  ? -4.608  -8.288  19.516  1.00 82.20  ? 95  VAL A C   1 
ATOM   348  O  O   . VAL A 1 46  ? -3.659  -7.521  19.683  1.00 82.28  ? 95  VAL A O   1 
ATOM   349  C  CB  . VAL A 1 46  ? -4.934  -10.292 18.049  1.00 87.62  ? 95  VAL A CB  1 
ATOM   350  C  CG1 . VAL A 1 46  ? -5.470  -10.785 16.715  1.00 83.46  ? 95  VAL A CG1 1 
ATOM   351  C  CG2 . VAL A 1 46  ? -3.508  -10.768 18.263  1.00 91.59  ? 95  VAL A CG2 1 
ATOM   352  N  N   . ALA A 1 47  ? -5.344  -8.754  20.519  1.00 82.09  ? 96  ALA A N   1 
ATOM   353  C  CA  . ALA A 1 47  ? -5.098  -8.357  21.900  1.00 82.96  ? 96  ALA A CA  1 
ATOM   354  C  C   . ALA A 1 47  ? -3.756  -8.869  22.419  1.00 87.88  ? 96  ALA A C   1 
ATOM   355  O  O   . ALA A 1 47  ? -3.041  -8.155  23.125  1.00 91.14  ? 96  ALA A O   1 
ATOM   356  C  CB  . ALA A 1 47  ? -6.233  -8.834  22.797  1.00 78.58  ? 96  ALA A CB  1 
ATOM   357  N  N   . SER A 1 48  ? -3.418  -10.104 22.062  1.00 87.23  ? 97  SER A N   1 
ATOM   358  C  CA  . SER A 1 48  ? -2.202  -10.744 22.559  1.00 89.67  ? 97  SER A CA  1 
ATOM   359  C  C   . SER A 1 48  ? -0.926  -10.045 22.094  1.00 93.41  ? 97  SER A C   1 
ATOM   360  O  O   . SER A 1 48  ? 0.055   -9.974  22.836  1.00 95.72  ? 97  SER A O   1 
ATOM   361  C  CB  . SER A 1 48  ? -2.172  -12.224 22.162  1.00 88.92  ? 97  SER A CB  1 
ATOM   362  O  OG  . SER A 1 48  ? -2.203  -12.380 20.755  1.00 88.72  ? 97  SER A OG  1 
ATOM   363  N  N   . GLU A 1 49  ? -0.942  -9.531  20.867  1.00 92.98  ? 98  GLU A N   1 
ATOM   364  C  CA  . GLU A 1 49  ? 0.212   -8.823  20.318  1.00 93.21  ? 98  GLU A CA  1 
ATOM   365  C  C   . GLU A 1 49  ? 0.463   -7.511  21.055  1.00 91.57  ? 98  GLU A C   1 
ATOM   366  O  O   . GLU A 1 49  ? -0.449  -6.709  21.241  1.00 89.84  ? 98  GLU A O   1 
ATOM   367  C  CB  . GLU A 1 49  ? 0.021   -8.553  18.825  1.00 94.25  ? 98  GLU A CB  1 
ATOM   368  C  CG  . GLU A 1 49  ? 0.019   -9.799  17.959  1.00 97.58  ? 98  GLU A CG  1 
ATOM   369  C  CD  . GLU A 1 49  ? -0.093  -9.477  16.483  1.00 101.12 ? 98  GLU A CD  1 
ATOM   370  O  OE1 . GLU A 1 49  ? 0.958   -9.283  15.832  1.00 103.15 ? 98  GLU A OE1 1 
ATOM   371  O  OE2 . GLU A 1 49  ? -1.232  -9.415  15.974  1.00 100.34 ? 98  GLU A OE2 1 
ATOM   372  N  N   . GLN A 1 50  ? 1.707   -7.297  21.469  1.00 92.51  ? 99  GLN A N   1 
ATOM   373  C  CA  . GLN A 1 50  ? 2.069   -6.090  22.201  1.00 92.73  ? 99  GLN A CA  1 
ATOM   374  C  C   . GLN A 1 50  ? 2.290   -4.909  21.267  1.00 85.61  ? 99  GLN A C   1 
ATOM   375  O  O   . GLN A 1 50  ? 2.811   -5.064  20.162  1.00 84.91  ? 99  GLN A O   1 
ATOM   376  C  CB  . GLN A 1 50  ? 3.329   -6.325  23.033  1.00 100.43 ? 99  GLN A CB  1 
ATOM   377  C  CG  . GLN A 1 50  ? 3.185   -7.396  24.095  1.00 108.69 ? 99  GLN A CG  1 
ATOM   378  C  CD  . GLN A 1 50  ? 4.485   -7.655  24.828  1.00 116.55 ? 99  GLN A CD  1 
ATOM   379  O  OE1 . GLN A 1 50  ? 5.546   -7.187  24.414  1.00 117.71 ? 99  GLN A OE1 1 
ATOM   380  N  NE2 . GLN A 1 50  ? 4.409   -8.401  25.925  1.00 119.97 ? 99  GLN A NE2 1 
ATOM   381  N  N   . LEU A 1 51  ? 1.894   -3.727  21.723  1.00 78.26  ? 100 LEU A N   1 
ATOM   382  C  CA  . LEU A 1 51  ? 2.134   -2.498  20.981  1.00 70.88  ? 100 LEU A CA  1 
ATOM   383  C  C   . LEU A 1 51  ? 2.660   -1.433  21.934  1.00 69.96  ? 100 LEU A C   1 
ATOM   384  O  O   . LEU A 1 51  ? 1.947   -0.978  22.829  1.00 70.48  ? 100 LEU A O   1 
ATOM   385  C  CB  . LEU A 1 51  ? 0.853   -2.020  20.299  1.00 68.29  ? 100 LEU A CB  1 
ATOM   386  C  CG  . LEU A 1 51  ? 0.986   -0.804  19.378  1.00 67.86  ? 100 LEU A CG  1 
ATOM   387  C  CD1 . LEU A 1 51  ? 1.765   -1.156  18.115  1.00 59.54  ? 100 LEU A CD1 1 
ATOM   388  C  CD2 . LEU A 1 51  ? -0.386  -0.239  19.036  1.00 64.47  ? 100 LEU A CD2 1 
ATOM   389  N  N   . PHE A 1 52  ? 3.915   -1.047  21.743  1.00 68.09  ? 101 PHE A N   1 
ATOM   390  C  CA  . PHE A 1 52  ? 4.558   -0.085  22.627  1.00 64.93  ? 101 PHE A CA  1 
ATOM   391  C  C   . PHE A 1 52  ? 4.374   1.343   22.133  1.00 62.30  ? 101 PHE A C   1 
ATOM   392  O  O   . PHE A 1 52  ? 4.392   1.604   20.930  1.00 62.06  ? 101 PHE A O   1 
ATOM   393  C  CB  . PHE A 1 52  ? 6.047   -0.403  22.772  1.00 67.23  ? 101 PHE A CB  1 
ATOM   394  C  CG  . PHE A 1 52  ? 6.321   -1.748  23.376  1.00 69.86  ? 101 PHE A CG  1 
ATOM   395  C  CD1 . PHE A 1 52  ? 6.473   -1.888  24.748  1.00 71.08  ? 101 PHE A CD1 1 
ATOM   396  C  CD2 . PHE A 1 52  ? 6.424   -2.874  22.575  1.00 71.30  ? 101 PHE A CD2 1 
ATOM   397  C  CE1 . PHE A 1 52  ? 6.724   -3.125  25.311  1.00 66.95  ? 101 PHE A CE1 1 
ATOM   398  C  CE2 . PHE A 1 52  ? 6.675   -4.115  23.130  1.00 73.71  ? 101 PHE A CE2 1 
ATOM   399  C  CZ  . PHE A 1 52  ? 6.827   -4.240  24.502  1.00 74.96  ? 101 PHE A CZ  1 
ATOM   400  N  N   . ILE A 1 53  ? 4.197   2.262   23.074  1.00 59.14  ? 102 ILE A N   1 
ATOM   401  C  CA  . ILE A 1 53  ? 4.030   3.672   22.759  1.00 59.54  ? 102 ILE A CA  1 
ATOM   402  C  C   . ILE A 1 53  ? 5.058   4.501   23.509  1.00 60.68  ? 102 ILE A C   1 
ATOM   403  O  O   . ILE A 1 53  ? 5.189   4.386   24.726  1.00 62.09  ? 102 ILE A O   1 
ATOM   404  C  CB  . ILE A 1 53  ? 2.615   4.158   23.110  1.00 61.32  ? 102 ILE A CB  1 
ATOM   405  C  CG1 . ILE A 1 53  ? 1.628   3.707   22.032  1.00 67.60  ? 102 ILE A CG1 1 
ATOM   406  C  CG2 . ILE A 1 53  ? 2.586   5.675   23.258  1.00 58.06  ? 102 ILE A CG2 1 
ATOM   407  C  CD1 . ILE A 1 53  ? 0.253   4.321   22.167  1.00 71.86  ? 102 ILE A CD1 1 
ATOM   408  N  N   . TYR A 1 54  ? 5.791   5.334   22.779  1.00 62.78  ? 103 TYR A N   1 
ATOM   409  C  CA  . TYR A 1 54  ? 6.858   6.124   23.381  1.00 63.17  ? 103 TYR A CA  1 
ATOM   410  C  C   . TYR A 1 54  ? 6.586   7.621   23.356  1.00 61.71  ? 103 TYR A C   1 
ATOM   411  O  O   . TYR A 1 54  ? 5.831   8.118   22.519  1.00 63.18  ? 103 TYR A O   1 
ATOM   412  C  CB  . TYR A 1 54  ? 8.196   5.821   22.707  1.00 60.02  ? 103 TYR A CB  1 
ATOM   413  C  CG  . TYR A 1 54  ? 8.725   4.451   23.034  1.00 61.86  ? 103 TYR A CG  1 
ATOM   414  C  CD1 . TYR A 1 54  ? 9.597   4.260   24.094  1.00 72.06  ? 103 TYR A CD1 1 
ATOM   415  C  CD2 . TYR A 1 54  ? 8.340   3.344   22.294  1.00 74.84  ? 103 TYR A CD2 1 
ATOM   416  C  CE1 . TYR A 1 54  ? 10.079  3.008   24.405  1.00 73.63  ? 103 TYR A CE1 1 
ATOM   417  C  CE2 . TYR A 1 54  ? 8.820   2.085   22.595  1.00 77.22  ? 103 TYR A CE2 1 
ATOM   418  C  CZ  . TYR A 1 54  ? 9.689   1.924   23.652  1.00 76.73  ? 103 TYR A CZ  1 
ATOM   419  O  OH  . TYR A 1 54  ? 10.171  0.673   23.961  1.00 82.20  ? 103 TYR A OH  1 
ATOM   420  N  N   . VAL A 1 55  ? 7.209   8.329   24.292  1.00 59.30  ? 104 VAL A N   1 
ATOM   421  C  CA  . VAL A 1 55  ? 7.130   9.779   24.357  1.00 57.77  ? 104 VAL A CA  1 
ATOM   422  C  C   . VAL A 1 55  ? 8.547   10.332  24.268  1.00 59.41  ? 104 VAL A C   1 
ATOM   423  O  O   . VAL A 1 55  ? 9.466   9.773   24.867  1.00 62.91  ? 104 VAL A O   1 
ATOM   424  C  CB  . VAL A 1 55  ? 6.463   10.239  25.668  1.00 57.78  ? 104 VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 55  ? 6.420   11.753  25.750  1.00 56.57  ? 104 VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 55  ? 5.061   9.659   25.780  1.00 57.70  ? 104 VAL A CG2 1 
ATOM   427  N  N   . ASN A 1 56  ? 8.724   11.405  23.498  1.00 62.13  ? 105 ASN A N   1 
ATOM   428  C  CA  . ASN A 1 56  ? 10.033  12.039  23.316  1.00 65.96  ? 105 ASN A CA  1 
ATOM   429  C  C   . ASN A 1 56  ? 11.090  11.120  22.716  1.00 61.76  ? 105 ASN A C   1 
ATOM   430  O  O   . ASN A 1 56  ? 12.282  11.400  22.828  1.00 62.51  ? 105 ASN A O   1 
ATOM   431  C  CB  . ASN A 1 56  ? 10.566  12.599  24.640  1.00 68.96  ? 105 ASN A CB  1 
ATOM   432  C  CG  . ASN A 1 56  ? 9.937   13.917  25.011  1.00 70.09  ? 105 ASN A CG  1 
ATOM   433  O  OD1 . ASN A 1 56  ? 8.919   14.310  24.445  1.00 76.74  ? 105 ASN A OD1 1 
ATOM   434  N  ND2 . ASN A 1 56  ? 10.539  14.610  25.970  1.00 66.33  ? 105 ASN A ND2 1 
ATOM   435  N  N   . GLN A 1 57  ? 10.652  10.034  22.085  1.00 60.20  ? 106 GLN A N   1 
ATOM   436  C  CA  . GLN A 1 57  ? 11.563  8.996   21.611  1.00 62.15  ? 106 GLN A CA  1 
ATOM   437  C  C   . GLN A 1 57  ? 12.504  8.557   22.731  1.00 66.44  ? 106 GLN A C   1 
ATOM   438  O  O   . GLN A 1 57  ? 13.690  8.326   22.503  1.00 68.94  ? 106 GLN A O   1 
ATOM   439  C  CB  . GLN A 1 57  ? 12.368  9.482   20.403  1.00 60.40  ? 106 GLN A CB  1 
ATOM   440  C  CG  . GLN A 1 57  ? 11.545  9.679   19.142  1.00 62.73  ? 106 GLN A CG  1 
ATOM   441  C  CD  . GLN A 1 57  ? 12.380  10.163  17.971  1.00 66.48  ? 106 GLN A CD  1 
ATOM   442  O  OE1 . GLN A 1 57  ? 13.056  11.188  18.057  1.00 66.55  ? 106 GLN A OE1 1 
ATOM   443  N  NE2 . GLN A 1 57  ? 12.345  9.420   16.869  1.00 68.12  ? 106 GLN A NE2 1 
ATOM   444  N  N   . SER A 1 58  ? 11.967  8.452   23.943  1.00 66.57  ? 107 SER A N   1 
ATOM   445  C  CA  . SER A 1 58  ? 12.785  8.185   25.119  1.00 67.08  ? 107 SER A CA  1 
ATOM   446  C  C   . SER A 1 58  ? 12.167  7.127   26.024  1.00 68.11  ? 107 SER A C   1 
ATOM   447  O  O   . SER A 1 58  ? 12.748  6.060   26.230  1.00 72.95  ? 107 SER A O   1 
ATOM   448  C  CB  . SER A 1 58  ? 13.013  9.476   25.906  1.00 72.18  ? 107 SER A CB  1 
ATOM   449  O  OG  . SER A 1 58  ? 13.743  9.231   27.095  1.00 76.81  ? 107 SER A OG  1 
ATOM   450  N  N   . PHE A 1 59  ? 10.988  7.421   26.563  1.00 65.03  ? 108 PHE A N   1 
ATOM   451  C  CA  . PHE A 1 59  ? 10.358  6.523   27.529  1.00 65.38  ? 108 PHE A CA  1 
ATOM   452  C  C   . PHE A 1 59  ? 8.983   6.026   27.091  1.00 60.29  ? 108 PHE A C   1 
ATOM   453  O  O   . PHE A 1 59  ? 8.327   6.630   26.245  1.00 59.30  ? 108 PHE A O   1 
ATOM   454  C  CB  . PHE A 1 59  ? 10.267  7.186   28.913  1.00 63.97  ? 108 PHE A CB  1 
ATOM   455  C  CG  . PHE A 1 59  ? 9.477   8.469   28.927  1.00 63.03  ? 108 PHE A CG  1 
ATOM   456  C  CD1 . PHE A 1 59  ? 10.070  9.672   28.571  1.00 60.16  ? 108 PHE A CD1 1 
ATOM   457  C  CD2 . PHE A 1 59  ? 8.143   8.473   29.308  1.00 64.06  ? 108 PHE A CD2 1 
ATOM   458  C  CE1 . PHE A 1 59  ? 9.345   10.851  28.583  1.00 59.95  ? 108 PHE A CE1 1 
ATOM   459  C  CE2 . PHE A 1 59  ? 7.413   9.651   29.325  1.00 62.68  ? 108 PHE A CE2 1 
ATOM   460  C  CZ  . PHE A 1 59  ? 8.017   10.841  28.961  1.00 61.16  ? 108 PHE A CZ  1 
ATOM   461  N  N   . ALA A 1 60  ? 8.560   4.911   27.677  1.00 58.80  ? 109 ALA A N   1 
ATOM   462  C  CA  . ALA A 1 60  ? 7.232   4.368   27.438  1.00 56.47  ? 109 ALA A CA  1 
ATOM   463  C  C   . ALA A 1 60  ? 6.371   4.602   28.673  1.00 61.14  ? 109 ALA A C   1 
ATOM   464  O  O   . ALA A 1 60  ? 6.572   3.958   29.707  1.00 59.57  ? 109 ALA A O   1 
ATOM   465  C  CB  . ALA A 1 60  ? 7.316   2.891   27.126  1.00 51.09  ? 109 ALA A CB  1 
ATOM   466  N  N   . PRO A 1 61  ? 5.411   5.533   28.574  1.00 60.65  ? 110 PRO A N   1 
ATOM   467  C  CA  . PRO A 1 61  ? 4.562   5.870   29.720  1.00 58.32  ? 110 PRO A CA  1 
ATOM   468  C  C   . PRO A 1 61  ? 3.695   4.687   30.126  1.00 56.17  ? 110 PRO A C   1 
ATOM   469  O  O   . PRO A 1 61  ? 3.409   3.829   29.296  1.00 59.90  ? 110 PRO A O   1 
ATOM   470  C  CB  . PRO A 1 61  ? 3.693   7.010   29.183  1.00 57.95  ? 110 PRO A CB  1 
ATOM   471  C  CG  . PRO A 1 61  ? 3.659   6.797   27.713  1.00 58.22  ? 110 PRO A CG  1 
ATOM   472  C  CD  . PRO A 1 61  ? 5.015   6.264   27.359  1.00 59.20  ? 110 PRO A CD  1 
ATOM   473  N  N   . SER A 1 62  ? 3.296   4.639   31.391  1.00 58.90  ? 111 SER A N   1 
ATOM   474  C  CA  . SER A 1 62  ? 2.436   3.569   31.873  1.00 60.20  ? 111 SER A CA  1 
ATOM   475  C  C   . SER A 1 62  ? 1.102   3.603   31.131  1.00 66.08  ? 111 SER A C   1 
ATOM   476  O  O   . SER A 1 62  ? 0.561   4.672   30.868  1.00 68.04  ? 111 SER A O   1 
ATOM   477  C  CB  . SER A 1 62  ? 2.216   3.705   33.378  1.00 54.80  ? 111 SER A CB  1 
ATOM   478  O  OG  . SER A 1 62  ? 1.700   2.505   33.924  1.00 59.59  ? 111 SER A OG  1 
ATOM   479  N  N   . PRO A 1 63  ? 0.570   2.426   30.779  1.00 68.04  ? 112 PRO A N   1 
ATOM   480  C  CA  . PRO A 1 63  ? -0.674  2.358   30.002  1.00 68.15  ? 112 PRO A CA  1 
ATOM   481  C  C   . PRO A 1 63  ? -1.882  2.999   30.694  1.00 65.46  ? 112 PRO A C   1 
ATOM   482  O  O   . PRO A 1 63  ? -2.864  3.306   30.017  1.00 69.76  ? 112 PRO A O   1 
ATOM   483  C  CB  . PRO A 1 63  ? -0.887  0.850   29.803  1.00 67.45  ? 112 PRO A CB  1 
ATOM   484  C  CG  . PRO A 1 63  ? -0.023  0.192   30.836  1.00 69.67  ? 112 PRO A CG  1 
ATOM   485  C  CD  . PRO A 1 63  ? 1.148   1.094   31.020  1.00 69.31  ? 112 PRO A CD  1 
ATOM   486  N  N   . ASP A 1 64  ? -1.812  3.211   32.005  1.00 56.68  ? 113 ASP A N   1 
ATOM   487  C  CA  . ASP A 1 64  ? -2.913  3.851   32.720  1.00 56.83  ? 113 ASP A CA  1 
ATOM   488  C  C   . ASP A 1 64  ? -2.714  5.362   32.822  1.00 58.81  ? 113 ASP A C   1 
ATOM   489  O  O   . ASP A 1 64  ? -3.443  6.046   33.539  1.00 57.29  ? 113 ASP A O   1 
ATOM   490  C  CB  . ASP A 1 64  ? -3.099  3.239   34.114  1.00 54.92  ? 113 ASP A CB  1 
ATOM   491  C  CG  . ASP A 1 64  ? -1.924  3.512   35.038  1.00 56.84  ? 113 ASP A CG  1 
ATOM   492  O  OD1 . ASP A 1 64  ? -0.798  3.692   34.530  1.00 50.55  ? 113 ASP A OD1 1 
ATOM   493  O  OD2 . ASP A 1 64  ? -2.127  3.545   36.275  1.00 56.32  ? 113 ASP A OD2 1 
ATOM   494  N  N   . GLN A 1 65  ? -1.727  5.877   32.098  1.00 52.09  ? 114 GLN A N   1 
ATOM   495  C  CA  . GLN A 1 65  ? -1.407  7.296   32.155  1.00 53.10  ? 114 GLN A CA  1 
ATOM   496  C  C   . GLN A 1 65  ? -2.226  8.077   31.135  1.00 56.94  ? 114 GLN A C   1 
ATOM   497  O  O   . GLN A 1 65  ? -2.306  7.697   29.969  1.00 62.88  ? 114 GLN A O   1 
ATOM   498  C  CB  . GLN A 1 65  ? 0.088   7.501   31.924  1.00 66.78  ? 114 GLN A CB  1 
ATOM   499  C  CG  . GLN A 1 65  ? 0.620   8.847   32.358  1.00 75.47  ? 114 GLN A CG  1 
ATOM   500  C  CD  . GLN A 1 65  ? 2.105   8.799   32.656  1.00 78.85  ? 114 GLN A CD  1 
ATOM   501  O  OE1 . GLN A 1 65  ? 2.692   7.722   32.783  1.00 73.99  ? 114 GLN A OE1 1 
ATOM   502  N  NE2 . GLN A 1 65  ? 2.722   9.970   32.772  1.00 83.70  ? 114 GLN A NE2 1 
ATOM   503  N  N   . GLU A 1 66  ? -2.842  9.166   31.579  1.00 60.77  ? 115 GLU A N   1 
ATOM   504  C  CA  . GLU A 1 66  ? -3.705  9.962   30.712  1.00 60.49  ? 115 GLU A CA  1 
ATOM   505  C  C   . GLU A 1 66  ? -2.901  10.803  29.731  1.00 63.00  ? 115 GLU A C   1 
ATOM   506  O  O   . GLU A 1 66  ? -1.804  11.260  30.042  1.00 66.50  ? 115 GLU A O   1 
ATOM   507  C  CB  . GLU A 1 66  ? -4.623  10.858  31.541  1.00 62.73  ? 115 GLU A CB  1 
ATOM   508  C  CG  . GLU A 1 66  ? -5.590  10.094  32.423  1.00 62.96  ? 115 GLU A CG  1 
ATOM   509  C  CD  . GLU A 1 66  ? -6.614  10.995  33.076  1.00 67.19  ? 115 GLU A CD  1 
ATOM   510  O  OE1 . GLU A 1 66  ? -7.580  10.464  33.662  1.00 71.28  ? 115 GLU A OE1 1 
ATOM   511  O  OE2 . GLU A 1 66  ? -6.454  12.233  33.002  1.00 67.53  ? 115 GLU A OE2 1 
ATOM   512  N  N   . VAL A 1 67  ? -3.464  11.011  28.547  1.00 59.43  ? 116 VAL A N   1 
ATOM   513  C  CA  . VAL A 1 67  ? -2.759  11.692  27.471  1.00 62.61  ? 116 VAL A CA  1 
ATOM   514  C  C   . VAL A 1 67  ? -2.679  13.209  27.683  1.00 61.92  ? 116 VAL A C   1 
ATOM   515  O  O   . VAL A 1 67  ? -1.660  13.832  27.373  1.00 62.92  ? 116 VAL A O   1 
ATOM   516  C  CB  . VAL A 1 67  ? -3.388  11.363  26.097  1.00 65.62  ? 116 VAL A CB  1 
ATOM   517  C  CG1 . VAL A 1 67  ? -2.673  12.103  24.996  1.00 68.30  ? 116 VAL A CG1 1 
ATOM   518  C  CG2 . VAL A 1 67  ? -3.321  9.868   25.835  1.00 66.38  ? 116 VAL A CG2 1 
ATOM   519  N  N   . GLY A 1 68  ? -3.746  13.795  28.218  1.00 58.65  ? 117 GLY A N   1 
ATOM   520  C  CA  . GLY A 1 68  ? -3.775  15.222  28.497  1.00 61.30  ? 117 GLY A CA  1 
ATOM   521  C  C   . GLY A 1 68  ? -2.610  15.693  29.353  1.00 62.78  ? 117 GLY A C   1 
ATOM   522  O  O   . GLY A 1 68  ? -2.038  16.760  29.114  1.00 54.01  ? 117 GLY A O   1 
ATOM   523  N  N   . THR A 1 69  ? -2.255  14.886  30.350  1.00 58.63  ? 118 THR A N   1 
ATOM   524  C  CA  . THR A 1 69  ? -1.116  15.182  31.211  1.00 56.28  ? 118 THR A CA  1 
ATOM   525  C  C   . THR A 1 69  ? 0.196   15.114  30.427  1.00 55.52  ? 118 THR A C   1 
ATOM   526  O  O   . THR A 1 69  ? 1.039   16.007  30.534  1.00 53.69  ? 118 THR A O   1 
ATOM   527  C  CB  . THR A 1 69  ? -1.046  14.210  32.404  1.00 55.44  ? 118 THR A CB  1 
ATOM   528  O  OG1 . THR A 1 69  ? -2.287  14.231  33.121  1.00 54.93  ? 118 THR A OG1 1 
ATOM   529  C  CG2 . THR A 1 69  ? 0.083   14.598  33.343  1.00 53.05  ? 118 THR A CG2 1 
ATOM   530  N  N   . LEU A 1 70  ? 0.358   14.055  29.639  1.00 53.47  ? 119 LEU A N   1 
ATOM   531  C  CA  . LEU A 1 70  ? 1.549   13.880  28.809  1.00 58.99  ? 119 LEU A CA  1 
ATOM   532  C  C   . LEU A 1 70  ? 1.707   15.030  27.819  1.00 65.43  ? 119 LEU A C   1 
ATOM   533  O  O   . LEU A 1 70  ? 2.824   15.401  27.456  1.00 64.72  ? 119 LEU A O   1 
ATOM   534  C  CB  . LEU A 1 70  ? 1.490   12.553  28.049  1.00 55.07  ? 119 LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 70  ? 1.575   11.263  28.864  1.00 53.82  ? 119 LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 70  ? 1.360   10.053  27.969  1.00 53.60  ? 119 LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 70  ? 2.915   11.169  29.572  1.00 51.22  ? 119 LEU A CD2 1 
ATOM   538  N  N   . TYR A 1 71  ? 0.581   15.588  27.387  1.00 66.21  ? 120 TYR A N   1 
ATOM   539  C  CA  . TYR A 1 71  ? 0.591   16.704  26.455  1.00 63.61  ? 120 TYR A CA  1 
ATOM   540  C  C   . TYR A 1 71  ? 1.158   17.960  27.095  1.00 63.75  ? 120 TYR A C   1 
ATOM   541  O  O   . TYR A 1 71  ? 2.037   18.605  26.534  1.00 66.19  ? 120 TYR A O   1 
ATOM   542  C  CB  . TYR A 1 71  ? -0.818  16.988  25.943  1.00 62.06  ? 120 TYR A CB  1 
ATOM   543  C  CG  . TYR A 1 71  ? -0.910  18.254  25.126  1.00 66.49  ? 120 TYR A CG  1 
ATOM   544  C  CD1 . TYR A 1 71  ? -0.520  18.271  23.795  1.00 70.18  ? 120 TYR A CD1 1 
ATOM   545  C  CD2 . TYR A 1 71  ? -1.383  19.436  25.687  1.00 67.09  ? 120 TYR A CD2 1 
ATOM   546  C  CE1 . TYR A 1 71  ? -0.599  19.427  23.044  1.00 74.65  ? 120 TYR A CE1 1 
ATOM   547  C  CE2 . TYR A 1 71  ? -1.464  20.595  24.944  1.00 68.29  ? 120 TYR A CE2 1 
ATOM   548  C  CZ  . TYR A 1 71  ? -1.072  20.585  23.623  1.00 74.94  ? 120 TYR A CZ  1 
ATOM   549  O  OH  . TYR A 1 71  ? -1.150  21.737  22.874  1.00 80.07  ? 120 TYR A OH  1 
ATOM   550  N  N   . GLU A 1 72  ? 0.648   18.306  28.269  1.00 64.36  ? 121 GLU A N   1 
ATOM   551  C  CA  . GLU A 1 72  ? 1.045   19.541  28.935  1.00 64.32  ? 121 GLU A CA  1 
ATOM   552  C  C   . GLU A 1 72  ? 2.512   19.539  29.360  1.00 62.83  ? 121 GLU A C   1 
ATOM   553  O  O   . GLU A 1 72  ? 3.117   20.598  29.531  1.00 62.53  ? 121 GLU A O   1 
ATOM   554  C  CB  . GLU A 1 72  ? 0.136   19.814  30.133  1.00 69.62  ? 121 GLU A CB  1 
ATOM   555  C  CG  . GLU A 1 72  ? -1.319  20.019  29.750  1.00 79.60  ? 121 GLU A CG  1 
ATOM   556  C  CD  . GLU A 1 72  ? -2.196  20.347  30.939  1.00 92.37  ? 121 GLU A CD  1 
ATOM   557  O  OE1 . GLU A 1 72  ? -3.416  20.532  30.738  1.00 96.21  ? 121 GLU A OE1 1 
ATOM   558  O  OE2 . GLU A 1 72  ? -1.668  20.420  32.072  1.00 96.66  ? 121 GLU A OE2 1 
ATOM   559  N  N   . CYS A 1 73  ? 3.085   18.351  29.520  1.00 62.06  ? 122 CYS A N   1 
ATOM   560  C  CA  . CYS A 1 73  ? 4.478   18.232  29.933  1.00 60.68  ? 122 CYS A CA  1 
ATOM   561  C  C   . CYS A 1 73  ? 5.423   18.020  28.754  1.00 61.96  ? 122 CYS A C   1 
ATOM   562  O  O   . CYS A 1 73  ? 6.541   18.536  28.747  1.00 63.74  ? 122 CYS A O   1 
ATOM   563  C  CB  . CYS A 1 73  ? 4.646   17.089  30.937  1.00 58.42  ? 122 CYS A CB  1 
ATOM   564  S  SG  . CYS A 1 73  ? 3.767   17.323  32.491  1.00 61.95  ? 122 CYS A SG  1 
ATOM   565  N  N   . PHE A 1 74  ? 4.977   17.256  27.762  1.00 61.79  ? 123 PHE A N   1 
ATOM   566  C  CA  . PHE A 1 74  ? 5.859   16.853  26.668  1.00 62.64  ? 123 PHE A CA  1 
ATOM   567  C  C   . PHE A 1 74  ? 5.317   17.180  25.277  1.00 68.17  ? 123 PHE A C   1 
ATOM   568  O  O   . PHE A 1 74  ? 5.813   16.665  24.274  1.00 67.03  ? 123 PHE A O   1 
ATOM   569  C  CB  . PHE A 1 74  ? 6.177   15.361  26.772  1.00 55.00  ? 123 PHE A CB  1 
ATOM   570  C  CG  . PHE A 1 74  ? 6.632   14.940  28.137  1.00 57.79  ? 123 PHE A CG  1 
ATOM   571  C  CD1 . PHE A 1 74  ? 7.898   15.270  28.591  1.00 58.59  ? 123 PHE A CD1 1 
ATOM   572  C  CD2 . PHE A 1 74  ? 5.792   14.221  28.972  1.00 56.53  ? 123 PHE A CD2 1 
ATOM   573  C  CE1 . PHE A 1 74  ? 8.318   14.888  29.850  1.00 57.60  ? 123 PHE A CE1 1 
ATOM   574  C  CE2 . PHE A 1 74  ? 6.207   13.836  30.230  1.00 54.78  ? 123 PHE A CE2 1 
ATOM   575  C  CZ  . PHE A 1 74  ? 7.472   14.169  30.669  1.00 56.55  ? 123 PHE A CZ  1 
ATOM   576  N  N   . GLY A 1 75  ? 4.304   18.038  25.219  1.00 69.16  ? 124 GLY A N   1 
ATOM   577  C  CA  . GLY A 1 75  ? 3.757   18.470  23.947  1.00 69.87  ? 124 GLY A CA  1 
ATOM   578  C  C   . GLY A 1 75  ? 4.673   19.466  23.269  1.00 71.02  ? 124 GLY A C   1 
ATOM   579  O  O   . GLY A 1 75  ? 5.552   20.049  23.904  1.00 69.95  ? 124 GLY A O   1 
ATOM   580  N  N   . SER A 1 76  ? 4.469   19.659  21.972  1.00 75.98  ? 125 SER A N   1 
ATOM   581  C  CA  . SER A 1 76  ? 5.282   20.593  21.205  1.00 78.94  ? 125 SER A CA  1 
ATOM   582  C  C   . SER A 1 76  ? 4.496   21.125  20.017  1.00 80.42  ? 125 SER A C   1 
ATOM   583  O  O   . SER A 1 76  ? 3.932   20.349  19.244  1.00 80.71  ? 125 SER A O   1 
ATOM   584  C  CB  . SER A 1 76  ? 6.566   19.913  20.726  1.00 77.67  ? 125 SER A CB  1 
ATOM   585  O  OG  . SER A 1 76  ? 7.410   20.833  20.059  1.00 78.95  ? 125 SER A OG  1 
ATOM   586  N  N   . ASP A 1 77  ? 4.458   22.449  19.886  1.00 81.06  ? 126 ASP A N   1 
ATOM   587  C  CA  . ASP A 1 77  ? 3.775   23.117  18.778  1.00 80.58  ? 126 ASP A CA  1 
ATOM   588  C  C   . ASP A 1 77  ? 2.303   22.730  18.674  1.00 75.51  ? 126 ASP A C   1 
ATOM   589  O  O   . ASP A 1 77  ? 1.771   22.569  17.576  1.00 75.94  ? 126 ASP A O   1 
ATOM   590  C  CB  . ASP A 1 77  ? 4.491   22.850  17.450  1.00 86.87  ? 126 ASP A CB  1 
ATOM   591  C  CG  . ASP A 1 77  ? 5.932   23.318  17.463  1.00 92.75  ? 126 ASP A CG  1 
ATOM   592  O  OD1 . ASP A 1 77  ? 6.216   24.355  18.099  1.00 94.71  ? 126 ASP A OD1 1 
ATOM   593  O  OD2 . ASP A 1 77  ? 6.783   22.647  16.842  1.00 95.23  ? 126 ASP A OD2 1 
ATOM   594  N  N   . GLY A 1 78  ? 1.657   22.572  19.825  1.00 72.79  ? 127 GLY A N   1 
ATOM   595  C  CA  . GLY A 1 78  ? 0.227   22.324  19.872  1.00 69.97  ? 127 GLY A CA  1 
ATOM   596  C  C   . GLY A 1 78  ? -0.182  20.870  19.722  1.00 70.89  ? 127 GLY A C   1 
ATOM   597  O  O   . GLY A 1 78  ? -1.370  20.568  19.617  1.00 73.23  ? 127 GLY A O   1 
ATOM   598  N  N   . LYS A 1 79  ? 0.794   19.967  19.714  1.00 69.48  ? 128 LYS A N   1 
ATOM   599  C  CA  . LYS A 1 79  ? 0.502   18.545  19.551  1.00 70.81  ? 128 LYS A CA  1 
ATOM   600  C  C   . LYS A 1 79  ? 1.433   17.638  20.358  1.00 69.02  ? 128 LYS A C   1 
ATOM   601  O  O   . LYS A 1 79  ? 2.553   18.020  20.697  1.00 71.21  ? 128 LYS A O   1 
ATOM   602  C  CB  . LYS A 1 79  ? 0.526   18.156  18.066  1.00 72.16  ? 128 LYS A CB  1 
ATOM   603  C  CG  . LYS A 1 79  ? 1.766   18.617  17.311  1.00 76.48  ? 128 LYS A CG  1 
ATOM   604  C  CD  . LYS A 1 79  ? 1.546   18.543  15.801  1.00 80.31  ? 128 LYS A CD  1 
ATOM   605  C  CE  . LYS A 1 79  ? 2.646   19.262  15.023  1.00 77.31  ? 128 LYS A CE  1 
ATOM   606  N  NZ  . LYS A 1 79  ? 3.955   18.556  15.102  1.00 76.39  ? 128 LYS A NZ  1 
ATOM   607  N  N   . LEU A 1 80  ? 0.952   16.436  20.667  1.00 64.24  ? 129 LEU A N   1 
ATOM   608  C  CA  . LEU A 1 80  ? 1.758   15.433  21.353  1.00 61.46  ? 129 LEU A CA  1 
ATOM   609  C  C   . LEU A 1 80  ? 2.216   14.347  20.385  1.00 61.35  ? 129 LEU A C   1 
ATOM   610  O  O   . LEU A 1 80  ? 1.397   13.630  19.810  1.00 60.08  ? 129 LEU A O   1 
ATOM   611  C  CB  . LEU A 1 80  ? 0.971   14.794  22.496  1.00 60.34  ? 129 LEU A CB  1 
ATOM   612  C  CG  . LEU A 1 80  ? 1.688   13.618  23.161  1.00 58.98  ? 129 LEU A CG  1 
ATOM   613  C  CD1 . LEU A 1 80  ? 2.936   14.101  23.889  1.00 55.37  ? 129 LEU A CD1 1 
ATOM   614  C  CD2 . LEU A 1 80  ? 0.759   12.863  24.097  1.00 52.56  ? 129 LEU A CD2 1 
ATOM   615  N  N   . VAL A 1 81  ? 3.528   14.223  20.215  1.00 60.20  ? 130 VAL A N   1 
ATOM   616  C  CA  . VAL A 1 81  ? 4.083   13.242  19.292  1.00 60.75  ? 130 VAL A CA  1 
ATOM   617  C  C   . VAL A 1 81  ? 4.302   11.899  19.974  1.00 60.90  ? 130 VAL A C   1 
ATOM   618  O  O   . VAL A 1 81  ? 5.046   11.803  20.951  1.00 64.23  ? 130 VAL A O   1 
ATOM   619  C  CB  . VAL A 1 81  ? 5.417   13.720  18.697  1.00 61.33  ? 130 VAL A CB  1 
ATOM   620  C  CG1 . VAL A 1 81  ? 5.999   12.652  17.775  1.00 61.35  ? 130 VAL A CG1 1 
ATOM   621  C  CG2 . VAL A 1 81  ? 5.225   15.035  17.957  1.00 56.73  ? 130 VAL A CG2 1 
ATOM   622  N  N   . LEU A 1 82  ? 3.652   10.863  19.454  1.00 57.79  ? 131 LEU A N   1 
ATOM   623  C  CA  . LEU A 1 82  ? 3.793   9.521   20.005  1.00 56.46  ? 131 LEU A CA  1 
ATOM   624  C  C   . LEU A 1 82  ? 4.271   8.544   18.941  1.00 62.58  ? 131 LEU A C   1 
ATOM   625  O  O   . LEU A 1 82  ? 3.708   8.479   17.848  1.00 65.48  ? 131 LEU A O   1 
ATOM   626  C  CB  . LEU A 1 82  ? 2.466   9.038   20.595  1.00 58.88  ? 131 LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 82  ? 1.890   9.854   21.754  1.00 59.62  ? 131 LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 82  ? 0.589   9.246   22.221  1.00 54.77  ? 131 LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 82  ? 2.879   9.944   22.903  1.00 61.03  ? 131 LEU A CD2 1 
ATOM   630  N  N   . HIS A 1 83  ? 5.315   7.788   19.264  1.00 60.58  ? 132 HIS A N   1 
ATOM   631  C  CA  . HIS A 1 83  ? 5.812   6.754   18.366  1.00 62.93  ? 132 HIS A CA  1 
ATOM   632  C  C   . HIS A 1 83  ? 5.290   5.386   18.790  1.00 65.40  ? 132 HIS A C   1 
ATOM   633  O  O   . HIS A 1 83  ? 5.402   5.012   19.959  1.00 65.78  ? 132 HIS A O   1 
ATOM   634  C  CB  . HIS A 1 83  ? 7.342   6.745   18.351  1.00 62.76  ? 132 HIS A CB  1 
ATOM   635  C  CG  . HIS A 1 83  ? 7.949   7.997   17.801  1.00 62.08  ? 132 HIS A CG  1 
ATOM   636  N  ND1 . HIS A 1 83  ? 8.485   8.070   16.533  1.00 64.32  ? 132 HIS A ND1 1 
ATOM   637  C  CD2 . HIS A 1 83  ? 8.106   9.227   18.346  1.00 59.95  ? 132 HIS A CD2 1 
ATOM   638  C  CE1 . HIS A 1 83  ? 8.947   9.289   16.321  1.00 61.71  ? 132 HIS A CE1 1 
ATOM   639  N  NE2 . HIS A 1 83  ? 8.728   10.011  17.406  1.00 59.48  ? 132 HIS A NE2 1 
ATOM   640  N  N   . TYR A 1 84  ? 4.715   4.644   17.846  1.00 65.08  ? 133 TYR A N   1 
ATOM   641  C  CA  . TYR A 1 84  ? 4.256   3.286   18.127  1.00 64.75  ? 133 TYR A CA  1 
ATOM   642  C  C   . TYR A 1 84  ? 5.185   2.248   17.508  1.00 69.98  ? 133 TYR A C   1 
ATOM   643  O  O   . TYR A 1 84  ? 5.751   2.467   16.437  1.00 72.66  ? 133 TYR A O   1 
ATOM   644  C  CB  . TYR A 1 84  ? 2.807   3.070   17.669  1.00 59.83  ? 133 TYR A CB  1 
ATOM   645  C  CG  . TYR A 1 84  ? 2.543   3.359   16.207  1.00 62.86  ? 133 TYR A CG  1 
ATOM   646  C  CD1 . TYR A 1 84  ? 2.317   4.657   15.766  1.00 65.11  ? 133 TYR A CD1 1 
ATOM   647  C  CD2 . TYR A 1 84  ? 2.497   2.334   15.271  1.00 64.44  ? 133 TYR A CD2 1 
ATOM   648  C  CE1 . TYR A 1 84  ? 2.070   4.929   14.433  1.00 68.14  ? 133 TYR A CE1 1 
ATOM   649  C  CE2 . TYR A 1 84  ? 2.247   2.596   13.933  1.00 66.80  ? 133 TYR A CE2 1 
ATOM   650  C  CZ  . TYR A 1 84  ? 2.033   3.895   13.520  1.00 68.85  ? 133 TYR A CZ  1 
ATOM   651  O  OH  . TYR A 1 84  ? 1.786   4.168   12.192  1.00 68.37  ? 133 TYR A OH  1 
ATOM   652  N  N   . CYS A 1 85  ? 5.338   1.120   18.194  1.00 71.45  ? 134 CYS A N   1 
ATOM   653  C  CA  . CYS A 1 85  ? 6.266   0.079   17.775  1.00 71.56  ? 134 CYS A CA  1 
ATOM   654  C  C   . CYS A 1 85  ? 5.881   -1.259  18.403  1.00 74.19  ? 134 CYS A C   1 
ATOM   655  O  O   . CYS A 1 85  ? 5.304   -1.298  19.490  1.00 74.08  ? 134 CYS A O   1 
ATOM   656  C  CB  . CYS A 1 85  ? 7.692   0.463   18.173  1.00 60.35  ? 134 CYS A CB  1 
ATOM   657  S  SG  . CYS A 1 85  ? 8.971   -0.693  17.643  1.00 75.32  ? 134 CYS A SG  1 
ATOM   658  N  N   . LYS A 1 86  ? 6.197   -2.353  17.717  1.00 76.94  ? 135 LYS A N   1 
ATOM   659  C  CA  . LYS A 1 86  ? 5.851   -3.683  18.211  1.00 77.42  ? 135 LYS A CA  1 
ATOM   660  C  C   . LYS A 1 86  ? 6.968   -4.302  19.046  1.00 72.82  ? 135 LYS A C   1 
ATOM   661  O  O   . LYS A 1 86  ? 6.921   -5.488  19.370  1.00 73.32  ? 135 LYS A O   1 
ATOM   662  C  CB  . LYS A 1 86  ? 5.493   -4.623  17.057  1.00 84.54  ? 135 LYS A CB  1 
ATOM   663  C  CG  . LYS A 1 86  ? 4.229   -4.251  16.297  1.00 92.00  ? 135 LYS A CG  1 
ATOM   664  C  CD  . LYS A 1 86  ? 3.674   -5.453  15.539  1.00 97.55  ? 135 LYS A CD  1 
ATOM   665  C  CE  . LYS A 1 86  ? 4.733   -6.103  14.665  1.00 101.67 ? 135 LYS A CE  1 
ATOM   666  N  NZ  . LYS A 1 86  ? 4.270   -7.411  14.126  1.00 105.33 ? 135 LYS A NZ  1 
ATOM   667  N  N   . SER A 1 87  ? 7.971   -3.502  19.387  1.00 68.00  ? 136 SER A N   1 
ATOM   668  C  CA  . SER A 1 87  ? 9.070   -3.976  20.221  1.00 68.69  ? 136 SER A CA  1 
ATOM   669  C  C   . SER A 1 87  ? 9.621   -2.847  21.088  1.00 71.38  ? 136 SER A C   1 
ATOM   670  O  O   . SER A 1 87  ? 9.284   -1.681  20.887  1.00 73.61  ? 136 SER A O   1 
ATOM   671  C  CB  . SER A 1 87  ? 10.182  -4.572  19.358  1.00 63.92  ? 136 SER A CB  1 
ATOM   672  O  OG  . SER A 1 87  ? 10.750  -3.586  18.516  1.00 62.67  ? 136 SER A OG  1 
ATOM   673  N  N   . GLN A 1 88  ? 10.461  -3.198  22.058  1.00 71.21  ? 137 GLN A N   1 
ATOM   674  C  CA  . GLN A 1 88  ? 11.095  -2.198  22.908  1.00 73.54  ? 137 GLN A CA  1 
ATOM   675  C  C   . GLN A 1 88  ? 12.144  -1.411  22.135  1.00 73.94  ? 137 GLN A C   1 
ATOM   676  O  O   . GLN A 1 88  ? 13.290  -1.838  22.023  1.00 80.35  ? 137 GLN A O   1 
ATOM   677  C  CB  . GLN A 1 88  ? 11.737  -2.848  24.135  1.00 74.92  ? 137 GLN A CB  1 
ATOM   678  C  CG  . GLN A 1 88  ? 10.814  -2.994  25.332  1.00 73.26  ? 137 GLN A CG  1 
ATOM   679  C  CD  . GLN A 1 88  ? 11.569  -3.361  26.597  1.00 75.46  ? 137 GLN A CD  1 
ATOM   680  O  OE1 . GLN A 1 88  ? 11.858  -2.504  27.435  1.00 71.42  ? 137 GLN A OE1 1 
ATOM   681  N  NE2 . GLN A 1 88  ? 11.900  -4.642  26.738  1.00 78.69  ? 137 GLN A NE2 1 
ATOM   682  N  N   . ALA A 1 89  ? 11.748  -0.257  21.608  1.00 69.39  ? 138 ALA A N   1 
ATOM   683  C  CA  . ALA A 1 89  ? 12.651  0.580   20.826  1.00 65.38  ? 138 ALA A CA  1 
ATOM   684  C  C   . ALA A 1 89  ? 13.721  1.229   21.700  1.00 66.22  ? 138 ALA A C   1 
ATOM   685  O  O   . ALA A 1 89  ? 14.913  1.095   21.429  1.00 64.89  ? 138 ALA A O   1 
ATOM   686  C  CB  . ALA A 1 89  ? 11.868  1.638   20.064  1.00 59.44  ? 138 ALA A CB  1 
ATOM   687  N  N   . TRP A 1 90  ? 13.290  1.925   22.750  1.00 64.70  ? 139 TRP A N   1 
ATOM   688  C  CA  . TRP A 1 90  ? 14.213  2.615   23.648  1.00 62.25  ? 139 TRP A CA  1 
ATOM   689  C  C   . TRP A 1 90  ? 13.986  2.214   25.107  1.00 68.72  ? 139 TRP A C   1 
ATOM   690  O  O   . TRP A 1 90  ? 12.850  1.994   25.527  1.00 73.62  ? 139 TRP A O   1 
ATOM   691  C  CB  . TRP A 1 90  ? 14.085  4.127   23.465  1.00 63.08  ? 139 TRP A CB  1 
ATOM   692  C  CG  . TRP A 1 90  ? 14.210  4.537   22.031  1.00 65.43  ? 139 TRP A CG  1 
ATOM   693  C  CD1 . TRP A 1 90  ? 15.347  4.537   21.277  1.00 66.52  ? 139 TRP A CD1 1 
ATOM   694  C  CD2 . TRP A 1 90  ? 13.158  4.993   21.172  1.00 63.78  ? 139 TRP A CD2 1 
ATOM   695  N  NE1 . TRP A 1 90  ? 15.070  4.968   20.002  1.00 69.59  ? 139 TRP A NE1 1 
ATOM   696  C  CE2 . TRP A 1 90  ? 13.733  5.255   19.911  1.00 69.05  ? 139 TRP A CE2 1 
ATOM   697  C  CE3 . TRP A 1 90  ? 11.789  5.210   21.346  1.00 59.31  ? 139 TRP A CE3 1 
ATOM   698  C  CZ2 . TRP A 1 90  ? 12.986  5.721   18.831  1.00 68.35  ? 139 TRP A CZ2 1 
ATOM   699  C  CZ3 . TRP A 1 90  ? 11.049  5.672   20.274  1.00 64.09  ? 139 TRP A CZ3 1 
ATOM   700  C  CH2 . TRP A 1 90  ? 11.649  5.923   19.032  1.00 68.27  ? 139 TRP A CH2 1 
ATOM   701  N  N   . GLY A 1 91  ? 15.067  2.124   25.879  1.00 68.71  ? 140 GLY A N   1 
ATOM   702  C  CA  . GLY A 1 91  ? 14.996  1.560   27.217  1.00 69.88  ? 140 GLY A CA  1 
ATOM   703  C  C   . GLY A 1 91  ? 15.085  2.530   28.381  1.00 70.14  ? 140 GLY A C   1 
ATOM   704  O  O   . GLY A 1 91  ? 14.849  2.150   29.527  1.00 68.75  ? 140 GLY A O   1 
ATOM   705  N  N   . ASP B 2 3   ? 24.357  15.158  57.436  1.00 96.00  ? 3   ASP B N   1 
ATOM   706  C  CA  . ASP B 2 3   ? 23.814  16.321  56.746  1.00 96.99  ? 3   ASP B CA  1 
ATOM   707  C  C   . ASP B 2 3   ? 22.627  15.940  55.866  1.00 92.43  ? 3   ASP B C   1 
ATOM   708  O  O   . ASP B 2 3   ? 21.674  15.312  56.329  1.00 90.35  ? 3   ASP B O   1 
ATOM   709  C  CB  . ASP B 2 3   ? 24.902  17.008  55.911  1.00 102.07 ? 3   ASP B CB  1 
ATOM   710  C  CG  . ASP B 2 3   ? 25.624  16.045  54.981  1.00 102.78 ? 3   ASP B CG  1 
ATOM   711  O  OD1 . ASP B 2 3   ? 25.851  14.885  55.381  1.00 103.13 ? 3   ASP B OD1 1 
ATOM   712  O  OD2 . ASP B 2 3   ? 25.955  16.450  53.846  1.00 102.79 ? 3   ASP B OD2 1 
ATOM   713  N  N   . ASP B 2 4   ? 22.691  16.334  54.597  1.00 89.12  ? 4   ASP B N   1 
ATOM   714  C  CA  . ASP B 2 4   ? 21.673  15.978  53.621  1.00 80.41  ? 4   ASP B CA  1 
ATOM   715  C  C   . ASP B 2 4   ? 21.680  14.479  53.354  1.00 80.63  ? 4   ASP B C   1 
ATOM   716  O  O   . ASP B 2 4   ? 20.645  13.889  53.043  1.00 81.71  ? 4   ASP B O   1 
ATOM   717  C  CB  . ASP B 2 4   ? 21.901  16.738  52.312  1.00 76.13  ? 4   ASP B CB  1 
ATOM   718  C  CG  . ASP B 2 4   ? 21.723  18.235  52.466  1.00 74.90  ? 4   ASP B CG  1 
ATOM   719  O  OD1 . ASP B 2 4   ? 22.321  18.986  51.670  1.00 76.93  ? 4   ASP B OD1 1 
ATOM   720  O  OD2 . ASP B 2 4   ? 20.987  18.663  53.380  1.00 73.80  ? 4   ASP B OD2 1 
ATOM   721  N  N   . LYS B 2 5   ? 22.852  13.864  53.479  1.00 77.99  ? 5   LYS B N   1 
ATOM   722  C  CA  . LYS B 2 5   ? 22.989  12.440  53.210  1.00 73.38  ? 5   LYS B CA  1 
ATOM   723  C  C   . LYS B 2 5   ? 22.228  11.601  54.233  1.00 70.91  ? 5   LYS B C   1 
ATOM   724  O  O   . LYS B 2 5   ? 21.777  10.501  53.927  1.00 72.43  ? 5   LYS B O   1 
ATOM   725  C  CB  . LYS B 2 5   ? 24.463  12.030  53.163  1.00 76.53  ? 5   LYS B CB  1 
ATOM   726  C  CG  . LYS B 2 5   ? 24.695  10.660  52.542  1.00 79.76  ? 5   LYS B CG  1 
ATOM   727  C  CD  . LYS B 2 5   ? 26.165  10.396  52.272  1.00 84.87  ? 5   LYS B CD  1 
ATOM   728  C  CE  . LYS B 2 5   ? 26.335  9.235   51.303  1.00 86.83  ? 5   LYS B CE  1 
ATOM   729  N  NZ  . LYS B 2 5   ? 25.662  9.504   49.996  1.00 84.97  ? 5   LYS B NZ  1 
ATOM   730  N  N   . ASP B 2 6   ? 22.082  12.125  55.446  1.00 69.04  ? 6   ASP B N   1 
ATOM   731  C  CA  . ASP B 2 6   ? 21.327  11.432  56.485  1.00 65.31  ? 6   ASP B CA  1 
ATOM   732  C  C   . ASP B 2 6   ? 19.843  11.383  56.141  1.00 57.80  ? 6   ASP B C   1 
ATOM   733  O  O   . ASP B 2 6   ? 19.158  10.408  56.446  1.00 52.67  ? 6   ASP B O   1 
ATOM   734  C  CB  . ASP B 2 6   ? 21.536  12.099  57.845  1.00 75.51  ? 6   ASP B CB  1 
ATOM   735  C  CG  . ASP B 2 6   ? 22.944  11.911  58.374  1.00 92.46  ? 6   ASP B CG  1 
ATOM   736  O  OD1 . ASP B 2 6   ? 23.539  10.840  58.118  1.00 97.64  ? 6   ASP B OD1 1 
ATOM   737  O  OD2 . ASP B 2 6   ? 23.460  12.833  59.043  1.00 99.35  ? 6   ASP B OD2 1 
ATOM   738  N  N   . VAL B 2 7   ? 19.352  12.440  55.503  1.00 55.13  ? 7   VAL B N   1 
ATOM   739  C  CA  . VAL B 2 7   ? 17.969  12.487  55.050  1.00 51.03  ? 7   VAL B CA  1 
ATOM   740  C  C   . VAL B 2 7   ? 17.742  11.447  53.955  1.00 52.29  ? 7   VAL B C   1 
ATOM   741  O  O   . VAL B 2 7   ? 16.720  10.754  53.937  1.00 52.18  ? 7   VAL B O   1 
ATOM   742  C  CB  . VAL B 2 7   ? 17.590  13.895  54.540  1.00 50.14  ? 7   VAL B CB  1 
ATOM   743  C  CG1 . VAL B 2 7   ? 16.299  13.853  53.744  1.00 48.00  ? 7   VAL B CG1 1 
ATOM   744  C  CG2 . VAL B 2 7   ? 17.475  14.872  55.708  1.00 49.39  ? 7   VAL B CG2 1 
ATOM   745  N  N   . LEU B 2 8   ? 18.714  11.332  53.054  1.00 53.06  ? 8   LEU B N   1 
ATOM   746  C  CA  . LEU B 2 8   ? 18.653  10.360  51.969  1.00 52.66  ? 8   LEU B CA  1 
ATOM   747  C  C   . LEU B 2 8   ? 18.545  8.931   52.488  1.00 52.01  ? 8   LEU B C   1 
ATOM   748  O  O   . LEU B 2 8   ? 17.780  8.126   51.959  1.00 52.00  ? 8   LEU B O   1 
ATOM   749  C  CB  . LEU B 2 8   ? 19.881  10.485  51.069  1.00 52.72  ? 8   LEU B CB  1 
ATOM   750  C  CG  . LEU B 2 8   ? 19.997  11.785  50.280  1.00 48.98  ? 8   LEU B CG  1 
ATOM   751  C  CD1 . LEU B 2 8   ? 21.200  11.739  49.345  1.00 48.56  ? 8   LEU B CD1 1 
ATOM   752  C  CD2 . LEU B 2 8   ? 18.722  12.017  49.503  1.00 43.57  ? 8   LEU B CD2 1 
ATOM   753  N  N   . ARG B 2 9   ? 19.316  8.623   53.524  1.00 54.87  ? 9   ARG B N   1 
ATOM   754  C  CA  . ARG B 2 9   ? 19.299  7.292   54.116  1.00 55.50  ? 9   ARG B CA  1 
ATOM   755  C  C   . ARG B 2 9   ? 17.980  7.024   54.830  1.00 53.61  ? 9   ARG B C   1 
ATOM   756  O  O   . ARG B 2 9   ? 17.426  5.928   54.730  1.00 57.09  ? 9   ARG B O   1 
ATOM   757  C  CB  . ARG B 2 9   ? 20.471  7.118   55.082  1.00 54.73  ? 9   ARG B CB  1 
ATOM   758  C  CG  . ARG B 2 9   ? 21.833  7.333   54.438  1.00 62.43  ? 9   ARG B CG  1 
ATOM   759  C  CD  . ARG B 2 9   ? 22.965  7.050   55.415  1.00 70.89  ? 9   ARG B CD  1 
ATOM   760  N  NE  . ARG B 2 9   ? 22.907  5.678   55.911  1.00 77.93  ? 9   ARG B NE  1 
ATOM   761  C  CZ  . ARG B 2 9   ? 23.468  4.639   55.300  1.00 79.53  ? 9   ARG B CZ  1 
ATOM   762  N  NH1 . ARG B 2 9   ? 24.141  4.817   54.170  1.00 82.75  ? 9   ARG B NH1 1 
ATOM   763  N  NH2 . ARG B 2 9   ? 23.358  3.423   55.819  1.00 77.17  ? 9   ARG B NH2 1 
ATOM   764  N  N   . ASP B 2 10  ? 17.481  8.027   55.547  1.00 50.12  ? 10  ASP B N   1 
ATOM   765  C  CA  . ASP B 2 10  ? 16.230  7.894   56.285  1.00 49.50  ? 10  ASP B CA  1 
ATOM   766  C  C   . ASP B 2 10  ? 15.072  7.619   55.337  1.00 47.08  ? 10  ASP B C   1 
ATOM   767  O  O   . ASP B 2 10  ? 14.171  6.842   55.649  1.00 48.72  ? 10  ASP B O   1 
ATOM   768  C  CB  . ASP B 2 10  ? 15.945  9.149   57.111  1.00 54.19  ? 10  ASP B CB  1 
ATOM   769  C  CG  . ASP B 2 10  ? 16.726  9.185   58.407  1.00 58.83  ? 10  ASP B CG  1 
ATOM   770  O  OD1 . ASP B 2 10  ? 17.092  8.103   58.910  1.00 59.46  ? 10  ASP B OD1 1 
ATOM   771  O  OD2 . ASP B 2 10  ? 16.969  10.294  58.929  1.00 65.69  ? 10  ASP B OD2 1 
ATOM   772  N  N   . VAL B 2 11  ? 15.104  8.263   54.178  1.00 45.14  ? 11  VAL B N   1 
ATOM   773  C  CA  . VAL B 2 11  ? 14.091  8.047   53.156  1.00 43.15  ? 11  VAL B CA  1 
ATOM   774  C  C   . VAL B 2 11  ? 14.231  6.660   52.537  1.00 42.86  ? 11  VAL B C   1 
ATOM   775  O  O   . VAL B 2 11  ? 13.246  5.934   52.388  1.00 41.59  ? 11  VAL B O   1 
ATOM   776  C  CB  . VAL B 2 11  ? 14.169  9.124   52.053  1.00 42.57  ? 11  VAL B CB  1 
ATOM   777  C  CG1 . VAL B 2 11  ? 13.354  8.714   50.839  1.00 30.30  ? 11  VAL B CG1 1 
ATOM   778  C  CG2 . VAL B 2 11  ? 13.696  10.470  52.599  1.00 42.20  ? 11  VAL B CG2 1 
ATOM   779  N  N   . TRP B 2 12  ? 15.463  6.294   52.193  1.00 43.64  ? 12  TRP B N   1 
ATOM   780  C  CA  . TRP B 2 12  ? 15.741  5.020   51.535  1.00 43.58  ? 12  TRP B CA  1 
ATOM   781  C  C   . TRP B 2 12  ? 15.345  3.800   52.365  1.00 48.21  ? 12  TRP B C   1 
ATOM   782  O  O   . TRP B 2 12  ? 14.842  2.815   51.820  1.00 49.96  ? 12  TRP B O   1 
ATOM   783  C  CB  . TRP B 2 12  ? 17.220  4.923   51.159  1.00 44.17  ? 12  TRP B CB  1 
ATOM   784  C  CG  . TRP B 2 12  ? 17.585  3.632   50.492  1.00 47.99  ? 12  TRP B CG  1 
ATOM   785  C  CD1 . TRP B 2 12  ? 17.991  2.481   51.104  1.00 53.88  ? 12  TRP B CD1 1 
ATOM   786  C  CD2 . TRP B 2 12  ? 17.575  3.355   49.086  1.00 44.37  ? 12  TRP B CD2 1 
ATOM   787  N  NE1 . TRP B 2 12  ? 18.235  1.506   50.167  1.00 54.07  ? 12  TRP B NE1 1 
ATOM   788  C  CE2 . TRP B 2 12  ? 17.988  2.018   48.920  1.00 49.46  ? 12  TRP B CE2 1 
ATOM   789  C  CE3 . TRP B 2 12  ? 17.257  4.107   47.952  1.00 38.69  ? 12  TRP B CE3 1 
ATOM   790  C  CZ2 . TRP B 2 12  ? 18.091  1.417   47.667  1.00 49.19  ? 12  TRP B CZ2 1 
ATOM   791  C  CZ3 . TRP B 2 12  ? 17.359  3.510   46.708  1.00 42.03  ? 12  TRP B CZ3 1 
ATOM   792  C  CH2 . TRP B 2 12  ? 17.774  2.178   46.575  1.00 48.53  ? 12  TRP B CH2 1 
ATOM   793  N  N   . PHE B 2 13  ? 15.575  3.860   53.674  1.00 47.57  ? 13  PHE B N   1 
ATOM   794  C  CA  . PHE B 2 13  ? 15.325  2.707   54.535  1.00 47.03  ? 13  PHE B CA  1 
ATOM   795  C  C   . PHE B 2 13  ? 13.964  2.727   55.227  1.00 48.51  ? 13  PHE B C   1 
ATOM   796  O  O   . PHE B 2 13  ? 13.746  1.992   56.191  1.00 49.58  ? 13  PHE B O   1 
ATOM   797  C  CB  . PHE B 2 13  ? 16.451  2.544   55.558  1.00 47.61  ? 13  PHE B CB  1 
ATOM   798  C  CG  . PHE B 2 13  ? 17.762  2.147   54.948  1.00 50.69  ? 13  PHE B CG  1 
ATOM   799  C  CD1 . PHE B 2 13  ? 17.934  0.880   54.411  1.00 49.61  ? 13  PHE B CD1 1 
ATOM   800  C  CD2 . PHE B 2 13  ? 18.819  3.039   54.900  1.00 52.51  ? 13  PHE B CD2 1 
ATOM   801  C  CE1 . PHE B 2 13  ? 19.133  0.511   53.841  1.00 49.30  ? 13  PHE B CE1 1 
ATOM   802  C  CE2 . PHE B 2 13  ? 20.025  2.673   54.330  1.00 54.06  ? 13  PHE B CE2 1 
ATOM   803  C  CZ  . PHE B 2 13  ? 20.181  1.406   53.801  1.00 51.86  ? 13  PHE B CZ  1 
ATOM   804  N  N   . GLY B 2 14  ? 13.051  3.553   54.723  1.00 44.86  ? 14  GLY B N   1 
ATOM   805  C  CA  . GLY B 2 14  ? 11.706  3.633   55.266  1.00 41.40  ? 14  GLY B CA  1 
ATOM   806  C  C   . GLY B 2 14  ? 10.981  2.299   55.224  1.00 44.06  ? 14  GLY B C   1 
ATOM   807  O  O   . GLY B 2 14  ? 10.934  1.637   54.183  1.00 44.86  ? 14  GLY B O   1 
ATOM   808  N  N   . ARG B 2 15  ? 10.415  1.905   56.363  1.00 42.61  ? 15  ARG B N   1 
ATOM   809  C  CA  . ARG B 2 15  ? 9.748   0.615   56.488  1.00 37.66  ? 15  ARG B CA  1 
ATOM   810  C  C   . ARG B 2 15  ? 8.313   0.763   56.977  1.00 38.29  ? 15  ARG B C   1 
ATOM   811  O  O   . ARG B 2 15  ? 8.029   1.573   57.852  1.00 44.55  ? 15  ARG B O   1 
ATOM   812  C  CB  . ARG B 2 15  ? 10.525  -0.294  57.442  1.00 39.86  ? 15  ARG B CB  1 
ATOM   813  C  CG  . ARG B 2 15  ? 11.852  -0.789  56.892  1.00 43.44  ? 15  ARG B CG  1 
ATOM   814  C  CD  . ARG B 2 15  ? 11.637  -1.548  55.595  1.00 42.00  ? 15  ARG B CD  1 
ATOM   815  N  NE  . ARG B 2 15  ? 12.825  -2.279  55.161  1.00 46.39  ? 15  ARG B NE  1 
ATOM   816  C  CZ  . ARG B 2 15  ? 13.749  -1.790  54.338  1.00 48.43  ? 15  ARG B CZ  1 
ATOM   817  N  NH1 . ARG B 2 15  ? 13.639  -0.554  53.863  1.00 49.11  ? 15  ARG B NH1 1 
ATOM   818  N  NH2 . ARG B 2 15  ? 14.789  -2.537  53.993  1.00 43.42  ? 15  ARG B NH2 1 
ATOM   819  N  N   . ILE B 2 16  ? 7.409   -0.030  56.415  1.00 40.81  ? 16  ILE B N   1 
ATOM   820  C  CA  . ILE B 2 16  ? 6.019   -0.020  56.852  1.00 43.63  ? 16  ILE B CA  1 
ATOM   821  C  C   . ILE B 2 16  ? 5.617   -1.393  57.363  1.00 46.05  ? 16  ILE B C   1 
ATOM   822  O  O   . ILE B 2 16  ? 5.658   -2.370  56.617  1.00 49.05  ? 16  ILE B O   1 
ATOM   823  C  CB  . ILE B 2 16  ? 5.072   0.396   55.717  1.00 43.29  ? 16  ILE B CB  1 
ATOM   824  C  CG1 . ILE B 2 16  ? 5.388   1.823   55.278  1.00 44.43  ? 16  ILE B CG1 1 
ATOM   825  C  CG2 . ILE B 2 16  ? 3.621   0.286   56.162  1.00 37.66  ? 16  ILE B CG2 1 
ATOM   826  C  CD1 . ILE B 2 16  ? 4.690   2.234   54.022  1.00 44.67  ? 16  ILE B CD1 1 
ATOM   827  N  N   . PRO B 2 17  ? 5.237   -1.473  58.646  1.00 48.59  ? 17  PRO B N   1 
ATOM   828  C  CA  . PRO B 2 17  ? 4.808   -2.756  59.203  1.00 48.39  ? 17  PRO B CA  1 
ATOM   829  C  C   . PRO B 2 17  ? 3.517   -3.181  58.526  1.00 49.58  ? 17  PRO B C   1 
ATOM   830  O  O   . PRO B 2 17  ? 2.540   -2.426  58.526  1.00 52.11  ? 17  PRO B O   1 
ATOM   831  C  CB  . PRO B 2 17  ? 4.574   -2.439  60.684  1.00 49.39  ? 17  PRO B CB  1 
ATOM   832  C  CG  . PRO B 2 17  ? 4.289   -0.975  60.721  1.00 52.53  ? 17  PRO B CG  1 
ATOM   833  C  CD  . PRO B 2 17  ? 5.104   -0.368  59.612  1.00 52.23  ? 17  PRO B CD  1 
ATOM   834  N  N   . THR B 2 18  ? 3.520   -4.371  57.937  1.00 45.01  ? 18  THR B N   1 
ATOM   835  C  CA  . THR B 2 18  ? 2.385   -4.813  57.146  1.00 44.20  ? 18  THR B CA  1 
ATOM   836  C  C   . THR B 2 18  ? 1.913   -6.197  57.562  1.00 40.99  ? 18  THR B C   1 
ATOM   837  O  O   . THR B 2 18  ? 2.718   -7.086  57.834  1.00 39.89  ? 18  THR B O   1 
ATOM   838  C  CB  . THR B 2 18  ? 2.727   -4.805  55.641  1.00 49.20  ? 18  THR B CB  1 
ATOM   839  O  OG1 . THR B 2 18  ? 3.101   -3.479  55.246  1.00 52.14  ? 18  THR B OG1 1 
ATOM   840  C  CG2 . THR B 2 18  ? 1.536   -5.253  54.806  1.00 50.05  ? 18  THR B CG2 1 
ATOM   841  N  N   . CYS B 2 19  ? 0.598   -6.369  57.620  1.00 43.23  ? 19  CYS B N   1 
ATOM   842  C  CA  . CYS B 2 19  ? 0.005   -7.667  57.901  1.00 44.03  ? 19  CYS B CA  1 
ATOM   843  C  C   . CYS B 2 19  ? -0.707  -8.206  56.670  1.00 47.20  ? 19  CYS B C   1 
ATOM   844  O  O   . CYS B 2 19  ? -1.747  -7.683  56.269  1.00 54.30  ? 19  CYS B O   1 
ATOM   845  C  CB  . CYS B 2 19  ? -0.987  -7.554  59.054  1.00 41.07  ? 19  CYS B CB  1 
ATOM   846  S  SG  . CYS B 2 19  ? -1.863  -9.082  59.414  1.00 43.08  ? 19  CYS B SG  1 
ATOM   847  N  N   . PHE B 2 20  ? -0.148  -9.251  56.070  1.00 46.56  ? 20  PHE B N   1 
ATOM   848  C  CA  . PHE B 2 20  ? -0.791  -9.904  54.933  1.00 43.63  ? 20  PHE B CA  1 
ATOM   849  C  C   . PHE B 2 20  ? -1.736  -11.011 55.396  1.00 43.73  ? 20  PHE B C   1 
ATOM   850  O  O   . PHE B 2 20  ? -1.328  -11.944 56.085  1.00 45.05  ? 20  PHE B O   1 
ATOM   851  C  CB  . PHE B 2 20  ? 0.252   -10.473 53.971  1.00 42.41  ? 20  PHE B CB  1 
ATOM   852  C  CG  . PHE B 2 20  ? 1.118   -9.430  53.330  1.00 41.54  ? 20  PHE B CG  1 
ATOM   853  C  CD1 . PHE B 2 20  ? 0.740   -8.839  52.140  1.00 38.36  ? 20  PHE B CD1 1 
ATOM   854  C  CD2 . PHE B 2 20  ? 2.312   -9.046  53.915  1.00 45.03  ? 20  PHE B CD2 1 
ATOM   855  C  CE1 . PHE B 2 20  ? 1.531   -7.886  51.545  1.00 40.31  ? 20  PHE B CE1 1 
ATOM   856  C  CE2 . PHE B 2 20  ? 3.110   -8.090  53.323  1.00 47.59  ? 20  PHE B CE2 1 
ATOM   857  C  CZ  . PHE B 2 20  ? 2.718   -7.510  52.135  1.00 46.22  ? 20  PHE B CZ  1 
ATOM   858  N  N   . THR B 2 21  ? -3.002  -10.896 55.014  1.00 41.46  ? 21  THR B N   1 
ATOM   859  C  CA  . THR B 2 21  ? -4.007  -11.884 55.372  1.00 44.58  ? 21  THR B CA  1 
ATOM   860  C  C   . THR B 2 21  ? -4.660  -12.432 54.110  1.00 51.53  ? 21  THR B C   1 
ATOM   861  O  O   . THR B 2 21  ? -5.124  -11.667 53.259  1.00 53.69  ? 21  THR B O   1 
ATOM   862  C  CB  . THR B 2 21  ? -5.080  -11.269 56.291  1.00 45.33  ? 21  THR B CB  1 
ATOM   863  O  OG1 . THR B 2 21  ? -4.514  -11.026 57.585  1.00 49.43  ? 21  THR B OG1 1 
ATOM   864  C  CG2 . THR B 2 21  ? -6.277  -12.194 56.431  1.00 38.65  ? 21  THR B CG2 1 
ATOM   865  N  N   . LEU B 2 22  ? -4.686  -13.757 53.983  1.00 47.99  ? 22  LEU B N   1 
ATOM   866  C  CA  . LEU B 2 22  ? -5.279  -14.395 52.816  1.00 44.58  ? 22  LEU B CA  1 
ATOM   867  C  C   . LEU B 2 22  ? -6.786  -14.196 52.793  1.00 47.41  ? 22  LEU B C   1 
ATOM   868  O  O   . LEU B 2 22  ? -7.462  -14.387 53.804  1.00 46.86  ? 22  LEU B O   1 
ATOM   869  C  CB  . LEU B 2 22  ? -4.958  -15.884 52.795  1.00 47.81  ? 22  LEU B CB  1 
ATOM   870  C  CG  . LEU B 2 22  ? -5.374  -16.619 51.521  1.00 49.82  ? 22  LEU B CG  1 
ATOM   871  C  CD1 . LEU B 2 22  ? -4.757  -15.961 50.298  1.00 49.67  ? 22  LEU B CD1 1 
ATOM   872  C  CD2 . LEU B 2 22  ? -4.948  -18.057 51.607  1.00 51.56  ? 22  LEU B CD2 1 
ATOM   873  N  N   . TYR B 2 23  ? -7.300  -13.808 51.629  1.00 51.01  ? 23  TYR B N   1 
ATOM   874  C  CA  . TYR B 2 23  ? -8.723  -13.547 51.451  1.00 55.82  ? 23  TYR B CA  1 
ATOM   875  C  C   . TYR B 2 23  ? -9.563  -14.731 51.913  1.00 60.53  ? 23  TYR B C   1 
ATOM   876  O  O   . TYR B 2 23  ? -9.183  -15.888 51.718  1.00 59.41  ? 23  TYR B O   1 
ATOM   877  C  CB  . TYR B 2 23  ? -9.025  -13.208 49.989  1.00 58.22  ? 23  TYR B CB  1 
ATOM   878  C  CG  . TYR B 2 23  ? -10.461 -12.812 49.733  1.00 59.26  ? 23  TYR B CG  1 
ATOM   879  C  CD1 . TYR B 2 23  ? -11.037 -11.748 50.415  1.00 60.54  ? 23  TYR B CD1 1 
ATOM   880  C  CD2 . TYR B 2 23  ? -11.236 -13.490 48.800  1.00 58.80  ? 23  TYR B CD2 1 
ATOM   881  C  CE1 . TYR B 2 23  ? -12.347 -11.377 50.184  1.00 61.46  ? 23  TYR B CE1 1 
ATOM   882  C  CE2 . TYR B 2 23  ? -12.548 -13.126 48.561  1.00 59.20  ? 23  TYR B CE2 1 
ATOM   883  C  CZ  . TYR B 2 23  ? -13.097 -12.068 49.256  1.00 62.46  ? 23  TYR B CZ  1 
ATOM   884  O  OH  . TYR B 2 23  ? -14.402 -11.697 49.024  1.00 65.90  ? 23  TYR B OH  1 
ATOM   885  N  N   . GLN B 2 24  ? -10.699 -14.429 52.534  1.00 68.05  ? 24  GLN B N   1 
ATOM   886  C  CA  . GLN B 2 24  ? -11.528 -15.444 53.183  1.00 71.41  ? 24  GLN B CA  1 
ATOM   887  C  C   . GLN B 2 24  ? -11.997 -16.537 52.234  1.00 68.03  ? 24  GLN B C   1 
ATOM   888  O  O   . GLN B 2 24  ? -12.088 -17.700 52.616  1.00 69.87  ? 24  GLN B O   1 
ATOM   889  C  CB  . GLN B 2 24  ? -12.747 -14.797 53.844  1.00 76.46  ? 24  GLN B CB  1 
ATOM   890  C  CG  . GLN B 2 24  ? -12.420 -13.903 55.023  1.00 85.51  ? 24  GLN B CG  1 
ATOM   891  C  CD  . GLN B 2 24  ? -13.664 -13.309 55.652  1.00 93.75  ? 24  GLN B CD  1 
ATOM   892  O  OE1 . GLN B 2 24  ? -14.668 -13.084 54.974  1.00 96.08  ? 24  GLN B OE1 1 
ATOM   893  N  NE2 . GLN B 2 24  ? -13.609 -13.061 56.958  1.00 94.86  ? 24  GLN B NE2 1 
ATOM   894  N  N   . ASP B 2 25  ? -12.291 -16.159 50.996  1.00 64.51  ? 25  ASP B N   1 
ATOM   895  C  CA  . ASP B 2 25  ? -12.910 -17.084 50.058  1.00 62.95  ? 25  ASP B CA  1 
ATOM   896  C  C   . ASP B 2 25  ? -11.921 -17.750 49.102  1.00 54.22  ? 25  ASP B C   1 
ATOM   897  O  O   . ASP B 2 25  ? -12.322 -18.363 48.116  1.00 52.93  ? 25  ASP B O   1 
ATOM   898  C  CB  . ASP B 2 25  ? -14.045 -16.397 49.292  1.00 70.58  ? 25  ASP B CB  1 
ATOM   899  C  CG  . ASP B 2 25  ? -15.145 -15.891 50.215  1.00 79.60  ? 25  ASP B CG  1 
ATOM   900  O  OD1 . ASP B 2 25  ? -15.165 -16.295 51.399  1.00 78.53  ? 25  ASP B OD1 1 
ATOM   901  O  OD2 . ASP B 2 25  ? -15.994 -15.097 49.757  1.00 83.73  ? 25  ASP B OD2 1 
ATOM   902  N  N   . GLU B 2 26  ? -10.629 -17.632 49.390  1.00 50.12  ? 26  GLU B N   1 
ATOM   903  C  CA  . GLU B 2 26  ? -9.651  -18.444 48.685  1.00 52.81  ? 26  GLU B CA  1 
ATOM   904  C  C   . GLU B 2 26  ? -9.770  -19.854 49.239  1.00 56.71  ? 26  GLU B C   1 
ATOM   905  O  O   . GLU B 2 26  ? -10.067 -20.039 50.415  1.00 59.41  ? 26  GLU B O   1 
ATOM   906  C  CB  . GLU B 2 26  ? -8.227  -17.911 48.870  1.00 53.34  ? 26  GLU B CB  1 
ATOM   907  C  CG  . GLU B 2 26  ? -7.950  -16.561 48.211  1.00 58.93  ? 26  GLU B CG  1 
ATOM   908  C  CD  . GLU B 2 26  ? -7.934  -16.618 46.688  1.00 65.88  ? 26  GLU B CD  1 
ATOM   909  O  OE1 . GLU B 2 26  ? -7.904  -17.732 46.118  1.00 68.76  ? 26  GLU B OE1 1 
ATOM   910  O  OE2 . GLU B 2 26  ? -7.950  -15.537 46.057  1.00 66.84  ? 26  GLU B OE2 1 
ATOM   911  N  N   . ILE B 2 27  ? -9.555  -20.849 48.392  1.00 61.30  ? 27  ILE B N   1 
ATOM   912  C  CA  . ILE B 2 27  ? -9.695  -22.229 48.824  1.00 65.52  ? 27  ILE B CA  1 
ATOM   913  C  C   . ILE B 2 27  ? -8.357  -22.758 49.315  1.00 61.65  ? 27  ILE B C   1 
ATOM   914  O  O   . ILE B 2 27  ? -7.387  -22.809 48.559  1.00 63.79  ? 27  ILE B O   1 
ATOM   915  C  CB  . ILE B 2 27  ? -10.206 -23.108 47.681  1.00 77.28  ? 27  ILE B CB  1 
ATOM   916  C  CG1 . ILE B 2 27  ? -11.111 -22.288 46.755  1.00 81.94  ? 27  ILE B CG1 1 
ATOM   917  C  CG2 . ILE B 2 27  ? -10.927 -24.327 48.238  1.00 78.03  ? 27  ILE B CG2 1 
ATOM   918  C  CD1 . ILE B 2 27  ? -11.521 -23.013 45.495  1.00 84.43  ? 27  ILE B CD1 1 
ATOM   919  N  N   . THR B 2 28  ? -8.306  -23.150 50.584  1.00 57.38  ? 28  THR B N   1 
ATOM   920  C  CA  . THR B 2 28  ? -7.053  -23.592 51.188  1.00 60.29  ? 28  THR B CA  1 
ATOM   921  C  C   . THR B 2 28  ? -7.076  -25.025 51.722  1.00 65.67  ? 28  THR B C   1 
ATOM   922  O  O   . THR B 2 28  ? -8.108  -25.520 52.184  1.00 63.86  ? 28  THR B O   1 
ATOM   923  C  CB  . THR B 2 28  ? -6.633  -22.661 52.331  1.00 61.29  ? 28  THR B CB  1 
ATOM   924  O  OG1 . THR B 2 28  ? -7.703  -22.555 53.280  1.00 62.23  ? 28  THR B OG1 1 
ATOM   925  C  CG2 . THR B 2 28  ? -6.302  -21.287 51.791  1.00 61.94  ? 28  THR B CG2 1 
ATOM   926  N  N   . GLU B 2 29  ? -5.920  -25.678 51.661  1.00 66.82  ? 29  GLU B N   1 
ATOM   927  C  CA  . GLU B 2 29  ? -5.760  -27.018 52.206  1.00 67.36  ? 29  GLU B CA  1 
ATOM   928  C  C   . GLU B 2 29  ? -5.802  -26.982 53.725  1.00 68.15  ? 29  GLU B C   1 
ATOM   929  O  O   . GLU B 2 29  ? -6.258  -27.926 54.366  1.00 72.06  ? 29  GLU B O   1 
ATOM   930  C  CB  . GLU B 2 29  ? -4.443  -27.628 51.736  1.00 65.28  ? 29  GLU B CB  1 
ATOM   931  C  CG  . GLU B 2 29  ? -4.372  -27.839 50.238  1.00 66.57  ? 29  GLU B CG  1 
ATOM   932  C  CD  . GLU B 2 29  ? -3.022  -28.343 49.788  1.00 67.34  ? 29  GLU B CD  1 
ATOM   933  O  OE1 . GLU B 2 29  ? -1.999  -27.822 50.279  1.00 68.20  ? 29  GLU B OE1 1 
ATOM   934  O  OE2 . GLU B 2 29  ? -2.985  -29.265 48.946  1.00 70.03  ? 29  GLU B OE2 1 
ATOM   935  N  N   . ARG B 2 30  ? -5.318  -25.886 54.297  1.00 65.77  ? 30  ARG B N   1 
ATOM   936  C  CA  . ARG B 2 30  ? -5.355  -25.697 55.742  1.00 65.41  ? 30  ARG B CA  1 
ATOM   937  C  C   . ARG B 2 30  ? -5.468  -24.218 56.062  1.00 64.15  ? 30  ARG B C   1 
ATOM   938  O  O   . ARG B 2 30  ? -5.436  -23.382 55.163  1.00 65.33  ? 30  ARG B O   1 
ATOM   939  C  CB  . ARG B 2 30  ? -4.108  -26.286 56.400  1.00 60.69  ? 30  ARG B CB  1 
ATOM   940  C  CG  . ARG B 2 30  ? -2.806  -25.728 55.869  1.00 55.32  ? 30  ARG B CG  1 
ATOM   941  C  CD  . ARG B 2 30  ? -1.618  -26.431 56.495  1.00 56.82  ? 30  ARG B CD  1 
ATOM   942  N  NE  . ARG B 2 30  ? -0.370  -26.050 55.847  1.00 61.59  ? 30  ARG B NE  1 
ATOM   943  C  CZ  . ARG B 2 30  ? 0.345   -24.979 56.174  1.00 64.09  ? 30  ARG B CZ  1 
ATOM   944  N  NH1 . ARG B 2 30  ? -0.067  -24.176 57.146  1.00 65.63  ? 30  ARG B NH1 1 
ATOM   945  N  NH2 . ARG B 2 30  ? 1.469   -24.708 55.525  1.00 64.20  ? 30  ARG B NH2 1 
ATOM   946  N  N   . GLU B 2 31  ? -5.605  -23.896 57.343  1.00 64.82  ? 31  GLU B N   1 
ATOM   947  C  CA  . GLU B 2 31  ? -5.711  -22.505 57.757  1.00 66.54  ? 31  GLU B CA  1 
ATOM   948  C  C   . GLU B 2 31  ? -4.428  -21.756 57.432  1.00 64.40  ? 31  GLU B C   1 
ATOM   949  O  O   . GLU B 2 31  ? -3.326  -22.235 57.703  1.00 63.72  ? 31  GLU B O   1 
ATOM   950  C  CB  . GLU B 2 31  ? -6.022  -22.397 59.249  1.00 75.53  ? 31  GLU B CB  1 
ATOM   951  C  CG  . GLU B 2 31  ? -6.172  -20.966 59.737  1.00 82.72  ? 31  GLU B CG  1 
ATOM   952  C  CD  . GLU B 2 31  ? -6.466  -20.883 61.219  1.00 93.19  ? 31  GLU B CD  1 
ATOM   953  O  OE1 . GLU B 2 31  ? -6.654  -21.946 61.851  1.00 96.11  ? 31  GLU B OE1 1 
ATOM   954  O  OE2 . GLU B 2 31  ? -6.510  -19.754 61.753  1.00 98.14  ? 31  GLU B OE2 1 
ATOM   955  N  N   . ALA B 2 32  ? -4.581  -20.582 56.834  1.00 65.13  ? 32  ALA B N   1 
ATOM   956  C  CA  . ALA B 2 32  ? -3.436  -19.776 56.452  1.00 63.84  ? 32  ALA B CA  1 
ATOM   957  C  C   . ALA B 2 32  ? -3.120  -18.764 57.540  1.00 60.16  ? 32  ALA B C   1 
ATOM   958  O  O   . ALA B 2 32  ? -3.981  -17.980 57.945  1.00 61.89  ? 32  ALA B O   1 
ATOM   959  C  CB  . ALA B 2 32  ? -3.702  -19.077 55.128  1.00 65.63  ? 32  ALA B CB  1 
ATOM   960  N  N   . GLU B 2 33  ? -1.884  -18.793 58.021  1.00 57.79  ? 33  GLU B N   1 
ATOM   961  C  CA  . GLU B 2 33  ? -1.438  -17.823 59.011  1.00 61.88  ? 33  GLU B CA  1 
ATOM   962  C  C   . GLU B 2 33  ? -1.088  -16.507 58.326  1.00 58.97  ? 33  GLU B C   1 
ATOM   963  O  O   . GLU B 2 33  ? -0.501  -16.500 57.241  1.00 54.56  ? 33  GLU B O   1 
ATOM   964  C  CB  . GLU B 2 33  ? -0.232  -18.358 59.790  1.00 66.38  ? 33  GLU B CB  1 
ATOM   965  C  CG  . GLU B 2 33  ? -0.530  -19.606 60.610  1.00 74.82  ? 33  GLU B CG  1 
ATOM   966  C  CD  . GLU B 2 33  ? 0.552   -20.666 60.485  1.00 83.64  ? 33  GLU B CD  1 
ATOM   967  O  OE1 . GLU B 2 33  ? 1.423   -20.531 59.599  1.00 82.99  ? 33  GLU B OE1 1 
ATOM   968  O  OE2 . GLU B 2 33  ? 0.529   -21.640 61.270  1.00 89.80  ? 33  GLU B OE2 1 
ATOM   969  N  N   . PRO B 2 34  ? -1.460  -15.385 58.954  1.00 57.13  ? 34  PRO B N   1 
ATOM   970  C  CA  . PRO B 2 34  ? -1.105  -14.069 58.420  1.00 51.30  ? 34  PRO B CA  1 
ATOM   971  C  C   . PRO B 2 34  ? 0.404   -13.870 58.452  1.00 53.55  ? 34  PRO B C   1 
ATOM   972  O  O   . PRO B 2 34  ? 1.064   -14.297 59.401  1.00 51.91  ? 34  PRO B O   1 
ATOM   973  C  CB  . PRO B 2 34  ? -1.787  -13.104 59.388  1.00 47.39  ? 34  PRO B CB  1 
ATOM   974  C  CG  . PRO B 2 34  ? -1.939  -13.877 60.647  1.00 51.96  ? 34  PRO B CG  1 
ATOM   975  C  CD  . PRO B 2 34  ? -2.202  -15.285 60.221  1.00 54.47  ? 34  PRO B CD  1 
ATOM   976  N  N   . TYR B 2 35  ? 0.940   -13.235 57.416  1.00 50.98  ? 35  TYR B N   1 
ATOM   977  C  CA  . TYR B 2 35  ? 2.371   -13.012 57.314  1.00 47.94  ? 35  TYR B CA  1 
ATOM   978  C  C   . TYR B 2 35  ? 2.684   -11.550 57.624  1.00 47.83  ? 35  TYR B C   1 
ATOM   979  O  O   . TYR B 2 35  ? 2.134   -10.647 56.998  1.00 49.71  ? 35  TYR B O   1 
ATOM   980  C  CB  . TYR B 2 35  ? 2.852   -13.382 55.908  1.00 46.90  ? 35  TYR B CB  1 
ATOM   981  C  CG  . TYR B 2 35  ? 4.348   -13.566 55.781  1.00 50.98  ? 35  TYR B CG  1 
ATOM   982  C  CD1 . TYR B 2 35  ? 5.192   -12.473 55.629  1.00 52.18  ? 35  TYR B CD1 1 
ATOM   983  C  CD2 . TYR B 2 35  ? 4.917   -14.836 55.798  1.00 53.59  ? 35  TYR B CD2 1 
ATOM   984  C  CE1 . TYR B 2 35  ? 6.564   -12.635 55.509  1.00 53.63  ? 35  TYR B CE1 1 
ATOM   985  C  CE2 . TYR B 2 35  ? 6.291   -15.010 55.675  1.00 54.50  ? 35  TYR B CE2 1 
ATOM   986  C  CZ  . TYR B 2 35  ? 7.108   -13.904 55.531  1.00 53.50  ? 35  TYR B CZ  1 
ATOM   987  O  OH  . TYR B 2 35  ? 8.472   -14.063 55.410  1.00 52.59  ? 35  TYR B OH  1 
ATOM   988  N  N   . TYR B 2 36  ? 3.558   -11.319 58.600  1.00 50.36  ? 36  TYR B N   1 
ATOM   989  C  CA  . TYR B 2 36  ? 3.957   -9.958  58.961  1.00 46.87  ? 36  TYR B CA  1 
ATOM   990  C  C   . TYR B 2 36  ? 5.278   -9.582  58.310  1.00 44.54  ? 36  TYR B C   1 
ATOM   991  O  O   . TYR B 2 36  ? 6.209   -10.384 58.257  1.00 43.18  ? 36  TYR B O   1 
ATOM   992  C  CB  . TYR B 2 36  ? 4.043   -9.794  60.479  1.00 43.79  ? 36  TYR B CB  1 
ATOM   993  C  CG  . TYR B 2 36  ? 2.693   -9.779  61.156  1.00 43.34  ? 36  TYR B CG  1 
ATOM   994  C  CD1 . TYR B 2 36  ? 2.141   -10.942 61.676  1.00 46.49  ? 36  TYR B CD1 1 
ATOM   995  C  CD2 . TYR B 2 36  ? 1.965   -8.604  61.264  1.00 39.97  ? 36  TYR B CD2 1 
ATOM   996  C  CE1 . TYR B 2 36  ? 0.901   -10.931 62.295  1.00 49.22  ? 36  TYR B CE1 1 
ATOM   997  C  CE2 . TYR B 2 36  ? 0.729   -8.583  61.879  1.00 44.48  ? 36  TYR B CE2 1 
ATOM   998  C  CZ  . TYR B 2 36  ? 0.201   -9.748  62.391  1.00 49.50  ? 36  TYR B CZ  1 
ATOM   999  O  OH  . TYR B 2 36  ? -1.031  -9.729  63.003  1.00 53.84  ? 36  TYR B OH  1 
ATOM   1000 N  N   . LEU B 2 37  ? 5.355   -8.353  57.812  1.00 47.17  ? 37  LEU B N   1 
ATOM   1001 C  CA  . LEU B 2 37  ? 6.517   -7.935  57.042  1.00 46.37  ? 37  LEU B CA  1 
ATOM   1002 C  C   . LEU B 2 37  ? 6.722   -6.427  57.091  1.00 46.89  ? 37  LEU B C   1 
ATOM   1003 O  O   . LEU B 2 37  ? 5.760   -5.655  57.086  1.00 49.87  ? 37  LEU B O   1 
ATOM   1004 C  CB  . LEU B 2 37  ? 6.363   -8.397  55.592  1.00 44.98  ? 37  LEU B CB  1 
ATOM   1005 C  CG  . LEU B 2 37  ? 7.530   -8.164  54.635  1.00 48.56  ? 37  LEU B CG  1 
ATOM   1006 C  CD1 . LEU B 2 37  ? 8.793   -8.847  55.132  1.00 47.56  ? 37  LEU B CD1 1 
ATOM   1007 C  CD2 . LEU B 2 37  ? 7.158   -8.659  53.249  1.00 51.25  ? 37  LEU B CD2 1 
ATOM   1008 N  N   . LEU B 2 38  ? 7.985   -6.016  57.152  1.00 41.74  ? 38  LEU B N   1 
ATOM   1009 C  CA  . LEU B 2 38  ? 8.341   -4.610  57.029  1.00 35.93  ? 38  LEU B CA  1 
ATOM   1010 C  C   . LEU B 2 38  ? 8.580   -4.279  55.558  1.00 40.20  ? 38  LEU B C   1 
ATOM   1011 O  O   . LEU B 2 38  ? 9.596   -4.675  54.983  1.00 39.95  ? 38  LEU B O   1 
ATOM   1012 C  CB  . LEU B 2 38  ? 9.592   -4.302  57.850  1.00 32.11  ? 38  LEU B CB  1 
ATOM   1013 C  CG  . LEU B 2 38  ? 9.447   -4.390  59.369  1.00 33.31  ? 38  LEU B CG  1 
ATOM   1014 C  CD1 . LEU B 2 38  ? 10.786  -4.171  60.055  1.00 29.79  ? 38  LEU B CD1 1 
ATOM   1015 C  CD2 . LEU B 2 38  ? 8.423   -3.382  59.855  1.00 34.95  ? 38  LEU B CD2 1 
ATOM   1016 N  N   . LEU B 2 39  ? 7.639   -3.562  54.949  1.00 39.96  ? 39  LEU B N   1 
ATOM   1017 C  CA  . LEU B 2 39  ? 7.743   -3.199  53.536  1.00 38.25  ? 39  LEU B CA  1 
ATOM   1018 C  C   . LEU B 2 39  ? 8.640   -1.988  53.312  1.00 37.29  ? 39  LEU B C   1 
ATOM   1019 O  O   . LEU B 2 39  ? 8.559   -1.010  54.047  1.00 39.91  ? 39  LEU B O   1 
ATOM   1020 C  CB  . LEU B 2 39  ? 6.358   -2.907  52.954  1.00 32.74  ? 39  LEU B CB  1 
ATOM   1021 C  CG  . LEU B 2 39  ? 5.421   -4.097  52.787  1.00 36.02  ? 39  LEU B CG  1 
ATOM   1022 C  CD1 . LEU B 2 39  ? 4.119   -3.648  52.143  1.00 36.61  ? 39  LEU B CD1 1 
ATOM   1023 C  CD2 . LEU B 2 39  ? 6.092   -5.179  51.953  1.00 35.05  ? 39  LEU B CD2 1 
ATOM   1024 N  N   . PRO B 2 40  ? 9.499   -2.047  52.284  1.00 43.44  ? 40  PRO B N   1 
ATOM   1025 C  CA  . PRO B 2 40  ? 10.287  -0.865  51.921  1.00 46.19  ? 40  PRO B CA  1 
ATOM   1026 C  C   . PRO B 2 40  ? 9.394   0.201   51.297  1.00 43.10  ? 40  PRO B C   1 
ATOM   1027 O  O   . PRO B 2 40  ? 8.727   -0.078  50.302  1.00 46.90  ? 40  PRO B O   1 
ATOM   1028 C  CB  . PRO B 2 40  ? 11.266  -1.404  50.870  1.00 47.15  ? 40  PRO B CB  1 
ATOM   1029 C  CG  . PRO B 2 40  ? 11.250  -2.892  51.037  1.00 46.59  ? 40  PRO B CG  1 
ATOM   1030 C  CD  . PRO B 2 40  ? 9.867   -3.222  51.479  1.00 44.98  ? 40  PRO B CD  1 
ATOM   1031 N  N   . ARG B 2 41  ? 9.378   1.395   51.879  1.00 39.30  ? 41  ARG B N   1 
ATOM   1032 C  CA  . ARG B 2 41  ? 8.592   2.508   51.346  1.00 37.97  ? 41  ARG B CA  1 
ATOM   1033 C  C   . ARG B 2 41  ? 8.900   2.830   49.880  1.00 40.09  ? 41  ARG B C   1 
ATOM   1034 O  O   . ARG B 2 41  ? 7.998   3.142   49.105  1.00 40.19  ? 41  ARG B O   1 
ATOM   1035 C  CB  . ARG B 2 41  ? 8.808   3.765   52.193  1.00 38.92  ? 41  ARG B CB  1 
ATOM   1036 C  CG  . ARG B 2 41  ? 7.873   3.888   53.386  1.00 39.81  ? 41  ARG B CG  1 
ATOM   1037 C  CD  . ARG B 2 41  ? 8.151   5.153   54.183  1.00 39.38  ? 41  ARG B CD  1 
ATOM   1038 N  NE  . ARG B 2 41  ? 7.162   5.358   55.239  1.00 39.30  ? 41  ARG B NE  1 
ATOM   1039 C  CZ  . ARG B 2 41  ? 5.983   5.942   55.048  1.00 40.00  ? 41  ARG B CZ  1 
ATOM   1040 N  NH1 . ARG B 2 41  ? 5.646   6.379   53.839  1.00 39.36  ? 41  ARG B NH1 1 
ATOM   1041 N  NH2 . ARG B 2 41  ? 5.138   6.086   56.062  1.00 36.72  ? 41  ARG B NH2 1 
ATOM   1042 N  N   . VAL B 2 42  ? 10.172  2.748   49.506  1.00 39.57  ? 42  VAL B N   1 
ATOM   1043 C  CA  . VAL B 2 42  ? 10.621  3.232   48.203  1.00 37.82  ? 42  VAL B CA  1 
ATOM   1044 C  C   . VAL B 2 42  ? 10.480  2.224   47.065  1.00 43.17  ? 42  VAL B C   1 
ATOM   1045 O  O   . VAL B 2 42  ? 10.735  2.556   45.905  1.00 44.18  ? 42  VAL B O   1 
ATOM   1046 C  CB  . VAL B 2 42  ? 12.096  3.650   48.261  1.00 35.67  ? 42  VAL B CB  1 
ATOM   1047 C  CG1 . VAL B 2 42  ? 12.279  4.830   49.203  1.00 36.82  ? 42  VAL B CG1 1 
ATOM   1048 C  CG2 . VAL B 2 42  ? 12.957  2.468   48.689  1.00 35.89  ? 42  VAL B CG2 1 
ATOM   1049 N  N   . SER B 2 43  ? 10.087  0.998   47.390  1.00 41.99  ? 43  SER B N   1 
ATOM   1050 C  CA  . SER B 2 43  ? 10.068  -0.074  46.401  1.00 40.70  ? 43  SER B CA  1 
ATOM   1051 C  C   . SER B 2 43  ? 8.639   -0.428  45.986  1.00 41.44  ? 43  SER B C   1 
ATOM   1052 O  O   . SER B 2 43  ? 7.701   0.310   46.292  1.00 42.35  ? 43  SER B O   1 
ATOM   1053 C  CB  . SER B 2 43  ? 10.802  -1.297  46.950  1.00 44.34  ? 43  SER B CB  1 
ATOM   1054 O  OG  . SER B 2 43  ? 11.129  -2.208  45.919  1.00 53.84  ? 43  SER B OG  1 
ATOM   1055 N  N   . TYR B 2 44  ? 8.472   -1.551  45.290  1.00 36.78  ? 44  TYR B N   1 
ATOM   1056 C  CA  . TYR B 2 44  ? 7.156   -1.940  44.783  1.00 34.57  ? 44  TYR B CA  1 
ATOM   1057 C  C   . TYR B 2 44  ? 6.691   -3.255  45.391  1.00 39.67  ? 44  TYR B C   1 
ATOM   1058 O  O   . TYR B 2 44  ? 7.510   -4.119  45.710  1.00 47.25  ? 44  TYR B O   1 
ATOM   1059 C  CB  . TYR B 2 44  ? 7.176   -2.037  43.256  1.00 34.89  ? 44  TYR B CB  1 
ATOM   1060 C  CG  . TYR B 2 44  ? 7.693   -0.781  42.602  1.00 39.48  ? 44  TYR B CG  1 
ATOM   1061 C  CD1 . TYR B 2 44  ? 6.827   0.235   42.228  1.00 41.39  ? 44  TYR B CD1 1 
ATOM   1062 C  CD2 . TYR B 2 44  ? 9.053   -0.600  42.382  1.00 42.88  ? 44  TYR B CD2 1 
ATOM   1063 C  CE1 . TYR B 2 44  ? 7.297   1.391   41.644  1.00 45.06  ? 44  TYR B CE1 1 
ATOM   1064 C  CE2 . TYR B 2 44  ? 9.533   0.552   41.800  1.00 46.01  ? 44  TYR B CE2 1 
ATOM   1065 C  CZ  . TYR B 2 44  ? 8.652   1.546   41.433  1.00 48.71  ? 44  TYR B CZ  1 
ATOM   1066 O  OH  . TYR B 2 44  ? 9.124   2.700   40.850  1.00 54.33  ? 44  TYR B OH  1 
ATOM   1067 N  N   . LEU B 2 45  ? 5.378   -3.399  45.548  1.00 37.66  ? 45  LEU B N   1 
ATOM   1068 C  CA  . LEU B 2 45  ? 4.793   -4.579  46.184  1.00 44.39  ? 45  LEU B CA  1 
ATOM   1069 C  C   . LEU B 2 45  ? 5.232   -5.892  45.541  1.00 50.21  ? 45  LEU B C   1 
ATOM   1070 O  O   . LEU B 2 45  ? 5.689   -6.807  46.226  1.00 54.75  ? 45  LEU B O   1 
ATOM   1071 C  CB  . LEU B 2 45  ? 3.264   -4.487  46.185  1.00 45.63  ? 45  LEU B CB  1 
ATOM   1072 C  CG  . LEU B 2 45  ? 2.629   -3.604  47.262  1.00 49.06  ? 45  LEU B CG  1 
ATOM   1073 C  CD1 . LEU B 2 45  ? 1.144   -3.437  47.004  1.00 49.08  ? 45  LEU B CD1 1 
ATOM   1074 C  CD2 . LEU B 2 45  ? 2.871   -4.182  48.656  1.00 48.65  ? 45  LEU B CD2 1 
ATOM   1075 N  N   . THR B 2 46  ? 5.107   -5.974  44.221  1.00 49.76  ? 46  THR B N   1 
ATOM   1076 C  CA  . THR B 2 46  ? 5.407   -7.207  43.497  1.00 47.86  ? 46  THR B CA  1 
ATOM   1077 C  C   . THR B 2 46  ? 6.900   -7.477  43.352  1.00 49.08  ? 46  THR B C   1 
ATOM   1078 O  O   . THR B 2 46  ? 7.297   -8.447  42.712  1.00 51.23  ? 46  THR B O   1 
ATOM   1079 C  CB  . THR B 2 46  ? 4.787   -7.194  42.098  1.00 43.47  ? 46  THR B CB  1 
ATOM   1080 O  OG1 . THR B 2 46  ? 5.192   -6.001  41.413  1.00 45.86  ? 46  THR B OG1 1 
ATOM   1081 C  CG2 . THR B 2 46  ? 3.270   -7.241  42.192  1.00 36.40  ? 46  THR B CG2 1 
ATOM   1082 N  N   . LEU B 2 47  ? 7.724   -6.622  43.946  1.00 45.38  ? 47  LEU B N   1 
ATOM   1083 C  CA  . LEU B 2 47  ? 9.169   -6.802  43.888  1.00 42.85  ? 47  LEU B CA  1 
ATOM   1084 C  C   . LEU B 2 47  ? 9.716   -7.313  45.220  1.00 44.71  ? 47  LEU B C   1 
ATOM   1085 O  O   . LEU B 2 47  ? 10.799  -7.901  45.272  1.00 50.48  ? 47  LEU B O   1 
ATOM   1086 C  CB  . LEU B 2 47  ? 9.850   -5.483  43.514  1.00 38.85  ? 47  LEU B CB  1 
ATOM   1087 C  CG  . LEU B 2 47  ? 11.373  -5.484  43.389  1.00 36.75  ? 47  LEU B CG  1 
ATOM   1088 C  CD1 . LEU B 2 47  ? 11.802  -6.385  42.246  1.00 39.31  ? 47  LEU B CD1 1 
ATOM   1089 C  CD2 . LEU B 2 47  ? 11.909  -4.076  43.199  1.00 37.39  ? 47  LEU B CD2 1 
ATOM   1090 N  N   . VAL B 2 48  ? 8.963   -7.100  46.295  1.00 36.53  ? 48  VAL B N   1 
ATOM   1091 C  CA  . VAL B 2 48  ? 9.477   -7.378  47.630  1.00 38.29  ? 48  VAL B CA  1 
ATOM   1092 C  C   . VAL B 2 48  ? 8.651   -8.397  48.419  1.00 43.30  ? 48  VAL B C   1 
ATOM   1093 O  O   . VAL B 2 48  ? 8.942   -8.663  49.588  1.00 47.34  ? 48  VAL B O   1 
ATOM   1094 C  CB  . VAL B 2 48  ? 9.593   -6.080  48.465  1.00 37.85  ? 48  VAL B CB  1 
ATOM   1095 C  CG1 . VAL B 2 48  ? 10.438  -5.042  47.732  1.00 31.56  ? 48  VAL B CG1 1 
ATOM   1096 C  CG2 . VAL B 2 48  ? 8.208   -5.524  48.781  1.00 38.98  ? 48  VAL B CG2 1 
ATOM   1097 N  N   . THR B 2 49  ? 7.632   -8.972  47.791  1.00 40.76  ? 49  THR B N   1 
ATOM   1098 C  CA  . THR B 2 49  ? 6.741   -9.887  48.504  1.00 45.13  ? 49  THR B CA  1 
ATOM   1099 C  C   . THR B 2 49  ? 6.865   -11.360 48.096  1.00 47.73  ? 49  THR B C   1 
ATOM   1100 O  O   . THR B 2 49  ? 5.887   -12.104 48.153  1.00 49.06  ? 49  THR B O   1 
ATOM   1101 C  CB  . THR B 2 49  ? 5.265   -9.447  48.389  1.00 45.44  ? 49  THR B CB  1 
ATOM   1102 O  OG1 . THR B 2 49  ? 4.928   -9.246  47.011  1.00 48.38  ? 49  THR B OG1 1 
ATOM   1103 C  CG2 . THR B 2 49  ? 5.032   -8.155  49.155  1.00 41.36  ? 49  THR B CG2 1 
ATOM   1104 N  N   . ASP B 2 50  ? 8.063   -11.784 47.710  1.00 49.93  ? 50  ASP B N   1 
ATOM   1105 C  CA  . ASP B 2 50  ? 8.282   -13.177 47.333  1.00 49.15  ? 50  ASP B CA  1 
ATOM   1106 C  C   . ASP B 2 50  ? 8.033   -14.129 48.496  1.00 50.88  ? 50  ASP B C   1 
ATOM   1107 O  O   . ASP B 2 50  ? 7.423   -15.185 48.318  1.00 51.03  ? 50  ASP B O   1 
ATOM   1108 C  CB  . ASP B 2 50  ? 9.691   -13.384 46.774  1.00 48.90  ? 50  ASP B CB  1 
ATOM   1109 C  CG  . ASP B 2 50  ? 9.852   -12.814 45.383  1.00 55.54  ? 50  ASP B CG  1 
ATOM   1110 O  OD1 . ASP B 2 50  ? 8.825   -12.634 44.692  1.00 56.26  ? 50  ASP B OD1 1 
ATOM   1111 O  OD2 . ASP B 2 50  ? 11.005  -12.550 44.979  1.00 58.64  ? 50  ASP B OD2 1 
ATOM   1112 N  N   . LYS B 2 51  ? 8.507   -13.758 49.683  1.00 50.14  ? 51  LYS B N   1 
ATOM   1113 C  CA  . LYS B 2 51  ? 8.286   -14.579 50.870  1.00 47.51  ? 51  LYS B CA  1 
ATOM   1114 C  C   . LYS B 2 51  ? 6.802   -14.655 51.212  1.00 49.76  ? 51  LYS B C   1 
ATOM   1115 O  O   . LYS B 2 51  ? 6.331   -15.663 51.734  1.00 53.26  ? 51  LYS B O   1 
ATOM   1116 C  CB  . LYS B 2 51  ? 9.088   -14.059 52.065  1.00 44.57  ? 51  LYS B CB  1 
ATOM   1117 C  CG  . LYS B 2 51  ? 10.575  -14.341 51.974  1.00 48.03  ? 51  LYS B CG  1 
ATOM   1118 C  CD  . LYS B 2 51  ? 11.328  -13.762 53.161  1.00 53.95  ? 51  LYS B CD  1 
ATOM   1119 C  CE  . LYS B 2 51  ? 12.835  -13.975 53.021  1.00 57.05  ? 51  LYS B CE  1 
ATOM   1120 N  NZ  . LYS B 2 51  ? 13.617  -13.176 54.012  1.00 56.26  ? 51  LYS B NZ  1 
ATOM   1121 N  N   . VAL B 2 52  ? 6.068   -13.589 50.906  1.00 52.66  ? 52  VAL B N   1 
ATOM   1122 C  CA  . VAL B 2 52  ? 4.626   -13.558 51.135  1.00 51.79  ? 52  VAL B CA  1 
ATOM   1123 C  C   . VAL B 2 52  ? 3.907   -14.471 50.146  1.00 52.75  ? 52  VAL B C   1 
ATOM   1124 O  O   . VAL B 2 52  ? 3.003   -15.221 50.519  1.00 51.20  ? 52  VAL B O   1 
ATOM   1125 C  CB  . VAL B 2 52  ? 4.063   -12.128 51.014  1.00 46.74  ? 52  VAL B CB  1 
ATOM   1126 C  CG1 . VAL B 2 52  ? 2.545   -12.130 51.185  1.00 42.47  ? 52  VAL B CG1 1 
ATOM   1127 C  CG2 . VAL B 2 52  ? 4.721   -11.216 52.034  1.00 42.20  ? 52  VAL B CG2 1 
ATOM   1128 N  N   . LYS B 2 53  ? 4.319   -14.403 48.884  1.00 51.51  ? 53  LYS B N   1 
ATOM   1129 C  CA  . LYS B 2 53  ? 3.758   -15.262 47.848  1.00 52.62  ? 53  LYS B CA  1 
ATOM   1130 C  C   . LYS B 2 53  ? 4.041   -16.739 48.136  1.00 55.78  ? 53  LYS B C   1 
ATOM   1131 O  O   . LYS B 2 53  ? 3.152   -17.584 48.015  1.00 56.35  ? 53  LYS B O   1 
ATOM   1132 C  CB  . LYS B 2 53  ? 4.295   -14.869 46.468  1.00 49.18  ? 53  LYS B CB  1 
ATOM   1133 C  CG  . LYS B 2 53  ? 3.793   -15.759 45.346  1.00 52.69  ? 53  LYS B CG  1 
ATOM   1134 C  CD  . LYS B 2 53  ? 3.908   -15.084 43.987  1.00 56.42  ? 53  LYS B CD  1 
ATOM   1135 C  CE  . LYS B 2 53  ? 5.354   -14.911 43.557  1.00 58.83  ? 53  LYS B CE  1 
ATOM   1136 N  NZ  . LYS B 2 53  ? 5.436   -14.200 42.249  1.00 58.74  ? 53  LYS B NZ  1 
ATOM   1137 N  N   . LYS B 2 54  ? 5.274   -17.046 48.525  1.00 50.23  ? 54  LYS B N   1 
ATOM   1138 C  CA  . LYS B 2 54  ? 5.646   -18.422 48.822  1.00 46.36  ? 54  LYS B CA  1 
ATOM   1139 C  C   . LYS B 2 54  ? 4.859   -18.955 50.016  1.00 52.26  ? 54  LYS B C   1 
ATOM   1140 O  O   . LYS B 2 54  ? 4.468   -20.124 50.040  1.00 54.74  ? 54  LYS B O   1 
ATOM   1141 C  CB  . LYS B 2 54  ? 7.147   -18.537 49.088  1.00 47.37  ? 54  LYS B CB  1 
ATOM   1142 C  CG  . LYS B 2 54  ? 7.631   -19.973 49.218  1.00 59.53  ? 54  LYS B CG  1 
ATOM   1143 C  CD  . LYS B 2 54  ? 9.087   -20.039 49.652  1.00 65.22  ? 54  LYS B CD  1 
ATOM   1144 C  CE  . LYS B 2 54  ? 9.511   -21.468 49.955  1.00 66.56  ? 54  LYS B CE  1 
ATOM   1145 N  NZ  . LYS B 2 54  ? 10.903  -21.529 50.485  1.00 70.13  ? 54  LYS B NZ  1 
ATOM   1146 N  N   . HIS B 2 55  ? 4.621   -18.086 50.995  1.00 48.01  ? 55  HIS B N   1 
ATOM   1147 C  CA  . HIS B 2 55  ? 3.941   -18.469 52.228  1.00 44.66  ? 55  HIS B CA  1 
ATOM   1148 C  C   . HIS B 2 55  ? 2.523   -18.970 51.977  1.00 48.66  ? 55  HIS B C   1 
ATOM   1149 O  O   . HIS B 2 55  ? 2.163   -20.069 52.398  1.00 56.76  ? 55  HIS B O   1 
ATOM   1150 C  CB  . HIS B 2 55  ? 3.927   -17.293 53.205  1.00 44.16  ? 55  HIS B CB  1 
ATOM   1151 C  CG  . HIS B 2 55  ? 3.107   -17.529 54.437  1.00 44.08  ? 55  HIS B CG  1 
ATOM   1152 N  ND1 . HIS B 2 55  ? 3.571   -18.252 55.515  1.00 45.19  ? 55  HIS B ND1 1 
ATOM   1153 C  CD2 . HIS B 2 55  ? 1.859   -17.118 54.768  1.00 39.80  ? 55  HIS B CD2 1 
ATOM   1154 C  CE1 . HIS B 2 55  ? 2.642   -18.283 56.455  1.00 44.29  ? 55  HIS B CE1 1 
ATOM   1155 N  NE2 . HIS B 2 55  ? 1.594   -17.601 56.027  1.00 42.61  ? 55  HIS B NE2 1 
ATOM   1156 N  N   . PHE B 2 56  ? 1.721   -18.170 51.285  1.00 47.18  ? 56  PHE B N   1 
ATOM   1157 C  CA  . PHE B 2 56  ? 0.334   -18.544 51.030  1.00 46.84  ? 56  PHE B CA  1 
ATOM   1158 C  C   . PHE B 2 56  ? 0.187   -19.618 49.957  1.00 49.24  ? 56  PHE B C   1 
ATOM   1159 O  O   . PHE B 2 56  ? -0.841  -20.285 49.885  1.00 53.79  ? 56  PHE B O   1 
ATOM   1160 C  CB  . PHE B 2 56  ? -0.507  -17.319 50.676  1.00 43.48  ? 56  PHE B CB  1 
ATOM   1161 C  CG  . PHE B 2 56  ? -0.656  -16.351 51.806  1.00 46.75  ? 56  PHE B CG  1 
ATOM   1162 C  CD1 . PHE B 2 56  ? -1.506  -16.632 52.864  1.00 47.04  ? 56  PHE B CD1 1 
ATOM   1163 C  CD2 . PHE B 2 56  ? 0.057   -15.164 51.819  1.00 44.91  ? 56  PHE B CD2 1 
ATOM   1164 C  CE1 . PHE B 2 56  ? -1.644  -15.746 53.914  1.00 44.31  ? 56  PHE B CE1 1 
ATOM   1165 C  CE2 . PHE B 2 56  ? -0.077  -14.272 52.868  1.00 45.32  ? 56  PHE B CE2 1 
ATOM   1166 C  CZ  . PHE B 2 56  ? -0.931  -14.564 53.916  1.00 43.74  ? 56  PHE B CZ  1 
ATOM   1167 N  N   . GLN B 2 57  ? 1.208   -19.789 49.125  1.00 48.59  ? 57  GLN B N   1 
ATOM   1168 C  CA  . GLN B 2 57  ? 1.149   -20.815 48.090  1.00 50.95  ? 57  GLN B CA  1 
ATOM   1169 C  C   . GLN B 2 57  ? 1.294   -22.215 48.677  1.00 53.38  ? 57  GLN B C   1 
ATOM   1170 O  O   . GLN B 2 57  ? 0.836   -23.192 48.086  1.00 55.77  ? 57  GLN B O   1 
ATOM   1171 C  CB  . GLN B 2 57  ? 2.195   -20.566 47.005  1.00 51.05  ? 57  GLN B CB  1 
ATOM   1172 C  CG  . GLN B 2 57  ? 1.772   -19.519 45.990  1.00 56.04  ? 57  GLN B CG  1 
ATOM   1173 C  CD  . GLN B 2 57  ? 2.793   -19.330 44.890  1.00 64.46  ? 57  GLN B CD  1 
ATOM   1174 O  OE1 . GLN B 2 57  ? 3.825   -20.003 44.862  1.00 70.02  ? 57  GLN B OE1 1 
ATOM   1175 N  NE2 . GLN B 2 57  ? 2.512   -18.411 43.972  1.00 64.85  ? 57  GLN B NE2 1 
ATOM   1176 N  N   . LYS B 2 58  ? 1.922   -22.303 49.846  1.00 52.38  ? 58  LYS B N   1 
ATOM   1177 C  CA  . LYS B 2 58  ? 2.045   -23.568 50.557  1.00 52.62  ? 58  LYS B CA  1 
ATOM   1178 C  C   . LYS B 2 58  ? 0.683   -24.151 50.917  1.00 57.90  ? 58  LYS B C   1 
ATOM   1179 O  O   . LYS B 2 58  ? 0.512   -25.367 50.933  1.00 70.16  ? 58  LYS B O   1 
ATOM   1180 C  CB  . LYS B 2 58  ? 2.858   -23.395 51.838  1.00 53.35  ? 58  LYS B CB  1 
ATOM   1181 C  CG  . LYS B 2 58  ? 4.324   -23.100 51.633  1.00 58.28  ? 58  LYS B CG  1 
ATOM   1182 C  CD  . LYS B 2 58  ? 5.009   -22.920 52.977  1.00 65.58  ? 58  LYS B CD  1 
ATOM   1183 C  CE  . LYS B 2 58  ? 6.423   -22.395 52.813  1.00 74.75  ? 58  LYS B CE  1 
ATOM   1184 N  NZ  . LYS B 2 58  ? 7.300   -23.372 52.107  1.00 80.96  ? 58  LYS B NZ  1 
ATOM   1185 N  N   . VAL B 2 59  ? -0.284  -23.289 51.217  1.00 54.56  ? 59  VAL B N   1 
ATOM   1186 C  CA  . VAL B 2 59  ? -1.590  -23.760 51.671  1.00 54.51  ? 59  VAL B CA  1 
ATOM   1187 C  C   . VAL B 2 59  ? -2.613  -23.805 50.545  1.00 54.43  ? 59  VAL B C   1 
ATOM   1188 O  O   . VAL B 2 59  ? -3.813  -23.900 50.791  1.00 59.04  ? 59  VAL B O   1 
ATOM   1189 C  CB  . VAL B 2 59  ? -2.144  -22.912 52.839  1.00 54.61  ? 59  VAL B CB  1 
ATOM   1190 C  CG1 . VAL B 2 59  ? -1.163  -22.903 53.995  1.00 54.92  ? 59  VAL B CG1 1 
ATOM   1191 C  CG2 . VAL B 2 59  ? -2.445  -21.492 52.384  1.00 58.47  ? 59  VAL B CG2 1 
ATOM   1192 N  N   . MET B 2 60  ? -2.137  -23.746 49.309  1.00 57.90  ? 60  MET B N   1 
ATOM   1193 C  CA  . MET B 2 60  ? -3.033  -23.798 48.160  1.00 57.78  ? 60  MET B CA  1 
ATOM   1194 C  C   . MET B 2 60  ? -2.631  -24.875 47.162  1.00 61.33  ? 60  MET B C   1 
ATOM   1195 O  O   . MET B 2 60  ? -1.443  -25.116 46.937  1.00 63.48  ? 60  MET B O   1 
ATOM   1196 C  CB  . MET B 2 60  ? -3.089  -22.438 47.466  1.00 52.80  ? 60  MET B CB  1 
ATOM   1197 C  CG  . MET B 2 60  ? -3.574  -21.325 48.365  1.00 51.06  ? 60  MET B CG  1 
ATOM   1198 S  SD  . MET B 2 60  ? -4.149  -19.909 47.436  1.00 74.06  ? 60  MET B SD  1 
ATOM   1199 C  CE  . MET B 2 60  ? -5.506  -20.645 46.528  1.00 87.13  ? 60  MET B CE  1 
ATOM   1200 N  N   . ARG B 2 61  ? -3.629  -25.525 46.571  1.00 61.55  ? 61  ARG B N   1 
ATOM   1201 C  CA  . ARG B 2 61  ? -3.384  -26.479 45.499  1.00 65.88  ? 61  ARG B CA  1 
ATOM   1202 C  C   . ARG B 2 61  ? -2.787  -25.757 44.300  1.00 68.23  ? 61  ARG B C   1 
ATOM   1203 O  O   . ARG B 2 61  ? -3.059  -24.580 44.082  1.00 67.61  ? 61  ARG B O   1 
ATOM   1204 C  CB  . ARG B 2 61  ? -4.681  -27.172 45.082  1.00 68.57  ? 61  ARG B CB  1 
ATOM   1205 C  CG  . ARG B 2 61  ? -5.335  -27.994 46.172  1.00 70.60  ? 61  ARG B CG  1 
ATOM   1206 C  CD  . ARG B 2 61  ? -6.373  -28.922 45.575  1.00 74.57  ? 61  ARG B CD  1 
ATOM   1207 N  NE  . ARG B 2 61  ? -5.795  -29.751 44.523  1.00 79.15  ? 61  ARG B NE  1 
ATOM   1208 C  CZ  . ARG B 2 61  ? -5.270  -30.956 44.723  1.00 83.64  ? 61  ARG B CZ  1 
ATOM   1209 N  NH1 . ARG B 2 61  ? -5.254  -31.481 45.941  1.00 83.34  ? 61  ARG B NH1 1 
ATOM   1210 N  NH2 . ARG B 2 61  ? -4.764  -31.638 43.705  1.00 86.70  ? 61  ARG B NH2 1 
ATOM   1211 N  N   . GLN B 2 62  ? -1.974  -26.468 43.527  1.00 74.92  ? 62  GLN B N   1 
ATOM   1212 C  CA  . GLN B 2 62  ? -1.340  -25.899 42.343  1.00 78.89  ? 62  GLN B CA  1 
ATOM   1213 C  C   . GLN B 2 62  ? -2.385  -25.406 41.348  1.00 78.55  ? 62  GLN B C   1 
ATOM   1214 O  O   . GLN B 2 62  ? -2.186  -24.401 40.668  1.00 79.22  ? 62  GLN B O   1 
ATOM   1215 C  CB  . GLN B 2 62  ? -0.434  -26.938 41.678  1.00 87.19  ? 62  GLN B CB  1 
ATOM   1216 C  CG  . GLN B 2 62  ? 0.489   -26.374 40.611  1.00 93.01  ? 62  GLN B CG  1 
ATOM   1217 C  CD  . GLN B 2 62  ? 1.544   -25.445 41.184  1.00 98.14  ? 62  GLN B CD  1 
ATOM   1218 O  OE1 . GLN B 2 62  ? 1.849   -25.490 42.378  1.00 94.98  ? 62  GLN B OE1 1 
ATOM   1219 N  NE2 . GLN B 2 62  ? 2.107   -24.594 40.332  1.00 103.48 ? 62  GLN B NE2 1 
ATOM   1220 N  N   . GLU B 2 63  ? -3.508  -26.113 41.285  1.00 79.98  ? 63  GLU B N   1 
ATOM   1221 C  CA  . GLU B 2 63  ? -4.588  -25.777 40.363  1.00 82.04  ? 63  GLU B CA  1 
ATOM   1222 C  C   . GLU B 2 63  ? -5.310  -24.479 40.732  1.00 79.77  ? 63  GLU B C   1 
ATOM   1223 O  O   . GLU B 2 63  ? -6.074  -23.939 39.931  1.00 81.66  ? 63  GLU B O   1 
ATOM   1224 C  CB  . GLU B 2 63  ? -5.591  -26.935 40.286  1.00 86.04  ? 63  GLU B CB  1 
ATOM   1225 C  CG  . GLU B 2 63  ? -5.929  -27.552 41.641  1.00 89.31  ? 63  GLU B CG  1 
ATOM   1226 C  CD  . GLU B 2 63  ? -7.003  -28.625 41.557  1.00 90.76  ? 63  GLU B CD  1 
ATOM   1227 O  OE1 . GLU B 2 63  ? -7.001  -29.536 42.412  1.00 86.63  ? 63  GLU B OE1 1 
ATOM   1228 O  OE2 . GLU B 2 63  ? -7.852  -28.554 40.643  1.00 95.24  ? 63  GLU B OE2 1 
ATOM   1229 N  N   . ASP B 2 64  ? -5.063  -23.978 41.938  1.00 74.38  ? 64  ASP B N   1 
ATOM   1230 C  CA  . ASP B 2 64  ? -5.772  -22.800 42.426  1.00 70.84  ? 64  ASP B CA  1 
ATOM   1231 C  C   . ASP B 2 64  ? -4.905  -21.545 42.488  1.00 72.13  ? 64  ASP B C   1 
ATOM   1232 O  O   . ASP B 2 64  ? -5.409  -20.455 42.760  1.00 72.56  ? 64  ASP B O   1 
ATOM   1233 C  CB  . ASP B 2 64  ? -6.388  -23.075 43.799  1.00 71.52  ? 64  ASP B CB  1 
ATOM   1234 C  CG  . ASP B 2 64  ? -7.391  -24.209 43.769  1.00 78.08  ? 64  ASP B CG  1 
ATOM   1235 O  OD1 . ASP B 2 64  ? -8.061  -24.384 42.730  1.00 82.23  ? 64  ASP B OD1 1 
ATOM   1236 O  OD2 . ASP B 2 64  ? -7.509  -24.929 44.783  1.00 80.72  ? 64  ASP B OD2 1 
ATOM   1237 N  N   . ILE B 2 65  ? -3.607  -21.690 42.242  1.00 72.76  ? 65  ILE B N   1 
ATOM   1238 C  CA  . ILE B 2 65  ? -2.722  -20.529 42.279  1.00 72.96  ? 65  ILE B CA  1 
ATOM   1239 C  C   . ILE B 2 65  ? -2.709  -19.792 40.943  1.00 68.90  ? 65  ILE B C   1 
ATOM   1240 O  O   . ILE B 2 65  ? -2.686  -20.400 39.874  1.00 71.51  ? 65  ILE B O   1 
ATOM   1241 C  CB  . ILE B 2 65  ? -1.279  -20.879 42.722  1.00 77.54  ? 65  ILE B CB  1 
ATOM   1242 C  CG1 . ILE B 2 65  ? -0.603  -21.805 41.712  1.00 87.29  ? 65  ILE B CG1 1 
ATOM   1243 C  CG2 . ILE B 2 65  ? -1.277  -21.511 44.106  1.00 73.62  ? 65  ILE B CG2 1 
ATOM   1244 C  CD1 . ILE B 2 65  ? 0.819   -22.152 42.081  1.00 92.15  ? 65  ILE B CD1 1 
ATOM   1245 N  N   . SER B 2 66  ? -2.739  -18.471 41.026  1.00 64.53  ? 66  SER B N   1 
ATOM   1246 C  CA  . SER B 2 66  ? -2.804  -17.617 39.857  1.00 56.94  ? 66  SER B CA  1 
ATOM   1247 C  C   . SER B 2 66  ? -1.869  -16.450 40.112  1.00 57.32  ? 66  SER B C   1 
ATOM   1248 O  O   . SER B 2 66  ? -1.085  -16.484 41.064  1.00 57.54  ? 66  SER B O   1 
ATOM   1249 C  CB  . SER B 2 66  ? -4.234  -17.122 39.665  1.00 55.39  ? 66  SER B CB  1 
ATOM   1250 O  OG  . SER B 2 66  ? -4.264  -15.977 38.838  1.00 72.63  ? 66  SER B OG  1 
ATOM   1251 N  N   . GLU B 2 67  ? -1.936  -15.420 39.274  1.00 53.49  ? 67  GLU B N   1 
ATOM   1252 C  CA  . GLU B 2 67  ? -1.212  -14.199 39.583  1.00 50.97  ? 67  GLU B CA  1 
ATOM   1253 C  C   . GLU B 2 67  ? -1.737  -13.693 40.921  1.00 52.44  ? 67  GLU B C   1 
ATOM   1254 O  O   . GLU B 2 67  ? -2.947  -13.696 41.165  1.00 50.98  ? 67  GLU B O   1 
ATOM   1255 C  CB  . GLU B 2 67  ? -1.396  -13.139 38.496  1.00 50.51  ? 67  GLU B CB  1 
ATOM   1256 C  CG  . GLU B 2 67  ? -0.568  -11.879 38.735  1.00 53.74  ? 67  GLU B CG  1 
ATOM   1257 C  CD  . GLU B 2 67  ? -0.723  -10.836 37.640  1.00 59.71  ? 67  GLU B CD  1 
ATOM   1258 O  OE1 . GLU B 2 67  ? -1.567  -11.031 36.736  1.00 66.13  ? 67  GLU B OE1 1 
ATOM   1259 O  OE2 . GLU B 2 67  ? 0.002   -9.817  37.686  1.00 53.90  ? 67  GLU B OE2 1 
ATOM   1260 N  N   . ILE B 2 68  ? -0.823  -13.301 41.799  1.00 49.53  ? 68  ILE B N   1 
ATOM   1261 C  CA  . ILE B 2 68  ? -1.198  -12.775 43.101  1.00 46.15  ? 68  ILE B CA  1 
ATOM   1262 C  C   . ILE B 2 68  ? -1.545  -11.296 42.969  1.00 50.53  ? 68  ILE B C   1 
ATOM   1263 O  O   . ILE B 2 68  ? -0.959  -10.581 42.153  1.00 53.48  ? 68  ILE B O   1 
ATOM   1264 C  CB  . ILE B 2 68  ? -0.063  -12.969 44.138  1.00 43.12  ? 68  ILE B CB  1 
ATOM   1265 C  CG1 . ILE B 2 68  ? -0.585  -12.783 45.562  1.00 44.94  ? 68  ILE B CG1 1 
ATOM   1266 C  CG2 . ILE B 2 68  ? 1.106   -12.025 43.868  1.00 36.77  ? 68  ILE B CG2 1 
ATOM   1267 C  CD1 . ILE B 2 68  ? 0.514   -12.826 46.601  1.00 44.86  ? 68  ILE B CD1 1 
ATOM   1268 N  N   . TRP B 2 69  ? -2.521  -10.843 43.746  1.00 50.26  ? 69  TRP B N   1 
ATOM   1269 C  CA  . TRP B 2 69  ? -2.822  -9.420  43.807  1.00 48.43  ? 69  TRP B CA  1 
ATOM   1270 C  C   . TRP B 2 69  ? -3.297  -9.018  45.196  1.00 50.45  ? 69  TRP B C   1 
ATOM   1271 O  O   . TRP B 2 69  ? -3.833  -9.835  45.946  1.00 50.93  ? 69  TRP B O   1 
ATOM   1272 C  CB  . TRP B 2 69  ? -3.823  -9.006  42.727  1.00 45.93  ? 69  TRP B CB  1 
ATOM   1273 C  CG  . TRP B 2 69  ? -5.163  -9.649  42.828  1.00 47.92  ? 69  TRP B CG  1 
ATOM   1274 C  CD1 . TRP B 2 69  ? -5.507  -10.903 42.408  1.00 50.58  ? 69  TRP B CD1 1 
ATOM   1275 C  CD2 . TRP B 2 69  ? -6.359  -9.060  43.351  1.00 48.52  ? 69  TRP B CD2 1 
ATOM   1276 N  NE1 . TRP B 2 69  ? -6.840  -11.135 42.651  1.00 50.53  ? 69  TRP B NE1 1 
ATOM   1277 C  CE2 . TRP B 2 69  ? -7.388  -10.017 43.224  1.00 49.36  ? 69  TRP B CE2 1 
ATOM   1278 C  CE3 . TRP B 2 69  ? -6.659  -7.817  43.918  1.00 48.72  ? 69  TRP B CE3 1 
ATOM   1279 C  CZ2 . TRP B 2 69  ? -8.692  -9.775  43.655  1.00 47.97  ? 69  TRP B CZ2 1 
ATOM   1280 C  CZ3 . TRP B 2 69  ? -7.960  -7.575  44.341  1.00 48.95  ? 69  TRP B CZ3 1 
ATOM   1281 C  CH2 . TRP B 2 69  ? -8.958  -8.550  44.207  1.00 48.33  ? 69  TRP B CH2 1 
ATOM   1282 N  N   . PHE B 2 70  ? -3.078  -7.754  45.540  1.00 47.02  ? 70  PHE B N   1 
ATOM   1283 C  CA  . PHE B 2 70  ? -3.332  -7.284  46.891  1.00 45.85  ? 70  PHE B CA  1 
ATOM   1284 C  C   . PHE B 2 70  ? -4.422  -6.225  46.891  1.00 45.51  ? 70  PHE B C   1 
ATOM   1285 O  O   . PHE B 2 70  ? -4.684  -5.596  45.866  1.00 50.31  ? 70  PHE B O   1 
ATOM   1286 C  CB  . PHE B 2 70  ? -2.045  -6.714  47.496  1.00 45.45  ? 70  PHE B CB  1 
ATOM   1287 C  CG  . PHE B 2 70  ? -0.856  -7.633  47.378  1.00 42.69  ? 70  PHE B CG  1 
ATOM   1288 C  CD1 . PHE B 2 70  ? -0.683  -8.683  48.266  1.00 42.71  ? 70  PHE B CD1 1 
ATOM   1289 C  CD2 . PHE B 2 70  ? 0.093   -7.441  46.382  1.00 39.76  ? 70  PHE B CD2 1 
ATOM   1290 C  CE1 . PHE B 2 70  ? 0.409   -9.531  48.159  1.00 44.11  ? 70  PHE B CE1 1 
ATOM   1291 C  CE2 . PHE B 2 70  ? 1.191   -8.286  46.270  1.00 38.90  ? 70  PHE B CE2 1 
ATOM   1292 C  CZ  . PHE B 2 70  ? 1.349   -9.331  47.160  1.00 40.53  ? 70  PHE B CZ  1 
ATOM   1293 N  N   . GLU B 2 71  ? -5.064  -6.038  48.038  1.00 44.78  ? 71  GLU B N   1 
ATOM   1294 C  CA  . GLU B 2 71  ? -6.064  -4.986  48.185  1.00 47.35  ? 71  GLU B CA  1 
ATOM   1295 C  C   . GLU B 2 71  ? -6.136  -4.484  49.614  1.00 48.83  ? 71  GLU B C   1 
ATOM   1296 O  O   . GLU B 2 71  ? -5.897  -5.234  50.561  1.00 50.03  ? 71  GLU B O   1 
ATOM   1297 C  CB  . GLU B 2 71  ? -7.445  -5.459  47.730  1.00 46.76  ? 71  GLU B CB  1 
ATOM   1298 C  CG  . GLU B 2 71  ? -7.951  -6.686  48.451  1.00 56.11  ? 71  GLU B CG  1 
ATOM   1299 C  CD  . GLU B 2 71  ? -8.956  -6.371  49.542  1.00 65.79  ? 71  GLU B CD  1 
ATOM   1300 O  OE1 . GLU B 2 71  ? -9.593  -7.318  50.049  1.00 67.91  ? 71  GLU B OE1 1 
ATOM   1301 O  OE2 . GLU B 2 71  ? -9.113  -5.183  49.895  1.00 69.30  ? 71  GLU B OE2 1 
ATOM   1302 N  N   . TYR B 2 72  ? -6.462  -3.204  49.761  1.00 49.09  ? 72  TYR B N   1 
ATOM   1303 C  CA  . TYR B 2 72  ? -6.648  -2.611  51.075  1.00 46.88  ? 72  TYR B CA  1 
ATOM   1304 C  C   . TYR B 2 72  ? -8.057  -2.053  51.207  1.00 51.85  ? 72  TYR B C   1 
ATOM   1305 O  O   . TYR B 2 72  ? -8.435  -1.140  50.472  1.00 58.86  ? 72  TYR B O   1 
ATOM   1306 C  CB  . TYR B 2 72  ? -5.630  -1.502  51.317  1.00 43.44  ? 72  TYR B CB  1 
ATOM   1307 C  CG  . TYR B 2 72  ? -5.920  -0.729  52.574  1.00 47.49  ? 72  TYR B CG  1 
ATOM   1308 C  CD1 . TYR B 2 72  ? -5.597  -1.250  53.818  1.00 45.70  ? 72  TYR B CD1 1 
ATOM   1309 C  CD2 . TYR B 2 72  ? -6.533  0.516   52.522  1.00 47.00  ? 72  TYR B CD2 1 
ATOM   1310 C  CE1 . TYR B 2 72  ? -5.867  -0.552  54.973  1.00 43.67  ? 72  TYR B CE1 1 
ATOM   1311 C  CE2 . TYR B 2 72  ? -6.805  1.220   53.672  1.00 46.42  ? 72  TYR B CE2 1 
ATOM   1312 C  CZ  . TYR B 2 72  ? -6.472  0.679   54.893  1.00 45.11  ? 72  TYR B CZ  1 
ATOM   1313 O  OH  . TYR B 2 72  ? -6.743  1.374   56.043  1.00 53.37  ? 72  TYR B OH  1 
ATOM   1314 N  N   . GLU B 2 73  ? -8.818  -2.599  52.154  1.00 50.57  ? 73  GLU B N   1 
ATOM   1315 C  CA  . GLU B 2 73  ? -10.206 -2.204  52.384  1.00 54.87  ? 73  GLU B CA  1 
ATOM   1316 C  C   . GLU B 2 73  ? -11.009 -2.132  51.090  1.00 54.26  ? 73  GLU B C   1 
ATOM   1317 O  O   . GLU B 2 73  ? -11.727 -1.162  50.853  1.00 53.71  ? 73  GLU B O   1 
ATOM   1318 C  CB  . GLU B 2 73  ? -10.281 -0.860  53.111  1.00 66.59  ? 73  GLU B CB  1 
ATOM   1319 C  CG  . GLU B 2 73  ? -9.469  -0.783  54.393  1.00 78.04  ? 73  GLU B CG  1 
ATOM   1320 C  CD  . GLU B 2 73  ? -10.187 -1.349  55.602  1.00 89.16  ? 73  GLU B CD  1 
ATOM   1321 O  OE1 . GLU B 2 73  ? -9.878  -0.899  56.728  1.00 94.78  ? 73  GLU B OE1 1 
ATOM   1322 O  OE2 . GLU B 2 73  ? -11.048 -2.241  55.438  1.00 90.58  ? 73  GLU B OE2 1 
ATOM   1323 N  N   . GLY B 2 74  ? -10.866 -3.151  50.249  1.00 54.59  ? 74  GLY B N   1 
ATOM   1324 C  CA  . GLY B 2 74  ? -11.619 -3.230  49.011  1.00 51.20  ? 74  GLY B CA  1 
ATOM   1325 C  C   . GLY B 2 74  ? -10.968 -2.528  47.834  1.00 52.53  ? 74  GLY B C   1 
ATOM   1326 O  O   . GLY B 2 74  ? -11.474 -2.592  46.714  1.00 57.83  ? 74  GLY B O   1 
ATOM   1327 N  N   . THR B 2 75  ? -9.847  -1.856  48.080  1.00 48.31  ? 75  THR B N   1 
ATOM   1328 C  CA  . THR B 2 75  ? -9.147  -1.133  47.025  1.00 47.64  ? 75  THR B CA  1 
ATOM   1329 C  C   . THR B 2 75  ? -7.950  -1.924  46.522  1.00 47.10  ? 75  THR B C   1 
ATOM   1330 O  O   . THR B 2 75  ? -6.960  -2.068  47.241  1.00 48.69  ? 75  THR B O   1 
ATOM   1331 C  CB  . THR B 2 75  ? -8.627  0.229   47.520  1.00 45.31  ? 75  THR B CB  1 
ATOM   1332 O  OG1 . THR B 2 75  ? -9.698  0.969   48.116  1.00 58.36  ? 75  THR B OG1 1 
ATOM   1333 C  CG2 . THR B 2 75  ? -8.038  1.025   46.370  1.00 30.96  ? 75  THR B CG2 1 
ATOM   1334 N  N   . PRO B 2 76  ? -8.035  -2.441  45.286  1.00 41.88  ? 76  PRO B N   1 
ATOM   1335 C  CA  . PRO B 2 76  ? -6.910  -3.136  44.658  1.00 42.14  ? 76  PRO B CA  1 
ATOM   1336 C  C   . PRO B 2 76  ? -5.677  -2.242  44.624  1.00 47.34  ? 76  PRO B C   1 
ATOM   1337 O  O   . PRO B 2 76  ? -5.754  -1.097  44.179  1.00 52.41  ? 76  PRO B O   1 
ATOM   1338 C  CB  . PRO B 2 76  ? -7.416  -3.398  43.238  1.00 40.60  ? 76  PRO B CB  1 
ATOM   1339 C  CG  . PRO B 2 76  ? -8.882  -3.474  43.376  1.00 40.10  ? 76  PRO B CG  1 
ATOM   1340 C  CD  . PRO B 2 76  ? -9.234  -2.461  44.431  1.00 43.25  ? 76  PRO B CD  1 
ATOM   1341 N  N   . LEU B 2 77  ? -4.552  -2.756  45.107  1.00 46.86  ? 77  LEU B N   1 
ATOM   1342 C  CA  . LEU B 2 77  ? -3.333  -1.968  45.177  1.00 46.99  ? 77  LEU B CA  1 
ATOM   1343 C  C   . LEU B 2 77  ? -2.576  -2.031  43.856  1.00 49.31  ? 77  LEU B C   1 
ATOM   1344 O  O   . LEU B 2 77  ? -2.234  -3.112  43.372  1.00 48.33  ? 77  LEU B O   1 
ATOM   1345 C  CB  . LEU B 2 77  ? -2.455  -2.448  46.335  1.00 45.63  ? 77  LEU B CB  1 
ATOM   1346 C  CG  . LEU B 2 77  ? -3.138  -2.396  47.707  1.00 44.93  ? 77  LEU B CG  1 
ATOM   1347 C  CD1 . LEU B 2 77  ? -2.356  -3.176  48.755  1.00 49.22  ? 77  LEU B CD1 1 
ATOM   1348 C  CD2 . LEU B 2 77  ? -3.328  -0.961  48.152  1.00 36.92  ? 77  LEU B CD2 1 
ATOM   1349 N  N   . LYS B 2 78  ? -2.338  -0.864  43.265  1.00 47.94  ? 78  LYS B N   1 
ATOM   1350 C  CA  . LYS B 2 78  ? -1.567  -0.779  42.035  1.00 46.76  ? 78  LYS B CA  1 
ATOM   1351 C  C   . LYS B 2 78  ? -0.095  -1.035  42.338  1.00 45.61  ? 78  LYS B C   1 
ATOM   1352 O  O   . LYS B 2 78  ? 0.557   -0.240  43.011  1.00 49.87  ? 78  LYS B O   1 
ATOM   1353 C  CB  . LYS B 2 78  ? -1.749  0.592   41.385  1.00 48.69  ? 78  LYS B CB  1 
ATOM   1354 C  CG  . LYS B 2 78  ? -3.162  0.870   40.889  1.00 47.40  ? 78  LYS B CG  1 
ATOM   1355 C  CD  . LYS B 2 78  ? -3.356  2.352   40.590  1.00 48.88  ? 78  LYS B CD  1 
ATOM   1356 C  CE  . LYS B 2 78  ? -4.680  2.613   39.893  1.00 55.80  ? 78  LYS B CE  1 
ATOM   1357 N  NZ  . LYS B 2 78  ? -5.840  2.087   40.664  1.00 63.01  ? 78  LYS B NZ  1 
ATOM   1358 N  N   . TRP B 2 79  ? 0.424   -2.150  41.837  1.00 42.27  ? 79  TRP B N   1 
ATOM   1359 C  CA  . TRP B 2 79  ? 1.794   -2.553  42.128  1.00 43.17  ? 79  TRP B CA  1 
ATOM   1360 C  C   . TRP B 2 79  ? 2.824   -1.569  41.593  1.00 46.68  ? 79  TRP B C   1 
ATOM   1361 O  O   . TRP B 2 79  ? 3.968   -1.555  42.048  1.00 49.58  ? 79  TRP B O   1 
ATOM   1362 C  CB  . TRP B 2 79  ? 2.082   -3.946  41.562  1.00 44.58  ? 79  TRP B CB  1 
ATOM   1363 C  CG  . TRP B 2 79  ? 2.090   -4.005  40.058  1.00 44.31  ? 79  TRP B CG  1 
ATOM   1364 C  CD1 . TRP B 2 79  ? 1.053   -4.370  39.247  1.00 41.84  ? 79  TRP B CD1 1 
ATOM   1365 C  CD2 . TRP B 2 79  ? 3.190   -3.694  39.188  1.00 41.85  ? 79  TRP B CD2 1 
ATOM   1366 N  NE1 . TRP B 2 79  ? 1.438   -4.300  37.928  1.00 43.20  ? 79  TRP B NE1 1 
ATOM   1367 C  CE2 . TRP B 2 79  ? 2.744   -3.890  37.865  1.00 39.97  ? 79  TRP B CE2 1 
ATOM   1368 C  CE3 . TRP B 2 79  ? 4.507   -3.269  39.400  1.00 41.86  ? 79  TRP B CE3 1 
ATOM   1369 C  CZ2 . TRP B 2 79  ? 3.566   -3.677  36.761  1.00 40.74  ? 79  TRP B CZ2 1 
ATOM   1370 C  CZ3 . TRP B 2 79  ? 5.319   -3.054  38.304  1.00 43.62  ? 79  TRP B CZ3 1 
ATOM   1371 C  CH2 . TRP B 2 79  ? 4.846   -3.258  37.000  1.00 43.20  ? 79  TRP B CH2 1 
ATOM   1372 N  N   . HIS B 2 80  ? 2.431   -0.762  40.614  1.00 48.61  ? 80  HIS B N   1 
ATOM   1373 C  CA  . HIS B 2 80  ? 3.383   0.147   39.987  1.00 51.25  ? 80  HIS B CA  1 
ATOM   1374 C  C   . HIS B 2 80  ? 3.495   1.499   40.695  1.00 48.18  ? 80  HIS B C   1 
ATOM   1375 O  O   . HIS B 2 80  ? 4.295   2.343   40.298  1.00 50.47  ? 80  HIS B O   1 
ATOM   1376 C  CB  . HIS B 2 80  ? 3.097   0.310   38.488  1.00 51.05  ? 80  HIS B CB  1 
ATOM   1377 C  CG  . HIS B 2 80  ? 1.732   0.841   38.177  1.00 49.28  ? 80  HIS B CG  1 
ATOM   1378 N  ND1 . HIS B 2 80  ? 0.586   0.096   38.348  1.00 48.82  ? 80  HIS B ND1 1 
ATOM   1379 C  CD2 . HIS B 2 80  ? 1.334   2.034   37.674  1.00 46.50  ? 80  HIS B CD2 1 
ATOM   1380 C  CE1 . HIS B 2 80  ? -0.461  0.812   37.979  1.00 49.73  ? 80  HIS B CE1 1 
ATOM   1381 N  NE2 . HIS B 2 80  ? -0.035  1.991   37.565  1.00 48.25  ? 80  HIS B NE2 1 
ATOM   1382 N  N   . TYR B 2 81  ? 2.694   1.698   41.741  1.00 43.29  ? 81  TYR B N   1 
ATOM   1383 C  CA  . TYR B 2 81  ? 2.867   2.842   42.631  1.00 41.71  ? 81  TYR B CA  1 
ATOM   1384 C  C   . TYR B 2 81  ? 3.805   2.411   43.750  1.00 41.54  ? 81  TYR B C   1 
ATOM   1385 O  O   . TYR B 2 81  ? 3.664   1.305   44.277  1.00 42.60  ? 81  TYR B O   1 
ATOM   1386 C  CB  . TYR B 2 81  ? 1.535   3.286   43.243  1.00 41.75  ? 81  TYR B CB  1 
ATOM   1387 C  CG  . TYR B 2 81  ? 0.601   4.031   42.313  1.00 45.39  ? 81  TYR B CG  1 
ATOM   1388 C  CD1 . TYR B 2 81  ? 0.586   3.772   40.949  1.00 46.89  ? 81  TYR B CD1 1 
ATOM   1389 C  CD2 . TYR B 2 81  ? -0.268  5.001   42.803  1.00 42.38  ? 81  TYR B CD2 1 
ATOM   1390 C  CE1 . TYR B 2 81  ? -0.266  4.449   40.103  1.00 45.00  ? 81  TYR B CE1 1 
ATOM   1391 C  CE2 . TYR B 2 81  ? -1.127  5.687   41.960  1.00 38.02  ? 81  TYR B CE2 1 
ATOM   1392 C  CZ  . TYR B 2 81  ? -1.120  5.404   40.610  1.00 41.79  ? 81  TYR B CZ  1 
ATOM   1393 O  OH  . TYR B 2 81  ? -1.965  6.073   39.752  1.00 45.15  ? 81  TYR B OH  1 
ATOM   1394 N  N   . PRO B 2 82  ? 4.772   3.268   44.115  1.00 38.80  ? 82  PRO B N   1 
ATOM   1395 C  CA  . PRO B 2 82  ? 5.657   2.903   45.226  1.00 38.24  ? 82  PRO B CA  1 
ATOM   1396 C  C   . PRO B 2 82  ? 4.864   2.605   46.496  1.00 41.58  ? 82  PRO B C   1 
ATOM   1397 O  O   . PRO B 2 82  ? 3.807   3.198   46.722  1.00 41.34  ? 82  PRO B O   1 
ATOM   1398 C  CB  . PRO B 2 82  ? 6.528   4.148   45.403  1.00 39.21  ? 82  PRO B CB  1 
ATOM   1399 C  CG  . PRO B 2 82  ? 6.561   4.774   44.047  1.00 39.70  ? 82  PRO B CG  1 
ATOM   1400 C  CD  . PRO B 2 82  ? 5.188   4.521   43.461  1.00 41.16  ? 82  PRO B CD  1 
ATOM   1401 N  N   . ILE B 2 83  ? 5.368   1.669   47.293  1.00 41.99  ? 83  ILE B N   1 
ATOM   1402 C  CA  . ILE B 2 83  ? 4.677   1.195   48.488  1.00 40.62  ? 83  ILE B CA  1 
ATOM   1403 C  C   . ILE B 2 83  ? 4.335   2.327   49.460  1.00 38.93  ? 83  ILE B C   1 
ATOM   1404 O  O   . ILE B 2 83  ? 3.208   2.419   49.945  1.00 34.85  ? 83  ILE B O   1 
ATOM   1405 C  CB  . ILE B 2 83  ? 5.513   0.112   49.208  1.00 42.60  ? 83  ILE B CB  1 
ATOM   1406 C  CG1 . ILE B 2 83  ? 5.622   -1.140  48.332  1.00 42.99  ? 83  ILE B CG1 1 
ATOM   1407 C  CG2 . ILE B 2 83  ? 4.908   -0.230  50.562  1.00 39.81  ? 83  ILE B CG2 1 
ATOM   1408 C  CD1 . ILE B 2 83  ? 6.528   -2.218  48.896  1.00 39.31  ? 83  ILE B CD1 1 
ATOM   1409 N  N   . GLY B 2 84  ? 5.309   3.189   49.727  1.00 37.55  ? 84  GLY B N   1 
ATOM   1410 C  CA  . GLY B 2 84  ? 5.115   4.305   50.633  1.00 42.02  ? 84  GLY B CA  1 
ATOM   1411 C  C   . GLY B 2 84  ? 3.985   5.225   50.209  1.00 44.37  ? 84  GLY B C   1 
ATOM   1412 O  O   . GLY B 2 84  ? 3.245   5.743   51.046  1.00 47.93  ? 84  GLY B O   1 
ATOM   1413 N  N   . LEU B 2 85  ? 3.848   5.428   48.905  1.00 41.99  ? 85  LEU B N   1 
ATOM   1414 C  CA  . LEU B 2 85  ? 2.781   6.265   48.382  1.00 42.35  ? 85  LEU B CA  1 
ATOM   1415 C  C   . LEU B 2 85  ? 1.424   5.648   48.679  1.00 45.24  ? 85  LEU B C   1 
ATOM   1416 O  O   . LEU B 2 85  ? 0.527   6.322   49.184  1.00 46.07  ? 85  LEU B O   1 
ATOM   1417 C  CB  . LEU B 2 85  ? 2.943   6.469   46.875  1.00 39.98  ? 85  LEU B CB  1 
ATOM   1418 C  CG  . LEU B 2 85  ? 1.778   7.178   46.189  1.00 38.37  ? 85  LEU B CG  1 
ATOM   1419 C  CD1 . LEU B 2 85  ? 1.644   8.604   46.698  1.00 40.82  ? 85  LEU B CD1 1 
ATOM   1420 C  CD2 . LEU B 2 85  ? 1.974   7.158   44.689  1.00 43.50  ? 85  LEU B CD2 1 
ATOM   1421 N  N   . LEU B 2 86  ? 1.282   4.363   48.364  1.00 49.08  ? 86  LEU B N   1 
ATOM   1422 C  CA  . LEU B 2 86  ? 0.026   3.651   48.588  1.00 46.90  ? 86  LEU B CA  1 
ATOM   1423 C  C   . LEU B 2 86  ? -0.412  3.729   50.047  1.00 42.10  ? 86  LEU B C   1 
ATOM   1424 O  O   . LEU B 2 86  ? -1.563  4.040   50.341  1.00 44.89  ? 86  LEU B O   1 
ATOM   1425 C  CB  . LEU B 2 86  ? 0.144   2.191   48.148  1.00 45.20  ? 86  LEU B CB  1 
ATOM   1426 C  CG  . LEU B 2 86  ? 0.299   1.935   46.648  1.00 39.96  ? 86  LEU B CG  1 
ATOM   1427 C  CD1 . LEU B 2 86  ? 0.479   0.444   46.381  1.00 37.34  ? 86  LEU B CD1 1 
ATOM   1428 C  CD2 . LEU B 2 86  ? -0.899  2.477   45.896  1.00 35.24  ? 86  LEU B CD2 1 
ATOM   1429 N  N   . PHE B 2 87  ? 0.514   3.461   50.958  1.00 40.99  ? 87  PHE B N   1 
ATOM   1430 C  CA  . PHE B 2 87  ? 0.209   3.541   52.379  1.00 44.55  ? 87  PHE B CA  1 
ATOM   1431 C  C   . PHE B 2 87  ? -0.184  4.953   52.816  1.00 45.34  ? 87  PHE B C   1 
ATOM   1432 O  O   . PHE B 2 87  ? -1.241  5.140   53.422  1.00 45.44  ? 87  PHE B O   1 
ATOM   1433 C  CB  . PHE B 2 87  ? 1.377   3.041   53.228  1.00 40.56  ? 87  PHE B CB  1 
ATOM   1434 C  CG  . PHE B 2 87  ? 1.123   3.137   54.703  1.00 41.33  ? 87  PHE B CG  1 
ATOM   1435 C  CD1 . PHE B 2 87  ? 0.310   2.213   55.339  1.00 40.98  ? 87  PHE B CD1 1 
ATOM   1436 C  CD2 . PHE B 2 87  ? 1.674   4.164   55.453  1.00 38.39  ? 87  PHE B CD2 1 
ATOM   1437 C  CE1 . PHE B 2 87  ? 0.062   2.305   56.701  1.00 43.35  ? 87  PHE B CE1 1 
ATOM   1438 C  CE2 . PHE B 2 87  ? 1.428   4.260   56.813  1.00 38.24  ? 87  PHE B CE2 1 
ATOM   1439 C  CZ  . PHE B 2 87  ? 0.623   3.331   57.437  1.00 36.96  ? 87  PHE B CZ  1 
ATOM   1440 N  N   . ASP B 2 88  ? 0.674   5.931   52.518  1.00 41.54  ? 88  ASP B N   1 
ATOM   1441 C  CA  . ASP B 2 88  ? 0.404   7.332   52.841  1.00 42.09  ? 88  ASP B CA  1 
ATOM   1442 C  C   . ASP B 2 88  ? -0.983  7.737   52.371  1.00 43.98  ? 88  ASP B C   1 
ATOM   1443 O  O   . ASP B 2 88  ? -1.783  8.302   53.123  1.00 44.58  ? 88  ASP B O   1 
ATOM   1444 C  CB  . ASP B 2 88  ? 1.426   8.245   52.161  1.00 41.93  ? 88  ASP B CB  1 
ATOM   1445 C  CG  . ASP B 2 88  ? 2.763   8.269   52.872  1.00 43.79  ? 88  ASP B CG  1 
ATOM   1446 O  OD1 . ASP B 2 88  ? 2.979   7.434   53.776  1.00 45.73  ? 88  ASP B OD1 1 
ATOM   1447 O  OD2 . ASP B 2 88  ? 3.603   9.124   52.518  1.00 43.96  ? 88  ASP B OD2 1 
ATOM   1448 N  N   . LEU B 2 89  ? -1.261  7.422   51.116  1.00 42.89  ? 89  LEU B N   1 
ATOM   1449 C  CA  . LEU B 2 89  ? -2.489  7.841   50.467  1.00 44.73  ? 89  LEU B CA  1 
ATOM   1450 C  C   . LEU B 2 89  ? -3.713  7.089   50.995  1.00 46.89  ? 89  LEU B C   1 
ATOM   1451 O  O   . LEU B 2 89  ? -4.771  7.684   51.192  1.00 48.50  ? 89  LEU B O   1 
ATOM   1452 C  CB  . LEU B 2 89  ? -2.341  7.653   48.958  1.00 43.73  ? 89  LEU B CB  1 
ATOM   1453 C  CG  . LEU B 2 89  ? -3.261  8.411   48.010  1.00 41.38  ? 89  LEU B CG  1 
ATOM   1454 C  CD1 . LEU B 2 89  ? -3.298  9.896   48.347  1.00 35.80  ? 89  LEU B CD1 1 
ATOM   1455 C  CD2 . LEU B 2 89  ? -2.768  8.183   46.592  1.00 38.45  ? 89  LEU B CD2 1 
ATOM   1456 N  N   . LEU B 2 90  ? -3.564  5.790   51.244  1.00 46.68  ? 90  LEU B N   1 
ATOM   1457 C  CA  . LEU B 2 90  ? -4.715  4.951   51.583  1.00 42.70  ? 90  LEU B CA  1 
ATOM   1458 C  C   . LEU B 2 90  ? -4.887  4.608   53.067  1.00 41.70  ? 90  LEU B C   1 
ATOM   1459 O  O   . LEU B 2 90  ? -6.014  4.529   53.553  1.00 45.42  ? 90  LEU B O   1 
ATOM   1460 C  CB  . LEU B 2 90  ? -4.688  3.655   50.769  1.00 43.51  ? 90  LEU B CB  1 
ATOM   1461 C  CG  . LEU B 2 90  ? -4.692  3.755   49.242  1.00 41.08  ? 90  LEU B CG  1 
ATOM   1462 C  CD1 . LEU B 2 90  ? -4.494  2.380   48.636  1.00 32.53  ? 90  LEU B CD1 1 
ATOM   1463 C  CD2 . LEU B 2 90  ? -5.981  4.380   48.736  1.00 40.35  ? 90  LEU B CD2 1 
ATOM   1464 N  N   . ALA B 2 91  ? -3.789  4.396   53.788  1.00 43.79  ? 91  ALA B N   1 
ATOM   1465 C  CA  . ALA B 2 91  ? -3.893  3.797   55.119  1.00 42.87  ? 91  ALA B CA  1 
ATOM   1466 C  C   . ALA B 2 91  ? -3.147  4.518   56.239  1.00 50.10  ? 91  ALA B C   1 
ATOM   1467 O  O   . ALA B 2 91  ? -3.038  3.987   57.347  1.00 55.40  ? 91  ALA B O   1 
ATOM   1468 C  CB  . ALA B 2 91  ? -3.459  2.335   55.066  1.00 41.41  ? 91  ALA B CB  1 
ATOM   1469 N  N   . SER B 2 92  ? -2.647  5.720   55.966  1.00 49.43  ? 92  SER B N   1 
ATOM   1470 C  CA  . SER B 2 92  ? -1.819  6.438   56.937  1.00 43.45  ? 92  SER B CA  1 
ATOM   1471 C  C   . SER B 2 92  ? -2.557  6.805   58.227  1.00 45.17  ? 92  SER B C   1 
ATOM   1472 O  O   . SER B 2 92  ? -1.959  6.823   59.301  1.00 43.39  ? 92  SER B O   1 
ATOM   1473 C  CB  . SER B 2 92  ? -1.202  7.690   56.306  1.00 44.26  ? 92  SER B CB  1 
ATOM   1474 O  OG  . SER B 2 92  ? -2.205  8.557   55.800  1.00 50.77  ? 92  SER B OG  1 
ATOM   1475 N  N   . SER B 2 93  ? -3.851  7.094   58.129  1.00 48.45  ? 93  SER B N   1 
ATOM   1476 C  CA  . SER B 2 93  ? -4.603  7.503   59.313  1.00 54.32  ? 93  SER B CA  1 
ATOM   1477 C  C   . SER B 2 93  ? -5.218  6.312   60.053  1.00 55.55  ? 93  SER B C   1 
ATOM   1478 O  O   . SER B 2 93  ? -5.797  6.472   61.129  1.00 53.74  ? 93  SER B O   1 
ATOM   1479 C  CB  . SER B 2 93  ? -5.671  8.550   58.966  1.00 56.75  ? 93  SER B CB  1 
ATOM   1480 O  OG  . SER B 2 93  ? -6.755  7.972   58.263  1.00 65.24  ? 93  SER B OG  1 
ATOM   1481 N  N   . SER B 2 94  ? -5.086  5.119   59.482  1.00 54.08  ? 94  SER B N   1 
ATOM   1482 C  CA  . SER B 2 94  ? -5.580  3.916   60.143  1.00 51.03  ? 94  SER B CA  1 
ATOM   1483 C  C   . SER B 2 94  ? -4.522  3.328   61.067  1.00 53.29  ? 94  SER B C   1 
ATOM   1484 O  O   . SER B 2 94  ? -3.337  3.649   60.956  1.00 56.12  ? 94  SER B O   1 
ATOM   1485 C  CB  . SER B 2 94  ? -6.022  2.869   59.122  1.00 48.54  ? 94  SER B CB  1 
ATOM   1486 O  OG  . SER B 2 94  ? -7.199  3.284   58.457  1.00 55.68  ? 94  SER B OG  1 
ATOM   1487 N  N   . ALA B 2 95  ? -4.963  2.466   61.976  1.00 49.53  ? 95  ALA B N   1 
ATOM   1488 C  CA  . ALA B 2 95  ? -4.068  1.808   62.911  1.00 42.00  ? 95  ALA B CA  1 
ATOM   1489 C  C   . ALA B 2 95  ? -3.043  0.967   62.174  1.00 44.65  ? 95  ALA B C   1 
ATOM   1490 O  O   . ALA B 2 95  ? -3.358  0.317   61.180  1.00 48.70  ? 95  ALA B O   1 
ATOM   1491 C  CB  . ALA B 2 95  ? -4.856  0.940   63.867  1.00 40.02  ? 95  ALA B CB  1 
ATOM   1492 N  N   . LEU B 2 96  ? -1.810  0.999   62.661  1.00 44.72  ? 96  LEU B N   1 
ATOM   1493 C  CA  . LEU B 2 96  ? -0.801  0.050   62.232  1.00 44.39  ? 96  LEU B CA  1 
ATOM   1494 C  C   . LEU B 2 96  ? -1.196  -1.310  62.804  1.00 49.60  ? 96  LEU B C   1 
ATOM   1495 O  O   . LEU B 2 96  ? -1.976  -1.375  63.754  1.00 51.84  ? 96  LEU B O   1 
ATOM   1496 C  CB  . LEU B 2 96  ? 0.566   0.474   62.768  1.00 44.53  ? 96  LEU B CB  1 
ATOM   1497 C  CG  . LEU B 2 96  ? 1.087   1.829   62.285  1.00 41.25  ? 96  LEU B CG  1 
ATOM   1498 C  CD1 . LEU B 2 96  ? 2.385   2.190   62.990  1.00 38.13  ? 96  LEU B CD1 1 
ATOM   1499 C  CD2 . LEU B 2 96  ? 1.284   1.810   60.778  1.00 38.77  ? 96  LEU B CD2 1 
ATOM   1500 N  N   . PRO B 2 97  ? -0.703  -2.407  62.208  1.00 50.36  ? 97  PRO B N   1 
ATOM   1501 C  CA  . PRO B 2 97  ? 0.058   -2.452  60.956  1.00 47.44  ? 97  PRO B CA  1 
ATOM   1502 C  C   . PRO B 2 97  ? -0.864  -2.314  59.755  1.00 41.93  ? 97  PRO B C   1 
ATOM   1503 O  O   . PRO B 2 97  ? -2.083  -2.347  59.908  1.00 43.12  ? 97  PRO B O   1 
ATOM   1504 C  CB  . PRO B 2 97  ? 0.687   -3.845  60.984  1.00 49.95  ? 97  PRO B CB  1 
ATOM   1505 C  CG  . PRO B 2 97  ? -0.246  -4.656  61.812  1.00 47.73  ? 97  PRO B CG  1 
ATOM   1506 C  CD  . PRO B 2 97  ? -0.788  -3.730  62.853  1.00 44.94  ? 97  PRO B CD  1 
ATOM   1507 N  N   . TRP B 2 98  ? -0.279  -2.147  58.576  1.00 40.95  ? 98  TRP B N   1 
ATOM   1508 C  CA  . TRP B 2 98  ? -1.044  -2.006  57.345  1.00 36.35  ? 98  TRP B CA  1 
ATOM   1509 C  C   . TRP B 2 98  ? -1.712  -3.335  57.021  1.00 39.79  ? 98  TRP B C   1 
ATOM   1510 O  O   . TRP B 2 98  ? -1.034  -4.335  56.782  1.00 45.03  ? 98  TRP B O   1 
ATOM   1511 C  CB  . TRP B 2 98  ? -0.104  -1.598  56.211  1.00 34.76  ? 98  TRP B CB  1 
ATOM   1512 C  CG  . TRP B 2 98  ? -0.785  -1.197  54.941  1.00 36.21  ? 98  TRP B CG  1 
ATOM   1513 C  CD1 . TRP B 2 98  ? -2.117  -0.970  54.757  1.00 41.12  ? 98  TRP B CD1 1 
ATOM   1514 C  CD2 . TRP B 2 98  ? -0.160  -0.971  53.668  1.00 36.72  ? 98  TRP B CD2 1 
ATOM   1515 N  NE1 . TRP B 2 98  ? -2.361  -0.617  53.449  1.00 42.68  ? 98  TRP B NE1 1 
ATOM   1516 C  CE2 . TRP B 2 98  ? -1.176  -0.609  52.762  1.00 35.85  ? 98  TRP B CE2 1 
ATOM   1517 C  CE3 . TRP B 2 98  ? 1.161   -1.037  53.210  1.00 39.96  ? 98  TRP B CE3 1 
ATOM   1518 C  CZ2 . TRP B 2 98  ? -0.915  -0.316  51.426  1.00 37.97  ? 98  TRP B CZ2 1 
ATOM   1519 C  CZ3 . TRP B 2 98  ? 1.419   -0.744  51.880  1.00 41.31  ? 98  TRP B CZ3 1 
ATOM   1520 C  CH2 . TRP B 2 98  ? 0.386   -0.392  51.004  1.00 40.55  ? 98  TRP B CH2 1 
ATOM   1521 N  N   . ASN B 2 99  ? -3.040  -3.353  57.020  1.00 40.72  ? 99  ASN B N   1 
ATOM   1522 C  CA  . ASN B 2 99  ? -3.773  -4.577  56.715  1.00 38.12  ? 99  ASN B CA  1 
ATOM   1523 C  C   . ASN B 2 99  ? -4.019  -4.768  55.224  1.00 41.97  ? 99  ASN B C   1 
ATOM   1524 O  O   . ASN B 2 99  ? -4.955  -4.205  54.659  1.00 47.46  ? 99  ASN B O   1 
ATOM   1525 C  CB  . ASN B 2 99  ? -5.091  -4.627  57.487  1.00 37.08  ? 99  ASN B CB  1 
ATOM   1526 C  CG  . ASN B 2 99  ? -4.886  -4.863  58.970  1.00 46.05  ? 99  ASN B CG  1 
ATOM   1527 O  OD1 . ASN B 2 99  ? -5.172  -3.995  59.795  1.00 53.44  ? 99  ASN B OD1 1 
ATOM   1528 N  ND2 . ASN B 2 99  ? -4.385  -6.042  59.317  1.00 42.11  ? 99  ASN B ND2 1 
ATOM   1529 N  N   . ILE B 2 100 ? -3.162  -5.564  54.594  1.00 42.87  ? 100 ILE B N   1 
ATOM   1530 C  CA  . ILE B 2 100 ? -3.307  -5.904  53.187  1.00 39.68  ? 100 ILE B CA  1 
ATOM   1531 C  C   . ILE B 2 100 ? -3.895  -7.304  53.041  1.00 44.08  ? 100 ILE B C   1 
ATOM   1532 O  O   . ILE B 2 100 ? -3.391  -8.260  53.634  1.00 47.10  ? 100 ILE B O   1 
ATOM   1533 C  CB  . ILE B 2 100 ? -1.947  -5.870  52.462  1.00 39.70  ? 100 ILE B CB  1 
ATOM   1534 C  CG1 . ILE B 2 100 ? -1.354  -4.461  52.488  1.00 39.86  ? 100 ILE B CG1 1 
ATOM   1535 C  CG2 . ILE B 2 100 ? -2.088  -6.362  51.027  1.00 34.97  ? 100 ILE B CG2 1 
ATOM   1536 C  CD1 . ILE B 2 100 ? -0.104  -4.316  51.638  1.00 33.22  ? 100 ILE B CD1 1 
ATOM   1537 N  N   . THR B 2 101 ? -4.962  -7.423  52.256  1.00 42.51  ? 101 THR B N   1 
ATOM   1538 C  CA  . THR B 2 101 ? -5.563  -8.722  51.973  1.00 40.68  ? 101 THR B CA  1 
ATOM   1539 C  C   . THR B 2 101 ? -4.956  -9.342  50.717  1.00 44.77  ? 101 THR B C   1 
ATOM   1540 O  O   . THR B 2 101 ? -4.905  -8.709  49.663  1.00 43.66  ? 101 THR B O   1 
ATOM   1541 C  CB  . THR B 2 101 ? -7.083  -8.612  51.778  1.00 40.96  ? 101 THR B CB  1 
ATOM   1542 O  OG1 . THR B 2 101 ? -7.690  -8.161  52.991  1.00 43.70  ? 101 THR B OG1 1 
ATOM   1543 C  CG2 . THR B 2 101 ? -7.674  -9.961  51.402  1.00 40.76  ? 101 THR B CG2 1 
ATOM   1544 N  N   . VAL B 2 102 ? -4.501  -10.585 50.833  1.00 48.04  ? 102 VAL B N   1 
ATOM   1545 C  CA  . VAL B 2 102 ? -3.903  -11.288 49.704  1.00 46.14  ? 102 VAL B CA  1 
ATOM   1546 C  C   . VAL B 2 102 ? -4.948  -12.073 48.909  1.00 45.45  ? 102 VAL B C   1 
ATOM   1547 O  O   . VAL B 2 102 ? -5.747  -12.817 49.479  1.00 47.12  ? 102 VAL B O   1 
ATOM   1548 C  CB  . VAL B 2 102 ? -2.789  -12.244 50.171  1.00 43.97  ? 102 VAL B CB  1 
ATOM   1549 C  CG1 . VAL B 2 102 ? -2.225  -13.018 48.992  1.00 41.98  ? 102 VAL B CG1 1 
ATOM   1550 C  CG2 . VAL B 2 102 ? -1.696  -11.469 50.885  1.00 40.04  ? 102 VAL B CG2 1 
ATOM   1551 N  N   . HIS B 2 103 ? -4.935  -11.894 47.590  1.00 44.49  ? 103 HIS B N   1 
ATOM   1552 C  CA  . HIS B 2 103 ? -5.844  -12.596 46.688  1.00 44.26  ? 103 HIS B CA  1 
ATOM   1553 C  C   . HIS B 2 103 ? -5.084  -13.390 45.629  1.00 48.94  ? 103 HIS B C   1 
ATOM   1554 O  O   . HIS B 2 103 ? -3.878  -13.214 45.446  1.00 55.27  ? 103 HIS B O   1 
ATOM   1555 C  CB  . HIS B 2 103 ? -6.734  -11.603 45.949  1.00 44.84  ? 103 HIS B CB  1 
ATOM   1556 C  CG  . HIS B 2 103 ? -7.762  -10.932 46.803  1.00 47.59  ? 103 HIS B CG  1 
ATOM   1557 N  ND1 . HIS B 2 103 ? -9.109  -11.200 46.690  1.00 46.42  ? 103 HIS B ND1 1 
ATOM   1558 C  CD2 . HIS B 2 103 ? -7.647  -9.978  47.757  1.00 50.66  ? 103 HIS B CD2 1 
ATOM   1559 C  CE1 . HIS B 2 103 ? -9.779  -10.453 47.549  1.00 45.97  ? 103 HIS B CE1 1 
ATOM   1560 N  NE2 . HIS B 2 103 ? -8.915  -9.703  48.209  1.00 49.38  ? 103 HIS B NE2 1 
ATOM   1561 N  N   . PHE B 2 104 ? -5.807  -14.249 44.916  1.00 53.69  ? 104 PHE B N   1 
ATOM   1562 C  CA  . PHE B 2 104 ? -5.274  -14.926 43.737  1.00 54.33  ? 104 PHE B CA  1 
ATOM   1563 C  C   . PHE B 2 104 ? -6.290  -14.918 42.603  1.00 54.61  ? 104 PHE B C   1 
ATOM   1564 O  O   . PHE B 2 104 ? -5.972  -14.576 41.463  1.00 54.92  ? 104 PHE B O   1 
ATOM   1565 C  CB  . PHE B 2 104 ? -4.871  -16.363 44.062  1.00 50.42  ? 104 PHE B CB  1 
ATOM   1566 C  CG  . PHE B 2 104 ? -3.590  -16.466 44.822  1.00 50.49  ? 104 PHE B CG  1 
ATOM   1567 C  CD1 . PHE B 2 104 ? -2.379  -16.242 44.190  1.00 51.89  ? 104 PHE B CD1 1 
ATOM   1568 C  CD2 . PHE B 2 104 ? -3.593  -16.781 46.167  1.00 50.59  ? 104 PHE B CD2 1 
ATOM   1569 C  CE1 . PHE B 2 104 ? -1.193  -16.328 44.885  1.00 51.01  ? 104 PHE B CE1 1 
ATOM   1570 C  CE2 . PHE B 2 104 ? -2.410  -16.872 46.869  1.00 53.71  ? 104 PHE B CE2 1 
ATOM   1571 C  CZ  . PHE B 2 104 ? -1.208  -16.645 46.226  1.00 53.00  ? 104 PHE B CZ  1 
ATOM   1572 N  N   . LYS B 2 105 ? -7.517  -15.294 42.932  1.00 51.59  ? 105 LYS B N   1 
ATOM   1573 C  CA  . LYS B 2 105 ? -8.567  -15.406 41.939  1.00 53.45  ? 105 LYS B CA  1 
ATOM   1574 C  C   . LYS B 2 105 ? -9.202  -14.042 41.693  1.00 54.18  ? 105 LYS B C   1 
ATOM   1575 O  O   . LYS B 2 105 ? -9.009  -13.114 42.472  1.00 50.18  ? 105 LYS B O   1 
ATOM   1576 C  CB  . LYS B 2 105 ? -9.625  -16.409 42.410  1.00 57.57  ? 105 LYS B CB  1 
ATOM   1577 C  CG  . LYS B 2 105 ? -10.378 -17.093 41.280  1.00 73.17  ? 105 LYS B CG  1 
ATOM   1578 C  CD  . LYS B 2 105 ? -11.443 -18.047 41.807  1.00 77.87  ? 105 LYS B CD  1 
ATOM   1579 C  CE  . LYS B 2 105 ? -12.295 -18.596 40.670  1.00 78.80  ? 105 LYS B CE  1 
ATOM   1580 N  NZ  . LYS B 2 105 ? -13.333 -19.541 41.166  1.00 83.02  ? 105 LYS B NZ  1 
ATOM   1581 N  N   . SER B 2 106 ? -9.947  -13.934 40.596  1.00 60.13  ? 106 SER B N   1 
ATOM   1582 C  CA  . SER B 2 106 ? -10.716 -12.737 40.266  1.00 59.88  ? 106 SER B CA  1 
ATOM   1583 C  C   . SER B 2 106 ? -9.875  -11.467 40.194  1.00 61.07  ? 106 SER B C   1 
ATOM   1584 O  O   . SER B 2 106 ? -10.219 -10.447 40.793  1.00 64.98  ? 106 SER B O   1 
ATOM   1585 C  CB  . SER B 2 106 ? -11.874 -12.555 41.247  1.00 65.06  ? 106 SER B CB  1 
ATOM   1586 O  OG  . SER B 2 106 ? -12.770 -13.651 41.176  1.00 71.54  ? 106 SER B OG  1 
ATOM   1587 N  N   . PHE B 2 107 ? -8.774  -11.540 39.455  1.00 58.22  ? 107 PHE B N   1 
ATOM   1588 C  CA  . PHE B 2 107 ? -7.921  -10.385 39.225  1.00 56.92  ? 107 PHE B CA  1 
ATOM   1589 C  C   . PHE B 2 107 ? -8.740  -9.258  38.590  1.00 58.22  ? 107 PHE B C   1 
ATOM   1590 O  O   . PHE B 2 107 ? -9.334  -9.443  37.530  1.00 59.94  ? 107 PHE B O   1 
ATOM   1591 C  CB  . PHE B 2 107 ? -6.759  -10.788 38.316  1.00 55.39  ? 107 PHE B CB  1 
ATOM   1592 C  CG  . PHE B 2 107 ? -5.678  -9.755  38.207  1.00 54.87  ? 107 PHE B CG  1 
ATOM   1593 C  CD1 . PHE B 2 107 ? -4.582  -9.789  39.055  1.00 55.24  ? 107 PHE B CD1 1 
ATOM   1594 C  CD2 . PHE B 2 107 ? -5.749  -8.757  37.249  1.00 54.34  ? 107 PHE B CD2 1 
ATOM   1595 C  CE1 . PHE B 2 107 ? -3.579  -8.838  38.954  1.00 56.94  ? 107 PHE B CE1 1 
ATOM   1596 C  CE2 . PHE B 2 107 ? -4.753  -7.808  37.142  1.00 56.21  ? 107 PHE B CE2 1 
ATOM   1597 C  CZ  . PHE B 2 107 ? -3.665  -7.848  37.997  1.00 56.95  ? 107 PHE B CZ  1 
ATOM   1598 N  N   . PRO B 2 108 ? -8.785  -8.090  39.251  1.00 60.62  ? 108 PRO B N   1 
ATOM   1599 C  CA  . PRO B 2 108 ? -9.561  -6.936  38.777  1.00 57.97  ? 108 PRO B CA  1 
ATOM   1600 C  C   . PRO B 2 108 ? -8.899  -6.237  37.592  1.00 65.00  ? 108 PRO B C   1 
ATOM   1601 O  O   . PRO B 2 108 ? -8.040  -5.377  37.776  1.00 68.16  ? 108 PRO B O   1 
ATOM   1602 C  CB  . PRO B 2 108 ? -9.587  -6.012  39.996  1.00 54.88  ? 108 PRO B CB  1 
ATOM   1603 C  CG  . PRO B 2 108 ? -8.343  -6.348  40.745  1.00 56.47  ? 108 PRO B CG  1 
ATOM   1604 C  CD  . PRO B 2 108 ? -8.112  -7.818  40.535  1.00 59.12  ? 108 PRO B CD  1 
ATOM   1605 N  N   . GLU B 2 109 ? -9.313  -6.607  36.385  1.00 71.27  ? 109 GLU B N   1 
ATOM   1606 C  CA  . GLU B 2 109 ? -8.706  -6.100  35.159  1.00 70.73  ? 109 GLU B CA  1 
ATOM   1607 C  C   . GLU B 2 109 ? -8.816  -4.584  35.019  1.00 67.04  ? 109 GLU B C   1 
ATOM   1608 O  O   . GLU B 2 109 ? -7.932  -3.942  34.453  1.00 73.07  ? 109 GLU B O   1 
ATOM   1609 C  CB  . GLU B 2 109 ? -9.344  -6.772  33.942  1.00 77.61  ? 109 GLU B CB  1 
ATOM   1610 C  CG  . GLU B 2 109 ? -9.183  -8.283  33.899  1.00 81.63  ? 109 GLU B CG  1 
ATOM   1611 C  CD  . GLU B 2 109 ? -7.820  -8.713  33.387  1.00 84.24  ? 109 GLU B CD  1 
ATOM   1612 O  OE1 . GLU B 2 109 ? -7.053  -7.842  32.926  1.00 82.87  ? 109 GLU B OE1 1 
ATOM   1613 O  OE2 . GLU B 2 109 ? -7.517  -9.924  33.442  1.00 88.00  ? 109 GLU B OE2 1 
ATOM   1614 N  N   . LYS B 2 110 ? -9.898  -4.014  35.535  1.00 61.80  ? 110 LYS B N   1 
ATOM   1615 C  CA  . LYS B 2 110 ? -10.160 -2.592  35.344  1.00 63.27  ? 110 LYS B CA  1 
ATOM   1616 C  C   . LYS B 2 110 ? -9.480  -1.723  36.395  1.00 64.00  ? 110 LYS B C   1 
ATOM   1617 O  O   . LYS B 2 110 ? -9.507  -0.496  36.303  1.00 68.82  ? 110 LYS B O   1 
ATOM   1618 C  CB  . LYS B 2 110 ? -11.666 -2.313  35.347  1.00 66.54  ? 110 LYS B CB  1 
ATOM   1619 C  CG  . LYS B 2 110 ? -12.304 -2.385  36.726  1.00 67.79  ? 110 LYS B CG  1 
ATOM   1620 C  CD  . LYS B 2 110 ? -13.779 -2.017  36.677  1.00 67.57  ? 110 LYS B CD  1 
ATOM   1621 C  CE  . LYS B 2 110 ? -14.390 -1.996  38.072  1.00 66.63  ? 110 LYS B CE  1 
ATOM   1622 N  NZ  . LYS B 2 110 ? -13.755 -0.973  38.952  1.00 65.44  ? 110 LYS B NZ  1 
ATOM   1623 N  N   . ASP B 2 111 ? -8.871  -2.354  37.393  1.00 61.84  ? 111 ASP B N   1 
ATOM   1624 C  CA  . ASP B 2 111 ? -8.263  -1.604  38.485  1.00 59.47  ? 111 ASP B CA  1 
ATOM   1625 C  C   . ASP B 2 111 ? -6.745  -1.736  38.526  1.00 55.45  ? 111 ASP B C   1 
ATOM   1626 O  O   . ASP B 2 111 ? -6.053  -0.847  39.022  1.00 50.90  ? 111 ASP B O   1 
ATOM   1627 C  CB  . ASP B 2 111 ? -8.856  -2.033  39.828  1.00 68.17  ? 111 ASP B CB  1 
ATOM   1628 C  CG  . ASP B 2 111 ? -10.343 -1.738  39.933  1.00 77.79  ? 111 ASP B CG  1 
ATOM   1629 O  OD1 . ASP B 2 111 ? -10.816 -0.792  39.269  1.00 78.85  ? 111 ASP B OD1 1 
ATOM   1630 O  OD2 . ASP B 2 111 ? -11.039 -2.452  40.685  1.00 83.36  ? 111 ASP B OD2 1 
ATOM   1631 N  N   . LEU B 2 112 ? -6.230  -2.845  38.002  1.00 57.00  ? 112 LEU B N   1 
ATOM   1632 C  CA  . LEU B 2 112 ? -4.805  -3.142  38.110  1.00 52.95  ? 112 LEU B CA  1 
ATOM   1633 C  C   . LEU B 2 112 ? -4.179  -3.538  36.782  1.00 52.19  ? 112 LEU B C   1 
ATOM   1634 O  O   . LEU B 2 112 ? -4.793  -4.249  35.985  1.00 52.28  ? 112 LEU B O   1 
ATOM   1635 C  CB  . LEU B 2 112 ? -4.575  -4.281  39.106  1.00 48.82  ? 112 LEU B CB  1 
ATOM   1636 C  CG  . LEU B 2 112 ? -5.132  -4.133  40.519  1.00 49.39  ? 112 LEU B CG  1 
ATOM   1637 C  CD1 . LEU B 2 112 ? -4.794  -5.368  41.345  1.00 46.72  ? 112 LEU B CD1 1 
ATOM   1638 C  CD2 . LEU B 2 112 ? -4.599  -2.863  41.175  1.00 48.28  ? 112 LEU B CD2 1 
ATOM   1639 N  N   . LEU B 2 113 ? -2.951  -3.079  36.560  1.00 47.90  ? 113 LEU B N   1 
ATOM   1640 C  CA  . LEU B 2 113 ? -2.124  -3.595  35.482  1.00 50.45  ? 113 LEU B CA  1 
ATOM   1641 C  C   . LEU B 2 113 ? -1.524  -4.912  35.954  1.00 55.54  ? 113 LEU B C   1 
ATOM   1642 O  O   . LEU B 2 113 ? -1.156  -5.044  37.120  1.00 56.48  ? 113 LEU B O   1 
ATOM   1643 C  CB  . LEU B 2 113 ? -0.992  -2.621  35.157  1.00 51.74  ? 113 LEU B CB  1 
ATOM   1644 C  CG  . LEU B 2 113 ? -1.338  -1.185  34.753  1.00 49.17  ? 113 LEU B CG  1 
ATOM   1645 C  CD1 . LEU B 2 113 ? -0.074  -0.342  34.653  1.00 48.63  ? 113 LEU B CD1 1 
ATOM   1646 C  CD2 . LEU B 2 113 ? -2.097  -1.166  33.442  1.00 43.12  ? 113 LEU B CD2 1 
ATOM   1647 N  N   . HIS B 2 114 ? -1.429  -5.888  35.058  1.00 57.07  ? 114 HIS B N   1 
ATOM   1648 C  CA  . HIS B 2 114 ? -0.804  -7.158  35.396  1.00 52.06  ? 114 HIS B CA  1 
ATOM   1649 C  C   . HIS B 2 114 ? 0.682   -6.965  35.659  1.00 52.88  ? 114 HIS B C   1 
ATOM   1650 O  O   . HIS B 2 114 ? 1.313   -6.087  35.071  1.00 57.01  ? 114 HIS B O   1 
ATOM   1651 C  CB  . HIS B 2 114 ? -0.995  -8.165  34.263  1.00 51.29  ? 114 HIS B CB  1 
ATOM   1652 C  CG  . HIS B 2 114 ? -2.389  -8.700  34.159  1.00 55.90  ? 114 HIS B CG  1 
ATOM   1653 N  ND1 . HIS B 2 114 ? -2.803  -9.830  34.831  1.00 57.24  ? 114 HIS B ND1 1 
ATOM   1654 C  CD2 . HIS B 2 114 ? -3.464  -8.261  33.463  1.00 56.70  ? 114 HIS B CD2 1 
ATOM   1655 C  CE1 . HIS B 2 114 ? -4.074  -10.064 34.553  1.00 58.75  ? 114 HIS B CE1 1 
ATOM   1656 N  NE2 . HIS B 2 114 ? -4.499  -9.126  33.726  1.00 57.50  ? 114 HIS B NE2 1 
ATOM   1657 N  N   . CYS B 2 115 ? 1.237   -7.781  36.550  1.00 48.90  ? 115 CYS B N   1 
ATOM   1658 C  CA  . CYS B 2 115 ? 2.681   -7.807  36.750  1.00 52.69  ? 115 CYS B CA  1 
ATOM   1659 C  C   . CYS B 2 115 ? 3.191   -9.207  36.460  1.00 55.01  ? 115 CYS B C   1 
ATOM   1660 O  O   . CYS B 2 115 ? 3.305   -10.029 37.364  1.00 61.02  ? 115 CYS B O   1 
ATOM   1661 C  CB  . CYS B 2 115 ? 3.055   -7.387  38.173  1.00 54.15  ? 115 CYS B CB  1 
ATOM   1662 S  SG  . CYS B 2 115 ? 4.842   -7.161  38.425  1.00 56.44  ? 115 CYS B SG  1 
ATOM   1663 N  N   . PRO B 2 116 ? 3.497   -9.483  35.186  1.00 60.99  ? 116 PRO B N   1 
ATOM   1664 C  CA  . PRO B 2 116 ? 3.814   -10.838 34.717  1.00 58.76  ? 116 PRO B CA  1 
ATOM   1665 C  C   . PRO B 2 116 ? 5.219   -11.307 35.091  1.00 56.31  ? 116 PRO B C   1 
ATOM   1666 O  O   . PRO B 2 116 ? 5.444   -12.507 35.214  1.00 58.07  ? 116 PRO B O   1 
ATOM   1667 C  CB  . PRO B 2 116 ? 3.679   -10.715 33.198  1.00 57.92  ? 116 PRO B CB  1 
ATOM   1668 C  CG  . PRO B 2 116 ? 4.030   -9.288  32.916  1.00 59.36  ? 116 PRO B CG  1 
ATOM   1669 C  CD  . PRO B 2 116 ? 3.530   -8.492  34.092  1.00 61.16  ? 116 PRO B CD  1 
ATOM   1670 N  N   . SER B 2 117 ? 6.149   -10.376 35.266  1.00 59.91  ? 117 SER B N   1 
ATOM   1671 C  CA  . SER B 2 117 ? 7.519   -10.732 35.614  1.00 58.55  ? 117 SER B CA  1 
ATOM   1672 C  C   . SER B 2 117 ? 8.230   -9.560  36.272  1.00 56.63  ? 117 SER B C   1 
ATOM   1673 O  O   . SER B 2 117 ? 7.718   -8.443  36.296  1.00 52.60  ? 117 SER B O   1 
ATOM   1674 C  CB  . SER B 2 117 ? 8.298   -11.149 34.366  1.00 58.53  ? 117 SER B CB  1 
ATOM   1675 O  OG  . SER B 2 117 ? 8.583   -10.023 33.554  1.00 58.18  ? 117 SER B OG  1 
ATOM   1676 N  N   . LYS B 2 118 ? 9.419   -9.820  36.799  1.00 58.51  ? 118 LYS B N   1 
ATOM   1677 C  CA  . LYS B 2 118 ? 10.214  -8.769  37.412  1.00 60.47  ? 118 LYS B CA  1 
ATOM   1678 C  C   . LYS B 2 118 ? 10.822  -7.859  36.354  1.00 63.09  ? 118 LYS B C   1 
ATOM   1679 O  O   . LYS B 2 118 ? 11.200  -6.726  36.648  1.00 68.63  ? 118 LYS B O   1 
ATOM   1680 C  CB  . LYS B 2 118 ? 11.296  -9.361  38.316  1.00 61.17  ? 118 LYS B CB  1 
ATOM   1681 C  CG  . LYS B 2 118 ? 10.724  -10.131 39.491  1.00 65.14  ? 118 LYS B CG  1 
ATOM   1682 C  CD  . LYS B 2 118 ? 11.705  -10.227 40.638  1.00 65.62  ? 118 LYS B CD  1 
ATOM   1683 C  CE  . LYS B 2 118 ? 11.030  -10.821 41.859  1.00 68.55  ? 118 LYS B CE  1 
ATOM   1684 N  NZ  . LYS B 2 118 ? 11.931  -10.834 43.042  1.00 74.82  ? 118 LYS B NZ  1 
ATOM   1685 N  N   . ASP B 2 119 ? 10.908  -8.351  35.123  1.00 59.55  ? 119 ASP B N   1 
ATOM   1686 C  CA  . ASP B 2 119 ? 11.376  -7.522  34.022  1.00 58.55  ? 119 ASP B CA  1 
ATOM   1687 C  C   . ASP B 2 119 ? 10.373  -6.415  33.743  1.00 64.08  ? 119 ASP B C   1 
ATOM   1688 O  O   . ASP B 2 119 ? 10.754  -5.287  33.423  1.00 67.05  ? 119 ASP B O   1 
ATOM   1689 C  CB  . ASP B 2 119 ? 11.613  -8.355  32.766  1.00 57.92  ? 119 ASP B CB  1 
ATOM   1690 C  CG  . ASP B 2 119 ? 12.880  -9.176  32.847  1.00 66.93  ? 119 ASP B CG  1 
ATOM   1691 O  OD1 . ASP B 2 119 ? 12.993  -10.174 32.106  1.00 68.00  ? 119 ASP B OD1 1 
ATOM   1692 O  OD2 . ASP B 2 119 ? 13.765  -8.824  33.657  1.00 73.29  ? 119 ASP B OD2 1 
ATOM   1693 N  N   . ALA B 2 120 ? 9.091   -6.744  33.870  1.00 63.35  ? 120 ALA B N   1 
ATOM   1694 C  CA  . ALA B 2 120 ? 8.027   -5.760  33.724  1.00 59.19  ? 120 ALA B CA  1 
ATOM   1695 C  C   . ALA B 2 120 ? 8.202   -4.637  34.743  1.00 60.34  ? 120 ALA B C   1 
ATOM   1696 O  O   . ALA B 2 120 ? 8.008   -3.463  34.422  1.00 62.20  ? 120 ALA B O   1 
ATOM   1697 C  CB  . ALA B 2 120 ? 6.666   -6.417  33.881  1.00 55.43  ? 120 ALA B CB  1 
ATOM   1698 N  N   . ILE B 2 121 ? 8.579   -5.006  35.966  1.00 57.27  ? 121 ILE B N   1 
ATOM   1699 C  CA  . ILE B 2 121 ? 8.832   -4.026  37.019  1.00 59.61  ? 121 ILE B CA  1 
ATOM   1700 C  C   . ILE B 2 121 ? 10.011  -3.120  36.667  1.00 63.04  ? 121 ILE B C   1 
ATOM   1701 O  O   . ILE B 2 121 ? 9.924   -1.900  36.799  1.00 64.56  ? 121 ILE B O   1 
ATOM   1702 C  CB  . ILE B 2 121 ? 9.111   -4.702  38.376  1.00 54.93  ? 121 ILE B CB  1 
ATOM   1703 C  CG1 . ILE B 2 121 ? 8.020   -5.722  38.700  1.00 58.86  ? 121 ILE B CG1 1 
ATOM   1704 C  CG2 . ILE B 2 121 ? 9.208   -3.663  39.477  1.00 46.04  ? 121 ILE B CG2 1 
ATOM   1705 C  CD1 . ILE B 2 121 ? 8.221   -6.431  40.021  1.00 57.68  ? 121 ILE B CD1 1 
ATOM   1706 N  N   . GLU B 2 122 ? 11.107  -3.726  36.218  1.00 62.83  ? 122 GLU B N   1 
ATOM   1707 C  CA  . GLU B 2 122 ? 12.300  -2.982  35.822  1.00 60.90  ? 122 GLU B CA  1 
ATOM   1708 C  C   . GLU B 2 122 ? 12.030  -2.061  34.631  1.00 59.18  ? 122 GLU B C   1 
ATOM   1709 O  O   . GLU B 2 122 ? 12.614  -0.982  34.523  1.00 61.84  ? 122 GLU B O   1 
ATOM   1710 C  CB  . GLU B 2 122 ? 13.441  -3.943  35.486  1.00 61.51  ? 122 GLU B CB  1 
ATOM   1711 C  CG  . GLU B 2 122 ? 14.733  -3.251  35.095  1.00 62.66  ? 122 GLU B CG  1 
ATOM   1712 C  CD  . GLU B 2 122 ? 15.763  -4.215  34.549  1.00 67.24  ? 122 GLU B CD  1 
ATOM   1713 O  OE1 . GLU B 2 122 ? 15.371  -5.322  34.123  1.00 68.13  ? 122 GLU B OE1 1 
ATOM   1714 O  OE2 . GLU B 2 122 ? 16.965  -3.868  34.551  1.00 70.12  ? 122 GLU B OE2 1 
ATOM   1715 N  N   . ALA B 2 123 ? 11.143  -2.491  33.739  1.00 55.08  ? 123 ALA B N   1 
ATOM   1716 C  CA  . ALA B 2 123 ? 10.764  -1.676  32.594  1.00 48.95  ? 123 ALA B CA  1 
ATOM   1717 C  C   . ALA B 2 123 ? 9.977   -0.455  33.049  1.00 51.89  ? 123 ALA B C   1 
ATOM   1718 O  O   . ALA B 2 123 ? 10.175  0.649   32.539  1.00 60.30  ? 123 ALA B O   1 
ATOM   1719 C  CB  . ALA B 2 123 ? 9.954   -2.488  31.608  1.00 46.10  ? 123 ALA B CB  1 
ATOM   1720 N  N   . HIS B 2 124 ? 9.084   -0.658  34.011  1.00 47.86  ? 124 HIS B N   1 
ATOM   1721 C  CA  . HIS B 2 124 ? 8.284   0.438   34.544  1.00 46.66  ? 124 HIS B CA  1 
ATOM   1722 C  C   . HIS B 2 124 ? 9.143   1.424   35.322  1.00 49.52  ? 124 HIS B C   1 
ATOM   1723 O  O   . HIS B 2 124 ? 8.941   2.634   35.239  1.00 54.18  ? 124 HIS B O   1 
ATOM   1724 C  CB  . HIS B 2 124 ? 7.163   -0.088  35.440  1.00 43.91  ? 124 HIS B CB  1 
ATOM   1725 C  CG  . HIS B 2 124 ? 6.370   0.992   36.107  1.00 50.08  ? 124 HIS B CG  1 
ATOM   1726 N  ND1 . HIS B 2 124 ? 6.651   1.446   37.378  1.00 49.98  ? 124 HIS B ND1 1 
ATOM   1727 C  CD2 . HIS B 2 124 ? 5.308   1.713   35.677  1.00 53.46  ? 124 HIS B CD2 1 
ATOM   1728 C  CE1 . HIS B 2 124 ? 5.794   2.396   37.704  1.00 49.95  ? 124 HIS B CE1 1 
ATOM   1729 N  NE2 . HIS B 2 124 ? 4.968   2.577   36.689  1.00 53.05  ? 124 HIS B NE2 1 
ATOM   1730 N  N   . PHE B 2 125 ? 10.102  0.901   36.078  1.00 49.46  ? 125 PHE B N   1 
ATOM   1731 C  CA  . PHE B 2 125 ? 10.979  1.738   36.886  1.00 52.60  ? 125 PHE B CA  1 
ATOM   1732 C  C   . PHE B 2 125 ? 11.864  2.614   36.006  1.00 58.72  ? 125 PHE B C   1 
ATOM   1733 O  O   . PHE B 2 125 ? 12.078  3.794   36.303  1.00 58.79  ? 125 PHE B O   1 
ATOM   1734 C  CB  . PHE B 2 125 ? 11.839  0.874   37.806  1.00 50.62  ? 125 PHE B CB  1 
ATOM   1735 C  CG  . PHE B 2 125 ? 12.797  1.660   38.655  1.00 49.42  ? 125 PHE B CG  1 
ATOM   1736 C  CD1 . PHE B 2 125 ? 12.333  2.452   39.697  1.00 46.96  ? 125 PHE B CD1 1 
ATOM   1737 C  CD2 . PHE B 2 125 ? 14.162  1.598   38.420  1.00 46.69  ? 125 PHE B CD2 1 
ATOM   1738 C  CE1 . PHE B 2 125 ? 13.216  3.173   40.485  1.00 43.58  ? 125 PHE B CE1 1 
ATOM   1739 C  CE2 . PHE B 2 125 ? 15.049  2.316   39.199  1.00 45.61  ? 125 PHE B CE2 1 
ATOM   1740 C  CZ  . PHE B 2 125 ? 14.576  3.105   40.234  1.00 48.11  ? 125 PHE B CZ  1 
ATOM   1741 N  N   . MET B 2 126 ? 12.373  2.033   34.922  1.00 55.50  ? 126 MET B N   1 
ATOM   1742 C  CA  . MET B 2 126 ? 13.209  2.777   33.985  1.00 55.90  ? 126 MET B CA  1 
ATOM   1743 C  C   . MET B 2 126 ? 12.420  3.813   33.188  1.00 57.45  ? 126 MET B C   1 
ATOM   1744 O  O   . MET B 2 126 ? 12.958  4.851   32.810  1.00 58.13  ? 126 MET B O   1 
ATOM   1745 C  CB  . MET B 2 126 ? 13.952  1.829   33.040  1.00 54.59  ? 126 MET B CB  1 
ATOM   1746 C  CG  . MET B 2 126 ? 15.133  1.118   33.682  1.00 49.24  ? 126 MET B CG  1 
ATOM   1747 S  SD  . MET B 2 126 ? 16.251  2.255   34.529  1.00 86.63  ? 126 MET B SD  1 
ATOM   1748 C  CE  . MET B 2 126 ? 16.634  3.414   33.210  1.00 40.45  ? 126 MET B CE  1 
ATOM   1749 N  N   . SER B 2 127 ? 11.148  3.527   32.930  1.00 59.85  ? 127 SER B N   1 
ATOM   1750 C  CA  . SER B 2 127 ? 10.284  4.480   32.246  1.00 56.58  ? 127 SER B CA  1 
ATOM   1751 C  C   . SER B 2 127 ? 10.082  5.706   33.116  1.00 52.19  ? 127 SER B C   1 
ATOM   1752 O  O   . SER B 2 127 ? 10.151  6.835   32.636  1.00 54.37  ? 127 SER B O   1 
ATOM   1753 C  CB  . SER B 2 127 ? 8.932   3.851   31.916  1.00 60.34  ? 127 SER B CB  1 
ATOM   1754 O  OG  . SER B 2 127 ? 9.053   2.915   30.861  1.00 66.91  ? 127 SER B OG  1 
ATOM   1755 N  N   . CYS B 2 128 ? 9.836   5.474   34.400  1.00 46.43  ? 128 CYS B N   1 
ATOM   1756 C  CA  . CYS B 2 128 ? 9.646   6.561   35.349  1.00 45.63  ? 128 CYS B CA  1 
ATOM   1757 C  C   . CYS B 2 128 ? 10.896  7.432   35.462  1.00 49.10  ? 128 CYS B C   1 
ATOM   1758 O  O   . CYS B 2 128 ? 10.802  8.665   35.444  1.00 48.97  ? 128 CYS B O   1 
ATOM   1759 C  CB  . CYS B 2 128 ? 9.232   6.016   36.716  1.00 43.15  ? 128 CYS B CB  1 
ATOM   1760 S  SG  . CYS B 2 128 ? 7.571   5.299   36.730  1.00 54.01  ? 128 CYS B SG  1 
ATOM   1761 N  N   . MET B 2 129 ? 12.060  6.793   35.566  1.00 46.13  ? 129 MET B N   1 
ATOM   1762 C  CA  . MET B 2 129 ? 13.321  7.528   35.619  1.00 47.96  ? 129 MET B CA  1 
ATOM   1763 C  C   . MET B 2 129 ? 13.531  8.351   34.359  1.00 51.33  ? 129 MET B C   1 
ATOM   1764 O  O   . MET B 2 129 ? 13.919  9.518   34.427  1.00 51.63  ? 129 MET B O   1 
ATOM   1765 C  CB  . MET B 2 129 ? 14.508  6.588   35.807  1.00 50.01  ? 129 MET B CB  1 
ATOM   1766 C  CG  . MET B 2 129 ? 14.490  5.826   37.108  1.00 57.93  ? 129 MET B CG  1 
ATOM   1767 S  SD  . MET B 2 129 ? 16.150  5.586   37.754  1.00 86.09  ? 129 MET B SD  1 
ATOM   1768 C  CE  . MET B 2 129 ? 16.566  7.272   38.156  1.00 63.30  ? 129 MET B CE  1 
ATOM   1769 N  N   . LYS B 2 130 ? 13.272  7.738   33.209  1.00 52.30  ? 130 LYS B N   1 
ATOM   1770 C  CA  . LYS B 2 130 ? 13.448  8.426   31.937  1.00 52.36  ? 130 LYS B CA  1 
ATOM   1771 C  C   . LYS B 2 130 ? 12.499  9.611   31.804  1.00 50.78  ? 130 LYS B C   1 
ATOM   1772 O  O   . LYS B 2 130 ? 12.889  10.667  31.320  1.00 57.94  ? 130 LYS B O   1 
ATOM   1773 C  CB  . LYS B 2 130 ? 13.292  7.456   30.765  1.00 49.73  ? 130 LYS B CB  1 
ATOM   1774 C  CG  . LYS B 2 130 ? 14.511  6.581   30.548  1.00 51.88  ? 130 LYS B CG  1 
ATOM   1775 C  CD  . LYS B 2 130 ? 14.289  5.537   29.465  1.00 57.32  ? 130 LYS B CD  1 
ATOM   1776 C  CE  . LYS B 2 130 ? 15.585  4.798   29.167  1.00 58.44  ? 130 LYS B CE  1 
ATOM   1777 N  NZ  . LYS B 2 130 ? 15.433  3.778   28.097  1.00 61.14  ? 130 LYS B NZ  1 
ATOM   1778 N  N   . GLU B 2 131 ? 11.259  9.439   32.247  1.00 52.11  ? 131 GLU B N   1 
ATOM   1779 C  CA  . GLU B 2 131 ? 10.287  10.524  32.189  1.00 54.42  ? 131 GLU B CA  1 
ATOM   1780 C  C   . GLU B 2 131 ? 10.702  11.661  33.112  1.00 59.84  ? 131 GLU B C   1 
ATOM   1781 O  O   . GLU B 2 131 ? 10.639  12.832  32.736  1.00 62.11  ? 131 GLU B O   1 
ATOM   1782 C  CB  . GLU B 2 131 ? 8.888   10.035  32.559  1.00 50.07  ? 131 GLU B CB  1 
ATOM   1783 C  CG  . GLU B 2 131 ? 7.847   11.133  32.501  1.00 53.40  ? 131 GLU B CG  1 
ATOM   1784 C  CD  . GLU B 2 131 ? 6.440   10.634  32.755  1.00 55.78  ? 131 GLU B CD  1 
ATOM   1785 O  OE1 . GLU B 2 131 ? 6.256   9.409   32.926  1.00 56.68  ? 131 GLU B OE1 1 
ATOM   1786 O  OE2 . GLU B 2 131 ? 5.515   11.473  32.779  1.00 53.57  ? 131 GLU B OE2 1 
ATOM   1787 N  N   . ALA B 2 132 ? 11.130  11.305  34.320  1.00 55.91  ? 132 ALA B N   1 
ATOM   1788 C  CA  . ALA B 2 132 ? 11.622  12.284  35.280  1.00 48.67  ? 132 ALA B CA  1 
ATOM   1789 C  C   . ALA B 2 132 ? 12.789  13.088  34.712  1.00 51.50  ? 132 ALA B C   1 
ATOM   1790 O  O   . ALA B 2 132 ? 12.812  14.313  34.811  1.00 53.58  ? 132 ALA B O   1 
ATOM   1791 C  CB  . ALA B 2 132 ? 12.036  11.596  36.569  1.00 43.59  ? 132 ALA B CB  1 
ATOM   1792 N  N   . ASP B 2 133 ? 13.753  12.394  34.114  1.00 56.09  ? 133 ASP B N   1 
ATOM   1793 C  CA  . ASP B 2 133 ? 14.956  13.051  33.616  1.00 61.92  ? 133 ASP B CA  1 
ATOM   1794 C  C   . ASP B 2 133 ? 14.675  13.897  32.380  1.00 67.44  ? 133 ASP B C   1 
ATOM   1795 O  O   . ASP B 2 133 ? 15.434  14.815  32.064  1.00 69.90  ? 133 ASP B O   1 
ATOM   1796 C  CB  . ASP B 2 133 ? 16.064  12.039  33.328  1.00 63.05  ? 133 ASP B CB  1 
ATOM   1797 C  CG  . ASP B 2 133 ? 17.405  12.704  33.088  1.00 70.44  ? 133 ASP B CG  1 
ATOM   1798 O  OD1 . ASP B 2 133 ? 18.031  13.160  34.071  1.00 70.97  ? 133 ASP B OD1 1 
ATOM   1799 O  OD2 . ASP B 2 133 ? 17.832  12.779  31.917  1.00 74.48  ? 133 ASP B OD2 1 
ATOM   1800 N  N   . ALA B 2 134 ? 13.587  13.587  31.684  1.00 65.33  ? 134 ALA B N   1 
ATOM   1801 C  CA  . ALA B 2 134 ? 13.156  14.405  30.560  1.00 63.84  ? 134 ALA B CA  1 
ATOM   1802 C  C   . ALA B 2 134 ? 12.803  15.799  31.068  1.00 64.48  ? 134 ALA B C   1 
ATOM   1803 O  O   . ALA B 2 134 ? 13.197  16.809  30.484  1.00 65.49  ? 134 ALA B O   1 
ATOM   1804 C  CB  . ALA B 2 134 ? 11.963  13.767  29.866  1.00 60.60  ? 134 ALA B CB  1 
ATOM   1805 N  N   . LEU B 2 135 ? 12.068  15.838  32.175  1.00 60.50  ? 135 LEU B N   1 
ATOM   1806 C  CA  . LEU B 2 135 ? 11.682  17.090  32.808  1.00 56.92  ? 135 LEU B CA  1 
ATOM   1807 C  C   . LEU B 2 135 ? 12.892  17.826  33.372  1.00 57.03  ? 135 LEU B C   1 
ATOM   1808 O  O   . LEU B 2 135 ? 12.924  19.055  33.402  1.00 58.91  ? 135 LEU B O   1 
ATOM   1809 C  CB  . LEU B 2 135 ? 10.684  16.816  33.933  1.00 55.14  ? 135 LEU B CB  1 
ATOM   1810 C  CG  . LEU B 2 135 ? 9.355   16.191  33.513  1.00 57.16  ? 135 LEU B CG  1 
ATOM   1811 C  CD1 . LEU B 2 135 ? 8.563   15.749  34.731  1.00 55.43  ? 135 LEU B CD1 1 
ATOM   1812 C  CD2 . LEU B 2 135 ? 8.549   17.174  32.683  1.00 59.96  ? 135 LEU B CD2 1 
ATOM   1813 N  N   . LYS B 2 136 ? 13.887  17.069  33.818  1.00 58.10  ? 136 LYS B N   1 
ATOM   1814 C  CA  . LYS B 2 136 ? 15.029  17.651  34.517  1.00 57.51  ? 136 LYS B CA  1 
ATOM   1815 C  C   . LYS B 2 136 ? 16.137  18.148  33.592  1.00 59.64  ? 136 LYS B C   1 
ATOM   1816 O  O   . LYS B 2 136 ? 16.624  19.266  33.748  1.00 62.10  ? 136 LYS B O   1 
ATOM   1817 C  CB  . LYS B 2 136 ? 15.598  16.662  35.541  1.00 52.08  ? 136 LYS B CB  1 
ATOM   1818 C  CG  . LYS B 2 136 ? 14.751  16.520  36.795  1.00 52.16  ? 136 LYS B CG  1 
ATOM   1819 C  CD  . LYS B 2 136 ? 15.463  15.725  37.884  1.00 50.75  ? 136 LYS B CD  1 
ATOM   1820 C  CE  . LYS B 2 136 ? 15.619  14.264  37.505  1.00 52.07  ? 136 LYS B CE  1 
ATOM   1821 N  NZ  . LYS B 2 136 ? 16.352  13.491  38.548  1.00 51.04  ? 136 LYS B NZ  1 
ATOM   1822 N  N   . HIS B 2 137 ? 16.535  17.315  32.635  1.00 60.93  ? 137 HIS B N   1 
ATOM   1823 C  CA  . HIS B 2 137 ? 17.681  17.624  31.790  1.00 63.97  ? 137 HIS B CA  1 
ATOM   1824 C  C   . HIS B 2 137 ? 17.416  17.392  30.305  1.00 72.33  ? 137 HIS B C   1 
ATOM   1825 O  O   . HIS B 2 137 ? 18.360  17.207  29.540  1.00 74.75  ? 137 HIS B O   1 
ATOM   1826 C  CB  . HIS B 2 137 ? 18.887  16.767  32.188  1.00 61.41  ? 137 HIS B CB  1 
ATOM   1827 C  CG  . HIS B 2 137 ? 19.177  16.754  33.656  1.00 57.40  ? 137 HIS B CG  1 
ATOM   1828 N  ND1 . HIS B 2 137 ? 18.859  15.685  34.466  1.00 57.68  ? 137 HIS B ND1 1 
ATOM   1829 C  CD2 . HIS B 2 137 ? 19.782  17.665  34.454  1.00 57.20  ? 137 HIS B CD2 1 
ATOM   1830 C  CE1 . HIS B 2 137 ? 19.245  15.943  35.703  1.00 59.59  ? 137 HIS B CE1 1 
ATOM   1831 N  NE2 . HIS B 2 137 ? 19.807  17.139  35.723  1.00 59.64  ? 137 HIS B NE2 1 
ATOM   1832 N  N   . LYS B 2 138 ? 16.147  17.398  29.901  1.00 68.76  ? 138 LYS B N   1 
ATOM   1833 C  CA  . LYS B 2 138 ? 15.767  17.051  28.527  1.00 74.08  ? 138 LYS B CA  1 
ATOM   1834 C  C   . LYS B 2 138 ? 16.323  15.685  28.127  1.00 72.41  ? 138 LYS B C   1 
ATOM   1835 O  O   . LYS B 2 138 ? 16.809  15.511  27.009  1.00 73.11  ? 138 LYS B O   1 
ATOM   1836 C  CB  . LYS B 2 138 ? 16.230  18.120  27.530  1.00 81.11  ? 138 LYS B CB  1 
ATOM   1837 C  CG  . LYS B 2 138 ? 15.721  19.525  27.818  1.00 85.45  ? 138 LYS B CG  1 
ATOM   1838 C  CD  . LYS B 2 138 ? 16.213  20.512  26.767  1.00 89.43  ? 138 LYS B CD  1 
ATOM   1839 C  CE  . LYS B 2 138 ? 15.688  21.915  27.033  1.00 90.94  ? 138 LYS B CE  1 
ATOM   1840 N  NZ  . LYS B 2 138 ? 16.092  22.877  25.973  1.00 93.75  ? 138 LYS B NZ  1 
ATOM   1841 N  N   . SER B 2 139 ? 16.264  14.735  29.059  1.00 72.18  ? 139 SER B N   1 
ATOM   1842 C  CA  . SER B 2 139 ? 16.731  13.361  28.848  1.00 73.09  ? 139 SER B CA  1 
ATOM   1843 C  C   . SER B 2 139 ? 18.226  13.249  28.542  1.00 80.25  ? 139 SER B C   1 
ATOM   1844 O  O   . SER B 2 139 ? 18.685  12.213  28.064  1.00 85.50  ? 139 SER B O   1 
ATOM   1845 C  CB  . SER B 2 139 ? 15.919  12.664  27.749  1.00 70.88  ? 139 SER B CB  1 
ATOM   1846 O  OG  . SER B 2 139 ? 14.538  12.633  28.066  1.00 72.98  ? 139 SER B OG  1 
ATOM   1847 N  N   . GLN B 2 140 ? 18.984  14.303  28.830  1.00 80.24  ? 140 GLN B N   1 
ATOM   1848 C  CA  . GLN B 2 140 ? 20.401  14.332  28.478  1.00 79.57  ? 140 GLN B CA  1 
ATOM   1849 C  C   . GLN B 2 140 ? 21.274  13.486  29.396  1.00 79.80  ? 140 GLN B C   1 
ATOM   1850 O  O   . GLN B 2 140 ? 22.266  12.908  28.952  1.00 84.45  ? 140 GLN B O   1 
ATOM   1851 C  CB  . GLN B 2 140 ? 20.926  15.767  28.441  1.00 80.33  ? 140 GLN B CB  1 
ATOM   1852 C  CG  . GLN B 2 140 ? 20.450  16.568  27.243  1.00 81.55  ? 140 GLN B CG  1 
ATOM   1853 C  CD  . GLN B 2 140 ? 20.841  18.027  27.335  1.00 82.13  ? 140 GLN B CD  1 
ATOM   1854 O  OE1 . GLN B 2 140 ? 21.714  18.495  26.604  1.00 86.70  ? 140 GLN B OE1 1 
ATOM   1855 N  NE2 . GLN B 2 140 ? 20.195  18.757  28.239  1.00 78.46  ? 140 GLN B NE2 1 
ATOM   1856 N  N   . VAL B 2 141 ? 20.913  13.411  30.672  1.00 73.02  ? 141 VAL B N   1 
ATOM   1857 C  CA  . VAL B 2 141 ? 21.729  12.666  31.626  1.00 71.41  ? 141 VAL B CA  1 
ATOM   1858 C  C   . VAL B 2 141 ? 21.516  11.153  31.537  1.00 74.78  ? 141 VAL B C   1 
ATOM   1859 O  O   . VAL B 2 141 ? 22.479  10.386  31.543  1.00 77.72  ? 141 VAL B O   1 
ATOM   1860 C  CB  . VAL B 2 141 ? 21.505  13.147  33.072  1.00 64.49  ? 141 VAL B CB  1 
ATOM   1861 C  CG1 . VAL B 2 141 ? 22.373  12.356  34.038  1.00 59.03  ? 141 VAL B CG1 1 
ATOM   1862 C  CG2 . VAL B 2 141 ? 21.814  14.625  33.183  1.00 63.53  ? 141 VAL B CG2 1 
ATOM   1863 N  N   . ILE B 2 142 ? 20.262  10.725  31.438  1.00 74.17  ? 142 ILE B N   1 
ATOM   1864 C  CA  . ILE B 2 142 ? 19.962  9.296   31.476  1.00 74.69  ? 142 ILE B CA  1 
ATOM   1865 C  C   . ILE B 2 142 ? 20.151  8.601   30.127  1.00 77.59  ? 142 ILE B C   1 
ATOM   1866 O  O   . ILE B 2 142 ? 20.394  7.395   30.077  1.00 76.46  ? 142 ILE B O   1 
ATOM   1867 C  CB  . ILE B 2 142 ? 18.546  9.012   32.036  1.00 69.19  ? 142 ILE B CB  1 
ATOM   1868 C  CG1 . ILE B 2 142 ? 18.444  7.560   32.511  1.00 66.12  ? 142 ILE B CG1 1 
ATOM   1869 C  CG2 . ILE B 2 142 ? 17.474  9.343   31.006  1.00 67.15  ? 142 ILE B CG2 1 
ATOM   1870 C  CD1 . ILE B 2 142 ? 17.109  7.211   33.110  1.00 65.30  ? 142 ILE B CD1 1 
ATOM   1871 N  N   . ASN B 2 143 ? 20.049  9.357   29.038  1.00 80.55  ? 143 ASN B N   1 
ATOM   1872 C  CA  . ASN B 2 143 ? 20.234  8.780   27.710  1.00 79.84  ? 143 ASN B CA  1 
ATOM   1873 C  C   . ASN B 2 143 ? 21.683  8.809   27.244  1.00 80.04  ? 143 ASN B C   1 
ATOM   1874 O  O   . ASN B 2 143 ? 21.991  8.395   26.129  1.00 84.41  ? 143 ASN B O   1 
ATOM   1875 C  CB  . ASN B 2 143 ? 19.324  9.451   26.681  1.00 80.96  ? 143 ASN B CB  1 
ATOM   1876 C  CG  . ASN B 2 143 ? 17.896  8.952   26.758  1.00 85.90  ? 143 ASN B CG  1 
ATOM   1877 O  OD1 . ASN B 2 143 ? 17.637  7.849   27.242  1.00 86.97  ? 143 ASN B OD1 1 
ATOM   1878 N  ND2 . ASN B 2 143 ? 16.960  9.761   26.275  1.00 87.26  ? 143 ASN B ND2 1 
ATOM   1879 N  N   . GLU B 2 144 ? 22.571  9.297   28.103  1.00 78.32  ? 144 GLU B N   1 
ATOM   1880 C  CA  . GLU B 2 144 ? 23.997  9.278   27.809  1.00 81.51  ? 144 GLU B CA  1 
ATOM   1881 C  C   . GLU B 2 144 ? 24.737  8.331   28.744  1.00 87.12  ? 144 GLU B C   1 
ATOM   1882 O  O   . GLU B 2 144 ? 25.945  8.139   28.618  1.00 89.18  ? 144 GLU B O   1 
ATOM   1883 C  CB  . GLU B 2 144 ? 24.591  10.683  27.887  1.00 82.42  ? 144 GLU B CB  1 
ATOM   1884 C  CG  . GLU B 2 144 ? 24.152  11.588  26.752  1.00 87.71  ? 144 GLU B CG  1 
ATOM   1885 C  CD  . GLU B 2 144 ? 24.775  12.965  26.836  1.00 95.07  ? 144 GLU B CD  1 
ATOM   1886 O  OE1 . GLU B 2 144 ? 24.026  13.964  26.750  1.00 96.00  ? 144 GLU B OE1 1 
ATOM   1887 O  OE2 . GLU B 2 144 ? 26.013  13.049  26.984  1.00 98.09  ? 144 GLU B OE2 1 
ATOM   1888 N  N   . MET B 2 145 ? 24.003  7.743   29.684  1.00 91.49  ? 145 MET B N   1 
ATOM   1889 C  CA  . MET B 2 145 ? 24.561  6.730   30.571  1.00 92.84  ? 145 MET B CA  1 
ATOM   1890 C  C   . MET B 2 145 ? 24.784  5.426   29.817  1.00 97.92  ? 145 MET B C   1 
ATOM   1891 O  O   . MET B 2 145 ? 24.102  5.146   28.830  1.00 98.33  ? 145 MET B O   1 
ATOM   1892 C  CB  . MET B 2 145 ? 23.624  6.469   31.750  1.00 87.94  ? 145 MET B CB  1 
ATOM   1893 C  CG  . MET B 2 145 ? 23.619  7.544   32.813  1.00 85.76  ? 145 MET B CG  1 
ATOM   1894 S  SD  . MET B 2 145 ? 22.700  7.005   34.267  1.00 78.14  ? 145 MET B SD  1 
ATOM   1895 C  CE  . MET B 2 145 ? 22.845  8.449   35.317  1.00 75.27  ? 145 MET B CE  1 
ATOM   1896 N  N   . GLN B 2 146 ? 25.737  4.628   30.288  1.00 101.29 ? 146 GLN B N   1 
ATOM   1897 C  CA  . GLN B 2 146 ? 25.947  3.293   29.743  1.00 103.09 ? 146 GLN B CA  1 
ATOM   1898 C  C   . GLN B 2 146 ? 24.768  2.406   30.123  1.00 101.61 ? 146 GLN B C   1 
ATOM   1899 O  O   . GLN B 2 146 ? 24.026  2.713   31.059  1.00 97.38  ? 146 GLN B O   1 
ATOM   1900 C  CB  . GLN B 2 146 ? 27.245  2.686   30.283  1.00 105.18 ? 146 GLN B CB  1 
ATOM   1901 C  CG  . GLN B 2 146 ? 28.515  3.412   29.859  1.00 105.39 ? 146 GLN B CG  1 
ATOM   1902 C  CD  . GLN B 2 146 ? 28.920  3.099   28.432  1.00 108.31 ? 146 GLN B CD  1 
ATOM   1903 O  OE1 . GLN B 2 146 ? 28.517  2.080   27.868  1.00 109.79 ? 146 GLN B OE1 1 
ATOM   1904 N  NE2 . GLN B 2 146 ? 29.722  3.976   27.839  1.00 109.59 ? 146 GLN B NE2 1 
ATOM   1905 N  N   . LYS B 2 147 ? 24.600  1.304   29.401  1.00 103.56 ? 147 LYS B N   1 
ATOM   1906 C  CA  . LYS B 2 147 ? 23.566  0.332   29.727  1.00 98.92  ? 147 LYS B CA  1 
ATOM   1907 C  C   . LYS B 2 147 ? 23.887  -0.282  31.086  1.00 96.71  ? 147 LYS B C   1 
ATOM   1908 O  O   . LYS B 2 147 ? 22.998  -0.742  31.801  1.00 94.48  ? 147 LYS B O   1 
ATOM   1909 C  CB  . LYS B 2 147 ? 23.500  -0.752  28.650  1.00 100.69 ? 147 LYS B CB  1 
ATOM   1910 C  CG  . LYS B 2 147 ? 22.146  -1.438  28.514  1.00 101.66 ? 147 LYS B CG  1 
ATOM   1911 C  CD  . LYS B 2 147 ? 22.132  -2.366  27.305  1.00 106.13 ? 147 LYS B CD  1 
ATOM   1912 C  CE  . LYS B 2 147 ? 20.738  -2.902  27.011  1.00 105.08 ? 147 LYS B CE  1 
ATOM   1913 N  NZ  . LYS B 2 147 ? 20.706  -3.677  25.733  1.00 105.27 ? 147 LYS B NZ  1 
ATOM   1914 N  N   . LYS B 2 148 ? 25.170  -0.266  31.433  1.00 97.44  ? 148 LYS B N   1 
ATOM   1915 C  CA  . LYS B 2 148 ? 25.658  -0.804  32.696  1.00 95.33  ? 148 LYS B CA  1 
ATOM   1916 C  C   . LYS B 2 148 ? 25.150  0.007   33.882  1.00 91.53  ? 148 LYS B C   1 
ATOM   1917 O  O   . LYS B 2 148 ? 24.952  -0.526  34.974  1.00 92.47  ? 148 LYS B O   1 
ATOM   1918 C  CB  . LYS B 2 148 ? 27.188  -0.813  32.694  1.00 98.01  ? 148 LYS B CB  1 
ATOM   1919 C  CG  . LYS B 2 148 ? 27.789  -1.378  31.416  1.00 103.61 ? 148 LYS B CG  1 
ATOM   1920 C  CD  . LYS B 2 148 ? 29.308  -1.346  31.439  1.00 106.41 ? 148 LYS B CD  1 
ATOM   1921 C  CE  . LYS B 2 148 ? 29.887  -1.934  30.161  1.00 106.62 ? 148 LYS B CE  1 
ATOM   1922 N  NZ  . LYS B 2 148 ? 31.375  -1.962  30.182  1.00 106.96 ? 148 LYS B NZ  1 
ATOM   1923 N  N   . ASP B 2 149 ? 24.944  1.300   33.662  1.00 86.68  ? 149 ASP B N   1 
ATOM   1924 C  CA  . ASP B 2 149 ? 24.490  2.191   34.722  1.00 81.75  ? 149 ASP B CA  1 
ATOM   1925 C  C   . ASP B 2 149 ? 22.993  2.041   34.975  1.00 75.65  ? 149 ASP B C   1 
ATOM   1926 O  O   . ASP B 2 149 ? 22.535  2.137   36.114  1.00 71.78  ? 149 ASP B O   1 
ATOM   1927 C  CB  . ASP B 2 149 ? 24.840  3.643   34.389  1.00 84.58  ? 149 ASP B CB  1 
ATOM   1928 C  CG  . ASP B 2 149 ? 26.334  3.910   34.450  1.00 85.66  ? 149 ASP B CG  1 
ATOM   1929 O  OD1 . ASP B 2 149 ? 27.115  2.954   34.262  1.00 87.63  ? 149 ASP B OD1 1 
ATOM   1930 O  OD2 . ASP B 2 149 ? 26.728  5.071   34.693  1.00 85.12  ? 149 ASP B OD2 1 
ATOM   1931 N  N   . HIS B 2 150 ? 22.238  1.801   33.908  1.00 73.66  ? 150 HIS B N   1 
ATOM   1932 C  CA  . HIS B 2 150 ? 20.808  1.551   34.024  1.00 70.20  ? 150 HIS B CA  1 
ATOM   1933 C  C   . HIS B 2 150 ? 20.543  0.285   34.829  1.00 69.62  ? 150 HIS B C   1 
ATOM   1934 O  O   . HIS B 2 150 ? 19.501  0.154   35.465  1.00 72.42  ? 150 HIS B O   1 
ATOM   1935 C  CB  . HIS B 2 150 ? 20.165  1.432   32.641  1.00 73.82  ? 150 HIS B CB  1 
ATOM   1936 C  CG  . HIS B 2 150 ? 20.021  2.738   31.927  1.00 76.25  ? 150 HIS B CG  1 
ATOM   1937 N  ND1 . HIS B 2 150 ? 19.321  2.867   30.747  1.00 75.72  ? 150 HIS B ND1 1 
ATOM   1938 C  CD2 . HIS B 2 150 ? 20.480  3.975   32.229  1.00 77.52  ? 150 HIS B CD2 1 
ATOM   1939 C  CE1 . HIS B 2 150 ? 19.357  4.127   30.352  1.00 75.21  ? 150 HIS B CE1 1 
ATOM   1940 N  NE2 . HIS B 2 150 ? 20.055  4.820   31.234  1.00 75.42  ? 150 HIS B NE2 1 
ATOM   1941 N  N   . LYS B 2 151 ? 21.490  -0.647  34.793  1.00 70.62  ? 151 LYS B N   1 
ATOM   1942 C  CA  . LYS B 2 151 ? 21.382  -1.883  35.560  1.00 70.89  ? 151 LYS B CA  1 
ATOM   1943 C  C   . LYS B 2 151 ? 21.761  -1.665  37.023  1.00 68.47  ? 151 LYS B C   1 
ATOM   1944 O  O   . LYS B 2 151 ? 21.156  -2.249  37.921  1.00 65.55  ? 151 LYS B O   1 
ATOM   1945 C  CB  . LYS B 2 151 ? 22.259  -2.982  34.951  1.00 73.35  ? 151 LYS B CB  1 
ATOM   1946 C  CG  . LYS B 2 151 ? 21.758  -3.518  33.620  1.00 77.03  ? 151 LYS B CG  1 
ATOM   1947 C  CD  . LYS B 2 151 ? 20.389  -4.168  33.763  1.00 77.57  ? 151 LYS B CD  1 
ATOM   1948 C  CE  . LYS B 2 151 ? 19.810  -4.537  32.405  1.00 79.54  ? 151 LYS B CE  1 
ATOM   1949 N  NZ  . LYS B 2 151 ? 18.401  -5.013  32.511  1.00 79.34  ? 151 LYS B NZ  1 
ATOM   1950 N  N   . GLN B 2 152 ? 22.767  -0.828  37.259  1.00 66.80  ? 152 GLN B N   1 
ATOM   1951 C  CA  . GLN B 2 152 ? 23.211  -0.557  38.619  1.00 63.84  ? 152 GLN B CA  1 
ATOM   1952 C  C   . GLN B 2 152 ? 22.118  0.151   39.408  1.00 62.62  ? 152 GLN B C   1 
ATOM   1953 O  O   . GLN B 2 152 ? 21.950  -0.091  40.602  1.00 66.41  ? 152 GLN B O   1 
ATOM   1954 C  CB  . GLN B 2 152 ? 24.506  0.260   38.635  1.00 62.10  ? 152 GLN B CB  1 
ATOM   1955 C  CG  . GLN B 2 152 ? 25.066  0.459   40.034  1.00 62.99  ? 152 GLN B CG  1 
ATOM   1956 C  CD  . GLN B 2 152 ? 26.477  1.007   40.042  1.00 70.68  ? 152 GLN B CD  1 
ATOM   1957 O  OE1 . GLN B 2 152 ? 27.216  0.875   39.065  1.00 78.41  ? 152 GLN B OE1 1 
ATOM   1958 N  NE2 . GLN B 2 152 ? 26.860  1.626   41.151  1.00 69.89  ? 152 GLN B NE2 1 
ATOM   1959 N  N   . LEU B 2 153 ? 21.375  1.024   38.735  1.00 58.73  ? 153 LEU B N   1 
ATOM   1960 C  CA  . LEU B 2 153 ? 20.225  1.672   39.352  1.00 58.85  ? 153 LEU B CA  1 
ATOM   1961 C  C   . LEU B 2 153 ? 19.199  0.623   39.773  1.00 59.64  ? 153 LEU B C   1 
ATOM   1962 O  O   . LEU B 2 153 ? 18.752  0.601   40.918  1.00 59.28  ? 153 LEU B O   1 
ATOM   1963 C  CB  . LEU B 2 153 ? 19.591  2.683   38.394  1.00 55.41  ? 153 LEU B CB  1 
ATOM   1964 C  CG  . LEU B 2 153 ? 20.329  4.013   38.229  1.00 54.53  ? 153 LEU B CG  1 
ATOM   1965 C  CD1 . LEU B 2 153 ? 19.736  4.835   37.093  1.00 48.61  ? 153 LEU B CD1 1 
ATOM   1966 C  CD2 . LEU B 2 153 ? 20.312  4.800   39.532  1.00 49.40  ? 153 LEU B CD2 1 
ATOM   1967 N  N   . TRP B 2 154 ? 18.849  -0.254  38.840  1.00 60.39  ? 154 TRP B N   1 
ATOM   1968 C  CA  . TRP B 2 154 ? 17.872  -1.308  39.091  1.00 59.32  ? 154 TRP B CA  1 
ATOM   1969 C  C   . TRP B 2 154 ? 18.318  -2.288  40.178  1.00 62.42  ? 154 TRP B C   1 
ATOM   1970 O  O   . TRP B 2 154 ? 17.561  -2.582  41.107  1.00 64.34  ? 154 TRP B O   1 
ATOM   1971 C  CB  . TRP B 2 154 ? 17.559  -2.056  37.795  1.00 58.11  ? 154 TRP B CB  1 
ATOM   1972 C  CG  . TRP B 2 154 ? 16.783  -3.311  38.000  1.00 59.07  ? 154 TRP B CG  1 
ATOM   1973 C  CD1 . TRP B 2 154 ? 17.201  -4.583  37.739  1.00 59.44  ? 154 TRP B CD1 1 
ATOM   1974 C  CD2 . TRP B 2 154 ? 15.451  -3.424  38.520  1.00 57.33  ? 154 TRP B CD2 1 
ATOM   1975 N  NE1 . TRP B 2 154 ? 16.212  -5.480  38.058  1.00 62.34  ? 154 TRP B NE1 1 
ATOM   1976 C  CE2 . TRP B 2 154 ? 15.127  -4.795  38.541  1.00 58.19  ? 154 TRP B CE2 1 
ATOM   1977 C  CE3 . TRP B 2 154 ? 14.501  -2.500  38.966  1.00 53.23  ? 154 TRP B CE3 1 
ATOM   1978 C  CZ2 . TRP B 2 154 ? 13.898  -5.263  38.988  1.00 49.15  ? 154 TRP B CZ2 1 
ATOM   1979 C  CZ3 . TRP B 2 154 ? 13.279  -2.969  39.412  1.00 46.21  ? 154 TRP B CZ3 1 
ATOM   1980 C  CH2 . TRP B 2 154 ? 12.988  -4.337  39.418  1.00 53.52  ? 154 TRP B CH2 1 
ATOM   1981 N  N   . MET B 2 155 ? 19.542  -2.793  40.060  1.00 59.37  ? 155 MET B N   1 
ATOM   1982 C  CA  . MET B 2 155 ? 20.086  -3.710  41.054  1.00 57.15  ? 155 MET B CA  1 
ATOM   1983 C  C   . MET B 2 155 ? 20.186  -3.054  42.428  1.00 59.82  ? 155 MET B C   1 
ATOM   1984 O  O   . MET B 2 155 ? 20.024  -3.717  43.456  1.00 57.88  ? 155 MET B O   1 
ATOM   1985 C  CB  . MET B 2 155 ? 21.460  -4.216  40.624  1.00 58.86  ? 155 MET B CB  1 
ATOM   1986 C  CG  . MET B 2 155 ? 21.429  -5.272  39.532  1.00 63.32  ? 155 MET B CG  1 
ATOM   1987 S  SD  . MET B 2 155 ? 23.092  -5.661  38.947  1.00 122.19 ? 155 MET B SD  1 
ATOM   1988 C  CE  . MET B 2 155 ? 23.955  -5.884  40.503  1.00 62.94  ? 155 MET B CE  1 
ATOM   1989 N  N   . GLY B 2 156 ? 20.459  -1.752  42.437  1.00 59.02  ? 156 GLY B N   1 
ATOM   1990 C  CA  . GLY B 2 156 ? 20.537  -0.999  43.674  1.00 55.02  ? 156 GLY B CA  1 
ATOM   1991 C  C   . GLY B 2 156 ? 19.197  -1.002  44.379  1.00 56.64  ? 156 GLY B C   1 
ATOM   1992 O  O   . GLY B 2 156 ? 19.118  -1.212  45.591  1.00 56.55  ? 156 GLY B O   1 
ATOM   1993 N  N   . LEU B 2 157 ? 18.140  -0.782  43.602  1.00 56.88  ? 157 LEU B N   1 
ATOM   1994 C  CA  . LEU B 2 157 ? 16.776  -0.786  44.118  1.00 54.97  ? 157 LEU B CA  1 
ATOM   1995 C  C   . LEU B 2 157 ? 16.352  -2.170  44.607  1.00 55.02  ? 157 LEU B C   1 
ATOM   1996 O  O   . LEU B 2 157 ? 15.796  -2.312  45.697  1.00 56.05  ? 157 LEU B O   1 
ATOM   1997 C  CB  . LEU B 2 157 ? 15.803  -0.303  43.038  1.00 45.03  ? 157 LEU B CB  1 
ATOM   1998 C  CG  . LEU B 2 157 ? 14.318  -0.327  43.413  1.00 48.56  ? 157 LEU B CG  1 
ATOM   1999 C  CD1 . LEU B 2 157 ? 14.022  0.687   44.509  1.00 43.13  ? 157 LEU B CD1 1 
ATOM   2000 C  CD2 . LEU B 2 157 ? 13.440  -0.077  42.197  1.00 48.22  ? 157 LEU B CD2 1 
ATOM   2001 N  N   . GLN B 2 158 ? 16.625  -3.185  43.795  1.00 54.22  ? 158 GLN B N   1 
ATOM   2002 C  CA  . GLN B 2 158 ? 16.142  -4.533  44.061  1.00 56.33  ? 158 GLN B CA  1 
ATOM   2003 C  C   . GLN B 2 158 ? 16.814  -5.162  45.273  1.00 59.88  ? 158 GLN B C   1 
ATOM   2004 O  O   . GLN B 2 158 ? 16.165  -5.846  46.064  1.00 55.42  ? 158 GLN B O   1 
ATOM   2005 C  CB  . GLN B 2 158 ? 16.350  -5.416  42.830  1.00 58.29  ? 158 GLN B CB  1 
ATOM   2006 C  CG  . GLN B 2 158 ? 15.757  -6.805  42.956  1.00 59.42  ? 158 GLN B CG  1 
ATOM   2007 C  CD  . GLN B 2 158 ? 15.809  -7.578  41.653  1.00 63.65  ? 158 GLN B CD  1 
ATOM   2008 O  OE1 . GLN B 2 158 ? 16.574  -7.243  40.746  1.00 64.77  ? 158 GLN B OE1 1 
ATOM   2009 N  NE2 . GLN B 2 158 ? 14.987  -8.615  41.548  1.00 66.81  ? 158 GLN B NE2 1 
ATOM   2010 N  N   . ASN B 2 159 ? 18.114  -4.921  45.415  1.00 56.68  ? 159 ASN B N   1 
ATOM   2011 C  CA  . ASN B 2 159 ? 18.905  -5.536  46.476  1.00 57.34  ? 159 ASN B CA  1 
ATOM   2012 C  C   . ASN B 2 159 ? 19.059  -4.658  47.712  1.00 61.64  ? 159 ASN B C   1 
ATOM   2013 O  O   . ASN B 2 159 ? 19.883  -4.947  48.583  1.00 63.92  ? 159 ASN B O   1 
ATOM   2014 C  CB  . ASN B 2 159 ? 20.288  -5.911  45.947  1.00 62.07  ? 159 ASN B CB  1 
ATOM   2015 C  CG  . ASN B 2 159 ? 20.220  -6.784  44.714  1.00 67.32  ? 159 ASN B CG  1 
ATOM   2016 O  OD1 . ASN B 2 159 ? 19.289  -7.574  44.551  1.00 66.40  ? 159 ASN B OD1 1 
ATOM   2017 N  ND2 . ASN B 2 159 ? 21.209  -6.647  43.835  1.00 70.59  ? 159 ASN B ND2 1 
ATOM   2018 N  N   . ASP B 2 160 ? 18.274  -3.585  47.775  1.00 64.67  ? 160 ASP B N   1 
ATOM   2019 C  CA  . ASP B 2 160 ? 18.303  -2.658  48.905  1.00 64.55  ? 160 ASP B CA  1 
ATOM   2020 C  C   . ASP B 2 160 ? 19.722  -2.150  49.181  1.00 65.98  ? 160 ASP B C   1 
ATOM   2021 O  O   . ASP B 2 160 ? 20.170  -2.098  50.325  1.00 68.37  ? 160 ASP B O   1 
ATOM   2022 C  CB  . ASP B 2 160 ? 17.707  -3.321  50.150  1.00 62.77  ? 160 ASP B CB  1 
ATOM   2023 C  CG  . ASP B 2 160 ? 17.398  -2.328  51.248  1.00 67.50  ? 160 ASP B CG  1 
ATOM   2024 O  OD1 . ASP B 2 160 ? 17.222  -2.757  52.409  1.00 67.28  ? 160 ASP B OD1 1 
ATOM   2025 O  OD2 . ASP B 2 160 ? 17.340  -1.116  50.950  1.00 71.95  ? 160 ASP B OD2 1 
ATOM   2026 N  N   . ARG B 2 161 ? 20.427  -1.785  48.117  1.00 63.35  ? 161 ARG B N   1 
ATOM   2027 C  CA  . ARG B 2 161 ? 21.804  -1.329  48.231  1.00 64.53  ? 161 ARG B CA  1 
ATOM   2028 C  C   . ARG B 2 161 ? 21.877  0.178   48.043  1.00 62.11  ? 161 ARG B C   1 
ATOM   2029 O  O   . ARG B 2 161 ? 21.920  0.668   46.915  1.00 65.63  ? 161 ARG B O   1 
ATOM   2030 C  CB  . ARG B 2 161 ? 22.678  -2.029  47.189  1.00 70.72  ? 161 ARG B CB  1 
ATOM   2031 C  CG  . ARG B 2 161 ? 22.765  -3.539  47.355  1.00 73.54  ? 161 ARG B CG  1 
ATOM   2032 C  CD  . ARG B 2 161 ? 23.773  -3.923  48.426  1.00 79.02  ? 161 ARG B CD  1 
ATOM   2033 N  NE  . ARG B 2 161 ? 25.116  -3.460  48.086  1.00 88.39  ? 161 ARG B NE  1 
ATOM   2034 C  CZ  . ARG B 2 161 ? 25.956  -4.115  47.289  1.00 90.46  ? 161 ARG B CZ  1 
ATOM   2035 N  NH1 . ARG B 2 161 ? 25.592  -5.269  46.744  1.00 90.92  ? 161 ARG B NH1 1 
ATOM   2036 N  NH2 . ARG B 2 161 ? 27.159  -3.618  47.034  1.00 87.90  ? 161 ARG B NH2 1 
ATOM   2037 N  N   . PHE B 2 162 ? 21.898  0.908   49.154  1.00 60.41  ? 162 PHE B N   1 
ATOM   2038 C  CA  . PHE B 2 162 ? 21.854  2.367   49.125  1.00 59.31  ? 162 PHE B CA  1 
ATOM   2039 C  C   . PHE B 2 162 ? 23.017  2.993   48.354  1.00 62.80  ? 162 PHE B C   1 
ATOM   2040 O  O   . PHE B 2 162 ? 22.807  3.764   47.416  1.00 62.95  ? 162 PHE B O   1 
ATOM   2041 C  CB  . PHE B 2 162 ? 21.809  2.928   50.548  1.00 55.28  ? 162 PHE B CB  1 
ATOM   2042 C  CG  . PHE B 2 162 ? 21.849  4.427   50.608  1.00 58.40  ? 162 PHE B CG  1 
ATOM   2043 C  CD1 . PHE B 2 162 ? 20.691  5.171   50.449  1.00 59.49  ? 162 PHE B CD1 1 
ATOM   2044 C  CD2 . PHE B 2 162 ? 23.045  5.094   50.822  1.00 58.40  ? 162 PHE B CD2 1 
ATOM   2045 C  CE1 . PHE B 2 162 ? 20.724  6.553   50.503  1.00 60.45  ? 162 PHE B CE1 1 
ATOM   2046 C  CE2 . PHE B 2 162 ? 23.089  6.474   50.872  1.00 62.56  ? 162 PHE B CE2 1 
ATOM   2047 C  CZ  . PHE B 2 162 ? 21.926  7.207   50.712  1.00 64.26  ? 162 PHE B CZ  1 
ATOM   2048 N  N   . ASP B 2 163 ? 24.240  2.663   48.758  1.00 64.85  ? 163 ASP B N   1 
ATOM   2049 C  CA  . ASP B 2 163 ? 25.432  3.248   48.149  1.00 70.93  ? 163 ASP B CA  1 
ATOM   2050 C  C   . ASP B 2 163 ? 25.581  2.883   46.674  1.00 69.62  ? 163 ASP B C   1 
ATOM   2051 O  O   . ASP B 2 163 ? 26.106  3.669   45.885  1.00 69.56  ? 163 ASP B O   1 
ATOM   2052 C  CB  . ASP B 2 163 ? 26.690  2.840   48.922  1.00 78.11  ? 163 ASP B CB  1 
ATOM   2053 C  CG  . ASP B 2 163 ? 26.732  3.428   50.319  1.00 84.41  ? 163 ASP B CG  1 
ATOM   2054 O  OD1 . ASP B 2 163 ? 26.274  4.578   50.496  1.00 84.61  ? 163 ASP B OD1 1 
ATOM   2055 O  OD2 . ASP B 2 163 ? 27.220  2.739   51.242  1.00 87.63  ? 163 ASP B OD2 1 
ATOM   2056 N  N   . GLN B 2 164 ? 25.118  1.691   46.308  1.00 69.38  ? 164 GLN B N   1 
ATOM   2057 C  CA  . GLN B 2 164 ? 25.200  1.233   44.925  1.00 70.78  ? 164 GLN B CA  1 
ATOM   2058 C  C   . GLN B 2 164 ? 24.262  2.038   44.035  1.00 72.38  ? 164 GLN B C   1 
ATOM   2059 O  O   . GLN B 2 164 ? 24.590  2.353   42.890  1.00 75.45  ? 164 GLN B O   1 
ATOM   2060 C  CB  . GLN B 2 164 ? 24.863  -0.256  44.821  1.00 70.07  ? 164 GLN B CB  1 
ATOM   2061 C  CG  . GLN B 2 164 ? 24.905  -0.789  43.398  1.00 75.00  ? 164 GLN B CG  1 
ATOM   2062 C  CD  . GLN B 2 164 ? 24.401  -2.215  43.276  1.00 82.18  ? 164 GLN B CD  1 
ATOM   2063 O  OE1 . GLN B 2 164 ? 23.992  -2.833  44.259  1.00 86.77  ? 164 GLN B OE1 1 
ATOM   2064 N  NE2 . GLN B 2 164 ? 24.425  -2.745  42.059  1.00 86.26  ? 164 GLN B NE2 1 
ATOM   2065 N  N   . PHE B 2 165 ? 23.095  2.372   44.574  1.00 66.42  ? 165 PHE B N   1 
ATOM   2066 C  CA  . PHE B 2 165 ? 22.085  3.111   43.830  1.00 59.44  ? 165 PHE B CA  1 
ATOM   2067 C  C   . PHE B 2 165 ? 22.477  4.571   43.640  1.00 60.58  ? 165 PHE B C   1 
ATOM   2068 O  O   . PHE B 2 165 ? 22.319  5.129   42.555  1.00 59.01  ? 165 PHE B O   1 
ATOM   2069 C  CB  . PHE B 2 165 ? 20.738  3.027   44.550  1.00 54.68  ? 165 PHE B CB  1 
ATOM   2070 C  CG  . PHE B 2 165 ? 19.643  3.801   43.878  1.00 53.03  ? 165 PHE B CG  1 
ATOM   2071 C  CD1 . PHE B 2 165 ? 18.914  3.235   42.841  1.00 49.30  ? 165 PHE B CD1 1 
ATOM   2072 C  CD2 . PHE B 2 165 ? 19.338  5.095   44.282  1.00 53.54  ? 165 PHE B CD2 1 
ATOM   2073 C  CE1 . PHE B 2 165 ? 17.901  3.946   42.218  1.00 48.78  ? 165 PHE B CE1 1 
ATOM   2074 C  CE2 . PHE B 2 165 ? 18.329  5.812   43.663  1.00 50.58  ? 165 PHE B CE2 1 
ATOM   2075 C  CZ  . PHE B 2 165 ? 17.610  5.238   42.629  1.00 50.58  ? 165 PHE B CZ  1 
ATOM   2076 N  N   . TRP B 2 166 ? 22.976  5.195   44.702  1.00 61.10  ? 166 TRP B N   1 
ATOM   2077 C  CA  . TRP B 2 166 ? 23.269  6.622   44.655  1.00 60.28  ? 166 TRP B CA  1 
ATOM   2078 C  C   . TRP B 2 166 ? 24.571  6.938   43.930  1.00 63.75  ? 166 TRP B C   1 
ATOM   2079 O  O   . TRP B 2 166 ? 24.812  8.084   43.555  1.00 68.12  ? 166 TRP B O   1 
ATOM   2080 C  CB  . TRP B 2 166 ? 23.244  7.243   46.054  1.00 54.19  ? 166 TRP B CB  1 
ATOM   2081 C  CG  . TRP B 2 166 ? 21.866  7.651   46.479  1.00 54.61  ? 166 TRP B CG  1 
ATOM   2082 C  CD1 . TRP B 2 166 ? 21.008  6.946   47.274  1.00 55.11  ? 166 TRP B CD1 1 
ATOM   2083 C  CD2 . TRP B 2 166 ? 21.175  8.853   46.113  1.00 53.11  ? 166 TRP B CD2 1 
ATOM   2084 N  NE1 . TRP B 2 166 ? 19.832  7.639   47.435  1.00 51.78  ? 166 TRP B NE1 1 
ATOM   2085 C  CE2 . TRP B 2 166 ? 19.908  8.812   46.731  1.00 50.90  ? 166 TRP B CE2 1 
ATOM   2086 C  CE3 . TRP B 2 166 ? 21.507  9.961   45.326  1.00 53.12  ? 166 TRP B CE3 1 
ATOM   2087 C  CZ2 . TRP B 2 166 ? 18.973  9.836   46.588  1.00 49.81  ? 166 TRP B CZ2 1 
ATOM   2088 C  CZ3 . TRP B 2 166 ? 20.578  10.975  45.184  1.00 54.03  ? 166 TRP B CZ3 1 
ATOM   2089 C  CH2 . TRP B 2 166 ? 19.324  10.906  45.811  1.00 51.64  ? 166 TRP B CH2 1 
ATOM   2090 N  N   . ALA B 2 167 ? 25.402  5.922   43.727  1.00 60.57  ? 167 ALA B N   1 
ATOM   2091 C  CA  . ALA B 2 167 ? 26.608  6.086   42.927  1.00 64.32  ? 167 ALA B CA  1 
ATOM   2092 C  C   . ALA B 2 167 ? 26.229  6.533   41.519  1.00 65.43  ? 167 ALA B C   1 
ATOM   2093 O  O   . ALA B 2 167 ? 26.963  7.278   40.873  1.00 65.97  ? 167 ALA B O   1 
ATOM   2094 C  CB  . ALA B 2 167 ? 27.393  4.788   42.879  1.00 64.75  ? 167 ALA B CB  1 
ATOM   2095 N  N   . ILE B 2 168 ? 25.068  6.080   41.058  1.00 64.70  ? 168 ILE B N   1 
ATOM   2096 C  CA  . ILE B 2 168 ? 24.577  6.430   39.734  1.00 64.00  ? 168 ILE B CA  1 
ATOM   2097 C  C   . ILE B 2 168 ? 23.525  7.532   39.805  1.00 63.87  ? 168 ILE B C   1 
ATOM   2098 O  O   . ILE B 2 168 ? 23.491  8.429   38.964  1.00 67.32  ? 168 ILE B O   1 
ATOM   2099 C  CB  . ILE B 2 168 ? 23.980  5.202   39.026  1.00 60.13  ? 168 ILE B CB  1 
ATOM   2100 C  CG1 . ILE B 2 168 ? 25.003  4.066   38.999  1.00 58.24  ? 168 ILE B CG1 1 
ATOM   2101 C  CG2 . ILE B 2 168 ? 23.536  5.555   37.613  1.00 59.90  ? 168 ILE B CG2 1 
ATOM   2102 C  CD1 . ILE B 2 168 ? 26.295  4.433   38.304  1.00 55.96  ? 168 ILE B CD1 1 
ATOM   2103 N  N   . ASN B 2 169 ? 22.672  7.466   40.820  1.00 62.23  ? 169 ASN B N   1 
ATOM   2104 C  CA  . ASN B 2 169 ? 21.556  8.395   40.933  1.00 59.07  ? 169 ASN B CA  1 
ATOM   2105 C  C   . ASN B 2 169 ? 21.993  9.823   41.246  1.00 64.71  ? 169 ASN B C   1 
ATOM   2106 O  O   . ASN B 2 169 ? 21.252  10.772  40.986  1.00 65.46  ? 169 ASN B O   1 
ATOM   2107 C  CB  . ASN B 2 169 ? 20.557  7.911   41.984  1.00 56.50  ? 169 ASN B CB  1 
ATOM   2108 C  CG  . ASN B 2 169 ? 19.203  8.581   41.851  1.00 58.12  ? 169 ASN B CG  1 
ATOM   2109 O  OD1 . ASN B 2 169 ? 18.656  8.684   40.751  1.00 59.22  ? 169 ASN B OD1 1 
ATOM   2110 N  ND2 . ASN B 2 169 ? 18.658  9.051   42.969  1.00 46.20  ? 169 ASN B ND2 1 
ATOM   2111 N  N   . ARG B 2 170 ? 23.192  9.977   41.801  1.00 64.86  ? 170 ARG B N   1 
ATOM   2112 C  CA  . ARG B 2 170 ? 23.698  11.306  42.116  1.00 63.27  ? 170 ARG B CA  1 
ATOM   2113 C  C   . ARG B 2 170 ? 23.956  12.109  40.843  1.00 66.48  ? 170 ARG B C   1 
ATOM   2114 O  O   . ARG B 2 170 ? 23.864  13.338  40.849  1.00 68.78  ? 170 ARG B O   1 
ATOM   2115 C  CB  . ARG B 2 170 ? 24.955  11.236  42.988  1.00 62.86  ? 170 ARG B CB  1 
ATOM   2116 C  CG  . ARG B 2 170 ? 26.185  10.680  42.299  1.00 69.96  ? 170 ARG B CG  1 
ATOM   2117 C  CD  . ARG B 2 170 ? 27.406  10.810  43.195  1.00 78.28  ? 170 ARG B CD  1 
ATOM   2118 N  NE  . ARG B 2 170 ? 28.588  10.192  42.604  1.00 88.37  ? 170 ARG B NE  1 
ATOM   2119 C  CZ  . ARG B 2 170 ? 29.809  10.264  43.126  1.00 96.52  ? 170 ARG B CZ  1 
ATOM   2120 N  NH1 . ARG B 2 170 ? 30.011  10.934  44.252  1.00 100.14 ? 170 ARG B NH1 1 
ATOM   2121 N  NH2 . ARG B 2 170 ? 30.829  9.669   42.521  1.00 98.90  ? 170 ARG B NH2 1 
ATOM   2122 N  N   . LYS B 2 171 ? 24.263  11.409  39.753  1.00 68.48  ? 171 LYS B N   1 
ATOM   2123 C  CA  . LYS B 2 171 ? 24.457  12.048  38.456  1.00 73.09  ? 171 LYS B CA  1 
ATOM   2124 C  C   . LYS B 2 171 ? 23.160  12.689  37.983  1.00 73.70  ? 171 LYS B C   1 
ATOM   2125 O  O   . LYS B 2 171 ? 23.169  13.726  37.323  1.00 74.70  ? 171 LYS B O   1 
ATOM   2126 C  CB  . LYS B 2 171 ? 24.918  11.031  37.410  1.00 77.46  ? 171 LYS B CB  1 
ATOM   2127 C  CG  . LYS B 2 171 ? 26.249  10.358  37.703  1.00 84.23  ? 171 LYS B CG  1 
ATOM   2128 C  CD  . LYS B 2 171 ? 26.639  9.432   36.557  1.00 87.63  ? 171 LYS B CD  1 
ATOM   2129 C  CE  . LYS B 2 171 ? 27.909  8.658   36.865  1.00 90.96  ? 171 LYS B CE  1 
ATOM   2130 N  NZ  . LYS B 2 171 ? 28.214  7.656   35.804  1.00 92.32  ? 171 LYS B NZ  1 
ATOM   2131 N  N   . LEU B 2 172 ? 22.042  12.057  38.321  1.00 72.27  ? 172 LEU B N   1 
ATOM   2132 C  CA  . LEU B 2 172 ? 20.733  12.538  37.902  1.00 69.44  ? 172 LEU B CA  1 
ATOM   2133 C  C   . LEU B 2 172 ? 20.221  13.660  38.802  1.00 68.08  ? 172 LEU B C   1 
ATOM   2134 O  O   . LEU B 2 172 ? 19.200  14.282  38.511  1.00 65.99  ? 172 LEU B O   1 
ATOM   2135 C  CB  . LEU B 2 172 ? 19.738  11.380  37.874  1.00 66.32  ? 172 LEU B CB  1 
ATOM   2136 C  CG  . LEU B 2 172 ? 20.067  10.293  36.849  1.00 66.90  ? 172 LEU B CG  1 
ATOM   2137 C  CD1 . LEU B 2 172 ? 19.543  8.945   37.304  1.00 63.50  ? 172 LEU B CD1 1 
ATOM   2138 C  CD2 . LEU B 2 172 ? 19.499  10.652  35.485  1.00 65.74  ? 172 LEU B CD2 1 
ATOM   2139 N  N   . MET B 2 173 ? 20.936  13.921  39.892  1.00 68.82  ? 173 MET B N   1 
ATOM   2140 C  CA  . MET B 2 173 ? 20.518  14.940  40.847  1.00 71.74  ? 173 MET B CA  1 
ATOM   2141 C  C   . MET B 2 173 ? 21.358  16.207  40.745  1.00 77.85  ? 173 MET B C   1 
ATOM   2142 O  O   . MET B 2 173 ? 21.191  17.140  41.532  1.00 76.18  ? 173 MET B O   1 
ATOM   2143 C  CB  . MET B 2 173 ? 20.559  14.393  42.277  1.00 69.47  ? 173 MET B CB  1 
ATOM   2144 C  CG  . MET B 2 173 ? 19.474  13.377  42.575  1.00 65.29  ? 173 MET B CG  1 
ATOM   2145 S  SD  . MET B 2 173 ? 17.840  13.989  42.120  1.00 62.80  ? 173 MET B SD  1 
ATOM   2146 C  CE  . MET B 2 173 ? 16.817  12.595  42.597  1.00 55.89  ? 173 MET B CE  1 
ATOM   2147 N  N   . GLU B 2 174 ? 22.262  16.239  39.775  1.00 74.23  ? 174 GLU B N   1 
ATOM   2148 C  CA  . GLU B 2 174 ? 23.077  17.423  39.559  1.00 80.15  ? 174 GLU B CA  1 
ATOM   2149 C  C   . GLU B 2 174 ? 22.563  18.231  38.370  1.00 79.33  ? 174 GLU B C   1 
ATOM   2150 O  O   . GLU B 2 174 ? 21.754  17.749  37.576  1.00 79.25  ? 174 GLU B O   1 
ATOM   2151 C  CB  . GLU B 2 174 ? 24.549  17.047  39.374  1.00 86.57  ? 174 GLU B CB  1 
ATOM   2152 C  CG  . GLU B 2 174 ? 24.827  16.194  38.154  1.00 91.96  ? 174 GLU B CG  1 
ATOM   2153 C  CD  . GLU B 2 174 ? 26.282  15.786  38.054  1.00 99.74  ? 174 GLU B CD  1 
ATOM   2154 O  OE1 . GLU B 2 174 ? 27.019  15.975  39.045  1.00 102.34 ? 174 GLU B OE1 1 
ATOM   2155 O  OE2 . GLU B 2 174 ? 26.688  15.282  36.984  1.00 102.27 ? 174 GLU B OE2 1 
ATOM   2156 N  N   . TYR B 2 175 ? 23.038  19.466  38.260  1.00 77.25  ? 175 TYR B N   1 
ATOM   2157 C  CA  . TYR B 2 175 ? 22.561  20.391  37.244  1.00 76.35  ? 175 TYR B CA  1 
ATOM   2158 C  C   . TYR B 2 175 ? 23.688  21.355  36.876  1.00 81.52  ? 175 TYR B C   1 
ATOM   2159 O  O   . TYR B 2 175 ? 24.599  21.568  37.678  1.00 83.58  ? 175 TYR B O   1 
ATOM   2160 C  CB  . TYR B 2 175 ? 21.330  21.145  37.763  1.00 73.49  ? 175 TYR B CB  1 
ATOM   2161 C  CG  . TYR B 2 175 ? 21.498  21.717  39.154  1.00 71.26  ? 175 TYR B CG  1 
ATOM   2162 C  CD1 . TYR B 2 175 ? 21.983  23.005  39.345  1.00 70.25  ? 175 TYR B CD1 1 
ATOM   2163 C  CD2 . TYR B 2 175 ? 21.168  20.970  40.277  1.00 65.60  ? 175 TYR B CD2 1 
ATOM   2164 C  CE1 . TYR B 2 175 ? 22.137  23.530  40.613  1.00 66.65  ? 175 TYR B CE1 1 
ATOM   2165 C  CE2 . TYR B 2 175 ? 21.322  21.486  41.547  1.00 65.02  ? 175 TYR B CE2 1 
ATOM   2166 C  CZ  . TYR B 2 175 ? 21.805  22.766  41.708  1.00 66.02  ? 175 TYR B CZ  1 
ATOM   2167 O  OH  . TYR B 2 175 ? 21.955  23.279  42.973  1.00 70.43  ? 175 TYR B OH  1 
ATOM   2168 N  N   . PRO B 2 176 ? 23.641  21.928  35.658  1.00 81.60  ? 176 PRO B N   1 
ATOM   2169 C  CA  . PRO B 2 176 ? 24.696  22.832  35.180  1.00 86.01  ? 176 PRO B CA  1 
ATOM   2170 C  C   . PRO B 2 176 ? 24.995  23.979  36.144  1.00 93.99  ? 176 PRO B C   1 
ATOM   2171 O  O   . PRO B 2 176 ? 24.103  24.434  36.860  1.00 95.43  ? 176 PRO B O   1 
ATOM   2172 C  CB  . PRO B 2 176 ? 24.130  23.372  33.858  1.00 85.77  ? 176 PRO B CB  1 
ATOM   2173 C  CG  . PRO B 2 176 ? 22.674  22.997  33.858  1.00 84.13  ? 176 PRO B CG  1 
ATOM   2174 C  CD  . PRO B 2 176 ? 22.596  21.733  34.639  1.00 79.53  ? 176 PRO B CD  1 
ATOM   2175 N  N   . ALA B 2 177 ? 26.247  24.432  36.148  1.00 98.61  ? 177 ALA B N   1 
ATOM   2176 C  CA  . ALA B 2 177 ? 26.722  25.427  37.109  1.00 101.22 ? 177 ALA B CA  1 
ATOM   2177 C  C   . ALA B 2 177 ? 25.957  26.750  37.057  1.00 104.00 ? 177 ALA B C   1 
ATOM   2178 O  O   . ALA B 2 177 ? 25.556  27.280  38.094  1.00 103.33 ? 177 ALA B O   1 
ATOM   2179 C  CB  . ALA B 2 177 ? 28.216  25.669  36.922  1.00 100.59 ? 177 ALA B CB  1 
ATOM   2180 N  N   . GLU B 2 178 ? 25.759  27.277  35.852  1.00 105.43 ? 178 GLU B N   1 
ATOM   2181 C  CA  . GLU B 2 178 ? 25.098  28.569  35.675  1.00 109.76 ? 178 GLU B CA  1 
ATOM   2182 C  C   . GLU B 2 178 ? 23.652  28.562  36.175  1.00 106.44 ? 178 GLU B C   1 
ATOM   2183 O  O   . GLU B 2 178 ? 23.125  29.592  36.598  1.00 107.51 ? 178 GLU B O   1 
ATOM   2184 C  CB  . GLU B 2 178 ? 25.162  29.022  34.209  1.00 115.70 ? 178 GLU B CB  1 
ATOM   2185 C  CG  . GLU B 2 178 ? 24.536  28.060  33.201  1.00 118.14 ? 178 GLU B CG  1 
ATOM   2186 C  CD  . GLU B 2 178 ? 25.482  26.954  32.755  1.00 122.48 ? 178 GLU B CD  1 
ATOM   2187 O  OE1 . GLU B 2 178 ? 26.330  26.518  33.564  1.00 124.21 ? 178 GLU B OE1 1 
ATOM   2188 O  OE2 . GLU B 2 178 ? 25.378  26.519  31.588  1.00 122.95 ? 178 GLU B OE2 1 
ATOM   2189 N  N   . GLU B 2 179 ? 23.019  27.395  36.130  1.00 101.44 ? 179 GLU B N   1 
ATOM   2190 C  CA  . GLU B 2 179 ? 21.663  27.240  36.638  1.00 95.56  ? 179 GLU B CA  1 
ATOM   2191 C  C   . GLU B 2 179 ? 21.691  27.004  38.143  1.00 90.75  ? 179 GLU B C   1 
ATOM   2192 O  O   . GLU B 2 179 ? 22.754  26.782  38.725  1.00 91.84  ? 179 GLU B O   1 
ATOM   2193 C  CB  . GLU B 2 179 ? 20.958  26.076  35.937  1.00 91.95  ? 179 GLU B CB  1 
ATOM   2194 C  CG  . GLU B 2 179 ? 20.805  26.247  34.432  1.00 92.01  ? 179 GLU B CG  1 
ATOM   2195 C  CD  . GLU B 2 179 ? 19.804  27.327  34.060  1.00 96.25  ? 179 GLU B CD  1 
ATOM   2196 O  OE1 . GLU B 2 179 ? 19.024  27.754  34.939  1.00 94.27  ? 179 GLU B OE1 1 
ATOM   2197 O  OE2 . GLU B 2 179 ? 19.795  27.749  32.884  1.00 101.31 ? 179 GLU B OE2 1 
ATOM   2198 N  N   . ASN B 2 180 ? 20.520  27.056  38.770  1.00 81.68  ? 180 ASN B N   1 
ATOM   2199 C  CA  . ASN B 2 180 ? 20.412  26.817  40.204  1.00 77.28  ? 180 ASN B CA  1 
ATOM   2200 C  C   . ASN B 2 180 ? 19.405  25.718  40.517  1.00 74.94  ? 180 ASN B C   1 
ATOM   2201 O  O   . ASN B 2 180 ? 18.881  25.632  41.628  1.00 73.49  ? 180 ASN B O   1 
ATOM   2202 C  CB  . ASN B 2 180 ? 20.044  28.106  40.938  1.00 79.24  ? 180 ASN B CB  1 
ATOM   2203 C  CG  . ASN B 2 180 ? 21.138  29.152  40.856  1.00 82.32  ? 180 ASN B CG  1 
ATOM   2204 O  OD1 . ASN B 2 180 ? 22.026  29.204  41.706  1.00 86.38  ? 180 ASN B OD1 1 
ATOM   2205 N  ND2 . ASN B 2 180 ? 21.082  29.990  39.826  1.00 80.52  ? 180 ASN B ND2 1 
ATOM   2206 N  N   . GLY B 2 181 ? 19.144  24.877  39.522  1.00 71.48  ? 181 GLY B N   1 
ATOM   2207 C  CA  . GLY B 2 181 ? 18.224  23.770  39.674  1.00 65.66  ? 181 GLY B CA  1 
ATOM   2208 C  C   . GLY B 2 181 ? 17.948  23.063  38.362  1.00 60.41  ? 181 GLY B C   1 
ATOM   2209 O  O   . GLY B 2 181 ? 18.532  23.388  37.330  1.00 57.10  ? 181 GLY B O   1 
ATOM   2210 N  N   . PHE B 2 182 ? 17.052  22.085  38.409  1.00 56.86  ? 182 PHE B N   1 
ATOM   2211 C  CA  . PHE B 2 182 ? 16.648  21.357  37.217  1.00 55.44  ? 182 PHE B CA  1 
ATOM   2212 C  C   . PHE B 2 182 ? 15.820  22.260  36.312  1.00 55.51  ? 182 PHE B C   1 
ATOM   2213 O  O   . PHE B 2 182 ? 15.394  23.342  36.723  1.00 50.71  ? 182 PHE B O   1 
ATOM   2214 C  CB  . PHE B 2 182 ? 15.827  20.130  37.613  1.00 56.34  ? 182 PHE B CB  1 
ATOM   2215 C  CG  . PHE B 2 182 ? 16.531  19.217  38.577  1.00 58.31  ? 182 PHE B CG  1 
ATOM   2216 C  CD1 . PHE B 2 182 ? 17.871  18.901  38.404  1.00 57.50  ? 182 PHE B CD1 1 
ATOM   2217 C  CD2 . PHE B 2 182 ? 15.856  18.684  39.663  1.00 56.75  ? 182 PHE B CD2 1 
ATOM   2218 C  CE1 . PHE B 2 182 ? 18.521  18.063  39.289  1.00 54.33  ? 182 PHE B CE1 1 
ATOM   2219 C  CE2 . PHE B 2 182 ? 16.499  17.847  40.550  1.00 55.06  ? 182 PHE B CE2 1 
ATOM   2220 C  CZ  . PHE B 2 182 ? 17.836  17.536  40.362  1.00 55.04  ? 182 PHE B CZ  1 
ATOM   2221 N  N   . ARG B 2 183 ? 15.593  21.820  35.079  1.00 52.04  ? 183 ARG B N   1 
ATOM   2222 C  CA  . ARG B 2 183 ? 14.736  22.571  34.173  1.00 58.05  ? 183 ARG B CA  1 
ATOM   2223 C  C   . ARG B 2 183 ? 13.318  22.606  34.735  1.00 56.52  ? 183 ARG B C   1 
ATOM   2224 O  O   . ARG B 2 183 ? 12.786  23.677  35.027  1.00 60.83  ? 183 ARG B O   1 
ATOM   2225 C  CB  . ARG B 2 183 ? 14.763  21.970  32.767  1.00 64.00  ? 183 ARG B CB  1 
ATOM   2226 C  CG  . ARG B 2 183 ? 13.975  22.768  31.736  1.00 74.60  ? 183 ARG B CG  1 
ATOM   2227 C  CD  . ARG B 2 183 ? 14.358  22.366  30.317  1.00 84.18  ? 183 ARG B CD  1 
ATOM   2228 N  NE  . ARG B 2 183 ? 13.437  22.903  29.316  1.00 92.96  ? 183 ARG B NE  1 
ATOM   2229 C  CZ  . ARG B 2 183 ? 13.522  24.123  28.791  1.00 105.70 ? 183 ARG B CZ  1 
ATOM   2230 N  NH1 . ARG B 2 183 ? 14.488  24.953  29.171  1.00 109.47 ? 183 ARG B NH1 1 
ATOM   2231 N  NH2 . ARG B 2 183 ? 12.636  24.517  27.886  1.00 110.91 ? 183 ARG B NH2 1 
ATOM   2232 N  N   . TYR B 2 184 ? 12.720  21.428  34.896  1.00 51.56  ? 184 TYR B N   1 
ATOM   2233 C  CA  . TYR B 2 184 ? 11.433  21.294  35.572  1.00 57.85  ? 184 TYR B CA  1 
ATOM   2234 C  C   . TYR B 2 184 ? 11.553  20.276  36.705  1.00 56.99  ? 184 TYR B C   1 
ATOM   2235 O  O   . TYR B 2 184 ? 12.366  19.357  36.627  1.00 57.86  ? 184 TYR B O   1 
ATOM   2236 C  CB  . TYR B 2 184 ? 10.348  20.851  34.589  1.00 59.79  ? 184 TYR B CB  1 
ATOM   2237 C  CG  . TYR B 2 184 ? 10.099  21.816  33.453  1.00 63.45  ? 184 TYR B CG  1 
ATOM   2238 C  CD1 . TYR B 2 184 ? 9.358   22.972  33.649  1.00 69.96  ? 184 TYR B CD1 1 
ATOM   2239 C  CD2 . TYR B 2 184 ? 10.595  21.564  32.179  1.00 64.38  ? 184 TYR B CD2 1 
ATOM   2240 C  CE1 . TYR B 2 184 ? 9.126   23.858  32.613  1.00 74.00  ? 184 TYR B CE1 1 
ATOM   2241 C  CE2 . TYR B 2 184 ? 10.366  22.443  31.134  1.00 65.88  ? 184 TYR B CE2 1 
ATOM   2242 C  CZ  . TYR B 2 184 ? 9.631   23.587  31.358  1.00 71.62  ? 184 TYR B CZ  1 
ATOM   2243 O  OH  . TYR B 2 184 ? 9.400   24.465  30.325  1.00 74.49  ? 184 TYR B OH  1 
ATOM   2244 N  N   . ILE B 2 185 ? 10.747  20.435  37.752  1.00 54.66  ? 185 ILE B N   1 
ATOM   2245 C  CA  . ILE B 2 185 ? 10.755  19.492  38.870  1.00 54.46  ? 185 ILE B CA  1 
ATOM   2246 C  C   . ILE B 2 185 ? 9.758   18.357  38.645  1.00 54.45  ? 185 ILE B C   1 
ATOM   2247 O  O   . ILE B 2 185 ? 8.568   18.609  38.449  1.00 58.66  ? 185 ILE B O   1 
ATOM   2248 C  CB  . ILE B 2 185 ? 10.410  20.179  40.210  1.00 57.18  ? 185 ILE B CB  1 
ATOM   2249 C  CG1 . ILE B 2 185 ? 11.432  21.267  40.544  1.00 60.58  ? 185 ILE B CG1 1 
ATOM   2250 C  CG2 . ILE B 2 185 ? 10.348  19.154  41.331  1.00 53.76  ? 185 ILE B CG2 1 
ATOM   2251 C  CD1 . ILE B 2 185 ? 12.852  20.756  40.670  1.00 58.68  ? 185 ILE B CD1 1 
ATOM   2252 N  N   . PRO B 2 186 ? 10.241  17.101  38.680  1.00 48.84  ? 186 PRO B N   1 
ATOM   2253 C  CA  . PRO B 2 186 ? 9.396   15.911  38.521  1.00 46.98  ? 186 PRO B CA  1 
ATOM   2254 C  C   . PRO B 2 186 ? 8.562   15.645  39.766  1.00 49.44  ? 186 PRO B C   1 
ATOM   2255 O  O   . PRO B 2 186 ? 9.102   15.186  40.773  1.00 54.66  ? 186 PRO B O   1 
ATOM   2256 C  CB  . PRO B 2 186 ? 10.409  14.767  38.355  1.00 45.26  ? 186 PRO B CB  1 
ATOM   2257 C  CG  . PRO B 2 186 ? 11.737  15.408  38.180  1.00 47.66  ? 186 PRO B CG  1 
ATOM   2258 C  CD  . PRO B 2 186 ? 11.657  16.742  38.848  1.00 50.46  ? 186 PRO B CD  1 
ATOM   2259 N  N   . PHE B 2 187 ? 7.265   15.920  39.699  1.00 43.49  ? 187 PHE B N   1 
ATOM   2260 C  CA  . PHE B 2 187 ? 6.396   15.706  40.844  1.00 44.61  ? 187 PHE B CA  1 
ATOM   2261 C  C   . PHE B 2 187 ? 5.092   15.077  40.397  1.00 47.38  ? 187 PHE B C   1 
ATOM   2262 O  O   . PHE B 2 187 ? 4.732   15.149  39.227  1.00 49.62  ? 187 PHE B O   1 
ATOM   2263 C  CB  . PHE B 2 187 ? 6.103   17.030  41.553  1.00 41.86  ? 187 PHE B CB  1 
ATOM   2264 C  CG  . PHE B 2 187 ? 5.233   17.960  40.756  1.00 42.71  ? 187 PHE B CG  1 
ATOM   2265 C  CD1 . PHE B 2 187 ? 5.797   18.874  39.885  1.00 46.05  ? 187 PHE B CD1 1 
ATOM   2266 C  CD2 . PHE B 2 187 ? 3.850   17.919  40.875  1.00 44.55  ? 187 PHE B CD2 1 
ATOM   2267 C  CE1 . PHE B 2 187 ? 5.000   19.730  39.145  1.00 52.59  ? 187 PHE B CE1 1 
ATOM   2268 C  CE2 . PHE B 2 187 ? 3.048   18.766  40.137  1.00 48.79  ? 187 PHE B CE2 1 
ATOM   2269 C  CZ  . PHE B 2 187 ? 3.623   19.676  39.271  1.00 51.54  ? 187 PHE B CZ  1 
ATOM   2270 N  N   . ARG B 2 188 ? 4.382   14.469  41.340  1.00 49.36  ? 188 ARG B N   1 
ATOM   2271 C  CA  . ARG B 2 188 ? 3.027   13.996  41.100  1.00 50.57  ? 188 ARG B CA  1 
ATOM   2272 C  C   . ARG B 2 188 ? 2.205   14.170  42.367  1.00 52.33  ? 188 ARG B C   1 
ATOM   2273 O  O   . ARG B 2 188 ? 2.585   13.691  43.439  1.00 51.24  ? 188 ARG B O   1 
ATOM   2274 C  CB  . ARG B 2 188 ? 3.020   12.534  40.647  1.00 53.42  ? 188 ARG B CB  1 
ATOM   2275 C  CG  . ARG B 2 188 ? 3.388   12.341  39.189  1.00 52.50  ? 188 ARG B CG  1 
ATOM   2276 C  CD  . ARG B 2 188 ? 3.505   10.876  38.821  1.00 54.50  ? 188 ARG B CD  1 
ATOM   2277 N  NE  . ARG B 2 188 ? 3.712   10.714  37.386  1.00 58.09  ? 188 ARG B NE  1 
ATOM   2278 C  CZ  . ARG B 2 188 ? 4.131   9.593   36.811  1.00 62.41  ? 188 ARG B CZ  1 
ATOM   2279 N  NH1 . ARG B 2 188 ? 4.396   8.524   37.549  1.00 66.30  ? 188 ARG B NH1 1 
ATOM   2280 N  NH2 . ARG B 2 188 ? 4.289   9.545   35.497  1.00 63.13  ? 188 ARG B NH2 1 
ATOM   2281 N  N   . ILE B 2 189 ? 1.084   14.870  42.238  1.00 53.12  ? 189 ILE B N   1 
ATOM   2282 C  CA  . ILE B 2 189 ? 0.216   15.151  43.373  1.00 48.17  ? 189 ILE B CA  1 
ATOM   2283 C  C   . ILE B 2 189 ? -1.011  14.258  43.350  1.00 48.69  ? 189 ILE B C   1 
ATOM   2284 O  O   . ILE B 2 189 ? -1.793  14.288  42.403  1.00 50.82  ? 189 ILE B O   1 
ATOM   2285 C  CB  . ILE B 2 189 ? -0.227  16.612  43.376  1.00 46.66  ? 189 ILE B CB  1 
ATOM   2286 C  CG1 . ILE B 2 189 ? 0.991   17.514  43.551  1.00 41.82  ? 189 ILE B CG1 1 
ATOM   2287 C  CG2 . ILE B 2 189 ? -1.258  16.851  44.470  1.00 47.06  ? 189 ILE B CG2 1 
ATOM   2288 C  CD1 . ILE B 2 189 ? 0.660   18.969  43.533  1.00 49.34  ? 189 ILE B CD1 1 
ATOM   2289 N  N   . TYR B 2 190 ? -1.171  13.465  44.402  1.00 50.99  ? 190 TYR B N   1 
ATOM   2290 C  CA  . TYR B 2 190 ? -2.250  12.490  44.474  1.00 47.47  ? 190 TYR B CA  1 
ATOM   2291 C  C   . TYR B 2 190 ? -3.309  12.938  45.470  1.00 47.41  ? 190 TYR B C   1 
ATOM   2292 O  O   . TYR B 2 190 ? -3.007  13.615  46.454  1.00 47.97  ? 190 TYR B O   1 
ATOM   2293 C  CB  . TYR B 2 190 ? -1.700  11.117  44.862  1.00 43.76  ? 190 TYR B CB  1 
ATOM   2294 C  CG  . TYR B 2 190 ? -0.636  10.588  43.921  1.00 46.93  ? 190 TYR B CG  1 
ATOM   2295 C  CD1 . TYR B 2 190 ? -0.951  9.661   42.935  1.00 46.83  ? 190 TYR B CD1 1 
ATOM   2296 C  CD2 . TYR B 2 190 ? 0.685   11.013  44.021  1.00 45.92  ? 190 TYR B CD2 1 
ATOM   2297 C  CE1 . TYR B 2 190 ? 0.017   9.176   42.077  1.00 48.41  ? 190 TYR B CE1 1 
ATOM   2298 C  CE2 . TYR B 2 190 ? 1.658   10.533  43.169  1.00 44.80  ? 190 TYR B CE2 1 
ATOM   2299 C  CZ  . TYR B 2 190 ? 1.321   9.616   42.200  1.00 49.95  ? 190 TYR B CZ  1 
ATOM   2300 O  OH  . TYR B 2 190 ? 2.292   9.135   41.351  1.00 56.04  ? 190 TYR B OH  1 
ATOM   2301 N  N   . GLN B 2 191 ? -4.552  12.552  45.211  1.00 48.23  ? 191 GLN B N   1 
ATOM   2302 C  CA  . GLN B 2 191 ? -5.675  12.990  46.023  1.00 49.12  ? 191 GLN B CA  1 
ATOM   2303 C  C   . GLN B 2 191 ? -6.874  12.096  45.734  1.00 52.27  ? 191 GLN B C   1 
ATOM   2304 O  O   . GLN B 2 191 ? -7.385  12.083  44.617  1.00 58.68  ? 191 GLN B O   1 
ATOM   2305 C  CB  . GLN B 2 191 ? -6.000  14.442  45.688  1.00 51.83  ? 191 GLN B CB  1 
ATOM   2306 C  CG  . GLN B 2 191 ? -6.978  15.113  46.625  1.00 63.55  ? 191 GLN B CG  1 
ATOM   2307 C  CD  . GLN B 2 191 ? -6.947  16.625  46.488  1.00 68.48  ? 191 GLN B CD  1 
ATOM   2308 O  OE1 . GLN B 2 191 ? -6.286  17.169  45.595  1.00 68.06  ? 191 GLN B OE1 1 
ATOM   2309 N  NE2 . GLN B 2 191 ? -7.656  17.313  47.376  1.00 64.97  ? 191 GLN B NE2 1 
ATOM   2310 N  N   . THR B 2 192 ? -7.320  11.345  46.734  1.00 52.05  ? 192 THR B N   1 
ATOM   2311 C  CA  . THR B 2 192 ? -8.358  10.341  46.511  1.00 60.46  ? 192 THR B CA  1 
ATOM   2312 C  C   . THR B 2 192 ? -9.733  10.929  46.185  1.00 68.22  ? 192 THR B C   1 
ATOM   2313 O  O   . THR B 2 192 ? -10.528 10.309  45.475  1.00 71.05  ? 192 THR B O   1 
ATOM   2314 C  CB  . THR B 2 192 ? -8.480  9.372   47.698  1.00 62.09  ? 192 THR B CB  1 
ATOM   2315 O  OG1 . THR B 2 192 ? -8.772  10.109  48.890  1.00 70.29  ? 192 THR B OG1 1 
ATOM   2316 C  CG2 . THR B 2 192 ? -7.185  8.606   47.885  1.00 58.40  ? 192 THR B CG2 1 
ATOM   2317 N  N   . THR B 2 193 ? -10.007 12.124  46.697  1.00 71.23  ? 193 THR B N   1 
ATOM   2318 C  CA  . THR B 2 193 ? -11.293 12.773  46.462  1.00 74.62  ? 193 THR B CA  1 
ATOM   2319 C  C   . THR B 2 193 ? -11.441 13.252  45.019  1.00 74.84  ? 193 THR B C   1 
ATOM   2320 O  O   . THR B 2 193 ? -12.552 13.472  44.542  1.00 75.49  ? 193 THR B O   1 
ATOM   2321 C  CB  . THR B 2 193 ? -11.499 13.968  47.408  1.00 76.47  ? 193 THR B CB  1 
ATOM   2322 O  OG1 . THR B 2 193 ? -10.417 14.895  47.249  1.00 74.78  ? 193 THR B OG1 1 
ATOM   2323 C  CG2 . THR B 2 193 ? -11.553 13.499  48.857  1.00 78.28  ? 193 THR B CG2 1 
ATOM   2324 N  N   . THR B 2 194 ? -10.316 13.408  44.326  1.00 76.67  ? 194 THR B N   1 
ATOM   2325 C  CA  . THR B 2 194 ? -10.327 13.931  42.965  1.00 77.54  ? 194 THR B CA  1 
ATOM   2326 C  C   . THR B 2 194 ? -10.420 12.818  41.923  1.00 79.89  ? 194 THR B C   1 
ATOM   2327 O  O   . THR B 2 194 ? -10.029 11.676  42.172  1.00 80.41  ? 194 THR B O   1 
ATOM   2328 C  CB  . THR B 2 194 ? -9.095  14.828  42.682  1.00 76.15  ? 194 THR B CB  1 
ATOM   2329 O  OG1 . THR B 2 194 ? -9.411  15.770  41.651  1.00 79.89  ? 194 THR B OG1 1 
ATOM   2330 C  CG2 . THR B 2 194 ? -7.895  13.996  42.256  1.00 70.87  ? 194 THR B CG2 1 
ATOM   2331 N  N   . GLU B 2 195 ? -10.947 13.167  40.754  1.00 82.61  ? 195 GLU B N   1 
ATOM   2332 C  CA  . GLU B 2 195 ? -11.205 12.201  39.693  1.00 83.11  ? 195 GLU B CA  1 
ATOM   2333 C  C   . GLU B 2 195 ? -9.928  11.763  38.983  1.00 75.29  ? 195 GLU B C   1 
ATOM   2334 O  O   . GLU B 2 195 ? -9.695  10.571  38.780  1.00 67.31  ? 195 GLU B O   1 
ATOM   2335 C  CB  . GLU B 2 195 ? -12.187 12.788  38.678  1.00 90.71  ? 195 GLU B CB  1 
ATOM   2336 C  CG  . GLU B 2 195 ? -12.592 11.815  37.593  1.00 96.78  ? 195 GLU B CG  1 
ATOM   2337 C  CD  . GLU B 2 195 ? -13.150 10.529  38.160  1.00 100.49 ? 195 GLU B CD  1 
ATOM   2338 O  OE1 . GLU B 2 195 ? -14.015 10.600  39.060  1.00 100.83 ? 195 GLU B OE1 1 
ATOM   2339 O  OE2 . GLU B 2 195 ? -12.716 9.447   37.713  1.00 103.48 ? 195 GLU B OE2 1 
ATOM   2340 N  N   . ARG B 2 196 ? -9.114  12.738  38.598  1.00 77.45  ? 196 ARG B N   1 
ATOM   2341 C  CA  . ARG B 2 196 ? -7.848  12.472  37.930  1.00 76.43  ? 196 ARG B CA  1 
ATOM   2342 C  C   . ARG B 2 196 ? -6.929  11.639  38.822  1.00 76.00  ? 196 ARG B C   1 
ATOM   2343 O  O   . ARG B 2 196 ? -6.958  11.773  40.047  1.00 78.95  ? 196 ARG B O   1 
ATOM   2344 C  CB  . ARG B 2 196 ? -7.174  13.790  37.547  1.00 81.29  ? 196 ARG B CB  1 
ATOM   2345 C  CG  . ARG B 2 196 ? -6.916  14.720  38.722  1.00 88.82  ? 196 ARG B CG  1 
ATOM   2346 C  CD  . ARG B 2 196 ? -6.718  16.149  38.253  1.00 96.78  ? 196 ARG B CD  1 
ATOM   2347 N  NE  . ARG B 2 196 ? -5.770  16.233  37.145  1.00 101.38 ? 196 ARG B NE  1 
ATOM   2348 C  CZ  . ARG B 2 196 ? -5.456  17.360  36.515  1.00 105.16 ? 196 ARG B CZ  1 
ATOM   2349 N  NH1 . ARG B 2 196 ? -6.015  18.507  36.883  1.00 105.07 ? 196 ARG B NH1 1 
ATOM   2350 N  NH2 . ARG B 2 196 ? -4.583  17.343  35.517  1.00 106.28 ? 196 ARG B NH2 1 
ATOM   2351 N  N   . PRO B 2 197 ? -6.125  10.758  38.208  1.00 72.37  ? 197 PRO B N   1 
ATOM   2352 C  CA  . PRO B 2 197 ? -5.188  9.913   38.955  1.00 69.53  ? 197 PRO B CA  1 
ATOM   2353 C  C   . PRO B 2 197 ? -4.218  10.758  39.775  1.00 70.47  ? 197 PRO B C   1 
ATOM   2354 O  O   . PRO B 2 197 ? -4.060  10.542  40.981  1.00 75.06  ? 197 PRO B O   1 
ATOM   2355 C  CB  . PRO B 2 197 ? -4.431  9.172   37.850  1.00 62.44  ? 197 PRO B CB  1 
ATOM   2356 C  CG  . PRO B 2 197 ? -5.361  9.166   36.698  1.00 66.38  ? 197 PRO B CG  1 
ATOM   2357 C  CD  . PRO B 2 197 ? -6.094  10.471  36.764  1.00 70.01  ? 197 PRO B CD  1 
ATOM   2358 N  N   . PHE B 2 198 ? -3.581  11.718  39.116  1.00 59.71  ? 198 PHE B N   1 
ATOM   2359 C  CA  . PHE B 2 198 ? -2.649  12.613  39.781  1.00 58.00  ? 198 PHE B CA  1 
ATOM   2360 C  C   . PHE B 2 198 ? -2.455  13.883  38.973  1.00 58.24  ? 198 PHE B C   1 
ATOM   2361 O  O   . PHE B 2 198 ? -2.771  13.925  37.785  1.00 62.30  ? 198 PHE B O   1 
ATOM   2362 C  CB  . PHE B 2 198 ? -1.300  11.924  39.998  1.00 57.75  ? 198 PHE B CB  1 
ATOM   2363 C  CG  . PHE B 2 198 ? -0.684  11.379  38.741  1.00 56.13  ? 198 PHE B CG  1 
ATOM   2364 C  CD1 . PHE B 2 198 ? 0.069   12.193  37.908  1.00 55.23  ? 198 PHE B CD1 1 
ATOM   2365 C  CD2 . PHE B 2 198 ? -0.846  10.045  38.398  1.00 52.52  ? 198 PHE B CD2 1 
ATOM   2366 C  CE1 . PHE B 2 198 ? 0.638   11.689  36.753  1.00 53.35  ? 198 PHE B CE1 1 
ATOM   2367 C  CE2 . PHE B 2 198 ? -0.278  9.537   37.247  1.00 48.42  ? 198 PHE B CE2 1 
ATOM   2368 C  CZ  . PHE B 2 198 ? 0.464   10.357  36.423  1.00 47.76  ? 198 PHE B CZ  1 
ATOM   2369 N  N   . ILE B 2 199 ? -1.930  14.916  39.621  1.00 51.33  ? 199 ILE B N   1 
ATOM   2370 C  CA  . ILE B 2 199 ? -1.589  16.145  38.929  1.00 46.75  ? 199 ILE B CA  1 
ATOM   2371 C  C   . ILE B 2 199 ? -0.093  16.199  38.619  1.00 47.27  ? 199 ILE B C   1 
ATOM   2372 O  O   . ILE B 2 199 ? 0.743   16.115  39.521  1.00 44.15  ? 199 ILE B O   1 
ATOM   2373 C  CB  . ILE B 2 199 ? -1.980  17.382  39.750  1.00 50.41  ? 199 ILE B CB  1 
ATOM   2374 C  CG1 . ILE B 2 199 ? -3.478  17.369  40.058  1.00 54.66  ? 199 ILE B CG1 1 
ATOM   2375 C  CG2 . ILE B 2 199 ? -1.599  18.653  39.006  1.00 44.48  ? 199 ILE B CG2 1 
ATOM   2376 C  CD1 . ILE B 2 199 ? -3.929  18.508  40.956  1.00 46.76  ? 199 ILE B CD1 1 
ATOM   2377 N  N   . GLN B 2 200 ? 0.231   16.325  37.335  1.00 52.46  ? 200 GLN B N   1 
ATOM   2378 C  CA  . GLN B 2 200 ? 1.604   16.532  36.892  1.00 51.87  ? 200 GLN B CA  1 
ATOM   2379 C  C   . GLN B 2 200 ? 1.642   17.630  35.828  1.00 55.69  ? 200 GLN B C   1 
ATOM   2380 O  O   . GLN B 2 200 ? 1.108   17.462  34.733  1.00 58.78  ? 200 GLN B O   1 
ATOM   2381 C  CB  . GLN B 2 200 ? 2.207   15.232  36.345  1.00 54.61  ? 200 GLN B CB  1 
ATOM   2382 C  CG  . GLN B 2 200 ? 3.649   15.375  35.852  1.00 59.36  ? 200 GLN B CG  1 
ATOM   2383 C  CD  . GLN B 2 200 ? 4.179   14.129  35.150  1.00 57.35  ? 200 GLN B CD  1 
ATOM   2384 O  OE1 . GLN B 2 200 ? 3.776   13.004  35.454  1.00 55.89  ? 200 GLN B OE1 1 
ATOM   2385 N  NE2 . GLN B 2 200 ? 5.089   14.331  34.203  1.00 54.62  ? 200 GLN B NE2 1 
ATOM   2386 N  N   . LYS B 2 201 ? 2.261   18.759  36.165  1.00 55.07  ? 201 LYS B N   1 
ATOM   2387 C  CA  . LYS B 2 201 ? 2.427   19.867  35.230  1.00 52.49  ? 201 LYS B CA  1 
ATOM   2388 C  C   . LYS B 2 201 ? 3.874   20.335  35.228  1.00 55.88  ? 201 LYS B C   1 
ATOM   2389 O  O   . LYS B 2 201 ? 4.689   19.859  36.020  1.00 55.45  ? 201 LYS B O   1 
ATOM   2390 C  CB  . LYS B 2 201 ? 1.529   21.042  35.614  1.00 55.85  ? 201 LYS B CB  1 
ATOM   2391 C  CG  . LYS B 2 201 ? 0.042   20.756  35.548  1.00 62.72  ? 201 LYS B CG  1 
ATOM   2392 C  CD  . LYS B 2 201 ? -0.759  21.986  35.933  1.00 65.48  ? 201 LYS B CD  1 
ATOM   2393 C  CE  . LYS B 2 201 ? -2.246  21.687  35.980  1.00 72.31  ? 201 LYS B CE  1 
ATOM   2394 N  NZ  . LYS B 2 201 ? -3.023  22.874  36.434  1.00 77.96  ? 201 LYS B NZ  1 
ATOM   2395 N  N   . LEU B 2 202 ? 4.191   21.274  34.341  1.00 56.50  ? 202 LEU B N   1 
ATOM   2396 C  CA  . LEU B 2 202 ? 5.528   21.851  34.302  1.00 54.85  ? 202 LEU B CA  1 
ATOM   2397 C  C   . LEU B 2 202 ? 5.667   22.938  35.363  1.00 58.41  ? 202 LEU B C   1 
ATOM   2398 O  O   . LEU B 2 202 ? 4.797   23.800  35.503  1.00 60.53  ? 202 LEU B O   1 
ATOM   2399 C  CB  . LEU B 2 202 ? 5.836   22.421  32.919  1.00 53.93  ? 202 LEU B CB  1 
ATOM   2400 C  CG  . LEU B 2 202 ? 5.917   21.425  31.762  1.00 52.04  ? 202 LEU B CG  1 
ATOM   2401 C  CD1 . LEU B 2 202 ? 6.302   22.132  30.473  1.00 47.96  ? 202 LEU B CD1 1 
ATOM   2402 C  CD2 . LEU B 2 202 ? 6.910   20.328  32.082  1.00 51.95  ? 202 LEU B CD2 1 
ATOM   2403 N  N   . PHE B 2 203 ? 6.765   22.888  36.111  1.00 55.32  ? 203 PHE B N   1 
ATOM   2404 C  CA  . PHE B 2 203 ? 7.024   23.857  37.165  1.00 50.38  ? 203 PHE B CA  1 
ATOM   2405 C  C   . PHE B 2 203 ? 8.526   24.037  37.369  1.00 53.59  ? 203 PHE B C   1 
ATOM   2406 O  O   . PHE B 2 203 ? 9.240   23.082  37.671  1.00 56.08  ? 203 PHE B O   1 
ATOM   2407 C  CB  . PHE B 2 203 ? 6.361   23.412  38.471  1.00 49.68  ? 203 PHE B CB  1 
ATOM   2408 C  CG  . PHE B 2 203 ? 6.323   24.481  39.528  1.00 49.42  ? 203 PHE B CG  1 
ATOM   2409 C  CD1 . PHE B 2 203 ? 5.211   25.294  39.669  1.00 46.34  ? 203 PHE B CD1 1 
ATOM   2410 C  CD2 . PHE B 2 203 ? 7.398   24.675  40.379  1.00 49.49  ? 203 PHE B CD2 1 
ATOM   2411 C  CE1 . PHE B 2 203 ? 5.174   26.278  40.638  1.00 46.20  ? 203 PHE B CE1 1 
ATOM   2412 C  CE2 . PHE B 2 203 ? 7.364   25.661  41.351  1.00 49.39  ? 203 PHE B CE2 1 
ATOM   2413 C  CZ  . PHE B 2 203 ? 6.250   26.462  41.479  1.00 44.07  ? 203 PHE B CZ  1 
ATOM   2414 N  N   . ARG B 2 204 ? 8.997   25.268  37.203  1.00 57.77  ? 204 ARG B N   1 
ATOM   2415 C  CA  . ARG B 2 204 ? 10.411  25.585  37.370  1.00 57.22  ? 204 ARG B CA  1 
ATOM   2416 C  C   . ARG B 2 204 ? 10.750  25.838  38.835  1.00 56.71  ? 204 ARG B C   1 
ATOM   2417 O  O   . ARG B 2 204 ? 10.009  26.520  39.539  1.00 61.40  ? 204 ARG B O   1 
ATOM   2418 C  CB  . ARG B 2 204 ? 10.780  26.808  36.529  1.00 61.46  ? 204 ARG B CB  1 
ATOM   2419 C  CG  . ARG B 2 204 ? 10.454  26.661  35.049  1.00 65.27  ? 204 ARG B CG  1 
ATOM   2420 C  CD  . ARG B 2 204 ? 10.840  27.904  34.265  1.00 64.98  ? 204 ARG B CD  1 
ATOM   2421 N  NE  . ARG B 2 204 ? 10.681  27.719  32.825  1.00 70.92  ? 204 ARG B NE  1 
ATOM   2422 C  CZ  . ARG B 2 204 ? 11.573  27.109  32.049  1.00 79.30  ? 204 ARG B CZ  1 
ATOM   2423 N  NH1 . ARG B 2 204 ? 12.688  26.614  32.575  1.00 80.86  ? 204 ARG B NH1 1 
ATOM   2424 N  NH2 . ARG B 2 204 ? 11.353  26.985  30.746  1.00 81.10  ? 204 ARG B NH2 1 
ATOM   2425 N  N   . PRO B 2 205 ? 11.878  25.284  39.301  1.00 49.49  ? 205 PRO B N   1 
ATOM   2426 C  CA  . PRO B 2 205 ? 12.336  25.471  40.683  1.00 46.32  ? 205 PRO B CA  1 
ATOM   2427 C  C   . PRO B 2 205 ? 12.837  26.886  40.995  1.00 51.33  ? 205 PRO B C   1 
ATOM   2428 O  O   . PRO B 2 205 ? 12.779  27.296  42.153  1.00 55.69  ? 205 PRO B O   1 
ATOM   2429 C  CB  . PRO B 2 205 ? 13.479  24.461  40.813  1.00 46.18  ? 205 PRO B CB  1 
ATOM   2430 C  CG  . PRO B 2 205 ? 13.941  24.228  39.419  1.00 45.04  ? 205 PRO B CG  1 
ATOM   2431 C  CD  . PRO B 2 205 ? 12.726  24.338  38.557  1.00 42.56  ? 205 PRO B CD  1 
ATOM   2432 N  N   . VAL B 2 206 ? 13.321  27.620  39.997  1.00 70.22  ? 206 VAL B N   1 
ATOM   2433 C  CA  . VAL B 2 206 ? 13.805  28.982  40.245  1.00 74.14  ? 206 VAL B CA  1 
ATOM   2434 C  C   . VAL B 2 206 ? 12.867  30.072  39.719  1.00 78.39  ? 206 VAL B C   1 
ATOM   2435 O  O   . VAL B 2 206 ? 12.346  29.984  38.605  1.00 77.31  ? 206 VAL B O   1 
ATOM   2436 C  CB  . VAL B 2 206 ? 15.236  29.210  39.700  1.00 71.15  ? 206 VAL B CB  1 
ATOM   2437 C  CG1 . VAL B 2 206 ? 16.230  28.335  40.449  1.00 67.40  ? 206 VAL B CG1 1 
ATOM   2438 C  CG2 . VAL B 2 206 ? 15.297  28.943  38.202  1.00 75.64  ? 206 VAL B CG2 1 
ATOM   2439 N  N   . ALA B 2 207 ? 12.655  31.098  40.536  1.00 81.83  ? 207 ALA B N   1 
ATOM   2440 C  CA  . ALA B 2 207 ? 11.813  32.223  40.147  1.00 85.82  ? 207 ALA B CA  1 
ATOM   2441 C  C   . ALA B 2 207 ? 12.552  33.146  39.187  1.00 87.06  ? 207 ALA B C   1 
ATOM   2442 O  O   . ALA B 2 207 ? 13.693  32.880  38.806  1.00 84.96  ? 207 ALA B O   1 
ATOM   2443 C  CB  . ALA B 2 207 ? 11.352  32.995  41.374  1.00 86.34  ? 207 ALA B CB  1 
ATOM   2444 N  N   . ALA B 2 208 ? 11.892  34.232  38.803  1.00 90.53  ? 208 ALA B N   1 
ATOM   2445 C  CA  . ALA B 2 208 ? 12.487  35.214  37.905  1.00 93.09  ? 208 ALA B CA  1 
ATOM   2446 C  C   . ALA B 2 208 ? 13.732  35.844  38.523  1.00 97.63  ? 208 ALA B C   1 
ATOM   2447 O  O   . ALA B 2 208 ? 14.819  35.786  37.945  1.00 100.82 ? 208 ALA B O   1 
ATOM   2448 C  CB  . ALA B 2 208 ? 11.471  36.286  37.551  1.00 92.92  ? 208 ALA B CB  1 
ATOM   2449 N  N   . ASP B 2 209 ? 13.572  36.429  39.707  1.00 96.99  ? 209 ASP B N   1 
ATOM   2450 C  CA  . ASP B 2 209 ? 14.668  37.125  40.377  1.00 97.85  ? 209 ASP B CA  1 
ATOM   2451 C  C   . ASP B 2 209 ? 15.721  36.178  40.952  1.00 93.23  ? 209 ASP B C   1 
ATOM   2452 O  O   . ASP B 2 209 ? 16.646  36.612  41.639  1.00 92.68  ? 209 ASP B O   1 
ATOM   2453 C  CB  . ASP B 2 209 ? 14.131  38.052  41.473  1.00 102.81 ? 209 ASP B CB  1 
ATOM   2454 C  CG  . ASP B 2 209 ? 13.317  37.314  42.518  1.00 105.38 ? 209 ASP B CG  1 
ATOM   2455 O  OD1 . ASP B 2 209 ? 12.660  36.312  42.165  1.00 108.25 ? 209 ASP B OD1 1 
ATOM   2456 O  OD2 . ASP B 2 209 ? 13.332  37.737  43.693  1.00 104.91 ? 209 ASP B OD2 1 
ATOM   2457 N  N   . GLY B 2 210 ? 15.573  34.886  40.673  1.00 87.18  ? 210 GLY B N   1 
ATOM   2458 C  CA  . GLY B 2 210 ? 16.562  33.905  41.071  1.00 82.27  ? 210 GLY B CA  1 
ATOM   2459 C  C   . GLY B 2 210 ? 16.312  33.278  42.428  1.00 81.38  ? 210 GLY B C   1 
ATOM   2460 O  O   . GLY B 2 210 ? 17.174  32.579  42.958  1.00 80.94  ? 210 GLY B O   1 
ATOM   2461 N  N   . GLN B 2 211 ? 15.137  33.526  42.997  1.00 80.00  ? 211 GLN B N   1 
ATOM   2462 C  CA  . GLN B 2 211 ? 14.782  32.919  44.275  1.00 76.64  ? 211 GLN B CA  1 
ATOM   2463 C  C   . GLN B 2 211 ? 14.259  31.501  44.087  1.00 71.21  ? 211 GLN B C   1 
ATOM   2464 O  O   . GLN B 2 211 ? 13.614  31.195  43.086  1.00 71.59  ? 211 GLN B O   1 
ATOM   2465 C  CB  . GLN B 2 211 ? 13.745  33.764  45.015  1.00 81.27  ? 211 GLN B CB  1 
ATOM   2466 C  CG  . GLN B 2 211 ? 14.276  35.088  45.533  1.00 86.11  ? 211 GLN B CG  1 
ATOM   2467 C  CD  . GLN B 2 211 ? 13.381  35.692  46.597  1.00 88.89  ? 211 GLN B CD  1 
ATOM   2468 O  OE1 . GLN B 2 211 ? 12.483  35.030  47.119  1.00 86.41  ? 211 GLN B OE1 1 
ATOM   2469 N  NE2 . GLN B 2 211 ? 13.622  36.956  46.924  1.00 91.95  ? 211 GLN B NE2 1 
ATOM   2470 N  N   . LEU B 2 212 ? 14.539  30.641  45.060  1.00 68.75  ? 212 LEU B N   1 
ATOM   2471 C  CA  . LEU B 2 212 ? 14.083  29.255  45.023  1.00 63.30  ? 212 LEU B CA  1 
ATOM   2472 C  C   . LEU B 2 212 ? 12.598  29.140  45.342  1.00 60.37  ? 212 LEU B C   1 
ATOM   2473 O  O   . LEU B 2 212 ? 12.148  29.597  46.392  1.00 63.28  ? 212 LEU B O   1 
ATOM   2474 C  CB  . LEU B 2 212 ? 14.882  28.404  46.013  1.00 60.80  ? 212 LEU B CB  1 
ATOM   2475 C  CG  . LEU B 2 212 ? 16.350  28.124  45.685  1.00 60.28  ? 212 LEU B CG  1 
ATOM   2476 C  CD1 . LEU B 2 212 ? 17.025  27.430  46.850  1.00 57.94  ? 212 LEU B CD1 1 
ATOM   2477 C  CD2 . LEU B 2 212 ? 16.468  27.283  44.425  1.00 60.76  ? 212 LEU B CD2 1 
ATOM   2478 N  N   . HIS B 2 213 ? 11.842  28.526  44.436  1.00 58.95  ? 213 HIS B N   1 
ATOM   2479 C  CA  . HIS B 2 213 ? 10.435  28.233  44.689  1.00 59.18  ? 213 HIS B CA  1 
ATOM   2480 C  C   . HIS B 2 213 ? 10.307  27.225  45.829  1.00 57.80  ? 213 HIS B C   1 
ATOM   2481 O  O   . HIS B 2 213 ? 11.177  26.374  46.012  1.00 55.80  ? 213 HIS B O   1 
ATOM   2482 C  CB  . HIS B 2 213 ? 9.760   27.683  43.432  1.00 61.61  ? 213 HIS B CB  1 
ATOM   2483 C  CG  . HIS B 2 213 ? 9.461   28.724  42.398  1.00 70.34  ? 213 HIS B CG  1 
ATOM   2484 N  ND1 . HIS B 2 213 ? 9.340   28.426  41.058  1.00 75.60  ? 213 HIS B ND1 1 
ATOM   2485 C  CD2 . HIS B 2 213 ? 9.249   30.057  42.508  1.00 75.08  ? 213 HIS B CD2 1 
ATOM   2486 C  CE1 . HIS B 2 213 ? 9.073   29.531  40.385  1.00 77.60  ? 213 HIS B CE1 1 
ATOM   2487 N  NE2 . HIS B 2 213 ? 9.013   30.535  41.241  1.00 78.74  ? 213 HIS B NE2 1 
ATOM   2488 N  N   . THR B 2 214 ? 9.222   27.323  46.590  1.00 58.66  ? 214 THR B N   1 
ATOM   2489 C  CA  . THR B 2 214 ? 8.998   26.432  47.723  1.00 55.63  ? 214 THR B CA  1 
ATOM   2490 C  C   . THR B 2 214 ? 7.927   25.387  47.416  1.00 55.96  ? 214 THR B C   1 
ATOM   2491 O  O   . THR B 2 214 ? 7.271   25.443  46.375  1.00 54.80  ? 214 THR B O   1 
ATOM   2492 C  CB  . THR B 2 214 ? 8.555   27.219  48.968  1.00 52.41  ? 214 THR B CB  1 
ATOM   2493 O  OG1 . THR B 2 214 ? 7.230   27.724  48.764  1.00 54.62  ? 214 THR B OG1 1 
ATOM   2494 C  CG2 . THR B 2 214 ? 9.500   28.378  49.233  1.00 49.69  ? 214 THR B CG2 1 
ATOM   2495 N  N   . LEU B 2 215 ? 7.756   24.436  48.332  1.00 54.73  ? 215 LEU B N   1 
ATOM   2496 C  CA  . LEU B 2 215 ? 6.682   23.455  48.239  1.00 50.87  ? 215 LEU B CA  1 
ATOM   2497 C  C   . LEU B 2 215 ? 5.332   24.160  48.208  1.00 55.30  ? 215 LEU B C   1 
ATOM   2498 O  O   . LEU B 2 215 ? 4.414   23.730  47.509  1.00 57.16  ? 215 LEU B O   1 
ATOM   2499 C  CB  . LEU B 2 215 ? 6.737   22.486  49.421  1.00 51.57  ? 215 LEU B CB  1 
ATOM   2500 C  CG  . LEU B 2 215 ? 5.626   21.436  49.515  1.00 54.22  ? 215 LEU B CG  1 
ATOM   2501 C  CD1 . LEU B 2 215 ? 5.562   20.599  48.248  1.00 53.38  ? 215 LEU B CD1 1 
ATOM   2502 C  CD2 . LEU B 2 215 ? 5.828   20.546  50.726  1.00 54.44  ? 215 LEU B CD2 1 
ATOM   2503 N  N   . GLY B 2 216 ? 5.224   25.248  48.969  1.00 55.13  ? 216 GLY B N   1 
ATOM   2504 C  CA  . GLY B 2 216 ? 4.017   26.054  49.000  1.00 53.12  ? 216 GLY B CA  1 
ATOM   2505 C  C   . GLY B 2 216 ? 3.717   26.711  47.665  1.00 58.19  ? 216 GLY B C   1 
ATOM   2506 O  O   . GLY B 2 216 ? 2.567   26.725  47.226  1.00 65.80  ? 216 GLY B O   1 
ATOM   2507 N  N   . ASP B 2 217 ? 4.749   27.260  47.026  1.00 54.50  ? 217 ASP B N   1 
ATOM   2508 C  CA  . ASP B 2 217 ? 4.618   27.862  45.700  1.00 51.70  ? 217 ASP B CA  1 
ATOM   2509 C  C   . ASP B 2 217 ? 4.085   26.862  44.685  1.00 55.48  ? 217 ASP B C   1 
ATOM   2510 O  O   . ASP B 2 217 ? 3.206   27.182  43.885  1.00 56.62  ? 217 ASP B O   1 
ATOM   2511 C  CB  . ASP B 2 217 ? 5.968   28.383  45.210  1.00 55.67  ? 217 ASP B CB  1 
ATOM   2512 C  CG  . ASP B 2 217 ? 6.363   29.689  45.862  1.00 62.35  ? 217 ASP B CG  1 
ATOM   2513 O  OD1 . ASP B 2 217 ? 5.475   30.543  46.079  1.00 65.63  ? 217 ASP B OD1 1 
ATOM   2514 O  OD2 . ASP B 2 217 ? 7.565   29.862  46.152  1.00 63.93  ? 217 ASP B OD2 1 
ATOM   2515 N  N   . LEU B 2 218 ? 4.636   25.651  44.718  1.00 57.65  ? 218 LEU B N   1 
ATOM   2516 C  CA  . LEU B 2 218 ? 4.212   24.586  43.820  1.00 53.50  ? 218 LEU B CA  1 
ATOM   2517 C  C   . LEU B 2 218 ? 2.738   24.271  44.023  1.00 53.12  ? 218 LEU B C   1 
ATOM   2518 O  O   . LEU B 2 218 ? 1.969   24.206  43.064  1.00 52.92  ? 218 LEU B O   1 
ATOM   2519 C  CB  . LEU B 2 218 ? 5.051   23.330  44.050  1.00 49.60  ? 218 LEU B CB  1 
ATOM   2520 C  CG  . LEU B 2 218 ? 4.505   22.029  43.457  1.00 49.13  ? 218 LEU B CG  1 
ATOM   2521 C  CD1 . LEU B 2 218 ? 4.529   22.059  41.935  1.00 48.51  ? 218 LEU B CD1 1 
ATOM   2522 C  CD2 . LEU B 2 218 ? 5.278   20.829  43.993  1.00 47.72  ? 218 LEU B CD2 1 
ATOM   2523 N  N   . LEU B 2 219 ? 2.347   24.089  45.279  1.00 53.06  ? 219 LEU B N   1 
ATOM   2524 C  CA  . LEU B 2 219 ? 0.961   23.783  45.603  1.00 51.21  ? 219 LEU B CA  1 
ATOM   2525 C  C   . LEU B 2 219 ? 0.041   24.946  45.244  1.00 55.21  ? 219 LEU B C   1 
ATOM   2526 O  O   . LEU B 2 219 ? -1.035  24.740  44.687  1.00 54.81  ? 219 LEU B O   1 
ATOM   2527 C  CB  . LEU B 2 219 ? 0.819   23.396  47.077  1.00 45.98  ? 219 LEU B CB  1 
ATOM   2528 C  CG  . LEU B 2 219 ? 1.510   22.081  47.449  1.00 44.59  ? 219 LEU B CG  1 
ATOM   2529 C  CD1 . LEU B 2 219 ? 1.312   21.745  48.917  1.00 48.07  ? 219 LEU B CD1 1 
ATOM   2530 C  CD2 . LEU B 2 219 ? 1.001   20.950  46.574  1.00 42.23  ? 219 LEU B CD2 1 
ATOM   2531 N  N   . LYS B 2 220 ? 0.475   26.166  45.543  1.00 55.27  ? 220 LYS B N   1 
ATOM   2532 C  CA  . LYS B 2 220 ? -0.309  27.348  45.199  1.00 55.79  ? 220 LYS B CA  1 
ATOM   2533 C  C   . LYS B 2 220 ? -0.563  27.411  43.697  1.00 56.45  ? 220 LYS B C   1 
ATOM   2534 O  O   . LYS B 2 220 ? -1.625  27.841  43.252  1.00 57.90  ? 220 LYS B O   1 
ATOM   2535 C  CB  . LYS B 2 220 ? 0.404   28.618  45.664  1.00 56.93  ? 220 LYS B CB  1 
ATOM   2536 C  CG  . LYS B 2 220 ? -0.374  29.905  45.417  1.00 58.12  ? 220 LYS B CG  1 
ATOM   2537 C  CD  . LYS B 2 220 ? -1.748  29.856  46.072  1.00 58.92  ? 220 LYS B CD  1 
ATOM   2538 C  CE  . LYS B 2 220 ? -2.366  31.244  46.162  1.00 58.86  ? 220 LYS B CE  1 
ATOM   2539 N  NZ  . LYS B 2 220 ? -2.321  31.948  44.857  1.00 59.60  ? 220 LYS B NZ  1 
ATOM   2540 N  N   . GLU B 2 221 ? 0.415   26.955  42.925  1.00 59.35  ? 221 GLU B N   1 
ATOM   2541 C  CA  . GLU B 2 221 ? 0.356   27.038  41.471  1.00 63.82  ? 221 GLU B CA  1 
ATOM   2542 C  C   . GLU B 2 221 ? -0.486  25.938  40.819  1.00 63.38  ? 221 GLU B C   1 
ATOM   2543 O  O   . GLU B 2 221 ? -1.304  26.220  39.945  1.00 63.12  ? 221 GLU B O   1 
ATOM   2544 C  CB  . GLU B 2 221 ? 1.774   27.038  40.890  1.00 66.33  ? 221 GLU B CB  1 
ATOM   2545 C  CG  . GLU B 2 221 ? 1.842   26.856  39.384  1.00 71.03  ? 221 GLU B CG  1 
ATOM   2546 C  CD  . GLU B 2 221 ? 1.164   27.978  38.628  1.00 80.44  ? 221 GLU B CD  1 
ATOM   2547 O  OE1 . GLU B 2 221 ? 1.233   29.140  39.088  1.00 83.74  ? 221 GLU B OE1 1 
ATOM   2548 O  OE2 . GLU B 2 221 ? 0.560   27.694  37.572  1.00 83.98  ? 221 GLU B OE2 1 
ATOM   2549 N  N   . VAL B 2 222 ? -0.293  24.691  41.243  1.00 62.30  ? 222 VAL B N   1 
ATOM   2550 C  CA  . VAL B 2 222 ? -0.909  23.560  40.549  1.00 62.26  ? 222 VAL B CA  1 
ATOM   2551 C  C   . VAL B 2 222 ? -2.034  22.870  41.322  1.00 62.60  ? 222 VAL B C   1 
ATOM   2552 O  O   . VAL B 2 222 ? -2.733  22.020  40.777  1.00 59.53  ? 222 VAL B O   1 
ATOM   2553 C  CB  . VAL B 2 222 ? 0.143   22.503  40.153  1.00 58.71  ? 222 VAL B CB  1 
ATOM   2554 C  CG1 . VAL B 2 222 ? 1.277   23.147  39.376  1.00 55.78  ? 222 VAL B CG1 1 
ATOM   2555 C  CG2 . VAL B 2 222 ? 0.675   21.805  41.387  1.00 57.11  ? 222 VAL B CG2 1 
ATOM   2556 N  N   . CYS B 2 223 ? -2.210  23.237  42.586  1.00 55.19  ? 223 CYS B N   1 
ATOM   2557 C  CA  . CYS B 2 223 ? -3.237  22.621  43.422  1.00 54.12  ? 223 CYS B CA  1 
ATOM   2558 C  C   . CYS B 2 223 ? -3.642  23.555  44.559  1.00 57.01  ? 223 CYS B C   1 
ATOM   2559 O  O   . CYS B 2 223 ? -3.412  23.250  45.729  1.00 57.55  ? 223 CYS B O   1 
ATOM   2560 C  CB  . CYS B 2 223 ? -2.718  21.295  43.990  1.00 48.34  ? 223 CYS B CB  1 
ATOM   2561 S  SG  . CYS B 2 223 ? -3.963  20.281  44.819  1.00 84.98  ? 223 CYS B SG  1 
ATOM   2562 N  N   . PRO B 2 224 ? -4.239  24.709  44.219  1.00 66.49  ? 224 PRO B N   1 
ATOM   2563 C  CA  . PRO B 2 224 ? -4.522  25.721  45.245  1.00 66.70  ? 224 PRO B CA  1 
ATOM   2564 C  C   . PRO B 2 224 ? -5.589  25.260  46.230  1.00 71.92  ? 224 PRO B C   1 
ATOM   2565 O  O   . PRO B 2 224 ? -5.657  25.780  47.342  1.00 71.68  ? 224 PRO B O   1 
ATOM   2566 C  CB  . PRO B 2 224 ? -5.025  26.912  44.428  1.00 60.30  ? 224 PRO B CB  1 
ATOM   2567 C  CG  . PRO B 2 224 ? -5.602  26.307  43.201  1.00 62.76  ? 224 PRO B CG  1 
ATOM   2568 C  CD  . PRO B 2 224 ? -4.750  25.107  42.895  1.00 67.12  ? 224 PRO B CD  1 
ATOM   2569 N  N   . SER B 2 225 ? -6.396  24.285  45.824  1.00 78.26  ? 225 SER B N   1 
ATOM   2570 C  CA  . SER B 2 225 ? -7.473  23.765  46.661  1.00 82.23  ? 225 SER B CA  1 
ATOM   2571 C  C   . SER B 2 225 ? -6.963  23.074  47.927  1.00 83.63  ? 225 SER B C   1 
ATOM   2572 O  O   . SER B 2 225 ? -7.690  22.955  48.911  1.00 86.75  ? 225 SER B O   1 
ATOM   2573 C  CB  . SER B 2 225 ? -8.353  22.806  45.856  1.00 86.94  ? 225 SER B CB  1 
ATOM   2574 O  OG  . SER B 2 225 ? -7.575  21.792  45.243  1.00 90.53  ? 225 SER B OG  1 
ATOM   2575 N  N   . ALA B 2 226 ? -5.712  22.624  47.901  1.00 83.76  ? 226 ALA B N   1 
ATOM   2576 C  CA  . ALA B 2 226 ? -5.123  21.952  49.054  1.00 81.14  ? 226 ALA B CA  1 
ATOM   2577 C  C   . ALA B 2 226 ? -4.580  22.944  50.082  1.00 84.02  ? 226 ALA B C   1 
ATOM   2578 O  O   . ALA B 2 226 ? -3.964  22.546  51.071  1.00 76.50  ? 226 ALA B O   1 
ATOM   2579 C  CB  . ALA B 2 226 ? -4.031  20.999  48.606  1.00 79.29  ? 226 ALA B CB  1 
ATOM   2580 N  N   . ILE B 2 227 ? -4.801  24.235  49.837  1.00 93.40  ? 227 ILE B N   1 
ATOM   2581 C  CA  . ILE B 2 227 ? -4.396  25.290  50.768  1.00 99.45  ? 227 ILE B CA  1 
ATOM   2582 C  C   . ILE B 2 227 ? -5.558  26.241  51.079  1.00 103.21 ? 227 ILE B C   1 
ATOM   2583 O  O   . ILE B 2 227 ? -5.723  27.271  50.423  1.00 102.94 ? 227 ILE B O   1 
ATOM   2584 C  CB  . ILE B 2 227 ? -3.210  26.124  50.222  1.00 100.63 ? 227 ILE B CB  1 
ATOM   2585 C  CG1 . ILE B 2 227 ? -2.095  25.221  49.693  1.00 96.98  ? 227 ILE B CG1 1 
ATOM   2586 C  CG2 . ILE B 2 227 ? -2.668  27.054  51.301  1.00 103.77 ? 227 ILE B CG2 1 
ATOM   2587 C  CD1 . ILE B 2 227 ? -0.906  25.986  49.141  1.00 93.83  ? 227 ILE B CD1 1 
ATOM   2588 N  N   . ASP B 2 228 ? -6.360  25.892  52.081  1.00 105.68 ? 228 ASP B N   1 
ATOM   2589 C  CA  . ASP B 2 228 ? -7.500  26.717  52.471  1.00 105.56 ? 228 ASP B CA  1 
ATOM   2590 C  C   . ASP B 2 228 ? -7.198  27.521  53.726  1.00 105.19 ? 228 ASP B C   1 
ATOM   2591 O  O   . ASP B 2 228 ? -7.922  27.427  54.715  1.00 105.78 ? 228 ASP B O   1 
ATOM   2592 C  CB  . ASP B 2 228 ? -8.741  25.854  52.703  1.00 107.77 ? 228 ASP B CB  1 
ATOM   2593 C  CG  . ASP B 2 228 ? -9.202  25.149  51.446  1.00 109.88 ? 228 ASP B CG  1 
ATOM   2594 O  OD1 . ASP B 2 228 ? -9.841  25.806  50.596  1.00 111.14 ? 228 ASP B OD1 1 
ATOM   2595 O  OD2 . ASP B 2 228 ? -8.930  23.938  51.308  1.00 108.74 ? 228 ASP B OD2 1 
ATOM   2596 N  N   . LYS B 2 235 ? -6.197  22.714  56.023  1.00 87.57  ? 235 LYS B N   1 
ATOM   2597 C  CA  . LYS B 2 235 ? -7.185  21.732  56.455  1.00 85.76  ? 235 LYS B CA  1 
ATOM   2598 C  C   . LYS B 2 235 ? -6.772  20.319  56.047  1.00 84.31  ? 235 LYS B C   1 
ATOM   2599 O  O   . LYS B 2 235 ? -7.100  19.344  56.725  1.00 89.90  ? 235 LYS B O   1 
ATOM   2600 C  CB  . LYS B 2 235 ? -8.566  22.070  55.887  1.00 84.33  ? 235 LYS B CB  1 
ATOM   2601 C  CG  . LYS B 2 235 ? -9.681  21.187  56.417  1.00 84.63  ? 235 LYS B CG  1 
ATOM   2602 C  CD  . LYS B 2 235 ? -9.635  21.125  57.936  1.00 84.49  ? 235 LYS B CD  1 
ATOM   2603 C  CE  . LYS B 2 235 ? -10.693 20.185  58.487  1.00 81.91  ? 235 LYS B CE  1 
ATOM   2604 N  NZ  . LYS B 2 235 ? -10.583 20.034  59.964  1.00 79.80  ? 235 LYS B NZ  1 
ATOM   2605 N  N   . ASN B 2 236 ? -6.050  20.214  54.935  1.00 74.18  ? 236 ASN B N   1 
ATOM   2606 C  CA  . ASN B 2 236 ? -5.530  18.930  54.484  1.00 63.55  ? 236 ASN B CA  1 
ATOM   2607 C  C   . ASN B 2 236 ? -4.061  18.753  54.843  1.00 62.23  ? 236 ASN B C   1 
ATOM   2608 O  O   . ASN B 2 236 ? -3.339  19.727  55.048  1.00 62.48  ? 236 ASN B O   1 
ATOM   2609 C  CB  . ASN B 2 236 ? -5.718  18.765  52.975  1.00 59.07  ? 236 ASN B CB  1 
ATOM   2610 C  CG  . ASN B 2 236 ? -7.168  18.560  52.586  1.00 61.15  ? 236 ASN B CG  1 
ATOM   2611 O  OD1 . ASN B 2 236 ? -7.987  18.142  53.402  1.00 70.22  ? 236 ASN B OD1 1 
ATOM   2612 N  ND2 . ASN B 2 236 ? -7.492  18.847  51.331  1.00 58.12  ? 236 ASN B ND2 1 
ATOM   2613 N  N   . GLN B 2 237 ? -3.625  17.501  54.926  1.00 63.95  ? 237 GLN B N   1 
ATOM   2614 C  CA  . GLN B 2 237 ? -2.220  17.196  55.147  1.00 61.99  ? 237 GLN B CA  1 
ATOM   2615 C  C   . GLN B 2 237 ? -1.501  17.133  53.812  1.00 57.15  ? 237 GLN B C   1 
ATOM   2616 O  O   . GLN B 2 237 ? -2.057  16.667  52.820  1.00 54.51  ? 237 GLN B O   1 
ATOM   2617 C  CB  . GLN B 2 237 ? -2.051  15.846  55.843  1.00 60.42  ? 237 GLN B CB  1 
ATOM   2618 C  CG  . GLN B 2 237 ? -2.677  15.722  57.211  1.00 62.95  ? 237 GLN B CG  1 
ATOM   2619 C  CD  . GLN B 2 237 ? -2.375  14.374  57.845  1.00 68.52  ? 237 GLN B CD  1 
ATOM   2620 O  OE1 . GLN B 2 237 ? -3.129  13.412  57.682  1.00 70.60  ? 237 GLN B OE1 1 
ATOM   2621 N  NE2 . GLN B 2 237 ? -1.261  14.296  58.562  1.00 69.81  ? 237 GLN B NE2 1 
ATOM   2622 N  N   . VAL B 2 238 ? -0.260  17.602  53.794  1.00 57.00  ? 238 VAL B N   1 
ATOM   2623 C  CA  . VAL B 2 238 ? 0.600   17.426  52.636  1.00 52.99  ? 238 VAL B CA  1 
ATOM   2624 C  C   . VAL B 2 238 ? 1.632   16.394  53.029  1.00 52.44  ? 238 VAL B C   1 
ATOM   2625 O  O   . VAL B 2 238 ? 2.570   16.703  53.763  1.00 56.47  ? 238 VAL B O   1 
ATOM   2626 C  CB  . VAL B 2 238 ? 1.321   18.726  52.265  1.00 52.85  ? 238 VAL B CB  1 
ATOM   2627 C  CG1 . VAL B 2 238 ? 2.113   18.539  50.986  1.00 54.05  ? 238 VAL B CG1 1 
ATOM   2628 C  CG2 . VAL B 2 238 ? 0.321   19.858  52.115  1.00 49.08  ? 238 VAL B CG2 1 
ATOM   2629 N  N   . MET B 2 239 ? 1.459   15.163  52.559  1.00 50.69  ? 239 MET B N   1 
ATOM   2630 C  CA  . MET B 2 239 ? 2.289   14.064  53.045  1.00 47.57  ? 239 MET B CA  1 
ATOM   2631 C  C   . MET B 2 239 ? 3.252   13.511  51.999  1.00 45.49  ? 239 MET B C   1 
ATOM   2632 O  O   . MET B 2 239 ? 2.840   13.056  50.934  1.00 47.03  ? 239 MET B O   1 
ATOM   2633 C  CB  . MET B 2 239 ? 1.422   12.944  53.628  1.00 41.07  ? 239 MET B CB  1 
ATOM   2634 C  CG  . MET B 2 239 ? 2.217   11.858  54.325  1.00 36.08  ? 239 MET B CG  1 
ATOM   2635 S  SD  . MET B 2 239 ? 1.166   10.600  55.067  1.00 56.32  ? 239 MET B SD  1 
ATOM   2636 C  CE  . MET B 2 239 ? 0.698   11.372  56.610  1.00 31.52  ? 239 MET B CE  1 
ATOM   2637 N  N   . ILE B 2 240 ? 4.542   13.572  52.315  1.00 44.26  ? 240 ILE B N   1 
ATOM   2638 C  CA  . ILE B 2 240 ? 5.582   13.014  51.461  1.00 45.81  ? 240 ILE B CA  1 
ATOM   2639 C  C   . ILE B 2 240 ? 6.440   12.085  52.313  1.00 48.31  ? 240 ILE B C   1 
ATOM   2640 O  O   . ILE B 2 240 ? 6.984   12.504  53.337  1.00 45.56  ? 240 ILE B O   1 
ATOM   2641 C  CB  . ILE B 2 240 ? 6.477   14.116  50.857  1.00 44.37  ? 240 ILE B CB  1 
ATOM   2642 C  CG1 . ILE B 2 240 ? 5.632   15.198  50.184  1.00 44.31  ? 240 ILE B CG1 1 
ATOM   2643 C  CG2 . ILE B 2 240 ? 7.457   13.524  49.865  1.00 43.46  ? 240 ILE B CG2 1 
ATOM   2644 C  CD1 . ILE B 2 240 ? 6.432   16.405  49.750  1.00 43.70  ? 240 ILE B CD1 1 
ATOM   2645 N  N   . HIS B 2 241 ? 6.546   10.826  51.894  1.00 45.22  ? 241 HIS B N   1 
ATOM   2646 C  CA  . HIS B 2 241 ? 7.276   9.809   52.648  1.00 43.56  ? 241 HIS B CA  1 
ATOM   2647 C  C   . HIS B 2 241 ? 6.814   9.684   54.099  1.00 43.59  ? 241 HIS B C   1 
ATOM   2648 O  O   . HIS B 2 241 ? 7.624   9.463   55.001  1.00 43.65  ? 241 HIS B O   1 
ATOM   2649 C  CB  . HIS B 2 241 ? 8.789   10.044  52.579  1.00 40.79  ? 241 HIS B CB  1 
ATOM   2650 C  CG  . HIS B 2 241 ? 9.407   9.599   51.291  1.00 41.10  ? 241 HIS B CG  1 
ATOM   2651 N  ND1 . HIS B 2 241 ? 9.798   10.479  50.306  1.00 44.39  ? 241 HIS B ND1 1 
ATOM   2652 C  CD2 . HIS B 2 241 ? 9.690   8.361   50.822  1.00 42.51  ? 241 HIS B CD2 1 
ATOM   2653 C  CE1 . HIS B 2 241 ? 10.302  9.803   49.288  1.00 43.06  ? 241 HIS B CE1 1 
ATOM   2654 N  NE2 . HIS B 2 241 ? 10.246  8.517   49.576  1.00 44.16  ? 241 HIS B NE2 1 
ATOM   2655 N  N   . GLY B 2 242 ? 5.511   9.830   54.316  1.00 43.81  ? 242 GLY B N   1 
ATOM   2656 C  CA  . GLY B 2 242 ? 4.929   9.643   55.635  1.00 43.05  ? 242 GLY B CA  1 
ATOM   2657 C  C   . GLY B 2 242 ? 5.096   10.808  56.598  1.00 44.77  ? 242 GLY B C   1 
ATOM   2658 O  O   . GLY B 2 242 ? 4.634   10.750  57.737  1.00 46.59  ? 242 GLY B O   1 
ATOM   2659 N  N   . ILE B 2 243 ? 5.764   11.866  56.154  1.00 43.54  ? 243 ILE B N   1 
ATOM   2660 C  CA  . ILE B 2 243 ? 5.927   13.050  56.984  1.00 39.10  ? 243 ILE B CA  1 
ATOM   2661 C  C   . ILE B 2 243 ? 5.289   14.258  56.314  1.00 39.78  ? 243 ILE B C   1 
ATOM   2662 O  O   . ILE B 2 243 ? 5.002   14.234  55.116  1.00 42.62  ? 243 ILE B O   1 
ATOM   2663 C  CB  . ILE B 2 243 ? 7.411   13.354  57.279  1.00 37.51  ? 243 ILE B CB  1 
ATOM   2664 C  CG1 . ILE B 2 243 ? 8.127   13.844  56.022  1.00 34.10  ? 243 ILE B CG1 1 
ATOM   2665 C  CG2 . ILE B 2 243 ? 8.109   12.132  57.846  1.00 37.75  ? 243 ILE B CG2 1 
ATOM   2666 C  CD1 . ILE B 2 243 ? 9.558   14.266  56.269  1.00 34.69  ? 243 ILE B CD1 1 
ATOM   2667 N  N   . GLU B 2 244 ? 5.063   15.309  57.094  1.00 42.38  ? 244 GLU B N   1 
ATOM   2668 C  CA  . GLU B 2 244 ? 4.459   16.533  56.582  1.00 46.56  ? 244 GLU B CA  1 
ATOM   2669 C  C   . GLU B 2 244 ? 5.470   17.676  56.611  1.00 46.89  ? 244 GLU B C   1 
ATOM   2670 O  O   . GLU B 2 244 ? 5.639   18.334  57.636  1.00 43.95  ? 244 GLU B O   1 
ATOM   2671 C  CB  . GLU B 2 244 ? 3.213   16.890  57.395  1.00 52.95  ? 244 GLU B CB  1 
ATOM   2672 C  CG  . GLU B 2 244 ? 2.377   18.015  56.800  1.00 67.85  ? 244 GLU B CG  1 
ATOM   2673 C  CD  . GLU B 2 244 ? 1.036   18.186  57.497  1.00 77.95  ? 244 GLU B CD  1 
ATOM   2674 O  OE1 . GLU B 2 244 ? 0.827   17.563  58.562  1.00 77.77  ? 244 GLU B OE1 1 
ATOM   2675 O  OE2 . GLU B 2 244 ? 0.187   18.942  56.974  1.00 82.56  ? 244 GLU B OE2 1 
ATOM   2676 N  N   . PRO B 2 245 ? 6.162   17.904  55.482  1.00 47.61  ? 245 PRO B N   1 
ATOM   2677 C  CA  . PRO B 2 245 ? 7.197   18.939  55.376  1.00 44.30  ? 245 PRO B CA  1 
ATOM   2678 C  C   . PRO B 2 245 ? 6.611   20.337  55.443  1.00 45.97  ? 245 PRO B C   1 
ATOM   2679 O  O   . PRO B 2 245 ? 5.464   20.543  55.034  1.00 45.08  ? 245 PRO B O   1 
ATOM   2680 C  CB  . PRO B 2 245 ? 7.788   18.704  53.980  1.00 44.44  ? 245 PRO B CB  1 
ATOM   2681 C  CG  . PRO B 2 245 ? 7.408   17.301  53.629  1.00 46.43  ? 245 PRO B CG  1 
ATOM   2682 C  CD  . PRO B 2 245 ? 6.064   17.104  54.251  1.00 45.65  ? 245 PRO B CD  1 
ATOM   2683 N  N   . MET B 2 246 ? 7.392   21.283  55.955  1.00 50.81  ? 246 MET B N   1 
ATOM   2684 C  CA  . MET B 2 246 ? 6.982   22.683  55.979  1.00 48.87  ? 246 MET B CA  1 
ATOM   2685 C  C   . MET B 2 246 ? 6.807   23.171  54.553  1.00 46.80  ? 246 MET B C   1 
ATOM   2686 O  O   . MET B 2 246 ? 7.577   22.799  53.673  1.00 55.19  ? 246 MET B O   1 
ATOM   2687 C  CB  . MET B 2 246 ? 8.020   23.545  56.699  1.00 48.36  ? 246 MET B CB  1 
ATOM   2688 C  CG  . MET B 2 246 ? 8.076   23.331  58.202  1.00 51.70  ? 246 MET B CG  1 
ATOM   2689 S  SD  . MET B 2 246 ? 9.265   24.421  59.016  1.00 67.12  ? 246 MET B SD  1 
ATOM   2690 C  CE  . MET B 2 246 ? 9.042   23.944  60.727  1.00 77.75  ? 246 MET B CE  1 
ATOM   2691 N  N   . LEU B 2 247 ? 5.795   23.999  54.321  1.00 45.24  ? 247 LEU B N   1 
ATOM   2692 C  CA  . LEU B 2 247 ? 5.530   24.508  52.980  1.00 45.50  ? 247 LEU B CA  1 
ATOM   2693 C  C   . LEU B 2 247 ? 6.673   25.370  52.459  1.00 49.88  ? 247 LEU B C   1 
ATOM   2694 O  O   . LEU B 2 247 ? 6.837   25.535  51.248  1.00 50.74  ? 247 LEU B O   1 
ATOM   2695 C  CB  . LEU B 2 247 ? 4.225   25.304  52.947  1.00 39.30  ? 247 LEU B CB  1 
ATOM   2696 C  CG  . LEU B 2 247 ? 2.942   24.509  53.173  1.00 40.16  ? 247 LEU B CG  1 
ATOM   2697 C  CD1 . LEU B 2 247 ? 1.725   25.394  52.954  1.00 42.25  ? 247 LEU B CD1 1 
ATOM   2698 C  CD2 . LEU B 2 247 ? 2.901   23.300  52.255  1.00 41.47  ? 247 LEU B CD2 1 
ATOM   2699 N  N   . GLU B 2 248 ? 7.465   25.912  53.379  1.00 50.31  ? 248 GLU B N   1 
ATOM   2700 C  CA  . GLU B 2 248 ? 8.543   26.821  53.018  1.00 53.45  ? 248 GLU B CA  1 
ATOM   2701 C  C   . GLU B 2 248 ? 9.786   26.082  52.540  1.00 56.39  ? 248 GLU B C   1 
ATOM   2702 O  O   . GLU B 2 248 ? 10.772  26.710  52.155  1.00 60.31  ? 248 GLU B O   1 
ATOM   2703 C  CB  . GLU B 2 248 ? 8.897   27.727  54.195  1.00 54.27  ? 248 GLU B CB  1 
ATOM   2704 C  CG  . GLU B 2 248 ? 9.684   27.041  55.295  1.00 57.41  ? 248 GLU B CG  1 
ATOM   2705 C  CD  . GLU B 2 248 ? 9.872   27.930  56.504  1.00 66.68  ? 248 GLU B CD  1 
ATOM   2706 O  OE1 . GLU B 2 248 ? 8.890   28.582  56.920  1.00 73.22  ? 248 GLU B OE1 1 
ATOM   2707 O  OE2 . GLU B 2 248 ? 11.000  27.988  57.036  1.00 69.91  ? 248 GLU B OE2 1 
ATOM   2708 N  N   . THR B 2 249 ? 9.739   24.752  52.569  1.00 54.18  ? 249 THR B N   1 
ATOM   2709 C  CA  . THR B 2 249 ? 10.850  23.935  52.090  1.00 50.58  ? 249 THR B CA  1 
ATOM   2710 C  C   . THR B 2 249 ? 11.123  24.223  50.617  1.00 51.51  ? 249 THR B C   1 
ATOM   2711 O  O   . THR B 2 249 ? 10.200  24.219  49.804  1.00 51.19  ? 249 THR B O   1 
ATOM   2712 C  CB  . THR B 2 249 ? 10.557  22.433  52.250  1.00 48.24  ? 249 THR B CB  1 
ATOM   2713 O  OG1 . THR B 2 249 ? 10.052  22.177  53.565  1.00 51.25  ? 249 THR B OG1 1 
ATOM   2714 C  CG2 . THR B 2 249 ? 11.821  21.611  52.025  1.00 47.59  ? 249 THR B CG2 1 
ATOM   2715 N  N   . PRO B 2 250 ? 12.390  24.503  50.275  1.00 57.13  ? 250 PRO B N   1 
ATOM   2716 C  CA  . PRO B 2 250 ? 12.796  24.724  48.882  1.00 57.02  ? 250 PRO B CA  1 
ATOM   2717 C  C   . PRO B 2 250 ? 12.466  23.523  47.997  1.00 57.38  ? 250 PRO B C   1 
ATOM   2718 O  O   . PRO B 2 250 ? 12.874  22.401  48.295  1.00 61.22  ? 250 PRO B O   1 
ATOM   2719 C  CB  . PRO B 2 250 ? 14.311  24.914  48.991  1.00 55.07  ? 250 PRO B CB  1 
ATOM   2720 C  CG  . PRO B 2 250 ? 14.505  25.499  50.345  1.00 53.45  ? 250 PRO B CG  1 
ATOM   2721 C  CD  . PRO B 2 250 ? 13.477  24.821  51.219  1.00 59.27  ? 250 PRO B CD  1 
ATOM   2722 N  N   . LEU B 2 251 ? 11.724  23.771  46.923  1.00 53.22  ? 251 LEU B N   1 
ATOM   2723 C  CA  . LEU B 2 251 ? 11.269  22.713  46.033  1.00 48.88  ? 251 LEU B CA  1 
ATOM   2724 C  C   . LEU B 2 251 ? 12.422  21.964  45.375  1.00 53.30  ? 251 LEU B C   1 
ATOM   2725 O  O   . LEU B 2 251 ? 12.355  20.748  45.197  1.00 60.10  ? 251 LEU B O   1 
ATOM   2726 C  CB  . LEU B 2 251 ? 10.345  23.281  44.961  1.00 47.11  ? 251 LEU B CB  1 
ATOM   2727 C  CG  . LEU B 2 251 ? 9.728   22.230  44.043  1.00 50.45  ? 251 LEU B CG  1 
ATOM   2728 C  CD1 . LEU B 2 251 ? 8.927   21.218  44.853  1.00 46.31  ? 251 LEU B CD1 1 
ATOM   2729 C  CD2 . LEU B 2 251 ? 8.855   22.900  43.004  1.00 54.13  ? 251 LEU B CD2 1 
ATOM   2730 N  N   . GLN B 2 252 ? 13.473  22.691  45.010  1.00 50.93  ? 252 GLN B N   1 
ATOM   2731 C  CA  . GLN B 2 252 ? 14.647  22.076  44.402  1.00 49.33  ? 252 GLN B CA  1 
ATOM   2732 C  C   . GLN B 2 252 ? 15.283  21.083  45.367  1.00 53.50  ? 252 GLN B C   1 
ATOM   2733 O  O   . GLN B 2 252 ? 15.638  19.968  44.986  1.00 54.39  ? 252 GLN B O   1 
ATOM   2734 C  CB  . GLN B 2 252 ? 15.666  23.141  43.992  1.00 49.50  ? 252 GLN B CB  1 
ATOM   2735 C  CG  . GLN B 2 252 ? 16.980  22.584  43.473  1.00 50.47  ? 252 GLN B CG  1 
ATOM   2736 C  CD  . GLN B 2 252 ? 16.826  21.816  42.175  1.00 54.00  ? 252 GLN B CD  1 
ATOM   2737 O  OE1 . GLN B 2 252 ? 15.980  22.142  41.342  1.00 56.42  ? 252 GLN B OE1 1 
ATOM   2738 N  NE2 . GLN B 2 252 ? 17.647  20.789  41.996  1.00 54.07  ? 252 GLN B NE2 1 
ATOM   2739 N  N   . TRP B 2 253 ? 15.414  21.492  46.624  1.00 54.92  ? 253 TRP B N   1 
ATOM   2740 C  CA  . TRP B 2 253 ? 15.997  20.630  47.641  1.00 52.88  ? 253 TRP B CA  1 
ATOM   2741 C  C   . TRP B 2 253 ? 15.149  19.379  47.856  1.00 52.32  ? 253 TRP B C   1 
ATOM   2742 O  O   . TRP B 2 253 ? 15.687  18.284  48.036  1.00 52.85  ? 253 TRP B O   1 
ATOM   2743 C  CB  . TRP B 2 253 ? 16.168  21.385  48.962  1.00 50.09  ? 253 TRP B CB  1 
ATOM   2744 C  CG  . TRP B 2 253 ? 16.920  20.596  49.983  1.00 51.82  ? 253 TRP B CG  1 
ATOM   2745 C  CD1 . TRP B 2 253 ? 18.267  20.598  50.188  1.00 50.35  ? 253 TRP B CD1 1 
ATOM   2746 C  CD2 . TRP B 2 253 ? 16.370  19.671  50.932  1.00 53.06  ? 253 TRP B CD2 1 
ATOM   2747 N  NE1 . TRP B 2 253 ? 18.592  19.739  51.211  1.00 51.76  ? 253 TRP B NE1 1 
ATOM   2748 C  CE2 . TRP B 2 253 ? 17.445  19.157  51.683  1.00 51.44  ? 253 TRP B CE2 1 
ATOM   2749 C  CE3 . TRP B 2 253 ? 15.074  19.233  51.221  1.00 50.23  ? 253 TRP B CE3 1 
ATOM   2750 C  CZ2 . TRP B 2 253 ? 17.265  18.227  52.704  1.00 48.87  ? 253 TRP B CZ2 1 
ATOM   2751 C  CZ3 . TRP B 2 253 ? 14.899  18.309  52.233  1.00 50.91  ? 253 TRP B CZ3 1 
ATOM   2752 C  CH2 . TRP B 2 253 ? 15.987  17.816  52.962  1.00 49.24  ? 253 TRP B CH2 1 
ATOM   2753 N  N   . LEU B 2 254 ? 13.828  19.548  47.839  1.00 47.72  ? 254 LEU B N   1 
ATOM   2754 C  CA  . LEU B 2 254 ? 12.907  18.426  48.008  1.00 49.78  ? 254 LEU B CA  1 
ATOM   2755 C  C   . LEU B 2 254 ? 13.055  17.417  46.883  1.00 50.61  ? 254 LEU B C   1 
ATOM   2756 O  O   . LEU B 2 254 ? 13.069  16.206  47.112  1.00 54.10  ? 254 LEU B O   1 
ATOM   2757 C  CB  . LEU B 2 254 ? 11.458  18.912  48.048  1.00 53.72  ? 254 LEU B CB  1 
ATOM   2758 C  CG  . LEU B 2 254 ? 10.804  18.992  49.424  1.00 56.66  ? 254 LEU B CG  1 
ATOM   2759 C  CD1 . LEU B 2 254 ? 9.311   19.229  49.292  1.00 61.41  ? 254 LEU B CD1 1 
ATOM   2760 C  CD2 . LEU B 2 254 ? 11.077  17.727  50.206  1.00 52.70  ? 254 LEU B CD2 1 
ATOM   2761 N  N   . SER B 2 255 ? 13.153  17.928  45.661  1.00 45.74  ? 255 SER B N   1 
ATOM   2762 C  CA  . SER B 2 255 ? 13.285  17.076  44.494  1.00 47.58  ? 255 SER B CA  1 
ATOM   2763 C  C   . SER B 2 255 ? 14.554  16.239  44.584  1.00 49.67  ? 255 SER B C   1 
ATOM   2764 O  O   . SER B 2 255 ? 14.577  15.082  44.165  1.00 52.83  ? 255 SER B O   1 
ATOM   2765 C  CB  . SER B 2 255 ? 13.289  17.917  43.219  1.00 48.93  ? 255 SER B CB  1 
ATOM   2766 O  OG  . SER B 2 255 ? 13.329  17.091  42.071  1.00 51.53  ? 255 SER B OG  1 
ATOM   2767 N  N   . GLU B 2 256 ? 15.603  16.826  45.152  1.00 50.41  ? 256 GLU B N   1 
ATOM   2768 C  CA  . GLU B 2 256 ? 16.885  16.141  45.297  1.00 50.53  ? 256 GLU B CA  1 
ATOM   2769 C  C   . GLU B 2 256 ? 16.890  15.126  46.438  1.00 53.00  ? 256 GLU B C   1 
ATOM   2770 O  O   . GLU B 2 256 ? 17.462  14.046  46.305  1.00 56.70  ? 256 GLU B O   1 
ATOM   2771 C  CB  . GLU B 2 256 ? 18.015  17.154  45.511  1.00 51.69  ? 256 GLU B CB  1 
ATOM   2772 C  CG  . GLU B 2 256 ? 18.223  18.123  44.357  1.00 54.87  ? 256 GLU B CG  1 
ATOM   2773 C  CD  . GLU B 2 256 ? 19.098  19.307  44.735  1.00 57.86  ? 256 GLU B CD  1 
ATOM   2774 O  OE1 . GLU B 2 256 ? 19.561  19.367  45.895  1.00 59.50  ? 256 GLU B OE1 1 
ATOM   2775 O  OE2 . GLU B 2 256 ? 19.318  20.184  43.873  1.00 57.64  ? 256 GLU B OE2 1 
ATOM   2776 N  N   . HIS B 2 257 ? 16.250  15.463  47.555  1.00 52.54  ? 257 HIS B N   1 
ATOM   2777 C  CA  . HIS B 2 257 ? 16.403  14.658  48.766  1.00 50.58  ? 257 HIS B CA  1 
ATOM   2778 C  C   . HIS B 2 257 ? 15.191  13.832  49.201  1.00 51.60  ? 257 HIS B C   1 
ATOM   2779 O  O   . HIS B 2 257 ? 15.340  12.880  49.966  1.00 54.41  ? 257 HIS B O   1 
ATOM   2780 C  CB  . HIS B 2 257 ? 16.901  15.526  49.920  1.00 49.99  ? 257 HIS B CB  1 
ATOM   2781 C  CG  . HIS B 2 257 ? 18.223  16.172  49.650  1.00 54.08  ? 257 HIS B CG  1 
ATOM   2782 N  ND1 . HIS B 2 257 ? 18.341  17.371  48.980  1.00 55.66  ? 257 HIS B ND1 1 
ATOM   2783 C  CD2 . HIS B 2 257 ? 19.485  15.775  49.938  1.00 55.70  ? 257 HIS B CD2 1 
ATOM   2784 C  CE1 . HIS B 2 257 ? 19.619  17.690  48.877  1.00 56.78  ? 257 HIS B CE1 1 
ATOM   2785 N  NE2 . HIS B 2 257 ? 20.334  16.738  49.449  1.00 57.80  ? 257 HIS B NE2 1 
ATOM   2786 N  N   . LEU B 2 258 ? 14.000  14.184  48.731  1.00 50.04  ? 258 LEU B N   1 
ATOM   2787 C  CA  . LEU B 2 258 ? 12.811  13.421  49.102  1.00 47.67  ? 258 LEU B CA  1 
ATOM   2788 C  C   . LEU B 2 258 ? 12.091  12.785  47.911  1.00 47.97  ? 258 LEU B C   1 
ATOM   2789 O  O   . LEU B 2 258 ? 10.922  12.414  48.008  1.00 50.83  ? 258 LEU B O   1 
ATOM   2790 C  CB  . LEU B 2 258 ? 11.841  14.264  49.937  1.00 41.92  ? 258 LEU B CB  1 
ATOM   2791 C  CG  . LEU B 2 258 ? 11.846  13.972  51.442  1.00 41.20  ? 258 LEU B CG  1 
ATOM   2792 C  CD1 . LEU B 2 258 ? 13.188  14.323  52.050  1.00 41.65  ? 258 LEU B CD1 1 
ATOM   2793 C  CD2 . LEU B 2 258 ? 10.722  14.703  52.171  1.00 38.75  ? 258 LEU B CD2 1 
ATOM   2794 N  N   . SER B 2 259 ? 12.783  12.654  46.788  1.00 43.54  ? 259 SER B N   1 
ATOM   2795 C  CA  . SER B 2 259 ? 12.216  11.910  45.676  1.00 45.01  ? 259 SER B CA  1 
ATOM   2796 C  C   . SER B 2 259 ? 12.311  10.422  45.970  1.00 46.28  ? 259 SER B C   1 
ATOM   2797 O  O   . SER B 2 259 ? 13.110  9.988   46.798  1.00 46.60  ? 259 SER B O   1 
ATOM   2798 C  CB  . SER B 2 259 ? 12.932  12.236  44.364  1.00 47.01  ? 259 SER B CB  1 
ATOM   2799 O  OG  . SER B 2 259 ? 12.700  13.579  43.974  1.00 52.46  ? 259 SER B OG  1 
ATOM   2800 N  N   . TYR B 2 260 ? 11.474  9.641   45.303  1.00 46.52  ? 260 TYR B N   1 
ATOM   2801 C  CA  . TYR B 2 260 ? 11.590  8.198   45.363  1.00 49.23  ? 260 TYR B CA  1 
ATOM   2802 C  C   . TYR B 2 260 ? 12.738  7.818   44.434  1.00 49.09  ? 260 TYR B C   1 
ATOM   2803 O  O   . TYR B 2 260 ? 13.260  8.677   43.724  1.00 51.56  ? 260 TYR B O   1 
ATOM   2804 C  CB  . TYR B 2 260 ? 10.271  7.555   44.928  1.00 48.61  ? 260 TYR B CB  1 
ATOM   2805 C  CG  . TYR B 2 260 ? 9.201   7.598   45.994  1.00 43.35  ? 260 TYR B CG  1 
ATOM   2806 C  CD1 . TYR B 2 260 ? 8.526   8.777   46.279  1.00 39.99  ? 260 TYR B CD1 1 
ATOM   2807 C  CD2 . TYR B 2 260 ? 8.866   6.460   46.716  1.00 38.55  ? 260 TYR B CD2 1 
ATOM   2808 C  CE1 . TYR B 2 260 ? 7.546   8.821   47.256  1.00 38.62  ? 260 TYR B CE1 1 
ATOM   2809 C  CE2 . TYR B 2 260 ? 7.887   6.495   47.696  1.00 33.73  ? 260 TYR B CE2 1 
ATOM   2810 C  CZ  . TYR B 2 260 ? 7.230   7.674   47.959  1.00 35.91  ? 260 TYR B CZ  1 
ATOM   2811 O  OH  . TYR B 2 260 ? 6.257   7.709   48.931  1.00 36.68  ? 260 TYR B OH  1 
ATOM   2812 N  N   . PRO B 2 261 ? 13.158  6.542   44.446  1.00 46.62  ? 261 PRO B N   1 
ATOM   2813 C  CA  . PRO B 2 261 ? 14.206  6.123   43.510  1.00 43.56  ? 261 PRO B CA  1 
ATOM   2814 C  C   . PRO B 2 261 ? 13.840  6.364   42.047  1.00 49.35  ? 261 PRO B C   1 
ATOM   2815 O  O   . PRO B 2 261 ? 14.737  6.423   41.206  1.00 54.15  ? 261 PRO B O   1 
ATOM   2816 C  CB  . PRO B 2 261 ? 14.329  4.626   43.785  1.00 44.21  ? 261 PRO B CB  1 
ATOM   2817 C  CG  . PRO B 2 261 ? 13.973  4.494   45.218  1.00 45.48  ? 261 PRO B CG  1 
ATOM   2818 C  CD  . PRO B 2 261 ? 12.869  5.494   45.440  1.00 47.05  ? 261 PRO B CD  1 
ATOM   2819 N  N   . ASP B 2 262 ? 12.552  6.516   41.745  1.00 49.77  ? 262 ASP B N   1 
ATOM   2820 C  CA  . ASP B 2 262 ? 12.128  6.782   40.375  1.00 45.95  ? 262 ASP B CA  1 
ATOM   2821 C  C   . ASP B 2 262 ? 12.362  8.241   39.979  1.00 50.04  ? 262 ASP B C   1 
ATOM   2822 O  O   . ASP B 2 262 ? 12.005  8.655   38.876  1.00 56.27  ? 262 ASP B O   1 
ATOM   2823 C  CB  . ASP B 2 262 ? 10.663  6.368   40.149  1.00 44.05  ? 262 ASP B CB  1 
ATOM   2824 C  CG  . ASP B 2 262 ? 9.673   7.127   41.039  1.00 51.26  ? 262 ASP B CG  1 
ATOM   2825 O  OD1 . ASP B 2 262 ? 10.017  8.190   41.603  1.00 46.92  ? 262 ASP B OD1 1 
ATOM   2826 O  OD2 . ASP B 2 262 ? 8.521   6.657   41.159  1.00 55.35  ? 262 ASP B OD2 1 
ATOM   2827 N  N   . ASN B 2 263 ? 12.956  9.002   40.898  1.00 44.44  ? 263 ASN B N   1 
ATOM   2828 C  CA  . ASN B 2 263 ? 13.243  10.431  40.725  1.00 41.20  ? 263 ASN B CA  1 
ATOM   2829 C  C   . ASN B 2 263 ? 12.015  11.339  40.738  1.00 45.64  ? 263 ASN B C   1 
ATOM   2830 O  O   . ASN B 2 263 ? 12.119  12.540  40.487  1.00 50.77  ? 263 ASN B O   1 
ATOM   2831 C  CB  . ASN B 2 263 ? 14.103  10.692  39.487  1.00 39.35  ? 263 ASN B CB  1 
ATOM   2832 C  CG  . ASN B 2 263 ? 15.566  10.405  39.730  1.00 45.89  ? 263 ASN B CG  1 
ATOM   2833 O  OD1 . ASN B 2 263 ? 16.439  11.154  39.285  1.00 51.79  ? 263 ASN B OD1 1 
ATOM   2834 N  ND2 . ASN B 2 263 ? 15.846  9.328   40.457  1.00 43.85  ? 263 ASN B ND2 1 
ATOM   2835 N  N   . PHE B 2 264 ? 10.857  10.772  41.050  1.00 43.47  ? 264 PHE B N   1 
ATOM   2836 C  CA  . PHE B 2 264 ? 9.650   11.576  41.171  1.00 43.47  ? 264 PHE B CA  1 
ATOM   2837 C  C   . PHE B 2 264 ? 9.368   11.975  42.609  1.00 47.49  ? 264 PHE B C   1 
ATOM   2838 O  O   . PHE B 2 264 ? 9.629   11.219  43.541  1.00 47.30  ? 264 PHE B O   1 
ATOM   2839 C  CB  . PHE B 2 264 ? 8.439   10.843  40.595  1.00 42.67  ? 264 PHE B CB  1 
ATOM   2840 C  CG  . PHE B 2 264 ? 8.162   11.180  39.163  1.00 44.79  ? 264 PHE B CG  1 
ATOM   2841 C  CD1 . PHE B 2 264 ? 7.399   12.288  38.836  1.00 47.89  ? 264 PHE B CD1 1 
ATOM   2842 C  CD2 . PHE B 2 264 ? 8.674   10.397  38.142  1.00 42.44  ? 264 PHE B CD2 1 
ATOM   2843 C  CE1 . PHE B 2 264 ? 7.145   12.608  37.512  1.00 46.79  ? 264 PHE B CE1 1 
ATOM   2844 C  CE2 . PHE B 2 264 ? 8.422   10.707  36.823  1.00 43.98  ? 264 PHE B CE2 1 
ATOM   2845 C  CZ  . PHE B 2 264 ? 7.656   11.816  36.506  1.00 44.47  ? 264 PHE B CZ  1 
ATOM   2846 N  N   . LEU B 2 265 ? 8.830   13.176  42.774  1.00 51.51  ? 265 LEU B N   1 
ATOM   2847 C  CA  . LEU B 2 265 ? 8.367   13.634  44.067  1.00 47.10  ? 265 LEU B CA  1 
ATOM   2848 C  C   . LEU B 2 265 ? 6.883   13.299  44.172  1.00 46.56  ? 265 LEU B C   1 
ATOM   2849 O  O   . LEU B 2 265 ? 6.037   14.014  43.642  1.00 50.36  ? 265 LEU B O   1 
ATOM   2850 C  CB  . LEU B 2 265 ? 8.595   15.137  44.190  1.00 47.29  ? 265 LEU B CB  1 
ATOM   2851 C  CG  . LEU B 2 265 ? 8.643   15.752  45.586  1.00 50.80  ? 265 LEU B CG  1 
ATOM   2852 C  CD1 . LEU B 2 265 ? 9.779   15.164  46.410  1.00 45.30  ? 265 LEU B CD1 1 
ATOM   2853 C  CD2 . LEU B 2 265 ? 8.792   17.258  45.463  1.00 56.04  ? 265 LEU B CD2 1 
ATOM   2854 N  N   . HIS B 2 266 ? 6.574   12.187  44.828  1.00 42.86  ? 266 HIS B N   1 
ATOM   2855 C  CA  . HIS B 2 266 ? 5.192   11.756  44.985  1.00 41.06  ? 266 HIS B CA  1 
ATOM   2856 C  C   . HIS B 2 266 ? 4.582   12.396  46.229  1.00 44.74  ? 266 HIS B C   1 
ATOM   2857 O  O   . HIS B 2 266 ? 4.959   12.062  47.354  1.00 43.93  ? 266 HIS B O   1 
ATOM   2858 C  CB  . HIS B 2 266 ? 5.108   10.229  45.081  1.00 38.00  ? 266 HIS B CB  1 
ATOM   2859 C  CG  . HIS B 2 266 ? 5.551   9.513   43.841  1.00 40.13  ? 266 HIS B CG  1 
ATOM   2860 N  ND1 . HIS B 2 266 ? 4.765   9.421   42.712  1.00 44.87  ? 266 HIS B ND1 1 
ATOM   2861 C  CD2 . HIS B 2 266 ? 6.690   8.837   43.559  1.00 39.88  ? 266 HIS B CD2 1 
ATOM   2862 C  CE1 . HIS B 2 266 ? 5.403   8.726   41.786  1.00 38.08  ? 266 HIS B CE1 1 
ATOM   2863 N  NE2 . HIS B 2 266 ? 6.573   8.360   42.274  1.00 36.47  ? 266 HIS B NE2 1 
ATOM   2864 N  N   . ILE B 2 267 ? 3.641   13.314  46.017  1.00 42.49  ? 267 ILE B N   1 
ATOM   2865 C  CA  . ILE B 2 267 ? 3.025   14.069  47.104  1.00 41.32  ? 267 ILE B CA  1 
ATOM   2866 C  C   . ILE B 2 267 ? 1.554   13.686  47.297  1.00 46.34  ? 267 ILE B C   1 
ATOM   2867 O  O   . ILE B 2 267 ? 0.778   13.680  46.342  1.00 50.75  ? 267 ILE B O   1 
ATOM   2868 C  CB  . ILE B 2 267 ? 3.120   15.585  46.836  1.00 41.53  ? 267 ILE B CB  1 
ATOM   2869 C  CG1 . ILE B 2 267 ? 4.562   15.977  46.493  1.00 41.68  ? 267 ILE B CG1 1 
ATOM   2870 C  CG2 . ILE B 2 267 ? 2.600   16.384  48.028  1.00 36.33  ? 267 ILE B CG2 1 
ATOM   2871 C  CD1 . ILE B 2 267 ? 4.698   17.370  45.908  1.00 39.71  ? 267 ILE B CD1 1 
ATOM   2872 N  N   . SER B 2 268 ? 1.175   13.366  48.531  1.00 43.57  ? 268 SER B N   1 
ATOM   2873 C  CA  . SER B 2 268 ? -0.209  13.010  48.833  1.00 44.13  ? 268 SER B CA  1 
ATOM   2874 C  C   . SER B 2 268 ? -0.949  14.142  49.545  1.00 47.95  ? 268 SER B C   1 
ATOM   2875 O  O   . SER B 2 268 ? -0.440  14.724  50.504  1.00 48.80  ? 268 SER B O   1 
ATOM   2876 C  CB  . SER B 2 268 ? -0.275  11.747  49.697  1.00 40.91  ? 268 SER B CB  1 
ATOM   2877 O  OG  . SER B 2 268 ? 0.290   10.637  49.034  1.00 45.42  ? 268 SER B OG  1 
ATOM   2878 N  N   . ILE B 2 269 ? -2.153  14.443  49.070  1.00 47.22  ? 269 ILE B N   1 
ATOM   2879 C  CA  . ILE B 2 269 ? -3.029  15.382  49.753  1.00 48.14  ? 269 ILE B CA  1 
ATOM   2880 C  C   . ILE B 2 269 ? -4.132  14.599  50.448  1.00 48.68  ? 269 ILE B C   1 
ATOM   2881 O  O   . ILE B 2 269 ? -5.035  14.063  49.802  1.00 50.37  ? 269 ILE B O   1 
ATOM   2882 C  CB  . ILE B 2 269 ? -3.654  16.398  48.783  1.00 48.51  ? 269 ILE B CB  1 
ATOM   2883 C  CG1 . ILE B 2 269 ? -2.558  17.110  47.981  1.00 49.14  ? 269 ILE B CG1 1 
ATOM   2884 C  CG2 . ILE B 2 269 ? -4.519  17.399  49.548  1.00 42.38  ? 269 ILE B CG2 1 
ATOM   2885 C  CD1 . ILE B 2 269 ? -1.579  17.884  48.837  1.00 50.18  ? 269 ILE B CD1 1 
ATOM   2886 N  N   . ILE B 2 270 ? -4.048  14.521  51.768  1.00 45.27  ? 270 ILE B N   1 
ATOM   2887 C  CA  . ILE B 2 270 ? -4.984  13.717  52.533  1.00 47.78  ? 270 ILE B CA  1 
ATOM   2888 C  C   . ILE B 2 270 ? -5.642  14.557  53.617  1.00 51.61  ? 270 ILE B C   1 
ATOM   2889 O  O   . ILE B 2 270 ? -5.067  15.542  54.079  1.00 51.79  ? 270 ILE B O   1 
ATOM   2890 C  CB  . ILE B 2 270 ? -4.277  12.503  53.171  1.00 47.98  ? 270 ILE B CB  1 
ATOM   2891 C  CG1 . ILE B 2 270 ? -3.220  12.970  54.168  1.00 48.37  ? 270 ILE B CG1 1 
ATOM   2892 C  CG2 . ILE B 2 270 ? -3.640  11.635  52.100  1.00 46.15  ? 270 ILE B CG2 1 
ATOM   2893 C  CD1 . ILE B 2 270 ? -2.452  11.849  54.813  1.00 54.58  ? 270 ILE B CD1 1 
ATOM   2894 N  N   . PRO B 2 271 ? -6.868  14.183  54.011  1.00 54.73  ? 271 PRO B N   1 
ATOM   2895 C  CA  . PRO B 2 271 ? -7.545  14.846  55.129  1.00 54.96  ? 271 PRO B CA  1 
ATOM   2896 C  C   . PRO B 2 271 ? -6.783  14.620  56.426  1.00 63.25  ? 271 PRO B C   1 
ATOM   2897 O  O   . PRO B 2 271 ? -6.062  13.626  56.546  1.00 63.64  ? 271 PRO B O   1 
ATOM   2898 C  CB  . PRO B 2 271 ? -8.892  14.124  55.199  1.00 51.21  ? 271 PRO B CB  1 
ATOM   2899 C  CG  . PRO B 2 271 ? -9.097  13.561  53.843  1.00 53.68  ? 271 PRO B CG  1 
ATOM   2900 C  CD  . PRO B 2 271 ? -7.736  13.199  53.343  1.00 52.67  ? 271 PRO B CD  1 
ATOM   2901 N  N   . GLN B 2 272 ? -6.935  15.528  57.384  1.00 72.52  ? 272 GLN B N   1 
ATOM   2902 C  CA  . GLN B 2 272 ? -6.328  15.339  58.696  1.00 78.79  ? 272 GLN B CA  1 
ATOM   2903 C  C   . GLN B 2 272 ? -7.092  14.278  59.479  1.00 82.84  ? 272 GLN B C   1 
ATOM   2904 O  O   . GLN B 2 272 ? -8.316  14.187  59.365  1.00 79.61  ? 272 GLN B O   1 
ATOM   2905 C  CB  . GLN B 2 272 ? -6.288  16.656  59.469  1.00 80.89  ? 272 GLN B CB  1 
ATOM   2906 C  CG  . GLN B 2 272 ? -5.369  17.689  58.851  1.00 84.87  ? 272 GLN B CG  1 
ATOM   2907 C  CD  . GLN B 2 272 ? -4.676  18.542  59.890  1.00 91.26  ? 272 GLN B CD  1 
ATOM   2908 O  OE1 . GLN B 2 272 ? -5.194  18.745  60.987  1.00 93.02  ? 272 GLN B OE1 1 
ATOM   2909 N  NE2 . GLN B 2 272 ? -3.490  19.038  59.553  1.00 94.18  ? 272 GLN B NE2 1 
ATOM   2910 N  N   . PRO B 2 273 ? -6.367  13.461  60.263  1.00 89.11  ? 273 PRO B N   1 
ATOM   2911 C  CA  . PRO B 2 273 ? -6.957  12.380  61.061  1.00 90.89  ? 273 PRO B CA  1 
ATOM   2912 C  C   . PRO B 2 273 ? -8.100  12.870  61.947  1.00 90.81  ? 273 PRO B C   1 
ATOM   2913 O  O   . PRO B 2 273 ? -8.035  13.964  62.508  1.00 88.31  ? 273 PRO B O   1 
ATOM   2914 C  CB  . PRO B 2 273 ? -5.783  11.901  61.917  1.00 92.45  ? 273 PRO B CB  1 
ATOM   2915 C  CG  . PRO B 2 273 ? -4.582  12.208  61.092  1.00 90.26  ? 273 PRO B CG  1 
ATOM   2916 C  CD  . PRO B 2 273 ? -4.899  13.503  60.399  1.00 89.81  ? 273 PRO B CD  1 
ATOM   2917 N  N   . THR B 2 274 ? -9.139  12.051  62.058  1.00 93.43  ? 274 THR B N   1 
ATOM   2918 C  CA  . THR B 2 274 ? -10.359 12.431  62.757  1.00 96.89  ? 274 THR B CA  1 
ATOM   2919 C  C   . THR B 2 274 ? -10.150 12.633  64.259  1.00 102.50 ? 274 THR B C   1 
ATOM   2920 O  O   . THR B 2 274 ? -10.332 13.736  64.776  1.00 106.45 ? 274 THR B O   1 
ATOM   2921 C  CB  . THR B 2 274 ? -11.464 11.383  62.535  1.00 95.27  ? 274 THR B CB  1 
ATOM   2922 O  OG1 . THR B 2 274 ? -11.026 10.113  63.036  1.00 94.58  ? 274 THR B OG1 1 
ATOM   2923 C  CG2 . THR B 2 274 ? -11.782 11.253  61.050  1.00 90.77  ? 274 THR B CG2 1 
ATOM   2924 N  N   . ASP B 2 275 ? -9.766  11.564  64.951  1.00 101.76 ? 275 ASP B N   1 
ATOM   2925 C  CA  . ASP B 2 275 ? -9.635  11.592  66.407  1.00 98.46  ? 275 ASP B CA  1 
ATOM   2926 C  C   . ASP B 2 275 ? -8.494  12.482  66.917  1.00 98.38  ? 275 ASP B C   1 
ATOM   2927 O  O   . ASP B 2 275 ? -7.468  12.652  66.256  1.00 97.41  ? 275 ASP B O   1 
ATOM   2928 C  CB  . ASP B 2 275 ? -9.496  10.167  66.955  1.00 92.30  ? 275 ASP B CB  1 
ATOM   2929 C  CG  . ASP B 2 275 ? -8.475  9.340   66.189  1.00 83.83  ? 275 ASP B CG  1 
ATOM   2930 O  OD1 . ASP B 2 275 ? -8.757  8.156   65.910  1.00 81.67  ? 275 ASP B OD1 1 
ATOM   2931 O  OD2 . ASP B 2 275 ? -7.387  9.867   65.874  1.00 78.05  ? 275 ASP B OD2 1 
ATOM   2932 N  N   . MET C 3 3   ? 21.672  24.788  60.778  1.00 72.75  ? 10  MET C N   1 
ATOM   2933 C  CA  . MET C 3 3   ? 20.723  24.003  59.991  1.00 69.62  ? 10  MET C CA  1 
ATOM   2934 C  C   . MET C 3 3   ? 19.372  24.706  59.900  1.00 66.61  ? 10  MET C C   1 
ATOM   2935 O  O   . MET C 3 3   ? 18.771  25.033  60.925  1.00 67.73  ? 10  MET C O   1 
ATOM   2936 C  CB  . MET C 3 3   ? 20.554  22.601  60.586  1.00 70.68  ? 10  MET C CB  1 
ATOM   2937 C  CG  . MET C 3 3   ? 19.477  21.760  59.904  1.00 73.23  ? 10  MET C CG  1 
ATOM   2938 S  SD  . MET C 3 3   ? 19.415  20.030  60.437  1.00 80.66  ? 10  MET C SD  1 
ATOM   2939 C  CE  . MET C 3 3   ? 21.030  19.452  59.919  1.00 152.09 ? 10  MET C CE  1 
ATOM   2940 N  N   . PRO C 3 4   ? 18.890  24.935  58.667  1.00 62.21  ? 11  PRO C N   1 
ATOM   2941 C  CA  . PRO C 3 4   ? 17.623  25.630  58.417  1.00 61.17  ? 11  PRO C CA  1 
ATOM   2942 C  C   . PRO C 3 4   ? 16.471  25.006  59.194  1.00 64.76  ? 11  PRO C C   1 
ATOM   2943 O  O   . PRO C 3 4   ? 16.471  23.801  59.441  1.00 68.67  ? 11  PRO C O   1 
ATOM   2944 C  CB  . PRO C 3 4   ? 17.406  25.434  56.915  1.00 55.31  ? 11  PRO C CB  1 
ATOM   2945 C  CG  . PRO C 3 4   ? 18.765  25.244  56.363  1.00 55.81  ? 11  PRO C CG  1 
ATOM   2946 C  CD  . PRO C 3 4   ? 19.532  24.500  57.415  1.00 59.65  ? 11  PRO C CD  1 
ATOM   2947 N  N   . ARG C 3 5   ? 15.508  25.835  59.574  1.00 64.45  ? 12  ARG C N   1 
ATOM   2948 C  CA  . ARG C 3 5   ? 14.353  25.401  60.347  1.00 64.98  ? 12  ARG C CA  1 
ATOM   2949 C  C   . ARG C 3 5   ? 13.606  24.234  59.698  1.00 64.11  ? 12  ARG C C   1 
ATOM   2950 O  O   . ARG C 3 5   ? 13.196  23.294  60.379  1.00 65.48  ? 12  ARG C O   1 
ATOM   2951 C  CB  . ARG C 3 5   ? 13.407  26.586  60.538  1.00 68.24  ? 12  ARG C CB  1 
ATOM   2952 C  CG  . ARG C 3 5   ? 12.108  26.248  61.235  1.00 75.13  ? 12  ARG C CG  1 
ATOM   2953 C  CD  . ARG C 3 5   ? 11.297  27.505  61.506  1.00 76.38  ? 12  ARG C CD  1 
ATOM   2954 N  NE  . ARG C 3 5   ? 10.907  28.194  60.279  1.00 69.97  ? 12  ARG C NE  1 
ATOM   2955 C  CZ  . ARG C 3 5   ? 10.111  29.257  60.248  1.00 66.75  ? 12  ARG C CZ  1 
ATOM   2956 N  NH1 . ARG C 3 5   ? 9.623   29.752  61.377  1.00 66.75  ? 12  ARG C NH1 1 
ATOM   2957 N  NH2 . ARG C 3 5   ? 9.798   29.826  59.094  1.00 66.58  ? 12  ARG C NH2 1 
ATOM   2958 N  N   . TRP C 3 6   ? 13.441  24.299  58.380  1.00 63.04  ? 13  TRP C N   1 
ATOM   2959 C  CA  . TRP C 3 6   ? 12.666  23.303  57.643  1.00 58.78  ? 13  TRP C CA  1 
ATOM   2960 C  C   . TRP C 3 6   ? 13.415  21.990  57.447  1.00 55.58  ? 13  TRP C C   1 
ATOM   2961 O  O   . TRP C 3 6   ? 12.799  20.940  57.272  1.00 53.81  ? 13  TRP C O   1 
ATOM   2962 C  CB  . TRP C 3 6   ? 12.236  23.860  56.282  1.00 57.79  ? 13  TRP C CB  1 
ATOM   2963 C  CG  . TRP C 3 6   ? 13.365  24.455  55.499  1.00 58.40  ? 13  TRP C CG  1 
ATOM   2964 C  CD1 . TRP C 3 6   ? 13.705  25.775  55.430  1.00 57.92  ? 13  TRP C CD1 1 
ATOM   2965 C  CD2 . TRP C 3 6   ? 14.312  23.753  54.681  1.00 55.51  ? 13  TRP C CD2 1 
ATOM   2966 N  NE1 . TRP C 3 6   ? 14.802  25.938  54.617  1.00 59.04  ? 13  TRP C NE1 1 
ATOM   2967 C  CE2 . TRP C 3 6   ? 15.194  24.712  54.147  1.00 56.55  ? 13  TRP C CE2 1 
ATOM   2968 C  CE3 . TRP C 3 6   ? 14.495  22.409  54.346  1.00 56.10  ? 13  TRP C CE3 1 
ATOM   2969 C  CZ2 . TRP C 3 6   ? 16.243  24.370  53.297  1.00 55.40  ? 13  TRP C CZ2 1 
ATOM   2970 C  CZ3 . TRP C 3 6   ? 15.541  22.072  53.506  1.00 58.04  ? 13  TRP C CZ3 1 
ATOM   2971 C  CH2 . TRP C 3 6   ? 16.398  23.048  52.989  1.00 55.90  ? 13  TRP C CH2 1 
ATOM   2972 N  N   . LYS C 3 7   ? 14.743  22.052  57.460  1.00 54.83  ? 14  LYS C N   1 
ATOM   2973 C  CA  . LYS C 3 7   ? 15.548  20.847  57.291  1.00 53.75  ? 14  LYS C CA  1 
ATOM   2974 C  C   . LYS C 3 7   ? 15.608  20.080  58.602  1.00 54.08  ? 14  LYS C C   1 
ATOM   2975 O  O   . LYS C 3 7   ? 15.613  18.851  58.615  1.00 51.20  ? 14  LYS C O   1 
ATOM   2976 C  CB  . LYS C 3 7   ? 16.959  21.180  56.801  1.00 54.14  ? 14  LYS C CB  1 
ATOM   2977 C  CG  . LYS C 3 7   ? 17.774  19.946  56.432  1.00 57.06  ? 14  LYS C CG  1 
ATOM   2978 C  CD  . LYS C 3 7   ? 19.188  20.298  55.997  1.00 61.02  ? 14  LYS C CD  1 
ATOM   2979 C  CE  . LYS C 3 7   ? 19.197  21.051  54.676  1.00 59.87  ? 14  LYS C CE  1 
ATOM   2980 N  NZ  . LYS C 3 7   ? 20.579  21.194  54.138  1.00 56.94  ? 14  LYS C NZ  1 
ATOM   2981 N  N   . ARG C 3 8   ? 15.654  20.819  59.705  1.00 58.66  ? 15  ARG C N   1 
ATOM   2982 C  CA  . ARG C 3 8   ? 15.636  20.215  61.025  1.00 61.36  ? 15  ARG C CA  1 
ATOM   2983 C  C   . ARG C 3 8   ? 14.290  19.538  61.237  1.00 62.08  ? 15  ARG C C   1 
ATOM   2984 O  O   . ARG C 3 8   ? 14.204  18.467  61.840  1.00 63.59  ? 15  ARG C O   1 
ATOM   2985 C  CB  . ARG C 3 8   ? 15.874  21.271  62.104  1.00 64.69  ? 15  ARG C CB  1 
ATOM   2986 C  CG  . ARG C 3 8   ? 15.981  20.694  63.508  1.00 70.43  ? 15  ARG C CG  1 
ATOM   2987 C  CD  . ARG C 3 8   ? 16.292  21.765  64.539  1.00 74.09  ? 15  ARG C CD  1 
ATOM   2988 N  NE  . ARG C 3 8   ? 17.555  22.449  64.269  1.00 81.24  ? 15  ARG C NE  1 
ATOM   2989 C  CZ  . ARG C 3 8   ? 18.753  21.966  64.589  1.00 85.68  ? 15  ARG C CZ  1 
ATOM   2990 N  NH1 . ARG C 3 8   ? 18.861  20.783  65.180  1.00 83.38  ? 15  ARG C NH1 1 
ATOM   2991 N  NH2 . ARG C 3 8   ? 19.848  22.664  64.309  1.00 87.99  ? 15  ARG C NH2 1 
ATOM   2992 N  N   . HIS C 3 9   ? 13.240  20.169  60.727  1.00 54.69  ? 16  HIS C N   1 
ATOM   2993 C  CA  . HIS C 3 9   ? 11.898  19.624  60.841  1.00 52.97  ? 16  HIS C CA  1 
ATOM   2994 C  C   . HIS C 3 9   ? 11.782  18.262  60.154  1.00 55.30  ? 16  HIS C C   1 
ATOM   2995 O  O   . HIS C 3 9   ? 11.184  17.330  60.696  1.00 55.41  ? 16  HIS C O   1 
ATOM   2996 C  CB  . HIS C 3 9   ? 10.888  20.595  60.241  1.00 44.06  ? 16  HIS C CB  1 
ATOM   2997 C  CG  . HIS C 3 9   ? 9.480   20.100  60.293  1.00 56.15  ? 16  HIS C CG  1 
ATOM   2998 N  ND1 . HIS C 3 9   ? 8.763   20.019  61.467  1.00 58.24  ? 16  HIS C ND1 1 
ATOM   2999 C  CD2 . HIS C 3 9   ? 8.657   19.651  59.317  1.00 54.45  ? 16  HIS C CD2 1 
ATOM   3000 C  CE1 . HIS C 3 9   ? 7.557   19.545  61.212  1.00 56.99  ? 16  HIS C CE1 1 
ATOM   3001 N  NE2 . HIS C 3 9   ? 7.467   19.313  59.915  1.00 56.50  ? 16  HIS C NE2 1 
ATOM   3002 N  N   . ILE C 3 10  ? 12.360  18.156  58.960  1.00 54.22  ? 17  ILE C N   1 
ATOM   3003 C  CA  . ILE C 3 10  ? 12.294  16.927  58.178  1.00 50.73  ? 17  ILE C CA  1 
ATOM   3004 C  C   . ILE C 3 10  ? 13.058  15.786  58.846  1.00 52.27  ? 17  ILE C C   1 
ATOM   3005 O  O   . ILE C 3 10  ? 12.547  14.670  58.944  1.00 53.16  ? 17  ILE C O   1 
ATOM   3006 C  CB  . ILE C 3 10  ? 12.795  17.145  56.734  1.00 52.15  ? 17  ILE C CB  1 
ATOM   3007 C  CG1 . ILE C 3 10  ? 11.759  17.944  55.935  1.00 54.02  ? 17  ILE C CG1 1 
ATOM   3008 C  CG2 . ILE C 3 10  ? 13.072  15.815  56.050  1.00 49.60  ? 17  ILE C CG2 1 
ATOM   3009 C  CD1 . ILE C 3 10  ? 12.201  18.301  54.531  1.00 52.51  ? 17  ILE C CD1 1 
ATOM   3010 N  N   . SER C 3 11  ? 14.271  16.071  59.315  1.00 51.48  ? 18  SER C N   1 
ATOM   3011 C  CA  . SER C 3 11  ? 15.067  15.080  60.038  1.00 54.04  ? 18  SER C CA  1 
ATOM   3012 C  C   . SER C 3 11  ? 14.340  14.554  61.273  1.00 54.33  ? 18  SER C C   1 
ATOM   3013 O  O   . SER C 3 11  ? 14.330  13.352  61.531  1.00 53.18  ? 18  SER C O   1 
ATOM   3014 C  CB  . SER C 3 11  ? 16.422  15.661  60.444  1.00 57.94  ? 18  SER C CB  1 
ATOM   3015 O  OG  . SER C 3 11  ? 17.297  15.745  59.334  1.00 62.83  ? 18  SER C OG  1 
ATOM   3016 N  N   . GLU C 3 12  ? 13.730  15.460  62.029  1.00 55.90  ? 19  GLU C N   1 
ATOM   3017 C  CA  . GLU C 3 12  ? 12.994  15.082  63.228  1.00 58.55  ? 19  GLU C CA  1 
ATOM   3018 C  C   . GLU C 3 12  ? 11.762  14.239  62.897  1.00 58.66  ? 19  GLU C C   1 
ATOM   3019 O  O   . GLU C 3 12  ? 11.481  13.242  63.565  1.00 59.29  ? 19  GLU C O   1 
ATOM   3020 C  CB  . GLU C 3 12  ? 12.607  16.323  64.039  1.00 55.35  ? 19  GLU C CB  1 
ATOM   3021 C  CG  . GLU C 3 12  ? 13.780  16.983  64.749  1.00 58.43  ? 19  GLU C CG  1 
ATOM   3022 C  CD  . GLU C 3 12  ? 13.431  18.343  65.329  1.00 65.84  ? 19  GLU C CD  1 
ATOM   3023 O  OE1 . GLU C 3 12  ? 14.299  18.940  66.005  1.00 68.48  ? 19  GLU C OE1 1 
ATOM   3024 O  OE2 . GLU C 3 12  ? 12.294  18.818  65.107  1.00 64.33  ? 19  GLU C OE2 1 
ATOM   3025 N  N   . GLN C 3 13  ? 11.035  14.633  61.859  1.00 55.36  ? 20  GLN C N   1 
ATOM   3026 C  CA  . GLN C 3 13  ? 9.841   13.896  61.460  1.00 53.34  ? 20  GLN C CA  1 
ATOM   3027 C  C   . GLN C 3 13  ? 10.169  12.498  60.937  1.00 52.69  ? 20  GLN C C   1 
ATOM   3028 O  O   . GLN C 3 13  ? 9.452   11.540  61.226  1.00 54.18  ? 20  GLN C O   1 
ATOM   3029 C  CB  . GLN C 3 13  ? 9.029   14.692  60.439  1.00 50.43  ? 20  GLN C CB  1 
ATOM   3030 C  CG  . GLN C 3 13  ? 8.303   15.871  61.054  1.00 52.06  ? 20  GLN C CG  1 
ATOM   3031 C  CD  . GLN C 3 13  ? 7.333   15.443  62.135  1.00 57.46  ? 20  GLN C CD  1 
ATOM   3032 O  OE1 . GLN C 3 13  ? 6.259   14.914  61.843  1.00 63.20  ? 20  GLN C OE1 1 
ATOM   3033 N  NE2 . GLN C 3 13  ? 7.707   15.660  63.394  1.00 54.73  ? 20  GLN C NE2 1 
ATOM   3034 N  N   . LEU C 3 14  ? 11.255  12.385  60.178  1.00 48.58  ? 21  LEU C N   1 
ATOM   3035 C  CA  . LEU C 3 14  ? 11.692  11.091  59.671  1.00 44.16  ? 21  LEU C CA  1 
ATOM   3036 C  C   . LEU C 3 14  ? 12.100  10.157  60.808  1.00 47.71  ? 21  LEU C C   1 
ATOM   3037 O  O   . LEU C 3 14  ? 11.769  8.971   60.793  1.00 46.71  ? 21  LEU C O   1 
ATOM   3038 C  CB  . LEU C 3 14  ? 12.831  11.257  58.668  1.00 44.98  ? 21  LEU C CB  1 
ATOM   3039 C  CG  . LEU C 3 14  ? 12.393  11.789  57.302  1.00 46.74  ? 21  LEU C CG  1 
ATOM   3040 C  CD1 . LEU C 3 14  ? 13.584  12.002  56.384  1.00 37.92  ? 21  LEU C CD1 1 
ATOM   3041 C  CD2 . LEU C 3 14  ? 11.380  10.842  56.670  1.00 42.70  ? 21  LEU C CD2 1 
ATOM   3042 N  N   . ARG C 3 15  ? 12.805  10.691  61.800  1.00 49.49  ? 22  ARG C N   1 
ATOM   3043 C  CA  . ARG C 3 15  ? 13.176  9.886   62.959  1.00 51.62  ? 22  ARG C CA  1 
ATOM   3044 C  C   . ARG C 3 15  ? 11.952  9.508   63.786  1.00 53.06  ? 22  ARG C C   1 
ATOM   3045 O  O   . ARG C 3 15  ? 11.870  8.401   64.313  1.00 57.37  ? 22  ARG C O   1 
ATOM   3046 C  CB  . ARG C 3 15  ? 14.219  10.595  63.826  1.00 53.88  ? 22  ARG C CB  1 
ATOM   3047 C  CG  . ARG C 3 15  ? 15.578  10.750  63.152  1.00 59.07  ? 22  ARG C CG  1 
ATOM   3048 C  CD  . ARG C 3 15  ? 16.651  11.174  64.145  1.00 68.47  ? 22  ARG C CD  1 
ATOM   3049 N  NE  . ARG C 3 15  ? 16.255  12.348  64.922  1.00 78.94  ? 22  ARG C NE  1 
ATOM   3050 C  CZ  . ARG C 3 15  ? 16.587  13.599  64.619  1.00 80.40  ? 22  ARG C CZ  1 
ATOM   3051 N  NH1 . ARG C 3 15  ? 17.331  13.853  63.550  1.00 81.21  ? 22  ARG C NH1 1 
ATOM   3052 N  NH2 . ARG C 3 15  ? 16.177  14.599  65.389  1.00 80.31  ? 22  ARG C NH2 1 
ATOM   3053 N  N   . ARG C 3 16  ? 10.995  10.422  63.889  1.00 55.73  ? 23  ARG C N   1 
ATOM   3054 C  CA  . ARG C 3 16  ? 9.769   10.133  64.620  1.00 56.68  ? 23  ARG C CA  1 
ATOM   3055 C  C   . ARG C 3 16  ? 8.981   9.045   63.901  1.00 55.20  ? 23  ARG C C   1 
ATOM   3056 O  O   . ARG C 3 16  ? 8.436   8.140   64.532  1.00 58.54  ? 23  ARG C O   1 
ATOM   3057 C  CB  . ARG C 3 16  ? 8.915   11.390  64.776  1.00 57.94  ? 23  ARG C CB  1 
ATOM   3058 C  CG  . ARG C 3 16  ? 7.716   11.202  65.688  1.00 61.97  ? 23  ARG C CG  1 
ATOM   3059 C  CD  . ARG C 3 16  ? 6.919   12.487  65.840  1.00 66.75  ? 23  ARG C CD  1 
ATOM   3060 N  NE  . ARG C 3 16  ? 5.841   12.340  66.812  1.00 75.95  ? 23  ARG C NE  1 
ATOM   3061 C  CZ  . ARG C 3 16  ? 4.621   11.899  66.515  1.00 79.98  ? 23  ARG C CZ  1 
ATOM   3062 N  NH1 . ARG C 3 16  ? 4.318   11.561  65.267  1.00 73.76  ? 23  ARG C NH1 1 
ATOM   3063 N  NH2 . ARG C 3 16  ? 3.700   11.797  67.467  1.00 82.35  ? 23  ARG C NH2 1 
ATOM   3064 N  N   . ARG C 3 17  ? 8.943   9.139   62.575  1.00 49.42  ? 24  ARG C N   1 
ATOM   3065 C  CA  . ARG C 3 17  ? 8.234   8.181   61.733  1.00 42.53  ? 24  ARG C CA  1 
ATOM   3066 C  C   . ARG C 3 17  ? 8.785   6.762   61.892  1.00 43.48  ? 24  ARG C C   1 
ATOM   3067 O  O   . ARG C 3 17  ? 8.023   5.807   62.055  1.00 43.83  ? 24  ARG C O   1 
ATOM   3068 C  CB  . ARG C 3 17  ? 8.331   8.620   60.272  1.00 43.30  ? 24  ARG C CB  1 
ATOM   3069 C  CG  . ARG C 3 17  ? 7.637   7.710   59.278  1.00 40.35  ? 24  ARG C CG  1 
ATOM   3070 C  CD  . ARG C 3 17  ? 8.262   7.868   57.902  1.00 40.20  ? 24  ARG C CD  1 
ATOM   3071 N  NE  . ARG C 3 17  ? 9.631   7.359   57.879  1.00 43.60  ? 24  ARG C NE  1 
ATOM   3072 C  CZ  . ARG C 3 17  ? 10.409  7.338   56.801  1.00 46.44  ? 24  ARG C CZ  1 
ATOM   3073 N  NH1 . ARG C 3 17  ? 9.963   7.812   55.644  1.00 46.98  ? 24  ARG C NH1 1 
ATOM   3074 N  NH2 . ARG C 3 17  ? 11.638  6.847   56.880  1.00 46.40  ? 24  ARG C NH2 1 
ATOM   3075 N  N   . ASP C 3 18  ? 10.110  6.637   61.847  1.00 43.09  ? 25  ASP C N   1 
ATOM   3076 C  CA  . ASP C 3 18  ? 10.781  5.347   61.987  1.00 46.74  ? 25  ASP C CA  1 
ATOM   3077 C  C   . ASP C 3 18  ? 10.554  4.733   63.361  1.00 54.28  ? 25  ASP C C   1 
ATOM   3078 O  O   . ASP C 3 18  ? 10.345  3.523   63.484  1.00 56.77  ? 25  ASP C O   1 
ATOM   3079 C  CB  . ASP C 3 18  ? 12.284  5.490   61.739  1.00 51.23  ? 25  ASP C CB  1 
ATOM   3080 C  CG  . ASP C 3 18  ? 12.604  5.941   60.328  1.00 56.90  ? 25  ASP C CG  1 
ATOM   3081 O  OD1 . ASP C 3 18  ? 11.700  5.906   59.464  1.00 60.65  ? 25  ASP C OD1 1 
ATOM   3082 O  OD2 . ASP C 3 18  ? 13.767  6.321   60.079  1.00 57.36  ? 25  ASP C OD2 1 
ATOM   3083 N  N   . ARG C 3 19  ? 10.601  5.571   64.392  1.00 57.75  ? 26  ARG C N   1 
ATOM   3084 C  CA  . ARG C 3 19  ? 10.413  5.112   65.764  1.00 62.13  ? 26  ARG C CA  1 
ATOM   3085 C  C   . ARG C 3 19  ? 9.016   4.539   65.954  1.00 58.35  ? 26  ARG C C   1 
ATOM   3086 O  O   . ARG C 3 19  ? 8.844   3.479   66.553  1.00 58.12  ? 26  ARG C O   1 
ATOM   3087 C  CB  . ARG C 3 19  ? 10.661  6.258   66.750  1.00 66.96  ? 26  ARG C CB  1 
ATOM   3088 C  CG  . ARG C 3 19  ? 10.491  5.879   68.213  1.00 70.33  ? 26  ARG C CG  1 
ATOM   3089 C  CD  . ARG C 3 19  ? 11.074  6.942   69.140  1.00 74.51  ? 26  ARG C CD  1 
ATOM   3090 N  NE  . ARG C 3 19  ? 10.375  8.224   69.040  1.00 78.00  ? 26  ARG C NE  1 
ATOM   3091 C  CZ  . ARG C 3 19  ? 10.862  9.303   68.429  1.00 78.14  ? 26  ARG C CZ  1 
ATOM   3092 N  NH1 . ARG C 3 19  ? 12.062  9.267   67.859  1.00 74.52  ? 26  ARG C NH1 1 
ATOM   3093 N  NH2 . ARG C 3 19  ? 10.152  10.423  68.391  1.00 78.92  ? 26  ARG C NH2 1 
ATOM   3094 N  N   . LEU C 3 20  ? 8.022   5.243   65.423  1.00 54.78  ? 27  LEU C N   1 
ATOM   3095 C  CA  . LEU C 3 20  ? 6.633   4.821   65.535  1.00 51.80  ? 27  LEU C CA  1 
ATOM   3096 C  C   . LEU C 3 20  ? 6.312   3.627   64.646  1.00 52.29  ? 27  LEU C C   1 
ATOM   3097 O  O   . LEU C 3 20  ? 5.579   2.729   65.052  1.00 54.36  ? 27  LEU C O   1 
ATOM   3098 C  CB  . LEU C 3 20  ? 5.700   5.975   65.175  1.00 41.51  ? 27  LEU C CB  1 
ATOM   3099 C  CG  . LEU C 3 20  ? 5.765   7.193   66.090  1.00 46.69  ? 27  LEU C CG  1 
ATOM   3100 C  CD1 . LEU C 3 20  ? 4.840   8.296   65.592  1.00 44.64  ? 27  LEU C CD1 1 
ATOM   3101 C  CD2 . LEU C 3 20  ? 5.418   6.796   67.518  1.00 46.00  ? 27  LEU C CD2 1 
ATOM   3102 N  N   . GLN C 3 21  ? 6.853   3.619   63.431  1.00 50.42  ? 28  GLN C N   1 
ATOM   3103 C  CA  . GLN C 3 21  ? 6.440   2.634   62.437  1.00 48.45  ? 28  GLN C CA  1 
ATOM   3104 C  C   . GLN C 3 21  ? 7.368   1.425   62.325  1.00 52.18  ? 28  GLN C C   1 
ATOM   3105 O  O   . GLN C 3 21  ? 6.900   0.296   62.192  1.00 55.63  ? 28  GLN C O   1 
ATOM   3106 C  CB  . GLN C 3 21  ? 6.227   3.299   61.071  1.00 43.11  ? 28  GLN C CB  1 
ATOM   3107 C  CG  . GLN C 3 21  ? 5.080   4.299   61.057  1.00 38.82  ? 28  GLN C CG  1 
ATOM   3108 C  CD  . GLN C 3 21  ? 4.934   5.027   59.732  1.00 43.58  ? 28  GLN C CD  1 
ATOM   3109 O  OE1 . GLN C 3 21  ? 5.762   4.885   58.834  1.00 49.46  ? 28  GLN C OE1 1 
ATOM   3110 N  NE2 . GLN C 3 21  ? 3.874   5.816   59.609  1.00 40.43  ? 28  GLN C NE2 1 
ATOM   3111 N  N   . ARG C 3 22  ? 8.677   1.649   62.386  1.00 46.09  ? 29  ARG C N   1 
ATOM   3112 C  CA  . ARG C 3 22  ? 9.617   0.542   62.243  1.00 46.65  ? 29  ARG C CA  1 
ATOM   3113 C  C   . ARG C 3 22  ? 10.079  -0.039  63.579  1.00 49.61  ? 29  ARG C C   1 
ATOM   3114 O  O   . ARG C 3 22  ? 9.934   -1.234  63.833  1.00 55.14  ? 29  ARG C O   1 
ATOM   3115 C  CB  . ARG C 3 22  ? 10.830  0.949   61.402  1.00 44.52  ? 29  ARG C CB  1 
ATOM   3116 C  CG  . ARG C 3 22  ? 11.814  -0.197  61.199  1.00 48.07  ? 29  ARG C CG  1 
ATOM   3117 C  CD  . ARG C 3 22  ? 12.985  0.175   60.305  1.00 51.14  ? 29  ARG C CD  1 
ATOM   3118 N  NE  . ARG C 3 22  ? 13.903  -0.952  60.139  1.00 56.84  ? 29  ARG C NE  1 
ATOM   3119 C  CZ  . ARG C 3 22  ? 14.858  -1.019  59.215  1.00 58.45  ? 29  ARG C CZ  1 
ATOM   3120 N  NH1 . ARG C 3 22  ? 15.034  -0.023  58.355  1.00 59.76  ? 29  ARG C NH1 1 
ATOM   3121 N  NH2 . ARG C 3 22  ? 15.638  -2.089  59.148  1.00 54.03  ? 29  ARG C NH2 1 
ATOM   3122 N  N   . GLN C 3 23  ? 10.639  0.814   64.427  1.00 49.29  ? 30  GLN C N   1 
ATOM   3123 C  CA  . GLN C 3 23  ? 11.230  0.371   65.685  1.00 54.74  ? 30  GLN C CA  1 
ATOM   3124 C  C   . GLN C 3 23  ? 10.228  -0.335  66.602  1.00 54.96  ? 30  GLN C C   1 
ATOM   3125 O  O   . GLN C 3 23  ? 10.581  -1.269  67.322  1.00 56.97  ? 30  GLN C O   1 
ATOM   3126 C  CB  . GLN C 3 23  ? 11.859  1.558   66.409  1.00 53.40  ? 30  GLN C CB  1 
ATOM   3127 C  CG  . GLN C 3 23  ? 12.615  1.186   67.662  1.00 58.30  ? 30  GLN C CG  1 
ATOM   3128 C  CD  . GLN C 3 23  ? 13.223  2.393   68.332  1.00 63.03  ? 30  GLN C CD  1 
ATOM   3129 O  OE1 . GLN C 3 23  ? 13.418  3.430   67.699  1.00 64.76  ? 30  GLN C OE1 1 
ATOM   3130 N  NE2 . GLN C 3 23  ? 13.518  2.272   69.622  1.00 64.82  ? 30  GLN C NE2 1 
ATOM   3131 N  N   . ALA C 3 24  ? 8.981   0.115   66.562  1.00 51.37  ? 31  ALA C N   1 
ATOM   3132 C  CA  . ALA C 3 24  ? 7.930   -0.458  67.388  1.00 47.54  ? 31  ALA C CA  1 
ATOM   3133 C  C   . ALA C 3 24  ? 7.574   -1.884  66.981  1.00 50.91  ? 31  ALA C C   1 
ATOM   3134 O  O   . ALA C 3 24  ? 7.151   -2.682  67.817  1.00 57.95  ? 31  ALA C O   1 
ATOM   3135 C  CB  . ALA C 3 24  ? 6.691   0.422   67.349  1.00 40.90  ? 31  ALA C CB  1 
ATOM   3136 N  N   . PHE C 3 25  ? 7.742   -2.208  65.703  1.00 46.81  ? 32  PHE C N   1 
ATOM   3137 C  CA  . PHE C 3 25  ? 7.289   -3.499  65.193  1.00 41.52  ? 32  PHE C CA  1 
ATOM   3138 C  C   . PHE C 3 25  ? 8.420   -4.437  64.822  1.00 42.53  ? 32  PHE C C   1 
ATOM   3139 O  O   . PHE C 3 25  ? 8.192   -5.627  64.592  1.00 45.65  ? 32  PHE C O   1 
ATOM   3140 C  CB  . PHE C 3 25  ? 6.374   -3.311  63.983  1.00 41.87  ? 32  PHE C CB  1 
ATOM   3141 C  CG  . PHE C 3 25  ? 5.019   -2.786  64.334  1.00 43.99  ? 32  PHE C CG  1 
ATOM   3142 C  CD1 . PHE C 3 25  ? 3.947   -3.653  64.484  1.00 39.59  ? 32  PHE C CD1 1 
ATOM   3143 C  CD2 . PHE C 3 25  ? 4.818   -1.427  64.533  1.00 37.20  ? 32  PHE C CD2 1 
ATOM   3144 C  CE1 . PHE C 3 25  ? 2.701   -3.178  64.819  1.00 33.62  ? 32  PHE C CE1 1 
ATOM   3145 C  CE2 . PHE C 3 25  ? 3.574   -0.945  64.870  1.00 37.38  ? 32  PHE C CE2 1 
ATOM   3146 C  CZ  . PHE C 3 25  ? 2.511   -1.822  65.014  1.00 41.18  ? 32  PHE C CZ  1 
ATOM   3147 N  N   . GLU C 3 26  ? 9.637   -3.912  64.766  1.00 40.18  ? 33  GLU C N   1 
ATOM   3148 C  CA  . GLU C 3 26  ? 10.750  -4.691  64.240  1.00 50.18  ? 33  GLU C CA  1 
ATOM   3149 C  C   . GLU C 3 26  ? 10.991  -6.013  64.976  1.00 53.10  ? 33  GLU C C   1 
ATOM   3150 O  O   . GLU C 3 26  ? 11.081  -7.069  64.344  1.00 52.62  ? 33  GLU C O   1 
ATOM   3151 C  CB  . GLU C 3 26  ? 12.030  -3.860  64.204  1.00 53.86  ? 33  GLU C CB  1 
ATOM   3152 C  CG  . GLU C 3 26  ? 13.145  -4.529  63.431  1.00 56.25  ? 33  GLU C CG  1 
ATOM   3153 C  CD  . GLU C 3 26  ? 13.855  -3.571  62.510  1.00 61.33  ? 33  GLU C CD  1 
ATOM   3154 O  OE1 . GLU C 3 26  ? 14.178  -3.975  61.370  1.00 64.86  ? 33  GLU C OE1 1 
ATOM   3155 O  OE2 . GLU C 3 26  ? 14.086  -2.415  62.927  1.00 61.28  ? 33  GLU C OE2 1 
ATOM   3156 N  N   . GLU C 3 27  ? 11.085  -5.955  66.303  1.00 50.38  ? 34  GLU C N   1 
ATOM   3157 C  CA  . GLU C 3 27  ? 11.378  -7.146  67.097  1.00 50.62  ? 34  GLU C CA  1 
ATOM   3158 C  C   . GLU C 3 27  ? 10.218  -8.137  67.115  1.00 47.08  ? 34  GLU C C   1 
ATOM   3159 O  O   . GLU C 3 27  ? 10.429  -9.344  66.992  1.00 45.89  ? 34  GLU C O   1 
ATOM   3160 C  CB  . GLU C 3 27  ? 11.775  -6.777  68.531  1.00 56.95  ? 34  GLU C CB  1 
ATOM   3161 C  CG  . GLU C 3 27  ? 13.212  -7.145  68.902  1.00 66.80  ? 34  GLU C CG  1 
ATOM   3162 C  CD  . GLU C 3 27  ? 13.474  -8.650  68.887  1.00 75.92  ? 34  GLU C CD  1 
ATOM   3163 O  OE1 . GLU C 3 27  ? 12.844  -9.385  69.681  1.00 80.21  ? 34  GLU C OE1 1 
ATOM   3164 O  OE2 . GLU C 3 27  ? 14.319  -9.100  68.082  1.00 75.18  ? 34  GLU C OE2 1 
ATOM   3165 N  N   . ILE C 3 28  ? 8.997   -7.634  67.270  1.00 41.16  ? 35  ILE C N   1 
ATOM   3166 C  CA  . ILE C 3 28  ? 7.849   -8.526  67.367  1.00 45.39  ? 35  ILE C CA  1 
ATOM   3167 C  C   . ILE C 3 28  ? 7.605   -9.277  66.054  1.00 52.57  ? 35  ILE C C   1 
ATOM   3168 O  O   . ILE C 3 28  ? 7.235   -10.450 66.067  1.00 50.56  ? 35  ILE C O   1 
ATOM   3169 C  CB  . ILE C 3 28  ? 6.570   -7.794  67.851  1.00 43.55  ? 35  ILE C CB  1 
ATOM   3170 C  CG1 . ILE C 3 28  ? 5.487   -8.809  68.228  1.00 46.25  ? 35  ILE C CG1 1 
ATOM   3171 C  CG2 . ILE C 3 28  ? 6.063   -6.809  66.809  1.00 37.80  ? 35  ILE C CG2 1 
ATOM   3172 C  CD1 . ILE C 3 28  ? 4.288   -8.197  68.914  1.00 48.47  ? 35  ILE C CD1 1 
ATOM   3173 N  N   . ILE C 3 29  ? 7.839   -8.604  64.929  1.00 56.00  ? 36  ILE C N   1 
ATOM   3174 C  CA  . ILE C 3 29  ? 7.685   -9.222  63.617  1.00 54.30  ? 36  ILE C CA  1 
ATOM   3175 C  C   . ILE C 3 29  ? 8.780   -10.261 63.400  1.00 58.28  ? 36  ILE C C   1 
ATOM   3176 O  O   . ILE C 3 29  ? 8.537   -11.340 62.851  1.00 56.55  ? 36  ILE C O   1 
ATOM   3177 C  CB  . ILE C 3 29  ? 7.722   -8.170  62.492  1.00 50.52  ? 36  ILE C CB  1 
ATOM   3178 C  CG1 . ILE C 3 29  ? 6.463   -7.304  62.537  1.00 49.23  ? 36  ILE C CG1 1 
ATOM   3179 C  CG2 . ILE C 3 29  ? 7.839   -8.840  61.134  1.00 48.62  ? 36  ILE C CG2 1 
ATOM   3180 C  CD1 . ILE C 3 29  ? 6.389   -6.276  61.435  1.00 47.50  ? 36  ILE C CD1 1 
ATOM   3181 N  N   . LEU C 3 30  ? 9.983   -9.934  63.859  1.00 60.88  ? 37  LEU C N   1 
ATOM   3182 C  CA  . LEU C 3 30  ? 11.117  -10.843 63.759  1.00 60.43  ? 37  LEU C CA  1 
ATOM   3183 C  C   . LEU C 3 30  ? 10.881  -12.107 64.588  1.00 62.45  ? 37  LEU C C   1 
ATOM   3184 O  O   . LEU C 3 30  ? 11.272  -13.199 64.180  1.00 65.58  ? 37  LEU C O   1 
ATOM   3185 C  CB  . LEU C 3 30  ? 12.395  -10.134 64.206  1.00 63.27  ? 37  LEU C CB  1 
ATOM   3186 C  CG  . LEU C 3 30  ? 13.744  -10.715 63.783  1.00 70.09  ? 37  LEU C CG  1 
ATOM   3187 C  CD1 . LEU C 3 30  ? 14.759  -9.590  63.647  1.00 72.58  ? 37  LEU C CD1 1 
ATOM   3188 C  CD2 . LEU C 3 30  ? 14.240  -11.761 64.778  1.00 72.81  ? 37  LEU C CD2 1 
ATOM   3189 N  N   . GLN C 3 31  ? 10.240  -11.951 65.744  1.00 63.67  ? 38  GLN C N   1 
ATOM   3190 C  CA  . GLN C 3 31  ? 9.938   -13.078 66.624  1.00 67.11  ? 38  GLN C CA  1 
ATOM   3191 C  C   . GLN C 3 31  ? 8.829   -13.950 66.051  1.00 67.83  ? 38  GLN C C   1 
ATOM   3192 O  O   . GLN C 3 31  ? 8.898   -15.178 66.105  1.00 68.57  ? 38  GLN C O   1 
ATOM   3193 C  CB  . GLN C 3 31  ? 9.521   -12.589 68.013  1.00 72.32  ? 38  GLN C CB  1 
ATOM   3194 C  CG  . GLN C 3 31  ? 10.634  -11.949 68.817  1.00 81.30  ? 38  GLN C CG  1 
ATOM   3195 C  CD  . GLN C 3 31  ? 11.803  -12.885 69.038  1.00 92.16  ? 38  GLN C CD  1 
ATOM   3196 O  OE1 . GLN C 3 31  ? 11.624  -14.075 69.312  1.00 94.36  ? 38  GLN C OE1 1 
ATOM   3197 N  NE2 . GLN C 3 31  ? 13.013  -12.351 68.913  1.00 96.56  ? 38  GLN C NE2 1 
ATOM   3198 N  N   . TYR C 3 32  ? 7.800   -13.302 65.518  1.00 65.70  ? 39  TYR C N   1 
ATOM   3199 C  CA  . TYR C 3 32  ? 6.668   -13.995 64.925  1.00 61.38  ? 39  TYR C CA  1 
ATOM   3200 C  C   . TYR C 3 32  ? 7.124   -14.823 63.733  1.00 68.76  ? 39  TYR C C   1 
ATOM   3201 O  O   . TYR C 3 32  ? 6.663   -15.946 63.532  1.00 70.80  ? 39  TYR C O   1 
ATOM   3202 C  CB  . TYR C 3 32  ? 5.613   -12.981 64.485  1.00 53.85  ? 39  TYR C CB  1 
ATOM   3203 C  CG  . TYR C 3 32  ? 4.416   -13.579 63.783  1.00 52.21  ? 39  TYR C CG  1 
ATOM   3204 C  CD1 . TYR C 3 32  ? 3.260   -13.885 64.485  1.00 47.80  ? 39  TYR C CD1 1 
ATOM   3205 C  CD2 . TYR C 3 32  ? 4.436   -13.824 62.412  1.00 57.05  ? 39  TYR C CD2 1 
ATOM   3206 C  CE1 . TYR C 3 32  ? 2.161   -14.424 63.849  1.00 52.70  ? 39  TYR C CE1 1 
ATOM   3207 C  CE2 . TYR C 3 32  ? 3.340   -14.368 61.768  1.00 59.09  ? 39  TYR C CE2 1 
ATOM   3208 C  CZ  . TYR C 3 32  ? 2.206   -14.663 62.492  1.00 56.15  ? 39  TYR C CZ  1 
ATOM   3209 O  OH  . TYR C 3 32  ? 1.116   -15.200 61.853  1.00 58.85  ? 39  TYR C OH  1 
ATOM   3210 N  N   . ASN C 3 33  ? 8.026   -14.256 62.940  1.00 73.38  ? 40  ASN C N   1 
ATOM   3211 C  CA  . ASN C 3 33  ? 8.523   -14.926 61.747  1.00 79.27  ? 40  ASN C CA  1 
ATOM   3212 C  C   . ASN C 3 33  ? 9.227   -16.238 62.085  1.00 85.16  ? 40  ASN C C   1 
ATOM   3213 O  O   . ASN C 3 33  ? 9.197   -17.188 61.303  1.00 89.81  ? 40  ASN C O   1 
ATOM   3214 C  CB  . ASN C 3 33  ? 9.463   -14.005 60.968  1.00 83.07  ? 40  ASN C CB  1 
ATOM   3215 C  CG  . ASN C 3 33  ? 9.479   -14.311 59.484  1.00 88.24  ? 40  ASN C CG  1 
ATOM   3216 O  OD1 . ASN C 3 33  ? 8.443   -14.613 58.891  1.00 88.45  ? 40  ASN C OD1 1 
ATOM   3217 N  ND2 . ASN C 3 33  ? 10.659  -14.243 58.876  1.00 90.65  ? 40  ASN C ND2 1 
ATOM   3218 N  N   . LYS C 3 34  ? 9.855   -16.284 63.256  1.00 84.84  ? 41  LYS C N   1 
ATOM   3219 C  CA  . LYS C 3 34  ? 10.524  -17.492 63.723  1.00 87.79  ? 41  LYS C CA  1 
ATOM   3220 C  C   . LYS C 3 34  ? 9.517   -18.604 63.985  1.00 90.64  ? 41  LYS C C   1 
ATOM   3221 O  O   . LYS C 3 34  ? 9.557   -19.660 63.354  1.00 96.49  ? 41  LYS C O   1 
ATOM   3222 C  CB  . LYS C 3 34  ? 11.312  -17.205 65.003  1.00 90.82  ? 41  LYS C CB  1 
ATOM   3223 C  CG  . LYS C 3 34  ? 12.511  -16.290 64.815  1.00 93.80  ? 41  LYS C CG  1 
ATOM   3224 C  CD  . LYS C 3 34  ? 13.095  -15.873 66.159  1.00 97.93  ? 41  LYS C CD  1 
ATOM   3225 C  CE  . LYS C 3 34  ? 13.444  -17.081 67.013  1.00 99.49  ? 41  LYS C CE  1 
ATOM   3226 N  NZ  . LYS C 3 34  ? 13.894  -16.687 68.377  1.00 101.36 ? 41  LYS C NZ  1 
ATOM   3227 N  N   . LEU C 3 35  ? 8.611   -18.353 64.922  1.00 87.18  ? 42  LEU C N   1 
ATOM   3228 C  CA  . LEU C 3 35  ? 7.617   -19.337 65.328  1.00 84.12  ? 42  LEU C CA  1 
ATOM   3229 C  C   . LEU C 3 35  ? 6.492   -19.429 64.305  1.00 85.13  ? 42  LEU C C   1 
ATOM   3230 O  O   . LEU C 3 35  ? 5.349   -19.087 64.605  1.00 90.90  ? 42  LEU C O   1 
ATOM   3231 C  CB  . LEU C 3 35  ? 7.033   -18.969 66.697  1.00 83.71  ? 42  LEU C CB  1 
ATOM   3232 C  CG  . LEU C 3 35  ? 7.927   -18.998 67.944  1.00 85.55  ? 42  LEU C CG  1 
ATOM   3233 C  CD1 . LEU C 3 35  ? 8.882   -17.809 68.020  1.00 87.54  ? 42  LEU C CD1 1 
ATOM   3234 C  CD2 . LEU C 3 35  ? 7.069   -19.063 69.193  1.00 86.00  ? 42  LEU C CD2 1 
ATOM   3235 N  N   . LEU C 3 36  ? 6.812   -19.894 63.101  1.00 81.27  ? 43  LEU C N   1 
ATOM   3236 C  CA  . LEU C 3 36  ? 5.829   -19.931 62.021  1.00 77.02  ? 43  LEU C CA  1 
ATOM   3237 C  C   . LEU C 3 36  ? 5.810   -21.279 61.294  1.00 75.83  ? 43  LEU C C   1 
ATOM   3238 O  O   . LEU C 3 36  ? 6.825   -21.732 60.765  1.00 72.30  ? 43  LEU C O   1 
ATOM   3239 C  CB  . LEU C 3 36  ? 6.087   -18.786 61.035  1.00 68.89  ? 43  LEU C CB  1 
ATOM   3240 C  CG  . LEU C 3 36  ? 4.972   -18.411 60.055  1.00 63.10  ? 43  LEU C CG  1 
ATOM   3241 C  CD1 . LEU C 3 36  ? 3.670   -18.135 60.788  1.00 60.70  ? 43  LEU C CD1 1 
ATOM   3242 C  CD2 . LEU C 3 36  ? 5.381   -17.203 59.228  1.00 58.54  ? 43  LEU C CD2 1 
ATOM   3243 N  N   . LYS D 1 5   ? 8.870   17.309  111.613 1.00 83.82  ? 54  LYS D N   1 
ATOM   3244 C  CA  . LYS D 1 5   ? 8.398   16.092  112.266 1.00 85.17  ? 54  LYS D CA  1 
ATOM   3245 C  C   . LYS D 1 5   ? 6.890   16.111  112.502 1.00 84.60  ? 54  LYS D C   1 
ATOM   3246 O  O   . LYS D 1 5   ? 6.297   17.170  112.709 1.00 84.60  ? 54  LYS D O   1 
ATOM   3247 C  CB  . LYS D 1 5   ? 9.119   15.877  113.597 1.00 88.04  ? 54  LYS D CB  1 
ATOM   3248 C  CG  . LYS D 1 5   ? 10.538  15.350  113.478 1.00 90.82  ? 54  LYS D CG  1 
ATOM   3249 C  CD  . LYS D 1 5   ? 11.182  15.246  114.854 1.00 96.65  ? 54  LYS D CD  1 
ATOM   3250 C  CE  . LYS D 1 5   ? 12.578  14.648  114.785 1.00 99.46  ? 54  LYS D CE  1 
ATOM   3251 N  NZ  . LYS D 1 5   ? 12.553  13.236  114.317 1.00 99.53  ? 54  LYS D NZ  1 
ATOM   3252 N  N   . ILE D 1 6   ? 6.284   14.927  112.478 1.00 82.07  ? 55  ILE D N   1 
ATOM   3253 C  CA  . ILE D 1 6   ? 4.851   14.779  112.712 1.00 79.26  ? 55  ILE D CA  1 
ATOM   3254 C  C   . ILE D 1 6   ? 4.578   14.189  114.092 1.00 79.05  ? 55  ILE D C   1 
ATOM   3255 O  O   . ILE D 1 6   ? 5.182   13.188  114.478 1.00 78.86  ? 55  ILE D O   1 
ATOM   3256 C  CB  . ILE D 1 6   ? 4.200   13.862  111.655 1.00 76.65  ? 55  ILE D CB  1 
ATOM   3257 C  CG1 . ILE D 1 6   ? 4.352   14.462  110.258 1.00 80.40  ? 55  ILE D CG1 1 
ATOM   3258 C  CG2 . ILE D 1 6   ? 2.730   13.635  111.973 1.00 71.56  ? 55  ILE D CG2 1 
ATOM   3259 C  CD1 . ILE D 1 6   ? 3.670   15.803  110.097 1.00 82.89  ? 55  ILE D CD1 1 
ATOM   3260 N  N   . ASP D 1 7   ? 3.669   14.814  114.834 1.00 78.65  ? 56  ASP D N   1 
ATOM   3261 C  CA  . ASP D 1 7   ? 3.242   14.282  116.122 1.00 77.62  ? 56  ASP D CA  1 
ATOM   3262 C  C   . ASP D 1 7   ? 2.141   13.248  115.927 1.00 74.89  ? 56  ASP D C   1 
ATOM   3263 O  O   . ASP D 1 7   ? 1.069   13.561  115.415 1.00 77.51  ? 56  ASP D O   1 
ATOM   3264 C  CB  . ASP D 1 7   ? 2.759   15.405  117.040 1.00 79.45  ? 56  ASP D CB  1 
ATOM   3265 C  CG  . ASP D 1 7   ? 3.896   16.265  117.555 1.00 80.76  ? 56  ASP D CG  1 
ATOM   3266 O  OD1 . ASP D 1 7   ? 5.010   15.731  117.749 1.00 78.31  ? 56  ASP D OD1 1 
ATOM   3267 O  OD2 . ASP D 1 7   ? 3.674   17.475  117.766 1.00 83.68  ? 56  ASP D OD2 1 
ATOM   3268 N  N   . ILE D 1 8   ? 2.412   12.014  116.335 1.00 70.55  ? 57  ILE D N   1 
ATOM   3269 C  CA  . ILE D 1 8   ? 1.453   10.932  116.164 1.00 66.32  ? 57  ILE D CA  1 
ATOM   3270 C  C   . ILE D 1 8   ? 0.946   10.383  117.493 1.00 66.39  ? 57  ILE D C   1 
ATOM   3271 O  O   . ILE D 1 8   ? 1.730   10.067  118.391 1.00 67.86  ? 57  ILE D O   1 
ATOM   3272 C  CB  . ILE D 1 8   ? 2.052   9.785   115.334 1.00 67.01  ? 57  ILE D CB  1 
ATOM   3273 C  CG1 . ILE D 1 8   ? 2.315   10.253  113.904 1.00 67.12  ? 57  ILE D CG1 1 
ATOM   3274 C  CG2 . ILE D 1 8   ? 1.123   8.580   115.334 1.00 66.74  ? 57  ILE D CG2 1 
ATOM   3275 C  CD1 . ILE D 1 8   ? 2.447   9.116   112.914 1.00 69.68  ? 57  ILE D CD1 1 
ATOM   3276 N  N   . LEU D 1 9   ? -0.374  10.278  117.610 1.00 63.71  ? 58  LEU D N   1 
ATOM   3277 C  CA  . LEU D 1 9   ? -0.996  9.685   118.784 1.00 65.22  ? 58  LEU D CA  1 
ATOM   3278 C  C   . LEU D 1 9   ? -1.548  8.311   118.426 1.00 66.66  ? 58  LEU D C   1 
ATOM   3279 O  O   . LEU D 1 9   ? -2.318  8.177   117.476 1.00 66.14  ? 58  LEU D O   1 
ATOM   3280 C  CB  . LEU D 1 9   ? -2.117  10.586  119.302 1.00 65.59  ? 58  LEU D CB  1 
ATOM   3281 C  CG  . LEU D 1 9   ? -2.845  10.122  120.564 1.00 70.36  ? 58  LEU D CG  1 
ATOM   3282 C  CD1 . LEU D 1 9   ? -1.862  9.933   121.709 1.00 69.71  ? 58  LEU D CD1 1 
ATOM   3283 C  CD2 . LEU D 1 9   ? -3.936  11.114  120.943 1.00 70.85  ? 58  LEU D CD2 1 
ATOM   3284 N  N   . LEU D 1 10  ? -1.149  7.294   119.181 1.00 67.09  ? 59  LEU D N   1 
ATOM   3285 C  CA  . LEU D 1 10  ? -1.583  5.925   118.918 1.00 63.66  ? 59  LEU D CA  1 
ATOM   3286 C  C   . LEU D 1 10  ? -2.667  5.485   119.895 1.00 68.62  ? 59  LEU D C   1 
ATOM   3287 O  O   . LEU D 1 10  ? -2.497  5.583   121.110 1.00 74.20  ? 59  LEU D O   1 
ATOM   3288 C  CB  . LEU D 1 10  ? -0.393  4.970   118.999 1.00 62.57  ? 59  LEU D CB  1 
ATOM   3289 C  CG  . LEU D 1 10  ? 0.756   5.267   118.035 1.00 61.79  ? 59  LEU D CG  1 
ATOM   3290 C  CD1 . LEU D 1 10  ? 1.899   4.278   118.226 1.00 61.71  ? 59  LEU D CD1 1 
ATOM   3291 C  CD2 . LEU D 1 10  ? 0.251   5.239   116.602 1.00 59.88  ? 59  LEU D CD2 1 
ATOM   3292 N  N   . LYS D 1 11  ? -3.781  4.995   119.362 1.00 67.57  ? 60  LYS D N   1 
ATOM   3293 C  CA  . LYS D 1 11  ? -4.888  4.537   120.194 1.00 68.21  ? 60  LYS D CA  1 
ATOM   3294 C  C   . LYS D 1 11  ? -5.221  3.086   119.878 1.00 64.63  ? 60  LYS D C   1 
ATOM   3295 O  O   . LYS D 1 11  ? -5.257  2.691   118.718 1.00 66.73  ? 60  LYS D O   1 
ATOM   3296 C  CB  . LYS D 1 11  ? -6.118  5.424   119.988 1.00 74.14  ? 60  LYS D CB  1 
ATOM   3297 C  CG  . LYS D 1 11  ? -5.878  6.896   120.301 1.00 80.34  ? 60  LYS D CG  1 
ATOM   3298 C  CD  . LYS D 1 11  ? -7.164  7.706   120.224 1.00 88.26  ? 60  LYS D CD  1 
ATOM   3299 C  CE  . LYS D 1 11  ? -6.937  9.141   120.679 1.00 96.11  ? 60  LYS D CE  1 
ATOM   3300 N  NZ  . LYS D 1 11  ? -8.162  9.985   120.565 1.00 99.99  ? 60  LYS D NZ  1 
ATOM   3301 N  N   . ALA D 1 12  ? -5.465  2.292   120.912 1.00 65.11  ? 61  ALA D N   1 
ATOM   3302 C  CA  . ALA D 1 12  ? -5.698  0.866   120.723 1.00 64.60  ? 61  ALA D CA  1 
ATOM   3303 C  C   . ALA D 1 12  ? -7.179  0.521   120.628 1.00 70.34  ? 61  ALA D C   1 
ATOM   3304 O  O   . ALA D 1 12  ? -8.024  1.153   121.266 1.00 70.81  ? 61  ALA D O   1 
ATOM   3305 C  CB  . ALA D 1 12  ? -5.045  0.069   121.836 1.00 62.52  ? 61  ALA D CB  1 
ATOM   3306 N  N   . VAL D 1 13  ? -7.480  -0.488  119.818 1.00 72.37  ? 62  VAL D N   1 
ATOM   3307 C  CA  . VAL D 1 13  ? -8.825  -1.033  119.720 1.00 75.66  ? 62  VAL D CA  1 
ATOM   3308 C  C   . VAL D 1 13  ? -8.725  -2.537  119.968 1.00 84.06  ? 62  VAL D C   1 
ATOM   3309 O  O   . VAL D 1 13  ? -8.134  -3.260  119.166 1.00 85.01  ? 62  VAL D O   1 
ATOM   3310 C  CB  . VAL D 1 13  ? -9.447  -0.755  118.331 1.00 74.61  ? 62  VAL D CB  1 
ATOM   3311 C  CG1 . VAL D 1 13  ? -10.906 -1.192  118.292 1.00 73.06  ? 62  VAL D CG1 1 
ATOM   3312 C  CG2 . VAL D 1 13  ? -9.333  0.722   117.979 1.00 72.99  ? 62  VAL D CG2 1 
ATOM   3313 N  N   . GLY D 1 14  ? -9.290  -2.999  121.083 1.00 91.36  ? 63  GLY D N   1 
ATOM   3314 C  CA  . GLY D 1 14  ? -9.145  -4.381  121.518 1.00 95.09  ? 63  GLY D CA  1 
ATOM   3315 C  C   . GLY D 1 14  ? -9.637  -5.403  120.509 1.00 101.63 ? 63  GLY D C   1 
ATOM   3316 O  O   . GLY D 1 14  ? -10.321 -5.040  119.552 1.00 102.52 ? 63  GLY D O   1 
ATOM   3317 N  N   . ASP D 1 15  ? -9.288  -6.677  120.699 1.00 104.23 ? 64  ASP D N   1 
ATOM   3318 C  CA  . ASP D 1 15  ? -8.420  -7.124  121.785 1.00 104.49 ? 64  ASP D CA  1 
ATOM   3319 C  C   . ASP D 1 15  ? -6.954  -7.029  121.380 1.00 98.05  ? 64  ASP D C   1 
ATOM   3320 O  O   . ASP D 1 15  ? -6.404  -7.946  120.769 1.00 98.70  ? 64  ASP D O   1 
ATOM   3321 C  CB  . ASP D 1 15  ? -8.751  -8.566  122.178 1.00 110.87 ? 64  ASP D CB  1 
ATOM   3322 C  CG  . ASP D 1 15  ? -10.042 -8.676  122.969 1.00 118.48 ? 64  ASP D CG  1 
ATOM   3323 O  OD1 . ASP D 1 15  ? -10.355 -7.738  123.733 1.00 120.51 ? 64  ASP D OD1 1 
ATOM   3324 O  OD2 . ASP D 1 15  ? -10.741 -9.703  122.832 1.00 121.33 ? 64  ASP D OD2 1 
ATOM   3325 N  N   . THR D 1 16  ? -6.327  -5.916  121.740 1.00 90.88  ? 65  THR D N   1 
ATOM   3326 C  CA  . THR D 1 16  ? -4.970  -5.621  121.313 1.00 85.08  ? 65  THR D CA  1 
ATOM   3327 C  C   . THR D 1 16  ? -4.137  -5.151  122.496 1.00 84.72  ? 65  THR D C   1 
ATOM   3328 O  O   . THR D 1 16  ? -4.600  -4.336  123.297 1.00 84.40  ? 65  THR D O   1 
ATOM   3329 C  CB  . THR D 1 16  ? -4.970  -4.518  120.234 1.00 79.62  ? 65  THR D CB  1 
ATOM   3330 O  OG1 . THR D 1 16  ? -5.721  -4.958  119.094 1.00 76.97  ? 65  THR D OG1 1 
ATOM   3331 C  CG2 . THR D 1 16  ? -3.551  -4.172  119.810 1.00 77.01  ? 65  THR D CG2 1 
ATOM   3332 N  N   . PRO D 1 17  ? -2.910  -5.681  122.622 1.00 82.33  ? 66  PRO D N   1 
ATOM   3333 C  CA  . PRO D 1 17  ? -1.923  -5.188  123.588 1.00 80.55  ? 66  PRO D CA  1 
ATOM   3334 C  C   . PRO D 1 17  ? -1.772  -3.673  123.482 1.00 81.27  ? 66  PRO D C   1 
ATOM   3335 O  O   . PRO D 1 17  ? -1.737  -3.147  122.370 1.00 81.37  ? 66  PRO D O   1 
ATOM   3336 C  CB  . PRO D 1 17  ? -0.636  -5.879  123.138 1.00 77.87  ? 66  PRO D CB  1 
ATOM   3337 C  CG  . PRO D 1 17  ? -1.099  -7.160  122.548 1.00 77.47  ? 66  PRO D CG  1 
ATOM   3338 C  CD  . PRO D 1 17  ? -2.421  -6.864  121.890 1.00 80.32  ? 66  PRO D CD  1 
ATOM   3339 N  N   . ILE D 1 18  ? -1.693  -2.986  124.619 1.00 82.64  ? 67  ILE D N   1 
ATOM   3340 C  CA  . ILE D 1 18  ? -1.628  -1.527  124.627 1.00 79.60  ? 67  ILE D CA  1 
ATOM   3341 C  C   . ILE D 1 18  ? -0.187  -1.025  124.627 1.00 77.91  ? 67  ILE D C   1 
ATOM   3342 O  O   . ILE D 1 18  ? 0.656   -1.539  125.359 1.00 78.91  ? 67  ILE D O   1 
ATOM   3343 C  CB  . ILE D 1 18  ? -2.354  -0.933  125.852 1.00 80.93  ? 67  ILE D CB  1 
ATOM   3344 C  CG1 . ILE D 1 18  ? -3.654  -1.689  126.133 1.00 84.24  ? 67  ILE D CG1 1 
ATOM   3345 C  CG2 . ILE D 1 18  ? -2.628  0.546   125.640 1.00 78.44  ? 67  ILE D CG2 1 
ATOM   3346 C  CD1 . ILE D 1 18  ? -4.700  -1.529  125.056 1.00 83.66  ? 67  ILE D CD1 1 
ATOM   3347 N  N   . MET D 1 19  ? 0.087   -0.019  123.802 1.00 77.89  ? 68  MET D N   1 
ATOM   3348 C  CA  . MET D 1 19  ? 1.407   0.603   123.752 1.00 79.39  ? 68  MET D CA  1 
ATOM   3349 C  C   . MET D 1 19  ? 1.693   1.373   125.039 1.00 80.95  ? 68  MET D C   1 
ATOM   3350 O  O   . MET D 1 19  ? 0.851   2.141   125.510 1.00 82.82  ? 68  MET D O   1 
ATOM   3351 C  CB  . MET D 1 19  ? 1.505   1.544   122.549 1.00 79.62  ? 68  MET D CB  1 
ATOM   3352 C  CG  . MET D 1 19  ? 1.597   0.837   121.207 1.00 80.27  ? 68  MET D CG  1 
ATOM   3353 S  SD  . MET D 1 19  ? 3.269   0.270   120.839 1.00 67.25  ? 68  MET D SD  1 
ATOM   3354 C  CE  . MET D 1 19  ? 4.102   1.825   120.553 1.00 54.20  ? 68  MET D CE  1 
ATOM   3355 N  N   . LYS D 1 20  ? 2.879   1.166   125.604 1.00 77.14  ? 69  LYS D N   1 
ATOM   3356 C  CA  . LYS D 1 20  ? 3.257   1.856   126.831 1.00 75.98  ? 69  LYS D CA  1 
ATOM   3357 C  C   . LYS D 1 20  ? 3.380   3.351   126.579 1.00 74.74  ? 69  LYS D C   1 
ATOM   3358 O  O   . LYS D 1 20  ? 2.934   4.164   127.386 1.00 77.53  ? 69  LYS D O   1 
ATOM   3359 C  CB  . LYS D 1 20  ? 4.565   1.299   127.396 1.00 75.37  ? 69  LYS D CB  1 
ATOM   3360 C  CG  . LYS D 1 20  ? 4.960   1.907   128.732 1.00 72.08  ? 69  LYS D CG  1 
ATOM   3361 C  CD  . LYS D 1 20  ? 6.126   1.168   129.362 1.00 69.73  ? 69  LYS D CD  1 
ATOM   3362 C  CE  . LYS D 1 20  ? 6.560   1.844   130.648 1.00 77.44  ? 69  LYS D CE  1 
ATOM   3363 N  NZ  . LYS D 1 20  ? 5.423   2.005   131.599 1.00 81.90  ? 69  LYS D NZ  1 
ATOM   3364 N  N   . THR D 1 21  ? 3.984   3.704   125.451 1.00 72.46  ? 70  THR D N   1 
ATOM   3365 C  CA  . THR D 1 21  ? 4.077   5.097   125.042 1.00 72.83  ? 70  THR D CA  1 
ATOM   3366 C  C   . THR D 1 21  ? 3.207   5.326   123.814 1.00 74.34  ? 70  THR D C   1 
ATOM   3367 O  O   . THR D 1 21  ? 3.445   4.740   122.758 1.00 75.61  ? 70  THR D O   1 
ATOM   3368 C  CB  . THR D 1 21  ? 5.522   5.502   124.725 1.00 72.40  ? 70  THR D CB  1 
ATOM   3369 O  OG1 . THR D 1 21  ? 6.348   5.263   125.871 1.00 72.75  ? 70  THR D OG1 1 
ATOM   3370 C  CG2 . THR D 1 21  ? 5.587   6.976   124.356 1.00 73.80  ? 70  THR D CG2 1 
ATOM   3371 N  N   . LYS D 1 22  ? 2.200   6.180   123.958 1.00 73.63  ? 71  LYS D N   1 
ATOM   3372 C  CA  . LYS D 1 22  ? 1.216   6.387   122.902 1.00 73.08  ? 71  LYS D CA  1 
ATOM   3373 C  C   . LYS D 1 22  ? 1.493   7.634   122.068 1.00 72.50  ? 71  LYS D C   1 
ATOM   3374 O  O   . LYS D 1 22  ? 1.000   7.760   120.946 1.00 75.35  ? 71  LYS D O   1 
ATOM   3375 C  CB  . LYS D 1 22  ? -0.193  6.448   123.499 1.00 73.46  ? 71  LYS D CB  1 
ATOM   3376 C  CG  . LYS D 1 22  ? -0.540  5.234   124.348 1.00 75.65  ? 71  LYS D CG  1 
ATOM   3377 C  CD  . LYS D 1 22  ? -1.941  5.333   124.929 1.00 76.71  ? 71  LYS D CD  1 
ATOM   3378 C  CE  . LYS D 1 22  ? -2.243  4.149   125.839 1.00 72.74  ? 71  LYS D CE  1 
ATOM   3379 N  NZ  . LYS D 1 22  ? -1.277  4.053   126.969 1.00 70.81  ? 71  LYS D NZ  1 
ATOM   3380 N  N   . LYS D 1 23  ? 2.286   8.550   122.615 1.00 80.72  ? 72  LYS D N   1 
ATOM   3381 C  CA  . LYS D 1 23  ? 2.596   9.797   121.928 1.00 80.49  ? 72  LYS D CA  1 
ATOM   3382 C  C   . LYS D 1 23  ? 4.002   9.737   121.332 1.00 81.48  ? 72  LYS D C   1 
ATOM   3383 O  O   . LYS D 1 23  ? 4.987   9.586   122.058 1.00 84.21  ? 72  LYS D O   1 
ATOM   3384 C  CB  . LYS D 1 23  ? 2.456   10.980  122.891 1.00 85.32  ? 72  LYS D CB  1 
ATOM   3385 C  CG  . LYS D 1 23  ? 2.257   12.328  122.211 1.00 91.85  ? 72  LYS D CG  1 
ATOM   3386 C  CD  . LYS D 1 23  ? 2.013   13.436  123.234 1.00 96.81  ? 72  LYS D CD  1 
ATOM   3387 C  CE  . LYS D 1 23  ? 1.830   14.792  122.557 1.00 98.18  ? 72  LYS D CE  1 
ATOM   3388 N  NZ  . LYS D 1 23  ? 1.562   15.885  123.534 1.00 99.55  ? 72  LYS D NZ  1 
ATOM   3389 N  N   . TRP D 1 24  ? 4.087   9.849   120.008 1.00 76.83  ? 73  TRP D N   1 
ATOM   3390 C  CA  . TRP D 1 24  ? 5.356   9.706   119.299 1.00 71.88  ? 73  TRP D CA  1 
ATOM   3391 C  C   . TRP D 1 24  ? 5.621   10.854  118.334 1.00 72.70  ? 73  TRP D C   1 
ATOM   3392 O  O   . TRP D 1 24  ? 4.694   11.422  117.761 1.00 76.61  ? 73  TRP D O   1 
ATOM   3393 C  CB  . TRP D 1 24  ? 5.387   8.385   118.529 1.00 68.32  ? 73  TRP D CB  1 
ATOM   3394 C  CG  . TRP D 1 24  ? 5.457   7.184   119.403 1.00 68.56  ? 73  TRP D CG  1 
ATOM   3395 C  CD1 . TRP D 1 24  ? 4.408   6.465   119.895 1.00 67.75  ? 73  TRP D CD1 1 
ATOM   3396 C  CD2 . TRP D 1 24  ? 6.643   6.556   119.896 1.00 74.39  ? 73  TRP D CD2 1 
ATOM   3397 N  NE1 . TRP D 1 24  ? 4.868   5.425   120.665 1.00 70.85  ? 73  TRP D NE1 1 
ATOM   3398 C  CE2 . TRP D 1 24  ? 6.238   5.459   120.683 1.00 75.81  ? 73  TRP D CE2 1 
ATOM   3399 C  CE3 . TRP D 1 24  ? 8.010   6.815   119.749 1.00 69.19  ? 73  TRP D CE3 1 
ATOM   3400 C  CZ2 . TRP D 1 24  ? 7.151   4.621   121.322 1.00 77.85  ? 73  TRP D CZ2 1 
ATOM   3401 C  CZ3 . TRP D 1 24  ? 8.914   5.983   120.382 1.00 84.30  ? 73  TRP D CZ3 1 
ATOM   3402 C  CH2 . TRP D 1 24  ? 8.481   4.898   121.159 1.00 81.11  ? 73  TRP D CH2 1 
ATOM   3403 N  N   . ALA D 1 25  ? 6.894   11.184  118.152 1.00 73.19  ? 74  ALA D N   1 
ATOM   3404 C  CA  . ALA D 1 25  ? 7.292   12.213  117.199 1.00 77.72  ? 74  ALA D CA  1 
ATOM   3405 C  C   . ALA D 1 25  ? 8.089   11.592  116.055 1.00 80.52  ? 74  ALA D C   1 
ATOM   3406 O  O   . ALA D 1 25  ? 9.290   11.346  116.180 1.00 81.16  ? 74  ALA D O   1 
ATOM   3407 C  CB  . ALA D 1 25  ? 8.102   13.299  117.892 1.00 76.24  ? 74  ALA D CB  1 
ATOM   3408 N  N   . VAL D 1 26  ? 7.412   11.344  114.938 1.00 82.51  ? 75  VAL D N   1 
ATOM   3409 C  CA  . VAL D 1 26  ? 8.016   10.628  113.819 1.00 84.05  ? 75  VAL D CA  1 
ATOM   3410 C  C   . VAL D 1 26  ? 8.367   11.548  112.654 1.00 88.09  ? 75  VAL D C   1 
ATOM   3411 O  O   . VAL D 1 26  ? 7.898   12.684  112.579 1.00 88.45  ? 75  VAL D O   1 
ATOM   3412 C  CB  . VAL D 1 26  ? 7.082   9.521   113.299 1.00 77.24  ? 75  VAL D CB  1 
ATOM   3413 C  CG1 . VAL D 1 26  ? 6.599   8.660   114.449 1.00 74.54  ? 75  VAL D CG1 1 
ATOM   3414 C  CG2 . VAL D 1 26  ? 5.903   10.131  112.569 1.00 74.56  ? 75  VAL D CG2 1 
ATOM   3415 N  N   . GLU D 1 27  ? 9.194   11.044  111.745 1.00 94.48  ? 76  GLU D N   1 
ATOM   3416 C  CA  . GLU D 1 27  ? 9.551   11.781  110.540 1.00 102.35 ? 76  GLU D CA  1 
ATOM   3417 C  C   . GLU D 1 27  ? 8.376   11.802  109.570 1.00 99.07  ? 76  GLU D C   1 
ATOM   3418 O  O   . GLU D 1 27  ? 7.506   10.932  109.620 1.00 97.89  ? 76  GLU D O   1 
ATOM   3419 C  CB  . GLU D 1 27  ? 10.770  11.147  109.867 1.00 108.48 ? 76  GLU D CB  1 
ATOM   3420 C  CG  . GLU D 1 27  ? 11.965  10.952  110.785 1.00 116.94 ? 76  GLU D CG  1 
ATOM   3421 C  CD  . GLU D 1 27  ? 12.654  12.256  111.147 1.00 125.92 ? 76  GLU D CD  1 
ATOM   3422 O  OE1 . GLU D 1 27  ? 13.566  12.229  112.002 1.00 128.89 ? 76  GLU D OE1 1 
ATOM   3423 O  OE2 . GLU D 1 27  ? 12.293  13.306  110.573 1.00 129.96 ? 76  GLU D OE2 1 
ATOM   3424 N  N   . ARG D 1 28  ? 8.354   12.796  108.688 1.00 95.99  ? 77  ARG D N   1 
ATOM   3425 C  CA  . ARG D 1 28  ? 7.288   12.913  107.702 1.00 90.07  ? 77  ARG D CA  1 
ATOM   3426 C  C   . ARG D 1 28  ? 7.337   11.778  106.684 1.00 83.64  ? 77  ARG D C   1 
ATOM   3427 O  O   . ARG D 1 28  ? 6.306   11.367  106.154 1.00 82.41  ? 77  ARG D O   1 
ATOM   3428 C  CB  . ARG D 1 28  ? 7.362   14.261  106.981 1.00 93.45  ? 77  ARG D CB  1 
ATOM   3429 C  CG  . ARG D 1 28  ? 6.889   15.449  107.806 1.00 98.16  ? 77  ARG D CG  1 
ATOM   3430 C  CD  . ARG D 1 28  ? 6.912   16.727  106.981 1.00 102.58 ? 77  ARG D CD  1 
ATOM   3431 N  NE  . ARG D 1 28  ? 6.173   16.577  105.730 1.00 104.48 ? 77  ARG D NE  1 
ATOM   3432 C  CZ  . ARG D 1 28  ? 4.908   16.949  105.556 1.00 105.17 ? 77  ARG D CZ  1 
ATOM   3433 N  NH1 . ARG D 1 28  ? 4.234   17.504  106.554 1.00 106.12 ? 77  ARG D NH1 1 
ATOM   3434 N  NH2 . ARG D 1 28  ? 4.318   16.770  104.381 1.00 102.97 ? 77  ARG D NH2 1 
ATOM   3435 N  N   . THR D 1 29  ? 8.538   11.268  106.426 1.00 80.99  ? 78  THR D N   1 
ATOM   3436 C  CA  . THR D 1 29  ? 8.744   10.290  105.360 1.00 80.01  ? 78  THR D CA  1 
ATOM   3437 C  C   . THR D 1 29  ? 8.587   8.839   105.800 1.00 88.27  ? 78  THR D C   1 
ATOM   3438 O  O   . THR D 1 29  ? 8.792   7.925   105.002 1.00 90.69  ? 78  THR D O   1 
ATOM   3439 C  CB  . THR D 1 29  ? 10.131  10.448  104.717 1.00 77.99  ? 78  THR D CB  1 
ATOM   3440 O  OG1 . THR D 1 29  ? 11.138  10.372  105.732 1.00 78.77  ? 78  THR D OG1 1 
ATOM   3441 C  CG2 . THR D 1 29  ? 10.238  11.785  104.001 1.00 77.45  ? 78  THR D CG2 1 
ATOM   3442 N  N   . ARG D 1 30  ? 8.230   8.623   107.061 1.00 93.02  ? 79  ARG D N   1 
ATOM   3443 C  CA  . ARG D 1 30  ? 8.039   7.266   107.561 1.00 94.13  ? 79  ARG D CA  1 
ATOM   3444 C  C   . ARG D 1 30  ? 6.729   6.672   107.053 1.00 89.38  ? 79  ARG D C   1 
ATOM   3445 O  O   . ARG D 1 30  ? 5.705   7.354   106.993 1.00 84.37  ? 79  ARG D O   1 
ATOM   3446 C  CB  . ARG D 1 30  ? 8.097   7.233   109.090 1.00 101.82 ? 79  ARG D CB  1 
ATOM   3447 C  CG  . ARG D 1 30  ? 9.452   7.628   109.651 1.00 111.69 ? 79  ARG D CG  1 
ATOM   3448 C  CD  . ARG D 1 30  ? 9.477   7.546   111.166 1.00 117.22 ? 79  ARG D CD  1 
ATOM   3449 N  NE  . ARG D 1 30  ? 9.296   6.179   111.644 1.00 116.85 ? 79  ARG D NE  1 
ATOM   3450 C  CZ  . ARG D 1 30  ? 9.247   5.838   112.928 1.00 114.20 ? 79  ARG D CZ  1 
ATOM   3451 N  NH1 . ARG D 1 30  ? 9.364   6.768   113.868 1.00 112.15 ? 79  ARG D NH1 1 
ATOM   3452 N  NH2 . ARG D 1 30  ? 9.080   4.569   113.274 1.00 112.36 ? 79  ARG D NH2 1 
ATOM   3453 N  N   . THR D 1 31  ? 6.772   5.395   106.688 1.00 89.05  ? 80  THR D N   1 
ATOM   3454 C  CA  . THR D 1 31  ? 5.623   4.723   106.095 1.00 84.04  ? 80  THR D CA  1 
ATOM   3455 C  C   . THR D 1 31  ? 4.761   4.018   107.135 1.00 80.66  ? 80  THR D C   1 
ATOM   3456 O  O   . THR D 1 31  ? 5.217   3.726   108.240 1.00 82.67  ? 80  THR D O   1 
ATOM   3457 C  CB  . THR D 1 31  ? 6.067   3.689   105.050 1.00 82.34  ? 80  THR D CB  1 
ATOM   3458 O  OG1 . THR D 1 31  ? 6.954   2.746   105.662 1.00 85.77  ? 80  THR D OG1 1 
ATOM   3459 C  CG2 . THR D 1 31  ? 6.783   4.374   103.897 1.00 79.22  ? 80  THR D CG2 1 
ATOM   3460 N  N   . ILE D 1 32  ? 3.511   3.754   106.767 1.00 74.43  ? 81  ILE D N   1 
ATOM   3461 C  CA  . ILE D 1 32  ? 2.589   3.001   107.612 1.00 75.99  ? 81  ILE D CA  1 
ATOM   3462 C  C   . ILE D 1 32  ? 3.163   1.626   107.939 1.00 83.02  ? 81  ILE D C   1 
ATOM   3463 O  O   . ILE D 1 32  ? 3.128   1.184   109.089 1.00 85.76  ? 81  ILE D O   1 
ATOM   3464 C  CB  . ILE D 1 32  ? 1.214   2.835   106.928 1.00 72.08  ? 81  ILE D CB  1 
ATOM   3465 C  CG1 . ILE D 1 32  ? 0.451   4.160   106.934 1.00 67.72  ? 81  ILE D CG1 1 
ATOM   3466 C  CG2 . ILE D 1 32  ? 0.392   1.765   107.623 1.00 70.91  ? 81  ILE D CG2 1 
ATOM   3467 C  CD1 . ILE D 1 32  ? 0.084   4.637   108.322 1.00 64.31  ? 81  ILE D CD1 1 
ATOM   3468 N  N   . GLN D 1 33  ? 3.701   0.960   106.921 1.00 85.41  ? 82  GLN D N   1 
ATOM   3469 C  CA  . GLN D 1 33  ? 4.318   -0.350  107.095 1.00 86.38  ? 82  GLN D CA  1 
ATOM   3470 C  C   . GLN D 1 33  ? 5.468   -0.276  108.094 1.00 80.34  ? 82  GLN D C   1 
ATOM   3471 O  O   . GLN D 1 33  ? 5.645   -1.174  108.918 1.00 79.48  ? 82  GLN D O   1 
ATOM   3472 C  CB  . GLN D 1 33  ? 4.820   -0.889  105.751 1.00 89.76  ? 82  GLN D CB  1 
ATOM   3473 C  CG  . GLN D 1 33  ? 5.376   -2.307  105.809 1.00 90.44  ? 82  GLN D CG  1 
ATOM   3474 C  CD  . GLN D 1 33  ? 4.335   -3.320  106.245 1.00 91.64  ? 82  GLN D CD  1 
ATOM   3475 O  OE1 . GLN D 1 33  ? 3.267   -3.431  105.641 1.00 90.95  ? 82  GLN D OE1 1 
ATOM   3476 N  NE2 . GLN D 1 33  ? 4.639   -4.062  107.307 1.00 93.33  ? 82  GLN D NE2 1 
ATOM   3477 N  N   . GLY D 1 34  ? 6.240   0.803   108.019 1.00 75.01  ? 83  GLY D N   1 
ATOM   3478 C  CA  . GLY D 1 34  ? 7.349   1.012   108.930 1.00 74.25  ? 83  GLY D CA  1 
ATOM   3479 C  C   . GLY D 1 34  ? 6.881   1.159   110.364 1.00 78.12  ? 83  GLY D C   1 
ATOM   3480 O  O   . GLY D 1 34  ? 7.599   0.810   111.301 1.00 81.00  ? 83  GLY D O   1 
ATOM   3481 N  N   . LEU D 1 35  ? 5.668   1.676   110.533 1.00 78.79  ? 84  LEU D N   1 
ATOM   3482 C  CA  . LEU D 1 35  ? 5.084   1.853   111.858 1.00 76.46  ? 84  LEU D CA  1 
ATOM   3483 C  C   . LEU D 1 35  ? 4.486   0.550   112.368 1.00 74.14  ? 84  LEU D C   1 
ATOM   3484 O  O   . LEU D 1 35  ? 4.544   0.259   113.562 1.00 75.81  ? 84  LEU D O   1 
ATOM   3485 C  CB  . LEU D 1 35  ? 4.010   2.941   111.834 1.00 76.33  ? 84  LEU D CB  1 
ATOM   3486 C  CG  . LEU D 1 35  ? 4.432   4.365   112.196 1.00 76.33  ? 84  LEU D CG  1 
ATOM   3487 C  CD1 . LEU D 1 35  ? 5.680   4.784   111.437 1.00 80.07  ? 84  LEU D CD1 1 
ATOM   3488 C  CD2 . LEU D 1 35  ? 3.288   5.321   111.908 1.00 75.61  ? 84  LEU D CD2 1 
ATOM   3489 N  N   . ILE D 1 36  ? 3.898   -0.222  111.459 1.00 70.84  ? 85  ILE D N   1 
ATOM   3490 C  CA  . ILE D 1 36  ? 3.331   -1.518  111.810 1.00 71.41  ? 85  ILE D CA  1 
ATOM   3491 C  C   . ILE D 1 36  ? 4.408   -2.408  112.413 1.00 71.91  ? 85  ILE D C   1 
ATOM   3492 O  O   . ILE D 1 36  ? 4.217   -3.007  113.471 1.00 67.78  ? 85  ILE D O   1 
ATOM   3493 C  CB  . ILE D 1 36  ? 2.720   -2.221  110.585 1.00 69.82  ? 85  ILE D CB  1 
ATOM   3494 C  CG1 . ILE D 1 36  ? 1.451   -1.499  110.134 1.00 67.94  ? 85  ILE D CG1 1 
ATOM   3495 C  CG2 . ILE D 1 36  ? 2.407   -3.673  110.904 1.00 72.22  ? 85  ILE D CG2 1 
ATOM   3496 C  CD1 . ILE D 1 36  ? 0.708   -2.217  109.036 1.00 65.95  ? 85  ILE D CD1 1 
ATOM   3497 N  N   . ASP D 1 37  ? 5.548   -2.470  111.736 1.00 75.62  ? 86  ASP D N   1 
ATOM   3498 C  CA  . ASP D 1 37  ? 6.673   -3.268  112.200 1.00 82.14  ? 86  ASP D CA  1 
ATOM   3499 C  C   . ASP D 1 37  ? 7.300   -2.637  113.443 1.00 81.84  ? 86  ASP D C   1 
ATOM   3500 O  O   . ASP D 1 37  ? 7.880   -3.329  114.280 1.00 82.80  ? 86  ASP D O   1 
ATOM   3501 C  CB  . ASP D 1 37  ? 7.706   -3.427  111.080 1.00 85.59  ? 86  ASP D CB  1 
ATOM   3502 C  CG  . ASP D 1 37  ? 7.111   -4.045  109.820 1.00 90.99  ? 86  ASP D CG  1 
ATOM   3503 O  OD1 . ASP D 1 37  ? 6.136   -4.820  109.934 1.00 93.67  ? 86  ASP D OD1 1 
ATOM   3504 O  OD2 . ASP D 1 37  ? 7.618   -3.756  108.715 1.00 91.43  ? 86  ASP D OD2 1 
ATOM   3505 N  N   . PHE D 1 38  ? 7.165   -1.320  113.559 1.00 80.42  ? 87  PHE D N   1 
ATOM   3506 C  CA  . PHE D 1 38  ? 7.627   -0.590  114.735 1.00 78.98  ? 87  PHE D CA  1 
ATOM   3507 C  C   . PHE D 1 38  ? 6.804   -0.975  115.963 1.00 73.75  ? 87  PHE D C   1 
ATOM   3508 O  O   . PHE D 1 38  ? 7.356   -1.308  117.014 1.00 73.85  ? 87  PHE D O   1 
ATOM   3509 C  CB  . PHE D 1 38  ? 7.539   0.920   114.477 1.00 81.83  ? 87  PHE D CB  1 
ATOM   3510 C  CG  . PHE D 1 38  ? 7.779   1.770   115.694 1.00 82.12  ? 87  PHE D CG  1 
ATOM   3511 C  CD1 . PHE D 1 38  ? 9.065   2.112   116.075 1.00 81.58  ? 87  PHE D CD1 1 
ATOM   3512 C  CD2 . PHE D 1 38  ? 6.715   2.244   116.445 1.00 83.57  ? 87  PHE D CD2 1 
ATOM   3513 C  CE1 . PHE D 1 38  ? 9.285   2.899   117.192 1.00 82.71  ? 87  PHE D CE1 1 
ATOM   3514 C  CE2 . PHE D 1 38  ? 6.929   3.030   117.564 1.00 82.95  ? 87  PHE D CE2 1 
ATOM   3515 C  CZ  . PHE D 1 38  ? 8.216   3.358   117.937 1.00 82.04  ? 87  PHE D CZ  1 
ATOM   3516 N  N   . ILE D 1 39  ? 5.483   -0.933  115.813 1.00 68.58  ? 88  ILE D N   1 
ATOM   3517 C  CA  . ILE D 1 39  ? 4.553   -1.250  116.894 1.00 62.00  ? 88  ILE D CA  1 
ATOM   3518 C  C   . ILE D 1 39  ? 4.558   -2.731  117.277 1.00 61.77  ? 88  ILE D C   1 
ATOM   3519 O  O   . ILE D 1 39  ? 4.549   -3.065  118.461 1.00 67.86  ? 88  ILE D O   1 
ATOM   3520 C  CB  . ILE D 1 39  ? 3.118   -0.824  116.528 1.00 59.93  ? 88  ILE D CB  1 
ATOM   3521 C  CG1 . ILE D 1 39  ? 3.041   0.694   116.375 1.00 63.70  ? 88  ILE D CG1 1 
ATOM   3522 C  CG2 . ILE D 1 39  ? 2.127   -1.289  117.579 1.00 54.61  ? 88  ILE D CG2 1 
ATOM   3523 C  CD1 . ILE D 1 39  ? 1.635   1.209   116.140 1.00 65.30  ? 88  ILE D CD1 1 
ATOM   3524 N  N   . LYS D 1 40  ? 4.570   -3.607  116.274 1.00 59.18  ? 89  LYS D N   1 
ATOM   3525 C  CA  . LYS D 1 40  ? 4.569   -5.057  116.485 1.00 59.67  ? 89  LYS D CA  1 
ATOM   3526 C  C   . LYS D 1 40  ? 5.585   -5.519  117.526 1.00 60.14  ? 89  LYS D C   1 
ATOM   3527 O  O   . LYS D 1 40  ? 5.309   -6.425  118.312 1.00 61.54  ? 89  LYS D O   1 
ATOM   3528 C  CB  . LYS D 1 40  ? 4.836   -5.800  115.169 1.00 60.67  ? 89  LYS D CB  1 
ATOM   3529 C  CG  . LYS D 1 40  ? 3.612   -6.033  114.298 1.00 62.36  ? 89  LYS D CG  1 
ATOM   3530 C  CD  . LYS D 1 40  ? 3.929   -7.013  113.176 1.00 67.30  ? 89  LYS D CD  1 
ATOM   3531 C  CE  . LYS D 1 40  ? 2.752   -7.167  112.227 1.00 73.84  ? 89  LYS D CE  1 
ATOM   3532 N  NZ  . LYS D 1 40  ? 3.068   -8.066  111.083 1.00 75.95  ? 89  LYS D NZ  1 
ATOM   3533 N  N   . LYS D 1 41  ? 6.760   -4.899  117.519 1.00 59.89  ? 90  LYS D N   1 
ATOM   3534 C  CA  . LYS D 1 41  ? 7.817   -5.251  118.456 1.00 64.13  ? 90  LYS D CA  1 
ATOM   3535 C  C   . LYS D 1 41  ? 7.368   -4.994  119.887 1.00 62.21  ? 90  LYS D C   1 
ATOM   3536 O  O   . LYS D 1 41  ? 7.484   -5.867  120.748 1.00 65.14  ? 90  LYS D O   1 
ATOM   3537 C  CB  . LYS D 1 41  ? 9.083   -4.445  118.168 1.00 69.45  ? 90  LYS D CB  1 
ATOM   3538 C  CG  . LYS D 1 41  ? 9.591   -4.550  116.746 1.00 67.63  ? 90  LYS D CG  1 
ATOM   3539 C  CD  . LYS D 1 41  ? 10.123  -5.931  116.440 1.00 67.42  ? 90  LYS D CD  1 
ATOM   3540 C  CE  . LYS D 1 41  ? 10.825  -5.928  115.095 1.00 70.35  ? 90  LYS D CE  1 
ATOM   3541 N  NZ  . LYS D 1 41  ? 11.860  -4.857  115.046 1.00 70.28  ? 90  LYS D NZ  1 
ATOM   3542 N  N   . PHE D 1 42  ? 6.856   -3.789  120.129 1.00 59.73  ? 91  PHE D N   1 
ATOM   3543 C  CA  . PHE D 1 42  ? 6.388   -3.394  121.454 1.00 60.37  ? 91  PHE D CA  1 
ATOM   3544 C  C   . PHE D 1 42  ? 5.235   -4.265  121.938 1.00 62.04  ? 91  PHE D C   1 
ATOM   3545 O  O   . PHE D 1 42  ? 5.087   -4.497  123.135 1.00 64.20  ? 91  PHE D O   1 
ATOM   3546 C  CB  . PHE D 1 42  ? 5.942   -1.930  121.463 1.00 60.13  ? 91  PHE D CB  1 
ATOM   3547 C  CG  . PHE D 1 42  ? 7.068   -0.943  121.335 1.00 63.68  ? 91  PHE D CG  1 
ATOM   3548 C  CD1 . PHE D 1 42  ? 7.796   -0.553  122.449 1.00 64.74  ? 91  PHE D CD1 1 
ATOM   3549 C  CD2 . PHE D 1 42  ? 7.383   -0.384  120.104 1.00 64.39  ? 91  PHE D CD2 1 
ATOM   3550 C  CE1 . PHE D 1 42  ? 8.828   0.365   122.339 1.00 62.38  ? 91  PHE D CE1 1 
ATOM   3551 C  CE2 . PHE D 1 42  ? 8.413   0.533   119.987 1.00 62.15  ? 91  PHE D CE2 1 
ATOM   3552 C  CZ  . PHE D 1 42  ? 9.136   0.908   121.108 1.00 61.40  ? 91  PHE D CZ  1 
ATOM   3553 N  N   . LEU D 1 43  ? 4.417   -4.744  121.008 1.00 63.25  ? 92  LEU D N   1 
ATOM   3554 C  CA  . LEU D 1 43  ? 3.246   -5.533  121.374 1.00 67.13  ? 92  LEU D CA  1 
ATOM   3555 C  C   . LEU D 1 43  ? 3.563   -7.019  121.487 1.00 65.84  ? 92  LEU D C   1 
ATOM   3556 O  O   . LEU D 1 43  ? 2.670   -7.828  121.731 1.00 69.88  ? 92  LEU D O   1 
ATOM   3557 C  CB  . LEU D 1 43  ? 2.108   -5.308  120.374 1.00 70.44  ? 92  LEU D CB  1 
ATOM   3558 C  CG  . LEU D 1 43  ? 1.617   -3.863  120.245 1.00 66.22  ? 92  LEU D CG  1 
ATOM   3559 C  CD1 . LEU D 1 43  ? 0.295   -3.800  119.488 1.00 62.67  ? 92  LEU D CD1 1 
ATOM   3560 C  CD2 . LEU D 1 43  ? 1.493   -3.209  121.615 1.00 61.16  ? 92  LEU D CD2 1 
ATOM   3561 N  N   . LYS D 1 44  ? 4.840   -7.359  121.323 1.00 63.46  ? 93  LYS D N   1 
ATOM   3562 C  CA  . LYS D 1 44  ? 5.300   -8.746  121.323 1.00 62.23  ? 93  LYS D CA  1 
ATOM   3563 C  C   . LYS D 1 44  ? 4.581   -9.552  120.250 1.00 66.37  ? 93  LYS D C   1 
ATOM   3564 O  O   . LYS D 1 44  ? 4.038   -10.620 120.524 1.00 72.87  ? 93  LYS D O   1 
ATOM   3565 C  CB  . LYS D 1 44  ? 5.102   -9.400  122.692 1.00 61.90  ? 93  LYS D CB  1 
ATOM   3566 C  CG  . LYS D 1 44  ? 5.611   -8.574  123.859 1.00 64.09  ? 93  LYS D CG  1 
ATOM   3567 C  CD  . LYS D 1 44  ? 5.224   -9.210  125.180 1.00 64.46  ? 93  LYS D CD  1 
ATOM   3568 C  CE  . LYS D 1 44  ? 5.441   -8.257  126.338 1.00 58.09  ? 93  LYS D CE  1 
ATOM   3569 N  NZ  . LYS D 1 44  ? 5.101   -8.912  127.630 1.00 58.87  ? 93  LYS D NZ  1 
ATOM   3570 N  N   . LEU D 1 45  ? 4.574   -9.025  119.030 1.00 66.28  ? 94  LEU D N   1 
ATOM   3571 C  CA  . LEU D 1 45  ? 3.906   -9.681  117.912 1.00 68.12  ? 94  LEU D CA  1 
ATOM   3572 C  C   . LEU D 1 45  ? 4.897   -10.044 116.810 1.00 69.39  ? 94  LEU D C   1 
ATOM   3573 O  O   . LEU D 1 45  ? 5.724   -9.225  116.410 1.00 68.76  ? 94  LEU D O   1 
ATOM   3574 C  CB  . LEU D 1 45  ? 2.803   -8.783  117.348 1.00 66.39  ? 94  LEU D CB  1 
ATOM   3575 C  CG  . LEU D 1 45  ? 1.616   -8.484  118.266 1.00 64.60  ? 94  LEU D CG  1 
ATOM   3576 C  CD1 . LEU D 1 45  ? 0.667   -7.490  117.608 1.00 63.07  ? 94  LEU D CD1 1 
ATOM   3577 C  CD2 . LEU D 1 45  ? 0.886   -9.766  118.631 1.00 62.00  ? 94  LEU D CD2 1 
ATOM   3578 N  N   . VAL D 1 46  ? 4.809   -11.277 116.322 1.00 71.03  ? 95  VAL D N   1 
ATOM   3579 C  CA  . VAL D 1 46  ? 5.687   -11.740 115.254 1.00 74.46  ? 95  VAL D CA  1 
ATOM   3580 C  C   . VAL D 1 46  ? 5.123   -11.359 113.888 1.00 78.74  ? 95  VAL D C   1 
ATOM   3581 O  O   . VAL D 1 46  ? 4.008   -10.843 113.792 1.00 81.05  ? 95  VAL D O   1 
ATOM   3582 C  CB  . VAL D 1 46  ? 5.904   -13.263 115.316 1.00 73.97  ? 95  VAL D CB  1 
ATOM   3583 C  CG1 . VAL D 1 46  ? 6.423   -13.666 116.690 1.00 73.48  ? 95  VAL D CG1 1 
ATOM   3584 C  CG2 . VAL D 1 46  ? 4.613   -13.996 114.992 1.00 72.43  ? 95  VAL D CG2 1 
ATOM   3585 N  N   . ALA D 1 47  ? 5.897   -11.620 112.839 1.00 78.77  ? 96  ALA D N   1 
ATOM   3586 C  CA  . ALA D 1 47  ? 5.535   -11.208 111.485 1.00 80.06  ? 96  ALA D CA  1 
ATOM   3587 C  C   . ALA D 1 47  ? 4.208   -11.795 111.015 1.00 84.13  ? 96  ALA D C   1 
ATOM   3588 O  O   . ALA D 1 47  ? 3.384   -11.089 110.431 1.00 83.60  ? 96  ALA D O   1 
ATOM   3589 C  CB  . ALA D 1 47  ? 6.650   -11.562 110.505 1.00 77.20  ? 96  ALA D CB  1 
ATOM   3590 N  N   . SER D 1 48  ? 4.004   -13.084 111.276 1.00 87.65  ? 97  SER D N   1 
ATOM   3591 C  CA  . SER D 1 48  ? 2.810   -13.783 110.808 1.00 88.70  ? 97  SER D CA  1 
ATOM   3592 C  C   . SER D 1 48  ? 1.533   -13.186 111.394 1.00 89.56  ? 97  SER D C   1 
ATOM   3593 O  O   . SER D 1 48  ? 0.480   -13.203 110.756 1.00 91.33  ? 97  SER D O   1 
ATOM   3594 C  CB  . SER D 1 48  ? 2.897   -15.280 111.121 1.00 88.92  ? 97  SER D CB  1 
ATOM   3595 O  OG  . SER D 1 48  ? 3.067   -15.509 112.509 1.00 90.94  ? 97  SER D OG  1 
ATOM   3596 N  N   . GLU D 1 49  ? 1.634   -12.654 112.607 1.00 88.09  ? 98  GLU D N   1 
ATOM   3597 C  CA  . GLU D 1 49  ? 0.497   -12.008 113.246 1.00 87.89  ? 98  GLU D CA  1 
ATOM   3598 C  C   . GLU D 1 49  ? 0.211   -10.671 112.578 1.00 86.18  ? 98  GLU D C   1 
ATOM   3599 O  O   . GLU D 1 49  ? 1.133   -9.935  112.229 1.00 83.45  ? 98  GLU D O   1 
ATOM   3600 C  CB  . GLU D 1 49  ? 0.764   -11.809 114.735 1.00 88.11  ? 98  GLU D CB  1 
ATOM   3601 C  CG  . GLU D 1 49  ? 1.087   -13.094 115.468 1.00 90.25  ? 98  GLU D CG  1 
ATOM   3602 C  CD  . GLU D 1 49  ? 1.173   -12.895 116.962 1.00 92.97  ? 98  GLU D CD  1 
ATOM   3603 O  OE1 . GLU D 1 49  ? 0.108   -12.854 117.612 1.00 95.61  ? 98  GLU D OE1 1 
ATOM   3604 O  OE2 . GLU D 1 49  ? 2.302   -12.774 117.484 1.00 93.67  ? 98  GLU D OE2 1 
ATOM   3605 N  N   . GLN D 1 50  ? -1.067  -10.362 112.397 1.00 87.81  ? 99  GLN D N   1 
ATOM   3606 C  CA  . GLN D 1 50  ? -1.454  -9.148  111.692 1.00 87.87  ? 99  GLN D CA  1 
ATOM   3607 C  C   . GLN D 1 50  ? -1.796  -8.012  112.646 1.00 85.70  ? 99  GLN D C   1 
ATOM   3608 O  O   . GLN D 1 50  ? -2.223  -8.240  113.777 1.00 86.60  ? 99  GLN D O   1 
ATOM   3609 C  CB  . GLN D 1 50  ? -2.627  -9.422  110.750 1.00 91.66  ? 99  GLN D CB  1 
ATOM   3610 C  CG  . GLN D 1 50  ? -3.856  -9.994  111.435 1.00 95.43  ? 99  GLN D CG  1 
ATOM   3611 C  CD  . GLN D 1 50  ? -4.944  -10.374 110.447 1.00 97.98  ? 99  GLN D CD  1 
ATOM   3612 O  OE1 . GLN D 1 50  ? -4.774  -10.237 109.233 1.00 91.58  ? 99  GLN D OE1 1 
ATOM   3613 N  NE2 . GLN D 1 50  ? -6.070  -10.855 110.963 1.00 101.91 ? 99  GLN D NE2 1 
ATOM   3614 N  N   . LEU D 1 51  ? -1.597  -6.786  112.174 1.00 82.87  ? 100 LEU D N   1 
ATOM   3615 C  CA  . LEU D 1 51  ? -1.897  -5.595  112.958 1.00 76.72  ? 100 LEU D CA  1 
ATOM   3616 C  C   . LEU D 1 51  ? -2.329  -4.469  112.026 1.00 70.96  ? 100 LEU D C   1 
ATOM   3617 O  O   . LEU D 1 51  ? -1.553  -4.009  111.188 1.00 67.63  ? 100 LEU D O   1 
ATOM   3618 C  CB  . LEU D 1 51  ? -0.679  -5.170  113.780 1.00 71.50  ? 100 LEU D CB  1 
ATOM   3619 C  CG  . LEU D 1 51  ? -0.824  -3.885  114.597 1.00 69.91  ? 100 LEU D CG  1 
ATOM   3620 C  CD1 . LEU D 1 51  ? -1.756  -4.095  115.778 1.00 70.56  ? 100 LEU D CD1 1 
ATOM   3621 C  CD2 . LEU D 1 51  ? 0.535   -3.391  115.061 1.00 70.87  ? 100 LEU D CD2 1 
ATOM   3622 N  N   . PHE D 1 52  ? -3.573  -4.029  112.178 1.00 67.47  ? 101 PHE D N   1 
ATOM   3623 C  CA  . PHE D 1 52  ? -4.148  -3.033  111.284 1.00 63.90  ? 101 PHE D CA  1 
ATOM   3624 C  C   . PHE D 1 52  ? -4.086  -1.624  111.870 1.00 63.49  ? 101 PHE D C   1 
ATOM   3625 O  O   . PHE D 1 52  ? -4.348  -1.422  113.053 1.00 65.03  ? 101 PHE D O   1 
ATOM   3626 C  CB  . PHE D 1 52  ? -5.603  -3.388  110.954 1.00 64.91  ? 101 PHE D CB  1 
ATOM   3627 C  CG  . PHE D 1 52  ? -5.778  -4.749  110.333 1.00 63.32  ? 101 PHE D CG  1 
ATOM   3628 C  CD1 . PHE D 1 52  ? -5.633  -4.928  108.966 1.00 63.23  ? 101 PHE D CD1 1 
ATOM   3629 C  CD2 . PHE D 1 52  ? -6.105  -5.846  111.116 1.00 63.18  ? 101 PHE D CD2 1 
ATOM   3630 C  CE1 . PHE D 1 52  ? -5.798  -6.177  108.391 1.00 61.47  ? 101 PHE D CE1 1 
ATOM   3631 C  CE2 . PHE D 1 52  ? -6.273  -7.097  110.547 1.00 64.09  ? 101 PHE D CE2 1 
ATOM   3632 C  CZ  . PHE D 1 52  ? -6.119  -7.262  109.182 1.00 62.99  ? 101 PHE D CZ  1 
ATOM   3633 N  N   . ILE D 1 53  ? -3.740  -0.656  111.028 1.00 64.74  ? 102 ILE D N   1 
ATOM   3634 C  CA  . ILE D 1 53  ? -3.714  0.752   111.412 1.00 63.90  ? 102 ILE D CA  1 
ATOM   3635 C  C   . ILE D 1 53  ? -4.792  1.525   110.651 1.00 61.83  ? 102 ILE D C   1 
ATOM   3636 O  O   . ILE D 1 53  ? -4.952  1.344   109.449 1.00 62.35  ? 102 ILE D O   1 
ATOM   3637 C  CB  . ILE D 1 53  ? -2.335  1.376   111.135 1.00 64.73  ? 102 ILE D CB  1 
ATOM   3638 C  CG1 . ILE D 1 53  ? -1.260  0.654   111.946 1.00 66.88  ? 102 ILE D CG1 1 
ATOM   3639 C  CG2 . ILE D 1 53  ? -2.337  2.866   111.452 1.00 66.34  ? 102 ILE D CG2 1 
ATOM   3640 C  CD1 . ILE D 1 53  ? 0.071   1.367   111.963 1.00 68.98  ? 102 ILE D CD1 1 
ATOM   3641 N  N   . TYR D 1 54  ? -5.532  2.379   111.353 1.00 62.50  ? 103 TYR D N   1 
ATOM   3642 C  CA  . TYR D 1 54  ? -6.654  3.096   110.750 1.00 63.74  ? 103 TYR D CA  1 
ATOM   3643 C  C   . TYR D 1 54  ? -6.543  4.615   110.878 1.00 68.29  ? 103 TYR D C   1 
ATOM   3644 O  O   . TYR D 1 54  ? -6.095  5.137   111.898 1.00 72.23  ? 103 TYR D O   1 
ATOM   3645 C  CB  . TYR D 1 54  ? -7.980  2.624   111.358 1.00 63.79  ? 103 TYR D CB  1 
ATOM   3646 C  CG  . TYR D 1 54  ? -8.367  1.210   110.985 1.00 67.35  ? 103 TYR D CG  1 
ATOM   3647 C  CD1 . TYR D 1 54  ? -9.172  0.959   109.881 1.00 74.01  ? 103 TYR D CD1 1 
ATOM   3648 C  CD2 . TYR D 1 54  ? -7.930  0.128   111.736 1.00 68.60  ? 103 TYR D CD2 1 
ATOM   3649 C  CE1 . TYR D 1 54  ? -9.530  -0.331  109.534 1.00 75.58  ? 103 TYR D CE1 1 
ATOM   3650 C  CE2 . TYR D 1 54  ? -8.283  -1.166  111.396 1.00 72.49  ? 103 TYR D CE2 1 
ATOM   3651 C  CZ  . TYR D 1 54  ? -9.082  -1.389  110.295 1.00 75.73  ? 103 TYR D CZ  1 
ATOM   3652 O  OH  . TYR D 1 54  ? -9.437  -2.675  109.952 1.00 81.55  ? 103 TYR D OH  1 
ATOM   3653 N  N   . VAL D 1 55  ? -6.965  5.319   109.835 1.00 70.58  ? 104 VAL D N   1 
ATOM   3654 C  CA  . VAL D 1 55  ? -7.023  6.774   109.858 1.00 73.04  ? 104 VAL D CA  1 
ATOM   3655 C  C   . VAL D 1 55  ? -8.487  7.211   109.853 1.00 75.56  ? 104 VAL D C   1 
ATOM   3656 O  O   . VAL D 1 55  ? -9.316  6.609   109.165 1.00 76.72  ? 104 VAL D O   1 
ATOM   3657 C  CB  . VAL D 1 55  ? -6.287  7.382   108.646 1.00 72.39  ? 104 VAL D CB  1 
ATOM   3658 C  CG1 . VAL D 1 55  ? -6.331  8.898   108.696 1.00 69.62  ? 104 VAL D CG1 1 
ATOM   3659 C  CG2 . VAL D 1 55  ? -4.848  6.894   108.604 1.00 73.39  ? 104 VAL D CG2 1 
ATOM   3660 N  N   . ASN D 1 56  ? -8.803  8.239   110.639 1.00 85.30  ? 105 ASN D N   1 
ATOM   3661 C  CA  . ASN D 1 56  ? -10.172 8.742   110.766 1.00 86.43  ? 105 ASN D CA  1 
ATOM   3662 C  C   . ASN D 1 56  ? -11.192 7.675   111.154 1.00 87.42  ? 105 ASN D C   1 
ATOM   3663 O  O   . ASN D 1 56  ? -12.389 7.839   110.915 1.00 88.76  ? 105 ASN D O   1 
ATOM   3664 C  CB  . ASN D 1 56  ? -10.619 9.454   109.487 1.00 88.48  ? 105 ASN D CB  1 
ATOM   3665 C  CG  . ASN D 1 56  ? -10.116 10.879  109.409 1.00 92.30  ? 105 ASN D CG  1 
ATOM   3666 O  OD1 . ASN D 1 56  ? -9.139  11.241  110.064 1.00 92.22  ? 105 ASN D OD1 1 
ATOM   3667 N  ND2 . ASN D 1 56  ? -10.785 11.700  108.607 1.00 95.40  ? 105 ASN D ND2 1 
ATOM   3668 N  N   . GLN D 1 57  ? -10.703 6.590   111.750 1.00 86.53  ? 106 GLN D N   1 
ATOM   3669 C  CA  . GLN D 1 57  ? -11.544 5.472   112.163 1.00 85.97  ? 106 GLN D CA  1 
ATOM   3670 C  C   . GLN D 1 57  ? -12.438 4.986   111.028 1.00 89.79  ? 106 GLN D C   1 
ATOM   3671 O  O   . GLN D 1 57  ? -13.617 4.705   111.235 1.00 92.73  ? 106 GLN D O   1 
ATOM   3672 C  CB  . GLN D 1 57  ? -12.382 5.859   113.381 1.00 84.21  ? 106 GLN D CB  1 
ATOM   3673 C  CG  . GLN D 1 57  ? -11.549 6.206   114.601 1.00 82.89  ? 106 GLN D CG  1 
ATOM   3674 C  CD  . GLN D 1 57  ? -12.387 6.708   115.757 1.00 82.79  ? 106 GLN D CD  1 
ATOM   3675 O  OE1 . GLN D 1 57  ? -13.190 7.627   115.603 1.00 80.78  ? 106 GLN D OE1 1 
ATOM   3676 N  NE2 . GLN D 1 57  ? -12.207 6.102   116.925 1.00 85.19  ? 106 GLN D NE2 1 
ATOM   3677 N  N   . SER D 1 58  ? -11.875 4.896   109.828 1.00 90.41  ? 107 SER D N   1 
ATOM   3678 C  CA  . SER D 1 58  ? -12.651 4.481   108.665 1.00 93.48  ? 107 SER D CA  1 
ATOM   3679 C  C   . SER D 1 58  ? -11.862 3.606   107.693 1.00 88.07  ? 107 SER D C   1 
ATOM   3680 O  O   . SER D 1 58  ? -12.337 2.546   107.282 1.00 92.73  ? 107 SER D O   1 
ATOM   3681 C  CB  . SER D 1 58  ? -13.230 5.700   107.939 1.00 100.27 ? 107 SER D CB  1 
ATOM   3682 O  OG  . SER D 1 58  ? -12.208 6.600   107.548 1.00 103.68 ? 107 SER D OG  1 
ATOM   3683 N  N   . PHE D 1 59  ? -10.662 4.042   107.323 1.00 78.03  ? 108 PHE D N   1 
ATOM   3684 C  CA  . PHE D 1 59  ? -9.876  3.297   106.342 1.00 73.32  ? 108 PHE D CA  1 
ATOM   3685 C  C   . PHE D 1 59  ? -8.470  2.948   106.817 1.00 68.00  ? 108 PHE D C   1 
ATOM   3686 O  O   . PHE D 1 59  ? -7.824  3.731   107.510 1.00 67.31  ? 108 PHE D O   1 
ATOM   3687 C  CB  . PHE D 1 59  ? -9.816  4.042   104.998 1.00 72.28  ? 108 PHE D CB  1 
ATOM   3688 C  CG  . PHE D 1 59  ? -8.874  5.219   104.985 1.00 68.51  ? 108 PHE D CG  1 
ATOM   3689 C  CD1 . PHE D 1 59  ? -9.323  6.486   105.319 1.00 70.78  ? 108 PHE D CD1 1 
ATOM   3690 C  CD2 . PHE D 1 59  ? -7.545  5.060   104.615 1.00 65.63  ? 108 PHE D CD2 1 
ATOM   3691 C  CE1 . PHE D 1 59  ? -8.461  7.574   105.299 1.00 70.11  ? 108 PHE D CE1 1 
ATOM   3692 C  CE2 . PHE D 1 59  ? -6.677  6.141   104.598 1.00 65.48  ? 108 PHE D CE2 1 
ATOM   3693 C  CZ  . PHE D 1 59  ? -7.137  7.401   104.938 1.00 66.95  ? 108 PHE D CZ  1 
ATOM   3694 N  N   . ALA D 1 60  ? -8.004  1.769   106.422 1.00 64.46  ? 109 ALA D N   1 
ATOM   3695 C  CA  . ALA D 1 60  ? -6.636  1.353   106.691 1.00 63.60  ? 109 ALA D CA  1 
ATOM   3696 C  C   . ALA D 1 60  ? -5.738  1.800   105.548 1.00 67.41  ? 109 ALA D C   1 
ATOM   3697 O  O   . ALA D 1 60  ? -5.789  1.228   104.464 1.00 70.00  ? 109 ALA D O   1 
ATOM   3698 C  CB  . ALA D 1 60  ? -6.569  -0.150  106.852 1.00 56.74  ? 109 ALA D CB  1 
ATOM   3699 N  N   . PRO D 1 61  ? -4.906  2.825   105.788 1.00 67.31  ? 110 PRO D N   1 
ATOM   3700 C  CA  . PRO D 1 61  ? -4.053  3.403   104.743 1.00 68.90  ? 110 PRO D CA  1 
ATOM   3701 C  C   . PRO D 1 61  ? -3.118  2.374   104.112 1.00 72.23  ? 110 PRO D C   1 
ATOM   3702 O  O   . PRO D 1 61  ? -2.790  1.371   104.744 1.00 71.87  ? 110 PRO D O   1 
ATOM   3703 C  CB  . PRO D 1 61  ? -3.237  4.456   105.502 1.00 64.62  ? 110 PRO D CB  1 
ATOM   3704 C  CG  . PRO D 1 61  ? -3.278  4.016   106.927 1.00 59.83  ? 110 PRO D CG  1 
ATOM   3705 C  CD  . PRO D 1 61  ? -4.642  3.431   107.103 1.00 61.57  ? 110 PRO D CD  1 
ATOM   3706 N  N   . SER D 1 62  ? -2.711  2.627   102.872 1.00 76.41  ? 111 SER D N   1 
ATOM   3707 C  CA  . SER D 1 62  ? -1.753  1.772   102.183 1.00 76.91  ? 111 SER D CA  1 
ATOM   3708 C  C   . SER D 1 62  ? -0.422  1.777   102.932 1.00 76.52  ? 111 SER D C   1 
ATOM   3709 O  O   . SER D 1 62  ? 0.026   2.824   103.397 1.00 76.84  ? 111 SER D O   1 
ATOM   3710 C  CB  . SER D 1 62  ? -1.546  2.270   100.753 1.00 77.91  ? 111 SER D CB  1 
ATOM   3711 O  OG  . SER D 1 62  ? -2.778  2.613   100.141 1.00 83.08  ? 111 SER D OG  1 
ATOM   3712 N  N   . PRO D 1 63  ? 0.217   0.605   103.055 1.00 74.14  ? 112 PRO D N   1 
ATOM   3713 C  CA  . PRO D 1 63  ? 1.478   0.486   103.800 1.00 70.01  ? 112 PRO D CA  1 
ATOM   3714 C  C   . PRO D 1 63  ? 2.631   1.313   103.225 1.00 74.39  ? 112 PRO D C   1 
ATOM   3715 O  O   . PRO D 1 63  ? 3.597   1.579   103.937 1.00 76.11  ? 112 PRO D O   1 
ATOM   3716 C  CB  . PRO D 1 63  ? 1.796   -1.014  103.721 1.00 64.10  ? 112 PRO D CB  1 
ATOM   3717 C  CG  . PRO D 1 63  ? 0.988   -1.527  102.589 1.00 66.96  ? 112 PRO D CG  1 
ATOM   3718 C  CD  . PRO D 1 63  ? -0.252  -0.698  102.558 1.00 72.06  ? 112 PRO D CD  1 
ATOM   3719 N  N   . ASP D 1 64  ? 2.532   1.719   101.964 1.00 78.79  ? 113 ASP D N   1 
ATOM   3720 C  CA  . ASP D 1 64  ? 3.584   2.518   101.339 1.00 78.70  ? 113 ASP D CA  1 
ATOM   3721 C  C   . ASP D 1 64  ? 3.401   4.001   101.637 1.00 76.48  ? 113 ASP D C   1 
ATOM   3722 O  O   . ASP D 1 64  ? 4.314   4.805   101.436 1.00 72.97  ? 113 ASP D O   1 
ATOM   3723 C  CB  . ASP D 1 64  ? 3.585   2.300   99.828  1.00 78.54  ? 113 ASP D CB  1 
ATOM   3724 C  CG  . ASP D 1 64  ? 2.260   2.662   99.195  1.00 83.73  ? 113 ASP D CG  1 
ATOM   3725 O  OD1 . ASP D 1 64  ? 1.264   1.971   99.490  1.00 82.94  ? 113 ASP D OD1 1 
ATOM   3726 O  OD2 . ASP D 1 64  ? 2.213   3.633   98.407  1.00 88.80  ? 113 ASP D OD2 1 
ATOM   3727 N  N   . GLN D 1 65  ? 2.213   4.356   102.117 1.00 75.43  ? 114 GLN D N   1 
ATOM   3728 C  CA  . GLN D 1 65  ? 1.870   5.753   102.348 1.00 72.62  ? 114 GLN D CA  1 
ATOM   3729 C  C   . GLN D 1 65  ? 2.713   6.377   103.449 1.00 67.49  ? 114 GLN D C   1 
ATOM   3730 O  O   . GLN D 1 65  ? 3.015   5.733   104.448 1.00 69.24  ? 114 GLN D O   1 
ATOM   3731 C  CB  . GLN D 1 65  ? 0.391   5.892   102.693 1.00 71.90  ? 114 GLN D CB  1 
ATOM   3732 C  CG  . GLN D 1 65  ? -0.117  7.309   102.583 1.00 74.39  ? 114 GLN D CG  1 
ATOM   3733 C  CD  . GLN D 1 65  ? -1.282  7.414   101.635 1.00 75.23  ? 114 GLN D CD  1 
ATOM   3734 O  OE1 . GLN D 1 65  ? -1.951  6.420   101.346 1.00 75.63  ? 114 GLN D OE1 1 
ATOM   3735 N  NE2 . GLN D 1 65  ? -1.534  8.619   101.139 1.00 73.11  ? 114 GLN D NE2 1 
ATOM   3736 N  N   . GLU D 1 66  ? 3.085   7.637   103.258 1.00 68.45  ? 115 GLU D N   1 
ATOM   3737 C  CA  . GLU D 1 66  ? 3.908   8.343   104.228 1.00 70.85  ? 115 GLU D CA  1 
ATOM   3738 C  C   . GLU D 1 66  ? 3.062   9.028   105.295 1.00 71.51  ? 115 GLU D C   1 
ATOM   3739 O  O   . GLU D 1 66  ? 1.938   9.467   105.036 1.00 72.28  ? 115 GLU D O   1 
ATOM   3740 C  CB  . GLU D 1 66  ? 4.813   9.364   103.534 1.00 74.67  ? 115 GLU D CB  1 
ATOM   3741 C  CG  . GLU D 1 66  ? 5.868   8.745   102.636 1.00 80.12  ? 115 GLU D CG  1 
ATOM   3742 C  CD  . GLU D 1 66  ? 6.772   9.781   101.998 1.00 86.08  ? 115 GLU D CD  1 
ATOM   3743 O  OE1 . GLU D 1 66  ? 7.704   9.380   101.269 1.00 83.42  ? 115 GLU D OE1 1 
ATOM   3744 O  OE2 . GLU D 1 66  ? 6.552   10.993  102.229 1.00 88.63  ? 115 GLU D OE2 1 
ATOM   3745 N  N   . VAL D 1 67  ? 3.620   9.111   106.496 1.00 67.93  ? 116 VAL D N   1 
ATOM   3746 C  CA  . VAL D 1 67  ? 2.955   9.736   107.629 1.00 66.35  ? 116 VAL D CA  1 
ATOM   3747 C  C   . VAL D 1 67  ? 2.637   11.205  107.361 1.00 68.96  ? 116 VAL D C   1 
ATOM   3748 O  O   . VAL D 1 67  ? 1.535   11.674  107.655 1.00 70.05  ? 116 VAL D O   1 
ATOM   3749 C  CB  . VAL D 1 67  ? 3.822   9.604   108.900 1.00 66.00  ? 116 VAL D CB  1 
ATOM   3750 C  CG1 . VAL D 1 67  ? 3.495   10.693  109.896 1.00 70.31  ? 116 VAL D CG1 1 
ATOM   3751 C  CG2 . VAL D 1 67  ? 3.651   8.221   109.518 1.00 64.07  ? 116 VAL D CG2 1 
ATOM   3752 N  N   . GLY D 1 68  ? 3.600   11.922  106.788 1.00 68.17  ? 117 GLY D N   1 
ATOM   3753 C  CA  . GLY D 1 68  ? 3.445   13.341  106.524 1.00 69.14  ? 117 GLY D CA  1 
ATOM   3754 C  C   . GLY D 1 68  ? 2.281   13.650  105.604 1.00 72.46  ? 117 GLY D C   1 
ATOM   3755 O  O   . GLY D 1 68  ? 1.515   14.584  105.843 1.00 75.29  ? 117 GLY D O   1 
ATOM   3756 N  N   . THR D 1 69  ? 2.151   12.856  104.547 1.00 73.59  ? 118 THR D N   1 
ATOM   3757 C  CA  . THR D 1 69  ? 1.074   13.020  103.580 1.00 71.60  ? 118 THR D CA  1 
ATOM   3758 C  C   . THR D 1 69  ? -0.286  12.814  104.244 1.00 72.10  ? 118 THR D C   1 
ATOM   3759 O  O   . THR D 1 69  ? -1.229  13.573  104.007 1.00 70.31  ? 118 THR D O   1 
ATOM   3760 C  CB  . THR D 1 69  ? 1.233   12.027  102.416 1.00 72.39  ? 118 THR D CB  1 
ATOM   3761 O  OG1 . THR D 1 69  ? 2.535   12.178  101.836 1.00 71.51  ? 118 THR D OG1 1 
ATOM   3762 C  CG2 . THR D 1 69  ? 0.170   12.265  101.353 1.00 75.88  ? 118 THR D CG2 1 
ATOM   3763 N  N   . LEU D 1 70  ? -0.371  11.786  105.083 1.00 72.06  ? 119 LEU D N   1 
ATOM   3764 C  CA  . LEU D 1 70  ? -1.600  11.468  105.799 1.00 70.04  ? 119 LEU D CA  1 
ATOM   3765 C  C   . LEU D 1 70  ? -1.979  12.572  106.777 1.00 74.71  ? 119 LEU D C   1 
ATOM   3766 O  O   . LEU D 1 70  ? -3.162  12.806  107.031 1.00 76.77  ? 119 LEU D O   1 
ATOM   3767 C  CB  . LEU D 1 70  ? -1.458  10.139  106.540 1.00 64.27  ? 119 LEU D CB  1 
ATOM   3768 C  CG  . LEU D 1 70  ? -1.482  8.882   105.671 1.00 59.97  ? 119 LEU D CG  1 
ATOM   3769 C  CD1 . LEU D 1 70  ? -1.132  7.652   106.492 1.00 54.98  ? 119 LEU D CD1 1 
ATOM   3770 C  CD2 . LEU D 1 70  ? -2.845  8.724   105.023 1.00 54.96  ? 119 LEU D CD2 1 
ATOM   3771 N  N   . TYR D 1 71  ? -0.973  13.245  107.327 1.00 74.20  ? 120 TYR D N   1 
ATOM   3772 C  CA  . TYR D 1 71  ? -1.223  14.333  108.263 1.00 77.31  ? 120 TYR D CA  1 
ATOM   3773 C  C   . TYR D 1 71  ? -1.863  15.524  107.561 1.00 78.40  ? 120 TYR D C   1 
ATOM   3774 O  O   . TYR D 1 71  ? -2.833  16.096  108.055 1.00 80.75  ? 120 TYR D O   1 
ATOM   3775 C  CB  . TYR D 1 71  ? 0.064   14.763  108.974 1.00 77.53  ? 120 TYR D CB  1 
ATOM   3776 C  CG  . TYR D 1 71  ? -0.102  16.023  109.796 1.00 79.41  ? 120 TYR D CG  1 
ATOM   3777 C  CD1 . TYR D 1 71  ? -0.802  16.006  110.996 1.00 82.06  ? 120 TYR D CD1 1 
ATOM   3778 C  CD2 . TYR D 1 71  ? 0.431   17.233  109.365 1.00 81.25  ? 120 TYR D CD2 1 
ATOM   3779 C  CE1 . TYR D 1 71  ? -0.964  17.156  111.747 1.00 85.40  ? 120 TYR D CE1 1 
ATOM   3780 C  CE2 . TYR D 1 71  ? 0.275   18.389  110.110 1.00 83.64  ? 120 TYR D CE2 1 
ATOM   3781 C  CZ  . TYR D 1 71  ? -0.423  18.345  111.301 1.00 86.31  ? 120 TYR D CZ  1 
ATOM   3782 O  OH  . TYR D 1 71  ? -0.583  19.490  112.049 1.00 86.72  ? 120 TYR D OH  1 
ATOM   3783 N  N   . GLU D 1 72  ? -1.324  15.893  106.404 1.00 76.36  ? 121 GLU D N   1 
ATOM   3784 C  CA  . GLU D 1 72  ? -1.828  17.050  105.673 1.00 82.07  ? 121 GLU D CA  1 
ATOM   3785 C  C   . GLU D 1 72  ? -3.272  16.859  105.208 1.00 82.96  ? 121 GLU D C   1 
ATOM   3786 O  O   . GLU D 1 72  ? -3.997  17.831  105.000 1.00 87.67  ? 121 GLU D O   1 
ATOM   3787 C  CB  . GLU D 1 72  ? -0.923  17.378  104.481 1.00 86.94  ? 121 GLU D CB  1 
ATOM   3788 C  CG  . GLU D 1 72  ? 0.483   17.810  104.868 1.00 91.43  ? 121 GLU D CG  1 
ATOM   3789 C  CD  . GLU D 1 72  ? 1.274   18.350  103.691 1.00 97.21  ? 121 GLU D CD  1 
ATOM   3790 O  OE1 . GLU D 1 72  ? 2.498   18.557  103.842 1.00 99.49  ? 121 GLU D OE1 1 
ATOM   3791 O  OE2 . GLU D 1 72  ? 0.673   18.574  102.617 1.00 98.56  ? 121 GLU D OE2 1 
ATOM   3792 N  N   . CYS D 1 73  ? -3.689  15.606  105.058 1.00 78.51  ? 122 CYS D N   1 
ATOM   3793 C  CA  . CYS D 1 73  ? -5.023  15.303  104.554 1.00 78.65  ? 122 CYS D CA  1 
ATOM   3794 C  C   . CYS D 1 73  ? -6.026  14.958  105.654 1.00 79.08  ? 122 CYS D C   1 
ATOM   3795 O  O   . CYS D 1 73  ? -7.221  15.220  105.510 1.00 80.16  ? 122 CYS D O   1 
ATOM   3796 C  CB  . CYS D 1 73  ? -4.966  14.159  103.540 1.00 80.25  ? 122 CYS D CB  1 
ATOM   3797 S  SG  . CYS D 1 73  ? -4.164  14.564  101.975 1.00 77.28  ? 122 CYS D SG  1 
ATOM   3798 N  N   . PHE D 1 74  ? -5.546  14.369  106.746 1.00 77.34  ? 123 PHE D N   1 
ATOM   3799 C  CA  . PHE D 1 74  ? -6.443  13.866  107.784 1.00 78.04  ? 123 PHE D CA  1 
ATOM   3800 C  C   . PHE D 1 74  ? -6.016  14.246  109.205 1.00 83.69  ? 123 PHE D C   1 
ATOM   3801 O  O   . PHE D 1 74  ? -6.572  13.741  110.181 1.00 82.05  ? 123 PHE D O   1 
ATOM   3802 C  CB  . PHE D 1 74  ? -6.576  12.345  107.673 1.00 71.60  ? 123 PHE D CB  1 
ATOM   3803 C  CG  . PHE D 1 74  ? -6.820  11.856  106.273 1.00 68.69  ? 123 PHE D CG  1 
ATOM   3804 C  CD1 . PHE D 1 74  ? -8.083  11.923  105.710 1.00 66.52  ? 123 PHE D CD1 1 
ATOM   3805 C  CD2 . PHE D 1 74  ? -5.783  11.324  105.519 1.00 65.53  ? 123 PHE D CD2 1 
ATOM   3806 C  CE1 . PHE D 1 74  ? -8.307  11.473  104.423 1.00 61.28  ? 123 PHE D CE1 1 
ATOM   3807 C  CE2 . PHE D 1 74  ? -6.003  10.872  104.234 1.00 60.56  ? 123 PHE D CE2 1 
ATOM   3808 C  CZ  . PHE D 1 74  ? -7.265  10.948  103.686 1.00 62.41  ? 123 PHE D CZ  1 
ATOM   3809 N  N   . GLY D 1 75  ? -5.035  15.135  109.321 1.00 88.61  ? 124 GLY D N   1 
ATOM   3810 C  CA  . GLY D 1 75  ? -4.546  15.552  110.623 1.00 89.61  ? 124 GLY D CA  1 
ATOM   3811 C  C   . GLY D 1 75  ? -5.358  16.680  111.228 1.00 92.74  ? 124 GLY D C   1 
ATOM   3812 O  O   . GLY D 1 75  ? -5.855  17.555  110.517 1.00 94.51  ? 124 GLY D O   1 
ATOM   3813 N  N   . SER D 1 76  ? -5.492  16.658  112.550 1.00 95.27  ? 125 SER D N   1 
ATOM   3814 C  CA  . SER D 1 76  ? -6.218  17.700  113.264 1.00 98.06  ? 125 SER D CA  1 
ATOM   3815 C  C   . SER D 1 76  ? -5.542  18.005  114.596 1.00 95.57  ? 125 SER D C   1 
ATOM   3816 O  O   . SER D 1 76  ? -4.883  17.140  115.175 1.00 92.06  ? 125 SER D O   1 
ATOM   3817 C  CB  . SER D 1 76  ? -7.671  17.282  113.492 1.00 101.89 ? 125 SER D CB  1 
ATOM   3818 O  OG  . SER D 1 76  ? -8.425  18.346  114.046 1.00 105.50 ? 125 SER D OG  1 
ATOM   3819 N  N   . ASP D 1 77  ? -5.704  19.242  115.064 1.00 98.83  ? 126 ASP D N   1 
ATOM   3820 C  CA  . ASP D 1 77  ? -5.136  19.700  116.336 1.00 101.79 ? 126 ASP D CA  1 
ATOM   3821 C  C   . ASP D 1 77  ? -3.611  19.604  116.403 1.00 96.19  ? 126 ASP D C   1 
ATOM   3822 O  O   . ASP D 1 77  ? -3.038  19.511  117.488 1.00 94.08  ? 126 ASP D O   1 
ATOM   3823 C  CB  . ASP D 1 77  ? -5.763  18.953  117.521 1.00 108.67 ? 126 ASP D CB  1 
ATOM   3824 C  CG  . ASP D 1 77  ? -7.239  19.260  117.692 1.00 115.46 ? 126 ASP D CG  1 
ATOM   3825 O  OD1 . ASP D 1 77  ? -7.645  20.407  117.412 1.00 118.12 ? 126 ASP D OD1 1 
ATOM   3826 O  OD2 . ASP D 1 77  ? -7.991  18.353  118.109 1.00 116.61 ? 126 ASP D OD2 1 
ATOM   3827 N  N   . GLY D 1 78  ? -2.960  19.627  115.245 1.00 94.25  ? 127 GLY D N   1 
ATOM   3828 C  CA  . GLY D 1 78  ? -1.510  19.573  115.185 1.00 92.57  ? 127 GLY D CA  1 
ATOM   3829 C  C   . GLY D 1 78  ? -0.921  18.180  115.339 1.00 90.02  ? 127 GLY D C   1 
ATOM   3830 O  O   . GLY D 1 78  ? 0.254   18.033  115.680 1.00 87.87  ? 127 GLY D O   1 
ATOM   3831 N  N   . LYS D 1 79  ? -1.733  17.157  115.084 1.00 88.16  ? 128 LYS D N   1 
ATOM   3832 C  CA  . LYS D 1 79  ? -1.267  15.775  115.179 1.00 84.21  ? 128 LYS D CA  1 
ATOM   3833 C  C   . LYS D 1 79  ? -2.070  14.809  114.299 1.00 78.98  ? 128 LYS D C   1 
ATOM   3834 O  O   . LYS D 1 79  ? -3.125  15.162  113.773 1.00 79.98  ? 128 LYS D O   1 
ATOM   3835 C  CB  . LYS D 1 79  ? -1.262  15.307  116.639 1.00 83.26  ? 128 LYS D CB  1 
ATOM   3836 C  CG  . LYS D 1 79  ? -2.557  15.566  117.392 1.00 85.82  ? 128 LYS D CG  1 
ATOM   3837 C  CD  . LYS D 1 79  ? -2.391  15.282  118.882 1.00 85.09  ? 128 LYS D CD  1 
ATOM   3838 C  CE  . LYS D 1 79  ? -3.669  15.572  119.659 1.00 85.03  ? 128 LYS D CE  1 
ATOM   3839 N  NZ  . LYS D 1 79  ? -4.794  14.688  119.241 1.00 84.50  ? 128 LYS D NZ  1 
ATOM   3840 N  N   . LEU D 1 80  ? -1.550  13.595  114.140 1.00 71.24  ? 129 LEU D N   1 
ATOM   3841 C  CA  . LEU D 1 80  ? -2.218  12.552  113.364 1.00 69.29  ? 129 LEU D CA  1 
ATOM   3842 C  C   . LEU D 1 80  ? -2.571  11.354  114.241 1.00 69.56  ? 129 LEU D C   1 
ATOM   3843 O  O   . LEU D 1 80  ? -1.692  10.611  114.673 1.00 71.83  ? 129 LEU D O   1 
ATOM   3844 C  CB  . LEU D 1 80  ? -1.327  12.087  112.206 1.00 67.95  ? 129 LEU D CB  1 
ATOM   3845 C  CG  . LEU D 1 80  ? -1.832  10.902  111.373 1.00 63.64  ? 129 LEU D CG  1 
ATOM   3846 C  CD1 . LEU D 1 80  ? -2.962  11.323  110.444 1.00 66.72  ? 129 LEU D CD1 1 
ATOM   3847 C  CD2 . LEU D 1 80  ? -0.699  10.261  110.589 1.00 55.92  ? 129 LEU D CD2 1 
ATOM   3848 N  N   . VAL D 1 81  ? -3.861  11.164  114.497 1.00 67.69  ? 130 VAL D N   1 
ATOM   3849 C  CA  . VAL D 1 81  ? -4.319  10.023  115.283 1.00 63.65  ? 130 VAL D CA  1 
ATOM   3850 C  C   . VAL D 1 81  ? -4.372  8.745   114.452 1.00 64.42  ? 130 VAL D C   1 
ATOM   3851 O  O   . VAL D 1 81  ? -4.988  8.708   113.388 1.00 60.94  ? 130 VAL D O   1 
ATOM   3852 C  CB  . VAL D 1 81  ? -5.709  10.279  115.890 1.00 61.97  ? 130 VAL D CB  1 
ATOM   3853 C  CG1 . VAL D 1 81  ? -6.265  9.003   116.516 1.00 61.70  ? 130 VAL D CG1 1 
ATOM   3854 C  CG2 . VAL D 1 81  ? -5.638  11.398  116.912 1.00 62.94  ? 130 VAL D CG2 1 
ATOM   3855 N  N   . LEU D 1 82  ? -3.716  7.699   114.945 1.00 67.63  ? 131 LEU D N   1 
ATOM   3856 C  CA  . LEU D 1 82  ? -3.782  6.386   114.316 1.00 64.90  ? 131 LEU D CA  1 
ATOM   3857 C  C   . LEU D 1 82  ? -4.304  5.352   115.308 1.00 65.42  ? 131 LEU D C   1 
ATOM   3858 O  O   . LEU D 1 82  ? -3.785  5.224   116.416 1.00 67.29  ? 131 LEU D O   1 
ATOM   3859 C  CB  . LEU D 1 82  ? -2.405  5.958   113.803 1.00 59.40  ? 131 LEU D CB  1 
ATOM   3860 C  CG  . LEU D 1 82  ? -1.719  6.844   112.764 1.00 60.06  ? 131 LEU D CG  1 
ATOM   3861 C  CD1 . LEU D 1 82  ? -0.424  6.196   112.303 1.00 56.90  ? 131 LEU D CD1 1 
ATOM   3862 C  CD2 . LEU D 1 82  ? -2.635  7.120   111.579 1.00 63.81  ? 131 LEU D CD2 1 
ATOM   3863 N  N   . HIS D 1 83  ? -5.339  4.622   114.910 1.00 65.20  ? 132 HIS D N   1 
ATOM   3864 C  CA  . HIS D 1 83  ? -5.840  3.518   115.719 1.00 61.33  ? 132 HIS D CA  1 
ATOM   3865 C  C   . HIS D 1 83  ? -5.217  2.211   115.252 1.00 61.58  ? 132 HIS D C   1 
ATOM   3866 O  O   . HIS D 1 83  ? -5.117  1.964   114.050 1.00 60.19  ? 132 HIS D O   1 
ATOM   3867 C  CB  . HIS D 1 83  ? -7.364  3.435   115.636 1.00 60.39  ? 132 HIS D CB  1 
ATOM   3868 C  CG  . HIS D 1 83  ? -8.067  4.549   116.346 1.00 66.27  ? 132 HIS D CG  1 
ATOM   3869 N  ND1 . HIS D 1 83  ? -8.658  4.388   117.580 1.00 68.03  ? 132 HIS D ND1 1 
ATOM   3870 C  CD2 . HIS D 1 83  ? -8.265  5.842   116.000 1.00 70.07  ? 132 HIS D CD2 1 
ATOM   3871 C  CE1 . HIS D 1 83  ? -9.194  5.533   117.962 1.00 69.62  ? 132 HIS D CE1 1 
ATOM   3872 N  NE2 . HIS D 1 83  ? -8.970  6.432   117.021 1.00 69.82  ? 132 HIS D NE2 1 
ATOM   3873 N  N   . TYR D 1 84  ? -4.785  1.383   116.199 1.00 58.91  ? 133 TYR D N   1 
ATOM   3874 C  CA  . TYR D 1 84  ? -4.231  0.076   115.860 1.00 61.20  ? 133 TYR D CA  1 
ATOM   3875 C  C   . TYR D 1 84  ? -5.072  -1.057  116.441 1.00 63.22  ? 133 TYR D C   1 
ATOM   3876 O  O   . TYR D 1 84  ? -5.735  -0.890  117.463 1.00 65.62  ? 133 TYR D O   1 
ATOM   3877 C  CB  . TYR D 1 84  ? -2.761  -0.042  116.283 1.00 63.05  ? 133 TYR D CB  1 
ATOM   3878 C  CG  . TYR D 1 84  ? -2.498  0.178   117.756 1.00 63.79  ? 133 TYR D CG  1 
ATOM   3879 C  CD1 . TYR D 1 84  ? -2.295  1.456   118.262 1.00 63.56  ? 133 TYR D CD1 1 
ATOM   3880 C  CD2 . TYR D 1 84  ? -2.436  -0.894  118.638 1.00 64.26  ? 133 TYR D CD2 1 
ATOM   3881 C  CE1 . TYR D 1 84  ? -2.049  1.664   119.605 1.00 63.10  ? 133 TYR D CE1 1 
ATOM   3882 C  CE2 . TYR D 1 84  ? -2.190  -0.696  119.985 1.00 67.47  ? 133 TYR D CE2 1 
ATOM   3883 C  CZ  . TYR D 1 84  ? -1.996  0.586   120.463 1.00 64.87  ? 133 TYR D CZ  1 
ATOM   3884 O  OH  . TYR D 1 84  ? -1.753  0.792   121.802 1.00 60.43  ? 133 TYR D OH  1 
ATOM   3885 N  N   . CYS D 1 85  ? -5.040  -2.208  115.778 1.00 64.58  ? 134 CYS D N   1 
ATOM   3886 C  CA  . CYS D 1 85  ? -5.910  -3.324  116.126 1.00 63.87  ? 134 CYS D CA  1 
ATOM   3887 C  C   . CYS D 1 85  ? -5.407  -4.612  115.479 1.00 66.22  ? 134 CYS D C   1 
ATOM   3888 O  O   . CYS D 1 85  ? -4.822  -4.583  114.396 1.00 65.40  ? 134 CYS D O   1 
ATOM   3889 C  CB  . CYS D 1 85  ? -7.336  -3.024  115.662 1.00 61.00  ? 134 CYS D CB  1 
ATOM   3890 S  SG  . CYS D 1 85  ? -8.579  -4.232  116.150 1.00 74.03  ? 134 CYS D SG  1 
ATOM   3891 N  N   . LYS D 1 86  ? -5.627  -5.743  116.143 1.00 70.57  ? 135 LYS D N   1 
ATOM   3892 C  CA  . LYS D 1 86  ? -5.202  -7.031  115.602 1.00 72.93  ? 135 LYS D CA  1 
ATOM   3893 C  C   . LYS D 1 86  ? -6.253  -7.648  114.682 1.00 73.00  ? 135 LYS D C   1 
ATOM   3894 O  O   . LYS D 1 86  ? -6.008  -8.674  114.049 1.00 76.90  ? 135 LYS D O   1 
ATOM   3895 C  CB  . LYS D 1 86  ? -4.846  -8.010  116.722 1.00 77.34  ? 135 LYS D CB  1 
ATOM   3896 C  CG  . LYS D 1 86  ? -3.548  -7.689  117.447 1.00 79.28  ? 135 LYS D CG  1 
ATOM   3897 C  CD  . LYS D 1 86  ? -2.832  -8.964  117.880 1.00 78.88  ? 135 LYS D CD  1 
ATOM   3898 C  CE  . LYS D 1 86  ? -3.765  -9.902  118.625 1.00 81.33  ? 135 LYS D CE  1 
ATOM   3899 N  NZ  . LYS D 1 86  ? -3.089  -11.177 118.993 1.00 83.23  ? 135 LYS D NZ  1 
ATOM   3900 N  N   . SER D 1 87  ? -7.422  -7.022  114.616 1.00 70.79  ? 136 SER D N   1 
ATOM   3901 C  CA  . SER D 1 87  ? -8.487  -7.478  113.731 1.00 72.48  ? 136 SER D CA  1 
ATOM   3902 C  C   . SER D 1 87  ? -9.026  -6.318  112.896 1.00 73.44  ? 136 SER D C   1 
ATOM   3903 O  O   . SER D 1 87  ? -8.702  -5.159  113.145 1.00 71.15  ? 136 SER D O   1 
ATOM   3904 C  CB  . SER D 1 87  ? -9.618  -8.123  114.534 1.00 73.87  ? 136 SER D CB  1 
ATOM   3905 O  OG  . SER D 1 87  ? -10.219 -7.188  115.413 1.00 76.65  ? 136 SER D OG  1 
ATOM   3906 N  N   . GLN D 1 88  ? -9.846  -6.636  111.902 1.00 77.51  ? 137 GLN D N   1 
ATOM   3907 C  CA  . GLN D 1 88  ? -10.415 -5.610  111.039 1.00 81.23  ? 137 GLN D CA  1 
ATOM   3908 C  C   . GLN D 1 88  ? -11.527 -4.855  111.763 1.00 80.15  ? 137 GLN D C   1 
ATOM   3909 O  O   . GLN D 1 88  ? -12.685 -5.272  111.750 1.00 84.32  ? 137 GLN D O   1 
ATOM   3910 C  CB  . GLN D 1 88  ? -10.939 -6.232  109.744 1.00 86.54  ? 137 GLN D CB  1 
ATOM   3911 C  CG  . GLN D 1 88  ? -11.474 -5.230  108.735 1.00 93.72  ? 137 GLN D CG  1 
ATOM   3912 C  CD  . GLN D 1 88  ? -12.093 -5.904  107.524 1.00 97.59  ? 137 GLN D CD  1 
ATOM   3913 O  OE1 . GLN D 1 88  ? -12.994 -5.356  106.886 1.00 98.53  ? 137 GLN D OE1 1 
ATOM   3914 N  NE2 . GLN D 1 88  ? -11.610 -7.100  107.202 1.00 97.54  ? 137 GLN D NE2 1 
ATOM   3915 N  N   . ALA D 1 89  ? -11.163 -3.744  112.397 1.00 73.78  ? 138 ALA D N   1 
ATOM   3916 C  CA  . ALA D 1 89  ? -12.114 -2.934  113.149 1.00 70.99  ? 138 ALA D CA  1 
ATOM   3917 C  C   . ALA D 1 89  ? -13.163 -2.308  112.239 1.00 78.36  ? 138 ALA D C   1 
ATOM   3918 O  O   . ALA D 1 89  ? -14.341 -2.240  112.589 1.00 81.00  ? 138 ALA D O   1 
ATOM   3919 C  CB  . ALA D 1 89  ? -11.387 -1.854  113.930 1.00 67.13  ? 138 ALA D CB  1 
ATOM   3920 N  N   . TRP D 1 90  ? -12.725 -1.845  111.073 1.00 82.22  ? 139 TRP D N   1 
ATOM   3921 C  CA  . TRP D 1 90  ? -13.618 -1.209  110.113 1.00 82.16  ? 139 TRP D CA  1 
ATOM   3922 C  C   . TRP D 1 90  ? -13.280 -1.646  108.688 1.00 84.86  ? 139 TRP D C   1 
ATOM   3923 O  O   . TRP D 1 90  ? -12.133 -1.983  108.390 1.00 86.21  ? 139 TRP D O   1 
ATOM   3924 C  CB  . TRP D 1 90  ? -13.554 0.311   110.259 1.00 81.63  ? 139 TRP D CB  1 
ATOM   3925 C  CG  . TRP D 1 90  ? -13.834 0.771   111.664 1.00 84.65  ? 139 TRP D CG  1 
ATOM   3926 C  CD1 . TRP D 1 90  ? -15.036 0.747   112.308 1.00 86.75  ? 139 TRP D CD1 1 
ATOM   3927 C  CD2 . TRP D 1 90  ? -12.892 1.317   112.598 1.00 83.29  ? 139 TRP D CD2 1 
ATOM   3928 N  NE1 . TRP D 1 90  ? -14.903 1.244   113.582 1.00 85.05  ? 139 TRP D NE1 1 
ATOM   3929 C  CE2 . TRP D 1 90  ? -13.597 1.602   113.785 1.00 82.72  ? 139 TRP D CE2 1 
ATOM   3930 C  CE3 . TRP D 1 90  ? -11.523 1.595   112.545 1.00 83.06  ? 139 TRP D CE3 1 
ATOM   3931 C  CZ2 . TRP D 1 90  ? -12.981 2.150   114.907 1.00 82.64  ? 139 TRP D CZ2 1 
ATOM   3932 C  CZ3 . TRP D 1 90  ? -10.913 2.140   113.660 1.00 82.18  ? 139 TRP D CZ3 1 
ATOM   3933 C  CH2 . TRP D 1 90  ? -11.642 2.411   114.826 1.00 82.48  ? 139 TRP D CH2 1 
ATOM   3934 N  N   . GLY D 1 91  ? -14.280 -1.646  107.814 1.00 85.36  ? 140 GLY D N   1 
ATOM   3935 C  CA  . GLY D 1 91  ? -14.113 -2.182  106.476 1.00 87.24  ? 140 GLY D CA  1 
ATOM   3936 C  C   . GLY D 1 91  ? -14.210 -1.172  105.347 1.00 93.95  ? 140 GLY D C   1 
ATOM   3937 O  O   . GLY D 1 91  ? -14.709 -1.496  104.268 1.00 95.65  ? 140 GLY D O   1 
ATOM   3938 N  N   . ASP E 2 3   ? -21.192 10.157  74.814  1.00 100.86 ? 3   ASP E N   1 
ATOM   3939 C  CA  . ASP E 2 3   ? -21.282 11.200  75.828  1.00 99.02  ? 3   ASP E CA  1 
ATOM   3940 C  C   . ASP E 2 3   ? -20.225 11.005  76.911  1.00 96.09  ? 3   ASP E C   1 
ATOM   3941 O  O   . ASP E 2 3   ? -19.053 10.761  76.614  1.00 93.16  ? 3   ASP E O   1 
ATOM   3942 C  CB  . ASP E 2 3   ? -22.680 11.222  76.453  1.00 100.77 ? 3   ASP E CB  1 
ATOM   3943 C  CG  . ASP E 2 3   ? -23.110 9.860   76.971  1.00 101.27 ? 3   ASP E CG  1 
ATOM   3944 O  OD1 . ASP E 2 3   ? -22.970 8.868   76.225  1.00 100.02 ? 3   ASP E OD1 1 
ATOM   3945 O  OD2 . ASP E 2 3   ? -23.574 9.784   78.130  1.00 101.00 ? 3   ASP E OD2 1 
ATOM   3946 N  N   . ASP E 2 4   ? -20.650 11.118  78.167  1.00 92.24  ? 4   ASP E N   1 
ATOM   3947 C  CA  . ASP E 2 4   ? -19.764 10.925  79.306  1.00 83.15  ? 4   ASP E CA  1 
ATOM   3948 C  C   . ASP E 2 4   ? -19.487 9.448   79.564  1.00 77.49  ? 4   ASP E C   1 
ATOM   3949 O  O   . ASP E 2 4   ? -18.452 9.093   80.125  1.00 78.68  ? 4   ASP E O   1 
ATOM   3950 C  CB  . ASP E 2 4   ? -20.358 11.570  80.559  1.00 85.61  ? 4   ASP E CB  1 
ATOM   3951 C  CG  . ASP E 2 4   ? -20.324 13.085  80.507  1.00 88.51  ? 4   ASP E CG  1 
ATOM   3952 O  OD1 . ASP E 2 4   ? -21.297 13.719  80.970  1.00 90.52  ? 4   ASP E OD1 1 
ATOM   3953 O  OD2 . ASP E 2 4   ? -19.322 13.641  80.008  1.00 86.58  ? 4   ASP E OD2 1 
ATOM   3954 N  N   . LYS E 2 5   ? -20.413 8.588   79.155  1.00 72.91  ? 5   LYS E N   1 
ATOM   3955 C  CA  . LYS E 2 5   ? -20.256 7.156   79.379  1.00 71.10  ? 5   LYS E CA  1 
ATOM   3956 C  C   . LYS E 2 5   ? -19.215 6.542   78.446  1.00 70.90  ? 5   LYS E C   1 
ATOM   3957 O  O   . LYS E 2 5   ? -18.483 5.634   78.837  1.00 72.65  ? 5   LYS E O   1 
ATOM   3958 C  CB  . LYS E 2 5   ? -21.593 6.426   79.246  1.00 72.50  ? 5   LYS E CB  1 
ATOM   3959 C  CG  . LYS E 2 5   ? -21.490 4.934   79.516  1.00 79.05  ? 5   LYS E CG  1 
ATOM   3960 C  CD  . LYS E 2 5   ? -22.852 4.275   79.639  1.00 87.81  ? 5   LYS E CD  1 
ATOM   3961 C  CE  . LYS E 2 5   ? -22.706 2.783   79.909  1.00 94.73  ? 5   LYS E CE  1 
ATOM   3962 N  NZ  . LYS E 2 5   ? -24.026 2.111   80.066  1.00 100.02 ? 5   LYS E NZ  1 
ATOM   3963 N  N   . ASP E 2 6   ? -19.147 7.041   77.217  1.00 71.44  ? 6   ASP E N   1 
ATOM   3964 C  CA  . ASP E 2 6   ? -18.162 6.561   76.254  1.00 71.14  ? 6   ASP E CA  1 
ATOM   3965 C  C   . ASP E 2 6   ? -16.749 6.875   76.725  1.00 67.13  ? 6   ASP E C   1 
ATOM   3966 O  O   . ASP E 2 6   ? -15.805 6.154   76.411  1.00 67.68  ? 6   ASP E O   1 
ATOM   3967 C  CB  . ASP E 2 6   ? -18.407 7.177   74.877  1.00 78.66  ? 6   ASP E CB  1 
ATOM   3968 C  CG  . ASP E 2 6   ? -19.725 6.737   74.270  1.00 90.12  ? 6   ASP E CG  1 
ATOM   3969 O  OD1 . ASP E 2 6   ? -20.118 5.568   74.482  1.00 90.22  ? 6   ASP E OD1 1 
ATOM   3970 O  OD2 . ASP E 2 6   ? -20.369 7.560   73.584  1.00 96.40  ? 6   ASP E OD2 1 
ATOM   3971 N  N   . VAL E 2 7   ? -16.610 7.956   77.483  1.00 62.85  ? 7   VAL E N   1 
ATOM   3972 C  CA  . VAL E 2 7   ? -15.322 8.316   78.057  1.00 61.47  ? 7   VAL E CA  1 
ATOM   3973 C  C   . VAL E 2 7   ? -14.942 7.321   79.155  1.00 63.76  ? 7   VAL E C   1 
ATOM   3974 O  O   . VAL E 2 7   ? -13.777 6.927   79.281  1.00 63.56  ? 7   VAL E O   1 
ATOM   3975 C  CB  . VAL E 2 7   ? -15.343 9.752   78.614  1.00 60.24  ? 7   VAL E CB  1 
ATOM   3976 C  CG1 . VAL E 2 7   ? -14.027 10.087  79.285  1.00 58.83  ? 7   VAL E CG1 1 
ATOM   3977 C  CG2 . VAL E 2 7   ? -15.637 10.742  77.501  1.00 61.46  ? 7   VAL E CG2 1 
ATOM   3978 N  N   . LEU E 2 8   ? -15.935 6.904   79.935  1.00 63.37  ? 8   LEU E N   1 
ATOM   3979 C  CA  . LEU E 2 8   ? -15.721 5.915   80.986  1.00 60.60  ? 8   LEU E CA  1 
ATOM   3980 C  C   . LEU E 2 8   ? -15.256 4.584   80.399  1.00 57.44  ? 8   LEU E C   1 
ATOM   3981 O  O   . LEU E 2 8   ? -14.347 3.944   80.925  1.00 55.76  ? 8   LEU E O   1 
ATOM   3982 C  CB  . LEU E 2 8   ? -17.000 5.707   81.805  1.00 57.93  ? 8   LEU E CB  1 
ATOM   3983 C  CG  . LEU E 2 8   ? -17.501 6.884   82.647  1.00 55.14  ? 8   LEU E CG  1 
ATOM   3984 C  CD1 . LEU E 2 8   ? -18.781 6.520   83.396  1.00 53.31  ? 8   LEU E CD1 1 
ATOM   3985 C  CD2 . LEU E 2 8   ? -16.428 7.342   83.613  1.00 47.72  ? 8   LEU E CD2 1 
ATOM   3986 N  N   . ARG E 2 9   ? -15.883 4.177   79.304  1.00 56.49  ? 9   ARG E N   1 
ATOM   3987 C  CA  . ARG E 2 9   ? -15.547 2.913   78.667  1.00 58.81  ? 9   ARG E CA  1 
ATOM   3988 C  C   . ARG E 2 9   ? -14.148 2.943   78.057  1.00 60.29  ? 9   ARG E C   1 
ATOM   3989 O  O   . ARG E 2 9   ? -13.397 1.974   78.169  1.00 65.77  ? 9   ARG E O   1 
ATOM   3990 C  CB  . ARG E 2 9   ? -16.600 2.548   77.618  1.00 61.68  ? 9   ARG E CB  1 
ATOM   3991 C  CG  . ARG E 2 9   ? -18.013 2.436   78.190  1.00 67.35  ? 9   ARG E CG  1 
ATOM   3992 C  CD  . ARG E 2 9   ? -19.022 2.002   77.137  1.00 72.75  ? 9   ARG E CD  1 
ATOM   3993 N  NE  . ARG E 2 9   ? -18.679 0.705   76.560  1.00 79.32  ? 9   ARG E NE  1 
ATOM   3994 C  CZ  . ARG E 2 9   ? -19.066 -0.464  77.064  1.00 86.77  ? 9   ARG E CZ  1 
ATOM   3995 N  NH1 . ARG E 2 9   ? -19.815 -0.504  78.160  1.00 91.43  ? 9   ARG E NH1 1 
ATOM   3996 N  NH2 . ARG E 2 9   ? -18.702 -1.595  76.473  1.00 86.48  ? 9   ARG E NH2 1 
ATOM   3997 N  N   . ASP E 2 10  ? -13.793 4.059   77.427  1.00 60.03  ? 10  ASP E N   1 
ATOM   3998 C  CA  . ASP E 2 10  ? -12.475 4.197   76.812  1.00 59.91  ? 10  ASP E CA  1 
ATOM   3999 C  C   . ASP E 2 10  ? -11.355 4.192   77.844  1.00 55.02  ? 10  ASP E C   1 
ATOM   4000 O  O   . ASP E 2 10  ? -10.289 3.629   77.609  1.00 57.88  ? 10  ASP E O   1 
ATOM   4001 C  CB  . ASP E 2 10  ? -12.391 5.455   75.945  1.00 64.92  ? 10  ASP E CB  1 
ATOM   4002 C  CG  . ASP E 2 10  ? -13.131 5.304   74.629  1.00 69.07  ? 10  ASP E CG  1 
ATOM   4003 O  OD1 . ASP E 2 10  ? -13.474 4.156   74.270  1.00 69.81  ? 10  ASP E OD1 1 
ATOM   4004 O  OD2 . ASP E 2 10  ? -13.363 6.331   73.955  1.00 68.87  ? 10  ASP E OD2 1 
ATOM   4005 N  N   . VAL E 2 11  ? -11.595 4.823   78.986  1.00 50.66  ? 11  VAL E N   1 
ATOM   4006 C  CA  . VAL E 2 11  ? -10.613 4.815   80.058  1.00 50.27  ? 11  VAL E CA  1 
ATOM   4007 C  C   . VAL E 2 11  ? -10.472 3.411   80.637  1.00 51.15  ? 11  VAL E C   1 
ATOM   4008 O  O   . VAL E 2 11  ? -9.362  2.932   80.858  1.00 53.69  ? 11  VAL E O   1 
ATOM   4009 C  CB  . VAL E 2 11  ? -10.983 5.812   81.174  1.00 49.82  ? 11  VAL E CB  1 
ATOM   4010 C  CG1 . VAL E 2 11  ? -10.147 5.556   82.420  1.00 38.12  ? 11  VAL E CG1 1 
ATOM   4011 C  CG2 . VAL E 2 11  ? -10.814 7.246   80.681  1.00 43.23  ? 11  VAL E CG2 1 
ATOM   4012 N  N   . TRP E 2 12  ? -11.609 2.756   80.860  1.00 52.81  ? 12  TRP E N   1 
ATOM   4013 C  CA  . TRP E 2 12  ? -11.653 1.412   81.432  1.00 53.17  ? 12  TRP E CA  1 
ATOM   4014 C  C   . TRP E 2 12  ? -10.943 0.376   80.565  1.00 56.24  ? 12  TRP E C   1 
ATOM   4015 O  O   . TRP E 2 12  ? -10.186 -0.455  81.071  1.00 58.13  ? 12  TRP E O   1 
ATOM   4016 C  CB  . TRP E 2 12  ? -13.107 0.980   81.651  1.00 52.53  ? 12  TRP E CB  1 
ATOM   4017 C  CG  . TRP E 2 12  ? -13.252 -0.415  82.188  1.00 50.59  ? 12  TRP E CG  1 
ATOM   4018 C  CD1 . TRP E 2 12  ? -13.360 -1.567  81.462  1.00 50.57  ? 12  TRP E CD1 1 
ATOM   4019 C  CD2 . TRP E 2 12  ? -13.305 -0.803  83.565  1.00 53.41  ? 12  TRP E CD2 1 
ATOM   4020 N  NE1 . TRP E 2 12  ? -13.474 -2.647  82.302  1.00 52.52  ? 12  TRP E NE1 1 
ATOM   4021 C  CE2 . TRP E 2 12  ? -13.443 -2.206  83.598  1.00 55.72  ? 12  TRP E CE2 1 
ATOM   4022 C  CE3 . TRP E 2 12  ? -13.248 -0.102  84.773  1.00 54.50  ? 12  TRP E CE3 1 
ATOM   4023 C  CZ2 . TRP E 2 12  ? -13.525 -2.921  84.793  1.00 53.93  ? 12  TRP E CZ2 1 
ATOM   4024 C  CZ3 . TRP E 2 12  ? -13.326 -0.813  85.957  1.00 53.88  ? 12  TRP E CZ3 1 
ATOM   4025 C  CH2 . TRP E 2 12  ? -13.465 -2.207  85.958  1.00 53.84  ? 12  TRP E CH2 1 
ATOM   4026 N  N   . PHE E 2 13  ? -11.196 0.420   79.262  1.00 55.92  ? 13  PHE E N   1 
ATOM   4027 C  CA  . PHE E 2 13  ? -10.668 -0.599  78.362  1.00 56.55  ? 13  PHE E CA  1 
ATOM   4028 C  C   . PHE E 2 13  ? -9.307  -0.254  77.769  1.00 54.19  ? 13  PHE E C   1 
ATOM   4029 O  O   . PHE E 2 13  ? -8.863  -0.903  76.824  1.00 58.93  ? 13  PHE E O   1 
ATOM   4030 C  CB  . PHE E 2 13  ? -11.670 -0.914  77.248  1.00 50.43  ? 13  PHE E CB  1 
ATOM   4031 C  CG  . PHE E 2 13  ? -12.885 -1.652  77.724  1.00 53.98  ? 13  PHE E CG  1 
ATOM   4032 C  CD1 . PHE E 2 13  ? -12.786 -2.969  78.151  1.00 56.39  ? 13  PHE E CD1 1 
ATOM   4033 C  CD2 . PHE E 2 13  ? -14.125 -1.034  77.749  1.00 53.35  ? 13  PHE E CD2 1 
ATOM   4034 C  CE1 . PHE E 2 13  ? -13.903 -3.657  78.596  1.00 55.78  ? 13  PHE E CE1 1 
ATOM   4035 C  CE2 . PHE E 2 13  ? -15.246 -1.717  78.192  1.00 55.02  ? 13  PHE E CE2 1 
ATOM   4036 C  CZ  . PHE E 2 13  ? -15.134 -3.031  78.616  1.00 55.44  ? 13  PHE E CZ  1 
ATOM   4037 N  N   . GLY E 2 14  ? -8.648  0.758   78.324  1.00 48.45  ? 14  GLY E N   1 
ATOM   4038 C  CA  . GLY E 2 14  ? -7.333  1.152   77.852  1.00 48.17  ? 14  GLY E CA  1 
ATOM   4039 C  C   . GLY E 2 14  ? -6.321  0.038   78.038  1.00 50.02  ? 14  GLY E C   1 
ATOM   4040 O  O   . GLY E 2 14  ? -6.231  -0.551  79.114  1.00 52.59  ? 14  GLY E O   1 
ATOM   4041 N  N   . ARG E 2 15  ? -5.562  -0.257  76.988  1.00 47.65  ? 15  ARG E N   1 
ATOM   4042 C  CA  . ARG E 2 15  ? -4.579  -1.338  77.030  1.00 47.07  ? 15  ARG E CA  1 
ATOM   4043 C  C   . ARG E 2 15  ? -3.165  -0.839  76.743  1.00 46.87  ? 15  ARG E C   1 
ATOM   4044 O  O   . ARG E 2 15  ? -2.979  0.159   76.053  1.00 54.64  ? 15  ARG E O   1 
ATOM   4045 C  CB  . ARG E 2 15  ? -4.951  -2.433  76.029  1.00 49.79  ? 15  ARG E CB  1 
ATOM   4046 C  CG  . ARG E 2 15  ? -6.222  -3.197  76.371  1.00 53.28  ? 15  ARG E CG  1 
ATOM   4047 C  CD  . ARG E 2 15  ? -6.049  -3.975  77.660  1.00 56.33  ? 15  ARG E CD  1 
ATOM   4048 N  NE  . ARG E 2 15  ? -7.184  -4.850  77.946  1.00 60.54  ? 15  ARG E NE  1 
ATOM   4049 C  CZ  . ARG E 2 15  ? -8.248  -4.493  78.659  1.00 60.36  ? 15  ARG E CZ  1 
ATOM   4050 N  NH1 . ARG E 2 15  ? -8.340  -3.267  79.155  1.00 58.47  ? 15  ARG E NH1 1 
ATOM   4051 N  NH2 . ARG E 2 15  ? -9.224  -5.363  78.874  1.00 62.74  ? 15  ARG E NH2 1 
ATOM   4052 N  N   . ILE E 2 16  ? -2.171  -1.537  77.279  1.00 44.29  ? 16  ILE E N   1 
ATOM   4053 C  CA  . ILE E 2 16  ? -0.775  -1.222  77.002  1.00 44.66  ? 16  ILE E CA  1 
ATOM   4054 C  C   . ILE E 2 16  ? -0.029  -2.464  76.541  1.00 47.62  ? 16  ILE E C   1 
ATOM   4055 O  O   . ILE E 2 16  ? 0.237   -3.364  77.342  1.00 49.31  ? 16  ILE E O   1 
ATOM   4056 C  CB  . ILE E 2 16  ? -0.061  -0.661  78.236  1.00 45.87  ? 16  ILE E CB  1 
ATOM   4057 C  CG1 . ILE E 2 16  ? -0.698  0.659   78.659  1.00 50.68  ? 16  ILE E CG1 1 
ATOM   4058 C  CG2 . ILE E 2 16  ? 1.420   -0.459  77.945  1.00 43.41  ? 16  ILE E CG2 1 
ATOM   4059 C  CD1 . ILE E 2 16  ? -0.291  1.096   80.033  1.00 54.96  ? 16  ILE E CD1 1 
ATOM   4060 N  N   . PRO E 2 17  ? 0.297   -2.525  75.241  1.00 47.39  ? 17  PRO E N   1 
ATOM   4061 C  CA  . PRO E 2 17  ? 1.073   -3.637  74.682  1.00 47.69  ? 17  PRO E CA  1 
ATOM   4062 C  C   . PRO E 2 17  ? 2.423   -3.776  75.373  1.00 46.31  ? 17  PRO E C   1 
ATOM   4063 O  O   . PRO E 2 17  ? 3.193   -2.819  75.419  1.00 47.28  ? 17  PRO E O   1 
ATOM   4064 C  CB  . PRO E 2 17  ? 1.249   -3.247  73.209  1.00 52.52  ? 17  PRO E CB  1 
ATOM   4065 C  CG  . PRO E 2 17  ? 0.858   -1.797  73.119  1.00 52.93  ? 17  PRO E CG  1 
ATOM   4066 C  CD  . PRO E 2 17  ? -0.136  -1.574  74.205  1.00 48.67  ? 17  PRO E CD  1 
ATOM   4067 N  N   . THR E 2 18  ? 2.695   -4.965  75.903  1.00 47.13  ? 18  THR E N   1 
ATOM   4068 C  CA  . THR E 2 18  ? 3.861   -5.189  76.745  1.00 47.50  ? 18  THR E CA  1 
ATOM   4069 C  C   . THR E 2 18  ? 4.642   -6.439  76.335  1.00 47.82  ? 18  THR E C   1 
ATOM   4070 O  O   . THR E 2 18  ? 4.056   -7.457  75.955  1.00 43.22  ? 18  THR E O   1 
ATOM   4071 C  CB  . THR E 2 18  ? 3.437   -5.312  78.221  1.00 48.80  ? 18  THR E CB  1 
ATOM   4072 O  OG1 . THR E 2 18  ? 2.700   -4.142  78.598  1.00 51.03  ? 18  THR E OG1 1 
ATOM   4073 C  CG2 . THR E 2 18  ? 4.645   -5.467  79.135  1.00 38.45  ? 18  THR E CG2 1 
ATOM   4074 N  N   . CYS E 2 19  ? 5.968   -6.346  76.410  1.00 45.14  ? 19  CYS E N   1 
ATOM   4075 C  CA  . CYS E 2 19  ? 6.840   -7.474  76.126  1.00 47.59  ? 19  CYS E CA  1 
ATOM   4076 C  C   . CYS E 2 19  ? 7.594   -7.901  77.377  1.00 52.92  ? 19  CYS E C   1 
ATOM   4077 O  O   . CYS E 2 19  ? 8.513   -7.214  77.828  1.00 54.10  ? 19  CYS E O   1 
ATOM   4078 C  CB  . CYS E 2 19  ? 7.836   -7.115  75.024  1.00 48.42  ? 19  CYS E CB  1 
ATOM   4079 S  SG  . CYS E 2 19  ? 8.978   -8.451  74.596  1.00 52.51  ? 19  CYS E SG  1 
ATOM   4080 N  N   . PHE E 2 20  ? 7.201   -9.041  77.936  1.00 52.36  ? 20  PHE E N   1 
ATOM   4081 C  CA  . PHE E 2 20  ? 7.878   -9.584  79.104  1.00 47.11  ? 20  PHE E CA  1 
ATOM   4082 C  C   . PHE E 2 20  ? 9.055   -10.453 78.679  1.00 49.92  ? 20  PHE E C   1 
ATOM   4083 O  O   . PHE E 2 20  ? 8.881   -11.464 77.998  1.00 51.24  ? 20  PHE E O   1 
ATOM   4084 C  CB  . PHE E 2 20  ? 6.913   -10.405 79.956  1.00 47.42  ? 20  PHE E CB  1 
ATOM   4085 C  CG  . PHE E 2 20  ? 5.798   -9.601  80.566  1.00 46.27  ? 20  PHE E CG  1 
ATOM   4086 C  CD1 . PHE E 2 20  ? 5.926   -9.067  81.836  1.00 44.27  ? 20  PHE E CD1 1 
ATOM   4087 C  CD2 . PHE E 2 20  ? 4.612   -9.400  79.876  1.00 45.76  ? 20  PHE E CD2 1 
ATOM   4088 C  CE1 . PHE E 2 20  ? 4.895   -8.335  82.402  1.00 45.01  ? 20  PHE E CE1 1 
ATOM   4089 C  CE2 . PHE E 2 20  ? 3.579   -8.674  80.438  1.00 46.01  ? 20  PHE E CE2 1 
ATOM   4090 C  CZ  . PHE E 2 20  ? 3.720   -8.140  81.703  1.00 43.47  ? 20  PHE E CZ  1 
ATOM   4091 N  N   . THR E 2 21  ? 10.254  -10.048 79.077  1.00 49.94  ? 21  THR E N   1 
ATOM   4092 C  CA  . THR E 2 21  ? 11.452  -10.823 78.800  1.00 49.96  ? 21  THR E CA  1 
ATOM   4093 C  C   . THR E 2 21  ? 12.053  -11.281 80.122  1.00 52.30  ? 21  THR E C   1 
ATOM   4094 O  O   . THR E 2 21  ? 12.120  -10.514 81.081  1.00 49.55  ? 21  THR E O   1 
ATOM   4095 C  CB  . THR E 2 21  ? 12.479  -10.007 77.988  1.00 52.00  ? 21  THR E CB  1 
ATOM   4096 O  OG1 . THR E 2 21  ? 11.926  -9.691  76.704  1.00 56.53  ? 21  THR E OG1 1 
ATOM   4097 C  CG2 . THR E 2 21  ? 13.762  -10.793 77.784  1.00 52.44  ? 21  THR E CG2 1 
ATOM   4098 N  N   . LEU E 2 22  ? 12.465  -12.543 80.177  1.00 58.76  ? 22  LEU E N   1 
ATOM   4099 C  CA  . LEU E 2 22  ? 13.030  -13.100 81.397  1.00 60.95  ? 22  LEU E CA  1 
ATOM   4100 C  C   . LEU E 2 22  ? 14.428  -12.548 81.640  1.00 63.31  ? 22  LEU E C   1 
ATOM   4101 O  O   . LEU E 2 22  ? 15.225  -12.422 80.709  1.00 59.91  ? 22  LEU E O   1 
ATOM   4102 C  CB  . LEU E 2 22  ? 13.067  -14.628 81.324  1.00 58.62  ? 22  LEU E CB  1 
ATOM   4103 C  CG  . LEU E 2 22  ? 13.487  -15.376 82.589  1.00 57.42  ? 22  LEU E CG  1 
ATOM   4104 C  CD1 . LEU E 2 22  ? 12.559  -15.038 83.741  1.00 60.46  ? 22  LEU E CD1 1 
ATOM   4105 C  CD2 . LEU E 2 22  ? 13.495  -16.868 82.339  1.00 56.23  ? 22  LEU E CD2 1 
ATOM   4106 N  N   . TYR E 2 23  ? 14.707  -12.208 82.894  1.00 69.71  ? 23  TYR E N   1 
ATOM   4107 C  CA  . TYR E 2 23  ? 16.026  -11.741 83.301  1.00 76.04  ? 23  TYR E CA  1 
ATOM   4108 C  C   . TYR E 2 23  ? 17.050  -12.843 83.058  1.00 81.54  ? 23  TYR E C   1 
ATOM   4109 O  O   . TYR E 2 23  ? 16.816  -14.001 83.401  1.00 84.63  ? 23  TYR E O   1 
ATOM   4110 C  CB  . TYR E 2 23  ? 16.005  -11.336 84.774  1.00 78.77  ? 23  TYR E CB  1 
ATOM   4111 C  CG  . TYR E 2 23  ? 17.294  -10.734 85.275  1.00 79.84  ? 23  TYR E CG  1 
ATOM   4112 C  CD1 . TYR E 2 23  ? 17.870  -9.645  84.637  1.00 77.51  ? 23  TYR E CD1 1 
ATOM   4113 C  CD2 . TYR E 2 23  ? 17.924  -11.240 86.405  1.00 81.13  ? 23  TYR E CD2 1 
ATOM   4114 C  CE1 . TYR E 2 23  ? 19.047  -9.087  85.100  1.00 79.08  ? 23  TYR E CE1 1 
ATOM   4115 C  CE2 . TYR E 2 23  ? 19.099  -10.689 86.875  1.00 80.71  ? 23  TYR E CE2 1 
ATOM   4116 C  CZ  . TYR E 2 23  ? 19.658  -9.614  86.220  1.00 80.25  ? 23  TYR E CZ  1 
ATOM   4117 O  OH  . TYR E 2 23  ? 20.829  -9.066  86.690  1.00 80.59  ? 23  TYR E OH  1 
ATOM   4118 N  N   . GLN E 2 24  ? 18.182  -12.478 82.466  1.00 85.33  ? 24  GLN E N   1 
ATOM   4119 C  CA  . GLN E 2 24  ? 19.142  -13.463 81.974  1.00 92.79  ? 24  GLN E CA  1 
ATOM   4120 C  C   . GLN E 2 24  ? 19.845  -14.277 83.061  1.00 95.26  ? 24  GLN E C   1 
ATOM   4121 O  O   . GLN E 2 24  ? 20.437  -15.319 82.773  1.00 95.34  ? 24  GLN E O   1 
ATOM   4122 C  CB  . GLN E 2 24  ? 20.177  -12.791 81.070  1.00 98.29  ? 24  GLN E CB  1 
ATOM   4123 C  CG  . GLN E 2 24  ? 21.020  -11.733 81.757  1.00 103.39 ? 24  GLN E CG  1 
ATOM   4124 C  CD  . GLN E 2 24  ? 21.924  -11.006 80.782  1.00 111.94 ? 24  GLN E CD  1 
ATOM   4125 O  OE1 . GLN E 2 24  ? 21.711  -11.054 79.568  1.00 115.87 ? 24  GLN E OE1 1 
ATOM   4126 N  NE2 . GLN E 2 24  ? 22.941  -10.334 81.304  1.00 113.70 ? 24  GLN E NE2 1 
ATOM   4127 N  N   . ASP E 2 25  ? 19.778  -13.809 84.303  1.00 97.71  ? 25  ASP E N   1 
ATOM   4128 C  CA  . ASP E 2 25  ? 20.457  -14.488 85.404  1.00 100.20 ? 25  ASP E CA  1 
ATOM   4129 C  C   . ASP E 2 25  ? 19.541  -15.410 86.201  1.00 97.76  ? 25  ASP E C   1 
ATOM   4130 O  O   . ASP E 2 25  ? 19.873  -15.808 87.316  1.00 97.98  ? 25  ASP E O   1 
ATOM   4131 C  CB  . ASP E 2 25  ? 21.115  -13.478 86.346  1.00 103.04 ? 25  ASP E CB  1 
ATOM   4132 C  CG  . ASP E 2 25  ? 22.319  -12.803 85.726  1.00 105.92 ? 25  ASP E CG  1 
ATOM   4133 O  OD1 . ASP E 2 25  ? 22.895  -13.372 84.774  1.00 105.73 ? 25  ASP E OD1 1 
ATOM   4134 O  OD2 . ASP E 2 25  ? 22.693  -11.709 86.198  1.00 107.43 ? 25  ASP E OD2 1 
ATOM   4135 N  N   . GLU E 2 26  ? 18.388  -15.747 85.634  1.00 96.27  ? 26  GLU E N   1 
ATOM   4136 C  CA  . GLU E 2 26  ? 17.481  -16.682 86.286  1.00 95.64  ? 26  GLU E CA  1 
ATOM   4137 C  C   . GLU E 2 26  ? 17.842  -18.114 85.901  1.00 94.59  ? 26  GLU E C   1 
ATOM   4138 O  O   . GLU E 2 26  ? 18.004  -18.426 84.719  1.00 94.02  ? 26  GLU E O   1 
ATOM   4139 C  CB  . GLU E 2 26  ? 16.024  -16.373 85.927  1.00 95.34  ? 26  GLU E CB  1 
ATOM   4140 C  CG  . GLU E 2 26  ? 15.549  -14.984 86.353  1.00 93.99  ? 26  GLU E CG  1 
ATOM   4141 C  CD  . GLU E 2 26  ? 15.366  -14.850 87.856  1.00 90.66  ? 26  GLU E CD  1 
ATOM   4142 O  OE1 . GLU E 2 26  ? 15.248  -15.888 88.540  1.00 93.28  ? 26  GLU E OE1 1 
ATOM   4143 O  OE2 . GLU E 2 26  ? 15.336  -13.704 88.355  1.00 85.08  ? 26  GLU E OE2 1 
ATOM   4144 N  N   . ILE E 2 27  ? 17.983  -18.974 86.905  1.00 93.26  ? 27  ILE E N   1 
ATOM   4145 C  CA  . ILE E 2 27  ? 18.337  -20.371 86.679  1.00 93.10  ? 27  ILE E CA  1 
ATOM   4146 C  C   . ILE E 2 27  ? 17.245  -21.070 85.880  1.00 94.79  ? 27  ILE E C   1 
ATOM   4147 O  O   . ILE E 2 27  ? 16.143  -21.290 86.382  1.00 94.05  ? 27  ILE E O   1 
ATOM   4148 C  CB  . ILE E 2 27  ? 18.550  -21.119 88.008  1.00 91.93  ? 27  ILE E CB  1 
ATOM   4149 C  CG1 . ILE E 2 27  ? 19.519  -20.346 88.906  1.00 88.64  ? 27  ILE E CG1 1 
ATOM   4150 C  CG2 . ILE E 2 27  ? 19.049  -22.538 87.750  1.00 92.25  ? 27  ILE E CG2 1 
ATOM   4151 C  CD1 . ILE E 2 27  ? 19.661  -20.925 90.297  1.00 88.29  ? 27  ILE E CD1 1 
ATOM   4152 N  N   . THR E 2 28  ? 17.553  -21.410 84.632  1.00 96.67  ? 28  THR E N   1 
ATOM   4153 C  CA  . THR E 2 28  ? 16.570  -22.022 83.745  1.00 99.63  ? 28  THR E CA  1 
ATOM   4154 C  C   . THR E 2 28  ? 17.107  -23.262 83.038  1.00 106.83 ? 28  THR E C   1 
ATOM   4155 O  O   . THR E 2 28  ? 18.280  -23.321 82.665  1.00 107.98 ? 28  THR E O   1 
ATOM   4156 C  CB  . THR E 2 28  ? 16.076  -21.027 82.678  1.00 97.73  ? 28  THR E CB  1 
ATOM   4157 O  OG1 . THR E 2 28  ? 17.200  -20.454 82.000  1.00 97.75  ? 28  THR E OG1 1 
ATOM   4158 C  CG2 . THR E 2 28  ? 15.259  -19.917 83.317  1.00 95.93  ? 28  THR E CG2 1 
ATOM   4159 N  N   . GLU E 2 29  ? 16.234  -24.247 82.853  1.00 111.38 ? 29  GLU E N   1 
ATOM   4160 C  CA  . GLU E 2 29  ? 16.578  -25.463 82.127  1.00 114.34 ? 29  GLU E CA  1 
ATOM   4161 C  C   . GLU E 2 29  ? 16.809  -25.157 80.654  1.00 115.53 ? 29  GLU E C   1 
ATOM   4162 O  O   . GLU E 2 29  ? 17.615  -25.809 79.991  1.00 116.13 ? 29  GLU E O   1 
ATOM   4163 C  CB  . GLU E 2 29  ? 15.460  -26.495 82.265  1.00 116.46 ? 29  GLU E CB  1 
ATOM   4164 C  CG  . GLU E 2 29  ? 15.254  -27.004 83.678  1.00 119.45 ? 29  GLU E CG  1 
ATOM   4165 C  CD  . GLU E 2 29  ? 14.024  -27.879 83.800  1.00 121.66 ? 29  GLU E CD  1 
ATOM   4166 O  OE1 . GLU E 2 29  ? 12.969  -27.499 83.249  1.00 120.10 ? 29  GLU E OE1 1 
ATOM   4167 O  OE2 . GLU E 2 29  ? 14.114  -28.949 84.441  1.00 123.14 ? 29  GLU E OE2 1 
ATOM   4168 N  N   . ARG E 2 30  ? 16.088  -24.163 80.149  1.00 117.53 ? 30  ARG E N   1 
ATOM   4169 C  CA  . ARG E 2 30  ? 16.224  -23.740 78.762  1.00 119.36 ? 30  ARG E CA  1 
ATOM   4170 C  C   . ARG E 2 30  ? 15.875  -22.263 78.620  1.00 115.20 ? 30  ARG E C   1 
ATOM   4171 O  O   . ARG E 2 30  ? 15.205  -21.691 79.482  1.00 115.55 ? 30  ARG E O   1 
ATOM   4172 C  CB  . ARG E 2 30  ? 15.325  -24.583 77.856  1.00 122.83 ? 30  ARG E CB  1 
ATOM   4173 C  CG  . ARG E 2 30  ? 13.852  -24.532 78.226  1.00 126.34 ? 30  ARG E CG  1 
ATOM   4174 C  CD  . ARG E 2 30  ? 13.010  -25.350 77.259  1.00 131.27 ? 30  ARG E CD  1 
ATOM   4175 N  NE  . ARG E 2 30  ? 11.582  -25.229 77.538  1.00 135.11 ? 30  ARG E NE  1 
ATOM   4176 C  CZ  . ARG E 2 30  ? 10.798  -24.283 77.028  1.00 137.02 ? 30  ARG E CZ  1 
ATOM   4177 N  NH1 . ARG E 2 30  ? 11.304  -23.367 76.213  1.00 137.21 ? 30  ARG E NH1 1 
ATOM   4178 N  NH2 . ARG E 2 30  ? 9.509   -24.249 77.336  1.00 137.26 ? 30  ARG E NH2 1 
ATOM   4179 N  N   . GLU E 2 31  ? 16.336  -21.649 77.535  1.00 109.61 ? 31  GLU E N   1 
ATOM   4180 C  CA  . GLU E 2 31  ? 16.027  -20.251 77.262  1.00 104.01 ? 31  GLU E CA  1 
ATOM   4181 C  C   . GLU E 2 31  ? 14.534  -20.093 76.998  1.00 96.50  ? 31  GLU E C   1 
ATOM   4182 O  O   . GLU E 2 31  ? 13.936  -20.885 76.270  1.00 93.18  ? 31  GLU E O   1 
ATOM   4183 C  CB  . GLU E 2 31  ? 16.837  -19.736 76.068  1.00 104.66 ? 31  GLU E CB  1 
ATOM   4184 C  CG  . GLU E 2 31  ? 18.351  -19.803 76.255  1.00 104.93 ? 31  GLU E CG  1 
ATOM   4185 C  CD  . GLU E 2 31  ? 18.869  -18.793 77.264  1.00 103.45 ? 31  GLU E CD  1 
ATOM   4186 O  OE1 . GLU E 2 31  ? 18.187  -17.772 77.492  1.00 102.73 ? 31  GLU E OE1 1 
ATOM   4187 O  OE2 . GLU E 2 31  ? 19.961  -19.022 77.828  1.00 102.18 ? 31  GLU E OE2 1 
ATOM   4188 N  N   . ALA E 2 32  ? 13.935  -19.074 77.605  1.00 91.42  ? 32  ALA E N   1 
ATOM   4189 C  CA  . ALA E 2 32  ? 12.508  -18.831 77.454  1.00 85.16  ? 32  ALA E CA  1 
ATOM   4190 C  C   . ALA E 2 32  ? 12.242  -17.790 76.375  1.00 83.23  ? 32  ALA E C   1 
ATOM   4191 O  O   . ALA E 2 32  ? 13.051  -16.887 76.151  1.00 84.92  ? 32  ALA E O   1 
ATOM   4192 C  CB  . ALA E 2 32  ? 11.902  -18.393 78.777  1.00 81.79  ? 32  ALA E CB  1 
ATOM   4193 N  N   . GLU E 2 33  ? 11.107  -17.927 75.701  1.00 79.37  ? 33  GLU E N   1 
ATOM   4194 C  CA  . GLU E 2 33  ? 10.698  -16.951 74.703  1.00 77.83  ? 33  GLU E CA  1 
ATOM   4195 C  C   . GLU E 2 33  ? 10.066  -15.751 75.397  1.00 68.66  ? 33  GLU E C   1 
ATOM   4196 O  O   . GLU E 2 33  ? 9.449   -15.898 76.453  1.00 64.87  ? 33  GLU E O   1 
ATOM   4197 C  CB  . GLU E 2 33  ? 9.704   -17.576 73.719  1.00 82.86  ? 33  GLU E CB  1 
ATOM   4198 C  CG  . GLU E 2 33  ? 10.252  -18.763 72.938  1.00 86.80  ? 33  GLU E CG  1 
ATOM   4199 C  CD  . GLU E 2 33  ? 11.354  -18.374 71.969  1.00 91.73  ? 33  GLU E CD  1 
ATOM   4200 O  OE1 . GLU E 2 33  ? 11.374  -17.210 71.514  1.00 95.32  ? 33  GLU E OE1 1 
ATOM   4201 O  OE2 . GLU E 2 33  ? 12.204  -19.235 71.660  1.00 93.02  ? 33  GLU E OE2 1 
ATOM   4202 N  N   . PRO E 2 34  ? 10.232  -14.555 74.814  1.00 63.13  ? 34  PRO E N   1 
ATOM   4203 C  CA  . PRO E 2 34  ? 9.543   -13.370 75.330  1.00 58.21  ? 34  PRO E CA  1 
ATOM   4204 C  C   . PRO E 2 34  ? 8.038   -13.563 75.241  1.00 53.81  ? 34  PRO E C   1 
ATOM   4205 O  O   . PRO E 2 34  ? 7.557   -14.225 74.323  1.00 54.84  ? 34  PRO E O   1 
ATOM   4206 C  CB  . PRO E 2 34  ? 9.993   -12.257 74.379  1.00 61.45  ? 34  PRO E CB  1 
ATOM   4207 C  CG  . PRO E 2 34  ? 10.471  -12.965 73.146  1.00 63.99  ? 34  PRO E CG  1 
ATOM   4208 C  CD  . PRO E 2 34  ? 11.063  -14.246 73.639  1.00 63.49  ? 34  PRO E CD  1 
ATOM   4209 N  N   . TYR E 2 35  ? 7.306   -13.002 76.194  1.00 52.61  ? 35  TYR E N   1 
ATOM   4210 C  CA  . TYR E 2 35  ? 5.864   -13.182 76.233  1.00 54.54  ? 35  TYR E CA  1 
ATOM   4211 C  C   . TYR E 2 35  ? 5.157   -11.849 76.046  1.00 53.66  ? 35  TYR E C   1 
ATOM   4212 O  O   . TYR E 2 35  ? 5.390   -10.907 76.800  1.00 59.43  ? 35  TYR E O   1 
ATOM   4213 C  CB  . TYR E 2 35  ? 5.442   -13.828 77.555  1.00 58.83  ? 35  TYR E CB  1 
ATOM   4214 C  CG  . TYR E 2 35  ? 3.998   -14.268 77.577  1.00 62.72  ? 35  TYR E CG  1 
ATOM   4215 C  CD1 . TYR E 2 35  ? 2.996   -13.405 77.996  1.00 60.20  ? 35  TYR E CD1 1 
ATOM   4216 C  CD2 . TYR E 2 35  ? 3.636   -15.545 77.169  1.00 68.20  ? 35  TYR E CD2 1 
ATOM   4217 C  CE1 . TYR E 2 35  ? 1.674   -13.801 78.011  1.00 61.64  ? 35  TYR E CE1 1 
ATOM   4218 C  CE2 . TYR E 2 35  ? 2.314   -15.951 77.182  1.00 67.84  ? 35  TYR E CE2 1 
ATOM   4219 C  CZ  . TYR E 2 35  ? 1.339   -15.074 77.604  1.00 64.80  ? 35  TYR E CZ  1 
ATOM   4220 O  OH  . TYR E 2 35  ? 0.024   -15.471 77.618  1.00 66.24  ? 35  TYR E OH  1 
ATOM   4221 N  N   . TYR E 2 36  ? 4.294   -11.772 75.037  1.00 48.96  ? 36  TYR E N   1 
ATOM   4222 C  CA  . TYR E 2 36  ? 3.571   -10.537 74.749  1.00 47.96  ? 36  TYR E CA  1 
ATOM   4223 C  C   . TYR E 2 36  ? 2.170   -10.552 75.345  1.00 53.01  ? 36  TYR E C   1 
ATOM   4224 O  O   . TYR E 2 36  ? 1.480   -11.575 75.313  1.00 51.44  ? 36  TYR E O   1 
ATOM   4225 C  CB  . TYR E 2 36  ? 3.496   -10.281 73.243  1.00 45.38  ? 36  TYR E CB  1 
ATOM   4226 C  CG  . TYR E 2 36  ? 4.829   -9.958  72.606  1.00 51.06  ? 36  TYR E CG  1 
ATOM   4227 C  CD1 . TYR E 2 36  ? 5.627   -10.962 72.067  1.00 51.48  ? 36  TYR E CD1 1 
ATOM   4228 C  CD2 . TYR E 2 36  ? 5.291   -8.649  72.540  1.00 52.71  ? 36  TYR E CD2 1 
ATOM   4229 C  CE1 . TYR E 2 36  ? 6.846   -10.672 71.481  1.00 51.99  ? 36  TYR E CE1 1 
ATOM   4230 C  CE2 . TYR E 2 36  ? 6.510   -8.350  71.956  1.00 55.48  ? 36  TYR E CE2 1 
ATOM   4231 C  CZ  . TYR E 2 36  ? 7.283   -9.366  71.428  1.00 54.84  ? 36  TYR E CZ  1 
ATOM   4232 O  OH  . TYR E 2 36  ? 8.495   -9.074  70.848  1.00 55.07  ? 36  TYR E OH  1 
ATOM   4233 N  N   . LEU E 2 37  ? 1.750   -9.403  75.872  1.00 51.80  ? 37  LEU E N   1 
ATOM   4234 C  CA  . LEU E 2 37  ? 0.466   -9.296  76.546  1.00 47.03  ? 37  LEU E CA  1 
ATOM   4235 C  C   . LEU E 2 37  ? -0.055  -7.862  76.528  1.00 48.10  ? 37  LEU E C   1 
ATOM   4236 O  O   . LEU E 2 37  ? 0.716   -6.918  76.686  1.00 52.83  ? 37  LEU E O   1 
ATOM   4237 C  CB  . LEU E 2 37  ? 0.603   -9.789  77.986  1.00 47.59  ? 37  LEU E CB  1 
ATOM   4238 C  CG  . LEU E 2 37  ? -0.673  -9.882  78.819  1.00 47.45  ? 37  LEU E CG  1 
ATOM   4239 C  CD1 . LEU E 2 37  ? -1.668  -10.813 78.152  1.00 45.34  ? 37  LEU E CD1 1 
ATOM   4240 C  CD2 . LEU E 2 37  ? -0.351  -10.350 80.230  1.00 44.96  ? 37  LEU E CD2 1 
ATOM   4241 N  N   . LEU E 2 38  ? -1.361  -7.705  76.326  1.00 46.79  ? 38  LEU E N   1 
ATOM   4242 C  CA  . LEU E 2 38  ? -2.014  -6.401  76.418  1.00 44.46  ? 38  LEU E CA  1 
ATOM   4243 C  C   . LEU E 2 38  ? -2.452  -6.118  77.853  1.00 49.45  ? 38  LEU E C   1 
ATOM   4244 O  O   . LEU E 2 38  ? -3.494  -6.605  78.295  1.00 50.81  ? 38  LEU E O   1 
ATOM   4245 C  CB  . LEU E 2 38  ? -3.244  -6.344  75.509  1.00 40.02  ? 38  LEU E CB  1 
ATOM   4246 C  CG  . LEU E 2 38  ? -3.105  -5.984  74.031  1.00 42.84  ? 38  LEU E CG  1 
ATOM   4247 C  CD1 . LEU E 2 38  ? -4.482  -5.827  73.424  1.00 42.57  ? 38  LEU E CD1 1 
ATOM   4248 C  CD2 . LEU E 2 38  ? -2.304  -4.710  73.846  1.00 46.98  ? 38  LEU E CD2 1 
ATOM   4249 N  N   . LEU E 2 39  ? -1.664  -5.325  78.573  1.00 52.62  ? 39  LEU E N   1 
ATOM   4250 C  CA  . LEU E 2 39  ? -1.949  -5.015  79.975  1.00 50.61  ? 39  LEU E CA  1 
ATOM   4251 C  C   . LEU E 2 39  ? -3.020  -3.933  80.122  1.00 51.22  ? 39  LEU E C   1 
ATOM   4252 O  O   . LEU E 2 39  ? -2.949  -2.891  79.473  1.00 50.30  ? 39  LEU E O   1 
ATOM   4253 C  CB  . LEU E 2 39  ? -0.674  -4.558  80.691  1.00 47.43  ? 39  LEU E CB  1 
ATOM   4254 C  CG  . LEU E 2 39  ? 0.510   -5.520  80.748  1.00 47.79  ? 39  LEU E CG  1 
ATOM   4255 C  CD1 . LEU E 2 39  ? 1.655   -4.888  81.515  1.00 47.94  ? 39  LEU E CD1 1 
ATOM   4256 C  CD2 . LEU E 2 39  ? 0.100   -6.829  81.391  1.00 52.66  ? 39  LEU E CD2 1 
ATOM   4257 N  N   . PRO E 2 40  ? -4.014  -4.177  80.989  1.00 51.00  ? 40  PRO E N   1 
ATOM   4258 C  CA  . PRO E 2 40  ? -5.049  -3.178  81.279  1.00 50.51  ? 40  PRO E CA  1 
ATOM   4259 C  C   . PRO E 2 40  ? -4.484  -1.998  82.072  1.00 51.33  ? 40  PRO E C   1 
ATOM   4260 O  O   . PRO E 2 40  ? -3.856  -2.203  83.110  1.00 52.27  ? 40  PRO E O   1 
ATOM   4261 C  CB  . PRO E 2 40  ? -6.054  -3.953  82.141  1.00 53.08  ? 40  PRO E CB  1 
ATOM   4262 C  CG  . PRO E 2 40  ? -5.733  -5.403  81.919  1.00 52.17  ? 40  PRO E CG  1 
ATOM   4263 C  CD  . PRO E 2 40  ? -4.265  -5.451  81.680  1.00 49.41  ? 40  PRO E CD  1 
ATOM   4264 N  N   . ARG E 2 41  ? -4.704  -0.782  81.581  1.00 50.63  ? 41  ARG E N   1 
ATOM   4265 C  CA  . ARG E 2 41  ? -4.233  0.426   82.253  1.00 48.26  ? 41  ARG E CA  1 
ATOM   4266 C  C   . ARG E 2 41  ? -4.750  0.543   83.686  1.00 47.50  ? 41  ARG E C   1 
ATOM   4267 O  O   . ARG E 2 41  ? -4.011  0.927   84.595  1.00 46.84  ? 41  ARG E O   1 
ATOM   4268 C  CB  . ARG E 2 41  ? -4.650  1.674   81.465  1.00 50.54  ? 41  ARG E CB  1 
ATOM   4269 C  CG  . ARG E 2 41  ? -3.740  2.038   80.296  1.00 52.15  ? 41  ARG E CG  1 
ATOM   4270 C  CD  . ARG E 2 41  ? -4.244  3.291   79.575  1.00 51.45  ? 41  ARG E CD  1 
ATOM   4271 N  NE  . ARG E 2 41  ? -3.271  3.821   78.622  1.00 46.60  ? 41  ARG E NE  1 
ATOM   4272 C  CZ  . ARG E 2 41  ? -2.247  4.601   78.959  1.00 43.19  ? 41  ARG E CZ  1 
ATOM   4273 N  NH1 . ARG E 2 41  ? -2.057  4.941   80.227  1.00 39.93  ? 41  ARG E NH1 1 
ATOM   4274 N  NH2 . ARG E 2 41  ? -1.408  5.039   78.030  1.00 42.44  ? 41  ARG E NH2 1 
ATOM   4275 N  N   . VAL E 2 42  ? -6.018  0.199   83.880  1.00 45.15  ? 42  VAL E N   1 
ATOM   4276 C  CA  . VAL E 2 42  ? -6.713  0.492   85.127  1.00 42.31  ? 42  VAL E CA  1 
ATOM   4277 C  C   . VAL E 2 42  ? -6.452  -0.515  86.242  1.00 45.01  ? 42  VAL E C   1 
ATOM   4278 O  O   . VAL E 2 42  ? -6.964  -0.362  87.352  1.00 45.82  ? 42  VAL E O   1 
ATOM   4279 C  CB  . VAL E 2 42  ? -8.226  0.567   84.897  1.00 47.92  ? 42  VAL E CB  1 
ATOM   4280 C  CG1 . VAL E 2 42  ? -8.551  1.627   83.854  1.00 47.81  ? 42  VAL E CG1 1 
ATOM   4281 C  CG2 . VAL E 2 42  ? -8.771  -0.793  84.484  1.00 52.84  ? 42  VAL E CG2 1 
ATOM   4282 N  N   . SER E 2 43  ? -5.650  -1.535  85.951  1.00 46.06  ? 43  SER E N   1 
ATOM   4283 C  CA  . SER E 2 43  ? -5.448  -2.643  86.879  1.00 43.75  ? 43  SER E CA  1 
ATOM   4284 C  C   . SER E 2 43  ? -4.009  -2.718  87.402  1.00 46.66  ? 43  SER E C   1 
ATOM   4285 O  O   . SER E 2 43  ? -3.252  -1.750  87.306  1.00 49.31  ? 43  SER E O   1 
ATOM   4286 C  CB  . SER E 2 43  ? -5.845  -3.959  86.211  1.00 44.23  ? 43  SER E CB  1 
ATOM   4287 O  OG  . SER E 2 43  ? -5.784  -5.036  87.124  1.00 50.04  ? 43  SER E OG  1 
ATOM   4288 N  N   . TYR E 2 44  ? -3.635  -3.872  87.949  1.00 43.41  ? 44  TYR E N   1 
ATOM   4289 C  CA  . TYR E 2 44  ? -2.352  -4.019  88.632  1.00 44.13  ? 44  TYR E CA  1 
ATOM   4290 C  C   . TYR E 2 44  ? -1.565  -5.207  88.098  1.00 47.93  ? 44  TYR E C   1 
ATOM   4291 O  O   . TYR E 2 44  ? -2.147  -6.234  87.757  1.00 55.86  ? 44  TYR E O   1 
ATOM   4292 C  CB  . TYR E 2 44  ? -2.575  -4.170  90.137  1.00 48.57  ? 44  TYR E CB  1 
ATOM   4293 C  CG  . TYR E 2 44  ? -3.400  -3.049  90.733  1.00 54.44  ? 44  TYR E CG  1 
ATOM   4294 C  CD1 . TYR E 2 44  ? -2.800  -1.871  91.159  1.00 55.02  ? 44  TYR E CD1 1 
ATOM   4295 C  CD2 . TYR E 2 44  ? -4.780  -3.165  90.859  1.00 55.46  ? 44  TYR E CD2 1 
ATOM   4296 C  CE1 . TYR E 2 44  ? -3.549  -0.841  91.698  1.00 57.85  ? 44  TYR E CE1 1 
ATOM   4297 C  CE2 . TYR E 2 44  ? -5.537  -2.139  91.393  1.00 55.90  ? 44  TYR E CE2 1 
ATOM   4298 C  CZ  . TYR E 2 44  ? -4.917  -0.981  91.813  1.00 59.52  ? 44  TYR E CZ  1 
ATOM   4299 O  OH  . TYR E 2 44  ? -5.664  0.043   92.348  1.00 62.41  ? 44  TYR E OH  1 
ATOM   4300 N  N   . LEU E 2 45  ? -0.243  -5.062  88.031  1.00 45.60  ? 45  LEU E N   1 
ATOM   4301 C  CA  . LEU E 2 45  ? 0.628   -6.078  87.440  1.00 48.02  ? 45  LEU E CA  1 
ATOM   4302 C  C   . LEU E 2 45  ? 0.434   -7.470  88.053  1.00 51.31  ? 45  LEU E C   1 
ATOM   4303 O  O   . LEU E 2 45  ? 0.316   -8.469  87.339  1.00 46.98  ? 45  LEU E O   1 
ATOM   4304 C  CB  . LEU E 2 45  ? 2.097   -5.658  87.556  1.00 47.68  ? 45  LEU E CB  1 
ATOM   4305 C  CG  . LEU E 2 45  ? 2.584   -4.520  86.652  1.00 48.99  ? 45  LEU E CG  1 
ATOM   4306 C  CD1 . LEU E 2 45  ? 4.021   -4.139  86.985  1.00 43.76  ? 45  LEU E CD1 1 
ATOM   4307 C  CD2 . LEU E 2 45  ? 2.460   -4.900  85.185  1.00 47.76  ? 45  LEU E CD2 1 
ATOM   4308 N  N   . THR E 2 46  ? 0.386   -7.524  89.377  1.00 50.95  ? 46  THR E N   1 
ATOM   4309 C  CA  . THR E 2 46  ? 0.266   -8.789  90.089  1.00 51.24  ? 46  THR E CA  1 
ATOM   4310 C  C   . THR E 2 46  ? -1.154  -9.358  90.064  1.00 54.68  ? 46  THR E C   1 
ATOM   4311 O  O   . THR E 2 46  ? -1.435  -10.365 90.710  1.00 60.50  ? 46  THR E O   1 
ATOM   4312 C  CB  . THR E 2 46  ? 0.726   -8.641  91.551  1.00 52.38  ? 46  THR E CB  1 
ATOM   4313 O  OG1 . THR E 2 46  ? 0.030   -7.546  92.158  1.00 53.01  ? 46  THR E OG1 1 
ATOM   4314 C  CG2 . THR E 2 46  ? 2.228   -8.375  91.618  1.00 46.95  ? 46  THR E CG2 1 
ATOM   4315 N  N   . LEU E 2 47  ? -2.044  -8.719  89.311  1.00 56.45  ? 47  LEU E N   1 
ATOM   4316 C  CA  . LEU E 2 47  ? -3.430  -9.166  89.219  1.00 58.54  ? 47  LEU E CA  1 
ATOM   4317 C  C   . LEU E 2 47  ? -3.754  -9.727  87.834  1.00 59.24  ? 47  LEU E C   1 
ATOM   4318 O  O   . LEU E 2 47  ? -4.677  -10.526 87.674  1.00 58.19  ? 47  LEU E O   1 
ATOM   4319 C  CB  . LEU E 2 47  ? -4.379  -8.008  89.544  1.00 56.43  ? 47  LEU E CB  1 
ATOM   4320 C  CG  . LEU E 2 47  ? -5.879  -8.310  89.580  1.00 57.71  ? 47  LEU E CG  1 
ATOM   4321 C  CD1 . LEU E 2 47  ? -6.180  -9.393  90.607  1.00 59.11  ? 47  LEU E CD1 1 
ATOM   4322 C  CD2 . LEU E 2 47  ? -6.687  -7.050  89.864  1.00 56.39  ? 47  LEU E CD2 1 
ATOM   4323 N  N   . VAL E 2 48  ? -2.981  -9.310  86.836  1.00 57.99  ? 48  VAL E N   1 
ATOM   4324 C  CA  . VAL E 2 48  ? -3.310  -9.606  85.447  1.00 53.77  ? 48  VAL E CA  1 
ATOM   4325 C  C   . VAL E 2 48  ? -2.229  -10.405 84.729  1.00 55.76  ? 48  VAL E C   1 
ATOM   4326 O  O   . VAL E 2 48  ? -2.322  -10.632 83.522  1.00 59.41  ? 48  VAL E O   1 
ATOM   4327 C  CB  . VAL E 2 48  ? -3.556  -8.306  84.648  1.00 48.10  ? 48  VAL E CB  1 
ATOM   4328 C  CG1 . VAL E 2 48  ? -4.665  -7.487  85.287  1.00 46.76  ? 48  VAL E CG1 1 
ATOM   4329 C  CG2 . VAL E 2 48  ? -2.277  -7.490  84.557  1.00 43.02  ? 48  VAL E CG2 1 
ATOM   4330 N  N   . THR E 2 49  ? -1.208  -10.835 85.461  1.00 54.41  ? 49  THR E N   1 
ATOM   4331 C  CA  . THR E 2 49  ? -0.078  -11.500 84.823  1.00 54.28  ? 49  THR E CA  1 
ATOM   4332 C  C   . THR E 2 49  ? 0.113   -12.960 85.224  1.00 53.79  ? 49  THR E C   1 
ATOM   4333 O  O   . THR E 2 49  ? 1.240   -13.458 85.226  1.00 52.20  ? 49  THR E O   1 
ATOM   4334 C  CB  . THR E 2 49  ? 1.238   -10.741 85.069  1.00 55.96  ? 49  THR E CB  1 
ATOM   4335 O  OG1 . THR E 2 49  ? 1.410   -10.520 86.474  1.00 59.59  ? 49  THR E OG1 1 
ATOM   4336 C  CG2 . THR E 2 49  ? 1.225   -9.407  84.343  1.00 52.41  ? 49  THR E CG2 1 
ATOM   4337 N  N   . ASP E 2 50  ? -0.979  -13.648 85.545  1.00 49.08  ? 50  ASP E N   1 
ATOM   4338 C  CA  . ASP E 2 50  ? -0.902  -15.072 85.860  1.00 54.14  ? 50  ASP E CA  1 
ATOM   4339 C  C   . ASP E 2 50  ? -0.299  -15.876 84.705  1.00 56.44  ? 50  ASP E C   1 
ATOM   4340 O  O   . ASP E 2 50  ? 0.613   -16.673 84.913  1.00 56.14  ? 50  ASP E O   1 
ATOM   4341 C  CB  . ASP E 2 50  ? -2.274  -15.631 86.252  1.00 58.36  ? 50  ASP E CB  1 
ATOM   4342 C  CG  . ASP E 2 50  ? -2.676  -15.260 87.673  1.00 68.82  ? 50  ASP E CG  1 
ATOM   4343 O  OD1 . ASP E 2 50  ? -1.783  -14.958 88.496  1.00 74.26  ? 50  ASP E OD1 1 
ATOM   4344 O  OD2 . ASP E 2 50  ? -3.890  -15.282 87.974  1.00 70.11  ? 50  ASP E OD2 1 
ATOM   4345 N  N   . LYS E 2 51  ? -0.795  -15.647 83.491  1.00 60.63  ? 51  LYS E N   1 
ATOM   4346 C  CA  . LYS E 2 51  ? -0.294  -16.349 82.305  1.00 59.59  ? 51  LYS E CA  1 
ATOM   4347 C  C   . LYS E 2 51  ? 1.191   -16.100 82.037  1.00 63.30  ? 51  LYS E C   1 
ATOM   4348 O  O   . LYS E 2 51  ? 1.877   -16.959 81.482  1.00 68.13  ? 51  LYS E O   1 
ATOM   4349 C  CB  . LYS E 2 51  ? -1.109  -15.979 81.063  1.00 51.51  ? 51  LYS E CB  1 
ATOM   4350 C  CG  . LYS E 2 51  ? -2.514  -16.546 81.044  1.00 51.70  ? 51  LYS E CG  1 
ATOM   4351 C  CD  . LYS E 2 51  ? -3.208  -16.219 79.736  1.00 56.79  ? 51  LYS E CD  1 
ATOM   4352 C  CE  . LYS E 2 51  ? -4.600  -16.820 79.672  1.00 62.80  ? 51  LYS E CE  1 
ATOM   4353 N  NZ  . LYS E 2 51  ? -5.239  -16.567 78.350  1.00 67.05  ? 51  LYS E NZ  1 
ATOM   4354 N  N   . VAL E 2 52  ? 1.682   -14.926 82.421  1.00 60.79  ? 52  VAL E N   1 
ATOM   4355 C  CA  . VAL E 2 52  ? 3.097   -14.609 82.265  1.00 59.30  ? 52  VAL E CA  1 
ATOM   4356 C  C   . VAL E 2 52  ? 3.937   -15.431 83.239  1.00 60.96  ? 52  VAL E C   1 
ATOM   4357 O  O   . VAL E 2 52  ? 4.969   -15.994 82.868  1.00 55.03  ? 52  VAL E O   1 
ATOM   4358 C  CB  . VAL E 2 52  ? 3.370   -13.109 82.492  1.00 54.99  ? 52  VAL E CB  1 
ATOM   4359 C  CG1 . VAL E 2 52  ? 4.864   -12.818 82.436  1.00 51.11  ? 52  VAL E CG1 1 
ATOM   4360 C  CG2 . VAL E 2 52  ? 2.620   -12.275 81.465  1.00 52.69  ? 52  VAL E CG2 1 
ATOM   4361 N  N   . LYS E 2 53  ? 3.478   -15.495 84.486  1.00 67.79  ? 53  LYS E N   1 
ATOM   4362 C  CA  . LYS E 2 53  ? 4.174   -16.230 85.536  1.00 70.15  ? 53  LYS E CA  1 
ATOM   4363 C  C   . LYS E 2 53  ? 4.264   -17.712 85.189  1.00 72.97  ? 53  LYS E C   1 
ATOM   4364 O  O   . LYS E 2 53  ? 5.315   -18.332 85.342  1.00 76.09  ? 53  LYS E O   1 
ATOM   4365 C  CB  . LYS E 2 53  ? 3.470   -16.030 86.883  1.00 71.59  ? 53  LYS E CB  1 
ATOM   4366 C  CG  . LYS E 2 53  ? 4.133   -16.736 88.062  1.00 73.67  ? 53  LYS E CG  1 
ATOM   4367 C  CD  . LYS E 2 53  ? 3.537   -16.275 89.390  1.00 72.46  ? 53  LYS E CD  1 
ATOM   4368 C  CE  . LYS E 2 53  ? 2.020   -16.411 89.403  1.00 75.35  ? 53  LYS E CE  1 
ATOM   4369 N  NZ  . LYS E 2 53  ? 1.405   -15.818 90.625  1.00 76.76  ? 53  LYS E NZ  1 
ATOM   4370 N  N   . LYS E 2 54  ? 3.157   -18.269 84.708  1.00 72.78  ? 54  LYS E N   1 
ATOM   4371 C  CA  . LYS E 2 54  ? 3.124   -19.662 84.285  1.00 72.78  ? 54  LYS E CA  1 
ATOM   4372 C  C   . LYS E 2 54  ? 4.089   -19.898 83.128  1.00 72.56  ? 54  LYS E C   1 
ATOM   4373 O  O   . LYS E 2 54  ? 4.763   -20.924 83.076  1.00 76.85  ? 54  LYS E O   1 
ATOM   4374 C  CB  . LYS E 2 54  ? 1.703   -20.065 83.882  1.00 74.88  ? 54  LYS E CB  1 
ATOM   4375 C  CG  . LYS E 2 54  ? 1.542   -21.539 83.536  1.00 82.55  ? 54  LYS E CG  1 
ATOM   4376 C  CD  . LYS E 2 54  ? 0.098   -21.865 83.171  1.00 87.66  ? 54  LYS E CD  1 
ATOM   4377 C  CE  . LYS E 2 54  ? -0.078  -23.339 82.831  1.00 88.87  ? 54  LYS E CE  1 
ATOM   4378 N  NZ  . LYS E 2 54  ? -1.489  -23.658 82.470  1.00 87.13  ? 54  LYS E NZ  1 
ATOM   4379 N  N   . HIS E 2 55  ? 4.157   -18.935 82.211  1.00 69.87  ? 55  HIS E N   1 
ATOM   4380 C  CA  . HIS E 2 55  ? 5.006   -19.043 81.024  1.00 64.03  ? 55  HIS E CA  1 
ATOM   4381 C  C   . HIS E 2 55  ? 6.486   -19.235 81.357  1.00 66.88  ? 55  HIS E C   1 
ATOM   4382 O  O   . HIS E 2 55  ? 7.126   -20.152 80.846  1.00 69.96  ? 55  HIS E O   1 
ATOM   4383 C  CB  . HIS E 2 55  ? 4.832   -17.816 80.122  1.00 53.15  ? 55  HIS E CB  1 
ATOM   4384 C  CG  . HIS E 2 55  ? 5.761   -17.794 78.947  1.00 52.10  ? 55  HIS E CG  1 
ATOM   4385 N  ND1 . HIS E 2 55  ? 5.455   -18.393 77.744  1.00 53.34  ? 55  HIS E ND1 1 
ATOM   4386 C  CD2 . HIS E 2 55  ? 6.990   -17.246 78.792  1.00 51.26  ? 55  HIS E CD2 1 
ATOM   4387 C  CE1 . HIS E 2 55  ? 6.453   -18.212 76.897  1.00 51.57  ? 55  HIS E CE1 1 
ATOM   4388 N  NE2 . HIS E 2 55  ? 7.397   -17.519 77.508  1.00 49.58  ? 55  HIS E NE2 1 
ATOM   4389 N  N   . PHE E 2 56  ? 7.025   -18.374 82.214  1.00 66.80  ? 56  PHE E N   1 
ATOM   4390 C  CA  . PHE E 2 56  ? 8.450   -18.414 82.528  1.00 69.10  ? 56  PHE E CA  1 
ATOM   4391 C  C   . PHE E 2 56  ? 8.809   -19.439 83.599  1.00 77.97  ? 56  PHE E C   1 
ATOM   4392 O  O   . PHE E 2 56  ? 9.988   -19.686 83.855  1.00 81.32  ? 56  PHE E O   1 
ATOM   4393 C  CB  . PHE E 2 56  ? 8.952   -17.029 82.940  1.00 65.24  ? 56  PHE E CB  1 
ATOM   4394 C  CG  . PHE E 2 56  ? 8.956   -16.033 81.821  1.00 58.58  ? 56  PHE E CG  1 
ATOM   4395 C  CD1 . PHE E 2 56  ? 9.894   -16.118 80.807  1.00 57.29  ? 56  PHE E CD1 1 
ATOM   4396 C  CD2 . PHE E 2 56  ? 8.029   -15.010 81.785  1.00 57.00  ? 56  PHE E CD2 1 
ATOM   4397 C  CE1 . PHE E 2 56  ? 9.904   -15.206 79.774  1.00 56.93  ? 56  PHE E CE1 1 
ATOM   4398 C  CE2 . PHE E 2 56  ? 8.034   -14.091 80.753  1.00 59.59  ? 56  PHE E CE2 1 
ATOM   4399 C  CZ  . PHE E 2 56  ? 8.974   -14.190 79.746  1.00 56.50  ? 56  PHE E CZ  1 
ATOM   4400 N  N   . GLN E 2 57  ? 7.799   -20.033 84.226  1.00 82.75  ? 57  GLN E N   1 
ATOM   4401 C  CA  . GLN E 2 57  ? 8.041   -21.056 85.240  1.00 85.93  ? 57  GLN E CA  1 
ATOM   4402 C  C   . GLN E 2 57  ? 8.151   -22.451 84.633  1.00 86.73  ? 57  GLN E C   1 
ATOM   4403 O  O   . GLN E 2 57  ? 8.593   -23.387 85.295  1.00 89.33  ? 57  GLN E O   1 
ATOM   4404 C  CB  . GLN E 2 57  ? 6.962   -21.026 86.326  1.00 86.25  ? 57  GLN E CB  1 
ATOM   4405 C  CG  . GLN E 2 57  ? 7.194   -19.968 87.398  1.00 85.78  ? 57  GLN E CG  1 
ATOM   4406 C  CD  . GLN E 2 57  ? 6.083   -19.924 88.432  1.00 84.01  ? 57  GLN E CD  1 
ATOM   4407 O  OE1 . GLN E 2 57  ? 5.062   -20.598 88.294  1.00 82.11  ? 57  GLN E OE1 1 
ATOM   4408 N  NE2 . GLN E 2 57  ? 6.278   -19.126 89.475  1.00 84.60  ? 57  GLN E NE2 1 
ATOM   4409 N  N   . LYS E 2 58  ? 7.751   -22.583 83.371  1.00 86.00  ? 58  LYS E N   1 
ATOM   4410 C  CA  . LYS E 2 58  ? 7.860   -23.856 82.668  1.00 88.14  ? 58  LYS E CA  1 
ATOM   4411 C  C   . LYS E 2 58  ? 9.321   -24.232 82.476  1.00 92.87  ? 58  LYS E C   1 
ATOM   4412 O  O   . LYS E 2 58  ? 9.665   -25.412 82.411  1.00 98.55  ? 58  LYS E O   1 
ATOM   4413 C  CB  . LYS E 2 58  ? 7.163   -23.785 81.309  1.00 87.85  ? 58  LYS E CB  1 
ATOM   4414 C  CG  . LYS E 2 58  ? 5.664   -23.562 81.387  1.00 92.08  ? 58  LYS E CG  1 
ATOM   4415 C  CD  . LYS E 2 58  ? 5.036   -23.539 80.000  1.00 96.47  ? 58  LYS E CD  1 
ATOM   4416 C  CE  . LYS E 2 58  ? 3.559   -23.174 80.066  1.00 99.56  ? 58  LYS E CE  1 
ATOM   4417 N  NZ  . LYS E 2 58  ? 2.801   -24.068 80.989  1.00 102.60 ? 58  LYS E NZ  1 
ATOM   4418 N  N   . VAL E 2 59  ? 10.177  -23.219 82.393  1.00 91.92  ? 59  VAL E N   1 
ATOM   4419 C  CA  . VAL E 2 59  ? 11.596  -23.427 82.137  1.00 93.76  ? 59  VAL E CA  1 
ATOM   4420 C  C   . VAL E 2 59  ? 12.430  -23.373 83.415  1.00 96.82  ? 59  VAL E C   1 
ATOM   4421 O  O   . VAL E 2 59  ? 13.655  -23.288 83.358  1.00 98.78  ? 59  VAL E O   1 
ATOM   4422 C  CB  . VAL E 2 59  ? 12.142  -22.377 81.150  1.00 93.58  ? 59  VAL E CB  1 
ATOM   4423 C  CG1 . VAL E 2 59  ? 11.348  -22.406 79.858  1.00 92.49  ? 59  VAL E CG1 1 
ATOM   4424 C  CG2 . VAL E 2 59  ? 12.093  -20.989 81.770  1.00 92.16  ? 59  VAL E CG2 1 
ATOM   4425 N  N   . MET E 2 60  ? 11.769  -23.430 84.566  1.00 98.01  ? 60  MET E N   1 
ATOM   4426 C  CA  . MET E 2 60  ? 12.476  -23.319 85.838  1.00 100.23 ? 60  MET E CA  1 
ATOM   4427 C  C   . MET E 2 60  ? 12.205  -24.475 86.797  1.00 101.26 ? 60  MET E C   1 
ATOM   4428 O  O   . MET E 2 60  ? 11.140  -25.092 86.767  1.00 96.67  ? 60  MET E O   1 
ATOM   4429 C  CB  . MET E 2 60  ? 12.145  -21.989 86.521  1.00 101.18 ? 60  MET E CB  1 
ATOM   4430 C  CG  . MET E 2 60  ? 12.639  -20.766 85.770  1.00 101.24 ? 60  MET E CG  1 
ATOM   4431 S  SD  . MET E 2 60  ? 12.274  -19.226 86.633  1.00 91.47  ? 60  MET E SD  1 
ATOM   4432 C  CE  . MET E 2 60  ? 13.241  -19.425 88.127  1.00 70.30  ? 60  MET E CE  1 
ATOM   4433 N  N   . ARG E 2 61  ? 13.187  -24.757 87.648  1.00 106.70 ? 61  ARG E N   1 
ATOM   4434 C  CA  . ARG E 2 61  ? 13.037  -25.747 88.704  1.00 114.02 ? 61  ARG E CA  1 
ATOM   4435 C  C   . ARG E 2 61  ? 12.165  -25.164 89.809  1.00 113.94 ? 61  ARG E C   1 
ATOM   4436 O  O   . ARG E 2 61  ? 12.117  -23.949 89.991  1.00 112.07 ? 61  ARG E O   1 
ATOM   4437 C  CB  . ARG E 2 61  ? 14.407  -26.131 89.268  1.00 120.74 ? 61  ARG E CB  1 
ATOM   4438 C  CG  . ARG E 2 61  ? 15.415  -26.583 88.220  1.00 124.52 ? 61  ARG E CG  1 
ATOM   4439 C  CD  . ARG E 2 61  ? 15.234  -28.049 87.854  1.00 129.11 ? 61  ARG E CD  1 
ATOM   4440 N  NE  . ARG E 2 61  ? 15.632  -28.938 88.944  1.00 133.60 ? 61  ARG E NE  1 
ATOM   4441 C  CZ  . ARG E 2 61  ? 15.697  -30.262 88.844  1.00 135.37 ? 61  ARG E CZ  1 
ATOM   4442 N  NH1 . ARG E 2 61  ? 15.391  -30.859 87.700  1.00 135.18 ? 61  ARG E NH1 1 
ATOM   4443 N  NH2 . ARG E 2 61  ? 16.071  -30.990 89.888  1.00 136.51 ? 61  ARG E NH2 1 
ATOM   4444 N  N   . GLN E 2 62  ? 11.481  -26.033 90.549  1.00 115.99 ? 62  GLN E N   1 
ATOM   4445 C  CA  . GLN E 2 62  ? 10.589  -25.601 91.623  1.00 114.35 ? 62  GLN E CA  1 
ATOM   4446 C  C   . GLN E 2 62  ? 11.362  -24.913 92.747  1.00 111.09 ? 62  GLN E C   1 
ATOM   4447 O  O   . GLN E 2 62  ? 10.811  -24.103 93.493  1.00 108.82 ? 62  GLN E O   1 
ATOM   4448 C  CB  . GLN E 2 62  ? 9.810   -26.797 92.177  1.00 117.08 ? 62  GLN E CB  1 
ATOM   4449 C  CG  . GLN E 2 62  ? 8.646   -26.427 93.084  1.00 118.19 ? 62  GLN E CG  1 
ATOM   4450 C  CD  . GLN E 2 62  ? 7.471   -25.844 92.321  1.00 117.58 ? 62  GLN E CD  1 
ATOM   4451 O  OE1 . GLN E 2 62  ? 7.411   -25.922 91.093  1.00 116.85 ? 62  GLN E OE1 1 
ATOM   4452 N  NE2 . GLN E 2 62  ? 6.526   -25.257 93.048  1.00 116.46 ? 62  GLN E NE2 1 
ATOM   4453 N  N   . GLU E 2 63  ? 12.644  -25.244 92.853  1.00 110.60 ? 63  GLU E N   1 
ATOM   4454 C  CA  . GLU E 2 63  ? 13.515  -24.697 93.885  1.00 110.27 ? 63  GLU E CA  1 
ATOM   4455 C  C   . GLU E 2 63  ? 13.987  -23.290 93.532  1.00 108.00 ? 63  GLU E C   1 
ATOM   4456 O  O   . GLU E 2 63  ? 14.417  -22.531 94.401  1.00 106.18 ? 63  GLU E O   1 
ATOM   4457 C  CB  . GLU E 2 63  ? 14.723  -25.612 94.062  1.00 111.76 ? 63  GLU E CB  1 
ATOM   4458 C  CG  . GLU E 2 63  ? 15.475  -25.854 92.765  1.00 112.57 ? 63  GLU E CG  1 
ATOM   4459 C  CD  . GLU E 2 63  ? 16.289  -27.127 92.784  1.00 115.20 ? 63  GLU E CD  1 
ATOM   4460 O  OE1 . GLU E 2 63  ? 16.579  -27.658 91.692  1.00 115.45 ? 63  GLU E OE1 1 
ATOM   4461 O  OE2 . GLU E 2 63  ? 16.637  -27.597 93.887  1.00 117.97 ? 63  GLU E OE2 1 
ATOM   4462 N  N   . ASP E 2 64  ? 13.906  -22.949 92.250  1.00 107.04 ? 64  ASP E N   1 
ATOM   4463 C  CA  . ASP E 2 64  ? 14.413  -21.671 91.760  1.00 103.76 ? 64  ASP E CA  1 
ATOM   4464 C  C   . ASP E 2 64  ? 13.341  -20.587 91.723  1.00 101.14 ? 64  ASP E C   1 
ATOM   4465 O  O   . ASP E 2 64  ? 13.651  -19.398 91.624  1.00 99.74  ? 64  ASP E O   1 
ATOM   4466 C  CB  . ASP E 2 64  ? 15.029  -21.845 90.371  1.00 101.70 ? 64  ASP E CB  1 
ATOM   4467 C  CG  . ASP E 2 64  ? 16.246  -22.745 90.386  1.00 103.23 ? 64  ASP E CG  1 
ATOM   4468 O  OD1 . ASP E 2 64  ? 17.037  -22.655 91.348  1.00 104.85 ? 64  ASP E OD1 1 
ATOM   4469 O  OD2 . ASP E 2 64  ? 16.409  -23.544 89.440  1.00 104.19 ? 64  ASP E OD2 1 
ATOM   4470 N  N   . ILE E 2 65  ? 12.079  -20.996 91.801  1.00 98.14  ? 65  ILE E N   1 
ATOM   4471 C  CA  . ILE E 2 65  ? 10.982  -20.039 91.763  1.00 93.50  ? 65  ILE E CA  1 
ATOM   4472 C  C   . ILE E 2 65  ? 10.724  -19.427 93.138  1.00 93.21  ? 65  ILE E C   1 
ATOM   4473 O  O   . ILE E 2 65  ? 10.989  -20.044 94.172  1.00 96.62  ? 65  ILE E O   1 
ATOM   4474 C  CB  . ILE E 2 65  ? 9.677   -20.658 91.201  1.00 89.47  ? 65  ILE E CB  1 
ATOM   4475 C  CG1 . ILE E 2 65  ? 8.981   -21.524 92.251  1.00 91.84  ? 65  ILE E CG1 1 
ATOM   4476 C  CG2 . ILE E 2 65  ? 9.961   -21.458 89.941  1.00 88.25  ? 65  ILE E CG2 1 
ATOM   4477 C  CD1 . ILE E 2 65  ? 7.646   -22.064 91.799  1.00 91.90  ? 65  ILE E CD1 1 
ATOM   4478 N  N   . SER E 2 66  ? 10.219  -18.200 93.130  1.00 88.01  ? 66  SER E N   1 
ATOM   4479 C  CA  . SER E 2 66  ? 9.853   -17.495 94.349  1.00 81.92  ? 66  SER E CA  1 
ATOM   4480 C  C   . SER E 2 66  ? 8.818   -16.437 93.993  1.00 79.25  ? 66  SER E C   1 
ATOM   4481 O  O   . SER E 2 66  ? 8.089   -16.582 93.011  1.00 76.93  ? 66  SER E O   1 
ATOM   4482 C  CB  . SER E 2 66  ? 11.081  -16.844 94.989  1.00 77.97  ? 66  SER E CB  1 
ATOM   4483 O  OG  . SER E 2 66  ? 11.690  -15.918 94.106  1.00 75.20  ? 66  SER E OG  1 
ATOM   4484 N  N   . GLU E 2 67  ? 8.753   -15.375 94.788  1.00 79.64  ? 67  GLU E N   1 
ATOM   4485 C  CA  . GLU E 2 67  ? 7.875   -14.256 94.477  1.00 79.18  ? 67  GLU E CA  1 
ATOM   4486 C  C   . GLU E 2 67  ? 8.398   -13.536 93.236  1.00 78.99  ? 67  GLU E C   1 
ATOM   4487 O  O   . GLU E 2 67  ? 9.545   -13.083 93.207  1.00 81.78  ? 67  GLU E O   1 
ATOM   4488 C  CB  . GLU E 2 67  ? 7.780   -13.289 95.663  1.00 79.91  ? 67  GLU E CB  1 
ATOM   4489 C  CG  . GLU E 2 67  ? 6.757   -12.176 95.473  1.00 82.82  ? 67  GLU E CG  1 
ATOM   4490 C  CD  . GLU E 2 67  ? 6.663   -11.236 96.665  1.00 85.93  ? 67  GLU E CD  1 
ATOM   4491 O  OE1 . GLU E 2 67  ? 7.367   -11.466 97.672  1.00 87.04  ? 67  GLU E OE1 1 
ATOM   4492 O  OE2 . GLU E 2 67  ? 5.879   -10.265 96.590  1.00 84.99  ? 67  GLU E OE2 1 
ATOM   4493 N  N   . ILE E 2 68  ? 7.557   -13.449 92.208  1.00 71.93  ? 68  ILE E N   1 
ATOM   4494 C  CA  . ILE E 2 68  ? 7.926   -12.791 90.959  1.00 64.51  ? 68  ILE E CA  1 
ATOM   4495 C  C   . ILE E 2 68  ? 7.943   -11.274 91.135  1.00 66.57  ? 68  ILE E C   1 
ATOM   4496 O  O   . ILE E 2 68  ? 7.200   -10.727 91.953  1.00 66.09  ? 68  ILE E O   1 
ATOM   4497 C  CB  . ILE E 2 68  ? 6.947   -13.171 89.819  1.00 52.22  ? 68  ILE E CB  1 
ATOM   4498 C  CG1 . ILE E 2 68  ? 7.532   -12.836 88.449  1.00 51.71  ? 68  ILE E CG1 1 
ATOM   4499 C  CG2 . ILE E 2 68  ? 5.592   -12.485 89.994  1.00 46.17  ? 68  ILE E CG2 1 
ATOM   4500 C  CD1 . ILE E 2 68  ? 6.571   -13.113 87.304  1.00 38.68  ? 68  ILE E CD1 1 
ATOM   4501 N  N   . TRP E 2 69  ? 8.809   -10.597 90.387  1.00 66.13  ? 69  TRP E N   1 
ATOM   4502 C  CA  . TRP E 2 69  ? 8.789   -9.137  90.347  1.00 62.55  ? 69  TRP E CA  1 
ATOM   4503 C  C   . TRP E 2 69  ? 9.244   -8.585  88.998  1.00 60.05  ? 69  TRP E C   1 
ATOM   4504 O  O   . TRP E 2 69  ? 9.934   -9.264  88.236  1.00 62.39  ? 69  TRP E O   1 
ATOM   4505 C  CB  . TRP E 2 69  ? 9.584   -8.524  91.505  1.00 60.99  ? 69  TRP E CB  1 
ATOM   4506 C  CG  . TRP E 2 69  ? 11.052  -8.832  91.517  1.00 66.57  ? 69  TRP E CG  1 
ATOM   4507 C  CD1 . TRP E 2 69  ? 11.642  -10.003 91.896  1.00 69.26  ? 69  TRP E CD1 1 
ATOM   4508 C  CD2 . TRP E 2 69  ? 12.120  -7.937  91.176  1.00 67.21  ? 69  TRP E CD2 1 
ATOM   4509 N  NE1 . TRP E 2 69  ? 13.009  -9.897  91.797  1.00 70.30  ? 69  TRP E NE1 1 
ATOM   4510 C  CE2 . TRP E 2 69  ? 13.328  -8.638  91.361  1.00 66.25  ? 69  TRP E CE2 1 
ATOM   4511 C  CE3 . TRP E 2 69  ? 12.171  -6.613  90.729  1.00 66.22  ? 69  TRP E CE3 1 
ATOM   4512 C  CZ2 . TRP E 2 69  ? 14.572  -8.065  91.104  1.00 62.91  ? 69  TRP E CZ2 1 
ATOM   4513 C  CZ3 . TRP E 2 69  ? 13.408  -6.043  90.480  1.00 66.62  ? 69  TRP E CZ3 1 
ATOM   4514 C  CH2 . TRP E 2 69  ? 14.591  -6.769  90.669  1.00 63.21  ? 69  TRP E CH2 1 
ATOM   4515 N  N   . PHE E 2 70  ? 8.843   -7.352  88.707  1.00 52.96  ? 70  PHE E N   1 
ATOM   4516 C  CA  . PHE E 2 70  ? 9.056   -6.772  87.390  1.00 52.12  ? 70  PHE E CA  1 
ATOM   4517 C  C   . PHE E 2 70  ? 9.872   -5.493  87.480  1.00 57.13  ? 70  PHE E C   1 
ATOM   4518 O  O   . PHE E 2 70  ? 9.786   -4.760  88.467  1.00 63.09  ? 70  PHE E O   1 
ATOM   4519 C  CB  . PHE E 2 70  ? 7.711   -6.478  86.718  1.00 47.14  ? 70  PHE E CB  1 
ATOM   4520 C  CG  . PHE E 2 70  ? 6.778   -7.657  86.682  1.00 47.14  ? 70  PHE E CG  1 
ATOM   4521 C  CD1 . PHE E 2 70  ? 6.940   -8.659  85.741  1.00 48.15  ? 70  PHE E CD1 1 
ATOM   4522 C  CD2 . PHE E 2 70  ? 5.733   -7.759  87.588  1.00 47.87  ? 70  PHE E CD2 1 
ATOM   4523 C  CE1 . PHE E 2 70  ? 6.081   -9.746  85.708  1.00 51.65  ? 70  PHE E CE1 1 
ATOM   4524 C  CE2 . PHE E 2 70  ? 4.868   -8.844  87.559  1.00 49.06  ? 70  PHE E CE2 1 
ATOM   4525 C  CZ  . PHE E 2 70  ? 5.043   -9.839  86.619  1.00 49.13  ? 70  PHE E CZ  1 
ATOM   4526 N  N   . GLU E 2 71  ? 10.663  -5.226  86.446  1.00 51.21  ? 71  GLU E N   1 
ATOM   4527 C  CA  . GLU E 2 71  ? 11.437  -3.997  86.394  1.00 53.46  ? 71  GLU E CA  1 
ATOM   4528 C  C   . GLU E 2 71  ? 11.511  -3.437  84.984  1.00 56.28  ? 71  GLU E C   1 
ATOM   4529 O  O   . GLU E 2 71  ? 11.577  -4.182  84.007  1.00 62.18  ? 71  GLU E O   1 
ATOM   4530 C  CB  . GLU E 2 71  ? 12.845  -4.209  86.953  1.00 56.78  ? 71  GLU E CB  1 
ATOM   4531 C  CG  . GLU E 2 71  ? 13.666  -5.243  86.208  1.00 61.97  ? 71  GLU E CG  1 
ATOM   4532 C  CD  . GLU E 2 71  ? 14.657  -4.631  85.235  1.00 67.31  ? 71  GLU E CD  1 
ATOM   4533 O  OE1 . GLU E 2 71  ? 15.509  -5.377  84.710  1.00 69.31  ? 71  GLU E OE1 1 
ATOM   4534 O  OE2 . GLU E 2 71  ? 14.588  -3.409  84.994  1.00 70.22  ? 71  GLU E OE2 1 
ATOM   4535 N  N   . TYR E 2 72  ? 11.487  -2.114  84.889  1.00 54.08  ? 72  TYR E N   1 
ATOM   4536 C  CA  . TYR E 2 72  ? 11.672  -1.432  83.620  1.00 52.90  ? 72  TYR E CA  1 
ATOM   4537 C  C   . TYR E 2 72  ? 12.929  -0.580  83.685  1.00 54.76  ? 72  TYR E C   1 
ATOM   4538 O  O   . TYR E 2 72  ? 13.021  0.339   84.501  1.00 55.00  ? 72  TYR E O   1 
ATOM   4539 C  CB  . TYR E 2 72  ? 10.459  -0.557  83.297  1.00 50.72  ? 72  TYR E CB  1 
ATOM   4540 C  CG  . TYR E 2 72  ? 10.649  0.315   82.079  1.00 49.80  ? 72  TYR E CG  1 
ATOM   4541 C  CD1 . TYR E 2 72  ? 10.549  -0.215  80.801  1.00 50.35  ? 72  TYR E CD1 1 
ATOM   4542 C  CD2 . TYR E 2 72  ? 10.929  1.668   82.206  1.00 49.72  ? 72  TYR E CD2 1 
ATOM   4543 C  CE1 . TYR E 2 72  ? 10.721  0.577   79.685  1.00 52.56  ? 72  TYR E CE1 1 
ATOM   4544 C  CE2 . TYR E 2 72  ? 11.101  2.468   81.098  1.00 51.31  ? 72  TYR E CE2 1 
ATOM   4545 C  CZ  . TYR E 2 72  ? 10.999  1.918   79.839  1.00 55.08  ? 72  TYR E CZ  1 
ATOM   4546 O  OH  . TYR E 2 72  ? 11.170  2.715   78.728  1.00 60.81  ? 72  TYR E OH  1 
ATOM   4547 N  N   . GLU E 2 73  ? 13.898  -0.901  82.834  1.00 56.62  ? 73  GLU E N   1 
ATOM   4548 C  CA  . GLU E 2 73  ? 15.134  -0.131  82.745  1.00 59.69  ? 73  GLU E CA  1 
ATOM   4549 C  C   . GLU E 2 73  ? 15.835  0.001   84.096  1.00 60.15  ? 73  GLU E C   1 
ATOM   4550 O  O   . GLU E 2 73  ? 16.376  1.055   84.420  1.00 62.23  ? 73  GLU E O   1 
ATOM   4551 C  CB  . GLU E 2 73  ? 14.855  1.254   82.161  1.00 62.02  ? 73  GLU E CB  1 
ATOM   4552 C  CG  . GLU E 2 73  ? 14.317  1.228   80.745  1.00 69.91  ? 73  GLU E CG  1 
ATOM   4553 C  CD  . GLU E 2 73  ? 15.413  1.335   79.707  1.00 81.87  ? 73  GLU E CD  1 
ATOM   4554 O  OE1 . GLU E 2 73  ? 16.349  2.137   79.916  1.00 86.44  ? 73  GLU E OE1 1 
ATOM   4555 O  OE2 . GLU E 2 73  ? 15.342  0.616   78.685  1.00 84.59  ? 73  GLU E OE2 1 
ATOM   4556 N  N   . GLY E 2 74  ? 15.814  -1.070  84.881  1.00 59.23  ? 74  GLY E N   1 
ATOM   4557 C  CA  . GLY E 2 74  ? 16.482  -1.080  86.170  1.00 61.30  ? 74  GLY E CA  1 
ATOM   4558 C  C   . GLY E 2 74  ? 15.568  -0.718  87.324  1.00 62.72  ? 74  GLY E C   1 
ATOM   4559 O  O   . GLY E 2 74  ? 15.838  -1.075  88.471  1.00 57.91  ? 74  GLY E O   1 
ATOM   4560 N  N   . THR E 2 75  ? 14.482  -0.012  87.013  1.00 65.68  ? 75  THR E N   1 
ATOM   4561 C  CA  . THR E 2 75  ? 13.517  0.442   88.013  1.00 63.67  ? 75  THR E CA  1 
ATOM   4562 C  C   . THR E 2 75  ? 12.501  -0.640  88.356  1.00 61.59  ? 75  THR E C   1 
ATOM   4563 O  O   . THR E 2 75  ? 11.733  -1.062  87.496  1.00 63.12  ? 75  THR E O   1 
ATOM   4564 C  CB  . THR E 2 75  ? 12.736  1.675   87.508  1.00 61.82  ? 75  THR E CB  1 
ATOM   4565 O  OG1 . THR E 2 75  ? 13.630  2.784   87.348  1.00 63.26  ? 75  THR E OG1 1 
ATOM   4566 C  CG2 . THR E 2 75  ? 11.625  2.046   88.484  1.00 56.81  ? 75  THR E CG2 1 
ATOM   4567 N  N   . PRO E 2 76  ? 12.488  -1.092  89.618  1.00 62.67  ? 76  PRO E N   1 
ATOM   4568 C  CA  . PRO E 2 76  ? 11.466  -2.055  90.045  1.00 63.13  ? 76  PRO E CA  1 
ATOM   4569 C  C   . PRO E 2 76  ? 10.069  -1.447  89.951  1.00 61.49  ? 76  PRO E C   1 
ATOM   4570 O  O   . PRO E 2 76  ? 9.859   -0.306  90.363  1.00 60.08  ? 76  PRO E O   1 
ATOM   4571 C  CB  . PRO E 2 76  ? 11.829  -2.326  91.510  1.00 59.35  ? 76  PRO E CB  1 
ATOM   4572 C  CG  . PRO E 2 76  ? 13.271  -1.981  91.614  1.00 58.62  ? 76  PRO E CG  1 
ATOM   4573 C  CD  . PRO E 2 76  ? 13.463  -0.817  90.686  1.00 60.33  ? 76  PRO E CD  1 
ATOM   4574 N  N   . LEU E 2 77  ? 9.128   -2.209  89.405  1.00 60.17  ? 77  LEU E N   1 
ATOM   4575 C  CA  . LEU E 2 77  ? 7.771   -1.720  89.196  1.00 53.64  ? 77  LEU E CA  1 
ATOM   4576 C  C   . LEU E 2 77  ? 6.886   -1.977  90.410  1.00 52.70  ? 77  LEU E C   1 
ATOM   4577 O  O   . LEU E 2 77  ? 6.529   -3.119  90.693  1.00 51.18  ? 77  LEU E O   1 
ATOM   4578 C  CB  . LEU E 2 77  ? 7.164   -2.367  87.948  1.00 50.47  ? 77  LEU E CB  1 
ATOM   4579 C  CG  . LEU E 2 77  ? 7.926   -2.124  86.642  1.00 48.63  ? 77  LEU E CG  1 
ATOM   4580 C  CD1 . LEU E 2 77  ? 7.303   -2.892  85.485  1.00 49.39  ? 77  LEU E CD1 1 
ATOM   4581 C  CD2 . LEU E 2 77  ? 7.983   -0.641  86.328  1.00 42.52  ? 77  LEU E CD2 1 
ATOM   4582 N  N   . LYS E 2 78  ? 6.547   -0.908  91.126  1.00 51.52  ? 78  LYS E N   1 
ATOM   4583 C  CA  . LYS E 2 78  ? 5.618   -0.994  92.247  1.00 49.65  ? 78  LYS E CA  1 
ATOM   4584 C  C   . LYS E 2 78  ? 4.264   -1.504  91.765  1.00 49.92  ? 78  LYS E C   1 
ATOM   4585 O  O   . LYS E 2 78  ? 3.572   -0.827  91.005  1.00 55.34  ? 78  LYS E O   1 
ATOM   4586 C  CB  . LYS E 2 78  ? 5.457   0.373   92.918  1.00 50.77  ? 78  LYS E CB  1 
ATOM   4587 C  CG  . LYS E 2 78  ? 6.671   0.836   93.713  1.00 56.58  ? 78  LYS E CG  1 
ATOM   4588 C  CD  . LYS E 2 78  ? 6.552   2.310   94.091  1.00 60.75  ? 78  LYS E CD  1 
ATOM   4589 C  CE  . LYS E 2 78  ? 7.528   2.694   95.197  1.00 68.84  ? 78  LYS E CE  1 
ATOM   4590 N  NZ  . LYS E 2 78  ? 8.949   2.510   94.795  1.00 73.54  ? 78  LYS E NZ  1 
ATOM   4591 N  N   . TRP E 2 79  ? 3.892   -2.700  92.209  1.00 45.54  ? 79  TRP E N   1 
ATOM   4592 C  CA  . TRP E 2 79  ? 2.668   -3.347  91.748  1.00 46.80  ? 79  TRP E CA  1 
ATOM   4593 C  C   . TRP E 2 79  ? 1.402   -2.652  92.238  1.00 51.87  ? 79  TRP E C   1 
ATOM   4594 O  O   . TRP E 2 79  ? 0.344   -2.792  91.630  1.00 55.36  ? 79  TRP E O   1 
ATOM   4595 C  CB  . TRP E 2 79  ? 2.637   -4.810  92.189  1.00 49.92  ? 79  TRP E CB  1 
ATOM   4596 C  CG  . TRP E 2 79  ? 2.523   -4.969  93.673  1.00 55.28  ? 79  TRP E CG  1 
ATOM   4597 C  CD1 . TRP E 2 79  ? 3.548   -5.105  94.563  1.00 56.91  ? 79  TRP E CD1 1 
ATOM   4598 C  CD2 . TRP E 2 79  ? 1.313   -4.992  94.448  1.00 59.41  ? 79  TRP E CD2 1 
ATOM   4599 N  NE1 . TRP E 2 79  ? 3.055   -5.217  95.843  1.00 61.05  ? 79  TRP E NE1 1 
ATOM   4600 C  CE2 . TRP E 2 79  ? 1.686   -5.150  95.799  1.00 60.38  ? 79  TRP E CE2 1 
ATOM   4601 C  CE3 . TRP E 2 79  ? -0.047  -4.896  94.129  1.00 55.11  ? 79  TRP E CE3 1 
ATOM   4602 C  CZ2 . TRP E 2 79  ? 0.748   -5.216  96.831  1.00 55.71  ? 79  TRP E CZ2 1 
ATOM   4603 C  CZ3 . TRP E 2 79  ? -0.976  -4.961  95.155  1.00 55.87  ? 79  TRP E CZ3 1 
ATOM   4604 C  CH2 . TRP E 2 79  ? -0.574  -5.119  96.489  1.00 55.67  ? 79  TRP E CH2 1 
ATOM   4605 N  N   . HIS E 2 80  ? 1.497   -1.925  93.346  1.00 56.48  ? 80  HIS E N   1 
ATOM   4606 C  CA  . HIS E 2 80  ? 0.313   -1.274  93.902  1.00 57.77  ? 80  HIS E CA  1 
ATOM   4607 C  C   . HIS E 2 80  ? -0.036  0.032   93.177  1.00 58.22  ? 80  HIS E C   1 
ATOM   4608 O  O   . HIS E 2 80  ? -1.047  0.666   93.482  1.00 59.44  ? 80  HIS E O   1 
ATOM   4609 C  CB  . HIS E 2 80  ? 0.442   -1.068  95.416  1.00 53.30  ? 80  HIS E CB  1 
ATOM   4610 C  CG  . HIS E 2 80  ? 1.679   -0.334  95.831  1.00 55.56  ? 80  HIS E CG  1 
ATOM   4611 N  ND1 . HIS E 2 80  ? 2.886   -0.967  96.039  1.00 57.67  ? 80  HIS E ND1 1 
ATOM   4612 C  CD2 . HIS E 2 80  ? 1.892   0.978   96.091  1.00 56.38  ? 80  HIS E CD2 1 
ATOM   4613 C  CE1 . HIS E 2 80  ? 3.791   -0.075  96.400  1.00 57.79  ? 80  HIS E CE1 1 
ATOM   4614 N  NE2 . HIS E 2 80  ? 3.214   1.112   96.439  1.00 58.03  ? 80  HIS E NE2 1 
ATOM   4615 N  N   . TYR E 2 81  ? 0.802   0.421   92.219  1.00 53.11  ? 81  TYR E N   1 
ATOM   4616 C  CA  . TYR E 2 81  ? 0.489   1.539   91.336  1.00 56.52  ? 81  TYR E CA  1 
ATOM   4617 C  C   . TYR E 2 81  ? -0.147  0.991   90.065  1.00 54.17  ? 81  TYR E C   1 
ATOM   4618 O  O   . TYR E 2 81  ? 0.362   0.030   89.487  1.00 59.01  ? 81  TYR E O   1 
ATOM   4619 C  CB  . TYR E 2 81  ? 1.751   2.325   90.962  1.00 59.67  ? 81  TYR E CB  1 
ATOM   4620 C  CG  . TYR E 2 81  ? 2.334   3.205   92.053  1.00 63.64  ? 81  TYR E CG  1 
ATOM   4621 C  CD1 . TYR E 2 81  ? 1.944   3.073   93.382  1.00 66.71  ? 81  TYR E CD1 1 
ATOM   4622 C  CD2 . TYR E 2 81  ? 3.278   4.176   91.744  1.00 60.93  ? 81  TYR E CD2 1 
ATOM   4623 C  CE1 . TYR E 2 81  ? 2.487   3.882   94.369  1.00 65.83  ? 81  TYR E CE1 1 
ATOM   4624 C  CE2 . TYR E 2 81  ? 3.821   4.986   92.718  1.00 60.03  ? 81  TYR E CE2 1 
ATOM   4625 C  CZ  . TYR E 2 81  ? 3.425   4.838   94.028  1.00 64.37  ? 81  TYR E CZ  1 
ATOM   4626 O  OH  . TYR E 2 81  ? 3.973   5.650   94.996  1.00 68.21  ? 81  TYR E OH  1 
ATOM   4627 N  N   . PRO E 2 82  ? -1.260  1.595   89.623  1.00 50.99  ? 82  PRO E N   1 
ATOM   4628 C  CA  . PRO E 2 82  ? -1.960  1.139   88.416  1.00 49.82  ? 82  PRO E CA  1 
ATOM   4629 C  C   . PRO E 2 82  ? -1.039  1.074   87.199  1.00 52.56  ? 82  PRO E C   1 
ATOM   4630 O  O   . PRO E 2 82  ? -0.177  1.939   87.029  1.00 57.10  ? 82  PRO E O   1 
ATOM   4631 C  CB  . PRO E 2 82  ? -3.036  2.207   88.215  1.00 49.99  ? 82  PRO E CB  1 
ATOM   4632 C  CG  . PRO E 2 82  ? -3.300  2.729   89.587  1.00 49.10  ? 82  PRO E CG  1 
ATOM   4633 C  CD  . PRO E 2 82  ? -1.965  2.708   90.282  1.00 52.38  ? 82  PRO E CD  1 
ATOM   4634 N  N   . ILE E 2 83  ? -1.226  0.045   86.378  1.00 49.91  ? 83  ILE E N   1 
ATOM   4635 C  CA  . ILE E 2 83  ? -0.383  -0.206  85.211  1.00 48.06  ? 83  ILE E CA  1 
ATOM   4636 C  C   . ILE E 2 83  ? -0.256  1.011   84.290  1.00 47.26  ? 83  ILE E C   1 
ATOM   4637 O  O   . ILE E 2 83  ? 0.832   1.312   83.788  1.00 45.42  ? 83  ILE E O   1 
ATOM   4638 C  CB  . ILE E 2 83  ? -0.912  -1.415  84.406  1.00 46.21  ? 83  ILE E CB  1 
ATOM   4639 C  CG1 . ILE E 2 83  ? -0.751  -2.704  85.214  1.00 45.47  ? 83  ILE E CG1 1 
ATOM   4640 C  CG2 . ILE E 2 83  ? -0.194  -1.542  83.072  1.00 45.41  ? 83  ILE E CG2 1 
ATOM   4641 C  CD1 . ILE E 2 83  ? -1.367  -3.919  84.549  1.00 44.20  ? 83  ILE E CD1 1 
ATOM   4642 N  N   . GLY E 2 84  ? -1.366  1.713   84.079  1.00 44.09  ? 84  GLY E N   1 
ATOM   4643 C  CA  . GLY E 2 84  ? -1.377  2.883   83.218  1.00 47.30  ? 84  GLY E CA  1 
ATOM   4644 C  C   . GLY E 2 84  ? -0.513  4.011   83.750  1.00 51.14  ? 84  GLY E C   1 
ATOM   4645 O  O   . GLY E 2 84  ? 0.182   4.691   82.993  1.00 52.05  ? 84  GLY E O   1 
ATOM   4646 N  N   . LEU E 2 85  ? -0.559  4.207   85.063  1.00 51.53  ? 85  LEU E N   1 
ATOM   4647 C  CA  . LEU E 2 85  ? 0.251   5.222   85.716  1.00 51.64  ? 85  LEU E CA  1 
ATOM   4648 C  C   . LEU E 2 85  ? 1.736   4.916   85.576  1.00 49.68  ? 85  LEU E C   1 
ATOM   4649 O  O   . LEU E 2 85  ? 2.527   5.796   85.231  1.00 53.53  ? 85  LEU E O   1 
ATOM   4650 C  CB  . LEU E 2 85  ? -0.115  5.314   87.195  1.00 56.27  ? 85  LEU E CB  1 
ATOM   4651 C  CG  . LEU E 2 85  ? 0.783   6.228   88.026  1.00 55.94  ? 85  LEU E CG  1 
ATOM   4652 C  CD1 . LEU E 2 85  ? 0.449   7.689   87.761  1.00 55.00  ? 85  LEU E CD1 1 
ATOM   4653 C  CD2 . LEU E 2 85  ? 0.647   5.888   89.493  1.00 59.96  ? 85  LEU E CD2 1 
ATOM   4654 N  N   . LEU E 2 86  ? 2.110   3.670   85.856  1.00 44.14  ? 86  LEU E N   1 
ATOM   4655 C  CA  . LEU E 2 86  ? 3.502   3.240   85.758  1.00 40.81  ? 86  LEU E CA  1 
ATOM   4656 C  C   . LEU E 2 86  ? 4.056   3.476   84.360  1.00 45.47  ? 86  LEU E C   1 
ATOM   4657 O  O   . LEU E 2 86  ? 5.189   3.927   84.198  1.00 51.41  ? 86  LEU E O   1 
ATOM   4658 C  CB  . LEU E 2 86  ? 3.634   1.758   86.107  1.00 38.70  ? 86  LEU E CB  1 
ATOM   4659 C  CG  . LEU E 2 86  ? 3.508   1.351   87.571  1.00 41.31  ? 86  LEU E CG  1 
ATOM   4660 C  CD1 . LEU E 2 86  ? 3.440   -0.159  87.682  1.00 37.97  ? 86  LEU E CD1 1 
ATOM   4661 C  CD2 . LEU E 2 86  ? 4.681   1.896   88.374  1.00 39.69  ? 86  LEU E CD2 1 
ATOM   4662 N  N   . PHE E 2 87  ? 3.252   3.167   83.350  1.00 42.32  ? 87  PHE E N   1 
ATOM   4663 C  CA  . PHE E 2 87  ? 3.687   3.325   81.972  1.00 47.94  ? 87  PHE E CA  1 
ATOM   4664 C  C   . PHE E 2 87  ? 3.812   4.800   81.588  1.00 52.19  ? 87  PHE E C   1 
ATOM   4665 O  O   . PHE E 2 87  ? 4.836   5.218   81.043  1.00 54.94  ? 87  PHE E O   1 
ATOM   4666 C  CB  . PHE E 2 87  ? 2.745   2.589   81.018  1.00 46.36  ? 87  PHE E CB  1 
ATOM   4667 C  CG  . PHE E 2 87  ? 3.107   2.744   79.572  1.00 46.09  ? 87  PHE E CG  1 
ATOM   4668 C  CD1 . PHE E 2 87  ? 4.168   2.036   79.028  1.00 45.90  ? 87  PHE E CD1 1 
ATOM   4669 C  CD2 . PHE E 2 87  ? 2.389   3.599   78.755  1.00 47.43  ? 87  PHE E CD2 1 
ATOM   4670 C  CE1 . PHE E 2 87  ? 4.506   2.178   77.693  1.00 43.97  ? 87  PHE E CE1 1 
ATOM   4671 C  CE2 . PHE E 2 87  ? 2.723   3.750   77.420  1.00 47.75  ? 87  PHE E CE2 1 
ATOM   4672 C  CZ  . PHE E 2 87  ? 3.783   3.036   76.889  1.00 45.27  ? 87  PHE E CZ  1 
ATOM   4673 N  N   . ASP E 2 88  ? 2.777   5.585   81.883  1.00 54.04  ? 88  ASP E N   1 
ATOM   4674 C  CA  . ASP E 2 88  ? 2.790   7.013   81.569  1.00 56.26  ? 88  ASP E CA  1 
ATOM   4675 C  C   . ASP E 2 88  ? 3.990   7.710   82.200  1.00 59.43  ? 88  ASP E C   1 
ATOM   4676 O  O   . ASP E 2 88  ? 4.589   8.605   81.609  1.00 64.74  ? 88  ASP E O   1 
ATOM   4677 C  CB  . ASP E 2 88  ? 1.497   7.685   82.034  1.00 52.76  ? 88  ASP E CB  1 
ATOM   4678 C  CG  . ASP E 2 88  ? 0.306   7.318   81.174  1.00 55.74  ? 88  ASP E CG  1 
ATOM   4679 O  OD1 . ASP E 2 88  ? 0.509   6.860   80.029  1.00 63.16  ? 88  ASP E OD1 1 
ATOM   4680 O  OD2 . ASP E 2 88  ? -0.838  7.497   81.638  1.00 56.16  ? 88  ASP E OD2 1 
ATOM   4681 N  N   . LEU E 2 89  ? 4.348   7.270   83.398  1.00 55.76  ? 89  LEU E N   1 
ATOM   4682 C  CA  . LEU E 2 89  ? 5.413   7.899   84.160  1.00 55.29  ? 89  LEU E CA  1 
ATOM   4683 C  C   . LEU E 2 89  ? 6.803   7.461   83.701  1.00 58.06  ? 89  LEU E C   1 
ATOM   4684 O  O   . LEU E 2 89  ? 7.737   8.263   83.699  1.00 62.43  ? 89  LEU E O   1 
ATOM   4685 C  CB  . LEU E 2 89  ? 5.229   7.585   85.645  1.00 53.53  ? 89  LEU E CB  1 
ATOM   4686 C  CG  . LEU E 2 89  ? 5.983   8.457   86.644  1.00 56.92  ? 89  LEU E CG  1 
ATOM   4687 C  CD1 . LEU E 2 89  ? 5.537   9.907   86.528  1.00 55.52  ? 89  LEU E CD1 1 
ATOM   4688 C  CD2 . LEU E 2 89  ? 5.763   7.934   88.056  1.00 57.73  ? 89  LEU E CD2 1 
ATOM   4689 N  N   . LEU E 2 90  ? 6.938   6.198   83.302  1.00 51.38  ? 90  LEU E N   1 
ATOM   4690 C  CA  . LEU E 2 90  ? 8.260   5.625   83.061  1.00 50.22  ? 90  LEU E CA  1 
ATOM   4691 C  C   . LEU E 2 90  ? 8.612   5.342   81.598  1.00 54.38  ? 90  LEU E C   1 
ATOM   4692 O  O   . LEU E 2 90  ? 9.774   5.453   81.211  1.00 56.83  ? 90  LEU E O   1 
ATOM   4693 C  CB  . LEU E 2 90  ? 8.441   4.341   83.880  1.00 49.50  ? 90  LEU E CB  1 
ATOM   4694 C  CG  . LEU E 2 90  ? 8.289   4.432   85.402  1.00 48.35  ? 90  LEU E CG  1 
ATOM   4695 C  CD1 . LEU E 2 90  ? 8.391   3.050   86.039  1.00 46.81  ? 90  LEU E CD1 1 
ATOM   4696 C  CD2 . LEU E 2 90  ? 9.319   5.374   85.999  1.00 42.00  ? 90  LEU E CD2 1 
ATOM   4697 N  N   . ALA E 2 91  ? 7.626   4.973   80.785  1.00 54.01  ? 91  ALA E N   1 
ATOM   4698 C  CA  . ALA E 2 91  ? 7.932   4.420   79.465  1.00 55.37  ? 91  ALA E CA  1 
ATOM   4699 C  C   . ALA E 2 91  ? 7.183   5.037   78.289  1.00 57.53  ? 91  ALA E C   1 
ATOM   4700 O  O   . ALA E 2 91  ? 7.419   4.655   77.140  1.00 60.56  ? 91  ALA E O   1 
ATOM   4701 C  CB  . ALA E 2 91  ? 7.731   2.907   79.472  1.00 56.59  ? 91  ALA E CB  1 
ATOM   4702 N  N   . SER E 2 92  ? 6.290   5.981   78.563  1.00 55.02  ? 92  SER E N   1 
ATOM   4703 C  CA  . SER E 2 92  ? 5.489   6.593   77.506  1.00 51.67  ? 92  SER E CA  1 
ATOM   4704 C  C   . SER E 2 92  ? 6.355   7.333   76.486  1.00 57.59  ? 92  SER E C   1 
ATOM   4705 O  O   . SER E 2 92  ? 5.935   7.568   75.352  1.00 52.93  ? 92  SER E O   1 
ATOM   4706 C  CB  . SER E 2 92  ? 4.439   7.531   78.100  1.00 53.60  ? 92  SER E CB  1 
ATOM   4707 O  OG  . SER E 2 92  ? 5.047   8.566   78.850  1.00 61.08  ? 92  SER E OG  1 
ATOM   4708 N  N   . SER E 2 93  ? 7.568   7.694   76.895  1.00 65.72  ? 93  SER E N   1 
ATOM   4709 C  CA  . SER E 2 93  ? 8.520   8.336   75.996  1.00 69.10  ? 93  SER E CA  1 
ATOM   4710 C  C   . SER E 2 93  ? 9.161   7.317   75.051  1.00 68.81  ? 93  SER E C   1 
ATOM   4711 O  O   . SER E 2 93  ? 9.476   7.632   73.903  1.00 70.30  ? 93  SER E O   1 
ATOM   4712 C  CB  . SER E 2 93  ? 9.598   9.068   76.797  1.00 72.71  ? 93  SER E CB  1 
ATOM   4713 O  OG  . SER E 2 93  ? 10.144  8.228   77.803  1.00 78.80  ? 93  SER E OG  1 
ATOM   4714 N  N   . SER E 2 94  ? 9.346   6.093   75.537  1.00 65.98  ? 94  SER E N   1 
ATOM   4715 C  CA  . SER E 2 94  ? 9.975   5.043   74.739  1.00 61.63  ? 94  SER E CA  1 
ATOM   4716 C  C   . SER E 2 94  ? 9.002   4.406   73.754  1.00 56.70  ? 94  SER E C   1 
ATOM   4717 O  O   . SER E 2 94  ? 7.788   4.572   73.864  1.00 58.71  ? 94  SER E O   1 
ATOM   4718 C  CB  . SER E 2 94  ? 10.584  3.967   75.640  1.00 61.40  ? 94  SER E CB  1 
ATOM   4719 O  OG  . SER E 2 94  ? 11.578  4.516   76.485  1.00 66.09  ? 94  SER E OG  1 
ATOM   4720 N  N   . ALA E 2 95  ? 9.549   3.671   72.795  1.00 49.92  ? 95  ALA E N   1 
ATOM   4721 C  CA  . ALA E 2 95  ? 8.743   3.023   71.775  1.00 46.10  ? 95  ALA E CA  1 
ATOM   4722 C  C   . ALA E 2 95  ? 8.000   1.826   72.347  1.00 49.57  ? 95  ALA E C   1 
ATOM   4723 O  O   . ALA E 2 95  ? 8.485   1.161   73.261  1.00 54.63  ? 95  ALA E O   1 
ATOM   4724 C  CB  . ALA E 2 95  ? 9.619   2.591   70.611  1.00 46.10  ? 95  ALA E CB  1 
ATOM   4725 N  N   . LEU E 2 96  ? 6.818   1.564   71.805  1.00 50.24  ? 96  LEU E N   1 
ATOM   4726 C  CA  . LEU E 2 96  ? 6.059   0.370   72.141  1.00 50.29  ? 96  LEU E CA  1 
ATOM   4727 C  C   . LEU E 2 96  ? 6.705   -0.841  71.471  1.00 52.58  ? 96  LEU E C   1 
ATOM   4728 O  O   . LEU E 2 96  ? 7.451   -0.686  70.507  1.00 57.63  ? 96  LEU E O   1 
ATOM   4729 C  CB  . LEU E 2 96  ? 4.608   0.527   71.678  1.00 47.66  ? 96  LEU E CB  1 
ATOM   4730 C  CG  . LEU E 2 96  ? 3.724   1.414   72.554  1.00 47.32  ? 96  LEU E CG  1 
ATOM   4731 C  CD1 . LEU E 2 96  ? 2.301   1.445   72.019  1.00 52.84  ? 96  LEU E CD1 1 
ATOM   4732 C  CD2 . LEU E 2 96  ? 3.748   0.928   73.992  1.00 39.30  ? 96  LEU E CD2 1 
ATOM   4733 N  N   . PRO E 2 97  ? 6.449   -2.051  71.993  1.00 52.70  ? 97  PRO E N   1 
ATOM   4734 C  CA  . PRO E 2 97  ? 5.700   -2.326  73.225  1.00 53.18  ? 97  PRO E CA  1 
ATOM   4735 C  C   . PRO E 2 97  ? 6.514   -2.000  74.474  1.00 48.52  ? 97  PRO E C   1 
ATOM   4736 O  O   . PRO E 2 97  ? 7.719   -1.753  74.375  1.00 48.76  ? 97  PRO E O   1 
ATOM   4737 C  CB  . PRO E 2 97  ? 5.428   -3.833  73.141  1.00 51.73  ? 97  PRO E CB  1 
ATOM   4738 C  CG  . PRO E 2 97  ? 6.506   -4.366  72.271  1.00 48.80  ? 97  PRO E CG  1 
ATOM   4739 C  CD  . PRO E 2 97  ? 6.789   -3.290  71.269  1.00 52.23  ? 97  PRO E CD  1 
ATOM   4740 N  N   . TRP E 2 98  ? 5.847   -1.978  75.624  1.00 41.34  ? 98  TRP E N   1 
ATOM   4741 C  CA  . TRP E 2 98  ? 6.508   -1.761  76.902  1.00 40.00  ? 98  TRP E CA  1 
ATOM   4742 C  C   . TRP E 2 98  ? 7.414   -2.945  77.211  1.00 42.41  ? 98  TRP E C   1 
ATOM   4743 O  O   . TRP E 2 98  ? 6.949   -4.078  77.313  1.00 46.91  ? 98  TRP E O   1 
ATOM   4744 C  CB  . TRP E 2 98  ? 5.461   -1.618  78.007  1.00 40.35  ? 98  TRP E CB  1 
ATOM   4745 C  CG  . TRP E 2 98  ? 6.007   -1.108  79.306  1.00 40.85  ? 98  TRP E CG  1 
ATOM   4746 C  CD1 . TRP E 2 98  ? 7.270   -0.646  79.540  1.00 40.68  ? 98  TRP E CD1 1 
ATOM   4747 C  CD2 . TRP E 2 98  ? 5.302   -1.002  80.554  1.00 39.37  ? 98  TRP E CD2 1 
ATOM   4748 N  NE1 . TRP E 2 98  ? 7.396   -0.259  80.855  1.00 45.58  ? 98  TRP E NE1 1 
ATOM   4749 C  CE2 . TRP E 2 98  ? 6.203   -0.468  81.498  1.00 43.41  ? 98  TRP E CE2 1 
ATOM   4750 C  CE3 . TRP E 2 98  ? 4.000   -1.306  80.962  1.00 38.19  ? 98  TRP E CE3 1 
ATOM   4751 C  CZ2 . TRP E 2 98  ? 5.842   -0.229  82.828  1.00 41.15  ? 98  TRP E CZ2 1 
ATOM   4752 C  CZ3 . TRP E 2 98  ? 3.642   -1.071  82.283  1.00 39.62  ? 98  TRP E CZ3 1 
ATOM   4753 C  CH2 . TRP E 2 98  ? 4.560   -0.535  83.199  1.00 38.85  ? 98  TRP E CH2 1 
ATOM   4754 N  N   . ASN E 2 99  ? 8.709   -2.690  77.355  1.00 45.23  ? 99  ASN E N   1 
ATOM   4755 C  CA  . ASN E 2 99  ? 9.645   -3.760  77.686  1.00 43.57  ? 99  ASN E CA  1 
ATOM   4756 C  C   . ASN E 2 99  ? 9.845   -3.927  79.186  1.00 46.39  ? 99  ASN E C   1 
ATOM   4757 O  O   . ASN E 2 99  ? 10.613  -3.198  79.814  1.00 52.03  ? 99  ASN E O   1 
ATOM   4758 C  CB  . ASN E 2 99  ? 10.986  -3.561  76.980  1.00 42.74  ? 99  ASN E CB  1 
ATOM   4759 C  CG  . ASN E 2 99  ? 10.876  -3.709  75.477  1.00 47.85  ? 99  ASN E CG  1 
ATOM   4760 O  OD1 . ASN E 2 99  ? 10.784  -2.721  74.750  1.00 50.97  ? 99  ASN E OD1 1 
ATOM   4761 N  ND2 . ASN E 2 99  ? 10.875  -4.951  75.002  1.00 49.23  ? 99  ASN E ND2 1 
ATOM   4762 N  N   . ILE E 2 100 ? 9.143   -4.900  79.750  1.00 44.34  ? 100 ILE E N   1 
ATOM   4763 C  CA  . ILE E 2 100 ? 9.236   -5.200  81.166  1.00 44.94  ? 100 ILE E CA  1 
ATOM   4764 C  C   . ILE E 2 100 ? 10.078  -6.458  81.370  1.00 48.39  ? 100 ILE E C   1 
ATOM   4765 O  O   . ILE E 2 100 ? 9.846   -7.476  80.717  1.00 49.61  ? 100 ILE E O   1 
ATOM   4766 C  CB  . ILE E 2 100 ? 7.830   -5.396  81.760  1.00 44.40  ? 100 ILE E CB  1 
ATOM   4767 C  CG1 . ILE E 2 100 ? 7.045   -4.082  81.686  1.00 43.60  ? 100 ILE E CG1 1 
ATOM   4768 C  CG2 . ILE E 2 100 ? 7.915   -5.907  83.183  1.00 40.80  ? 100 ILE E CG2 1 
ATOM   4769 C  CD1 . ILE E 2 100 ? 5.701   -4.121  82.378  1.00 42.66  ? 100 ILE E CD1 1 
ATOM   4770 N  N   . THR E 2 101 ? 11.067  -6.380  82.257  1.00 48.47  ? 101 THR E N   1 
ATOM   4771 C  CA  . THR E 2 101 ? 11.928  -7.528  82.549  1.00 48.69  ? 101 THR E CA  1 
ATOM   4772 C  C   . THR E 2 101 ? 11.398  -8.337  83.735  1.00 53.65  ? 101 THR E C   1 
ATOM   4773 O  O   . THR E 2 101 ? 11.142  -7.789  84.807  1.00 55.39  ? 101 THR E O   1 
ATOM   4774 C  CB  . THR E 2 101 ? 13.381  -7.097  82.827  1.00 47.53  ? 101 THR E CB  1 
ATOM   4775 O  OG1 . THR E 2 101 ? 13.916  -6.436  81.673  1.00 47.01  ? 101 THR E OG1 1 
ATOM   4776 C  CG2 . THR E 2 101 ? 14.243  -8.305  83.156  1.00 48.90  ? 101 THR E CG2 1 
ATOM   4777 N  N   . VAL E 2 102 ? 11.237  -9.643  83.537  1.00 54.57  ? 102 VAL E N   1 
ATOM   4778 C  CA  . VAL E 2 102 ? 10.681  -10.514 84.569  1.00 53.93  ? 102 VAL E CA  1 
ATOM   4779 C  C   . VAL E 2 102 ? 11.760  -11.105 85.478  1.00 58.64  ? 102 VAL E C   1 
ATOM   4780 O  O   . VAL E 2 102 ? 12.707  -11.737 85.007  1.00 59.58  ? 102 VAL E O   1 
ATOM   4781 C  CB  . VAL E 2 102 ? 9.858   -11.662 83.952  1.00 52.51  ? 102 VAL E CB  1 
ATOM   4782 C  CG1 . VAL E 2 102 ? 9.435   -12.647 85.023  1.00 55.90  ? 102 VAL E CG1 1 
ATOM   4783 C  CG2 . VAL E 2 102 ? 8.646   -11.114 83.229  1.00 53.89  ? 102 VAL E CG2 1 
ATOM   4784 N  N   . HIS E 2 103 ? 11.603  -10.897 86.783  1.00 58.04  ? 103 HIS E N   1 
ATOM   4785 C  CA  . HIS E 2 103 ? 12.543  -11.416 87.769  1.00 57.72  ? 103 HIS E CA  1 
ATOM   4786 C  C   . HIS E 2 103 ? 11.864  -12.365 88.749  1.00 60.02  ? 103 HIS E C   1 
ATOM   4787 O  O   . HIS E 2 103 ? 10.648  -12.313 88.943  1.00 59.38  ? 103 HIS E O   1 
ATOM   4788 C  CB  . HIS E 2 103 ? 13.157  -10.273 88.567  1.00 59.91  ? 103 HIS E CB  1 
ATOM   4789 C  CG  . HIS E 2 103 ? 14.097  -9.414  87.786  1.00 61.08  ? 103 HIS E CG  1 
ATOM   4790 N  ND1 . HIS E 2 103 ? 15.437  -9.315  88.090  1.00 61.93  ? 103 HIS E ND1 1 
ATOM   4791 C  CD2 . HIS E 2 103 ? 13.891  -8.600  86.725  1.00 65.46  ? 103 HIS E CD2 1 
ATOM   4792 C  CE1 . HIS E 2 103 ? 16.019  -8.483  87.246  1.00 65.45  ? 103 HIS E CE1 1 
ATOM   4793 N  NE2 . HIS E 2 103 ? 15.103  -8.038  86.405  1.00 68.92  ? 103 HIS E NE2 1 
ATOM   4794 N  N   . PHE E 2 104 ? 12.664  -13.219 89.378  1.00 66.31  ? 104 PHE E N   1 
ATOM   4795 C  CA  . PHE E 2 104 ? 12.180  -14.090 90.444  1.00 70.03  ? 104 PHE E CA  1 
ATOM   4796 C  C   . PHE E 2 104 ? 13.086  -13.995 91.664  1.00 74.70  ? 104 PHE E C   1 
ATOM   4797 O  O   . PHE E 2 104 ? 12.633  -13.691 92.769  1.00 75.71  ? 104 PHE E O   1 
ATOM   4798 C  CB  . PHE E 2 104 ? 12.110  -15.542 89.973  1.00 67.63  ? 104 PHE E CB  1 
ATOM   4799 C  CG  . PHE E 2 104 ? 10.989  -15.817 89.016  1.00 63.72  ? 104 PHE E CG  1 
ATOM   4800 C  CD1 . PHE E 2 104 ? 9.703   -16.032 89.482  1.00 63.80  ? 104 PHE E CD1 1 
ATOM   4801 C  CD2 . PHE E 2 104 ? 11.223  -15.877 87.653  1.00 60.60  ? 104 PHE E CD2 1 
ATOM   4802 C  CE1 . PHE E 2 104 ? 8.669   -16.294 88.603  1.00 63.18  ? 104 PHE E CE1 1 
ATOM   4803 C  CE2 . PHE E 2 104 ? 10.196  -16.139 86.773  1.00 61.17  ? 104 PHE E CE2 1 
ATOM   4804 C  CZ  . PHE E 2 104 ? 8.916   -16.348 87.248  1.00 62.65  ? 104 PHE E CZ  1 
ATOM   4805 N  N   . LYS E 2 105 ? 14.370  -14.257 91.449  1.00 78.18  ? 105 LYS E N   1 
ATOM   4806 C  CA  . LYS E 2 105 ? 15.353  -14.253 92.524  1.00 80.43  ? 105 LYS E CA  1 
ATOM   4807 C  C   . LYS E 2 105 ? 15.717  -12.821 92.902  1.00 76.81  ? 105 LYS E C   1 
ATOM   4808 O  O   . LYS E 2 105 ? 15.559  -11.905 92.094  1.00 76.64  ? 105 LYS E O   1 
ATOM   4809 C  CB  . LYS E 2 105 ? 16.602  -15.027 92.089  1.00 82.81  ? 105 LYS E CB  1 
ATOM   4810 C  CG  . LYS E 2 105 ? 17.473  -15.527 93.232  1.00 88.79  ? 105 LYS E CG  1 
ATOM   4811 C  CD  . LYS E 2 105 ? 18.530  -16.498 92.726  1.00 91.10  ? 105 LYS E CD  1 
ATOM   4812 C  CE  . LYS E 2 105 ? 19.392  -17.028 93.863  1.00 93.70  ? 105 LYS E CE  1 
ATOM   4813 N  NZ  . LYS E 2 105 ? 20.447  -17.958 93.367  1.00 94.25  ? 105 LYS E NZ  1 
ATOM   4814 N  N   . SER E 2 106 ? 16.179  -12.639 94.138  1.00 73.61  ? 106 SER E N   1 
ATOM   4815 C  CA  . SER E 2 106 ? 16.676  -11.349 94.619  1.00 74.71  ? 106 SER E CA  1 
ATOM   4816 C  C   . SER E 2 106 ? 15.611  -10.245 94.654  1.00 73.04  ? 106 SER E C   1 
ATOM   4817 O  O   . SER E 2 106 ? 15.667  -9.293  93.877  1.00 71.71  ? 106 SER E O   1 
ATOM   4818 C  CB  . SER E 2 106 ? 17.890  -10.900 93.793  1.00 76.99  ? 106 SER E CB  1 
ATOM   4819 O  OG  . SER E 2 106 ? 18.495  -9.744  94.344  1.00 82.29  ? 106 SER E OG  1 
ATOM   4820 N  N   . PHE E 2 107 ? 14.653  -10.374 95.569  1.00 71.38  ? 107 PHE E N   1 
ATOM   4821 C  CA  . PHE E 2 107 ? 13.584  -9.387  95.722  1.00 64.90  ? 107 PHE E CA  1 
ATOM   4822 C  C   . PHE E 2 107 ? 14.094  -8.098  96.371  1.00 66.04  ? 107 PHE E C   1 
ATOM   4823 O  O   . PHE E 2 107 ? 14.720  -8.138  97.429  1.00 69.06  ? 107 PHE E O   1 
ATOM   4824 C  CB  . PHE E 2 107 ? 12.440  -9.976  96.555  1.00 61.21  ? 107 PHE E CB  1 
ATOM   4825 C  CG  . PHE E 2 107 ? 11.147  -9.209  96.447  1.00 63.27  ? 107 PHE E CG  1 
ATOM   4826 C  CD1 . PHE E 2 107 ? 10.175  -9.589  95.531  1.00 60.89  ? 107 PHE E CD1 1 
ATOM   4827 C  CD2 . PHE E 2 107 ? 10.900  -8.111  97.260  1.00 63.58  ? 107 PHE E CD2 1 
ATOM   4828 C  CE1 . PHE E 2 107 ? 8.981   -8.889  95.427  1.00 57.20  ? 107 PHE E CE1 1 
ATOM   4829 C  CE2 . PHE E 2 107 ? 9.709   -7.405  97.158  1.00 61.65  ? 107 PHE E CE2 1 
ATOM   4830 C  CZ  . PHE E 2 107 ? 8.749   -7.797  96.240  1.00 57.52  ? 107 PHE E CZ  1 
ATOM   4831 N  N   . PRO E 2 108 ? 13.826  -6.945  95.734  1.00 69.66  ? 108 PRO E N   1 
ATOM   4832 C  CA  . PRO E 2 108 ? 14.218  -5.630  96.264  1.00 72.90  ? 108 PRO E CA  1 
ATOM   4833 C  C   . PRO E 2 108 ? 13.329  -5.176  97.423  1.00 77.44  ? 108 PRO E C   1 
ATOM   4834 O  O   . PRO E 2 108 ? 12.310  -4.518  97.211  1.00 73.70  ? 108 PRO E O   1 
ATOM   4835 C  CB  . PRO E 2 108 ? 14.043  -4.704  95.058  1.00 67.17  ? 108 PRO E CB  1 
ATOM   4836 C  CG  . PRO E 2 108 ? 13.007  -5.372  94.222  1.00 64.45  ? 108 PRO E CG  1 
ATOM   4837 C  CD  . PRO E 2 108 ? 13.217  -6.845  94.395  1.00 65.04  ? 108 PRO E CD  1 
ATOM   4838 N  N   . GLU E 2 109 ? 13.737  -5.519  98.642  1.00 84.88  ? 109 GLU E N   1 
ATOM   4839 C  CA  . GLU E 2 109 ? 12.923  -5.307  99.837  1.00 86.60  ? 109 GLU E CA  1 
ATOM   4840 C  C   . GLU E 2 109 ? 12.587  -3.842  100.121 1.00 86.15  ? 109 GLU E C   1 
ATOM   4841 O  O   . GLU E 2 109 ? 11.533  -3.540  100.681 1.00 83.11  ? 109 GLU E O   1 
ATOM   4842 C  CB  . GLU E 2 109 ? 13.616  -5.921  101.057 1.00 89.70  ? 109 GLU E CB  1 
ATOM   4843 C  CG  . GLU E 2 109 ? 13.812  -7.427  100.974 1.00 92.93  ? 109 GLU E CG  1 
ATOM   4844 C  CD  . GLU E 2 109 ? 12.512  -8.197  101.118 1.00 94.70  ? 109 GLU E CD  1 
ATOM   4845 O  OE1 . GLU E 2 109 ? 11.514  -7.598  101.571 1.00 93.98  ? 109 GLU E OE1 1 
ATOM   4846 O  OE2 . GLU E 2 109 ? 12.487  -9.401  100.781 1.00 95.67  ? 109 GLU E OE2 1 
ATOM   4847 N  N   . LYS E 2 110 ? 13.482  -2.938  99.730  1.00 87.31  ? 110 LYS E N   1 
ATOM   4848 C  CA  . LYS E 2 110 ? 13.347  -1.526  100.079 1.00 86.40  ? 110 LYS E CA  1 
ATOM   4849 C  C   . LYS E 2 110 ? 12.642  -0.699  99.010  1.00 84.96  ? 110 LYS E C   1 
ATOM   4850 O  O   . LYS E 2 110 ? 12.334  0.472   99.231  1.00 86.71  ? 110 LYS E O   1 
ATOM   4851 C  CB  . LYS E 2 110 ? 14.721  -0.919  100.364 1.00 87.63  ? 110 LYS E CB  1 
ATOM   4852 C  CG  . LYS E 2 110 ? 15.481  -1.587  101.494 1.00 91.15  ? 110 LYS E CG  1 
ATOM   4853 C  CD  . LYS E 2 110 ? 16.971  -1.465  101.255 1.00 97.98  ? 110 LYS E CD  1 
ATOM   4854 C  CE  . LYS E 2 110 ? 17.342  -2.063  99.903  1.00 100.14 ? 110 LYS E CE  1 
ATOM   4855 N  NZ  . LYS E 2 110 ? 18.727  -1.719  99.488  1.00 100.78 ? 110 LYS E NZ  1 
ATOM   4856 N  N   . ASP E 2 111 ? 12.393  -1.303  97.853  1.00 82.71  ? 111 ASP E N   1 
ATOM   4857 C  CA  . ASP E 2 111 ? 11.763  -0.589  96.747  1.00 81.40  ? 111 ASP E CA  1 
ATOM   4858 C  C   . ASP E 2 111 ? 10.299  -0.982  96.570  1.00 78.90  ? 111 ASP E C   1 
ATOM   4859 O  O   . ASP E 2 111 ? 9.450   -0.137  96.286  1.00 80.47  ? 111 ASP E O   1 
ATOM   4860 C  CB  . ASP E 2 111 ? 12.530  -0.829  95.441  1.00 81.19  ? 111 ASP E CB  1 
ATOM   4861 C  CG  . ASP E 2 111 ? 13.908  -0.191  95.443  1.00 82.54  ? 111 ASP E CG  1 
ATOM   4862 O  OD1 . ASP E 2 111 ? 14.026  0.978   95.017  1.00 83.11  ? 111 ASP E OD1 1 
ATOM   4863 O  OD2 . ASP E 2 111 ? 14.875  -0.858  95.865  1.00 84.93  ? 111 ASP E OD2 1 
ATOM   4864 N  N   . LEU E 2 112 ? 10.009  -2.268  96.737  1.00 74.88  ? 112 LEU E N   1 
ATOM   4865 C  CA  . LEU E 2 112 ? 8.666   -2.779  96.498  1.00 71.02  ? 112 LEU E CA  1 
ATOM   4866 C  C   . LEU E 2 112 ? 8.025   -3.327  97.761  1.00 71.25  ? 112 LEU E C   1 
ATOM   4867 O  O   . LEU E 2 112 ? 8.715   -3.687  98.713  1.00 73.54  ? 112 LEU E O   1 
ATOM   4868 C  CB  . LEU E 2 112 ? 8.698   -3.891  95.450  1.00 67.50  ? 112 LEU E CB  1 
ATOM   4869 C  CG  . LEU E 2 112 ? 9.344   -3.600  94.099  1.00 63.85  ? 112 LEU E CG  1 
ATOM   4870 C  CD1 . LEU E 2 112 ? 9.202   -4.810  93.195  1.00 59.55  ? 112 LEU E CD1 1 
ATOM   4871 C  CD2 . LEU E 2 112 ? 8.719   -2.373  93.465  1.00 68.20  ? 112 LEU E CD2 1 
ATOM   4872 N  N   . LEU E 2 113 ? 6.697   -3.391  97.751  1.00 72.52  ? 113 LEU E N   1 
ATOM   4873 C  CA  . LEU E 2 113 ? 5.945   -4.081  98.789  1.00 68.98  ? 113 LEU E CA  1 
ATOM   4874 C  C   . LEU E 2 113 ? 5.634   -5.481  98.286  1.00 69.20  ? 113 LEU E C   1 
ATOM   4875 O  O   . LEU E 2 113 ? 5.238   -5.652  97.132  1.00 67.73  ? 113 LEU E O   1 
ATOM   4876 C  CB  . LEU E 2 113 ? 4.634   -3.356  99.083  1.00 66.21  ? 113 LEU E CB  1 
ATOM   4877 C  CG  . LEU E 2 113 ? 4.675   -1.844  99.285  1.00 67.21  ? 113 LEU E CG  1 
ATOM   4878 C  CD1 . LEU E 2 113 ? 3.297   -1.339  99.684  1.00 64.88  ? 113 LEU E CD1 1 
ATOM   4879 C  CD2 . LEU E 2 113 ? 5.718   -1.464  100.322 1.00 70.95  ? 113 LEU E CD2 1 
ATOM   4880 N  N   . HIS E 2 114 ? 5.816   -6.479  99.145  1.00 68.44  ? 114 HIS E N   1 
ATOM   4881 C  CA  . HIS E 2 114 ? 5.516   -7.859  98.785  1.00 68.68  ? 114 HIS E CA  1 
ATOM   4882 C  C   . HIS E 2 114 ? 4.048   -8.029  98.415  1.00 72.11  ? 114 HIS E C   1 
ATOM   4883 O  O   . HIS E 2 114 ? 3.183   -7.303  98.905  1.00 71.93  ? 114 HIS E O   1 
ATOM   4884 C  CB  . HIS E 2 114 ? 5.863   -8.805  99.934  1.00 72.40  ? 114 HIS E CB  1 
ATOM   4885 C  CG  . HIS E 2 114 ? 7.320   -8.835  100.272 1.00 76.55  ? 114 HIS E CG  1 
ATOM   4886 N  ND1 . HIS E 2 114 ? 8.215   -9.666  99.633  1.00 76.46  ? 114 HIS E ND1 1 
ATOM   4887 C  CD2 . HIS E 2 114 ? 8.039   -8.136  101.182 1.00 76.92  ? 114 HIS E CD2 1 
ATOM   4888 C  CE1 . HIS E 2 114 ? 9.422   -9.478  100.135 1.00 78.30  ? 114 HIS E CE1 1 
ATOM   4889 N  NE2 . HIS E 2 114 ? 9.342   -8.555  101.076 1.00 78.61  ? 114 HIS E NE2 1 
ATOM   4890 N  N   . CYS E 2 115 ? 3.773   -8.991  97.544  1.00 74.13  ? 115 CYS E N   1 
ATOM   4891 C  CA  . CYS E 2 115 ? 2.404   -9.291  97.158  1.00 72.53  ? 115 CYS E CA  1 
ATOM   4892 C  C   . CYS E 2 115 ? 2.145   -10.781 97.333  1.00 76.49  ? 115 CYS E C   1 
ATOM   4893 O  O   . CYS E 2 115 ? 2.149   -11.536 96.361  1.00 77.94  ? 115 CYS E O   1 
ATOM   4894 C  CB  . CYS E 2 115 ? 2.152   -8.865  95.714  1.00 70.29  ? 115 CYS E CB  1 
ATOM   4895 S  SG  . CYS E 2 115 ? 0.419   -8.911  95.235  1.00 69.91  ? 115 CYS E SG  1 
ATOM   4896 N  N   . PRO E 2 116 ? 1.915   -11.207 98.586  1.00 79.87  ? 116 PRO E N   1 
ATOM   4897 C  CA  . PRO E 2 116 ? 1.805   -12.624 98.950  1.00 78.65  ? 116 PRO E CA  1 
ATOM   4898 C  C   . PRO E 2 116 ? 0.574   -13.298 98.360  1.00 79.98  ? 116 PRO E C   1 
ATOM   4899 O  O   . PRO E 2 116 ? 0.598   -14.505 98.120  1.00 84.33  ? 116 PRO E O   1 
ATOM   4900 C  CB  . PRO E 2 116 ? 1.698   -12.579 100.477 1.00 77.56  ? 116 PRO E CB  1 
ATOM   4901 C  CG  . PRO E 2 116 ? 1.114   -11.247 100.772 1.00 76.34  ? 116 PRO E CG  1 
ATOM   4902 C  CD  . PRO E 2 116 ? 1.699   -10.324 99.746  1.00 78.46  ? 116 PRO E CD  1 
ATOM   4903 N  N   . SER E 2 117 ? -0.487  -12.535 98.128  1.00 79.14  ? 117 SER E N   1 
ATOM   4904 C  CA  . SER E 2 117 ? -1.723  -13.113 97.616  1.00 78.05  ? 117 SER E CA  1 
ATOM   4905 C  C   . SER E 2 117 ? -2.552  -12.097 96.846  1.00 78.58  ? 117 SER E C   1 
ATOM   4906 O  O   . SER E 2 117 ? -2.226  -10.909 96.809  1.00 76.77  ? 117 SER E O   1 
ATOM   4907 C  CB  . SER E 2 117 ? -2.558  -13.675 98.765  1.00 75.43  ? 117 SER E CB  1 
ATOM   4908 O  OG  . SER E 2 117 ? -2.966  -12.635 99.635  1.00 75.11  ? 117 SER E OG  1 
ATOM   4909 N  N   . LYS E 2 118 ? -3.631  -12.578 96.237  1.00 77.61  ? 118 LYS E N   1 
ATOM   4910 C  CA  . LYS E 2 118 ? -4.573  -11.702 95.558  1.00 75.43  ? 118 LYS E CA  1 
ATOM   4911 C  C   . LYS E 2 118 ? -5.511  -11.040 96.563  1.00 73.71  ? 118 LYS E C   1 
ATOM   4912 O  O   . LYS E 2 118 ? -6.230  -10.101 96.226  1.00 73.25  ? 118 LYS E O   1 
ATOM   4913 C  CB  . LYS E 2 118 ? -5.355  -12.466 94.489  1.00 77.87  ? 118 LYS E CB  1 
ATOM   4914 C  CG  . LYS E 2 118 ? -4.483  -12.935 93.333  1.00 80.72  ? 118 LYS E CG  1 
ATOM   4915 C  CD  . LYS E 2 118 ? -5.297  -13.531 92.194  1.00 79.17  ? 118 LYS E CD  1 
ATOM   4916 C  CE  . LYS E 2 118 ? -4.383  -13.956 91.051  1.00 78.89  ? 118 LYS E CE  1 
ATOM   4917 N  NZ  . LYS E 2 118 ? -5.140  -14.440 89.866  1.00 80.29  ? 118 LYS E NZ  1 
ATOM   4918 N  N   . ASP E 2 119 ? -5.494  -11.528 97.800  1.00 73.34  ? 119 ASP E N   1 
ATOM   4919 C  CA  . ASP E 2 119 ? -6.224  -10.874 98.879  1.00 75.69  ? 119 ASP E CA  1 
ATOM   4920 C  C   . ASP E 2 119 ? -5.493  -9.603  99.294  1.00 68.90  ? 119 ASP E C   1 
ATOM   4921 O  O   . ASP E 2 119 ? -6.111  -8.634  99.737  1.00 68.45  ? 119 ASP E O   1 
ATOM   4922 C  CB  . ASP E 2 119 ? -6.378  -11.805 100.084 1.00 85.54  ? 119 ASP E CB  1 
ATOM   4923 C  CG  . ASP E 2 119 ? -7.359  -12.930 99.831  1.00 92.90  ? 119 ASP E CG  1 
ATOM   4924 O  OD1 . ASP E 2 119 ? -6.910  -14.038 99.467  1.00 97.35  ? 119 ASP E OD1 1 
ATOM   4925 O  OD2 . ASP E 2 119 ? -8.578  -12.705 99.998  1.00 93.38  ? 119 ASP E OD2 1 
ATOM   4926 N  N   . ALA E 2 120 ? -4.171  -9.618  99.150  1.00 60.75  ? 120 ALA E N   1 
ATOM   4927 C  CA  . ALA E 2 120 ? -3.357  -8.452  99.457  1.00 54.49  ? 120 ALA E CA  1 
ATOM   4928 C  C   . ALA E 2 120 ? -3.664  -7.320  98.482  1.00 59.47  ? 120 ALA E C   1 
ATOM   4929 O  O   . ALA E 2 120 ? -3.669  -6.147  98.859  1.00 66.42  ? 120 ALA E O   1 
ATOM   4930 C  CB  . ALA E 2 120 ? -1.884  -8.808  99.414  1.00 48.55  ? 120 ALA E CB  1 
ATOM   4931 N  N   . ILE E 2 121 ? -3.924  -7.678  97.228  1.00 54.70  ? 121 ILE E N   1 
ATOM   4932 C  CA  . ILE E 2 121 ? -4.280  -6.695  96.215  1.00 57.76  ? 121 ILE E CA  1 
ATOM   4933 C  C   . ILE E 2 121 ? -5.668  -6.124  96.485  1.00 61.56  ? 121 ILE E C   1 
ATOM   4934 O  O   . ILE E 2 121 ? -5.874  -4.914  96.394  1.00 61.18  ? 121 ILE E O   1 
ATOM   4935 C  CB  . ILE E 2 121 ? -4.249  -7.293  94.794  1.00 57.07  ? 121 ILE E CB  1 
ATOM   4936 C  CG1 . ILE E 2 121 ? -2.907  -7.979  94.533  1.00 56.36  ? 121 ILE E CG1 1 
ATOM   4937 C  CG2 . ILE E 2 121 ? -4.500  -6.212  93.755  1.00 53.72  ? 121 ILE E CG2 1 
ATOM   4938 C  CD1 . ILE E 2 121 ? -2.844  -8.718  93.218  1.00 55.18  ? 121 ILE E CD1 1 
ATOM   4939 N  N   . GLU E 2 122 ? -6.612  -7.000  96.823  1.00 65.14  ? 122 GLU E N   1 
ATOM   4940 C  CA  . GLU E 2 122 ? -7.982  -6.580  97.110  1.00 66.05  ? 122 GLU E CA  1 
ATOM   4941 C  C   . GLU E 2 122 ? -8.016  -5.601  98.279  1.00 66.70  ? 122 GLU E C   1 
ATOM   4942 O  O   . GLU E 2 122 ? -8.689  -4.569  98.218  1.00 66.20  ? 122 GLU E O   1 
ATOM   4943 C  CB  . GLU E 2 122 ? -8.883  -7.786  97.401  1.00 68.12  ? 122 GLU E CB  1 
ATOM   4944 C  CG  . GLU E 2 122 ? -10.350 -7.418  97.632  1.00 72.93  ? 122 GLU E CG  1 
ATOM   4945 C  CD  . GLU E 2 122 ? -11.254 -8.627  97.835  1.00 75.72  ? 122 GLU E CD  1 
ATOM   4946 O  OE1 . GLU E 2 122 ? -10.741 -9.764  97.908  1.00 78.49  ? 122 GLU E OE1 1 
ATOM   4947 O  OE2 . GLU E 2 122 ? -12.487 -8.437  97.921  1.00 74.94  ? 122 GLU E OE2 1 
ATOM   4948 N  N   . ALA E 2 123 ? -7.277  -5.930  99.334  1.00 62.39  ? 123 ALA E N   1 
ATOM   4949 C  CA  . ALA E 2 123 ? -7.175  -5.070  100.505 1.00 59.81  ? 123 ALA E CA  1 
ATOM   4950 C  C   . ALA E 2 123 ? -6.600  -3.706  100.137 1.00 60.24  ? 123 ALA E C   1 
ATOM   4951 O  O   . ALA E 2 123 ? -7.082  -2.674  100.606 1.00 62.66  ? 123 ALA E O   1 
ATOM   4952 C  CB  . ALA E 2 123 ? -6.325  -5.729  101.572 1.00 44.65  ? 123 ALA E CB  1 
ATOM   4953 N  N   . HIS E 2 124 ? -5.571  -3.702  99.295  1.00 55.77  ? 124 HIS E N   1 
ATOM   4954 C  CA  . HIS E 2 124 ? -4.943  -2.451  98.895  1.00 53.82  ? 124 HIS E CA  1 
ATOM   4955 C  C   . HIS E 2 124 ? -5.892  -1.631  98.037  1.00 54.66  ? 124 HIS E C   1 
ATOM   4956 O  O   . HIS E 2 124 ? -5.985  -0.413  98.184  1.00 59.27  ? 124 HIS E O   1 
ATOM   4957 C  CB  . HIS E 2 124 ? -3.638  -2.699  98.142  1.00 55.13  ? 124 HIS E CB  1 
ATOM   4958 C  CG  . HIS E 2 124 ? -2.898  -1.444  97.803  1.00 62.99  ? 124 HIS E CG  1 
ATOM   4959 N  ND1 . HIS E 2 124 ? -3.116  -0.745  96.635  1.00 67.04  ? 124 HIS E ND1 1 
ATOM   4960 C  CD2 . HIS E 2 124 ? -1.957  -0.751  98.487  1.00 65.61  ? 124 HIS E CD2 1 
ATOM   4961 C  CE1 . HIS E 2 124 ? -2.337  0.322   96.611  1.00 68.74  ? 124 HIS E CE1 1 
ATOM   4962 N  NE2 . HIS E 2 124 ? -1.621  0.340   97.721  1.00 69.18  ? 124 HIS E NE2 1 
ATOM   4963 N  N   . PHE E 2 125 ? -6.597  -2.311  97.143  1.00 52.99  ? 125 PHE E N   1 
ATOM   4964 C  CA  . PHE E 2 125 ? -7.576  -1.660  96.292  1.00 53.59  ? 125 PHE E CA  1 
ATOM   4965 C  C   . PHE E 2 125 ? -8.685  -1.041  97.130  1.00 58.29  ? 125 PHE E C   1 
ATOM   4966 O  O   . PHE E 2 125 ? -9.108  0.086   96.874  1.00 62.42  ? 125 PHE E O   1 
ATOM   4967 C  CB  . PHE E 2 125 ? -8.166  -2.657  95.294  1.00 55.32  ? 125 PHE E CB  1 
ATOM   4968 C  CG  . PHE E 2 125 ? -9.204  -2.061  94.386  1.00 56.00  ? 125 PHE E CG  1 
ATOM   4969 C  CD1 . PHE E 2 125 ? -8.842  -1.191  93.369  1.00 51.58  ? 125 PHE E CD1 1 
ATOM   4970 C  CD2 . PHE E 2 125 ? -10.544 -2.376  94.547  1.00 60.14  ? 125 PHE E CD2 1 
ATOM   4971 C  CE1 . PHE E 2 125 ? -9.797  -0.642  92.531  1.00 53.37  ? 125 PHE E CE1 1 
ATOM   4972 C  CE2 . PHE E 2 125 ? -11.506 -1.830  93.709  1.00 61.63  ? 125 PHE E CE2 1 
ATOM   4973 C  CZ  . PHE E 2 125 ? -11.130 -0.962  92.699  1.00 57.39  ? 125 PHE E CZ  1 
ATOM   4974 N  N   . MET E 2 126 ? -9.150  -1.776  98.135  1.00 57.47  ? 126 MET E N   1 
ATOM   4975 C  CA  . MET E 2 126 ? -10.217 -1.283  98.996  1.00 58.41  ? 126 MET E CA  1 
ATOM   4976 C  C   . MET E 2 126 ? -9.736  -0.143  99.881  1.00 60.36  ? 126 MET E C   1 
ATOM   4977 O  O   . MET E 2 126 ? -10.512 0.743   100.239 1.00 64.10  ? 126 MET E O   1 
ATOM   4978 C  CB  . MET E 2 126 ? -10.794 -2.410  99.854  1.00 61.05  ? 126 MET E CB  1 
ATOM   4979 C  CG  . MET E 2 126 ? -11.574 -3.452  99.069  1.00 64.64  ? 126 MET E CG  1 
ATOM   4980 S  SD  . MET E 2 126 ? -12.910 -2.735  98.090  1.00 87.66  ? 126 MET E SD  1 
ATOM   4981 C  CE  . MET E 2 126 ? -13.890 -1.964  99.377  1.00 84.13  ? 126 MET E CE  1 
ATOM   4982 N  N   . SER E 2 127 ? -8.454  -0.168  100.229 1.00 59.81  ? 127 SER E N   1 
ATOM   4983 C  CA  . SER E 2 127 ? -7.866  0.867   101.072 1.00 59.03  ? 127 SER E CA  1 
ATOM   4984 C  C   . SER E 2 127 ? -7.771  2.182   100.319 1.00 61.45  ? 127 SER E C   1 
ATOM   4985 O  O   . SER E 2 127 ? -7.810  3.259   100.917 1.00 62.75  ? 127 SER E O   1 
ATOM   4986 C  CB  . SER E 2 127 ? -6.480  0.444   101.549 1.00 58.63  ? 127 SER E CB  1 
ATOM   4987 O  OG  . SER E 2 127 ? -6.576  -0.593  102.507 1.00 60.26  ? 127 SER E OG  1 
ATOM   4988 N  N   . CYS E 2 128 ? -7.640  2.084   99.000  1.00 59.95  ? 128 CYS E N   1 
ATOM   4989 C  CA  . CYS E 2 128 ? -7.597  3.262   98.151  1.00 57.32  ? 128 CYS E CA  1 
ATOM   4990 C  C   . CYS E 2 128 ? -8.995  3.838   97.970  1.00 56.62  ? 128 CYS E C   1 
ATOM   4991 O  O   . CYS E 2 128 ? -9.180  5.052   98.013  1.00 59.36  ? 128 CYS E O   1 
ATOM   4992 C  CB  . CYS E 2 128 ? -6.966  2.934   96.796  1.00 58.85  ? 128 CYS E CB  1 
ATOM   4993 S  SG  . CYS E 2 128 ? -5.192  2.582   96.862  1.00 86.15  ? 128 CYS E SG  1 
ATOM   4994 N  N   . MET E 2 129 ? -9.980  2.965   97.779  1.00 57.22  ? 129 MET E N   1 
ATOM   4995 C  CA  . MET E 2 129 ? -11.361 3.408   97.620  1.00 61.30  ? 129 MET E CA  1 
ATOM   4996 C  C   . MET E 2 129 ? -11.887 4.076   98.885  1.00 67.62  ? 129 MET E C   1 
ATOM   4997 O  O   . MET E 2 129 ? -12.468 5.157   98.822  1.00 73.18  ? 129 MET E O   1 
ATOM   4998 C  CB  . MET E 2 129 ? -12.279 2.246   97.233  1.00 63.01  ? 129 MET E CB  1 
ATOM   4999 C  CG  . MET E 2 129 ? -11.877 1.521   95.967  1.00 65.18  ? 129 MET E CG  1 
ATOM   5000 S  SD  . MET E 2 129 ? -13.286 0.747   95.154  1.00 76.21  ? 129 MET E SD  1 
ATOM   5001 C  CE  . MET E 2 129 ? -14.049 2.176   94.417  1.00 75.67  ? 129 MET E CE  1 
ATOM   5002 N  N   . LYS E 2 130 ? -11.686 3.430   100.031 1.00 67.48  ? 130 LYS E N   1 
ATOM   5003 C  CA  . LYS E 2 130 ? -12.191 3.963   101.291 1.00 68.52  ? 130 LYS E CA  1 
ATOM   5004 C  C   . LYS E 2 130 ? -11.508 5.279   101.651 1.00 68.72  ? 130 LYS E C   1 
ATOM   5005 O  O   . LYS E 2 130 ? -12.118 6.151   102.265 1.00 73.88  ? 130 LYS E O   1 
ATOM   5006 C  CB  . LYS E 2 130 ? -12.046 2.941   102.424 1.00 67.21  ? 130 LYS E CB  1 
ATOM   5007 C  CG  . LYS E 2 130 ? -12.860 1.675   102.212 1.00 65.29  ? 130 LYS E CG  1 
ATOM   5008 C  CD  . LYS E 2 130 ? -12.754 0.719   103.389 1.00 67.17  ? 130 LYS E CD  1 
ATOM   5009 C  CE  . LYS E 2 130 ? -13.707 1.098   104.520 1.00 75.98  ? 130 LYS E CE  1 
ATOM   5010 N  NZ  . LYS E 2 130 ? -13.741 0.048   105.589 1.00 81.82  ? 130 LYS E NZ  1 
ATOM   5011 N  N   . GLU E 2 131 ? -10.245 5.421   101.258 1.00 66.00  ? 131 GLU E N   1 
ATOM   5012 C  CA  . GLU E 2 131 ? -9.508  6.661   101.487 1.00 64.27  ? 131 GLU E CA  1 
ATOM   5013 C  C   . GLU E 2 131 ? -10.007 7.758   100.551 1.00 63.94  ? 131 GLU E C   1 
ATOM   5014 O  O   . GLU E 2 131 ? -10.031 8.937   100.909 1.00 63.10  ? 131 GLU E O   1 
ATOM   5015 C  CB  . GLU E 2 131 ? -8.006  6.439   101.293 1.00 60.43  ? 131 GLU E CB  1 
ATOM   5016 C  CG  . GLU E 2 131 ? -7.164  7.702   101.380 1.00 60.49  ? 131 GLU E CG  1 
ATOM   5017 C  CD  . GLU E 2 131 ? -5.674  7.409   101.372 1.00 68.49  ? 131 GLU E CD  1 
ATOM   5018 O  OE1 . GLU E 2 131 ? -5.296  6.239   101.602 1.00 72.52  ? 131 GLU E OE1 1 
ATOM   5019 O  OE2 . GLU E 2 131 ? -4.881  8.346   101.138 1.00 69.61  ? 131 GLU E OE2 1 
ATOM   5020 N  N   . ALA E 2 132 ? -10.406 7.359   99.349  1.00 61.96  ? 132 ALA E N   1 
ATOM   5021 C  CA  . ALA E 2 132 ? -10.981 8.291   98.392  1.00 64.14  ? 132 ALA E CA  1 
ATOM   5022 C  C   . ALA E 2 132 ? -12.330 8.800   98.881  1.00 70.81  ? 132 ALA E C   1 
ATOM   5023 O  O   . ALA E 2 132 ? -12.589 10.004  98.872  1.00 78.37  ? 132 ALA E O   1 
ATOM   5024 C  CB  . ALA E 2 132 ? -11.125 7.635   97.031  1.00 62.13  ? 132 ALA E CB  1 
ATOM   5025 N  N   . ASP E 2 133 ? -13.188 7.883   99.318  1.00 68.01  ? 133 ASP E N   1 
ATOM   5026 C  CA  . ASP E 2 133 ? -14.525 8.260   99.756  1.00 68.89  ? 133 ASP E CA  1 
ATOM   5027 C  C   . ASP E 2 133 ? -14.481 9.078   101.040 1.00 71.49  ? 133 ASP E C   1 
ATOM   5028 O  O   . ASP E 2 133 ? -15.418 9.819   101.342 1.00 76.93  ? 133 ASP E O   1 
ATOM   5029 C  CB  . ASP E 2 133 ? -15.415 7.034   99.945  1.00 71.46  ? 133 ASP E CB  1 
ATOM   5030 C  CG  . ASP E 2 133 ? -16.890 7.383   99.901  1.00 78.63  ? 133 ASP E CG  1 
ATOM   5031 O  OD1 . ASP E 2 133 ? -17.284 8.174   99.016  1.00 81.77  ? 133 ASP E OD1 1 
ATOM   5032 O  OD2 . ASP E 2 133 ? -17.654 6.880   100.751 1.00 81.25  ? 133 ASP E OD2 1 
ATOM   5033 N  N   . ALA E 2 134 ? -13.393 8.934   101.792 1.00 65.37  ? 134 ALA E N   1 
ATOM   5034 C  CA  . ALA E 2 134 ? -13.177 9.725   102.995 1.00 61.44  ? 134 ALA E CA  1 
ATOM   5035 C  C   . ALA E 2 134 ? -12.981 11.189  102.622 1.00 64.33  ? 134 ALA E C   1 
ATOM   5036 O  O   . ALA E 2 134 ? -13.458 12.087  103.312 1.00 67.70  ? 134 ALA E O   1 
ATOM   5037 C  CB  . ALA E 2 134 ? -11.974 9.207   103.764 1.00 56.87  ? 134 ALA E CB  1 
ATOM   5038 N  N   . LEU E 2 135 ? -12.280 11.423  101.518 1.00 62.79  ? 135 LEU E N   1 
ATOM   5039 C  CA  . LEU E 2 135 ? -12.066 12.777  101.024 1.00 65.74  ? 135 LEU E CA  1 
ATOM   5040 C  C   . LEU E 2 135 ? -13.325 13.332  100.357 1.00 71.04  ? 135 LEU E C   1 
ATOM   5041 O  O   . LEU E 2 135 ? -13.625 14.523  100.471 1.00 72.80  ? 135 LEU E O   1 
ATOM   5042 C  CB  . LEU E 2 135 ? -10.894 12.808  100.039 1.00 62.32  ? 135 LEU E CB  1 
ATOM   5043 C  CG  . LEU E 2 135 ? -9.495  12.568  100.614 1.00 60.57  ? 135 LEU E CG  1 
ATOM   5044 C  CD1 . LEU E 2 135 ? -8.478  12.370  99.502  1.00 59.87  ? 135 LEU E CD1 1 
ATOM   5045 C  CD2 . LEU E 2 135 ? -9.084  13.724  101.502 1.00 60.68  ? 135 LEU E CD2 1 
ATOM   5046 N  N   . LYS E 2 136 ? -14.064 12.465  99.671  1.00 67.29  ? 136 LYS E N   1 
ATOM   5047 C  CA  . LYS E 2 136 ? -15.215 12.900  98.883  1.00 66.24  ? 136 LYS E CA  1 
ATOM   5048 C  C   . LYS E 2 136 ? -16.515 13.041  99.675  1.00 67.95  ? 136 LYS E C   1 
ATOM   5049 O  O   . LYS E 2 136 ? -17.320 13.932  99.396  1.00 65.36  ? 136 LYS E O   1 
ATOM   5050 C  CB  . LYS E 2 136 ? -15.441 11.960  97.697  1.00 62.24  ? 136 LYS E CB  1 
ATOM   5051 C  CG  . LYS E 2 136 ? -14.337 11.997  96.658  1.00 61.68  ? 136 LYS E CG  1 
ATOM   5052 C  CD  . LYS E 2 136 ? -14.728 11.241  95.397  1.00 56.82  ? 136 LYS E CD  1 
ATOM   5053 C  CE  . LYS E 2 136 ? -15.045 9.789   95.698  1.00 57.85  ? 136 LYS E CE  1 
ATOM   5054 N  NZ  . LYS E 2 136 ? -15.446 9.057   94.469  1.00 58.00  ? 136 LYS E NZ  1 
ATOM   5055 N  N   . HIS E 2 137 ? -16.728 12.159  100.647 1.00 67.31  ? 137 HIS E N   1 
ATOM   5056 C  CA  . HIS E 2 137 ? -18.000 12.125  101.361 1.00 71.25  ? 137 HIS E CA  1 
ATOM   5057 C  C   . HIS E 2 137 ? -17.857 11.915  102.867 1.00 78.81  ? 137 HIS E C   1 
ATOM   5058 O  O   . HIS E 2 137 ? -18.837 11.583  103.535 1.00 81.79  ? 137 HIS E O   1 
ATOM   5059 C  CB  . HIS E 2 137 ? -18.888 11.016  100.798 1.00 70.87  ? 137 HIS E CB  1 
ATOM   5060 C  CG  . HIS E 2 137 ? -19.142 11.128  99.328  1.00 76.63  ? 137 HIS E CG  1 
ATOM   5061 N  ND1 . HIS E 2 137 ? -18.616 10.241  98.413  1.00 78.17  ? 137 HIS E ND1 1 
ATOM   5062 C  CD2 . HIS E 2 137 ? -19.869 12.020  98.615  1.00 80.06  ? 137 HIS E CD2 1 
ATOM   5063 C  CE1 . HIS E 2 137 ? -19.008 10.583  97.199  1.00 79.87  ? 137 HIS E CE1 1 
ATOM   5064 N  NE2 . HIS E 2 137 ? -19.769 11.659  97.293  1.00 81.05  ? 137 HIS E NE2 1 
ATOM   5065 N  N   . LYS E 2 138 ? -16.652 12.112  103.394 1.00 76.78  ? 138 LYS E N   1 
ATOM   5066 C  CA  . LYS E 2 138 ? -16.349 11.754  104.780 1.00 81.30  ? 138 LYS E CA  1 
ATOM   5067 C  C   . LYS E 2 138 ? -16.712 10.290  105.047 1.00 84.81  ? 138 LYS E C   1 
ATOM   5068 O  O   . LYS E 2 138 ? -17.311 9.966   106.072 1.00 89.72  ? 138 LYS E O   1 
ATOM   5069 C  CB  . LYS E 2 138 ? -17.064 12.682  105.775 1.00 82.40  ? 138 LYS E CB  1 
ATOM   5070 C  CG  . LYS E 2 138 ? -16.577 14.128  105.766 1.00 83.36  ? 138 LYS E CG  1 
ATOM   5071 C  CD  . LYS E 2 138 ? -17.368 14.984  106.752 1.00 84.91  ? 138 LYS E CD  1 
ATOM   5072 C  CE  . LYS E 2 138 ? -16.918 16.442  106.733 1.00 84.40  ? 138 LYS E CE  1 
ATOM   5073 N  NZ  . LYS E 2 138 ? -17.728 17.310  107.645 1.00 81.74  ? 138 LYS E NZ  1 
ATOM   5074 N  N   . SER E 2 139 ? -16.364 9.425   104.094 1.00 81.93  ? 139 SER E N   1 
ATOM   5075 C  CA  . SER E 2 139 ? -16.569 7.976   104.191 1.00 79.94  ? 139 SER E CA  1 
ATOM   5076 C  C   . SER E 2 139 ? -18.037 7.532   104.181 1.00 82.94  ? 139 SER E C   1 
ATOM   5077 O  O   . SER E 2 139 ? -18.328 6.339   104.253 1.00 83.43  ? 139 SER E O   1 
ATOM   5078 C  CB  . SER E 2 139 ? -15.851 7.400   105.419 1.00 78.44  ? 139 SER E CB  1 
ATOM   5079 O  OG  . SER E 2 139 ? -14.461 7.669   105.376 1.00 79.55  ? 139 SER E OG  1 
ATOM   5080 N  N   . GLN E 2 140 ? -18.955 8.486   104.069 1.00 86.70  ? 140 GLN E N   1 
ATOM   5081 C  CA  . GLN E 2 140 ? -20.383 8.200   104.216 1.00 89.35  ? 140 GLN E CA  1 
ATOM   5082 C  C   . GLN E 2 140 ? -20.970 7.258   103.162 1.00 87.10  ? 140 GLN E C   1 
ATOM   5083 O  O   . GLN E 2 140 ? -21.772 6.386   103.489 1.00 88.39  ? 140 GLN E O   1 
ATOM   5084 C  CB  . GLN E 2 140 ? -21.187 9.502   104.276 1.00 92.06  ? 140 GLN E CB  1 
ATOM   5085 C  CG  . GLN E 2 140 ? -20.954 10.291  105.554 1.00 97.24  ? 140 GLN E CG  1 
ATOM   5086 C  CD  . GLN E 2 140 ? -21.498 11.702  105.483 1.00 102.27 ? 140 GLN E CD  1 
ATOM   5087 O  OE1 . GLN E 2 140 ? -21.840 12.195  104.408 1.00 104.68 ? 140 GLN E OE1 1 
ATOM   5088 N  NE2 . GLN E 2 140 ? -21.579 12.363  106.631 1.00 104.74 ? 140 GLN E NE2 1 
ATOM   5089 N  N   . VAL E 2 141 ? -20.574 7.428   101.904 1.00 81.82  ? 141 VAL E N   1 
ATOM   5090 C  CA  . VAL E 2 141 ? -21.140 6.620   100.823 1.00 76.51  ? 141 VAL E CA  1 
ATOM   5091 C  C   . VAL E 2 141 ? -20.655 5.166   100.836 1.00 75.04  ? 141 VAL E C   1 
ATOM   5092 O  O   . VAL E 2 141 ? -21.453 4.238   100.695 1.00 74.03  ? 141 VAL E O   1 
ATOM   5093 C  CB  . VAL E 2 141 ? -20.871 7.248   99.437  1.00 71.95  ? 141 VAL E CB  1 
ATOM   5094 C  CG1 . VAL E 2 141 ? -21.446 6.373   98.334  1.00 64.70  ? 141 VAL E CG1 1 
ATOM   5095 C  CG2 . VAL E 2 141 ? -21.464 8.643   99.365  1.00 73.69  ? 141 VAL E CG2 1 
ATOM   5096 N  N   . ILE E 2 142 ? -19.351 4.970   101.013 1.00 72.32  ? 142 ILE E N   1 
ATOM   5097 C  CA  . ILE E 2 142 ? -18.767 3.632   100.951 1.00 73.12  ? 142 ILE E CA  1 
ATOM   5098 C  C   . ILE E 2 142 ? -19.058 2.797   102.201 1.00 75.27  ? 142 ILE E C   1 
ATOM   5099 O  O   . ILE E 2 142 ? -19.092 1.568   102.136 1.00 72.18  ? 142 ILE E O   1 
ATOM   5100 C  CB  . ILE E 2 142 ? -17.240 3.678   100.676 1.00 68.04  ? 142 ILE E CB  1 
ATOM   5101 C  CG1 . ILE E 2 142 ? -16.747 2.336   100.133 1.00 66.94  ? 142 ILE E CG1 1 
ATOM   5102 C  CG2 . ILE E 2 142 ? -16.468 4.085   101.925 1.00 66.00  ? 142 ILE E CG2 1 
ATOM   5103 C  CD1 . ILE E 2 142 ? -15.325 2.376   99.635  1.00 66.84  ? 142 ILE E CD1 1 
ATOM   5104 N  N   . ASN E 2 143 ? -19.279 3.465   103.331 1.00 80.90  ? 143 ASN E N   1 
ATOM   5105 C  CA  . ASN E 2 143 ? -19.584 2.770   104.579 1.00 85.06  ? 143 ASN E CA  1 
ATOM   5106 C  C   . ASN E 2 143 ? -21.005 2.218   104.601 1.00 89.22  ? 143 ASN E C   1 
ATOM   5107 O  O   . ASN E 2 143 ? -21.282 1.217   105.261 1.00 91.29  ? 143 ASN E O   1 
ATOM   5108 C  CB  . ASN E 2 143 ? -19.363 3.686   105.786 1.00 84.57  ? 143 ASN E CB  1 
ATOM   5109 C  CG  . ASN E 2 143 ? -17.894 3.903   106.096 1.00 84.57  ? 143 ASN E CG  1 
ATOM   5110 O  OD1 . ASN E 2 143 ? -17.035 3.125   105.679 1.00 84.93  ? 143 ASN E OD1 1 
ATOM   5111 N  ND2 . ASN E 2 143 ? -17.598 4.963   106.841 1.00 84.06  ? 143 ASN E ND2 1 
ATOM   5112 N  N   . GLU E 2 144 ? -21.900 2.872   103.870 1.00 90.53  ? 144 GLU E N   1 
ATOM   5113 C  CA  . GLU E 2 144 ? -23.302 2.475   103.844 1.00 96.26  ? 144 GLU E CA  1 
ATOM   5114 C  C   . GLU E 2 144 ? -23.585 1.411   102.787 1.00 94.49  ? 144 GLU E C   1 
ATOM   5115 O  O   . GLU E 2 144 ? -24.730 1.213   102.383 1.00 91.59  ? 144 GLU E O   1 
ATOM   5116 C  CB  . GLU E 2 144 ? -24.198 3.698   103.637 1.00 104.81 ? 144 GLU E CB  1 
ATOM   5117 C  CG  . GLU E 2 144 ? -24.155 4.680   104.803 1.00 113.34 ? 144 GLU E CG  1 
ATOM   5118 C  CD  . GLU E 2 144 ? -24.847 5.997   104.499 1.00 119.50 ? 144 GLU E CD  1 
ATOM   5119 O  OE1 . GLU E 2 144 ? -24.727 6.931   105.321 1.00 120.38 ? 144 GLU E OE1 1 
ATOM   5120 O  OE2 . GLU E 2 144 ? -25.510 6.098   103.442 1.00 120.69 ? 144 GLU E OE2 1 
ATOM   5121 N  N   . MET E 2 145 ? -22.536 0.727   102.345 1.00 95.52  ? 145 MET E N   1 
ATOM   5122 C  CA  . MET E 2 145 ? -22.684 -0.387  101.417 1.00 96.58  ? 145 MET E CA  1 
ATOM   5123 C  C   . MET E 2 145 ? -22.560 -1.709  102.158 1.00 100.69 ? 145 MET E C   1 
ATOM   5124 O  O   . MET E 2 145 ? -21.846 -1.804  103.156 1.00 99.92  ? 145 MET E O   1 
ATOM   5125 C  CB  . MET E 2 145 ? -21.620 -0.326  100.322 1.00 92.91  ? 145 MET E CB  1 
ATOM   5126 C  CG  . MET E 2 145 ? -21.779 0.817   99.342  1.00 92.62  ? 145 MET E CG  1 
ATOM   5127 S  SD  . MET E 2 145 ? -20.478 0.788   98.095  1.00 85.51  ? 145 MET E SD  1 
ATOM   5128 C  CE  . MET E 2 145 ? -20.997 2.136   97.036  1.00 83.00  ? 145 MET E CE  1 
ATOM   5129 N  N   . GLN E 2 146 ? -23.255 -2.729  101.666 1.00 105.80 ? 146 GLN E N   1 
ATOM   5130 C  CA  . GLN E 2 146 ? -23.102 -4.075  102.200 1.00 110.79 ? 146 GLN E CA  1 
ATOM   5131 C  C   . GLN E 2 146 ? -21.778 -4.658  101.720 1.00 108.88 ? 146 GLN E C   1 
ATOM   5132 O  O   . GLN E 2 146 ? -21.149 -4.119  100.810 1.00 107.92 ? 146 GLN E O   1 
ATOM   5133 C  CB  . GLN E 2 146 ? -24.268 -4.971  101.771 1.00 115.71 ? 146 GLN E CB  1 
ATOM   5134 C  CG  . GLN E 2 146 ? -25.590 -4.686  102.478 1.00 120.90 ? 146 GLN E CG  1 
ATOM   5135 C  CD  . GLN E 2 146 ? -25.650 -5.259  103.887 1.00 126.84 ? 146 GLN E CD  1 
ATOM   5136 O  OE1 . GLN E 2 146 ? -24.799 -4.969  104.731 1.00 128.03 ? 146 GLN E OE1 1 
ATOM   5137 N  NE2 . GLN E 2 146 ? -26.663 -6.079  104.147 1.00 128.56 ? 146 GLN E NE2 1 
ATOM   5138 N  N   . LYS E 2 147 ? -21.359 -5.758  102.336 1.00 107.47 ? 147 LYS E N   1 
ATOM   5139 C  CA  . LYS E 2 147 ? -20.092 -6.392  101.991 1.00 102.67 ? 147 LYS E CA  1 
ATOM   5140 C  C   . LYS E 2 147 ? -20.112 -6.922  100.559 1.00 99.54  ? 147 LYS E C   1 
ATOM   5141 O  O   . LYS E 2 147 ? -19.070 -7.018  99.910  1.00 97.32  ? 147 LYS E O   1 
ATOM   5142 C  CB  . LYS E 2 147 ? -19.778 -7.522  102.975 1.00 104.22 ? 147 LYS E CB  1 
ATOM   5143 C  CG  . LYS E 2 147 ? -18.362 -8.070  102.873 1.00 105.34 ? 147 LYS E CG  1 
ATOM   5144 C  CD  . LYS E 2 147 ? -18.082 -9.097  103.963 1.00 107.15 ? 147 LYS E CD  1 
ATOM   5145 C  CE  . LYS E 2 147 ? -16.646 -9.599  103.898 1.00 104.83 ? 147 LYS E CE  1 
ATOM   5146 N  NZ  . LYS E 2 147 ? -16.346 -10.576 104.984 1.00 104.25 ? 147 LYS E NZ  1 
ATOM   5147 N  N   . LYS E 2 148 ? -21.302 -7.258  100.072 1.00 99.27  ? 148 LYS E N   1 
ATOM   5148 C  CA  . LYS E 2 148 ? -21.459 -7.775  98.716  1.00 95.20  ? 148 LYS E CA  1 
ATOM   5149 C  C   . LYS E 2 148 ? -21.128 -6.725  97.659  1.00 91.41  ? 148 LYS E C   1 
ATOM   5150 O  O   . LYS E 2 148 ? -20.674 -7.057  96.564  1.00 87.91  ? 148 LYS E O   1 
ATOM   5151 C  CB  . LYS E 2 148 ? -22.876 -8.312  98.497  1.00 95.52  ? 148 LYS E CB  1 
ATOM   5152 C  CG  . LYS E 2 148 ? -23.102 -9.730  99.003  1.00 97.96  ? 148 LYS E CG  1 
ATOM   5153 C  CD  . LYS E 2 148 ? -24.404 -10.297 98.453  1.00 102.74 ? 148 LYS E CD  1 
ATOM   5154 C  CE  . LYS E 2 148 ? -24.554 -11.781 98.756  1.00 103.98 ? 148 LYS E CE  1 
ATOM   5155 N  NZ  . LYS E 2 148 ? -25.739 -12.366 98.062  1.00 105.76 ? 148 LYS E NZ  1 
ATOM   5156 N  N   . ASP E 2 149 ? -21.360 -5.458  97.991  1.00 91.67  ? 149 ASP E N   1 
ATOM   5157 C  CA  . ASP E 2 149 ? -21.071 -4.362  97.070  1.00 89.73  ? 149 ASP E CA  1 
ATOM   5158 C  C   . ASP E 2 149 ? -19.569 -4.132  96.926  1.00 85.28  ? 149 ASP E C   1 
ATOM   5159 O  O   . ASP E 2 149 ? -19.074 -3.899  95.824  1.00 82.38  ? 149 ASP E O   1 
ATOM   5160 C  CB  . ASP E 2 149 ? -21.773 -3.078  97.515  1.00 92.88  ? 149 ASP E CB  1 
ATOM   5161 C  CG  . ASP E 2 149 ? -23.286 -3.181  97.429  1.00 98.35  ? 149 ASP E CG  1 
ATOM   5162 O  OD1 . ASP E 2 149 ? -23.828 -4.274  97.696  1.00 102.87 ? 149 ASP E OD1 1 
ATOM   5163 O  OD2 . ASP E 2 149 ? -23.935 -2.167  97.094  1.00 97.71  ? 149 ASP E OD2 1 
ATOM   5164 N  N   . HIS E 2 150 ? -18.851 -4.198  98.045  1.00 84.09  ? 150 HIS E N   1 
ATOM   5165 C  CA  . HIS E 2 150 ? -17.394 -4.116  98.029  1.00 79.82  ? 150 HIS E CA  1 
ATOM   5166 C  C   . HIS E 2 150 ? -16.808 -5.242  97.183  1.00 76.93  ? 150 HIS E C   1 
ATOM   5167 O  O   . HIS E 2 150 ? -15.882 -5.026  96.400  1.00 76.59  ? 150 HIS E O   1 
ATOM   5168 C  CB  . HIS E 2 150 ? -16.834 -4.190  99.450  1.00 81.82  ? 150 HIS E CB  1 
ATOM   5169 C  CG  . HIS E 2 150 ? -17.162 -3.000  100.297 1.00 84.50  ? 150 HIS E CG  1 
ATOM   5170 N  ND1 . HIS E 2 150 ? -16.919 -2.963  101.653 1.00 86.00  ? 150 HIS E ND1 1 
ATOM   5171 C  CD2 . HIS E 2 150 ? -17.709 -1.802  99.980  1.00 86.04  ? 150 HIS E CD2 1 
ATOM   5172 C  CE1 . HIS E 2 150 ? -17.306 -1.796  102.136 1.00 86.32  ? 150 HIS E CE1 1 
ATOM   5173 N  NE2 . HIS E 2 150 ? -17.788 -1.073  101.142 1.00 87.48  ? 150 HIS E NE2 1 
ATOM   5174 N  N   . LYS E 2 151 ? -17.356 -6.444  97.344  1.00 76.11  ? 151 LYS E N   1 
ATOM   5175 C  CA  . LYS E 2 151 ? -16.914 -7.603  96.574  1.00 74.60  ? 151 LYS E CA  1 
ATOM   5176 C  C   . LYS E 2 151 ? -17.161 -7.438  95.077  1.00 74.11  ? 151 LYS E C   1 
ATOM   5177 O  O   . LYS E 2 151 ? -16.351 -7.870  94.257  1.00 73.76  ? 151 LYS E O   1 
ATOM   5178 C  CB  . LYS E 2 151 ? -17.594 -8.877  97.079  1.00 73.37  ? 151 LYS E CB  1 
ATOM   5179 C  CG  . LYS E 2 151 ? -16.869 -9.542  98.232  1.00 76.75  ? 151 LYS E CG  1 
ATOM   5180 C  CD  . LYS E 2 151 ? -15.465 -9.954  97.821  1.00 78.75  ? 151 LYS E CD  1 
ATOM   5181 C  CE  . LYS E 2 151 ? -14.705 -10.585 98.977  1.00 78.84  ? 151 LYS E CE  1 
ATOM   5182 N  NZ  . LYS E 2 151 ? -13.329 -10.975 98.563  1.00 78.14  ? 151 LYS E NZ  1 
ATOM   5183 N  N   . GLN E 2 152 ? -18.279 -6.812  94.724  1.00 73.12  ? 152 GLN E N   1 
ATOM   5184 C  CA  . GLN E 2 152 ? -18.618 -6.619  93.319  1.00 68.43  ? 152 GLN E CA  1 
ATOM   5185 C  C   . GLN E 2 152 ? -17.682 -5.614  92.652  1.00 67.01  ? 152 GLN E C   1 
ATOM   5186 O  O   . GLN E 2 152 ? -17.276 -5.803  91.506  1.00 67.71  ? 152 GLN E O   1 
ATOM   5187 C  CB  . GLN E 2 152 ? -20.077 -6.190  93.160  1.00 64.25  ? 152 GLN E CB  1 
ATOM   5188 C  CG  . GLN E 2 152 ? -20.513 -6.088  91.711  1.00 69.22  ? 152 GLN E CG  1 
ATOM   5189 C  CD  . GLN E 2 152 ? -22.011 -5.936  91.560  1.00 72.90  ? 152 GLN E CD  1 
ATOM   5190 O  OE1 . GLN E 2 152 ? -22.770 -6.246  92.478  1.00 75.00  ? 152 GLN E OE1 1 
ATOM   5191 N  NE2 . GLN E 2 152 ? -22.445 -5.456  90.398  1.00 68.55  ? 152 GLN E NE2 1 
ATOM   5192 N  N   . LEU E 2 153 ? -17.345 -4.550  93.376  1.00 64.16  ? 153 LEU E N   1 
ATOM   5193 C  CA  . LEU E 2 153 ? -16.370 -3.573  92.904  1.00 61.38  ? 153 LEU E CA  1 
ATOM   5194 C  C   . LEU E 2 153 ? -15.054 -4.255  92.562  1.00 65.51  ? 153 LEU E C   1 
ATOM   5195 O  O   . LEU E 2 153 ? -14.441 -3.966  91.534  1.00 65.87  ? 153 LEU E O   1 
ATOM   5196 C  CB  . LEU E 2 153 ? -16.124 -2.498  93.965  1.00 57.78  ? 153 LEU E CB  1 
ATOM   5197 C  CG  . LEU E 2 153 ? -17.218 -1.449  94.160  1.00 60.23  ? 153 LEU E CG  1 
ATOM   5198 C  CD1 . LEU E 2 153 ? -16.931 -0.589  95.382  1.00 58.35  ? 153 LEU E CD1 1 
ATOM   5199 C  CD2 . LEU E 2 153 ? -17.351 -0.588  92.913  1.00 59.60  ? 153 LEU E CD2 1 
ATOM   5200 N  N   . TRP E 2 154 ? -14.628 -5.165  93.432  1.00 68.65  ? 154 TRP E N   1 
ATOM   5201 C  CA  . TRP E 2 154 ? -13.378 -5.890  93.240  1.00 66.48  ? 154 TRP E CA  1 
ATOM   5202 C  C   . TRP E 2 154 ? -13.453 -6.865  92.066  1.00 64.15  ? 154 TRP E C   1 
ATOM   5203 O  O   . TRP E 2 154 ? -12.559 -6.900  91.218  1.00 63.80  ? 154 TRP E O   1 
ATOM   5204 C  CB  . TRP E 2 154 ? -12.990 -6.631  94.520  1.00 66.34  ? 154 TRP E CB  1 
ATOM   5205 C  CG  . TRP E 2 154 ? -11.876 -7.603  94.320  1.00 70.46  ? 154 TRP E CG  1 
ATOM   5206 C  CD1 . TRP E 2 154 ? -11.956 -8.966  94.374  1.00 73.18  ? 154 TRP E CD1 1 
ATOM   5207 C  CD2 . TRP E 2 154 ? -10.509 -7.292  94.016  1.00 68.94  ? 154 TRP E CD2 1 
ATOM   5208 N  NE1 . TRP E 2 154 ? -10.721 -9.522  94.130  1.00 73.17  ? 154 TRP E NE1 1 
ATOM   5209 C  CE2 . TRP E 2 154 ? -9.817  -8.516  93.907  1.00 69.56  ? 154 TRP E CE2 1 
ATOM   5210 C  CE3 . TRP E 2 154 ? -9.804  -6.099  93.828  1.00 64.62  ? 154 TRP E CE3 1 
ATOM   5211 C  CZ2 . TRP E 2 154 ? -8.455  -8.580  93.620  1.00 64.94  ? 154 TRP E CZ2 1 
ATOM   5212 C  CZ3 . TRP E 2 154 ? -8.453  -6.165  93.541  1.00 63.34  ? 154 TRP E CZ3 1 
ATOM   5213 C  CH2 . TRP E 2 154 ? -7.793  -7.397  93.441  1.00 64.08  ? 154 TRP E CH2 1 
ATOM   5214 N  N   . MET E 2 155 ? -14.521 -7.654  92.022  1.00 62.08  ? 155 MET E N   1 
ATOM   5215 C  CA  . MET E 2 155 ? -14.706 -8.635  90.956  1.00 63.84  ? 155 MET E CA  1 
ATOM   5216 C  C   . MET E 2 155 ? -14.829 -7.971  89.591  1.00 63.71  ? 155 MET E C   1 
ATOM   5217 O  O   . MET E 2 155 ? -14.394 -8.526  88.582  1.00 62.12  ? 155 MET E O   1 
ATOM   5218 C  CB  . MET E 2 155 ? -15.936 -9.500  91.228  1.00 67.22  ? 155 MET E CB  1 
ATOM   5219 C  CG  . MET E 2 155 ? -15.740 -10.538 92.324  1.00 67.68  ? 155 MET E CG  1 
ATOM   5220 S  SD  . MET E 2 155 ? -17.305 -11.297 92.800  1.00 131.86 ? 155 MET E SD  1 
ATOM   5221 C  CE  . MET E 2 155 ? -17.910 -11.858 91.211  1.00 77.57  ? 155 MET E CE  1 
ATOM   5222 N  N   . GLY E 2 156 ? -15.425 -6.783  89.568  1.00 62.21  ? 156 GLY E N   1 
ATOM   5223 C  CA  . GLY E 2 156 ? -15.564 -6.024  88.340  1.00 61.91  ? 156 GLY E CA  1 
ATOM   5224 C  C   . GLY E 2 156 ? -14.209 -5.640  87.781  1.00 59.60  ? 156 GLY E C   1 
ATOM   5225 O  O   . GLY E 2 156 ? -13.983 -5.708  86.574  1.00 58.64  ? 156 GLY E O   1 
ATOM   5226 N  N   . LEU E 2 157 ? -13.307 -5.239  88.669  1.00 59.16  ? 157 LEU E N   1 
ATOM   5227 C  CA  . LEU E 2 157 ? -11.949 -4.879  88.278  1.00 60.17  ? 157 LEU E CA  1 
ATOM   5228 C  C   . LEU E 2 157 ? -11.164 -6.119  87.890  1.00 60.41  ? 157 LEU E C   1 
ATOM   5229 O  O   . LEU E 2 157 ? -10.467 -6.130  86.877  1.00 62.04  ? 157 LEU E O   1 
ATOM   5230 C  CB  . LEU E 2 157 ? -11.228 -4.163  89.423  1.00 56.44  ? 157 LEU E CB  1 
ATOM   5231 C  CG  . LEU E 2 157 ? -9.728  -3.947  89.213  1.00 51.70  ? 157 LEU E CG  1 
ATOM   5232 C  CD1 . LEU E 2 157 ? -9.487  -2.888  88.153  1.00 51.92  ? 157 LEU E CD1 1 
ATOM   5233 C  CD2 . LEU E 2 157 ? -9.029  -3.581  90.515  1.00 50.08  ? 157 LEU E CD2 1 
ATOM   5234 N  N   . GLN E 2 158 ? -11.282 -7.161  88.705  1.00 60.77  ? 158 GLN E N   1 
ATOM   5235 C  CA  . GLN E 2 158 ? -10.534 -8.389  88.480  1.00 60.34  ? 158 GLN E CA  1 
ATOM   5236 C  C   . GLN E 2 158 ? -10.982 -9.099  87.210  1.00 61.66  ? 158 GLN E C   1 
ATOM   5237 O  O   . GLN E 2 158 ? -10.160 -9.647  86.479  1.00 63.89  ? 158 GLN E O   1 
ATOM   5238 C  CB  . GLN E 2 158 ? -10.658 -9.328  89.680  1.00 61.12  ? 158 GLN E CB  1 
ATOM   5239 C  CG  . GLN E 2 158 ? -9.796  -10.572 89.563  1.00 67.75  ? 158 GLN E CG  1 
ATOM   5240 C  CD  . GLN E 2 158 ? -9.871  -11.462 90.788  1.00 74.19  ? 158 GLN E CD  1 
ATOM   5241 O  OE1 . GLN E 2 158 ? -10.726 -11.278 91.656  1.00 76.24  ? 158 GLN E OE1 1 
ATOM   5242 N  NE2 . GLN E 2 158 ? -8.967  -12.432 90.866  1.00 77.18  ? 158 GLN E NE2 1 
ATOM   5243 N  N   . ASN E 2 159 ? -12.285 -9.084  86.945  1.00 61.78  ? 159 ASN E N   1 
ATOM   5244 C  CA  . ASN E 2 159 ? -12.826 -9.795  85.789  1.00 64.47  ? 159 ASN E CA  1 
ATOM   5245 C  C   . ASN E 2 159 ? -12.995 -8.925  84.546  1.00 68.58  ? 159 ASN E C   1 
ATOM   5246 O  O   . ASN E 2 159 ? -13.511 -9.388  83.528  1.00 70.94  ? 159 ASN E O   1 
ATOM   5247 C  CB  . ASN E 2 159 ? -14.154 -10.469 86.142  1.00 66.42  ? 159 ASN E CB  1 
ATOM   5248 C  CG  . ASN E 2 159 ? -14.011 -11.493 87.250  1.00 68.78  ? 159 ASN E CG  1 
ATOM   5249 O  OD1 . ASN E 2 159 ? -13.043 -12.254 87.288  1.00 66.32  ? 159 ASN E OD1 1 
ATOM   5250 N  ND2 . ASN E 2 159 ? -14.976 -11.514 88.165  1.00 71.07  ? 159 ASN E ND2 1 
ATOM   5251 N  N   . ASP E 2 160 ? -12.562 -7.669  84.637  1.00 71.77  ? 160 ASP E N   1 
ATOM   5252 C  CA  . ASP E 2 160 ? -12.633 -6.734  83.515  1.00 71.47  ? 160 ASP E CA  1 
ATOM   5253 C  C   . ASP E 2 160 ? -14.074 -6.557  83.024  1.00 74.53  ? 160 ASP E C   1 
ATOM   5254 O  O   . ASP E 2 160 ? -14.346 -6.581  81.824  1.00 77.14  ? 160 ASP E O   1 
ATOM   5255 C  CB  . ASP E 2 160 ? -11.707 -7.194  82.382  1.00 71.46  ? 160 ASP E CB  1 
ATOM   5256 C  CG  . ASP E 2 160 ? -11.541 -6.149  81.303  1.00 75.51  ? 160 ASP E CG  1 
ATOM   5257 O  OD1 . ASP E 2 160 ? -11.151 -6.520  80.175  1.00 77.57  ? 160 ASP E OD1 1 
ATOM   5258 O  OD2 . ASP E 2 160 ? -11.807 -4.962  81.579  1.00 78.91  ? 160 ASP E OD2 1 
ATOM   5259 N  N   . ARG E 2 161 ? -14.992 -6.376  83.968  1.00 72.30  ? 161 ARG E N   1 
ATOM   5260 C  CA  . ARG E 2 161 ? -16.410 -6.239  83.655  1.00 69.71  ? 161 ARG E CA  1 
ATOM   5261 C  C   . ARG E 2 161 ? -16.896 -4.833  83.976  1.00 66.68  ? 161 ARG E C   1 
ATOM   5262 O  O   . ARG E 2 161 ? -17.290 -4.551  85.109  1.00 64.39  ? 161 ARG E O   1 
ATOM   5263 C  CB  . ARG E 2 161 ? -17.220 -7.248  84.461  1.00 72.74  ? 161 ARG E CB  1 
ATOM   5264 C  CG  . ARG E 2 161 ? -16.700 -8.668  84.374  1.00 75.38  ? 161 ARG E CG  1 
ATOM   5265 C  CD  . ARG E 2 161 ? -17.376 -9.431  83.257  1.00 78.88  ? 161 ARG E CD  1 
ATOM   5266 N  NE  . ARG E 2 161 ? -18.827 -9.290  83.325  1.00 83.29  ? 161 ARG E NE  1 
ATOM   5267 C  CZ  . ARG E 2 161 ? -19.602 -9.934  84.192  1.00 85.93  ? 161 ARG E CZ  1 
ATOM   5268 N  NH1 . ARG E 2 161 ? -19.068 -10.767 85.075  1.00 86.58  ? 161 ARG E NH1 1 
ATOM   5269 N  NH2 . ARG E 2 161 ? -20.915 -9.742  84.180  1.00 87.68  ? 161 ARG E NH2 1 
ATOM   5270 N  N   . PHE E 2 162 ? -16.869 -3.964  82.969  1.00 67.88  ? 162 PHE E N   1 
ATOM   5271 C  CA  . PHE E 2 162 ? -17.235 -2.555  83.119  1.00 66.96  ? 162 PHE E CA  1 
ATOM   5272 C  C   . PHE E 2 162 ? -18.581 -2.349  83.813  1.00 70.52  ? 162 PHE E C   1 
ATOM   5273 O  O   . PHE E 2 162 ? -18.681 -1.593  84.781  1.00 67.50  ? 162 PHE E O   1 
ATOM   5274 C  CB  . PHE E 2 162 ? -17.252 -1.876  81.750  1.00 61.49  ? 162 PHE E CB  1 
ATOM   5275 C  CG  . PHE E 2 162 ? -17.615 -0.417  81.793  1.00 62.18  ? 162 PHE E CG  1 
ATOM   5276 C  CD1 . PHE E 2 162 ? -16.645 0.543   82.033  1.00 58.67  ? 162 PHE E CD1 1 
ATOM   5277 C  CD2 . PHE E 2 162 ? -18.922 -0.003  81.570  1.00 63.36  ? 162 PHE E CD2 1 
ATOM   5278 C  CE1 . PHE E 2 162 ? -16.972 1.886   82.061  1.00 57.66  ? 162 PHE E CE1 1 
ATOM   5279 C  CE2 . PHE E 2 162 ? -19.256 1.340   81.600  1.00 60.17  ? 162 PHE E CE2 1 
ATOM   5280 C  CZ  . PHE E 2 162 ? -18.281 2.285   81.847  1.00 59.00  ? 162 PHE E CZ  1 
ATOM   5281 N  N   . ASP E 2 163 ? -19.611 -3.022  83.312  1.00 72.66  ? 163 ASP E N   1 
ATOM   5282 C  CA  . ASP E 2 163 ? -20.958 -2.853  83.842  1.00 69.55  ? 163 ASP E CA  1 
ATOM   5283 C  C   . ASP E 2 163 ? -21.077 -3.361  85.269  1.00 63.67  ? 163 ASP E C   1 
ATOM   5284 O  O   . ASP E 2 163 ? -21.714 -2.727  86.106  1.00 60.89  ? 163 ASP E O   1 
ATOM   5285 C  CB  . ASP E 2 163 ? -21.981 -3.541  82.940  1.00 70.07  ? 163 ASP E CB  1 
ATOM   5286 C  CG  . ASP E 2 163 ? -22.160 -2.824  81.618  1.00 70.80  ? 163 ASP E CG  1 
ATOM   5287 O  OD1 . ASP E 2 163 ? -22.011 -1.582  81.589  1.00 60.73  ? 163 ASP E OD1 1 
ATOM   5288 O  OD2 . ASP E 2 163 ? -22.446 -3.503  80.609  1.00 80.29  ? 163 ASP E OD2 1 
ATOM   5289 N  N   . GLN E 2 164 ? -20.461 -4.506  85.540  1.00 65.09  ? 164 GLN E N   1 
ATOM   5290 C  CA  . GLN E 2 164 ? -20.478 -5.079  86.876  1.00 64.78  ? 164 GLN E CA  1 
ATOM   5291 C  C   . GLN E 2 164 ? -19.851 -4.101  87.861  1.00 67.63  ? 164 GLN E C   1 
ATOM   5292 O  O   . GLN E 2 164 ? -20.378 -3.876  88.951  1.00 70.97  ? 164 GLN E O   1 
ATOM   5293 C  CB  . GLN E 2 164 ? -19.730 -6.410  86.901  1.00 64.79  ? 164 GLN E CB  1 
ATOM   5294 C  CG  . GLN E 2 164 ? -19.717 -7.090  88.261  1.00 69.07  ? 164 GLN E CG  1 
ATOM   5295 C  CD  . GLN E 2 164 ? -18.797 -8.294  88.295  1.00 75.47  ? 164 GLN E CD  1 
ATOM   5296 O  OE1 . GLN E 2 164 ? -17.889 -8.415  87.474  1.00 79.63  ? 164 GLN E OE1 1 
ATOM   5297 N  NE2 . GLN E 2 164 ? -19.027 -9.192  89.245  1.00 78.58  ? 164 GLN E NE2 1 
ATOM   5298 N  N   . PHE E 2 165 ? -18.731 -3.510  87.459  1.00 65.14  ? 165 PHE E N   1 
ATOM   5299 C  CA  . PHE E 2 165 ? -18.025 -2.559  88.306  1.00 61.25  ? 165 PHE E CA  1 
ATOM   5300 C  C   . PHE E 2 165 ? -18.817 -1.273  88.510  1.00 61.51  ? 165 PHE E C   1 
ATOM   5301 O  O   . PHE E 2 165 ? -19.025 -0.841  89.644  1.00 64.49  ? 165 PHE E O   1 
ATOM   5302 C  CB  . PHE E 2 165 ? -16.649 -2.230  87.726  1.00 59.60  ? 165 PHE E CB  1 
ATOM   5303 C  CG  . PHE E 2 165 ? -15.878 -1.226  88.534  1.00 59.00  ? 165 PHE E CG  1 
ATOM   5304 C  CD1 . PHE E 2 165 ? -15.213 -1.611  89.688  1.00 63.44  ? 165 PHE E CD1 1 
ATOM   5305 C  CD2 . PHE E 2 165 ? -15.819 0.100   88.146  1.00 58.49  ? 165 PHE E CD2 1 
ATOM   5306 C  CE1 . PHE E 2 165 ? -14.502 -0.689  90.439  1.00 64.01  ? 165 PHE E CE1 1 
ATOM   5307 C  CE2 . PHE E 2 165 ? -15.111 1.027   88.893  1.00 60.52  ? 165 PHE E CE2 1 
ATOM   5308 C  CZ  . PHE E 2 165 ? -14.451 0.632   90.040  1.00 61.60  ? 165 PHE E CZ  1 
ATOM   5309 N  N   . TRP E 2 166 ? -19.254 -0.663  87.413  1.00 58.00  ? 166 TRP E N   1 
ATOM   5310 C  CA  . TRP E 2 166 ? -19.899 0.645   87.488  1.00 57.32  ? 166 TRP E CA  1 
ATOM   5311 C  C   . TRP E 2 166 ? -21.323 0.624   88.039  1.00 64.61  ? 166 TRP E C   1 
ATOM   5312 O  O   . TRP E 2 166 ? -21.879 1.673   88.369  1.00 67.37  ? 166 TRP E O   1 
ATOM   5313 C  CB  . TRP E 2 166 ? -19.848 1.364   86.141  1.00 53.81  ? 166 TRP E CB  1 
ATOM   5314 C  CG  . TRP E 2 166 ? -18.591 2.142   85.957  1.00 54.89  ? 166 TRP E CG  1 
ATOM   5315 C  CD1 . TRP E 2 166 ? -17.468 1.736   85.304  1.00 54.03  ? 166 TRP E CD1 1 
ATOM   5316 C  CD2 . TRP E 2 166 ? -18.317 3.461   86.448  1.00 58.51  ? 166 TRP E CD2 1 
ATOM   5317 N  NE1 . TRP E 2 166 ? -16.513 2.722   85.346  1.00 56.26  ? 166 TRP E NE1 1 
ATOM   5318 C  CE2 . TRP E 2 166 ? -17.007 3.792   86.043  1.00 57.39  ? 166 TRP E CE2 1 
ATOM   5319 C  CE3 . TRP E 2 166 ? -19.052 4.395   87.186  1.00 56.38  ? 166 TRP E CE3 1 
ATOM   5320 C  CZ2 . TRP E 2 166 ? -16.415 5.018   86.351  1.00 52.52  ? 166 TRP E CZ2 1 
ATOM   5321 C  CZ3 . TRP E 2 166 ? -18.463 5.612   87.492  1.00 57.12  ? 166 TRP E CZ3 1 
ATOM   5322 C  CH2 . TRP E 2 166 ? -17.157 5.911   87.075  1.00 56.24  ? 166 TRP E CH2 1 
ATOM   5323 N  N   . ALA E 2 167 ? -21.907 -0.563  88.159  1.00 67.88  ? 167 ALA E N   1 
ATOM   5324 C  CA  . ALA E 2 167 ? -23.232 -0.681  88.756  1.00 70.33  ? 167 ALA E CA  1 
ATOM   5325 C  C   . ALA E 2 167 ? -23.173 -0.315  90.237  1.00 75.75  ? 167 ALA E C   1 
ATOM   5326 O  O   . ALA E 2 167 ? -24.190 0.025   90.845  1.00 80.28  ? 167 ALA E O   1 
ATOM   5327 C  CB  . ALA E 2 167 ? -23.785 -2.085  88.568  1.00 66.09  ? 167 ALA E CB  1 
ATOM   5328 N  N   . ILE E 2 168 ? -21.971 -0.382  90.805  1.00 73.92  ? 168 ILE E N   1 
ATOM   5329 C  CA  . ILE E 2 168 ? -21.749 -0.021  92.201  1.00 71.70  ? 168 ILE E CA  1 
ATOM   5330 C  C   . ILE E 2 168 ? -20.958 1.281   92.316  1.00 67.76  ? 168 ILE E C   1 
ATOM   5331 O  O   . ILE E 2 168 ? -21.242 2.117   93.175  1.00 66.43  ? 168 ILE E O   1 
ATOM   5332 C  CB  . ILE E 2 168 ? -20.997 -1.133  92.960  1.00 70.27  ? 168 ILE E CB  1 
ATOM   5333 C  CG1 . ILE E 2 168 ? -21.673 -2.488  92.737  1.00 73.18  ? 168 ILE E CG1 1 
ATOM   5334 C  CG2 . ILE E 2 168 ? -20.919 -0.808  94.442  1.00 69.35  ? 168 ILE E CG2 1 
ATOM   5335 C  CD1 . ILE E 2 168 ? -23.108 -2.547  93.217  1.00 74.68  ? 168 ILE E CD1 1 
ATOM   5336 N  N   . ASN E 2 169 ? -19.972 1.453   91.439  1.00 65.23  ? 169 ASN E N   1 
ATOM   5337 C  CA  . ASN E 2 169 ? -19.093 2.618   91.497  1.00 64.07  ? 169 ASN E CA  1 
ATOM   5338 C  C   . ASN E 2 169 ? -19.803 3.931   91.180  1.00 65.68  ? 169 ASN E C   1 
ATOM   5339 O  O   . ASN E 2 169 ? -19.306 5.006   91.518  1.00 65.21  ? 169 ASN E O   1 
ATOM   5340 C  CB  . ASN E 2 169 ? -17.890 2.442   90.568  1.00 66.31  ? 169 ASN E CB  1 
ATOM   5341 C  CG  . ASN E 2 169 ? -16.776 3.431   90.869  1.00 66.09  ? 169 ASN E CG  1 
ATOM   5342 O  OD1 . ASN E 2 169 ? -16.382 3.605   92.022  1.00 68.61  ? 169 ASN E OD1 1 
ATOM   5343 N  ND2 . ASN E 2 169 ? -16.274 4.096   89.833  1.00 60.58  ? 169 ASN E ND2 1 
ATOM   5344 N  N   . ARG E 2 170 ? -20.958 3.840   90.525  1.00 67.84  ? 170 ARG E N   1 
ATOM   5345 C  CA  . ARG E 2 170 ? -21.757 5.022   90.217  1.00 70.98  ? 170 ARG E CA  1 
ATOM   5346 C  C   . ARG E 2 170 ? -22.167 5.749   91.499  1.00 74.32  ? 170 ARG E C   1 
ATOM   5347 O  O   . ARG E 2 170 ? -22.264 6.976   91.525  1.00 76.85  ? 170 ARG E O   1 
ATOM   5348 C  CB  . ARG E 2 170 ? -22.998 4.644   89.399  1.00 75.88  ? 170 ARG E CB  1 
ATOM   5349 C  CG  . ARG E 2 170 ? -23.896 3.603   90.059  1.00 80.63  ? 170 ARG E CG  1 
ATOM   5350 C  CD  . ARG E 2 170 ? -25.270 3.544   89.405  1.00 86.93  ? 170 ARG E CD  1 
ATOM   5351 N  NE  . ARG E 2 170 ? -25.207 3.069   88.026  1.00 93.40  ? 170 ARG E NE  1 
ATOM   5352 C  CZ  . ARG E 2 170 ? -26.262 2.951   87.223  1.00 97.84  ? 170 ARG E CZ  1 
ATOM   5353 N  NH1 . ARG E 2 170 ? -27.473 3.277   87.657  1.00 99.24  ? 170 ARG E NH1 1 
ATOM   5354 N  NH2 . ARG E 2 170 ? -26.104 2.508   85.982  1.00 97.72  ? 170 ARG E NH2 1 
ATOM   5355 N  N   . LYS E 2 171 ? -22.388 4.980   92.561  1.00 72.95  ? 171 LYS E N   1 
ATOM   5356 C  CA  . LYS E 2 171 ? -22.818 5.531   93.840  1.00 71.43  ? 171 LYS E CA  1 
ATOM   5357 C  C   . LYS E 2 171 ? -21.728 6.381   94.487  1.00 68.45  ? 171 LYS E C   1 
ATOM   5358 O  O   . LYS E 2 171 ? -22.022 7.293   95.261  1.00 69.96  ? 171 LYS E O   1 
ATOM   5359 C  CB  . LYS E 2 171 ? -23.244 4.406   94.785  1.00 71.91  ? 171 LYS E CB  1 
ATOM   5360 C  CG  . LYS E 2 171 ? -24.387 3.555   94.251  1.00 75.06  ? 171 LYS E CG  1 
ATOM   5361 C  CD  . LYS E 2 171 ? -24.680 2.375   95.161  1.00 75.96  ? 171 LYS E CD  1 
ATOM   5362 C  CE  . LYS E 2 171 ? -25.737 1.465   94.557  1.00 78.67  ? 171 LYS E CE  1 
ATOM   5363 N  NZ  . LYS E 2 171 ? -25.982 0.261   95.401  1.00 83.57  ? 171 LYS E NZ  1 
ATOM   5364 N  N   . LEU E 2 172 ? -20.473 6.086   94.159  1.00 60.92  ? 172 LEU E N   1 
ATOM   5365 C  CA  . LEU E 2 172 ? -19.340 6.799   94.743  1.00 57.15  ? 172 LEU E CA  1 
ATOM   5366 C  C   . LEU E 2 172 ? -19.031 8.106   94.017  1.00 62.67  ? 172 LEU E C   1 
ATOM   5367 O  O   . LEU E 2 172 ? -18.159 8.868   94.437  1.00 63.23  ? 172 LEU E O   1 
ATOM   5368 C  CB  . LEU E 2 172 ? -18.106 5.904   94.752  1.00 51.75  ? 172 LEU E CB  1 
ATOM   5369 C  CG  . LEU E 2 172 ? -18.294 4.590   95.505  1.00 52.63  ? 172 LEU E CG  1 
ATOM   5370 C  CD1 . LEU E 2 172 ? -17.130 3.666   95.239  1.00 55.11  ? 172 LEU E CD1 1 
ATOM   5371 C  CD2 . LEU E 2 172 ? -18.428 4.854   96.990  1.00 52.92  ? 172 LEU E CD2 1 
ATOM   5372 N  N   . MET E 2 173 ? -19.748 8.363   92.928  1.00 65.94  ? 173 MET E N   1 
ATOM   5373 C  CA  . MET E 2 173 ? -19.547 9.584   92.158  1.00 64.77  ? 173 MET E CA  1 
ATOM   5374 C  C   . MET E 2 173 ? -20.697 10.563  92.364  1.00 68.46  ? 173 MET E C   1 
ATOM   5375 O  O   . MET E 2 173 ? -20.728 11.636  91.764  1.00 65.97  ? 173 MET E O   1 
ATOM   5376 C  CB  . MET E 2 173 ? -19.380 9.255   90.677  1.00 60.86  ? 173 MET E CB  1 
ATOM   5377 C  CG  . MET E 2 173 ? -18.231 8.301   90.395  1.00 59.91  ? 173 MET E CG  1 
ATOM   5378 S  SD  . MET E 2 173 ? -16.632 8.995   90.854  1.00 70.19  ? 173 MET E SD  1 
ATOM   5379 C  CE  . MET E 2 173 ? -15.539 7.627   90.482  1.00 50.14  ? 173 MET E CE  1 
ATOM   5380 N  N   . GLU E 2 174 ? -21.641 10.182  93.220  1.00 75.33  ? 174 GLU E N   1 
ATOM   5381 C  CA  . GLU E 2 174 ? -22.758 11.048  93.576  1.00 81.73  ? 174 GLU E CA  1 
ATOM   5382 C  C   . GLU E 2 174 ? -22.309 12.126  94.556  1.00 83.31  ? 174 GLU E C   1 
ATOM   5383 O  O   . GLU E 2 174 ? -21.211 12.057  95.109  1.00 85.23  ? 174 GLU E O   1 
ATOM   5384 C  CB  . GLU E 2 174 ? -23.880 10.229  94.216  1.00 84.32  ? 174 GLU E CB  1 
ATOM   5385 C  CG  . GLU E 2 174 ? -24.331 9.030   93.402  1.00 87.39  ? 174 GLU E CG  1 
ATOM   5386 C  CD  . GLU E 2 174 ? -25.419 9.372   92.408  1.00 93.66  ? 174 GLU E CD  1 
ATOM   5387 O  OE1 . GLU E 2 174 ? -25.623 10.573  92.129  1.00 97.93  ? 174 GLU E OE1 1 
ATOM   5388 O  OE2 . GLU E 2 174 ? -26.077 8.436   91.910  1.00 96.73  ? 174 GLU E OE2 1 
ATOM   5389 N  N   . TYR E 2 175 ? -23.168 13.117  94.767  1.00 82.22  ? 175 TYR E N   1 
ATOM   5390 C  CA  . TYR E 2 175 ? -22.927 14.159  95.760  1.00 81.71  ? 175 TYR E CA  1 
ATOM   5391 C  C   . TYR E 2 175 ? -24.225 14.898  96.073  1.00 85.83  ? 175 TYR E C   1 
ATOM   5392 O  O   . TYR E 2 175 ? -25.152 14.881  95.263  1.00 87.28  ? 175 TYR E O   1 
ATOM   5393 C  CB  . TYR E 2 175 ? -21.833 15.130  95.294  1.00 78.29  ? 175 TYR E CB  1 
ATOM   5394 C  CG  . TYR E 2 175 ? -22.052 15.738  93.928  1.00 78.12  ? 175 TYR E CG  1 
ATOM   5395 C  CD1 . TYR E 2 175 ? -22.796 16.900  93.772  1.00 78.89  ? 175 TYR E CD1 1 
ATOM   5396 C  CD2 . TYR E 2 175 ? -21.495 15.160  92.795  1.00 77.38  ? 175 TYR E CD2 1 
ATOM   5397 C  CE1 . TYR E 2 175 ? -22.989 17.462  92.524  1.00 80.32  ? 175 TYR E CE1 1 
ATOM   5398 C  CE2 . TYR E 2 175 ? -21.683 15.714  91.544  1.00 78.53  ? 175 TYR E CE2 1 
ATOM   5399 C  CZ  . TYR E 2 175 ? -22.431 16.864  91.414  1.00 81.07  ? 175 TYR E CZ  1 
ATOM   5400 O  OH  . TYR E 2 175 ? -22.618 17.416  90.168  1.00 86.45  ? 175 TYR E OH  1 
ATOM   5401 N  N   . PRO E 2 176 ? -24.304 15.520  97.265  1.00 89.84  ? 176 PRO E N   1 
ATOM   5402 C  CA  . PRO E 2 176 ? -25.457 16.325  97.685  1.00 96.06  ? 176 PRO E CA  1 
ATOM   5403 C  C   . PRO E 2 176 ? -25.967 17.248  96.582  1.00 101.42 ? 176 PRO E C   1 
ATOM   5404 O  O   . PRO E 2 176 ? -25.168 17.854  95.867  1.00 98.46  ? 176 PRO E O   1 
ATOM   5405 C  CB  . PRO E 2 176 ? -24.899 17.157  98.852  1.00 94.82  ? 176 PRO E CB  1 
ATOM   5406 C  CG  . PRO E 2 176 ? -23.483 16.645  99.102  1.00 90.49  ? 176 PRO E CG  1 
ATOM   5407 C  CD  . PRO E 2 176 ? -23.350 15.354  98.371  1.00 88.56  ? 176 PRO E CD  1 
ATOM   5408 N  N   . ALA E 2 177 ? -27.287 17.338  96.446  1.00 108.16 ? 177 ALA E N   1 
ATOM   5409 C  CA  . ALA E 2 177 ? -27.900 18.161  95.410  1.00 112.26 ? 177 ALA E CA  1 
ATOM   5410 C  C   . ALA E 2 177 ? -27.560 19.635  95.603  1.00 114.13 ? 177 ALA E C   1 
ATOM   5411 O  O   . ALA E 2 177 ? -27.363 20.369  94.635  1.00 113.27 ? 177 ALA E O   1 
ATOM   5412 C  CB  . ALA E 2 177 ? -29.409 17.959  95.397  1.00 114.96 ? 177 ALA E CB  1 
ATOM   5413 N  N   . GLU E 2 178 ? -27.483 20.057  96.862  1.00 116.68 ? 178 GLU E N   1 
ATOM   5414 C  CA  . GLU E 2 178 ? -27.166 21.442  97.193  1.00 118.19 ? 178 GLU E CA  1 
ATOM   5415 C  C   . GLU E 2 178 ? -25.707 21.778  96.890  1.00 113.09 ? 178 GLU E C   1 
ATOM   5416 O  O   . GLU E 2 178 ? -25.337 22.949  96.797  1.00 112.58 ? 178 GLU E O   1 
ATOM   5417 C  CB  . GLU E 2 178 ? -27.487 21.736  98.664  1.00 120.42 ? 178 GLU E CB  1 
ATOM   5418 C  CG  . GLU E 2 178 ? -26.735 20.873  99.672  1.00 119.38 ? 178 GLU E CG  1 
ATOM   5419 C  CD  . GLU E 2 178 ? -27.399 19.529  99.920  1.00 119.74 ? 178 GLU E CD  1 
ATOM   5420 O  OE1 . GLU E 2 178 ? -28.318 19.163  99.157  1.00 120.64 ? 178 GLU E OE1 1 
ATOM   5421 O  OE2 . GLU E 2 178 ? -27.003 18.839  100.883 1.00 118.73 ? 178 GLU E OE2 1 
ATOM   5422 N  N   . GLU E 2 179 ? -24.883 20.748  96.735  1.00 108.99 ? 179 GLU E N   1 
ATOM   5423 C  CA  . GLU E 2 179 ? -23.473 20.938  96.420  1.00 107.38 ? 179 GLU E CA  1 
ATOM   5424 C  C   . GLU E 2 179 ? -23.220 20.779  94.925  1.00 107.86 ? 179 GLU E C   1 
ATOM   5425 O  O   . GLU E 2 179 ? -24.086 20.308  94.187  1.00 113.58 ? 179 GLU E O   1 
ATOM   5426 C  CB  . GLU E 2 179 ? -22.612 19.955  97.214  1.00 106.34 ? 179 GLU E CB  1 
ATOM   5427 C  CG  . GLU E 2 179 ? -22.640 20.186  98.715  1.00 109.74 ? 179 GLU E CG  1 
ATOM   5428 C  CD  . GLU E 2 179 ? -22.041 21.522  99.109  1.00 114.42 ? 179 GLU E CD  1 
ATOM   5429 O  OE1 . GLU E 2 179 ? -21.161 22.024  98.376  1.00 116.21 ? 179 GLU E OE1 1 
ATOM   5430 O  OE2 . GLU E 2 179 ? -22.453 22.074  100.151 1.00 115.65 ? 179 GLU E OE2 1 
ATOM   5431 N  N   . ASN E 2 180 ? -22.031 21.173  94.482  1.00 100.36 ? 180 ASN E N   1 
ATOM   5432 C  CA  . ASN E 2 180 ? -21.676 21.068  93.072  1.00 96.65  ? 180 ASN E CA  1 
ATOM   5433 C  C   . ASN E 2 180 ? -20.461 20.182  92.840  1.00 92.42  ? 180 ASN E C   1 
ATOM   5434 O  O   . ASN E 2 180 ? -19.740 20.340  91.855  1.00 90.51  ? 180 ASN E O   1 
ATOM   5435 C  CB  . ASN E 2 180 ? -21.442 22.455  92.477  1.00 98.49  ? 180 ASN E CB  1 
ATOM   5436 C  CG  . ASN E 2 180 ? -22.709 23.277  92.414  1.00 99.27  ? 180 ASN E CG  1 
ATOM   5437 O  OD1 . ASN E 2 180 ? -23.794 22.745  92.178  1.00 99.05  ? 180 ASN E OD1 1 
ATOM   5438 N  ND2 . ASN E 2 180 ? -22.582 24.580  92.629  1.00 100.79 ? 180 ASN E ND2 1 
ATOM   5439 N  N   . GLY E 2 181 ? -20.241 19.247  93.755  1.00 91.63  ? 181 GLY E N   1 
ATOM   5440 C  CA  . GLY E 2 181 ? -19.128 18.325  93.645  1.00 84.33  ? 181 GLY E CA  1 
ATOM   5441 C  C   . GLY E 2 181 ? -18.861 17.595  94.945  1.00 76.29  ? 181 GLY E C   1 
ATOM   5442 O  O   . GLY E 2 181 ? -19.724 17.521  95.819  1.00 74.28  ? 181 GLY E O   1 
ATOM   5443 N  N   . PHE E 2 182 ? -17.656 17.051  95.064  1.00 70.57  ? 182 PHE E N   1 
ATOM   5444 C  CA  . PHE E 2 182 ? -17.242 16.341  96.265  1.00 70.22  ? 182 PHE E CA  1 
ATOM   5445 C  C   . PHE E 2 182 ? -16.698 17.347  97.272  1.00 72.69  ? 182 PHE E C   1 
ATOM   5446 O  O   . PHE E 2 182 ? -16.560 18.525  96.955  1.00 77.51  ? 182 PHE E O   1 
ATOM   5447 C  CB  . PHE E 2 182 ? -16.165 15.313  95.916  1.00 66.49  ? 182 PHE E CB  1 
ATOM   5448 C  CG  . PHE E 2 182 ? -16.550 14.386  94.798  1.00 62.65  ? 182 PHE E CG  1 
ATOM   5449 C  CD1 . PHE E 2 182 ? -17.774 13.737  94.808  1.00 60.14  ? 182 PHE E CD1 1 
ATOM   5450 C  CD2 . PHE E 2 182 ? -15.692 14.173  93.730  1.00 61.67  ? 182 PHE E CD2 1 
ATOM   5451 C  CE1 . PHE E 2 182 ? -18.129 12.885  93.779  1.00 58.82  ? 182 PHE E CE1 1 
ATOM   5452 C  CE2 . PHE E 2 182 ? -16.044 13.323  92.699  1.00 58.30  ? 182 PHE E CE2 1 
ATOM   5453 C  CZ  . PHE E 2 182 ? -17.264 12.680  92.723  1.00 57.63  ? 182 PHE E CZ  1 
ATOM   5454 N  N   . ARG E 2 183 ? -16.397 16.891  98.483  1.00 71.66  ? 183 ARG E N   1 
ATOM   5455 C  CA  . ARG E 2 183 ? -15.795 17.770  99.479  1.00 77.96  ? 183 ARG E CA  1 
ATOM   5456 C  C   . ARG E 2 183 ? -14.354 18.081  99.078  1.00 80.65  ? 183 ARG E C   1 
ATOM   5457 O  O   . ARG E 2 183 ? -13.985 19.244  98.908  1.00 85.85  ? 183 ARG E O   1 
ATOM   5458 C  CB  . ARG E 2 183 ? -15.865 17.152  100.879 1.00 82.23  ? 183 ARG E CB  1 
ATOM   5459 C  CG  . ARG E 2 183 ? -15.348 18.059  101.989 1.00 88.03  ? 183 ARG E CG  1 
ATOM   5460 C  CD  . ARG E 2 183 ? -15.839 17.613  103.363 1.00 94.82  ? 183 ARG E CD  1 
ATOM   5461 N  NE  . ARG E 2 183 ? -15.249 18.402  104.447 1.00 101.84 ? 183 ARG E NE  1 
ATOM   5462 C  CZ  . ARG E 2 183 ? -15.664 19.614  104.808 1.00 107.39 ? 183 ARG E CZ  1 
ATOM   5463 N  NH1 . ARG E 2 183 ? -16.672 20.195  104.170 1.00 107.76 ? 183 ARG E NH1 1 
ATOM   5464 N  NH2 . ARG E 2 183 ? -15.065 20.252  105.807 1.00 109.44 ? 183 ARG E NH2 1 
ATOM   5465 N  N   . TYR E 2 184 ? -13.548 17.036  98.919  1.00 76.77  ? 184 TYR E N   1 
ATOM   5466 C  CA  . TYR E 2 184 ? -12.204 17.172  98.368  1.00 72.61  ? 184 TYR E CA  1 
ATOM   5467 C  C   . TYR E 2 184 ? -12.019 16.188  97.217  1.00 66.58  ? 184 TYR E C   1 
ATOM   5468 O  O   . TYR E 2 184 ? -12.699 15.163  97.155  1.00 67.63  ? 184 TYR E O   1 
ATOM   5469 C  CB  . TYR E 2 184 ? -11.143 16.923  99.441  1.00 75.27  ? 184 TYR E CB  1 
ATOM   5470 C  CG  . TYR E 2 184 ? -11.225 17.857  100.626 1.00 80.75  ? 184 TYR E CG  1 
ATOM   5471 C  CD1 . TYR E 2 184 ? -10.676 19.131  100.571 1.00 82.46  ? 184 TYR E CD1 1 
ATOM   5472 C  CD2 . TYR E 2 184 ? -11.841 17.459  101.806 1.00 84.72  ? 184 TYR E CD2 1 
ATOM   5473 C  CE1 . TYR E 2 184 ? -10.746 19.986  101.655 1.00 86.71  ? 184 TYR E CE1 1 
ATOM   5474 C  CE2 . TYR E 2 184 ? -11.916 18.308  102.897 1.00 86.76  ? 184 TYR E CE2 1 
ATOM   5475 C  CZ  . TYR E 2 184 ? -11.368 19.570  102.817 1.00 87.57  ? 184 TYR E CZ  1 
ATOM   5476 O  OH  . TYR E 2 184 ? -11.442 20.416  103.900 1.00 89.25  ? 184 TYR E OH  1 
ATOM   5477 N  N   . ILE E 2 185 ? -11.104 16.499  96.306  1.00 59.99  ? 185 ILE E N   1 
ATOM   5478 C  CA  . ILE E 2 185 ? -10.827 15.611  95.183  1.00 56.65  ? 185 ILE E CA  1 
ATOM   5479 C  C   . ILE E 2 185 ? -9.631  14.709  95.481  1.00 60.42  ? 185 ILE E C   1 
ATOM   5480 O  O   . ILE E 2 185 ? -8.547  15.200  95.798  1.00 65.47  ? 185 ILE E O   1 
ATOM   5481 C  CB  . ILE E 2 185 ? -10.559 16.397  93.882  1.00 51.19  ? 185 ILE E CB  1 
ATOM   5482 C  CG1 . ILE E 2 185 ? -11.730 17.330  93.563  1.00 52.44  ? 185 ILE E CG1 1 
ATOM   5483 C  CG2 . ILE E 2 185 ? -10.298 15.445  92.725  1.00 46.50  ? 185 ILE E CG2 1 
ATOM   5484 C  CD1 . ILE E 2 185 ? -13.065 16.625  93.409  1.00 49.92  ? 185 ILE E CD1 1 
ATOM   5485 N  N   . PRO E 2 186 ? -9.833  13.383  95.394  1.00 59.72  ? 186 PRO E N   1 
ATOM   5486 C  CA  . PRO E 2 186 ? -8.745  12.407  95.544  1.00 58.98  ? 186 PRO E CA  1 
ATOM   5487 C  C   . PRO E 2 186 ? -7.794  12.463  94.356  1.00 59.00  ? 186 PRO E C   1 
ATOM   5488 O  O   . PRO E 2 186 ? -8.138  11.992  93.271  1.00 61.19  ? 186 PRO E O   1 
ATOM   5489 C  CB  . PRO E 2 186 ? -9.474  11.056  95.543  1.00 53.77  ? 186 PRO E CB  1 
ATOM   5490 C  CG  . PRO E 2 186 ? -10.906 11.369  95.803  1.00 55.23  ? 186 PRO E CG  1 
ATOM   5491 C  CD  . PRO E 2 186 ? -11.139 12.727  95.223  1.00 56.20  ? 186 PRO E CD  1 
ATOM   5492 N  N   . PHE E 2 187 ? -6.614  13.037  94.554  1.00 55.06  ? 187 PHE E N   1 
ATOM   5493 C  CA  . PHE E 2 187 ? -5.629  13.097  93.486  1.00 56.29  ? 187 PHE E CA  1 
ATOM   5494 C  C   . PHE E 2 187 ? -4.251  12.792  94.033  1.00 57.99  ? 187 PHE E C   1 
ATOM   5495 O  O   . PHE E 2 187 ? -3.940  13.120  95.177  1.00 62.18  ? 187 PHE E O   1 
ATOM   5496 C  CB  . PHE E 2 187 ? -5.620  14.479  92.829  1.00 59.85  ? 187 PHE E CB  1 
ATOM   5497 C  CG  . PHE E 2 187 ? -5.007  15.555  93.687  1.00 62.01  ? 187 PHE E CG  1 
ATOM   5498 C  CD1 . PHE E 2 187 ? -5.773  16.236  94.618  1.00 57.41  ? 187 PHE E CD1 1 
ATOM   5499 C  CD2 . PHE E 2 187 ? -3.665  15.886  93.560  1.00 62.90  ? 187 PHE E CD2 1 
ATOM   5500 C  CE1 . PHE E 2 187 ? -5.213  17.222  95.407  1.00 57.42  ? 187 PHE E CE1 1 
ATOM   5501 C  CE2 . PHE E 2 187 ? -3.099  16.871  94.351  1.00 61.63  ? 187 PHE E CE2 1 
ATOM   5502 C  CZ  . PHE E 2 187 ? -3.875  17.539  95.275  1.00 59.38  ? 187 PHE E CZ  1 
ATOM   5503 N  N   . ARG E 2 188 ? -3.424  12.166  93.209  1.00 53.48  ? 188 ARG E N   1 
ATOM   5504 C  CA  . ARG E 2 188 ? -2.025  11.977  93.550  1.00 52.20  ? 188 ARG E CA  1 
ATOM   5505 C  C   . ARG E 2 188 ? -1.180  12.383  92.351  1.00 53.84  ? 188 ARG E C   1 
ATOM   5506 O  O   . ARG E 2 188 ? -1.345  11.851  91.252  1.00 54.09  ? 188 ARG E O   1 
ATOM   5507 C  CB  . ARG E 2 188 ? -1.753  10.530  93.967  1.00 52.37  ? 188 ARG E CB  1 
ATOM   5508 C  CG  . ARG E 2 188 ? -2.416  10.135  95.284  1.00 51.36  ? 188 ARG E CG  1 
ATOM   5509 C  CD  . ARG E 2 188 ? -2.206  8.664   95.600  1.00 55.16  ? 188 ARG E CD  1 
ATOM   5510 N  NE  . ARG E 2 188 ? -2.830  8.281   96.865  1.00 62.54  ? 188 ARG E NE  1 
ATOM   5511 C  CZ  . ARG E 2 188 ? -2.881  7.035   97.325  1.00 66.70  ? 188 ARG E CZ  1 
ATOM   5512 N  NH1 . ARG E 2 188 ? -2.346  6.047   96.621  1.00 67.20  ? 188 ARG E NH1 1 
ATOM   5513 N  NH2 . ARG E 2 188 ? -3.471  6.773   98.485  1.00 67.06  ? 188 ARG E NH2 1 
ATOM   5514 N  N   . ILE E 2 189 ? -0.298  13.354  92.559  1.00 52.92  ? 189 ILE E N   1 
ATOM   5515 C  CA  . ILE E 2 189 ? 0.555   13.834  91.484  1.00 55.13  ? 189 ILE E CA  1 
ATOM   5516 C  C   . ILE E 2 189 ? 1.925   13.178  91.550  1.00 57.09  ? 189 ILE E C   1 
ATOM   5517 O  O   . ILE E 2 189 ? 2.596   13.216  92.582  1.00 57.45  ? 189 ILE E O   1 
ATOM   5518 C  CB  . ILE E 2 189 ? 0.704   15.365  91.504  1.00 54.65  ? 189 ILE E CB  1 
ATOM   5519 C  CG1 . ILE E 2 189 ? -0.651  16.024  91.239  1.00 56.03  ? 189 ILE E CG1 1 
ATOM   5520 C  CG2 . ILE E 2 189 ? 1.721   15.814  90.467  1.00 52.85  ? 189 ILE E CG2 1 
ATOM   5521 C  CD1 . ILE E 2 189 ? -0.597  17.535  91.156  1.00 54.70  ? 189 ILE E CD1 1 
ATOM   5522 N  N   . TYR E 2 190 ? 2.331   12.577  90.437  1.00 56.35  ? 190 TYR E N   1 
ATOM   5523 C  CA  . TYR E 2 190 ? 3.591   11.857  90.368  1.00 52.79  ? 190 TYR E CA  1 
ATOM   5524 C  C   . TYR E 2 190 ? 4.577   12.595  89.486  1.00 58.72  ? 190 TYR E C   1 
ATOM   5525 O  O   . TYR E 2 190 ? 4.201   13.194  88.482  1.00 60.64  ? 190 TYR E O   1 
ATOM   5526 C  CB  . TYR E 2 190 ? 3.373   10.451  89.816  1.00 46.87  ? 190 TYR E CB  1 
ATOM   5527 C  CG  . TYR E 2 190 ? 2.401   9.611   90.612  1.00 48.08  ? 190 TYR E CG  1 
ATOM   5528 C  CD1 . TYR E 2 190 ? 2.854   8.637   91.489  1.00 45.80  ? 190 TYR E CD1 1 
ATOM   5529 C  CD2 . TYR E 2 190 ? 1.030   9.788   90.480  1.00 52.07  ? 190 TYR E CD2 1 
ATOM   5530 C  CE1 . TYR E 2 190 ? 1.971   7.862   92.210  1.00 47.92  ? 190 TYR E CE1 1 
ATOM   5531 C  CE2 . TYR E 2 190 ? 0.138   9.020   91.201  1.00 53.40  ? 190 TYR E CE2 1 
ATOM   5532 C  CZ  . TYR E 2 190 ? 0.613   8.057   92.065  1.00 53.17  ? 190 TYR E CZ  1 
ATOM   5533 O  OH  . TYR E 2 190 ? -0.275  7.285   92.782  1.00 57.02  ? 190 TYR E OH  1 
ATOM   5534 N  N   . GLN E 2 191 ? 5.845   12.539  89.868  1.00 69.20  ? 191 GLN E N   1 
ATOM   5535 C  CA  . GLN E 2 191 ? 6.902   13.183  89.110  1.00 76.78  ? 191 GLN E CA  1 
ATOM   5536 C  C   . GLN E 2 191 ? 8.187   12.406  89.337  1.00 83.49  ? 191 GLN E C   1 
ATOM   5537 O  O   . GLN E 2 191 ? 8.492   12.014  90.461  1.00 86.28  ? 191 GLN E O   1 
ATOM   5538 C  CB  . GLN E 2 191 ? 7.061   14.628  89.564  1.00 81.67  ? 191 GLN E CB  1 
ATOM   5539 C  CG  . GLN E 2 191 ? 7.746   15.530  88.563  1.00 86.37  ? 191 GLN E CG  1 
ATOM   5540 C  CD  . GLN E 2 191 ? 7.623   16.989  88.945  1.00 88.53  ? 191 GLN E CD  1 
ATOM   5541 O  OE1 . GLN E 2 191 ? 7.131   17.319  90.027  1.00 85.74  ? 191 GLN E OE1 1 
ATOM   5542 N  NE2 . GLN E 2 191 ? 8.061   17.874  88.056  1.00 90.93  ? 191 GLN E NE2 1 
ATOM   5543 N  N   . THR E 2 192 ? 8.932   12.170  88.266  1.00 89.56  ? 192 THR E N   1 
ATOM   5544 C  CA  . THR E 2 192 ? 10.106  11.307  88.341  1.00 93.12  ? 192 THR E CA  1 
ATOM   5545 C  C   . THR E 2 192 ? 11.302  11.968  89.026  1.00 95.14  ? 192 THR E C   1 
ATOM   5546 O  O   . THR E 2 192 ? 12.133  11.288  89.628  1.00 93.71  ? 192 THR E O   1 
ATOM   5547 C  CB  . THR E 2 192 ? 10.519  10.809  86.947  1.00 91.56  ? 192 THR E CB  1 
ATOM   5548 O  OG1 . THR E 2 192 ? 10.336  11.863  85.992  1.00 91.77  ? 192 THR E OG1 1 
ATOM   5549 C  CG2 . THR E 2 192 ? 9.668   9.614   86.543  1.00 87.54  ? 192 THR E CG2 1 
ATOM   5550 N  N   . THR E 2 193 ? 11.381  13.291  88.941  1.00 97.91  ? 193 THR E N   1 
ATOM   5551 C  CA  . THR E 2 193 ? 12.529  14.016  89.473  1.00 99.86  ? 193 THR E CA  1 
ATOM   5552 C  C   . THR E 2 193 ? 12.276  14.585  90.865  1.00 101.64 ? 193 THR E C   1 
ATOM   5553 O  O   . THR E 2 193 ? 12.865  15.597  91.240  1.00 101.76 ? 193 THR E O   1 
ATOM   5554 C  CB  . THR E 2 193 ? 12.944  15.167  88.543  1.00 98.10  ? 193 THR E CB  1 
ATOM   5555 O  OG1 . THR E 2 193 ? 11.860  16.097  88.423  1.00 96.03  ? 193 THR E OG1 1 
ATOM   5556 C  CG2 . THR E 2 193 ? 13.307  14.632  87.166  1.00 97.22  ? 193 THR E CG2 1 
ATOM   5557 N  N   . THR E 2 194 ? 11.402  13.937  91.628  1.00 103.81 ? 194 THR E N   1 
ATOM   5558 C  CA  . THR E 2 194 ? 11.123  14.380  92.990  1.00 106.33 ? 194 THR E CA  1 
ATOM   5559 C  C   . THR E 2 194 ? 11.359  13.272  94.018  1.00 108.55 ? 194 THR E C   1 
ATOM   5560 O  O   . THR E 2 194 ? 11.219  12.086  93.718  1.00 106.32 ? 194 THR E O   1 
ATOM   5561 C  CB  . THR E 2 194 ? 9.692   14.952  93.134  1.00 103.99 ? 194 THR E CB  1 
ATOM   5562 O  OG1 . THR E 2 194 ? 9.536   15.537  94.433  1.00 105.04 ? 194 THR E OG1 1 
ATOM   5563 C  CG2 . THR E 2 194 ? 8.649   13.864  92.946  1.00 101.16 ? 194 THR E CG2 1 
ATOM   5564 N  N   . GLU E 2 195 ? 11.730  13.679  95.228  1.00 112.65 ? 195 GLU E N   1 
ATOM   5565 C  CA  . GLU E 2 195 ? 12.013  12.751  96.316  1.00 113.27 ? 195 GLU E CA  1 
ATOM   5566 C  C   . GLU E 2 195 ? 10.740  12.025  96.727  1.00 108.05 ? 195 GLU E C   1 
ATOM   5567 O  O   . GLU E 2 195 ? 10.715  10.800  96.838  1.00 106.55 ? 195 GLU E O   1 
ATOM   5568 C  CB  . GLU E 2 195 ? 12.571  13.510  97.524  1.00 120.33 ? 195 GLU E CB  1 
ATOM   5569 C  CG  . GLU E 2 195 ? 13.595  14.591  97.188  1.00 126.93 ? 195 GLU E CG  1 
ATOM   5570 C  CD  . GLU E 2 195 ? 15.003  14.047  97.036  1.00 131.84 ? 195 GLU E CD  1 
ATOM   5571 O  OE1 . GLU E 2 195 ? 15.443  13.839  95.885  1.00 135.20 ? 195 GLU E OE1 1 
ATOM   5572 O  OE2 . GLU E 2 195 ? 15.673  13.837  98.071  1.00 131.35 ? 195 GLU E OE2 1 
ATOM   5573 N  N   . ARG E 2 196 ? 9.688   12.803  96.956  1.00 106.04 ? 196 ARG E N   1 
ATOM   5574 C  CA  . ARG E 2 196 ? 8.399   12.277  97.385  1.00 100.25 ? 196 ARG E CA  1 
ATOM   5575 C  C   . ARG E 2 196 ? 7.809   11.343  96.337  1.00 91.33  ? 196 ARG E C   1 
ATOM   5576 O  O   . ARG E 2 196 ? 7.897   11.615  95.141  1.00 93.42  ? 196 ARG E O   1 
ATOM   5577 C  CB  . ARG E 2 196 ? 7.430   13.431  97.652  1.00 104.39 ? 196 ARG E CB  1 
ATOM   5578 C  CG  . ARG E 2 196 ? 7.948   14.448  98.655  1.00 110.02 ? 196 ARG E CG  1 
ATOM   5579 C  CD  . ARG E 2 196 ? 7.294   15.812  98.465  1.00 114.77 ? 196 ARG E CD  1 
ATOM   5580 N  NE  . ARG E 2 196 ? 5.853   15.784  98.698  1.00 115.64 ? 196 ARG E NE  1 
ATOM   5581 C  CZ  . ARG E 2 196 ? 5.073   16.861  98.678  1.00 117.44 ? 196 ARG E CZ  1 
ATOM   5582 N  NH1 . ARG E 2 196 ? 5.595   18.057  98.436  1.00 119.97 ? 196 ARG E NH1 1 
ATOM   5583 N  NH2 . ARG E 2 196 ? 3.771   16.745  98.901  1.00 115.90 ? 196 ARG E NH2 1 
ATOM   5584 N  N   . PRO E 2 197 ? 7.216   10.229  96.788  1.00 82.17  ? 197 PRO E N   1 
ATOM   5585 C  CA  . PRO E 2 197 ? 6.528   9.284   95.905  1.00 76.86  ? 197 PRO E CA  1 
ATOM   5586 C  C   . PRO E 2 197 ? 5.450   9.989   95.087  1.00 73.69  ? 197 PRO E C   1 
ATOM   5587 O  O   . PRO E 2 197 ? 5.348   9.779   93.876  1.00 72.96  ? 197 PRO E O   1 
ATOM   5588 C  CB  . PRO E 2 197 ? 5.891   8.300   96.888  1.00 74.57  ? 197 PRO E CB  1 
ATOM   5589 C  CG  . PRO E 2 197 ? 6.786   8.337   98.074  1.00 74.00  ? 197 PRO E CG  1 
ATOM   5590 C  CD  . PRO E 2 197 ? 7.236   9.763   98.184  1.00 78.23  ? 197 PRO E CD  1 
ATOM   5591 N  N   . PHE E 2 198 ? 4.666   10.831  95.753  1.00 68.09  ? 198 PHE E N   1 
ATOM   5592 C  CA  . PHE E 2 198 ? 3.631   11.609  95.089  1.00 64.95  ? 198 PHE E CA  1 
ATOM   5593 C  C   . PHE E 2 198 ? 3.125   12.729  95.986  1.00 69.05  ? 198 PHE E C   1 
ATOM   5594 O  O   . PHE E 2 198 ? 3.350   12.718  97.195  1.00 72.17  ? 198 PHE E O   1 
ATOM   5595 C  CB  . PHE E 2 198 ? 2.463   10.717  94.658  1.00 64.19  ? 198 PHE E CB  1 
ATOM   5596 C  CG  . PHE E 2 198 ? 1.896   9.878   95.768  1.00 64.07  ? 198 PHE E CG  1 
ATOM   5597 C  CD1 . PHE E 2 198 ? 0.936   10.392  96.624  1.00 61.38  ? 198 PHE E CD1 1 
ATOM   5598 C  CD2 . PHE E 2 198 ? 2.318   8.572   95.950  1.00 63.24  ? 198 PHE E CD2 1 
ATOM   5599 C  CE1 . PHE E 2 198 ? 0.415   9.622   97.645  1.00 58.17  ? 198 PHE E CE1 1 
ATOM   5600 C  CE2 . PHE E 2 198 ? 1.798   7.799   96.967  1.00 61.92  ? 198 PHE E CE2 1 
ATOM   5601 C  CZ  . PHE E 2 198 ? 0.843   8.327   97.816  1.00 58.26  ? 198 PHE E CZ  1 
ATOM   5602 N  N   . ILE E 2 199 ? 2.436   13.691  95.384  1.00 67.78  ? 199 ILE E N   1 
ATOM   5603 C  CA  . ILE E 2 199 ? 1.846   14.798  96.122  1.00 59.87  ? 199 ILE E CA  1 
ATOM   5604 C  C   . ILE E 2 199 ? 0.345   14.604  96.268  1.00 60.05  ? 199 ILE E C   1 
ATOM   5605 O  O   . ILE E 2 199 ? -0.373  14.491  95.277  1.00 62.09  ? 199 ILE E O   1 
ATOM   5606 C  CB  . ILE E 2 199 ? 2.095   16.138  95.414  1.00 63.27  ? 199 ILE E CB  1 
ATOM   5607 C  CG1 . ILE E 2 199 ? 3.588   16.470  95.404  1.00 62.98  ? 199 ILE E CG1 1 
ATOM   5608 C  CG2 . ILE E 2 199 ? 1.302   17.252  96.085  1.00 63.40  ? 199 ILE E CG2 1 
ATOM   5609 C  CD1 . ILE E 2 199 ? 3.909   17.777  94.721  1.00 60.69  ? 199 ILE E CD1 1 
ATOM   5610 N  N   . GLN E 2 200 ? -0.124  14.562  97.510  1.00 65.15  ? 200 GLN E N   1 
ATOM   5611 C  CA  . GLN E 2 200 ? -1.552  14.469  97.793  1.00 65.91  ? 200 GLN E CA  1 
ATOM   5612 C  C   . GLN E 2 200 ? -1.942  15.446  98.892  1.00 68.42  ? 200 GLN E C   1 
ATOM   5613 O  O   . GLN E 2 200 ? -1.549  15.277  100.046 1.00 72.44  ? 200 GLN E O   1 
ATOM   5614 C  CB  . GLN E 2 200 ? -1.929  13.049  98.209  1.00 66.64  ? 200 GLN E CB  1 
ATOM   5615 C  CG  . GLN E 2 200 ? -3.373  12.910  98.658  1.00 67.59  ? 200 GLN E CG  1 
ATOM   5616 C  CD  . GLN E 2 200 ? -3.681  11.531  99.196  1.00 68.20  ? 200 GLN E CD  1 
ATOM   5617 O  OE1 . GLN E 2 200 ? -2.976  10.564  98.901  1.00 69.93  ? 200 GLN E OE1 1 
ATOM   5618 N  NE2 . GLN E 2 200 ? -4.737  11.431  99.997  1.00 67.30  ? 200 GLN E NE2 1 
ATOM   5619 N  N   . LYS E 2 201 ? -2.711  16.470  98.529  1.00 68.15  ? 201 LYS E N   1 
ATOM   5620 C  CA  . LYS E 2 201 ? -3.136  17.492  99.481  1.00 69.17  ? 201 LYS E CA  1 
ATOM   5621 C  C   . LYS E 2 201 ? -4.638  17.738  99.397  1.00 70.70  ? 201 LYS E C   1 
ATOM   5622 O  O   . LYS E 2 201 ? -5.307  17.248  98.488  1.00 65.94  ? 201 LYS E O   1 
ATOM   5623 C  CB  . LYS E 2 201 ? -2.374  18.797  99.244  1.00 69.18  ? 201 LYS E CB  1 
ATOM   5624 C  CG  . LYS E 2 201 ? -0.876  18.672  99.452  1.00 72.43  ? 201 LYS E CG  1 
ATOM   5625 C  CD  . LYS E 2 201 ? -0.148  19.963  99.132  1.00 75.60  ? 201 LYS E CD  1 
ATOM   5626 C  CE  . LYS E 2 201 ? 1.338   19.816  99.410  1.00 78.98  ? 201 LYS E CE  1 
ATOM   5627 N  NZ  . LYS E 2 201 ? 2.091   21.066  99.125  1.00 85.96  ? 201 LYS E NZ  1 
ATOM   5628 N  N   . LEU E 2 202 ? -5.164  18.495  100.353 1.00 76.22  ? 202 LEU E N   1 
ATOM   5629 C  CA  . LEU E 2 202 ? -6.584  18.825  100.359 1.00 78.10  ? 202 LEU E CA  1 
ATOM   5630 C  C   . LEU E 2 202 ? -6.885  19.912  99.339  1.00 76.18  ? 202 LEU E C   1 
ATOM   5631 O  O   . LEU E 2 202 ? -6.278  20.982  99.357  1.00 80.67  ? 202 LEU E O   1 
ATOM   5632 C  CB  . LEU E 2 202 ? -7.040  19.263  101.754 1.00 79.20  ? 202 LEU E CB  1 
ATOM   5633 C  CG  . LEU E 2 202 ? -6.970  18.196  102.848 1.00 76.48  ? 202 LEU E CG  1 
ATOM   5634 C  CD1 . LEU E 2 202 ? -7.428  18.762  104.181 1.00 77.93  ? 202 LEU E CD1 1 
ATOM   5635 C  CD2 . LEU E 2 202 ? -7.798  16.980  102.466 1.00 70.47  ? 202 LEU E CD2 1 
ATOM   5636 N  N   . PHE E 2 203 ? -7.821  19.627  98.442  1.00 70.53  ? 203 PHE E N   1 
ATOM   5637 C  CA  . PHE E 2 203 ? -8.212  20.585  97.423  1.00 66.58  ? 203 PHE E CA  1 
ATOM   5638 C  C   . PHE E 2 203 ? -9.706  20.467  97.151  1.00 68.71  ? 203 PHE E C   1 
ATOM   5639 O  O   . PHE E 2 203 ? -10.219 19.372  96.929  1.00 65.53  ? 203 PHE E O   1 
ATOM   5640 C  CB  . PHE E 2 203 ? -7.408  20.359  96.140  1.00 63.48  ? 203 PHE E CB  1 
ATOM   5641 C  CG  . PHE E 2 203 ? -7.489  21.498  95.166  1.00 66.49  ? 203 PHE E CG  1 
ATOM   5642 C  CD1 . PHE E 2 203 ? -6.550  22.518  95.193  1.00 65.32  ? 203 PHE E CD1 1 
ATOM   5643 C  CD2 . PHE E 2 203 ? -8.504  21.552  94.225  1.00 70.25  ? 203 PHE E CD2 1 
ATOM   5644 C  CE1 . PHE E 2 203 ? -6.619  23.570  94.299  1.00 64.35  ? 203 PHE E CE1 1 
ATOM   5645 C  CE2 . PHE E 2 203 ? -8.582  22.603  93.326  1.00 72.67  ? 203 PHE E CE2 1 
ATOM   5646 C  CZ  . PHE E 2 203 ? -7.636  23.615  93.363  1.00 68.79  ? 203 PHE E CZ  1 
ATOM   5647 N  N   . ARG E 2 204 ? -10.401 21.601  97.185  1.00 74.25  ? 204 ARG E N   1 
ATOM   5648 C  CA  . ARG E 2 204 ? -11.839 21.626  96.944  1.00 72.97  ? 204 ARG E CA  1 
ATOM   5649 C  C   . ARG E 2 204 ? -12.122 21.868  95.465  1.00 75.07  ? 204 ARG E C   1 
ATOM   5650 O  O   . ARG E 2 204 ? -11.435 22.660  94.822  1.00 78.76  ? 204 ARG E O   1 
ATOM   5651 C  CB  . ARG E 2 204 ? -12.509 22.697  97.808  1.00 73.60  ? 204 ARG E CB  1 
ATOM   5652 C  CG  . ARG E 2 204 ? -12.300 22.500  99.306  1.00 72.27  ? 204 ARG E CG  1 
ATOM   5653 C  CD  . ARG E 2 204 ? -13.070 23.524  100.131 1.00 74.95  ? 204 ARG E CD  1 
ATOM   5654 N  NE  . ARG E 2 204 ? -12.775 23.405  101.559 1.00 81.99  ? 204 ARG E NE  1 
ATOM   5655 C  CZ  . ARG E 2 204 ? -13.537 22.756  102.437 1.00 88.03  ? 204 ARG E CZ  1 
ATOM   5656 N  NH1 . ARG E 2 204 ? -14.657 22.164  102.043 1.00 90.78  ? 204 ARG E NH1 1 
ATOM   5657 N  NH2 . ARG E 2 204 ? -13.181 22.702  103.714 1.00 87.76  ? 204 ARG E NH2 1 
ATOM   5658 N  N   . PRO E 2 205 ? -13.128 21.171  94.915  1.00 74.40  ? 205 PRO E N   1 
ATOM   5659 C  CA  . PRO E 2 205 ? -13.470 21.289  93.492  1.00 75.22  ? 205 PRO E CA  1 
ATOM   5660 C  C   . PRO E 2 205 ? -14.129 22.620  93.127  1.00 77.15  ? 205 PRO E C   1 
ATOM   5661 O  O   . PRO E 2 205 ? -13.984 23.068  91.988  1.00 74.67  ? 205 PRO E O   1 
ATOM   5662 C  CB  . PRO E 2 205 ? -14.450 20.134  93.272  1.00 75.05  ? 205 PRO E CB  1 
ATOM   5663 C  CG  . PRO E 2 205 ? -15.044 19.892  94.602  1.00 75.16  ? 205 PRO E CG  1 
ATOM   5664 C  CD  . PRO E 2 205 ? -13.949 20.156  95.594  1.00 73.28  ? 205 PRO E CD  1 
ATOM   5665 N  N   . VAL E 2 206 ? -14.844 23.231  94.070  1.00 80.79  ? 206 VAL E N   1 
ATOM   5666 C  CA  . VAL E 2 206 ? -15.486 24.526  93.832  1.00 83.95  ? 206 VAL E CA  1 
ATOM   5667 C  C   . VAL E 2 206 ? -14.854 25.638  94.666  1.00 88.19  ? 206 VAL E C   1 
ATOM   5668 O  O   . VAL E 2 206 ? -14.265 25.384  95.718  1.00 90.23  ? 206 VAL E O   1 
ATOM   5669 C  CB  . VAL E 2 206 ? -17.006 24.485  94.114  1.00 83.67  ? 206 VAL E CB  1 
ATOM   5670 C  CG1 . VAL E 2 206 ? -17.657 23.335  93.361  1.00 84.63  ? 206 VAL E CG1 1 
ATOM   5671 C  CG2 . VAL E 2 206 ? -17.277 24.372  95.606  1.00 83.66  ? 206 VAL E CG2 1 
ATOM   5672 N  N   . ALA E 2 207 ? -14.978 26.872  94.189  1.00 92.30  ? 207 ALA E N   1 
ATOM   5673 C  CA  . ALA E 2 207 ? -14.435 28.023  94.901  1.00 97.43  ? 207 ALA E CA  1 
ATOM   5674 C  C   . ALA E 2 207 ? -15.519 28.735  95.706  1.00 103.15 ? 207 ALA E C   1 
ATOM   5675 O  O   . ALA E 2 207 ? -16.629 28.222  95.861  1.00 102.54 ? 207 ALA E O   1 
ATOM   5676 C  CB  . ALA E 2 207 ? -13.772 28.987  93.929  1.00 97.70  ? 207 ALA E CB  1 
ATOM   5677 N  N   . ALA E 2 208 ? -15.187 29.917  96.217  1.00 107.47 ? 208 ALA E N   1 
ATOM   5678 C  CA  . ALA E 2 208 ? -16.129 30.714  96.995  1.00 109.61 ? 208 ALA E CA  1 
ATOM   5679 C  C   . ALA E 2 208 ? -17.305 31.173  96.138  1.00 112.83 ? 208 ALA E C   1 
ATOM   5680 O  O   . ALA E 2 208 ? -18.424 31.317  96.629  1.00 114.89 ? 208 ALA E O   1 
ATOM   5681 C  CB  . ALA E 2 208 ? -15.423 31.910  97.611  1.00 110.35 ? 208 ALA E CB  1 
ATOM   5682 N  N   . ASP E 2 209 ? -17.042 31.393  94.853  1.00 113.72 ? 209 ASP E N   1 
ATOM   5683 C  CA  . ASP E 2 209 ? -18.062 31.858  93.918  1.00 115.96 ? 209 ASP E CA  1 
ATOM   5684 C  C   . ASP E 2 209 ? -19.071 30.765  93.583  1.00 112.16 ? 209 ASP E C   1 
ATOM   5685 O  O   . ASP E 2 209 ? -20.180 31.047  93.129  1.00 110.31 ? 209 ASP E O   1 
ATOM   5686 C  CB  . ASP E 2 209 ? -17.407 32.338  92.622  1.00 120.41 ? 209 ASP E CB  1 
ATOM   5687 C  CG  . ASP E 2 209 ? -16.233 33.260  92.868  1.00 124.80 ? 209 ASP E CG  1 
ATOM   5688 O  OD1 . ASP E 2 209 ? -16.304 34.080  93.808  1.00 129.57 ? 209 ASP E OD1 1 
ATOM   5689 O  OD2 . ASP E 2 209 ? -15.237 33.162  92.121  1.00 123.21 ? 209 ASP E OD2 1 
ATOM   5690 N  N   . GLY E 2 210 ? -18.679 29.515  93.804  1.00 110.18 ? 210 GLY E N   1 
ATOM   5691 C  CA  . GLY E 2 210 ? -19.467 28.386  93.352  1.00 105.98 ? 210 GLY E CA  1 
ATOM   5692 C  C   . GLY E 2 210 ? -19.022 28.036  91.949  1.00 104.15 ? 210 GLY E C   1 
ATOM   5693 O  O   . GLY E 2 210 ? -19.720 27.344  91.207  1.00 104.19 ? 210 GLY E O   1 
ATOM   5694 N  N   . GLN E 2 211 ? -17.844 28.536  91.587  1.00 103.15 ? 211 GLN E N   1 
ATOM   5695 C  CA  . GLN E 2 211 ? -17.260 28.275  90.279  1.00 101.35 ? 211 GLN E CA  1 
ATOM   5696 C  C   . GLN E 2 211 ? -16.335 27.064  90.363  1.00 96.75  ? 211 GLN E C   1 
ATOM   5697 O  O   . GLN E 2 211 ? -15.687 26.838  91.387  1.00 94.36  ? 211 GLN E O   1 
ATOM   5698 C  CB  . GLN E 2 211 ? -16.499 29.506  89.784  1.00 102.47 ? 211 GLN E CB  1 
ATOM   5699 C  CG  . GLN E 2 211 ? -16.202 29.506  88.293  1.00 103.50 ? 211 GLN E CG  1 
ATOM   5700 C  CD  . GLN E 2 211 ? -15.837 30.885  87.775  1.00 107.51 ? 211 GLN E CD  1 
ATOM   5701 O  OE1 . GLN E 2 211 ? -15.823 31.861  88.527  1.00 109.75 ? 211 GLN E OE1 1 
ATOM   5702 N  NE2 . GLN E 2 211 ? -15.544 30.974  86.482  1.00 106.85 ? 211 GLN E NE2 1 
ATOM   5703 N  N   . LEU E 2 212 ? -16.282 26.287  89.287  1.00 91.94  ? 212 LEU E N   1 
ATOM   5704 C  CA  . LEU E 2 212 ? -15.515 25.046  89.273  1.00 87.21  ? 212 LEU E CA  1 
ATOM   5705 C  C   . LEU E 2 212 ? -14.024 25.277  89.046  1.00 83.99  ? 212 LEU E C   1 
ATOM   5706 O  O   . LEU E 2 212 ? -13.628 25.948  88.094  1.00 83.02  ? 212 LEU E O   1 
ATOM   5707 C  CB  . LEU E 2 212 ? -16.061 24.095  88.206  1.00 83.89  ? 212 LEU E CB  1 
ATOM   5708 C  CG  . LEU E 2 212 ? -17.500 23.610  88.396  1.00 81.41  ? 212 LEU E CG  1 
ATOM   5709 C  CD1 . LEU E 2 212 ? -17.928 22.736  87.228  1.00 79.72  ? 212 LEU E CD1 1 
ATOM   5710 C  CD2 . LEU E 2 212 ? -17.640 22.860  89.710  1.00 80.87  ? 212 LEU E CD2 1 
ATOM   5711 N  N   . HIS E 2 213 ? -13.203 24.716  89.929  1.00 82.23  ? 213 HIS E N   1 
ATOM   5712 C  CA  . HIS E 2 213 ? -11.756 24.757  89.760  1.00 82.53  ? 213 HIS E CA  1 
ATOM   5713 C  C   . HIS E 2 213 ? -11.353 23.881  88.581  1.00 78.49  ? 213 HIS E C   1 
ATOM   5714 O  O   . HIS E 2 213 ? -11.973 22.849  88.326  1.00 73.98  ? 213 HIS E O   1 
ATOM   5715 C  CB  . HIS E 2 213 ? -11.049 24.290  91.033  1.00 86.71  ? 213 HIS E CB  1 
ATOM   5716 C  CG  . HIS E 2 213 ? -11.111 25.278  92.156  1.00 94.85  ? 213 HIS E CG  1 
ATOM   5717 N  ND1 . HIS E 2 213 ? -11.559 24.947  93.417  1.00 96.07  ? 213 HIS E ND1 1 
ATOM   5718 C  CD2 . HIS E 2 213 ? -10.777 26.590  92.209  1.00 99.02  ? 213 HIS E CD2 1 
ATOM   5719 C  CE1 . HIS E 2 213 ? -11.503 26.013  94.196  1.00 98.99  ? 213 HIS E CE1 1 
ATOM   5720 N  NE2 . HIS E 2 213 ? -11.032 27.023  93.487  1.00 101.05 ? 213 HIS E NE2 1 
ATOM   5721 N  N   . THR E 2 214 ? -10.318 24.300  87.860  1.00 78.39  ? 214 THR E N   1 
ATOM   5722 C  CA  . THR E 2 214 ? -9.860  23.569  86.685  1.00 75.95  ? 214 THR E CA  1 
ATOM   5723 C  C   . THR E 2 214 ? -8.667  22.687  87.028  1.00 72.78  ? 214 THR E C   1 
ATOM   5724 O  O   . THR E 2 214 ? -8.191  22.689  88.165  1.00 72.05  ? 214 THR E O   1 
ATOM   5725 C  CB  . THR E 2 214 ? -9.454  24.526  85.550  1.00 75.27  ? 214 THR E CB  1 
ATOM   5726 O  OG1 . THR E 2 214 ? -8.269  25.240  85.922  1.00 78.32  ? 214 THR E OG1 1 
ATOM   5727 C  CG2 . THR E 2 214 ? -10.569 25.518  85.260  1.00 70.45  ? 214 THR E CG2 1 
ATOM   5728 N  N   . LEU E 2 215 ? -8.190  21.927  86.046  1.00 70.17  ? 215 LEU E N   1 
ATOM   5729 C  CA  . LEU E 2 215 ? -6.976  21.145  86.226  1.00 64.63  ? 215 LEU E CA  1 
ATOM   5730 C  C   . LEU E 2 215 ? -5.821  22.091  86.502  1.00 69.83  ? 215 LEU E C   1 
ATOM   5731 O  O   . LEU E 2 215 ? -5.004  21.846  87.386  1.00 70.32  ? 215 LEU E O   1 
ATOM   5732 C  CB  . LEU E 2 215 ? -6.673  20.307  84.986  1.00 61.37  ? 215 LEU E CB  1 
ATOM   5733 C  CG  . LEU E 2 215 ? -5.378  19.493  85.067  1.00 63.37  ? 215 LEU E CG  1 
ATOM   5734 C  CD1 . LEU E 2 215 ? -5.394  18.568  86.278  1.00 56.71  ? 215 LEU E CD1 1 
ATOM   5735 C  CD2 . LEU E 2 215 ? -5.148  18.697  83.791  1.00 64.19  ? 215 LEU E CD2 1 
ATOM   5736 N  N   . GLY E 2 216 ? -5.771  23.182  85.741  1.00 74.59  ? 216 GLY E N   1 
ATOM   5737 C  CA  . GLY E 2 216 ? -4.746  24.194  85.908  1.00 71.86  ? 216 GLY E CA  1 
ATOM   5738 C  C   . GLY E 2 216 ? -4.764  24.806  87.295  1.00 70.12  ? 216 GLY E C   1 
ATOM   5739 O  O   . GLY E 2 216 ? -3.712  25.076  87.872  1.00 71.07  ? 216 GLY E O   1 
ATOM   5740 N  N   . ASP E 2 217 ? -5.963  25.019  87.830  1.00 70.13  ? 217 ASP E N   1 
ATOM   5741 C  CA  . ASP E 2 217 ? -6.118  25.574  89.171  1.00 74.60  ? 217 ASP E CA  1 
ATOM   5742 C  C   . ASP E 2 217 ? -5.486  24.667  90.219  1.00 77.35  ? 217 ASP E C   1 
ATOM   5743 O  O   . ASP E 2 217 ? -4.827  25.139  91.147  1.00 81.09  ? 217 ASP E O   1 
ATOM   5744 C  CB  . ASP E 2 217 ? -7.595  25.792  89.498  1.00 76.46  ? 217 ASP E CB  1 
ATOM   5745 C  CG  . ASP E 2 217 ? -8.224  26.880  88.656  1.00 81.38  ? 217 ASP E CG  1 
ATOM   5746 O  OD1 . ASP E 2 217 ? -7.485  27.757  88.161  1.00 85.24  ? 217 ASP E OD1 1 
ATOM   5747 O  OD2 . ASP E 2 217 ? -9.461  26.862  88.495  1.00 83.14  ? 217 ASP E OD2 1 
ATOM   5748 N  N   . LEU E 2 218 ? -5.693  23.363  90.064  1.00 74.92  ? 218 LEU E N   1 
ATOM   5749 C  CA  . LEU E 2 218 ? -5.096  22.387  90.963  1.00 75.68  ? 218 LEU E CA  1 
ATOM   5750 C  C   . LEU E 2 218 ? -3.579  22.440  90.873  1.00 76.92  ? 218 LEU E C   1 
ATOM   5751 O  O   . LEU E 2 218 ? -2.887  22.499  91.889  1.00 76.35  ? 218 LEU E O   1 
ATOM   5752 C  CB  . LEU E 2 218 ? -5.582  20.978  90.627  1.00 71.40  ? 218 LEU E CB  1 
ATOM   5753 C  CG  . LEU E 2 218 ? -4.898  19.862  91.418  1.00 67.69  ? 218 LEU E CG  1 
ATOM   5754 C  CD1 . LEU E 2 218 ? -5.097  20.071  92.910  1.00 67.26  ? 218 LEU E CD1 1 
ATOM   5755 C  CD2 . LEU E 2 218 ? -5.416  18.499  90.990  1.00 67.41  ? 218 LEU E CD2 1 
ATOM   5756 N  N   . LEU E 2 219 ? -3.072  22.422  89.645  1.00 75.81  ? 219 LEU E N   1 
ATOM   5757 C  CA  . LEU E 2 219 ? -1.635  22.415  89.409  1.00 76.50  ? 219 LEU E CA  1 
ATOM   5758 C  C   . LEU E 2 219 ? -0.957  23.680  89.932  1.00 80.39  ? 219 LEU E C   1 
ATOM   5759 O  O   . LEU E 2 219 ? 0.086   23.605  90.570  1.00 81.10  ? 219 LEU E O   1 
ATOM   5760 C  CB  . LEU E 2 219 ? -1.337  22.217  87.922  1.00 74.13  ? 219 LEU E CB  1 
ATOM   5761 C  CG  . LEU E 2 219 ? -1.841  20.903  87.320  1.00 72.93  ? 219 LEU E CG  1 
ATOM   5762 C  CD1 . LEU E 2 219 ? -1.501  20.821  85.841  1.00 74.68  ? 219 LEU E CD1 1 
ATOM   5763 C  CD2 . LEU E 2 219 ? -1.276  19.705  88.071  1.00 70.18  ? 219 LEU E CD2 1 
ATOM   5764 N  N   . LYS E 2 220 ? -1.558  24.837  89.675  1.00 81.31  ? 220 LYS E N   1 
ATOM   5765 C  CA  . LYS E 2 220 ? -1.004  26.102  90.151  1.00 83.94  ? 220 LYS E CA  1 
ATOM   5766 C  C   . LYS E 2 220 ? -0.924  26.135  91.679  1.00 81.79  ? 220 LYS E C   1 
ATOM   5767 O  O   . LYS E 2 220 ? -0.053  26.789  92.251  1.00 81.45  ? 220 LYS E O   1 
ATOM   5768 C  CB  . LYS E 2 220 ? -1.838  27.278  89.630  1.00 89.20  ? 220 LYS E CB  1 
ATOM   5769 C  CG  . LYS E 2 220 ? -1.263  28.657  89.933  1.00 96.02  ? 220 LYS E CG  1 
ATOM   5770 C  CD  . LYS E 2 220 ? -2.144  29.756  89.350  1.00 102.58 ? 220 LYS E CD  1 
ATOM   5771 C  CE  . LYS E 2 220 ? -1.638  31.150  89.710  1.00 107.59 ? 220 LYS E CE  1 
ATOM   5772 N  NZ  . LYS E 2 220 ? -0.323  31.466  89.083  1.00 109.33 ? 220 LYS E NZ  1 
ATOM   5773 N  N   . GLU E 2 221 ? -1.824  25.405  92.330  1.00 80.81  ? 221 GLU E N   1 
ATOM   5774 C  CA  . GLU E 2 221 ? -1.910  25.395  93.788  1.00 81.21  ? 221 GLU E CA  1 
ATOM   5775 C  C   . GLU E 2 221 ? -0.911  24.454  94.464  1.00 82.58  ? 221 GLU E C   1 
ATOM   5776 O  O   . GLU E 2 221 ? -0.231  24.845  95.410  1.00 86.06  ? 221 GLU E O   1 
ATOM   5777 C  CB  . GLU E 2 221 ? -3.332  25.036  94.232  1.00 81.60  ? 221 GLU E CB  1 
ATOM   5778 C  CG  . GLU E 2 221 ? -3.476  24.762  95.724  1.00 84.77  ? 221 GLU E CG  1 
ATOM   5779 C  CD  . GLU E 2 221 ? -3.414  26.024  96.566  1.00 91.03  ? 221 GLU E CD  1 
ATOM   5780 O  OE1 . GLU E 2 221 ? -2.627  26.058  97.536  1.00 92.66  ? 221 GLU E OE1 1 
ATOM   5781 O  OE2 . GLU E 2 221 ? -4.159  26.980  96.265  1.00 93.01  ? 221 GLU E OE2 1 
ATOM   5782 N  N   . VAL E 2 222 ? -0.826  23.216  93.984  1.00 79.85  ? 222 VAL E N   1 
ATOM   5783 C  CA  . VAL E 2 222 ? -0.051  22.190  94.680  1.00 79.06  ? 222 VAL E CA  1 
ATOM   5784 C  C   . VAL E 2 222 ? 1.251   21.807  93.979  1.00 85.30  ? 222 VAL E C   1 
ATOM   5785 O  O   . VAL E 2 222 ? 2.129   21.191  94.584  1.00 84.73  ? 222 VAL E O   1 
ATOM   5786 C  CB  . VAL E 2 222 ? -0.886  20.916  94.910  1.00 70.26  ? 222 VAL E CB  1 
ATOM   5787 C  CG1 . VAL E 2 222 ? -2.121  21.236  95.732  1.00 68.95  ? 222 VAL E CG1 1 
ATOM   5788 C  CG2 . VAL E 2 222 ? -1.273  20.290  93.583  1.00 64.34  ? 222 VAL E CG2 1 
ATOM   5789 N  N   . CYS E 2 223 ? 1.373   22.165  92.706  1.00 89.73  ? 223 CYS E N   1 
ATOM   5790 C  CA  . CYS E 2 223 ? 2.582   21.859  91.948  1.00 90.52  ? 223 CYS E CA  1 
ATOM   5791 C  C   . CYS E 2 223 ? 2.762   22.839  90.794  1.00 92.78  ? 223 CYS E C   1 
ATOM   5792 O  O   . CYS E 2 223 ? 2.606   22.467  89.629  1.00 94.33  ? 223 CYS E O   1 
ATOM   5793 C  CB  . CYS E 2 223 ? 2.528   20.423  91.420  1.00 87.32  ? 223 CYS E CB  1 
ATOM   5794 S  SG  . CYS E 2 223 ? 4.085   19.818  90.730  1.00 95.16  ? 223 CYS E SG  1 
ATOM   5795 N  N   . PRO E 2 224 ? 3.077   24.105  91.116  1.00 92.76  ? 224 PRO E N   1 
ATOM   5796 C  CA  . PRO E 2 224 ? 3.185   25.169  90.111  1.00 93.77  ? 224 PRO E CA  1 
ATOM   5797 C  C   . PRO E 2 224 ? 4.414   24.992  89.226  1.00 93.44  ? 224 PRO E C   1 
ATOM   5798 O  O   . PRO E 2 224 ? 4.518   25.618  88.170  1.00 90.15  ? 224 PRO E O   1 
ATOM   5799 C  CB  . PRO E 2 224 ? 3.325   26.431  90.962  1.00 94.74  ? 224 PRO E CB  1 
ATOM   5800 C  CG  . PRO E 2 224 ? 3.979   25.956  92.210  1.00 93.84  ? 224 PRO E CG  1 
ATOM   5801 C  CD  . PRO E 2 224 ? 3.416   24.590  92.466  1.00 91.81  ? 224 PRO E CD  1 
ATOM   5802 N  N   . SER E 2 225 ? 5.333   24.138  89.664  1.00 97.30  ? 225 SER E N   1 
ATOM   5803 C  CA  . SER E 2 225 ? 6.544   23.844  88.910  1.00 100.66 ? 225 SER E CA  1 
ATOM   5804 C  C   . SER E 2 225 ? 6.269   22.791  87.838  1.00 99.89  ? 225 SER E C   1 
ATOM   5805 O  O   . SER E 2 225 ? 6.941   21.760  87.778  1.00 100.07 ? 225 SER E O   1 
ATOM   5806 C  CB  . SER E 2 225 ? 7.642   23.356  89.855  1.00 100.93 ? 225 SER E CB  1 
ATOM   5807 O  OG  . SER E 2 225 ? 7.774   24.221  90.972  1.00 100.32 ? 225 SER E OG  1 
ATOM   5808 N  N   . ALA E 2 226 ? 5.278   23.059  86.994  1.00 97.67  ? 226 ALA E N   1 
ATOM   5809 C  CA  . ALA E 2 226 ? 4.879   22.124  85.950  1.00 91.77  ? 226 ALA E CA  1 
ATOM   5810 C  C   . ALA E 2 226 ? 4.148   22.841  84.820  1.00 91.93  ? 226 ALA E C   1 
ATOM   5811 O  O   . ALA E 2 226 ? 3.541   22.204  83.960  1.00 89.73  ? 226 ALA E O   1 
ATOM   5812 C  CB  . ALA E 2 226 ? 4.004   21.027  86.533  1.00 88.14  ? 226 ALA E CB  1 
ATOM   5813 N  N   . ILE E 2 227 ? 4.204   24.170  84.829  1.00 93.82  ? 227 ILE E N   1 
ATOM   5814 C  CA  . ILE E 2 227 ? 3.559   24.971  83.793  1.00 92.52  ? 227 ILE E CA  1 
ATOM   5815 C  C   . ILE E 2 227 ? 4.543   25.936  83.134  1.00 92.04  ? 227 ILE E C   1 
ATOM   5816 O  O   . ILE E 2 227 ? 5.100   26.818  83.789  1.00 93.03  ? 227 ILE E O   1 
ATOM   5817 C  CB  . ILE E 2 227 ? 2.361   25.766  84.352  1.00 92.80  ? 227 ILE E CB  1 
ATOM   5818 C  CG1 . ILE E 2 227 ? 1.394   24.832  85.086  1.00 88.94  ? 227 ILE E CG1 1 
ATOM   5819 C  CG2 . ILE E 2 227 ? 1.652   26.511  83.231  1.00 92.17  ? 227 ILE E CG2 1 
ATOM   5820 C  CD1 . ILE E 2 227 ? 0.266   25.547  85.800  1.00 86.80  ? 227 ILE E CD1 1 
ATOM   5821 N  N   . LYS E 2 235 ? 7.171   22.989  78.670  1.00 86.28  ? 235 LYS E N   1 
ATOM   5822 C  CA  . LYS E 2 235 ? 8.404   22.312  79.059  1.00 90.36  ? 235 LYS E CA  1 
ATOM   5823 C  C   . LYS E 2 235 ? 8.101   20.960  79.700  1.00 89.08  ? 235 LYS E C   1 
ATOM   5824 O  O   . LYS E 2 235 ? 8.805   19.976  79.465  1.00 85.99  ? 235 LYS E O   1 
ATOM   5825 C  CB  . LYS E 2 235 ? 9.213   23.187  80.016  1.00 92.62  ? 235 LYS E CB  1 
ATOM   5826 C  CG  . LYS E 2 235 ? 10.628  22.697  80.268  1.00 94.32  ? 235 LYS E CG  1 
ATOM   5827 C  CD  . LYS E 2 235 ? 11.440  23.763  80.984  1.00 100.78 ? 235 LYS E CD  1 
ATOM   5828 C  CE  . LYS E 2 235 ? 12.910  23.391  81.065  1.00 101.96 ? 235 LYS E CE  1 
ATOM   5829 N  NZ  . LYS E 2 235 ? 13.724  24.506  81.627  1.00 101.82 ? 235 LYS E NZ  1 
ATOM   5830 N  N   . ASN E 2 236 ? 7.051   20.921  80.514  1.00 89.20  ? 236 ASN E N   1 
ATOM   5831 C  CA  . ASN E 2 236 ? 6.578   19.672  81.098  1.00 86.24  ? 236 ASN E CA  1 
ATOM   5832 C  C   . ASN E 2 236 ? 5.235   19.250  80.520  1.00 82.46  ? 236 ASN E C   1 
ATOM   5833 O  O   . ASN E 2 236 ? 4.484   20.072  79.994  1.00 83.76  ? 236 ASN E O   1 
ATOM   5834 C  CB  . ASN E 2 236 ? 6.467   19.782  82.619  1.00 86.96  ? 236 ASN E CB  1 
ATOM   5835 C  CG  . ASN E 2 236 ? 7.811   19.925  83.292  1.00 90.83  ? 236 ASN E CG  1 
ATOM   5836 O  OD1 . ASN E 2 236 ? 7.954   20.671  84.262  1.00 95.43  ? 236 ASN E OD1 1 
ATOM   5837 N  ND2 . ASN E 2 236 ? 8.809   19.213  82.781  1.00 91.48  ? 236 ASN E ND2 1 
ATOM   5838 N  N   . GLN E 2 237 ? 4.935   17.963  80.636  1.00 77.32  ? 237 GLN E N   1 
ATOM   5839 C  CA  . GLN E 2 237 ? 3.696   17.416  80.113  1.00 76.06  ? 237 GLN E CA  1 
ATOM   5840 C  C   . GLN E 2 237 ? 2.832   16.906  81.265  1.00 70.84  ? 237 GLN E C   1 
ATOM   5841 O  O   . GLN E 2 237 ? 3.327   16.232  82.168  1.00 70.62  ? 237 GLN E O   1 
ATOM   5842 C  CB  . GLN E 2 237 ? 4.011   16.283  79.134  1.00 79.25  ? 237 GLN E CB  1 
ATOM   5843 C  CG  . GLN E 2 237 ? 2.937   16.014  78.102  1.00 82.88  ? 237 GLN E CG  1 
ATOM   5844 C  CD  . GLN E 2 237 ? 3.398   15.050  77.023  1.00 86.72  ? 237 GLN E CD  1 
ATOM   5845 O  OE1 . GLN E 2 237 ? 4.304   14.243  77.239  1.00 86.00  ? 237 GLN E OE1 1 
ATOM   5846 N  NE2 . GLN E 2 237 ? 2.779   15.136  75.851  1.00 89.66  ? 237 GLN E NE2 1 
ATOM   5847 N  N   . VAL E 2 238 ? 1.546   17.244  81.242  1.00 66.60  ? 238 VAL E N   1 
ATOM   5848 C  CA  . VAL E 2 238 ? 0.606   16.750  82.245  1.00 61.97  ? 238 VAL E CA  1 
ATOM   5849 C  C   . VAL E 2 238 ? -0.230  15.613  81.669  1.00 62.34  ? 238 VAL E C   1 
ATOM   5850 O  O   . VAL E 2 238 ? -1.145  15.844  80.874  1.00 65.22  ? 238 VAL E O   1 
ATOM   5851 C  CB  . VAL E 2 238 ? -0.339  17.852  82.738  1.00 59.00  ? 238 VAL E CB  1 
ATOM   5852 C  CG1 . VAL E 2 238 ? -1.359  17.275  83.715  1.00 59.65  ? 238 VAL E CG1 1 
ATOM   5853 C  CG2 . VAL E 2 238 ? 0.453   18.975  83.378  1.00 57.89  ? 238 VAL E CG2 1 
ATOM   5854 N  N   . MET E 2 239 ? 0.080   14.387  82.077  1.00 55.40  ? 239 MET E N   1 
ATOM   5855 C  CA  . MET E 2 239 ? -0.544  13.218  81.480  1.00 53.69  ? 239 MET E CA  1 
ATOM   5856 C  C   . MET E 2 239 ? -1.457  12.469  82.454  1.00 55.03  ? 239 MET E C   1 
ATOM   5857 O  O   . MET E 2 239 ? -1.085  12.203  83.597  1.00 56.21  ? 239 MET E O   1 
ATOM   5858 C  CB  . MET E 2 239 ? 0.528   12.286  80.911  1.00 51.71  ? 239 MET E CB  1 
ATOM   5859 C  CG  . MET E 2 239 ? -0.022  11.109  80.130  1.00 53.25  ? 239 MET E CG  1 
ATOM   5860 S  SD  . MET E 2 239 ? 1.278   10.143  79.333  1.00 61.16  ? 239 MET E SD  1 
ATOM   5861 C  CE  . MET E 2 239 ? 1.954   11.351  78.193  1.00 37.90  ? 239 MET E CE  1 
ATOM   5862 N  N   . ILE E 2 240 ? -2.663  12.157  81.993  1.00 51.91  ? 240 ILE E N   1 
ATOM   5863 C  CA  . ILE E 2 240 ? -3.602  11.337  82.746  1.00 51.76  ? 240 ILE E CA  1 
ATOM   5864 C  C   . ILE E 2 240 ? -4.152  10.282  81.795  1.00 54.51  ? 240 ILE E C   1 
ATOM   5865 O  O   . ILE E 2 240 ? -4.697  10.620  80.745  1.00 57.41  ? 240 ILE E O   1 
ATOM   5866 C  CB  . ILE E 2 240 ? -4.790  12.160  83.279  1.00 51.34  ? 240 ILE E CB  1 
ATOM   5867 C  CG1 . ILE E 2 240 ? -4.323  13.488  83.876  1.00 49.25  ? 240 ILE E CG1 1 
ATOM   5868 C  CG2 . ILE E 2 240 ? -5.576  11.359  84.305  1.00 52.05  ? 240 ILE E CG2 1 
ATOM   5869 C  CD1 . ILE E 2 240 ? -5.463  14.395  84.293  1.00 46.47  ? 240 ILE E CD1 1 
ATOM   5870 N  N   . HIS E 2 241 ? -4.006  9.012   82.159  1.00 50.89  ? 241 HIS E N   1 
ATOM   5871 C  CA  . HIS E 2 241 ? -4.454  7.904   81.314  1.00 48.64  ? 241 HIS E CA  1 
ATOM   5872 C  C   . HIS E 2 241 ? -3.895  7.961   79.892  1.00 52.57  ? 241 HIS E C   1 
ATOM   5873 O  O   . HIS E 2 241 ? -4.581  7.619   78.928  1.00 54.07  ? 241 HIS E O   1 
ATOM   5874 C  CB  . HIS E 2 241 ? -5.982  7.821   81.280  1.00 46.80  ? 241 HIS E CB  1 
ATOM   5875 C  CG  . HIS E 2 241 ? -6.575  7.182   82.495  1.00 49.93  ? 241 HIS E CG  1 
ATOM   5876 N  ND1 . HIS E 2 241 ? -7.237  7.900   83.468  1.00 49.71  ? 241 HIS E ND1 1 
ATOM   5877 C  CD2 . HIS E 2 241 ? -6.595  5.890   82.901  1.00 45.79  ? 241 HIS E CD2 1 
ATOM   5878 C  CE1 . HIS E 2 241 ? -7.646  7.074   84.416  1.00 51.20  ? 241 HIS E CE1 1 
ATOM   5879 N  NE2 . HIS E 2 241 ? -7.267  5.850   84.097  1.00 45.35  ? 241 HIS E NE2 1 
ATOM   5880 N  N   . GLY E 2 242 ? -2.648  8.399   79.767  1.00 47.15  ? 242 GLY E N   1 
ATOM   5881 C  CA  . GLY E 2 242 ? -1.995  8.438   78.474  1.00 48.65  ? 242 GLY E CA  1 
ATOM   5882 C  C   . GLY E 2 242 ? -2.380  9.618   77.602  1.00 53.88  ? 242 GLY E C   1 
ATOM   5883 O  O   . GLY E 2 242 ? -1.905  9.740   76.473  1.00 54.39  ? 242 GLY E O   1 
ATOM   5884 N  N   . ILE E 2 243 ? -3.245  10.489  78.110  1.00 56.63  ? 243 ILE E N   1 
ATOM   5885 C  CA  . ILE E 2 243 ? -3.605  11.694  77.372  1.00 56.76  ? 243 ILE E CA  1 
ATOM   5886 C  C   . ILE E 2 243 ? -3.254  12.952  78.154  1.00 57.87  ? 243 ILE E C   1 
ATOM   5887 O  O   . ILE E 2 243 ? -3.067  12.913  79.371  1.00 58.40  ? 243 ILE E O   1 
ATOM   5888 C  CB  . ILE E 2 243 ? -5.102  11.731  76.991  1.00 54.73  ? 243 ILE E CB  1 
ATOM   5889 C  CG1 . ILE E 2 243 ? -5.969  11.999  78.222  1.00 54.11  ? 243 ILE E CG1 1 
ATOM   5890 C  CG2 . ILE E 2 243 ? -5.508  10.448  76.284  1.00 51.71  ? 243 ILE E CG2 1 
ATOM   5891 C  CD1 . ILE E 2 243 ? -7.437  12.157  77.910  1.00 56.91  ? 243 ILE E CD1 1 
ATOM   5892 N  N   . GLU E 2 244 ? -3.165  14.066  77.437  1.00 59.67  ? 244 GLU E N   1 
ATOM   5893 C  CA  . GLU E 2 244 ? -2.837  15.353  78.034  1.00 61.76  ? 244 GLU E CA  1 
ATOM   5894 C  C   . GLU E 2 244 ? -4.038  16.285  77.924  1.00 62.11  ? 244 GLU E C   1 
ATOM   5895 O  O   . GLU E 2 244 ? -4.214  16.959  76.911  1.00 61.19  ? 244 GLU E O   1 
ATOM   5896 C  CB  . GLU E 2 244 ? -1.622  15.959  77.333  1.00 64.38  ? 244 GLU E CB  1 
ATOM   5897 C  CG  . GLU E 2 244 ? -1.137  17.266  77.928  1.00 74.87  ? 244 GLU E CG  1 
ATOM   5898 C  CD  . GLU E 2 244 ? 0.133   17.763  77.266  1.00 82.47  ? 244 GLU E CD  1 
ATOM   5899 O  OE1 . GLU E 2 244 ? 0.566   17.142  76.270  1.00 85.70  ? 244 GLU E OE1 1 
ATOM   5900 O  OE2 . GLU E 2 244 ? 0.702   18.768  77.743  1.00 83.13  ? 244 GLU E OE2 1 
ATOM   5901 N  N   . PRO E 2 245 ? -4.876  16.318  78.970  1.00 61.17  ? 245 PRO E N   1 
ATOM   5902 C  CA  . PRO E 2 245 ? -6.113  17.105  78.951  1.00 65.01  ? 245 PRO E CA  1 
ATOM   5903 C  C   . PRO E 2 245 ? -5.821  18.595  79.072  1.00 67.22  ? 245 PRO E C   1 
ATOM   5904 O  O   . PRO E 2 245 ? -4.779  18.964  79.616  1.00 70.26  ? 245 PRO E O   1 
ATOM   5905 C  CB  . PRO E 2 245 ? -6.855  16.606  80.192  1.00 62.14  ? 245 PRO E CB  1 
ATOM   5906 C  CG  . PRO E 2 245 ? -5.769  16.196  81.125  1.00 57.65  ? 245 PRO E CG  1 
ATOM   5907 C  CD  . PRO E 2 245 ? -4.661  15.653  80.268  1.00 56.47  ? 245 PRO E CD  1 
ATOM   5908 N  N   . MET E 2 246 ? -6.719  19.435  78.567  1.00 65.71  ? 246 MET E N   1 
ATOM   5909 C  CA  . MET E 2 246 ? -6.527  20.881  78.643  1.00 66.35  ? 246 MET E CA  1 
ATOM   5910 C  C   . MET E 2 246 ? -6.517  21.333  80.098  1.00 68.00  ? 246 MET E C   1 
ATOM   5911 O  O   . MET E 2 246 ? -7.184  20.736  80.943  1.00 69.06  ? 246 MET E O   1 
ATOM   5912 C  CB  . MET E 2 246 ? -7.626  21.619  77.875  1.00 65.42  ? 246 MET E CB  1 
ATOM   5913 C  CG  . MET E 2 246 ? -7.722  21.248  76.404  1.00 64.92  ? 246 MET E CG  1 
ATOM   5914 S  SD  . MET E 2 246 ? -8.986  22.199  75.532  1.00 73.29  ? 246 MET E SD  1 
ATOM   5915 C  CE  . MET E 2 246 ? -8.310  23.852  75.660  1.00 93.73  ? 246 MET E CE  1 
ATOM   5916 N  N   . LEU E 2 247 ? -5.758  22.385  80.387  1.00 70.00  ? 247 LEU E N   1 
ATOM   5917 C  CA  . LEU E 2 247 ? -5.676  22.913  81.746  1.00 70.57  ? 247 LEU E CA  1 
ATOM   5918 C  C   . LEU E 2 247 ? -7.003  23.508  82.208  1.00 68.55  ? 247 LEU E C   1 
ATOM   5919 O  O   . LEU E 2 247 ? -7.245  23.643  83.406  1.00 66.95  ? 247 LEU E O   1 
ATOM   5920 C  CB  . LEU E 2 247 ? -4.569  23.963  81.858  1.00 71.89  ? 247 LEU E CB  1 
ATOM   5921 C  CG  . LEU E 2 247 ? -3.130  23.473  81.685  1.00 70.01  ? 247 LEU E CG  1 
ATOM   5922 C  CD1 . LEU E 2 247 ? -2.149  24.616  81.916  1.00 72.78  ? 247 LEU E CD1 1 
ATOM   5923 C  CD2 . LEU E 2 247 ? -2.841  22.312  82.625  1.00 64.55  ? 247 LEU E CD2 1 
ATOM   5924 N  N   . GLU E 2 248 ? -7.860  23.859  81.255  1.00 70.49  ? 248 GLU E N   1 
ATOM   5925 C  CA  . GLU E 2 248 ? -9.147  24.467  81.571  1.00 73.05  ? 248 GLU E CA  1 
ATOM   5926 C  C   . GLU E 2 248 ? -10.208 23.421  81.908  1.00 71.38  ? 248 GLU E C   1 
ATOM   5927 O  O   . GLU E 2 248 ? -11.364 23.759  82.157  1.00 72.75  ? 248 GLU E O   1 
ATOM   5928 C  CB  . GLU E 2 248 ? -9.623  25.358  80.418  1.00 77.26  ? 248 GLU E CB  1 
ATOM   5929 C  CG  . GLU E 2 248 ? -9.984  24.608  79.143  1.00 83.45  ? 248 GLU E CG  1 
ATOM   5930 C  CD  . GLU E 2 248 ? -10.528 25.524  78.054  1.00 91.19  ? 248 GLU E CD  1 
ATOM   5931 O  OE1 . GLU E 2 248 ? -10.263 26.743  78.114  1.00 96.01  ? 248 GLU E OE1 1 
ATOM   5932 O  OE2 . GLU E 2 248 ? -11.225 25.028  77.141  1.00 90.12  ? 248 GLU E OE2 1 
ATOM   5933 N  N   . THR E 2 249 ? -9.811  22.152  81.919  1.00 70.39  ? 249 THR E N   1 
ATOM   5934 C  CA  . THR E 2 249 ? -10.737 21.066  82.228  1.00 68.47  ? 249 THR E CA  1 
ATOM   5935 C  C   . THR E 2 249 ? -11.182 21.125  83.687  1.00 70.99  ? 249 THR E C   1 
ATOM   5936 O  O   . THR E 2 249 ? -10.346 21.185  84.591  1.00 70.09  ? 249 THR E O   1 
ATOM   5937 C  CB  . THR E 2 249 ? -10.104 19.686  81.959  1.00 64.12  ? 249 THR E CB  1 
ATOM   5938 O  OG1 . THR E 2 249 ? -9.508  19.671  80.657  1.00 60.95  ? 249 THR E OG1 1 
ATOM   5939 C  CG2 . THR E 2 249 ? -11.156 18.592  82.043  1.00 64.35  ? 249 THR E CG2 1 
ATOM   5940 N  N   . PRO E 2 250 ? -12.506 21.117  83.918  1.00 73.12  ? 250 PRO E N   1 
ATOM   5941 C  CA  . PRO E 2 250 ? -13.071 21.126  85.273  1.00 70.36  ? 250 PRO E CA  1 
ATOM   5942 C  C   . PRO E 2 250 ? -12.614 19.919  86.086  1.00 71.20  ? 250 PRO E C   1 
ATOM   5943 O  O   . PRO E 2 250 ? -12.841 18.776  85.691  1.00 72.35  ? 250 PRO E O   1 
ATOM   5944 C  CB  . PRO E 2 250 ? -14.581 21.053  85.024  1.00 68.34  ? 250 PRO E CB  1 
ATOM   5945 C  CG  . PRO E 2 250 ? -14.765 21.619  83.660  1.00 71.26  ? 250 PRO E CG  1 
ATOM   5946 C  CD  . PRO E 2 250 ? -13.553 21.186  82.885  1.00 74.14  ? 250 PRO E CD  1 
ATOM   5947 N  N   . LEU E 2 251 ? -11.972 20.192  87.217  1.00 70.89  ? 251 LEU E N   1 
ATOM   5948 C  CA  . LEU E 2 251 ? -11.441 19.158  88.092  1.00 65.00  ? 251 LEU E CA  1 
ATOM   5949 C  C   . LEU E 2 251 ? -12.517 18.182  88.550  1.00 64.21  ? 251 LEU E C   1 
ATOM   5950 O  O   . LEU E 2 251 ? -12.267 16.983  88.656  1.00 65.49  ? 251 LEU E O   1 
ATOM   5951 C  CB  . LEU E 2 251 ? -10.780 19.799  89.311  1.00 64.12  ? 251 LEU E CB  1 
ATOM   5952 C  CG  . LEU E 2 251 ? -9.919  18.873  90.162  1.00 63.01  ? 251 LEU E CG  1 
ATOM   5953 C  CD1 . LEU E 2 251 ? -8.731  18.373  89.355  1.00 60.38  ? 251 LEU E CD1 1 
ATOM   5954 C  CD2 . LEU E 2 251 ? -9.461  19.586  91.422  1.00 65.35  ? 251 LEU E CD2 1 
ATOM   5955 N  N   . GLN E 2 252 ? -13.711 18.698  88.820  1.00 63.84  ? 252 GLN E N   1 
ATOM   5956 C  CA  . GLN E 2 252 ? -14.813 17.861  89.285  1.00 63.80  ? 252 GLN E CA  1 
ATOM   5957 C  C   . GLN E 2 252 ? -15.223 16.819  88.242  1.00 64.68  ? 252 GLN E C   1 
ATOM   5958 O  O   . GLN E 2 252 ? -15.469 15.661  88.579  1.00 65.12  ? 252 GLN E O   1 
ATOM   5959 C  CB  . GLN E 2 252 ? -16.016 18.717  89.698  1.00 62.17  ? 252 GLN E CB  1 
ATOM   5960 C  CG  . GLN E 2 252 ? -17.244 17.912  90.112  1.00 63.49  ? 252 GLN E CG  1 
ATOM   5961 C  CD  . GLN E 2 252 ? -16.969 16.958  91.262  1.00 68.20  ? 252 GLN E CD  1 
ATOM   5962 O  OE1 . GLN E 2 252 ? -16.140 17.232  92.131  1.00 70.74  ? 252 GLN E OE1 1 
ATOM   5963 N  NE2 . GLN E 2 252 ? -17.666 15.829  91.271  1.00 68.70  ? 252 GLN E NE2 1 
ATOM   5964 N  N   . TRP E 2 253 ? -15.285 17.232  86.979  1.00 62.60  ? 253 TRP E N   1 
ATOM   5965 C  CA  . TRP E 2 253 ? -15.627 16.320  85.895  1.00 59.62  ? 253 TRP E CA  1 
ATOM   5966 C  C   . TRP E 2 253 ? -14.540 15.260  85.701  1.00 62.27  ? 253 TRP E C   1 
ATOM   5967 O  O   . TRP E 2 253 ? -14.842 14.080  85.500  1.00 63.27  ? 253 TRP E O   1 
ATOM   5968 C  CB  . TRP E 2 253 ? -15.857 17.095  84.593  1.00 60.12  ? 253 TRP E CB  1 
ATOM   5969 C  CG  . TRP E 2 253 ? -16.305 16.235  83.450  1.00 58.30  ? 253 TRP E CG  1 
ATOM   5970 C  CD1 . TRP E 2 253 ? -17.591 15.971  83.078  1.00 59.83  ? 253 TRP E CD1 1 
ATOM   5971 C  CD2 . TRP E 2 253 ? -15.468 15.524  82.531  1.00 55.89  ? 253 TRP E CD2 1 
ATOM   5972 N  NE1 . TRP E 2 253 ? -17.607 15.139  81.984  1.00 61.49  ? 253 TRP E NE1 1 
ATOM   5973 C  CE2 . TRP E 2 253 ? -16.316 14.850  81.628  1.00 60.70  ? 253 TRP E CE2 1 
ATOM   5974 C  CE3 . TRP E 2 253 ? -14.084 15.390  82.384  1.00 55.31  ? 253 TRP E CE3 1 
ATOM   5975 C  CZ2 . TRP E 2 253 ? -15.825 14.057  80.593  1.00 63.80  ? 253 TRP E CZ2 1 
ATOM   5976 C  CZ3 . TRP E 2 253 ? -13.597 14.600  81.358  1.00 59.19  ? 253 TRP E CZ3 1 
ATOM   5977 C  CH2 . TRP E 2 253 ? -14.465 13.944  80.475  1.00 63.77  ? 253 TRP E CH2 1 
ATOM   5978 N  N   . LEU E 2 254 ? -13.279 15.686  85.757  1.00 58.63  ? 254 LEU E N   1 
ATOM   5979 C  CA  . LEU E 2 254 ? -12.148 14.769  85.645  1.00 58.50  ? 254 LEU E CA  1 
ATOM   5980 C  C   . LEU E 2 254 ? -12.216 13.679  86.703  1.00 63.97  ? 254 LEU E C   1 
ATOM   5981 O  O   . LEU E 2 254 ? -11.974 12.505  86.418  1.00 67.92  ? 254 LEU E O   1 
ATOM   5982 C  CB  . LEU E 2 254 ? -10.827 15.520  85.798  1.00 59.17  ? 254 LEU E CB  1 
ATOM   5983 C  CG  . LEU E 2 254 ? -10.212 16.120  84.538  1.00 63.01  ? 254 LEU E CG  1 
ATOM   5984 C  CD1 . LEU E 2 254 ? -8.955  16.902  84.886  1.00 64.24  ? 254 LEU E CD1 1 
ATOM   5985 C  CD2 . LEU E 2 254 ? -9.906  15.025  83.533  1.00 61.36  ? 254 LEU E CD2 1 
ATOM   5986 N  N   . SER E 2 255 ? -12.538 14.085  87.927  1.00 61.50  ? 255 SER E N   1 
ATOM   5987 C  CA  . SER E 2 255 ? -12.608 13.171  89.056  1.00 57.55  ? 255 SER E CA  1 
ATOM   5988 C  C   . SER E 2 255 ? -13.714 12.139  88.861  1.00 57.67  ? 255 SER E C   1 
ATOM   5989 O  O   . SER E 2 255 ? -13.581 10.984  89.272  1.00 53.95  ? 255 SER E O   1 
ATOM   5990 C  CB  . SER E 2 255 ? -12.839 13.954  90.349  1.00 57.76  ? 255 SER E CB  1 
ATOM   5991 O  OG  . SER E 2 255 ? -12.940 13.083  91.458  1.00 59.45  ? 255 SER E OG  1 
ATOM   5992 N  N   . GLU E 2 256 ? -14.800 12.561  88.221  1.00 57.48  ? 256 GLU E N   1 
ATOM   5993 C  CA  . GLU E 2 256 ? -15.941 11.686  87.995  1.00 58.04  ? 256 GLU E CA  1 
ATOM   5994 C  C   . GLU E 2 256 ? -15.695 10.708  86.855  1.00 58.20  ? 256 GLU E C   1 
ATOM   5995 O  O   . GLU E 2 256 ? -16.199 9.583   86.879  1.00 60.28  ? 256 GLU E O   1 
ATOM   5996 C  CB  . GLU E 2 256 ? -17.195 12.507  87.692  1.00 60.72  ? 256 GLU E CB  1 
ATOM   5997 C  CG  . GLU E 2 256 ? -17.716 13.329  88.854  1.00 62.47  ? 256 GLU E CG  1 
ATOM   5998 C  CD  . GLU E 2 256 ? -18.882 14.213  88.454  1.00 69.25  ? 256 GLU E CD  1 
ATOM   5999 O  OE1 . GLU E 2 256 ? -19.254 14.200  87.260  1.00 73.05  ? 256 GLU E OE1 1 
ATOM   6000 O  OE2 . GLU E 2 256 ? -19.427 14.922  89.326  1.00 70.23  ? 256 GLU E OE2 1 
ATOM   6001 N  N   . HIS E 2 257 ? -14.915 11.133  85.863  1.00 56.65  ? 257 HIS E N   1 
ATOM   6002 C  CA  . HIS E 2 257 ? -14.795 10.381  84.614  1.00 55.01  ? 257 HIS E CA  1 
ATOM   6003 C  C   . HIS E 2 257 ? -13.403 9.830   84.285  1.00 54.73  ? 257 HIS E C   1 
ATOM   6004 O  O   . HIS E 2 257 ? -13.288 8.801   83.623  1.00 59.19  ? 257 HIS E O   1 
ATOM   6005 C  CB  . HIS E 2 257 ? -15.316 11.217  83.439  1.00 58.14  ? 257 HIS E CB  1 
ATOM   6006 C  CG  . HIS E 2 257 ? -16.747 11.631  83.583  1.00 61.91  ? 257 HIS E CG  1 
ATOM   6007 N  ND1 . HIS E 2 257 ? -17.129 12.763  84.270  1.00 62.94  ? 257 HIS E ND1 1 
ATOM   6008 C  CD2 . HIS E 2 257 ? -17.891 11.059  83.138  1.00 63.79  ? 257 HIS E CD2 1 
ATOM   6009 C  CE1 . HIS E 2 257 ? -18.445 12.874  84.236  1.00 64.69  ? 257 HIS E CE1 1 
ATOM   6010 N  NE2 . HIS E 2 257 ? -18.932 11.851  83.556  1.00 63.37  ? 257 HIS E NE2 1 
ATOM   6011 N  N   . LEU E 2 258 ? -12.348 10.504  84.731  1.00 54.53  ? 258 LEU E N   1 
ATOM   6012 C  CA  . LEU E 2 258 ? -10.992 10.070  84.385  1.00 57.81  ? 258 LEU E CA  1 
ATOM   6013 C  C   . LEU E 2 258 ? -10.189 9.533   85.573  1.00 59.05  ? 258 LEU E C   1 
ATOM   6014 O  O   . LEU E 2 258 ? -8.964  9.451   85.521  1.00 61.16  ? 258 LEU E O   1 
ATOM   6015 C  CB  . LEU E 2 258 ? -10.220 11.186  83.672  1.00 56.48  ? 258 LEU E CB  1 
ATOM   6016 C  CG  . LEU E 2 258 ? -9.973  10.969  82.175  1.00 55.12  ? 258 LEU E CG  1 
ATOM   6017 C  CD1 . LEU E 2 258 ? -11.281 10.921  81.405  1.00 52.59  ? 258 LEU E CD1 1 
ATOM   6018 C  CD2 . LEU E 2 258 ? -9.055  12.038  81.606  1.00 55.57  ? 258 LEU E CD2 1 
ATOM   6019 N  N   . SER E 2 259 ? -10.880 9.168   86.642  1.00 57.24  ? 259 SER E N   1 
ATOM   6020 C  CA  . SER E 2 259 ? -10.220 8.524   87.765  1.00 55.91  ? 259 SER E CA  1 
ATOM   6021 C  C   . SER E 2 259 ? -9.986  7.055   87.434  1.00 55.83  ? 259 SER E C   1 
ATOM   6022 O  O   . SER E 2 259 ? -10.571 6.520   86.490  1.00 57.72  ? 259 SER E O   1 
ATOM   6023 C  CB  . SER E 2 259 ? -11.065 8.648   89.034  1.00 54.20  ? 259 SER E CB  1 
ATOM   6024 O  OG  . SER E 2 259 ? -11.300 10.007  89.357  1.00 53.26  ? 259 SER E OG  1 
ATOM   6025 N  N   . TYR E 2 260 ? -9.115  6.413   88.202  1.00 50.02  ? 260 TYR E N   1 
ATOM   6026 C  CA  . TYR E 2 260 ? -8.905  4.979   88.083  1.00 48.57  ? 260 TYR E CA  1 
ATOM   6027 C  C   . TYR E 2 260 ? -9.987  4.295   88.909  1.00 44.15  ? 260 TYR E C   1 
ATOM   6028 O  O   . TYR E 2 260 ? -10.673 4.960   89.680  1.00 50.44  ? 260 TYR E O   1 
ATOM   6029 C  CB  . TYR E 2 260 ? -7.506  4.611   88.582  1.00 50.50  ? 260 TYR E CB  1 
ATOM   6030 C  CG  . TYR E 2 260 ? -6.400  4.991   87.626  1.00 53.09  ? 260 TYR E CG  1 
ATOM   6031 C  CD1 . TYR E 2 260 ? -6.011  6.315   87.475  1.00 53.91  ? 260 TYR E CD1 1 
ATOM   6032 C  CD2 . TYR E 2 260 ? -5.741  4.025   86.878  1.00 54.31  ? 260 TYR E CD2 1 
ATOM   6033 C  CE1 . TYR E 2 260 ? -4.996  6.666   86.603  1.00 54.33  ? 260 TYR E CE1 1 
ATOM   6034 C  CE2 . TYR E 2 260 ? -4.725  4.366   86.004  1.00 52.45  ? 260 TYR E CE2 1 
ATOM   6035 C  CZ  . TYR E 2 260 ? -4.357  5.688   85.870  1.00 54.55  ? 260 TYR E CZ  1 
ATOM   6036 O  OH  . TYR E 2 260 ? -3.347  6.033   85.002  1.00 59.09  ? 260 TYR E OH  1 
ATOM   6037 N  N   . PRO E 2 261 ? -10.166 2.975   88.740  1.00 40.17  ? 261 PRO E N   1 
ATOM   6038 C  CA  . PRO E 2 261 ? -11.164 2.249   89.536  1.00 42.32  ? 261 PRO E CA  1 
ATOM   6039 C  C   . PRO E 2 261 ? -11.045 2.495   91.038  1.00 50.00  ? 261 PRO E C   1 
ATOM   6040 O  O   . PRO E 2 261 ? -12.044 2.377   91.747  1.00 55.84  ? 261 PRO E O   1 
ATOM   6041 C  CB  . PRO E 2 261 ? -10.863 0.789   89.211  1.00 41.76  ? 261 PRO E CB  1 
ATOM   6042 C  CG  . PRO E 2 261 ? -10.376 0.838   87.800  1.00 43.75  ? 261 PRO E CG  1 
ATOM   6043 C  CD  . PRO E 2 261 ? -9.596  2.127   87.678  1.00 38.58  ? 261 PRO E CD  1 
ATOM   6044 N  N   . ASP E 2 262 ? -9.853  2.850   91.514  1.00 50.53  ? 262 ASP E N   1 
ATOM   6045 C  CA  . ASP E 2 262 ? -9.660  3.155   92.932  1.00 54.55  ? 262 ASP E CA  1 
ATOM   6046 C  C   . ASP E 2 262 ? -10.217 4.526   93.332  1.00 54.55  ? 262 ASP E C   1 
ATOM   6047 O  O   . ASP E 2 262 ? -9.955  5.003   94.437  1.00 54.49  ? 262 ASP E O   1 
ATOM   6048 C  CB  . ASP E 2 262 ? -8.178  3.054   93.323  1.00 53.84  ? 262 ASP E CB  1 
ATOM   6049 C  CG  . ASP E 2 262 ? -7.285  3.997   92.521  1.00 53.66  ? 262 ASP E CG  1 
ATOM   6050 O  OD1 . ASP E 2 262 ? -7.803  4.951   91.904  1.00 51.02  ? 262 ASP E OD1 1 
ATOM   6051 O  OD2 . ASP E 2 262 ? -6.053  3.787   92.517  1.00 52.88  ? 262 ASP E OD2 1 
ATOM   6052 N  N   . ASN E 2 263 ? -10.960 5.154   92.420  1.00 51.20  ? 263 ASN E N   1 
ATOM   6053 C  CA  . ASN E 2 263 ? -11.549 6.479   92.641  1.00 53.09  ? 263 ASN E CA  1 
ATOM   6054 C  C   . ASN E 2 263 ? -10.527 7.609   92.796  1.00 54.33  ? 263 ASN E C   1 
ATOM   6055 O  O   . ASN E 2 263 ? -10.880 8.731   93.157  1.00 56.24  ? 263 ASN E O   1 
ATOM   6056 C  CB  . ASN E 2 263 ? -12.517 6.462   93.831  1.00 54.28  ? 263 ASN E CB  1 
ATOM   6057 C  CG  . ASN E 2 263 ? -13.880 5.918   93.466  1.00 56.36  ? 263 ASN E CG  1 
ATOM   6058 O  OD1 . ASN E 2 263 ? -14.905 6.479   93.848  1.00 59.32  ? 263 ASN E OD1 1 
ATOM   6059 N  ND2 . ASN E 2 263 ? -13.900 4.830   92.706  1.00 55.17  ? 263 ASN E ND2 1 
ATOM   6060 N  N   . PHE E 2 264 ? -9.263  7.311   92.519  1.00 54.77  ? 264 PHE E N   1 
ATOM   6061 C  CA  . PHE E 2 264 ? -8.212  8.314   92.613  1.00 52.51  ? 264 PHE E CA  1 
ATOM   6062 C  C   . PHE E 2 264 ? -7.830  8.867   91.244  1.00 55.43  ? 264 PHE E C   1 
ATOM   6063 O  O   . PHE E 2 264 ? -7.908  8.171   90.231  1.00 50.71  ? 264 PHE E O   1 
ATOM   6064 C  CB  . PHE E 2 264 ? -6.977  7.747   93.319  1.00 50.67  ? 264 PHE E CB  1 
ATOM   6065 C  CG  . PHE E 2 264 ? -6.858  8.166   94.760  1.00 58.36  ? 264 PHE E CG  1 
ATOM   6066 C  CD1 . PHE E 2 264 ? -6.172  9.323   95.102  1.00 59.97  ? 264 PHE E CD1 1 
ATOM   6067 C  CD2 . PHE E 2 264 ? -7.435  7.407   95.772  1.00 56.37  ? 264 PHE E CD2 1 
ATOM   6068 C  CE1 . PHE E 2 264 ? -6.060  9.714   96.426  1.00 61.97  ? 264 PHE E CE1 1 
ATOM   6069 C  CE2 . PHE E 2 264 ? -7.328  7.793   97.097  1.00 56.13  ? 264 PHE E CE2 1 
ATOM   6070 C  CZ  . PHE E 2 264 ? -6.640  8.946   97.426  1.00 59.52  ? 264 PHE E CZ  1 
ATOM   6071 N  N   . LEU E 2 265 ? -7.418  10.129  91.232  1.00 56.41  ? 265 LEU E N   1 
ATOM   6072 C  CA  . LEU E 2 265 ? -6.984  10.793  90.017  1.00 51.81  ? 265 LEU E CA  1 
ATOM   6073 C  C   . LEU E 2 265 ? -5.459  10.831  90.006  1.00 55.78  ? 265 LEU E C   1 
ATOM   6074 O  O   . LEU E 2 265 ? -4.847  11.774  90.508  1.00 61.45  ? 265 LEU E O   1 
ATOM   6075 C  CB  . LEU E 2 265 ? -7.564  12.207  89.974  1.00 54.12  ? 265 LEU E CB  1 
ATOM   6076 C  CG  . LEU E 2 265 ? -7.552  13.006  88.670  1.00 55.25  ? 265 LEU E CG  1 
ATOM   6077 C  CD1 . LEU E 2 265 ? -8.192  12.222  87.534  1.00 55.10  ? 265 LEU E CD1 1 
ATOM   6078 C  CD2 . LEU E 2 265 ? -8.277  14.323  88.877  1.00 54.64  ? 265 LEU E CD2 1 
ATOM   6079 N  N   . HIS E 2 266 ? -4.847  9.787   89.454  1.00 56.35  ? 266 HIS E N   1 
ATOM   6080 C  CA  . HIS E 2 266 ? -3.394  9.717   89.362  1.00 54.22  ? 266 HIS E CA  1 
ATOM   6081 C  C   . HIS E 2 266 ? -2.916  10.544  88.171  1.00 57.98  ? 266 HIS E C   1 
ATOM   6082 O  O   . HIS E 2 266 ? -3.316  10.298  87.032  1.00 58.23  ? 266 HIS E O   1 
ATOM   6083 C  CB  . HIS E 2 266 ? -2.925  8.266   89.230  1.00 49.22  ? 266 HIS E CB  1 
ATOM   6084 C  CG  . HIS E 2 266 ? -3.389  7.371   90.339  1.00 52.92  ? 266 HIS E CG  1 
ATOM   6085 N  ND1 . HIS E 2 266 ? -2.626  7.110   91.457  1.00 56.16  ? 266 HIS E ND1 1 
ATOM   6086 C  CD2 . HIS E 2 266 ? -4.533  6.662   90.494  1.00 53.95  ? 266 HIS E CD2 1 
ATOM   6087 C  CE1 . HIS E 2 266 ? -3.280  6.285   92.255  1.00 51.72  ? 266 HIS E CE1 1 
ATOM   6088 N  NE2 . HIS E 2 266 ? -4.441  5.998   91.694  1.00 51.71  ? 266 HIS E NE2 1 
ATOM   6089 N  N   . ILE E 2 267 ? -2.063  11.528  88.446  1.00 59.04  ? 267 ILE E N   1 
ATOM   6090 C  CA  . ILE E 2 267 ? -1.600  12.468  87.430  1.00 55.23  ? 267 ILE E CA  1 
ATOM   6091 C  C   . ILE E 2 267 ? -0.084  12.404  87.264  1.00 59.22  ? 267 ILE E C   1 
ATOM   6092 O  O   . ILE E 2 267 ? 0.660   12.511  88.240  1.00 62.91  ? 267 ILE E O   1 
ATOM   6093 C  CB  . ILE E 2 267 ? -2.002  13.908  87.802  1.00 55.07  ? 267 ILE E CB  1 
ATOM   6094 C  CG1 . ILE E 2 267 ? -3.513  13.994  88.033  1.00 47.41  ? 267 ILE E CG1 1 
ATOM   6095 C  CG2 . ILE E 2 267 ? -1.555  14.889  86.730  1.00 57.58  ? 267 ILE E CG2 1 
ATOM   6096 C  CD1 . ILE E 2 267 ? -3.968  15.323  88.569  1.00 46.32  ? 267 ILE E CD1 1 
ATOM   6097 N  N   . SER E 2 268 ? 0.370   12.226  86.026  1.00 58.91  ? 268 SER E N   1 
ATOM   6098 C  CA  . SER E 2 268 ? 1.798   12.156  85.734  1.00 58.46  ? 268 SER E CA  1 
ATOM   6099 C  C   . SER E 2 268 ? 2.320   13.487  85.203  1.00 62.53  ? 268 SER E C   1 
ATOM   6100 O  O   . SER E 2 268 ? 1.758   14.055  84.265  1.00 62.98  ? 268 SER E O   1 
ATOM   6101 C  CB  . SER E 2 268 ? 2.085   11.058  84.707  1.00 60.03  ? 268 SER E CB  1 
ATOM   6102 O  OG  . SER E 2 268 ? 1.637   9.793   85.157  1.00 63.30  ? 268 SER E OG  1 
ATOM   6103 N  N   . ILE E 2 269 ? 3.395   13.983  85.806  1.00 62.51  ? 269 ILE E N   1 
ATOM   6104 C  CA  . ILE E 2 269 ? 4.090   15.152  85.281  1.00 62.19  ? 269 ILE E CA  1 
ATOM   6105 C  C   . ILE E 2 269 ? 5.425   14.711  84.689  1.00 62.71  ? 269 ILE E C   1 
ATOM   6106 O  O   . ILE E 2 269 ? 6.383   14.445  85.415  1.00 66.61  ? 269 ILE E O   1 
ATOM   6107 C  CB  . ILE E 2 269 ? 4.330   16.218  86.368  1.00 61.50  ? 269 ILE E CB  1 
ATOM   6108 C  CG1 . ILE E 2 269 ? 3.020   16.569  87.074  1.00 60.37  ? 269 ILE E CG1 1 
ATOM   6109 C  CG2 . ILE E 2 269 ? 4.957   17.464  85.763  1.00 62.46  ? 269 ILE E CG2 1 
ATOM   6110 C  CD1 . ILE E 2 269 ? 1.938   17.056  86.141  1.00 60.75  ? 269 ILE E CD1 1 
ATOM   6111 N  N   . ILE E 2 270 ? 5.478   14.617  83.367  1.00 61.96  ? 270 ILE E N   1 
ATOM   6112 C  CA  . ILE E 2 270 ? 6.672   14.132  82.689  1.00 68.72  ? 270 ILE E CA  1 
ATOM   6113 C  C   . ILE E 2 270 ? 7.210   15.190  81.735  1.00 78.38  ? 270 ILE E C   1 
ATOM   6114 O  O   . ILE E 2 270 ? 6.451   16.022  81.239  1.00 82.12  ? 270 ILE E O   1 
ATOM   6115 C  CB  . ILE E 2 270 ? 6.387   12.828  81.918  1.00 64.63  ? 270 ILE E CB  1 
ATOM   6116 C  CG1 . ILE E 2 270 ? 5.335   13.065  80.836  1.00 69.00  ? 270 ILE E CG1 1 
ATOM   6117 C  CG2 . ILE E 2 270 ? 5.923   11.737  82.871  1.00 58.03  ? 270 ILE E CG2 1 
ATOM   6118 C  CD1 . ILE E 2 270 ? 4.976   11.820  80.058  1.00 72.07  ? 270 ILE E CD1 1 
ATOM   6119 N  N   . PRO E 2 271 ? 8.529   15.179  81.495  1.00 82.59  ? 271 PRO E N   1 
ATOM   6120 C  CA  . PRO E 2 271 ? 9.131   16.126  80.550  1.00 85.67  ? 271 PRO E CA  1 
ATOM   6121 C  C   . PRO E 2 271 ? 8.595   15.934  79.134  1.00 86.54  ? 271 PRO E C   1 
ATOM   6122 O  O   . PRO E 2 271 ? 8.310   14.807  78.734  1.00 86.51  ? 271 PRO E O   1 
ATOM   6123 C  CB  . PRO E 2 271 ? 10.618  15.766  80.600  1.00 85.12  ? 271 PRO E CB  1 
ATOM   6124 C  CG  . PRO E 2 271 ? 10.810  15.156  81.942  1.00 83.57  ? 271 PRO E CG  1 
ATOM   6125 C  CD  . PRO E 2 271 ? 9.549   14.395  82.213  1.00 81.10  ? 271 PRO E CD  1 
ATOM   6126 N  N   . GLN E 2 272 ? 8.452   17.029  78.394  1.00 90.04  ? 272 GLN E N   1 
ATOM   6127 C  CA  . GLN E 2 272 ? 8.033   16.966  76.999  1.00 90.45  ? 272 GLN E CA  1 
ATOM   6128 C  C   . GLN E 2 272 ? 9.118   16.296  76.163  1.00 91.26  ? 272 GLN E C   1 
ATOM   6129 O  O   . GLN E 2 272 ? 10.271  16.725  76.184  1.00 91.00  ? 272 GLN E O   1 
ATOM   6130 C  CB  . GLN E 2 272 ? 7.748   18.372  76.464  1.00 92.55  ? 272 GLN E CB  1 
ATOM   6131 C  CG  . GLN E 2 272 ? 7.356   18.418  74.997  1.00 96.99  ? 272 GLN E CG  1 
ATOM   6132 C  CD  . GLN E 2 272 ? 6.010   17.772  74.727  1.00 102.29 ? 272 GLN E CD  1 
ATOM   6133 O  OE1 . GLN E 2 272 ? 5.170   17.662  75.621  1.00 105.82 ? 272 GLN E OE1 1 
ATOM   6134 N  NE2 . GLN E 2 272 ? 5.800   17.337  73.490  1.00 102.54 ? 272 GLN E NE2 1 
ATOM   6135 N  N   . PRO E 2 273 ? 8.755   15.232  75.429  1.00 94.72  ? 273 PRO E N   1 
ATOM   6136 C  CA  . PRO E 2 273 ? 9.727   14.471  74.633  1.00 95.56  ? 273 PRO E CA  1 
ATOM   6137 C  C   . PRO E 2 273 ? 10.225  15.228  73.400  1.00 96.39  ? 273 PRO E C   1 
ATOM   6138 O  O   . PRO E 2 273 ? 9.826   16.370  73.166  1.00 92.92  ? 273 PRO E O   1 
ATOM   6139 C  CB  . PRO E 2 273 ? 8.935   13.229  74.212  1.00 93.09  ? 273 PRO E CB  1 
ATOM   6140 C  CG  . PRO E 2 273 ? 7.510   13.671  74.225  1.00 92.60  ? 273 PRO E CG  1 
ATOM   6141 C  CD  . PRO E 2 273 ? 7.401   14.654  75.353  1.00 94.09  ? 273 PRO E CD  1 
ATOM   6142 N  N   . THR E 2 274 ? 11.098  14.588  72.626  1.00 99.72  ? 274 THR E N   1 
ATOM   6143 C  CA  . THR E 2 274 ? 11.634  15.192  71.410  1.00 101.58 ? 274 THR E CA  1 
ATOM   6144 C  C   . THR E 2 274 ? 11.700  14.181  70.268  1.00 101.53 ? 274 THR E C   1 
ATOM   6145 O  O   . THR E 2 274 ? 11.081  13.117  70.328  1.00 99.53  ? 274 THR E O   1 
ATOM   6146 C  CB  . THR E 2 274 ? 13.037  15.780  71.644  1.00 100.84 ? 274 THR E CB  1 
ATOM   6147 O  OG1 . THR E 2 274 ? 13.014  16.628  72.798  1.00 98.19  ? 274 THR E OG1 1 
ATOM   6148 C  CG2 . THR E 2 274 ? 13.489  16.583  70.431  1.00 102.60 ? 274 THR E CG2 1 
ATOM   6149 N  N   . HIS F 3 2   ? -23.592 20.260  70.856  1.00 111.86 ? 9   HIS F N   1 
ATOM   6150 C  CA  . HIS F 3 2   ? -22.315 20.929  71.078  1.00 113.46 ? 9   HIS F CA  1 
ATOM   6151 C  C   . HIS F 3 2   ? -21.786 20.700  72.492  1.00 108.08 ? 9   HIS F C   1 
ATOM   6152 O  O   . HIS F 3 2   ? -22.281 21.291  73.453  1.00 107.97 ? 9   HIS F O   1 
ATOM   6153 C  CB  . HIS F 3 2   ? -22.437 22.432  70.805  1.00 119.87 ? 9   HIS F CB  1 
ATOM   6154 C  CG  . HIS F 3 2   ? -21.237 23.221  71.229  1.00 124.00 ? 9   HIS F CG  1 
ATOM   6155 N  ND1 . HIS F 3 2   ? -21.132 23.807  72.473  1.00 123.94 ? 9   HIS F ND1 1 
ATOM   6156 C  CD2 . HIS F 3 2   ? -20.087 23.517  70.577  1.00 125.94 ? 9   HIS F CD2 1 
ATOM   6157 C  CE1 . HIS F 3 2   ? -19.972 24.431  72.568  1.00 124.31 ? 9   HIS F CE1 1 
ATOM   6158 N  NE2 . HIS F 3 2   ? -19.318 24.270  71.431  1.00 125.84 ? 9   HIS F NE2 1 
ATOM   6159 N  N   . MET F 3 3   ? -20.780 19.839  72.608  1.00 100.99 ? 10  MET F N   1 
ATOM   6160 C  CA  . MET F 3 3   ? -20.100 19.616  73.878  1.00 94.49  ? 10  MET F CA  1 
ATOM   6161 C  C   . MET F 3 3   ? -18.912 20.567  73.984  1.00 90.25  ? 10  MET F C   1 
ATOM   6162 O  O   . MET F 3 3   ? -18.365 20.985  72.965  1.00 92.55  ? 10  MET F O   1 
ATOM   6163 C  CB  . MET F 3 3   ? -19.634 18.163  73.991  1.00 95.09  ? 10  MET F CB  1 
ATOM   6164 C  CG  . MET F 3 3   ? -18.586 17.755  72.970  1.00 95.45  ? 10  MET F CG  1 
ATOM   6165 S  SD  . MET F 3 3   ? -17.842 16.159  73.357  1.00 97.45  ? 10  MET F SD  1 
ATOM   6166 C  CE  . MET F 3 3   ? -19.284 15.095  73.346  1.00 117.78 ? 10  MET F CE  1 
ATOM   6167 N  N   . PRO F 3 4   ? -18.515 20.922  75.217  1.00 86.24  ? 11  PRO F N   1 
ATOM   6168 C  CA  . PRO F 3 4   ? -17.398 21.849  75.432  1.00 85.14  ? 11  PRO F CA  1 
ATOM   6169 C  C   . PRO F 3 4   ? -16.116 21.394  74.741  1.00 86.32  ? 11  PRO F C   1 
ATOM   6170 O  O   . PRO F 3 4   ? -15.956 20.212  74.442  1.00 86.49  ? 11  PRO F O   1 
ATOM   6171 C  CB  . PRO F 3 4   ? -17.217 21.826  76.949  1.00 81.42  ? 11  PRO F CB  1 
ATOM   6172 C  CG  . PRO F 3 4   ? -18.564 21.501  77.471  1.00 81.84  ? 11  PRO F CG  1 
ATOM   6173 C  CD  . PRO F 3 4   ? -19.152 20.533  76.487  1.00 83.29  ? 11  PRO F CD  1 
ATOM   6174 N  N   . ARG F 3 5   ? -15.215 22.337  74.498  1.00 86.97  ? 12  ARG F N   1 
ATOM   6175 C  CA  . ARG F 3 5   ? -13.998 22.069  73.743  1.00 86.66  ? 12  ARG F CA  1 
ATOM   6176 C  C   . ARG F 3 5   ? -13.032 21.151  74.489  1.00 84.09  ? 12  ARG F C   1 
ATOM   6177 O  O   . ARG F 3 5   ? -12.360 20.319  73.878  1.00 83.52  ? 12  ARG F O   1 
ATOM   6178 C  CB  . ARG F 3 5   ? -13.324 23.387  73.375  1.00 93.50  ? 12  ARG F CB  1 
ATOM   6179 C  CG  . ARG F 3 5   ? -14.303 24.381  72.776  1.00 105.02 ? 12  ARG F CG  1 
ATOM   6180 C  CD  . ARG F 3 5   ? -13.647 25.697  72.414  1.00 112.63 ? 12  ARG F CD  1 
ATOM   6181 N  NE  . ARG F 3 5   ? -14.585 26.585  71.734  1.00 115.97 ? 12  ARG F NE  1 
ATOM   6182 C  CZ  . ARG F 3 5   ? -14.845 26.536  70.431  1.00 117.72 ? 12  ARG F CZ  1 
ATOM   6183 N  NH1 . ARG F 3 5   ? -14.237 25.641  69.664  1.00 116.06 ? 12  ARG F NH1 1 
ATOM   6184 N  NH2 . ARG F 3 5   ? -15.714 27.382  69.894  1.00 121.00 ? 12  ARG F NH2 1 
ATOM   6185 N  N   . TRP F 3 6   ? -12.969 21.297  75.808  1.00 80.43  ? 13  TRP F N   1 
ATOM   6186 C  CA  . TRP F 3 6   ? -12.091 20.460  76.620  1.00 75.66  ? 13  TRP F CA  1 
ATOM   6187 C  C   . TRP F 3 6   ? -12.575 19.011  76.665  1.00 71.72  ? 13  TRP F C   1 
ATOM   6188 O  O   . TRP F 3 6   ? -11.771 18.084  76.770  1.00 69.91  ? 13  TRP F O   1 
ATOM   6189 C  CB  . TRP F 3 6   ? -11.957 21.026  78.036  1.00 73.98  ? 13  TRP F CB  1 
ATOM   6190 C  CG  . TRP F 3 6   ? -13.267 21.259  78.708  1.00 76.13  ? 13  TRP F CG  1 
ATOM   6191 C  CD1 . TRP F 3 6   ? -13.959 22.433  78.766  1.00 78.48  ? 13  TRP F CD1 1 
ATOM   6192 C  CD2 . TRP F 3 6   ? -14.054 20.293  79.417  1.00 74.38  ? 13  TRP F CD2 1 
ATOM   6193 N  NE1 . TRP F 3 6   ? -15.126 22.261  79.470  1.00 78.50  ? 13  TRP F NE1 1 
ATOM   6194 C  CE2 . TRP F 3 6   ? -15.210 20.956  79.879  1.00 76.28  ? 13  TRP F CE2 1 
ATOM   6195 C  CE3 . TRP F 3 6   ? -13.894 18.935  79.708  1.00 70.14  ? 13  TRP F CE3 1 
ATOM   6196 C  CZ2 . TRP F 3 6   ? -16.200 20.306  80.613  1.00 74.63  ? 13  TRP F CZ2 1 
ATOM   6197 C  CZ3 . TRP F 3 6   ? -14.880 18.290  80.433  1.00 72.06  ? 13  TRP F CZ3 1 
ATOM   6198 C  CH2 . TRP F 3 6   ? -16.017 18.976  80.879  1.00 74.88  ? 13  TRP F CH2 1 
ATOM   6199 N  N   . LYS F 3 7   ? -13.888 18.822  76.581  1.00 68.60  ? 14  LYS F N   1 
ATOM   6200 C  CA  . LYS F 3 7   ? -14.471 17.485  76.605  1.00 66.78  ? 14  LYS F CA  1 
ATOM   6201 C  C   . LYS F 3 7   ? -14.307 16.801  75.253  1.00 71.31  ? 14  LYS F C   1 
ATOM   6202 O  O   . LYS F 3 7   ? -14.069 15.593  75.179  1.00 67.19  ? 14  LYS F O   1 
ATOM   6203 C  CB  . LYS F 3 7   ? -15.950 17.541  76.998  1.00 65.70  ? 14  LYS F CB  1 
ATOM   6204 C  CG  . LYS F 3 7   ? -16.648 16.188  76.964  1.00 65.38  ? 14  LYS F CG  1 
ATOM   6205 C  CD  . LYS F 3 7   ? -18.076 16.268  77.475  1.00 65.57  ? 14  LYS F CD  1 
ATOM   6206 C  CE  . LYS F 3 7   ? -18.115 16.608  78.954  1.00 68.72  ? 14  LYS F CE  1 
ATOM   6207 N  NZ  . LYS F 3 7   ? -19.509 16.592  79.471  1.00 69.81  ? 14  LYS F NZ  1 
ATOM   6208 N  N   . ARG F 3 8   ? -14.443 17.584  74.187  1.00 76.09  ? 15  ARG F N   1 
ATOM   6209 C  CA  . ARG F 3 8   ? -14.226 17.085  72.836  1.00 76.66  ? 15  ARG F CA  1 
ATOM   6210 C  C   . ARG F 3 8   ? -12.775 16.653  72.683  1.00 67.99  ? 15  ARG F C   1 
ATOM   6211 O  O   . ARG F 3 8   ? -12.482 15.617  72.088  1.00 66.51  ? 15  ARG F O   1 
ATOM   6212 C  CB  . ARG F 3 8   ? -14.553 18.170  71.809  1.00 82.64  ? 15  ARG F CB  1 
ATOM   6213 C  CG  . ARG F 3 8   ? -14.466 17.706  70.363  1.00 87.63  ? 15  ARG F CG  1 
ATOM   6214 C  CD  . ARG F 3 8   ? -14.712 18.858  69.404  1.00 94.56  ? 15  ARG F CD  1 
ATOM   6215 N  NE  . ARG F 3 8   ? -15.816 19.702  69.851  1.00 100.18 ? 15  ARG F NE  1 
ATOM   6216 C  CZ  . ARG F 3 8   ? -17.101 19.409  69.674  1.00 103.73 ? 15  ARG F CZ  1 
ATOM   6217 N  NH1 . ARG F 3 8   ? -17.452 18.288  69.058  1.00 104.59 ? 15  ARG F NH1 1 
ATOM   6218 N  NH2 . ARG F 3 8   ? -18.036 20.238  70.117  1.00 105.00 ? 15  ARG F NH2 1 
ATOM   6219 N  N   . HIS F 3 9   ? -11.876 17.461  73.232  1.00 62.08  ? 16  HIS F N   1 
ATOM   6220 C  CA  . HIS F 3 9   ? -10.446 17.193  73.173  1.00 54.25  ? 16  HIS F CA  1 
ATOM   6221 C  C   . HIS F 3 9   ? -10.090 15.875  73.859  1.00 59.97  ? 16  HIS F C   1 
ATOM   6222 O  O   . HIS F 3 9   ? -9.319  15.077  73.326  1.00 54.84  ? 16  HIS F O   1 
ATOM   6223 C  CB  . HIS F 3 9   ? -9.678  18.348  73.813  1.00 60.62  ? 16  HIS F CB  1 
ATOM   6224 C  CG  . HIS F 3 9   ? -8.218  18.079  73.992  1.00 60.07  ? 16  HIS F CG  1 
ATOM   6225 N  ND1 . HIS F 3 9   ? -7.323  18.105  72.945  1.00 61.41  ? 16  HIS F ND1 1 
ATOM   6226 C  CD2 . HIS F 3 9   ? -7.496  17.782  75.098  1.00 63.71  ? 16  HIS F CD2 1 
ATOM   6227 C  CE1 . HIS F 3 9   ? -6.111  17.833  73.397  1.00 64.49  ? 16  HIS F CE1 1 
ATOM   6228 N  NE2 . HIS F 3 9   ? -6.189  17.633  74.701  1.00 66.84  ? 16  HIS F NE2 1 
ATOM   6229 N  N   . ILE F 3 10  ? -10.662 15.648  75.038  1.00 59.53  ? 17  ILE F N   1 
ATOM   6230 C  CA  . ILE F 3 10  ? -10.413 14.424  75.788  1.00 56.92  ? 17  ILE F CA  1 
ATOM   6231 C  C   . ILE F 3 10  ? -10.896 13.180  75.038  1.00 59.95  ? 17  ILE F C   1 
ATOM   6232 O  O   . ILE F 3 10  ? -10.180 12.180  74.966  1.00 60.38  ? 17  ILE F O   1 
ATOM   6233 C  CB  . ILE F 3 10  ? -11.038 14.492  77.198  1.00 59.47  ? 17  ILE F CB  1 
ATOM   6234 C  CG1 . ILE F 3 10  ? -10.208 15.419  78.087  1.00 62.52  ? 17  ILE F CG1 1 
ATOM   6235 C  CG2 . ILE F 3 10  ? -11.125 13.108  77.831  1.00 56.48  ? 17  ILE F CG2 1 
ATOM   6236 C  CD1 . ILE F 3 10  ? -10.732 15.554  79.496  1.00 60.45  ? 17  ILE F CD1 1 
ATOM   6237 N  N   . SER F 3 11  ? -12.099 13.249  74.473  1.00 61.12  ? 18  SER F N   1 
ATOM   6238 C  CA  . SER F 3 11  ? -12.656 12.121  73.730  1.00 62.17  ? 18  SER F CA  1 
ATOM   6239 C  C   . SER F 3 11  ? -11.767 11.729  72.556  1.00 68.36  ? 18  SER F C   1 
ATOM   6240 O  O   . SER F 3 11  ? -11.505 10.547  72.331  1.00 71.77  ? 18  SER F O   1 
ATOM   6241 C  CB  . SER F 3 11  ? -14.069 12.433  73.235  1.00 62.15  ? 18  SER F CB  1 
ATOM   6242 O  OG  . SER F 3 11  ? -14.984 12.501  74.315  1.00 66.48  ? 18  SER F OG  1 
ATOM   6243 N  N   . GLU F 3 12  ? -11.300 12.730  71.818  1.00 69.07  ? 19  GLU F N   1 
ATOM   6244 C  CA  . GLU F 3 12  ? -10.449 12.498  70.659  1.00 67.29  ? 19  GLU F CA  1 
ATOM   6245 C  C   . GLU F 3 12  ? -9.089  11.945  71.063  1.00 64.08  ? 19  GLU F C   1 
ATOM   6246 O  O   . GLU F 3 12  ? -8.537  11.079  70.388  1.00 67.61  ? 19  GLU F O   1 
ATOM   6247 C  CB  . GLU F 3 12  ? -10.263 13.793  69.869  1.00 68.72  ? 19  GLU F CB  1 
ATOM   6248 C  CG  . GLU F 3 12  ? -11.546 14.368  69.311  1.00 72.35  ? 19  GLU F CG  1 
ATOM   6249 C  CD  . GLU F 3 12  ? -11.315 15.653  68.546  1.00 78.18  ? 19  GLU F CD  1 
ATOM   6250 O  OE1 . GLU F 3 12  ? -12.304 16.358  68.254  1.00 82.05  ? 19  GLU F OE1 1 
ATOM   6251 O  OE2 . GLU F 3 12  ? -10.144 15.958  68.237  1.00 78.93  ? 19  GLU F OE2 1 
ATOM   6252 N  N   . GLN F 3 13  ? -8.551  12.457  72.164  1.00 59.60  ? 20  GLN F N   1 
ATOM   6253 C  CA  . GLN F 3 13  ? -7.234  12.049  72.640  1.00 58.76  ? 20  GLN F CA  1 
ATOM   6254 C  C   . GLN F 3 13  ? -7.227  10.599  73.087  1.00 55.54  ? 20  GLN F C   1 
ATOM   6255 O  O   . GLN F 3 13  ? -6.258  9.879   72.863  1.00 54.58  ? 20  GLN F O   1 
ATOM   6256 C  CB  . GLN F 3 13  ? -6.786  12.946  73.792  1.00 61.54  ? 20  GLN F CB  1 
ATOM   6257 C  CG  . GLN F 3 13  ? -6.280  14.299  73.346  1.00 63.69  ? 20  GLN F CG  1 
ATOM   6258 C  CD  . GLN F 3 13  ? -4.963  14.193  72.618  1.00 68.61  ? 20  GLN F CD  1 
ATOM   6259 O  OE1 . GLN F 3 13  ? -3.914  14.012  73.240  1.00 72.34  ? 20  GLN F OE1 1 
ATOM   6260 N  NE2 . GLN F 3 13  ? -5.006  14.290  71.294  1.00 67.78  ? 20  GLN F NE2 1 
ATOM   6261 N  N   . LEU F 3 14  ? -8.311  10.180  73.729  1.00 60.13  ? 21  LEU F N   1 
ATOM   6262 C  CA  . LEU F 3 14  ? -8.447  8.802   74.178  1.00 58.71  ? 21  LEU F CA  1 
ATOM   6263 C  C   . LEU F 3 14  ? -8.537  7.860   72.979  1.00 61.83  ? 21  LEU F C   1 
ATOM   6264 O  O   . LEU F 3 14  ? -7.943  6.779   72.981  1.00 62.72  ? 21  LEU F O   1 
ATOM   6265 C  CB  . LEU F 3 14  ? -9.674  8.646   75.082  1.00 53.53  ? 21  LEU F CB  1 
ATOM   6266 C  CG  . LEU F 3 14  ? -9.592  9.233   76.496  1.00 53.38  ? 21  LEU F CG  1 
ATOM   6267 C  CD1 . LEU F 3 14  ? -10.936 9.125   77.202  1.00 51.83  ? 21  LEU F CD1 1 
ATOM   6268 C  CD2 . LEU F 3 14  ? -8.512  8.539   77.312  1.00 52.19  ? 21  LEU F CD2 1 
ATOM   6269 N  N   . ARG F 3 15  ? -9.273  8.277   71.953  1.00 58.32  ? 22  ARG F N   1 
ATOM   6270 C  CA  . ARG F 3 15  ? -9.429  7.458   70.757  1.00 56.23  ? 22  ARG F CA  1 
ATOM   6271 C  C   . ARG F 3 15  ? -8.137  7.431   69.945  1.00 56.18  ? 22  ARG F C   1 
ATOM   6272 O  O   . ARG F 3 15  ? -7.799  6.416   69.337  1.00 59.15  ? 22  ARG F O   1 
ATOM   6273 C  CB  . ARG F 3 15  ? -10.605 7.944   69.907  1.00 59.53  ? 22  ARG F CB  1 
ATOM   6274 C  CG  . ARG F 3 15  ? -11.965 7.745   70.573  1.00 63.02  ? 22  ARG F CG  1 
ATOM   6275 C  CD  . ARG F 3 15  ? -13.108 7.855   69.573  1.00 67.37  ? 22  ARG F CD  1 
ATOM   6276 N  NE  . ARG F 3 15  ? -13.249 9.203   69.029  1.00 71.63  ? 22  ARG F NE  1 
ATOM   6277 C  CZ  . ARG F 3 15  ? -14.166 10.078  69.428  1.00 71.47  ? 22  ARG F CZ  1 
ATOM   6278 N  NH1 . ARG F 3 15  ? -15.033 9.747   70.378  1.00 73.42  ? 22  ARG F NH1 1 
ATOM   6279 N  NH2 . ARG F 3 15  ? -14.220 11.285  68.877  1.00 66.60  ? 22  ARG F NH2 1 
ATOM   6280 N  N   . ARG F 3 16  ? -7.418  8.549   69.948  1.00 54.33  ? 23  ARG F N   1 
ATOM   6281 C  CA  . ARG F 3 16  ? -6.096  8.615   69.338  1.00 50.24  ? 23  ARG F CA  1 
ATOM   6282 C  C   . ARG F 3 16  ? -5.146  7.645   70.030  1.00 51.38  ? 23  ARG F C   1 
ATOM   6283 O  O   . ARG F 3 16  ? -4.356  6.959   69.378  1.00 51.64  ? 23  ARG F O   1 
ATOM   6284 C  CB  . ARG F 3 16  ? -5.525  10.032  69.430  1.00 51.36  ? 23  ARG F CB  1 
ATOM   6285 C  CG  . ARG F 3 16  ? -4.167  10.177  68.760  1.00 53.33  ? 23  ARG F CG  1 
ATOM   6286 C  CD  . ARG F 3 16  ? -3.622  11.590  68.865  1.00 57.16  ? 23  ARG F CD  1 
ATOM   6287 N  NE  . ARG F 3 16  ? -2.530  11.805  67.921  1.00 65.68  ? 23  ARG F NE  1 
ATOM   6288 C  CZ  . ARG F 3 16  ? -1.240  11.668  68.217  1.00 70.44  ? 23  ARG F CZ  1 
ATOM   6289 N  NH1 . ARG F 3 16  ? -0.866  11.324  69.442  1.00 65.40  ? 23  ARG F NH1 1 
ATOM   6290 N  NH2 . ARG F 3 16  ? -0.319  11.880  67.282  1.00 73.72  ? 23  ARG F NH2 1 
ATOM   6291 N  N   . ARG F 3 17  ? -5.232  7.599   71.356  1.00 48.88  ? 24  ARG F N   1 
ATOM   6292 C  CA  . ARG F 3 17  ? -4.372  6.749   72.167  1.00 45.82  ? 24  ARG F CA  1 
ATOM   6293 C  C   . ARG F 3 17  ? -4.628  5.271   71.891  1.00 47.87  ? 24  ARG F C   1 
ATOM   6294 O  O   . ARG F 3 17  ? -3.689  4.493   71.731  1.00 49.03  ? 24  ARG F O   1 
ATOM   6295 C  CB  . ARG F 3 17  ? -4.591  7.046   73.650  1.00 45.62  ? 24  ARG F CB  1 
ATOM   6296 C  CG  . ARG F 3 17  ? -3.858  6.110   74.584  1.00 44.91  ? 24  ARG F CG  1 
ATOM   6297 C  CD  . ARG F 3 17  ? -4.526  6.069   75.943  1.00 44.95  ? 24  ARG F CD  1 
ATOM   6298 N  NE  . ARG F 3 17  ? -5.813  5.382   75.900  1.00 45.21  ? 24  ARG F NE  1 
ATOM   6299 C  CZ  . ARG F 3 17  ? -6.627  5.254   76.945  1.00 49.81  ? 24  ARG F CZ  1 
ATOM   6300 N  NH1 . ARG F 3 17  ? -6.291  5.771   78.122  1.00 52.41  ? 24  ARG F NH1 1 
ATOM   6301 N  NH2 . ARG F 3 17  ? -7.778  4.610   76.816  1.00 46.99  ? 24  ARG F NH2 1 
ATOM   6302 N  N   . ASP F 3 18  ? -5.903  4.893   71.838  1.00 46.33  ? 25  ASP F N   1 
ATOM   6303 C  CA  . ASP F 3 18  ? -6.286  3.513   71.559  1.00 47.71  ? 25  ASP F CA  1 
ATOM   6304 C  C   . ASP F 3 18  ? -5.766  3.067   70.201  1.00 50.35  ? 25  ASP F C   1 
ATOM   6305 O  O   . ASP F 3 18  ? -5.389  1.910   70.020  1.00 56.43  ? 25  ASP F O   1 
ATOM   6306 C  CB  . ASP F 3 18  ? -7.809  3.349   71.594  1.00 51.71  ? 25  ASP F CB  1 
ATOM   6307 C  CG  . ASP F 3 18  ? -8.394  3.590   72.973  1.00 54.28  ? 25  ASP F CG  1 
ATOM   6308 O  OD1 . ASP F 3 18  ? -7.642  3.507   73.967  1.00 52.94  ? 25  ASP F OD1 1 
ATOM   6309 O  OD2 . ASP F 3 18  ? -9.612  3.858   73.061  1.00 57.65  ? 25  ASP F OD2 1 
ATOM   6310 N  N   . ARG F 3 19  ? -5.751  3.993   69.248  1.00 48.93  ? 26  ARG F N   1 
ATOM   6311 C  CA  . ARG F 3 19  ? -5.294  3.689   67.900  1.00 50.38  ? 26  ARG F CA  1 
ATOM   6312 C  C   . ARG F 3 19  ? -3.783  3.481   67.866  1.00 54.11  ? 26  ARG F C   1 
ATOM   6313 O  O   . ARG F 3 19  ? -3.282  2.595   67.173  1.00 54.55  ? 26  ARG F O   1 
ATOM   6314 C  CB  . ARG F 3 19  ? -5.692  4.804   66.933  1.00 50.71  ? 26  ARG F CB  1 
ATOM   6315 C  CG  . ARG F 3 19  ? -5.357  4.499   65.485  1.00 54.16  ? 26  ARG F CG  1 
ATOM   6316 C  CD  . ARG F 3 19  ? -5.749  5.639   64.559  1.00 58.52  ? 26  ARG F CD  1 
ATOM   6317 N  NE  . ARG F 3 19  ? -4.655  6.585   64.357  1.00 61.52  ? 26  ARG F NE  1 
ATOM   6318 C  CZ  . ARG F 3 19  ? -4.645  7.830   64.817  1.00 63.26  ? 26  ARG F CZ  1 
ATOM   6319 N  NH1 . ARG F 3 19  ? -5.677  8.293   65.508  1.00 65.45  ? 26  ARG F NH1 1 
ATOM   6320 N  NH2 . ARG F 3 19  ? -3.603  8.617   64.582  1.00 64.03  ? 26  ARG F NH2 1 
ATOM   6321 N  N   . LEU F 3 20  ? -3.058  4.297   68.621  1.00 47.18  ? 27  LEU F N   1 
ATOM   6322 C  CA  . LEU F 3 20  ? -1.605  4.228   68.610  1.00 53.09  ? 27  LEU F CA  1 
ATOM   6323 C  C   . LEU F 3 20  ? -1.101  3.103   69.494  1.00 53.16  ? 27  LEU F C   1 
ATOM   6324 O  O   . LEU F 3 20  ? -0.023  2.556   69.265  1.00 52.57  ? 27  LEU F O   1 
ATOM   6325 C  CB  . LEU F 3 20  ? -0.997  5.556   69.064  1.00 47.81  ? 27  LEU F CB  1 
ATOM   6326 C  CG  . LEU F 3 20  ? -1.320  6.760   68.176  1.00 56.91  ? 27  LEU F CG  1 
ATOM   6327 C  CD1 . LEU F 3 20  ? -0.822  8.060   68.796  1.00 54.11  ? 27  LEU F CD1 1 
ATOM   6328 C  CD2 . LEU F 3 20  ? -0.737  6.565   66.783  1.00 55.47  ? 27  LEU F CD2 1 
ATOM   6329 N  N   . GLN F 3 21  ? -1.886  2.752   70.505  1.00 46.32  ? 28  GLN F N   1 
ATOM   6330 C  CA  . GLN F 3 21  ? -1.416  1.803   71.507  1.00 50.33  ? 28  GLN F CA  1 
ATOM   6331 C  C   . GLN F 3 21  ? -2.083  0.434   71.404  1.00 53.79  ? 28  GLN F C   1 
ATOM   6332 O  O   . GLN F 3 21  ? -1.444  -0.537  71.005  1.00 59.49  ? 28  GLN F O   1 
ATOM   6333 C  CB  . GLN F 3 21  ? -1.543  2.403   72.910  1.00 46.95  ? 28  GLN F CB  1 
ATOM   6334 C  CG  . GLN F 3 21  ? -0.756  3.698   73.054  1.00 44.47  ? 28  GLN F CG  1 
ATOM   6335 C  CD  . GLN F 3 21  ? -0.708  4.220   74.474  1.00 49.44  ? 28  GLN F CD  1 
ATOM   6336 O  OE1 . GLN F 3 21  ? -1.566  3.903   75.300  1.00 51.57  ? 28  GLN F OE1 1 
ATOM   6337 N  NE2 . GLN F 3 21  ? 0.303   5.028   74.767  1.00 48.07  ? 28  GLN F NE2 1 
ATOM   6338 N  N   . ARG F 3 22  ? -3.364  0.357   71.747  1.00 52.69  ? 29  ARG F N   1 
ATOM   6339 C  CA  . ARG F 3 22  ? -4.075  -0.916  71.725  1.00 52.27  ? 29  ARG F CA  1 
ATOM   6340 C  C   . ARG F 3 22  ? -4.235  -1.502  70.317  1.00 53.53  ? 29  ARG F C   1 
ATOM   6341 O  O   . ARG F 3 22  ? -3.776  -2.613  70.045  1.00 55.37  ? 29  ARG F O   1 
ATOM   6342 C  CB  . ARG F 3 22  ? -5.443  -0.782  72.395  1.00 52.97  ? 29  ARG F CB  1 
ATOM   6343 C  CG  . ARG F 3 22  ? -6.211  -2.082  72.447  1.00 56.34  ? 29  ARG F CG  1 
ATOM   6344 C  CD  . ARG F 3 22  ? -7.521  -1.939  73.184  1.00 63.60  ? 29  ARG F CD  1 
ATOM   6345 N  NE  . ARG F 3 22  ? -8.172  -3.236  73.344  1.00 73.38  ? 29  ARG F NE  1 
ATOM   6346 C  CZ  . ARG F 3 22  ? -9.277  -3.439  74.052  1.00 79.28  ? 29  ARG F CZ  1 
ATOM   6347 N  NH1 . ARG F 3 22  ? -9.866  -2.426  74.673  1.00 81.52  ? 29  ARG F NH1 1 
ATOM   6348 N  NH2 . ARG F 3 22  ? -9.793  -4.659  74.142  1.00 80.96  ? 29  ARG F NH2 1 
ATOM   6349 N  N   . GLN F 3 23  ? -4.879  -0.752  69.427  1.00 51.27  ? 30  GLN F N   1 
ATOM   6350 C  CA  . GLN F 3 23  ? -5.233  -1.261  68.099  1.00 51.44  ? 30  GLN F CA  1 
ATOM   6351 C  C   . GLN F 3 23  ? -4.027  -1.612  67.231  1.00 48.00  ? 30  GLN F C   1 
ATOM   6352 O  O   . GLN F 3 23  ? -4.151  -2.345  66.254  1.00 48.47  ? 30  GLN F O   1 
ATOM   6353 C  CB  . GLN F 3 23  ? -6.123  -0.263  67.361  1.00 52.38  ? 30  GLN F CB  1 
ATOM   6354 C  CG  . GLN F 3 23  ? -7.415  0.065   68.082  1.00 58.72  ? 30  GLN F CG  1 
ATOM   6355 C  CD  . GLN F 3 23  ? -8.231  1.114   67.355  1.00 66.89  ? 30  GLN F CD  1 
ATOM   6356 O  OE1 . GLN F 3 23  ? -8.104  1.285   66.142  1.00 70.82  ? 30  GLN F OE1 1 
ATOM   6357 N  NE2 . GLN F 3 23  ? -9.072  1.827   68.095  1.00 69.64  ? 30  GLN F NE2 1 
ATOM   6358 N  N   . ALA F 3 24  ? -2.863  -1.086  67.588  1.00 43.91  ? 31  ALA F N   1 
ATOM   6359 C  CA  . ALA F 3 24  ? -1.650  -1.368  66.839  1.00 39.31  ? 31  ALA F CA  1 
ATOM   6360 C  C   . ALA F 3 24  ? -1.076  -2.750  67.153  1.00 43.36  ? 31  ALA F C   1 
ATOM   6361 O  O   . ALA F 3 24  ? -0.325  -3.305  66.352  1.00 44.03  ? 31  ALA F O   1 
ATOM   6362 C  CB  . ALA F 3 24  ? -0.610  -0.293  67.099  1.00 35.72  ? 31  ALA F CB  1 
ATOM   6363 N  N   . PHE F 3 25  ? -1.423  -3.308  68.310  1.00 43.09  ? 32  PHE F N   1 
ATOM   6364 C  CA  . PHE F 3 25  ? -0.746  -4.518  68.770  1.00 42.23  ? 32  PHE F CA  1 
ATOM   6365 C  C   . PHE F 3 25  ? -1.658  -5.683  69.117  1.00 47.96  ? 32  PHE F C   1 
ATOM   6366 O  O   . PHE F 3 25  ? -1.190  -6.811  69.267  1.00 50.90  ? 32  PHE F O   1 
ATOM   6367 C  CB  . PHE F 3 25  ? 0.168   -4.203  69.955  1.00 41.55  ? 32  PHE F CB  1 
ATOM   6368 C  CG  . PHE F 3 25  ? 1.410   -3.450  69.572  1.00 42.86  ? 32  PHE F CG  1 
ATOM   6369 C  CD1 . PHE F 3 25  ? 2.585   -4.127  69.292  1.00 41.33  ? 32  PHE F CD1 1 
ATOM   6370 C  CD2 . PHE F 3 25  ? 1.396   -2.067  69.473  1.00 42.37  ? 32  PHE F CD2 1 
ATOM   6371 C  CE1 . PHE F 3 25  ? 3.729   -3.441  68.930  1.00 41.73  ? 32  PHE F CE1 1 
ATOM   6372 C  CE2 . PHE F 3 25  ? 2.539   -1.368  69.111  1.00 43.13  ? 32  PHE F CE2 1 
ATOM   6373 C  CZ  . PHE F 3 25  ? 3.708   -2.056  68.839  1.00 43.19  ? 32  PHE F CZ  1 
ATOM   6374 N  N   . GLU F 3 26  ? -2.953  -5.419  69.238  1.00 47.37  ? 33  GLU F N   1 
ATOM   6375 C  CA  . GLU F 3 26  ? -3.881  -6.447  69.690  1.00 48.59  ? 33  GLU F CA  1 
ATOM   6376 C  C   . GLU F 3 26  ? -3.886  -7.682  68.799  1.00 53.58  ? 33  GLU F C   1 
ATOM   6377 O  O   . GLU F 3 26  ? -3.806  -8.806  69.293  1.00 52.16  ? 33  GLU F O   1 
ATOM   6378 C  CB  . GLU F 3 26  ? -5.292  -5.887  69.813  1.00 53.16  ? 33  GLU F CB  1 
ATOM   6379 C  CG  . GLU F 3 26  ? -6.256  -6.849  70.465  1.00 59.67  ? 33  GLU F CG  1 
ATOM   6380 C  CD  . GLU F 3 26  ? -7.563  -6.192  70.820  1.00 73.00  ? 33  GLU F CD  1 
ATOM   6381 O  OE1 . GLU F 3 26  ? -8.357  -6.807  71.563  1.00 77.15  ? 33  GLU F OE1 1 
ATOM   6382 O  OE2 . GLU F 3 26  ? -7.797  -5.056  70.354  1.00 79.63  ? 33  GLU F OE2 1 
ATOM   6383 N  N   . GLU F 3 27  ? -3.970  -7.477  67.488  1.00 59.03  ? 34  GLU F N   1 
ATOM   6384 C  CA  . GLU F 3 27  ? -4.036  -8.602  66.560  1.00 58.97  ? 34  GLU F CA  1 
ATOM   6385 C  C   . GLU F 3 27  ? -2.740  -9.395  66.490  1.00 55.30  ? 34  GLU F C   1 
ATOM   6386 O  O   . GLU F 3 27  ? -2.760  -10.619 66.566  1.00 57.89  ? 34  GLU F O   1 
ATOM   6387 C  CB  . GLU F 3 27  ? -4.449  -8.145  65.162  1.00 65.64  ? 34  GLU F CB  1 
ATOM   6388 C  CG  . GLU F 3 27  ? -5.941  -8.219  64.931  1.00 77.54  ? 34  GLU F CG  1 
ATOM   6389 C  CD  . GLU F 3 27  ? -6.489  -9.605  65.204  1.00 87.92  ? 34  GLU F CD  1 
ATOM   6390 O  OE1 . GLU F 3 27  ? -5.873  -10.587 64.736  1.00 94.58  ? 34  GLU F OE1 1 
ATOM   6391 O  OE2 . GLU F 3 27  ? -7.527  -9.716  65.893  1.00 88.27  ? 34  GLU F OE2 1 
ATOM   6392 N  N   . ILE F 3 28  ? -1.619  -8.698  66.347  1.00 51.38  ? 35  ILE F N   1 
ATOM   6393 C  CA  . ILE F 3 28  ? -0.332  -9.368  66.207  1.00 49.51  ? 35  ILE F CA  1 
ATOM   6394 C  C   . ILE F 3 28  ? 0.047   -10.132 67.473  1.00 53.34  ? 35  ILE F C   1 
ATOM   6395 O  O   . ILE F 3 28  ? 0.625   -11.214 67.400  1.00 59.50  ? 35  ILE F O   1 
ATOM   6396 C  CB  . ILE F 3 28  ? 0.789   -8.383  65.800  1.00 51.40  ? 35  ILE F CB  1 
ATOM   6397 C  CG1 . ILE F 3 28  ? 2.097   -9.133  65.538  1.00 48.37  ? 35  ILE F CG1 1 
ATOM   6398 C  CG2 . ILE F 3 28  ? 0.965   -7.286  66.849  1.00 49.56  ? 35  ILE F CG2 1 
ATOM   6399 C  CD1 . ILE F 3 28  ? 3.157   -8.287  64.878  1.00 44.31  ? 35  ILE F CD1 1 
ATOM   6400 N  N   . ILE F 3 29  ? -0.298  -9.579  68.630  1.00 53.26  ? 36  ILE F N   1 
ATOM   6401 C  CA  . ILE F 3 29  ? -0.019  -10.240 69.896  1.00 52.61  ? 36  ILE F CA  1 
ATOM   6402 C  C   . ILE F 3 29  ? -0.889  -11.483 70.033  1.00 58.03  ? 36  ILE F C   1 
ATOM   6403 O  O   . ILE F 3 29  ? -0.424  -12.539 70.457  1.00 64.27  ? 36  ILE F O   1 
ATOM   6404 C  CB  . ILE F 3 29  ? -0.245  -9.286  71.087  1.00 48.95  ? 36  ILE F CB  1 
ATOM   6405 C  CG1 . ILE F 3 29  ? 0.904   -8.285  71.183  1.00 49.35  ? 36  ILE F CG1 1 
ATOM   6406 C  CG2 . ILE F 3 29  ? -0.358  -10.057 72.387  1.00 42.53  ? 36  ILE F CG2 1 
ATOM   6407 C  CD1 . ILE F 3 29  ? 0.817   -7.383  72.388  1.00 51.53  ? 36  ILE F CD1 1 
ATOM   6408 N  N   . LEU F 3 30  ? -2.153  -11.350 69.653  1.00 57.86  ? 37  LEU F N   1 
ATOM   6409 C  CA  . LEU F 3 30  ? -3.086  -12.466 69.669  1.00 58.96  ? 37  LEU F CA  1 
ATOM   6410 C  C   . LEU F 3 30  ? -2.632  -13.563 68.702  1.00 62.28  ? 37  LEU F C   1 
ATOM   6411 O  O   . LEU F 3 30  ? -2.751  -14.753 68.996  1.00 65.01  ? 37  LEU F O   1 
ATOM   6412 C  CB  . LEU F 3 30  ? -4.482  -11.961 69.299  1.00 64.57  ? 37  LEU F CB  1 
ATOM   6413 C  CG  . LEU F 3 30  ? -5.721  -12.781 69.644  1.00 71.92  ? 37  LEU F CG  1 
ATOM   6414 C  CD1 . LEU F 3 30  ? -6.908  -11.843 69.771  1.00 72.21  ? 37  LEU F CD1 1 
ATOM   6415 C  CD2 . LEU F 3 30  ? -5.992  -13.847 68.588  1.00 77.05  ? 37  LEU F CD2 1 
ATOM   6416 N  N   . GLN F 3 31  ? -2.106  -13.159 67.549  1.00 62.64  ? 38  GLN F N   1 
ATOM   6417 C  CA  . GLN F 3 31  ? -1.617  -14.110 66.556  1.00 67.37  ? 38  GLN F CA  1 
ATOM   6418 C  C   . GLN F 3 31  ? -0.297  -14.746 66.980  1.00 73.37  ? 38  GLN F C   1 
ATOM   6419 O  O   . GLN F 3 31  ? -0.032  -15.909 66.673  1.00 77.14  ? 38  GLN F O   1 
ATOM   6420 C  CB  . GLN F 3 31  ? -1.473  -13.443 65.187  1.00 61.59  ? 38  GLN F CB  1 
ATOM   6421 C  CG  . GLN F 3 31  ? -2.746  -13.458 64.367  1.00 60.45  ? 38  GLN F CG  1 
ATOM   6422 C  CD  . GLN F 3 31  ? -3.145  -14.863 63.963  1.00 68.02  ? 38  GLN F CD  1 
ATOM   6423 O  OE1 . GLN F 3 31  ? -2.294  -15.743 63.812  1.00 73.20  ? 38  GLN F OE1 1 
ATOM   6424 N  NE2 . GLN F 3 31  ? -4.443  -15.084 63.789  1.00 68.45  ? 38  GLN F NE2 1 
ATOM   6425 N  N   . TYR F 3 32  ? 0.527   -13.978 67.685  1.00 71.09  ? 39  TYR F N   1 
ATOM   6426 C  CA  . TYR F 3 32  ? 1.795   -14.488 68.188  1.00 67.86  ? 39  TYR F CA  1 
ATOM   6427 C  C   . TYR F 3 32  ? 1.567   -15.561 69.249  1.00 68.49  ? 39  TYR F C   1 
ATOM   6428 O  O   . TYR F 3 32  ? 2.287   -16.554 69.296  1.00 71.59  ? 39  TYR F O   1 
ATOM   6429 C  CB  . TYR F 3 32  ? 2.652   -13.349 68.748  1.00 67.72  ? 39  TYR F CB  1 
ATOM   6430 C  CG  . TYR F 3 32  ? 3.943   -13.797 69.400  1.00 68.43  ? 39  TYR F CG  1 
ATOM   6431 C  CD1 . TYR F 3 32  ? 5.093   -13.987 68.647  1.00 69.13  ? 39  TYR F CD1 1 
ATOM   6432 C  CD2 . TYR F 3 32  ? 4.014   -14.020 70.771  1.00 64.77  ? 39  TYR F CD2 1 
ATOM   6433 C  CE1 . TYR F 3 32  ? 6.276   -14.395 69.240  1.00 68.42  ? 39  TYR F CE1 1 
ATOM   6434 C  CE2 . TYR F 3 32  ? 5.190   -14.428 71.369  1.00 62.22  ? 39  TYR F CE2 1 
ATOM   6435 C  CZ  . TYR F 3 32  ? 6.316   -14.613 70.601  1.00 64.50  ? 39  TYR F CZ  1 
ATOM   6436 O  OH  . TYR F 3 32  ? 7.489   -15.019 71.193  1.00 67.31  ? 39  TYR F OH  1 
ATOM   6437 N  N   . ASN F 3 33  ? 0.562   -15.366 70.096  1.00 70.24  ? 40  ASN F N   1 
ATOM   6438 C  CA  . ASN F 3 33  ? 0.277   -16.326 71.161  1.00 70.61  ? 40  ASN F CA  1 
ATOM   6439 C  C   . ASN F 3 33  ? -0.368  -17.615 70.665  1.00 75.91  ? 40  ASN F C   1 
ATOM   6440 O  O   . ASN F 3 33  ? -0.381  -18.617 71.375  1.00 81.36  ? 40  ASN F O   1 
ATOM   6441 C  CB  . ASN F 3 33  ? -0.569  -15.689 72.263  1.00 70.14  ? 40  ASN F CB  1 
ATOM   6442 C  CG  . ASN F 3 33  ? 0.242   -14.774 73.153  1.00 77.97  ? 40  ASN F CG  1 
ATOM   6443 O  OD1 . ASN F 3 33  ? 1.345   -15.120 73.577  1.00 80.54  ? 40  ASN F OD1 1 
ATOM   6444 N  ND2 . ASN F 3 33  ? -0.293  -13.591 73.431  1.00 81.13  ? 40  ASN F ND2 1 
ATOM   6445 N  N   . LYS F 3 34  ? -0.902  -17.587 69.448  1.00 78.17  ? 41  LYS F N   1 
ATOM   6446 C  CA  . LYS F 3 34  ? -1.447  -18.792 68.835  1.00 82.43  ? 41  LYS F CA  1 
ATOM   6447 C  C   . LYS F 3 34  ? -0.320  -19.720 68.397  1.00 88.17  ? 41  LYS F C   1 
ATOM   6448 O  O   . LYS F 3 34  ? -0.453  -20.943 68.441  1.00 94.42  ? 41  LYS F O   1 
ATOM   6449 C  CB  . LYS F 3 34  ? -2.323  -18.442 67.632  1.00 83.72  ? 41  LYS F CB  1 
ATOM   6450 C  CG  . LYS F 3 34  ? -3.632  -17.766 67.989  1.00 86.13  ? 41  LYS F CG  1 
ATOM   6451 C  CD  . LYS F 3 34  ? -4.394  -17.366 66.736  1.00 87.92  ? 41  LYS F CD  1 
ATOM   6452 C  CE  . LYS F 3 34  ? -4.685  -18.569 65.858  1.00 86.92  ? 41  LYS F CE  1 
ATOM   6453 N  NZ  . LYS F 3 34  ? -5.445  -18.185 64.637  1.00 88.24  ? 41  LYS F NZ  1 
ATOM   6454 N  N   . LEU F 3 35  ? 0.793   -19.129 67.981  1.00 87.49  ? 42  LEU F N   1 
ATOM   6455 C  CA  . LEU F 3 35  ? 1.914   -19.895 67.454  1.00 88.90  ? 42  LEU F CA  1 
ATOM   6456 C  C   . LEU F 3 35  ? 3.018   -20.068 68.496  1.00 93.69  ? 42  LEU F C   1 
ATOM   6457 O  O   . LEU F 3 35  ? 4.168   -20.333 68.151  1.00 101.71 ? 42  LEU F O   1 
ATOM   6458 C  CB  . LEU F 3 35  ? 2.473   -19.206 66.207  1.00 84.61  ? 42  LEU F CB  1 
ATOM   6459 C  CG  . LEU F 3 35  ? 1.419   -18.704 65.214  1.00 86.01  ? 42  LEU F CG  1 
ATOM   6460 C  CD1 . LEU F 3 35  ? 2.069   -17.963 64.058  1.00 84.22  ? 42  LEU F CD1 1 
ATOM   6461 C  CD2 . LEU F 3 35  ? 0.550   -19.849 64.701  1.00 89.33  ? 42  LEU F CD2 1 
ATOM   6462 N  N   . LEU F 3 36  ? 2.662   -19.923 69.770  1.00 87.09  ? 43  LEU F N   1 
ATOM   6463 C  CA  . LEU F 3 36  ? 3.637   -20.007 70.855  1.00 77.71  ? 43  LEU F CA  1 
ATOM   6464 C  C   . LEU F 3 36  ? 3.509   -21.321 71.616  1.00 76.42  ? 43  LEU F C   1 
ATOM   6465 O  O   . LEU F 3 36  ? 3.539   -22.397 71.022  1.00 77.97  ? 43  LEU F O   1 
ATOM   6466 C  CB  . LEU F 3 36  ? 3.470   -18.824 71.812  1.00 73.44  ? 43  LEU F CB  1 
ATOM   6467 C  CG  . LEU F 3 36  ? 4.440   -18.717 72.992  1.00 69.69  ? 43  LEU F CG  1 
ATOM   6468 C  CD1 . LEU F 3 36  ? 5.864   -18.502 72.512  1.00 64.82  ? 43  LEU F CD1 1 
ATOM   6469 C  CD2 . LEU F 3 36  ? 4.015   -17.597 73.932  1.00 71.44  ? 43  LEU F CD2 1 
HETATM 6470 NA NA  . NA  G 4 .   ? -4.395  -1.794  60.445  1.00 52.20  ? 301 NA  B NA  1 
HETATM 6471 NA NA  . NA  H 4 .   ? 9.932   -0.630  73.927  1.00 65.63  ? 301 NA  E NA  1 
HETATM 6472 O  O   . HOH I 5 .   ? -0.781  -3.953  24.419  1.00 51.15  ? 201 HOH A O   1 
HETATM 6473 O  O   . HOH I 5 .   ? -5.865  5.942   34.259  1.00 43.42  ? 202 HOH A O   1 
HETATM 6474 O  O   . HOH I 5 .   ? -7.771  7.776   34.141  1.00 48.75  ? 203 HOH A O   1 
HETATM 6475 O  O   . HOH J 5 .   ? 12.063  2.094   51.739  1.00 39.79  ? 401 HOH B O   1 
HETATM 6476 O  O   . HOH J 5 .   ? 7.219   6.819   51.208  1.00 45.83  ? 402 HOH B O   1 
HETATM 6477 O  O   . HOH J 5 .   ? 5.373   10.154  49.218  1.00 37.63  ? 403 HOH B O   1 
HETATM 6478 O  O   . HOH J 5 .   ? 10.904  2.960   28.655  1.00 44.92  ? 404 HOH B O   1 
HETATM 6479 O  O   . HOH J 5 .   ? 11.656  15.050  42.156  1.00 45.73  ? 405 HOH B O   1 
HETATM 6480 O  O   . HOH J 5 .   ? 13.356  -3.592  46.717  1.00 50.05  ? 406 HOH B O   1 
HETATM 6481 O  O   . HOH J 5 .   ? 3.711   -1.408  44.794  1.00 48.37  ? 407 HOH B O   1 
HETATM 6482 O  O   . HOH J 5 .   ? -7.398  -4.308  54.158  1.00 49.50  ? 408 HOH B O   1 
HETATM 6483 O  O   . HOH J 5 .   ? 10.189  -7.754  57.950  1.00 47.00  ? 409 HOH B O   1 
HETATM 6484 O  O   . HOH J 5 .   ? 2.592   7.178   56.313  1.00 45.12  ? 410 HOH B O   1 
HETATM 6485 O  O   . HOH J 5 .   ? -1.343  -2.217  38.829  1.00 49.01  ? 411 HOH B O   1 
HETATM 6486 O  O   . HOH J 5 .   ? -3.052  10.117  57.850  1.00 58.11  ? 412 HOH B O   1 
HETATM 6487 O  O   . HOH J 5 .   ? -5.313  -11.268 59.861  1.00 49.11  ? 413 HOH B O   1 
HETATM 6488 O  O   . HOH J 5 .   ? -4.199  1.332   44.235  1.00 45.59  ? 414 HOH B O   1 
HETATM 6489 O  O   . HOH J 5 .   ? -6.288  -24.460 46.898  1.00 59.59  ? 415 HOH B O   1 
HETATM 6490 O  O   . HOH J 5 .   ? 9.557   -16.355 55.587  1.00 47.71  ? 416 HOH B O   1 
HETATM 6491 O  O   . HOH J 5 .   ? 22.783  15.658  48.284  1.00 50.79  ? 417 HOH B O   1 
HETATM 6492 O  O   . HOH J 5 .   ? 9.128   -11.134 50.669  1.00 47.59  ? 418 HOH B O   1 
HETATM 6493 O  O   . HOH J 5 .   ? 5.985   -19.055 55.931  1.00 55.55  ? 419 HOH B O   1 
HETATM 6494 O  O   . HOH J 5 .   ? 7.372   20.123  36.462  1.00 58.15  ? 420 HOH B O   1 
HETATM 6495 O  O   . HOH J 5 .   ? -11.790 -8.070  50.963  1.00 51.16  ? 421 HOH B O   1 
HETATM 6496 O  O   . HOH J 5 .   ? 3.339   5.657   36.524  1.00 54.70  ? 422 HOH B O   1 
HETATM 6497 O  O   . HOH J 5 .   ? 17.393  7.971   49.191  1.00 50.72  ? 423 HOH B O   1 
HETATM 6498 O  O   . HOH J 5 .   ? -4.313  -0.880  58.169  1.00 47.58  ? 424 HOH B O   1 
HETATM 6499 O  O   . HOH J 5 .   ? 2.873   10.439  50.289  1.00 37.72  ? 425 HOH B O   1 
HETATM 6500 O  O   . HOH J 5 .   ? -1.712  -6.040  43.738  1.00 41.41  ? 426 HOH B O   1 
HETATM 6501 O  O   . HOH J 5 .   ? -4.342  -15.386 56.461  1.00 47.38  ? 427 HOH B O   1 
HETATM 6502 O  O   . HOH J 5 .   ? 10.454  3.937   43.360  1.00 48.71  ? 428 HOH B O   1 
HETATM 6503 O  O   . HOH J 5 .   ? 13.972  2.831   59.094  1.00 47.12  ? 429 HOH B O   1 
HETATM 6504 O  O   . HOH J 5 .   ? -2.359  -5.243  32.259  1.00 49.75  ? 430 HOH B O   1 
HETATM 6505 O  O   . HOH J 5 .   ? -7.098  12.132  49.060  1.00 50.03  ? 431 HOH B O   1 
HETATM 6506 O  O   . HOH J 5 .   ? 15.967  11.791  46.258  1.00 56.17  ? 432 HOH B O   1 
HETATM 6507 O  O   . HOH J 5 .   ? 10.896  6.678   52.984  1.00 47.10  ? 433 HOH B O   1 
HETATM 6508 O  O   . HOH J 5 .   ? -9.529  5.830   65.931  1.00 67.00  ? 434 HOH B O   1 
HETATM 6509 O  O   . HOH J 5 .   ? 14.556  -1.504  49.107  1.00 51.52  ? 435 HOH B O   1 
HETATM 6510 O  O   . HOH J 5 .   ? 14.885  2.999   61.239  1.00 54.54  ? 436 HOH B O   1 
HETATM 6511 O  O   . HOH J 5 .   ? -4.024  -2.790  62.664  1.00 59.65  ? 437 HOH B O   1 
HETATM 6512 O  O   . HOH J 5 .   ? -6.689  -1.012  60.531  1.00 52.35  ? 438 HOH B O   1 
HETATM 6513 O  O   . HOH J 5 .   ? -2.896  1.365   58.640  1.00 43.20  ? 439 HOH B O   1 
HETATM 6514 O  O   . HOH J 5 .   ? 15.157  0.072   51.460  1.00 45.84  ? 440 HOH B O   1 
HETATM 6515 O  O   . HOH J 5 .   ? -1.018  -5.400  41.465  1.00 50.31  ? 441 HOH B O   1 
HETATM 6516 O  O   . HOH J 5 .   ? -5.503  7.962   54.981  1.00 53.53  ? 442 HOH B O   1 
HETATM 6517 O  O   . HOH J 5 .   ? -4.434  4.476   44.294  1.00 43.50  ? 443 HOH B O   1 
HETATM 6518 O  O   . HOH J 5 .   ? 3.450   6.168   39.479  1.00 46.58  ? 444 HOH B O   1 
HETATM 6519 O  O   . HOH K 5 .   ? 8.199   7.270   70.370  1.00 56.45  ? 101 HOH C O   1 
HETATM 6520 O  O   . HOH K 5 .   ? 8.290   4.448   57.728  1.00 46.35  ? 102 HOH C O   1 
HETATM 6521 O  O   . HOH K 5 .   ? 8.512   -4.745  68.284  1.00 45.64  ? 103 HOH C O   1 
HETATM 6522 O  O   . HOH K 5 .   ? 12.323  -9.104  72.714  1.00 59.71  ? 104 HOH C O   1 
HETATM 6523 O  O   . HOH K 5 .   ? 14.600  5.131   57.836  1.00 42.90  ? 105 HOH C O   1 
HETATM 6524 O  O   . HOH K 5 .   ? 13.896  3.969   65.403  1.00 48.48  ? 106 HOH C O   1 
HETATM 6525 O  O   . HOH K 5 .   ? 12.436  -0.588  70.514  1.00 58.57  ? 107 HOH C O   1 
HETATM 6526 O  O   . HOH L 5 .   ? 9.448   3.829   106.846 1.00 52.03  ? 201 HOH D O   1 
HETATM 6527 O  O   . HOH M 5 .   ? -7.600  -0.336  81.547  1.00 41.43  ? 401 HOH E O   1 
HETATM 6528 O  O   . HOH M 5 .   ? 8.764   8.658   79.985  1.00 45.40  ? 402 HOH E O   1 
HETATM 6529 O  O   . HOH M 5 .   ? -10.092 -3.287  81.126  1.00 50.04  ? 403 HOH E O   1 
HETATM 6530 O  O   . HOH M 5 .   ? -9.690  -4.513  83.868  1.00 45.39  ? 404 HOH E O   1 
HETATM 6531 O  O   . HOH M 5 .   ? -10.177 2.598   75.309  1.00 44.14  ? 405 HOH E O   1 
HETATM 6532 O  O   . HOH M 5 .   ? 15.026  -4.059  82.012  1.00 52.00  ? 406 HOH E O   1 
HETATM 6533 O  O   . HOH M 5 .   ? 10.179  -1.589  71.645  1.00 64.41  ? 407 HOH E O   1 
HETATM 6534 O  O   . HOH M 5 .   ? -7.293  27.112  84.505  1.00 60.76  ? 408 HOH E O   1 
HETATM 6535 O  O   . HOH M 5 .   ? -4.250  1.996   93.481  1.00 45.84  ? 409 HOH E O   1 
HETATM 6536 O  O   . HOH M 5 .   ? 7.848   1.880   75.760  1.00 46.78  ? 410 HOH E O   1 
HETATM 6537 O  O   . HOH M 5 .   ? -7.338  4.351   80.555  1.00 57.08  ? 411 HOH E O   1 
HETATM 6538 O  O   . HOH M 5 .   ? -3.854  4.864   82.332  1.00 47.71  ? 412 HOH E O   1 
HETATM 6539 O  O   . HOH M 5 .   ? 9.799   0.045   76.271  1.00 48.20  ? 413 HOH E O   1 
HETATM 6540 O  O   . HOH N 5 .   ? -1.478  2.420   65.169  1.00 48.67  ? 101 HOH F O   1 
HETATM 6541 O  O   . HOH N 5 .   ? -3.706  2.728   75.900  1.00 42.97  ? 102 HOH F O   1 
HETATM 6542 O  O   . HOH N 5 .   ? -6.023  1.496   74.707  1.00 47.58  ? 103 HOH F O   1 
HETATM 6543 O  O   . HOH N 5 .   ? -4.510  -5.075  65.973  1.00 55.22  ? 104 HOH F O   1 
HETATM 6544 O  O   . HOH N 5 .   ? -7.965  -3.201  69.078  1.00 62.94  ? 105 HOH F O   1 
HETATM 6545 O  O   . HOH N 5 .   ? -9.072  3.609   65.001  1.00 59.46  ? 106 HOH F O   1 
HETATM 6546 O  O   . HOH N 5 .   ? -1.873  -5.721  65.934  1.00 44.24  ? 107 HOH F O   1 
HETATM 6547 O  O   . HOH N 5 .   ? -1.605  10.921  65.102  1.00 70.58  ? 108 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 4   ? 1.3482 1.0117 1.1129 0.3362  -0.1865 -0.0220 53  LYS A N   
2    C CA  . LYS A 4   ? 1.3813 1.0306 1.1347 0.3430  -0.1746 -0.0433 53  LYS A CA  
3    C C   . LYS A 4   ? 1.3871 1.0584 1.1211 0.3289  -0.1551 -0.0475 53  LYS A C   
4    O O   . LYS A 4   ? 1.3663 1.0363 1.0837 0.3335  -0.1405 -0.0670 53  LYS A O   
5    C CB  . LYS A 4   ? 1.4094 1.0465 1.1553 0.3603  -0.1716 -0.0635 53  LYS A CB  
6    C CG  . LYS A 4   ? 1.4409 1.0443 1.2032 0.3776  -0.1862 -0.0699 53  LYS A CG  
7    C CD  . LYS A 4   ? 1.4806 1.0644 1.2483 0.3780  -0.1863 -0.0744 53  LYS A CD  
8    C CE  . LYS A 4   ? 1.5382 1.0881 1.3194 0.3964  -0.1983 -0.0844 53  LYS A CE  
9    N NZ  . LYS A 4   ? 1.5553 1.0998 1.3247 0.4079  -0.1888 -0.1066 53  LYS A NZ  
10   N N   . LYS A 5   ? 1.3899 1.0813 1.1260 0.3117  -0.1549 -0.0291 54  LYS A N   
11   C CA  . LYS A 5   ? 1.3340 1.0458 1.0539 0.2970  -0.1377 -0.0308 54  LYS A CA  
12   C C   . LYS A 5   ? 1.3420 1.0492 1.0726 0.2866  -0.1424 -0.0185 54  LYS A C   
13   O O   . LYS A 5   ? 1.4128 1.1064 1.1634 0.2884  -0.1593 -0.0050 54  LYS A O   
14   C CB  . LYS A 5   ? 1.2726 1.0185 0.9812 0.2839  -0.1298 -0.0209 54  LYS A CB  
15   C CG  . LYS A 5   ? 1.2232 0.9792 0.9141 0.2907  -0.1180 -0.0367 54  LYS A CG  
16   C CD  . LYS A 5   ? 1.1789 0.9697 0.8578 0.2762  -0.1088 -0.0268 54  LYS A CD  
17   C CE  . LYS A 5   ? 1.1791 0.9802 0.8400 0.2828  -0.0965 -0.0428 54  LYS A CE  
18   N NZ  . LYS A 5   ? 1.2027 1.0381 0.8517 0.2687  -0.0873 -0.0335 54  LYS A NZ  
19   N N   . ILE A 6   ? 1.2816 1.0000 0.9988 0.2759  -0.1275 -0.0232 55  ILE A N   
20   C CA  . ILE A 6   ? 1.2720 0.9875 0.9976 0.2652  -0.1303 -0.0122 55  ILE A CA  
21   C C   . ILE A 6   ? 1.2252 0.9715 0.9383 0.2455  -0.1173 -0.0034 55  ILE A C   
22   O O   . ILE A 6   ? 1.1797 0.9458 0.8737 0.2415  -0.1019 -0.0121 55  ILE A O   
23   C CB  . ILE A 6   ? 1.3066 0.9972 1.0314 0.2732  -0.1265 -0.0285 55  ILE A CB  
24   C CG1 . ILE A 6   ? 1.2886 0.9878 0.9898 0.2734  -0.1056 -0.0489 55  ILE A CG1 
25   C CG2 . ILE A 6   ? 1.3547 1.0134 1.0938 0.2923  -0.1405 -0.0361 55  ILE A CG2 
26   C CD1 . ILE A 6   ? 1.3278 1.0019 1.0271 0.2832  -0.1015 -0.0669 55  ILE A CD1 
27   N N   . ASP A 7   ? 1.2107 0.9607 0.9346 0.2333  -0.1237 0.0140  56  ASP A N   
28   C CA  . ASP A 7   ? 1.1623 0.9408 0.8765 0.2139  -0.1131 0.0246  56  ASP A CA  
29   C C   . ASP A 7   ? 1.0977 0.8759 0.7988 0.2085  -0.0978 0.0123  56  ASP A C   
30   O O   . ASP A 7   ? 1.1039 0.8593 0.8124 0.2137  -0.1015 0.0068  56  ASP A O   
31   C CB  . ASP A 7   ? 1.1981 0.9821 0.9299 0.2026  -0.1269 0.0497  56  ASP A CB  
32   C CG  . ASP A 7   ? 1.2747 1.0646 1.0176 0.2050  -0.1404 0.0637  56  ASP A CG  
33   O OD1 . ASP A 7   ? 1.3520 1.1298 1.1151 0.2062  -0.1576 0.0784  56  ASP A OD1 
34   O OD2 . ASP A 7   ? 1.2534 1.0601 0.9848 0.2059  -0.1337 0.0597  56  ASP A OD2 
35   N N   . ILE A 8   ? 1.0631 0.8671 0.7448 0.1980  -0.0806 0.0081  57  ILE A N   
36   C CA  . ILE A 8   ? 1.1101 0.9175 0.7780 0.1911  -0.0649 -0.0027 57  ILE A CA  
37   C C   . ILE A 8   ? 1.1240 0.9609 0.7856 0.1703  -0.0572 0.0121  57  ILE A C   
38   O O   . ILE A 8   ? 1.1745 1.0373 0.8277 0.1624  -0.0518 0.0186  57  ILE A O   
39   C CB  . ILE A 8   ? 1.1134 0.9223 0.7608 0.1991  -0.0484 -0.0263 57  ILE A CB  
40   C CG1 . ILE A 8   ? 1.1001 0.8782 0.7533 0.2199  -0.0553 -0.0423 57  ILE A CG1 
41   C CG2 . ILE A 8   ? 1.1335 0.9490 0.7660 0.1904  -0.0316 -0.0362 57  ILE A CG2 
42   C CD1 . ILE A 8   ? 1.0855 0.8616 0.7195 0.2284  -0.0394 -0.0665 57  ILE A CD1 
43   N N   . LEU A 9   ? 1.1041 0.9370 0.7701 0.1616  -0.0569 0.0175  58  LEU A N   
44   C CA  . LEU A 9   ? 1.0816 0.9412 0.7412 0.1417  -0.0487 0.0303  58  LEU A CA  
45   C C   . LEU A 9   ? 1.0828 0.9481 0.7234 0.1370  -0.0294 0.0142  58  LEU A C   
46   O O   . LEU A 9   ? 1.0992 0.9445 0.7417 0.1414  -0.0284 0.0049  58  LEU A O   
47   C CB  . LEU A 9   ? 1.0285 0.8822 0.7069 0.1334  -0.0624 0.0499  58  LEU A CB  
48   C CG  . LEU A 9   ? 1.0273 0.9069 0.7006 0.1127  -0.0549 0.0638  58  LEU A CG  
49   C CD1 . LEU A 9   ? 1.0332 0.9443 0.6982 0.1027  -0.0501 0.0740  58  LEU A CD1 
50   C CD2 . LEU A 9   ? 1.0012 0.8717 0.6940 0.1061  -0.0694 0.0823  58  LEU A CD2 
51   N N   . LEU A 10  ? 1.0746 0.9671 0.6969 0.1283  -0.0141 0.0109  59  LEU A N   
52   C CA  . LEU A 10  ? 1.0240 0.9245 0.6269 0.1236  0.0052  -0.0047 59  LEU A CA  
53   C C   . LEU A 10  ? 1.0530 0.9721 0.6533 0.1044  0.0114  0.0075  59  LEU A C   
54   O O   . LEU A 10  ? 1.0609 1.0056 0.6603 0.0909  0.0119  0.0234  59  LEU A O   
55   C CB  . LEU A 10  ? 0.9328 0.8525 0.5164 0.1251  0.0194  -0.0164 59  LEU A CB  
56   C CG  . LEU A 10  ? 1.0286 0.9328 0.6118 0.1437  0.0157  -0.0302 59  LEU A CG  
57   C CD1 . LEU A 10  ? 1.0457 0.9731 0.6101 0.1424  0.0296  -0.0386 59  LEU A CD1 
58   C CD2 . LEU A 10  ? 0.9289 0.8035 0.5114 0.1581  0.0174  -0.0501 59  LEU A CD2 
59   N N   . LYS A 11  ? 1.0886 0.9947 0.6876 0.1032  0.0161  0.0000  60  LYS A N   
60   C CA  . LYS A 11  ? 1.0867 1.0088 0.6819 0.0855  0.0233  0.0092  60  LYS A CA  
61   C C   . LYS A 11  ? 1.1109 1.0413 0.6845 0.0823  0.0440  -0.0091 60  LYS A C   
62   O O   . LYS A 11  ? 1.1944 1.1072 0.7613 0.0953  0.0495  -0.0291 60  LYS A O   
63   C CB  . LYS A 11  ? 1.0621 0.9631 0.6749 0.0849  0.0109  0.0178  60  LYS A CB  
64   C CG  . LYS A 11  ? 1.0553 0.9475 0.6901 0.0876  -0.0099 0.0365  60  LYS A CG  
65   C CD  . LYS A 11  ? 1.0646 0.9403 0.7156 0.0839  -0.0207 0.0469  60  LYS A CD  
66   C CE  . LYS A 11  ? 1.0806 0.9510 0.7533 0.0843  -0.0409 0.0673  60  LYS A CE  
67   N NZ  . LYS A 11  ? 1.1372 0.9936 0.8252 0.0793  -0.0508 0.0784  60  LYS A NZ  
68   N N   . ALA A 12  ? 1.0739 1.0313 0.6369 0.0651  0.0555  -0.0022 61  ALA A N   
69   C CA  . ALA A 12  ? 0.9920 0.9610 0.5337 0.0607  0.0759  -0.0184 61  ALA A CA  
70   C C   . ALA A 12  ? 0.9965 0.9594 0.5371 0.0528  0.0813  -0.0202 61  ALA A C   
71   O O   . ALA A 12  ? 1.0698 1.0345 0.6223 0.0425  0.0731  -0.0034 61  ALA A O   
72   C CB  . ALA A 12  ? 0.9249 0.9294 0.4524 0.0476  0.0875  -0.0126 61  ALA A CB  
73   N N   . VAL A 13  ? 0.9893 0.8780 0.6426 0.1466  -0.0309 -0.0694 62  VAL A N   
74   C CA  . VAL A 13  ? 1.0521 0.9254 0.6989 0.1583  -0.0350 -0.0716 62  VAL A CA  
75   C C   . VAL A 13  ? 1.1993 1.0575 0.8216 0.1568  -0.0360 -0.0927 62  VAL A C   
76   O O   . VAL A 13  ? 1.2002 1.0186 0.8028 0.1468  -0.0367 -0.1055 62  VAL A O   
77   C CB  . VAL A 13  ? 1.0253 0.8533 0.6691 0.1576  -0.0382 -0.0661 62  VAL A CB  
78   C CG1 . VAL A 13  ? 1.0398 0.8581 0.6810 0.1712  -0.0424 -0.0654 62  VAL A CG1 
79   C CG2 . VAL A 13  ? 0.9710 0.8091 0.6369 0.1557  -0.0368 -0.0467 62  VAL A CG2 
80   N N   . GLY A 14  ? 1.3038 1.1940 0.9276 0.1668  -0.0361 -0.0962 63  GLY A N   
81   C CA  . GLY A 14  ? 1.3648 1.2488 0.9674 0.1659  -0.0366 -0.1158 63  GLY A CA  
82   C C   . GLY A 14  ? 1.4904 1.3227 1.0702 0.1647  -0.0406 -0.1288 63  GLY A C   
83   O O   . GLY A 14  ? 1.5259 1.3295 1.1073 0.1674  -0.0435 -0.1217 63  GLY A O   
84   N N   . ASP A 15  ? 1.5319 1.3516 1.0904 0.1604  -0.0408 -0.1478 64  ASP A N   
85   C CA  . ASP A 15  ? 1.5399 1.3925 1.0962 0.1567  -0.0374 -0.1562 64  ASP A CA  
86   C C   . ASP A 15  ? 1.5134 1.3508 1.0611 0.1404  -0.0344 -0.1630 64  ASP A C   
87   O O   . ASP A 15  ? 1.5726 1.3755 1.0980 0.1323  -0.0354 -0.1790 64  ASP A O   
88   C CB  . ASP A 15  ? 1.6434 1.4931 1.1813 0.1617  -0.0393 -0.1734 64  ASP A CB  
89   C CG  . ASP A 15  ? 1.7184 1.5933 1.2662 0.1779  -0.0414 -0.1675 64  ASP A CG  
90   O OD1 . ASP A 15  ? 1.7304 1.6465 1.3004 0.1846  -0.0395 -0.1527 64  ASP A OD1 
91   O OD2 . ASP A 15  ? 1.7499 1.6034 1.2832 0.1839  -0.0450 -0.1776 64  ASP A OD2 
92   N N   . THR A 16  ? 1.4171 1.2802 0.9827 0.1356  -0.0309 -0.1508 65  THR A N   
93   C CA  . THR A 16  ? 1.3242 1.1789 0.8845 0.1204  -0.0277 -0.1560 65  THR A CA  
94   C C   . THR A 16  ? 1.3099 1.2156 0.8840 0.1197  -0.0235 -0.1523 65  THR A C   
95   O O   . THR A 16  ? 1.3238 1.2689 0.9172 0.1299  -0.0230 -0.1398 65  THR A O   
96   C CB  . THR A 16  ? 1.2631 1.0945 0.8321 0.1133  -0.0276 -0.1440 65  THR A CB  
97   O OG1 . THR A 16  ? 1.2057 1.0764 0.8013 0.1173  -0.0253 -0.1254 65  THR A OG1 
98   C CG2 . THR A 16  ? 1.2548 1.0457 0.8178 0.1183  -0.0320 -0.1416 65  THR A CG2 
99   N N   . PRO A 17  ? 1.2958 1.2013 0.8599 0.1077  -0.0205 -0.1633 66  PRO A N   
100  C CA  . PRO A 17  ? 1.2778 1.2304 0.8553 0.1057  -0.0164 -0.1595 66  PRO A CA  
101  C C   . PRO A 17  ? 1.2199 1.1943 0.8228 0.1056  -0.0146 -0.1393 66  PRO A C   
102  O O   . PRO A 17  ? 1.2240 1.1695 0.8290 0.1002  -0.0154 -0.1327 66  PRO A O   
103  C CB  . PRO A 17  ? 1.3016 1.2368 0.8619 0.0908  -0.0140 -0.1747 66  PRO A CB  
104  C CG  . PRO A 17  ? 1.3054 1.1936 0.8402 0.0888  -0.0172 -0.1905 66  PRO A CG  
105  C CD  . PRO A 17  ? 1.2921 1.1547 0.8311 0.0960  -0.0210 -0.1807 66  PRO A CD  
106  N N   . ILE A 18  ? 1.1543 1.1787 0.7762 0.1116  -0.0124 -0.1296 67  ILE A N   
107  C CA  . ILE A 18  ? 1.0787 1.1271 0.7257 0.1125  -0.0109 -0.1100 67  ILE A CA  
108  C C   . ILE A 18  ? 1.0680 1.1280 0.7198 0.0994  -0.0069 -0.1099 67  ILE A C   
109  O O   . ILE A 18  ? 1.0543 1.1278 0.6972 0.0938  -0.0046 -0.1218 67  ILE A O   
110  C CB  . ILE A 18  ? 1.0219 1.1196 0.6890 0.1261  -0.0108 -0.0977 67  ILE A CB  
111  C CG1 . ILE A 18  ? 1.0403 1.1336 0.6991 0.1387  -0.0142 -0.1028 67  ILE A CG1 
112  C CG2 . ILE A 18  ? 0.9219 1.0340 0.6136 0.1294  -0.0108 -0.0762 67  ILE A CG2 
113  C CD1 . ILE A 18  ? 1.0335 1.0911 0.6908 0.1441  -0.0180 -0.0970 67  ILE A CD1 
114  N N   . MET A 19  ? 1.0619 1.1164 0.7277 0.0946  -0.0063 -0.0966 68  MET A N   
115  C CA  . MET A 19  ? 1.0404 1.1077 0.7135 0.0828  -0.0026 -0.0944 68  MET A CA  
116  C C   . MET A 19  ? 1.0163 1.1401 0.7101 0.0882  -0.0001 -0.0843 68  MET A C   
117  O O   . MET A 19  ? 0.9851 1.1343 0.6950 0.1002  -0.0014 -0.0714 68  MET A O   
118  C CB  . MET A 19  ? 1.0116 1.0553 0.6941 0.0766  -0.0029 -0.0826 68  MET A CB  
119  C CG  . MET A 19  ? 1.0529 1.0397 0.7152 0.0692  -0.0049 -0.0922 68  MET A CG  
120  S SD  . MET A 19  ? 1.1165 1.0800 0.7601 0.0507  -0.0019 -0.1092 68  MET A SD  
121  C CE  . MET A 19  ? 0.9169 0.9009 0.5837 0.0424  0.0013  -0.0935 68  MET A CE  
122  N N   . LYS A 20  ? 1.0335 1.1767 0.7268 0.0792  0.0033  -0.0903 69  LYS A N   
123  C CA  . LYS A 20  ? 1.0845 1.2803 0.7982 0.0824  0.0058  -0.0803 69  LYS A CA  
124  C C   . LYS A 20  ? 1.0574 1.2622 0.7935 0.0804  0.0065  -0.0617 69  LYS A C   
125  O O   . LYS A 20  ? 1.0237 1.2563 0.7796 0.0903  0.0056  -0.0460 69  LYS A O   
126  C CB  . LYS A 20  ? 1.1435 1.3553 0.8494 0.0728  0.0093  -0.0928 69  LYS A CB  
127  C CG  . LYS A 20  ? 1.1920 1.4135 0.8822 0.0774  0.0092  -0.1079 69  LYS A CG  
128  C CD  . LYS A 20  ? 1.2199 1.4586 0.9039 0.0677  0.0128  -0.1191 69  LYS A CD  
129  C CE  . LYS A 20  ? 1.1946 1.4816 0.9020 0.0679  0.0155  -0.1063 69  LYS A CE  
130  N NZ  . LYS A 20  ? 1.2025 1.5310 0.9232 0.0820  0.0148  -0.0980 69  LYS A NZ  
131  N N   . THR A 21  ? 1.0649 1.2460 0.7975 0.0672  0.0080  -0.0638 70  THR A N   
132  C CA  . THR A 21  ? 1.0505 1.2336 0.8023 0.0640  0.0085  -0.0474 70  THR A CA  
133  C C   . THR A 21  ? 1.0577 1.2016 0.8071 0.0672  0.0052  -0.0415 70  THR A C   
134  O O   . THR A 21  ? 1.1055 1.2048 0.8360 0.0601  0.0042  -0.0524 70  THR A O   
135  C CB  . THR A 21  ? 1.0275 1.2012 0.7767 0.0482  0.0115  -0.0523 70  THR A CB  
136  O OG1 . THR A 21  ? 0.9786 1.1840 0.7261 0.0446  0.0145  -0.0606 70  THR A OG1 
137  C CG2 . THR A 21  ? 1.0109 1.1946 0.7827 0.0455  0.0122  -0.0343 70  THR A CG2 
138  N N   . LYS A 22  ? 1.0097 1.1703 0.7781 0.0778  0.0034  -0.0244 71  LYS A N   
139  C CA  . LYS A 22  ? 0.9864 1.1134 0.7542 0.0825  0.0001  -0.0175 71  LYS A CA  
140  C C   . LYS A 22  ? 0.9561 1.0729 0.7389 0.0765  0.0005  -0.0033 71  LYS A C   
141  O O   . LYS A 22  ? 0.9572 1.0349 0.7345 0.0749  -0.0016 -0.0015 71  LYS A O   
142  C CB  . LYS A 22  ? 1.0018 1.1493 0.7791 0.0988  -0.0024 -0.0084 71  LYS A CB  
143  C CG  . LYS A 22  ? 1.0339 1.1896 0.7964 0.1054  -0.0031 -0.0222 71  LYS A CG  
144  C CD  . LYS A 22  ? 1.0511 1.2278 0.8240 0.1215  -0.0056 -0.0126 71  LYS A CD  
145  C CE  . LYS A 22  ? 1.0888 1.2709 0.8460 0.1280  -0.0064 -0.0271 71  LYS A CE  
146  N NZ  . LYS A 22  ? 1.1152 1.3292 0.8702 0.1234  -0.0032 -0.0359 71  LYS A NZ  
147  N N   . LYS A 23  ? 1.1374 0.9490 0.6858 0.0785  -0.0889 0.0763  72  LYS A N   
148  C CA  . LYS A 23  ? 1.1451 0.9433 0.6953 0.0870  -0.0727 0.0789  72  LYS A CA  
149  C C   . LYS A 23  ? 1.0879 0.9099 0.6756 0.0988  -0.0764 0.0858  72  LYS A C   
150  O O   . LYS A 23  ? 1.0850 0.9174 0.6870 0.1092  -0.0904 0.0946  72  LYS A O   
151  C CB  . LYS A 23  ? 1.2650 1.0315 0.7885 0.0957  -0.0689 0.0848  72  LYS A CB  
152  C CG  . LYS A 23  ? 1.3552 1.0955 0.8401 0.0853  -0.0646 0.0788  72  LYS A CG  
153  C CD  . LYS A 23  ? 1.4130 1.1227 0.8736 0.0952  -0.0605 0.0853  72  LYS A CD  
154  C CE  . LYS A 23  ? 1.4193 1.1017 0.8410 0.0849  -0.0548 0.0792  72  LYS A CE  
155  N NZ  . LYS A 23  ? 1.4539 1.1054 0.8518 0.0941  -0.0482 0.0849  72  LYS A NZ  
156  N N   . TRP A 24  ? 1.0521 0.8825 0.6556 0.0972  -0.0636 0.0819  73  TRP A N   
157  C CA  . TRP A 24  ? 1.0258 0.8797 0.6657 0.1075  -0.0658 0.0877  73  TRP A CA  
158  C C   . TRP A 24  ? 1.0295 0.8713 0.6722 0.1146  -0.0475 0.0890  73  TRP A C   
159  O O   . TRP A 24  ? 1.0311 0.8556 0.6551 0.1068  -0.0318 0.0817  73  TRP A O   
160  C CB  . TRP A 24  ? 1.0020 0.8883 0.6679 0.0985  -0.0717 0.0819  73  TRP A CB  
161  C CG  . TRP A 24  ? 1.0645 0.9686 0.7362 0.0944  -0.0916 0.0827  73  TRP A CG  
162  C CD1 . TRP A 24  ? 1.0923 0.9956 0.7466 0.0806  -0.0969 0.0752  73  TRP A CD1 
163  C CD2 . TRP A 24  ? 1.0840 1.0094 0.7807 0.1043  -0.1090 0.0915  73  TRP A CD2 
164  N NE1 . TRP A 24  ? 1.0877 1.0101 0.7543 0.0813  -0.1165 0.0787  73  TRP A NE1 
165  C CE2 . TRP A 24  ? 1.0841 1.0205 0.7769 0.0957  -0.1243 0.0887  73  TRP A CE2 
166  C CE3 . TRP A 24  ? 1.0866 1.0229 0.8088 0.1197  -0.1131 0.1016  73  TRP A CE3 
167  C CZ2 . TRP A 24  ? 1.0870 1.0445 0.8001 0.1018  -0.1435 0.0955  73  TRP A CZ2 
168  C CZ3 . TRP A 24  ? 1.0996 1.0570 0.8421 0.1257  -0.1322 0.1084  73  TRP A CZ3 
169  C CH2 . TRP A 24  ? 1.1057 1.0734 0.8435 0.1167  -0.1472 0.1053  73  TRP A CH2 
170  N N   . ALA A 25  ? 1.0174 0.8684 0.6837 0.1293  -0.0499 0.0983  74  ALA A N   
171  C CA  . ALA A 25  ? 1.0074 0.8512 0.6815 0.1371  -0.0338 0.1002  74  ALA A CA  
172  C C   . ALA A 25  ? 1.0546 0.9290 0.7646 0.1366  -0.0333 0.0985  74  ALA A C   
173  O O   . ALA A 25  ? 1.1012 0.9993 0.8397 0.1447  -0.0457 0.1053  74  ALA A O   
174  C CB  . ALA A 25  ? 0.9814 0.8133 0.6567 0.1543  -0.0354 0.1119  74  ALA A CB  
175  N N   . VAL A 26  ? 1.0541 0.9279 0.7626 0.1272  -0.0188 0.0896  75  VAL A N   
176  C CA  . VAL A 26  ? 1.0414 0.9448 0.7813 0.1235  -0.0185 0.0859  75  VAL A CA  
177  C C   . VAL A 26  ? 1.0669 0.9680 0.8191 0.1295  -0.0017 0.0863  75  VAL A C   
178  O O   . VAL A 26  ? 1.0714 0.9458 0.8014 0.1299  0.0137  0.0845  75  VAL A O   
179  C CB  . VAL A 26  ? 0.9755 0.8865 0.7074 0.1052  -0.0177 0.0740  75  VAL A CB  
180  C CG1 . VAL A 26  ? 0.9149 0.8605 0.6812 0.1016  -0.0223 0.0711  75  VAL A CG1 
181  C CG2 . VAL A 26  ? 0.9840 0.8904 0.6962 0.0985  -0.0316 0.0729  75  VAL A CG2 
182  N N   . GLU A 27  ? 1.0909 1.0199 0.8786 0.1344  -0.0049 0.0889  76  GLU A N   
183  C CA  . GLU A 27  ? 1.1413 1.0724 0.9441 0.1390  0.0103  0.0884  76  GLU A CA  
184  C C   . GLU A 27  ? 1.1047 1.0274 0.8931 0.1247  0.0259  0.0765  76  GLU A C   
185  O O   . GLU A 27  ? 1.0974 1.0299 0.8820 0.1109  0.0219  0.0682  76  GLU A O   
186  C CB  . GLU A 27  ? 1.1778 1.1435 1.0222 0.1450  0.0023  0.0924  76  GLU A CB  
187  C CG  . GLU A 27  ? 1.2752 1.2470 1.1376 0.1625  -0.0071 0.1055  76  GLU A CG  
188  C CD  . GLU A 27  ? 1.4000 1.3509 1.2572 0.1747  0.0073  0.1112  76  GLU A CD  
189  O OE1 . GLU A 27  ? 1.4343 1.3793 1.2939 0.1884  0.0015  0.1216  76  GLU A OE1 
190  O OE2 . GLU A 27  ? 1.4407 1.3813 1.2915 0.1706  0.0246  0.1052  76  GLU A OE2 
191  N N   . ARG A 28  ? 1.0809 0.9852 0.8611 0.1283  0.0438  0.0757  77  ARG A N   
192  C CA  . ARG A 28  ? 1.0112 0.9047 0.7761 0.1155  0.0599  0.0648  77  ARG A CA  
193  C C   . ARG A 28  ? 0.9274 0.8503 0.7194 0.1076  0.0605  0.0583  77  ARG A C   
194  O O   . ARG A 28  ? 0.9100 0.8316 0.6915 0.0934  0.0680  0.0480  77  ARG A O   
195  C CB  . ARG A 28  ? 1.0303 0.8983 0.7825 0.1225  0.0784  0.0664  77  ARG A CB  
196  C CG  . ARG A 28  ? 1.0951 0.9345 0.8230 0.1321  0.0784  0.0737  77  ARG A CG  
197  C CD  . ARG A 28  ? 1.1809 0.9959 0.8974 0.1391  0.0971  0.0753  77  ARG A CD  
198  N NE  . ARG A 28  ? 1.2584 1.0501 0.9450 0.1267  0.1117  0.0656  77  ARG A NE  
199  C CZ  . ARG A 28  ? 1.3035 1.0641 0.9556 0.1254  0.1167  0.0653  77  ARG A CZ  
200  N NH1 . ARG A 28  ? 1.3423 1.0912 0.9854 0.1357  0.1082  0.0740  77  ARG A NH1 
201  N NH2 . ARG A 28  ? 1.2783 1.0193 0.9050 0.1137  0.1301  0.0563  77  ARG A NH2 
202  N N   . THR A 29  ? 0.9023 0.8519 0.7293 0.1168  0.0526  0.0644  78  THR A N   
203  C CA  . THR A 29  ? 0.8657 0.8441 0.7211 0.1109  0.0532  0.0592  78  THR A CA  
204  C C   . THR A 29  ? 0.8897 0.8929 0.7556 0.1011  0.0370  0.0554  78  THR A C   
205  O O   . THR A 29  ? 0.8965 0.9241 0.7842 0.0943  0.0366  0.0500  78  THR A O   
206  C CB  . THR A 29  ? 0.8296 0.8267 0.7197 0.1250  0.0530  0.0672  78  THR A CB  
207  O OG1 . THR A 29  ? 0.8692 0.8734 0.7702 0.1372  0.0373  0.0781  78  THR A OG1 
208  C CG2 . THR A 29  ? 0.7946 0.7708 0.6777 0.1326  0.0715  0.0689  78  THR A CG2 
209  N N   . ARG A 30  ? 0.8869 0.8841 0.7380 0.1006  0.0235  0.0583  79  ARG A N   
210  C CA  . ARG A 30  ? 0.8877 0.9068 0.7466 0.0912  0.0079  0.0548  79  ARG A CA  
211  C C   . ARG A 30  ? 0.8514 0.8674 0.6939 0.0733  0.0156  0.0421  79  ARG A C   
212  O O   . ARG A 30  ? 0.8594 0.8482 0.6710 0.0673  0.0271  0.0374  79  ARG A O   
213  C CB  . ARG A 30  ? 0.9702 0.9816 0.8146 0.0944  -0.0077 0.0605  79  ARG A CB  
214  C CG  . ARG A 30  ? 1.0022 1.0371 0.8560 0.0853  -0.0246 0.0573  79  ARG A CG  
215  C CD  . ARG A 30  ? 1.1054 1.1334 0.9463 0.0894  -0.0403 0.0635  79  ARG A CD  
216  N NE  . ARG A 30  ? 1.2250 1.2575 1.0834 0.1064  -0.0479 0.0757  79  ARG A NE  
217  C CZ  . ARG A 30  ? 1.2721 1.3314 1.1587 0.1122  -0.0640 0.0816  79  ARG A CZ  
218  N NH1 . ARG A 30  ? 1.2517 1.3355 1.1519 0.1023  -0.0743 0.0764  79  ARG A NH1 
219  N NH2 . ARG A 30  ? 1.3128 1.3742 1.2136 0.1279  -0.0699 0.0929  79  ARG A NH2 
220  N N   . THR A 31  ? 0.8036 0.8477 0.6669 0.0647  0.0093  0.0368  80  THR A N   
221  C CA  . THR A 31  ? 0.7707 0.8149 0.6214 0.0476  0.0163  0.0248  80  THR A CA  
222  C C   . THR A 31  ? 0.8689 0.9092 0.6986 0.0375  0.0045  0.0214  80  THR A C   
223  O O   . THR A 31  ? 0.8657 0.9073 0.6947 0.0437  -0.0104 0.0282  80  THR A O   
224  C CB  . THR A 31  ? 0.7375 0.8138 0.6202 0.0423  0.0158  0.0200  80  THR A CB  
225  O OG1 . THR A 31  ? 0.7071 0.8106 0.6131 0.0448  -0.0035 0.0243  80  THR A OG1 
226  C CG2 . THR A 31  ? 0.6123 0.6928 0.5162 0.0523  0.0277  0.0233  80  THR A CG2 
227  N N   . ILE A 32  ? 1.0955 0.8484 0.5430 0.0048  -0.1011 0.0869  81  ILE A N   
228  C CA  . ILE A 32  ? 1.0228 0.7747 0.4956 -0.0083 -0.0857 0.0752  81  ILE A CA  
229  C C   . ILE A 32  ? 1.0199 0.7819 0.5232 -0.0167 -0.0661 0.0623  81  ILE A C   
230  O O   . ILE A 32  ? 1.0289 0.7958 0.5359 -0.0292 -0.0553 0.0456  81  ILE A O   
231  C CB  . ILE A 32  ? 0.9696 0.7105 0.4682 -0.0057 -0.0840 0.0872  81  ILE A CB  
232  C CG1 . ILE A 32  ? 0.9450 0.6759 0.4134 -0.0003 -0.1019 0.0967  81  ILE A CG1 
233  C CG2 . ILE A 32  ? 0.9365 0.6776 0.4689 -0.0190 -0.0652 0.0754  81  ILE A CG2 
234  C CD1 . ILE A 32  ? 0.9780 0.7083 0.4263 -0.0111 -0.1025 0.0833  81  ILE A CD1 
235  N N   . GLN A 33  ? 0.9848 0.7499 0.5094 -0.0097 -0.0617 0.0701  82  GLN A N   
236  C CA  . GLN A 33  ? 0.9638 0.7382 0.5199 -0.0169 -0.0429 0.0593  82  GLN A CA  
237  C C   . GLN A 33  ? 1.0071 0.7925 0.5424 -0.0233 -0.0408 0.0433  82  GLN A C   
238  O O   . GLN A 33  ? 0.9986 0.7906 0.5515 -0.0350 -0.0251 0.0276  82  GLN A O   
239  C CB  . GLN A 33  ? 0.8158 0.5911 0.3965 -0.0072 -0.0401 0.0719  82  GLN A CB  
240  C CG  . GLN A 33  ? 0.8121 0.5964 0.4280 -0.0143 -0.0203 0.0615  82  GLN A CG  
241  C CD  . GLN A 33  ? 0.9229 0.7054 0.5719 -0.0267 -0.0033 0.0518  82  GLN A CD  
242  O OE1 . GLN A 33  ? 0.9305 0.7196 0.5827 -0.0387 0.0078  0.0344  82  GLN A OE1 
243  N NE2 . GLN A 33  ? 0.9022 0.6758 0.5762 -0.0238 -0.0012 0.0629  82  GLN A NE2 
244  N N   . GLY A 34  ? 1.0462 0.8338 0.5441 -0.0155 -0.0565 0.0473  83  GLY A N   
245  C CA  . GLY A 34  ? 1.0428 0.8403 0.5167 -0.0208 -0.0566 0.0330  83  GLY A CA  
246  C C   . GLY A 34  ? 1.0535 0.8509 0.5124 -0.0329 -0.0546 0.0181  83  GLY A C   
247  O O   . GLY A 34  ? 1.1074 0.9135 0.5586 -0.0418 -0.0479 0.0022  83  GLY A O   
248  N N   . LEU A 35  ? 1.0357 0.8231 0.4906 -0.0334 -0.0603 0.0235  84  LEU A N   
249  C CA  . LEU A 35  ? 1.0544 0.8405 0.4970 -0.0448 -0.0584 0.0106  84  LEU A CA  
250  C C   . LEU A 35  ? 1.0923 0.8798 0.5741 -0.0572 -0.0377 -0.0005 84  LEU A C   
251  O O   . LEU A 35  ? 1.0822 0.8740 0.5607 -0.0693 -0.0297 -0.0169 84  LEU A O   
252  C CB  . LEU A 35  ? 1.0668 0.8416 0.4880 -0.0399 -0.0737 0.0212  84  LEU A CB  
253  C CG  . LEU A 35  ? 1.1294 0.9025 0.5258 -0.0492 -0.0773 0.0099  84  LEU A CG  
254  C CD1 . LEU A 35  ? 1.1467 0.9369 0.5250 -0.0484 -0.0827 0.0002  84  LEU A CD1 
255  C CD2 . LEU A 35  ? 1.1216 0.8828 0.5025 -0.0433 -0.0916 0.0225  84  LEU A CD2 
256  N N   . ILE A 36  ? 1.0713 0.8552 0.5903 -0.0541 -0.0290 0.0084  85  ILE A N   
257  C CA  . ILE A 36  ? 1.0319 0.8172 0.5916 -0.0649 -0.0087 -0.0010 85  ILE A CA  
258  C C   . ILE A 36  ? 1.0791 0.8768 0.6499 -0.0730 0.0054  -0.0168 85  ILE A C   
259  O O   . ILE A 36  ? 1.1067 0.9082 0.6887 -0.0859 0.0184  -0.0326 85  ILE A O   
260  C CB  . ILE A 36  ? 0.9982 0.7778 0.5956 -0.0588 -0.0027 0.0127  85  ILE A CB  
261  C CG1 . ILE A 36  ? 1.0132 0.7801 0.6058 -0.0534 -0.0134 0.0263  85  ILE A CG1 
262  C CG2 . ILE A 36  ? 1.0202 0.8032 0.6607 -0.0697 0.0193  0.0021  85  ILE A CG2 
263  C CD1 . ILE A 36  ? 0.9764 0.7370 0.6055 -0.0475 -0.0080 0.0401  85  ILE A CD1 
264  N N   . ASP A 37  ? 1.1096 0.9134 0.6768 -0.0652 0.0026  -0.0123 86  ASP A N   
265  C CA  . ASP A 37  ? 1.1394 0.9551 0.7170 -0.0715 0.0152  -0.0258 86  ASP A CA  
266  C C   . ASP A 37  ? 1.1737 0.9958 0.7193 -0.0797 0.0125  -0.0418 86  ASP A C   
267  O O   . ASP A 37  ? 1.2032 1.0340 0.7597 -0.0899 0.0259  -0.0577 86  ASP A O   
268  C CB  . ASP A 37  ? 1.1420 0.9622 0.7200 -0.0602 0.0108  -0.0159 86  ASP A CB  
269  C CG  . ASP A 37  ? 1.1277 0.9418 0.7371 -0.0517 0.0133  0.0002  86  ASP A CG  
270  O OD1 . ASP A 37  ? 1.1381 0.9487 0.7816 -0.0577 0.0261  -0.0013 86  ASP A OD1 
271  O OD2 . ASP A 37  ? 1.1157 0.9287 0.7157 -0.0391 0.0023  0.0143  86  ASP A OD2 
272  N N   . PHE A 38  ? 1.1847 1.0025 0.6909 -0.0752 -0.0051 -0.0374 87  PHE A N   
273  C CA  . PHE A 38  ? 1.1980 1.0205 0.6714 -0.0827 -0.0094 -0.0515 87  PHE A CA  
274  C C   . PHE A 38  ? 1.1562 0.9776 0.6426 -0.0970 0.0027  -0.0655 87  PHE A C   
275  O O   . PHE A 38  ? 1.2056 1.0346 0.6858 -0.1075 0.0102  -0.0823 87  PHE A O   
276  C CB  . PHE A 38  ? 1.2749 1.0915 0.7051 -0.0741 -0.0314 -0.0419 87  PHE A CB  
277  C CG  . PHE A 38  ? 1.2620 1.0816 0.6580 -0.0820 -0.0369 -0.0552 87  PHE A CG  
278  C CD1 . PHE A 38  ? 1.2898 1.1204 0.6656 -0.0823 -0.0396 -0.0640 87  PHE A CD1 
279  C CD2 . PHE A 38  ? 1.2895 1.1023 0.6768 -0.0882 -0.0394 -0.0585 87  PHE A CD2 
280  C CE1 . PHE A 38  ? 1.3297 1.1809 0.7197 -0.0799 -0.0422 -0.0721 87  PHE A CE1 
281  C CE2 . PHE A 38  ? 1.3516 1.1768 0.7318 -0.0905 -0.0430 -0.0685 87  PHE A CE2 
282  C CZ  . PHE A 38  ? 1.3569 1.2052 0.7490 -0.0837 -0.0438 -0.0742 87  PHE A CZ  
283  N N   . ILE A 39  ? 1.1165 0.9283 0.6211 -0.0973 0.0045  -0.0583 88  ILE A N   
284  C CA  . ILE A 39  ? 1.1152 0.9247 0.6323 -0.1102 0.0150  -0.0700 88  ILE A CA  
285  C C   . ILE A 39  ? 1.1654 0.9810 0.7241 -0.1201 0.0373  -0.0814 88  ILE A C   
286  O O   . ILE A 39  ? 1.2027 1.0228 0.7651 -0.1328 0.0480  -0.0980 88  ILE A O   
287  C CB  . ILE A 39  ? 1.1345 0.9315 0.6565 -0.1069 0.0089  -0.0581 88  ILE A CB  
288  C CG1 . ILE A 39  ? 1.1784 0.9696 0.6570 -0.0989 -0.0129 -0.0491 88  ILE A CG1 
289  C CG2 . ILE A 39  ? 1.1335 0.9283 0.6728 -0.1204 0.0214  -0.0701 88  ILE A CG2 
290  C CD1 . ILE A 39  ? 1.1765 0.9551 0.6573 -0.0942 -0.0207 -0.0359 88  ILE A CD1 
291  N N   . LYS A 40  ? 1.1179 0.9338 0.7078 -0.1142 0.0442  -0.0725 89  LYS A N   
292  C CA  . LYS A 40  ? 1.0965 0.9179 0.7279 -0.1226 0.0653  -0.0819 89  LYS A CA  
293  C C   . LYS A 40  ? 1.1175 0.9509 0.7441 -0.1322 0.0748  -0.1005 89  LYS A C   
294  O O   . LYS A 40  ? 1.1602 0.9975 0.8107 -0.1441 0.0914  -0.1142 89  LYS A O   
295  C CB  . LYS A 40  ? 1.0910 0.9121 0.7514 -0.1132 0.0691  -0.0689 89  LYS A CB  
296  C CG  . LYS A 40  ? 1.0754 0.8855 0.7568 -0.1072 0.0673  -0.0534 89  LYS A CG  
297  C CD  . LYS A 40  ? 1.0596 0.8712 0.7769 -0.1013 0.0760  -0.0446 89  LYS A CD  
298  C CE  . LYS A 40  ? 1.0854 0.8859 0.8208 -0.0936 0.0722  -0.0274 89  LYS A CE  
299  N NZ  . LYS A 40  ? 1.1103 0.9126 0.8808 -0.0878 0.0809  -0.0189 89  LYS A NZ  
300  N N   . LYS A 41  ? 1.0891 0.9284 0.6845 -0.1270 0.0642  -0.1009 90  LYS A N   
301  C CA  . LYS A 41  ? 1.0737 0.9244 0.6618 -0.1352 0.0719  -0.1179 90  LYS A CA  
302  C C   . LYS A 41  ? 1.1260 0.9780 0.6973 -0.1478 0.0743  -0.1339 90  LYS A C   
303  O O   . LYS A 41  ? 1.1735 1.0335 0.7542 -0.1588 0.0875  -0.1505 90  LYS A O   
304  C CB  . LYS A 41  ? 1.0319 0.8881 0.5891 -0.1260 0.0588  -0.1137 90  LYS A CB  
305  C CG  . LYS A 41  ? 1.0396 0.8969 0.6146 -0.1148 0.0587  -0.1004 90  LYS A CG  
306  C CD  . LYS A 41  ? 1.0636 0.9271 0.6082 -0.1066 0.0467  -0.0977 90  LYS A CD  
307  C CE  . LYS A 41  ? 1.0659 0.9297 0.6274 -0.0948 0.0455  -0.0833 90  LYS A CE  
308  N NZ  . LYS A 41  ? 1.1199 0.9724 0.6893 -0.0855 0.0375  -0.0651 90  LYS A NZ  
309  N N   . PHE A 42  ? 1.1513 0.9951 0.6974 -0.1462 0.0613  -0.1290 91  PHE A N   
310  C CA  . PHE A 42  ? 1.2008 1.0446 0.7308 -0.1578 0.0628  -0.1430 91  PHE A CA  
311  C C   . PHE A 42  ? 1.1955 1.0364 0.7610 -0.1685 0.0795  -0.1502 91  PHE A C   
312  O O   . PHE A 42  ? 1.2353 1.0807 0.8028 -0.1812 0.0897  -0.1669 91  PHE A O   
313  C CB  . PHE A 42  ? 1.2560 1.0917 0.7485 -0.1524 0.0435  -0.1348 91  PHE A CB  
314  C CG  . PHE A 42  ? 1.3156 1.1563 0.7649 -0.1491 0.0295  -0.1376 91  PHE A CG  
315  C CD1 . PHE A 42  ? 1.3724 1.2198 0.8029 -0.1598 0.0325  -0.1550 91  PHE A CD1 
316  C CD2 . PHE A 42  ? 1.3167 1.1554 0.7441 -0.1352 0.0131  -0.1229 91  PHE A CD2 
317  C CE1 . PHE A 42  ? 1.3667 1.2271 0.7881 -0.1473 0.0180  -0.1501 91  PHE A CE1 
318  C CE2 . PHE A 42  ? 1.3337 1.1809 0.7339 -0.1286 -0.0001 -0.1232 91  PHE A CE2 
319  C CZ  . PHE A 42  ? 1.3232 1.1857 0.7362 -0.1300 0.0022  -0.1338 91  PHE A CZ  
320  N N   . LEU A 43  ? 1.2280 1.0617 0.7825 -0.0298 0.1916  -0.0156 92  LEU A N   
321  C CA  . LEU A 43  ? 1.2449 1.0845 0.8204 -0.0101 0.1909  -0.0245 92  LEU A CA  
322  C C   . LEU A 43  ? 1.2859 1.0859 0.8366 -0.0019 0.1876  -0.0279 92  LEU A C   
323  O O   . LEU A 43  ? 1.3393 1.1372 0.9029 0.0153  0.1848  -0.0347 92  LEU A O   
324  C CB  . LEU A 43  ? 1.2332 1.0876 0.8344 0.0027  0.1774  -0.0232 92  LEU A CB  
325  C CG  . LEU A 43  ? 1.1527 1.0460 0.7801 -0.0040 0.1787  -0.0196 92  LEU A CG  
326  C CD1 . LEU A 43  ? 1.1541 1.0631 0.8101 0.0119  0.1667  -0.0207 92  LEU A CD1 
327  C CD2 . LEU A 43  ? 1.1031 1.0300 0.7485 -0.0104 0.1967  -0.0251 92  LEU A CD2 
328  N N   . LYS A 44  ? 1.2329 1.0018 0.7482 -0.0142 0.1882  -0.0231 93  LYS A N   
329  C CA  . LYS A 44  ? 1.2463 0.9757 0.7348 -0.0086 0.1857  -0.0256 93  LYS A CA  
330  C C   . LYS A 44  ? 1.2836 0.9924 0.7730 0.0080  0.1690  -0.0250 93  LYS A C   
331  O O   . LYS A 44  ? 1.3265 1.0193 0.8144 0.0217  0.1679  -0.0315 93  LYS A O   
332  C CB  . LYS A 44  ? 1.2544 0.9897 0.7485 -0.0033 0.2001  -0.0360 93  LYS A CB  
333  C CG  . LYS A 44  ? 1.2272 0.9889 0.7265 -0.0177 0.2174  -0.0376 93  LYS A CG  
334  C CD  . LYS A 44  ? 1.2001 0.9712 0.7091 -0.0108 0.2312  -0.0483 93  LYS A CD  
335  C CE  . LYS A 44  ? 1.1911 0.9954 0.7124 -0.0233 0.2478  -0.0501 93  LYS A CE  
336  N NZ  . LYS A 44  ? 1.2430 1.0550 0.7707 -0.0183 0.2621  -0.0602 93  LYS A NZ  
337  N N   . LEU A 45  ? 1.2730 0.9829 0.7652 0.0068  0.1559  -0.0172 94  LEU A N   
338  C CA  . LEU A 45  ? 1.3127 1.0040 0.8058 0.0217  0.1392  -0.0157 94  LEU A CA  
339  C C   . LEU A 45  ? 1.3865 1.0376 0.8436 0.0145  0.1285  -0.0072 94  LEU A C   
340  O O   . LEU A 45  ? 1.4161 1.0648 0.8576 -0.0021 0.1290  0.0003  94  LEU A O   
341  C CB  . LEU A 45  ? 1.2942 1.0164 0.8187 0.0278  0.1311  -0.0135 94  LEU A CB  
342  C CG  . LEU A 45  ? 1.2931 1.0548 0.8559 0.0378  0.1395  -0.0219 94  LEU A CG  
343  C CD1 . LEU A 45  ? 1.2649 1.0585 0.8565 0.0395  0.1327  -0.0185 94  LEU A CD1 
344  C CD2 . LEU A 45  ? 1.3218 1.0728 0.8925 0.0576  0.1370  -0.0304 94  LEU A CD2 
345  N N   . VAL A 46  ? 1.4072 1.0264 0.8510 0.0270  0.1188  -0.0086 95  VAL A N   
346  C CA  . VAL A 46  ? 1.4112 0.9903 0.8209 0.0219  0.1079  -0.0010 95  VAL A CA  
347  C C   . VAL A 46  ? 1.3758 0.9562 0.7911 0.0238  0.0919  0.0071  95  VAL A C   
348  O O   . VAL A 46  ? 1.3561 0.9683 0.8019 0.0294  0.0893  0.0065  95  VAL A O   
349  C CB  . VAL A 46  ? 1.4645 1.0077 0.8570 0.0347  0.1037  -0.0054 95  VAL A CB  
350  C CG1 . VAL A 46  ? 1.4166 0.9550 0.7996 0.0314  0.1193  -0.0128 95  VAL A CG1 
351  C CG2 . VAL A 46  ? 1.5035 1.0549 0.9215 0.0561  0.0949  -0.0105 95  VAL A CG2 
352  N N   . ALA A 47  ? 1.3959 0.9417 0.7815 0.0189  0.0813  0.0147  96  ALA A N   
353  C CA  . ALA A 47  ? 1.4072 0.9507 0.7942 0.0195  0.0658  0.0230  96  ALA A CA  
354  C C   . ALA A 47  ? 1.4615 1.0077 0.8697 0.0404  0.0537  0.0199  96  ALA A C   
355  O O   . ALA A 47  ? 1.4890 1.0559 0.9179 0.0439  0.0453  0.0232  96  ALA A O   
356  C CB  . ALA A 47  ? 1.3778 0.8814 0.7265 0.0099  0.0578  0.0314  96  ALA A CB  
357  N N   . SER A 48  ? 1.4622 0.9873 0.8649 0.0541  0.0528  0.0136  97  SER A N   
358  C CA  . SER A 48  ? 1.4883 1.0112 0.9077 0.0744  0.0410  0.0106  97  SER A CA  
359  C C   . SER A 48  ? 1.5075 1.0733 0.9684 0.0843  0.0442  0.0047  97  SER A C   
360  O O   . SER A 48  ? 1.5276 1.1023 1.0070 0.0963  0.0325  0.0056  97  SER A O   
361  C CB  . SER A 48  ? 1.4943 0.9858 0.8984 0.0863  0.0409  0.0047  97  SER A CB  
362  O OG  . SER A 48  ? 1.4856 0.9889 0.8965 0.0863  0.0568  -0.0041 97  SER A OG  
363  N N   . GLU A 49  ? 1.4885 1.0807 0.9638 0.0793  0.0601  -0.0013 98  GLU A N   
364  C CA  . GLU A 49  ? 1.4642 1.0984 0.9789 0.0875  0.0648  -0.0072 98  GLU A CA  
365  C C   . GLU A 49  ? 1.4283 1.0903 0.9606 0.0806  0.0596  -0.0007 98  GLU A C   
366  O O   . GLU A 49  ? 1.4094 1.0745 0.9295 0.0631  0.0630  0.0057  98  GLU A O   
367  C CB  . GLU A 49  ? 1.4675 1.1225 0.9912 0.0822  0.0836  -0.0147 98  GLU A CB  
368  C CG  . GLU A 49  ? 1.5199 1.1542 1.0336 0.0916  0.0896  -0.0229 98  GLU A CG  
369  C CD  . GLU A 49  ? 1.5532 1.2108 1.0783 0.0870  0.1081  -0.0304 98  GLU A CD  
370  O OE1 . GLU A 49  ? 1.5588 1.2453 1.1150 0.0980  0.1127  -0.0377 98  GLU A OE1 
371  O OE2 . GLU A 49  ? 1.5542 1.2013 1.0571 0.0723  0.1180  -0.0292 98  GLU A OE2 
372  N N   . GLN A 50  ? 1.4238 1.1062 0.9848 0.0943  0.0513  -0.0025 99  GLN A N   
373  C CA  . GLN A 50  ? 1.4113 1.1208 0.9913 0.0895  0.0454  0.0031  99  GLN A CA  
374  C C   . GLN A 50  ? 1.2979 1.0504 0.9044 0.0822  0.0594  -0.0004 99  GLN A C   
375  O O   . GLN A 50  ? 1.2775 1.0471 0.9016 0.0892  0.0700  -0.0092 99  GLN A O   
376  C CB  . GLN A 50  ? 1.5001 1.2148 1.1008 0.1073  0.0308  0.0026  99  GLN A CB  
377  C CG  . GLN A 50  ? 1.6263 1.3006 1.2028 0.1149  0.0155  0.0070  99  GLN A CG  
378  C CD  . GLN A 50  ? 1.7164 1.3972 1.3148 0.1335  0.0018  0.0056  99  GLN A CD  
379  O OE1 . GLN A 50  ? 1.7088 1.4229 1.3407 0.1424  0.0045  0.0001  99  GLN A OE1 
380  N NE2 . GLN A 50  ? 1.7766 1.4255 1.3562 0.1394  -0.0131 0.0107  99  GLN A NE2 
381  N N   . LEU A 51  ? 1.1981 0.9678 0.8074 0.0682  0.0593  0.0065  100 LEU A N   
382  C CA  . LEU A 51  ? 1.0818 0.8937 0.7175 0.0608  0.0713  0.0041  100 LEU A CA  
383  C C   . LEU A 51  ? 1.0558 0.8912 0.7110 0.0592  0.0620  0.0100  100 LEU A C   
384  O O   . LEU A 51  ? 1.0714 0.8964 0.7099 0.0474  0.0554  0.0189  100 LEU A O   
385  C CB  . LEU A 51  ? 1.0559 0.8666 0.6722 0.0411  0.0851  0.0062  100 LEU A CB  
386  C CG  . LEU A 51  ? 1.0283 0.8809 0.6693 0.0326  0.0995  0.0033  100 LEU A CG  
387  C CD1 . LEU A 51  ? 0.9094 0.7803 0.5725 0.0443  0.1105  -0.0077 100 LEU A CD1 
388  C CD2 . LEU A 51  ? 0.9942 0.8426 0.6126 0.0114  0.1099  0.0080  100 LEU A CD2 
389  N N   . PHE A 52  ? 1.0097 0.8769 0.7006 0.0712  0.0613  0.0048  101 PHE A N   
390  C CA  . PHE A 52  ? 0.9545 0.8455 0.6670 0.0717  0.0521  0.0095  101 PHE A CA  
391  C C   . PHE A 52  ? 0.9031 0.8311 0.6330 0.0577  0.0634  0.0106  101 PHE A C   
392  O O   . PHE A 52  ? 0.8894 0.8374 0.6311 0.0552  0.0784  0.0044  101 PHE A O   
393  C CB  . PHE A 52  ? 0.9688 0.8746 0.7112 0.0924  0.0444  0.0037  101 PHE A CB  
394  C CG  . PHE A 52  ? 1.0187 0.8896 0.7460 0.1070  0.0319  0.0030  101 PHE A CG  
395  C CD1 . PHE A 52  ? 1.0419 0.8968 0.7619 0.1108  0.0149  0.0099  101 PHE A CD1 
396  C CD2 . PHE A 52  ? 1.0449 0.8990 0.7653 0.1169  0.0371  -0.0044 101 PHE A CD2 
397  C CE1 . PHE A 52  ? 1.0050 0.8277 0.7110 0.1244  0.0033  0.0094  101 PHE A CE1 
398  C CE2 . PHE A 52  ? 1.0907 0.9126 0.7973 0.1304  0.0257  -0.0050 101 PHE A CE2 
399  C CZ  . PHE A 52  ? 1.1143 0.9203 0.8136 0.1342  0.0087  0.0020  101 PHE A CZ  
400  N N   . ILE A 53  ? 0.8595 0.7964 0.5910 0.0486  0.0561  0.0187  102 ILE A N   
401  C CA  . ILE A 53  ? 0.8475 0.8192 0.5954 0.0350  0.0653  0.0208  102 ILE A CA  
402  C C   . ILE A 53  ? 0.8426 0.8425 0.6205 0.0411  0.0560  0.0226  102 ILE A C   
403  O O   . ILE A 53  ? 0.8672 0.8532 0.6388 0.0442  0.0408  0.0285  102 ILE A O   
404  C CB  . ILE A 53  ? 0.8849 0.8415 0.6034 0.0143  0.0675  0.0294  102 ILE A CB  
405  C CG1 . ILE A 53  ? 0.9767 0.9186 0.6732 0.0055  0.0818  0.0263  102 ILE A CG1 
406  C CG2 . ILE A 53  ? 0.8262 0.8171 0.5627 0.0018  0.0711  0.0338  102 ILE A CG2 
407  C CD1 . ILE A 53  ? 1.0420 0.9751 0.7132 -0.0158 0.0869  0.0339  102 ILE A CD1 
408  N N   . TYR A 54  ? 0.8450 0.8848 0.6558 0.0427  0.0652  0.0175  103 TYR A N   
409  C CA  . TYR A 54  ? 0.8294 0.8989 0.6718 0.0494  0.0574  0.0182  103 TYR A CA  
410  C C   . TYR A 54  ? 0.7960 0.8972 0.6517 0.0340  0.0639  0.0224  103 TYR A C   
411  O O   . TYR A 54  ? 0.8137 0.9236 0.6634 0.0205  0.0781  0.0221  103 TYR A O   
412  C CB  . TYR A 54  ? 0.7716 0.8630 0.6460 0.0676  0.0599  0.0084  103 TYR A CB  
413  C CG  . TYR A 54  ? 0.8066 0.8702 0.6735 0.0853  0.0494  0.0050  103 TYR A CG  
414  C CD1 . TYR A 54  ? 0.9327 0.9945 0.8108 0.0979  0.0334  0.0068  103 TYR A CD1 
415  C CD2 . TYR A 54  ? 0.9855 1.0243 0.8337 0.0893  0.0555  0.0001  103 TYR A CD2 
416  C CE1 . TYR A 54  ? 0.9635 0.9998 0.8345 0.1142  0.0237  0.0039  103 TYR A CE1 
417  C CE2 . TYR A 54  ? 1.0267 1.0397 0.8677 0.1055  0.0460  -0.0030 103 TYR A CE2 
418  C CZ  . TYR A 54  ? 1.0170 1.0288 0.8695 0.1179  0.0301  -0.0010 103 TYR A CZ  
419  O OH  . TYR A 54  ? 1.0972 1.0834 0.9426 0.1342  0.0205  -0.0039 103 TYR A OH  
420  N N   . VAL A 55  ? 0.7538 0.8718 0.6274 0.0361  0.0534  0.0265  104 VAL A N   
421  C CA  . VAL A 55  ? 0.7180 0.8687 0.6083 0.0234  0.0582  0.0303  104 VAL A CA  
422  C C   . VAL A 55  ? 0.7125 0.9004 0.6443 0.0357  0.0567  0.0251  104 VAL A C   
423  O O   . VAL A 55  ? 0.7549 0.9381 0.6973 0.0515  0.0445  0.0233  104 VAL A O   
424  C CB  . VAL A 55  ? 0.7289 0.8655 0.6010 0.0123  0.0464  0.0411  104 VAL A CB  
425  C CG1 . VAL A 55  ? 0.6960 0.8671 0.5864 -0.0005 0.0511  0.0449  104 VAL A CG1 
426  C CG2 . VAL A 55  ? 0.7543 0.8531 0.5848 0.0004  0.0475  0.0462  104 VAL A CG2 
427  N N   . ASN A 56  ? 0.9655 0.6785 0.7167 -0.0301 0.1412  0.0967  105 ASN A N   
428  C CA  . ASN A 56  ? 1.0070 0.7026 0.7966 -0.0225 0.1435  0.0900  105 ASN A CA  
429  C C   . ASN A 56  ? 0.9748 0.6408 0.7308 -0.0308 0.1516  0.0985  105 ASN A C   
430  O O   . ASN A 56  ? 0.9813 0.6331 0.7608 -0.0236 0.1533  0.0886  105 ASN A O   
431  C CB  . ASN A 56  ? 1.0287 0.7372 0.8543 -0.0048 0.1371  0.0604  105 ASN A CB  
432  C CG  . ASN A 56  ? 1.0174 0.7490 0.8966 0.0062  0.1297  0.0521  105 ASN A CG  
433  O OD1 . ASN A 56  ? 1.0964 0.8387 0.9808 0.0005  0.1286  0.0668  105 ASN A OD1 
434  N ND2 . ASN A 56  ? 0.9537 0.6933 0.8734 0.0220  0.1245  0.0281  105 ASN A ND2 
435  N N   . GLN A 57  ? 0.9764 0.6332 0.6779 -0.0458 0.1564  0.1166  106 GLN A N   
436  C CA  . GLN A 57  ? 1.0232 0.6533 0.6851 -0.0543 0.1639  0.1239  106 GLN A CA  
437  C C   . GLN A 57  ? 1.0800 0.7074 0.7370 -0.0447 0.1627  0.0998  106 GLN A C   
438  O O   . GLN A 57  ? 1.1193 0.7247 0.7755 -0.0442 0.1675  0.0981  106 GLN A O   
439  C CB  . GLN A 57  ? 1.0014 0.6081 0.6853 -0.0580 0.1699  0.1396  106 GLN A CB  
440  C CG  . GLN A 57  ? 1.0334 0.6380 0.7120 -0.0700 0.1728  0.1665  106 GLN A CG  
441  C CD  . GLN A 57  ? 1.0811 0.6628 0.7822 -0.0732 0.1788  0.1817  106 GLN A CD  
442  O OE1 . GLN A 57  ? 1.0652 0.6456 0.8179 -0.0625 0.1773  0.1729  106 GLN A OE1 
443  N NE2 . GLN A 57  ? 1.1209 0.6843 0.7832 -0.0876 0.1856  0.2045  106 GLN A NE2 
444  N N   . SER A 58  ? 1.0751 0.7252 0.7292 -0.0369 0.1563  0.0812  107 SER A N   
445  C CA  . SER A 58  ? 1.0805 0.7319 0.7364 -0.0258 0.1541  0.0561  107 SER A CA  
446  C C   . SER A 58  ? 1.1043 0.7697 0.7141 -0.0279 0.1516  0.0474  107 SER A C   
447  O O   . SER A 58  ? 1.1832 0.8354 0.7532 -0.0321 0.1554  0.0445  107 SER A O   
448  C CB  . SER A 58  ? 1.1192 0.7862 0.8372 -0.0085 0.1473  0.0354  107 SER A CB  
449  O OG  . SER A 58  ? 1.1762 0.8461 0.8961 0.0026  0.1447  0.0104  107 SER A OG  
450  N N   . PHE A 59  ? 1.0546 0.7466 0.6696 -0.0249 0.1453  0.0434  108 PHE A N   
451  C CA  . PHE A 59  ? 1.0665 0.7750 0.6428 -0.0251 0.1421  0.0334  108 PHE A CA  
452  C C   . PHE A 59  ? 1.0099 0.7298 0.5510 -0.0374 0.1417  0.0517  108 PHE A C   
453  O O   . PHE A 59  ? 0.9913 0.7136 0.5480 -0.0426 0.1419  0.0684  108 PHE A O   
454  C CB  . PHE A 59  ? 1.0288 0.7618 0.6399 -0.0080 0.1340  0.0063  108 PHE A CB  
455  C CG  . PHE A 59  ? 0.9941 0.7476 0.6532 -0.0007 0.1280  0.0055  108 PHE A CG  
456  C CD1 . PHE A 59  ? 0.9414 0.6891 0.6554 0.0070  0.1274  0.0033  108 PHE A CD1 
457  C CD2 . PHE A 59  ? 1.0018 0.7808 0.6515 -0.0016 0.1229  0.0068  108 PHE A CD2 
458  C CE1 . PHE A 59  ? 0.9176 0.6842 0.6760 0.0136  0.1218  0.0025  108 PHE A CE1 
459  C CE2 . PHE A 59  ? 0.9634 0.7613 0.6570 0.0051  0.1174  0.0060  108 PHE A CE2 
460  C CZ  . PHE A 59  ? 0.9281 0.7197 0.6761 0.0127  0.1168  0.0038  108 PHE A CZ  
461  N N   . ALA A 60  ? 1.0046 0.7314 0.4981 -0.0419 0.1412  0.0485  109 ALA A N   
462  C CA  . ALA A 60  ? 0.9825 0.7224 0.4407 -0.0526 0.1401  0.0633  109 ALA A CA  
463  C C   . ALA A 60  ? 1.0280 0.7996 0.4955 -0.0425 0.1320  0.0459  109 ALA A C   
464  O O   . ALA A 60  ? 1.0122 0.7910 0.4600 -0.0372 0.1300  0.0291  109 ALA A O   
465  C CB  . ALA A 60  ? 0.9406 0.6650 0.3356 -0.0662 0.1455  0.0745  109 ALA A CB  
466  N N   . PRO A 61  ? 1.0052 0.7959 0.5032 -0.0395 0.1273  0.0499  110 PRO A N   
467  C CA  . PRO A 61  ? 0.9609 0.7828 0.4722 -0.0291 0.1193  0.0336  110 PRO A CA  
468  C C   . PRO A 61  ? 0.9482 0.7813 0.4049 -0.0371 0.1185  0.0374  110 PRO A C   
469  O O   . PRO A 61  ? 1.0140 0.8339 0.4281 -0.0523 0.1234  0.0577  110 PRO A O   
470  C CB  . PRO A 61  ? 0.9394 0.7743 0.4883 -0.0284 0.1161  0.0438  110 PRO A CB  
471  C CG  . PRO A 61  ? 0.9556 0.7691 0.4876 -0.0437 0.1228  0.0711  110 PRO A CG  
472  C CD  . PRO A 61  ? 0.9818 0.7665 0.5009 -0.0464 0.1294  0.0709  110 PRO A CD  
473  N N   . SER A 62  ? 0.9742 0.8312 0.4324 -0.0269 0.1124  0.0181  111 SER A N   
474  C CA  . SER A 62  ? 1.0025 0.8729 0.4120 -0.0332 0.1109  0.0204  111 SER A CA  
475  C C   . SER A 62  ? 1.0782 0.9582 0.4742 -0.0443 0.1103  0.0423  111 SER A C   
476  O O   . SER A 62  ? 1.0866 0.9778 0.5208 -0.0404 0.1071  0.0457  111 SER A O   
477  C CB  . SER A 62  ? 0.9214 0.8181 0.3428 -0.0185 0.1038  -0.0050 111 SER A CB  
478  O OG  . SER A 62  ? 0.9933 0.9011 0.3697 -0.0234 0.1025  -0.0052 111 SER A OG  
479  N N   . PRO A 63  ? 1.0999 0.9962 0.4892 -0.0502 0.1055  0.0555  112 PRO A N   
480  C CA  . PRO A 63  ? 1.0918 1.0054 0.4921 -0.0547 0.1017  0.0752  112 PRO A CA  
481  C C   . PRO A 63  ? 1.0536 0.9868 0.4466 -0.0518 0.0986  0.0709  112 PRO A C   
482  O O   . PRO A 63  ? 1.1040 1.0441 0.5026 -0.0566 0.0976  0.0869  112 PRO A O   
483  C CB  . PRO A 63  ? 1.0692 1.0044 0.4890 -0.0488 0.0947  0.0808  112 PRO A CB  
484  C CG  . PRO A 63  ? 1.0961 1.0361 0.5151 -0.0415 0.0924  0.0627  112 PRO A CG  
485  C CD  . PRO A 63  ? 1.1071 1.0163 0.5101 -0.0455 0.1000  0.0512  112 PRO A CD  
486  N N   . ASP A 64  ? 0.9424 0.8855 0.3256 -0.0435 0.0966  0.0488  113 ASP A N   
487  C CA  . ASP A 64  ? 0.9369 0.9033 0.3191 -0.0399 0.0923  0.0419  113 ASP A CA  
488  C C   . ASP A 64  ? 0.9380 0.9124 0.3842 -0.0267 0.0885  0.0315  113 ASP A C   
489  O O   . ASP A 64  ? 0.9014 0.9019 0.3734 -0.0167 0.0818  0.0209  113 ASP A O   
490  C CB  . ASP A 64  ? 0.9047 0.8953 0.2865 -0.0263 0.0854  0.0223  113 ASP A CB  
491  C CG  . ASP A 64  ? 0.9290 0.9130 0.3178 -0.0166 0.0865  -0.0036 113 ASP A CG  
492  O OD1 . ASP A 64  ? 0.8526 0.8128 0.2551 -0.0167 0.0911  -0.0038 113 ASP A OD1 
493  O OD2 . ASP A 64  ? 0.9128 0.9191 0.3079 -0.0046 0.0809  -0.0237 113 ASP A OD2 
494  N N   . GLN A 65  ? 0.8518 0.8036 0.3235 -0.0267 0.0927  0.0346  114 GLN A N   
495  C CA  . GLN A 65  ? 0.8425 0.7993 0.3758 -0.0143 0.0895  0.0246  114 GLN A CA  
496  C C   . GLN A 65  ? 0.8835 0.8429 0.4370 -0.0209 0.0895  0.0446  114 GLN A C   
497  O O   . GLN A 65  ? 0.9723 0.9136 0.5034 -0.0353 0.0953  0.0674  114 GLN A O   
498  C CB  . GLN A 65  ? 1.0175 0.9494 0.5707 -0.0102 0.0938  0.0174  114 GLN A CB  
499  C CG  . GLN A 65  ? 1.1042 1.0429 0.7204 0.0060  0.0894  -0.0003 114 GLN A CG  
500  C CD  . GLN A 65  ? 1.1492 1.0691 0.7776 0.0132  0.0920  -0.0154 114 GLN A CD  
501  O OE1 . GLN A 65  ? 1.1055 1.0115 0.6945 0.0081  0.0962  -0.0166 114 GLN A OE1 
502  N NE2 . GLN A 65  ? 1.1924 1.1120 0.8759 0.0252  0.0896  -0.0271 114 GLN A NE2 
503  N N   . GLU A 66  ? 0.9104 0.8925 0.5063 -0.0103 0.0831  0.0360  115 GLU A N   
504  C CA  . GLU A 66  ? 0.8977 0.8855 0.5150 -0.0155 0.0824  0.0535  115 GLU A CA  
505  C C   . GLU A 66  ? 0.9240 0.8911 0.5785 -0.0161 0.0863  0.0614  115 GLU A C   
506  O O   . GLU A 66  ? 0.9614 0.9193 0.6462 -0.0060 0.0864  0.0462  115 GLU A O   
507  C CB  . GLU A 66  ? 0.9043 0.9239 0.5552 -0.0035 0.0740  0.0411  115 GLU A CB  
508  C CG  . GLU A 66  ? 0.9115 0.9538 0.5267 -0.0036 0.0700  0.0362  115 GLU A CG  
509  C CD  . GLU A 66  ? 0.9443 1.0175 0.5912 0.0066  0.0621  0.0278  115 GLU A CD  
510  O OE1 . GLU A 66  ? 0.9984 1.0919 0.6180 0.0055  0.0587  0.0272  115 GLU A OE1 
511  O OE2 . GLU A 66  ? 0.9296 1.0072 0.6290 0.0158  0.0593  0.0218  115 GLU A OE2 
512  N N   . VAL A 67  ? 0.8648 0.7415 0.6518 0.1824  0.0964  0.0316  116 VAL A N   
513  C CA  . VAL A 67  ? 0.8951 0.7894 0.6945 0.1849  0.0885  0.0483  116 VAL A CA  
514  C C   . VAL A 67  ? 0.8733 0.7711 0.7081 0.1746  0.0893  0.0486  116 VAL A C   
515  O O   . VAL A 67  ? 0.8792 0.7932 0.7184 0.1737  0.0854  0.0586  116 VAL A O   
516  C CB  . VAL A 67  ? 0.9315 0.8263 0.7355 0.1935  0.0816  0.0594  116 VAL A CB  
517  C CG1 . VAL A 67  ? 0.9548 0.8676 0.7726 0.1958  0.0735  0.0765  116 VAL A CG1 
518  C CG2 . VAL A 67  ? 0.9537 0.8471 0.7212 0.2042  0.0802  0.0605  116 VAL A CG2 
519  N N   . GLY A 68  ? 0.8286 0.7112 0.6885 0.1667  0.0945  0.0376  117 GLY A N   
520  C CA  . GLY A 68  ? 0.8503 0.7344 0.7445 0.1564  0.0959  0.0364  117 GLY A CA  
521  C C   . GLY A 68  ? 0.8677 0.7615 0.7562 0.1504  0.0987  0.0342  117 GLY A C   
522  O O   . GLY A 68  ? 0.7460 0.6512 0.6547 0.1459  0.0959  0.0415  117 GLY A O   
523  N N   . THR A 69  ? 0.8260 0.7153 0.6864 0.1504  0.1041  0.0241  118 THR A N   
524  C CA  . THR A 69  ? 0.7965 0.6947 0.6472 0.1454  0.1070  0.0215  118 THR A CA  
525  C C   . THR A 69  ? 0.7845 0.7040 0.6210 0.1517  0.0997  0.0374  118 THR A C   
526  O O   . THR A 69  ? 0.7536 0.6850 0.6014 0.1467  0.0985  0.0422  118 THR A O   
527  C CB  . THR A 69  ? 0.7988 0.6874 0.6202 0.1449  0.1141  0.0074  118 THR A CB  
528  O OG1 . THR A 69  ? 0.7949 0.6634 0.6287 0.1393  0.1209  -0.0074 118 THR A OG1 
529  C CG2 . THR A 69  ? 0.7683 0.6653 0.5819 0.1388  0.1174  0.0040  118 THR A CG2 
530  N N   . LEU A 70  ? 0.7652 0.6893 0.5770 0.1627  0.0949  0.0454  119 LEU A N   
531  C CA  . LEU A 70  ? 0.8337 0.7776 0.6302 0.1698  0.0877  0.0610  119 LEU A CA  
532  C C   . LEU A 70  ? 0.9013 0.8568 0.7279 0.1683  0.0813  0.0744  119 LEU A C   
533  O O   . LEU A 70  ? 0.8875 0.8601 0.7114 0.1694  0.0769  0.0853  119 LEU A O   
534  C CB  . LEU A 70  ? 0.7932 0.7381 0.5610 0.1820  0.0836  0.0671  119 LEU A CB  
535  C CG  . LEU A 70  ? 0.7920 0.7291 0.5240 0.1856  0.0886  0.0569  119 LEU A CG  
536  C CD1 . LEU A 70  ? 0.7970 0.7343 0.5054 0.1977  0.0840  0.0637  119 LEU A CD1 
537  C CD2 . LEU A 70  ? 0.7621 0.7108 0.4733 0.1841  0.0902  0.0566  119 LEU A CD2 
538  N N   . TYR A 71  ? 0.9047 0.8507 0.7601 0.1658  0.0807  0.0736  120 TYR A N   
539  C CA  . TYR A 71  ? 0.8584 0.8137 0.7447 0.1640  0.0749  0.0854  120 TYR A CA  
540  C C   . TYR A 71  ? 0.8511 0.8122 0.7589 0.1535  0.0773  0.0834  120 TYR A C   
541  O O   . TYR A 71  ? 0.8741 0.8515 0.7895 0.1537  0.0721  0.0955  120 TYR A O   
542  C CB  . TYR A 71  ? 0.8346 0.7767 0.7466 0.1631  0.0745  0.0835  120 TYR A CB  
543  C CG  . TYR A 71  ? 0.8764 0.8261 0.8237 0.1596  0.0695  0.0938  120 TYR A CG  
544  C CD1 . TYR A 71  ? 0.9182 0.8817 0.8664 0.1672  0.0608  0.1106  120 TYR A CD1 
545  C CD2 . TYR A 71  ? 0.8754 0.8186 0.8553 0.1487  0.0735  0.0867  120 TYR A CD2 
546  C CE1 . TYR A 71  ? 0.9618 0.9324 0.9422 0.1640  0.0561  0.1201  120 TYR A CE1 
547  C CE2 . TYR A 71  ? 0.8774 0.8276 0.8896 0.1455  0.0689  0.0960  120 TYR A CE2 
548  C CZ  . TYR A 71  ? 0.9571 0.9210 0.9695 0.1531  0.0602  0.1127  120 TYR A CZ  
549  O OH  . TYR A 71  ? 1.0089 0.9799 1.0535 0.1500  0.0555  0.1222  120 TYR A OH  
550  N N   . GLU A 72  ? 0.8600 0.8078 0.7778 0.1444  0.0852  0.0681  121 GLU A N   
551  C CA  . GLU A 72  ? 0.8507 0.8019 0.7913 0.1337  0.0881  0.0648  121 GLU A CA  
552  C C   . GLU A 72  ? 0.8331 0.7995 0.7545 0.1332  0.0877  0.0685  121 GLU A C   
553  O O   . GLU A 72  ? 0.8204 0.7957 0.7598 0.1265  0.0872  0.0716  121 GLU A O   
554  C CB  . GLU A 72  ? 0.9197 0.8523 0.8731 0.1243  0.0970  0.0469  121 GLU A CB  
555  C CG  . GLU A 72  ? 1.0430 0.9609 1.0204 0.1233  0.0976  0.0432  121 GLU A CG  
556  C CD  . GLU A 72  ? 1.2062 1.1060 1.1973 0.1138  0.1064  0.0256  121 GLU A CD  
557  O OE1 . GLU A 72  ? 1.2525 1.1392 1.2637 0.1122  0.1076  0.0212  121 GLU A OE1 
558  O OE2 . GLU A 72  ? 1.2639 1.1626 1.2459 0.1079  0.1121  0.0162  121 GLU A OE2 
559  N N   . CYS A 73  ? 0.8346 0.8040 0.7195 0.1404  0.0878  0.0683  122 CYS A N   
560  C CA  . CYS A 73  ? 0.8195 0.8029 0.6833 0.1406  0.0875  0.0716  122 CYS A CA  
561  C C   . CYS A 73  ? 0.8332 0.8358 0.6854 0.1495  0.0787  0.0896  122 CYS A C   
562  O O   . CYS A 73  ? 0.8509 0.8686 0.7025 0.1478  0.0763  0.0969  122 CYS A O   
563  C CB  . CYS A 73  ? 0.8046 0.7804 0.6346 0.1424  0.0934  0.0600  122 CYS A CB  
564  S SG  . CYS A 73  ? 0.8530 0.8079 0.6929 0.1313  0.1043  0.0382  122 CYS A SG  
565  N N   . PHE A 74  ? 0.8344 0.8362 0.6771 0.1591  0.0740  0.0969  123 PHE A N   
566  C CA  . PHE A 74  ? 0.8448 0.8639 0.6715 0.1687  0.0659  0.1133  123 PHE A CA  
567  C C   . PHE A 74  ? 0.9071 0.9297 0.7535 0.1735  0.0587  0.1259  123 PHE A C   
568  O O   . PHE A 74  ? 0.8937 0.9278 0.7255 0.1828  0.0520  0.1390  123 PHE A O   
569  C CB  . PHE A 74  ? 0.7617 0.7802 0.5477 0.1777  0.0664  0.1118  123 PHE A CB  
570  C CG  . PHE A 74  ? 0.8056 0.8194 0.5707 0.1734  0.0736  0.0989  123 PHE A CG  
571  C CD1 . PHE A 74  ? 0.8141 0.8413 0.5707 0.1706  0.0737  0.1017  123 PHE A CD1 
572  C CD2 . PHE A 74  ? 0.7993 0.7952 0.5535 0.1722  0.0804  0.0840  123 PHE A CD2 
573  C CE1 . PHE A 74  ? 0.8094 0.8323 0.5468 0.1665  0.0804  0.0899  123 PHE A CE1 
574  C CE2 . PHE A 74  ? 0.7849 0.7765 0.5199 0.1683  0.0870  0.0720  123 PHE A CE2 
575  C CZ  . PHE A 74  ? 0.8056 0.8107 0.5322 0.1654  0.0870  0.0750  123 PHE A CZ  
576  N N   . GLY A 75  ? 0.8092 0.8167 1.0019 0.0283  -0.0115 0.0616  124 GLY A N   
577  C CA  . GLY A 75  ? 0.8208 0.8316 1.0024 0.0223  -0.0167 0.0654  124 GLY A CA  
578  C C   . GLY A 75  ? 0.8300 0.8538 1.0144 0.0238  -0.0140 0.0740  124 GLY A C   
579  O O   . GLY A 75  ? 0.8089 0.8406 1.0082 0.0283  -0.0100 0.0781  124 GLY A O   
580  N N   . SER A 76  ? 0.8969 0.9230 1.0669 0.0200  -0.0161 0.0766  125 SER A N   
581  C CA  . SER A 76  ? 0.9301 0.9682 1.1013 0.0212  -0.0137 0.0849  125 SER A CA  
582  C C   . SER A 76  ? 0.9503 0.9925 1.1128 0.0146  -0.0204 0.0892  125 SER A C   
583  O O   . SER A 76  ? 0.9632 0.9972 1.1063 0.0115  -0.0220 0.0841  125 SER A O   
584  C CB  . SER A 76  ? 0.9197 0.9553 1.0761 0.0275  -0.0034 0.0823  125 SER A CB  
585  O OG  . SER A 76  ? 0.9311 0.9785 1.0900 0.0291  -0.0007 0.0904  125 SER A OG  
586  N N   . ASP A 77  ? 0.9494 1.0043 1.1263 0.0124  -0.0241 0.0986  126 ASP A N   
587  C CA  . ASP A 77  ? 0.9433 1.0041 1.1141 0.0066  -0.0303 0.1042  126 ASP A CA  
588  C C   . ASP A 77  ? 0.8834 0.9373 1.0484 -0.0001 -0.0388 0.1002  126 ASP A C   
589  O O   . ASP A 77  ? 0.8945 0.9474 1.0435 -0.0041 -0.0420 0.1000  126 ASP A O   
590  C CB  . ASP A 77  ? 1.0295 1.0912 1.1798 0.0084  -0.0251 0.1047  126 ASP A CB  
591  C CG  . ASP A 77  ? 1.0995 1.1690 1.2555 0.0147  -0.0169 0.1095  126 ASP A CG  
592  O OD1 . ASP A 77  ? 1.1140 1.1934 1.2910 0.0156  -0.0175 0.1161  126 ASP A OD1 
593  O OD2 . ASP A 77  ? 1.1376 1.2035 1.2773 0.0188  -0.0098 0.1066  126 ASP A OD2 
594  N N   . GLY A 78  ? 0.8462 0.8954 1.0243 -0.0011 -0.0425 0.0971  127 GLY A N   
595  C CA  . GLY A 78  ? 0.8130 0.8564 0.9891 -0.0075 -0.0511 0.0941  127 GLY A CA  
596  C C   . GLY A 78  ? 0.8359 0.8648 0.9929 -0.0082 -0.0500 0.0833  127 GLY A C   
597  O O   . GLY A 78  ? 0.8687 0.8924 1.0212 -0.0138 -0.0569 0.0802  127 GLY A O   
598  N N   . LYS A 79  ? 0.8240 0.8463 0.9697 -0.0025 -0.0412 0.0776  128 LYS A N   
599  C CA  . LYS A 79  ? 0.8520 0.8599 0.9787 -0.0026 -0.0391 0.0672  128 LYS A CA  
600  C C   . LYS A 79  ? 0.8322 0.8322 0.9581 0.0046  -0.0300 0.0608  128 LYS A C   
601  O O   . LYS A 79  ? 0.8550 0.8611 0.9894 0.0104  -0.0238 0.0645  128 LYS A O   
602  C CB  . LYS A 79  ? 0.8776 0.8840 0.9802 -0.0049 -0.0381 0.0659  128 LYS A CB  
603  C CG  . LYS A 79  ? 0.9311 0.9458 1.0288 -0.0006 -0.0315 0.0715  128 LYS A CG  
604  C CD  . LYS A 79  ? 0.9862 1.0021 1.0633 -0.0042 -0.0331 0.0723  128 LYS A CD  
605  C CE  . LYS A 79  ? 0.9454 0.9716 1.0205 -0.0007 -0.0280 0.0798  128 LYS A CE  
606  N NZ  . LYS A 79  ? 0.9380 0.9594 1.0049 0.0067  -0.0174 0.0762  128 LYS A NZ  
607  N N   . LEU A 80  ? 0.7794 0.7659 0.8953 0.0043  -0.0292 0.0513  129 LEU A N   
608  C CA  . LEU A 80  ? 0.7484 0.7259 0.8608 0.0111  -0.0203 0.0445  129 LEU A CA  
609  C C   . LEU A 80  ? 0.7587 0.7273 0.8450 0.0126  -0.0138 0.0382  129 LEU A C   
610  O O   . LEU A 80  ? 0.7507 0.7107 0.8214 0.0080  -0.0168 0.0324  129 LEU A O   
611  C CB  . LEU A 80  ? 0.7348 0.7026 0.8552 0.0105  -0.0229 0.0379  129 LEU A CB  
612  C CG  . LEU A 80  ? 0.7230 0.6802 0.8377 0.0173  -0.0136 0.0299  129 LEU A CG  
613  C CD1 . LEU A 80  ? 0.6698 0.6349 0.7990 0.0247  -0.0070 0.0343  129 LEU A CD1 
614  C CD2 . LEU A 80  ? 0.6442 0.5901 0.7629 0.0160  -0.0165 0.0226  129 LEU A CD2 
615  N N   . VAL A 81  ? 0.7449 0.7157 0.8267 0.0191  -0.0047 0.0393  130 VAL A N   
616  C CA  . VAL A 81  ? 0.7627 0.7256 0.8199 0.0212  0.0023  0.0341  130 VAL A CA  
617  C C   . VAL A 81  ? 0.7718 0.7207 0.8216 0.0256  0.0092  0.0244  130 VAL A C   
618  O O   . VAL A 81  ? 0.8100 0.7593 0.8711 0.0319  0.0149  0.0241  130 VAL A O   
619  C CB  . VAL A 81  ? 0.7681 0.7398 0.8224 0.0263  0.0092  0.0401  130 VAL A CB  
620  C CG1 . VAL A 81  ? 0.7800 0.7426 0.8085 0.0287  0.0168  0.0345  130 VAL A CG1 
621  C CG2 . VAL A 81  ? 0.7031 0.6884 0.7639 0.0221  0.0030  0.0498  130 VAL A CG2 
622  N N   . LEU A 82  ? 0.7427 0.6794 0.7735 0.0223  0.0088  0.0165  131 LEU A N   
623  C CA  . LEU A 82  ? 0.7337 0.6560 0.7554 0.0261  0.0155  0.0068  131 LEU A CA  
624  C C   . LEU A 82  ? 0.8230 0.7367 0.8181 0.0272  0.0225  0.0016  131 LEU A C   
625  O O   . LEU A 82  ? 0.8652 0.7775 0.8451 0.0216  0.0185  0.0008  131 LEU A O   
626  C CB  . LEU A 82  ? 0.7663 0.6796 0.7912 0.0210  0.0090  0.0007  131 LEU A CB  
627  C CG  . LEU A 82  ? 0.7649 0.6845 0.8157 0.0199  0.0022  0.0047  131 LEU A CG  
628  C CD1 . LEU A 82  ? 0.7069 0.6163 0.7580 0.0150  -0.0038 -0.0020 131 LEU A CD1 
629  C CD2 . LEU A 82  ? 0.7767 0.6992 0.8431 0.0280  0.0089  0.0062  131 LEU A CD2 
630  N N   . HIS A 83  ? 0.8016 0.7095 0.7908 0.0347  0.0331  -0.0020 132 HIS A N   
631  C CA  . HIS A 83  ? 0.8431 0.7412 0.8068 0.0365  0.0407  -0.0076 132 HIS A CA  
632  C C   . HIS A 83  ? 0.8835 0.7649 0.8367 0.0364  0.0439  -0.0185 132 HIS A C   
633  O O   . HIS A 83  ? 0.8859 0.7631 0.8503 0.0407  0.0470  -0.0215 132 HIS A O   
634  C CB  . HIS A 83  ? 0.8402 0.7422 0.8022 0.0449  0.0512  -0.0044 132 HIS A CB  
635  C CG  . HIS A 83  ? 0.8239 0.7415 0.7935 0.0453  0.0493  0.0059  132 HIS A CG  
636  N ND1 . HIS A 83  ? 0.8570 0.7770 0.8098 0.0452  0.0521  0.0086  132 HIS A ND1 
637  C CD2 . HIS A 83  ? 0.7848 0.7161 0.7770 0.0457  0.0452  0.0142  132 HIS A CD2 
638  C CE1 . HIS A 83  ? 0.8151 0.7497 0.7801 0.0456  0.0498  0.0181  132 HIS A CE1 
639  N NE2 . HIS A 83  ? 0.7765 0.7182 0.7654 0.0459  0.0457  0.0217  132 HIS A NE2 
640  N N   . TYR A 84  ? 0.8896 0.7617 0.8213 0.0316  0.0430  -0.0245 133 TYR A N   
641  C CA  . TYR A 84  ? 0.8951 0.7506 0.8146 0.0314  0.0467  -0.0352 133 TYR A CA  
642  C C   . TYR A 84  ? 0.9720 0.8180 0.8690 0.0362  0.0581  -0.0402 133 TYR A C   
643  O O   . TYR A 84  ? 1.0088 0.8589 0.8930 0.0363  0.0602  -0.0368 133 TYR A O   
644  C CB  . TYR A 84  ? 0.8370 0.6870 0.7492 0.0221  0.0376  -0.0398 133 TYR A CB  
645  C CG  . TYR A 84  ? 0.8796 0.7334 0.7756 0.0162  0.0334  -0.0377 133 TYR A CG  
646  C CD1 . TYR A 84  ? 0.8997 0.7683 0.8058 0.0125  0.0253  -0.0286 133 TYR A CD1 
647  C CD2 . TYR A 84  ? 0.9118 0.7543 0.7822 0.0144  0.0376  -0.0450 133 TYR A CD2 
648  C CE1 . TYR A 84  ? 0.9417 0.8142 0.8330 0.0074  0.0215  -0.0265 133 TYR A CE1 
649  C CE2 . TYR A 84  ? 0.9455 0.7919 0.8009 0.0091  0.0337  -0.0432 133 TYR A CE2 
650  C CZ  . TYR A 84  ? 0.9628 0.8243 0.8288 0.0057  0.0256  -0.0338 133 TYR A CZ  
651  O OH  . TYR A 84  ? 0.9602 0.8260 0.8114 0.0008  0.0218  -0.0318 133 TYR A OH  
652  N N   . CYS A 85  ? 0.9964 0.8295 0.8887 0.0404  0.0655  -0.0480 134 CYS A N   
653  C CA  . CYS A 85  ? 1.0078 0.8311 0.8802 0.0459  0.0773  -0.0528 134 CYS A CA  
654  C C   . CYS A 85  ? 1.0491 0.8557 0.9141 0.0472  0.0826  -0.0633 134 CYS A C   
655  O O   . CYS A 85  ? 1.0432 0.8478 0.9237 0.0472  0.0795  -0.0654 134 CYS A O   
656  C CB  . CYS A 85  ? 0.8602 0.6917 0.7411 0.0549  0.0854  -0.0466 134 CYS A CB  
657  S SG  . CYS A 85  ? 1.0611 0.8824 0.9185 0.0624  0.1004  -0.0509 134 CYS A SG  
658  N N   . LYS A 86  ? 1.0959 0.8902 0.9373 0.0484  0.0906  -0.0700 135 LYS A N   
659  C CA  . LYS A 86  ? 1.1105 0.8881 0.9429 0.0495  0.0964  -0.0803 135 LYS A CA  
660  C C   . LYS A 86  ? 1.0530 0.8262 0.8877 0.0598  0.1086  -0.0816 135 LYS A C   
661  O O   . LYS A 86  ? 1.0674 0.8262 0.8921 0.0622  0.1159  -0.0899 135 LYS A O   
662  C CB  . LYS A 86  ? 1.2139 0.9791 1.0189 0.0448  0.0986  -0.0878 135 LYS A CB  
663  C CG  . LYS A 86  ? 1.3092 1.0762 1.1100 0.0342  0.0868  -0.0886 135 LYS A CG  
664  C CD  . LYS A 86  ? 1.3930 1.1443 1.1691 0.0296  0.0896  -0.0988 135 LYS A CD  
665  C CE  . LYS A 86  ? 1.4546 1.2001 1.2083 0.0340  0.1004  -0.1004 135 LYS A CE  
666  N NZ  . LYS A 86  ? 1.5144 1.2428 1.2449 0.0305  0.1048  -0.1113 135 LYS A NZ  
667  N N   . SER A 87  ? 0.9834 0.7691 0.8314 0.0658  0.1110  -0.0733 136 SER A N   
668  C CA  . SER A 87  ? 0.9913 0.7752 0.8435 0.0758  0.1223  -0.0736 136 SER A CA  
669  C C   . SER A 87  ? 1.0115 0.8112 0.8892 0.0801  0.1198  -0.0647 136 SER A C   
670  O O   . SER A 87  ? 1.0315 0.8438 0.9214 0.0756  0.1104  -0.0579 136 SER A O   
671  C CB  . SER A 87  ? 0.9394 0.7189 0.7704 0.0806  0.1331  -0.0741 136 SER A CB  
672  O OG  . SER A 87  ? 0.9192 0.7117 0.7500 0.0799  0.1305  -0.0656 136 SER A OG  
673  N N   . GLN A 88  ? 1.0070 0.8061 0.8926 0.0888  0.1285  -0.0650 137 GLN A N   
674  C CA  . GLN A 88  ? 1.0236 0.8377 0.9327 0.0936  0.1274  -0.0570 137 GLN A CA  
675  C C   . GLN A 88  ? 1.0254 0.8516 0.9323 0.0958  0.1294  -0.0487 137 GLN A C   
676  O O   . GLN A 88  ? 1.1096 0.9350 1.0082 0.1030  0.1399  -0.0481 137 GLN A O   
677  C CB  . GLN A 88  ? 1.0398 0.8500 0.9569 0.1026  0.1366  -0.0598 137 GLN A CB  
678  C CG  . GLN A 88  ? 1.0146 0.8209 0.9478 0.1016  0.1319  -0.0637 137 GLN A CG  
679  C CD  . GLN A 88  ? 1.0384 0.8451 0.9835 0.1111  0.1403  -0.0644 137 GLN A CD  
680  O OE1 . GLN A 88  ? 0.9759 0.7949 0.9428 0.1139  0.1374  -0.0586 137 GLN A OE1 
681  N NE2 . GLN A 88  ? 1.0886 0.8819 1.0194 0.1163  0.1509  -0.0714 137 GLN A NE2 
682  N N   . ALA A 89  ? 0.9613 0.7991 0.8759 0.0898  0.1196  -0.0422 138 ALA A N   
683  C CA  . ALA A 89  ? 0.9070 0.7569 0.8203 0.0912  0.1206  -0.0339 138 ALA A CA  
684  C C   . ALA A 89  ? 0.9072 0.7693 0.8396 0.0987  0.1248  -0.0274 138 ALA A C   
685  O O   . ALA A 89  ? 0.8916 0.7564 0.8174 0.1050  0.1336  -0.0248 138 ALA A O   
686  C CB  . ALA A 89  ? 0.8276 0.6862 0.7446 0.0827  0.1089  -0.0288 138 ALA A CB  
687  N N   . TRP A 90  ? 0.8776 0.7472 0.8336 0.0980  0.1185  -0.0248 139 TRP A N   
688  C CA  . TRP A 90  ? 0.8356 0.7177 0.8117 0.1045  0.1215  -0.0187 139 TRP A CA  
689  C C   . TRP A 90  ? 0.9137 0.7923 0.9049 0.1084  0.1228  -0.0227 139 TRP A C   
690  O O   . TRP A 90  ? 0.9766 0.8485 0.9719 0.1038  0.1165  -0.0272 139 TRP A O   
691  C CB  . TRP A 90  ? 0.8352 0.7334 0.8279 0.1002  0.1124  -0.0095 139 TRP A CB  
692  C CG  . TRP A 90  ? 0.8686 0.7703 0.8470 0.0962  0.1104  -0.0055 139 TRP A CG  
693  C CD1 . TRP A 90  ? 0.8850 0.7902 0.8521 0.1005  0.1179  -0.0021 139 TRP A CD1 
694  C CD2 . TRP A 90  ? 0.8494 0.7514 0.8227 0.0872  0.1006  -0.0046 139 TRP A CD2 
695  N NE1 . TRP A 90  ? 0.9270 0.8345 0.8824 0.0948  0.1132  0.0010  139 TRP A NE1 
696  C CE2 . TRP A 90  ? 0.9195 0.8254 0.8785 0.0866  0.1026  -0.0005 139 TRP A CE2 
697  C CE3 . TRP A 90  ? 0.7914 0.6911 0.7710 0.0797  0.0902  -0.0067 139 TRP A CE3 
698  C CZ2 . TRP A 90  ? 0.9128 0.8205 0.8636 0.0790  0.0948  0.0015  139 TRP A CZ2 
699  C CZ3 . TRP A 90  ? 0.8541 0.7557 0.8255 0.0720  0.0824  -0.0046 139 TRP A CZ3 
700  C CH2 . TRP A 90  ? 0.9103 0.8160 0.8675 0.0717  0.0847  -0.0006 139 TRP A CH2 
701  N N   . GLY A 91  ? 0.9092 0.7926 0.9088 0.1170  0.1311  -0.0210 140 GLY A N   
702  C CA  . GLY A 91  ? 0.9219 0.8008 0.9326 0.1220  0.1345  -0.0254 140 GLY A CA  
703  C C   . GLY A 91  ? 0.9115 0.8035 0.9500 0.1239  0.1301  -0.0202 140 GLY A C   
704  O O   . GLY A 91  ? 0.8913 0.7800 0.9408 0.1271  0.1312  -0.0238 140 GLY A O   
705  N N   . ASP B 3   ? 1.0604 1.1577 1.4296 -0.1441 -0.1912 0.0747  3   ASP B N   
706  C CA  . ASP B 3   ? 1.0817 1.1644 1.4391 -0.1451 -0.1828 0.0702  3   ASP B CA  
707  C C   . ASP B 3   ? 1.0293 1.1122 1.3705 -0.1301 -0.1603 0.0629  3   ASP B C   
708  O O   . ASP B 3   ? 1.0153 1.0886 1.3292 -0.1218 -0.1564 0.0533  3   ASP B O   
709  C CB  . ASP B 3   ? 1.1275 1.2269 1.5237 -0.1536 -0.1827 0.0833  3   ASP B CB  
710  C CG  . ASP B 3   ? 1.1113 1.2463 1.5478 -0.1467 -0.1692 0.0949  3   ASP B CG  
711  O OD1 . ASP B 3   ? 1.1082 1.2570 1.5533 -0.1412 -0.1708 0.0968  3   ASP B OD1 
712  O OD2 . ASP B 3   ? 1.0998 1.2477 1.5582 -0.1464 -0.1565 0.1021  3   ASP B OD2 
713  N N   . ASP B 4   ? 0.9782 1.0719 1.3362 -0.1275 -0.1460 0.0680  4   ASP B N   
714  C CA  . ASP B 4   ? 0.8710 0.9670 1.2170 -0.1145 -0.1257 0.0630  4   ASP B CA  
715  C C   . ASP B 4   ? 0.8634 0.9804 1.2197 -0.1040 -0.1156 0.0646  4   ASP B C   
716  O O   . ASP B 4   ? 0.8845 0.9985 1.2215 -0.0933 -0.1038 0.0572  4   ASP B O   
717  C CB  . ASP B 4   ? 0.8092 0.9121 1.1714 -0.1157 -0.1143 0.0700  4   ASP B CB  
718  C CG  . ASP B 4   ? 0.8059 0.8850 1.1551 -0.1247 -0.1224 0.0677  4   ASP B CG  
719  O OD1 . ASP B 4   ? 0.8231 0.9079 1.1919 -0.1307 -0.1193 0.0766  4   ASP B OD1 
720  O OD2 . ASP B 4   ? 0.8104 0.8641 1.1293 -0.1256 -0.1310 0.0572  4   ASP B OD2 
721  N N   . LYS B 5   ? 0.8123 0.9504 1.2006 -0.1071 -0.1206 0.0746  5   LYS B N   
722  C CA  . LYS B 5   ? 0.7430 0.9007 1.1445 -0.0971 -0.1110 0.0771  5   LYS B CA  
723  C C   . LYS B 5   ? 0.7245 0.8708 1.0991 -0.0921 -0.1169 0.0680  5   LYS B C   
724  O O   . LYS B 5   ? 0.7423 0.8961 1.1135 -0.0816 -0.1057 0.0654  5   LYS B O   
725  C CB  . LYS B 5   ? 0.7598 0.9428 1.2051 -0.1013 -0.1155 0.0909  5   LYS B CB  
726  C CG  . LYS B 5   ? 0.7874 0.9918 1.2514 -0.0896 -0.1006 0.0947  5   LYS B CG  
727  C CD  . LYS B 5   ? 0.8270 1.0583 1.3393 -0.0926 -0.1010 0.1095  5   LYS B CD  
728  C CE  . LYS B 5   ? 0.8397 1.0900 1.3694 -0.0795 -0.0801 0.1126  5   LYS B CE  
729  N NZ  . LYS B 5   ? 0.8225 1.0688 1.3370 -0.0735 -0.0591 0.1082  5   LYS B NZ  
730  N N   . ASP B 6   ? 0.7142 0.8409 1.0682 -0.1000 -0.1342 0.0631  6   ASP B N   
731  C CA  . ASP B 6   ? 0.6811 0.7944 1.0060 -0.0963 -0.1396 0.0545  6   ASP B CA  
732  C C   . ASP B 6   ? 0.6007 0.7008 0.8945 -0.0867 -0.1253 0.0431  6   ASP B C   
733  O O   . ASP B 6   ? 0.5410 0.6401 0.8200 -0.0792 -0.1206 0.0381  6   ASP B O   
734  C CB  . ASP B 6   ? 0.8232 0.9159 1.1298 -0.1080 -0.1610 0.0518  6   ASP B CB  
735  C CG  . ASP B 6   ? 1.0235 1.1299 1.3597 -0.1175 -0.1783 0.0635  6   ASP B CG  
736  O OD1 . ASP B 6   ? 1.0722 1.2018 1.4357 -0.1123 -0.1749 0.0716  6   ASP B OD1 
737  O OD2 . ASP B 6   ? 1.1161 1.2096 1.4490 -0.1304 -0.1957 0.0649  6   ASP B OD2 
738  N N   . VAL B 7   ? 0.5730 0.6631 0.8586 -0.0874 -0.1189 0.0399  7   VAL B N   
739  C CA  . VAL B 7   ? 0.5327 0.6125 0.7938 -0.0784 -0.1056 0.0307  7   VAL B CA  
740  C C   . VAL B 7   ? 0.5382 0.6372 0.8115 -0.0681 -0.0892 0.0332  7   VAL B C   
741  O O   . VAL B 7   ? 0.5438 0.6396 0.7993 -0.0599 -0.0814 0.0266  7   VAL B O   
742  C CB  . VAL B 7   ? 0.5287 0.5943 0.7822 -0.0815 -0.1033 0.0286  7   VAL B CB  
743  C CG1 . VAL B 7   ? 0.5079 0.5699 0.7459 -0.0712 -0.0882 0.0226  7   VAL B CG1 
744  C CG2 . VAL B 7   ? 0.5351 0.5749 0.7667 -0.0897 -0.1177 0.0224  7   VAL B CG2 
745  N N   . LEU B 8   ? 0.5317 0.6497 0.8347 -0.0690 -0.0840 0.0429  8   LEU B N   
746  C CA  . LEU B 8   ? 0.5173 0.6520 0.8315 -0.0599 -0.0680 0.0454  8   LEU B CA  
747  C C   . LEU B 8   ? 0.5076 0.6484 0.8201 -0.0537 -0.0678 0.0435  8   LEU B C   
748  O O   . LEU B 8   ? 0.5103 0.6527 0.8125 -0.0451 -0.0563 0.0392  8   LEU B O   
749  C CB  . LEU B 8   ? 0.5005 0.6542 0.8483 -0.0626 -0.0626 0.0568  8   LEU B CB  
750  C CG  . LEU B 8   ? 0.4533 0.6031 0.8047 -0.0680 -0.0593 0.0603  8   LEU B CG  
751  C CD1 . LEU B 8   ? 0.4296 0.6004 0.8151 -0.0698 -0.0510 0.0722  8   LEU B CD1 
752  C CD2 . LEU B 8   ? 0.3969 0.5356 0.7231 -0.0615 -0.0482 0.0533  8   LEU B CD2 
753  N N   . ARG B 9   ? 0.5396 0.6832 0.8621 -0.0586 -0.0814 0.0472  9   ARG B N   
754  C CA  . ARG B 9   ? 0.5462 0.6945 0.8680 -0.0534 -0.0831 0.0468  9   ARG B CA  
755  C C   . ARG B 9   ? 0.5401 0.6706 0.8265 -0.0501 -0.0839 0.0361  9   ARG B C   
756  O O   . ARG B 9   ? 0.5855 0.7186 0.8651 -0.0425 -0.0764 0.0332  9   ARG B O   
757  C CB  . ARG B 9   ? 0.5277 0.6827 0.8690 -0.0604 -0.0997 0.0547  9   ARG B CB  
758  C CG  . ARG B 9   ? 0.6050 0.7805 0.9867 -0.0638 -0.0990 0.0668  9   ARG B CG  
759  C CD  . ARG B 9   ? 0.7017 0.8858 1.1058 -0.0704 -0.1169 0.0758  9   ARG B CD  
760  N NE  . ARG B 9   ? 0.7896 0.9779 1.1934 -0.0634 -0.1176 0.0761  9   ARG B NE  
761  C CZ  . ARG B 9   ? 0.7945 1.0018 1.2256 -0.0550 -0.1073 0.0826  9   ARG B CZ  
762  N NH1 . ARG B 9   ? 0.8199 1.0442 1.2801 -0.0526 -0.0945 0.0892  9   ARG B NH1 
763  N NH2 . ARG B 9   ? 0.7652 0.9731 1.1937 -0.0489 -0.1091 0.0826  9   ARG B NH2 
764  N N   . ASP B 10  ? 0.5094 0.6213 0.7737 -0.0559 -0.0923 0.0303  10  ASP B N   
765  C CA  . ASP B 10  ? 0.5184 0.6129 0.7495 -0.0530 -0.0920 0.0203  10  ASP B CA  
766  C C   . ASP B 10  ? 0.4905 0.5861 0.7121 -0.0440 -0.0758 0.0151  10  ASP B C   
767  O O   . ASP B 10  ? 0.5181 0.6097 0.7233 -0.0387 -0.0714 0.0098  10  ASP B O   
768  C CB  . ASP B 10  ? 0.5921 0.6650 0.8019 -0.0603 -0.1018 0.0148  10  ASP B CB  
769  C CG  . ASP B 10  ? 0.6546 0.7199 0.8606 -0.0692 -0.1200 0.0171  10  ASP B CG  
770  O OD1 . ASP B 10  ? 0.6583 0.7314 0.8694 -0.0681 -0.1246 0.0208  10  ASP B OD1 
771  O OD2 . ASP B 10  ? 0.7497 0.7997 0.9464 -0.0777 -0.1304 0.0154  10  ASP B OD2 
772  N N   . VAL B 11  ? 0.4609 0.5616 0.6926 -0.0431 -0.0675 0.0171  11  VAL B N   
773  C CA  . VAL B 11  ? 0.4378 0.5401 0.6618 -0.0356 -0.0536 0.0135  11  VAL B CA  
774  C C   . VAL B 11  ? 0.4259 0.5424 0.6603 -0.0291 -0.0448 0.0160  11  VAL B C   
775  O O   . VAL B 11  ? 0.4150 0.5294 0.6358 -0.0233 -0.0383 0.0111  11  VAL B O   
776  C CB  . VAL B 11  ? 0.4279 0.5308 0.6589 -0.0370 -0.0481 0.0163  11  VAL B CB  
777  C CG1 . VAL B 11  ? 0.2724 0.3800 0.4988 -0.0298 -0.0346 0.0149  11  VAL B CG1 
778  C CG2 . VAL B 11  ? 0.4343 0.5190 0.6502 -0.0414 -0.0548 0.0119  11  VAL B CG2 
779  N N   . TRP B 12  ? 0.4226 0.5533 0.6820 -0.0302 -0.0447 0.0239  12  TRP B N   
780  C CA  . TRP B 12  ? 0.4139 0.5569 0.6850 -0.0236 -0.0351 0.0265  12  TRP B CA  
781  C C   . TRP B 12  ? 0.4765 0.6169 0.7382 -0.0200 -0.0380 0.0233  12  TRP B C   
782  O O   . TRP B 12  ? 0.4997 0.6420 0.7566 -0.0135 -0.0287 0.0208  12  TRP B O   
783  C CB  . TRP B 12  ? 0.4055 0.5645 0.7083 -0.0253 -0.0345 0.0363  12  TRP B CB  
784  C CG  . TRP B 12  ? 0.4458 0.6160 0.7615 -0.0176 -0.0234 0.0388  12  TRP B CG  
785  C CD1 . TRP B 12  ? 0.5158 0.6908 0.8406 -0.0142 -0.0266 0.0409  12  TRP B CD1 
786  C CD2 . TRP B 12  ? 0.3970 0.5728 0.7161 -0.0122 -0.0070 0.0394  12  TRP B CD2 
787  N NE1 . TRP B 12  ? 0.5123 0.6952 0.8470 -0.0065 -0.0127 0.0423  12  TRP B NE1 
788  C CE2 . TRP B 12  ? 0.4554 0.6383 0.7854 -0.0054 -0.0003 0.0410  12  TRP B CE2 
789  C CE3 . TRP B 12  ? 0.3281 0.5019 0.6402 -0.0126 0.0024  0.0389  12  TRP B CE3 
790  C CZ2 . TRP B 12  ? 0.4499 0.6368 0.7824 0.0011  0.0162  0.0411  12  TRP B CZ2 
791  C CZ3 . TRP B 12  ? 0.3683 0.5467 0.6820 -0.0069 0.0181  0.0396  12  TRP B CZ3 
792  C CH2 . TRP B 12  ? 0.4455 0.6298 0.7686 -0.0001 0.0252  0.0402  12  TRP B CH2 
793  N N   . PHE B 13  ? 0.4718 0.6064 0.7293 -0.0246 -0.0514 0.0235  13  PHE B N   
794  C CA  . PHE B 13  ? 0.4686 0.6004 0.7178 -0.0221 -0.0553 0.0222  13  PHE B CA  
795  C C   . PHE B 13  ? 0.5027 0.6192 0.7213 -0.0216 -0.0559 0.0136  13  PHE B C   
796  O O   . PHE B 13  ? 0.5215 0.6328 0.7295 -0.0217 -0.0613 0.0127  13  PHE B O   
797  C CB  . PHE B 13  ? 0.4702 0.6055 0.7333 -0.0272 -0.0697 0.0290  13  PHE B CB  
798  C CG  . PHE B 13  ? 0.4915 0.6450 0.7894 -0.0256 -0.0677 0.0386  13  PHE B CG  
799  C CD1 . PHE B 13  ? 0.4709 0.6333 0.7808 -0.0175 -0.0582 0.0408  13  PHE B CD1 
800  C CD2 . PHE B 13  ? 0.5049 0.6660 0.8242 -0.0321 -0.0747 0.0455  13  PHE B CD2 
801  C CE1 . PHE B 13  ? 0.4504 0.6294 0.7934 -0.0148 -0.0543 0.0495  13  PHE B CE1 
802  C CE2 . PHE B 13  ? 0.5066 0.6864 0.8611 -0.0302 -0.0713 0.0551  13  PHE B CE2 
803  C CZ  . PHE B 13  ? 0.4718 0.6606 0.8382 -0.0210 -0.0605 0.0570  13  PHE B CZ  
804  N N   . GLY B 14  ? 0.4630 0.5730 0.6686 -0.0210 -0.0498 0.0082  14  GLY B N   
805  C CA  . GLY B 14  ? 0.4317 0.5292 0.6120 -0.0196 -0.0481 0.0006  14  GLY B CA  
806  C C   . GLY B 14  ? 0.4670 0.5666 0.6407 -0.0143 -0.0418 -0.0014 14  GLY B C   
807  O O   . GLY B 14  ? 0.4713 0.5792 0.6539 -0.0098 -0.0331 -0.0003 14  GLY B O   
808  N N   . ARG B 15  ? 0.4574 0.5478 0.6138 -0.0152 -0.0459 -0.0044 15  ARG B N   
809  C CA  . ARG B 15  ? 0.3966 0.4877 0.5465 -0.0114 -0.0412 -0.0056 15  ARG B CA  
810  C C   . ARG B 15  ? 0.4150 0.4967 0.5433 -0.0106 -0.0370 -0.0119 15  ARG B C   
811  O O   . ARG B 15  ? 0.5027 0.5737 0.6165 -0.0136 -0.0409 -0.0150 15  ARG B O   
812  C CB  . ARG B 15  ? 0.4237 0.5145 0.5762 -0.0132 -0.0498 -0.0009 15  ARG B CB  
813  C CG  . ARG B 15  ? 0.4564 0.5593 0.6348 -0.0119 -0.0517 0.0063  15  ARG B CG  
814  C CD  . ARG B 15  ? 0.4322 0.5432 0.6205 -0.0056 -0.0395 0.0059  15  ARG B CD  
815  N NE  . ARG B 15  ? 0.4765 0.5978 0.6884 -0.0027 -0.0389 0.0125  15  ARG B NE  
816  C CZ  . ARG B 15  ? 0.4923 0.6234 0.7245 -0.0022 -0.0360 0.0165  15  ARG B CZ  
817  N NH1 . ARG B 15  ? 0.5013 0.6325 0.7321 -0.0052 -0.0345 0.0148  15  ARG B NH1 
818  N NH2 . ARG B 15  ? 0.4180 0.5588 0.6730 0.0014  -0.0338 0.0226  15  ARG B NH2 
819  N N   . ILE B 16  ? 0.4463 0.5315 0.5728 -0.0067 -0.0287 -0.0136 16  ILE B N   
820  C CA  . ILE B 16  ? 0.4894 0.5685 0.5998 -0.0057 -0.0239 -0.0183 16  ILE B CA  
821  C C   . ILE B 16  ? 0.5222 0.6007 0.6267 -0.0051 -0.0227 -0.0173 16  ILE B C   
822  O O   . ILE B 16  ? 0.5552 0.6399 0.6685 -0.0029 -0.0193 -0.0155 16  ILE B O   
823  C CB  . ILE B 16  ? 0.4824 0.5662 0.5961 -0.0025 -0.0158 -0.0207 16  ILE B CB  
824  C CG1 . ILE B 16  ? 0.4960 0.5783 0.6138 -0.0032 -0.0171 -0.0213 16  ILE B CG1 
825  C CG2 . ILE B 16  ? 0.4163 0.4966 0.5182 -0.0012 -0.0105 -0.0243 16  ILE B CG2 
826  C CD1 . ILE B 16  ? 0.4956 0.5831 0.6187 -0.0004 -0.0110 -0.0218 16  ILE B CD1 
827  N N   . PRO B 17  ? 0.5630 0.6323 0.6510 -0.0075 -0.0251 -0.0185 17  PRO B N   
828  C CA  . PRO B 17  ? 0.5633 0.6309 0.6444 -0.0076 -0.0239 -0.0168 17  PRO B CA  
829  C C   . PRO B 17  ? 0.5764 0.6488 0.6585 -0.0051 -0.0144 -0.0190 17  PRO B C   
830  O O   . PRO B 17  ? 0.6106 0.6821 0.6873 -0.0042 -0.0091 -0.0226 17  PRO B O   
831  C CB  . PRO B 17  ? 0.5873 0.6424 0.6469 -0.0111 -0.0272 -0.0182 17  PRO B CB  
832  C CG  . PRO B 17  ? 0.6307 0.6808 0.6843 -0.0111 -0.0256 -0.0230 17  PRO B CG  
833  C CD  . PRO B 17  ? 0.6180 0.6762 0.6905 -0.0101 -0.0281 -0.0218 17  PRO B CD  
834  N N   . THR B 18  ? 0.5145 0.5914 0.6043 -0.0039 -0.0127 -0.0167 18  THR B N   
835  C CA  . THR B 18  ? 0.5019 0.5834 0.5942 -0.0027 -0.0056 -0.0184 18  THR B CA  
836  C C   . THR B 18  ? 0.4635 0.5425 0.5514 -0.0041 -0.0044 -0.0162 18  THR B C   
837  O O   . THR B 18  ? 0.4501 0.5259 0.5395 -0.0043 -0.0085 -0.0129 18  THR B O   
838  C CB  . THR B 18  ? 0.5587 0.6468 0.6639 -0.0004 -0.0038 -0.0186 18  THR B CB  
839  O OG1 . THR B 18  ? 0.5938 0.6841 0.7031 0.0004  -0.0046 -0.0198 18  THR B OG1 
840  C CG2 . THR B 18  ? 0.5680 0.6596 0.6740 -0.0003 0.0014  -0.0201 18  THR B CG2 
841  N N   . CYS B 19  ? 0.4927 0.5731 0.5766 -0.0051 0.0012  -0.0174 19  CYS B N   
842  C CA  . CYS B 19  ? 0.5046 0.5829 0.5855 -0.0074 0.0029  -0.0151 19  CYS B CA  
843  C C   . CYS B 19  ? 0.5401 0.6237 0.6297 -0.0075 0.0059  -0.0159 19  CYS B C   
844  O O   . CYS B 19  ? 0.6269 0.7166 0.7196 -0.0078 0.0097  -0.0174 19  CYS B O   
845  C CB  . CYS B 19  ? 0.4718 0.5475 0.5413 -0.0096 0.0072  -0.0147 19  CYS B CB  
846  S SG  . CYS B 19  ? 0.4987 0.5725 0.5655 -0.0136 0.0102  -0.0108 19  CYS B SG  
847  N N   . PHE B 20  ? 0.5317 0.6123 0.6251 -0.0074 0.0039  -0.0148 20  PHE B N   
848  C CA  . PHE B 20  ? 0.4928 0.5746 0.5903 -0.0086 0.0057  -0.0160 20  PHE B CA  
849  C C   . PHE B 20  ? 0.4963 0.5750 0.5904 -0.0130 0.0069  -0.0137 20  PHE B C   
850  O O   . PHE B 20  ? 0.5169 0.5881 0.6068 -0.0140 0.0053  -0.0110 20  PHE B O   
851  C CB  . PHE B 20  ? 0.4775 0.5550 0.5789 -0.0060 0.0045  -0.0168 20  PHE B CB  
852  C CG  . PHE B 20  ? 0.4633 0.5451 0.5700 -0.0024 0.0045  -0.0183 20  PHE B CG  
853  C CD1 . PHE B 20  ? 0.4211 0.5069 0.5294 -0.0022 0.0064  -0.0208 20  PHE B CD1 
854  C CD2 . PHE B 20  ? 0.5063 0.5881 0.6165 0.0000  0.0019  -0.0165 20  PHE B CD2 
855  C CE1 . PHE B 20  ? 0.4433 0.5324 0.5560 0.0006  0.0069  -0.0214 20  PHE B CE1 
856  C CE2 . PHE B 20  ? 0.5351 0.6213 0.6517 0.0025  0.0019  -0.0171 20  PHE B CE2 
857  C CZ  . PHE B 20  ? 0.5164 0.6060 0.6339 0.0029  0.0051  -0.0196 20  PHE B CZ  
858  N N   . THR B 21  ? 0.4645 0.5492 0.5616 -0.0159 0.0093  -0.0141 21  THR B N   
859  C CA  . THR B 21  ? 0.5045 0.5881 0.6011 -0.0211 0.0105  -0.0113 21  THR B CA  
860  C C   . THR B 21  ? 0.5908 0.6750 0.6920 -0.0245 0.0087  -0.0125 21  THR B C   
861  O O   . THR B 21  ? 0.6140 0.7056 0.7205 -0.0241 0.0082  -0.0142 21  THR B O   
862  C CB  . THR B 21  ? 0.5111 0.6025 0.6086 -0.0226 0.0155  -0.0093 21  THR B CB  
863  O OG1 . THR B 21  ? 0.5681 0.6545 0.6557 -0.0210 0.0168  -0.0082 21  THR B OG1 
864  C CG2 . THR B 21  ? 0.4245 0.5182 0.5258 -0.0287 0.0175  -0.0057 21  THR B CG2 
865  N N   . LEU B 22  ? 0.5501 0.6250 0.6483 -0.0282 0.0068  -0.0114 22  LEU B N   
866  C CA  . LEU B 22  ? 0.5076 0.5794 0.6069 -0.0327 0.0039  -0.0129 22  LEU B CA  
867  C C   . LEU B 22  ? 0.5370 0.6199 0.6447 -0.0384 0.0039  -0.0101 22  LEU B C   
868  O O   . LEU B 22  ? 0.5272 0.6148 0.6384 -0.0412 0.0070  -0.0060 22  LEU B O   
869  C CB  . LEU B 22  ? 0.5556 0.6121 0.6487 -0.0356 0.0020  -0.0125 22  LEU B CB  
870  C CG  . LEU B 22  ? 0.5851 0.6331 0.6748 -0.0403 -0.0017 -0.0155 22  LEU B CG  
871  C CD1 . LEU B 22  ? 0.5849 0.6317 0.6707 -0.0361 -0.0021 -0.0206 22  LEU B CD1 
872  C CD2 . LEU B 22  ? 0.6154 0.6455 0.6981 -0.0421 -0.0027 -0.0155 22  LEU B CD2 
873  N N   . TYR B 23  ? 0.5798 0.6672 0.6911 -0.0402 0.0004  -0.0119 23  TYR B N   
874  C CA  . TYR B 23  ? 0.6326 0.7327 0.7558 -0.0454 -0.0011 -0.0084 23  TYR B CA  
875  C C   . TYR B 23  ? 0.6917 0.7898 0.8184 -0.0535 -0.0019 -0.0042 23  TYR B C   
876  O O   . TYR B 23  ? 0.6854 0.7687 0.8031 -0.0569 -0.0047 -0.0054 23  TYR B O   
877  C CB  . TYR B 23  ? 0.6624 0.7636 0.7860 -0.0474 -0.0074 -0.0104 23  TYR B CB  
878  C CG  . TYR B 23  ? 0.6654 0.7818 0.8045 -0.0523 -0.0106 -0.0058 23  TYR B CG  
879  C CD1 . TYR B 23  ? 0.6716 0.8040 0.8248 -0.0482 -0.0055 -0.0025 23  TYR B CD1 
880  C CD2 . TYR B 23  ? 0.6599 0.7740 0.8002 -0.0609 -0.0190 -0.0045 23  TYR B CD2 
881  C CE1 . TYR B 23  ? 0.6720 0.8199 0.8433 -0.0517 -0.0078 0.0027  23  TYR B CE1 
882  C CE2 . TYR B 23  ? 0.6539 0.7837 0.8118 -0.0656 -0.0232 0.0010  23  TYR B CE2 
883  C CZ  . TYR B 23  ? 0.6835 0.8312 0.8585 -0.0605 -0.0172 0.0050  23  TYR B CZ  
884  O OH  . TYR B 23  ? 0.7142 0.8791 0.9106 -0.0642 -0.0208 0.0114  23  TYR B OH  
885  N N   . GLN B 24  ? 0.7776 0.8901 0.9180 -0.0562 0.0013  0.0010  24  GLN B N   
886  C CA  . GLN B 24  ? 0.8181 0.9312 0.9640 -0.0640 0.0024  0.0064  24  GLN B CA  
887  C C   . GLN B 24  ? 0.7781 0.8831 0.9238 -0.0733 -0.0063 0.0068  24  GLN B C   
888  O O   . GLN B 24  ? 0.8060 0.9010 0.9479 -0.0793 -0.0071 0.0090  24  GLN B O   
889  C CB  . GLN B 24  ? 0.8694 1.0022 1.0335 -0.0649 0.0085  0.0123  24  GLN B CB  
890  C CG  . GLN B 24  ? 0.9836 1.1208 1.1447 -0.0570 0.0187  0.0121  24  GLN B CG  
891  C CD  . GLN B 24  ? 1.0759 1.2312 1.2549 -0.0572 0.0268  0.0175  24  GLN B CD  
892  O OE1 . GLN B 24  ? 1.0946 1.2636 1.2924 -0.0603 0.0238  0.0208  24  GLN B OE1 
893  N NE2 . GLN B 24  ? 1.0920 1.2472 1.2651 -0.0538 0.0373  0.0189  24  GLN B NE2 
894  N N   . ASP B 25  ? 0.7317 0.8394 0.8798 -0.0751 -0.0136 0.0047  25  ASP B N   
895  C CA  . ASP B 25  ? 0.7147 0.8149 0.8620 -0.0854 -0.0233 0.0052  25  ASP B CA  
896  C C   . ASP B 25  ? 0.6193 0.6962 0.7447 -0.0852 -0.0282 -0.0022 25  ASP B C   
897  O O   . ASP B 25  ? 0.6081 0.6754 0.7276 -0.0932 -0.0371 -0.0037 25  ASP B O   
898  C CB  . ASP B 25  ? 0.8004 0.9174 0.9640 -0.0896 -0.0299 0.0089  25  ASP B CB  
899  C CG  . ASP B 25  ? 0.8986 1.0388 1.0871 -0.0901 -0.0239 0.0169  25  ASP B CG  
900  O OD1 . ASP B 25  ? 0.8840 1.0250 1.0746 -0.0898 -0.0154 0.0198  25  ASP B OD1 
901  O OD2 . ASP B 25  ? 0.9394 1.0966 1.1454 -0.0906 -0.0273 0.0208  25  ASP B OD2 
902  N N   . GLU B 26  ? 0.5746 0.6418 0.6879 -0.0763 -0.0224 -0.0068 26  GLU B N   
903  C CA  . GLU B 26  ? 0.6225 0.6669 0.7170 -0.0752 -0.0243 -0.0131 26  GLU B CA  
904  C C   . GLU B 26  ? 0.6778 0.7081 0.7689 -0.0812 -0.0250 -0.0112 26  GLU B C   
905  O O   . GLU B 26  ? 0.7066 0.7440 0.8066 -0.0820 -0.0209 -0.0056 26  GLU B O   
906  C CB  . GLU B 26  ? 0.6330 0.6734 0.7201 -0.0638 -0.0178 -0.0172 26  GLU B CB  
907  C CG  . GLU B 26  ? 0.7001 0.7507 0.7882 -0.0581 -0.0171 -0.0194 26  GLU B CG  
908  C CD  . GLU B 26  ? 0.7957 0.8360 0.8712 -0.0609 -0.0227 -0.0241 26  GLU B CD  
909  O OE1 . GLU B 26  ? 0.8426 0.8644 0.9055 -0.0660 -0.0260 -0.0273 26  GLU B OE1 
910  O OE2 . GLU B 26  ? 0.8047 0.8537 0.8813 -0.0582 -0.0236 -0.0247 26  GLU B OE2 
911  N N   . ILE B 27  ? 0.7479 0.7566 0.8246 -0.0855 -0.0298 -0.0158 27  ILE B N   
912  C CA  . ILE B 27  ? 0.8080 0.8006 0.8809 -0.0918 -0.0313 -0.0140 27  ILE B CA  
913  C C   . ILE B 27  ? 0.7673 0.7443 0.8309 -0.0829 -0.0251 -0.0167 27  ILE B C   
914  O O   . ILE B 27  ? 0.8031 0.7664 0.8542 -0.0765 -0.0234 -0.0234 27  ILE B O   
915  C CB  . ILE B 27  ? 0.9670 0.9411 1.0282 -0.1019 -0.0404 -0.0178 27  ILE B CB  
916  C CG1 . ILE B 27  ? 1.0198 1.0076 1.0858 -0.1074 -0.0478 -0.0175 27  ILE B CG1 
917  C CG2 . ILE B 27  ? 0.9781 0.9435 1.0432 -0.1124 -0.0440 -0.0129 27  ILE B CG2 
918  C CD1 . ILE B 27  ? 1.0635 1.0313 1.1134 -0.1175 -0.0584 -0.0221 27  ILE B CD1 
919  N N   . THR B 28  ? 0.7103 0.6895 0.7802 -0.0824 -0.0215 -0.0107 28  THR B N   
920  C CA  . THR B 28  ? 0.7532 0.7203 0.8174 -0.0738 -0.0168 -0.0112 28  THR B CA  
921  C C   . THR B 28  ? 0.8290 0.7770 0.8890 -0.0786 -0.0183 -0.0079 28  THR B C   
922  O O   . THR B 28  ? 0.8035 0.7540 0.8689 -0.0884 -0.0208 -0.0022 28  THR B O   
923  C CB  . THR B 28  ? 0.7575 0.7418 0.8296 -0.0667 -0.0114 -0.0069 28  THR B CB  
924  O OG1 . THR B 28  ? 0.7618 0.7598 0.8431 -0.0733 -0.0106 0.0003  28  THR B OG1 
925  C CG2 . THR B 28  ? 0.7600 0.7587 0.8347 -0.0601 -0.0096 -0.0109 28  THR B CG2 
926  N N   . GLU B 29  ? 0.8526 0.7817 0.9045 -0.0713 -0.0163 -0.0108 29  GLU B N   
927  C CA  . GLU B 29  ? 0.8674 0.7764 0.9155 -0.0738 -0.0174 -0.0073 29  GLU B CA  
928  C C   . GLU B 29  ? 0.8716 0.7908 0.9271 -0.0737 -0.0155 0.0023  29  GLU B C   
929  O O   . GLU B 29  ? 0.9244 0.8340 0.9794 -0.0806 -0.0172 0.0083  29  GLU B O   
930  C CB  . GLU B 29  ? 0.8510 0.7385 0.8910 -0.0641 -0.0149 -0.0126 29  GLU B CB  
931  C CG  . GLU B 29  ? 0.8766 0.7484 0.9044 -0.0645 -0.0155 -0.0226 29  GLU B CG  
932  C CD  . GLU B 29  ? 0.8951 0.7472 0.9164 -0.0531 -0.0101 -0.0279 29  GLU B CD  
933  O OE1 . GLU B 29  ? 0.8997 0.7619 0.9298 -0.0423 -0.0055 -0.0257 29  GLU B OE1 
934  O OE2 . GLU B 29  ? 0.9423 0.7685 0.9502 -0.0549 -0.0104 -0.0342 29  GLU B OE2 
935  N N   . ARG B 30  ? 0.8338 0.7709 0.8943 -0.0665 -0.0119 0.0037  30  ARG B N   
936  C CA  . ARG B 30  ? 0.8251 0.7715 0.8888 -0.0664 -0.0099 0.0121  30  ARG B CA  
937  C C   . ARG B 30  ? 0.7996 0.7694 0.8684 -0.0629 -0.0066 0.0118  30  ARG B C   
938  O O   . ARG B 30  ? 0.8108 0.7893 0.8822 -0.0599 -0.0062 0.0057  30  ARG B O   
939  C CB  . ARG B 30  ? 0.7710 0.7038 0.8312 -0.0589 -0.0103 0.0152  30  ARG B CB  
940  C CG  . ARG B 30  ? 0.7022 0.6356 0.7641 -0.0472 -0.0092 0.0098  30  ARG B CG  
941  C CD  . ARG B 30  ? 0.7254 0.6456 0.7877 -0.0401 -0.0106 0.0143  30  ARG B CD  
942  N NE  . ARG B 30  ? 0.7843 0.7043 0.8514 -0.0292 -0.0088 0.0094  30  ARG B NE  
943  C CZ  . ARG B 30  ? 0.8089 0.7444 0.8818 -0.0230 -0.0084 0.0100  30  ARG B CZ  
944  N NH1 . ARG B 30  ? 0.8239 0.7740 0.8956 -0.0264 -0.0095 0.0144  30  ARG B NH1 
945  N NH2 . ARG B 30  ? 0.8081 0.7436 0.8875 -0.0137 -0.0062 0.0063  30  ARG B NH2 
946  N N   . GLU B 31  ? 0.8053 0.7836 0.8741 -0.0634 -0.0041 0.0184  31  GLU B N   
947  C CA  . GLU B 31  ? 0.8197 0.8171 0.8912 -0.0599 -0.0003 0.0178  31  GLU B CA  
948  C C   . GLU B 31  ? 0.7925 0.7910 0.8633 -0.0498 -0.0012 0.0129  31  GLU B C   
949  O O   . GLU B 31  ? 0.7885 0.7761 0.8564 -0.0446 -0.0035 0.0142  31  GLU B O   
950  C CB  . GLU B 31  ? 0.9338 0.9355 1.0006 -0.0624 0.0032  0.0254  31  GLU B CB  
951  C CG  . GLU B 31  ? 1.0191 1.0375 1.0863 -0.0588 0.0078  0.0241  31  GLU B CG  
952  C CD  . GLU B 31  ? 1.1544 1.1739 1.2126 -0.0613 0.0123  0.0309  31  GLU B CD  
953  O OE1 . GLU B 31  ? 1.1968 1.2056 1.2495 -0.0667 0.0118  0.0375  31  GLU B OE1 
954  O OE2 . GLU B 31  ? 1.2149 1.2442 1.2698 -0.0581 0.0166  0.0296  31  GLU B OE2 
955  N N   . ALA B 32  ? 0.7957 0.8080 0.8711 -0.0471 0.0005  0.0081  32  ALA B N   
956  C CA  . ALA B 32  ? 0.7781 0.7930 0.8544 -0.0385 0.0001  0.0038  32  ALA B CA  
957  C C   . ALA B 32  ? 0.7289 0.7534 0.8035 -0.0353 0.0015  0.0063  32  ALA B C   
958  O O   . ALA B 32  ? 0.7468 0.7827 0.8219 -0.0379 0.0050  0.0069  32  ALA B O   
959  C CB  . ALA B 32  ? 0.7971 0.8191 0.8776 -0.0376 0.0006  -0.0026 32  ALA B CB  
960  N N   . GLU B 33  ? 0.7014 0.7204 0.7739 -0.0299 -0.0012 0.0079  33  GLU B N   
961  C CA  . GLU B 33  ? 0.7525 0.7777 0.8209 -0.0275 -0.0018 0.0098  33  GLU B CA  
962  C C   . GLU B 33  ? 0.7101 0.7462 0.7842 -0.0229 -0.0008 0.0042  33  GLU B C   
963  O O   . GLU B 33  ? 0.6522 0.6878 0.7330 -0.0191 -0.0013 0.0004  33  GLU B O   
964  C CB  . GLU B 33  ? 0.8136 0.8293 0.8791 -0.0243 -0.0073 0.0148  33  GLU B CB  
965  C CG  . GLU B 33  ? 0.9269 0.9306 0.9853 -0.0289 -0.0089 0.0216  33  GLU B CG  
966  C CD  . GLU B 33  ? 1.0413 1.0323 1.1042 -0.0247 -0.0140 0.0248  33  GLU B CD  
967  O OE1 . GLU B 33  ? 1.0293 1.0213 1.1024 -0.0183 -0.0146 0.0210  33  GLU B OE1 
968  O OE2 . GLU B 33  ? 1.1251 1.1050 1.1821 -0.0276 -0.0168 0.0316  33  GLU B OE2 
969  N N   . PRO B 34  ? 0.6854 0.7298 0.7556 -0.0233 0.0014  0.0037  34  PRO B N   
970  C CA  . PRO B 34  ? 0.6070 0.6602 0.6819 -0.0192 0.0018  -0.0009 34  PRO B CA  
971  C C   . PRO B 34  ? 0.6355 0.6858 0.7132 -0.0144 -0.0033 -0.0004 34  PRO B C   
972  O O   . PRO B 34  ? 0.6185 0.6623 0.6914 -0.0144 -0.0077 0.0042  34  PRO B O   
973  C CB  . PRO B 34  ? 0.5584 0.6166 0.6257 -0.0208 0.0053  -0.0007 34  PRO B CB  
974  C CG  . PRO B 34  ? 0.6228 0.6728 0.6786 -0.0245 0.0050  0.0047  34  PRO B CG  
975  C CD  . PRO B 34  ? 0.6551 0.6995 0.7151 -0.0274 0.0042  0.0074  34  PRO B CD  
976  N N   . TYR B 35  ? 0.5984 0.6540 0.6847 -0.0105 -0.0029 -0.0042 35  TYR B N   
977  C CA  . TYR B 35  ? 0.5576 0.6130 0.6509 -0.0060 -0.0068 -0.0032 35  TYR B CA  
978  C C   . TYR B 35  ? 0.5540 0.6162 0.6470 -0.0052 -0.0083 -0.0046 35  TYR B C   
979  O O   . TYR B 35  ? 0.5754 0.6439 0.6696 -0.0051 -0.0048 -0.0086 35  TYR B O   
980  C CB  . TYR B 35  ? 0.5413 0.5964 0.6441 -0.0022 -0.0041 -0.0060 35  TYR B CB  
981  C CG  . TYR B 35  ? 0.5897 0.6440 0.7033 0.0031  -0.0065 -0.0036 35  TYR B CG  
982  C CD1 . TYR B 35  ? 0.5996 0.6619 0.7211 0.0056  -0.0079 -0.0036 35  TYR B CD1 
983  C CD2 . TYR B 35  ? 0.6243 0.6698 0.7421 0.0057  -0.0073 -0.0006 35  TYR B CD2 
984  C CE1 . TYR B 35  ? 0.6129 0.6767 0.7481 0.0102  -0.0098 -0.0003 35  TYR B CE1 
985  C CE2 . TYR B 35  ? 0.6310 0.6773 0.7625 0.0114  -0.0089 0.0026  35  TYR B CE2 
986  C CZ  . TYR B 35  ? 0.6116 0.6683 0.7528 0.0135  -0.0100 0.0030  35  TYR B CZ  
987  O OH  . TYR B 35  ? 0.5934 0.6531 0.7518 0.0190  -0.0113 0.0071  35  TYR B OH  
988  N N   . TYR B 36  ? 0.5876 0.6474 0.6784 -0.0051 -0.0145 -0.0011 36  TYR B N   
989  C CA  . TYR B 36  ? 0.5427 0.6062 0.6318 -0.0053 -0.0173 -0.0025 36  TYR B CA  
990  C C   . TYR B 36  ? 0.5065 0.5750 0.6109 -0.0018 -0.0206 -0.0014 36  TYR B C   
991  O O   . TYR B 36  ? 0.4864 0.5538 0.6006 0.0006  -0.0239 0.0027  36  TYR B O   
992  C CB  . TYR B 36  ? 0.5111 0.5674 0.5853 -0.0088 -0.0229 0.0005  36  TYR B CB  
993  C CG  . TYR B 36  ? 0.5119 0.5646 0.5702 -0.0121 -0.0172 -0.0011 36  TYR B CG  
994  C CD1 . TYR B 36  ? 0.5560 0.6030 0.6073 -0.0146 -0.0157 0.0025  36  TYR B CD1 
995  C CD2 . TYR B 36  ? 0.4707 0.5256 0.5224 -0.0125 -0.0124 -0.0057 36  TYR B CD2 
996  C CE1 . TYR B 36  ? 0.5954 0.6405 0.6341 -0.0178 -0.0091 0.0019  36  TYR B CE1 
997  C CE2 . TYR B 36  ? 0.5325 0.5852 0.5723 -0.0147 -0.0054 -0.0068 36  TYR B CE2 
998  C CZ  . TYR B 36  ? 0.5995 0.6481 0.6332 -0.0175 -0.0035 -0.0028 36  TYR B CZ  
999  O OH  . TYR B 36  ? 0.6580 0.7060 0.6817 -0.0198 0.0047  -0.0031 36  TYR B OH  
1000 N N   . LEU B 37  ? 0.5366 0.6109 0.6445 -0.0013 -0.0193 -0.0047 37  LEU B N   
1001 C CA  . LEU B 37  ? 0.5191 0.5996 0.6430 0.0016  -0.0206 -0.0035 37  LEU B CA  
1002 C C   . LEU B 37  ? 0.5247 0.6084 0.6484 0.0000  -0.0227 -0.0054 37  LEU B C   
1003 O O   . LEU B 37  ? 0.5659 0.6487 0.6801 -0.0013 -0.0193 -0.0095 37  LEU B O   
1004 C CB  . LEU B 37  ? 0.4979 0.5816 0.6298 0.0050  -0.0128 -0.0059 37  LEU B CB  
1005 C CG  . LEU B 37  ? 0.5357 0.6255 0.6841 0.0087  -0.0109 -0.0045 37  LEU B CG  
1006 C CD1 . LEU B 37  ? 0.5184 0.6088 0.6800 0.0111  -0.0158 0.0015  37  LEU B CD1 
1007 C CD2 . LEU B 37  ? 0.5697 0.6589 0.7185 0.0114  -0.0022 -0.0080 37  LEU B CD2 
1008 N N   . LEU B 38  ? 0.4542 0.5415 0.5901 0.0001  -0.0285 -0.0017 38  LEU B N   
1009 C CA  . LEU B 38  ? 0.3788 0.4689 0.5175 -0.0017 -0.0308 -0.0029 38  LEU B CA  
1010 C C   . LEU B 38  ? 0.4256 0.5237 0.5779 0.0014  -0.0236 -0.0039 38  LEU B C   
1011 O O   . LEU B 38  ? 0.4150 0.5192 0.5839 0.0040  -0.0227 -0.0001 38  LEU B O   
1012 C CB  . LEU B 38  ? 0.3279 0.4182 0.4738 -0.0046 -0.0419 0.0023  38  LEU B CB  
1013 C CG  . LEU B 38  ? 0.3526 0.4324 0.4806 -0.0090 -0.0508 0.0034  38  LEU B CG  
1014 C CD1 . LEU B 38  ? 0.3046 0.3853 0.4419 -0.0125 -0.0638 0.0097  38  LEU B CD1 
1015 C CD2 . LEU B 38  ? 0.3832 0.4546 0.4902 -0.0118 -0.0485 -0.0029 38  LEU B CD2 
1016 N N   . LEU B 39  ? 0.4251 0.5230 0.5701 0.0014  -0.0181 -0.0084 39  LEU B N   
1017 C CA  . LEU B 39  ? 0.3988 0.5024 0.5523 0.0037  -0.0115 -0.0092 39  LEU B CA  
1018 C C   . LEU B 39  ? 0.3819 0.4895 0.5455 0.0021  -0.0142 -0.0069 39  LEU B C   
1019 O O   . LEU B 39  ? 0.4183 0.5219 0.5762 -0.0011 -0.0197 -0.0078 39  LEU B O   
1020 C CB  . LEU B 39  ? 0.3331 0.4351 0.4759 0.0039  -0.0062 -0.0137 39  LEU B CB  
1021 C CG  . LEU B 39  ? 0.3778 0.4773 0.5134 0.0048  -0.0025 -0.0155 39  LEU B CG  
1022 C CD1 . LEU B 39  ? 0.3874 0.4875 0.5164 0.0044  0.0012  -0.0187 39  LEU B CD1 
1023 C CD2 . LEU B 39  ? 0.3629 0.4631 0.5057 0.0075  0.0012  -0.0142 39  LEU B CD2 
1024 N N   . PRO B 40  ? 0.4527 0.5671 0.6308 0.0042  -0.0097 -0.0040 40  PRO B N   
1025 C CA  . PRO B 40  ? 0.4824 0.6014 0.6712 0.0021  -0.0111 -0.0012 40  PRO B CA  
1026 C C   . PRO B 40  ? 0.4476 0.5635 0.6266 0.0012  -0.0079 -0.0046 40  PRO B C   
1027 O O   . PRO B 40  ? 0.4974 0.6135 0.6711 0.0035  -0.0008 -0.0067 40  PRO B O   
1028 C CB  . PRO B 40  ? 0.4864 0.6134 0.6918 0.0056  -0.0038 0.0027  40  PRO B CB  
1029 C CG  . PRO B 40  ? 0.4798 0.6053 0.6851 0.0094  -0.0017 0.0024  40  PRO B CG  
1030 C CD  . PRO B 40  ? 0.4688 0.5860 0.6541 0.0085  -0.0029 -0.0029 40  PRO B CD  
1031 N N   . ARG B 41  ? 0.4016 0.5137 0.5778 -0.0024 -0.0137 -0.0051 41  ARG B N   
1032 C CA  . ARG B 41  ? 0.3884 0.4967 0.5574 -0.0028 -0.0113 -0.0075 41  ARG B CA  
1033 C C   . ARG B 41  ? 0.4109 0.5247 0.5875 -0.0018 -0.0046 -0.0047 41  ARG B C   
1034 O O   . ARG B 41  ? 0.4155 0.5274 0.5842 -0.0004 -0.0006 -0.0065 41  ARG B O   
1035 C CB  . ARG B 41  ? 0.4036 0.5051 0.5702 -0.0069 -0.0187 -0.0079 41  ARG B CB  
1036 C CG  . ARG B 41  ? 0.4238 0.5151 0.5736 -0.0073 -0.0220 -0.0131 41  ARG B CG  
1037 C CD  . ARG B 41  ? 0.4236 0.5046 0.5680 -0.0115 -0.0290 -0.0144 41  ARG B CD  
1038 N NE  . ARG B 41  ? 0.4327 0.5020 0.5584 -0.0110 -0.0294 -0.0201 41  ARG B NE  
1039 C CZ  . ARG B 41  ? 0.4458 0.5104 0.5637 -0.0077 -0.0237 -0.0240 41  ARG B CZ  
1040 N NH1 . ARG B 41  ? 0.4332 0.5032 0.5593 -0.0052 -0.0190 -0.0225 41  ARG B NH1 
1041 N NH2 . ARG B 41  ? 0.4130 0.4673 0.5149 -0.0067 -0.0225 -0.0290 41  ARG B NH2 
1042 N N   . VAL B 42  ? 0.3969 0.5176 0.5890 -0.0025 -0.0034 0.0003  42  VAL B N   
1043 C CA  . VAL B 42  ? 0.3709 0.4961 0.5699 -0.0024 0.0034  0.0038  42  VAL B CA  
1044 C C   . VAL B 42  ? 0.4390 0.5665 0.6347 0.0018  0.0134  0.0033  42  VAL B C   
1045 O O   . VAL B 42  ? 0.4509 0.5801 0.6475 0.0020  0.0204  0.0057  42  VAL B O   
1046 C CB  . VAL B 42  ? 0.3344 0.4670 0.5538 -0.0052 0.0017  0.0103  42  VAL B CB  
1047 C CG1 . VAL B 42  ? 0.3502 0.4779 0.5709 -0.0108 -0.0087 0.0110  42  VAL B CG1 
1048 C CG2 . VAL B 42  ? 0.3304 0.4700 0.5631 -0.0029 0.0017  0.0129  42  VAL B CG2 
1049 N N   . SER B 43  ? 0.4265 0.5524 0.6167 0.0046  0.0141  0.0001  43  SER B N   
1050 C CA  . SER B 43  ? 0.4115 0.5370 0.5978 0.0083  0.0231  -0.0011 43  SER B CA  
1051 C C   . SER B 43  ? 0.4296 0.5481 0.5967 0.0086  0.0238  -0.0061 43  SER B C   
1052 O O   . SER B 43  ? 0.4445 0.5605 0.6042 0.0066  0.0188  -0.0078 43  SER B O   
1053 C CB  . SER B 43  ? 0.4535 0.5815 0.6498 0.0113  0.0237  -0.0001 43  SER B CB  
1054 O OG  . SER B 43  ? 0.5743 0.7013 0.7701 0.0154  0.0341  -0.0006 43  SER B OG  
1055 N N   . TYR B 44  ? 0.3743 0.4891 0.5341 0.0111  0.0298  -0.0084 44  TYR B N   
1056 C CA  . TYR B 44  ? 0.3542 0.4625 0.4967 0.0102  0.0295  -0.0125 44  TYR B CA  
1057 C C   . TYR B 44  ? 0.4215 0.5258 0.5598 0.0112  0.0280  -0.0158 44  TYR B C   
1058 O O   . TYR B 44  ? 0.5150 0.6192 0.6609 0.0139  0.0305  -0.0152 44  TYR B O   
1059 C CB  . TYR B 44  ? 0.3635 0.4672 0.4950 0.0105  0.0370  -0.0128 44  TYR B CB  
1060 C CG  . TYR B 44  ? 0.4193 0.5264 0.5545 0.0092  0.0394  -0.0086 44  TYR B CG  
1061 C CD1 . TYR B 44  ? 0.4465 0.5521 0.5738 0.0064  0.0351  -0.0077 44  TYR B CD1 
1062 C CD2 . TYR B 44  ? 0.4562 0.5684 0.6047 0.0107  0.0460  -0.0046 44  TYR B CD2 
1063 C CE1 . TYR B 44  ? 0.4916 0.5989 0.6218 0.0049  0.0369  -0.0031 44  TYR B CE1 
1064 C CE2 . TYR B 44  ? 0.4935 0.6086 0.6460 0.0087  0.0483  0.0000  44  TYR B CE2 
1065 C CZ  . TYR B 44  ? 0.5323 0.6441 0.6745 0.0056  0.0436  0.0007  44  TYR B CZ  
1066 O OH  . TYR B 44  ? 0.6017 0.7152 0.7474 0.0033  0.0457  0.0059  44  TYR B OH  
1067 N N   . LEU B 45  ? 0.4006 0.5018 0.5286 0.0091  0.0238  -0.0185 45  LEU B N   
1068 C CA  . LEU B 45  ? 0.4885 0.5858 0.6124 0.0088  0.0218  -0.0209 45  LEU B CA  
1069 C C   . LEU B 45  ? 0.5661 0.6561 0.6855 0.0109  0.0274  -0.0228 45  LEU B C   
1070 O O   . LEU B 45  ? 0.6225 0.7105 0.7471 0.0128  0.0274  -0.0226 45  LEU B O   
1071 C CB  . LEU B 45  ? 0.5074 0.6038 0.6225 0.0057  0.0176  -0.0227 45  LEU B CB  
1072 C CG  . LEU B 45  ? 0.5477 0.6492 0.6673 0.0047  0.0129  -0.0218 45  LEU B CG  
1073 C CD1 . LEU B 45  ? 0.5491 0.6519 0.6638 0.0025  0.0104  -0.0225 45  LEU B CD1 
1074 C CD2 . LEU B 45  ? 0.5414 0.6426 0.6644 0.0051  0.0108  -0.0217 45  LEU B CD2 
1075 N N   . THR B 46  ? 0.5660 0.6504 0.6744 0.0105  0.0321  -0.0246 46  THR B N   
1076 C CA  . THR B 46  ? 0.5483 0.6221 0.6479 0.0124  0.0383  -0.0277 46  THR B CA  
1077 C C   . THR B 46  ? 0.5598 0.6345 0.6706 0.0179  0.0467  -0.0260 46  THR B C   
1078 O O   . THR B 46  ? 0.5924 0.6573 0.6968 0.0209  0.0541  -0.0287 46  THR B O   
1079 C CB  . THR B 46  ? 0.5021 0.5671 0.5823 0.0096  0.0404  -0.0305 46  THR B CB  
1080 O OG1 . THR B 46  ? 0.5306 0.6005 0.6114 0.0096  0.0432  -0.0276 46  THR B OG1 
1081 C CG2 . THR B 46  ? 0.4159 0.4797 0.4873 0.0041  0.0316  -0.0317 46  THR B CG2 
1082 N N   . LEU B 47  ? 0.5035 0.5894 0.6315 0.0192  0.0457  -0.0214 47  LEU B N   
1083 C CA  . LEU B 47  ? 0.4646 0.5548 0.6088 0.0242  0.0529  -0.0181 47  LEU B CA  
1084 C C   . LEU B 47  ? 0.4810 0.5760 0.6419 0.0263  0.0475  -0.0151 47  LEU B C   
1085 O O   . LEU B 47  ? 0.5485 0.6454 0.7239 0.0313  0.0526  -0.0125 47  LEU B O   
1086 C CB  . LEU B 47  ? 0.4075 0.5072 0.5614 0.0234  0.0552  -0.0137 47  LEU B CB  
1087 C CG  . LEU B 47  ? 0.3714 0.4788 0.5461 0.0278  0.0630  -0.0088 47  LEU B CG  
1088 C CD1 . LEU B 47  ? 0.4092 0.5079 0.5765 0.0328  0.0768  -0.0114 47  LEU B CD1 
1089 C CD2 . LEU B 47  ? 0.3728 0.4901 0.5579 0.0251  0.0628  -0.0036 47  LEU B CD2 
1090 N N   . VAL B 48  ? 0.3775 0.4742 0.5363 0.0226  0.0375  -0.0152 48  VAL B N   
1091 C CA  . VAL B 48  ? 0.3941 0.4949 0.5660 0.0233  0.0307  -0.0115 48  VAL B CA  
1092 C C   . VAL B 48  ? 0.4631 0.5563 0.6258 0.0221  0.0259  -0.0135 48  VAL B C   
1093 O O   . VAL B 48  ? 0.5114 0.6062 0.6810 0.0219  0.0194  -0.0103 48  VAL B O   
1094 C CB  . VAL B 48  ? 0.3835 0.4926 0.5620 0.0195  0.0227  -0.0084 48  VAL B CB  
1095 C CG1 . VAL B 48  ? 0.2978 0.4144 0.4870 0.0197  0.0268  -0.0054 48  VAL B CG1 
1096 C CG2 . VAL B 48  ? 0.4040 0.5101 0.5670 0.0152  0.0179  -0.0119 48  VAL B CG2 
1097 N N   . THR B 49  ? 0.4391 0.5236 0.5859 0.0206  0.0284  -0.0183 49  THR B N   
1098 C CA  . THR B 49  ? 0.4996 0.5772 0.6379 0.0183  0.0239  -0.0197 49  THR B CA  
1099 C C   . THR B 49  ? 0.5379 0.6036 0.6721 0.0210  0.0284  -0.0217 49  THR B C   
1100 O O   . THR B 49  ? 0.5613 0.6187 0.6840 0.0178  0.0265  -0.0243 49  THR B O   
1101 C CB  . THR B 49  ? 0.5081 0.5853 0.6332 0.0129  0.0208  -0.0226 49  THR B CB  
1102 O OG1 . THR B 49  ? 0.5494 0.6233 0.6653 0.0122  0.0253  -0.0258 49  THR B OG1 
1103 C CG2 . THR B 49  ? 0.4521 0.5385 0.5810 0.0107  0.0159  -0.0207 49  THR B CG2 
1104 N N   . ASP B 50  ? 0.5625 0.6271 0.7074 0.0271  0.0347  -0.0203 50  ASP B N   
1105 C CA  . ASP B 50  ? 0.5582 0.6094 0.6999 0.0310  0.0400  -0.0225 50  ASP B CA  
1106 C C   . ASP B 50  ? 0.5812 0.6272 0.7246 0.0301  0.0333  -0.0199 50  ASP B C   
1107 O O   . ASP B 50  ? 0.5915 0.6239 0.7235 0.0289  0.0341  -0.0231 50  ASP B O   
1108 C CB  . ASP B 50  ? 0.5498 0.6021 0.7062 0.0389  0.0494  -0.0206 50  ASP B CB  
1109 C CG  . ASP B 50  ? 0.6367 0.6882 0.7854 0.0399  0.0591  -0.0241 50  ASP B CG  
1110 O OD1 . ASP B 50  ? 0.6551 0.6996 0.7831 0.0348  0.0587  -0.0291 50  ASP B OD1 
1111 O OD2 . ASP B 50  ? 0.6689 0.7267 0.8324 0.0454  0.0671  -0.0213 50  ASP B OD2 
1112 N N   . LYS B 51  ? 0.5645 0.6200 0.7206 0.0301  0.0262  -0.0140 51  LYS B N   
1113 C CA  . LYS B 51  ? 0.5329 0.5835 0.6889 0.0287  0.0192  -0.0105 51  LYS B CA  
1114 C C   . LYS B 51  ? 0.5686 0.6148 0.7073 0.0214  0.0152  -0.0132 51  LYS B C   
1115 O O   . LYS B 51  ? 0.6179 0.6547 0.7510 0.0195  0.0127  -0.0123 51  LYS B O   
1116 C CB  . LYS B 51  ? 0.4876 0.5483 0.6575 0.0290  0.0112  -0.0033 51  LYS B CB  
1117 C CG  . LYS B 51  ? 0.5228 0.5877 0.7146 0.0363  0.0133  0.0018  51  LYS B CG  
1118 C CD  . LYS B 51  ? 0.5899 0.6650 0.7950 0.0349  0.0028  0.0094  51  LYS B CD  
1119 C CE  . LYS B 51  ? 0.6177 0.7002 0.8496 0.0420  0.0043  0.0158  51  LYS B CE  
1120 N NZ  . LYS B 51  ? 0.5992 0.6934 0.8451 0.0393  -0.0072 0.0232  51  LYS B NZ  
1121 N N   . VAL B 52  ? 0.6052 0.6584 0.7372 0.0173  0.0149  -0.0160 52  VAL B N   
1122 C CA  . VAL B 52  ? 0.5988 0.6506 0.7182 0.0108  0.0121  -0.0181 52  VAL B CA  
1123 C C   . VAL B 52  ? 0.6185 0.6588 0.7271 0.0089  0.0155  -0.0226 52  VAL B C   
1124 O O   . VAL B 52  ? 0.6031 0.6372 0.7049 0.0043  0.0129  -0.0225 52  VAL B O   
1125 C CB  . VAL B 52  ? 0.5319 0.5945 0.6495 0.0081  0.0111  -0.0193 52  VAL B CB  
1126 C CG1 . VAL B 52  ? 0.4808 0.5435 0.5892 0.0022  0.0093  -0.0208 52  VAL B CG1 
1127 C CG2 . VAL B 52  ? 0.4691 0.5400 0.5943 0.0089  0.0070  -0.0156 52  VAL B CG2 
1128 N N   . LYS B 53  ? 0.6048 0.6415 0.7111 0.0118  0.0213  -0.0264 53  LYS B N   
1129 C CA  . LYS B 53  ? 0.6280 0.6507 0.7208 0.0097  0.0242  -0.0314 53  LYS B CA  
1130 C C   . LYS B 53  ? 0.6733 0.6809 0.7651 0.0116  0.0251  -0.0313 53  LYS B C   
1131 O O   . LYS B 53  ? 0.6878 0.6842 0.7690 0.0065  0.0228  -0.0335 53  LYS B O   
1132 C CB  . LYS B 53  ? 0.5871 0.6069 0.6748 0.0129  0.0313  -0.0354 53  LYS B CB  
1133 C CG  . LYS B 53  ? 0.6436 0.6455 0.7130 0.0104  0.0342  -0.0414 53  LYS B CG  
1134 C CD  . LYS B 53  ? 0.6950 0.6952 0.7534 0.0106  0.0393  -0.0451 53  LYS B CD  
1135 C CE  . LYS B 53  ? 0.7227 0.7235 0.7891 0.0192  0.0496  -0.0448 53  LYS B CE  
1136 N NZ  . LYS B 53  ? 0.7264 0.7253 0.7800 0.0187  0.0553  -0.0477 53  LYS B NZ  
1137 N N   . LYS B 54  ? 0.5989 0.6064 0.7033 0.0188  0.0279  -0.0282 54  LYS B N   
1138 C CA  . LYS B 54  ? 0.5542 0.5471 0.6601 0.0220  0.0289  -0.0272 54  LYS B CA  
1139 C C   . LYS B 54  ? 0.6303 0.6214 0.7341 0.0163  0.0209  -0.0231 54  LYS B C   
1140 O O   . LYS B 54  ? 0.6692 0.6448 0.7659 0.0144  0.0203  -0.0239 54  LYS B O   
1141 C CB  . LYS B 54  ? 0.5597 0.5561 0.6841 0.0314  0.0326  -0.0229 54  LYS B CB  
1142 C CG  . LYS B 54  ? 0.7182 0.6979 0.8456 0.0365  0.0350  -0.0219 54  LYS B CG  
1143 C CD  . LYS B 54  ? 0.7802 0.7668 0.9309 0.0458  0.0368  -0.0155 54  LYS B CD  
1144 C CE  . LYS B 54  ? 0.8011 0.7712 0.9568 0.0513  0.0378  -0.0131 54  LYS B CE  
1145 N NZ  . LYS B 54  ? 0.8345 0.8135 1.0167 0.0603  0.0377  -0.0051 54  LYS B NZ  
1146 N N   . HIS B 55  ? 0.5699 0.5757 0.6786 0.0133  0.0153  -0.0187 55  HIS B N   
1147 C CA  . HIS B 55  ? 0.5287 0.5338 0.6345 0.0081  0.0090  -0.0140 55  HIS B CA  
1148 C C   . HIS B 55  ? 0.5856 0.5840 0.6791 0.0001  0.0080  -0.0168 55  HIS B C   
1149 O O   . HIS B 55  ? 0.6934 0.6801 0.7829 -0.0028 0.0061  -0.0147 55  HIS B O   
1150 C CB  . HIS B 55  ? 0.5159 0.5364 0.6257 0.0065  0.0048  -0.0103 55  HIS B CB  
1151 C CG  . HIS B 55  ? 0.5171 0.5373 0.6205 0.0006  0.0001  -0.0060 55  HIS B CG  
1152 N ND1 . HIS B 55  ? 0.5327 0.5469 0.6374 0.0012  -0.0042 0.0002  55  HIS B ND1 
1153 C CD2 . HIS B 55  ? 0.4636 0.4890 0.5596 -0.0059 -0.0003 -0.0066 55  HIS B CD2 
1154 C CE1 . HIS B 55  ? 0.5242 0.5388 0.6200 -0.0051 -0.0065 0.0031  55  HIS B CE1 
1155 N NE2 . HIS B 55  ? 0.5018 0.5238 0.5935 -0.0092 -0.0035 -0.0011 55  HIS B NE2 
1156 N N   . PHE B 56  ? 0.5661 0.5719 0.6547 -0.0038 0.0088  -0.0206 56  PHE B N   
1157 C CA  . PHE B 56  ? 0.5657 0.5681 0.6459 -0.0121 0.0066  -0.0222 56  PHE B CA  
1158 C C   . PHE B 56  ? 0.6054 0.5895 0.6759 -0.0138 0.0079  -0.0271 56  PHE B C   
1159 O O   . PHE B 56  ? 0.6675 0.6447 0.7317 -0.0214 0.0047  -0.0273 56  PHE B O   
1160 C CB  . PHE B 56  ? 0.5182 0.5352 0.5986 -0.0156 0.0058  -0.0236 56  PHE B CB  
1161 C CG  . PHE B 56  ? 0.5527 0.5843 0.6394 -0.0154 0.0047  -0.0194 56  PHE B CG  
1162 C CD1 . PHE B 56  ? 0.5556 0.5896 0.6420 -0.0204 0.0030  -0.0153 56  PHE B CD1 
1163 C CD2 . PHE B 56  ? 0.5243 0.5658 0.6162 -0.0105 0.0059  -0.0198 56  PHE B CD2 
1164 C CE1 . PHE B 56  ? 0.5166 0.5614 0.6055 -0.0200 0.0032  -0.0123 56  PHE B CE1 
1165 C CE2 . PHE B 56  ? 0.5250 0.5768 0.6199 -0.0106 0.0048  -0.0168 56  PHE B CE2 
1166 C CZ  . PHE B 56  ? 0.5057 0.5584 0.5979 -0.0151 0.0038  -0.0135 56  PHE B CZ  
1167 N N   . GLN B 57  ? 0.6006 0.5761 0.6695 -0.0070 0.0130  -0.0310 57  GLN B N   
1168 C CA  . GLN B 57  ? 0.6418 0.5962 0.6980 -0.0079 0.0153  -0.0368 57  GLN B CA  
1169 C C   . GLN B 57  ? 0.6783 0.6158 0.7341 -0.0077 0.0144  -0.0347 57  GLN B C   
1170 O O   . GLN B 57  ? 0.7190 0.6373 0.7626 -0.0119 0.0138  -0.0388 57  GLN B O   
1171 C CB  . GLN B 57  ? 0.6458 0.5950 0.6990 -0.0001 0.0233  -0.0418 57  GLN B CB  
1172 C CG  . GLN B 57  ? 0.7091 0.6660 0.7542 -0.0029 0.0238  -0.0455 57  GLN B CG  
1173 C CD  . GLN B 57  ? 0.8198 0.7699 0.8596 0.0043  0.0330  -0.0502 57  GLN B CD  
1174 O OE1 . GLN B 57  ? 0.8921 0.8323 0.9360 0.0121  0.0400  -0.0509 57  GLN B OE1 
1175 N NE2 . GLN B 57  ? 0.8257 0.7812 0.8570 0.0019  0.0337  -0.0527 57  GLN B NE2 
1176 N N   . LYS B 58  ? 0.6595 0.6029 0.7277 -0.0034 0.0133  -0.0281 58  LYS B N   
1177 C CA  . LYS B 58  ? 0.6674 0.5958 0.7363 -0.0034 0.0113  -0.0242 58  LYS B CA  
1178 C C   . LYS B 58  ? 0.7386 0.6618 0.7995 -0.0147 0.0057  -0.0226 58  LYS B C   
1179 O O   . LYS B 58  ? 0.9022 0.8060 0.9576 -0.0171 0.0046  -0.0225 58  LYS B O   
1180 C CB  . LYS B 58  ? 0.6688 0.6069 0.7515 0.0018  0.0090  -0.0160 58  LYS B CB  
1181 C CG  . LYS B 58  ? 0.7257 0.6676 0.8209 0.0129  0.0135  -0.0155 58  LYS B CG  
1182 C CD  . LYS B 58  ? 0.8107 0.7623 0.9187 0.0159  0.0081  -0.0064 58  LYS B CD  
1183 C CE  . LYS B 58  ? 0.9183 0.8791 1.0428 0.0257  0.0111  -0.0046 58  LYS B CE  
1184 N NZ  . LYS B 58  ? 0.9998 0.9455 1.1306 0.0345  0.0179  -0.0065 58  LYS B NZ  
1185 N N   . VAL B 59  ? 0.6903 0.6305 0.7521 -0.0214 0.0027  -0.0208 59  VAL B N   
1186 C CA  . VAL B 59  ? 0.6911 0.6304 0.7496 -0.0322 -0.0018 -0.0176 59  VAL B CA  
1187 C C   . VAL B 59  ? 0.6942 0.6296 0.7444 -0.0401 -0.0041 -0.0230 59  VAL B C   
1188 O O   . VAL B 59  ? 0.7505 0.6912 0.8017 -0.0497 -0.0081 -0.0201 59  VAL B O   
1189 C CB  . VAL B 59  ? 0.6831 0.6430 0.7489 -0.0351 -0.0032 -0.0111 59  VAL B CB  
1190 C CG1 . VAL B 59  ? 0.6848 0.6463 0.7555 -0.0288 -0.0030 -0.0054 59  VAL B CG1 
1191 C CG2 . VAL B 59  ? 0.7246 0.7033 0.7936 -0.0344 -0.0020 -0.0140 59  VAL B CG2 
1192 N N   . MET B 60  ? 0.7440 0.6700 0.7860 -0.0365 -0.0016 -0.0305 60  MET B N   
1193 C CA  . MET B 60  ? 0.7484 0.6680 0.7790 -0.0445 -0.0051 -0.0358 60  MET B CA  
1194 C C   . MET B 60  ? 0.8084 0.6992 0.8227 -0.0438 -0.0035 -0.0430 60  MET B C   
1195 O O   . MET B 60  ? 0.8397 0.7202 0.8522 -0.0338 0.0034  -0.0461 60  MET B O   
1196 C CB  . MET B 60  ? 0.6795 0.6159 0.7109 -0.0426 -0.0042 -0.0383 60  MET B CB  
1197 C CG  . MET B 60  ? 0.6440 0.6064 0.6899 -0.0433 -0.0054 -0.0322 60  MET B CG  
1198 S SD  . MET B 60  ? 0.9297 0.9086 0.9758 -0.0449 -0.0074 -0.0343 60  MET B SD  
1199 C CE  . MET B 60  ? 1.1020 1.0703 1.1383 -0.0579 -0.0159 -0.0361 60  MET B CE  
1200 N N   . ARG B 61  ? 0.8193 0.6970 0.8223 -0.0547 -0.0098 -0.0456 61  ARG B N   
1201 C CA  . ARG B 61  ? 0.8911 0.7384 0.8737 -0.0556 -0.0089 -0.0540 61  ARG B CA  
1202 C C   . ARG B 61  ? 0.9255 0.7709 0.8960 -0.0498 -0.0037 -0.0613 61  ARG B C   
1203 O O   . ARG B 61  ? 0.9091 0.7753 0.8843 -0.0503 -0.0051 -0.0599 61  ARG B O   
1204 C CB  . ARG B 61  ? 0.9326 0.7677 0.9050 -0.0705 -0.0189 -0.0549 61  ARG B CB  
1205 C CG  . ARG B 61  ? 0.9550 0.7894 0.9380 -0.0778 -0.0236 -0.0474 61  ARG B CG  
1206 C CD  . ARG B 61  ? 1.0161 0.8307 0.9864 -0.0922 -0.0330 -0.0497 61  ARG B CD  
1207 N NE  . ARG B 61  ? 1.0938 0.8739 1.0398 -0.0902 -0.0309 -0.0600 61  ARG B NE  
1208 C CZ  . ARG B 61  ? 1.1621 0.9149 1.1010 -0.0875 -0.0279 -0.0621 61  ARG B CZ  
1209 N NH1 . ARG B 61  ? 1.1520 0.9085 1.1062 -0.0870 -0.0277 -0.0538 61  ARG B NH1 
1210 N NH2 . ARG B 61  ? 1.2195 0.9399 1.1348 -0.0850 -0.0247 -0.0724 61  ARG B NH2 
1211 N N   . GLN B 62  ? 1.0244 0.8436 0.9787 -0.0440 0.0031  -0.0689 62  GLN B N   
1212 C CA  . GLN B 62  ? 1.0813 0.8952 1.0211 -0.0382 0.0101  -0.0761 62  GLN B CA  
1213 C C   . GLN B 62  ? 1.0825 0.8964 1.0056 -0.0495 0.0016  -0.0793 62  GLN B C   
1214 O O   . GLN B 62  ? 1.0891 0.9132 1.0076 -0.0470 0.0041  -0.0809 62  GLN B O   
1215 C CB  . GLN B 62  ? 1.2028 0.9843 1.1257 -0.0310 0.0196  -0.0843 62  GLN B CB  
1216 C CG  . GLN B 62  ? 1.2822 1.0590 1.1928 -0.0221 0.0310  -0.0908 62  GLN B CG  
1217 C CD  . GLN B 62  ? 1.3303 1.1332 1.2655 -0.0101 0.0393  -0.0850 62  GLN B CD  
1218 O OE1 . GLN B 62  ? 1.2776 1.0949 1.2363 -0.0060 0.0382  -0.0776 62  GLN B OE1 
1219 N NE2 . GLN B 62  ? 1.3983 1.2064 1.3269 -0.0051 0.0471  -0.0881 62  GLN B NE2 
1220 N N   . GLU B 63  ? 1.1069 0.9098 1.0222 -0.0624 -0.0093 -0.0793 63  GLU B N   
1221 C CA  . GLU B 63  ? 1.1382 0.9401 1.0389 -0.0747 -0.0201 -0.0812 63  GLU B CA  
1222 C C   . GLU B 63  ? 1.0911 0.9281 1.0118 -0.0778 -0.0261 -0.0732 63  GLU B C   
1223 O O   . GLU B 63  ? 1.1167 0.9576 1.0286 -0.0858 -0.0345 -0.0736 63  GLU B O   
1224 C CB  . GLU B 63  ? 1.1990 0.9805 1.0896 -0.0886 -0.0311 -0.0822 63  GLU B CB  
1225 C CG  . GLU B 63  ? 1.2302 1.0199 1.1433 -0.0908 -0.0333 -0.0742 63  GLU B CG  
1226 C CD  . GLU B 63  ? 1.2570 1.0287 1.1626 -0.1061 -0.0450 -0.0739 63  GLU B CD  
1227 O OE1 . GLU B 63  ? 1.2046 0.9683 1.1186 -0.1071 -0.0445 -0.0704 63  GLU B OE1 
1228 O OE2 . GLU B 63  ? 1.3206 1.0861 1.2119 -0.1178 -0.0556 -0.0766 63  GLU B OE2 
1229 N N   . ASP B 64  ? 1.0061 0.8673 0.9526 -0.0714 -0.0221 -0.0660 64  ASP B N   
1230 C CA  . ASP B 64  ? 0.9441 0.8370 0.9105 -0.0737 -0.0266 -0.0585 64  ASP B CA  
1231 C C   . ASP B 64  ? 0.9518 0.8626 0.9263 -0.0625 -0.0186 -0.0577 64  ASP B C   
1232 O O   . ASP B 64  ? 0.9446 0.8794 0.9331 -0.0632 -0.0215 -0.0526 64  ASP B O   
1233 C CB  . ASP B 64  ? 0.9407 0.8481 0.9288 -0.0772 -0.0292 -0.0504 64  ASP B CB  
1234 C CG  . ASP B 64  ? 1.0299 0.9232 1.0135 -0.0900 -0.0381 -0.0495 64  ASP B CG  
1235 O OD1 . ASP B 64  ? 1.0910 0.9734 1.0602 -0.0993 -0.0466 -0.0529 64  ASP B OD1 
1236 O OD2 . ASP B 64  ? 1.0603 0.9525 1.0540 -0.0915 -0.0373 -0.0449 64  ASP B OD2 
1237 N N   . ILE B 65  ? 0.9659 0.8653 0.9333 -0.0522 -0.0083 -0.0623 65  ILE B N   
1238 C CA  . ILE B 65  ? 0.9601 0.8759 0.9362 -0.0423 -0.0009 -0.0611 65  ILE B CA  
1239 C C   . ILE B 65  ? 0.9153 0.8280 0.8747 -0.0433 -0.0007 -0.0652 65  ILE B C   
1240 O O   . ILE B 65  ? 0.9642 0.8535 0.8993 -0.0463 -0.0004 -0.0719 65  ILE B O   
1241 C CB  . ILE B 65  ? 1.0179 0.9282 1.0001 -0.0303 0.0102  -0.0621 65  ILE B CB  
1242 C CG1 . ILE B 65  ? 1.1581 1.0395 1.1191 -0.0271 0.0172  -0.0702 65  ILE B CG1 
1243 C CG2 . ILE B 65  ? 0.9614 0.8758 0.9599 -0.0295 0.0088  -0.0566 65  ILE B CG2 
1244 C CD1 . ILE B 65  ? 1.2178 1.0950 1.1883 -0.0144 0.0286  -0.0704 65  ILE B CD1 
1245 N N   . SER B 66  ? 0.8487 0.7836 0.8194 -0.0410 -0.0009 -0.0611 66  SER B N   
1246 C CA  . SER B 66  ? 0.7573 0.6922 0.7142 -0.0423 -0.0018 -0.0630 66  SER B CA  
1247 C C   . SER B 66  ? 0.7519 0.7039 0.7221 -0.0329 0.0061  -0.0601 66  SER B C   
1248 O O   . SER B 66  ? 0.7466 0.7062 0.7333 -0.0256 0.0122  -0.0579 66  SER B O   
1249 C CB  . SER B 66  ? 0.7330 0.6791 0.6924 -0.0526 -0.0149 -0.0589 66  SER B CB  
1250 O OG  . SER B 66  ? 0.9508 0.9043 0.9044 -0.0523 -0.0162 -0.0578 66  SER B OG  
1251 N N   . GLU B 67  ? 0.7038 0.6614 0.6670 -0.0335 0.0053  -0.0595 67  GLU B N   
1252 C CA  . GLU B 67  ? 0.6611 0.6365 0.6392 -0.0263 0.0109  -0.0556 67  GLU B CA  
1253 C C   . GLU B 67  ? 0.6642 0.6610 0.6672 -0.0263 0.0060  -0.0496 67  GLU B C   
1254 O O   . GLU B 67  ? 0.6421 0.6453 0.6495 -0.0332 -0.0030 -0.0469 67  GLU B O   
1255 C CB  . GLU B 67  ? 0.6581 0.6360 0.6248 -0.0284 0.0090  -0.0548 67  GLU B CB  
1256 C CG  . GLU B 67  ? 0.6889 0.6829 0.6699 -0.0213 0.0153  -0.0508 67  GLU B CG  
1257 C CD  . GLU B 67  ? 0.7684 0.7633 0.7372 -0.0235 0.0135  -0.0492 67  GLU B CD  
1258 O OE1 . GLU B 67  ? 0.8594 0.8440 0.8092 -0.0309 0.0059  -0.0504 67  GLU B OE1 
1259 O OE2 . GLU B 67  ? 0.6881 0.6934 0.6663 -0.0184 0.0190  -0.0460 67  GLU B OE2 
1260 N N   . ILE B 68  ? 0.6186 0.6256 0.6376 -0.0188 0.0122  -0.0473 68  ILE B N   
1261 C CA  . ILE B 68  ? 0.5633 0.5879 0.6022 -0.0183 0.0089  -0.0422 68  ILE B CA  
1262 C C   . ILE B 68  ? 0.6114 0.6513 0.6571 -0.0183 0.0063  -0.0388 68  ILE B C   
1263 O O   . ILE B 68  ? 0.6509 0.6901 0.6910 -0.0157 0.0097  -0.0393 68  ILE B O   
1264 C CB  . ILE B 68  ? 0.5199 0.5474 0.5712 -0.0112 0.0148  -0.0409 68  ILE B CB  
1265 C CG1 . ILE B 68  ? 0.5341 0.5738 0.5996 -0.0124 0.0108  -0.0365 68  ILE B CG1 
1266 C CG2 . ILE B 68  ? 0.4356 0.4692 0.4922 -0.0047 0.0210  -0.0401 68  ILE B CG2 
1267 C CD1 . ILE B 68  ? 0.5285 0.5714 0.6048 -0.0064 0.0142  -0.0343 68  ILE B CD1 
1268 N N   . TRP B 69  ? 0.5997 0.6525 0.6574 -0.0210 0.0010  -0.0350 69  TRP B N   
1269 C CA  . TRP B 69  ? 0.5689 0.6357 0.6356 -0.0196 -0.0006 -0.0316 69  TRP B CA  
1270 C C   . TRP B 69  ? 0.5850 0.6645 0.6675 -0.0185 -0.0012 -0.0284 69  TRP B C   
1271 O O   . TRP B 69  ? 0.5900 0.6692 0.6758 -0.0213 -0.0024 -0.0277 69  TRP B O   
1272 C CB  . TRP B 69  ? 0.5392 0.6067 0.5994 -0.0249 -0.0074 -0.0304 69  TRP B CB  
1273 C CG  . TRP B 69  ? 0.5629 0.6322 0.6258 -0.0320 -0.0148 -0.0288 69  TRP B CG  
1274 C CD1 . TRP B 69  ? 0.6046 0.6610 0.6561 -0.0380 -0.0182 -0.0314 69  TRP B CD1 
1275 C CD2 . TRP B 69  ? 0.5599 0.6446 0.6390 -0.0342 -0.0197 -0.0238 69  TRP B CD2 
1276 N NE1 . TRP B 69  ? 0.5983 0.6624 0.6591 -0.0447 -0.0258 -0.0277 69  TRP B NE1 
1277 C CE2 . TRP B 69  ? 0.5714 0.6538 0.6503 -0.0420 -0.0262 -0.0228 69  TRP B CE2 
1278 C CE3 . TRP B 69  ? 0.5524 0.6519 0.6467 -0.0301 -0.0186 -0.0200 69  TRP B CE3 
1279 C CZ2 . TRP B 69  ? 0.5431 0.6401 0.6393 -0.0457 -0.0311 -0.0174 69  TRP B CZ2 
1280 C CZ3 . TRP B 69  ? 0.5458 0.6583 0.6558 -0.0328 -0.0226 -0.0154 69  TRP B CZ3 
1281 C CH2 . TRP B 69  ? 0.5373 0.6497 0.6494 -0.0404 -0.0286 -0.0137 69  TRP B CH2 
1282 N N   . PHE B 70  ? 0.5356 0.6246 0.6263 -0.0146 0.0001  -0.0264 70  PHE B N   
1283 C CA  . PHE B 70  ? 0.5140 0.6119 0.6161 -0.0127 0.0013  -0.0244 70  PHE B CA  
1284 C C   . PHE B 70  ? 0.5032 0.6119 0.6140 -0.0131 -0.0013 -0.0215 70  PHE B C   
1285 O O   . PHE B 70  ? 0.5641 0.6741 0.6733 -0.0138 -0.0042 -0.0205 70  PHE B O   
1286 C CB  . PHE B 70  ? 0.5082 0.6060 0.6127 -0.0075 0.0051  -0.0248 70  PHE B CB  
1287 C CG  . PHE B 70  ? 0.4778 0.5667 0.5776 -0.0057 0.0079  -0.0266 70  PHE B CG  
1288 C CD1 . PHE B 70  ? 0.4794 0.5640 0.5794 -0.0060 0.0083  -0.0265 70  PHE B CD1 
1289 C CD2 . PHE B 70  ? 0.4433 0.5281 0.5392 -0.0034 0.0108  -0.0277 70  PHE B CD2 
1290 C CE1 . PHE B 70  ? 0.5004 0.5769 0.5987 -0.0034 0.0109  -0.0275 70  PHE B CE1 
1291 C CE2 . PHE B 70  ? 0.4354 0.5128 0.5298 -0.0006 0.0149  -0.0290 70  PHE B CE2 
1292 C CZ  . PHE B 70  ? 0.4568 0.5301 0.5532 -0.0003 0.0146  -0.0289 70  PHE B CZ  
1293 N N   . GLU B 71  ? 0.4887 0.6044 0.6082 -0.0125 0.0003  -0.0198 71  GLU B N   
1294 C CA  . GLU B 71  ? 0.5142 0.6403 0.6445 -0.0113 -0.0002 -0.0171 71  GLU B CA  
1295 C C   . GLU B 71  ? 0.5302 0.6597 0.6656 -0.0078 0.0051  -0.0171 71  GLU B C   
1296 O O   . GLU B 71  ? 0.5477 0.6737 0.6794 -0.0087 0.0077  -0.0178 71  GLU B O   
1297 C CB  . GLU B 71  ? 0.5022 0.6348 0.6397 -0.0163 -0.0045 -0.0139 71  GLU B CB  
1298 C CG  . GLU B 71  ? 0.6203 0.7526 0.7591 -0.0206 -0.0035 -0.0133 71  GLU B CG  
1299 C CD  . GLU B 71  ? 0.7347 0.8781 0.8871 -0.0197 0.0010  -0.0100 71  GLU B CD  
1300 O OE1 . GLU B 71  ? 0.7597 0.9049 0.9156 -0.0242 0.0018  -0.0081 71  GLU B OE1 
1301 O OE2 . GLU B 71  ? 0.7748 0.9242 0.9342 -0.0144 0.0044  -0.0094 71  GLU B OE2 
1302 N N   . TYR B 72  ? 0.5295 0.6641 0.6717 -0.0039 0.0066  -0.0162 72  TYR B N   
1303 C CA  . TYR B 72  ? 0.5003 0.6361 0.6449 -0.0004 0.0123  -0.0168 72  TYR B CA  
1304 C C   . TYR B 72  ? 0.5552 0.7013 0.7138 0.0012  0.0149  -0.0138 72  TYR B C   
1305 O O   . TYR B 72  ? 0.6399 0.7903 0.8064 0.0036  0.0125  -0.0119 72  TYR B O   
1306 C CB  . TYR B 72  ? 0.4606 0.5901 0.6000 0.0037  0.0132  -0.0193 72  TYR B CB  
1307 C CG  . TYR B 72  ? 0.5124 0.6403 0.6515 0.0072  0.0188  -0.0208 72  TYR B CG  
1308 C CD1 . TYR B 72  ? 0.4949 0.6171 0.6246 0.0063  0.0220  -0.0225 72  TYR B CD1 
1309 C CD2 . TYR B 72  ? 0.5028 0.6333 0.6495 0.0116  0.0211  -0.0203 72  TYR B CD2 
1310 C CE1 . TYR B 72  ? 0.4720 0.5901 0.5971 0.0092  0.0277  -0.0245 72  TYR B CE1 
1311 C CE2 . TYR B 72  ? 0.4978 0.6241 0.6417 0.0153  0.0275  -0.0226 72  TYR B CE2 
1312 C CZ  . TYR B 72  ? 0.4875 0.6071 0.6193 0.0138  0.0310  -0.0250 72  TYR B CZ  
1313 O OH  . TYR B 72  ? 0.5966 0.7095 0.7215 0.0171  0.0380  -0.0278 72  TYR B OH  
1314 N N   . GLU B 73  ? 0.5362 0.6864 0.6987 0.0001  0.0200  -0.0126 73  GLU B N   
1315 C CA  . GLU B 73  ? 0.5813 0.7433 0.7603 0.0019  0.0242  -0.0089 73  GLU B CA  
1316 C C   . GLU B 73  ? 0.5655 0.7374 0.7588 -0.0002 0.0169  -0.0043 73  GLU B C   
1317 O O   . GLU B 73  ? 0.5512 0.7309 0.7587 0.0040  0.0176  -0.0014 73  GLU B O   
1318 C CB  . GLU B 73  ? 0.7297 0.8900 0.9104 0.0093  0.0313  -0.0108 73  GLU B CB  
1319 C CG  . GLU B 73  ? 0.8845 1.0327 1.0480 0.0108  0.0371  -0.0155 73  GLU B CG  
1320 C CD  . GLU B 73  ? 1.0250 1.1751 1.1876 0.0101  0.0461  -0.0147 73  GLU B CD  
1321 O OE1 . GLU B 73  ? 1.1036 1.2442 1.2532 0.0129  0.0527  -0.0182 73  GLU B OE1 
1322 O OE2 . GLU B 73  ? 1.0360 1.1961 1.2095 0.0061  0.0465  -0.0103 73  GLU B OE2 
1323 N N   . GLY B 74  ? 0.5719 0.7419 0.7604 -0.0067 0.0095  -0.0036 74  GLY B N   
1324 C CA  . GLY B 74  ? 0.5234 0.7005 0.7214 -0.0106 0.0007  0.0008  74  GLY B CA  
1325 C C   . GLY B 74  ? 0.5448 0.7161 0.7349 -0.0094 -0.0058 0.0000  74  GLY B C   
1326 O O   . GLY B 74  ? 0.6099 0.7843 0.8032 -0.0133 -0.0144 0.0035  74  GLY B O   
1327 N N   . THR B 75  ? 0.4980 0.6604 0.6773 -0.0047 -0.0021 -0.0041 75  THR B N   
1328 C CA  . THR B 75  ? 0.4938 0.6505 0.6656 -0.0035 -0.0067 -0.0043 75  THR B CA  
1329 C C   . THR B 75  ? 0.4968 0.6420 0.6506 -0.0067 -0.0080 -0.0082 75  THR B C   
1330 O O   . THR B 75  ? 0.5216 0.6605 0.6681 -0.0047 -0.0031 -0.0120 75  THR B O   
1331 C CB  . THR B 75  ? 0.4648 0.6187 0.6379 0.0034  -0.0020 -0.0057 75  THR B CB  
1332 O OG1 . THR B 75  ? 0.6216 0.7844 0.8112 0.0078  0.0015  -0.0029 75  THR B OG1 
1333 C CG2 . THR B 75  ? 0.2866 0.4357 0.4540 0.0039  -0.0068 -0.0044 75  THR B CG2 
1334 N N   . PRO B 76  ? 0.4344 0.5762 0.5806 -0.0116 -0.0147 -0.0072 76  PRO B N   
1335 C CA  . PRO B 76  ? 0.4477 0.5774 0.5762 -0.0137 -0.0144 -0.0110 76  PRO B CA  
1336 C C   . PRO B 76  ? 0.5168 0.6417 0.6403 -0.0089 -0.0102 -0.0127 76  PRO B C   
1337 O O   . PRO B 76  ? 0.5791 0.7062 0.7060 -0.0067 -0.0118 -0.0099 76  PRO B O   
1338 C CB  . PRO B 76  ? 0.4318 0.5584 0.5523 -0.0191 -0.0225 -0.0089 76  PRO B CB  
1339 C CG  . PRO B 76  ? 0.4168 0.5546 0.5524 -0.0222 -0.0282 -0.0043 76  PRO B CG  
1340 C CD  . PRO B 76  ? 0.4471 0.5957 0.6005 -0.0158 -0.0229 -0.0022 76  PRO B CD  
1341 N N   . LEU B 77  ? 0.5149 0.6335 0.6322 -0.0076 -0.0053 -0.0163 77  LEU B N   
1342 C CA  . LEU B 77  ? 0.5181 0.6336 0.6337 -0.0038 -0.0017 -0.0171 77  LEU B CA  
1343 C C   . LEU B 77  ? 0.5536 0.6621 0.6578 -0.0050 -0.0015 -0.0172 77  LEU B C   
1344 O O   . LEU B 77  ? 0.5468 0.6484 0.6412 -0.0071 -0.0003 -0.0196 77  LEU B O   
1345 C CB  . LEU B 77  ? 0.5014 0.6145 0.6178 -0.0020 0.0025  -0.0197 77  LEU B CB  
1346 C CG  . LEU B 77  ? 0.4887 0.6064 0.6121 -0.0010 0.0035  -0.0198 77  LEU B CG  
1347 C CD1 . LEU B 77  ? 0.5452 0.6588 0.6660 -0.0007 0.0058  -0.0217 77  LEU B CD1 
1348 C CD2 . LEU B 77  ? 0.3841 0.5049 0.5139 0.0024  0.0042  -0.0189 77  LEU B CD2 
1349 N N   . LYS B 78  ? 0.5359 0.6450 0.6405 -0.0037 -0.0020 -0.0146 78  LYS B N   
1350 C CA  . LYS B 78  ? 0.5272 0.6295 0.6200 -0.0047 -0.0003 -0.0140 78  LYS B CA  
1351 C C   . LYS B 78  ? 0.5135 0.6127 0.6065 -0.0023 0.0068  -0.0161 78  LYS B C   
1352 O O   . LYS B 78  ? 0.5632 0.6658 0.6656 0.0002  0.0085  -0.0150 78  LYS B O   
1353 C CB  . LYS B 78  ? 0.5507 0.6544 0.6448 -0.0042 -0.0030 -0.0094 78  LYS B CB  
1354 C CG  . LYS B 78  ? 0.5329 0.6400 0.6282 -0.0064 -0.0109 -0.0058 78  LYS B CG  
1355 C CD  . LYS B 78  ? 0.5488 0.6582 0.6502 -0.0044 -0.0136 -0.0007 78  LYS B CD  
1356 C CE  . LYS B 78  ? 0.6348 0.7475 0.7379 -0.0066 -0.0225 0.0044  78  LYS B CE  
1357 N NZ  . LYS B 78  ? 0.7188 0.8403 0.8349 -0.0066 -0.0255 0.0039  78  LYS B NZ  
1358 N N   . TRP B 79  ? 0.4769 0.5691 0.5601 -0.0031 0.0105  -0.0188 79  TRP B N   
1359 C CA  . TRP B 79  ? 0.4878 0.5783 0.5744 -0.0001 0.0175  -0.0202 79  TRP B CA  
1360 C C   . TRP B 79  ? 0.5309 0.6226 0.6201 0.0014  0.0220  -0.0171 79  TRP B C   
1361 O O   . TRP B 79  ? 0.5635 0.6578 0.6624 0.0039  0.0265  -0.0164 79  TRP B O   
1362 C CB  . TRP B 79  ? 0.5126 0.5935 0.5876 -0.0004 0.0217  -0.0238 79  TRP B CB  
1363 C CG  . TRP B 79  ? 0.5184 0.5900 0.5753 -0.0025 0.0244  -0.0244 79  TRP B CG  
1364 C CD1 . TRP B 79  ? 0.4948 0.5592 0.5359 -0.0072 0.0191  -0.0255 79  TRP B CD1 
1365 C CD2 . TRP B 79  ? 0.4903 0.5580 0.5417 -0.0005 0.0330  -0.0233 79  TRP B CD2 
1366 N NE1 . TRP B 79  ? 0.5213 0.5758 0.5442 -0.0084 0.0234  -0.0258 79  TRP B NE1 
1367 C CE2 . TRP B 79  ? 0.4778 0.5343 0.5066 -0.0040 0.0330  -0.0245 79  TRP B CE2 
1368 C CE3 . TRP B 79  ? 0.4846 0.5575 0.5485 0.0034  0.0405  -0.0211 79  TRP B CE3 
1369 C CZ2 . TRP B 79  ? 0.4943 0.5435 0.5103 -0.0033 0.0418  -0.0238 79  TRP B CZ2 
1370 C CZ3 . TRP B 79  ? 0.5115 0.5794 0.5665 0.0042  0.0495  -0.0198 79  TRP B CZ3 
1371 C CH2 . TRP B 79  ? 0.5185 0.5742 0.5488 0.0011  0.0509  -0.0213 79  TRP B CH2 
1372 N N   . HIS B 80  ? 0.5586 0.6486 0.6399 -0.0006 0.0204  -0.0144 80  HIS B N   
1373 C CA  . HIS B 80  ? 0.5916 0.6817 0.6739 0.0000  0.0253  -0.0107 80  HIS B CA  
1374 C C   . HIS B 80  ? 0.5458 0.6425 0.6424 0.0007  0.0218  -0.0071 80  HIS B C   
1375 O O   . HIS B 80  ? 0.5735 0.6708 0.6733 0.0005  0.0251  -0.0033 80  HIS B O   
1376 C CB  . HIS B 80  ? 0.5981 0.6803 0.6614 -0.0028 0.0262  -0.0089 80  HIS B CB  
1377 C CG  . HIS B 80  ? 0.5775 0.6596 0.6355 -0.0056 0.0165  -0.0067 80  HIS B CG  
1378 N ND1 . HIS B 80  ? 0.5730 0.6546 0.6274 -0.0076 0.0099  -0.0092 80  HIS B ND1 
1379 C CD2 . HIS B 80  ? 0.5422 0.6251 0.5995 -0.0069 0.0121  -0.0014 80  HIS B CD2 
1380 C CE1 . HIS B 80  ? 0.5842 0.6677 0.6378 -0.0097 0.0017  -0.0053 80  HIS B CE1 
1381 N NE2 . HIS B 80  ? 0.5649 0.6486 0.6198 -0.0090 0.0028  -0.0005 80  HIS B NE2 
1382 N N   . TYR B 81  ? 0.4800 0.5806 0.5843 0.0012  0.0158  -0.0084 81  TYR B N   
1383 C CA  . TYR B 81  ? 0.4549 0.5589 0.5712 0.0023  0.0131  -0.0067 81  TYR B CA  
1384 C C   . TYR B 81  ? 0.4488 0.5552 0.5743 0.0034  0.0148  -0.0087 81  TYR B C   
1385 O O   . TYR B 81  ? 0.4625 0.5692 0.5871 0.0041  0.0151  -0.0118 81  TYR B O   
1386 C CB  . TYR B 81  ? 0.4539 0.5595 0.5728 0.0030  0.0073  -0.0074 81  TYR B CB  
1387 C CG  . TYR B 81  ? 0.5017 0.6063 0.6166 0.0023  0.0035  -0.0037 81  TYR B CG  
1388 C CD1 . TYR B 81  ? 0.5259 0.6269 0.6287 -0.0001 0.0039  -0.0014 81  TYR B CD1 
1389 C CD2 . TYR B 81  ? 0.4605 0.5667 0.5830 0.0043  -0.0005 -0.0023 81  TYR B CD2 
1390 C CE1 . TYR B 81  ? 0.5038 0.6036 0.6024 -0.0012 -0.0013 0.0030  81  TYR B CE1 
1391 C CE2 . TYR B 81  ? 0.4058 0.5117 0.5272 0.0042  -0.0048 0.0022  81  TYR B CE2 
1392 C CZ  . TYR B 81  ? 0.4585 0.5615 0.5680 0.0010  -0.0061 0.0053  81  TYR B CZ  
1393 O OH  . TYR B 81  ? 0.5020 0.6042 0.6094 0.0003  -0.0121 0.0108  81  TYR B OH  
1394 N N   . PRO B 82  ? 0.4105 0.5182 0.5454 0.0031  0.0149  -0.0062 82  PRO B N   
1395 C CA  . PRO B 82  ? 0.3995 0.5097 0.5438 0.0034  0.0142  -0.0072 82  PRO B CA  
1396 C C   . PRO B 82  ? 0.4428 0.5518 0.5854 0.0040  0.0096  -0.0109 82  PRO B C   
1397 O O   . PRO B 82  ? 0.4415 0.5487 0.5805 0.0044  0.0070  -0.0121 82  PRO B O   
1398 C CB  . PRO B 82  ? 0.4084 0.5191 0.5621 0.0015  0.0125  -0.0035 82  PRO B CB  
1399 C CG  . PRO B 82  ? 0.4163 0.5260 0.5663 0.0006  0.0163  0.0002  82  PRO B CG  
1400 C CD  . PRO B 82  ? 0.4400 0.5467 0.5772 0.0016  0.0154  -0.0017 82  PRO B CD  
1401 N N   . ILE B 83  ? 0.4466 0.5567 0.5922 0.0045  0.0092  -0.0122 83  ILE B N   
1402 C CA  . ILE B 83  ? 0.4312 0.5394 0.5729 0.0047  0.0060  -0.0152 83  ILE B CA  
1403 C C   . ILE B 83  ? 0.4112 0.5159 0.5519 0.0039  0.0019  -0.0163 83  ILE B C   
1404 O O   . ILE B 83  ? 0.3621 0.4649 0.4972 0.0048  0.0017  -0.0187 83  ILE B O   
1405 C CB  . ILE B 83  ? 0.4546 0.5636 0.6003 0.0049  0.0053  -0.0149 83  ILE B CB  
1406 C CG1 . ILE B 83  ? 0.4599 0.5694 0.6043 0.0065  0.0103  -0.0151 83  ILE B CG1 
1407 C CG2 . ILE B 83  ? 0.4223 0.5280 0.5622 0.0043  0.0016  -0.0171 83  ILE B CG2 
1408 C CD1 . ILE B 83  ? 0.4110 0.5209 0.5618 0.0079  0.0103  -0.0140 83  ILE B CD1 
1409 N N   . GLY B 84  ? 0.3923 0.4957 0.5388 0.0022  -0.0009 -0.0144 84  GLY B N   
1410 C CA  . GLY B 84  ? 0.4523 0.5489 0.5955 0.0010  -0.0050 -0.0161 84  GLY B CA  
1411 C C   . GLY B 84  ? 0.4842 0.5778 0.6237 0.0030  -0.0033 -0.0172 84  GLY B C   
1412 O O   . GLY B 84  ? 0.5333 0.6208 0.6669 0.0042  -0.0039 -0.0204 84  GLY B O   
1413 N N   . LEU B 85  ? 0.4520 0.5492 0.5944 0.0036  -0.0007 -0.0143 85  LEU B N   
1414 C CA  . LEU B 85  ? 0.4576 0.5529 0.5984 0.0056  -0.0002 -0.0139 85  LEU B CA  
1415 C C   . LEU B 85  ? 0.4946 0.5923 0.6319 0.0082  0.0013  -0.0164 85  LEU B C   
1416 O O   . LEU B 85  ? 0.5063 0.6008 0.6433 0.0107  0.0016  -0.0179 85  LEU B O   
1417 C CB  . LEU B 85  ? 0.4262 0.5244 0.5685 0.0050  0.0014  -0.0094 85  LEU B CB  
1418 C CG  . LEU B 85  ? 0.4066 0.5038 0.5476 0.0070  0.0006  -0.0075 85  LEU B CG  
1419 C CD1 . LEU B 85  ? 0.4392 0.5288 0.5831 0.0082  -0.0015 -0.0074 85  LEU B CD1 
1420 C CD2 . LEU B 85  ? 0.4719 0.5708 0.6101 0.0054  0.0017  -0.0029 85  LEU B CD2 
1421 N N   . LEU B 86  ? 0.5422 0.6451 0.6777 0.0076  0.0028  -0.0166 86  LEU B N   
1422 C CA  . LEU B 86  ? 0.5140 0.6203 0.6479 0.0088  0.0038  -0.0181 86  LEU B CA  
1423 C C   . LEU B 86  ? 0.4548 0.5581 0.5867 0.0101  0.0048  -0.0213 86  LEU B C   
1424 O O   . LEU B 86  ? 0.4891 0.5937 0.6229 0.0125  0.0066  -0.0219 86  LEU B O   
1425 C CB  . LEU B 86  ? 0.4923 0.6018 0.6232 0.0070  0.0047  -0.0183 86  LEU B CB  
1426 C CG  . LEU B 86  ? 0.4265 0.5369 0.5547 0.0057  0.0050  -0.0160 86  LEU B CG  
1427 C CD1 . LEU B 86  ? 0.3952 0.5052 0.5184 0.0042  0.0065  -0.0175 86  LEU B CD1 
1428 C CD2 . LEU B 86  ? 0.3658 0.4785 0.4945 0.0059  0.0026  -0.0137 86  LEU B CD2 
1429 N N   . PHE B 87  ? 0.4434 0.5425 0.5716 0.0086  0.0037  -0.0230 87  PHE B N   
1430 C CA  . PHE B 87  ? 0.4925 0.5860 0.6142 0.0091  0.0045  -0.0262 87  PHE B CA  
1431 C C   . PHE B 87  ? 0.5055 0.5917 0.6255 0.0114  0.0054  -0.0281 87  PHE B C   
1432 O O   . PHE B 87  ? 0.5081 0.5928 0.6258 0.0142  0.0096  -0.0302 87  PHE B O   
1433 C CB  . PHE B 87  ? 0.4449 0.5342 0.5619 0.0062  0.0011  -0.0267 87  PHE B CB  
1434 C CG  . PHE B 87  ? 0.4612 0.5422 0.5670 0.0058  0.0012  -0.0298 87  PHE B CG  
1435 C CD1 . PHE B 87  ? 0.4582 0.5405 0.5585 0.0062  0.0047  -0.0307 87  PHE B CD1 
1436 C CD2 . PHE B 87  ? 0.4297 0.5001 0.5287 0.0045  -0.0021 -0.0319 87  PHE B CD2 
1437 C CE1 . PHE B 87  ? 0.4956 0.5689 0.5827 0.0056  0.0060  -0.0334 87  PHE B CE1 
1438 C CE2 . PHE B 87  ? 0.4363 0.4962 0.5205 0.0038  -0.0017 -0.0354 87  PHE B CE2 
1439 C CZ  . PHE B 87  ? 0.4218 0.4833 0.4995 0.0046  0.0029  -0.0361 87  PHE B CZ  
1440 N N   . ASP B 88  ? 0.4585 0.5396 0.5801 0.0102  0.0020  -0.0273 88  ASP B N   
1441 C CA  . ASP B 88  ? 0.4694 0.5407 0.5890 0.0122  0.0023  -0.0292 88  ASP B CA  
1442 C C   . ASP B 88  ? 0.4903 0.5652 0.6157 0.0173  0.0068  -0.0285 88  ASP B C   
1443 O O   . ASP B 88  ? 0.5009 0.5696 0.6232 0.0210  0.0109  -0.0316 88  ASP B O   
1444 C CB  . ASP B 88  ? 0.4670 0.5349 0.5912 0.0097  -0.0020 -0.0265 88  ASP B CB  
1445 C CG  . ASP B 88  ? 0.4937 0.5558 0.6143 0.0047  -0.0074 -0.0271 88  ASP B CG  
1446 O OD1 . ASP B 88  ? 0.5206 0.5822 0.6347 0.0032  -0.0086 -0.0290 88  ASP B OD1 
1447 O OD2 . ASP B 88  ? 0.4957 0.5540 0.6206 0.0019  -0.0112 -0.0248 88  ASP B OD2 
1448 N N   . LEU B 89  ? 0.4704 0.5552 0.6041 0.0174  0.0060  -0.0242 89  LEU B N   
1449 C CA  . LEU B 89  ? 0.4893 0.5790 0.6312 0.0214  0.0077  -0.0216 89  LEU B CA  
1450 C C   . LEU B 89  ? 0.5133 0.6100 0.6581 0.0237  0.0122  -0.0226 89  LEU B C   
1451 O O   . LEU B 89  ? 0.5311 0.6287 0.6828 0.0285  0.0157  -0.0223 89  LEU B O   
1452 C CB  . LEU B 89  ? 0.4728 0.5694 0.6193 0.0194  0.0042  -0.0163 89  LEU B CB  
1453 C CG  . LEU B 89  ? 0.4394 0.5388 0.5940 0.0223  0.0026  -0.0116 89  LEU B CG  
1454 C CD1 . LEU B 89  ? 0.3712 0.4606 0.5285 0.0260  0.0031  -0.0119 89  LEU B CD1 
1455 C CD2 . LEU B 89  ? 0.4020 0.5044 0.5546 0.0186  -0.0013 -0.0069 89  LEU B CD2 
1456 N N   . LEU B 90  ? 0.5103 0.6120 0.6513 0.0205  0.0124  -0.0234 90  LEU B N   
1457 C CA  . LEU B 90  ? 0.4558 0.5655 0.6010 0.0214  0.0161  -0.0230 90  LEU B CA  
1458 C C   . LEU B 90  ? 0.4474 0.5525 0.5846 0.0219  0.0216  -0.0269 90  LEU B C   
1459 O O   . LEU B 90  ? 0.4913 0.6008 0.6337 0.0247  0.0274  -0.0267 90  LEU B O   
1460 C CB  . LEU B 90  ? 0.4631 0.5808 0.6093 0.0171  0.0128  -0.0205 90  LEU B CB  
1461 C CG  . LEU B 90  ? 0.4295 0.5514 0.5799 0.0156  0.0078  -0.0165 90  LEU B CG  
1462 C CD1 . LEU B 90  ? 0.3216 0.4466 0.4677 0.0111  0.0055  -0.0160 90  LEU B CD1 
1463 C CD2 . LEU B 90  ? 0.4140 0.5426 0.5764 0.0185  0.0070  -0.0126 90  LEU B CD2 
1464 N N   . ALA B 91  ? 0.5127 0.5705 0.5806 0.0373  0.0746  -0.0139 91  ALA B N   
1465 C CA  . ALA B 91  ? 0.4999 0.5622 0.5666 0.0409  0.0776  -0.0125 91  ALA B CA  
1466 C C   . ALA B 91  ? 0.5947 0.6497 0.6591 0.0549  0.0776  -0.0181 91  ALA B C   
1467 O O   . ALA B 91  ? 0.6626 0.7187 0.7238 0.0595  0.0802  -0.0179 91  ALA B O   
1468 C CB  . ALA B 91  ? 0.4860 0.5385 0.5489 0.0297  0.0791  -0.0121 91  ALA B CB  
1469 N N   . SER B 92  ? 0.5881 0.6355 0.6545 0.0622  0.0744  -0.0232 92  SER B N   
1470 C CA  . SER B 92  ? 0.5155 0.5536 0.5819 0.0753  0.0727  -0.0305 92  SER B CA  
1471 C C   . SER B 92  ? 0.5321 0.5860 0.5980 0.0895  0.0726  -0.0293 92  SER B C   
1472 O O   . SER B 92  ? 0.5122 0.5609 0.5755 0.0999  0.0723  -0.0347 92  SER B O   
1473 C CB  . SER B 92  ? 0.5279 0.5545 0.5992 0.0790  0.0687  -0.0353 92  SER B CB  
1474 O OG  . SER B 92  ? 0.6055 0.6439 0.6796 0.0819  0.0667  -0.0307 92  SER B OG  
1475 N N   . SER B 93  ? 0.5662 0.6404 0.6343 0.0910  0.0728  -0.0225 93  SER B N   
1476 C CA  . SER B 93  ? 0.6348 0.7270 0.7022 0.1059  0.0728  -0.0209 93  SER B CA  
1477 C C   . SER B 93  ? 0.6464 0.7532 0.7112 0.1028  0.0790  -0.0133 93  SER B C   
1478 O O   . SER B 93  ? 0.6185 0.7418 0.6817 0.1155  0.0804  -0.0107 93  SER B O   
1479 C CB  . SER B 93  ? 0.6591 0.7675 0.7298 0.1122  0.0693  -0.0182 93  SER B CB  
1480 O OG  . SER B 93  ? 0.7602 0.8853 0.8335 0.1008  0.0722  -0.0098 93  SER B OG  
1481 N N   . SER B 94  ? 0.6299 0.7305 0.6944 0.0866  0.0825  -0.0094 94  SER B N   
1482 C CA  . SER B 94  ? 0.5884 0.6991 0.6514 0.0818  0.0884  -0.0014 94  SER B CA  
1483 C C   . SER B 94  ? 0.6250 0.7198 0.6798 0.0871  0.0905  -0.0057 94  SER B C   
1484 O O   . SER B 94  ? 0.6687 0.7432 0.7203 0.0903  0.0871  -0.0155 94  SER B O   
1485 C CB  . SER B 94  ? 0.5551 0.6666 0.6225 0.0621  0.0899  0.0046  94  SER B CB  
1486 O OG  . SER B 94  ? 0.6364 0.7676 0.7115 0.0586  0.0887  0.0094  94  SER B OG  
1487 N N   . ALA B 95  ? 0.5750 0.6798 0.6269 0.0885  0.0963  0.0019  95  ALA B N   
1488 C CA  . ALA B 95  ? 0.4875 0.5784 0.5298 0.0946  0.0989  -0.0010 95  ALA B CA  
1489 C C   . ALA B 95  ? 0.5307 0.5966 0.5693 0.0810  0.0976  -0.0059 95  ALA B C   
1490 O O   . ALA B 95  ? 0.5812 0.6453 0.6240 0.0642  0.0974  -0.0017 95  ALA B O   
1491 C CB  . ALA B 95  ? 0.4578 0.5646 0.4980 0.0962  0.1065  0.0109  95  ALA B CB  
1492 N N   . LEU B 96  ? 0.5403 0.5878 0.5711 0.0894  0.0958  -0.0158 96  LEU B N   
1493 C CA  . LEU B 96  ? 0.5457 0.5708 0.5702 0.0793  0.0952  -0.0204 96  LEU B CA  
1494 C C   . LEU B 96  ? 0.6134 0.6395 0.6318 0.0738  0.1010  -0.0108 96  LEU B C   
1495 O O   . LEU B 96  ? 0.6366 0.6789 0.6544 0.0819  0.1060  -0.0024 96  LEU B O   
1496 C CB  . LEU B 96  ? 0.5551 0.5634 0.5735 0.0920  0.0920  -0.0339 96  LEU B CB  
1497 C CG  . LEU B 96  ? 0.5122 0.5169 0.5384 0.0974  0.0861  -0.0435 96  LEU B CG  
1498 C CD1 . LEU B 96  ? 0.4787 0.4689 0.5011 0.1106  0.0828  -0.0569 96  LEU B CD1 
1499 C CD2 . LEU B 96  ? 0.4814 0.4786 0.5130 0.0811  0.0839  -0.0437 96  LEU B CD2 
1500 N N   . PRO B 97  ? 0.6300 0.6392 0.6441 0.0602  0.1004  -0.0112 97  PRO B N   
1501 C CA  . PRO B 97  ? 0.5979 0.5916 0.6131 0.0495  0.0950  -0.0191 97  PRO B CA  
1502 C C   . PRO B 97  ? 0.5206 0.5256 0.5467 0.0362  0.0930  -0.0134 97  PRO B C   
1503 O O   . PRO B 97  ? 0.5270 0.5510 0.5603 0.0335  0.0959  -0.0035 97  PRO B O   
1504 C CB  . PRO B 97  ? 0.6394 0.6143 0.6442 0.0419  0.0953  -0.0197 97  PRO B CB  
1505 C CG  . PRO B 97  ? 0.6084 0.5929 0.6123 0.0405  0.1012  -0.0070 97  PRO B CG  
1506 C CD  . PRO B 97  ? 0.5661 0.5694 0.5722 0.0565  0.1051  -0.0038 97  PRO B CD  
1507 N N   . TRP B 98  ? 0.5113 0.5060 0.5386 0.0290  0.0883  -0.0199 98  TRP B N   
1508 C CA  . TRP B 98  ? 0.4471 0.4510 0.4830 0.0181  0.0857  -0.0161 98  TRP B CA  
1509 C C   . TRP B 98  ? 0.4899 0.4947 0.5274 0.0041  0.0857  -0.0088 98  TRP B C   
1510 O O   . TRP B 98  ? 0.5643 0.5520 0.5947 -0.0024 0.0836  -0.0120 98  TRP B O   
1511 C CB  . TRP B 98  ? 0.4316 0.4228 0.4663 0.0155  0.0813  -0.0246 98  TRP B CB  
1512 C CG  . TRP B 98  ? 0.4444 0.4451 0.4864 0.0084  0.0785  -0.0219 98  TRP B CG  
1513 C CD1 . TRP B 98  ? 0.4973 0.5174 0.5477 0.0057  0.0790  -0.0144 98  TRP B CD1 
1514 C CD2 . TRP B 98  ? 0.4539 0.4463 0.4949 0.0042  0.0749  -0.0268 98  TRP B CD2 
1515 N NE1 . TRP B 98  ? 0.5149 0.5381 0.5688 0.0007  0.0754  -0.0151 98  TRP B NE1 
1516 C CE2 . TRP B 98  ? 0.4360 0.4423 0.4838 0.0000  0.0732  -0.0221 98  TRP B CE2 
1517 C CE3 . TRP B 98  ? 0.5025 0.4783 0.5374 0.0045  0.0733  -0.0346 98  TRP B CE3 
1518 C CZ2 . TRP B 98  ? 0.4639 0.4674 0.5114 -0.0031 0.0701  -0.0245 98  TRP B CZ2 
1519 C CZ3 . TRP B 98  ? 0.5199 0.4941 0.5555 0.0008  0.0707  -0.0362 98  TRP B CZ3 
1520 C CH2 . TRP B 98  ? 0.5040 0.4915 0.5452 -0.0026 0.0692  -0.0310 98  TRP B CH2 
1521 N N   . ASN B 99  ? 0.4916 0.5165 0.5391 -0.0004 0.0875  0.0005  99  ASN B N   
1522 C CA  . ASN B 99  ? 0.4562 0.4834 0.5090 -0.0147 0.0869  0.0077  99  ASN B CA  
1523 C C   . ASN B 99  ? 0.5032 0.5299 0.5617 -0.0260 0.0803  0.0049  99  ASN B C   
1524 O O   . ASN B 99  ? 0.5635 0.6080 0.6319 -0.0278 0.0791  0.0077  99  ASN B O   
1525 C CB  . ASN B 99  ? 0.4318 0.4825 0.4946 -0.0149 0.0924  0.0196  99  ASN B CB  
1526 C CG  . ASN B 99  ? 0.5480 0.5979 0.6037 -0.0052 0.0993  0.0243  99  ASN B CG  
1527 O OD1 . ASN B 99  ? 0.6368 0.7011 0.6924 0.0081  0.1032  0.0262  99  ASN B OD1 
1528 N ND2 . ASN B 99  ? 0.5063 0.5388 0.5548 -0.0106 0.1002  0.0259  99  ASN B ND2 
1529 N N   . ILE B 100 ? 0.5238 0.5303 0.5748 -0.0321 0.0755  -0.0012 100 ILE B N   
1530 C CA  . ILE B 100 ? 0.4829 0.4874 0.5373 -0.0414 0.0683  -0.0047 100 ILE B CA  
1531 C C   . ILE B 100 ? 0.5378 0.5394 0.5977 -0.0548 0.0648  -0.0002 100 ILE B C   
1532 O O   . ILE B 100 ? 0.5836 0.5694 0.6365 -0.0574 0.0653  0.0004  100 ILE B O   
1533 C CB  . ILE B 100 ? 0.4935 0.4787 0.5360 -0.0386 0.0642  -0.0151 100 ILE B CB  
1534 C CG1 . ILE B 100 ? 0.4956 0.4831 0.5357 -0.0269 0.0671  -0.0193 100 ILE B CG1 
1535 C CG2 . ILE B 100 ? 0.4338 0.4171 0.4779 -0.0467 0.0563  -0.0187 100 ILE B CG2 
1536 C CD1 . ILE B 100 ? 0.4193 0.3921 0.4509 -0.0249 0.0638  -0.0282 100 ILE B CD1 
1537 N N   . THR B 101 ? 0.5087 0.5249 0.5815 -0.0629 0.0608  0.0027  101 THR B N   
1538 C CA  . THR B 101 ? 0.4836 0.4971 0.5650 -0.0766 0.0557  0.0059  101 THR B CA  
1539 C C   . THR B 101 ? 0.5427 0.5402 0.6181 -0.0811 0.0453  -0.0037 101 THR B C   
1540 O O   . THR B 101 ? 0.5271 0.5299 0.6018 -0.0775 0.0411  -0.0096 101 THR B O   
1541 C CB  . THR B 101 ? 0.4720 0.5112 0.5731 -0.0834 0.0556  0.0131  101 THR B CB  
1542 O OG1 . THR B 101 ? 0.4995 0.5551 0.6059 -0.0791 0.0652  0.0229  101 THR B OG1 
1543 C CG2 . THR B 101 ? 0.4668 0.5022 0.5796 -0.0986 0.0489  0.0154  101 THR B CG2 
1544 N N   . VAL B 102 ? 0.5923 0.5702 0.6627 -0.0879 0.0410  -0.0051 102 VAL B N   
1545 C CA  . VAL B 102 ? 0.5758 0.5381 0.6394 -0.0910 0.0300  -0.0148 102 VAL B CA  
1546 C C   . VAL B 102 ? 0.5596 0.5285 0.6388 -0.1027 0.0207  -0.0142 102 VAL B C   
1547 O O   . VAL B 102 ? 0.5755 0.5472 0.6676 -0.1129 0.0213  -0.0063 102 VAL B O   
1548 C CB  . VAL B 102 ? 0.5623 0.4979 0.6104 -0.0908 0.0282  -0.0186 102 VAL B CB  
1549 C CG1 . VAL B 102 ? 0.5446 0.4652 0.5853 -0.0932 0.0158  -0.0290 102 VAL B CG1 
1550 C CG2 . VAL B 102 ? 0.5195 0.4488 0.5530 -0.0785 0.0361  -0.0213 102 VAL B CG2 
1551 N N   . HIS B 103 ? 0.5465 0.5186 0.6252 -0.1008 0.0121  -0.0225 103 HIS B N   
1552 C CA  . HIS B 103 ? 0.5368 0.5151 0.6299 -0.1099 0.0011  -0.0250 103 HIS B CA  
1553 C C   . HIS B 103 ? 0.6057 0.5657 0.6878 -0.1089 -0.0118 -0.0366 103 HIS B C   
1554 O O   . HIS B 103 ? 0.6967 0.6433 0.7600 -0.1002 -0.0113 -0.0427 103 HIS B O   
1555 C CB  . HIS B 103 ? 0.5323 0.5356 0.6357 -0.1062 0.0010  -0.0253 103 HIS B CB  
1556 C CG  . HIS B 103 ? 0.5550 0.5805 0.6726 -0.1080 0.0107  -0.0148 103 HIS B CG  
1557 N ND1 . HIS B 103 ? 0.5267 0.5713 0.6660 -0.1170 0.0078  -0.0106 103 HIS B ND1 
1558 C CD2 . HIS B 103 ? 0.5928 0.6258 0.7062 -0.1008 0.0226  -0.0084 103 HIS B CD2 
1559 C CE1 . HIS B 103 ? 0.5118 0.5757 0.6590 -0.1152 0.0182  -0.0014 103 HIS B CE1 
1560 N NE2 . HIS B 103 ? 0.5628 0.6195 0.6939 -0.1049 0.0269  -0.0001 103 HIS B NE2 
1561 N N   . PHE B 104 ? 0.6614 0.6224 0.7562 -0.1173 -0.0238 -0.0400 104 PHE B N   
1562 C CA  . PHE B 104 ? 0.6767 0.6248 0.7627 -0.1144 -0.0382 -0.0523 104 PHE B CA  
1563 C C   . PHE B 104 ? 0.6698 0.6346 0.7707 -0.1159 -0.0487 -0.0574 104 PHE B C   
1564 O O   . PHE B 104 ? 0.6756 0.6437 0.7672 -0.1058 -0.0551 -0.0664 104 PHE B O   
1565 C CB  . PHE B 104 ? 0.6367 0.5595 0.7196 -0.1225 -0.0465 -0.0545 104 PHE B CB  
1566 C CG  . PHE B 104 ? 0.6512 0.5541 0.7132 -0.1170 -0.0400 -0.0544 104 PHE B CG  
1567 C CD1 . PHE B 104 ? 0.6789 0.5726 0.7199 -0.1052 -0.0428 -0.0641 104 PHE B CD1 
1568 C CD2 . PHE B 104 ? 0.6548 0.5494 0.7181 -0.1229 -0.0310 -0.0447 104 PHE B CD2 
1569 C CE1 . PHE B 104 ? 0.6796 0.5563 0.7023 -0.0998 -0.0372 -0.0652 104 PHE B CE1 
1570 C CE2 . PHE B 104 ? 0.7069 0.5835 0.7504 -0.1165 -0.0256 -0.0459 104 PHE B CE2 
1571 C CZ  . PHE B 104 ? 0.7074 0.5751 0.7311 -0.1052 -0.0291 -0.0567 104 PHE B CZ  
1572 N N   . LYS B 105 ? 0.6198 0.5963 0.7442 -0.1278 -0.0501 -0.0515 105 LYS B N   
1573 C CA  . LYS B 105 ? 0.6321 0.6249 0.7739 -0.1304 -0.0612 -0.0571 105 LYS B CA  
1574 C C   . LYS B 105 ? 0.6310 0.6508 0.7767 -0.1227 -0.0532 -0.0543 105 LYS B C   
1575 O O   . LYS B 105 ? 0.5803 0.6063 0.7199 -0.1184 -0.0390 -0.0463 105 LYS B O   
1576 C CB  . LYS B 105 ? 0.6748 0.6697 0.8431 -0.1476 -0.0662 -0.0519 105 LYS B CB  
1577 C CG  . LYS B 105 ? 0.8651 0.8649 1.0499 -0.1516 -0.0842 -0.0624 105 LYS B CG  
1578 C CD  . LYS B 105 ? 0.9138 0.9164 1.1285 -0.1703 -0.0884 -0.0560 105 LYS B CD  
1579 C CE  . LYS B 105 ? 0.9160 0.9273 1.1508 -0.1738 -0.1069 -0.0675 105 LYS B CE  
1580 N NZ  . LYS B 105 ? 0.9576 0.9719 1.2250 -0.1933 -0.1114 -0.0612 105 LYS B NZ  
1581 N N   . SER B 106 ? 0.6982 0.7330 0.8535 -0.1198 -0.0632 -0.0619 106 SER B N   
1582 C CA  . SER B 106 ? 0.6846 0.7455 0.8451 -0.1127 -0.0578 -0.0602 106 SER B CA  
1583 C C   . SER B 106 ? 0.7071 0.7681 0.8453 -0.0980 -0.0470 -0.0586 106 SER B C   
1584 O O   . SER B 106 ? 0.7513 0.8264 0.8914 -0.0952 -0.0353 -0.0507 106 SER B O   
1585 C CB  . SER B 106 ? 0.7362 0.8165 0.9192 -0.1233 -0.0496 -0.0492 106 SER B CB  
1586 O OG  . SER B 106 ? 0.8090 0.8927 1.0166 -0.1373 -0.0599 -0.0505 106 SER B OG  
1587 N N   . PHE B 107 ? 0.6829 0.7285 0.8009 -0.0884 -0.0514 -0.0661 107 PHE B N   
1588 C CA  . PHE B 107 ? 0.6730 0.7182 0.7715 -0.0748 -0.0424 -0.0650 107 PHE B CA  
1589 C C   . PHE B 107 ? 0.6807 0.7486 0.7829 -0.0663 -0.0402 -0.0643 107 PHE B C   
1590 O O   . PHE B 107 ? 0.6978 0.7753 0.8044 -0.0624 -0.0508 -0.0718 107 PHE B O   
1591 C CB  . PHE B 107 ? 0.6655 0.6944 0.7446 -0.0660 -0.0497 -0.0739 107 PHE B CB  
1592 C CG  . PHE B 107 ? 0.6666 0.6918 0.7266 -0.0542 -0.0394 -0.0716 107 PHE B CG  
1593 C CD1 . PHE B 107 ? 0.6800 0.6891 0.7296 -0.0553 -0.0316 -0.0686 107 PHE B CD1 
1594 C CD2 . PHE B 107 ? 0.6581 0.6957 0.7110 -0.0417 -0.0378 -0.0726 107 PHE B CD2 
1595 C CE1 . PHE B 107 ? 0.7074 0.7137 0.7424 -0.0452 -0.0226 -0.0667 107 PHE B CE1 
1596 C CE2 . PHE B 107 ? 0.6882 0.7219 0.7258 -0.0319 -0.0281 -0.0693 107 PHE B CE2 
1597 C CZ  . PHE B 107 ? 0.7052 0.7236 0.7350 -0.0342 -0.0207 -0.0666 107 PHE B CZ  
1598 N N   . PRO B 108 ? 0.7090 0.7851 0.8091 -0.0625 -0.0271 -0.0560 108 PRO B N   
1599 C CA  . PRO B 108 ? 0.6680 0.7644 0.7703 -0.0539 -0.0242 -0.0545 108 PRO B CA  
1600 C C   . PRO B 108 ? 0.7639 0.8579 0.8479 -0.0389 -0.0252 -0.0589 108 PRO B C   
1601 O O   . PRO B 108 ? 0.8108 0.8975 0.8815 -0.0318 -0.0158 -0.0546 108 PRO B O   
1602 C CB  . PRO B 108 ? 0.6270 0.7277 0.7305 -0.0543 -0.0105 -0.0444 108 PRO B CB  
1603 C CG  . PRO B 108 ? 0.6579 0.7370 0.7508 -0.0567 -0.0052 -0.0424 108 PRO B CG  
1604 C CD  . PRO B 108 ? 0.6950 0.7609 0.7903 -0.0653 -0.0153 -0.0482 108 PRO B CD  
1605 N N   . GLU B 109 ? 0.8411 0.9416 0.9253 -0.0337 -0.0367 -0.0674 109 GLU B N   
1606 C CA  . GLU B 109 ? 0.8408 0.9397 0.9069 -0.0183 -0.0386 -0.0715 109 GLU B CA  
1607 C C   . GLU B 109 ? 0.7934 0.9019 0.8520 -0.0075 -0.0282 -0.0649 109 GLU B C   
1608 O O   . GLU B 109 ? 0.8775 0.9793 0.9194 0.0033  -0.0234 -0.0632 109 GLU B O   
1609 C CB  . GLU B 109 ? 0.9240 1.0314 0.9935 -0.0135 -0.0539 -0.0824 109 GLU B CB  
1610 C CG  . GLU B 109 ? 0.9766 1.0724 1.0525 -0.0224 -0.0666 -0.0905 109 GLU B CG  
1611 C CD  . GLU B 109 ? 1.0223 1.1002 1.0783 -0.0152 -0.0692 -0.0948 109 GLU B CD  
1612 O OE1 . GLU B 109 ? 1.0112 1.0881 1.0495 -0.0028 -0.0615 -0.0916 109 GLU B OE1 
1613 O OE2 . GLU B 109 ? 1.0736 1.1384 1.1317 -0.0218 -0.0792 -0.1011 109 GLU B OE2 
1614 N N   . LYS B 110 ? 0.7176 0.8418 0.7888 -0.0104 -0.0249 -0.0608 110 LYS B N   
1615 C CA  . LYS B 110 ? 0.7353 0.8689 0.7997 0.0007  -0.0171 -0.0555 110 LYS B CA  
1616 C C   . LYS B 110 ? 0.7491 0.8736 0.8091 -0.0003 -0.0040 -0.0463 110 LYS B C   
1617 O O   . LYS B 110 ? 0.8112 0.9392 0.8644 0.0089  0.0027  -0.0413 110 LYS B O   
1618 C CB  . LYS B 110 ? 0.7643 0.9207 0.8431 0.0003  -0.0206 -0.0566 110 LYS B CB  
1619 C CG  . LYS B 110 ? 0.7719 0.9361 0.8677 -0.0119 -0.0155 -0.0509 110 LYS B CG  
1620 C CD  . LYS B 110 ? 0.7561 0.9456 0.8656 -0.0108 -0.0184 -0.0519 110 LYS B CD  
1621 C CE  . LYS B 110 ? 0.7355 0.9352 0.8608 -0.0212 -0.0119 -0.0447 110 LYS B CE  
1622 N NZ  . LYS B 110 ? 0.7267 0.9183 0.8416 -0.0166 0.0001  -0.0363 110 LYS B NZ  
1623 N N   . ASP B 111 ? 0.7246 0.8368 0.7882 -0.0106 -0.0010 -0.0443 111 ASP B N   
1624 C CA  . ASP B 111 ? 0.6981 0.8023 0.7591 -0.0111 0.0102  -0.0370 111 ASP B CA  
1625 C C   . ASP B 111 ? 0.6583 0.7419 0.7068 -0.0099 0.0140  -0.0371 111 ASP B C   
1626 O O   . ASP B 111 ? 0.6047 0.6812 0.6480 -0.0060 0.0227  -0.0323 111 ASP B O   
1627 C CB  . ASP B 111 ? 0.8017 0.9110 0.8774 -0.0222 0.0125  -0.0335 111 ASP B CB  
1628 C CG  . ASP B 111 ? 0.9113 1.0438 1.0005 -0.0230 0.0107  -0.0321 111 ASP B CG  
1629 O OD1 . ASP B 111 ? 0.9226 1.0657 1.0077 -0.0130 0.0108  -0.0322 111 ASP B OD1 
1630 O OD2 . ASP B 111 ? 0.9742 1.1149 1.0783 -0.0335 0.0095  -0.0305 111 ASP B OD2 
1631 N N   . LEU B 112 ? 0.6822 0.7569 0.7266 -0.0129 0.0068  -0.0433 112 LEU B N   
1632 C CA  . LEU B 112 ? 0.6407 0.6973 0.6740 -0.0125 0.0095  -0.0444 112 LEU B CA  
1633 C C   . LEU B 112 ? 0.6365 0.6891 0.6573 -0.0049 0.0032  -0.0502 112 LEU B C   
1634 O O   . LEU B 112 ? 0.6349 0.6939 0.6575 -0.0042 -0.0073 -0.0564 112 LEU B O   
1635 C CB  . LEU B 112 ? 0.5901 0.6361 0.6289 -0.0242 0.0075  -0.0461 112 LEU B CB  
1636 C CG  . LEU B 112 ? 0.5922 0.6417 0.6427 -0.0317 0.0135  -0.0403 112 LEU B CG  
1637 C CD1 . LEU B 112 ? 0.5618 0.5986 0.6148 -0.0418 0.0112  -0.0418 112 LEU B CD1 
1638 C CD2 . LEU B 112 ? 0.5800 0.6275 0.6267 -0.0255 0.0244  -0.0346 112 LEU B CD2 
1639 N N   . LEU B 113 ? 0.5894 0.6324 0.5983 0.0013  0.0093  -0.0484 113 LEU B N   
1640 C CA  . LEU B 113 ? 0.6276 0.6657 0.6234 0.0083  0.0042  -0.0536 113 LEU B CA  
1641 C C   . LEU B 113 ? 0.6969 0.7218 0.6916 0.0005  -0.0018 -0.0600 113 LEU B C   
1642 O O   . LEU B 113 ? 0.7105 0.7261 0.7093 -0.0074 0.0031  -0.0580 113 LEU B O   
1643 C CB  . LEU B 113 ? 0.6488 0.6827 0.6343 0.0169  0.0142  -0.0482 113 LEU B CB  
1644 C CG  . LEU B 113 ? 0.6136 0.6561 0.5985 0.0251  0.0220  -0.0402 113 LEU B CG  
1645 C CD1 . LEU B 113 ? 0.6115 0.6466 0.5897 0.0303  0.0323  -0.0341 113 LEU B CD1 
1646 C CD2 . LEU B 113 ? 0.5348 0.5898 0.5139 0.0351  0.0154  -0.0423 113 LEU B CD2 
1647 N N   . HIS B 114 ? 0.7188 0.7425 0.7071 0.0037  -0.0131 -0.0681 114 HIS B N   
1648 C CA  . HIS B 114 ? 0.6613 0.6707 0.6462 -0.0022 -0.0202 -0.0749 114 HIS B CA  
1649 C C   . HIS B 114 ? 0.6793 0.6775 0.6525 0.0010  -0.0127 -0.0738 114 HIS B C   
1650 O O   . HIS B 114 ? 0.7326 0.7355 0.6980 0.0104  -0.0056 -0.0701 114 HIS B O   
1651 C CB  . HIS B 114 ? 0.6529 0.6636 0.6323 0.0030  -0.0354 -0.0848 114 HIS B CB  
1652 C CG  . HIS B 114 ? 0.7037 0.7224 0.6977 -0.0031 -0.0456 -0.0884 114 HIS B CG  
1653 N ND1 . HIS B 114 ? 0.7200 0.7299 0.7248 -0.0158 -0.0536 -0.0921 114 HIS B ND1 
1654 C CD2 . HIS B 114 ? 0.7063 0.7413 0.7068 0.0016  -0.0491 -0.0889 114 HIS B CD2 
1655 C CE1 . HIS B 114 ? 0.7305 0.7519 0.7499 -0.0195 -0.0616 -0.0945 114 HIS B CE1 
1656 N NE2 . HIS B 114 ? 0.7103 0.7475 0.7271 -0.0087 -0.0593 -0.0933 114 HIS B NE2 
1657 N N   . CYS B 115 ? 0.6338 0.6177 0.6065 -0.0066 -0.0140 -0.0769 115 CYS B N   
1658 C CA  . CYS B 115 ? 0.6891 0.6625 0.6503 -0.0031 -0.0092 -0.0785 115 CYS B CA  
1659 C C   . CYS B 115 ? 0.7256 0.6877 0.6770 -0.0030 -0.0213 -0.0885 115 CYS B C   
1660 O O   . CYS B 115 ? 0.8056 0.7544 0.7586 -0.0113 -0.0243 -0.0912 115 CYS B O   
1661 C CB  . CYS B 115 ? 0.7082 0.6738 0.6753 -0.0099 0.0010  -0.0738 115 CYS B CB  
1662 S SG  . CYS B 115 ? 0.7442 0.7002 0.7002 -0.0047 0.0083  -0.0758 115 CYS B SG  
1663 N N   . PRO B 116 ? 0.8033 0.7705 0.7437 0.0075  -0.0288 -0.0939 116 PRO B N   
1664 C CA  . PRO B 116 ? 0.7813 0.7392 0.7120 0.0097  -0.0434 -0.1049 116 PRO B CA  
1665 C C   . PRO B 116 ? 0.7589 0.7040 0.6766 0.0118  -0.0421 -0.1093 116 PRO B C   
1666 O O   . PRO B 116 ? 0.7875 0.7195 0.6992 0.0097  -0.0534 -0.1177 116 PRO B O   
1667 C CB  . PRO B 116 ? 0.7689 0.7403 0.6913 0.0235  -0.0501 -0.1083 116 PRO B CB  
1668 C CG  . PRO B 116 ? 0.7836 0.7672 0.7046 0.0305  -0.0352 -0.0986 116 PRO B CG  
1669 C CD  . PRO B 116 ? 0.8019 0.7844 0.7377 0.0193  -0.0239 -0.0897 116 PRO B CD  
1670 N N   . SER B 117 ? 0.8044 0.7533 0.7187 0.0160  -0.0291 -0.1040 117 SER B N   
1671 C CA  . SER B 117 ? 0.7941 0.7335 0.6972 0.0186  -0.0272 -0.1086 117 SER B CA  
1672 C C   . SER B 117 ? 0.7670 0.7094 0.6753 0.0178  -0.0111 -0.1010 117 SER B C   
1673 O O   . SER B 117 ? 0.7094 0.6612 0.6279 0.0168  -0.0020 -0.0921 117 SER B O   
1674 C CB  . SER B 117 ? 0.7972 0.7425 0.6841 0.0321  -0.0342 -0.1152 117 SER B CB  
1675 O OG  . SER B 117 ? 0.7876 0.7495 0.6736 0.0413  -0.0244 -0.1079 117 SER B OG  
1676 N N   . LYS B 118 ? 0.7959 0.7299 0.6973 0.0188  -0.0085 -0.1053 118 LYS B N   
1677 C CA  . LYS B 118 ? 0.8180 0.7544 0.7254 0.0185  0.0053  -0.1001 118 LYS B CA  
1678 C C   . LYS B 118 ? 0.8467 0.7985 0.7522 0.0279  0.0126  -0.0949 118 LYS B C   
1679 O O   . LYS B 118 ? 0.9120 0.8687 0.8268 0.0272  0.0245  -0.0878 118 LYS B O   
1680 C CB  . LYS B 118 ? 0.8332 0.7566 0.7344 0.0172  0.0052  -0.1074 118 LYS B CB  
1681 C CG  . LYS B 118 ? 0.8880 0.7955 0.7914 0.0082  0.0006  -0.1101 118 LYS B CG  
1682 C CD  . LYS B 118 ? 0.8985 0.7950 0.7996 0.0072  0.0052  -0.1144 118 LYS B CD  
1683 C CE  . LYS B 118 ? 0.9394 0.8216 0.8436 -0.0010 0.0029  -0.1143 118 LYS B CE  
1684 N NZ  . LYS B 118 ? 1.0231 0.8951 0.9247 -0.0003 0.0079  -0.1184 118 LYS B NZ  
1685 N N   . ASP B 119 ? 0.8032 0.7627 0.6969 0.0371  0.0052  -0.0983 119 ASP B N   
1686 C CA  . ASP B 119 ? 0.7861 0.7617 0.6768 0.0472  0.0123  -0.0919 119 ASP B CA  
1687 C C   . ASP B 119 ? 0.8497 0.8340 0.7511 0.0462  0.0190  -0.0810 119 ASP B C   
1688 O O   . ASP B 119 ? 0.8827 0.8761 0.7890 0.0496  0.0306  -0.0717 119 ASP B O   
1689 C CB  . ASP B 119 ? 0.7813 0.7641 0.6552 0.0595  0.0018  -0.0984 119 ASP B CB  
1690 C CG  . ASP B 119 ? 0.9010 0.8795 0.7626 0.0640  -0.0022 -0.1077 119 ASP B CG  
1691 O OD1 . ASP B 119 ? 0.9192 0.8984 0.7661 0.0727  -0.0148 -0.1165 119 ASP B OD1 
1692 O OD2 . ASP B 119 ? 0.9812 0.9558 0.8479 0.0596  0.0065  -0.1070 119 ASP B OD2 
1693 N N   . ALA B 120 ? 0.8399 0.8214 0.7456 0.0414  0.0115  -0.0822 120 ALA B N   
1694 C CA  . ALA B 120 ? 0.7814 0.7706 0.6971 0.0402  0.0167  -0.0733 120 ALA B CA  
1695 C C   . ALA B 120 ? 0.7925 0.7785 0.7217 0.0332  0.0295  -0.0654 120 ALA B C   
1696 O O   . ALA B 120 ? 0.8116 0.8054 0.7464 0.0361  0.0382  -0.0560 120 ALA B O   
1697 C CB  . ALA B 120 ? 0.7330 0.7198 0.6532 0.0346  0.0060  -0.0772 120 ALA B CB  
1698 N N   . ILE B 121 ? 0.7561 0.7301 0.6897 0.0251  0.0299  -0.0696 121 ILE B N   
1699 C CA  . ILE B 121 ? 0.7830 0.7531 0.7289 0.0198  0.0404  -0.0644 121 ILE B CA  
1700 C C   . ILE B 121 ? 0.8242 0.7992 0.7718 0.0248  0.0506  -0.0596 121 ILE B C   
1701 O O   . ILE B 121 ? 0.8389 0.8171 0.7970 0.0244  0.0595  -0.0511 121 ILE B O   
1702 C CB  . ILE B 121 ? 0.7276 0.6840 0.6756 0.0123  0.0382  -0.0710 121 ILE B CB  
1703 C CG1 . ILE B 121 ? 0.7794 0.7305 0.7264 0.0065  0.0283  -0.0748 121 ILE B CG1 
1704 C CG2 . ILE B 121 ? 0.6116 0.5651 0.5728 0.0085  0.0476  -0.0664 121 ILE B CG2 
1705 C CD1 . ILE B 121 ? 0.7690 0.7062 0.7165 -0.0001 0.0266  -0.0799 121 ILE B CD1 
1706 N N   . GLU B 122 ? 0.8246 0.8005 0.7623 0.0296  0.0489  -0.0649 122 GLU B N   
1707 C CA  . GLU B 122 ? 0.7970 0.7797 0.7371 0.0342  0.0586  -0.0604 122 GLU B CA  
1708 C C   . GLU B 122 ? 0.7708 0.7666 0.7110 0.0413  0.0648  -0.0492 122 GLU B C   
1709 O O   . GLU B 122 ? 0.8000 0.8002 0.7494 0.0420  0.0757  -0.0406 122 GLU B O   
1710 C CB  . GLU B 122 ? 0.8086 0.7922 0.7361 0.0393  0.0544  -0.0691 122 GLU B CB  
1711 C CG  . GLU B 122 ? 0.8187 0.8118 0.7502 0.0436  0.0646  -0.0645 122 GLU B CG  
1712 C CD  . GLU B 122 ? 0.8799 0.8780 0.7968 0.0510  0.0598  -0.0727 122 GLU B CD  
1713 O OE1 . GLU B 122 ? 0.8969 0.8929 0.7987 0.0553  0.0480  -0.0803 122 GLU B OE1 
1714 O OE2 . GLU B 122 ? 0.9129 0.9173 0.8342 0.0528  0.0673  -0.0720 122 GLU B OE2 
1715 N N   . ALA B 123 ? 0.7203 0.7219 0.6506 0.0468  0.0576  -0.0493 123 ALA B N   
1716 C CA  . ALA B 123 ? 0.6393 0.6531 0.5673 0.0552  0.0626  -0.0390 123 ALA B CA  
1717 C C   . ALA B 123 ? 0.6728 0.6844 0.6143 0.0504  0.0696  -0.0297 123 ALA B C   
1718 O O   . ALA B 123 ? 0.7761 0.7934 0.7217 0.0544  0.0794  -0.0186 123 ALA B O   
1719 C CB  . ALA B 123 ? 0.6057 0.6259 0.5201 0.0633  0.0514  -0.0436 123 ALA B CB  
1720 N N   . HIS B 124 ? 0.6223 0.6258 0.5705 0.0422  0.0646  -0.0339 124 HIS B N   
1721 C CA  . HIS B 124 ? 0.6037 0.6054 0.5639 0.0384  0.0698  -0.0266 124 HIS B CA  
1722 C C   . HIS B 124 ? 0.6375 0.6333 0.6108 0.0342  0.0799  -0.0219 124 HIS B C   
1723 O O   . HIS B 124 ? 0.6935 0.6902 0.6749 0.0353  0.0871  -0.0125 124 HIS B O   
1724 C CB  . HIS B 124 ? 0.5690 0.5657 0.5335 0.0311  0.0622  -0.0323 124 HIS B CB  
1725 C CG  . HIS B 124 ? 0.6436 0.6393 0.6199 0.0279  0.0669  -0.0260 124 HIS B CG  
1726 N ND1 . HIS B 124 ? 0.6414 0.6288 0.6289 0.0218  0.0710  -0.0263 124 HIS B ND1 
1727 C CD2 . HIS B 124 ? 0.6836 0.6861 0.6613 0.0314  0.0674  -0.0199 124 HIS B CD2 
1728 C CE1 . HIS B 124 ? 0.6379 0.6269 0.6332 0.0217  0.0735  -0.0207 124 HIS B CE1 
1729 N NE2 . HIS B 124 ? 0.6760 0.6741 0.6655 0.0272  0.0716  -0.0165 124 HIS B NE2 
1730 N N   . PHE B 125 ? 0.6382 0.6273 0.6138 0.0298  0.0796  -0.0291 125 PHE B N   
1731 C CA  . PHE B 125 ? 0.6753 0.6586 0.6648 0.0259  0.0875  -0.0271 125 PHE B CA  
1732 C C   . PHE B 125 ? 0.7491 0.7394 0.7424 0.0305  0.0972  -0.0176 125 PHE B C   
1733 O O   . PHE B 125 ? 0.7463 0.7338 0.7538 0.0285  0.1047  -0.0104 125 PHE B O   
1734 C CB  . PHE B 125 ? 0.6528 0.6285 0.6420 0.0219  0.0842  -0.0383 125 PHE B CB  
1735 C CG  . PHE B 125 ? 0.6344 0.6048 0.6386 0.0188  0.0911  -0.0385 125 PHE B CG  
1736 C CD1 . PHE B 125 ? 0.6012 0.5646 0.6184 0.0151  0.0926  -0.0374 125 PHE B CD1 
1737 C CD2 . PHE B 125 ? 0.5982 0.5717 0.6042 0.0202  0.0952  -0.0406 125 PHE B CD2 
1738 C CE1 . PHE B 125 ? 0.5551 0.5134 0.5873 0.0131  0.0974  -0.0391 125 PHE B CE1 
1739 C CE2 . PHE B 125 ? 0.5805 0.5499 0.6026 0.0172  0.1007  -0.0420 125 PHE B CE2 
1740 C CZ  . PHE B 125 ? 0.6105 0.5715 0.6460 0.0137  0.1013  -0.0416 125 PHE B CZ  
1741 N N   . MET B 126 ? 0.7094 0.7090 0.6903 0.0371  0.0968  -0.0174 126 MET B N   
1742 C CA  . MET B 126 ? 0.7106 0.7195 0.6938 0.0424  0.1067  -0.0069 126 MET B CA  
1743 C C   . MET B 126 ? 0.7287 0.7419 0.7123 0.0472  0.1121  0.0064  126 MET B C   
1744 O O   . MET B 126 ? 0.7334 0.7492 0.7260 0.0484  0.1224  0.0179  126 MET B O   
1745 C CB  . MET B 126 ? 0.6955 0.7152 0.6635 0.0501  0.1045  -0.0105 126 MET B CB  
1746 C CG  . MET B 126 ? 0.6280 0.6452 0.5975 0.0468  0.1029  -0.0209 126 MET B CG  
1747 S SD  . MET B 126 ? 1.0947 1.1082 1.0886 0.0391  0.1143  -0.0167 126 MET B SD  
1748 C CE  . MET B 126 ? 0.5036 0.5309 0.5025 0.0451  0.1276  0.0020  126 MET B CE  
1749 N N   . SER B 127 ? 0.7619 0.7758 0.7362 0.0501  0.1049  0.0049  127 SER B N   
1750 C CA  . SER B 127 ? 0.7197 0.7371 0.6930 0.0556  0.1087  0.0161  127 SER B CA  
1751 C C   . SER B 127 ? 0.6617 0.6692 0.6521 0.0491  0.1143  0.0219  127 SER B C   
1752 O O   . SER B 127 ? 0.6875 0.6953 0.6829 0.0522  0.1226  0.0343  127 SER B O   
1753 C CB  . SER B 127 ? 0.7700 0.7909 0.7317 0.0595  0.0984  0.0108  127 SER B CB  
1754 O OG  . SER B 127 ? 0.8553 0.8862 0.8007 0.0685  0.0931  0.0069  127 SER B OG  
1755 N N   . CYS B 128 ? 0.5890 0.5874 0.5878 0.0409  0.1092  0.0131  128 CYS B N   
1756 C CA  . CYS B 128 ? 0.5766 0.5656 0.5914 0.0358  0.1125  0.0164  128 CYS B CA  
1757 C C   . CYS B 128 ? 0.6171 0.6020 0.6465 0.0333  0.1219  0.0225  128 CYS B C   
1758 O O   . CYS B 128 ? 0.6135 0.5938 0.6535 0.0335  0.1275  0.0320  128 CYS B O   
1759 C CB  . CYS B 128 ? 0.5461 0.5279 0.5655 0.0292  0.1053  0.0051  128 CYS B CB  
1760 S SG  . CYS B 128 ? 0.6857 0.6721 0.6944 0.0303  0.0955  0.0005  128 CYS B SG  
1761 N N   . MET B 129 ? 0.5783 0.5652 0.6091 0.0310  0.1231  0.0169  129 MET B N   
1762 C CA  . MET B 129 ? 0.5966 0.5823 0.6432 0.0282  0.1319  0.0221  129 MET B CA  
1763 C C   . MET B 129 ? 0.6370 0.6299 0.6832 0.0336  0.1415  0.0381  129 MET B C   
1764 O O   . MET B 129 ? 0.6371 0.6249 0.6997 0.0309  0.1489  0.0476  129 MET B O   
1765 C CB  . MET B 129 ? 0.6216 0.6114 0.6673 0.0264  0.1311  0.0127  129 MET B CB  
1766 C CG  . MET B 129 ? 0.7243 0.7057 0.7711 0.0215  0.1229  -0.0024 129 MET B CG  
1767 S SD  . MET B 129 ? 1.0770 1.0580 1.1361 0.0176  0.1255  -0.0111 129 MET B SD  
1768 C CE  . MET B 129 ? 0.7812 0.7560 0.8680 0.0131  0.1337  -0.0022 129 MET B CE  
1769 N N   . LYS B 130 ? 0.6518 0.6561 0.6792 0.0417  0.1410  0.0411  130 LYS B N   
1770 C CA  . LYS B 130 ? 0.6511 0.6638 0.6747 0.0492  0.1505  0.0569  130 LYS B CA  
1771 C C   . LYS B 130 ? 0.6323 0.6377 0.6593 0.0510  0.1532  0.0677  130 LYS B C   
1772 O O   . LYS B 130 ? 0.7205 0.7247 0.7563 0.0520  0.1632  0.0821  130 LYS B O   
1773 C CB  . LYS B 130 ? 0.6206 0.6476 0.6212 0.0600  0.1476  0.0560  130 LYS B CB  
1774 C CG  . LYS B 130 ? 0.6457 0.6825 0.6431 0.0610  0.1485  0.0505  130 LYS B CG  
1775 C CD  . LYS B 130 ? 0.7181 0.7683 0.6917 0.0730  0.1429  0.0470  130 LYS B CD  
1776 C CE  . LYS B 130 ? 0.7297 0.7911 0.6996 0.0757  0.1447  0.0430  130 LYS B CE  
1777 N NZ  . LYS B 130 ? 0.7674 0.8420 0.7136 0.0892  0.1381  0.0388  130 LYS B NZ  
1778 N N   . GLU B 131 ? 0.6529 0.6533 0.6735 0.0513  0.1443  0.0611  131 GLU B N   
1779 C CA  . GLU B 131 ? 0.6838 0.6775 0.7063 0.0539  0.1455  0.0695  131 GLU B CA  
1780 C C   . GLU B 131 ? 0.7496 0.7296 0.7944 0.0462  0.1495  0.0731  131 GLU B C   
1781 O O   . GLU B 131 ? 0.7782 0.7525 0.8292 0.0483  0.1560  0.0861  131 GLU B O   
1782 C CB  . GLU B 131 ? 0.6321 0.6257 0.6446 0.0555  0.1347  0.0603  131 GLU B CB  
1783 C CG  . GLU B 131 ? 0.6760 0.6641 0.6890 0.0595  0.1351  0.0679  131 GLU B CG  
1784 C CD  . GLU B 131 ? 0.7080 0.6998 0.7116 0.0617  0.1249  0.0593  131 GLU B CD  
1785 O OE1 . GLU B 131 ? 0.7194 0.7175 0.7165 0.0597  0.1176  0.0482  131 GLU B OE1 
1786 O OE2 . GLU B 131 ? 0.6812 0.6698 0.6844 0.0655  0.1241  0.0638  131 GLU B OE2 
1787 N N   . ALA B 132 ? 0.6979 0.6719 0.7546 0.0380  0.1449  0.0613  132 ALA B N   
1788 C CA  . ALA B 132 ? 0.6029 0.5643 0.6821 0.0313  0.1469  0.0618  132 ALA B CA  
1789 C C   . ALA B 132 ? 0.6341 0.5951 0.7277 0.0293  0.1580  0.0742  132 ALA B C   
1790 O O   . ALA B 132 ? 0.6591 0.6097 0.7670 0.0277  0.1619  0.0834  132 ALA B O   
1791 C CB  . ALA B 132 ? 0.5371 0.4948 0.6243 0.0249  0.1404  0.0460  132 ALA B CB  
1792 N N   . ASP B 133 ? 0.6895 0.6618 0.7797 0.0295  0.1628  0.0747  133 ASP B N   
1793 C CA  . ASP B 133 ? 0.7573 0.7323 0.8632 0.0267  0.1741  0.0864  133 ASP B CA  
1794 C C   . ASP B 133 ? 0.8282 0.8056 0.9284 0.0333  0.1834  0.1060  133 ASP B C   
1795 O O   . ASP B 133 ? 0.8546 0.8297 0.9715 0.0302  0.1933  0.1192  133 ASP B O   
1796 C CB  . ASP B 133 ? 0.7678 0.7569 0.8707 0.0262  0.1766  0.0810  133 ASP B CB  
1797 C CG  . ASP B 133 ? 0.8530 0.8458 0.9777 0.0211  0.1877  0.0908  133 ASP B CG  
1798 O OD1 . ASP B 133 ? 0.8547 0.8387 1.0030 0.0125  0.1868  0.0851  133 ASP B OD1 
1799 O OD2 . ASP B 133 ? 0.9018 0.9073 1.0206 0.0263  0.1974  0.1044  133 ASP B OD2 
1800 N N   . ALA B 134 ? 0.8077 0.7897 0.8847 0.0427  0.1801  0.1079  134 ALA B N   
1801 C CA  . ALA B 134 ? 0.7914 0.7745 0.8599 0.0511  0.1878  0.1256  134 ALA B CA  
1802 C C   . ALA B 134 ? 0.8002 0.7651 0.8848 0.0472  0.1891  0.1332  134 ALA B C   
1803 O O   . ALA B 134 ? 0.8115 0.7719 0.9049 0.0477  0.1992  0.1502  134 ALA B O   
1804 C CB  . ALA B 134 ? 0.7567 0.7477 0.7980 0.0625  0.1816  0.1226  134 ALA B CB  
1805 N N   . LEU B 135 ? 0.7519 0.7063 0.8404 0.0436  0.1786  0.1208  135 LEU B N   
1806 C CA  . LEU B 135 ? 0.7076 0.6443 0.8108 0.0408  0.1770  0.1247  135 LEU B CA  
1807 C C   . LEU B 135 ? 0.7024 0.6296 0.8350 0.0308  0.1820  0.1279  135 LEU B C   
1808 O O   . LEU B 135 ? 0.7261 0.6393 0.8729 0.0292  0.1851  0.1384  135 LEU B O   
1809 C CB  . LEU B 135 ? 0.6878 0.6191 0.7880 0.0403  0.1641  0.1090  135 LEU B CB  
1810 C CG  . LEU B 135 ? 0.7189 0.6588 0.7942 0.0490  0.1579  0.1049  135 LEU B CG  
1811 C CD1 . LEU B 135 ? 0.6976 0.6353 0.7731 0.0466  0.1463  0.0890  135 LEU B CD1 
1812 C CD2 . LEU B 135 ? 0.7591 0.6944 0.8248 0.0579  0.1612  0.1186  135 LEU B CD2 
1813 N N   . LYS B 136 ? 0.7103 0.6447 0.8524 0.0243  0.1820  0.1183  136 LYS B N   
1814 C CA  . LYS B 136 ? 0.6955 0.6222 0.8676 0.0145  0.1845  0.1173  136 LYS B CA  
1815 C C   . LYS B 136 ? 0.7161 0.6485 0.9013 0.0115  0.1984  0.1343  136 LYS B C   
1816 O O   . LYS B 136 ? 0.7432 0.6637 0.9526 0.0056  0.2027  0.1434  136 LYS B O   
1817 C CB  . LYS B 136 ? 0.6233 0.5545 0.8008 0.0094  0.1775  0.0978  136 LYS B CB  
1818 C CG  . LYS B 136 ? 0.6282 0.5497 0.8038 0.0098  0.1647  0.0821  136 LYS B CG  
1819 C CD  . LYS B 136 ? 0.6069 0.5302 0.7910 0.0050  0.1588  0.0643  136 LYS B CD  
1820 C CE  . LYS B 136 ? 0.6253 0.5638 0.7893 0.0071  0.1584  0.0574  136 LYS B CE  
1821 N NZ  . LYS B 136 ? 0.6097 0.5489 0.7806 0.0032  0.1530  0.0404  136 LYS B NZ  
1822 N N   . HIS B 137 ? 0.7314 0.6823 0.9014 0.0159  0.2050  0.1387  137 HIS B N   
1823 C CA  . HIS B 137 ? 0.7625 0.7234 0.9447 0.0136  0.2188  0.1542  137 HIS B CA  
1824 C C   . HIS B 137 ? 0.8717 0.8469 1.0294 0.0249  0.2278  0.1695  137 HIS B C   
1825 O O   . HIS B 137 ? 0.8964 0.8871 1.0569 0.0257  0.2385  0.1793  137 HIS B O   
1826 C CB  . HIS B 137 ? 0.7222 0.6960 0.9151 0.0076  0.2192  0.1427  137 HIS B CB  
1827 C CG  . HIS B 137 ? 0.6685 0.6311 0.8813 -0.0011 0.2093  0.1246  137 HIS B CG  
1828 N ND1 . HIS B 137 ? 0.6758 0.6397 0.8759 0.0002  0.1979  0.1043  137 HIS B ND1 
1829 C CD2 . HIS B 137 ? 0.6596 0.6096 0.9042 -0.0104 0.2089  0.1235  137 HIS B CD2 
1830 C CE1 . HIS B 137 ? 0.6965 0.6497 0.9180 -0.0069 0.1914  0.0917  137 HIS B CE1 
1831 N NE2 . HIS B 137 ? 0.6907 0.6356 0.9398 -0.0132 0.1972  0.1021  137 HIS B NE2 
1832 N N   . LYS B 138 ? 0.8599 1.0278 0.7250 0.1274  0.0949  -0.0820 138 LYS B N   
1833 C CA  . LYS B 138 ? 0.9386 1.1019 0.7741 0.1290  0.1244  -0.1019 138 LYS B CA  
1834 C C   . LYS B 138 ? 0.9080 1.0665 0.7767 0.1343  0.1553  -0.1058 138 LYS B C   
1835 O O   . LYS B 138 ? 0.9144 1.0741 0.7893 0.1374  0.1833  -0.1096 138 LYS B O   
1836 C CB  . LYS B 138 ? 1.0281 1.1984 0.8551 0.1287  0.1319  -0.0962 138 LYS B CB  
1837 C CG  . LYS B 138 ? 1.0927 1.2674 0.8868 0.1238  0.1020  -0.0925 138 LYS B CG  
1838 C CD  . LYS B 138 ? 1.1437 1.3242 0.9300 0.1231  0.1112  -0.0868 138 LYS B CD  
1839 C CE  . LYS B 138 ? 1.1729 1.3567 0.9257 0.1183  0.0806  -0.0836 138 LYS B CE  
1840 N NZ  . LYS B 138 ? 1.2109 1.3992 0.9520 0.1168  0.0891  -0.0790 138 LYS B NZ  
1841 N N   . SER B 139 ? 0.8997 1.0528 0.7901 0.1350  0.1494  -0.1047 139 SER B N   
1842 C CA  . SER B 139 ? 0.9022 1.0495 0.8253 0.1400  0.1751  -0.1085 139 SER B CA  
1843 C C   . SER B 139 ? 0.9715 1.1256 0.9522 0.1453  0.1926  -0.0900 139 SER B C   
1844 O O   . SER B 139 ? 1.0307 1.1812 1.0369 0.1501  0.2187  -0.0949 139 SER B O   
1845 C CB  . SER B 139 ? 0.8898 1.0289 0.7743 0.1411  0.2011  -0.1353 139 SER B CB  
1846 O OG  . SER B 139 ? 0.9365 1.0623 0.7743 0.1313  0.1831  -0.1495 139 SER B OG  
1847 N N   . GLN B 140 ? 0.9610 1.1251 0.9629 0.1443  0.1778  -0.0691 140 GLN B N   
1848 C CA  . GLN B 140 ? 0.9323 1.1045 0.9866 0.1488  0.1940  -0.0515 140 GLN B CA  
1849 C C   . GLN B 140 ? 0.9160 1.0873 1.0288 0.1526  0.1921  -0.0363 140 GLN B C   
1850 O O   . GLN B 140 ? 0.9599 1.1339 1.1151 0.1579  0.2150  -0.0306 140 GLN B O   
1851 C CB  . GLN B 140 ? 0.9375 1.1208 0.9940 0.1463  0.1790  -0.0340 140 GLN B CB  
1852 C CG  . GLN B 140 ? 0.9674 1.1531 0.9781 0.1437  0.1890  -0.0461 140 GLN B CG  
1853 C CD  . GLN B 140 ? 0.9722 1.1674 0.9810 0.1403  0.1694  -0.0289 140 GLN B CD  
1854 O OE1 . GLN B 140 ? 1.0212 1.2245 1.0486 0.1412  0.1835  -0.0192 140 GLN B OE1 
1855 N NE2 . GLN B 140 ? 0.9334 1.1281 0.9197 0.1360  0.1364  -0.0254 140 GLN B NE2 
1856 N N   . VAL B 141 ? 0.8305 0.9981 0.9461 0.1497  0.1647  -0.0299 141 VAL B N   
1857 C CA  . VAL B 141 ? 0.7922 0.9583 0.9627 0.1526  0.1597  -0.0142 141 VAL B CA  
1858 C C   . VAL B 141 ? 0.8355 0.9905 1.0154 0.1559  0.1789  -0.0284 141 VAL B C   
1859 O O   . VAL B 141 ? 0.8563 1.0109 1.0858 0.1613  0.1939  -0.0201 141 VAL B O   
1860 C CB  . VAL B 141 ? 0.7033 0.8702 0.8768 0.1479  0.1227  -0.0003 141 VAL B CB  
1861 C CG1 . VAL B 141 ? 0.6158 0.7805 0.8467 0.1508  0.1180  0.0163  141 VAL B CG1 
1862 C CG2 . VAL B 141 ? 0.6889 0.8669 0.8581 0.1452  0.1037  0.0151  141 VAL B CG2 
1863 N N   . ILE B 142 ? 0.8467 0.9925 0.9791 0.1529  0.1783  -0.0501 142 ILE B N   
1864 C CA  . ILE B 142 ? 0.8550 0.9893 0.9935 0.1552  0.1928  -0.0635 142 ILE B CA  
1865 C C   . ILE B 142 ? 0.8925 1.0244 1.0311 0.1607  0.2300  -0.0789 142 ILE B C   
1866 O O   . ILE B 142 ? 0.8724 0.9968 1.0361 0.1648  0.2464  -0.0843 142 ILE B O   
1867 C CB  . ILE B 142 ? 0.8045 0.9296 0.8949 0.1493  0.1760  -0.0799 142 ILE B CB  
1868 C CG1 . ILE B 142 ? 0.7631 0.8765 0.8728 0.1508  0.1824  -0.0859 142 ILE B CG1 
1869 C CG2 . ILE B 142 ? 0.7994 0.9229 0.8292 0.1473  0.1867  -0.1033 142 ILE B CG2 
1870 C CD1 . ILE B 142 ? 0.7701 0.8749 0.8359 0.1445  0.1663  -0.1012 142 ILE B CD1 
1871 N N   . ASN B 143 ? 0.9370 1.0752 1.0482 0.1606  0.2429  -0.0860 143 ASN B N   
1872 C CA  . ASN B 143 ? 0.9288 1.0662 1.0385 0.1653  0.2784  -0.1007 143 ASN B CA  
1873 C C   . ASN B 143 ? 0.9100 1.0572 1.0737 0.1709  0.2969  -0.0854 143 ASN B C   
1874 O O   . ASN B 143 ? 0.9634 1.1123 1.1314 0.1750  0.3270  -0.0957 143 ASN B O   
1875 C CB  . ASN B 143 ? 0.9625 1.1007 1.0128 0.1621  0.2858  -0.1186 143 ASN B CB  
1876 C CG  . ASN B 143 ? 1.0460 1.1728 1.0451 0.1587  0.2812  -0.1413 143 ASN B CG  
1877 O OD1 . ASN B 143 ? 1.0594 1.1770 1.0682 0.1594  0.2816  -0.1475 143 ASN B OD1 
1878 N ND2 . ASN B 143 ? 1.0789 1.2094 1.0270 0.1495  0.2659  -0.1525 143 ASN B ND2 
1879 N N   . GLU B 144 ? 0.8723 1.0264 1.0772 0.1710  0.2789  -0.0612 144 GLU B N   
1880 C CA  . GLU B 144 ? 0.8907 1.0545 1.1518 0.1763  0.2942  -0.0453 144 GLU B CA  
1881 C C   . GLU B 144 ? 0.9446 1.1042 1.2614 0.1804  0.2902  -0.0331 144 GLU B C   
1882 O O   . GLU B 144 ? 0.9509 1.1175 1.3198 0.1855  0.3025  -0.0202 144 GLU B O   
1883 C CB  . GLU B 144 ? 0.8958 1.0725 1.1634 0.1735  0.2797  -0.0259 144 GLU B CB  
1884 C CG  . GLU B 144 ? 0.9761 1.1582 1.1982 0.1704  0.2894  -0.0361 144 GLU B CG  
1885 C CD  . GLU B 144 ? 1.0626 1.2570 1.2926 0.1674  0.2745  -0.0162 144 GLU B CD  
1886 O OE1 . GLU B 144 ? 1.0894 1.2845 1.2736 0.1620  0.2584  -0.0195 144 GLU B OE1 
1887 O OE2 . GLU B 144 ? 1.0806 1.2838 1.3627 0.1706  0.2786  0.0025  144 GLU B OE2 
1888 N N   . MET B 145 ? 1.0075 1.1558 1.3130 0.1779  0.2726  -0.0373 145 MET B N   
1889 C CA  . MET B 145 ? 1.0108 1.1525 1.3642 0.1812  0.2684  -0.0281 145 MET B CA  
1890 C C   . MET B 145 ? 1.0713 1.2065 1.4429 0.1877  0.2998  -0.0429 145 MET B C   
1891 O O   . MET B 145 ? 1.0898 1.2217 1.4247 0.1881  0.3197  -0.0643 145 MET B O   
1892 C CB  . MET B 145 ? 0.9596 1.0909 1.2908 0.1756  0.2408  -0.0299 145 MET B CB  
1893 C CG  . MET B 145 ? 0.9306 1.0678 1.2599 0.1701  0.2067  -0.0113 145 MET B CG  
1894 S SD  . MET B 145 ? 0.8431 0.9686 1.1575 0.1639  0.1766  -0.0123 145 MET B SD  
1895 C CE  . MET B 145 ? 0.8033 0.9392 1.1176 0.1582  0.1397  0.0100  145 MET B CE  
1896 N N   . GLN B 146 ? 1.0955 1.2288 1.5244 0.1929  0.3036  -0.0317 146 GLN B N   
1897 C CA  . GLN B 146 ? 1.1136 1.2394 1.5638 0.1992  0.3301  -0.0451 146 GLN B CA  
1898 C C   . GLN B 146 ? 1.1116 1.2213 1.5278 0.1962  0.3240  -0.0622 146 GLN B C   
1899 O O   . GLN B 146 ? 1.0683 1.1730 1.4589 0.1896  0.2967  -0.0589 146 GLN B O   
1900 C CB  . GLN B 146 ? 1.1161 1.2432 1.6370 0.2053  0.3318  -0.0278 146 GLN B CB  
1901 C CG  . GLN B 146 ? 1.1000 1.2435 1.6608 0.2091  0.3411  -0.0116 146 GLN B CG  
1902 C CD  . GLN B 146 ? 1.1386 1.2852 1.6917 0.2097  0.3687  -0.0249 146 GLN B CD  
1903 O OE1 . GLN B 146 ? 1.1679 1.3034 1.7004 0.2085  0.3797  -0.0430 146 GLN B OE1 
1904 N NE2 . GLN B 146 ? 1.1459 1.3070 1.7109 0.2096  0.3755  -0.0151 146 GLN B NE2 
1905 N N   . LYS B 147 ? 1.1392 1.2410 1.5547 0.2005  0.3489  -0.0805 147 LYS B N   
1906 C CA  . LYS B 147 ? 1.0952 1.1810 1.4824 0.1977  0.3445  -0.0965 147 LYS B CA  
1907 C C   . LYS B 147 ? 1.0571 1.1346 1.4828 0.1975  0.3239  -0.0819 147 LYS B C   
1908 O O   . LYS B 147 ? 1.0410 1.1068 1.4420 0.1923  0.3079  -0.0880 147 LYS B O   
1909 C CB  . LYS B 147 ? 1.1260 1.2043 1.4953 0.1957  0.3598  -0.1129 147 LYS B CB  
1910 C CG  . LYS B 147 ? 1.1605 1.2261 1.4762 0.1902  0.3554  -0.1332 147 LYS B CG  
1911 C CD  . LYS B 147 ? 1.2237 1.2860 1.5228 0.1889  0.3688  -0.1465 147 LYS B CD  
1912 C CE  . LYS B 147 ? 1.2326 1.2859 1.4741 0.1831  0.3615  -0.1646 147 LYS B CE  
1913 N NZ  . LYS B 147 ? 1.2405 1.2938 1.4656 0.1826  0.3725  -0.1755 147 LYS B NZ  
1914 N N   . LYS B 148 ? 1.0445 1.1283 1.5294 0.2022  0.3231  -0.0621 148 LYS B N   
1915 C CA  . LYS B 148 ? 1.0061 1.0828 1.5331 0.2019  0.3030  -0.0455 148 LYS B CA  
1916 C C   . LYS B 148 ? 0.9648 1.0420 1.4710 0.1933  0.2673  -0.0323 148 LYS B C   
1917 O O   . LYS B 148 ? 0.9767 1.0439 1.4927 0.1898  0.2473  -0.0259 148 LYS B O   
1918 C CB  . LYS B 148 ? 1.0148 1.1003 1.6087 0.2092  0.3111  -0.0272 148 LYS B CB  
1919 C CG  . LYS B 148 ? 1.0812 1.1691 1.6866 0.2142  0.3419  -0.0386 148 LYS B CG  
1920 C CD  . LYS B 148 ? 1.0953 1.1910 1.7569 0.2174  0.3442  -0.0202 148 LYS B CD  
1921 C CE  . LYS B 148 ? 1.0976 1.1942 1.7591 0.2181  0.3683  -0.0318 148 LYS B CE  
1922 N NZ  . LYS B 148 ? 1.0815 1.1851 1.7974 0.2211  0.3713  -0.0155 148 LYS B NZ  
1923 N N   . ASP B 149 ? 0.9090 0.9979 1.3867 0.1897  0.2592  -0.0283 149 ASP B N   
1924 C CA  . ASP B 149 ? 0.8524 0.9437 1.3099 0.1818  0.2256  -0.0161 149 ASP B CA  
1925 C C   . ASP B 149 ? 0.7981 0.8803 1.1961 0.1744  0.2137  -0.0336 149 ASP B C   
1926 O O   . ASP B 149 ? 0.7533 0.8316 1.1424 0.1679  0.1860  -0.0265 149 ASP B O   
1927 C CB  . ASP B 149 ? 0.8855 0.9927 1.3355 0.1808  0.2207  -0.0053 149 ASP B CB  
1928 C CG  . ASP B 149 ? 0.8754 0.9926 1.3866 0.1865  0.2249  0.0164  149 ASP B CG  
1929 O OD1 . ASP B 149 ? 0.8868 1.0003 1.4424 0.1931  0.2424  0.0174  149 ASP B OD1 
1930 O OD2 . ASP B 149 ? 0.8634 0.9920 1.3787 0.1844  0.2104  0.0323  149 ASP B OD2 
1931 N N   . HIS B 150 ? 0.7874 0.8666 1.1447 0.1752  0.2348  -0.0568 150 HIS B N   
1932 C CA  . HIS B 150 ? 0.7655 0.8357 1.0662 0.1688  0.2271  -0.0760 150 HIS B CA  
1933 C C   . HIS B 150 ? 0.7587 0.8141 1.0725 0.1672  0.2205  -0.0787 150 HIS B C   
1934 O O   . HIS B 150 ? 0.8084 0.8572 1.0860 0.1599  0.2028  -0.0863 150 HIS B O   
1935 C CB  . HIS B 150 ? 0.8250 0.8944 1.0852 0.1711  0.2542  -0.1003 150 HIS B CB  
1936 C CG  . HIS B 150 ? 0.8620 0.9438 1.0914 0.1698  0.2556  -0.1014 150 HIS B CG  
1937 N ND1 . HIS B 150 ? 0.8700 0.9519 1.0550 0.1702  0.2753  -0.1225 150 HIS B ND1 
1938 C CD2 . HIS B 150 ? 0.8717 0.9655 1.1080 0.1679  0.2391  -0.0839 150 HIS B CD2 
1939 C CE1 . HIS B 150 ? 0.8661 0.9595 1.0319 0.1684  0.2706  -0.1178 150 HIS B CE1 
1940 N NE2 . HIS B 150 ? 0.8562 0.9569 1.0525 0.1670  0.2487  -0.0945 150 HIS B NE2 
1941 N N   . LYS B 151 ? 0.7556 0.8061 1.1215 0.1739  0.2346  -0.0726 151 LYS B N   
1942 C CA  . LYS B 151 ? 0.7576 0.7934 1.1423 0.1728  0.2284  -0.0732 151 LYS B CA  
1943 C C   . LYS B 151 ? 0.7177 0.7533 1.1305 0.1680  0.1968  -0.0503 151 LYS B C   
1944 O O   . LYS B 151 ? 0.6876 0.7127 1.0901 0.1619  0.1794  -0.0514 151 LYS B O   
1945 C CB  . LYS B 151 ? 0.7753 0.8054 1.2062 0.1822  0.2553  -0.0761 151 LYS B CB  
1946 C CG  . LYS B 151 ? 0.8324 0.8590 1.2352 0.1864  0.2862  -0.1014 151 LYS B CG  
1947 C CD  . LYS B 151 ? 0.8602 0.8736 1.2135 0.1802  0.2818  -0.1211 151 LYS B CD  
1948 C CE  . LYS B 151 ? 0.8972 0.9084 1.2167 0.1838  0.3114  -0.1465 151 LYS B CE  
1949 N NZ  . LYS B 151 ? 0.9164 0.9162 1.1820 0.1772  0.3061  -0.1660 151 LYS B NZ  
1950 N N   . GLN B 152 ? 0.6809 0.7283 1.1289 0.1705  0.1894  -0.0294 152 GLN B N   
1951 C CA  . GLN B 152 ? 0.6333 0.6816 1.1105 0.1664  0.1599  -0.0065 152 GLN B CA  
1952 C C   . GLN B 152 ? 0.6336 0.6834 1.0625 0.1560  0.1314  -0.0077 152 GLN B C   
1953 O O   . GLN B 152 ? 0.6810 0.7253 1.1171 0.1500  0.1070  0.0021  152 GLN B O   
1954 C CB  . GLN B 152 ? 0.5916 0.6532 1.1147 0.1713  0.1588  0.0155  152 GLN B CB  
1955 C CG  . GLN B 152 ? 0.5910 0.6528 1.1495 0.1678  0.1295  0.0399  152 GLN B CG  
1956 C CD  . GLN B 152 ? 0.6666 0.7394 1.2795 0.1740  0.1314  0.0616  152 GLN B CD  
1957 O OE1 . GLN B 152 ? 0.7547 0.8325 1.3919 0.1820  0.1574  0.0589  152 GLN B OE1 
1958 N NE2 . GLN B 152 ? 0.6485 0.7259 1.2810 0.1700  0.1038  0.0831  152 GLN B NE2 
1959 N N   . LEU B 153 ? 0.5979 0.6555 0.9778 0.1538  0.1344  -0.0199 153 LEU B N   
1960 C CA  . LEU B 153 ? 0.6158 0.6752 0.9451 0.1443  0.1096  -0.0250 153 LEU B CA  
1961 C C   . LEU B 153 ? 0.6395 0.6849 0.9416 0.1387  0.1053  -0.0405 153 LEU B C   
1962 O O   . LEU B 153 ? 0.6384 0.6811 0.9328 0.1309  0.0790  -0.0343 153 LEU B O   
1963 C CB  . LEU B 153 ? 0.5853 0.6540 0.8661 0.1439  0.1171  -0.0383 153 LEU B CB  
1964 C CG  . LEU B 153 ? 0.5645 0.6484 0.8591 0.1460  0.1114  -0.0221 153 LEU B CG  
1965 C CD1 . LEU B 153 ? 0.5028 0.5936 0.7507 0.1463  0.1238  -0.0375 153 LEU B CD1 
1966 C CD2 . LEU B 153 ? 0.4964 0.5861 0.7945 0.1394  0.0760  -0.0041 153 LEU B CD2 
1967 N N   . TRP B 154 ? 0.6564 0.6932 0.9448 0.1424  0.1313  -0.0604 154 TRP B N   
1968 C CA  . TRP B 154 ? 0.6565 0.6794 0.9179 0.1375  0.1306  -0.0768 154 TRP B CA  
1969 C C   . TRP B 154 ? 0.6859 0.6978 0.9879 0.1356  0.1179  -0.0639 154 TRP B C   
1970 O O   . TRP B 154 ? 0.7191 0.7249 1.0006 0.1268  0.0970  -0.0654 154 TRP B O   
1971 C CB  . TRP B 154 ? 0.6492 0.6653 0.8936 0.1433  0.1633  -0.0996 154 TRP B CB  
1972 C CG  . TRP B 154 ? 0.6720 0.6724 0.8999 0.1398  0.1660  -0.1147 154 TRP B CG  
1973 C CD1 . TRP B 154 ? 0.6706 0.6588 0.9291 0.1451  0.1840  -0.1190 154 TRP B CD1 
1974 C CD2 . TRP B 154 ? 0.6686 0.6640 0.8458 0.1300  0.1496  -0.1277 154 TRP B CD2 
1975 N NE1 . TRP B 154 ? 0.7214 0.6965 0.9508 0.1390  0.1798  -0.1334 154 TRP B NE1 
1976 C CE2 . TRP B 154 ? 0.6841 0.6637 0.8634 0.1296  0.1591  -0.1390 154 TRP B CE2 
1977 C CE3 . TRP B 154 ? 0.6296 0.6327 0.7603 0.1216  0.1278  -0.1312 154 TRP B CE3 
1978 C CZ2 . TRP B 154 ? 0.5866 0.5581 0.7227 0.1206  0.1478  -0.1532 154 TRP B CZ2 
1979 C CZ3 . TRP B 154 ? 0.5573 0.5529 0.6455 0.1129  0.1168  -0.1459 154 TRP B CZ3 
1980 C CH2 . TRP B 154 ? 0.6541 0.6342 0.7451 0.1123  0.1269  -0.1566 154 TRP B CH2 
1981 N N   . MET B 155 ? 0.6288 0.6385 0.9883 0.1435  0.1302  -0.0515 155 MET B N   
1982 C CA  . MET B 155 ? 0.5900 0.5888 0.9927 0.1425  0.1186  -0.0379 155 MET B CA  
1983 C C   . MET B 155 ? 0.6191 0.6230 1.0306 0.1348  0.0841  -0.0172 155 MET B C   
1984 O O   . MET B 155 ? 0.5947 0.5888 1.0158 0.1287  0.0664  -0.0111 155 MET B O   
1985 C CB  . MET B 155 ? 0.5914 0.5892 1.0559 0.1532  0.1379  -0.0277 155 MET B CB  
1986 C CG  . MET B 155 ? 0.6503 0.6389 1.1166 0.1604  0.1696  -0.0470 155 MET B CG  
1987 S SD  . MET B 155 ? 1.3708 1.3623 1.9097 0.1735  0.1927  -0.0354 155 MET B SD  
1988 C CE  . MET B 155 ? 0.6037 0.5905 1.1971 0.1708  0.1638  -0.0074 155 MET B CE  
1989 N N   . GLY B 156 ? 0.6050 0.6240 1.0133 0.1349  0.0747  -0.0065 156 GLY B N   
1990 C CA  . GLY B 156 ? 0.5502 0.5758 0.9644 0.1279  0.0422  0.0125  156 GLY B CA  
1991 C C   . GLY B 156 ? 0.5889 0.6113 0.9519 0.1165  0.0212  0.0018  156 GLY B C   
1992 O O   . GLY B 156 ? 0.5858 0.6046 0.9584 0.1092  -0.0034 0.0132  156 GLY B O   
1993 N N   . LEU B 157 ? 0.6095 0.6336 0.9181 0.1148  0.0312  -0.0206 157 LEU B N   
1994 C CA  . LEU B 157 ? 0.6038 0.6258 0.8591 0.1043  0.0142  -0.0343 157 LEU B CA  
1995 C C   . LEU B 157 ? 0.6095 0.6152 0.8658 0.0996  0.0136  -0.0414 157 LEU B C   
1996 O O   . LEU B 157 ? 0.6277 0.6309 0.8711 0.0898  -0.0108 -0.0379 157 LEU B O   
1997 C CB  . LEU B 157 ? 0.4950 0.5217 0.6942 0.1047  0.0284  -0.0577 157 LEU B CB  
1998 C CG  . LEU B 157 ? 0.5599 0.5849 0.7003 0.0945  0.0140  -0.0754 157 LEU B CG  
1999 C CD1 . LEU B 157 ? 0.4917 0.5280 0.6193 0.0863  -0.0194 -0.0638 157 LEU B CD1 
2000 C CD2 . LEU B 157 ? 0.5718 0.5986 0.6617 0.0966  0.0332  -0.1002 157 LEU B CD2 
2001 N N   . GLN B 158 ? 0.5978 0.5926 0.8696 0.1066  0.0403  -0.0512 158 GLN B N   
2002 C CA  . GLN B 158 ? 0.6313 0.6095 0.8993 0.1028  0.0432  -0.0613 158 GLN B CA  
2003 C C   . GLN B 158 ? 0.6638 0.6339 0.9773 0.0994  0.0247  -0.0410 158 GLN B C   
2004 O O   . GLN B 158 ? 0.6154 0.5759 0.9145 0.0904  0.0101  -0.0440 158 GLN B O   
2005 C CB  . GLN B 158 ? 0.6564 0.6256 0.9326 0.1122  0.0773  -0.0766 158 GLN B CB  
2006 C CG  . GLN B 158 ? 0.6798 0.6313 0.9467 0.1086  0.0824  -0.0898 158 GLN B CG  
2007 C CD  . GLN B 158 ? 0.7358 0.6798 1.0028 0.1177  0.1164  -0.1080 158 GLN B CD  
2008 O OE1 . GLN B 158 ? 0.7404 0.6912 1.0293 0.1276  0.1368  -0.1067 158 GLN B OE1 
2009 N NE2 . GLN B 158 ? 0.7887 0.7190 1.0308 0.1140  0.1226  -0.1253 158 GLN B NE2 
2010 N N   . ASN B 159 ? 0.5335 0.7293 0.8906 0.1870  0.0895  -0.0210 159 ASN B N   
2011 C CA  . ASN B 159 ? 0.5232 0.7518 0.9037 0.1787  0.0879  -0.0146 159 ASN B CA  
2012 C C   . ASN B 159 ? 0.5597 0.8101 0.9720 0.1631  0.0837  -0.0121 159 ASN B C   
2013 O O   . ASN B 159 ? 0.5711 0.8508 1.0068 0.1535  0.0826  -0.0052 159 ASN B O   
2014 C CB  . ASN B 159 ? 0.5714 0.8145 0.9726 0.1798  0.1016  0.0018  159 ASN B CB  
2015 C CG  . ASN B 159 ? 0.6542 0.8753 1.0284 0.1922  0.1063  0.0009  159 ASN B CG  
2016 O OD1 . ASN B 159 ? 0.6583 0.8622 1.0022 0.1973  0.0954  -0.0144 159 ASN B OD1 
2017 N ND2 . ASN B 159 ? 0.6916 0.9134 1.0769 0.1961  0.1222  0.0181  159 ASN B ND2 
2018 N N   . ASP B 160 ? 0.6031 0.8375 1.0166 0.1586  0.0800  -0.0189 160 ASP B N   
2019 C CA  . ASP B 160 ? 0.5853 0.8361 1.0313 0.1405  0.0729  -0.0208 160 ASP B CA  
2020 C C   . ASP B 160 ? 0.5784 0.8611 1.0673 0.1295  0.0801  -0.0058 160 ASP B C   
2021 O O   . ASP B 160 ? 0.5933 0.9019 1.1024 0.1148  0.0727  -0.0038 160 ASP B O   
2022 C CB  . ASP B 160 ? 0.5642 0.8221 0.9987 0.1330  0.0595  -0.0281 160 ASP B CB  
2023 C CG  . ASP B 160 ? 0.6140 0.8784 1.0724 0.1135  0.0481  -0.0363 160 ASP B CG  
2024 O OD1 . ASP B 160 ? 0.6080 0.8838 1.0645 0.1037  0.0379  -0.0393 160 ASP B OD1 
2025 O OD2 . ASP B 160 ? 0.6664 0.9235 1.1439 0.1078  0.0487  -0.0404 160 ASP B OD2 
2026 N N   . ARG B 161 ? 0.5430 0.8221 1.0417 0.1361  0.0945  0.0061  161 ARG B N   
2027 C CA  . ARG B 161 ? 0.5367 0.8431 1.0719 0.1265  0.1033  0.0239  161 ARG B CA  
2028 C C   . ARG B 161 ? 0.4977 0.8020 1.0604 0.1173  0.1064  0.0268  161 ARG B C   
2029 O O   . ARG B 161 ? 0.5490 0.8355 1.1093 0.1267  0.1186  0.0327  161 ARG B O   
2030 C CB  . ARG B 161 ? 0.6181 0.9232 1.1457 0.1394  0.1185  0.0388  161 ARG B CB  
2031 C CG  . ARG B 161 ? 0.6601 0.9688 1.1653 0.1466  0.1154  0.0362  161 ARG B CG  
2032 C CD  . ARG B 161 ? 0.7109 1.0530 1.2386 0.1341  0.1119  0.0439  161 ARG B CD  
2033 N NE  . ARG B 161 ? 0.8150 1.1736 1.3700 0.1296  0.1245  0.0641  161 ARG B NE  
2034 C CZ  . ARG B 161 ? 0.8425 1.2008 1.3936 0.1389  0.1369  0.0776  161 ARG B CZ  
2035 N NH1 . ARG B 161 ? 0.8636 1.2056 1.3855 0.1523  0.1377  0.0722  161 ARG B NH1 
2036 N NH2 . ARG B 161 ? 0.7968 1.1706 1.3725 0.1342  0.1477  0.0966  161 ARG B NH2 
2037 N N   . PHE B 162 ? 0.4624 0.7841 1.0490 0.0982  0.0947  0.0222  162 PHE B N   
2038 C CA  . PHE B 162 ? 0.4403 0.7600 1.0532 0.0862  0.0937  0.0213  162 PHE B CA  
2039 C C   . PHE B 162 ? 0.4729 0.8030 1.1102 0.0854  0.1097  0.0423  162 PHE B C   
2040 O O   . PHE B 162 ? 0.4795 0.7915 1.1207 0.0913  0.1190  0.0442  162 PHE B O   
2041 C CB  . PHE B 162 ? 0.3777 0.7157 1.0070 0.0636  0.0762  0.0132  162 PHE B CB  
2042 C CG  . PHE B 162 ? 0.4085 0.7463 1.0641 0.0482  0.0728  0.0118  162 PHE B CG  
2043 C CD1 . PHE B 162 ? 0.4319 0.7449 1.0834 0.0474  0.0652  -0.0066 162 PHE B CD1 
2044 C CD2 . PHE B 162 ? 0.3920 0.7528 1.0740 0.0339  0.0763  0.0279  162 PHE B CD2 
2045 C CE1 . PHE B 162 ? 0.4365 0.7488 1.1114 0.0322  0.0610  -0.0090 162 PHE B CE1 
2046 C CE2 . PHE B 162 ? 0.4381 0.7976 1.1414 0.0187  0.0723  0.0269  162 PHE B CE2 
2047 C CZ  . PHE B 162 ? 0.4686 0.8041 1.1690 0.0173  0.0645  0.0085  162 PHE B CZ  
2048 N N   . ASP B 163 ? 0.4848 0.8427 1.1363 0.0781  0.1128  0.0578  163 ASP B N   
2049 C CA  . ASP B 163 ? 0.5503 0.9201 1.2245 0.0751  0.1268  0.0788  163 ASP B CA  
2050 C C   . ASP B 163 ? 0.5450 0.8961 1.2040 0.0962  0.1458  0.0896  163 ASP B C   
2051 O O   . ASP B 163 ? 0.5402 0.8891 1.2137 0.0969  0.1585  0.1031  163 ASP B O   
2052 C CB  . ASP B 163 ? 0.6269 1.0272 1.3138 0.0641  0.1249  0.0911  163 ASP B CB  
2053 C CG  . ASP B 163 ? 0.6964 1.1141 1.3965 0.0418  0.1074  0.0828  163 ASP B CG  
2054 O OD1 . ASP B 163 ? 0.6972 1.1086 1.4091 0.0303  0.1006  0.0760  163 ASP B OD1 
2055 O OD2 . ASP B 163 ? 0.7325 1.1682 1.4287 0.0359  0.1003  0.0824  163 ASP B OD2 
2056 N N   . GLN B 164 ? 0.5577 0.8941 1.1845 0.1127  0.1471  0.0834  164 GLN B N   
2057 C CA  . GLN B 164 ? 0.5902 0.9050 1.1941 0.1326  0.1629  0.0915  164 GLN B CA  
2058 C C   . GLN B 164 ? 0.6256 0.9080 1.2165 0.1414  0.1673  0.0834  164 GLN B C   
2059 O O   . GLN B 164 ? 0.6709 0.9393 1.2564 0.1515  0.1824  0.0949  164 GLN B O   
2060 C CB  . GLN B 164 ? 0.5958 0.9013 1.1653 0.1455  0.1598  0.0842  164 GLN B CB  
2061 C CG  . GLN B 164 ? 0.6759 0.9569 1.2168 0.1644  0.1735  0.0907  164 GLN B CG  
2062 C CD  . GLN B 164 ? 0.7830 1.0515 1.2881 0.1752  0.1676  0.0801  164 GLN B CD  
2063 O OE1 . GLN B 164 ? 0.8392 1.1171 1.3406 0.1698  0.1539  0.0681  164 GLN B OE1 
2064 N NE2 . GLN B 164 ? 0.8506 1.0977 1.3290 0.1896  0.1772  0.0845  164 GLN B NE2 
2065 N N   . PHE B 165 ? 0.5568 0.8258 1.1409 0.1373  0.1534  0.0631  165 PHE B N   
2066 C CA  . PHE B 165 ? 0.4855 0.7196 1.0531 0.1451  0.1547  0.0514  165 PHE B CA  
2067 C C   . PHE B 165 ? 0.4866 0.7257 1.0894 0.1351  0.1614  0.0596  165 PHE B C   
2068 O O   . PHE B 165 ? 0.4786 0.6927 1.0707 0.1455  0.1729  0.0629  165 PHE B O   
2069 C CB  . PHE B 165 ? 0.4364 0.6548 0.9863 0.1422  0.1363  0.0263  165 PHE B CB  
2070 C CG  . PHE B 165 ? 0.4356 0.6149 0.9645 0.1485  0.1346  0.0116  165 PHE B CG  
2071 C CD1 . PHE B 165 ? 0.4174 0.5604 0.8954 0.1658  0.1370  0.0050  165 PHE B CD1 
2072 C CD2 . PHE B 165 ? 0.4330 0.6112 0.9901 0.1354  0.1286  0.0032  165 PHE B CD2 
2073 C CE1 . PHE B 165 ? 0.4324 0.5370 0.8839 0.1701  0.1336  -0.0087 165 PHE B CE1 
2074 C CE2 . PHE B 165 ? 0.4199 0.5562 0.9457 0.1387  0.1241  -0.0116 165 PHE B CE2 
2075 C CZ  . PHE B 165 ? 0.4475 0.5482 0.9263 0.1582  0.1287  -0.0172 165 PHE B CZ  
2076 N N   . TRP B 166 ? 0.4699 0.7401 1.1117 0.1138  0.1529  0.0623  166 TRP B N   
2077 C CA  . TRP B 166 ? 0.4542 0.7227 1.1133 0.0973  0.1515  0.0663  166 TRP B CA  
2078 C C   . TRP B 166 ? 0.4867 0.7702 1.1653 0.0979  0.1698  0.0924  166 TRP B C   
2079 O O   . TRP B 166 ? 0.5444 0.8176 1.2264 0.0879  0.1714  0.0975  166 TRP B O   
2080 C CB  . TRP B 166 ? 0.3615 0.6517 1.0457 0.0718  0.1322  0.0573  166 TRP B CB  
2081 C CG  . TRP B 166 ? 0.3841 0.6463 1.0444 0.0668  0.1140  0.0306  166 TRP B CG  
2082 C CD1 . TRP B 166 ? 0.3932 0.6562 1.0446 0.0684  0.1007  0.0127  166 TRP B CD1 
2083 C CD2 . TRP B 166 ? 0.3822 0.6112 1.0244 0.0598  0.1073  0.0191  166 TRP B CD2 
2084 N NE1 . TRP B 166 ? 0.3685 0.6012 0.9976 0.0628  0.0862  -0.0094 166 TRP B NE1 
2085 C CE2 . TRP B 166 ? 0.3666 0.5779 0.9896 0.0575  0.0899  -0.0060 166 TRP B CE2 
2086 C CE3 . TRP B 166 ? 0.3883 0.6012 1.0290 0.0553  0.1144  0.0277  166 TRP B CE3 
2087 C CZ2 . TRP B 166 ? 0.3706 0.5487 0.9731 0.0509  0.0793  -0.0228 166 TRP B CZ2 
2088 C CZ3 . TRP B 166 ? 0.4176 0.5973 1.0379 0.0487  0.1038  0.0111  166 TRP B CZ3 
2089 C CH2 . TRP B 166 ? 0.3993 0.5619 1.0008 0.0467  0.0864  -0.0140 166 TRP B CH2 
2090 N N   . ALA B 167 ? 0.4384 0.7416 1.1213 0.1084  0.1814  0.1081  167 ALA B N   
2091 C CA  . ALA B 167 ? 0.4790 0.7922 1.1726 0.1115  0.1992  0.1324  167 ALA B CA  
2092 C C   . ALA B 167 ? 0.5102 0.7908 1.1851 0.1283  0.2146  0.1353  167 ALA B C   
2093 O O   . ALA B 167 ? 0.5139 0.7946 1.1979 0.1249  0.2256  0.1511  167 ALA B O   
2094 C CB  . ALA B 167 ? 0.4852 0.8105 1.1644 0.1198  0.2037  0.1428  167 ALA B CB  
2095 N N   . ILE B 168 ? 0.5248 0.7713 1.1623 0.1444  0.2117  0.1180  168 ILE B N   
2096 C CA  . ILE B 168 ? 0.5407 0.7467 1.1443 0.1595  0.2217  0.1166  168 ILE B CA  
2097 C C   . ILE B 168 ? 0.5564 0.7296 1.1406 0.1489  0.2069  0.0969  168 ILE B C   
2098 O O   . ILE B 168 ? 0.6123 0.7616 1.1841 0.1492  0.2128  0.1003  168 ILE B O   
2099 C CB  . ILE B 168 ? 0.5155 0.6959 1.0734 0.1812  0.2241  0.1091  168 ILE B CB  
2100 C CG1 . ILE B 168 ? 0.4842 0.6876 1.0410 0.1845  0.2300  0.1243  168 ILE B CG1 
2101 C CG2 . ILE B 168 ? 0.5375 0.6775 1.0608 0.1967  0.2348  0.1088  168 ILE B CG2 
2102 C CD1 . ILE B 168 ? 0.4438 0.6619 1.0206 0.1853  0.2485  0.1500  168 ILE B CD1 
2103 N N   . ASN B 169 ? 0.5367 0.7093 1.1185 0.1395  0.1878  0.0764  169 ASN B N   
2104 C CA  . ASN B 169 ? 0.5143 0.6548 1.0754 0.1310  0.1728  0.0555  169 ASN B CA  
2105 C C   . ASN B 169 ? 0.5767 0.7230 1.1588 0.1078  0.1669  0.0598  169 ASN B C   
2106 O O   . ASN B 169 ? 0.6025 0.7183 1.1663 0.1025  0.1593  0.0475  169 ASN B O   
2107 C CB  . ASN B 169 ? 0.4838 0.6245 1.0384 0.1269  0.1539  0.0329  169 ASN B CB  
2108 C CG  . ASN B 169 ? 0.5282 0.6284 1.0517 0.1258  0.1409  0.0096  169 ASN B CG  
2109 O OD1 . ASN B 169 ? 0.5645 0.6289 1.0566 0.1409  0.1483  0.0062  169 ASN B OD1 
2110 N ND2 . ASN B 169 ? 0.3726 0.4781 0.9045 0.1078  0.1215  -0.0066 169 ASN B ND2 
2111 N N   . ARG B 170 ? 0.5529 0.7380 1.1734 0.0940  0.1700  0.0773  170 ARG B N   
2112 C CA  . ARG B 170 ? 0.5226 0.7156 1.1657 0.0717  0.1647  0.0829  170 ARG B CA  
2113 C C   . ARG B 170 ? 0.5757 0.7442 1.2062 0.0774  0.1785  0.0943  170 ARG B C   
2114 O O   . ARG B 170 ? 0.6078 0.7643 1.2413 0.0626  0.1720  0.0915  170 ARG B O   
2115 C CB  . ARG B 170 ? 0.4865 0.7276 1.1743 0.0562  0.1654  0.0998  170 ARG B CB  
2116 C CG  . ARG B 170 ? 0.5641 0.8266 1.2675 0.0671  0.1867  0.1261  170 ARG B CG  
2117 C CD  . ARG B 170 ? 0.6389 0.9475 1.3879 0.0490  0.1857  0.1422  170 ARG B CD  
2118 N NE  . ARG B 170 ? 0.7536 1.0851 1.5190 0.0596  0.2058  0.1672  170 ARG B NE  
2119 C CZ  . ARG B 170 ? 0.8306 1.2017 1.6353 0.0471  0.2095  0.1856  170 ARG B CZ  
2120 N NH1 . ARG B 170 ? 0.8630 1.2521 1.6898 0.0232  0.1930  0.1809  170 ARG B NH1 
2121 N NH2 . ARG B 170 ? 0.8576 1.2391 1.6612 0.0577  0.2247  0.2052  170 ARG B NH2 
2122 N N   . LYS B 171 ? 0.6084 0.7691 1.2244 0.0990  0.1974  0.1068  171 LYS B N   
2123 C CA  . LYS B 171 ? 0.6804 0.8159 1.2807 0.1075  0.2118  0.1175  171 LYS B CA  
2124 C C   . LYS B 171 ? 0.7158 0.8050 1.2794 0.1109  0.2030  0.0970  171 LYS B C   
2125 O O   . LYS B 171 ? 0.7377 0.8063 1.2942 0.1067  0.2063  0.1004  171 LYS B O   
2126 C CB  . LYS B 171 ? 0.7400 0.8748 1.3285 0.1322  0.2330  0.1326  171 LYS B CB  
2127 C CG  . LYS B 171 ? 0.7995 0.9782 1.4225 0.1316  0.2443  0.1549  171 LYS B CG  
2128 C CD  . LYS B 171 ? 0.8494 1.0230 1.4572 0.1571  0.2657  0.1691  171 LYS B CD  
2129 C CE  . LYS B 171 ? 0.8660 1.0833 1.5070 0.1579  0.2768  0.1902  171 LYS B CE  
2130 N NZ  . LYS B 171 ? 0.8904 1.1024 1.5150 0.1839  0.2968  0.2022  171 LYS B NZ  
2131 N N   . LEU B 172 ? 0.7107 0.7839 1.2513 0.1186  0.1919  0.0758  172 LEU B N   
2132 C CA  . LEU B 172 ? 0.7016 0.7308 1.2060 0.1233  0.1831  0.0549  172 LEU B CA  
2133 C C   . LEU B 172 ? 0.6829 0.7081 1.1957 0.0999  0.1630  0.0395  172 LEU B C   
2134 O O   . LEU B 172 ? 0.6770 0.6668 1.1635 0.1001  0.1546  0.0229  172 LEU B O   
2135 C CB  . LEU B 172 ? 0.6769 0.6902 1.1529 0.1417  0.1796  0.0386  172 LEU B CB  
2136 C CG  . LEU B 172 ? 0.6905 0.7001 1.1515 0.1673  0.1990  0.0512  172 LEU B CG  
2137 C CD1 . LEU B 172 ? 0.6483 0.6641 1.1003 0.1798  0.1946  0.0406  172 LEU B CD1 
2138 C CD2 . LEU B 172 ? 0.7024 0.6685 1.1268 0.1832  0.2081  0.0489  172 LEU B CD2 
2139 N N   . MET B 173 ? 0.6677 0.7295 1.2175 0.0797  0.1553  0.0452  173 MET B N   
2140 C CA  . MET B 173 ? 0.7011 0.7629 1.2617 0.0567  0.1357  0.0311  173 MET B CA  
2141 C C   . MET B 173 ? 0.7680 0.8378 1.3520 0.0391  0.1381  0.0451  173 MET B C   
2142 O O   . MET B 173 ? 0.7414 0.8145 1.3388 0.0184  0.1228  0.0362  173 MET B O   
2143 C CB  . MET B 173 ? 0.6536 0.7485 1.2374 0.0448  0.1219  0.0237  173 MET B CB  
2144 C CG  . MET B 173 ? 0.6127 0.6956 1.1723 0.0577  0.1139  0.0042  173 MET B CG  
2145 S SD  . MET B 173 ? 0.6133 0.6431 1.1297 0.0628  0.1025  -0.0222 173 MET B SD  
2146 C CE  . MET B 173 ? 0.5338 0.5599 1.0298 0.0775  0.0946  -0.0408 173 MET B CE  
2147 N N   . GLU B 174 ? 0.7821 0.9527 1.0856 -0.0786 0.2548  0.0927  174 GLU B N   
2148 C CA  . GLU B 174 ? 0.8570 1.0218 1.1665 -0.1021 0.2497  0.1067  174 GLU B CA  
2149 C C   . GLU B 174 ? 0.8605 0.9898 1.1639 -0.1098 0.2510  0.1132  174 GLU B C   
2150 O O   . GLU B 174 ? 0.8691 0.9848 1.1574 -0.0971 0.2548  0.1072  174 GLU B O   
2151 C CB  . GLU B 174 ? 0.9380 1.1053 1.2458 -0.1113 0.2538  0.1242  174 GLU B CB  
2152 C CG  . GLU B 174 ? 1.0171 1.1666 1.3104 -0.1038 0.2628  0.1337  174 GLU B CG  
2153 C CD  . GLU B 174 ? 1.1125 1.2694 1.4078 -0.1111 0.2667  0.1487  174 GLU B CD  
2154 O OE1 . GLU B 174 ? 1.1349 1.3119 1.4417 -0.1190 0.2637  0.1500  174 GLU B OE1 
2155 O OE2 . GLU B 174 ? 1.1520 1.2956 1.4383 -0.1088 0.2729  0.1585  174 GLU B OE2 
2156 N N   . TYR B 175 ? 0.8358 0.9394 1.1598 -0.1291 0.2521  0.1277  175 TYR B N   
2157 C CA  . TYR B 175 ? 0.8401 0.8923 1.1686 -0.1373 0.2565  0.1368  175 TYR B CA  
2158 C C   . TYR B 175 ? 0.9166 0.9420 1.2388 -0.1651 0.2457  0.1588  175 TYR B C   
2159 O O   . TYR B 175 ? 0.9326 0.9792 1.2639 -0.1768 0.2390  0.1633  175 TYR B O   
2160 C CB  . TYR B 175 ? 0.7975 0.8286 1.1663 -0.1318 0.2634  0.1204  175 TYR B CB  
2161 C CG  . TYR B 175 ? 0.7479 0.8006 1.1590 -0.1385 0.2570  0.1116  175 TYR B CG  
2162 C CD1 . TYR B 175 ? 0.7389 0.7562 1.1740 -0.1639 0.2417  0.1224  175 TYR B CD1 
2163 C CD2 . TYR B 175 ? 0.6558 0.7595 1.0772 -0.1196 0.2593  0.0911  175 TYR B CD2 
2164 C CE1 . TYR B 175 ? 0.6737 0.7118 1.1469 -0.1690 0.2287  0.1110  175 TYR B CE1 
2165 C CE2 . TYR B 175 ? 0.6274 0.7549 1.0880 -0.1245 0.2516  0.0809  175 TYR B CE2 
2166 C CZ  . TYR B 175 ? 0.6386 0.7370 1.1331 -0.1505 0.2386  0.0908  175 TYR B CZ  
2167 O OH  . TYR B 175 ? 0.6781 0.7983 1.1996 -0.1513 0.2194  0.0757  175 TYR B OH  
2168 N N   . PRO B 176 ? 0.9406 0.9177 1.2421 -0.1757 0.2420  0.1712  176 PRO B N   
2169 C CA  . PRO B 176 ? 1.0128 0.9584 1.2968 -0.2026 0.2280  0.1905  176 PRO B CA  
2170 C C   . PRO B 176 ? 1.1101 1.0380 1.4232 -0.2194 0.2154  0.1937  176 PRO B C   
2171 O O   . PRO B 176 ? 1.1206 1.0358 1.4696 -0.2134 0.2130  0.1811  176 PRO B O   
2172 C CB  . PRO B 176 ? 1.0378 0.9241 1.2970 -0.2063 0.2231  0.1973  176 PRO B CB  
2173 C CG  . PRO B 176 ? 1.0143 0.8939 1.2883 -0.1829 0.2357  0.1801  176 PRO B CG  
2174 C CD  . PRO B 176 ? 0.9291 0.8763 1.2165 -0.1628 0.2495  0.1661  176 PRO B CD  
2175 N N   . ALA B 177 ? 1.1742 1.0999 1.4725 -0.2409 0.2061  0.2071  177 ALA B N   
2176 C CA  . ALA B 177 ? 1.2020 1.1178 1.5262 -0.2573 0.1924  0.2100  177 ALA B CA  
2177 C C   . ALA B 177 ? 1.2552 1.1023 1.5941 -0.2658 0.1700  0.2086  177 ALA B C   
2178 O O   . ALA B 177 ? 1.2332 1.0789 1.6140 -0.2657 0.1568  0.1976  177 ALA B O   
2179 C CB  . ALA B 177 ? 1.2019 1.1202 1.4997 -0.2788 0.1893  0.2226  177 ALA B CB  
2180 N N   . GLU B 178 ? 1.3056 1.0928 1.6075 -0.2725 0.1605  0.2160  178 GLU B N   
2181 C CA  . GLU B 178 ? 1.3870 1.0955 1.6880 -0.2790 0.1299  0.2114  178 GLU B CA  
2182 C C   . GLU B 178 ? 1.3413 1.0394 1.6635 -0.2540 0.1184  0.1814  178 GLU B C   
2183 O O   . GLU B 178 ? 1.3721 1.0329 1.6798 -0.2456 0.0779  0.1569  178 GLU B O   
2184 C CB  . GLU B 178 ? 1.5010 1.1493 1.7458 -0.2869 0.1226  0.2218  178 GLU B CB  
2185 C CG  . GLU B 178 ? 1.5363 1.1940 1.7587 -0.2705 0.1425  0.2208  178 GLU B CG  
2186 C CD  . GLU B 178 ? 1.5766 1.2961 1.7810 -0.2725 0.1653  0.2315  178 GLU B CD  
2187 O OE1 . GLU B 178 ? 1.5746 1.3481 1.7965 -0.2765 0.1743  0.2326  178 GLU B OE1 
2188 O OE2 . GLU B 178 ? 1.5957 1.3079 1.7680 -0.2693 0.1701  0.2361  178 GLU B OE2 
2189 N N   . GLU B 179 ? 1.2605 1.0010 1.5928 -0.2339 0.1477  0.1727  179 GLU B N   
2190 C CA  . GLU B 179 ? 1.1843 0.9336 1.5130 -0.2007 0.1344  0.1325  179 GLU B CA  
2191 C C   . GLU B 179 ? 1.0911 0.9004 1.4567 -0.1915 0.1325  0.1139  179 GLU B C   
2192 O O   . GLU B 179 ? 1.0817 0.9308 1.4768 -0.2097 0.1471  0.1340  179 GLU B O   
2193 C CB  . GLU B 179 ? 1.1339 0.9030 1.4568 -0.1834 0.1672  0.1305  179 GLU B CB  
2194 C CG  . GLU B 179 ? 1.1667 0.8773 1.4520 -0.1894 0.1697  0.1462  179 GLU B CG  
2195 C CD  . GLU B 179 ? 1.2564 0.8974 1.5034 -0.1750 0.1271  0.1197  179 GLU B CD  
2196 O OE1 . GLU B 179 ? 1.2292 0.8734 1.4793 -0.1551 0.0995  0.0850  179 GLU B OE1 
2197 O OE2 . GLU B 179 ? 1.3511 0.9338 1.5644 -0.1835 0.1209  0.1332  179 GLU B OE2 
2198 N N   . ASN B 180 ? 0.9746 0.7904 1.3383 -0.1633 0.1143  0.0751  180 ASN B N   
2199 C CA  . ASN B 180 ? 0.8893 0.7610 1.2859 -0.1521 0.1117  0.0541  180 ASN B CA  
2200 C C   . ASN B 180 ? 0.8407 0.7590 1.2475 -0.1242 0.1334  0.0300  180 ASN B C   
2201 O O   . ASN B 180 ? 0.8050 0.7578 1.2296 -0.1073 0.1238  0.0016  180 ASN B O   
2202 C CB  . ASN B 180 ? 0.9283 0.7659 1.3168 -0.1466 0.0631  0.0272  180 ASN B CB  
2203 C CG  . ASN B 180 ? 0.9809 0.7817 1.3652 -0.1755 0.0428  0.0506  180 ASN B CG  
2204 O OD1 . ASN B 180 ? 1.0110 0.8468 1.4241 -0.1901 0.0455  0.0614  180 ASN B OD1 
2205 N ND2 . ASN B 180 ? 0.9940 0.7238 1.3417 -0.1842 0.0224  0.0586  180 ASN B ND2 
2206 N N   . GLY B 181 ? 0.8008 0.7195 1.1955 -0.1201 0.1630  0.0415  181 GLY B N   
2207 C CA  . GLY B 181 ? 0.7106 0.6716 1.1125 -0.0954 0.1871  0.0217  181 GLY B CA  
2208 C C   . GLY B 181 ? 0.6561 0.6018 1.0373 -0.0932 0.2144  0.0364  181 GLY B C   
2209 O O   . GLY B 181 ? 0.6343 0.5387 0.9967 -0.1119 0.2166  0.0640  181 GLY B O   
2210 N N   . PHE B 182 ? 0.5989 0.5781 0.9832 -0.0706 0.2356  0.0177  182 PHE B N   
2211 C CA  . PHE B 182 ? 0.5912 0.5589 0.9562 -0.0651 0.2615  0.0274  182 PHE B CA  
2212 C C   . PHE B 182 ? 0.6299 0.5252 0.9542 -0.0562 0.2300  0.0125  182 PHE B C   
2213 O O   . PHE B 182 ? 0.5844 0.4450 0.8973 -0.0496 0.1889  -0.0108 182 PHE B O   
2214 C CB  . PHE B 182 ? 0.5796 0.6025 0.9585 -0.0419 0.2894  0.0071  182 PHE B CB  
2215 C CG  . PHE B 182 ? 0.5862 0.6635 0.9659 -0.0420 0.2902  0.0154  182 PHE B CG  
2216 C CD1 . PHE B 182 ? 0.5811 0.6640 0.9398 -0.0577 0.2832  0.0462  182 PHE B CD1 
2217 C CD2 . PHE B 182 ? 0.5569 0.6688 0.9304 -0.0232 0.2762  -0.0108 182 PHE B CD2 
2218 C CE1 . PHE B 182 ? 0.5333 0.6574 0.8736 -0.0553 0.2681  0.0483  182 PHE B CE1 
2219 C CE2 . PHE B 182 ? 0.5312 0.6793 0.8815 -0.0239 0.2604  -0.0018 182 PHE B CE2 
2220 C CZ  . PHE B 182 ? 0.5333 0.6880 0.8701 -0.0396 0.2581  0.0261  182 PHE B CZ  
2221 N N   . ARG B 183 ? 0.6009 0.4730 0.9032 -0.0557 0.2488  0.0258  183 ARG B N   
2222 C CA  . ARG B 183 ? 0.7126 0.5177 0.9753 -0.0450 0.2214  0.0109  183 ARG B CA  
2223 C C   . ARG B 183 ? 0.6927 0.5044 0.9503 -0.0129 0.2021  -0.0357 183 ARG B C   
2224 O O   . ARG B 183 ? 0.7654 0.5381 1.0077 -0.0041 0.1605  -0.0605 183 ARG B O   
2225 C CB  . ARG B 183 ? 0.8016 0.5865 1.0436 -0.0500 0.2490  0.0343  183 ARG B CB  
2226 C CG  . ARG B 183 ? 0.9746 0.6861 1.1736 -0.0412 0.2212  0.0226  183 ARG B CG  
2227 C CD  . ARG B 183 ? 1.1116 0.7965 1.2904 -0.0546 0.2463  0.0547  183 ARG B CD  
2228 N NE  . ARG B 183 ? 1.2574 0.8792 1.3954 -0.0416 0.2249  0.0404  183 ARG B NE  
2229 C CZ  . ARG B 183 ? 1.4523 1.0038 1.5599 -0.0504 0.1897  0.0431  183 ARG B CZ  
2230 N NH1 . ARG B 183 ? 1.5037 1.0386 1.6171 -0.0730 0.1717  0.0594  183 ARG B NH1 
2231 N NH2 . ARG B 183 ? 1.5488 1.0460 1.6194 -0.0365 0.1721  0.0290  183 ARG B NH2 
2232 N N   . TYR B 184 ? 0.6090 0.4707 0.8795 0.0041  0.2326  -0.0476 184 TYR B N   
2233 C CA  . TYR B 184 ? 0.6818 0.5627 0.9536 0.0338  0.2198  -0.0918 184 TYR B CA  
2234 C C   . TYR B 184 ? 0.6324 0.5914 0.9417 0.0391  0.2474  -0.0981 184 TYR B C   
2235 O O   . TYR B 184 ? 0.6239 0.6221 0.9524 0.0254  0.2853  -0.0691 184 TYR B O   
2236 C CB  . TYR B 184 ? 0.7217 0.5829 0.9672 0.0533  0.2284  -0.1062 184 TYR B CB  
2237 C CG  . TYR B 184 ? 0.8073 0.5904 1.0132 0.0511  0.2009  -0.1032 184 TYR B CG  
2238 C CD1 . TYR B 184 ? 0.9119 0.6489 1.0973 0.0644  0.1545  -0.1337 184 TYR B CD1 
2239 C CD2 . TYR B 184 ? 0.8344 0.5892 1.0225 0.0362  0.2213  -0.0702 184 TYR B CD2 
2240 C CE1 . TYR B 184 ? 1.0001 0.6639 1.1476 0.0629  0.1287  -0.1311 184 TYR B CE1 
2241 C CE2 . TYR B 184 ? 0.8903 0.5722 1.0406 0.0341  0.1961  -0.0673 184 TYR B CE2 
2242 C CZ  . TYR B 184 ? 0.9851 0.6213 1.1148 0.0476  0.1497  -0.0978 184 TYR B CZ  
2243 O OH  . TYR B 184 ? 1.0591 0.6213 1.1498 0.0459  0.1241  -0.0951 184 TYR B OH  
2244 N N   . ILE B 185 ? 0.5921 0.5733 0.9114 0.0590  0.2284  -0.1360 185 ILE B N   
2245 C CA  . ILE B 185 ? 0.5654 0.6127 0.8910 0.0585  0.2322  -0.1338 185 ILE B CA  
2246 C C   . ILE B 185 ? 0.5771 0.6427 0.8489 0.0668  0.2171  -0.1269 185 ILE B C   
2247 O O   . ILE B 185 ? 0.6443 0.6940 0.8906 0.0844  0.1965  -0.1476 185 ILE B O   
2248 C CB  . ILE B 185 ? 0.5891 0.6508 0.9327 0.0694  0.2049  -0.1661 185 ILE B CB  
2249 C CG1 . ILE B 185 ? 0.6298 0.6701 1.0019 0.0541  0.1929  -0.1601 185 ILE B CG1 
2250 C CG2 . ILE B 185 ? 0.5360 0.6489 0.8579 0.0666  0.1975  -0.1521 185 ILE B CG2 
2251 C CD1 . ILE B 185 ? 0.5867 0.6595 0.9834 0.0282  0.2225  -0.1193 185 ILE B CD1 
2252 N N   . PRO B 186 ? 0.5032 0.5985 0.7539 0.0563  0.2205  -0.0973 186 PRO B N   
2253 C CA  . PRO B 186 ? 0.4873 0.5962 0.7016 0.0625  0.2077  -0.0923 186 PRO B CA  
2254 C C   . PRO B 186 ? 0.5132 0.6396 0.7256 0.0712  0.1946  -0.1089 186 PRO B C   
2255 O O   . PRO B 186 ? 0.5689 0.7160 0.7918 0.0640  0.1963  -0.1035 186 PRO B O   
2256 C CB  . PRO B 186 ? 0.4634 0.5762 0.6800 0.0436  0.2228  -0.0664 186 PRO B CB  
2257 C CG  . PRO B 186 ? 0.4890 0.6007 0.7211 0.0322  0.2319  -0.0496 186 PRO B CG  
2258 C CD  . PRO B 186 ? 0.5147 0.6234 0.7791 0.0371  0.2344  -0.0698 186 PRO B CD  
2259 N N   . PHE B 187 ? 0.5308 0.5092 0.6123 -0.0245 -0.0068 0.0246  187 PHE B N   
2260 C CA  . PHE B 187 ? 0.5320 0.5314 0.6316 -0.0288 0.0014  0.0261  187 PHE B CA  
2261 C C   . PHE B 187 ? 0.5532 0.5719 0.6750 -0.0281 -0.0120 0.0409  187 PHE B C   
2262 O O   . PHE B 187 ? 0.5802 0.5968 0.7081 -0.0214 -0.0234 0.0500  187 PHE B O   
2263 C CB  . PHE B 187 ? 0.4915 0.4930 0.6061 -0.0216 0.0253  0.0214  187 PHE B CB  
2264 C CG  . PHE B 187 ? 0.4940 0.4982 0.6305 -0.0091 0.0286  0.0310  187 PHE B CG  
2265 C CD1 . PHE B 187 ? 0.5453 0.5305 0.6740 0.0001  0.0324  0.0290  187 PHE B CD1 
2266 C CD2 . PHE B 187 ? 0.5009 0.5263 0.6655 -0.0063 0.0280  0.0420  187 PHE B CD2 
2267 C CE1 . PHE B 187 ? 0.6210 0.6081 0.7689 0.0121  0.0354  0.0379  187 PHE B CE1 
2268 C CE2 . PHE B 187 ? 0.5471 0.5751 0.7314 0.0055  0.0307  0.0506  187 PHE B CE2 
2269 C CZ  . PHE B 187 ? 0.5914 0.6001 0.7670 0.0150  0.0344  0.0487  187 PHE B CZ  
2270 N N   . ARG B 188 ? 0.5680 0.6055 0.7019 -0.0350 -0.0103 0.0430  188 ARG B N   
2271 C CA  . ARG B 188 ? 0.5680 0.6263 0.7273 -0.0341 -0.0194 0.0561  188 ARG B CA  
2272 C C   . ARG B 188 ? 0.5778 0.6541 0.7566 -0.0365 -0.0043 0.0554  188 ARG B C   
2273 O O   . ARG B 188 ? 0.5666 0.6451 0.7353 -0.0454 0.0014  0.0479  188 ARG B O   
2274 C CB  . ARG B 188 ? 0.6056 0.6684 0.7560 -0.0429 -0.0419 0.0617  188 ARG B CB  
2275 C CG  . ARG B 188 ? 0.6014 0.6519 0.7415 -0.0387 -0.0595 0.0670  188 ARG B CG  
2276 C CD  . ARG B 188 ? 0.6293 0.6832 0.7583 -0.0483 -0.0810 0.0712  188 ARG B CD  
2277 N NE  . ARG B 188 ? 0.6802 0.7243 0.8025 -0.0436 -0.0982 0.0775  188 ARG B NE  
2278 C CZ  . ARG B 188 ? 0.7415 0.7818 0.8482 -0.0505 -0.1176 0.0798  188 ARG B CZ  
2279 N NH1 . ARG B 188 ? 0.7927 0.8380 0.8884 -0.0625 -0.1223 0.0763  188 ARG B NH1 
2280 N NH2 . ARG B 188 ? 0.7553 0.7864 0.8570 -0.0452 -0.1322 0.0856  188 ARG B NH2 
2281 N N   . ILE B 189 ? 0.5743 0.6632 0.7809 -0.0282 0.0022  0.0632  189 ILE B N   
2282 C CA  . ILE B 189 ? 0.4988 0.6050 0.7265 -0.0293 0.0173  0.0632  189 ILE B CA  
2283 C C   . ILE B 189 ? 0.4910 0.6192 0.7399 -0.0331 0.0059  0.0742  189 ILE B C   
2284 O O   . ILE B 189 ? 0.5101 0.6454 0.7754 -0.0267 -0.0043 0.0845  189 ILE B O   
2285 C CB  . ILE B 189 ? 0.4737 0.5798 0.7192 -0.0175 0.0347  0.0636  189 ILE B CB  
2286 C CG1 . ILE B 189 ? 0.4262 0.5112 0.6516 -0.0146 0.0484  0.0514  189 ILE B CG1 
2287 C CG2 . ILE B 189 ? 0.4641 0.5900 0.7341 -0.0185 0.0487  0.0652  189 ILE B CG2 
2288 C CD1 . ILE B 189 ? 0.5171 0.5999 0.7577 -0.0031 0.0661  0.0510  189 ILE B CD1 
2289 N N   . TYR B 190 ? 0.5168 0.6556 0.7652 -0.0432 0.0080  0.0717  190 TYR B N   
2290 C CA  . TYR B 190 ? 0.4594 0.6184 0.7258 -0.0485 -0.0026 0.0810  190 TYR B CA  
2291 C C   . TYR B 190 ? 0.4439 0.6209 0.7365 -0.0475 0.0134  0.0826  190 TYR B C   
2292 O O   . TYR B 190 ? 0.4528 0.6267 0.7429 -0.0473 0.0319  0.0744  190 TYR B O   
2293 C CB  . TYR B 190 ? 0.4195 0.5774 0.6657 -0.0614 -0.0137 0.0779  190 TYR B CB  
2294 C CG  . TYR B 190 ? 0.4744 0.6148 0.6939 -0.0634 -0.0300 0.0761  190 TYR B CG  
2295 C CD1 . TYR B 190 ? 0.4712 0.6159 0.6921 -0.0655 -0.0513 0.0850  190 TYR B CD1 
2296 C CD2 . TYR B 190 ? 0.4773 0.5971 0.6704 -0.0633 -0.0241 0.0652  190 TYR B CD2 
2297 C CE1 . TYR B 190 ? 0.5046 0.6334 0.7013 -0.0674 -0.0662 0.0835  190 TYR B CE1 
2298 C CE2 . TYR B 190 ? 0.4765 0.5803 0.6454 -0.0653 -0.0387 0.0633  190 TYR B CE2 
2299 C CZ  . TYR B 190 ? 0.5397 0.6479 0.7103 -0.0673 -0.0598 0.0727  190 TYR B CZ  
2300 O OH  . TYR B 190 ? 0.6303 0.7223 0.7767 -0.0694 -0.0745 0.0709  190 TYR B OH  
2301 N N   . GLN B 191 ? 0.4396 0.6355 0.7576 -0.0468 0.0060  0.0930  191 GLN B N   
2302 C CA  . GLN B 191 ? 0.4355 0.6496 0.7813 -0.0450 0.0199  0.0957  191 GLN B CA  
2303 C C   . GLN B 191 ? 0.4612 0.6956 0.8292 -0.0481 0.0068  0.1062  191 GLN B C   
2304 O O   . GLN B 191 ? 0.5373 0.7757 0.9167 -0.0420 -0.0061 0.1145  191 GLN B O   
2305 C CB  . GLN B 191 ? 0.4654 0.6774 0.8264 -0.0319 0.0322  0.0969  191 GLN B CB  
2306 C CG  . GLN B 191 ? 0.6000 0.8276 0.9870 -0.0294 0.0500  0.0977  191 GLN B CG  
2307 C CD  . GLN B 191 ? 0.6623 0.8828 1.0567 -0.0174 0.0655  0.0956  191 GLN B CD  
2308 O OE1 . GLN B 191 ? 0.6665 0.8711 1.0485 -0.0104 0.0621  0.0946  191 GLN B OE1 
2309 N NE2 . GLN B 191 ? 0.6074 0.8394 1.0219 -0.0151 0.0830  0.0949  191 GLN B NE2 
2310 N N   . THR B 192 ? 0.4523 0.6994 0.8262 -0.0575 0.0102  0.1057  192 THR B N   
2311 C CA  . THR B 192 ? 0.5464 0.8119 0.9388 -0.0623 -0.0027 0.1146  192 THR B CA  
2312 C C   . THR B 192 ? 0.6270 0.9105 1.0546 -0.0539 -0.0002 0.1231  192 THR B C   
2313 O O   . THR B 192 ? 0.6533 0.9495 1.0967 -0.0539 -0.0148 0.1315  192 THR B O   
2314 C CB  . THR B 192 ? 0.5654 0.8391 0.9546 -0.0745 0.0012  0.1116  192 THR B CB  
2315 O OG1 . THR B 192 ? 0.6643 0.9430 1.0636 -0.0736 0.0227  0.1069  192 THR B OG1 
2316 C CG2 . THR B 192 ? 0.5358 0.7930 0.8901 -0.0830 -0.0049 0.1043  192 THR B CG2 
2317 N N   . THR B 193 ? 0.6605 0.9454 1.1007 -0.0466 0.0183  0.1207  193 THR B N   
2318 C CA  . THR B 193 ? 0.6867 0.9884 1.1603 -0.0382 0.0223  0.1281  193 THR B CA  
2319 C C   . THR B 193 ? 0.6889 0.9868 1.1679 -0.0269 0.0105  0.1345  193 THR B C   
2320 O O   . THR B 193 ? 0.6830 0.9962 1.1889 -0.0205 0.0071  0.1423  193 THR B O   
2321 C CB  . THR B 193 ? 0.7060 1.0091 1.1904 -0.0332 0.0459  0.1234  193 THR B CB  
2322 O OG1 . THR B 193 ? 0.6982 0.9809 1.1623 -0.0274 0.0541  0.1165  193 THR B OG1 
2323 C CG2 . THR B 193 ? 0.7272 1.0368 1.2104 -0.0436 0.0579  0.1181  193 THR B CG2 
2324 N N   . THR B 194 ? 0.7274 1.0050 1.1808 -0.0244 0.0044  0.1311  194 THR B N   
2325 C CA  . THR B 194 ? 0.7401 1.0110 1.1952 -0.0132 -0.0057 0.1365  194 THR B CA  
2326 C C   . THR B 194 ? 0.7699 1.0438 1.2216 -0.0162 -0.0299 0.1430  194 THR B C   
2327 O O   . THR B 194 ? 0.7813 1.0548 1.2190 -0.0275 -0.0392 0.1413  194 THR B O   
2328 C CB  . THR B 194 ? 0.7387 0.9852 1.1694 -0.0073 0.0015  0.1294  194 THR B CB  
2329 O OG1 . THR B 194 ? 0.7838 1.0268 1.2247 0.0065  0.0002  0.1347  194 THR B OG1 
2330 C CG2 . THR B 194 ? 0.6879 0.9177 1.0871 -0.0144 -0.0121 0.1255  194 THR B CG2 
2331 N N   . GLU B 195 ? 0.7993 1.0761 1.2636 -0.0058 -0.0399 0.1506  195 GLU B N   
2332 C CA  . GLU B 195 ? 0.8034 1.0854 1.2689 -0.0070 -0.0629 0.1577  195 GLU B CA  
2333 C C   . GLU B 195 ? 0.7222 0.9830 1.1555 -0.0096 -0.0754 0.1547  195 GLU B C   
2334 O O   . GLU B 195 ? 0.6242 0.8863 1.0472 -0.0188 -0.0906 0.1558  195 GLU B O   
2335 C CB  . GLU B 195 ? 0.8883 1.1803 1.3779 0.0062  -0.0690 0.1663  195 GLU B CB  
2336 C CG  . GLU B 195 ? 0.9609 1.2610 1.4554 0.0056  -0.0926 0.1739  195 GLU B CG  
2337 C CD  . GLU B 195 ? 0.9988 1.3164 1.5028 -0.0072 -0.0999 0.1754  195 GLU B CD  
2338 O OE1 . GLU B 195 ? 0.9903 1.3246 1.5161 -0.0099 -0.0887 0.1755  195 GLU B OE1 
2339 O OE2 . GLU B 195 ? 1.0426 1.3570 1.5322 -0.0147 -0.1164 0.1764  195 GLU B OE2 
2340 N N   . ARG B 196 ? 0.7613 1.0026 1.1791 -0.0015 -0.0686 0.1508  196 ARG B N   
2341 C CA  . ARG B 196 ? 0.7659 0.9853 1.1527 -0.0031 -0.0785 0.1472  196 ARG B CA  
2342 C C   . ARG B 196 ? 0.7706 0.9828 1.1340 -0.0171 -0.0771 0.1390  196 ARG B C   
2343 O O   . ARG B 196 ? 0.8058 1.0225 1.1716 -0.0225 -0.0616 0.1334  196 ARG B O   
2344 C CB  . ARG B 196 ? 0.8375 1.0374 1.2136 0.0080  -0.0673 0.1433  196 ARG B CB  
2345 C CG  . ARG B 196 ? 0.9342 1.1302 1.3102 0.0082  -0.0431 0.1350  196 ARG B CG  
2346 C CD  . ARG B 196 ? 1.0393 1.2223 1.4158 0.0219  -0.0314 0.1340  196 ARG B CD  
2347 N NE  . ARG B 196 ? 1.1122 1.2741 1.4659 0.0263  -0.0418 0.1333  196 ARG B NE  
2348 C CZ  . ARG B 196 ? 1.1662 1.3132 1.5160 0.0383  -0.0347 0.1328  196 ARG B CZ  
2349 N NH1 . ARG B 196 ? 1.1579 1.3092 1.5252 0.0470  -0.0173 0.1328  196 ARG B NH1 
2350 N NH2 . ARG B 196 ? 1.1941 1.3216 1.5223 0.0415  -0.0447 0.1322  196 ARG B NH2 
2351 N N   . PRO B 197 ? 0.7359 0.9372 1.0766 -0.0228 -0.0935 0.1385  197 PRO B N   
2352 C CA  . PRO B 197 ? 0.7109 0.9041 1.0270 -0.0357 -0.0940 0.1308  197 PRO B CA  
2353 C C   . PRO B 197 ? 0.7339 0.9111 1.0326 -0.0355 -0.0750 0.1197  197 PRO B C   
2354 O O   . PRO B 197 ? 0.7922 0.9726 1.0869 -0.0434 -0.0637 0.1134  197 PRO B O   
2355 C CB  . PRO B 197 ? 0.6324 0.8128 0.9271 -0.0377 -0.1146 0.1326  197 PRO B CB  
2356 C CG  . PRO B 197 ? 0.6721 0.8631 0.9871 -0.0295 -0.1282 0.1434  197 PRO B CG  
2357 C CD  . PRO B 197 ? 0.7088 0.9053 1.0461 -0.0174 -0.1132 0.1454  197 PRO B CD  
2358 N N   . PHE B 198 ? 0.6067 0.7666 0.8952 -0.0262 -0.0712 0.1172  198 PHE B N   
2359 C CA  . PHE B 198 ? 0.5957 0.7397 0.8685 -0.0248 -0.0530 0.1064  198 PHE B CA  
2360 C C   . PHE B 198 ? 0.6028 0.7337 0.8765 -0.0113 -0.0469 0.1069  198 PHE B C   
2361 O O   . PHE B 198 ? 0.6528 0.7826 0.9318 -0.0039 -0.0596 0.1147  198 PHE B O   
2362 C CB  . PHE B 198 ? 0.6090 0.7365 0.8488 -0.0344 -0.0580 0.0975  198 PHE B CB  
2363 C CG  . PHE B 198 ? 0.5985 0.7133 0.8208 -0.0340 -0.0779 0.1006  198 PHE B CG  
2364 C CD1 . PHE B 198 ? 0.5981 0.6931 0.8071 -0.0255 -0.0769 0.0980  198 PHE B CD1 
2365 C CD2 . PHE B 198 ? 0.5516 0.6737 0.7704 -0.0422 -0.0972 0.1058  198 PHE B CD2 
2366 C CE1 . PHE B 198 ? 0.5837 0.6667 0.7765 -0.0251 -0.0951 0.1009  198 PHE B CE1 
2367 C CE2 . PHE B 198 ? 0.5088 0.6194 0.7115 -0.0420 -0.1155 0.1087  198 PHE B CE2 
2368 C CZ  . PHE B 198 ? 0.5114 0.6023 0.7010 -0.0334 -0.1147 0.1063  198 PHE B CZ  
2369 N N   . ILE B 199 ? 0.5205 0.6412 0.7886 -0.0080 -0.0271 0.0982  199 ILE B N   
2370 C CA  . ILE B 199 ? 0.4685 0.5738 0.7341 0.0042  -0.0194 0.0971  199 ILE B CA  
2371 C C   . ILE B 199 ? 0.4941 0.5743 0.7275 0.0022  -0.0207 0.0879  199 ILE B C   
2372 O O   . ILE B 199 ? 0.4626 0.5356 0.6794 -0.0052 -0.0115 0.0773  199 ILE B O   
2373 C CB  . ILE B 199 ? 0.5082 0.6175 0.7897 0.0105  0.0042  0.0935  199 ILE B CB  
2374 C CG1 . ILE B 199 ? 0.5429 0.6771 0.8570 0.0128  0.0060  0.1024  199 ILE B CG1 
2375 C CG2 . ILE B 199 ? 0.4400 0.5322 0.7179 0.0233  0.0126  0.0922  199 ILE B CG2 
2376 C CD1 . ILE B 199 ? 0.4352 0.5751 0.7661 0.0180  0.0292  0.0990  199 ILE B CD1 
2377 N N   . GLN B 200 ? 0.5671 0.6343 0.7918 0.0091  -0.0324 0.0920  200 GLN B N   
2378 C CA  . GLN B 200 ? 0.5776 0.6197 0.7734 0.0091  -0.0331 0.0838  200 GLN B CA  
2379 C C   . GLN B 200 ? 0.6299 0.6584 0.8277 0.0232  -0.0300 0.0871  200 GLN B C   
2380 O O   . GLN B 200 ? 0.6657 0.6965 0.8710 0.0296  -0.0443 0.0971  200 GLN B O   
2381 C CB  . GLN B 200 ? 0.6207 0.6577 0.7965 0.0002  -0.0546 0.0848  200 GLN B CB  
2382 C CG  . GLN B 200 ? 0.6997 0.7106 0.8451 -0.0003 -0.0565 0.0763  200 GLN B CG  
2383 C CD  . GLN B 200 ? 0.6822 0.6877 0.8089 -0.0079 -0.0791 0.0786  200 GLN B CD  
2384 O OE1 . GLN B 200 ? 0.6578 0.6778 0.7880 -0.0169 -0.0905 0.0824  200 GLN B OE1 
2385 N NE2 . GLN B 200 ? 0.6613 0.6456 0.7682 -0.0041 -0.0854 0.0763  200 GLN B NE2 
2386 N N   . LYS B 201 ? 0.6290 0.6432 0.8201 0.0283  -0.0110 0.0783  201 LYS B N   
2387 C CA  . LYS B 201 ? 0.6020 0.6004 0.7922 0.0415  -0.0057 0.0799  201 LYS B CA  
2388 C C   . LYS B 201 ? 0.6624 0.6353 0.8254 0.0406  0.0027  0.0676  201 LYS B C   
2389 O O   . LYS B 201 ? 0.6637 0.6328 0.8104 0.0300  0.0055  0.0576  201 LYS B O   
2390 C CB  . LYS B 201 ? 0.6333 0.6408 0.8481 0.0514  0.0126  0.0825  201 LYS B CB  
2391 C CG  . LYS B 201 ? 0.7023 0.7346 0.9462 0.0543  0.0058  0.0946  201 LYS B CG  
2392 C CD  . LYS B 201 ? 0.7272 0.7668 0.9939 0.0643  0.0248  0.0962  201 LYS B CD  
2393 C CE  . LYS B 201 ? 0.7951 0.8606 1.0916 0.0665  0.0190  0.1072  201 LYS B CE  
2394 N NZ  . LYS B 201 ? 0.8566 0.9299 1.1755 0.0757  0.0381  0.1084  201 LYS B NZ  
2395 N N   . LEU B 202 ? 0.6778 0.6331 0.8359 0.0518  0.0072  0.0681  202 LEU B N   
2396 C CA  . LEU B 202 ? 0.6732 0.6037 0.8074 0.0520  0.0171  0.0561  202 LEU B CA  
2397 C C   . LEU B 202 ? 0.7166 0.6459 0.8568 0.0539  0.0429  0.0465  202 LEU B C   
2398 O O   . LEU B 202 ? 0.7333 0.6713 0.8952 0.0626  0.0549  0.0512  202 LEU B O   
2399 C CB  . LEU B 202 ? 0.6709 0.5817 0.7966 0.0632  0.0121  0.0602  202 LEU B CB  
2400 C CG  . LEU B 202 ? 0.6515 0.5589 0.7669 0.0619  -0.0132 0.0683  202 LEU B CG  
2401 C CD1 . LEU B 202 ? 0.6103 0.4959 0.7161 0.0738  -0.0150 0.0710  202 LEU B CD1 
2402 C CD2 . LEU B 202 ? 0.6599 0.5620 0.7521 0.0480  -0.0236 0.0606  202 LEU B CD2 
2403 N N   . PHE B 203 ? 0.6872 0.6062 0.8085 0.0458  0.0514  0.0328  203 PHE B N   
2404 C CA  . PHE B 203 ? 0.6240 0.5413 0.7488 0.0466  0.0756  0.0221  203 PHE B CA  
2405 C C   . PHE B 203 ? 0.6809 0.5766 0.7788 0.0421  0.0827  0.0069  203 PHE B C   
2406 O O   . PHE B 203 ? 0.7190 0.6128 0.7991 0.0313  0.0731  0.0009  203 PHE B O   
2407 C CB  . PHE B 203 ? 0.6026 0.5429 0.7420 0.0387  0.0809  0.0215  203 PHE B CB  
2408 C CG  . PHE B 203 ? 0.5953 0.5378 0.7446 0.0412  0.1060  0.0131  203 PHE B CG  
2409 C CD1 . PHE B 203 ? 0.5434 0.4984 0.7191 0.0499  0.1170  0.0203  203 PHE B CD1 
2410 C CD2 . PHE B 203 ? 0.6052 0.5377 0.7377 0.0351  0.1185  -0.0021 203 PHE B CD2 
2411 C CE1 . PHE B 203 ? 0.5378 0.4949 0.7227 0.0522  0.1401  0.0127  203 PHE B CE1 
2412 C CE2 . PHE B 203 ? 0.5999 0.5349 0.7418 0.0376  0.1416  -0.0100 203 PHE B CE2 
2413 C CZ  . PHE B 203 ? 0.5197 0.4669 0.6879 0.0460  0.1525  -0.0024 203 PHE B CZ  
2414 N N   . ARG B 204 ? 0.7402 0.6195 0.8354 0.0504  0.0997  0.0005  204 ARG B N   
2415 C CA  . ARG B 204 ? 0.7482 0.6063 0.8195 0.0472  0.1084  -0.0148 204 ARG B CA  
2416 C C   . ARG B 204 ? 0.7394 0.6040 0.8112 0.0407  0.1262  -0.0277 204 ARG B C   
2417 O O   . ARG B 204 ? 0.7880 0.6650 0.8799 0.0444  0.1414  -0.0266 204 ARG B O   
2418 C CB  . ARG B 204 ? 0.8101 0.6470 0.8782 0.0592  0.1196  -0.0163 204 ARG B CB  
2419 C CG  . ARG B 204 ? 0.8612 0.6904 0.9285 0.0671  0.1032  -0.0037 204 ARG B CG  
2420 C CD  . ARG B 204 ? 0.8662 0.6733 0.9295 0.0793  0.1157  -0.0057 204 ARG B CD  
2421 N NE  . ARG B 204 ? 0.9463 0.7433 1.0049 0.0866  0.0995  0.0053  204 ARG B NE  
2422 C CZ  . ARG B 204 ? 1.0654 0.8461 1.1013 0.0831  0.0852  0.0031  204 ARG B CZ  
2423 N NH1 . ARG B 204 ? 1.0946 0.8675 1.1104 0.0722  0.0849  -0.0098 204 ARG B NH1 
2424 N NH2 . ARG B 204 ? 1.0920 0.8643 1.1250 0.0906  0.0710  0.0136  204 ARG B NH2 
2425 N N   . PRO B 205 ? 0.6583 0.5145 0.7076 0.0310  0.1243  -0.0403 205 PRO B N   
2426 C CA  . PRO B 205 ? 0.6175 0.4783 0.6640 0.0245  0.1403  -0.0540 205 PRO B CA  
2427 C C   . PRO B 205 ? 0.6848 0.5329 0.7325 0.0314  0.1648  -0.0652 205 PRO B C   
2428 O O   . PRO B 205 ? 0.7346 0.5915 0.7899 0.0292  0.1812  -0.0731 205 PRO B O   
2429 C CB  . PRO B 205 ? 0.6276 0.4798 0.6472 0.0136  0.1285  -0.0636 205 PRO B CB  
2430 C CG  . PRO B 205 ? 0.6236 0.4585 0.6291 0.0167  0.1132  -0.0589 205 PRO B CG  
2431 C CD  . PRO B 205 ? 0.5827 0.4262 0.6082 0.0251  0.1050  -0.0415 205 PRO B CD  
2432 N N   . VAL B 206 ? 0.9392 0.7531 0.9758 -0.1585 0.0879  0.1574  206 VAL B N   
2433 C CA  . VAL B 206 ? 1.0032 0.7830 1.0309 -0.1644 0.0761  0.1747  206 VAL B CA  
2434 C C   . VAL B 206 ? 1.0675 0.8285 1.0824 -0.1586 0.0607  0.1890  206 VAL B C   
2435 O O   . VAL B 206 ? 1.0504 0.8307 1.0565 -0.1596 0.0591  0.1943  206 VAL B O   
2436 C CB  . VAL B 206 ? 0.9650 0.7528 0.9857 -0.1846 0.0799  0.1871  206 VAL B CB  
2437 C CG1 . VAL B 206 ? 0.9096 0.7077 0.9435 -0.1899 0.0932  0.1740  206 VAL B CG1 
2438 C CG2 . VAL B 206 ? 1.0150 0.8342 1.0247 -0.1946 0.0826  0.1952  206 VAL B CG2 
2439 N N   . ALA B 207 ? 1.1240 0.8471 1.1380 -0.1524 0.0495  0.1953  207 ALA B N   
2440 C CA  . ALA B 207 ? 1.1858 0.8873 1.1878 -0.1468 0.0343  0.2094  207 ALA B CA  
2441 C C   . ALA B 207 ? 1.2078 0.9063 1.1936 -0.1627 0.0280  0.2311  207 ALA B C   
2442 O O   . ALA B 207 ? 1.1765 0.8907 1.1607 -0.1779 0.0357  0.2349  207 ALA B O   
2443 C CB  . ALA B 207 ? 1.2039 0.8657 1.2107 -0.1348 0.0247  0.2084  207 ALA B CB  
2444 N N   . ALA B 208 ? 1.2626 0.9407 1.2366 -0.1592 0.0140  0.2454  208 ALA B N   
2445 C CA  . ALA B 208 ? 1.3023 0.9745 1.2602 -0.1730 0.0067  0.2669  208 ALA B CA  
2446 C C   . ALA B 208 ? 1.3668 1.0179 1.3249 -0.1843 0.0061  0.2750  208 ALA B C   
2447 O O   . ALA B 208 ? 1.4042 1.0692 1.3574 -0.2003 0.0115  0.2825  208 ALA B O   
2448 C CB  . ALA B 208 ? 1.3111 0.9618 1.2576 -0.1651 -0.0087 0.2795  208 ALA B CB  
2449 N N   . ASP B 209 ? 1.3677 0.9854 1.3320 -0.1758 -0.0004 0.2730  209 ASP B N   
2450 C CA  . ASP B 209 ? 1.3865 0.9803 1.3510 -0.1850 -0.0024 0.2808  209 ASP B CA  
2451 C C   . ASP B 209 ? 1.3188 0.9276 1.2957 -0.1920 0.0118  0.2682  209 ASP B C   
2452 O O   . ASP B 209 ? 1.3172 0.9074 1.2969 -0.1988 0.0115  0.2719  209 ASP B O   
2453 C CB  . ASP B 209 ? 1.4621 1.0150 1.4292 -0.1732 -0.0140 0.2825  209 ASP B CB  
2454 C CG  . ASP B 209 ? 1.4906 1.0405 1.4729 -0.1562 -0.0101 0.2623  209 ASP B CG  
2455 O OD1 . ASP B 209 ? 1.5165 1.0931 1.5036 -0.1495 -0.0029 0.2498  209 ASP B OD1 
2456 O OD2 . ASP B 209 ? 1.4921 1.0126 1.4813 -0.1495 -0.0142 0.2590  209 ASP B OD2 
2457 N N   . GLY B 210 ? 1.2284 0.8709 1.2130 -0.1903 0.0241  0.2533  210 GLY B N   
2458 C CA  . GLY B 210 ? 1.1563 0.8175 1.1520 -0.1976 0.0383  0.2414  210 GLY B CA  
2459 C C   . GLY B 210 ? 1.1425 0.7945 1.1549 -0.1851 0.0435  0.2223  210 GLY B C   
2460 O O   . GLY B 210 ? 1.1305 0.7920 1.1528 -0.1904 0.0543  0.2125  210 GLY B O   
2461 N N   . GLN B 211 ? 1.1303 0.7636 1.1458 -0.1683 0.0360  0.2170  211 GLN B N   
2462 C CA  . GLN B 211 ? 1.0854 0.7098 1.1166 -0.1551 0.0408  0.1983  211 GLN B CA  
2463 C C   . GLN B 211 ? 1.0022 0.6605 1.0429 -0.1482 0.0529  0.1797  211 GLN B C   
2464 O O   . GLN B 211 ? 1.0016 0.6821 1.0364 -0.1470 0.0532  0.1810  211 GLN B O   
2465 C CB  . GLN B 211 ? 1.1557 0.7452 1.1870 -0.1397 0.0279  0.1998  211 GLN B CB  
2466 C CG  . GLN B 211 ? 1.2314 0.7837 1.2567 -0.1443 0.0168  0.2148  211 GLN B CG  
2467 C CD  . GLN B 211 ? 1.2767 0.7943 1.3065 -0.1282 0.0070  0.2113  211 GLN B CD  
2468 O OE1 . GLN B 211 ? 1.2409 0.7618 1.2804 -0.1136 0.0100  0.1957  211 GLN B OE1 
2469 N NE2 . GLN B 211 ? 1.3290 0.8131 1.3518 -0.1307 -0.0047 0.2259  211 GLN B NE2 
2470 N N   . LEU B 212 ? 0.9648 0.6269 1.0203 -0.1438 0.0630  0.1625  212 LEU B N   
2471 C CA  . LEU B 212 ? 0.8820 0.5749 0.9481 -0.1368 0.0753  0.1434  212 LEU B CA  
2472 C C   . LEU B 212 ? 0.8459 0.5316 0.9162 -0.1176 0.0704  0.1340  212 LEU B C   
2473 O O   . LEU B 212 ? 0.8910 0.5467 0.9667 -0.1062 0.0641  0.1304  212 LEU B O   
2474 C CB  . LEU B 212 ? 0.8439 0.5415 0.9245 -0.1380 0.0876  0.1280  212 LEU B CB  
2475 C CG  . LEU B 212 ? 0.8322 0.5463 0.9119 -0.1565 0.0965  0.1323  212 LEU B CG  
2476 C CD1 . LEU B 212 ? 0.7984 0.5101 0.8928 -0.1553 0.1065  0.1170  212 LEU B CD1 
2477 C CD2 . LEU B 212 ? 0.8258 0.5811 0.9015 -0.1650 0.1054  0.1315  212 LEU B CD2 
2478 N N   . HIS B 213 ? 0.8196 0.5326 0.8876 -0.1140 0.0734  0.1301  213 HIS B N   
2479 C CA  . HIS B 213 ? 0.8214 0.5325 0.8946 -0.0958 0.0706  0.1191  213 HIS B CA  
2480 C C   . HIS B 213 ? 0.7972 0.5110 0.8878 -0.0854 0.0809  0.0972  213 HIS B C   
2481 O O   . HIS B 213 ? 0.7631 0.4957 0.8613 -0.0928 0.0934  0.0882  213 HIS B O   
2482 C CB  . HIS B 213 ? 0.8434 0.5867 0.9109 -0.0955 0.0730  0.1189  213 HIS B CB  
2483 C CG  . HIS B 213 ? 0.9618 0.6982 1.0125 -0.1004 0.0606  0.1388  213 HIS B CG  
2484 N ND1 . HIS B 213 ? 1.0216 0.7874 1.0633 -0.1072 0.0627  0.1444  213 HIS B ND1 
2485 C CD2 . HIS B 213 ? 1.0360 0.7394 1.0771 -0.0992 0.0460  0.1542  213 HIS B CD2 
2486 C CE1 . HIS B 213 ? 1.0567 0.8079 1.0839 -0.1100 0.0499  0.1626  213 HIS B CE1 
2487 N NE2 . HIS B 213 ? 1.0839 0.7974 1.1105 -0.1053 0.0397  0.1689  213 HIS B NE2 
2488 N N   . THR B 214 ? 0.8123 0.5073 0.9092 -0.0682 0.0757  0.0886  214 THR B N   
2489 C CA  . THR B 214 ? 0.7686 0.4632 0.8819 -0.0568 0.0846  0.0679  214 THR B CA  
2490 C C   . THR B 214 ? 0.7620 0.4824 0.8819 -0.0450 0.0911  0.0526  214 THR B C   
2491 O O   . THR B 214 ? 0.7450 0.4805 0.8567 -0.0445 0.0874  0.0585  214 THR B O   
2492 C CB  . THR B 214 ? 0.7402 0.3935 0.8576 -0.0447 0.0751  0.0671  214 THR B CB  
2493 O OG1 . THR B 214 ? 0.7737 0.4150 0.8867 -0.0318 0.0644  0.0700  214 THR B OG1 
2494 C CG2 . THR B 214 ? 0.7176 0.3429 0.8274 -0.0555 0.0668  0.0836  214 THR B CG2 
2495 N N   . LEU B 215 ? 0.7397 0.4650 0.8746 -0.0355 0.1009  0.0329  215 LEU B N   
2496 C CA  . LEU B 215 ? 0.6813 0.4271 0.8243 -0.0223 0.1069  0.0167  215 LEU B CA  
2497 C C   . LEU B 215 ? 0.7455 0.4715 0.8841 -0.0083 0.0941  0.0207  215 LEU B C   
2498 O O   . LEU B 215 ? 0.7630 0.5083 0.9005 -0.0018 0.0946  0.0166  215 LEU B O   
2499 C CB  . LEU B 215 ? 0.6843 0.4311 0.8441 -0.0135 0.1181  -0.0043 215 LEU B CB  
2500 C CG  . LEU B 215 ? 0.7083 0.4737 0.8784 0.0014  0.1250  -0.0229 215 LEU B CG  
2501 C CD1 . LEU B 215 ? 0.6847 0.4918 0.8517 -0.0050 0.1329  -0.0246 215 LEU B CD1 
2502 C CD2 . LEU B 215 ? 0.7060 0.4703 0.8922 0.0087  0.1360  -0.0426 215 LEU B CD2 
2503 N N   . GLY B 216 ? 0.7571 0.4444 0.8932 -0.0038 0.0826  0.0287  216 GLY B N   
2504 C CA  . GLY B 216 ? 0.7407 0.4054 0.8721 0.0088  0.0693  0.0341  216 GLY B CA  
2505 C C   . GLY B 216 ? 0.8075 0.4801 0.9233 0.0024  0.0603  0.0512  216 GLY B C   
2506 O O   . GLY B 216 ? 0.9033 0.5798 1.0169 0.0126  0.0553  0.0500  216 GLY B O   
2507 N N   . ASP B 217 ? 0.7636 0.4383 0.8687 -0.0144 0.0584  0.0671  217 ASP B N   
2508 C CA  . ASP B 217 ? 0.7303 0.4143 0.8199 -0.0224 0.0508  0.0842  217 ASP B CA  
2509 C C   . ASP B 217 ? 0.7650 0.4880 0.8549 -0.0214 0.0585  0.0766  217 ASP B C   
2510 O O   . ASP B 217 ? 0.7809 0.5079 0.8626 -0.0170 0.0510  0.0831  217 ASP B O   
2511 C CB  . ASP B 217 ? 0.7834 0.4683 0.8634 -0.0418 0.0507  0.0999  217 ASP B CB  
2512 C CG  . ASP B 217 ? 0.8831 0.5281 0.9577 -0.0441 0.0390  0.1134  217 ASP B CG  
2513 O OD1 . ASP B 217 ? 0.9348 0.5538 1.0052 -0.0339 0.0266  0.1194  217 ASP B OD1 
2514 O OD2 . ASP B 217 ? 0.9049 0.5447 0.9795 -0.0561 0.0423  0.1182  217 ASP B OD2 
2515 N N   . LEU B 218 ? 0.7798 0.5316 0.8791 -0.0256 0.0735  0.0630  218 LEU B N   
2516 C CA  . LEU B 218 ? 0.7137 0.5043 0.8147 -0.0249 0.0825  0.0541  218 LEU B CA  
2517 C C   . LEU B 218 ? 0.7072 0.4968 0.8142 -0.0063 0.0798  0.0425  218 LEU B C   
2518 O O   . LEU B 218 ? 0.7015 0.5071 0.8022 -0.0036 0.0767  0.0455  218 LEU B O   
2519 C CB  . LEU B 218 ? 0.6516 0.4694 0.7636 -0.0311 0.0993  0.0396  218 LEU B CB  
2520 C CG  . LEU B 218 ? 0.6307 0.4870 0.7490 -0.0267 0.1105  0.0250  218 LEU B CG  
2521 C CD1 . LEU B 218 ? 0.6184 0.5008 0.7239 -0.0369 0.1093  0.0367  218 LEU B CD1 
2522 C CD2 . LEU B 218 ? 0.6016 0.4783 0.7331 -0.0302 0.1267  0.0087  218 LEU B CD2 
2523 N N   . LEU B 219 ? 0.7088 0.4792 0.8281 0.0066  0.0810  0.0293  219 LEU B N   
2524 C CA  . LEU B 219 ? 0.6840 0.4512 0.8104 0.0250  0.0788  0.0172  219 LEU B CA  
2525 C C   . LEU B 219 ? 0.7461 0.4903 0.8614 0.0313  0.0625  0.0311  219 LEU B C   
2526 O O   . LEU B 219 ? 0.7376 0.4930 0.8518 0.0404  0.0598  0.0280  219 LEU B O   
2527 C CB  . LEU B 219 ? 0.6187 0.3680 0.7603 0.0368  0.0835  0.0008  219 LEU B CB  
2528 C CG  . LEU B 219 ? 0.5885 0.3632 0.7427 0.0335  0.1006  -0.0161 219 LEU B CG  
2529 C CD1 . LEU B 219 ? 0.6341 0.3894 0.8029 0.0459  0.1045  -0.0321 219 LEU B CD1 
2530 C CD2 . LEU B 219 ? 0.5443 0.3589 0.7014 0.0354  0.1100  -0.0265 219 LEU B CD2 
2531 N N   . LYS B 220 ? 0.7601 0.4725 0.8673 0.0264  0.0515  0.0465  220 LYS B N   
2532 C CA  . LYS B 220 ? 0.7782 0.4673 0.8741 0.0313  0.0356  0.0611  220 LYS B CA  
2533 C C   . LYS B 220 ? 0.7827 0.4961 0.8660 0.0245  0.0327  0.0719  220 LYS B C   
2534 O O   . LYS B 220 ? 0.8047 0.5128 0.8823 0.0331  0.0234  0.0763  220 LYS B O   
2535 C CB  . LYS B 220 ? 0.8069 0.4611 0.8953 0.0241  0.0255  0.0772  220 LYS B CB  
2536 C CG  . LYS B 220 ? 0.8348 0.4617 0.9118 0.0294  0.0086  0.0924  220 LYS B CG  
2537 C CD  . LYS B 220 ? 0.8473 0.4593 0.9321 0.0492  0.0038  0.0814  220 LYS B CD  
2538 C CE  . LYS B 220 ? 0.8614 0.4383 0.9366 0.0546  -0.0132 0.0962  220 LYS B CE  
2539 N NZ  . LYS B 220 ? 0.8740 0.4580 0.9324 0.0447  -0.0214 0.1150  220 LYS B NZ  
2540 N N   . GLU B 221 ? 0.8119 0.5522 0.8910 0.0091  0.0411  0.0757  221 GLU B N   
2541 C CA  . GLU B 221 ? 0.8650 0.6287 0.9312 0.0004  0.0389  0.0872  221 GLU B CA  
2542 C C   . GLU B 221 ? 0.8465 0.6442 0.9175 0.0076  0.0464  0.0741  221 GLU B C   
2543 O O   . GLU B 221 ? 0.8440 0.6479 0.9064 0.0111  0.0393  0.0807  221 GLU B O   
2544 C CB  . GLU B 221 ? 0.8943 0.6724 0.9536 -0.0195 0.0446  0.0974  221 GLU B CB  
2545 C CG  . GLU B 221 ? 0.9475 0.7559 0.9952 -0.0295 0.0458  0.1063  221 GLU B CG  
2546 C CD  . GLU B 221 ? 1.0767 0.8703 1.1094 -0.0281 0.0306  0.1236  221 GLU B CD  
2547 O OE1 . GLU B 221 ? 1.1318 0.8910 1.1588 -0.0277 0.0191  0.1355  221 GLU B OE1 
2548 O OE2 . GLU B 221 ? 1.1159 0.9323 1.1425 -0.0273 0.0302  0.1251  221 GLU B OE2 
2549 N N   . VAL B 222 ? 0.8211 0.6405 0.9057 0.0100  0.0607  0.0557  222 VAL B N   
2550 C CA  . VAL B 222 ? 0.8069 0.6626 0.8960 0.0144  0.0696  0.0435  222 VAL B CA  
2551 C C   . VAL B 222 ? 0.8068 0.6614 0.9101 0.0333  0.0728  0.0240  222 VAL B C   
2552 O O   . VAL B 222 ? 0.7578 0.6393 0.8649 0.0392  0.0785  0.0139  222 VAL B O   
2553 C CB  . VAL B 222 ? 0.7492 0.6393 0.8422 0.0014  0.0849  0.0372  222 VAL B CB  
2554 C CG1 . VAL B 222 ? 0.7159 0.6081 0.7952 -0.0175 0.0824  0.0560  222 VAL B CG1 
2555 C CG2 . VAL B 222 ? 0.7252 0.6113 0.8335 0.0042  0.0956  0.0213  222 VAL B CG2 
2556 N N   . CYS B 223 ? 0.7102 0.6377 0.7490 0.0440  0.1355  0.0676  223 CYS B N   
2557 C CA  . CYS B 223 ? 0.7045 0.6287 0.7232 0.0453  0.1308  0.0652  223 CYS B CA  
2558 C C   . CYS B 223 ? 0.7426 0.6611 0.7624 0.0453  0.1277  0.0595  223 CYS B C   
2559 O O   . CYS B 223 ? 0.7519 0.6679 0.7670 0.0457  0.1201  0.0520  223 CYS B O   
2560 C CB  . CYS B 223 ? 0.6340 0.5594 0.6434 0.0458  0.1231  0.0606  223 CYS B CB  
2561 S SG  . CYS B 223 ? 1.1071 1.0305 1.0910 0.0472  0.1172  0.0601  223 CYS B SG  
2562 N N   . PRO B 224 ? 0.8613 0.7777 0.8871 0.0452  0.1332  0.0628  224 PRO B N   
2563 C CA  . PRO B 224 ? 0.8652 0.7755 0.8937 0.0459  0.1302  0.0569  224 PRO B CA  
2564 C C   . PRO B 224 ? 0.9387 0.8470 0.9471 0.0485  0.1264  0.0542  224 PRO B C   
2565 O O   . PRO B 224 ? 0.9377 0.8411 0.9448 0.0500  0.1217  0.0472  224 PRO B O   
2566 C CB  . PRO B 224 ? 0.7812 0.6905 0.8193 0.0455  0.1378  0.0628  224 PRO B CB  
2567 C CG  . PRO B 224 ? 0.8131 0.7275 0.8440 0.0453  0.1446  0.0723  224 PRO B CG  
2568 C CD  . PRO B 224 ? 0.8674 0.7864 0.8964 0.0449  0.1422  0.0722  224 PRO B CD  
2569 N N   . SER B 225 ? 1.0229 0.9350 1.0157 0.0492  0.1280  0.0601  225 SER B N   
2570 C CA  . SER B 225 ? 1.0796 0.9914 1.0535 0.0514  0.1248  0.0597  225 SER B CA  
2571 C C   . SER B 225 ? 1.0997 1.0107 1.0671 0.0520  0.1156  0.0514  225 SER B C   
2572 O O   . SER B 225 ? 1.1437 1.0540 1.0985 0.0542  0.1121  0.0489  225 SER B O   
2573 C CB  . SER B 225 ? 1.1424 1.0584 1.1026 0.0514  0.1276  0.0689  225 SER B CB  
2574 O OG  . SER B 225 ? 1.1867 1.1055 1.1475 0.0500  0.1258  0.0701  225 SER B OG  
2575 N N   . ALA B 226 ? 1.0982 1.0097 1.0744 0.0501  0.1117  0.0473  226 ALA B N   
2576 C CA  . ALA B 226 ? 1.0671 0.9776 1.0384 0.0501  0.1027  0.0394  226 ALA B CA  
2577 C C   . ALA B 226 ? 1.1025 1.0070 1.0828 0.0507  0.0986  0.0304  226 ALA B C   
2578 O O   . ALA B 226 ? 1.0085 0.9111 0.9870 0.0506  0.0908  0.0230  226 ALA B O   
2579 C CB  . ALA B 226 ? 1.0409 0.9545 1.0174 0.0481  0.0999  0.0389  226 ALA B CB  
2580 N N   . ILE B 227 ? 1.2193 1.1202 1.2093 0.0513  0.1033  0.0310  227 ILE B N   
2581 C CA  . ILE B 227 ? 1.2957 1.1894 1.2937 0.0524  0.0990  0.0228  227 ILE B CA  
2582 C C   . ILE B 227 ? 1.3467 1.2368 1.3380 0.0559  0.1023  0.0232  227 ILE B C   
2583 O O   . ILE B 227 ? 1.3404 1.2284 1.3426 0.0557  0.1076  0.0264  227 ILE B O   
2584 C CB  . ILE B 227 ? 1.3036 1.1949 1.3251 0.0495  0.0997  0.0218  227 ILE B CB  
2585 C CG1 . ILE B 227 ? 1.2529 1.1495 1.2824 0.0464  0.0984  0.0230  227 ILE B CG1 
2586 C CG2 . ILE B 227 ? 1.3437 1.2263 1.3727 0.0503  0.0928  0.0124  227 ILE B CG2 
2587 C CD1 . ILE B 227 ? 1.2051 1.1012 1.2586 0.0436  0.0993  0.0234  227 ILE B CD1 
2588 N N   . ASP B 228 ? 1.3839 1.2738 1.3577 0.0593  0.0990  0.0204  228 ASP B N   
2589 C CA  . ASP B 228 ? 1.3859 1.2732 1.3517 0.0637  0.1020  0.0206  228 ASP B CA  
2590 C C   . ASP B 228 ? 1.3839 1.2628 1.3499 0.0670  0.0955  0.0100  228 ASP B C   
2591 O O   . ASP B 228 ? 1.3966 1.2751 1.3473 0.0715  0.0930  0.0068  228 ASP B O   
2592 C CB  . ASP B 228 ? 1.4184 1.3122 1.3640 0.0661  0.1035  0.0260  228 ASP B CB  
2593 C CG  . ASP B 228 ? 1.4434 1.3440 1.3874 0.0633  0.1096  0.0369  228 ASP B CG  
2594 O OD1 . ASP B 228 ? 1.4579 1.3588 1.4060 0.0635  0.1169  0.0433  228 ASP B OD1 
2595 O OD2 . ASP B 228 ? 1.4294 1.3345 1.3677 0.0611  0.1066  0.0390  228 ASP B OD2 
2596 N N   . LYS B 235 ? 1.1689 1.0629 1.0954 0.0632  0.0723  0.0030  235 LYS B N   
2597 C CA  . LYS B 235 ? 1.1501 1.0509 1.0576 0.0648  0.0712  0.0074  235 LYS B CA  
2598 C C   . LYS B 235 ? 1.1307 1.0370 1.0358 0.0608  0.0678  0.0111  235 LYS B C   
2599 O O   . LYS B 235 ? 1.2046 1.1151 1.0962 0.0611  0.0626  0.0116  235 LYS B O   
2600 C CB  . LYS B 235 ? 1.1329 1.0378 1.0333 0.0673  0.0794  0.0163  235 LYS B CB  
2601 C CG  . LYS B 235 ? 1.1405 1.0529 1.0220 0.0693  0.0781  0.0217  235 LYS B CG  
2602 C CD  . LYS B 235 ? 1.1426 1.0538 1.0137 0.0728  0.0711  0.0137  235 LYS B CD  
2603 C CE  . LYS B 235 ? 1.1129 1.0331 0.9660 0.0745  0.0695  0.0199  235 LYS B CE  
2604 N NZ  . LYS B 235 ? 1.0899 1.0098 0.9325 0.0778  0.0625  0.0124  235 LYS B NZ  
2605 N N   . ASN B 236 ? 0.9981 0.9044 0.9162 0.0574  0.0707  0.0138  236 ASN B N   
2606 C CA  . ASN B 236 ? 0.8625 0.7729 0.7794 0.0542  0.0673  0.0165  236 ASN B CA  
2607 C C   . ASN B 236 ? 0.8430 0.7501 0.7713 0.0519  0.0609  0.0084  236 ASN B C   
2608 O O   . ASN B 236 ? 0.8435 0.7452 0.7850 0.0518  0.0607  0.0026  236 ASN B O   
2609 C CB  . ASN B 236 ? 0.8031 0.7166 0.7249 0.0527  0.0745  0.0254  236 ASN B CB  
2610 C CG  . ASN B 236 ? 0.8324 0.7500 0.7409 0.0542  0.0791  0.0347  236 ASN B CG  
2611 O OD1 . ASN B 236 ? 0.9512 0.8714 0.8455 0.0558  0.0758  0.0356  236 ASN B OD1 
2612 N ND2 . ASN B 236 ? 0.7921 0.7106 0.7056 0.0536  0.0867  0.0420  236 ASN B ND2 
2613 N N   . GLN B 237 ? 0.8653 0.7756 0.7888 0.0499  0.0550  0.0083  237 GLN B N   
2614 C CA  . GLN B 237 ? 0.8375 0.7456 0.7722 0.0476  0.0491  0.0018  237 GLN B CA  
2615 C C   . GLN B 237 ? 0.7710 0.6810 0.7196 0.0457  0.0542  0.0059  237 GLN B C   
2616 O O   . GLN B 237 ? 0.7378 0.6519 0.6816 0.0459  0.0591  0.0138  237 GLN B O   
2617 C CB  . GLN B 237 ? 0.8206 0.7311 0.7440 0.0464  0.0402  -0.0003 237 GLN B CB  
2618 C CG  . GLN B 237 ? 0.8576 0.7676 0.7665 0.0482  0.0343  -0.0040 237 GLN B CG  
2619 C CD  . GLN B 237 ? 0.9303 0.8430 0.8302 0.0464  0.0250  -0.0058 237 GLN B CD  
2620 O OE1 . GLN B 237 ? 0.9591 0.8769 0.8464 0.0461  0.0236  0.0006  237 GLN B OE1 
2621 N NE2 . GLN B 237 ? 0.9456 0.8545 0.8525 0.0449  0.0179  -0.0142 237 GLN B NE2 
2622 N N   . VAL B 238 ? 0.7642 0.6716 0.7300 0.0442  0.0528  0.0009  238 VAL B N   
2623 C CA  . VAL B 238 ? 0.7077 0.6183 0.6874 0.0428  0.0568  0.0044  238 VAL B CA  
2624 C C   . VAL B 238 ? 0.6998 0.6116 0.6812 0.0413  0.0488  -0.0002 238 VAL B C   
2625 O O   . VAL B 238 ? 0.7485 0.6569 0.7401 0.0399  0.0434  -0.0071 238 VAL B O   
2626 C CB  . VAL B 238 ? 0.6998 0.6079 0.7003 0.0419  0.0611  0.0033  238 VAL B CB  
2627 C CG1 . VAL B 238 ? 0.7088 0.6220 0.7228 0.0410  0.0664  0.0085  238 VAL B CG1 
2628 C CG2 . VAL B 238 ? 0.6534 0.5589 0.6523 0.0435  0.0674  0.0062  238 VAL B CG2 
2629 N N   . MET B 239 ? 0.6795 0.5954 0.6509 0.0415  0.0475  0.0037  239 MET B N   
2630 C CA  . MET B 239 ? 0.6402 0.5569 0.6103 0.0403  0.0388  -0.0009 239 MET B CA  
2631 C C   . MET B 239 ? 0.6091 0.5297 0.5896 0.0404  0.0409  0.0015  239 MET B C   
2632 O O   . MET B 239 ? 0.6293 0.5532 0.6046 0.0419  0.0458  0.0082  239 MET B O   
2633 C CB  . MET B 239 ? 0.5646 0.4822 0.5138 0.0406  0.0325  0.0002  239 MET B CB  
2634 C CG  . MET B 239 ? 0.5019 0.4197 0.4491 0.0391  0.0223  -0.0052 239 MET B CG  
2635 S SD  . MET B 239 ? 0.7657 0.6850 0.6893 0.0390  0.0141  -0.0032 239 MET B SD  
2636 C CE  . MET B 239 ? 0.4545 0.3705 0.3724 0.0390  0.0106  -0.0090 239 MET B CE  
2637 N N   . ILE B 240 ? 0.5887 0.5091 0.5840 0.0390  0.0371  -0.0039 240 ILE B N   
2638 C CA  . ILE B 240 ? 0.6033 0.5282 0.6093 0.0396  0.0384  -0.0023 240 ILE B CA  
2639 C C   . ILE B 240 ? 0.6352 0.5594 0.6410 0.0383  0.0280  -0.0089 240 ILE B C   
2640 O O   . ILE B 240 ? 0.5992 0.5197 0.6120 0.0362  0.0223  -0.0154 240 ILE B O   
2641 C CB  . ILE B 240 ? 0.5767 0.5034 0.6057 0.0391  0.0449  -0.0011 240 ILE B CB  
2642 C CG1 . ILE B 240 ? 0.5756 0.5021 0.6060 0.0398  0.0544  0.0046  240 ILE B CG1 
2643 C CG2 . ILE B 240 ? 0.5597 0.4928 0.5988 0.0406  0.0477  0.0018  240 ILE B CG2 
2644 C CD1 . ILE B 240 ? 0.5598 0.4875 0.6132 0.0387  0.0597  0.0059  240 ILE B CD1 
2645 N N   . HIS B 241 ? 0.5979 0.5249 0.5953 0.0397  0.0250  -0.0074 241 HIS B N   
2646 C CA  . HIS B 241 ? 0.5777 0.5041 0.5733 0.0386  0.0147  -0.0131 241 HIS B CA  
2647 C C   . HIS B 241 ? 0.5833 0.5051 0.5679 0.0362  0.0058  -0.0186 241 HIS B C   
2648 O O   . HIS B 241 ? 0.5829 0.5027 0.5729 0.0342  -0.0021 -0.0252 241 HIS B O   
2649 C CB  . HIS B 241 ? 0.5347 0.4633 0.5518 0.0379  0.0141  -0.0165 241 HIS B CB  
2650 C CG  . HIS B 241 ? 0.5342 0.4688 0.5584 0.0411  0.0197  -0.0119 241 HIS B CG  
2651 N ND1 . HIS B 241 ? 0.5693 0.5082 0.6091 0.0424  0.0297  -0.0072 241 HIS B ND1 
2652 C CD2 . HIS B 241 ? 0.5535 0.4907 0.5709 0.0436  0.0166  -0.0113 241 HIS B CD2 
2653 C CE1 . HIS B 241 ? 0.5500 0.4944 0.5919 0.0459  0.0330  -0.0038 241 HIS B CE1 
2654 N NE2 . HIS B 241 ? 0.5689 0.5119 0.5970 0.0469  0.0251  -0.0064 241 HIS B NE2 
2655 N N   . GLY B 242 ? 0.5917 0.5121 0.5610 0.0366  0.0072  -0.0156 242 GLY B N   
2656 C CA  . GLY B 242 ? 0.5872 0.5046 0.5438 0.0352  -0.0005 -0.0196 242 GLY B CA  
2657 C C   . GLY B 242 ? 0.6082 0.5210 0.5718 0.0341  -0.0011 -0.0254 242 GLY B C   
2658 O O   . GLY B 242 ? 0.6357 0.5459 0.5885 0.0336  -0.0071 -0.0290 242 GLY B O   
2659 N N   . ILE B 243 ? 0.5871 0.4988 0.5686 0.0341  0.0046  -0.0260 243 ILE B N   
2660 C CA  . ILE B 243 ? 0.5303 0.4363 0.5190 0.0333  0.0036  -0.0313 243 ILE B CA  
2661 C C   . ILE B 243 ? 0.5377 0.4430 0.5309 0.0349  0.0135  -0.0268 243 ILE B C   
2662 O O   . ILE B 243 ? 0.5715 0.4812 0.5666 0.0360  0.0215  -0.0198 243 ILE B O   
2663 C CB  . ILE B 243 ? 0.5044 0.4080 0.5128 0.0312  -0.0009 -0.0370 243 ILE B CB  
2664 C CG1 . ILE B 243 ? 0.4534 0.3611 0.4812 0.0313  0.0072  -0.0321 243 ILE B CG1 
2665 C CG2 . ILE B 243 ? 0.5081 0.4126 0.5135 0.0296  -0.0104 -0.0411 243 ILE B CG2 
2666 C CD1 . ILE B 243 ? 0.4542 0.3604 0.5035 0.0290  0.0033  -0.0363 243 ILE B CD1 
2667 N N   . GLU B 244 ? 0.5722 0.4716 0.5665 0.0352  0.0125  -0.0311 244 GLU B N   
2668 C CA  . GLU B 244 ? 0.6241 0.5219 0.6230 0.0366  0.0209  -0.0276 244 GLU B CA  
2669 C C   . GLU B 244 ? 0.6227 0.5158 0.6430 0.0352  0.0207  -0.0311 244 GLU B C   
2670 O O   . GLU B 244 ? 0.5876 0.4734 0.6090 0.0351  0.0149  -0.0378 244 GLU B O   
2671 C CB  . GLU B 244 ? 0.7119 0.6065 0.6935 0.0390  0.0204  -0.0289 244 GLU B CB  
2672 C CG  . GLU B 244 ? 0.9004 0.7940 0.8836 0.0411  0.0294  -0.0244 244 GLU B CG  
2673 C CD  . GLU B 244 ? 1.0350 0.9275 0.9994 0.0442  0.0298  -0.0243 244 GLU B CD  
2674 O OE1 . GLU B 244 ? 1.0373 0.9292 0.9882 0.0448  0.0226  -0.0284 244 GLU B OE1 
2675 O OE2 . GLU B 244 ? 1.0937 0.9863 1.0568 0.0461  0.0374  -0.0197 244 GLU B OE2 
2676 N N   . PRO B 245 ? 0.6246 0.5221 0.6622 0.0341  0.0266  -0.0262 245 PRO B N   
2677 C CA  . PRO B 245 ? 0.5759 0.4705 0.6366 0.0322  0.0264  -0.0277 245 PRO B CA  
2678 C C   . PRO B 245 ? 0.5980 0.4867 0.6619 0.0331  0.0299  -0.0276 245 PRO B C   
2679 O O   . PRO B 245 ? 0.5901 0.4800 0.6428 0.0353  0.0365  -0.0233 245 PRO B O   
2680 C CB  . PRO B 245 ? 0.5703 0.4736 0.6447 0.0317  0.0340  -0.0201 245 PRO B CB  
2681 C CG  . PRO B 245 ? 0.5989 0.5078 0.6575 0.0332  0.0344  -0.0176 245 PRO B CG  
2682 C CD  . PRO B 245 ? 0.5976 0.5033 0.6337 0.0348  0.0330  -0.0187 245 PRO B CD  
2683 N N   . MET B 246 ? 0.6563 0.5383 0.7358 0.0314  0.0251  -0.0321 246 MET B N   
2684 C CA  . MET B 246 ? 0.6321 0.5075 0.7173 0.0322  0.0274  -0.0322 246 MET B CA  
2685 C C   . MET B 246 ? 0.5999 0.4819 0.6964 0.0320  0.0384  -0.0228 246 MET B C   
2686 O O   . MET B 246 ? 0.6991 0.5889 0.8088 0.0302  0.0419  -0.0176 246 MET B O   
2687 C CB  . MET B 246 ? 0.6228 0.4896 0.7251 0.0300  0.0190  -0.0382 246 MET B CB  
2688 C CG  . MET B 246 ? 0.6721 0.5299 0.7622 0.0308  0.0079  -0.0482 246 MET B CG  
2689 S SD  . MET B 246 ? 0.8649 0.7106 0.9748 0.0282  -0.0029 -0.0551 246 MET B SD  
2690 C CE  . MET B 246 ? 1.0098 0.8461 1.0983 0.0304  -0.0146 -0.0665 246 MET B CE  
2691 N N   . LEU B 247 ? 0.5829 0.4621 0.6740 0.0339  0.0438  -0.0204 247 LEU B N   
2692 C CA  . LEU B 247 ? 0.5811 0.4661 0.6817 0.0337  0.0542  -0.0112 247 LEU B CA  
2693 C C   . LEU B 247 ? 0.6272 0.5128 0.7553 0.0305  0.0544  -0.0086 247 LEU B C   
2694 O O   . LEU B 247 ? 0.6317 0.5249 0.7712 0.0296  0.0626  -0.0002 247 LEU B O   
2695 C CB  . LEU B 247 ? 0.5073 0.3883 0.5974 0.0364  0.0589  -0.0098 247 LEU B CB  
2696 C CG  . LEU B 247 ? 0.5261 0.4091 0.5907 0.0395  0.0611  -0.0092 247 LEU B CG  
2697 C CD1 . LEU B 247 ? 0.5558 0.4360 0.6137 0.0421  0.0671  -0.0062 247 LEU B CD1 
2698 C CD2 . LEU B 247 ? 0.5412 0.4340 0.6003 0.0390  0.0660  -0.0026 247 LEU B CD2 
2699 N N   . GLU B 248 ? 0.6318 0.5094 0.7703 0.0288  0.0451  -0.0152 248 GLU B N   
2700 C CA  . GLU B 248 ? 0.6627 0.5399 0.8282 0.0255  0.0437  -0.0126 248 GLU B CA  
2701 C C   . GLU B 248 ? 0.6919 0.5783 0.8724 0.0229  0.0436  -0.0092 248 GLU B C   
2702 O O   . GLU B 248 ? 0.7328 0.6212 0.9374 0.0199  0.0429  -0.0055 248 GLU B O   
2703 C CB  . GLU B 248 ? 0.6758 0.5396 0.8467 0.0247  0.0328  -0.0209 248 GLU B CB  
2704 C CG  . GLU B 248 ? 0.7178 0.5774 0.8861 0.0237  0.0220  -0.0289 248 GLU B CG  
2705 C CD  . GLU B 248 ? 0.8398 0.6844 1.0094 0.0238  0.0109  -0.0377 248 GLU B CD  
2706 O OE1 . GLU B 248 ? 0.9296 0.7663 1.0862 0.0271  0.0109  -0.0412 248 GLU B OE1 
2707 O OE2 . GLU B 248 ? 0.8773 0.7179 1.0609 0.0208  0.0019  -0.0412 248 GLU B OE2 
2708 N N   . THR B 249 ? 0.6666 0.5586 0.8333 0.0242  0.0439  -0.0102 249 THR B N   
2709 C CA  . THR B 249 ? 0.6140 0.5153 0.7926 0.0228  0.0442  -0.0072 249 THR B CA  
2710 C C   . THR B 249 ? 0.6170 0.5291 0.8112 0.0226  0.0548  0.0035  249 THR B C   
2711 O O   . THR B 249 ? 0.6150 0.5306 0.7993 0.0247  0.0636  0.0088  249 THR B O   
2712 C CB  . THR B 249 ? 0.5897 0.4950 0.7481 0.0249  0.0434  -0.0095 249 THR B CB  
2713 O OG1 . THR B 249 ? 0.6368 0.5329 0.7775 0.0256  0.0348  -0.0184 249 THR B OG1 
2714 C CG2 . THR B 249 ? 0.5749 0.4876 0.7457 0.0238  0.0411  -0.0086 249 THR B CG2 
2715 N N   . PRO B 250 ? 0.6781 0.5955 0.8971 0.0200  0.0539  0.0071  250 PRO B N   
2716 C CA  . PRO B 250 ? 0.6672 0.5966 0.9025 0.0200  0.0640  0.0178  250 PRO B CA  
2717 C C   . PRO B 250 ? 0.6733 0.6124 0.8944 0.0237  0.0718  0.0219  250 PRO B C   
2718 O O   . PRO B 250 ? 0.7236 0.6652 0.9374 0.0249  0.0681  0.0183  250 PRO B O   
2719 C CB  . PRO B 250 ? 0.6324 0.5660 0.8940 0.0169  0.0591  0.0193  250 PRO B CB  
2720 C CG  . PRO B 250 ? 0.6156 0.5357 0.8794 0.0142  0.0469  0.0106  250 PRO B CG  
2721 C CD  . PRO B 250 ? 0.7020 0.6137 0.9365 0.0168  0.0431  0.0018  250 PRO B CD  
2722 N N   . LEU B 251 ? 0.6205 0.5643 0.8374 0.0255  0.0820  0.0292  251 LEU B N   
2723 C CA  . LEU B 251 ? 0.5682 0.5195 0.7697 0.0293  0.0893  0.0332  251 LEU B CA  
2724 C C   . LEU B 251 ? 0.6165 0.5792 0.8296 0.0307  0.0917  0.0371  251 LEU B C   
2725 O O   . LEU B 251 ? 0.7064 0.6723 0.9049 0.0339  0.0918  0.0358  251 LEU B O   
2726 C CB  . LEU B 251 ? 0.5461 0.5000 0.7439 0.0306  0.0996  0.0410  251 LEU B CB  
2727 C CG  . LEU B 251 ? 0.5926 0.5521 0.7720 0.0347  0.1065  0.0451  251 LEU B CG  
2728 C CD1 . LEU B 251 ? 0.5511 0.5038 0.7047 0.0363  0.1003  0.0380  251 LEU B CD1 
2729 C CD2 . LEU B 251 ? 0.6392 0.6007 0.8168 0.0355  0.1162  0.0530  251 LEU B CD2 
2730 N N   . GLN B 252 ? 0.5755 0.5446 0.8150 0.0286  0.0933  0.0423  252 GLN B N   
2731 C CA  . GLN B 252 ? 0.5466 0.5278 0.7998 0.0303  0.0959  0.0466  252 GLN B CA  
2732 C C   . GLN B 252 ? 0.6019 0.5804 0.8504 0.0303  0.0863  0.0384  252 GLN B C   
2733 O O   . GLN B 252 ? 0.6132 0.5984 0.8552 0.0339  0.0878  0.0387  252 GLN B O   
2734 C CB  . GLN B 252 ? 0.5360 0.5244 0.8205 0.0272  0.0981  0.0539  252 GLN B CB  
2735 C CG  . GLN B 252 ? 0.5381 0.5400 0.8395 0.0290  0.1003  0.0587  252 GLN B CG  
2736 C CD  . GLN B 252 ? 0.5821 0.5953 0.8744 0.0348  0.1112  0.0653  252 GLN B CD  
2737 O OE1 . GLN B 252 ? 0.6150 0.6294 0.8992 0.0364  0.1194  0.0705  252 GLN B OE1 
2738 N NE2 . GLN B 252 ? 0.5800 0.6013 0.8732 0.0384  0.1111  0.0650  252 GLN B NE2 
2739 N N   . TRP B 253 ? 0.6224 0.5906 0.8736 0.0265  0.0760  0.0309  253 TRP B N   
2740 C CA  . TRP B 253 ? 0.5992 0.5637 0.8463 0.0259  0.0659  0.0228  253 TRP B CA  
2741 C C   . TRP B 253 ? 0.6028 0.5642 0.8209 0.0292  0.0646  0.0177  253 TRP B C   
2742 O O   . TRP B 253 ? 0.6100 0.5745 0.8238 0.0308  0.0608  0.0147  253 TRP B O   
2743 C CB  . TRP B 253 ? 0.5659 0.5183 0.8190 0.0215  0.0550  0.0155  253 TRP B CB  
2744 C CG  . TRP B 253 ? 0.5892 0.5384 0.8415 0.0203  0.0445  0.0079  253 TRP B CG  
2745 C CD1 . TRP B 253 ? 0.5617 0.5151 0.8361 0.0181  0.0397  0.0085  253 TRP B CD1 
2746 C CD2 . TRP B 253 ? 0.6152 0.5568 0.8441 0.0212  0.0373  -0.0010 253 TRP B CD2 
2747 N NE1 . TRP B 253 ? 0.5842 0.5323 0.8500 0.0174  0.0298  0.0002  253 TRP B NE1 
2748 C CE2 . TRP B 253 ? 0.5919 0.5329 0.8297 0.0193  0.0282  -0.0058 253 TRP B CE2 
2749 C CE3 . TRP B 253 ? 0.5904 0.5261 0.7921 0.0233  0.0375  -0.0048 253 TRP B CE3 
2750 C CZ2 . TRP B 253 ? 0.5673 0.5018 0.7876 0.0194  0.0193  -0.0144 253 TRP B CZ2 
2751 C CZ3 . TRP B 253 ? 0.6065 0.5366 0.7913 0.0234  0.0288  -0.0129 253 TRP B CZ3 
2752 C CH2 . TRP B 253 ? 0.5826 0.5120 0.7765 0.0214  0.0198  -0.0177 253 TRP B CH2 
2753 N N   . LEU B 254 ? 0.5529 0.5084 0.7519 0.0302  0.0673  0.0171  254 LEU B N   
2754 C CA  . LEU B 254 ? 0.5890 0.5417 0.7608 0.0330  0.0659  0.0136  254 LEU B CA  
2755 C C   . LEU B 254 ? 0.5981 0.5603 0.7645 0.0373  0.0723  0.0189  254 LEU B C   
2756 O O   . LEU B 254 ? 0.6469 0.6091 0.7995 0.0394  0.0678  0.0152  254 LEU B O   
2757 C CB  . LEU B 254 ? 0.6467 0.5928 0.8017 0.0333  0.0689  0.0140  254 LEU B CB  
2758 C CG  . LEU B 254 ? 0.6923 0.6273 0.8333 0.0317  0.0600  0.0056  254 LEU B CG  
2759 C CD1 . LEU B 254 ? 0.7599 0.6910 0.8823 0.0332  0.0643  0.0073  254 LEU B CD1 
2760 C CD2 . LEU B 254 ? 0.6465 0.5802 0.7756 0.0321  0.0514  -0.0008 254 LEU B CD2 
2761 N N   . SER B 255 ? 0.5303 0.5004 0.7072 0.0390  0.0826  0.0275  255 SER B N   
2762 C CA  . SER B 255 ? 0.5524 0.5315 0.7240 0.0439  0.0895  0.0330  255 SER B CA  
2763 C C   . SER B 255 ? 0.5736 0.5591 0.7547 0.0456  0.0856  0.0310  255 SER B C   
2764 O O   . SER B 255 ? 0.6167 0.6053 0.7851 0.0500  0.0859  0.0307  255 SER B O   
2765 C CB  . SER B 255 ? 0.5626 0.5497 0.7467 0.0452  0.1011  0.0428  255 SER B CB  
2766 O OG  . SER B 255 ? 0.5956 0.5905 0.7719 0.0507  0.1080  0.0479  255 SER B OG  
2767 N N   . GLU B 256 ? 0.5750 0.5619 0.7785 0.0420  0.0815  0.0297  256 GLU B N   
2768 C CA  . GLU B 256 ? 0.5703 0.5637 0.7859 0.0431  0.0776  0.0282  256 GLU B CA  
2769 C C   . GLU B 256 ? 0.6088 0.5946 0.8103 0.0423  0.0661  0.0185  256 GLU B C   
2770 O O   . GLU B 256 ? 0.6553 0.6455 0.8535 0.0456  0.0640  0.0170  256 GLU B O   
2771 C CB  . GLU B 256 ? 0.5734 0.5710 0.8194 0.0391  0.0765  0.0310  256 GLU B CB  
2772 C CG  . GLU B 256 ? 0.6044 0.6118 0.8684 0.0397  0.0875  0.0417  256 GLU B CG  
2773 C CD  . GLU B 256 ? 0.6323 0.6409 0.9252 0.0344  0.0846  0.0445  256 GLU B CD  
2774 O OE1 . GLU B 256 ? 0.6537 0.6549 0.9522 0.0305  0.0739  0.0376  256 GLU B OE1 
2775 O OE2 . GLU B 256 ? 0.6211 0.6377 0.9311 0.0340  0.0925  0.0537  256 GLU B OE2 
2776 N N   . HIS B 257 ? 0.6098 0.5842 0.8023 0.0384  0.0587  0.0120  257 HIS B N   
2777 C CA  . HIS B 257 ? 0.5906 0.5580 0.7733 0.0367  0.0470  0.0030  257 HIS B CA  
2778 C C   . HIS B 257 ? 0.6156 0.5758 0.7693 0.0379  0.0431  -0.0015 257 HIS B C   
2779 O O   . HIS B 257 ? 0.6555 0.6123 0.7995 0.0376  0.0343  -0.0077 257 HIS B O   
2780 C CB  . HIS B 257 ? 0.5808 0.5411 0.7776 0.0313  0.0389  -0.0020 257 HIS B CB  
2781 C CG  . HIS B 257 ? 0.6203 0.5876 0.8468 0.0296  0.0401  0.0022  257 HIS B CG  
2782 N ND1 . HIS B 257 ? 0.6331 0.6044 0.8773 0.0284  0.0473  0.0095  257 HIS B ND1 
2783 C CD2 . HIS B 257 ? 0.6341 0.6058 0.8764 0.0287  0.0350  0.0010  257 HIS B CD2 
2784 C CE1 . HIS B 257 ? 0.6364 0.6145 0.9063 0.0268  0.0464  0.0129  257 HIS B CE1 
2785 N NE2 . HIS B 257 ? 0.6494 0.6280 0.9188 0.0270  0.0391  0.0078  257 HIS B NE2 
2786 N N   . LEU B 258 ? 0.6010 0.5589 0.7415 0.0390  0.0492  0.0019  258 LEU B N   
2787 C CA  . LEU B 258 ? 0.5817 0.5337 0.6957 0.0400  0.0456  -0.0010 258 LEU B CA  
2788 C C   . LEU B 258 ? 0.5890 0.5451 0.6885 0.0445  0.0529  0.0051  258 LEU B C   
2789 O O   . LEU B 258 ? 0.6336 0.5850 0.7125 0.0451  0.0520  0.0052  258 LEU B O   
2790 C CB  . LEU B 258 ? 0.5144 0.4577 0.6206 0.0371  0.0435  -0.0038 258 LEU B CB  
2791 C CG  . LEU B 258 ? 0.5104 0.4459 0.6090 0.0343  0.0317  -0.0126 258 LEU B CG  
2792 C CD1 . LEU B 258 ? 0.5092 0.4443 0.6288 0.0315  0.0260  -0.0167 258 LEU B CD1 
2793 C CD2 . LEU B 258 ? 0.4859 0.4135 0.5729 0.0330  0.0306  -0.0149 258 LEU B CD2 
2794 N N   . SER B 259 ? 0.5266 0.4913 0.6366 0.0479  0.0599  0.0106  259 SER B N   
2795 C CA  . SER B 259 ? 0.5490 0.5168 0.6442 0.0528  0.0655  0.0156  259 SER B CA  
2796 C C   . SER B 259 ? 0.5708 0.5369 0.6507 0.0552  0.0573  0.0111  259 SER B C   
2797 O O   . SER B 259 ? 0.5731 0.5385 0.6590 0.0536  0.0492  0.0053  259 SER B O   
2798 C CB  . SER B 259 ? 0.5659 0.5439 0.6763 0.0565  0.0759  0.0229  259 SER B CB  
2799 O OG  . SER B 259 ? 0.6303 0.6098 0.7531 0.0543  0.0837  0.0281  259 SER B OG  
2800 N N   . TYR B 260 ? 0.5809 0.5455 0.6410 0.0588  0.0587  0.0139  260 TYR B N   
2801 C CA  . TYR B 260 ? 0.6205 0.5837 0.6665 0.0619  0.0512  0.0108  260 TYR B CA  
2802 C C   . TYR B 260 ? 0.6120 0.5837 0.6694 0.0672  0.0557  0.0130  260 TYR B C   
2803 O O   . TYR B 260 ? 0.6354 0.6141 0.7096 0.0682  0.0650  0.0178  260 TYR B O   
2804 C CB  . TYR B 260 ? 0.6224 0.5805 0.6439 0.0639  0.0506  0.0138  260 TYR B CB  
2805 C CG  . TYR B 260 ? 0.5628 0.5134 0.5709 0.0593  0.0439  0.0111  260 TYR B CG  
2806 C CD1 . TYR B 260 ? 0.5196 0.4684 0.5313 0.0559  0.0486  0.0129  260 TYR B CD1 
2807 C CD2 . TYR B 260 ? 0.5089 0.4548 0.5011 0.0586  0.0329  0.0072  260 TYR B CD2 
2808 C CE1 . TYR B 260 ? 0.5085 0.4514 0.5077 0.0525  0.0430  0.0107  260 TYR B CE1 
2809 C CE2 . TYR B 260 ? 0.4535 0.3941 0.4338 0.0546  0.0272  0.0055  260 TYR B CE2 
2810 C CZ  . TYR B 260 ? 0.4806 0.4199 0.4641 0.0519  0.0326  0.0073  260 TYR B CZ  
2811 O OH  . TYR B 260 ? 0.4958 0.4306 0.4672 0.0489  0.0274  0.0059  260 TYR B OH  
2812 N N   . PRO B 261 ? 0.5837 0.5551 0.6326 0.0707  0.0489  0.0096  261 PRO B N   
2813 C CA  . PRO B 261 ? 0.5390 0.5189 0.5970 0.0770  0.0536  0.0117  261 PRO B CA  
2814 C C   . PRO B 261 ? 0.6123 0.5965 0.6662 0.0826  0.0649  0.0195  261 PRO B C   
2815 O O   . PRO B 261 ? 0.6661 0.6594 0.7321 0.0876  0.0719  0.0229  261 PRO B O   
2816 C CB  . PRO B 261 ? 0.5537 0.5296 0.5965 0.0800  0.0431  0.0066  261 PRO B CB  
2817 C CG  . PRO B 261 ? 0.5739 0.5422 0.6118 0.0733  0.0322  0.0004  261 PRO B CG  
2818 C CD  . PRO B 261 ? 0.5965 0.5608 0.6304 0.0687  0.0361  0.0032  261 PRO B CD  
2819 N N   . ASP B 262 ? 0.6251 0.6033 0.6626 0.0819  0.0670  0.0227  262 ASP B N   
2820 C CA  . ASP B 262 ? 0.5773 0.5587 0.6100 0.0868  0.0775  0.0302  262 ASP B CA  
2821 C C   . ASP B 262 ? 0.6200 0.6083 0.6729 0.0844  0.0885  0.0358  262 ASP B C   
2822 O O   . ASP B 262 ? 0.6984 0.6899 0.7497 0.0876  0.0980  0.0426  262 ASP B O   
2823 C CB  . ASP B 262 ? 0.5645 0.5368 0.5723 0.0868  0.0751  0.0322  262 ASP B CB  
2824 C CG  . ASP B 262 ? 0.6585 0.6249 0.6641 0.0795  0.0731  0.0317  262 ASP B CG  
2825 O OD1 . ASP B 262 ? 0.5969 0.5659 0.6199 0.0749  0.0757  0.0308  262 ASP B OD1 
2826 O OD2 . ASP B 262 ? 0.7194 0.6784 0.7052 0.0787  0.0686  0.0324  262 ASP B OD2 
2827 N N   . ASN B 263 ? 0.5422 0.5322 0.6140 0.0788  0.0864  0.0329  263 ASN B N   
2828 C CA  . ASN B 263 ? 0.4922 0.4877 0.5854 0.0754  0.0946  0.0376  263 ASN B CA  
2829 C C   . ASN B 263 ? 0.5524 0.5421 0.6393 0.0715  0.0982  0.0405  263 ASN B C   
2830 O O   . ASN B 263 ? 0.6109 0.6043 0.7139 0.0690  0.1051  0.0450  263 ASN B O   
2831 C CB  . ASN B 263 ? 0.4599 0.4676 0.5677 0.0808  0.1052  0.0446  263 ASN B CB  
2832 C CG  . ASN B 263 ? 0.5338 0.5497 0.6599 0.0822  0.1029  0.0426  263 ASN B CG  
2833 O OD1 . ASN B 263 ? 0.5977 0.6239 0.7463 0.0825  0.1100  0.0479  263 ASN B OD1 
2834 N ND2 . ASN B 263 ? 0.5124 0.5239 0.6298 0.0829  0.0928  0.0353  263 ASN B ND2 
2835 N N   . PHE B 264 ? 0.5355 0.5163 0.5997 0.0710  0.0931  0.0384  264 PHE B N   
2836 C CA  . PHE B 264 ? 0.5398 0.5149 0.5972 0.0674  0.0957  0.0409  264 PHE B CA  
2837 C C   . PHE B 264 ? 0.5925 0.5610 0.6509 0.0614  0.0878  0.0346  264 PHE B C   
2838 O O   . PHE B 264 ? 0.5929 0.5581 0.6462 0.0603  0.0782  0.0281  264 PHE B O   
2839 C CB  . PHE B 264 ? 0.5396 0.5094 0.5721 0.0702  0.0956  0.0438  264 PHE B CB  
2840 C CG  . PHE B 264 ? 0.5654 0.5393 0.5970 0.0742  0.1064  0.0520  264 PHE B CG  
2841 C CD1 . PHE B 264 ? 0.6039 0.5771 0.6388 0.0716  0.1136  0.0572  264 PHE B CD1 
2842 C CD2 . PHE B 264 ? 0.5357 0.5140 0.5629 0.0809  0.1093  0.0545  264 PHE B CD2 
2843 C CE1 . PHE B 264 ? 0.5889 0.5658 0.6230 0.0750  0.1235  0.0650  264 PHE B CE1 
2844 C CE2 . PHE B 264 ? 0.5544 0.5365 0.5800 0.0849  0.1193  0.0621  264 PHE B CE2 
2845 C CZ  . PHE B 264 ? 0.5597 0.5411 0.5889 0.0817  0.1263  0.0675  264 PHE B CZ  
2846 N N   . LEU B 265 ? 0.6419 0.6083 0.7068 0.0579  0.0920  0.0367  265 LEU B N   
2847 C CA  . LEU B 265 ? 0.5891 0.5485 0.6520 0.0531  0.0854  0.0312  265 LEU B CA  
2848 C C   . LEU B 265 ? 0.5920 0.5452 0.6318 0.0532  0.0840  0.0324  265 LEU B C   
2849 O O   . LEU B 265 ? 0.6413 0.5936 0.6786 0.0531  0.0908  0.0376  265 LEU B O   
2850 C CB  . LEU B 265 ? 0.5848 0.5448 0.6673 0.0498  0.0900  0.0326  265 LEU B CB  
2851 C CG  . LEU B 265 ? 0.6298 0.5833 0.7173 0.0454  0.0825  0.0257  265 LEU B CG  
2852 C CD1 . LEU B 265 ? 0.5573 0.5113 0.6525 0.0444  0.0738  0.0191  265 LEU B CD1 
2853 C CD2 . LEU B 265 ? 0.6898 0.6434 0.7960 0.0429  0.0877  0.0284  265 LEU B CD2 
2854 N N   . HIS B 266 ? 0.5519 0.5012 0.5753 0.0535  0.0751  0.0282  266 HIS B N   
2855 C CA  . HIS B 266 ? 0.5381 0.4822 0.5399 0.0534  0.0727  0.0300  266 HIS B CA  
2856 C C   . HIS B 266 ? 0.5870 0.5263 0.5866 0.0496  0.0686  0.0260  266 HIS B C   
2857 O O   . HIS B 266 ? 0.5776 0.5147 0.5768 0.0477  0.0600  0.0193  266 HIS B O   
2858 C CB  . HIS B 266 ? 0.5053 0.4479 0.4905 0.0554  0.0644  0.0283  266 HIS B CB  
2859 C CG  . HIS B 266 ? 0.5318 0.4778 0.5151 0.0602  0.0678  0.0321  266 HIS B CG  
2860 N ND1 . HIS B 266 ? 0.5955 0.5411 0.5682 0.0631  0.0738  0.0392  266 HIS B ND1 
2861 C CD2 . HIS B 266 ? 0.5252 0.4750 0.5149 0.0632  0.0659  0.0296  266 HIS B CD2 
2862 C CE1 . HIS B 266 ? 0.5088 0.4574 0.4808 0.0680  0.0754  0.0407  266 HIS B CE1 
2863 N NE2 . HIS B 266 ? 0.4839 0.4354 0.4663 0.0683  0.0708  0.0350  266 HIS B NE2 
2864 N N   . ILE B 267 ? 0.5597 0.4973 0.5576 0.0489  0.0747  0.0301  267 ILE B N   
2865 C CA  . ILE B 267 ? 0.5469 0.4801 0.5430 0.0463  0.0722  0.0267  267 ILE B CA  
2866 C C   . ILE B 267 ? 0.6183 0.5488 0.5935 0.0467  0.0709  0.0300  267 ILE B C   
2867 O O   . ILE B 267 ? 0.6762 0.6075 0.6445 0.0482  0.0769  0.0372  267 ILE B O   
2868 C CB  . ILE B 267 ? 0.5441 0.4773 0.5565 0.0453  0.0798  0.0284  267 ILE B CB  
2869 C CG1 . ILE B 267 ? 0.5373 0.4745 0.5720 0.0448  0.0817  0.0272  267 ILE B CG1 
2870 C CG2 . ILE B 267 ? 0.4806 0.4084 0.4915 0.0434  0.0764  0.0236  267 ILE B CG2 
2871 C CD1 . ILE B 267 ? 0.5061 0.4446 0.5580 0.0438  0.0899  0.0311  267 ILE B CD1 
2872 N N   . SER B 268 ? 0.5875 0.5151 0.5529 0.0454  0.0630  0.0253  268 SER B N   
2873 C CA  . SER B 268 ? 0.6013 0.5276 0.5480 0.0457  0.0612  0.0289  268 SER B CA  
2874 C C   . SER B 268 ? 0.6504 0.5742 0.5971 0.0451  0.0638  0.0279  268 SER B C   
2875 O O   . SER B 268 ? 0.6594 0.5809 0.6136 0.0442  0.0605  0.0209  268 SER B O   
2876 C CB  . SER B 268 ? 0.5651 0.4909 0.4983 0.0450  0.0504  0.0258  268 SER B CB  
2877 O OG  . SER B 268 ? 0.6225 0.5497 0.5535 0.0460  0.0473  0.0269  268 SER B OG  
2878 N N   . ILE B 269 ? 0.6439 0.5680 0.5821 0.0461  0.0693  0.0347  269 ILE B N   
2879 C CA  . ILE B 269 ? 0.6573 0.5795 0.5925 0.0464  0.0714  0.0343  269 ILE B CA  
2880 C C   . ILE B 269 ? 0.6702 0.5935 0.5861 0.0468  0.0661  0.0367  269 ILE B C   
2881 O O   . ILE B 269 ? 0.6946 0.6197 0.5997 0.0473  0.0679  0.0446  269 ILE B O   
2882 C CB  . ILE B 269 ? 0.6601 0.5823 0.6005 0.0472  0.0816  0.0407  269 ILE B CB  
2883 C CG1 . ILE B 269 ? 0.6615 0.5839 0.6216 0.0466  0.0870  0.0399  269 ILE B CG1 
2884 C CG2 . ILE B 269 ? 0.5842 0.5041 0.5218 0.0482  0.0834  0.0395  269 ILE B CG2 
2885 C CD1 . ILE B 269 ? 0.6709 0.5905 0.6454 0.0455  0.0838  0.0315  269 ILE B CD1 
2886 N N   . ILE B 270 ? 0.6288 0.5510 0.5404 0.0467  0.0593  0.0303  270 ILE B N   
2887 C CA  . ILE B 270 ? 0.6656 0.5901 0.5597 0.0469  0.0534  0.0326  270 ILE B CA  
2888 C C   . ILE B 270 ? 0.7157 0.6395 0.6056 0.0487  0.0538  0.0297  270 ILE B C   
2889 O O   . ILE B 270 ? 0.7159 0.6358 0.6159 0.0493  0.0549  0.0228  270 ILE B O   
2890 C CB  . ILE B 270 ? 0.6694 0.5946 0.5591 0.0453  0.0430  0.0282  270 ILE B CB  
2891 C CG1 . ILE B 270 ? 0.6721 0.5941 0.5714 0.0448  0.0387  0.0177  270 ILE B CG1 
2892 C CG2 . ILE B 270 ? 0.6450 0.5707 0.5379 0.0445  0.0423  0.0308  270 ILE B CG2 
2893 C CD1 . ILE B 270 ? 0.7517 0.6740 0.6481 0.0430  0.0285  0.0129  270 ILE B CD1 
2894 N N   . PRO B 271 ? 0.7591 0.6865 0.6339 0.0498  0.0528  0.0353  271 PRO B N   
2895 C CA  . PRO B 271 ? 0.7641 0.6919 0.6323 0.0524  0.0527  0.0327  271 PRO B CA  
2896 C C   . PRO B 271 ? 0.8700 0.7960 0.7372 0.0522  0.0442  0.0231  271 PRO B C   
2897 O O   . PRO B 271 ? 0.8749 0.8013 0.7418 0.0498  0.0371  0.0209  271 PRO B O   
2898 C CB  . PRO B 271 ? 0.7199 0.6539 0.5722 0.0530  0.0519  0.0422  271 PRO B CB  
2899 C CG  . PRO B 271 ? 0.7506 0.6855 0.6035 0.0512  0.0548  0.0506  271 PRO B CG  
2900 C CD  . PRO B 271 ? 0.7355 0.6669 0.5990 0.0490  0.0522  0.0453  271 PRO B CD  
2901 N N   . GLN B 272 ? 0.9886 0.9121 0.8548 0.0551  0.0445  0.0173  272 GLN B N   
2902 C CA  . GLN B 272 ? 1.0697 0.9911 0.9328 0.0554  0.0361  0.0084  272 GLN B CA  
2903 C C   . GLN B 272 ? 1.1245 1.0526 0.9704 0.0557  0.0302  0.0123  272 GLN B C   
2904 O O   . GLN B 272 ? 1.0850 1.0188 0.9209 0.0575  0.0338  0.0206  272 GLN B O   
2905 C CB  . GLN B 272 ? 1.0972 1.0129 0.9632 0.0591  0.0378  0.0009  272 GLN B CB  
2906 C CG  . GLN B 272 ? 1.1439 1.0524 1.0284 0.0582  0.0414  -0.0037 272 GLN B CG  
2907 C CD  . GLN B 272 ? 1.2259 1.1265 1.1150 0.0600  0.0368  -0.0146 272 GLN B CD  
2908 O OE1 . GLN B 272 ? 1.2524 1.1522 1.1296 0.0637  0.0338  -0.0183 272 GLN B OE1 
2909 N NE2 . GLN B 272 ? 1.2591 1.1537 1.1655 0.0575  0.0357  -0.0195 272 GLN B NE2 
2910 N N   . PRO B 273 ? 1.2048 1.1327 1.0482 0.0537  0.0208  0.0069  273 PRO B N   
2911 C CA  . PRO B 273 ? 1.2303 1.1647 1.0586 0.0533  0.0138  0.0105  273 PRO B CA  
2912 C C   . PRO B 273 ? 1.2319 1.1707 1.0476 0.0579  0.0161  0.0126  273 PRO B C   
2913 O O   . PRO B 273 ? 1.2012 1.1355 1.0186 0.0616  0.0188  0.0060  273 PRO B O   
2914 C CB  . PRO B 273 ? 1.2503 1.1812 1.0812 0.0512  0.0042  0.0010  273 PRO B CB  
2915 C CG  . PRO B 273 ? 1.2190 1.1436 1.0671 0.0489  0.0058  -0.0036 273 PRO B CG  
2916 C CD  . PRO B 273 ? 1.2116 1.1332 1.0676 0.0513  0.0160  -0.0023 273 PRO B CD  
2917 N N   . THR B 274 ? 1.2665 1.2139 1.0696 0.0578  0.0146  0.0221  274 THR B N   
2918 C CA  . THR B 274 ? 1.3121 1.2660 1.1032 0.0625  0.0178  0.0266  274 THR B CA  
2919 C C   . THR B 274 ? 1.3858 1.3396 1.1693 0.0657  0.0126  0.0184  274 THR B C   
2920 O O   . THR B 274 ? 1.4373 1.3878 1.2196 0.0709  0.0168  0.0131  274 THR B O   
2921 C CB  . THR B 274 ? 1.2916 1.2558 1.0722 0.0609  0.0162  0.0399  274 THR B CB  
2922 O OG1 . THR B 274 ? 1.2836 1.2505 1.0594 0.0571  0.0056  0.0398  274 THR B OG1 
2923 C CG2 . THR B 274 ? 1.2329 1.1965 1.0195 0.0584  0.0215  0.0483  274 THR B CG2 
2924 N N   . ASP B 275 ? 1.3774 1.3341 1.1551 0.0629  0.0031  0.0172  275 ASP B N   
2925 C CA  . ASP B 275 ? 1.3383 1.2959 1.1068 0.0657  -0.0027 0.0106  275 ASP B CA  
2926 C C   . ASP B 275 ? 1.3386 1.2847 1.1149 0.0672  -0.0045 -0.0036 275 ASP B C   
2927 O O   . ASP B 275 ? 1.3243 1.2624 1.1145 0.0639  -0.0049 -0.0087 275 ASP B O   
2928 C CB  . ASP B 275 ? 1.2606 1.2244 1.0219 0.0616  -0.0130 0.0136  275 ASP B CB  
2929 C CG  . ASP B 275 ? 1.1514 1.1106 0.9231 0.0552  -0.0185 0.0121  275 ASP B CG  
2930 O OD1 . ASP B 275 ? 1.1235 1.0885 0.8910 0.0514  -0.0236 0.0201  275 ASP B OD1 
2931 O OD2 . ASP B 275 ? 1.0773 1.0269 0.8612 0.0542  -0.0179 0.0032  275 ASP B OD2 
2932 N N   . MET C 3   ? 0.8438 0.8008 1.1194 -0.0968 -0.2079 -0.0781 10  MET C N   
2933 C CA  . MET C 3   ? 0.7953 0.7658 1.0841 -0.0873 -0.1843 -0.0720 10  MET C CA  
2934 C C   . MET C 3   ? 0.7715 0.7229 1.0365 -0.0841 -0.1611 -0.0792 10  MET C C   
2935 O O   . MET C 3   ? 0.8111 0.7328 1.0294 -0.0840 -0.1601 -0.0855 10  MET C O   
2936 C CB  . MET C 3   ? 0.8144 0.7850 1.0862 -0.0798 -0.1856 -0.0640 10  MET C CB  
2937 C CG  . MET C 3   ? 0.8404 0.8217 1.1201 -0.0696 -0.1605 -0.0583 10  MET C CG  
2938 S SD  . MET C 3   ? 0.9365 0.9233 1.2049 -0.0609 -0.1627 -0.0477 10  MET C SD  
2939 C CE  . MET C 3   ? 1.8141 1.8334 2.1313 -0.0652 -0.1851 -0.0392 10  MET C CE  
2940 N N   . PRO C 4   ? 0.6992 0.6680 0.9965 -0.0816 -0.1423 -0.0782 11  PRO C N   
2941 C CA  . PRO C 4   ? 0.6965 0.6505 0.9772 -0.0786 -0.1192 -0.0847 11  PRO C CA  
2942 C C   . PRO C 4   ? 0.7635 0.6965 1.0006 -0.0706 -0.1060 -0.0848 11  PRO C C   
2943 O O   . PRO C 4   ? 0.8118 0.7517 1.0457 -0.0648 -0.1072 -0.0771 11  PRO C O   
2944 C CB  . PRO C 4   ? 0.5965 0.5803 0.9249 -0.0748 -0.1023 -0.0795 11  PRO C CB  
2945 C CG  . PRO C 4   ? 0.5796 0.5900 0.9510 -0.0800 -0.1202 -0.0741 11  PRO C CG  
2946 C CD  . PRO C 4   ? 0.6363 0.6409 0.9891 -0.0812 -0.1418 -0.0706 11  PRO C CD  
2947 N N   . ARG C 5   ? 0.7790 0.6865 0.9831 -0.0705 -0.0937 -0.0935 12  ARG C N   
2948 C CA  . ARG C 5   ? 0.8081 0.6927 0.9680 -0.0635 -0.0804 -0.0950 12  ARG C CA  
2949 C C   . ARG C 5   ? 0.7867 0.6883 0.9608 -0.0532 -0.0612 -0.0866 12  ARG C C   
2950 O O   . ARG C 5   ? 0.8156 0.7086 0.9637 -0.0472 -0.0592 -0.0828 12  ARG C O   
2951 C CB  . ARG C 5   ? 0.8670 0.7266 0.9993 -0.0650 -0.0669 -0.1057 12  ARG C CB  
2952 C CG  . ARG C 5   ? 0.9768 0.8128 1.0648 -0.0578 -0.0506 -0.1080 12  ARG C CG  
2953 C CD  . ARG C 5   ? 1.0107 0.8207 1.0707 -0.0604 -0.0401 -0.1192 12  ARG C CD  
2954 N NE  . ARG C 5   ? 0.9142 0.7380 1.0064 -0.0603 -0.0237 -0.1212 12  ARG C NE  
2955 C CZ  . ARG C 5   ? 0.8849 0.6908 0.9605 -0.0616 -0.0108 -0.1301 12  ARG C CZ  
2956 N NH1 . ARG C 5   ? 0.9118 0.6854 0.9392 -0.0631 -0.0124 -0.1380 12  ARG C NH1 
2957 N NH2 . ARG C 5   ? 0.8675 0.6877 0.9746 -0.0613 0.0037  -0.1311 12  ARG C NH2 
2958 N N   . TRP C 6   ? 0.7513 0.6771 0.9669 -0.0511 -0.0472 -0.0837 13  TRP C N   
2959 C CA  . TRP C 6   ? 0.6863 0.6291 0.9180 -0.0415 -0.0270 -0.0766 13  TRP C CA  
2960 C C   . TRP C 6   ? 0.6292 0.5963 0.8862 -0.0384 -0.0367 -0.0656 13  TRP C C   
2961 O O   . TRP C 6   ? 0.6042 0.5790 0.8614 -0.0299 -0.0238 -0.0593 13  TRP C O   
2962 C CB  . TRP C 6   ? 0.6558 0.6163 0.9236 -0.0405 -0.0087 -0.0775 13  TRP C CB  
2963 C CG  . TRP C 6   ? 0.6422 0.6238 0.9528 -0.0481 -0.0215 -0.0770 13  TRP C CG  
2964 C CD1 . TRP C 6   ? 0.6382 0.6114 0.9511 -0.0562 -0.0277 -0.0849 13  TRP C CD1 
2965 C CD2 . TRP C 6   ? 0.5791 0.5935 0.9364 -0.0484 -0.0298 -0.0681 13  TRP C CD2 
2966 N NE1 . TRP C 6   ? 0.6288 0.6275 0.9869 -0.0616 -0.0393 -0.0815 13  TRP C NE1 
2967 C CE2 . TRP C 6   ? 0.5795 0.6039 0.9655 -0.0569 -0.0408 -0.0713 13  TRP C CE2 
2968 C CE3 . TRP C 6   ? 0.5724 0.6089 0.9503 -0.0423 -0.0288 -0.0580 13  TRP C CE3 
2969 C CZ2 . TRP C 6   ? 0.5385 0.5939 0.9725 -0.0595 -0.0507 -0.0646 13  TRP C CZ2 
2970 C CZ3 . TRP C 6   ? 0.5709 0.6381 0.9964 -0.0448 -0.0388 -0.0514 13  TRP C CZ3 
2971 C CH2 . TRP C 6   ? 0.5315 0.6079 0.9846 -0.0534 -0.0495 -0.0547 13  TRP C CH2 
2972 N N   . LYS C 7   ? 0.6083 0.5878 0.8873 -0.0452 -0.0593 -0.0633 14  LYS C N   
2973 C CA  . LYS C 7   ? 0.5784 0.5812 0.8825 -0.0430 -0.0704 -0.0530 14  LYS C CA  
2974 C C   . LYS C 7   ? 0.6020 0.5864 0.8663 -0.0408 -0.0820 -0.0509 14  LYS C C   
2975 O O   . LYS C 7   ? 0.5598 0.5560 0.8297 -0.0347 -0.0809 -0.0425 14  LYS C O   
2976 C CB  . LYS C 7   ? 0.5633 0.5869 0.9069 -0.0510 -0.0903 -0.0511 14  LYS C CB  
2977 C CG  . LYS C 7   ? 0.5802 0.6316 0.9562 -0.0484 -0.0997 -0.0402 14  LYS C CG  
2978 C CD  . LYS C 7   ? 0.6113 0.6823 1.0250 -0.0567 -0.1201 -0.0388 14  LYS C CD  
2979 C CE  . LYS C 7   ? 0.5766 0.6669 1.0313 -0.0591 -0.1093 -0.0405 14  LYS C CE  
2980 N NZ  . LYS C 7   ? 0.5178 0.6315 1.0143 -0.0662 -0.1279 -0.0374 14  LYS C NZ  
2981 N N   . ARG C 8   ? 0.6830 0.6385 0.9072 -0.0460 -0.0929 -0.0588 15  ARG C N   
2982 C CA  . ARG C 8   ? 0.7384 0.6730 0.9201 -0.0443 -0.1034 -0.0579 15  ARG C CA  
2983 C C   . ARG C 8   ? 0.7603 0.6835 0.9148 -0.0346 -0.0816 -0.0565 15  ARG C C   
2984 O O   . ARG C 8   ? 0.7862 0.7066 0.9235 -0.0294 -0.0842 -0.0506 15  ARG C O   
2985 C CB  . ARG C 8   ? 0.8029 0.7080 0.9470 -0.0520 -0.1178 -0.0676 15  ARG C CB  
2986 C CG  . ARG C 8   ? 0.8973 0.7810 0.9977 -0.0511 -0.1312 -0.0669 15  ARG C CG  
2987 C CD  . ARG C 8   ? 0.9644 0.8204 1.0301 -0.0592 -0.1465 -0.0767 15  ARG C CD  
2988 N NE  . ARG C 8   ? 1.0418 0.9096 1.1356 -0.0685 -0.1664 -0.0784 15  ARG C NE  
2989 C CZ  . ARG C 8   ? 1.0903 0.9688 1.1962 -0.0721 -0.1894 -0.0734 15  ARG C CZ  
2990 N NH1 . ARG C 8   ? 1.0654 0.9446 1.1579 -0.0670 -0.1954 -0.0661 15  ARG C NH1 
2991 N NH2 . ARG C 8   ? 1.1076 0.9964 1.2394 -0.0806 -0.2064 -0.0757 15  ARG C NH2 
2992 N N   . HIS C 9   ? 0.6700 0.5868 0.8210 -0.0322 -0.0599 -0.0619 16  HIS C N   
2993 C CA  . HIS C 9   ? 0.6598 0.5661 0.7866 -0.0231 -0.0374 -0.0612 16  HIS C CA  
2994 C C   . HIS C 9   ? 0.6714 0.6035 0.8261 -0.0150 -0.0282 -0.0504 16  HIS C C   
2995 O O   . HIS C 9   ? 0.6836 0.6076 0.8141 -0.0081 -0.0215 -0.0466 16  HIS C O   
2996 C CB  . HIS C 9   ? 0.5497 0.4487 0.6755 -0.0224 -0.0162 -0.0687 16  HIS C CB  
2997 C CG  . HIS C 9   ? 0.7141 0.6028 0.8167 -0.0132 0.0079  -0.0686 16  HIS C CG  
2998 N ND1 . HIS C 9   ? 0.7678 0.6263 0.8188 -0.0107 0.0105  -0.0726 16  HIS C ND1 
2999 C CD2 . HIS C 9   ? 0.6800 0.5848 0.8043 -0.0058 0.0306  -0.0649 16  HIS C CD2 
3000 C CE1 . HIS C 9   ? 0.7557 0.6121 0.7976 -0.0023 0.0337  -0.0715 16  HIS C CE1 
3001 N NE2 . HIS C 9   ? 0.7256 0.6098 0.8113 0.0009  0.0463  -0.0669 16  HIS C NE2 
3002 N N   . ILE C 10  ? 0.6303 0.5935 0.8361 -0.0159 -0.0278 -0.0455 17  ILE C N   
3003 C CA  . ILE C 10  ? 0.5666 0.5569 0.8039 -0.0086 -0.0187 -0.0354 17  ILE C CA  
3004 C C   . ILE C 10  ? 0.5859 0.5811 0.8190 -0.0073 -0.0361 -0.0275 17  ILE C C   
3005 O O   . ILE C 10  ? 0.5981 0.5969 0.8248 0.0006  -0.0269 -0.0212 17  ILE C O   
3006 C CB  . ILE C 10  ? 0.5550 0.5777 0.8487 -0.0105 -0.0152 -0.0324 17  ILE C CB  
3007 C CG1 . ILE C 10  ? 0.5774 0.5984 0.8766 -0.0085 0.0082  -0.0381 17  ILE C CG1 
3008 C CG2 . ILE C 10  ? 0.5013 0.5536 0.8296 -0.0045 -0.0126 -0.0213 17  ILE C CG2 
3009 C CD1 . ILE C 10  ? 0.5308 0.5814 0.8831 -0.0109 0.0123  -0.0361 17  ILE C CD1 
3010 N N   . SER C 11  ? 0.5748 0.5699 0.8112 -0.0150 -0.0611 -0.0278 18  SER C N   
3011 C CA  . SER C 11  ? 0.6084 0.6062 0.8386 -0.0145 -0.0799 -0.0209 18  SER C CA  
3012 C C   . SER C 11  ? 0.6386 0.6090 0.8167 -0.0097 -0.0774 -0.0215 18  SER C C   
3013 O O   . SER C 11  ? 0.6230 0.5993 0.7981 -0.0038 -0.0780 -0.0137 18  SER C O   
3014 C CB  . SER C 11  ? 0.6557 0.6535 0.8925 -0.0243 -0.1072 -0.0230 18  SER C CB  
3015 O OG  . SER C 11  ? 0.6898 0.7182 0.9794 -0.0278 -0.1126 -0.0192 18  SER C OG  
3016 N N   . GLU C 12  ? 0.6822 0.6225 0.8194 -0.0122 -0.0744 -0.0309 19  GLU C N   
3017 C CA  . GLU C 12  ? 0.7425 0.6545 0.8276 -0.0081 -0.0715 -0.0326 19  GLU C CA  
3018 C C   . GLU C 12  ? 0.7449 0.6591 0.8247 0.0023  -0.0464 -0.0286 19  GLU C C   
3019 O O   . GLU C 12  ? 0.7629 0.6699 0.8198 0.0079  -0.0460 -0.0236 19  GLU C O   
3020 C CB  . GLU C 12  ? 0.7261 0.6061 0.7707 -0.0134 -0.0731 -0.0441 19  GLU C CB  
3021 C CG  . GLU C 12  ? 0.7707 0.6420 0.8075 -0.0230 -0.1002 -0.0479 19  GLU C CG  
3022 C CD  . GLU C 12  ? 0.8846 0.7279 0.8891 -0.0290 -0.1006 -0.0599 19  GLU C CD  
3023 O OE1 . GLU C 12  ? 0.9253 0.7583 0.9185 -0.0368 -0.1220 -0.0640 19  GLU C OE1 
3024 O OE2 . GLU C 12  ? 0.8739 0.7057 0.8646 -0.0258 -0.0795 -0.0652 19  GLU C OE2 
3025 N N   . GLN C 13  ? 0.6926 0.6170 0.7939 0.0049  -0.0256 -0.0308 20  GLN C N   
3026 C CA  . GLN C 13  ? 0.6668 0.5943 0.7655 0.0146  -0.0008 -0.0275 20  GLN C CA  
3027 C C   . GLN C 13  ? 0.6393 0.5939 0.7687 0.0205  -0.0003 -0.0159 20  GLN C C   
3028 O O   . GLN C 13  ? 0.6653 0.6158 0.7777 0.0283  0.0109  -0.0116 20  GLN C O   
3029 C CB  . GLN C 13  ? 0.6223 0.5553 0.7386 0.0156  0.0207  -0.0327 20  GLN C CB  
3030 C CG  . GLN C 13  ? 0.6662 0.5682 0.7434 0.0125  0.0266  -0.0440 20  GLN C CG  
3031 C CD  . GLN C 13  ? 0.7610 0.6353 0.7870 0.0179  0.0348  -0.0458 20  GLN C CD  
3032 O OE1 . GLN C 13  ? 0.8352 0.7099 0.8562 0.0259  0.0564  -0.0440 20  GLN C OE1 
3033 N NE2 . GLN C 13  ? 0.7471 0.5973 0.7349 0.0136  0.0177  -0.0492 20  GLN C NE2 
3034 N N   . LEU C 14  ? 0.5631 0.5452 0.7374 0.0168  -0.0124 -0.0110 21  LEU C N   
3035 C CA  . LEU C 14  ? 0.4877 0.4967 0.6936 0.0218  -0.0140 -0.0001 21  LEU C CA  
3036 C C   . LEU C 14  ? 0.5453 0.5436 0.7240 0.0234  -0.0294 0.0051  21  LEU C C   
3037 O O   . LEU C 14  ? 0.5295 0.5358 0.7095 0.0309  -0.0219 0.0126  21  LEU C O   
3038 C CB  . LEU C 14  ? 0.4702 0.5097 0.7291 0.0166  -0.0252 0.0034  21  LEU C CB  
3039 C CG  . LEU C 14  ? 0.4741 0.5324 0.7693 0.0174  -0.0068 0.0016  21  LEU C CG  
3040 C CD1 . LEU C 14  ? 0.3360 0.4230 0.6817 0.0116  -0.0196 0.0047  21  LEU C CD1 
3041 C CD2 . LEU C 14  ? 0.4157 0.4860 0.7205 0.0275  0.0171  0.0069  21  LEU C CD2 
3042 N N   . ARG C 15  ? 0.5822 0.5623 0.7358 0.0165  -0.0507 0.0010  22  ARG C N   
3043 C CA  . ARG C 15  ? 0.6233 0.5908 0.7474 0.0177  -0.0659 0.0053  22  ARG C CA  
3044 C C   . ARG C 15  ? 0.6660 0.6076 0.7425 0.0244  -0.0512 0.0036  22  ARG C C   
3045 O O   . ARG C 15  ? 0.7257 0.6657 0.7884 0.0298  -0.0527 0.0103  22  ARG C O   
3046 C CB  . ARG C 15  ? 0.6618 0.6156 0.7698 0.0084  -0.0923 0.0009  22  ARG C CB  
3047 C CG  . ARG C 15  ? 0.7035 0.6835 0.8574 0.0020  -0.1103 0.0042  22  ARG C CG  
3048 C CD  . ARG C 15  ? 0.8329 0.7998 0.9687 -0.0060 -0.1380 0.0015  22  ARG C CD  
3049 N NE  . ARG C 15  ? 0.9890 0.9253 1.0850 -0.0109 -0.1393 -0.0094 22  ARG C NE  
3050 C CZ  . ARG C 15  ? 1.0048 0.9391 1.1108 -0.0186 -0.1439 -0.0172 22  ARG C CZ  
3051 N NH1 . ARG C 15  ? 0.9899 0.9511 1.1445 -0.0224 -0.1478 -0.0151 22  ARG C NH1 
3052 N NH2 . ARG C 15  ? 1.0263 0.9315 1.0935 -0.0226 -0.1446 -0.0270 22  ARG C NH2 
3053 N N   . ARG C 16  ? 0.7147 0.6362 0.7667 0.0240  -0.0366 -0.0054 23  ARG C N   
3054 C CA  . ARG C 16  ? 0.7498 0.6465 0.7572 0.0304  -0.0210 -0.0077 23  ARG C CA  
3055 C C   . ARG C 16  ? 0.7195 0.6331 0.7446 0.0401  0.0002  -0.0005 23  ARG C C   
3056 O O   . ARG C 16  ? 0.7740 0.6773 0.7728 0.0465  0.0057  0.0034  23  ARG C O   
3057 C CB  . ARG C 16  ? 0.7822 0.6557 0.7635 0.0278  -0.0092 -0.0190 23  ARG C CB  
3058 C CG  . ARG C 16  ? 0.8598 0.7043 0.7903 0.0332  0.0044  -0.0225 23  ARG C CG  
3059 C CD  . ARG C 16  ? 0.9364 0.7580 0.8419 0.0303  0.0152  -0.0340 23  ARG C CD  
3060 N NE  . ARG C 16  ? 1.0796 0.8719 0.9343 0.0349  0.0263  -0.0376 23  ARG C NE  
3061 C CZ  . ARG C 16  ? 1.1338 0.9241 0.9810 0.0430  0.0506  -0.0369 23  ARG C CZ  
3062 N NH1 . ARG C 16  ? 1.0329 0.8491 0.9205 0.0475  0.0665  -0.0328 23  ARG C NH1 
3063 N NH2 . ARG C 16  ? 1.1890 0.9515 0.9885 0.0466  0.0591  -0.0405 23  ARG C NH2 
3064 N N   . ARG C 17  ? 0.6226 0.5624 0.6926 0.0412  0.0118  0.0012  24  ARG C N   
3065 C CA  . ARG C 17  ? 0.5215 0.4805 0.6141 0.0501  0.0325  0.0077  24  ARG C CA  
3066 C C   . ARG C 17  ? 0.5246 0.4987 0.6287 0.0544  0.0237  0.0187  24  ARG C C   
3067 O O   . ARG C 17  ? 0.5342 0.5060 0.6253 0.0625  0.0370  0.0231  24  ARG C O   
3068 C CB  . ARG C 17  ? 0.5055 0.4917 0.6478 0.0490  0.0423  0.0077  24  ARG C CB  
3069 C CG  . ARG C 17  ? 0.4515 0.4600 0.6216 0.0577  0.0638  0.0140  24  ARG C CG  
3070 C CD  . ARG C 17  ? 0.4196 0.4615 0.6465 0.0554  0.0643  0.0170  24  ARG C CD  
3071 N NE  . ARG C 17  ? 0.4475 0.5080 0.7009 0.0516  0.0417  0.0238  24  ARG C NE  
3072 C CZ  . ARG C 17  ? 0.4567 0.5475 0.7602 0.0492  0.0374  0.0278  24  ARG C CZ  
3073 N NH1 . ARG C 17  ? 0.4486 0.5548 0.7815 0.0501  0.0541  0.0257  24  ARG C NH1 
3074 N NH2 . ARG C 17  ? 0.4442 0.5500 0.7686 0.0458  0.0164  0.0339  24  ARG C NH2 
3075 N N   . ASP C 18  ? 0.5064 0.4957 0.6349 0.0491  0.0013  0.0229  25  ASP C N   
3076 C CA  . ASP C 18  ? 0.5430 0.5478 0.6852 0.0523  -0.0096 0.0333  25  ASP C CA  
3077 C C   . ASP C 18  ? 0.6630 0.6425 0.7569 0.0552  -0.0163 0.0348  25  ASP C C   
3078 O O   . ASP C 18  ? 0.6927 0.6784 0.7858 0.0620  -0.0118 0.0427  25  ASP C O   
3079 C CB  . ASP C 18  ? 0.5824 0.6062 0.7578 0.0451  -0.0339 0.0364  25  ASP C CB  
3080 C CG  . ASP C 18  ? 0.6276 0.6797 0.8548 0.0426  -0.0281 0.0364  25  ASP C CG  
3081 O OD1 . ASP C 18  ? 0.6670 0.7284 0.9089 0.0477  -0.0051 0.0360  25  ASP C OD1 
3082 O OD2 . ASP C 18  ? 0.6201 0.6856 0.8735 0.0356  -0.0466 0.0370  25  ASP C OD2 
3083 N N   . ARG C 19  ? 0.7297 0.6809 0.7838 0.0498  -0.0271 0.0273  26  ARG C N   
3084 C CA  . ARG C 19  ? 0.8101 0.7351 0.8155 0.0516  -0.0346 0.0278  26  ARG C CA  
3085 C C   . ARG C 19  ? 0.7755 0.6875 0.7540 0.0605  -0.0108 0.0281  26  ARG C C   
3086 O O   . ARG C 19  ? 0.7802 0.6874 0.7407 0.0661  -0.0111 0.0344  26  ARG C O   
3087 C CB  . ARG C 19  ? 0.8929 0.7898 0.8615 0.0438  -0.0490 0.0184  26  ARG C CB  
3088 C CG  . ARG C 19  ? 0.9625 0.8309 0.8788 0.0450  -0.0577 0.0183  26  ARG C CG  
3089 C CD  . ARG C 19  ? 1.0324 0.8784 0.9201 0.0361  -0.0774 0.0102  26  ARG C CD  
3090 N NE  . ARG C 19  ? 1.0872 0.9166 0.9599 0.0328  -0.0661 -0.0008 26  ARG C NE  
3091 C CZ  . ARG C 19  ? 1.0783 0.9155 0.9751 0.0257  -0.0710 -0.0064 26  ARG C CZ  
3092 N NH1 . ARG C 19  ? 1.0108 0.8723 0.9481 0.0211  -0.0872 -0.0022 26  ARG C NH1 
3093 N NH2 . ARG C 19  ? 1.0991 0.9199 0.9796 0.0232  -0.0597 -0.0163 26  ARG C NH2 
3094 N N   . LEU C 20  ? 0.7326 0.6394 0.7093 0.0619  0.0100  0.0214  27  LEU C N   
3095 C CA  . LEU C 20  ? 0.7072 0.6016 0.6594 0.0701  0.0341  0.0207  27  LEU C CA  
3096 C C   . LEU C 20  ? 0.6938 0.6142 0.6786 0.0784  0.0490  0.0298  27  LEU C C   
3097 O O   . LEU C 20  ? 0.7297 0.6423 0.6934 0.0857  0.0600  0.0335  27  LEU C O   
3098 C CB  . LEU C 20  ? 0.5840 0.4663 0.5270 0.0689  0.0515  0.0106  27  LEU C CB  
3099 C CG  . LEU C 20  ? 0.6718 0.5249 0.5772 0.0616  0.0410  0.0005  27  LEU C CG  
3100 C CD1 . LEU C 20  ? 0.6500 0.4942 0.5517 0.0609  0.0596  -0.0089 27  LEU C CD1 
3101 C CD2 . LEU C 20  ? 0.6908 0.5143 0.5425 0.0636  0.0360  -0.0001 27  LEU C CD2 
3102 N N   . GLN C 21  ? 0.6427 0.5939 0.6790 0.0772  0.0495  0.0332  28  GLN C N   
3103 C CA  . GLN C 21  ? 0.5981 0.5748 0.6680 0.0849  0.0665  0.0405  28  GLN C CA  
3104 C C   . GLN C 21  ? 0.6292 0.6282 0.7255 0.0868  0.0533  0.0515  28  GLN C C   
3105 O O   . GLN C 21  ? 0.6689 0.6760 0.7689 0.0946  0.0645  0.0583  28  GLN C O   
3106 C CB  . GLN C 21  ? 0.5102 0.5076 0.6203 0.0839  0.0804  0.0375  28  GLN C CB  
3107 C CG  . GLN C 21  ? 0.4706 0.4480 0.5565 0.0842  0.0987  0.0276  28  GLN C CG  
3108 C CD  . GLN C 21  ? 0.5111 0.5083 0.6363 0.0827  0.1109  0.0244  28  GLN C CD  
3109 O OE1 . GLN C 21  ? 0.5610 0.5865 0.7317 0.0805  0.1042  0.0290  28  GLN C OE1 
3110 N NE2 . GLN C 21  ? 0.4820 0.4644 0.5897 0.0838  0.1290  0.0164  28  GLN C NE2 
3111 N N   . ARG C 22  ? 0.5731 0.5245 0.6537 0.0597  -0.1031 -0.0721 29  ARG C N   
3112 C CA  . ARG C 22  ? 0.5759 0.5334 0.6633 0.0641  -0.0975 -0.0474 29  ARG C CA  
3113 C C   . ARG C 22  ? 0.6166 0.5867 0.6816 0.0679  -0.0958 -0.0331 29  ARG C C   
3114 O O   . ARG C 22  ? 0.6876 0.6577 0.7498 0.0729  -0.0794 -0.0194 29  ARG C O   
3115 C CB  . ARG C 22  ? 0.5417 0.5033 0.6465 0.0618  -0.1129 -0.0393 29  ARG C CB  
3116 C CG  . ARG C 22  ? 0.5820 0.5496 0.6949 0.0665  -0.1070 -0.0134 29  ARG C CG  
3117 C CD  . ARG C 22  ? 0.6136 0.5847 0.7449 0.0643  -0.1215 -0.0053 29  ARG C CD  
3118 N NE  . ARG C 22  ? 0.6814 0.6582 0.8201 0.0692  -0.1150 0.0198  29  ARG C NE  
3119 C CZ  . ARG C 22  ? 0.6949 0.6730 0.8529 0.0688  -0.1216 0.0309  29  ARG C CZ  
3120 N NH1 . ARG C 22  ? 0.7081 0.6822 0.8804 0.0637  -0.1352 0.0192  29  ARG C NH1 
3121 N NH2 . ARG C 22  ? 0.6355 0.6188 0.7986 0.0736  -0.1145 0.0539  29  ARG C NH2 
3122 N N   . GLN C 23  ? 0.6145 0.5951 0.6633 0.0653  -0.1128 -0.0362 30  GLN C N   
3123 C CA  . GLN C 23  ? 0.6861 0.6800 0.7139 0.0682  -0.1140 -0.0221 30  GLN C CA  
3124 C C   . GLN C 23  ? 0.6956 0.6871 0.7056 0.0718  -0.0968 -0.0241 30  GLN C C   
3125 O O   . GLN C 23  ? 0.7220 0.7211 0.7215 0.0763  -0.0890 -0.0072 30  GLN C O   
3126 C CB  . GLN C 23  ? 0.6706 0.6747 0.6836 0.0638  -0.1358 -0.0287 30  GLN C CB  
3127 C CG  . GLN C 23  ? 0.7347 0.7536 0.7269 0.0662  -0.1395 -0.0133 30  GLN C CG  
3128 C CD  . GLN C 23  ? 0.7962 0.8246 0.7739 0.0612  -0.1613 -0.0204 30  GLN C CD  
3129 O OE1 . GLN C 23  ? 0.8160 0.8416 0.8031 0.0563  -0.1755 -0.0320 30  GLN C OE1 
3130 N NE2 . GLN C 23  ? 0.8230 0.8624 0.7775 0.0623  -0.1640 -0.0137 30  GLN C NE2 
3131 N N   . ALA C 24  ? 0.6546 0.6357 0.6616 0.0698  -0.0909 -0.0446 31  ALA C N   
3132 C CA  . ALA C 24  ? 0.6126 0.5905 0.6031 0.0727  -0.0748 -0.0489 31  ALA C CA  
3133 C C   . ALA C 24  ? 0.6541 0.6261 0.6540 0.0780  -0.0531 -0.0356 31  ALA C C   
3134 O O   . ALA C 24  ? 0.7477 0.7216 0.7327 0.0818  -0.0400 -0.0298 31  ALA C O   
3135 C CB  . ALA C 24  ? 0.5330 0.5011 0.5200 0.0691  -0.0743 -0.0745 31  ALA C CB  
3136 N N   . PHE C 25  ? 0.5965 0.5612 0.6209 0.0781  -0.0490 -0.0310 32  PHE C N   
3137 C CA  . PHE C 25  ? 0.5287 0.4855 0.5633 0.0825  -0.0278 -0.0207 32  PHE C CA  
3138 C C   . PHE C 25  ? 0.5361 0.4986 0.5814 0.0862  -0.0256 0.0041  32  PHE C C   
3139 O O   . PHE C 25  ? 0.5754 0.5333 0.6257 0.0906  -0.0078 0.0160  32  PHE C O   
3140 C CB  . PHE C 25  ? 0.5316 0.4734 0.5859 0.0800  -0.0204 -0.0350 32  PHE C CB  
3141 C CG  . PHE C 25  ? 0.5644 0.4987 0.6085 0.0780  -0.0152 -0.0569 32  PHE C CG  
3142 C CD1 . PHE C 25  ? 0.5125 0.4392 0.5525 0.0809  0.0054  -0.0583 32  PHE C CD1 
3143 C CD2 . PHE C 25  ? 0.4800 0.4150 0.5183 0.0731  -0.0308 -0.0759 32  PHE C CD2 
3144 C CE1 . PHE C 25  ? 0.4421 0.3624 0.4728 0.0792  0.0104  -0.0782 32  PHE C CE1 
3145 C CE2 . PHE C 25  ? 0.4877 0.4160 0.5165 0.0714  -0.0258 -0.0959 32  PHE C CE2 
3146 C CZ  . PHE C 25  ? 0.5394 0.4605 0.5646 0.0745  -0.0052 -0.0969 32  PHE C CZ  
3147 N N   . GLU C 26  ? 0.5020 0.4742 0.5506 0.0846  -0.0433 0.0118  33  GLU C N   
3148 C CA  . GLU C 26  ? 0.6225 0.5994 0.6846 0.0877  -0.0427 0.0344  33  GLU C CA  
3149 C C   . GLU C 26  ? 0.6613 0.6441 0.7123 0.0941  -0.0285 0.0548  33  GLU C C   
3150 O O   . GLU C 26  ? 0.6526 0.6303 0.7164 0.0978  -0.0146 0.0685  33  GLU C O   
3151 C CB  . GLU C 26  ? 0.6645 0.6526 0.7293 0.0848  -0.0651 0.0392  33  GLU C CB  
3152 C CG  . GLU C 26  ? 0.6878 0.6790 0.7706 0.0874  -0.0654 0.0603  33  GLU C CG  
3153 C CD  . GLU C 26  ? 0.7463 0.7378 0.8462 0.0827  -0.0832 0.0556  33  GLU C CD  
3154 O OE1 . GLU C 26  ? 0.7857 0.7711 0.9077 0.0834  -0.0793 0.0632  33  GLU C OE1 
3155 O OE2 . GLU C 26  ? 0.7466 0.7441 0.8376 0.0783  -0.1010 0.0442  33  GLU C OE2 
3156 N N   . GLU C 27  ? 0.6312 0.6244 0.6585 0.0952  -0.0319 0.0568  34  GLU C N   
3157 C CA  . GLU C 27  ? 0.6360 0.6360 0.6512 0.1011  -0.0201 0.0763  34  GLU C CA  
3158 C C   . GLU C 27  ? 0.5956 0.5850 0.6084 0.1045  0.0034  0.0747  34  GLU C C   
3159 O O   . GLU C 27  ? 0.5794 0.5681 0.5961 0.1096  0.0175  0.0923  34  GLU C O   
3160 C CB  . GLU C 27  ? 0.7200 0.7341 0.7098 0.1009  -0.0305 0.0781  34  GLU C CB  
3161 C CG  . GLU C 27  ? 0.8405 0.8694 0.8282 0.1035  -0.0392 0.1010  34  GLU C CG  
3162 C CD  . GLU C 27  ? 0.9548 0.9843 0.9456 0.1102  -0.0218 0.1233  34  GLU C CD  
3163 O OE1 . GLU C 27  ? 1.0144 1.0432 0.9899 0.1137  -0.0076 0.1257  34  GLU C OE1 
3164 O OE2 . GLU C 27  ? 0.9392 0.9697 0.9475 0.1121  -0.0222 0.1385  34  GLU C OE2 
3165 N N   . ILE C 28  ? 0.5256 0.5066 0.5317 0.1019  0.0076  0.0537  35  ILE C N   
3166 C CA  . ILE C 28  ? 0.5837 0.5550 0.5857 0.1049  0.0294  0.0512  35  ILE C CA  
3167 C C   . ILE C 28  ? 0.6710 0.6300 0.6964 0.1063  0.0432  0.0563  35  ILE C C   
3168 O O   . ILE C 28  ? 0.6473 0.6017 0.6720 0.1106  0.0619  0.0666  35  ILE C O   
3169 C CB  . ILE C 28  ? 0.5667 0.5322 0.5560 0.1018  0.0308  0.0272  35  ILE C CB  
3170 C CG1 . ILE C 28  ? 0.6062 0.5646 0.5866 0.1055  0.0532  0.0274  35  ILE C CG1 
3171 C CG2 . ILE C 28  ? 0.4917 0.4471 0.4976 0.0965  0.0240  0.0079  35  ILE C CG2 
3172 C CD1 . ILE C 28  ? 0.6408 0.5955 0.6054 0.1031  0.0552  0.0062  35  ILE C CD1 
3173 N N   . ILE C 29  ? 0.7094 0.6632 0.7552 0.1025  0.0338  0.0495  36  ILE C N   
3174 C CA  . ILE C 29  ? 0.6840 0.6260 0.7530 0.1031  0.0451  0.0541  36  ILE C CA  
3175 C C   . ILE C 29  ? 0.7303 0.6776 0.8066 0.1078  0.0495  0.0800  36  ILE C C   
3176 O O   . ILE C 29  ? 0.7079 0.6471 0.7935 0.1111  0.0669  0.0901  36  ILE C O   
3177 C CB  . ILE C 29  ? 0.6316 0.5674 0.7203 0.0976  0.0325  0.0402  36  ILE C CB  
3178 C CG1 . ILE C 29  ? 0.6195 0.5473 0.7036 0.0934  0.0323  0.0146  36  ILE C CG1 
3179 C CG2 . ILE C 29  ? 0.6027 0.5283 0.7161 0.0983  0.0421  0.0486  36  ILE C CG2 
3180 C CD1 . ILE C 29  ? 0.5936 0.5144 0.6967 0.0879  0.0209  -0.0003 36  ILE C CD1 
3181 N N   . LEU C 30  ? 0.7602 0.7211 0.8318 0.1081  0.0339  0.0909  37  LEU C N   
3182 C CA  . LEU C 30  ? 0.7504 0.7182 0.8275 0.1127  0.0361  0.1160  37  LEU C CA  
3183 C C   . LEU C 30  ? 0.7802 0.7500 0.8424 0.1187  0.0539  0.1300  37  LEU C C   
3184 O O   . LEU C 30  ? 0.8178 0.7854 0.8885 0.1231  0.0658  0.1481  37  LEU C O   
3185 C CB  . LEU C 30  ? 0.7828 0.7659 0.8554 0.1114  0.0146  0.1232  37  LEU C CB  
3186 C CG  . LEU C 30  ? 0.8628 0.8531 0.9474 0.1146  0.0111  0.1466  37  LEU C CG  
3187 C CD1 . LEU C 30  ? 0.8894 0.8894 0.9788 0.1105  -0.0128 0.1447  37  LEU C CD1 
3188 C CD2 . LEU C 30  ? 0.8990 0.8994 0.9682 0.1207  0.0193  0.1673  37  LEU C CD2 
3189 N N   . GLN C 31  ? 0.8019 0.7755 0.8417 0.1189  0.0557  0.1215  38  GLN C N   
3190 C CA  . GLN C 31  ? 0.8501 0.8258 0.8738 0.1242  0.0721  0.1329  38  GLN C CA  
3191 C C   . GLN C 31  ? 0.8621 0.8226 0.8925 0.1260  0.0944  0.1297  38  GLN C C   
3192 O O   . GLN C 31  ? 0.8724 0.8312 0.9019 0.1311  0.1103  0.1461  38  GLN C O   
3193 C CB  . GLN C 31  ? 0.9222 0.9057 0.9199 0.1234  0.0671  0.1231  38  GLN C CB  
3194 C CG  . GLN C 31  ? 1.0342 1.0340 1.0207 0.1224  0.0475  0.1296  38  GLN C CG  
3195 C CD  . GLN C 31  ? 1.1683 1.1782 1.1551 0.1276  0.0492  0.1562  38  GLN C CD  
3196 O OE1 . GLN C 31  ? 1.1983 1.2066 1.1802 0.1328  0.0663  0.1693  38  GLN C OE1 
3197 N NE2 . GLN C 31  ? 1.2187 1.2390 1.2111 0.1262  0.0316  0.1644  38  GLN C NE2 
3198 N N   . TYR C 32  ? 0.8368 0.7864 0.8733 0.1217  0.0956  0.1086  39  TYR C N   
3199 C CA  . TYR C 32  ? 0.7847 0.7195 0.8281 0.1224  0.1157  0.1031  39  TYR C CA  
3200 C C   . TYR C 32  ? 0.8732 0.8007 0.9386 0.1244  0.1247  0.1178  39  TYR C C   
3201 O O   . TYR C 32  ? 0.9012 0.8208 0.9680 0.1278  0.1442  0.1261  39  TYR C O   
3202 C CB  . TYR C 32  ? 0.6907 0.6164 0.7390 0.1168  0.1120  0.0774  39  TYR C CB  
3203 C CG  . TYR C 32  ? 0.6721 0.5825 0.7290 0.1167  0.1315  0.0701  39  TYR C CG  
3204 C CD1 . TYR C 32  ? 0.6229 0.5293 0.6641 0.1176  0.1447  0.0609  39  TYR C CD1 
3205 C CD2 . TYR C 32  ? 0.7291 0.6287 0.8098 0.1154  0.1366  0.0721  39  TYR C CD2 
3206 C CE1 . TYR C 32  ? 0.6870 0.5797 0.7358 0.1173  0.1623  0.0542  39  TYR C CE1 
3207 C CE2 . TYR C 32  ? 0.7571 0.6427 0.8454 0.1150  0.1543  0.0655  39  TYR C CE2 
3208 C CZ  . TYR C 32  ? 0.7263 0.6086 0.7986 0.1159  0.1671  0.0566  39  TYR C CZ  
3209 O OH  . TYR C 32  ? 0.7625 0.6313 0.8423 0.1152  0.1846  0.0501  39  TYR C OH  
3210 N N   . ASN C 33  ? 0.9255 0.8551 1.0076 0.1220  0.1104  0.1207  40  ASN C N   
3211 C CA  . ASN C 33  ? 0.9951 0.9176 1.0992 0.1234  0.1171  0.1339  40  ASN C CA  
3212 C C   . ASN C 33  ? 1.0695 0.9969 1.1693 0.1300  0.1284  0.1593  40  ASN C C   
3213 O O   . ASN C 33  ? 1.1273 1.0455 1.2397 0.1325  0.1429  0.1701  40  ASN C O   
3214 C CB  . ASN C 33  ? 1.0364 0.9625 1.1573 0.1198  0.0976  0.1328  40  ASN C CB  
3215 C CG  . ASN C 33  ? 1.0975 1.0111 1.2440 0.1186  0.1040  0.1353  40  ASN C CG  
3216 O OD1 . ASN C 33  ? 1.1025 1.0026 1.2558 0.1174  0.1180  0.1261  40  ASN C OD1 
3217 N ND2 . ASN C 33  ? 1.1218 1.0400 1.2826 0.1189  0.0939  0.1480  40  ASN C ND2 
3218 N N   . LYS C 34  ? 1.0667 1.0083 1.1484 0.1328  0.1216  0.1687  41  LYS C N   
3219 C CA  . LYS C 34  ? 1.1043 1.0518 1.1795 0.1392  0.1317  0.1927  41  LYS C CA  
3220 C C   . LYS C 34  ? 1.1464 1.0848 1.2128 0.1427  0.1552  0.1946  41  LYS C C   
3221 O O   . LYS C 34  ? 1.2197 1.1502 1.2962 0.1461  0.1705  0.2077  41  LYS C O   
3222 C CB  . LYS C 34  ? 1.1432 1.1083 1.1992 0.1409  0.1188  0.2002  41  LYS C CB  
3223 C CG  . LYS C 34  ? 1.1748 1.1508 1.2385 0.1383  0.0961  0.2033  41  LYS C CG  
3224 C CD  . LYS C 34  ? 1.2286 1.2213 1.2710 0.1388  0.0831  0.2068  41  LYS C CD  
3225 C CE  . LYS C 34  ? 1.2506 1.2503 1.2792 0.1455  0.0951  0.2275  41  LYS C CE  
3226 N NZ  . LYS C 34  ? 1.2765 1.2919 1.2829 0.1457  0.0834  0.2298  41  LYS C NZ  
3227 N N   . LEU C 35  ? 1.1086 1.0479 1.1561 0.1418  0.1579  0.1812  42  LEU C N   
3228 C CA  . LEU C 35  ? 1.0760 1.0079 1.1123 0.1449  0.1792  0.1818  42  LEU C CA  
3229 C C   . LEU C 35  ? 1.0900 1.0048 1.1399 0.1421  0.1918  0.1683  42  LEU C C   
3230 O O   . LEU C 35  ? 1.1676 1.0772 1.2089 0.1396  0.1964  0.1505  42  LEU C O   
3231 C CB  . LEU C 35  ? 1.0768 1.0160 1.0879 0.1446  0.1769  0.1714  42  LEU C CB  
3232 C CG  . LEU C 35  ? 1.1007 1.0566 1.0934 0.1476  0.1675  0.1839  42  LEU C CG  
3233 C CD1 . LEU C 35  ? 1.1212 1.0885 1.1165 0.1441  0.1429  0.1808  42  LEU C CD1 
3234 C CD2 . LEU C 35  ? 1.1137 1.0722 1.0818 0.1484  0.1736  0.1753  42  LEU C CD2 
3235 N N   . LEU C 36  ? 1.0369 0.9432 1.1079 0.1424  0.1975  0.1769  43  LEU C N   
3236 C CA  . LEU C 36  ? 0.9836 0.8736 1.0694 0.1391  0.2082  0.1646  43  LEU C CA  
3237 C C   . LEU C 36  ? 0.9667 0.8525 1.0621 0.1398  0.2260  0.1763  43  LEU C C   
3238 O O   . LEU C 36  ? 0.9129 0.8146 1.0195 0.1368  0.2194  0.1826  43  LEU C O   
3239 C CB  . LEU C 36  ? 0.8750 0.7626 0.9800 0.1335  0.1919  0.1524  43  LEU C CB  
3240 C CG  . LEU C 36  ? 0.8020 0.6758 0.9198 0.1276  0.1973  0.1331  43  LEU C CG  
3241 C CD1 . LEU C 36  ? 0.7780 0.6481 0.8802 0.1270  0.2039  0.1154  43  LEU C CD1 
3242 C CD2 . LEU C 36  ? 0.7383 0.6150 0.8710 0.1199  0.1770  0.1208  43  LEU C CD2 
3243 N N   . LYS D 5   ? 1.2015 1.0174 0.9658 -0.1331 -0.1366 -0.2395 54  LYS D N   
3244 C CA  . LYS D 5   ? 1.2159 1.0398 0.9804 -0.1351 -0.1400 -0.2270 54  LYS D CA  
3245 C C   . LYS D 5   ? 1.2169 1.0595 0.9380 -0.1219 -0.1240 -0.2103 54  LYS D C   
3246 O O   . LYS D 5   ? 1.2367 1.0702 0.9075 -0.1074 -0.1195 -0.2078 54  LYS D O   
3247 C CB  . LYS D 5   ? 1.2652 1.0598 1.0202 -0.1280 -0.1655 -0.2233 54  LYS D CB  
3248 C CG  . LYS D 5   ? 1.2820 1.0727 1.0961 -0.1411 -0.1764 -0.2325 54  LYS D CG  
3249 C CD  . LYS D 5   ? 1.3698 1.1327 1.1698 -0.1319 -0.1993 -0.2266 54  LYS D CD  
3250 C CE  . LYS D 5   ? 1.3834 1.1523 1.2435 -0.1425 -0.2009 -0.2286 54  LYS D CE  
3251 N NZ  . LYS D 5   ? 1.3610 1.1538 1.2669 -0.1571 -0.1949 -0.2263 54  LYS D NZ  
3252 N N   . ILE D 6   ? 1.1695 1.0383 0.9106 -0.1270 -0.1158 -0.1989 55  ILE D N   
3253 C CA  . ILE D 6   ? 1.1389 1.0285 0.8440 -0.1159 -0.1007 -0.1817 55  ILE D CA  
3254 C C   . ILE D 6   ? 1.1472 1.0280 0.8282 -0.1043 -0.1137 -0.1654 55  ILE D C   
3255 O O   . ILE D 6   ? 1.1342 1.0131 0.8490 -0.1125 -0.1260 -0.1638 55  ILE D O   
3256 C CB  . ILE D 6   ? 1.0805 1.0091 0.8229 -0.1296 -0.0800 -0.1786 55  ILE D CB  
3257 C CG1 . ILE D 6   ? 1.1174 1.0569 0.8806 -0.1403 -0.0652 -0.1938 55  ILE D CG1 
3258 C CG2 . ILE D 6   ? 1.0208 0.9711 0.7271 -0.1183 -0.0655 -0.1596 55  ILE D CG2 
3259 C CD1 . ILE D 6   ? 1.1676 1.1020 0.8799 -0.1269 -0.0548 -0.1942 55  ILE D CD1 
3260 N N   . ASP D 7   ? 1.1635 1.0391 0.7858 -0.0851 -0.1110 -0.1534 56  ASP D N   
3261 C CA  . ASP D 7   ? 1.1612 1.0318 0.7561 -0.0728 -0.1208 -0.1362 56  ASP D CA  
3262 C C   . ASP D 7   ? 1.1116 1.0180 0.7160 -0.0760 -0.1046 -0.1204 56  ASP D C   
3263 O O   . ASP D 7   ? 1.1446 1.0725 0.7279 -0.0714 -0.0849 -0.1145 56  ASP D O   
3264 C CB  . ASP D 7   ? 1.2142 1.0633 0.7410 -0.0501 -0.1256 -0.1301 56  ASP D CB  
3265 C CG  . ASP D 7   ? 1.2480 1.0576 0.7630 -0.0455 -0.1467 -0.1428 56  ASP D CG  
3266 O OD1 . ASP D 7   ? 1.2091 1.0049 0.7615 -0.0559 -0.1633 -0.1501 56  ASP D OD1 
3267 O OD2 . ASP D 7   ? 1.3063 1.0986 0.7747 -0.0314 -0.1470 -0.1454 56  ASP D OD2 
3268 N N   . ILE D 8   ? 1.0437 0.9564 0.6804 -0.0840 -0.1132 -0.1136 57  ILE D N   
3269 C CA  . ILE D 8   ? 0.9745 0.9204 0.6251 -0.0885 -0.0996 -0.0986 57  ILE D CA  
3270 C C   . ILE D 8   ? 0.9861 0.9290 0.6075 -0.0759 -0.1088 -0.0791 57  ILE D C   
3271 O O   . ILE D 8   ? 1.0106 0.9313 0.6365 -0.0744 -0.1294 -0.0788 57  ILE D O   
3272 C CB  . ILE D 8   ? 0.9548 0.9176 0.6738 -0.1108 -0.0983 -0.1058 57  ILE D CB  
3273 C CG1 . ILE D 8   ? 0.9434 0.9165 0.6904 -0.1233 -0.0846 -0.1228 57  ILE D CG1 
3274 C CG2 . ILE D 8   ? 0.9363 0.9302 0.6692 -0.1151 -0.0878 -0.0890 57  ILE D CG2 
3275 C CD1 . ILE D 8   ? 0.9468 0.9465 0.7544 -0.1436 -0.0757 -0.1266 57  ILE D CD1 
3276 N N   . LEU D 9   ? 0.9545 0.9204 0.5458 -0.0669 -0.0934 -0.0626 58  LEU D N   
3277 C CA  . LEU D 9   ? 0.9815 0.9500 0.5464 -0.0556 -0.0993 -0.0424 58  LEU D CA  
3278 C C   . LEU D 9   ? 0.9762 0.9776 0.5787 -0.0683 -0.0895 -0.0309 58  LEU D C   
3279 O O   . LEU D 9   ? 0.9566 0.9866 0.5699 -0.0746 -0.0693 -0.0292 58  LEU D O   
3280 C CB  . LEU D 9   ? 1.0077 0.9775 0.5071 -0.0343 -0.0900 -0.0305 58  LEU D CB  
3281 C CG  . LEU D 9   ? 1.0789 1.0513 0.5433 -0.0200 -0.0951 -0.0088 58  LEU D CG  
3282 C CD1 . LEU D 9   ? 1.0819 1.0228 0.5441 -0.0159 -0.1208 -0.0096 58  LEU D CD1 
3283 C CD2 . LEU D 9   ? 1.1058 1.0802 0.5061 0.0010  -0.0843 0.0010  58  LEU D CD2 
3284 N N   . LEU D 10  ? 0.9766 0.9735 0.5991 -0.0721 -0.1043 -0.0232 59  LEU D N   
3285 C CA  . LEU D 10  ? 0.9111 0.9366 0.5713 -0.0846 -0.0977 -0.0122 59  LEU D CA  
3286 C C   . LEU D 10  ? 0.9815 1.0195 0.6061 -0.0717 -0.0954 0.0119  59  LEU D C   
3287 O O   . LEU D 10  ? 1.0691 1.0867 0.6635 -0.0591 -0.1109 0.0199  59  LEU D O   
3288 C CB  . LEU D 10  ? 0.8832 0.8978 0.5963 -0.0997 -0.1150 -0.0200 59  LEU D CB  
3289 C CG  . LEU D 10  ? 0.8633 0.8669 0.6177 -0.1139 -0.1181 -0.0436 59  LEU D CG  
3290 C CD1 . LEU D 10  ? 0.8490 0.8419 0.6536 -0.1275 -0.1361 -0.0497 59  LEU D CD1 
3291 C CD2 . LEU D 10  ? 0.8211 0.8535 0.6006 -0.1257 -0.0957 -0.0500 59  LEU D CD2 
3292 N N   . LYS D 11  ? 0.9557 1.0276 0.5840 -0.0751 -0.0763 0.0237  60  LYS D N   
3293 C CA  . LYS D 11  ? 0.9690 1.0569 0.5659 -0.0639 -0.0722 0.0476  60  LYS D CA  
3294 C C   . LYS D 11  ? 0.8996 1.0153 0.5408 -0.0792 -0.0674 0.0580  60  LYS D C   
3295 O O   . LYS D 11  ? 0.9063 1.0417 0.5875 -0.0948 -0.0553 0.0504  60  LYS D O   
3296 C CB  . LYS D 11  ? 1.0549 1.1583 0.6039 -0.0500 -0.0528 0.0553  60  LYS D CB  
3297 C CG  . LYS D 11  ? 1.1582 1.2344 0.6600 -0.0338 -0.0568 0.0457  60  LYS D CG  
3298 C CD  . LYS D 11  ? 1.2700 1.3620 0.7216 -0.0185 -0.0384 0.0556  60  LYS D CD  
3299 C CE  . LYS D 11  ? 1.3958 1.4587 0.7971 -0.0008 -0.0443 0.0474  60  LYS D CE  
3300 N NZ  . LYS D 11  ? 1.4558 1.5050 0.8383 0.0100  -0.0253 0.0515  60  LYS D NZ  
3301 N N   . ALA D 12  ? 0.9078 1.0247 0.5416 -0.0747 -0.0771 0.0756  61  ALA D N   
3302 C CA  . ALA D 12  ? 0.8793 1.0195 0.5556 -0.0891 -0.0754 0.0860  61  ALA D CA  
3303 C C   . ALA D 12  ? 0.9468 1.1212 0.6047 -0.0851 -0.0568 0.1063  61  ALA D C   
3304 O O   . ALA D 12  ? 0.9696 1.1461 0.5747 -0.0673 -0.0512 0.1191  61  ALA D O   
3305 C CB  . ALA D 12  ? 0.8554 0.9784 0.5416 -0.0891 -0.0974 0.0932  61  ALA D CB  
3306 N N   . VAL D 13  ? 0.9489 1.1501 0.6509 -0.1017 -0.0472 0.1091  62  VAL D N   
3307 C CA  . VAL D 13  ? 0.9823 1.2174 0.6752 -0.1008 -0.0311 0.1294  62  VAL D CA  
3308 C C   . VAL D 13  ? 1.0712 1.3175 0.8052 -0.1139 -0.0395 0.1404  62  VAL D C   
3309 O O   . VAL D 13  ? 1.0638 1.3150 0.8512 -0.1322 -0.0408 0.1294  62  VAL D O   
3310 C CB  . VAL D 13  ? 0.9561 1.2166 0.6621 -0.1089 -0.0084 0.1225  62  VAL D CB  
3311 C CG1 . VAL D 13  ? 0.9302 1.2252 0.6205 -0.1058 0.0085  0.1443  62  VAL D CG1 
3312 C CG2 . VAL D 13  ? 0.9515 1.1976 0.6241 -0.0984 -0.0020 0.1081  62  VAL D CG2 
3313 N N   . GLY D 14  ? 1.1708 1.4209 0.8797 -0.1042 -0.0454 0.1619  63  GLY D N   
3314 C CA  . GLY D 14  ? 1.2045 1.4612 0.9473 -0.1146 -0.0562 0.1736  63  GLY D CA  
3315 C C   . GLY D 14  ? 1.2616 1.5498 1.0499 -0.1327 -0.0435 0.1771  63  GLY D C   
3316 O O   . GLY D 14  ? 1.2666 1.5754 1.0535 -0.1352 -0.0242 0.1744  63  GLY D O   
3317 N N   . ASP D 15  ? 1.2799 1.5714 1.1088 -0.1454 -0.0544 0.1828  64  ASP D N   
3318 C CA  . ASP D 15  ? 1.2901 1.5565 1.1235 -0.1434 -0.0776 0.1850  64  ASP D CA  
3319 C C   . ASP D 15  ? 1.2049 1.4454 1.0753 -0.1536 -0.0910 0.1603  64  ASP D C   
3320 O O   . ASP D 15  ? 1.1936 1.4389 1.1176 -0.1712 -0.0949 0.1527  64  ASP D O   
3321 C CB  . ASP D 15  ? 1.3564 1.6391 1.2169 -0.1526 -0.0832 0.2034  64  ASP D CB  
3322 C CG  . ASP D 15  ? 1.4604 1.7623 1.2790 -0.1399 -0.0758 0.2303  64  ASP D CG  
3323 O OD1 . ASP D 15  ? 1.5073 1.7988 1.2726 -0.1209 -0.0758 0.2360  64  ASP D OD1 
3324 O OD2 . ASP D 15  ? 1.4811 1.8086 1.3202 -0.1487 -0.0702 0.2459  64  ASP D OD2 
3325 N N   . THR D 16  ? 1.1329 1.3460 0.9741 -0.1421 -0.0984 0.1481  65  THR D N   
3326 C CA  . THR D 16  ? 1.0577 1.2462 0.9289 -0.1502 -0.1096 0.1239  65  THR D CA  
3327 C C   . THR D 16  ? 1.0733 1.2270 0.9188 -0.1382 -0.1307 0.1216  65  THR D C   
3328 O O   . THR D 16  ? 1.0901 1.2350 0.8816 -0.1199 -0.1308 0.1302  65  THR D O   
3329 C CB  . THR D 16  ? 0.9901 1.1801 0.8548 -0.1501 -0.0946 0.1062  65  THR D CB  
3330 O OG1 . THR D 16  ? 0.9375 1.1597 0.8273 -0.1617 -0.0750 0.1077  65  THR D OG1 
3331 C CG2 . THR D 16  ? 0.9556 1.1201 0.8504 -0.1582 -0.1063 0.0815  65  THR D CG2 
3332 N N   . PRO D 17  ? 1.0366 1.1705 0.9209 -0.1483 -0.1490 0.1102  66  PRO D N   
3333 C CA  . PRO D 17  ? 1.0318 1.1303 0.8986 -0.1391 -0.1700 0.1037  66  PRO D CA  
3334 C C   . PRO D 17  ? 1.0599 1.1409 0.8873 -0.1265 -0.1662 0.0910  66  PRO D C   
3335 O O   . PRO D 17  ? 1.0544 1.1428 0.8946 -0.1328 -0.1531 0.0766  66  PRO D O   
3336 C CB  . PRO D 17  ? 0.9819 1.0686 0.9083 -0.1566 -0.1833 0.0871  66  PRO D CB  
3337 C CG  . PRO D 17  ? 0.9531 1.0683 0.9220 -0.1720 -0.1754 0.0953  66  PRO D CG  
3338 C CD  . PRO D 17  ? 0.9862 1.1314 0.9341 -0.1690 -0.1511 0.1041  66  PRO D CD  
3339 N N   . ILE D 18  ? 1.1006 1.1587 0.8805 -0.1090 -0.1776 0.0965  67  ILE D N   
3340 C CA  . ILE D 18  ? 1.0822 1.1228 0.8195 -0.0953 -0.1747 0.0863  67  ILE D CA  
3341 C C   . ILE D 18  ? 1.0663 1.0738 0.8201 -0.0987 -0.1919 0.0649  67  ILE D C   
3342 O O   . ILE D 18  ? 1.0804 1.0685 0.8495 -0.1009 -0.2120 0.0645  67  ILE D O   
3343 C CB  . ILE D 18  ? 1.1234 1.1560 0.7955 -0.0729 -0.1773 0.1031  67  ILE D CB  
3344 C CG1 . ILE D 18  ? 1.1591 1.2226 0.8189 -0.0700 -0.1655 0.1275  67  ILE D CG1 
3345 C CG2 . ILE D 18  ? 1.1101 1.1334 0.7370 -0.0590 -0.1681 0.0947  67  ILE D CG2 
3346 C CD1 . ILE D 18  ? 1.1410 1.2364 0.8012 -0.0736 -0.1401 0.1297  67  ILE D CD1 
3347 N N   . MET D 19  ? 1.0690 1.0705 0.8198 -0.0992 -0.1840 0.0475  68  MET D N   
3348 C CA  . MET D 19  ? 1.0944 1.0649 0.8573 -0.1016 -0.1990 0.0270  68  MET D CA  
3349 C C   . MET D 19  ? 1.1412 1.0802 0.8544 -0.0831 -0.2156 0.0304  68  MET D C   
3350 O O   . MET D 19  ? 1.1828 1.1221 0.8418 -0.0660 -0.2087 0.0400  68  MET D O   
3351 C CB  . MET D 19  ? 1.0946 1.0683 0.8623 -0.1058 -0.1848 0.0092  68  MET D CB  
3352 C CG  . MET D 19  ? 1.0757 1.0738 0.9004 -0.1262 -0.1723 0.0002  68  MET D CG  
3353 S SD  . MET D 19  ? 0.8956 0.8755 0.7841 -0.1444 -0.1902 -0.0199 68  MET D SD  
3354 C CE  . MET D 19  ? 0.7462 0.6978 0.6152 -0.1385 -0.1944 -0.0411 68  MET D CE  
3355 N N   . LYS D 20  ? 1.0957 1.0078 0.8274 -0.0863 -0.2378 0.0225  69  LYS D N   
3356 C CA  . LYS D 20  ? 1.1063 0.9866 0.7939 -0.0696 -0.2555 0.0246  69  LYS D CA  
3357 C C   . LYS D 20  ? 1.1082 0.9712 0.7603 -0.0593 -0.2520 0.0115  69  LYS D C   
3358 O O   . LYS D 20  ? 1.1667 1.0165 0.7627 -0.0405 -0.2543 0.0187  69  LYS D O   
3359 C CB  . LYS D 20  ? 1.0962 0.9517 0.8158 -0.0769 -0.2801 0.0176  69  LYS D CB  
3360 C CG  . LYS D 20  ? 1.0804 0.9028 0.7556 -0.0600 -0.2998 0.0209  69  LYS D CG  
3361 C CD  . LYS D 20  ? 1.0466 0.8482 0.7544 -0.0674 -0.3237 0.0175  69  LYS D CD  
3362 C CE  . LYS D 20  ? 1.1706 0.9379 0.8338 -0.0507 -0.3435 0.0194  69  LYS D CE  
3363 N NZ  . LYS D 20  ? 1.2442 1.0173 0.8503 -0.0320 -0.3391 0.0402  69  LYS D NZ  
3364 N N   . THR D 21  ? 1.0684 0.9315 0.7533 -0.0716 -0.2464 -0.0076 70  THR D N   
3365 C CA  . THR D 21  ? 1.0873 0.9368 0.7433 -0.0639 -0.2412 -0.0208 70  THR D CA  
3366 C C   . THR D 21  ? 1.0947 0.9741 0.7559 -0.0691 -0.2154 -0.0226 70  THR D C   
3367 O O   . THR D 21  ? 1.0880 0.9853 0.7995 -0.0868 -0.2070 -0.0310 70  THR D O   
3368 C CB  . THR D 21  ? 1.0806 0.9037 0.7666 -0.0729 -0.2560 -0.0425 70  THR D CB  
3369 O OG1 . THR D 21  ? 1.0954 0.8907 0.7779 -0.0684 -0.2806 -0.0407 70  THR D OG1 
3370 C CG2 . THR D 21  ? 1.1142 0.9223 0.7674 -0.0642 -0.2512 -0.0550 70  THR D CG2 
3371 N N   . LYS D 22  ? 1.1014 0.9861 0.7101 -0.0534 -0.2029 -0.0149 71  LYS D N   
3372 C CA  . LYS D 22  ? 1.0849 0.9994 0.6923 -0.0563 -0.1778 -0.0137 71  LYS D CA  
3373 C C   . LYS D 22  ? 1.0839 0.9887 0.6820 -0.0556 -0.1706 -0.0315 71  LYS D C   
3374 O O   . LYS D 22  ? 1.1077 1.0354 0.7198 -0.0631 -0.1512 -0.0360 71  LYS D O   
3375 C CB  . LYS D 22  ? 1.1005 1.0321 0.6587 -0.0403 -0.1661 0.0076  71  LYS D CB  
3376 C CG  . LYS D 22  ? 1.1225 1.0648 0.6873 -0.0404 -0.1727 0.0268  71  LYS D CG  
3377 C CD  . LYS D 22  ? 1.1464 1.1064 0.6617 -0.0243 -0.1607 0.0481  71  LYS D CD  
3378 C CE  . LYS D 22  ? 1.0912 1.0604 0.6120 -0.0241 -0.1686 0.0677  71  LYS D CE  
3379 N NZ  . LYS D 22  ? 1.0794 1.0163 0.5947 -0.0190 -0.1939 0.0664  71  LYS D NZ  
3380 N N   . LYS D 23  ? 1.0706 1.1044 0.8920 -0.2372 -0.0556 -0.3104 72  LYS D N   
3381 C CA  . LYS D 23  ? 1.0200 1.0830 0.9553 -0.2402 -0.0719 -0.2852 72  LYS D CA  
3382 C C   . LYS D 23  ? 1.0059 1.0993 0.9906 -0.2256 -0.0743 -0.2281 72  LYS D C   
3383 O O   . LYS D 23  ? 1.0362 1.1366 1.0269 -0.2239 -0.0914 -0.2225 72  LYS D O   
3384 C CB  . LYS D 23  ? 1.0585 1.1238 1.0595 -0.2595 -0.1081 -0.3225 72  LYS D CB  
3385 C CG  . LYS D 23  ? 1.0988 1.1857 1.2056 -0.2668 -0.1218 -0.3119 72  LYS D CG  
3386 C CD  . LYS D 23  ? 1.1432 1.2290 1.3063 -0.2865 -0.1566 -0.3537 72  LYS D CD  
3387 C CE  . LYS D 23  ? 1.1176 1.2252 1.3876 -0.2938 -0.1708 -0.3428 72  LYS D CE  
3388 N NZ  . LYS D 23  ? 1.1248 1.2237 1.4341 -0.3042 -0.1992 -0.3675 72  LYS D NZ  
3389 N N   . TRP D 24  ? 0.9295 1.0407 0.9489 -0.2150 -0.0569 -0.1859 73  TRP D N   
3390 C CA  . TRP D 24  ? 0.8438 0.9832 0.9042 -0.1997 -0.0547 -0.1290 73  TRP D CA  
3391 C C   . TRP D 24  ? 0.8074 0.9771 0.9778 -0.2001 -0.0645 -0.0963 73  TRP D C   
3392 O O   . TRP D 24  ? 0.8497 1.0171 1.0439 -0.2064 -0.0584 -0.1062 73  TRP D O   
3393 C CB  . TRP D 24  ? 0.8287 0.9603 0.8068 -0.1817 -0.0178 -0.1004 73  TRP D CB  
3394 C CG  . TRP D 24  ? 0.8737 0.9811 0.7499 -0.1780 -0.0087 -0.1210 73  TRP D CG  
3395 C CD1 . TRP D 24  ? 0.9060 0.9802 0.6881 -0.1826 0.0070  -0.1623 73  TRP D CD1 
3396 C CD2 . TRP D 24  ? 0.9515 1.0658 0.8092 -0.1689 -0.0150 -0.1012 73  TRP D CD2 
3397 N NE1 . TRP D 24  ? 0.9754 1.0354 0.6813 -0.1769 0.0109  -0.1694 73  TRP D NE1 
3398 C CE2 . TRP D 24  ? 1.0154 1.0994 0.7657 -0.1685 -0.0024 -0.1324 73  TRP D CE2 
3399 C CE3 . TRP D 24  ? 0.8547 0.9978 0.7762 -0.1611 -0.0300 -0.0601 73  TRP D CE3 
3400 C CZ2 . TRP D 24  ? 1.0568 1.1387 0.7624 -0.1606 -0.0045 -0.1238 73  TRP D CZ2 
3401 C CZ3 . TRP D 24  ? 1.0618 1.2027 0.9387 -0.1532 -0.0320 -0.0517 73  TRP D CZ3 
3402 C CH2 . TRP D 24  ? 1.0671 1.1775 0.8370 -0.1530 -0.0194 -0.0834 73  TRP D CH2 
3403 N N   . ALA D 25  ? 0.7819 0.9802 1.0189 -0.1933 -0.0795 -0.0569 74  ALA D N   
3404 C CA  . ALA D 25  ? 0.7940 1.0232 1.1360 -0.1920 -0.0883 -0.0204 74  ALA D CA  
3405 C C   . ALA D 25  ? 0.8233 1.0715 1.1644 -0.1722 -0.0660 0.0381  74  ALA D C   
3406 O O   . ALA D 25  ? 0.8205 1.0851 1.1781 -0.1634 -0.0739 0.0680  74  ALA D O   
3407 C CB  . ALA D 25  ? 0.7376 0.9871 1.1719 -0.2018 -0.1271 -0.0228 74  ALA D CB  
3408 N N   . VAL D 26  ? 0.8556 1.1016 1.1778 -0.1654 -0.0380 0.0543  75  VAL D N   
3409 C CA  . VAL D 26  ? 0.8751 1.1353 1.1832 -0.1464 -0.0124 0.1071  75  VAL D CA  
3410 C C   . VAL D 26  ? 0.8828 1.1743 1.2900 -0.1430 -0.0155 0.1490  75  VAL D C   
3411 O O   . VAL D 26  ? 0.8615 1.1601 1.3390 -0.1554 -0.0322 0.1349  75  VAL D O   
3412 C CB  . VAL D 26  ? 0.8305 1.0662 1.0379 -0.1385 0.0254  0.1008  75  VAL D CB  
3413 C CG1 . VAL D 26  ? 0.8401 1.0430 0.9489 -0.1433 0.0287  0.0555  75  VAL D CG1 
3414 C CG2 . VAL D 26  ? 0.7909 1.0220 1.0200 -0.1456 0.0353  0.0888  75  VAL D CG2 
3415 N N   . GLU D 27  ? 0.9560 1.2661 1.3677 -0.1262 0.0008  0.2007  76  GLU D N   
3416 C CA  . GLU D 27  ? 1.0170 1.3566 1.5151 -0.1210 0.0018  0.2446  76  GLU D CA  
3417 C C   . GLU D 27  ? 0.9843 1.3148 1.4652 -0.1211 0.0267  0.2420  76  GLU D C   
3418 O O   . GLU D 27  ? 1.0087 1.3123 1.3982 -0.1194 0.0506  0.2195  76  GLU D O   
3419 C CB  . GLU D 27  ? 1.0867 1.4475 1.5876 -0.1025 0.0136  0.3001  76  GLU D CB  
3420 C CG  . GLU D 27  ? 1.1891 1.5578 1.6962 -0.1003 -0.0073 0.3054  76  GLU D CG  
3421 C CD  . GLU D 27  ? 1.2579 1.6511 1.8752 -0.1101 -0.0443 0.3091  76  GLU D CD  
3422 O OE1 . GLU D 27  ? 1.2901 1.6891 1.9182 -0.1107 -0.0650 0.3081  76  GLU D OE1 
3423 O OE2 . GLU D 27  ? 1.2793 1.6861 1.9725 -0.1172 -0.0527 0.3134  76  GLU D OE2 
3424 N N   . ARG D 28  ? 0.9085 1.2615 1.4773 -0.1232 0.0210  0.2651  77  ARG D N   
3425 C CA  . ARG D 28  ? 0.8376 1.1848 1.3999 -0.1234 0.0432  0.2657  77  ARG D CA  
3426 C C   . ARG D 28  ? 0.7780 1.1236 1.2766 -0.1054 0.0805  0.3014  77  ARG D C   
3427 O O   . ARG D 28  ? 0.7855 1.1139 1.2318 -0.1042 0.1058  0.2908  77  ARG D O   
3428 C CB  . ARG D 28  ? 0.8336 1.2074 1.5098 -0.1293 0.0271  0.2856  77  ARG D CB  
3429 C CG  . ARG D 28  ? 0.8746 1.2456 1.6092 -0.1491 -0.0045 0.2440  77  ARG D CG  
3430 C CD  . ARG D 28  ? 0.8855 1.2825 1.7294 -0.1539 -0.0172 0.2659  77  ARG D CD  
3431 N NE  . ARG D 28  ? 0.9136 1.3102 1.7461 -0.1478 0.0112  0.2844  77  ARG D NE  
3432 C CZ  . ARG D 28  ? 0.9302 1.3111 1.7547 -0.1577 0.0176  0.2542  77  ARG D CZ  
3433 N NH1 . ARG D 28  ? 0.9467 1.3113 1.7742 -0.1744 -0.0025 0.2037  77  ARG D NH1 
3434 N NH2 . ARG D 28  ? 0.9055 1.2874 1.7195 -0.1510 0.0441  0.2746  77  ARG D NH2 
3435 N N   . THR D 29  ? 0.7372 1.1005 1.2396 -0.0913 0.0838  0.3434  78  THR D N   
3436 C CA  . THR D 29  ? 0.7389 1.1061 1.1950 -0.0733 0.1174  0.3842  78  THR D CA  
3437 C C   . THR D 29  ? 0.8919 1.2328 1.2292 -0.0648 0.1404  0.3709  78  THR D C   
3438 O O   . THR D 29  ? 0.9375 1.2799 1.2285 -0.0495 0.1687  0.4033  78  THR D O   
3439 C CB  . THR D 29  ? 0.6801 1.0813 1.2017 -0.0612 0.1119  0.4407  78  THR D CB  
3440 O OG1 . THR D 29  ? 0.6860 1.0921 1.2150 -0.0618 0.0889  0.4374  78  THR D OG1 
3441 C CG2 . THR D 29  ? 0.6263 1.0547 1.2616 -0.0670 0.0958  0.4614  78  THR D CG2 
3442 N N   . ARG D 30  ? 0.9764 1.2934 1.2645 -0.0748 0.1284  0.3237  79  ARG D N   
3443 C CA  . ARG D 30  ? 1.0372 1.3278 1.2113 -0.0679 0.1488  0.3075  79  ARG D CA  
3444 C C   . ARG D 30  ? 1.0103 1.2762 1.1096 -0.0670 0.1799  0.2891  79  ARG D C   
3445 O O   . ARG D 30  ? 0.9432 1.2004 1.0620 -0.0791 0.1766  0.2611  79  ARG D O   
3446 C CB  . ARG D 30  ? 1.1497 1.4229 1.2959 -0.0790 0.1254  0.2630  79  ARG D CB  
3447 C CG  . ARG D 30  ? 1.2471 1.5426 1.4540 -0.0782 0.0970  0.2816  79  ARG D CG  
3448 C CD  . ARG D 30  ? 1.3340 1.6112 1.5085 -0.0891 0.0750  0.2368  79  ARG D CD  
3449 N NE  . ARG D 30  ? 1.3761 1.6270 1.4365 -0.0820 0.0957  0.2217  79  ARG D NE  
3450 C CZ  . ARG D 30  ? 1.3658 1.5965 1.3767 -0.0895 0.0829  0.1827  79  ARG D CZ  
3451 N NH1 . ARG D 30  ? 1.3206 1.5544 1.3863 -0.1043 0.0494  0.1546  79  ARG D NH1 
3452 N NH2 . ARG D 30  ? 1.3849 1.5924 1.2917 -0.0822 0.1035  0.1717  79  ARG D NH2 
3453 N N   . THR D 31  ? 1.0382 1.2931 1.0521 -0.0527 0.2100  0.3052  80  THR D N   
3454 C CA  . THR D 31  ? 1.0098 1.2338 0.9498 -0.0492 0.2353  0.2837  80  THR D CA  
3455 C C   . THR D 31  ? 1.0098 1.2006 0.8542 -0.0570 0.2435  0.2354  80  THR D C   
3456 O O   . THR D 31  ? 1.0456 1.2337 0.8617 -0.0599 0.2324  0.2211  80  THR D O   
3457 C CB  . THR D 31  ? 1.0108 1.2020 0.9158 -0.0311 0.2302  0.2787  80  THR D CB  
3458 O OG1 . THR D 31  ? 1.0719 1.2528 0.9344 -0.0243 0.2255  0.2779  80  THR D OG1 
3459 C CG2 . THR D 31  ? 0.9332 1.1548 0.9222 -0.0197 0.2221  0.3180  80  THR D CG2 
3460 N N   . ILE D 32  ? 1.0884 1.0203 0.7194 0.0715  -0.0722 -0.1394 81  ILE D N   
3461 C CA  . ILE D 32  ? 1.1106 1.0367 0.7399 0.0538  -0.0706 -0.1359 81  ILE D CA  
3462 C C   . ILE D 32  ? 1.2196 1.1073 0.8276 0.0530  -0.0695 -0.1310 81  ILE D C   
3463 O O   . ILE D 32  ? 1.2570 1.1393 0.8622 0.0470  -0.0658 -0.1238 81  ILE D O   
3464 C CB  . ILE D 32  ? 1.0570 0.9897 0.6921 0.0378  -0.0746 -0.1430 81  ILE D CB  
3465 C CG1 . ILE D 32  ? 0.9807 0.9540 0.6384 0.0350  -0.0747 -0.1462 81  ILE D CG1 
3466 C CG2 . ILE D 32  ? 1.0494 0.9670 0.6780 0.0202  -0.0737 -0.1395 81  ILE D CG2 
3467 C CD1 . ILE D 32  ? 0.9264 0.9214 0.5957 0.0291  -0.0700 -0.1394 81  ILE D CD1 
3468 N N   . GLN D 33  ? 1.2636 1.1247 0.8568 0.0594  -0.0728 -0.1349 82  GLN D N   
3469 C CA  . GLN D 33  ? 1.2956 1.1187 0.8677 0.0601  -0.0721 -0.1309 82  GLN D CA  
3470 C C   . GLN D 33  ? 1.2223 1.0404 0.7897 0.0717  -0.0672 -0.1221 82  GLN D C   
3471 O O   . GLN D 33  ? 1.2218 1.0197 0.7783 0.0669  -0.0645 -0.1159 82  GLN D O   
3472 C CB  . GLN D 33  ? 1.3514 1.1497 0.9093 0.0679  -0.0765 -0.1369 82  GLN D CB  
3473 C CG  . GLN D 33  ? 1.3813 1.1387 0.9165 0.0677  -0.0764 -0.1336 82  GLN D CG  
3474 C CD  . GLN D 33  ? 1.4024 1.1468 0.9328 0.0482  -0.0769 -0.1327 82  GLN D CD  
3475 O OE1 . GLN D 33  ? 1.3905 1.1397 0.9254 0.0361  -0.0806 -0.1388 82  GLN D OE1 
3476 N NE2 . GLN D 33  ? 1.4322 1.1603 0.9536 0.0449  -0.0731 -0.1248 82  GLN D NE2 
3477 N N   . GLY D 34  ? 1.1456 0.9826 0.7218 0.0869  -0.0660 -0.1217 83  GLY D N   
3478 C CA  . GLY D 34  ? 1.1375 0.9727 0.7109 0.0988  -0.0615 -0.1136 83  GLY D CA  
3479 C C   . GLY D 34  ? 1.1789 1.0287 0.7607 0.0894  -0.0571 -0.1067 83  GLY D C   
3480 O O   . GLY D 34  ? 1.2216 1.0599 0.7961 0.0937  -0.0532 -0.0989 83  GLY D O   
3481 N N   . LEU D 35  ? 1.1737 1.0492 0.7709 0.0766  -0.0577 -0.1095 84  LEU D N   
3482 C CA  . LEU D 35  ? 1.1358 1.0274 0.7422 0.0665  -0.0537 -0.1035 84  LEU D CA  
3483 C C   . LEU D 35  ? 1.1179 0.9860 0.7130 0.0511  -0.0531 -0.1005 84  LEU D C   
3484 O O   . LEU D 35  ? 1.1404 1.0062 0.7340 0.0471  -0.0489 -0.0930 84  LEU D O   
3485 C CB  . LEU D 35  ? 1.1145 1.0434 0.7421 0.0589  -0.0546 -0.1076 84  LEU D CB  
3486 C CG  . LEU D 35  ? 1.0986 1.0595 0.7421 0.0703  -0.0526 -0.1061 84  LEU D CG  
3487 C CD1 . LEU D 35  ? 1.1494 1.1047 0.7884 0.0897  -0.0539 -0.1077 84  LEU D CD1 
3488 C CD2 . LEU D 35  ? 1.0718 1.0664 0.7347 0.0620  -0.0544 -0.1117 84  LEU D CD2 
3489 N N   . ILE D 36  ? 1.0844 0.9353 0.6717 0.0426  -0.0572 -0.1064 85  ILE D N   
3490 C CA  . ILE D 36  ? 1.1037 0.9302 0.6793 0.0281  -0.0573 -0.1041 85  ILE D CA  
3491 C C   . ILE D 36  ? 1.1258 0.9224 0.6839 0.0351  -0.0542 -0.0969 85  ILE D C   
3492 O O   . ILE D 36  ? 1.0773 0.8663 0.6318 0.0267  -0.0510 -0.0904 85  ILE D O   
3493 C CB  . ILE D 36  ? 1.0919 0.9013 0.6598 0.0204  -0.0628 -0.1120 85  ILE D CB  
3494 C CG1 . ILE D 36  ? 1.0528 0.8908 0.6380 0.0097  -0.0656 -0.1183 85  ILE D CG1 
3495 C CG2 . ILE D 36  ? 1.1377 0.9160 0.6902 0.0083  -0.0629 -0.1090 85  ILE D CG2 
3496 C CD1 . ILE D 36  ? 1.0350 0.8572 0.6134 -0.0001 -0.0710 -0.1257 85  ILE D CD1 
3497 N N   . ASP D 37  ? 1.1818 0.9621 0.7293 0.0507  -0.0552 -0.0981 86  ASP D N   
3498 C CA  . ASP D 37  ? 1.2797 1.0312 0.8101 0.0592  -0.0525 -0.0916 86  ASP D CA  
3499 C C   . ASP D 37  ? 1.2686 1.0353 0.8059 0.0664  -0.0471 -0.0834 86  ASP D C   
3500 O O   . ASP D 37  ? 1.2906 1.0385 0.8170 0.0675  -0.0436 -0.0762 86  ASP D O   
3501 C CB  . ASP D 37  ? 1.3341 1.0659 0.8522 0.0745  -0.0551 -0.0953 86  ASP D CB  
3502 C CG  . ASP D 37  ? 1.4099 1.1263 0.9208 0.0680  -0.0607 -0.1036 86  ASP D CG  
3503 O OD1 . ASP D 37  ? 1.4479 1.1552 0.9560 0.0517  -0.0620 -0.1046 86  ASP D OD1 
3504 O OD2 . ASP D 37  ? 1.4176 1.1307 0.9256 0.0793  -0.0638 -0.1090 86  ASP D OD2 
3505 N N   . PHE D 38  ? 1.2331 1.0339 0.7884 0.0710  -0.0464 -0.0846 87  PHE D N   
3506 C CA  . PHE D 38  ? 1.2058 1.0251 0.7699 0.0770  -0.0416 -0.0773 87  PHE D CA  
3507 C C   . PHE D 38  ? 1.1368 0.9608 0.7046 0.0616  -0.0384 -0.0719 87  PHE D C   
3508 O O   . PHE D 38  ? 1.1429 0.9581 0.7050 0.0637  -0.0342 -0.0639 87  PHE D O   
3509 C CB  . PHE D 38  ? 1.2234 1.0791 0.8066 0.0842  -0.0423 -0.0808 87  PHE D CB  
3510 C CG  . PHE D 38  ? 1.2154 1.0946 0.8103 0.0880  -0.0378 -0.0741 87  PHE D CG  
3511 C CD1 . PHE D 38  ? 1.2108 1.0869 0.8020 0.1042  -0.0352 -0.0688 87  PHE D CD1 
3512 C CD2 . PHE D 38  ? 1.2204 1.1250 0.8299 0.0756  -0.0363 -0.0731 87  PHE D CD2 
3513 C CE1 . PHE D 38  ? 1.2145 1.1119 0.8162 0.1077  -0.0313 -0.0627 87  PHE D CE1 
3514 C CE2 . PHE D 38  ? 1.2019 1.1280 0.8218 0.0792  -0.0322 -0.0671 87  PHE D CE2 
3515 C CZ  . PHE D 38  ? 1.1930 1.1153 0.8089 0.0953  -0.0298 -0.0619 87  PHE D CZ  
3516 N N   . ILE D 39  ? 1.0637 0.9014 0.6408 0.0462  -0.0404 -0.0761 88  ILE D N   
3517 C CA  . ILE D 39  ? 0.9763 0.8211 0.5585 0.0305  -0.0377 -0.0715 88  ILE D CA  
3518 C C   . ILE D 39  ? 0.9904 0.8012 0.5552 0.0219  -0.0368 -0.0674 88  ILE D C   
3519 O O   . ILE D 39  ? 1.0687 0.8773 0.6323 0.0170  -0.0327 -0.0600 88  ILE D O   
3520 C CB  . ILE D 39  ? 0.9374 0.8055 0.5342 0.0163  -0.0404 -0.0774 88  ILE D CB  
3521 C CG1 . ILE D 39  ? 0.9666 0.8714 0.5822 0.0236  -0.0405 -0.0804 88  ILE D CG1 
3522 C CG2 . ILE D 39  ? 0.8674 0.7396 0.4679 -0.0007 -0.0380 -0.0727 88  ILE D CG2 
3523 C CD1 . ILE D 39  ? 0.9731 0.9037 0.6044 0.0100  -0.0426 -0.0855 88  ILE D CD1 
3524 N N   . LYS D 40  ? 0.9709 0.7554 0.5223 0.0202  -0.0407 -0.0722 89  LYS D N   
3525 C CA  . LYS D 40  ? 0.9943 0.7447 0.5283 0.0122  -0.0406 -0.0692 89  LYS D CA  
3526 C C   . LYS D 40  ? 1.0091 0.7431 0.5328 0.0193  -0.0357 -0.0601 89  LYS D C   
3527 O O   . LYS D 40  ? 1.0342 0.7531 0.5508 0.0092  -0.0336 -0.0549 89  LYS D O   
3528 C CB  . LYS D 40  ? 1.0210 0.7439 0.5404 0.0153  -0.0454 -0.0755 89  LYS D CB  
3529 C CG  . LYS D 40  ? 1.0404 0.7656 0.5635 0.0015  -0.0504 -0.0832 89  LYS D CG  
3530 C CD  . LYS D 40  ? 1.1199 0.8119 0.6251 0.0036  -0.0547 -0.0881 89  LYS D CD  
3531 C CE  . LYS D 40  ? 1.2005 0.8956 0.7096 -0.0090 -0.0600 -0.0962 89  LYS D CE  
3532 N NZ  . LYS D 40  ? 1.2435 0.9069 0.7354 -0.0063 -0.0644 -0.1013 89  LYS D NZ  
3533 N N   . LYS D 41  ? 1.0052 0.7422 0.5282 0.0367  -0.0340 -0.0581 90  LYS D N   
3534 C CA  . LYS D 41  ? 1.0670 0.7893 0.5803 0.0451  -0.0294 -0.0496 90  LYS D CA  
3535 C C   . LYS D 41  ? 1.0334 0.7737 0.5568 0.0372  -0.0248 -0.0426 90  LYS D C   
3536 O O   . LYS D 41  ? 1.0796 0.8020 0.5936 0.0318  -0.0218 -0.0361 90  LYS D O   
3537 C CB  . LYS D 41  ? 1.1326 0.8600 0.6462 0.0653  -0.0286 -0.0490 90  LYS D CB  
3538 C CG  . LYS D 41  ? 1.1172 0.8301 0.6224 0.0750  -0.0330 -0.0558 90  LYS D CG  
3539 C CD  . LYS D 41  ? 1.1354 0.8078 0.6185 0.0754  -0.0337 -0.0546 90  LYS D CD  
3540 C CE  . LYS D 41  ? 1.1798 0.8386 0.6544 0.0881  -0.0376 -0.0605 90  LYS D CE  
3541 N NZ  . LYS D 41  ? 1.1716 0.8461 0.6526 0.1062  -0.0361 -0.0589 90  LYS D NZ  
3542 N N   . PHE D 42  ? 0.9839 0.7594 0.5261 0.0366  -0.0243 -0.0439 91  PHE D N   
3543 C CA  . PHE D 42  ? 0.9814 0.7776 0.5348 0.0297  -0.0200 -0.0377 91  PHE D CA  
3544 C C   . PHE D 42  ? 1.0050 0.7949 0.5574 0.0102  -0.0198 -0.0363 91  PHE D C   
3545 O O   . PHE D 42  ? 1.0313 0.8232 0.5847 0.0044  -0.0157 -0.0292 91  PHE D O   
3546 C CB  . PHE D 42  ? 0.9582 0.7939 0.5324 0.0320  -0.0202 -0.0406 91  PHE D CB  
3547 C CG  . PHE D 42  ? 0.9983 0.8451 0.5761 0.0508  -0.0194 -0.0399 91  PHE D CG  
3548 C CD1 . PHE D 42  ? 1.0088 0.8624 0.5885 0.0586  -0.0148 -0.0321 91  PHE D CD1 
3549 C CD2 . PHE D 42  ? 1.0051 0.8563 0.5850 0.0605  -0.0233 -0.0470 91  PHE D CD2 
3550 C CE1 . PHE D 42  ? 0.9743 0.8383 0.5577 0.0758  -0.0142 -0.0313 91  PHE D CE1 
3551 C CE2 . PHE D 42  ? 0.9720 0.8339 0.5557 0.0778  -0.0226 -0.0462 91  PHE D CE2 
3552 C CZ  . PHE D 42  ? 0.9597 0.8280 0.5453 0.0854  -0.0181 -0.0383 91  PHE D CZ  
3553 N N   . LEU D 43  ? 1.0235 0.8059 0.5739 0.0003  -0.0243 -0.0430 92  LEU D N   
3554 C CA  . LEU D 43  ? 1.0742 0.8519 0.6246 -0.0187 -0.0247 -0.0422 92  LEU D CA  
3555 C C   . LEU D 43  ? 1.0772 0.8167 0.6079 -0.0230 -0.0245 -0.0389 92  LEU D C   
3556 O O   . LEU D 43  ? 1.1320 0.8628 0.6603 -0.0385 -0.0252 -0.0380 92  LEU D O   
3557 C CB  . LEU D 43  ? 1.1092 0.8991 0.6681 -0.0287 -0.0297 -0.0507 92  LEU D CB  
3558 C CG  . LEU D 43  ? 1.0359 0.8649 0.6153 -0.0267 -0.0301 -0.0544 92  LEU D CG  
3559 C CD1 . LEU D 43  ? 0.9842 0.8247 0.5721 -0.0404 -0.0344 -0.0615 92  LEU D CD1 
3560 C CD2 . LEU D 43  ? 0.9599 0.8127 0.5511 -0.0279 -0.0249 -0.0473 92  LEU D CD2 
3561 N N   . LYS D 44  ? 1.0591 0.7762 0.5758 -0.0091 -0.0236 -0.0368 93  LYS D N   
3562 C CA  . LYS D 44  ? 1.0629 0.7419 0.5597 -0.0108 -0.0235 -0.0340 93  LYS D CA  
3563 C C   . LYS D 44  ? 1.1237 0.7850 0.6131 -0.0209 -0.0289 -0.0409 93  LYS D C   
3564 O O   . LYS D 44  ? 1.2148 0.8575 0.6962 -0.0337 -0.0293 -0.0390 93  LYS D O   
3565 C CB  . LYS D 44  ? 1.0617 0.7345 0.5559 -0.0201 -0.0190 -0.0253 93  LYS D CB  
3566 C CG  . LYS D 44  ? 1.0794 0.7729 0.5828 -0.0126 -0.0137 -0.0183 93  LYS D CG  
3567 C CD  . LYS D 44  ? 1.0858 0.7753 0.5881 -0.0237 -0.0095 -0.0104 93  LYS D CD  
3568 C CE  . LYS D 44  ? 0.9922 0.7081 0.5069 -0.0188 -0.0046 -0.0043 93  LYS D CE  
3569 N NZ  . LYS D 44  ? 1.0042 0.7153 0.5173 -0.0292 -0.0005 0.0037  93  LYS D NZ  
3570 N N   . LEU D 45  ? 1.1195 0.7870 0.6118 -0.0151 -0.0332 -0.0489 94  LEU D N   
3571 C CA  . LEU D 45  ? 1.1499 0.8022 0.6359 -0.0236 -0.0388 -0.0563 94  LEU D CA  
3572 C C   . LEU D 45  ? 1.1795 0.8067 0.6503 -0.0103 -0.0416 -0.0604 94  LEU D C   
3573 O O   . LEU D 45  ? 1.1674 0.8040 0.6410 0.0051  -0.0414 -0.0619 94  LEU D O   
3574 C CB  . LEU D 45  ? 1.1121 0.7947 0.6158 -0.0309 -0.0419 -0.0631 94  LEU D CB  
3575 C CG  . LEU D 45  ? 1.0762 0.7834 0.5950 -0.0461 -0.0400 -0.0602 94  LEU D CG  
3576 C CD1 . LEU D 45  ? 1.0408 0.7785 0.5770 -0.0508 -0.0431 -0.0673 94  LEU D CD1 
3577 C CD2 . LEU D 45  ? 1.0534 0.7392 0.5633 -0.0626 -0.0406 -0.0576 94  LEU D CD2 
3578 N N   . VAL D 46  ? 1.2164 0.8115 0.6710 -0.0164 -0.0444 -0.0620 95  VAL D N   
3579 C CA  . VAL D 46  ? 1.2739 0.8427 0.7127 -0.0048 -0.0473 -0.0659 95  VAL D CA  
3580 C C   . VAL D 46  ? 1.3240 0.9002 0.7674 -0.0059 -0.0531 -0.0759 95  VAL D C   
3581 O O   . VAL D 46  ? 1.3406 0.9404 0.7986 -0.0168 -0.0549 -0.0796 95  VAL D O   
3582 C CB  . VAL D 46  ? 1.2877 0.8170 0.7058 -0.0101 -0.0478 -0.0632 95  VAL D CB  
3583 C CG1 . VAL D 46  ? 1.2854 0.8074 0.6991 -0.0098 -0.0420 -0.0533 95  VAL D CG1 
3584 C CG2 . VAL D 46  ? 1.2707 0.7931 0.6883 -0.0289 -0.0518 -0.0672 95  VAL D CG2 
3585 N N   . ALA D 47  ? 1.3354 0.8914 0.7662 0.0056  -0.0560 -0.0802 96  ALA D N   
3586 C CA  . ALA D 47  ? 1.3485 0.9107 0.7827 0.0074  -0.0614 -0.0897 96  ALA D CA  
3587 C C   . ALA D 47  ? 1.4011 0.9594 0.8362 -0.0108 -0.0659 -0.0949 96  ALA D C   
3588 O O   . ALA D 47  ? 1.3823 0.9633 0.8308 -0.0157 -0.0689 -0.1011 96  ALA D O   
3589 C CB  . ALA D 47  ? 1.3262 0.8629 0.7442 0.0226  -0.0635 -0.0925 96  ALA D CB  
3590 N N   . SER D 48  ? 1.4599 0.9895 0.8809 -0.0206 -0.0664 -0.0922 97  SER D N   
3591 C CA  . SER D 48  ? 1.4764 0.9978 0.8959 -0.0377 -0.0709 -0.0968 97  SER D CA  
3592 C C   . SER D 48  ? 1.4703 1.0232 0.9095 -0.0525 -0.0703 -0.0965 97  SER D C   
3593 O O   . SER D 48  ? 1.4886 1.0480 0.9335 -0.0639 -0.0747 -0.1024 97  SER D O   
3594 C CB  . SER D 48  ? 1.4977 0.9824 0.8985 -0.0452 -0.0711 -0.0930 97  SER D CB  
3595 O OG  . SER D 48  ? 1.5227 1.0083 0.9243 -0.0485 -0.0656 -0.0838 97  SER D OG  
3596 N N   . GLU D 49  ? 1.4418 1.0141 0.8911 -0.0521 -0.0649 -0.0895 98  GLU D N   
3597 C CA  . GLU D 49  ? 1.4224 1.0262 0.8908 -0.0647 -0.0638 -0.0885 98  GLU D CA  
3598 C C   . GLU D 49  ? 1.3844 1.0205 0.8696 -0.0595 -0.0655 -0.0948 98  GLU D C   
3599 O O   . GLU D 49  ? 1.3471 0.9901 0.8334 -0.0433 -0.0647 -0.0961 98  GLU D O   
3600 C CB  . GLU D 49  ? 1.4198 1.0345 0.8936 -0.0645 -0.0574 -0.0791 98  GLU D CB  
3601 C CG  . GLU D 49  ? 1.4625 1.0464 0.9203 -0.0692 -0.0552 -0.0723 98  GLU D CG  
3602 C CD  . GLU D 49  ? 1.4904 1.0871 0.9549 -0.0712 -0.0491 -0.0632 98  GLU D CD  
3603 O OE1 . GLU D 49  ? 1.5148 1.1275 0.9903 -0.0857 -0.0483 -0.0611 98  GLU D OE1 
3604 O OE2 . GLU D 49  ? 1.5030 1.0940 0.9621 -0.0581 -0.0451 -0.0581 98  GLU D OE2 
3605 N N   . GLN D 50  ? 1.3940 1.0500 0.8923 -0.0733 -0.0680 -0.0986 99  GLN D N   
3606 C CA  . GLN D 50  ? 1.3794 1.0655 0.8936 -0.0699 -0.0701 -0.1052 99  GLN D CA  
3607 C C   . GLN D 50  ? 1.3330 1.0562 0.8670 -0.0708 -0.0659 -0.1013 99  GLN D C   
3608 O O   . GLN D 50  ? 1.3413 1.0697 0.8791 -0.0803 -0.0624 -0.0948 99  GLN D O   
3609 C CB  . GLN D 50  ? 1.4265 1.1126 0.9434 -0.0834 -0.0759 -0.1127 99  GLN D CB  
3610 C CG  . GLN D 50  ? 1.4719 1.1605 0.9934 -0.1035 -0.0758 -0.1096 99  GLN D CG  
3611 C CD  . GLN D 50  ? 1.5054 1.1899 1.0273 -0.1165 -0.0819 -0.1169 99  GLN D CD  
3612 O OE1 . GLN D 50  ? 1.4274 1.1065 0.9457 -0.1104 -0.0862 -0.1245 99  GLN D OE1 
3613 N NE2 . GLN D 50  ? 1.5528 1.2402 1.0794 -0.1345 -0.0823 -0.1146 99  GLN D NE2 
3614 N N   . LEU D 51  ? 1.2844 1.0334 0.8308 -0.0608 -0.0662 -0.1055 100 LEU D N   
3615 C CA  . LEU D 51  ? 1.1878 0.9736 0.7535 -0.0604 -0.0627 -0.1027 100 LEU D CA  
3616 C C   . LEU D 51  ? 1.1009 0.9140 0.6812 -0.0574 -0.0658 -0.1106 100 LEU D C   
3617 O O   . LEU D 51  ? 1.0599 0.8719 0.6379 -0.0432 -0.0675 -0.1149 100 LEU D O   
3618 C CB  . LEU D 51  ? 1.1216 0.9095 0.6856 -0.0453 -0.0576 -0.0961 100 LEU D CB  
3619 C CG  . LEU D 51  ? 1.0827 0.9078 0.6658 -0.0425 -0.0538 -0.0930 100 LEU D CG  
3620 C CD1 . LEU D 51  ? 1.0849 0.9208 0.6753 -0.0579 -0.0508 -0.0872 100 LEU D CD1 
3621 C CD2 . LEU D 51  ? 1.0957 0.9211 0.6761 -0.0245 -0.0500 -0.0883 100 LEU D CD2 
3622 N N   . PHE D 52  ? 1.0435 0.8811 0.6389 -0.0708 -0.0665 -0.1124 101 PHE D N   
3623 C CA  . PHE D 52  ? 0.9848 0.8484 0.5946 -0.0705 -0.0697 -0.1201 101 PHE D CA  
3624 C C   . PHE D 52  ? 0.9612 0.8618 0.5894 -0.0638 -0.0662 -0.1183 101 PHE D C   
3625 O O   . PHE D 52  ? 0.9737 0.8880 0.6092 -0.0689 -0.0620 -0.1117 101 PHE D O   
3626 C CB  . PHE D 52  ? 0.9942 0.8624 0.6096 -0.0895 -0.0732 -0.1240 101 PHE D CB  
3627 C CG  . PHE D 52  ? 0.9916 0.8246 0.5897 -0.0972 -0.0772 -0.1263 101 PHE D CG  
3628 C CD1 . PHE D 52  ? 0.9973 0.8169 0.5883 -0.0928 -0.0823 -0.1343 101 PHE D CD1 
3629 C CD2 . PHE D 52  ? 0.9993 0.8127 0.5885 -0.1090 -0.0758 -0.1204 101 PHE D CD2 
3630 C CE1 . PHE D 52  ? 0.9913 0.7781 0.5661 -0.0999 -0.0862 -0.1365 101 PHE D CE1 
3631 C CE2 . PHE D 52  ? 1.0269 0.8079 0.6003 -0.1162 -0.0797 -0.1225 101 PHE D CE2 
3632 C CZ  . PHE D 52  ? 1.0200 0.7874 0.5860 -0.1116 -0.0849 -0.1306 101 PHE D CZ  
3633 N N   . ILE D 53  ? 0.9692 0.8858 0.6048 -0.0524 -0.0681 -0.1241 102 ILE D N   
3634 C CA  . ILE D 53  ? 0.9404 0.8932 0.5942 -0.0457 -0.0655 -0.1235 102 ILE D CA  
3635 C C   . ILE D 53  ? 0.9002 0.8795 0.5697 -0.0530 -0.0689 -0.1310 102 ILE D C   
3636 O O   . ILE D 53  ? 0.9109 0.8816 0.5766 -0.0530 -0.0736 -0.1384 102 ILE D O   
3637 C CB  . ILE D 53  ? 0.9520 0.9044 0.6029 -0.0249 -0.0646 -0.1235 102 ILE D CB  
3638 C CG1 . ILE D 53  ? 0.9925 0.9200 0.6285 -0.0175 -0.0609 -0.1157 102 ILE D CG1 
3639 C CG2 . ILE D 53  ? 0.9533 0.9438 0.6236 -0.0180 -0.0625 -0.1235 102 ILE D CG2 
3640 C CD1 . ILE D 53  ? 1.0180 0.9493 0.6535 0.0024  -0.0590 -0.1138 102 ILE D CD1 
3641 N N   . TYR D 54  ? 0.8921 0.9035 0.5790 -0.0593 -0.0665 -0.1291 103 TYR D N   
3642 C CA  . TYR D 54  ? 0.8938 0.9317 0.5964 -0.0679 -0.0693 -0.1355 103 TYR D CA  
3643 C C   . TYR D 54  ? 0.9332 1.0077 0.6539 -0.0588 -0.0675 -0.1365 103 TYR D C   
3644 O O   . TYR D 54  ? 0.9771 1.0643 0.7029 -0.0530 -0.0631 -0.1304 103 TYR D O   
3645 C CB  . TYR D 54  ? 0.8909 0.9341 0.5986 -0.0880 -0.0688 -0.1330 103 TYR D CB  
3646 C CG  . TYR D 54  ? 0.9519 0.9627 0.6444 -0.0994 -0.0719 -0.1339 103 TYR D CG  
3647 C CD1 . TYR D 54  ? 1.0372 1.0448 0.7301 -0.1081 -0.0772 -0.1414 103 TYR D CD1 
3648 C CD2 . TYR D 54  ? 0.9817 0.9651 0.6595 -0.1015 -0.0697 -0.1272 103 TYR D CD2 
3649 C CE1 . TYR D 54  ? 1.0716 1.0494 0.7506 -0.1185 -0.0803 -0.1423 103 TYR D CE1 
3650 C CE2 . TYR D 54  ? 1.0456 0.9992 0.7095 -0.1119 -0.0727 -0.1279 103 TYR D CE2 
3651 C CZ  . TYR D 54  ? 1.0873 1.0381 0.7518 -0.1204 -0.0780 -0.1355 103 TYR D CZ  
3652 O OH  . TYR D 54  ? 1.1757 1.0967 0.8263 -0.1308 -0.0812 -0.1363 103 TYR D OH  
3653 N N   . VAL D 55  ? 0.9534 1.0447 0.6837 -0.0579 -0.0711 -0.1445 104 VAL D N   
3654 C CA  . VAL D 55  ? 0.9663 1.0939 0.7150 -0.0510 -0.0700 -0.1464 104 VAL D CA  
3655 C C   . VAL D 55  ? 0.9842 1.1379 0.7487 -0.0666 -0.0710 -0.1492 104 VAL D C   
3656 O O   . VAL D 55  ? 1.0028 1.1474 0.7646 -0.0784 -0.0746 -0.1538 104 VAL D O   
3657 C CB  . VAL D 55  ? 0.9574 1.0869 0.7064 -0.0360 -0.0732 -0.1533 104 VAL D CB  
3658 C CG1 . VAL D 55  ? 0.9033 1.0706 0.6715 -0.0287 -0.0720 -0.1551 104 VAL D CG1 
3659 C CG2 . VAL D 55  ? 0.9845 1.0868 0.7172 -0.0208 -0.0724 -0.1504 104 VAL D CG2 
3660 N N   . ASN D 56  ? 1.1048 1.1847 0.9517 0.0276  -0.0460 0.0626  105 ASN D N   
3661 C CA  . ASN D 56  ? 1.0999 1.2023 0.9818 0.0350  -0.0461 0.0775  105 ASN D CA  
3662 C C   . ASN D 56  ? 1.0959 1.2237 1.0020 0.0302  -0.0512 0.0918  105 ASN D C   
3663 O O   . ASN D 56  ? 1.0980 1.2426 1.0318 0.0321  -0.0570 0.1069  105 ASN D O   
3664 C CB  . ASN D 56  ? 1.1277 1.2199 1.0141 0.0335  -0.0587 0.0853  105 ASN D CB  
3665 C CG  . ASN D 56  ? 1.1834 1.2615 1.0621 0.0439  -0.0499 0.0760  105 ASN D CG  
3666 O OD1 . ASN D 56  ? 1.1915 1.2596 1.0526 0.0493  -0.0370 0.0611  105 ASN D OD1 
3667 N ND2 . ASN D 56  ? 1.2184 1.2954 1.1108 0.0467  -0.0570 0.0850  105 ASN D ND2 
3668 N N   . GLN D 57  ? 1.0873 1.2178 0.9828 0.0240  -0.0490 0.0870  106 GLN D N   
3669 C CA  . GLN D 57  ? 1.0655 1.2191 0.9818 0.0184  -0.0540 0.0998  106 GLN D CA  
3670 C C   . GLN D 57  ? 1.1089 1.2647 1.0382 0.0086  -0.0741 0.1155  106 GLN D C   
3671 O O   . GLN D 57  ? 1.1281 1.3077 1.0874 0.0092  -0.0775 0.1310  106 GLN D O   
3672 C CB  . GLN D 57  ? 1.0237 1.2065 0.9693 0.0308  -0.0394 0.1061  106 GLN D CB  
3673 C CG  . GLN D 57  ? 1.0108 1.1941 0.9447 0.0403  -0.0197 0.0911  106 GLN D CG  
3674 C CD  . GLN D 57  ? 0.9904 1.2023 0.9529 0.0539  -0.0051 0.0968  106 GLN D CD  
3675 O OE1 . GLN D 57  ? 0.9552 1.1759 0.9380 0.0626  -0.0039 0.1040  106 GLN D OE1 
3676 N NE2 . GLN D 57  ? 1.0151 1.2423 0.9794 0.0559  0.0059  0.0936  106 GLN D NE2 
3677 N N   . SER D 58  ? 1.1322 1.2637 1.0391 -0.0003 -0.0874 0.1115  107 SER D N   
3678 C CA  . SER D 58  ? 1.1680 1.2992 1.0847 -0.0096 -0.1072 0.1253  107 SER D CA  
3679 C C   . SER D 58  ? 1.1164 1.2250 1.0048 -0.0235 -0.1223 0.1195  107 SER D C   
3680 O O   . SER D 58  ? 1.1716 1.2854 1.0664 -0.0340 -0.1367 0.1288  107 SER D O   
3681 C CB  . SER D 58  ? 1.2509 1.3796 1.1793 -0.0030 -0.1100 0.1314  107 SER D CB  
3682 O OG  . SER D 58  ? 1.3106 1.4154 1.2135 0.0006  -0.1052 0.1175  107 SER D OG  
3683 N N   . PHE D 59  ? 1.0080 1.0916 0.8652 -0.0235 -0.1193 0.1043  108 PHE D N   
3684 C CA  . PHE D 59  ? 0.9651 1.0266 0.7940 -0.0359 -0.1334 0.0982  108 PHE D CA  
3685 C C   . PHE D 59  ? 0.9135 0.9589 0.7111 -0.0376 -0.1247 0.0803  108 PHE D C   
3686 O O   . PHE D 59  ? 0.9091 0.9503 0.6982 -0.0284 -0.1085 0.0693  108 PHE D O   
3687 C CB  . PHE D 59  ? 0.9612 1.0051 0.7801 -0.0374 -0.1443 0.0993  108 PHE D CB  
3688 C CG  . PHE D 59  ? 0.9258 0.9523 0.7251 -0.0294 -0.1329 0.0860  108 PHE D CG  
3689 C CD1 . PHE D 59  ? 0.9463 0.9802 0.7627 -0.0171 -0.1223 0.0885  108 PHE D CD1 
3690 C CD2 . PHE D 59  ? 0.9090 0.9116 0.6731 -0.0341 -0.1332 0.0711  108 PHE D CD2 
3691 C CE1 . PHE D 59  ? 0.9491 0.9666 0.7483 -0.0099 -0.1124 0.0765  108 PHE D CE1 
3692 C CE2 . PHE D 59  ? 0.9182 0.9049 0.6649 -0.0271 -0.1231 0.0595  108 PHE D CE2 
3693 C CZ  . PHE D 59  ? 0.9284 0.9224 0.6930 -0.0151 -0.1129 0.0622  108 PHE D CZ  
3694 N N   . ALA D 60  ? 0.8774 0.9136 0.6581 -0.0494 -0.1359 0.0774  109 ALA D N   
3695 C CA  . ALA D 60  ? 0.8829 0.9017 0.6318 -0.0526 -0.1303 0.0607  109 ALA D CA  
3696 C C   . ALA D 60  ? 0.9501 0.9419 0.6694 -0.0559 -0.1373 0.0515  109 ALA D C   
3697 O O   . ALA D 60  ? 0.9890 0.9712 0.6994 -0.0655 -0.1546 0.0550  109 ALA D O   
3698 C CB  . ALA D 60  ? 0.7960 0.8183 0.5417 -0.0634 -0.1390 0.0620  109 ALA D CB  
3699 N N   . PRO D 61  ? 0.9579 0.9377 0.6618 -0.0477 -0.1240 0.0396  110 PRO D N   
3700 C CA  . PRO D 61  ? 0.9952 0.9504 0.6723 -0.0496 -0.1292 0.0313  110 PRO D CA  
3701 C C   . PRO D 61  ? 1.0533 0.9907 0.7003 -0.0612 -0.1399 0.0229  110 PRO D C   
3702 O O   . PRO D 61  ? 1.0495 0.9901 0.6911 -0.0657 -0.1380 0.0185  110 PRO D O   
3703 C CB  . PRO D 61  ? 0.9466 0.8951 0.6136 -0.0389 -0.1101 0.0187  110 PRO D CB  
3704 C CG  . PRO D 61  ? 0.8771 0.8416 0.5546 -0.0347 -0.0964 0.0159  110 PRO D CG  
3705 C CD  . PRO D 61  ? 0.8805 0.8688 0.5899 -0.0366 -0.1033 0.0324  110 PRO D CD  
3706 N N   . SER D 62  ? 1.1187 1.0379 0.7467 -0.0657 -0.1511 0.0209  111 SER D N   
3707 C CA  . SER D 62  ? 1.1414 1.0422 0.7386 -0.0757 -0.1612 0.0118  111 SER D CA  
3708 C C   . SER D 62  ? 1.1487 1.0378 0.7210 -0.0732 -0.1468 -0.0052 111 SER D C   
3709 O O   . SER D 62  ? 1.1551 1.0404 0.7241 -0.0642 -0.1325 -0.0118 111 SER D O   
3710 C CB  . SER D 62  ? 1.1646 1.0491 0.7465 -0.0788 -0.1736 0.0127  111 SER D CB  
3711 O OG  . SER D 62  ? 1.2181 1.1137 0.8250 -0.0784 -0.1837 0.0282  111 SER D OG  
3712 N N   . PRO D 63  ? 1.1264 1.0095 0.6812 -0.0813 -0.1509 -0.0123 112 PRO D N   
3713 C CA  . PRO D 63  ? 1.0853 0.9580 0.6167 -0.0797 -0.1378 -0.0283 112 PRO D CA  
3714 C C   . PRO D 63  ? 1.1578 1.0084 0.6602 -0.0775 -0.1340 -0.0402 112 PRO D C   
3715 O O   . PRO D 63  ? 1.1872 1.0305 0.6741 -0.0734 -0.1200 -0.0527 112 PRO D O   
3716 C CB  . PRO D 63  ? 1.0155 0.8852 0.5347 -0.0906 -0.1480 -0.0312 112 PRO D CB  
3717 C CG  . PRO D 63  ? 1.0487 0.9197 0.5758 -0.0984 -0.1684 -0.0197 112 PRO D CG  
3718 C CD  . PRO D 63  ? 1.0977 0.9845 0.6558 -0.0921 -0.1680 -0.0055 112 PRO D CD  
3719 N N   . ASP D 64  ? 1.2191 1.0598 0.7146 -0.0802 -0.1462 -0.0361 113 ASP D N   
3720 C CA  . ASP D 64  ? 1.2335 1.0541 0.7026 -0.0784 -0.1436 -0.0459 113 ASP D CA  
3721 C C   . ASP D 64  ? 1.2005 1.0233 0.6820 -0.0673 -0.1314 -0.0444 113 ASP D C   
3722 O O   . ASP D 64  ? 1.1673 0.9753 0.6299 -0.0638 -0.1250 -0.0533 113 ASP D O   
3723 C CB  . ASP D 64  ? 1.2398 1.0490 0.6952 -0.0862 -0.1623 -0.0420 113 ASP D CB  
3724 C CG  . ASP D 64  ? 1.2928 1.1138 0.7746 -0.0856 -0.1728 -0.0258 113 ASP D CG  
3725 O OD1 . ASP D 64  ? 1.2699 1.1069 0.7746 -0.0882 -0.1784 -0.0159 113 ASP D OD1 
3726 O OD2 . ASP D 64  ? 1.3598 1.1742 0.8399 -0.0827 -0.1756 -0.0226 113 ASP D OD2 
3727 N N   . GLN D 65  ? 1.1701 1.0118 0.6840 -0.0617 -0.1285 -0.0329 114 GLN D N   
3728 C CA  . GLN D 65  ? 1.1281 0.9735 0.6574 -0.0509 -0.1186 -0.0300 114 GLN D CA  
3729 C C   . GLN D 65  ? 1.0671 0.9087 0.5885 -0.0424 -0.0991 -0.0427 114 GLN D C   
3730 O O   . GLN D 65  ? 1.0880 0.9352 0.6075 -0.0423 -0.0905 -0.0490 114 GLN D O   
3731 C CB  . GLN D 65  ? 1.0992 0.9672 0.6655 -0.0468 -0.1196 -0.0150 114 GLN D CB  
3732 C CG  . GLN D 65  ? 1.1242 0.9950 0.7072 -0.0370 -0.1144 -0.0095 114 GLN D CG  
3733 C CD  . GLN D 65  ? 1.1256 1.0044 0.7285 -0.0396 -0.1291 0.0064  114 GLN D CD  
3734 O OE1 . GLN D 65  ? 1.1247 1.0125 0.7365 -0.0472 -0.1411 0.0149  114 GLN D OE1 
3735 N NE2 . GLN D 65  ? 1.0974 0.9728 0.7077 -0.0336 -0.1287 0.0106  114 GLN D NE2 
3736 N N   . GLU D 66  ? 1.0840 0.9159 0.6011 -0.0353 -0.0926 -0.0462 115 GLU D N   
3737 C CA  . GLU D 66  ? 1.1187 0.9454 0.6279 -0.0268 -0.0748 -0.0585 115 GLU D CA  
3738 C C   . GLU D 66  ? 1.1110 0.9559 0.6501 -0.0155 -0.0623 -0.0539 115 GLU D C   
3739 O O   . GLU D 66  ? 1.1083 0.9653 0.6728 -0.0122 -0.0669 -0.0413 115 GLU D O   
3740 C CB  . GLU D 66  ? 1.1805 0.9870 0.6696 -0.0247 -0.0737 -0.0653 115 GLU D CB  
3741 C CG  . GLU D 66  ? 1.2668 1.0547 0.7227 -0.0346 -0.0830 -0.0726 115 GLU D CG  
3742 C CD  . GLU D 66  ? 1.3549 1.1241 0.7917 -0.0322 -0.0812 -0.0788 115 GLU D CD  
3743 O OE1 . GLU D 66  ? 1.3357 1.0895 0.7444 -0.0393 -0.0877 -0.0852 115 GLU D OE1 
3744 O OE2 . GLU D 66  ? 1.3824 1.1526 0.8325 -0.0231 -0.0734 -0.0771 115 GLU D OE2 
3745 N N   . VAL D 67  ? 1.0662 0.9131 0.6018 -0.0095 -0.0464 -0.0644 116 VAL D N   
3746 C CA  . VAL D 67  ? 1.0320 0.8960 0.5931 0.0020  -0.0329 -0.0623 116 VAL D CA  
3747 C C   . VAL D 67  ? 1.0619 0.9231 0.6353 0.0115  -0.0296 -0.0593 116 VAL D C   
3748 O O   . VAL D 67  ? 1.0605 0.9384 0.6627 0.0184  -0.0277 -0.0495 116 VAL D O   
3749 C CB  . VAL D 67  ? 1.0315 0.8948 0.5814 0.0065  -0.0165 -0.0763 116 VAL D CB  
3750 C CG1 . VAL D 67  ? 1.0766 0.9497 0.6452 0.0205  -0.0011 -0.0782 116 VAL D CG1 
3751 C CG2 . VAL D 67  ? 1.0022 0.8782 0.5541 0.0002  -0.0173 -0.0753 116 VAL D CG2 
3752 N N   . GLY D 68  ? 1.0660 0.9064 0.6179 0.0117  -0.0293 -0.0674 117 GLY D N   
3753 C CA  . GLY D 68  ? 1.0768 0.9122 0.6379 0.0204  -0.0262 -0.0657 117 GLY D CA  
3754 C C   . GLY D 68  ? 1.1092 0.9523 0.6916 0.0194  -0.0388 -0.0498 117 GLY D C   
3755 O O   . GLY D 68  ? 1.1341 0.9864 0.7402 0.0288  -0.0345 -0.0438 117 GLY D O   
3756 N N   . THR D 69  ? 1.1277 0.9671 0.7014 0.0083  -0.0546 -0.0433 118 THR D N   
3757 C CA  . THR D 69  ? 1.0942 0.9404 0.6861 0.0059  -0.0683 -0.0280 118 THR D CA  
3758 C C   . THR D 69  ? 1.0809 0.9520 0.7067 0.0104  -0.0665 -0.0167 118 THR D C   
3759 O O   . THR D 69  ? 1.0473 0.9273 0.6968 0.0160  -0.0688 -0.0062 118 THR D O   
3760 C CB  . THR D 69  ? 1.1125 0.9509 0.6872 -0.0075 -0.0855 -0.0243 118 THR D CB  
3761 O OG1 . THR D 69  ? 1.1195 0.9357 0.6618 -0.0115 -0.0865 -0.0351 118 THR D OG1 
3762 C CG2 . THR D 69  ? 1.1490 0.9931 0.7410 -0.0099 -0.1001 -0.0088 118 THR D CG2 
3763 N N   . LEU D 70  ? 1.0758 0.9584 0.7039 0.0080  -0.0625 -0.0186 119 LEU D N   
3764 C CA  . LEU D 70  ? 1.0315 0.9391 0.6907 0.0118  -0.0602 -0.0081 119 LEU D CA  
3765 C C   . LEU D 70  ? 1.0802 0.9984 0.7600 0.0262  -0.0449 -0.0093 119 LEU D C   
3766 O O   . LEU D 70  ? 1.0901 1.0273 0.7996 0.0316  -0.0447 0.0022  119 LEU D O   
3767 C CB  . LEU D 70  ? 0.9568 0.8734 0.6118 0.0060  -0.0582 -0.0111 119 LEU D CB  
3768 C CG  . LEU D 70  ? 0.9072 0.8201 0.5512 -0.0079 -0.0751 -0.0063 119 LEU D CG  
3769 C CD1 . LEU D 70  ? 0.8444 0.7634 0.4813 -0.0129 -0.0714 -0.0118 119 LEU D CD1 
3770 C CD2 . LEU D 70  ? 0.8304 0.7576 0.5004 -0.0106 -0.0883 0.0113  119 LEU D CD2 
3771 N N   . TYR D 71  ? 1.0831 0.9889 0.7472 0.0325  -0.0321 -0.0233 120 TYR D N   
3772 C CA  . TYR D 71  ? 1.1142 1.0279 0.7953 0.0467  -0.0174 -0.0263 120 TYR D CA  
3773 C C   . TYR D 71  ? 1.1231 1.0352 0.8206 0.0526  -0.0220 -0.0179 120 TYR D C   
3774 O O   . TYR D 71  ? 1.1380 1.0667 0.8634 0.0620  -0.0170 -0.0108 120 TYR D O   
3775 C CB  . TYR D 71  ? 1.1291 1.0284 0.7882 0.0517  -0.0036 -0.0438 120 TYR D CB  
3776 C CG  . TYR D 71  ? 1.1463 1.0500 0.8208 0.0666  0.0103  -0.0480 120 TYR D CG  
3777 C CD1 . TYR D 71  ? 1.1651 1.0907 0.8620 0.0757  0.0215  -0.0465 120 TYR D CD1 
3778 C CD2 . TYR D 71  ? 1.1779 1.0644 0.8449 0.0717  0.0119  -0.0532 120 TYR D CD2 
3779 C CE1 . TYR D 71  ? 1.2013 1.1313 0.9122 0.0899  0.0340  -0.0509 120 TYR D CE1 
3780 C CE2 . TYR D 71  ? 1.2021 1.0921 0.8836 0.0855  0.0240  -0.0573 120 TYR D CE2 
3781 C CZ  . TYR D 71  ? 1.2215 1.1331 0.9247 0.0947  0.0350  -0.0565 120 TYR D CZ  
3782 O OH  . TYR D 71  ? 1.2208 1.1360 0.9382 0.1090  0.0468  -0.0612 120 TYR D OH  
3783 N N   . GLU D 72  ? 1.1094 1.0020 0.7897 0.0471  -0.0317 -0.0184 121 GLU D N   
3784 C CA  . GLU D 72  ? 1.1785 1.0675 0.8722 0.0520  -0.0365 -0.0108 121 GLU D CA  
3785 C C   . GLU D 72  ? 1.1744 1.0815 0.8963 0.0507  -0.0470 0.0068  121 GLU D C   
3786 O O   . GLU D 72  ? 1.2255 1.1375 0.9682 0.0581  -0.0475 0.0144  121 GLU D O   
3787 C CB  . GLU D 72  ? 1.2566 1.1218 0.9247 0.0453  -0.0455 -0.0143 121 GLU D CB  
3788 C CG  . GLU D 72  ? 1.3285 1.1749 0.9707 0.0478  -0.0351 -0.0308 121 GLU D CG  
3789 C CD  . GLU D 72  ? 1.4160 1.2405 1.0371 0.0428  -0.0434 -0.0326 121 GLU D CD  
3790 O OE1 . GLU D 72  ? 1.4585 1.2665 1.0554 0.0426  -0.0371 -0.0454 121 GLU D OE1 
3791 O OE2 . GLU D 72  ? 1.4306 1.2549 1.0595 0.0392  -0.0562 -0.0209 121 GLU D OE2 
3792 N N   . CYS D 73  ? 1.1143 1.0311 0.8374 0.0414  -0.0556 0.0133  122 CYS D N   
3793 C CA  . CYS D 73  ? 1.1022 1.0355 0.8507 0.0386  -0.0671 0.0303  122 CYS D CA  
3794 C C   . CYS D 73  ? 1.0894 1.0490 0.8662 0.0447  -0.0594 0.0366  122 CYS D C   
3795 O O   . CYS D 73  ? 1.0886 1.0640 0.8933 0.0481  -0.0637 0.0501  122 CYS D O   
3796 C CB  . CYS D 73  ? 1.1290 1.0569 0.8632 0.0240  -0.0840 0.0354  122 CYS D CB  
3797 S SG  . CYS D 73  ? 1.1090 1.0108 0.8164 0.0163  -0.0971 0.0334  122 CYS D SG  
3798 N N   . PHE D 74  ? 1.0681 1.0328 0.8379 0.0461  -0.0481 0.0273  123 PHE D N   
3799 C CA  . PHE D 74  ? 1.0599 1.0506 0.8545 0.0505  -0.0415 0.0336  123 PHE D CA  
3800 C C   . PHE D 74  ? 1.1292 1.1259 0.9246 0.0617  -0.0220 0.0219  123 PHE D C   
3801 O O   . PHE D 74  ? 1.0959 1.1138 0.9079 0.0652  -0.0148 0.0250  123 PHE D O   
3802 C CB  . PHE D 74  ? 0.9777 0.9751 0.7678 0.0382  -0.0509 0.0383  123 PHE D CB  
3803 C CG  . PHE D 74  ? 0.9455 0.9344 0.7298 0.0263  -0.0705 0.0474  123 PHE D CG  
3804 C CD1 . PHE D 74  ? 0.9048 0.9074 0.7151 0.0255  -0.0810 0.0640  123 PHE D CD1 
3805 C CD2 . PHE D 74  ? 0.9231 0.8907 0.6759 0.0160  -0.0786 0.0394  123 PHE D CD2 
3806 C CE1 . PHE D 74  ? 0.8429 0.8378 0.6476 0.0147  -0.0993 0.0721  123 PHE D CE1 
3807 C CE2 . PHE D 74  ? 0.8646 0.8248 0.6114 0.0054  -0.0967 0.0473  123 PHE D CE2 
3808 C CZ  . PHE D 74  ? 0.8750 0.8486 0.6477 0.0048  -0.1072 0.0636  123 PHE D CZ  
3809 N N   . GLY D 75  ? 1.2033 1.1821 0.9813 0.0674  -0.0135 0.0087  124 GLY D N   
3810 C CA  . GLY D 75  ? 1.2152 1.1976 0.9919 0.0782  0.0046  -0.0036 124 GLY D CA  
3811 C C   . GLY D 75  ? 1.2411 1.2374 1.0452 0.0931  0.0140  -0.0001 124 GLY D C   
3812 O O   . GLY D 75  ? 1.2607 1.2536 1.0766 0.0964  0.0081  0.0069  124 GLY D O   
3813 N N   . SER D 76  ? 1.2643 1.2768 1.0788 0.1023  0.0285  -0.0049 125 SER D N   
3814 C CA  . SER D 76  ? 1.2864 1.3133 1.1263 0.1176  0.0389  -0.0032 125 SER D CA  
3815 C C   . SER D 76  ? 1.2566 1.2852 1.0896 0.1279  0.0570  -0.0183 125 SER D C   
3816 O O   . SER D 76  ? 1.2174 1.2460 1.0343 0.1231  0.0619  -0.0259 125 SER D O   
3817 C CB  . SER D 76  ? 1.3144 1.3701 1.1867 0.1194  0.0360  0.0131  125 SER D CB  
3818 O OG  . SER D 76  ? 1.3473 1.4165 1.2449 0.1343  0.0447  0.0157  125 SER D OG  
3819 N N   . ASP D 77  ? 1.2934 1.3232 1.1386 0.1421  0.0665  -0.0226 126 ASP D N   
3820 C CA  . ASP D 77  ? 1.3316 1.3635 1.1725 0.1538  0.0838  -0.0371 126 ASP D CA  
3821 C C   . ASP D 77  ? 1.2803 1.2878 1.0869 0.1491  0.0878  -0.0537 126 ASP D C   
3822 O O   . ASP D 77  ? 1.2553 1.2657 1.0537 0.1547  0.1009  -0.0655 126 ASP D O   
3823 C CB  . ASP D 77  ? 1.4039 1.4642 1.2608 0.1581  0.0931  -0.0340 126 ASP D CB  
3824 C CG  . ASP D 77  ? 1.4694 1.5556 1.3620 0.1662  0.0927  -0.0195 126 ASP D CG  
3825 O OD1 . ASP D 77  ? 1.4996 1.5829 1.4057 0.1753  0.0926  -0.0177 126 ASP D OD1 
3826 O OD2 . ASP D 77  ? 1.4712 1.5808 1.3787 0.1636  0.0924  -0.0098 126 ASP D OD2 
3827 N N   . GLY D 78  ? 1.2700 1.2542 1.0568 0.1390  0.0766  -0.0544 127 GLY D N   
3828 C CA  . GLY D 78  ? 1.2677 1.2279 1.0217 0.1341  0.0792  -0.0692 127 GLY D CA  
3829 C C   . GLY D 78  ? 1.2420 1.2019 0.9763 0.1224  0.0776  -0.0725 127 GLY D C   
3830 O O   . GLY D 78  ? 1.2280 1.1733 0.9373 0.1204  0.0838  -0.0862 127 GLY D O   
3831 N N   . LYS D 79  ? 1.2093 1.1851 0.9551 0.1145  0.0690  -0.0598 128 LYS D N   
3832 C CA  . LYS D 79  ? 1.1647 1.1410 0.8939 0.1028  0.0659  -0.0615 128 LYS D CA  
3833 C C   . LYS D 79  ? 1.0928 1.0774 0.8308 0.0910  0.0500  -0.0461 128 LYS D C   
3834 O O   . LYS D 79  ? 1.0948 1.0890 0.8552 0.0928  0.0426  -0.0330 128 LYS D O   
3835 C CB  . LYS D 79  ? 1.1448 1.1392 0.8793 0.1089  0.0804  -0.0673 128 LYS D CB  
3836 C CG  . LYS D 79  ? 1.1564 1.1794 0.9249 0.1196  0.0866  -0.0575 128 LYS D CG  
3837 C CD  . LYS D 79  ? 1.1409 1.1800 0.9120 0.1274  0.1026  -0.0654 128 LYS D CD  
3838 C CE  . LYS D 79  ? 1.1191 1.1878 0.9239 0.1389  0.1094  -0.0559 128 LYS D CE  
3839 N NZ  . LYS D 79  ? 1.0993 1.1871 0.9242 0.1312  0.0983  -0.0379 128 LYS D NZ  
3840 N N   . LEU D 80  ? 1.0022 0.9823 0.7222 0.0790  0.0444  -0.0479 129 LEU D N   
3841 C CA  . LEU D 80  ? 0.9731 0.9602 0.6993 0.0671  0.0290  -0.0346 129 LEU D CA  
3842 C C   . LEU D 80  ? 0.9670 0.9745 0.7016 0.0639  0.0322  -0.0312 129 LEU D C   
3843 O O   . LEU D 80  ? 1.0045 1.0058 0.7189 0.0588  0.0361  -0.0409 129 LEU D O   
3844 C CB  . LEU D 80  ? 0.9739 0.9367 0.6711 0.0542  0.0163  -0.0385 129 LEU D CB  
3845 C CG  . LEU D 80  ? 0.9175 0.8843 0.6162 0.0408  -0.0005 -0.0270 129 LEU D CG  
3846 C CD1 . LEU D 80  ? 0.9471 0.9203 0.6674 0.0406  -0.0125 -0.0116 129 LEU D CD1 
3847 C CD2 . LEU D 80  ? 0.8386 0.7824 0.5039 0.0290  -0.0090 -0.0352 129 LEU D CD2 
3848 N N   . VAL D 81  ? 0.9248 0.9571 0.6898 0.0667  0.0304  -0.0171 130 VAL D N   
3849 C CA  . VAL D 81  ? 0.8628 0.9165 0.6391 0.0634  0.0324  -0.0115 130 VAL D CA  
3850 C C   . VAL D 81  ? 0.8764 0.9263 0.6449 0.0476  0.0158  -0.0042 130 VAL D C   
3851 O O   . VAL D 81  ? 0.8305 0.8782 0.6067 0.0418  0.0014  0.0068  130 VAL D O   
3852 C CB  . VAL D 81  ? 0.8194 0.9027 0.6324 0.0724  0.0367  0.0018  130 VAL D CB  
3853 C CG1 . VAL D 81  ? 0.8042 0.9100 0.6301 0.0669  0.0356  0.0103  130 VAL D CG1 
3854 C CG2 . VAL D 81  ? 0.8271 0.9167 0.6477 0.0886  0.0544  -0.0066 130 VAL D CG2 
3855 N N   . LEU D 82  ? 0.9224 0.9714 0.6757 0.0408  0.0179  -0.0106 131 LEU D N   
3856 C CA  . LEU D 82  ? 0.8904 0.9378 0.6378 0.0263  0.0029  -0.0041 131 LEU D CA  
3857 C C   . LEU D 82  ? 0.8835 0.9551 0.6470 0.0247  0.0068  0.0022  131 LEU D C   
3858 O O   . LEU D 82  ? 0.9071 0.9844 0.6651 0.0295  0.0207  -0.0068 131 LEU D O   
3859 C CB  . LEU D 82  ? 0.8419 0.8624 0.5527 0.0174  -0.0011 -0.0176 131 LEU D CB  
3860 C CG  . LEU D 82  ? 0.8655 0.8603 0.5561 0.0171  -0.0058 -0.0245 131 LEU D CG  
3861 C CD1 . LEU D 82  ? 0.8449 0.8165 0.5007 0.0072  -0.0105 -0.0364 131 LEU D CD1 
3862 C CD2 . LEU D 82  ? 0.9081 0.9033 0.6130 0.0139  -0.0209 -0.0107 131 LEU D CD2 
3863 N N   . HIS D 83  ? 0.8690 0.9554 0.6528 0.0180  -0.0057 0.0180  132 HIS D N   
3864 C CA  . HIS D 83  ? 0.8074 0.9163 0.6065 0.0144  -0.0046 0.0255  132 HIS D CA  
3865 C C   . HIS D 83  ? 0.8214 0.9178 0.6004 -0.0003 -0.0165 0.0229  132 HIS D C   
3866 O O   . HIS D 83  ? 0.8129 0.8931 0.5810 -0.0095 -0.0322 0.0251  132 HIS D O   
3867 C CB  . HIS D 83  ? 0.7753 0.9092 0.6101 0.0157  -0.0111 0.0449  132 HIS D CB  
3868 C CG  . HIS D 83  ? 0.8361 0.9878 0.6942 0.0309  0.0022  0.0482  132 HIS D CG  
3869 N ND1 . HIS D 83  ? 0.8419 1.0212 0.7217 0.0384  0.0141  0.0532  132 HIS D ND1 
3870 C CD2 . HIS D 83  ? 0.8845 1.0304 0.7474 0.0402  0.0054  0.0471  132 HIS D CD2 
3871 C CE1 . HIS D 83  ? 0.8529 1.0428 0.7496 0.0520  0.0242  0.0546  132 HIS D CE1 
3872 N NE2 . HIS D 83  ? 0.8653 1.0350 0.7525 0.0533  0.0190  0.0510  132 HIS D NE2 
3873 N N   . TYR D 84  ? 0.7867 0.8907 0.5608 -0.0024 -0.0092 0.0181  133 TYR D N   
3874 C CA  . TYR D 84  ? 0.8248 0.9188 0.5818 -0.0161 -0.0202 0.0159  133 TYR D CA  
3875 C C   . TYR D 84  ? 0.8342 0.9532 0.6146 -0.0212 -0.0240 0.0291  133 TYR D C   
3876 O O   . TYR D 84  ? 0.8486 0.9925 0.6522 -0.0130 -0.0128 0.0353  133 TYR D O   
3877 C CB  . TYR D 84  ? 0.8651 0.9405 0.5899 -0.0167 -0.0109 -0.0028 133 TYR D CB  
3878 C CG  . TYR D 84  ? 0.8684 0.9581 0.5972 -0.0070 0.0090  -0.0096 133 TYR D CG  
3879 C CD1 . TYR D 84  ? 0.8658 0.9547 0.5944 0.0064  0.0240  -0.0174 133 TYR D CD1 
3880 C CD2 . TYR D 84  ? 0.8686 0.9722 0.6010 -0.0110 0.0124  -0.0085 133 TYR D CD2 
3881 C CE1 . TYR D 84  ? 0.8546 0.9566 0.5864 0.0157  0.0419  -0.0241 133 TYR D CE1 
3882 C CE2 . TYR D 84  ? 0.9035 1.0208 0.6391 -0.0020 0.0306  -0.0147 133 TYR D CE2 
3883 C CZ  . TYR D 84  ? 0.8712 0.9876 0.6061 0.0115  0.0453  -0.0227 133 TYR D CZ  
3884 O OH  . TYR D 84  ? 0.8094 0.9395 0.5471 0.0209  0.0632  -0.0294 133 TYR D OH  
3885 N N   . CYS D 85  ? 0.8556 0.9681 0.6299 -0.0346 -0.0402 0.0334  134 CYS D N   
3886 C CA  . CYS D 85  ? 0.8315 0.9660 0.6292 -0.0411 -0.0474 0.0477  134 CYS D CA  
3887 C C   . CYS D 85  ? 0.8719 0.9918 0.6525 -0.0560 -0.0633 0.0460  134 CYS D C   
3888 O O   . CYS D 85  ? 0.8770 0.9726 0.6352 -0.0620 -0.0741 0.0394  134 CYS D O   
3889 C CB  . CYS D 85  ? 0.7790 0.9307 0.6082 -0.0394 -0.0560 0.0659  134 CYS D CB  
3890 S SG  . CYS D 85  ? 0.9221 1.1049 0.7857 -0.0457 -0.0639 0.0859  134 CYS D SG  
3891 N N   . LYS D 86  ? 0.9183 1.0535 0.7096 -0.0618 -0.0648 0.0519  135 LYS D N   
3892 C CA  . LYS D 86  ? 0.9569 1.0797 0.7342 -0.0758 -0.0802 0.0507  135 LYS D CA  
3893 C C   . LYS D 86  ? 0.9496 1.0782 0.7461 -0.0848 -0.1008 0.0670  135 LYS D C   
3894 O O   . LYS D 86  ? 1.0063 1.1234 0.7924 -0.0967 -0.1164 0.0670  135 LYS D O   
3895 C CB  . LYS D 86  ? 1.0088 1.1431 0.7868 -0.0787 -0.0731 0.0486  135 LYS D CB  
3896 C CG  . LYS D 86  ? 1.0463 1.1685 0.7977 -0.0735 -0.0566 0.0300  135 LYS D CG  
3897 C CD  . LYS D 86  ? 1.0467 1.1652 0.7851 -0.0827 -0.0590 0.0246  135 LYS D CD  
3898 C CE  . LYS D 86  ? 1.0584 1.2051 0.8266 -0.0862 -0.0613 0.0401  135 LYS D CE  
3899 N NZ  . LYS D 86  ? 1.0878 1.2305 0.8442 -0.0958 -0.0650 0.0355  135 LYS D NZ  
3900 N N   . SER D 87  ? 0.9063 1.0527 0.7309 -0.0789 -0.1010 0.0808  136 SER D N   
3901 C CA  . SER D 87  ? 0.9190 1.0716 0.7634 -0.0865 -0.1201 0.0969  136 SER D CA  
3902 C C   . SER D 87  ? 0.9306 1.0789 0.7811 -0.0805 -0.1230 0.1011  136 SER D C   
3903 O O   . SER D 87  ? 0.9050 1.0494 0.7490 -0.0697 -0.1090 0.0931  136 SER D O   
3904 C CB  . SER D 87  ? 0.9141 1.0985 0.7940 -0.0871 -0.1201 0.1142  136 SER D CB  
3905 O OG  . SER D 87  ? 0.9350 1.1413 0.8360 -0.0739 -0.1034 0.1191  136 SER D OG  
3906 N N   . GLN D 88  ? 0.9777 1.1265 0.8409 -0.0877 -0.1414 0.1136  137 GLN D N   
3907 C CA  . GLN D 88  ? 1.0238 1.1689 0.8939 -0.0831 -0.1459 0.1189  137 GLN D CA  
3908 C C   . GLN D 88  ? 0.9897 1.1623 0.8934 -0.0721 -0.1350 0.1313  137 GLN D C   
3909 O O   . GLN D 88  ? 1.0260 1.2189 0.9590 -0.0748 -0.1433 0.1484  137 GLN D O   
3910 C CB  . GLN D 88  ? 1.0928 1.2299 0.9655 -0.0944 -0.1696 0.1283  137 GLN D CB  
3911 C CG  . GLN D 88  ? 1.1840 1.3153 1.0617 -0.0909 -0.1760 0.1336  137 GLN D CG  
3912 C CD  . GLN D 88  ? 1.2328 1.3592 1.1159 -0.1021 -0.1997 0.1442  137 GLN D CD  
3913 O OE1 . GLN D 88  ? 1.2370 1.3692 1.1375 -0.1003 -0.2069 0.1556  137 GLN D OE1 
3914 N NE2 . GLN D 88  ? 1.2408 1.3561 1.1090 -0.1136 -0.2122 0.1404  137 GLN D NE2 
3915 N N   . ALA D 89  ? 0.9102 1.0835 0.8096 -0.0595 -0.1165 0.1225  138 ALA D N   
3916 C CA  . ALA D 89  ? 0.8565 1.0551 0.7855 -0.0474 -0.1043 0.1320  138 ALA D CA  
3917 C C   . ALA D 89  ? 0.9420 1.1448 0.8906 -0.0461 -0.1147 0.1452  138 ALA D C   
3918 O O   . ALA D 89  ? 0.9561 1.1843 0.9371 -0.0423 -0.1143 0.1607  138 ALA D O   
3919 C CB  . ALA D 89  ? 0.8131 1.0078 0.7299 -0.0344 -0.0834 0.1178  138 ALA D CB  
3920 N N   . TRP D 90  ? 1.0056 1.1838 0.9344 -0.0491 -0.1241 0.1392  139 TRP D N   
3921 C CA  . TRP D 90  ? 0.9995 1.1787 0.9435 -0.0481 -0.1346 0.1505  139 TRP D CA  
3922 C C   . TRP D 90  ? 1.0483 1.2037 0.9724 -0.0600 -0.1546 0.1490  139 TRP D C   
3923 O O   . TRP D 90  ? 1.0833 1.2163 0.9760 -0.0654 -0.1564 0.1349  139 TRP D O   
3924 C CB  . TRP D 90  ? 0.9933 1.1702 0.9380 -0.0344 -0.1208 0.1451  139 TRP D CB  
3925 C CG  . TRP D 90  ? 1.0180 1.2176 0.9806 -0.0219 -0.1008 0.1452  139 TRP D CG  
3926 C CD1 . TRP D 90  ? 1.0231 1.2527 1.0205 -0.0168 -0.0974 0.1604  139 TRP D CD1 
3927 C CD2 . TRP D 90  ? 1.0079 1.2025 0.9543 -0.0128 -0.0818 0.1294  139 TRP D CD2 
3928 N NE1 . TRP D 90  ? 0.9946 1.2386 0.9982 -0.0048 -0.0772 0.1548  139 TRP D NE1 
3929 C CE2 . TRP D 90  ? 0.9825 1.2052 0.9551 -0.0022 -0.0675 0.1357  139 TRP D CE2 
3930 C CE3 . TRP D 90  ? 1.0247 1.1942 0.9371 -0.0125 -0.0755 0.1106  139 TRP D CE3 
3931 C CZ2 . TRP D 90  ? 0.9828 1.2088 0.9483 0.0087  -0.0475 0.1235  139 TRP D CZ2 
3932 C CZ3 . TRP D 90  ? 1.0147 1.1872 0.9206 -0.0020 -0.0558 0.0988  139 TRP D CZ3 
3933 C CH2 . TRP D 90  ? 1.0005 1.2009 0.9326 0.0085  -0.0421 0.1050  139 TRP D CH2 
3934 N N   . GLY D 91  ? 1.0467 1.2074 0.9890 -0.0639 -0.1696 0.1634  140 GLY D N   
3935 C CA  . GLY D 91  ? 1.0822 1.2237 1.0089 -0.0756 -0.1902 0.1639  140 GLY D CA  
3936 C C   . GLY D 91  ? 1.1738 1.3012 1.0945 -0.0732 -0.1966 0.1644  140 GLY D C   
3937 O O   . GLY D 91  ? 1.1959 1.3186 1.1198 -0.0811 -0.2149 0.1730  140 GLY D O   
3938 N N   . ASP E 3   ? 1.1816 1.5405 1.1101 0.1227  -0.1386 0.0040  3   ASP E N   
3939 C CA  . ASP E 3   ? 1.1524 1.5265 1.0833 0.1353  -0.1373 0.0038  3   ASP E CA  
3940 C C   . ASP E 3   ? 1.1173 1.4811 1.0528 0.1326  -0.1301 0.0081  3   ASP E C   
3941 O O   . ASP E 3   ? 1.0925 1.4256 1.0216 0.1293  -0.1259 0.0087  3   ASP E O   
3942 C CB  . ASP E 3   ? 1.1562 1.5730 1.0998 0.1363  -0.1413 0.0040  3   ASP E CB  
3943 C CG  . ASP E 3   ? 1.1515 1.5867 1.1095 0.1192  -0.1401 0.0085  3   ASP E CG  
3944 O OD1 . ASP E 3   ? 1.1407 1.5624 1.0972 0.1068  -0.1406 0.0093  3   ASP E OD1 
3945 O OD2 . ASP E 3   ? 1.1353 1.5973 1.1050 0.1178  -0.1384 0.0111  3   ASP E OD2 
3946 N N   . ASP E 4   ? 1.0558 1.4462 1.0025 0.1340  -0.1286 0.0108  4   ASP E N   
3947 C CA  . ASP E 4   ? 0.9410 1.3256 0.8928 0.1315  -0.1224 0.0151  4   ASP E CA  
3948 C C   . ASP E 4   ? 0.8677 1.2488 0.8277 0.1147  -0.1199 0.0202  4   ASP E C   
3949 O O   . ASP E 4   ? 0.8880 1.2525 0.8488 0.1112  -0.1150 0.0234  4   ASP E O   
3950 C CB  . ASP E 4   ? 0.9596 1.3736 0.9194 0.1390  -0.1219 0.0162  4   ASP E CB  
3951 C CG  . ASP E 4   ? 1.0007 1.4118 0.9505 0.1566  -0.1229 0.0118  4   ASP E CG  
3952 O OD1 . ASP E 4   ? 1.0155 1.4545 0.9693 0.1648  -0.1255 0.0103  4   ASP E OD1 
3953 O OD2 . ASP E 4   ? 0.9906 1.3711 0.9278 0.1622  -0.1207 0.0096  4   ASP E OD2 
3954 N N   . LYS E 5   ? 0.8028 1.1992 0.7682 0.1043  -0.1234 0.0208  5   LYS E N   
3955 C CA  . LYS E 5   ? 0.7790 1.1718 0.7505 0.0877  -0.1212 0.0256  5   LYS E CA  
3956 C C   . LYS E 5   ? 0.7917 1.1478 0.7544 0.0819  -0.1195 0.0254  5   LYS E C   
3957 O O   . LYS E 5   ? 0.8179 1.1597 0.7826 0.0729  -0.1157 0.0295  5   LYS E O   
3958 C CB  . LYS E 5   ? 0.7846 1.2058 0.7641 0.0773  -0.1252 0.0260  5   LYS E CB  
3959 C CG  . LYS E 5   ? 0.8677 1.2843 0.8517 0.0594  -0.1228 0.0311  5   LYS E CG  
3960 C CD  . LYS E 5   ? 0.9648 1.4137 0.9577 0.0484  -0.1257 0.0316  5   LYS E CD  
3961 C CE  . LYS E 5   ? 1.0546 1.4954 1.0494 0.0300  -0.1230 0.0368  5   LYS E CE  
3962 N NZ  . LYS E 5   ? 1.1085 1.5807 1.1113 0.0175  -0.1252 0.0371  5   LYS E NZ  
3963 N N   . ASP E 6   ? 0.8072 1.1477 0.7596 0.0874  -0.1223 0.0205  6   ASP E N   
3964 C CA  . ASP E 6   ? 0.8181 1.1235 0.7612 0.0829  -0.1205 0.0195  6   ASP E CA  
3965 C C   . ASP E 6   ? 0.7763 1.0582 0.7162 0.0879  -0.1147 0.0203  6   ASP E C   
3966 O O   . ASP E 6   ? 0.7926 1.0494 0.7296 0.0814  -0.1115 0.0213  6   ASP E O   
3967 C CB  . ASP E 6   ? 0.9211 1.2152 0.8524 0.0889  -0.1247 0.0137  6   ASP E CB  
3968 C CG  . ASP E 6   ? 1.0582 1.3735 0.9924 0.0827  -0.1308 0.0125  6   ASP E CG  
3969 O OD1 . ASP E 6   ? 1.0538 1.3784 0.9956 0.0688  -0.1308 0.0160  6   ASP E OD1 
3970 O OD2 . ASP E 6   ? 1.1376 1.4598 1.0656 0.0917  -0.1358 0.0080  6   ASP E OD2 
3971 N N   . VAL E 7   ? 0.7190 1.0096 0.6595 0.0997  -0.1133 0.0195  7   VAL E N   
3972 C CA  . VAL E 7   ? 0.7083 0.9804 0.6467 0.1045  -0.1079 0.0201  7   VAL E CA  
3973 C C   . VAL E 7   ? 0.7324 1.0090 0.6812 0.0955  -0.1046 0.0261  7   VAL E C   
3974 O O   . VAL E 7   ? 0.7374 0.9923 0.6851 0.0932  -0.1006 0.0273  7   VAL E O   
3975 C CB  . VAL E 7   ? 0.6909 0.9718 0.6262 0.1190  -0.1075 0.0177  7   VAL E CB  
3976 C CG1 . VAL E 7   ? 0.6790 0.9431 0.6131 0.1228  -0.1019 0.0183  7   VAL E CG1 
3977 C CG2 . VAL E 7   ? 0.7136 0.9858 0.6359 0.1284  -0.1108 0.0117  7   VAL E CG2 
3978 N N   . LEU E 8   ? 0.7149 1.0197 0.6733 0.0905  -0.1064 0.0298  8   LEU E N   
3979 C CA  . LEU E 8   ? 0.6753 0.9850 0.6420 0.0812  -0.1037 0.0358  8   LEU E CA  
3980 C C   . LEU E 8   ? 0.6430 0.9315 0.6079 0.0686  -0.1029 0.0379  8   LEU E C   
3981 O O   . LEU E 8   ? 0.6262 0.8999 0.5923 0.0648  -0.0995 0.0413  8   LEU E O   
3982 C CB  . LEU E 8   ? 0.6268 0.9713 0.6029 0.0769  -0.1057 0.0387  8   LEU E CB  
3983 C CG  . LEU E 8   ? 0.5822 0.9509 0.5618 0.0885  -0.1060 0.0375  8   LEU E CG  
3984 C CD1 . LEU E 8   ? 0.5441 0.9478 0.5337 0.0823  -0.1076 0.0401  8   LEU E CD1 
3985 C CD2 . LEU E 8   ? 0.4917 0.8503 0.4712 0.0950  -0.1016 0.0393  8   LEU E CD2 
3986 N N   . ARG E 9   ? 0.6328 0.9194 0.5940 0.0627  -0.1062 0.0357  9   ARG E N   
3987 C CA  . ARG E 9   ? 0.6699 0.9363 0.6282 0.0505  -0.1057 0.0374  9   ARG E CA  
3988 C C   . ARG E 9   ? 0.7026 0.9347 0.6533 0.0540  -0.1024 0.0351  9   ARG E C   
3989 O O   . ARG E 9   ? 0.7781 0.9922 0.7286 0.0471  -0.0998 0.0379  9   ARG E O   
3990 C CB  . ARG E 9   ? 0.7047 0.9785 0.6604 0.0435  -0.1102 0.0351  9   ARG E CB  
3991 C CG  . ARG E 9   ? 0.7616 1.0714 0.7258 0.0388  -0.1134 0.0368  9   ARG E CG  
3992 C CD  . ARG E 9   ? 0.8281 1.1458 0.7903 0.0309  -0.1181 0.0343  9   ARG E CD  
3993 N NE  . ARG E 9   ? 0.9201 1.2158 0.8778 0.0172  -0.1171 0.0362  9   ARG E NE  
3994 C CZ  . ARG E 9   ? 1.0111 1.3131 0.9726 0.0030  -0.1162 0.0408  9   ARG E CZ  
3995 N NH1 . ARG E 9   ? 1.0576 1.3884 1.0280 0.0000  -0.1160 0.0438  9   ARG E NH1 
3996 N NH2 . ARG E 9   ? 1.0173 1.2960 0.9727 -0.0085 -0.1153 0.0422  9   ARG E NH2 
3997 N N   . ASP E 10  ? 0.7046 0.9277 0.6486 0.0650  -0.1025 0.0298  10  ASP E N   
3998 C CA  . ASP E 10  ? 0.7159 0.9078 0.6525 0.0684  -0.0989 0.0266  10  ASP E CA  
3999 C C   . ASP E 10  ? 0.6549 0.8397 0.5960 0.0716  -0.0943 0.0290  10  ASP E C   
4000 O O   . ASP E 10  ? 0.6994 0.8612 0.6386 0.0690  -0.0911 0.0288  10  ASP E O   
4001 C CB  . ASP E 10  ? 0.7853 0.9692 0.7121 0.0790  -0.0998 0.0203  10  ASP E CB  
4002 C CG  . ASP E 10  ? 0.8416 1.0217 0.7610 0.0754  -0.1039 0.0172  10  ASP E CG  
4003 O OD1 . ASP E 10  ? 0.8510 1.0292 0.7722 0.0639  -0.1053 0.0194  10  ASP E OD1 
4004 O OD2 . ASP E 10  ? 0.8427 1.0206 0.7535 0.0840  -0.1059 0.0124  10  ASP E OD2 
4005 N N   . VAL E 11  ? 0.5909 0.7961 0.5380 0.0776  -0.0940 0.0311  11  VAL E N   
4006 C CA  . VAL E 11  ? 0.5858 0.7869 0.5375 0.0804  -0.0902 0.0336  11  VAL E CA  
4007 C C   . VAL E 11  ? 0.5959 0.7947 0.5531 0.0697  -0.0895 0.0395  11  VAL E C   
4008 O O   . VAL E 11  ? 0.6338 0.8147 0.5913 0.0691  -0.0866 0.0405  11  VAL E O   
4009 C CB  . VAL E 11  ? 0.5708 0.7950 0.5270 0.0889  -0.0902 0.0346  11  VAL E CB  
4010 C CG1 . VAL E 11  ? 0.4209 0.6445 0.3831 0.0894  -0.0870 0.0385  11  VAL E CG1 
4011 C CG2 . VAL E 11  ? 0.4913 0.7113 0.4398 0.1008  -0.0899 0.0286  11  VAL E CG2 
4012 N N   . TRP E 12  ? 0.6096 0.8264 0.5705 0.0612  -0.0923 0.0432  12  TRP E N   
4013 C CA  . TRP E 12  ? 0.6136 0.8290 0.5777 0.0499  -0.0919 0.0491  12  TRP E CA  
4014 C C   . TRP E 12  ? 0.6639 0.8506 0.6224 0.0430  -0.0910 0.0488  12  TRP E C   
4015 O O   . TRP E 12  ? 0.6921 0.8653 0.6512 0.0395  -0.0890 0.0522  12  TRP E O   
4016 C CB  . TRP E 12  ? 0.5959 0.8364 0.5637 0.0412  -0.0950 0.0520  12  TRP E CB  
4017 C CG  . TRP E 12  ? 0.5718 0.8097 0.5406 0.0282  -0.0945 0.0580  12  TRP E CG  
4018 C CD1 . TRP E 12  ? 0.5783 0.8011 0.5423 0.0167  -0.0952 0.0591  12  TRP E CD1 
4019 C CD2 . TRP E 12  ? 0.6022 0.8514 0.5757 0.0251  -0.0931 0.0638  12  TRP E CD2 
4020 N NE1 . TRP E 12  ? 0.6026 0.8256 0.5672 0.0067  -0.0943 0.0652  12  TRP E NE1 
4021 C CE2 . TRP E 12  ? 0.6360 0.8750 0.6062 0.0116  -0.0930 0.0682  12  TRP E CE2 
4022 C CE3 . TRP E 12  ? 0.6087 0.8744 0.5875 0.0323  -0.0918 0.0656  12  TRP E CE3 
4023 C CZ2 . TRP E 12  ? 0.6111 0.8554 0.5828 0.0051  -0.0918 0.0745  12  TRP E CZ2 
4024 C CZ3 . TRP E 12  ? 0.5981 0.8699 0.5791 0.0259  -0.0906 0.0718  12  TRP E CZ3 
4025 C CH2 . TRP E 12  ? 0.6025 0.8634 0.5796 0.0124  -0.0906 0.0762  12  TRP E CH2 
4026 N N   . PHE E 13  ? 0.6650 0.8423 0.6176 0.0412  -0.0925 0.0445  13  PHE E N   
4027 C CA  . PHE E 13  ? 0.6837 0.8347 0.6303 0.0337  -0.0917 0.0439  13  PHE E CA  
4028 C C   . PHE E 13  ? 0.6639 0.7890 0.6061 0.0409  -0.0884 0.0393  13  PHE E C   
4029 O O   . PHE E 13  ? 0.7334 0.8361 0.6697 0.0363  -0.0876 0.0373  13  PHE E O   
4030 C CB  . PHE E 13  ? 0.6069 0.7603 0.5488 0.0261  -0.0952 0.0419  13  PHE E CB  
4031 C CG  . PHE E 13  ? 0.6437 0.8181 0.5894 0.0152  -0.0978 0.0465  13  PHE E CG  
4032 C CD1 . PHE E 13  ? 0.6773 0.8430 0.6224 0.0041  -0.0968 0.0516  13  PHE E CD1 
4033 C CD2 . PHE E 13  ? 0.6250 0.8277 0.5742 0.0160  -0.1013 0.0453  13  PHE E CD2 
4034 C CE1 . PHE E 13  ? 0.6624 0.8468 0.6100 -0.0072 -0.0987 0.0556  13  PHE E CE1 
4035 C CE2 . PHE E 13  ? 0.6379 0.8616 0.5912 0.0052  -0.1033 0.0490  13  PHE E CE2 
4036 C CZ  . PHE E 13  ? 0.6466 0.8609 0.5988 -0.0071 -0.1018 0.0541  13  PHE E CZ  
4037 N N   . GLY E 14  ? 0.5893 0.7174 0.5340 0.0517  -0.0863 0.0374  14  GLY E N   
4038 C CA  . GLY E 14  ? 0.5944 0.7003 0.5357 0.0582  -0.0827 0.0326  14  GLY E CA  
4039 C C   . GLY E 14  ? 0.6239 0.7103 0.5663 0.0541  -0.0802 0.0348  14  GLY E C   
4040 O O   . GLY E 14  ? 0.6525 0.7453 0.6003 0.0520  -0.0802 0.0401  14  GLY E O   
4041 N N   . ARG E 15  ? 0.6038 0.6661 0.5406 0.0532  -0.0781 0.0304  15  ARG E N   
4042 C CA  . ARG E 15  ? 0.6030 0.6452 0.5401 0.0501  -0.0759 0.0316  15  ARG E CA  
4043 C C   . ARG E 15  ? 0.6060 0.6319 0.5429 0.0579  -0.0716 0.0258  15  ARG E C   
4044 O O   . ARG E 15  ? 0.7068 0.7295 0.6397 0.0630  -0.0700 0.0199  15  ARG E O   
4045 C CB  . ARG E 15  ? 0.6449 0.6715 0.5753 0.0400  -0.0771 0.0320  15  ARG E CB  
4046 C CG  . ARG E 15  ? 0.6845 0.7249 0.6151 0.0300  -0.0809 0.0380  15  ARG E CG  
4047 C CD  . ARG E 15  ? 0.7200 0.7647 0.6555 0.0276  -0.0809 0.0446  15  ARG E CD  
4048 N NE  . ARG E 15  ? 0.7706 0.8251 0.7047 0.0162  -0.0837 0.0502  15  ARG E NE  
4049 C CZ  . ARG E 15  ? 0.7579 0.8390 0.6964 0.0143  -0.0860 0.0534  15  ARG E CZ  
4050 N NH1 . ARG E 15  ? 0.7259 0.8257 0.6700 0.0236  -0.0859 0.0517  15  ARG E NH1 
4051 N NH2 . ARG E 15  ? 0.7861 0.8749 0.7229 0.0027  -0.0880 0.0580  15  ARG E NH2 
4052 N N   . ILE E 16  ? 0.5754 0.5910 0.5163 0.0590  -0.0696 0.0273  16  ILE E N   
4053 C CA  . ILE E 16  ? 0.5848 0.5855 0.5266 0.0655  -0.0654 0.0214  16  ILE E CA  
4054 C C   . ILE E 16  ? 0.6304 0.6086 0.5704 0.0617  -0.0640 0.0211  16  ILE E C   
4055 O O   . ILE E 16  ? 0.6511 0.6277 0.5946 0.0605  -0.0650 0.0259  16  ILE E O   
4056 C CB  . ILE E 16  ? 0.5936 0.6057 0.5435 0.0735  -0.0641 0.0221  16  ILE E CB  
4057 C CG1 . ILE E 16  ? 0.6474 0.6799 0.5981 0.0783  -0.0650 0.0216  16  ILE E CG1 
4058 C CG2 . ILE E 16  ? 0.5667 0.5642 0.5184 0.0793  -0.0597 0.0157  16  ILE E CG2 
4059 C CD1 . ILE E 16  ? 0.6943 0.7413 0.6526 0.0844  -0.0647 0.0241  16  ILE E CD1 
4060 N N   . PRO E 17  ? 0.6358 0.5957 0.5692 0.0599  -0.0617 0.0153  17  PRO E N   
4061 C CA  . PRO E 17  ? 0.6480 0.5849 0.5789 0.0570  -0.0598 0.0138  17  PRO E CA  
4062 C C   . PRO E 17  ? 0.6295 0.5622 0.5679 0.0643  -0.0571 0.0122  17  PRO E C   
4063 O O   . PRO E 17  ? 0.6395 0.5756 0.5815 0.0714  -0.0539 0.0067  17  PRO E O   
4064 C CB  . PRO E 17  ? 0.7170 0.6385 0.6399 0.0558  -0.0570 0.0064  17  PRO E CB  
4065 C CG  . PRO E 17  ? 0.7181 0.6533 0.6398 0.0602  -0.0568 0.0033  17  PRO E CG  
4066 C CD  . PRO E 17  ? 0.6546 0.6137 0.5811 0.0601  -0.0611 0.0100  17  PRO E CD  
4067 N N   . THR E 18  ? 0.6419 0.5670 0.5817 0.0626  -0.0585 0.0168  18  THR E N   
4068 C CA  . THR E 18  ? 0.6445 0.5684 0.5919 0.0700  -0.0573 0.0165  18  THR E CA  
4069 C C   . THR E 18  ? 0.6570 0.5580 0.6018 0.0692  -0.0562 0.0155  18  THR E C   
4070 O O   . THR E 18  ? 0.6053 0.4941 0.5426 0.0617  -0.0581 0.0193  18  THR E O   
4071 C CB  . THR E 18  ? 0.6536 0.5947 0.6059 0.0711  -0.0609 0.0244  18  THR E CB  
4072 O OG1 . THR E 18  ? 0.6740 0.6364 0.6285 0.0722  -0.0617 0.0250  18  THR E OG1 
4073 C CG2 . THR E 18  ? 0.5200 0.4611 0.4799 0.0795  -0.0603 0.0239  18  THR E CG2 
4074 N N   . CYS E 19  ? 0.6229 0.5185 0.5737 0.0772  -0.0531 0.0101  19  CYS E N   
4075 C CA  . CYS E 19  ? 0.6611 0.5364 0.6107 0.0787  -0.0521 0.0085  19  CYS E CA  
4076 C C   . CYS E 19  ? 0.7247 0.6046 0.6816 0.0862  -0.0541 0.0117  19  CYS E C   
4077 O O   . CYS E 19  ? 0.7333 0.6230 0.6992 0.0944  -0.0522 0.0073  19  CYS E O   
4078 C CB  . CYS E 19  ? 0.6752 0.5388 0.6255 0.0820  -0.0466 -0.0016 19  CYS E CB  
4079 S SG  . CYS E 19  ? 0.7356 0.5747 0.6850 0.0851  -0.0448 -0.0049 19  CYS E SG  
4080 N N   . PHE E 20  ? 0.7217 0.5941 0.6738 0.0830  -0.0579 0.0194  20  PHE E N   
4081 C CA  . PHE E 20  ? 0.6533 0.5268 0.6099 0.0899  -0.0604 0.0230  20  PHE E CA  
4082 C C   . PHE E 20  ? 0.6957 0.5490 0.6522 0.0957  -0.0589 0.0185  20  PHE E C   
4083 O O   . PHE E 20  ? 0.7225 0.5548 0.6697 0.0908  -0.0589 0.0195  20  PHE E O   
4084 C CB  . PHE E 20  ? 0.6595 0.5329 0.6091 0.0838  -0.0652 0.0335  20  PHE E CB  
4085 C CG  . PHE E 20  ? 0.6370 0.5329 0.5881 0.0792  -0.0670 0.0382  20  PHE E CG  
4086 C CD1 . PHE E 20  ? 0.6033 0.5175 0.5613 0.0847  -0.0688 0.0413  20  PHE E CD1 
4087 C CD2 . PHE E 20  ? 0.6316 0.5305 0.5768 0.0696  -0.0670 0.0393  20  PHE E CD2 
4088 C CE1 . PHE E 20  ? 0.6054 0.5404 0.5645 0.0809  -0.0702 0.0454  20  PHE E CE1 
4089 C CE2 . PHE E 20  ? 0.6269 0.5475 0.5738 0.0661  -0.0687 0.0432  20  PHE E CE2 
4090 C CZ  . PHE E 20  ? 0.5864 0.5249 0.5403 0.0718  -0.0701 0.0463  20  PHE E CZ  
4091 N N   . THR E 21  ? 0.6903 0.5502 0.6571 0.1061  -0.0574 0.0131  21  THR E N   
4092 C CA  . THR E 21  ? 0.6951 0.5392 0.6638 0.1133  -0.0562 0.0083  21  THR E CA  
4093 C C   . THR E 21  ? 0.7216 0.5704 0.6950 0.1220  -0.0604 0.0125  21  THR E C   
4094 O O   . THR E 21  ? 0.6776 0.5466 0.6586 0.1258  -0.0618 0.0140  21  THR E O   
4095 C CB  . THR E 21  ? 0.7170 0.5644 0.6942 0.1183  -0.0503 -0.0033 21  THR E CB  
4096 O OG1 . THR E 21  ? 0.7793 0.6187 0.7497 0.1102  -0.0466 -0.0070 21  THR E OG1 
4097 C CG2 . THR E 21  ? 0.7259 0.5600 0.7067 0.1268  -0.0490 -0.0089 21  THR E CG2 
4098 N N   . LEU E 22  ? 0.8120 0.6411 0.7796 0.1250  -0.0626 0.0146  22  LEU E N   
4099 C CA  . LEU E 22  ? 0.8386 0.6687 0.8083 0.1337  -0.0673 0.0190  22  LEU E CA  
4100 C C   . LEU E 22  ? 0.8598 0.7019 0.8440 0.1461  -0.0657 0.0105  22  LEU E C   
4101 O O   . LEU E 22  ? 0.8166 0.6538 0.8057 0.1494  -0.0612 0.0012  22  LEU E O   
4102 C CB  . LEU E 22  ? 0.8224 0.6253 0.7796 0.1338  -0.0701 0.0234  22  LEU E CB  
4103 C CG  . LEU E 22  ? 0.8093 0.6084 0.7642 0.1420  -0.0759 0.0295  22  LEU E CG  
4104 C CD1 . LEU E 22  ? 0.8434 0.6575 0.7961 0.1370  -0.0796 0.0387  22  LEU E CD1 
4105 C CD2 . LEU E 22  ? 0.8094 0.5779 0.7494 0.1415  -0.0781 0.0332  22  LEU E CD2 
4106 N N   . TYR E 23  ? 0.9331 0.7916 0.9240 0.1525  -0.0692 0.0136  23  TYR E N   
4107 C CA  . TYR E 23  ? 1.0043 0.8759 1.0090 0.1644  -0.0687 0.0062  23  TYR E CA  
4108 C C   . TYR E 23  ? 1.0800 0.9339 1.0843 0.1735  -0.0697 0.0026  23  TYR E C   
4109 O O   . TYR E 23  ? 1.1289 0.9645 1.1223 0.1743  -0.0742 0.0096  23  TYR E O   
4110 C CB  . TYR E 23  ? 1.0311 0.9213 1.0404 0.1689  -0.0733 0.0117  23  TYR E CB  
4111 C CG  . TYR E 23  ? 1.0340 0.9413 1.0583 0.1802  -0.0731 0.0042  23  TYR E CG  
4112 C CD1 . TYR E 23  ? 0.9963 0.9172 1.0314 0.1807  -0.0672 -0.0061 23  TYR E CD1 
4113 C CD2 . TYR E 23  ? 1.0486 0.9585 1.0753 0.1901  -0.0788 0.0073  23  TYR E CD2 
4114 C CE1 . TYR E 23  ? 1.0060 0.9437 1.0548 0.1901  -0.0667 -0.0134 23  TYR E CE1 
4115 C CE2 . TYR E 23  ? 1.0329 0.9601 1.0737 0.2004  -0.0789 0.0001  23  TYR E CE2 
4116 C CZ  . TYR E 23  ? 1.0183 0.9600 1.0706 0.2000  -0.0727 -0.0104 23  TYR E CZ  
4117 O OH  . TYR E 23  ? 1.0119 0.9718 1.0783 0.2093  -0.0725 -0.0180 23  TYR E OH  
4118 N N   . GLN E 24  ? 1.1227 0.9815 1.1382 0.1803  -0.0655 -0.0085 24  GLN E N   
4119 C CA  . GLN E 24  ? 1.2228 1.0645 1.2384 0.1885  -0.0653 -0.0137 24  GLN E CA  
4120 C C   . GLN E 24  ? 1.2545 1.0938 1.2712 0.2008  -0.0719 -0.0104 24  GLN E C   
4121 O O   . GLN E 24  ? 1.2630 1.0839 1.2758 0.2077  -0.0732 -0.0122 24  GLN E O   
4122 C CB  . GLN E 24  ? 1.2853 1.1356 1.3135 0.1921  -0.0585 -0.0272 24  GLN E CB  
4123 C CG  . GLN E 24  ? 1.3353 1.2133 1.3798 0.1990  -0.0578 -0.0333 24  GLN E CG  
4124 C CD  . GLN E 24  ? 1.4372 1.3233 1.4926 0.1999  -0.0501 -0.0467 24  GLN E CD  
4125 O OE1 . GLN E 24  ? 1.4933 1.3662 1.5433 0.1933  -0.0448 -0.0508 24  GLN E OE1 
4126 N NE2 . GLN E 24  ? 1.4474 1.3552 1.5177 0.2077  -0.0494 -0.0539 24  GLN E NE2 
4127 N N   . ASP E 25  ? 1.2782 1.1353 1.2993 0.2038  -0.0762 -0.0056 25  ASP E N   
4128 C CA  . ASP E 25  ? 1.3097 1.1660 1.3317 0.2160  -0.0830 -0.0024 25  ASP E CA  
4129 C C   . ASP E 25  ? 1.2899 1.1297 1.2949 0.2125  -0.0893 0.0107  25  ASP E C   
4130 O O   . ASP E 25  ? 1.2927 1.1337 1.2964 0.2209  -0.0956 0.0154  25  ASP E O   
4131 C CB  . ASP E 25  ? 1.3309 1.2162 1.3680 0.2229  -0.0843 -0.0059 25  ASP E CB  
4132 C CG  . ASP E 25  ? 1.3567 1.2570 1.4108 0.2291  -0.0791 -0.0197 25  ASP E CG  
4133 O OD1 . ASP E 25  ? 1.3586 1.2455 1.4132 0.2323  -0.0760 -0.0264 25  ASP E OD1 
4134 O OD2 . ASP E 25  ? 1.3634 1.2887 1.4297 0.2305  -0.0778 -0.0239 25  ASP E OD2 
4135 N N   . GLU E 26  ? 1.2806 1.1050 1.2722 0.1999  -0.0877 0.0165  26  GLU E N   
4136 C CA  . GLU E 26  ? 1.2843 1.0912 1.2582 0.1948  -0.0928 0.0286  26  GLU E CA  
4137 C C   . GLU E 26  ? 1.2856 1.0614 1.2470 0.1996  -0.0949 0.0295  26  GLU E C   
4138 O O   . GLU E 26  ? 1.2836 1.0456 1.2432 0.1976  -0.0906 0.0238  26  GLU E O   
4139 C CB  . GLU E 26  ? 1.2834 1.0902 1.2488 0.1784  -0.0903 0.0344  26  GLU E CB  
4140 C CG  . GLU E 26  ? 1.2532 1.0893 1.2289 0.1737  -0.0885 0.0343  26  GLU E CG  
4141 C CD  . GLU E 26  ? 1.2071 1.0555 1.1822 0.1767  -0.0940 0.0420  26  GLU E CD  
4142 O OE1 . GLU E 26  ? 1.2498 1.0817 1.2127 0.1786  -0.0991 0.0496  26  GLU E OE1 
4143 O OE2 . GLU E 26  ? 1.1245 0.9979 1.1102 0.1770  -0.0931 0.0404  26  GLU E OE2 
4144 N N   . ILE E 27  ? 1.2761 1.0398 1.2275 0.2062  -0.1016 0.0366  27  ILE E N   
4145 C CA  . ILE E 27  ? 1.2893 1.0216 1.2265 0.2120  -0.1044 0.0382  27  ILE E CA  
4146 C C   . ILE E 27  ? 1.3248 1.0325 1.2442 0.1977  -0.1020 0.0433  27  ILE E C   
4147 O O   . ILE E 27  ? 1.3216 1.0240 1.2280 0.1868  -0.1040 0.0531  27  ILE E O   
4148 C CB  . ILE E 27  ? 1.2810 1.0039 1.2080 0.2207  -0.1125 0.0462  27  ILE E CB  
4149 C CG1 . ILE E 27  ? 1.2244 0.9746 1.1691 0.2337  -0.1155 0.0419  27  ILE E CG1 
4150 C CG2 . ILE E 27  ? 1.3013 0.9905 1.2133 0.2288  -0.1156 0.0469  27  ILE E CG2 
4151 C CD1 . ILE E 27  ? 1.2251 0.9692 1.1601 0.2417  -0.1237 0.0501  27  ILE E CD1 
4152 N N   . THR E 28  ? 1.3537 1.0469 1.2724 0.1973  -0.0975 0.0364  28  THR E N   
4153 C CA  . THR E 28  ? 1.4040 1.0747 1.3067 0.1834  -0.0948 0.0399  28  THR E CA  
4154 C C   . THR E 28  ? 1.5102 1.1483 1.4007 0.1889  -0.0948 0.0374  28  THR E C   
4155 O O   . THR E 28  ? 1.5214 1.1596 1.4218 0.2019  -0.0936 0.0285  28  THR E O   
4156 C CB  . THR E 28  ? 1.3718 1.0576 1.2840 0.1726  -0.0880 0.0342  28  THR E CB  
4157 O OG1 . THR E 28  ? 1.3628 1.0597 1.2916 0.1820  -0.0838 0.0222  28  THR E OG1 
4158 C CG2 . THR E 28  ? 1.3374 1.0507 1.2567 0.1647  -0.0880 0.0383  28  THR E CG2 
4159 N N   . GLU E 29  ? 1.5843 1.1947 1.4531 0.1787  -0.0959 0.0450  29  GLU E N   
4160 C CA  . GLU E 29  ? 1.6381 1.2143 1.4921 0.1818  -0.0955 0.0433  29  GLU E CA  
4161 C C   . GLU E 29  ? 1.6508 1.2264 1.5123 0.1788  -0.0885 0.0334  29  GLU E C   
4162 O O   . GLU E 29  ? 1.6654 1.2227 1.5245 0.1873  -0.0871 0.0272  29  GLU E O   
4163 C CB  . GLU E 29  ? 1.6831 1.2308 1.5111 0.1689  -0.0978 0.0539  29  GLU E CB  
4164 C CG  . GLU E 29  ? 1.7271 1.2684 1.5430 0.1716  -0.1046 0.0641  29  GLU E CG  
4165 C CD  . GLU E 29  ? 1.7718 1.2882 1.5624 0.1557  -0.1058 0.0744  29  GLU E CD  
4166 O OE1 . GLU E 29  ? 1.7498 1.2736 1.5397 0.1392  -0.1020 0.0759  29  GLU E OE1 
4167 O OE2 . GLU E 29  ? 1.8061 1.2956 1.5771 0.1596  -0.1105 0.0809  29  GLU E OE2 
4168 N N   . ARG E 30  ? 1.6667 1.2621 1.5367 0.1667  -0.0842 0.0318  30  ARG E N   
4169 C CA  . ARG E 30  ? 1.6874 1.2839 1.5640 0.1626  -0.0774 0.0226  30  ARG E CA  
4170 C C   . ARG E 30  ? 1.6183 1.2475 1.5115 0.1564  -0.0739 0.0193  30  ARG E C   
4171 O O   . ARG E 30  ? 1.6158 1.2631 1.5115 0.1516  -0.0765 0.0256  30  ARG E O   
4172 C CB  . ARG E 30  ? 1.7473 1.3156 1.6041 0.1490  -0.0756 0.0260  30  ARG E CB  
4173 C CG  . ARG E 30  ? 1.7947 1.3652 1.6406 0.1325  -0.0774 0.0361  30  ARG E CG  
4174 C CD  . ARG E 30  ? 1.8723 1.4160 1.6994 0.1187  -0.0754 0.0384  30  ARG E CD  
4175 N NE  . ARG E 30  ? 1.9219 1.4713 1.7404 0.1021  -0.0767 0.0469  30  ARG E NE  
4176 C CZ  . ARG E 30  ? 1.9367 1.5066 1.7629 0.0915  -0.0738 0.0454  30  ARG E CZ  
4177 N NH1 . ARG E 30  ? 1.9292 1.5139 1.7705 0.0952  -0.0693 0.0360  30  ARG E NH1 
4178 N NH2 . ARG E 30  ? 1.9404 1.5161 1.7589 0.0772  -0.0753 0.0530  30  ARG E NH2 
4179 N N   . GLU E 31  ? 1.5417 1.1776 1.4452 0.1567  -0.0678 0.0091  31  GLU E N   
4180 C CA  . GLU E 31  ? 1.4572 1.1205 1.3741 0.1508  -0.0640 0.0052  31  GLU E CA  
4181 C C   . GLU E 31  ? 1.3660 1.0283 1.2723 0.1340  -0.0639 0.0122  31  GLU E C   
4182 O O   . GLU E 31  ? 1.3366 0.9758 1.2280 0.1252  -0.0632 0.0145  31  GLU E O   
4183 C CB  . GLU E 31  ? 1.4612 1.1273 1.3882 0.1539  -0.0572 -0.0072 31  GLU E CB  
4184 C CG  . GLU E 31  ? 1.4587 1.1296 1.3986 0.1703  -0.0565 -0.0157 31  GLU E CG  
4185 C CD  . GLU E 31  ? 1.4239 1.1257 1.3809 0.1779  -0.0581 -0.0173 31  GLU E CD  
4186 O OE1 . GLU E 31  ? 1.4068 1.1282 1.3684 0.1702  -0.0574 -0.0150 31  GLU E OE1 
4187 O OE2 . GLU E 31  ? 1.4033 1.1100 1.3691 0.1919  -0.0603 -0.0211 31  GLU E OE2 
4188 N N   . ALA E 32  ? 1.2905 0.9783 1.2046 0.1297  -0.0648 0.0154  32  ALA E N   
4189 C CA  . ALA E 32  ? 1.2128 0.9042 1.1187 0.1147  -0.0651 0.0217  32  ALA E CA  
4190 C C   . ALA E 32  ? 1.1823 0.8853 1.0947 0.1085  -0.0598 0.0148  32  ALA E C   
4191 O O   . ALA E 32  ? 1.1943 0.9121 1.1203 0.1155  -0.0564 0.0065  32  ALA E O   
4192 C CB  . ALA E 32  ? 1.1625 0.8738 1.0713 0.1133  -0.0695 0.0298  32  ALA E CB  
4193 N N   . GLU E 33  ? 1.1394 0.8352 1.0412 0.0951  -0.0592 0.0180  33  GLU E N   
4194 C CA  . GLU E 33  ? 1.1153 0.8211 1.0207 0.0886  -0.0551 0.0124  33  GLU E CA  
4195 C C   . GLU E 33  ? 0.9866 0.7216 0.9007 0.0865  -0.0563 0.0152  33  GLU E C   
4196 O O   . GLU E 33  ? 0.9364 0.6798 0.8487 0.0844  -0.0606 0.0235  33  GLU E O   
4197 C CB  . GLU E 33  ? 1.1902 0.8776 1.0805 0.0753  -0.0545 0.0147  33  GLU E CB  
4198 C CG  . GLU E 33  ? 1.2539 0.9104 1.1337 0.0763  -0.0529 0.0118  33  GLU E CG  
4199 C CD  . GLU E 33  ? 1.3150 0.9679 1.2023 0.0836  -0.0472 0.0004  33  GLU E CD  
4200 O OE1 . GLU E 33  ? 1.3520 1.0218 1.2480 0.0828  -0.0439 -0.0052 33  GLU E OE1 
4201 O OE2 . GLU E 33  ? 1.3394 0.9721 1.2231 0.0900  -0.0460 -0.0031 33  GLU E OE2 
4202 N N   . PRO E 34  ? 0.9087 0.6584 0.8315 0.0872  -0.0524 0.0081  34  PRO E N   
4203 C CA  . PRO E 34  ? 0.8357 0.6112 0.7648 0.0847  -0.0533 0.0103  34  PRO E CA  
4204 C C   . PRO E 34  ? 0.7831 0.5594 0.7022 0.0721  -0.0561 0.0176  34  PRO E C   
4205 O O   . PRO E 34  ? 0.8056 0.5641 0.7139 0.0640  -0.0555 0.0177  34  PRO E O   
4206 C CB  . PRO E 34  ? 0.8725 0.6547 0.8078 0.0863  -0.0479 0.0005  34  PRO E CB  
4207 C CG  . PRO E 34  ? 0.9149 0.6729 0.8435 0.0849  -0.0444 -0.0054 34  PRO E CG  
4208 C CD  . PRO E 34  ? 0.9149 0.6567 0.8406 0.0902  -0.0467 -0.0024 34  PRO E CD  
4209 N N   . TYR E 35  ? 0.7597 0.5569 0.6824 0.0703  -0.0591 0.0234  35  TYR E N   
4210 C CA  . TYR E 35  ? 0.7855 0.5868 0.7000 0.0586  -0.0619 0.0303  35  TYR E CA  
4211 C C   . TYR E 35  ? 0.7650 0.5890 0.6849 0.0561  -0.0611 0.0284  35  TYR E C   
4212 O O   . TYR E 35  ? 0.8283 0.6722 0.7577 0.0626  -0.0612 0.0279  35  TYR E O   
4213 C CB  . TYR E 35  ? 0.8395 0.6446 0.7513 0.0572  -0.0663 0.0398  35  TYR E CB  
4214 C CG  . TYR E 35  ? 0.8915 0.6979 0.7936 0.0438  -0.0689 0.0468  35  TYR E CG  
4215 C CD1 . TYR E 35  ? 0.8499 0.6811 0.7562 0.0394  -0.0702 0.0496  35  TYR E CD1 
4216 C CD2 . TYR E 35  ? 0.9733 0.7563 0.8618 0.0354  -0.0699 0.0502  35  TYR E CD2 
4217 C CE1 . TYR E 35  ? 0.8696 0.7044 0.7681 0.0270  -0.0725 0.0554  35  TYR E CE1 
4218 C CE2 . TYR E 35  ? 0.9710 0.7562 0.8506 0.0222  -0.0720 0.0562  35  TYR E CE2 
4219 C CZ  . TYR E 35  ? 0.9215 0.7337 0.8068 0.0180  -0.0733 0.0586  35  TYR E CZ  
4220 O OH  . TYR E 35  ? 0.9408 0.7575 0.8184 0.0046  -0.0752 0.0638  35  TYR E OH  
4221 N N   . TYR E 36  ? 0.7090 0.5293 0.6218 0.0471  -0.0606 0.0273  36  TYR E N   
4222 C CA  . TYR E 36  ? 0.6888 0.5286 0.6048 0.0451  -0.0603 0.0252  36  TYR E CA  
4223 C C   . TYR E 36  ? 0.7482 0.6040 0.6617 0.0369  -0.0643 0.0328  36  TYR E C   
4224 O O   . TYR E 36  ? 0.7344 0.5806 0.6394 0.0278  -0.0665 0.0380  36  TYR E O   
4225 C CB  . TYR E 36  ? 0.6620 0.4901 0.5721 0.0413  -0.0574 0.0185  36  TYR E CB  
4226 C CG  . TYR E 36  ? 0.7365 0.5535 0.6501 0.0492  -0.0524 0.0096  36  TYR E CG  
4227 C CD1 . TYR E 36  ? 0.7511 0.5444 0.6605 0.0501  -0.0504 0.0069  36  TYR E CD1 
4228 C CD2 . TYR E 36  ? 0.7507 0.5807 0.6713 0.0557  -0.0496 0.0037  36  TYR E CD2 
4229 C CE1 . TYR E 36  ? 0.7591 0.5438 0.6725 0.0571  -0.0455 -0.0018 36  TYR E CE1 
4230 C CE2 . TYR E 36  ? 0.7879 0.6086 0.7117 0.0619  -0.0446 -0.0049 36  TYR E CE2 
4231 C CZ  . TYR E 36  ? 0.7879 0.5869 0.7087 0.0626  -0.0425 -0.0077 36  TYR E CZ  
4232 O OH  . TYR E 36  ? 0.7922 0.5834 0.7167 0.0686  -0.0371 -0.0168 36  TYR E OH  
4233 N N   . LEU E 37  ? 0.7226 0.6026 0.6431 0.0399  -0.0650 0.0331  37  LEU E N   
4234 C CA  . LEU E 37  ? 0.6559 0.5550 0.5760 0.0335  -0.0686 0.0397  37  LEU E CA  
4235 C C   . LEU E 37  ? 0.6601 0.5820 0.5856 0.0366  -0.0685 0.0370  37  LEU E C   
4236 O O   . LEU E 37  ? 0.7157 0.6437 0.6477 0.0458  -0.0663 0.0324  37  LEU E O   
4237 C CB  . LEU E 37  ? 0.6599 0.5651 0.5832 0.0355  -0.0707 0.0466  37  LEU E CB  
4238 C CG  . LEU E 37  ? 0.6525 0.5759 0.5747 0.0280  -0.0740 0.0540  37  LEU E CG  
4239 C CD1 . LEU E 37  ? 0.6323 0.5460 0.5442 0.0147  -0.0755 0.0569  37  LEU E CD1 
4240 C CD2 . LEU E 37  ? 0.6192 0.5456 0.5434 0.0310  -0.0756 0.0603  37  LEU E CD2 
4241 N N   . LEU E 38  ? 0.6403 0.5748 0.5627 0.0289  -0.0711 0.0395  38  LEU E N   
4242 C CA  . LEU E 38  ? 0.6017 0.5592 0.5283 0.0321  -0.0718 0.0379  38  LEU E CA  
4243 C C   . LEU E 38  ? 0.6551 0.6354 0.5884 0.0340  -0.0738 0.0437  38  LEU E C   
4244 O O   . LEU E 38  ? 0.6693 0.6602 0.6011 0.0260  -0.0766 0.0494  38  LEU E O   
4245 C CB  . LEU E 38  ? 0.5459 0.5081 0.4665 0.0237  -0.0740 0.0373  38  LEU E CB  
4246 C CG  . LEU E 38  ? 0.5884 0.5367 0.5026 0.0235  -0.0725 0.0303  38  LEU E CG  
4247 C CD1 . LEU E 38  ? 0.5828 0.5424 0.4924 0.0160  -0.0759 0.0309  38  LEU E CD1 
4248 C CD2 . LEU E 38  ? 0.6392 0.5892 0.5565 0.0342  -0.0695 0.0239  38  LEU E CD2 
4249 N N   . LEU E 39  ? 0.6902 0.6784 0.6307 0.0440  -0.0722 0.0421  39  LEU E N   
4250 C CA  . LEU E 39  ? 0.6560 0.6646 0.6026 0.0467  -0.0738 0.0473  39  LEU E CA  
4251 C C   . LEU E 39  ? 0.6547 0.6879 0.6036 0.0471  -0.0752 0.0472  39  LEU E C   
4252 O O   . LEU E 39  ? 0.6421 0.6782 0.5908 0.0522  -0.0740 0.0414  39  LEU E O   
4253 C CB  . LEU E 39  ? 0.6137 0.6216 0.5669 0.0573  -0.0717 0.0452  39  LEU E CB  
4254 C CG  . LEU E 39  ? 0.6254 0.6122 0.5782 0.0596  -0.0706 0.0449  39  LEU E CG  
4255 C CD1 . LEU E 39  ? 0.6230 0.6149 0.5837 0.0703  -0.0690 0.0423  39  LEU E CD1 
4256 C CD2 . LEU E 39  ? 0.6905 0.6713 0.6389 0.0526  -0.0733 0.0527  39  LEU E CD2 
4257 N N   . PRO E 40  ? 0.6456 0.6964 0.5959 0.0420  -0.0778 0.0535  40  PRO E N   
4258 C CA  . PRO E 40  ? 0.6297 0.7064 0.5832 0.0432  -0.0793 0.0536  40  PRO E CA  
4259 C C   . PRO E 40  ? 0.6340 0.7229 0.5936 0.0544  -0.0778 0.0517  40  PRO E C   
4260 O O   . PRO E 40  ? 0.6443 0.7340 0.6077 0.0576  -0.0773 0.0548  40  PRO E O   
4261 C CB  . PRO E 40  ? 0.6576 0.7477 0.6113 0.0342  -0.0817 0.0610  40  PRO E CB  
4262 C CG  . PRO E 40  ? 0.6557 0.7233 0.6034 0.0261  -0.0817 0.0641  40  PRO E CG  
4263 C CD  . PRO E 40  ? 0.6277 0.6740 0.5755 0.0340  -0.0793 0.0605  40  PRO E CD  
4264 N N   . ARG E 41  ? 0.6223 0.7196 0.5817 0.0602  -0.0773 0.0466  41  ARG E N   
4265 C CA  . ARG E 41  ? 0.5872 0.6955 0.5508 0.0704  -0.0757 0.0443  41  ARG E CA  
4266 C C   . ARG E 41  ? 0.5686 0.6987 0.5376 0.0711  -0.0771 0.0501  41  ARG E C   
4267 O O   . ARG E 41  ? 0.5579 0.6911 0.5309 0.0774  -0.0757 0.0506  41  ARG E O   
4268 C CB  . ARG E 41  ? 0.6155 0.7294 0.5754 0.0754  -0.0756 0.0386  41  ARG E CB  
4269 C CG  . ARG E 41  ? 0.6449 0.7373 0.5994 0.0788  -0.0727 0.0313  41  ARG E CG  
4270 C CD  . ARG E 41  ? 0.6363 0.7336 0.5850 0.0837  -0.0730 0.0262  41  ARG E CD  
4271 N NE  . ARG E 41  ? 0.5836 0.6607 0.5262 0.0876  -0.0695 0.0190  41  ARG E NE  
4272 C CZ  . ARG E 41  ? 0.5414 0.6146 0.4850 0.0947  -0.0659 0.0152  41  ARG E CZ  
4273 N NH1 . ARG E 41  ? 0.4931 0.5808 0.4434 0.0991  -0.0657 0.0180  41  ARG E NH1 
4274 N NH2 . ARG E 41  ? 0.5401 0.5949 0.4775 0.0969  -0.0623 0.0083  41  ARG E NH2 
4275 N N   . VAL E 42  ? 0.5337 0.6793 0.5027 0.0640  -0.0797 0.0543  42  VAL E N   
4276 C CA  . VAL E 42  ? 0.4882 0.6577 0.4618 0.0645  -0.0807 0.0588  42  VAL E CA  
4277 C C   . VAL E 42  ? 0.5223 0.6901 0.4977 0.0599  -0.0809 0.0656  42  VAL E C   
4278 O O   . VAL E 42  ? 0.5253 0.7116 0.5039 0.0596  -0.0814 0.0698  42  VAL E O   
4279 C CB  . VAL E 42  ? 0.5526 0.7420 0.5260 0.0587  -0.0833 0.0600  42  VAL E CB  
4280 C CG1 . VAL E 42  ? 0.5513 0.7433 0.5220 0.0644  -0.0838 0.0535  42  VAL E CG1 
4281 C CG2 . VAL E 42  ? 0.6184 0.8005 0.5887 0.0459  -0.0848 0.0635  42  VAL E CG2 
4282 N N   . SER E 43  ? 0.5442 0.6892 0.5166 0.0566  -0.0804 0.0665  43  SER E N   
4283 C CA  . SER E 43  ? 0.5173 0.6566 0.4886 0.0515  -0.0811 0.0731  43  SER E CA  
4284 C C   . SER E 43  ? 0.5581 0.6834 0.5313 0.0594  -0.0799 0.0726  43  SER E C   
4285 O O   . SER E 43  ? 0.5902 0.7162 0.5670 0.0688  -0.0782 0.0675  43  SER E O   
4286 C CB  . SER E 43  ? 0.5305 0.6546 0.4953 0.0401  -0.0822 0.0756  43  SER E CB  
4287 O OG  . SER E 43  ? 0.6072 0.7252 0.5688 0.0344  -0.0830 0.0824  43  SER E OG  
4288 N N   . TYR E 44  ? 0.5223 0.6348 0.4923 0.0555  -0.0808 0.0777  44  TYR E N   
4289 C CA  . TYR E 44  ? 0.5342 0.6363 0.5063 0.0631  -0.0804 0.0780  44  TYR E CA  
4290 C C   . TYR E 44  ? 0.5929 0.6680 0.5600 0.0612  -0.0807 0.0781  44  TYR E C   
4291 O O   . TYR E 44  ? 0.6991 0.7640 0.6592 0.0516  -0.0817 0.0816  44  TYR E O   
4292 C CB  . TYR E 44  ? 0.5861 0.7007 0.5588 0.0628  -0.0818 0.0847  44  TYR E CB  
4293 C CG  . TYR E 44  ? 0.6498 0.7915 0.6270 0.0646  -0.0814 0.0848  44  TYR E CG  
4294 C CD1 . TYR E 44  ? 0.6519 0.8037 0.6349 0.0750  -0.0802 0.0811  44  TYR E CD1 
4295 C CD2 . TYR E 44  ? 0.6581 0.8156 0.6336 0.0560  -0.0822 0.0883  44  TYR E CD2 
4296 C CE1 . TYR E 44  ? 0.6788 0.8542 0.6650 0.0773  -0.0798 0.0810  44  TYR E CE1 
4297 C CE2 . TYR E 44  ? 0.6537 0.8366 0.6336 0.0584  -0.0818 0.0880  44  TYR E CE2 
4298 C CZ  . TYR E 44  ? 0.6952 0.8862 0.6800 0.0694  -0.0806 0.0845  44  TYR E CZ  
4299 O OH  . TYR E 44  ? 0.7227 0.9377 0.7108 0.0724  -0.0802 0.0840  44  TYR E OH  
4300 N N   . LEU E 45  ? 0.5661 0.6298 0.5365 0.0701  -0.0796 0.0740  45  LEU E N   
4301 C CA  . LEU E 45  ? 0.6066 0.6448 0.5732 0.0703  -0.0795 0.0727  45  LEU E CA  
4302 C C   . LEU E 45  ? 0.6551 0.6806 0.6138 0.0640  -0.0821 0.0803  45  LEU E C   
4303 O O   . LEU E 45  ? 0.6091 0.6156 0.5602 0.0576  -0.0823 0.0811  45  LEU E O   
4304 C CB  . LEU E 45  ? 0.6019 0.6347 0.5749 0.0818  -0.0782 0.0673  45  LEU E CB  
4305 C CG  . LEU E 45  ? 0.6158 0.6517 0.5940 0.0873  -0.0749 0.0583  45  LEU E CG  
4306 C CD1 . LEU E 45  ? 0.5479 0.5816 0.5330 0.0978  -0.0735 0.0534  45  LEU E CD1 
4307 C CD2 . LEU E 45  ? 0.6073 0.6268 0.5805 0.0824  -0.0733 0.0542  45  LEU E CD2 
4308 N N   . THR E 46  ? 0.6473 0.6822 0.6062 0.0655  -0.0839 0.0859  46  THR E N   
4309 C CA  . THR E 46  ? 0.6584 0.6802 0.6082 0.0602  -0.0863 0.0935  46  THR E CA  
4310 C C   . THR E 46  ? 0.7032 0.7290 0.6452 0.0463  -0.0868 0.0989  46  THR E C   
4311 O O   . THR E 46  ? 0.7832 0.7995 0.7159 0.0400  -0.0885 0.1057  46  THR E O   
4312 C CB  . THR E 46  ? 0.6695 0.6995 0.6213 0.0666  -0.0882 0.0976  46  THR E CB  
4313 O OG1 . THR E 46  ? 0.6665 0.7234 0.6243 0.0668  -0.0874 0.0980  46  THR E OG1 
4314 C CG2 . THR E 46  ? 0.6010 0.6238 0.5592 0.0796  -0.0883 0.0926  46  THR E CG2 
4315 N N   . LEU E 47  ? 0.7201 0.7597 0.6651 0.0415  -0.0854 0.0958  47  LEU E N   
4316 C CA  . LEU E 47  ? 0.7459 0.7930 0.6852 0.0282  -0.0859 0.0999  47  LEU E CA  
4317 C C   . LEU E 47  ? 0.7616 0.7938 0.6956 0.0207  -0.0853 0.0970  47  LEU E C   
4318 O O   . LEU E 47  ? 0.7519 0.7811 0.6781 0.0084  -0.0859 0.1007  47  LEU E O   
4319 C CB  . LEU E 47  ? 0.7064 0.7845 0.6533 0.0280  -0.0853 0.0991  47  LEU E CB  
4320 C CG  . LEU E 47  ? 0.7190 0.8115 0.6622 0.0149  -0.0857 0.1027  47  LEU E CG  
4321 C CD1 . LEU E 47  ? 0.7418 0.8282 0.6761 0.0063  -0.0866 0.1107  47  LEU E CD1 
4322 C CD2 . LEU E 47  ? 0.6889 0.8128 0.6409 0.0175  -0.0851 0.1007  47  LEU E CD2 
4323 N N   . VAL E 48  ? 0.7476 0.7703 0.6854 0.0278  -0.0840 0.0900  48  VAL E N   
4324 C CA  . VAL E 48  ? 0.6994 0.7108 0.6330 0.0217  -0.0833 0.0862  48  VAL E CA  
4325 C C   . VAL E 48  ? 0.7362 0.7178 0.6647 0.0246  -0.0825 0.0835  48  VAL E C   
4326 O O   . VAL E 48  ? 0.7876 0.7572 0.7125 0.0207  -0.0816 0.0796  48  VAL E O   
4327 C CB  . VAL E 48  ? 0.6198 0.6469 0.5609 0.0261  -0.0820 0.0794  48  VAL E CB  
4328 C CG1 . VAL E 48  ? 0.5913 0.6481 0.5372 0.0241  -0.0828 0.0815  48  VAL E CG1 
4329 C CG2 . VAL E 48  ? 0.5544 0.5779 0.5022 0.0394  -0.0802 0.0736  48  VAL E CG2 
4330 N N   . THR E 49  ? 0.7231 0.6930 0.6513 0.0317  -0.0831 0.0854  49  THR E N   
4331 C CA  . THR E 49  ? 0.7313 0.6748 0.6562 0.0367  -0.0823 0.0820  49  THR E CA  
4332 C C   . THR E 49  ? 0.7369 0.6568 0.6500 0.0324  -0.0841 0.0879  49  THR E C   
4333 O O   . THR E 49  ? 0.7233 0.6248 0.6351 0.0403  -0.0843 0.0863  49  THR E O   
4334 C CB  . THR E 49  ? 0.7482 0.6946 0.6832 0.0511  -0.0812 0.0767  49  THR E CB  
4335 O OG1 . THR E 49  ? 0.7888 0.7479 0.7273 0.0560  -0.0830 0.0813  49  THR E OG1 
4336 C CG2 . THR E 49  ? 0.6954 0.6568 0.6390 0.0550  -0.0787 0.0694  49  THR E CG2 
4337 N N   . ASP E 50  ? 0.6264 0.6309 0.6074 -0.0077 -0.0557 0.1404  50  ASP E N   
4338 C CA  . ASP E 50  ? 0.6906 0.6862 0.6802 -0.0094 -0.0620 0.1513  50  ASP E CA  
4339 C C   . ASP E 50  ? 0.7182 0.6995 0.7267 -0.0094 -0.0622 0.1446  50  ASP E C   
4340 O O   . ASP E 50  ? 0.7132 0.6864 0.7335 -0.0062 -0.0690 0.1470  50  ASP E O   
4341 C CB  . ASP E 50  ? 0.7463 0.7449 0.7262 -0.0155 -0.0607 0.1641  50  ASP E CB  
4342 C CG  . ASP E 50  ? 0.8792 0.8925 0.8432 -0.0145 -0.0638 0.1745  50  ASP E CG  
4343 O OD1 . ASP E 50  ? 0.9466 0.9650 0.9099 -0.0093 -0.0693 0.1744  50  ASP E OD1 
4344 O OD2 . ASP E 50  ? 0.8968 0.9184 0.8489 -0.0190 -0.0610 0.1826  50  ASP E OD2 
4345 N N   . LYS E 51  ? 0.7708 0.7507 0.7822 -0.0122 -0.0548 0.1359  51  LYS E N   
4346 C CA  . LYS E 51  ? 0.7553 0.7245 0.7843 -0.0120 -0.0544 0.1277  51  LYS E CA  
4347 C C   . LYS E 51  ? 0.7988 0.7665 0.8397 -0.0054 -0.0577 0.1182  51  LYS E C   
4348 O O   . LYS E 51  ? 0.8580 0.8162 0.9145 -0.0033 -0.0611 0.1145  51  LYS E O   
4349 C CB  . LYS E 51  ? 0.6518 0.6249 0.6805 -0.0158 -0.0452 0.1195  51  LYS E CB  
4350 C CG  . LYS E 51  ? 0.6563 0.6299 0.6783 -0.0230 -0.0421 0.1276  51  LYS E CG  
4351 C CD  . LYS E 51  ? 0.7183 0.6978 0.7416 -0.0260 -0.0331 0.1184  51  LYS E CD  
4352 C CE  . LYS E 51  ? 0.7957 0.7774 0.8130 -0.0339 -0.0301 0.1257  51  LYS E CE  
4353 N NZ  . LYS E 51  ? 0.8461 0.8357 0.8658 -0.0365 -0.0214 0.1162  51  LYS E NZ  
4354 N N   . VAL E 52  ? 0.7663 0.7436 0.8000 -0.0023 -0.0569 0.1137  52  VAL E N   
4355 C CA  . VAL E 52  ? 0.7435 0.7220 0.7875 0.0031  -0.0602 0.1052  52  VAL E CA  
4356 C C   . VAL E 52  ? 0.7641 0.7386 0.8133 0.0071  -0.0699 0.1127  52  VAL E C   
4357 O O   . VAL E 52  ? 0.6858 0.6555 0.7495 0.0114  -0.0741 0.1084  52  VAL E O   
4358 C CB  . VAL E 52  ? 0.6884 0.6777 0.7232 0.0042  -0.0569 0.0987  52  VAL E CB  
4359 C CG1 . VAL E 52  ? 0.6349 0.6268 0.6804 0.0088  -0.0610 0.0908  52  VAL E CG1 
4360 C CG2 . VAL E 52  ? 0.6594 0.6523 0.6902 0.0014  -0.0470 0.0917  52  VAL E CG2 
4361 N N   . LYS E 53  ? 0.8534 0.8318 0.8906 0.0063  -0.0734 0.1244  53  LYS E N   
4362 C CA  . LYS E 53  ? 0.8825 0.8600 0.9228 0.0103  -0.0824 0.1338  53  LYS E CA  
4363 C C   . LYS E 53  ? 0.9187 0.8808 0.9728 0.0109  -0.0863 0.1396  53  LYS E C   
4364 O O   . LYS E 53  ? 0.9559 0.9136 1.0214 0.0166  -0.0927 0.1401  53  LYS E O   
4365 C CB  . LYS E 53  ? 0.9030 0.8902 0.9271 0.0087  -0.0845 0.1461  53  LYS E CB  
4366 C CG  . LYS E 53  ? 0.9277 0.9176 0.9538 0.0132  -0.0936 0.1576  53  LYS E CG  
4367 C CD  . LYS E 53  ? 0.9129 0.9182 0.9221 0.0123  -0.0953 0.1673  53  LYS E CD  
4368 C CE  . LYS E 53  ? 0.9533 0.9583 0.9515 0.0057  -0.0906 0.1755  53  LYS E CE  
4369 N NZ  . LYS E 53  ? 0.9709 0.9941 0.9516 0.0054  -0.0914 0.1830  53  LYS E NZ  
4370 N N   . LYS E 54  ? 0.9194 0.8733 0.9727 0.0049  -0.0826 0.1434  54  LYS E N   
4371 C CA  . LYS E 54  ? 0.9204 0.8575 0.9872 0.0043  -0.0857 0.1476  54  LYS E CA  
4372 C C   . LYS E 54  ? 0.9142 0.8447 0.9981 0.0089  -0.0856 0.1335  54  LYS E C   
4373 O O   . LYS E 54  ? 0.9679 0.8867 1.0652 0.0133  -0.0914 0.1353  54  LYS E O   
4374 C CB  . LYS E 54  ? 0.9503 0.8822 1.0127 -0.0043 -0.0806 0.1520  54  LYS E CB  
4375 C CG  . LYS E 54  ? 1.0492 0.9621 1.1251 -0.0066 -0.0840 0.1569  54  LYS E CG  
4376 C CD  . LYS E 54  ? 1.1165 1.0268 1.1873 -0.0164 -0.0788 0.1609  54  LYS E CD  
4377 C CE  . LYS E 54  ? 1.1339 1.0237 1.2190 -0.0197 -0.0823 0.1652  54  LYS E CE  
4378 N NZ  . LYS E 54  ? 1.1138 1.0026 1.1943 -0.0305 -0.0773 0.1686  54  LYS E NZ  
4379 N N   . HIS E 55  ? 0.8775 0.8165 0.9609 0.0084  -0.0791 0.1200  55  HIS E N   
4380 C CA  . HIS E 55  ? 0.7989 0.7360 0.8979 0.0124  -0.0781 0.1061  55  HIS E CA  
4381 C C   . HIS E 55  ? 0.8314 0.7694 0.9402 0.0208  -0.0853 0.1039  55  HIS E C   
4382 O O   . HIS E 55  ? 0.8685 0.7973 0.9924 0.0255  -0.0890 0.1001  55  HIS E O   
4383 C CB  . HIS E 55  ? 0.6583 0.6077 0.7534 0.0104  -0.0696 0.0942  55  HIS E CB  
4384 C CG  . HIS E 55  ? 0.6390 0.5911 0.7495 0.0146  -0.0685 0.0804  55  HIS E CG  
4385 N ND1 . HIS E 55  ? 0.6526 0.6005 0.7738 0.0134  -0.0652 0.0727  55  HIS E ND1 
4386 C CD2 . HIS E 55  ? 0.6234 0.5840 0.7404 0.0200  -0.0704 0.0727  55  HIS E CD2 
4387 C CE1 . HIS E 55  ? 0.6238 0.5783 0.7573 0.0184  -0.0650 0.0610  55  HIS E CE1 
4388 N NE2 . HIS E 55  ? 0.5968 0.5589 0.7280 0.0222  -0.0681 0.0612  55  HIS E NE2 
4389 N N   . PHE E 56  ? 0.8292 0.7791 0.9297 0.0230  -0.0873 0.1056  56  PHE E N   
4390 C CA  . PHE E 56  ? 0.8539 0.8088 0.9629 0.0307  -0.0936 0.1027  56  PHE E CA  
4391 C C   . PHE E 56  ? 0.9677 0.9159 1.0789 0.0354  -0.1023 0.1158  56  PHE E C   
4392 O O   . PHE E 56  ? 1.0062 0.9579 1.1258 0.0427  -0.1082 0.1146  56  PHE E O   
4393 C CB  . PHE E 56  ? 0.8024 0.7739 0.9027 0.0306  -0.0921 0.0975  56  PHE E CB  
4394 C CG  . PHE E 56  ? 0.7153 0.6935 0.8171 0.0278  -0.0845 0.0843  56  PHE E CG  
4395 C CD1 . PHE E 56  ? 0.6931 0.6740 0.8098 0.0316  -0.0843 0.0733  56  PHE E CD1 
4396 C CD2 . PHE E 56  ? 0.6980 0.6809 0.7866 0.0220  -0.0774 0.0834  56  PHE E CD2 
4397 C CE1 . PHE E 56  ? 0.6853 0.6740 0.8040 0.0290  -0.0772 0.0626  56  PHE E CE1 
4398 C CE2 . PHE E 56  ? 0.7282 0.7171 0.8187 0.0199  -0.0702 0.0726  56  PHE E CE2 
4399 C CZ  . PHE E 56  ? 0.6830 0.6751 0.7887 0.0231  -0.0701 0.0627  56  PHE E CZ  
4400 N N   . GLN E 57  ? 1.0333 0.9734 1.1373 0.0312  -0.1030 0.1291  57  GLN E N   
4401 C CA  . GLN E 57  ? 1.0750 1.0083 1.1815 0.0353  -0.1110 0.1439  57  GLN E CA  
4402 C C   . GLN E 57  ? 1.0867 0.9995 1.2091 0.0379  -0.1140 0.1453  57  GLN E C   
4403 O O   . GLN E 57  ? 1.1203 1.0252 1.2488 0.0433  -0.1210 0.1561  57  GLN E O   
4404 C CB  . GLN E 57  ? 1.0832 1.0196 1.1743 0.0296  -0.1110 0.1592  57  GLN E CB  
4405 C CG  . GLN E 57  ? 1.0750 1.0319 1.1523 0.0307  -0.1121 0.1615  57  GLN E CG  
4406 C CD  . GLN E 57  ? 1.0558 1.0186 1.1177 0.0256  -0.1119 0.1760  57  GLN E CD  
4407 O OE1 . GLN E 57  ? 1.0356 0.9878 1.0964 0.0200  -0.1101 0.1844  57  GLN E OE1 
4408 N NE2 . GLN E 57  ? 1.0610 1.0424 1.1112 0.0273  -0.1138 0.1786  57  GLN E NE2 
4409 N N   . LYS E 58  ? 1.0778 0.9826 1.2073 0.0345  -0.1088 0.1341  58  LYS E N   
4410 C CA  . LYS E 58  ? 1.1060 0.9913 1.2515 0.0370  -0.1113 0.1321  58  LYS E CA  
4411 C C   . LYS E 58  ? 1.1612 1.0464 1.3209 0.0483  -0.1171 0.1256  58  LYS E C   
4412 O O   . LYS E 58  ? 1.2344 1.1032 1.4067 0.0537  -0.1223 0.1288  58  LYS E O   
4413 C CB  . LYS E 58  ? 1.1020 0.9838 1.2518 0.0312  -0.1040 0.1191  58  LYS E CB  
4414 C CG  . LYS E 58  ? 1.1600 1.0416 1.2972 0.0202  -0.0982 0.1253  58  LYS E CG  
4415 C CD  . LYS E 58  ? 1.2142 1.0944 1.3567 0.0151  -0.0912 0.1120  58  LYS E CD  
4416 C CE  . LYS E 58  ? 1.2567 1.1409 1.3854 0.0046  -0.0848 0.1175  58  LYS E CE  
4417 N NZ  . LYS E 58  ? 1.3005 1.1723 1.4253 -0.0006 -0.0886 0.1346  58  LYS E NZ  
4418 N N   . VAL E 59  ? 1.1437 1.0475 1.3015 0.0520  -0.1162 0.1165  59  VAL E N   
4419 C CA  . VAL E 59  ? 1.1611 1.0696 1.3317 0.0625  -0.1210 0.1088  59  VAL E CA  
4420 C C   . VAL E 59  ? 1.1980 1.1159 1.3647 0.0689  -0.1279 0.1192  59  VAL E C   
4421 O O   . VAL E 59  ? 1.2169 1.1448 1.3913 0.0772  -0.1317 0.1131  59  VAL E O   
4422 C CB  . VAL E 59  ? 1.1524 1.0776 1.3255 0.0624  -0.1159 0.0917  59  VAL E CB  
4423 C CG1 . VAL E 59  ? 1.1392 1.0587 1.3164 0.0568  -0.1089 0.0814  59  VAL E CG1 
4424 C CG2 . VAL E 59  ? 1.1333 1.0767 1.2916 0.0577  -0.1129 0.0925  59  VAL E CG2 
4425 N N   . MET E 60  ? 1.2173 1.1344 1.3722 0.0652  -0.1296 0.1348  60  MET E N   
4426 C CA  . MET E 60  ? 1.2429 1.1727 1.3928 0.0709  -0.1358 0.1451  60  MET E CA  
4427 C C   . MET E 60  ? 1.2598 1.1769 1.4106 0.0737  -0.1419 0.1645  60  MET E C   
4428 O O   . MET E 60  ? 1.2076 1.1085 1.3568 0.0676  -0.1402 0.1729  60  MET E O   
4429 C CB  . MET E 60  ? 1.2540 1.2036 1.3869 0.0648  -0.1326 0.1452  60  MET E CB  
4430 C CG  . MET E 60  ? 1.2501 1.2139 1.3826 0.0630  -0.1277 0.1278  60  MET E CG  
4431 S SD  . MET E 60  ? 1.1260 1.1102 1.2392 0.0565  -0.1244 0.1274  60  MET E SD  
4432 C CE  . MET E 60  ? 0.8536 0.8531 0.9646 0.0642  -0.1335 0.1379  60  MET E CE  
4433 N N   . ARG E 61  ? 1.3248 1.2507 1.4784 0.0829  -0.1488 0.1720  61  ARG E N   
4434 C CA  . ARG E 61  ? 1.4202 1.3382 1.5738 0.0866  -0.1548 0.1924  61  ARG E CA  
4435 C C   . ARG E 61  ? 1.4206 1.3520 1.5566 0.0792  -0.1536 0.2049  61  ARG E C   
4436 O O   . ARG E 61  ? 1.3942 1.3452 1.5188 0.0751  -0.1502 0.1971  61  ARG E O   
4437 C CB  . ARG E 61  ? 1.4994 1.4271 1.6610 0.0997  -0.1624 0.1962  61  ARG E CB  
4438 C CG  . ARG E 61  ? 1.5444 1.4642 1.7227 0.1086  -0.1640 0.1824  61  ARG E CG  
4439 C CD  . ARG E 61  ? 1.6077 1.4982 1.7998 0.1132  -0.1671 0.1893  61  ARG E CD  
4440 N NE  . ARG E 61  ? 1.6647 1.5520 1.8596 0.1220  -0.1744 0.2087  61  ARG E NE  
4441 C CZ  . ARG E 61  ? 1.6912 1.5534 1.8989 0.1286  -0.1786 0.2173  61  ARG E CZ  
4442 N NH1 . ARG E 61  ? 1.6930 1.5313 1.9120 0.1271  -0.1764 0.2067  61  ARG E NH1 
4443 N NH2 . ARG E 61  ? 1.7052 1.5666 1.9148 0.1369  -0.1851 0.2364  61  ARG E NH2 
4444 N N   . GLN E 62  ? 1.4506 1.3717 1.5847 0.0776  -0.1564 0.2242  62  GLN E N   
4445 C CA  . GLN E 62  ? 1.4307 1.3656 1.5485 0.0709  -0.1555 0.2376  62  GLN E CA  
4446 C C   . GLN E 62  ? 1.3826 1.3462 1.4922 0.0768  -0.1595 0.2409  62  GLN E C   
4447 O O   . GLN E 62  ? 1.3526 1.3349 1.4470 0.0717  -0.1578 0.2441  62  GLN E O   
4448 C CB  . GLN E 62  ? 1.4701 1.3885 1.5898 0.0686  -0.1584 0.2592  62  GLN E CB  
4449 C CG  . GLN E 62  ? 1.4854 1.4165 1.5886 0.0598  -0.1564 0.2726  62  GLN E CG  
4450 C CD  . GLN E 62  ? 1.4819 1.4084 1.5772 0.0481  -0.1484 0.2630  62  GLN E CD  
4451 O OE1 . GLN E 62  ? 1.4752 1.3858 1.5789 0.0458  -0.1444 0.2487  62  GLN E OE1 
4452 N NE2 . GLN E 62  ? 1.4678 1.4104 1.5469 0.0412  -0.1459 0.2707  62  GLN E NE2 
4453 N N   . GLU E 63  ? 1.3715 1.3396 1.4912 0.0877  -0.1650 0.2394  63  GLU E N   
4454 C CA  . GLU E 63  ? 1.3597 1.3563 1.4738 0.0941  -0.1695 0.2419  63  GLU E CA  
4455 C C   . GLU E 63  ? 1.3266 1.3421 1.4348 0.0915  -0.1658 0.2215  63  GLU E C   
4456 O O   . GLU E 63  ? 1.2978 1.3393 1.3974 0.0929  -0.1679 0.2209  63  GLU E O   
4457 C CB  . GLU E 63  ? 1.3745 1.3693 1.5025 0.1073  -0.1766 0.2477  63  GLU E CB  
4458 C CG  . GLU E 63  ? 1.3848 1.3648 1.5277 0.1120  -0.1757 0.2312  63  GLU E CG  
4459 C CD  . GLU E 63  ? 1.4173 1.3844 1.5755 0.1246  -0.1822 0.2400  63  GLU E CD  
4460 O OE1 . GLU E 63  ? 1.4226 1.3700 1.5940 0.1280  -0.1815 0.2298  63  GLU E OE1 
4461 O OE2 . GLU E 63  ? 1.4493 1.4267 1.6064 0.1317  -0.1879 0.2570  63  GLU E OE2 
4462 N N   . ASP E 64  ? 1.3169 1.3198 1.4303 0.0874  -0.1604 0.2048  64  ASP E N   
4463 C CA  . ASP E 64  ? 1.2714 1.2893 1.3819 0.0849  -0.1567 0.1856  64  ASP E CA  
4464 C C   . ASP E 64  ? 1.2416 1.2639 1.3373 0.0740  -0.1498 0.1801  64  ASP E C   
4465 O O   . ASP E 64  ? 1.2209 1.2579 1.3111 0.0711  -0.1470 0.1670  64  ASP E O   
4466 C CB  . ASP E 64  ? 1.2445 1.2501 1.3695 0.0875  -0.1546 0.1705  64  ASP E CB  
4467 C CG  . ASP E 64  ? 1.2593 1.2643 1.3986 0.0996  -0.1614 0.1729  64  ASP E CG  
4468 O OD1 . ASP E 64  ? 1.2739 1.2984 1.4113 0.1058  -0.1669 0.1785  64  ASP E OD1 
4469 O OD2 . ASP E 64  ? 1.2733 1.2596 1.4259 0.1033  -0.1614 0.1688  64  ASP E OD2 
4470 N N   . ILE E 65  ? 1.2099 1.2195 1.2995 0.0680  -0.1471 0.1904  65  ILE E N   
4471 C CA  . ILE E 65  ? 1.1546 1.1684 1.2298 0.0586  -0.1405 0.1862  65  ILE E CA  
4472 C C   . ILE E 65  ? 1.1485 1.1848 1.2084 0.0578  -0.1427 0.1942  65  ILE E C   
4473 O O   . ILE E 65  ? 1.1888 1.2340 1.2483 0.0629  -0.1489 0.2088  65  ILE E O   
4474 C CB  . ILE E 65  ? 1.1106 1.1040 1.1850 0.0517  -0.1360 0.1925  65  ILE E CB  
4475 C CG1 . ILE E 65  ? 1.1427 1.1348 1.2120 0.0510  -0.1400 0.2141  65  ILE E CG1 
4476 C CG2 . ILE E 65  ? 1.0969 1.0685 1.1878 0.0534  -0.1351 0.1856  65  ILE E CG2 
4477 C CD1 . ILE E 65  ? 1.1498 1.1248 1.2173 0.0427  -0.1357 0.2207  65  ILE E CD1 
4478 N N   . SER E 66  ? 1.0833 1.1298 1.1310 0.0519  -0.1374 0.1844  66  SER E N   
4479 C CA  . SER E 66  ? 1.0041 1.0724 1.0362 0.0507  -0.1387 0.1891  66  SER E CA  
4480 C C   . SER E 66  ? 0.9744 1.0427 0.9940 0.0430  -0.1310 0.1801  66  SER E C   
4481 O O   . SER E 66  ? 0.9501 1.0013 0.9718 0.0383  -0.1253 0.1774  66  SER E O   
4482 C CB  . SER E 66  ? 0.9466 1.0368 0.9791 0.0559  -0.1433 0.1814  66  SER E CB  
4483 O OG  . SER E 66  ? 0.9106 0.9994 0.9475 0.0541  -0.1395 0.1621  66  SER E OG  
4484 N N   . GLU E 67  ? 0.9770 1.0653 0.9838 0.0423  -0.1308 0.1751  67  GLU E N   
4485 C CA  . GLU E 67  ? 0.9748 1.0638 0.9698 0.0364  -0.1237 0.1653  67  GLU E CA  
4486 C C   . GLU E 67  ? 0.9733 1.0517 0.9762 0.0345  -0.1186 0.1474  67  GLU E C   
4487 O O   . GLU E 67  ? 1.0042 1.0897 1.0135 0.0371  -0.1210 0.1374  67  GLU E O   
4488 C CB  . GLU E 67  ? 0.9810 1.0940 0.9614 0.0370  -0.1254 0.1628  67  GLU E CB  
4489 C CG  . GLU E 67  ? 1.0221 1.1358 0.9888 0.0321  -0.1183 0.1542  67  GLU E CG  
4490 C CD  . GLU E 67  ? 1.0583 1.1957 1.0108 0.0334  -0.1204 0.1505  67  GLU E CD  
4491 O OE1 . GLU E 67  ? 1.0662 1.2217 1.0191 0.0377  -0.1274 0.1551  67  GLU E OE1 
4492 O OE2 . GLU E 67  ? 1.0498 1.1885 0.9907 0.0306  -0.1149 0.1427  67  GLU E OE2 
4493 N N   . ILE E 68  ? 0.8892 0.9522 0.8918 0.0298  -0.1115 0.1440  68  ILE E N   
4494 C CA  . ILE E 68  ? 0.7957 0.8497 0.8058 0.0278  -0.1058 0.1287  68  ILE E CA  
4495 C C   . ILE E 68  ? 0.8217 0.8858 0.8220 0.0256  -0.1022 0.1161  68  ILE E C   
4496 O O   . ILE E 68  ? 0.8173 0.8909 0.8029 0.0244  -0.1014 0.1186  68  ILE E O   
4497 C CB  . ILE E 68  ? 0.6450 0.6820 0.6573 0.0236  -0.0991 0.1294  68  ILE E CB  
4498 C CG1 . ILE E 68  ? 0.6372 0.6657 0.6617 0.0230  -0.0946 0.1159  68  ILE E CG1 
4499 C CG2 . ILE E 68  ? 0.5727 0.6127 0.5688 0.0191  -0.0931 0.1309  68  ILE E CG2 
4500 C CD1 . ILE E 68  ? 0.4760 0.4913 0.5024 0.0189  -0.0876 0.1152  68  ILE E CD1 
4501 N N   . TRP E 69  ? 0.8138 0.8763 0.8227 0.0251  -0.1002 0.1026  69  TRP E N   
4502 C CA  . TRP E 69  ? 0.7692 0.8367 0.7707 0.0221  -0.0957 0.0900  69  TRP E CA  
4503 C C   . TRP E 69  ? 0.7371 0.7953 0.7491 0.0196  -0.0900 0.0782  69  TRP E C   
4504 O O   . TRP E 69  ? 0.7637 0.8167 0.7900 0.0212  -0.0913 0.0774  69  TRP E O   
4505 C CB  . TRP E 69  ? 0.7451 0.8301 0.7422 0.0238  -0.1015 0.0856  69  TRP E CB  
4506 C CG  . TRP E 69  ? 0.8089 0.9008 0.8197 0.0267  -0.1075 0.0818  69  TRP E CG  
4507 C CD1 . TRP E 69  ? 0.8392 0.9349 0.8576 0.0318  -0.1143 0.0915  69  TRP E CD1 
4508 C CD2 . TRP E 69  ? 0.8130 0.9099 0.8309 0.0248  -0.1073 0.0678  69  TRP E CD2 
4509 N NE1 . TRP E 69  ? 0.8458 0.9498 0.8755 0.0339  -0.1183 0.0839  69  TRP E NE1 
4510 C CE2 . TRP E 69  ? 0.7940 0.8996 0.8236 0.0291  -0.1141 0.0694  69  TRP E CE2 
4511 C CE3 . TRP E 69  ? 0.8017 0.8965 0.8177 0.0198  -0.1019 0.0546  69  TRP E CE3 
4512 C CZ2 . TRP E 69  ? 0.7456 0.8597 0.7848 0.0280  -0.1158 0.0579  69  TRP E CZ2 
4513 C CZ3 . TRP E 69  ? 0.8012 0.9028 0.8273 0.0181  -0.1035 0.0437  69  TRP E CZ3 
4514 C CH2 . TRP E 69  ? 0.7507 0.8628 0.7880 0.0219  -0.1105 0.0453  69  TRP E CH2 
4515 N N   . PHE E 70  ? 0.6501 0.7071 0.6550 0.0161  -0.0838 0.0693  70  PHE E N   
4516 C CA  . PHE E 70  ? 0.6394 0.6881 0.6530 0.0134  -0.0771 0.0601  70  PHE E CA  
4517 C C   . PHE E 70  ? 0.7005 0.7548 0.7152 0.0110  -0.0766 0.0479  70  PHE E C   
4518 O O   . PHE E 70  ? 0.7771 0.8387 0.7813 0.0105  -0.0784 0.0448  70  PHE E O   
4519 C CB  . PHE E 70  ? 0.5820 0.6216 0.5874 0.0111  -0.0686 0.0619  70  PHE E CB  
4520 C CG  . PHE E 70  ? 0.5845 0.6192 0.5875 0.0119  -0.0687 0.0737  70  PHE E CG  
4521 C CD1 . PHE E 70  ? 0.5955 0.6226 0.6115 0.0124  -0.0684 0.0761  70  PHE E CD1 
4522 C CD2 . PHE E 70  ? 0.5975 0.6358 0.5855 0.0120  -0.0692 0.0821  70  PHE E CD2 
4523 C CE1 . PHE E 70  ? 0.6423 0.6635 0.6568 0.0122  -0.0687 0.0864  70  PHE E CE1 
4524 C CE2 . PHE E 70  ? 0.6145 0.6486 0.6009 0.0116  -0.0694 0.0936  70  PHE E CE2 
4525 C CZ  . PHE E 70  ? 0.6141 0.6386 0.6139 0.0113  -0.0691 0.0956  70  PHE E CZ  
4526 N N   . GLU E 71  ? 0.6220 0.6738 0.6500 0.0092  -0.0741 0.0405  71  GLU E N   
4527 C CA  . GLU E 71  ? 0.6482 0.7040 0.6790 0.0055  -0.0730 0.0292  71  GLU E CA  
4528 C C   . GLU E 71  ? 0.6833 0.7319 0.7231 0.0023  -0.0653 0.0236  71  GLU E C   
4529 O O   . GLU E 71  ? 0.7557 0.8014 0.8057 0.0037  -0.0636 0.0263  71  GLU E O   
4530 C CB  . GLU E 71  ? 0.6830 0.7517 0.7228 0.0065  -0.0811 0.0255  71  GLU E CB  
4531 C CG  . GLU E 71  ? 0.7429 0.8132 0.7985 0.0095  -0.0840 0.0278  71  GLU E CG  
4532 C CD  . GLU E 71  ? 0.8050 0.8784 0.8742 0.0061  -0.0815 0.0183  71  GLU E CD  
4533 O OE1 . GLU E 71  ? 0.8242 0.9027 0.9068 0.0090  -0.0847 0.0184  71  GLU E OE1 
4534 O OE2 . GLU E 71  ? 0.8434 0.9145 0.9102 0.0007  -0.0765 0.0111  71  GLU E OE2 
4535 N N   . TYR E 72  ? 0.6575 0.7036 0.6938 -0.0018 -0.0608 0.0160  72  TYR E N   
4536 C CA  . TYR E 72  ? 0.6411 0.6822 0.6866 -0.0053 -0.0536 0.0112  72  TYR E CA  
4537 C C   . TYR E 72  ? 0.6596 0.7070 0.7139 -0.0099 -0.0559 0.0018  72  TYR E C   
4538 O O   . TYR E 72  ? 0.6650 0.7126 0.7121 -0.0126 -0.0572 -0.0040 72  TYR E O   
4539 C CB  . TYR E 72  ? 0.6206 0.6513 0.6551 -0.0064 -0.0449 0.0115  72  TYR E CB  
4540 C CG  . TYR E 72  ? 0.6075 0.6338 0.6507 -0.0100 -0.0372 0.0073  72  TYR E CG  
4541 C CD1 . TYR E 72  ? 0.6111 0.6378 0.6642 -0.0091 -0.0326 0.0106  72  TYR E CD1 
4542 C CD2 . TYR E 72  ? 0.6084 0.6306 0.6503 -0.0143 -0.0346 0.0000  72  TYR E CD2 
4543 C CE1 . TYR E 72  ? 0.6367 0.6622 0.6981 -0.0122 -0.0254 0.0079  72  TYR E CE1 
4544 C CE2 . TYR E 72  ? 0.6269 0.6452 0.6773 -0.0178 -0.0274 -0.0022 72  TYR E CE2 
4545 C CZ  . TYR E 72  ? 0.6706 0.6916 0.7307 -0.0166 -0.0228 0.0023  72  TYR E CZ  
4546 O OH  . TYR E 72  ? 0.7407 0.7603 0.8095 -0.0198 -0.0155 0.0012  72  TYR E OH  
4547 N N   . GLU E 73  ? 0.6759 0.7294 0.7460 -0.0108 -0.0566 -0.0001 73  GLU E N   
4548 C CA  . GLU E 73  ? 0.7087 0.7701 0.7891 -0.0160 -0.0584 -0.0084 73  GLU E CA  
4549 C C   . GLU E 73  ? 0.7127 0.7837 0.7892 -0.0168 -0.0668 -0.0129 73  GLU E C   
4550 O O   . GLU E 73  ? 0.7381 0.8112 0.8153 -0.0227 -0.0671 -0.0211 73  GLU E O   
4551 C CB  . GLU E 73  ? 0.7414 0.7939 0.8211 -0.0220 -0.0504 -0.0130 73  GLU E CB  
4552 C CG  . GLU E 73  ? 0.8412 0.8884 0.9267 -0.0215 -0.0419 -0.0089 73  GLU E CG  
4553 C CD  . GLU E 73  ? 0.9835 1.0405 1.0868 -0.0248 -0.0409 -0.0118 73  GLU E CD  
4554 O OE1 . GLU E 73  ? 1.0377 1.0996 1.1470 -0.0308 -0.0429 -0.0182 73  GLU E OE1 
4555 O OE2 . GLU E 73  ? 1.0138 1.0750 1.1254 -0.0217 -0.0383 -0.0081 73  GLU E OE2 
4556 N N   . GLY E 74  ? 0.7003 0.7774 0.7729 -0.0110 -0.0734 -0.0073 74  GLY E N   
4557 C CA  . GLY E 74  ? 0.7234 0.8132 0.7925 -0.0106 -0.0816 -0.0103 74  GLY E CA  
4558 C C   . GLY E 74  ? 0.7480 0.8351 0.7999 -0.0097 -0.0824 -0.0095 74  GLY E C   
4559 O O   . GLY E 74  ? 0.6848 0.7838 0.7316 -0.0069 -0.0896 -0.0085 74  GLY E O   
4560 N N   . THR E 75  ? 0.7933 0.8664 0.8360 -0.0113 -0.0751 -0.0098 75  THR E N   
4561 C CA  . THR E 75  ? 0.7743 0.8449 0.8001 -0.0100 -0.0749 -0.0099 75  THR E CA  
4562 C C   . THR E 75  ? 0.7513 0.8211 0.7677 -0.0038 -0.0758 0.0021  75  THR E C   
4563 O O   . THR E 75  ? 0.7740 0.8337 0.7907 -0.0024 -0.0703 0.0086  75  THR E O   
4564 C CB  . THR E 75  ? 0.7578 0.8136 0.7776 -0.0134 -0.0662 -0.0149 75  THR E CB  
4565 O OG1 . THR E 75  ? 0.7735 0.8289 0.8010 -0.0201 -0.0656 -0.0261 75  THR E OG1 
4566 C CG2 . THR E 75  ? 0.7011 0.7549 0.7026 -0.0105 -0.0657 -0.0146 75  THR E CG2 
4567 N N   . PRO E 76  ? 0.7637 0.8454 0.7721 -0.0004 -0.0828 0.0054  76  PRO E N   
4568 C CA  . PRO E 76  ? 0.7727 0.8543 0.7715 0.0046  -0.0837 0.0178  76  PRO E CA  
4569 C C   . PRO E 76  ? 0.7599 0.8315 0.7449 0.0044  -0.0767 0.0188  76  PRO E C   
4570 O O   . PRO E 76  ? 0.7449 0.8160 0.7218 0.0026  -0.0747 0.0101  76  PRO E O   
4571 C CB  . PRO E 76  ? 0.7210 0.8206 0.7135 0.0075  -0.0924 0.0193  76  PRO E CB  
4572 C CG  . PRO E 76  ? 0.7045 0.8144 0.7083 0.0049  -0.0970 0.0099  76  PRO E CG  
4573 C CD  . PRO E 76  ? 0.7283 0.8266 0.7373 -0.0012 -0.0903 -0.0013 76  PRO E CD  
4574 N N   . LEU E 77  ? 0.7465 0.8104 0.7291 0.0064  -0.0730 0.0289  77  LEU E N   
4575 C CA  . LEU E 77  ? 0.6707 0.7266 0.6409 0.0067  -0.0658 0.0308  77  LEU E CA  
4576 C C   . LEU E 77  ? 0.6610 0.7264 0.6152 0.0100  -0.0690 0.0374  77  LEU E C   
4577 O O   . LEU E 77  ? 0.6407 0.7102 0.5938 0.0122  -0.0722 0.0492  77  LEU E O   
4578 C CB  . LEU E 77  ? 0.6323 0.6776 0.6079 0.0065  -0.0598 0.0375  77  LEU E CB  
4579 C CG  . LEU E 77  ? 0.6060 0.6443 0.5973 0.0037  -0.0558 0.0317  77  LEU E CG  
4580 C CD1 . LEU E 77  ? 0.6163 0.6475 0.6129 0.0041  -0.0506 0.0382  77  LEU E CD1 
4581 C CD2 . LEU E 77  ? 0.5312 0.5639 0.5206 0.0007  -0.0501 0.0215  77  LEU E CD2 
4582 N N   . LYS E 78  ? 0.6486 0.7179 0.5910 0.0103  -0.0682 0.0299  78  LYS E N   
4583 C CA  . LYS E 78  ? 0.6266 0.7071 0.5527 0.0139  -0.0704 0.0350  78  LYS E CA  
4584 C C   . LYS E 78  ? 0.6344 0.7092 0.5530 0.0151  -0.0648 0.0458  78  LYS E C   
4585 O O   . LYS E 78  ? 0.7078 0.7720 0.6227 0.0146  -0.0569 0.0425  78  LYS E O   
4586 C CB  . LYS E 78  ? 0.6433 0.7270 0.5586 0.0144  -0.0694 0.0225  78  LYS E CB  
4587 C CG  . LYS E 78  ? 0.7118 0.8062 0.6318 0.0130  -0.0763 0.0118  78  LYS E CG  
4588 C CD  . LYS E 78  ? 0.7680 0.8600 0.6802 0.0124  -0.0739 -0.0033 78  LYS E CD  
4589 C CE  . LYS E 78  ? 0.8648 0.9730 0.7779 0.0116  -0.0818 -0.0136 78  LYS E CE  
4590 N NZ  . LYS E 78  ? 0.9186 1.0269 0.8486 0.0069  -0.0852 -0.0176 78  LYS E NZ  
4591 N N   . TRP E 79  ? 0.5772 0.6596 0.4937 0.0166  -0.0688 0.0591  79  TRP E N   
4592 C CA  . TRP E 79  ? 0.5963 0.6745 0.5075 0.0166  -0.0642 0.0702  79  TRP E CA  
4593 C C   . TRP E 79  ? 0.6645 0.7489 0.5574 0.0188  -0.0601 0.0703  79  TRP E C   
4594 O O   . TRP E 79  ? 0.7121 0.7917 0.5998 0.0184  -0.0540 0.0757  79  TRP E O   
4595 C CB  . TRP E 79  ? 0.6327 0.7171 0.5471 0.0169  -0.0702 0.0849  79  TRP E CB  
4596 C CG  . TRP E 79  ? 0.6977 0.8011 0.6015 0.0198  -0.0770 0.0905  79  TRP E CG  
4597 C CD1 . TRP E 79  ? 0.7130 0.8285 0.6207 0.0216  -0.0849 0.0891  79  TRP E CD1 
4598 C CD2 . TRP E 79  ? 0.7513 0.8672 0.6389 0.0214  -0.0764 0.0984  79  TRP E CD2 
4599 N NE1 . TRP E 79  ? 0.7632 0.8983 0.6583 0.0244  -0.0893 0.0958  79  TRP E NE1 
4600 C CE2 . TRP E 79  ? 0.7587 0.8944 0.6413 0.0243  -0.0843 0.1016  79  TRP E CE2 
4601 C CE3 . TRP E 79  ? 0.7010 0.8153 0.5778 0.0208  -0.0701 0.1031  79  TRP E CE3 
4602 C CZ2 . TRP E 79  ? 0.6984 0.8526 0.5658 0.0266  -0.0860 0.1096  79  TRP E CZ2 
4603 C CZ3 . TRP E 79  ? 0.7097 0.8420 0.5713 0.0230  -0.0718 0.1109  79  TRP E CZ3 
4604 C CH2 . TRP E 79  ? 0.7020 0.8541 0.5591 0.0259  -0.0797 0.1142  79  TRP E CH2 
4605 N N   . HIS E 80  ? 0.7221 0.8188 0.6051 0.0215  -0.0637 0.0639  80  HIS E N   
4606 C CA  . HIS E 80  ? 0.7416 0.8466 0.6068 0.0248  -0.0605 0.0633  80  HIS E CA  
4607 C C   . HIS E 80  ? 0.7528 0.8447 0.6144 0.0256  -0.0524 0.0514  80  HIS E C   
4608 O O   . HIS E 80  ? 0.7717 0.8681 0.6188 0.0292  -0.0486 0.0498  80  HIS E O   
4609 C CB  . HIS E 80  ? 0.6812 0.8074 0.5364 0.0282  -0.0677 0.0614  80  HIS E CB  
4610 C CG  . HIS E 80  ? 0.7073 0.8351 0.5686 0.0279  -0.0721 0.0473  80  HIS E CG  
4611 N ND1 . HIS E 80  ? 0.7285 0.8604 0.6023 0.0260  -0.0788 0.0487  80  HIS E ND1 
4612 C CD2 . HIS E 80  ? 0.7197 0.8460 0.5766 0.0290  -0.0709 0.0313  80  HIS E CD2 
4613 C CE1 . HIS E 80  ? 0.7282 0.8627 0.6050 0.0254  -0.0815 0.0341  80  HIS E CE1 
4614 N NE2 . HIS E 80  ? 0.7359 0.8661 0.6028 0.0268  -0.0768 0.0232  80  HIS E NE2 
4615 N N   . TYR E 81  ? 0.6888 0.7652 0.5638 0.0225  -0.0496 0.0438  81  TYR E N   
4616 C CA  . TYR E 81  ? 0.7372 0.7990 0.6114 0.0227  -0.0410 0.0353  81  TYR E CA  
4617 C C   . TYR E 81  ? 0.7089 0.7617 0.5878 0.0212  -0.0340 0.0437  81  TYR E C   
4618 O O   . TYR E 81  ? 0.7669 0.8168 0.6585 0.0180  -0.0357 0.0495  81  TYR E O   
4619 C CB  . TYR E 81  ? 0.7763 0.8278 0.6633 0.0195  -0.0415 0.0228  81  TYR E CB  
4620 C CG  . TYR E 81  ? 0.8260 0.8838 0.7084 0.0203  -0.0467 0.0105  81  TYR E CG  
4621 C CD1 . TYR E 81  ? 0.8632 0.9388 0.7327 0.0241  -0.0523 0.0114  81  TYR E CD1 
4622 C CD2 . TYR E 81  ? 0.7920 0.8395 0.6836 0.0169  -0.0459 -0.0023 81  TYR E CD2 
4623 C CE1 . TYR E 81  ? 0.8506 0.9340 0.7164 0.0249  -0.0571 -0.0012 81  TYR E CE1 
4624 C CE2 . TYR E 81  ? 0.7799 0.8331 0.6681 0.0169  -0.0507 -0.0148 81  TYR E CE2 
4625 C CZ  . TYR E 81  ? 0.8331 0.9045 0.7083 0.0211  -0.0563 -0.0149 81  TYR E CZ  
4626 O OH  . TYR E 81  ? 0.8802 0.9591 0.7524 0.0211  -0.0612 -0.0288 81  TYR E OH  
4627 N N   . PRO E 82  ? 0.6730 0.7223 0.5419 0.0240  -0.0261 0.0440  82  PRO E N   
4628 C CA  . PRO E 82  ? 0.6591 0.7027 0.5313 0.0229  -0.0189 0.0514  82  PRO E CA  
4629 C C   . PRO E 82  ? 0.6918 0.7232 0.5822 0.0189  -0.0163 0.0483  82  PRO E C   
4630 O O   . PRO E 82  ? 0.7496 0.7731 0.6469 0.0179  -0.0160 0.0386  82  PRO E O   
4631 C CB  . PRO E 82  ? 0.6663 0.7079 0.5253 0.0276  -0.0108 0.0482  82  PRO E CB  
4632 C CG  . PRO E 82  ? 0.6565 0.7083 0.5009 0.0319  -0.0153 0.0439  82  PRO E CG  
4633 C CD  . PRO E 82  ? 0.6948 0.7473 0.5480 0.0292  -0.0238 0.0372  82  PRO E CD  
4634 N N   . ILE E 83  ? 0.6557 0.6867 0.5541 0.0164  -0.0147 0.0563  83  ILE E N   
4635 C CA  . ILE E 83  ? 0.6291 0.6519 0.5452 0.0131  -0.0129 0.0541  83  ILE E CA  
4636 C C   . ILE E 83  ? 0.6206 0.6345 0.5404 0.0135  -0.0050 0.0466  83  ILE E C   
4637 O O   . ILE E 83  ? 0.5947 0.6030 0.5280 0.0109  -0.0056 0.0407  83  ILE E O   
4638 C CB  . ILE E 83  ? 0.6032 0.6278 0.5249 0.0111  -0.0108 0.0630  83  ILE E CB  
4639 C CG1 . ILE E 83  ? 0.5916 0.6218 0.5144 0.0098  -0.0194 0.0708  83  ILE E CG1 
4640 C CG2 . ILE E 83  ? 0.5893 0.6077 0.5283 0.0088  -0.0075 0.0596  83  ILE E CG2 
4641 C CD1 . ILE E 83  ? 0.5738 0.6044 0.5013 0.0074  -0.0179 0.0795  83  ILE E CD1 
4642 N N   . GLY E 84  ? 0.5846 0.5980 0.4925 0.0170  0.0024  0.0475  84  GLY E N   
4643 C CA  . GLY E 84  ? 0.6275 0.6320 0.5379 0.0182  0.0105  0.0422  84  GLY E CA  
4644 C C   . GLY E 84  ? 0.6782 0.6746 0.5901 0.0179  0.0082  0.0319  84  GLY E C   
4645 O O   . GLY E 84  ? 0.6890 0.6767 0.6119 0.0157  0.0116  0.0271  84  GLY E O   
4646 N N   . LEU E 85  ? 0.6855 0.6857 0.5866 0.0198  0.0022  0.0284  85  LEU E N   
4647 C CA  . LEU E 85  ? 0.6888 0.6827 0.5907 0.0190  -0.0011 0.0173  85  LEU E CA  
4648 C C   . LEU E 85  ? 0.6586 0.6514 0.5777 0.0131  -0.0068 0.0132  85  LEU E C   
4649 O O   . LEU E 85  ? 0.7075 0.6911 0.6353 0.0101  -0.0053 0.0055  85  LEU E O   
4650 C CB  . LEU E 85  ? 0.7494 0.7523 0.6364 0.0225  -0.0071 0.0144  85  LEU E CB  
4651 C CG  . LEU E 85  ? 0.7460 0.7454 0.6341 0.0212  -0.0121 0.0015  85  LEU E CG  
4652 C CD1 . LEU E 85  ? 0.7404 0.7255 0.6239 0.0239  -0.0053 -0.0069 85  LEU E CD1 
4653 C CD2 . LEU E 85  ? 0.7956 0.8103 0.6723 0.0238  -0.0202 0.0004  85  LEU E CD2 
4654 N N   . LEU E 86  ? 0.5837 0.5860 0.5075 0.0114  -0.0134 0.0189  86  LEU E N   
4655 C CA  . LEU E 86  ? 0.5357 0.5396 0.4754 0.0069  -0.0193 0.0159  86  LEU E CA  
4656 C C   . LEU E 86  ? 0.5921 0.5884 0.5471 0.0036  -0.0137 0.0148  86  LEU E C   
4657 O O   . LEU E 86  ? 0.6643 0.6583 0.6308 -0.0004 -0.0157 0.0079  86  LEU E O   
4658 C CB  . LEU E 86  ? 0.5047 0.5186 0.4471 0.0070  -0.0260 0.0243  86  LEU E CB  
4659 C CG  . LEU E 86  ? 0.5376 0.5628 0.4693 0.0093  -0.0339 0.0263  86  LEU E CG  
4660 C CD1 . LEU E 86  ? 0.4918 0.5239 0.4268 0.0096  -0.0386 0.0374  86  LEU E CD1 
4661 C CD2 . LEU E 86  ? 0.5144 0.5435 0.4501 0.0074  -0.0405 0.0164  86  LEU E CD2 
4662 N N   . PHE E 87  ? 0.5526 0.5474 0.5078 0.0051  -0.0066 0.0215  87  PHE E N   
4663 C CA  . PHE E 87  ? 0.6202 0.6113 0.5898 0.0026  -0.0008 0.0214  87  PHE E CA  
4664 C C   . PHE E 87  ? 0.6772 0.6582 0.6476 0.0017  0.0054  0.0154  87  PHE E C   
4665 O O   . PHE E 87  ? 0.7083 0.6868 0.6925 -0.0026 0.0056  0.0111  87  PHE E O   
4666 C CB  . PHE E 87  ? 0.5991 0.5938 0.5684 0.0046  0.0051  0.0298  87  PHE E CB  
4667 C CG  . PHE E 87  ? 0.5911 0.5855 0.5747 0.0028  0.0114  0.0299  87  PHE E CG  
4668 C CD1 . PHE E 87  ? 0.5816 0.5808 0.5816 -0.0001 0.0077  0.0287  87  PHE E CD1 
4669 C CD2 . PHE E 87  ? 0.6102 0.6012 0.5907 0.0047  0.0212  0.0314  87  PHE E CD2 
4670 C CE1 . PHE E 87  ? 0.5518 0.5539 0.5651 -0.0015 0.0134  0.0288  87  PHE E CE1 
4671 C CE2 . PHE E 87  ? 0.6090 0.6025 0.6029 0.0032  0.0271  0.0324  87  PHE E CE2 
4672 C CZ  . PHE E 87  ? 0.5700 0.5698 0.5803 0.0000  0.0232  0.0308  87  PHE E CZ  
4673 N N   . ASP E 88  ? 0.7073 0.6828 0.6633 0.0057  0.0103  0.0153  88  ASP E N   
4674 C CA  . ASP E 88  ? 0.7394 0.7028 0.6954 0.0057  0.0165  0.0101  88  ASP E CA  
4675 C C   . ASP E 88  ? 0.7792 0.7370 0.7419 0.0008  0.0108  0.0000  88  ASP E C   
4676 O O   . ASP E 88  ? 0.8462 0.7951 0.8186 -0.0029 0.0144  -0.0038 88  ASP E O   
4677 C CB  . ASP E 88  ? 0.7027 0.6616 0.6404 0.0123  0.0211  0.0106  88  ASP E CB  
4678 C CG  . ASP E 88  ? 0.7406 0.7043 0.6729 0.0167  0.0290  0.0201  88  ASP E CG  
4679 O OD1 . ASP E 88  ? 0.8294 0.7969 0.7735 0.0146  0.0328  0.0251  88  ASP E OD1 
4680 O OD2 . ASP E 88  ? 0.7507 0.7161 0.6669 0.0225  0.0315  0.0223  88  ASP E OD2 
4681 N N   . LEU E 89  ? 0.7321 0.6966 0.6900 0.0003  0.0018  -0.0040 89  LEU E N   
4682 C CA  . LEU E 89  ? 0.7254 0.6876 0.6878 -0.0042 -0.0043 -0.0147 89  LEU E CA  
4683 C C   . LEU E 89  ? 0.7525 0.7203 0.7333 -0.0108 -0.0085 -0.0160 89  LEU E C   
4684 O O   . LEU E 89  ? 0.8065 0.7694 0.7962 -0.0164 -0.0096 -0.0239 89  LEU E O   
4685 C CB  . LEU E 89  ? 0.7043 0.6754 0.6540 -0.0015 -0.0123 -0.0182 89  LEU E CB  
4686 C CG  . LEU E 89  ? 0.7481 0.7175 0.6972 -0.0046 -0.0178 -0.0312 89  LEU E CG  
4687 C CD1 . LEU E 89  ? 0.7377 0.6903 0.6816 -0.0037 -0.0114 -0.0384 89  LEU E CD1 
4688 C CD2 . LEU E 89  ? 0.7577 0.7413 0.6946 -0.0010 -0.0258 -0.0327 89  LEU E CD2 
4689 N N   . LEU E 90  ? 0.6624 0.6404 0.6492 -0.0100 -0.0108 -0.0086 90  LEU E N   
4690 C CA  . LEU E 90  ? 0.6396 0.6259 0.6424 -0.0146 -0.0164 -0.0101 90  LEU E CA  
4691 C C   . LEU E 90  ? 0.6869 0.6745 0.7047 -0.0166 -0.0112 -0.0056 90  LEU E C   
4692 O O   . LEU E 90  ? 0.7117 0.7035 0.7440 -0.0215 -0.0134 -0.0093 90  LEU E O   
4693 C CB  . LEU E 90  ? 0.6273 0.6259 0.6276 -0.0121 -0.0250 -0.0066 90  LEU E CB  
4694 C CG  . LEU E 90  ? 0.6154 0.6188 0.6027 -0.0102 -0.0317 -0.0105 90  LEU E CG  
4695 C CD1 . LEU E 90  ? 0.5921 0.6080 0.5783 -0.0072 -0.0393 -0.0038 90  LEU E CD1 
4696 C CD2 . LEU E 90  ? 0.5335 0.5372 0.5252 -0.0152 -0.0358 -0.0223 90  LEU E CD2 
4697 N N   . ALA E 91  ? 0.6837 0.6701 0.6984 -0.0128 -0.0046 0.0021  91  ALA E N   
4698 C CA  . ALA E 91  ? 0.6942 0.6865 0.7229 -0.0136 -0.0010 0.0064  91  ALA E CA  
4699 C C   . ALA E 91  ? 0.7229 0.7108 0.7523 -0.0124 0.0098  0.0107  91  ALA E C   
4700 O O   . ALA E 91  ? 0.7549 0.7500 0.7962 -0.0130 0.0134  0.0139  91  ALA E O   
4701 C CB  . ALA E 91  ? 0.7066 0.7077 0.7360 -0.0104 -0.0053 0.0119  91  ALA E CB  
4702 N N   . SER E 92  ? 0.6987 0.6764 0.7156 -0.0102 0.0151  0.0106  92  SER E N   
4703 C CA  . SER E 92  ? 0.6577 0.6319 0.6738 -0.0078 0.0257  0.0157  92  SER E CA  
4704 C C   . SER E 92  ? 0.7274 0.7010 0.7596 -0.0126 0.0300  0.0149  92  SER E C   
4705 O O   . SER E 92  ? 0.6661 0.6425 0.7027 -0.0110 0.0384  0.0206  92  SER E O   
4706 C CB  . SER E 92  ? 0.6915 0.6542 0.6909 -0.0037 0.0299  0.0151  92  SER E CB  
4707 O OG  . SER E 92  ? 0.7901 0.7418 0.7888 -0.0069 0.0270  0.0069  92  SER E OG  
4708 N N   . SER E 93  ? 0.8280 0.8000 0.8691 -0.0185 0.0244  0.0083  93  SER E N   
4709 C CA  . SER E 93  ? 0.8647 0.8383 0.9223 -0.0243 0.0274  0.0078  93  SER E CA  
4710 C C   . SER E 93  ? 0.8504 0.8414 0.9227 -0.0251 0.0262  0.0109  93  SER E C   
4711 O O   . SER E 93  ? 0.8631 0.8604 0.9476 -0.0272 0.0319  0.0144  93  SER E O   
4712 C CB  . SER E 93  ? 0.9111 0.8784 0.9732 -0.0312 0.0215  -0.0010 93  SER E CB  
4713 O OG  . SER E 93  ? 0.9865 0.9611 1.0466 -0.0316 0.0114  -0.0060 93  SER E OG  
4714 N N   . SER E 94  ? 0.8120 0.8115 0.8834 -0.0231 0.0188  0.0097  94  SER E N   
4715 C CA  . SER E 94  ? 0.7471 0.7624 0.8322 -0.0229 0.0166  0.0112  94  SER E CA  
4716 C C   . SER E 94  ? 0.6829 0.7046 0.7670 -0.0178 0.0230  0.0176  94  SER E C   
4717 O O   . SER E 94  ? 0.7149 0.7299 0.7859 -0.0141 0.0279  0.0214  94  SER E O   
4718 C CB  . SER E 94  ? 0.7424 0.7629 0.8277 -0.0221 0.0060  0.0076  94  SER E CB  
4719 O OG  . SER E 94  ? 0.8016 0.8202 0.8893 -0.0270 -0.0002 0.0011  94  SER E OG  
4720 N N   . ALA E 95  ? 0.5874 0.6239 0.6855 -0.0176 0.0229  0.0182  95  ALA E N   
4721 C CA  . ALA E 95  ? 0.5354 0.5811 0.6350 -0.0134 0.0287  0.0228  95  ALA E CA  
4722 C C   . ALA E 95  ? 0.5833 0.6270 0.6733 -0.0093 0.0244  0.0237  95  ALA E C   
4723 O O   . ALA E 95  ? 0.6486 0.6896 0.7374 -0.0094 0.0156  0.0209  95  ALA E O   
4724 C CB  . ALA E 95  ? 0.5233 0.5870 0.6414 -0.0141 0.0291  0.0217  95  ALA E CB  
4725 N N   . LEU E 96  ? 0.5931 0.6391 0.6767 -0.0059 0.0307  0.0282  96  LEU E N   
4726 C CA  . LEU E 96  ? 0.5961 0.6420 0.6726 -0.0030 0.0276  0.0298  96  LEU E CA  
4727 C C   . LEU E 96  ? 0.6164 0.6738 0.7077 -0.0022 0.0236  0.0270  96  LEU E C   
4728 O O   . LEU E 96  ? 0.6717 0.7407 0.7772 -0.0029 0.0257  0.0246  96  LEU E O   
4729 C CB  . LEU E 96  ? 0.5659 0.6130 0.6318 -0.0003 0.0362  0.0350  96  LEU E CB  
4730 C CG  . LEU E 96  ? 0.5717 0.6067 0.6196 0.0008  0.0389  0.0379  96  LEU E CG  
4731 C CD1 . LEU E 96  ? 0.6433 0.6829 0.6814 0.0041  0.0473  0.0433  96  LEU E CD1 
4732 C CD2 . LEU E 96  ? 0.4764 0.5023 0.5145 0.0005  0.0299  0.0368  96  LEU E CD2 
4733 N N   . PRO E 97  ? 0.6198 0.6745 0.7082 -0.0006 0.0175  0.0272  97  PRO E N   
4734 C CA  . PRO E 97  ? 0.6349 0.6780 0.7075 -0.0001 0.0137  0.0307  97  PRO E CA  
4735 C C   . PRO E 97  ? 0.5795 0.6151 0.6489 -0.0015 0.0060  0.0287  97  PRO E C   
4736 O O   . PRO E 97  ? 0.5776 0.6169 0.6580 -0.0030 0.0026  0.0242  97  PRO E O   
4737 C CB  . PRO E 97  ? 0.6149 0.6597 0.6910 0.0014  0.0094  0.0316  97  PRO E CB  
4738 C CG  . PRO E 97  ? 0.5684 0.6228 0.6631 0.0022  0.0071  0.0263  97  PRO E CG  
4739 C CD  . PRO E 97  ? 0.6064 0.6703 0.7077 0.0012  0.0147  0.0245  97  PRO E CD  
4740 N N   . TRP E 98  ? 0.4965 0.5237 0.5506 -0.0010 0.0033  0.0318  98  TRP E N   
4741 C CA  . TRP E 98  ? 0.4826 0.5050 0.5323 -0.0018 -0.0044 0.0299  98  TRP E CA  
4742 C C   . TRP E 98  ? 0.5086 0.5344 0.5682 -0.0009 -0.0135 0.0291  98  TRP E C   
4743 O O   . TRP E 98  ? 0.5663 0.5912 0.6248 0.0010  -0.0162 0.0333  98  TRP E O   
4744 C CB  . TRP E 98  ? 0.4952 0.5115 0.5262 -0.0007 -0.0050 0.0340  98  TRP E CB  
4745 C CG  . TRP E 98  ? 0.5048 0.5181 0.5293 -0.0014 -0.0114 0.0311  98  TRP E CG  
4746 C CD1 . TRP E 98  ? 0.4992 0.5141 0.5324 -0.0036 -0.0157 0.0249  98  TRP E CD1 
4747 C CD2 . TRP E 98  ? 0.4923 0.5031 0.5005 0.0001  -0.0143 0.0338  98  TRP E CD2 
4748 N NE1 . TRP E 98  ? 0.5650 0.5784 0.5884 -0.0038 -0.0211 0.0228  98  TRP E NE1 
4749 C CE2 . TRP E 98  ? 0.5434 0.5546 0.5513 -0.0012 -0.0203 0.0282  98  TRP E CE2 
4750 C CE3 . TRP E 98  ? 0.4823 0.4926 0.4762 0.0022  -0.0123 0.0402  98  TRP E CE3 
4751 C CZ2 . TRP E 98  ? 0.5194 0.5311 0.5132 0.0001  -0.0245 0.0284  98  TRP E CZ2 
4752 C CZ3 . TRP E 98  ? 0.5049 0.5158 0.4847 0.0035  -0.0164 0.0412  98  TRP E CZ3 
4753 C CH2 . TRP E 98  ? 0.4948 0.5066 0.4746 0.0028  -0.0225 0.0351  98  TRP E CH2 
4754 N N   . ASN E 99  ? 0.5398 0.5695 0.6091 -0.0022 -0.0182 0.0240  99  ASN E N   
4755 C CA  . ASN E 99  ? 0.5142 0.5481 0.5929 -0.0002 -0.0270 0.0232  99  ASN E CA  
4756 C C   . ASN E 99  ? 0.5539 0.5853 0.6236 0.0005  -0.0350 0.0250  99  ASN E C   
4757 O O   . ASN E 99  ? 0.6245 0.6586 0.6939 -0.0014 -0.0383 0.0206  99  ASN E O   
4758 C CB  . ASN E 99  ? 0.4950 0.5384 0.5904 -0.0012 -0.0283 0.0170  99  ASN E CB  
4759 C CG  . ASN E 99  ? 0.5539 0.6038 0.6603 -0.0007 -0.0218 0.0158  99  ASN E CG  
4760 O OD1 . ASN E 99  ? 0.5919 0.6446 0.7002 -0.0034 -0.0146 0.0144  99  ASN E OD1 
4761 N ND2 . ASN E 99  ? 0.5679 0.6206 0.6820 0.0030  -0.0242 0.0163  99  ASN E ND2 
4762 N N   . ILE E 100 ? 0.5315 0.5591 0.5942 0.0031  -0.0382 0.0317  100 ILE E N   
4763 C CA  . ILE E 100 ? 0.5419 0.5695 0.5959 0.0044  -0.0458 0.0352  100 ILE E CA  
4764 C C   . ILE E 100 ? 0.5810 0.6117 0.6457 0.0079  -0.0540 0.0375  100 ILE E C   
4765 O O   . ILE E 100 ? 0.5953 0.6227 0.6670 0.0100  -0.0538 0.0405  100 ILE E O   
4766 C CB  . ILE E 100 ? 0.5422 0.5646 0.5802 0.0048  -0.0439 0.0429  100 ILE E CB  
4767 C CG1 . ILE E 100 ? 0.5367 0.5567 0.5632 0.0027  -0.0363 0.0402  100 ILE E CG1 
4768 C CG2 . ILE E 100 ? 0.4983 0.5233 0.5287 0.0067  -0.0521 0.0483  100 ILE E CG2 
4769 C CD1 . ILE E 100 ? 0.5312 0.5491 0.5406 0.0035  -0.0345 0.0470  100 ILE E CD1 
4770 N N   . THR E 101 ? 0.5794 0.6166 0.6457 0.0089  -0.0612 0.0356  101 THR E N   
4771 C CA  . THR E 101 ? 0.5776 0.6187 0.6536 0.0134  -0.0694 0.0383  101 THR E CA  
4772 C C   . THR E 101 ? 0.6444 0.6833 0.7107 0.0161  -0.0750 0.0483  101 THR E C   
4773 O O   . THR E 101 ? 0.6693 0.7120 0.7234 0.0151  -0.0768 0.0500  101 THR E O   
4774 C CB  . THR E 101 ? 0.5562 0.6090 0.6406 0.0135  -0.0744 0.0314  101 THR E CB  
4775 O OG1 . THR E 101 ? 0.5450 0.6011 0.6399 0.0106  -0.0694 0.0234  101 THR E OG1 
4776 C CG2 . THR E 101 ? 0.5688 0.6264 0.6626 0.0195  -0.0828 0.0349  101 THR E CG2 
4777 N N   . VAL E 102 ? 0.6560 0.6891 0.7283 0.0197  -0.0778 0.0550  102 VAL E N   
4778 C CA  . VAL E 102 ? 0.6516 0.6816 0.7161 0.0219  -0.0829 0.0665  102 VAL E CA  
4779 C C   . VAL E 102 ? 0.7069 0.7448 0.7764 0.0269  -0.0922 0.0698  102 VAL E C   
4780 O O   . VAL E 102 ? 0.7138 0.7525 0.7973 0.0310  -0.0958 0.0674  102 VAL E O   
4781 C CB  . VAL E 102 ? 0.6364 0.6543 0.7046 0.0224  -0.0812 0.0731  102 VAL E CB  
4782 C CG1 . VAL E 102 ? 0.6823 0.6970 0.7447 0.0244  -0.0871 0.0863  102 VAL E CG1 
4783 C CG2 . VAL E 102 ? 0.6580 0.6709 0.7187 0.0175  -0.0721 0.0715  102 VAL E CG2 
4784 N N   . HIS E 103 ? 0.7007 0.7460 0.7587 0.0273  -0.0962 0.0755  103 HIS E N   
4785 C CA  . HIS E 103 ? 0.6920 0.7479 0.7532 0.0324  -0.1051 0.0799  103 HIS E CA  
4786 C C   . HIS E 103 ? 0.7241 0.7782 0.7780 0.0349  -0.1094 0.0951  103 HIS E C   
4787 O O   . HIS E 103 ? 0.7215 0.7705 0.7643 0.0316  -0.1058 0.1010  103 HIS E O   
4788 C CB  . HIS E 103 ? 0.7165 0.7882 0.7715 0.0307  -0.1069 0.0726  103 HIS E CB  
4789 C CG  . HIS E 103 ? 0.7269 0.8029 0.7910 0.0282  -0.1045 0.0590  103 HIS E CG  
4790 N ND1 . HIS E 103 ? 0.7302 0.8203 0.8025 0.0304  -0.1102 0.0538  103 HIS E ND1 
4791 C CD2 . HIS E 103 ? 0.7837 0.8534 0.8502 0.0234  -0.0971 0.0503  103 HIS E CD2 
4792 C CE1 . HIS E 103 ? 0.7718 0.8638 0.8514 0.0265  -0.1064 0.0425  103 HIS E CE1 
4793 N NE2 . HIS E 103 ? 0.8209 0.9003 0.8973 0.0223  -0.0984 0.0405  103 HIS E NE2 
4794 N N   . PHE E 104 ? 0.7998 0.8596 0.8601 0.0410  -0.1172 0.1019  104 PHE E N   
4795 C CA  . PHE E 104 ? 0.8485 0.9096 0.9027 0.0439  -0.1222 0.1177  104 PHE E CA  
4796 C C   . PHE E 104 ? 0.9015 0.9829 0.9538 0.0486  -0.1296 0.1205  104 PHE E C   
4797 O O   . PHE E 104 ? 0.9144 1.0080 0.9541 0.0479  -0.1314 0.1265  104 PHE E O   
4798 C CB  . PHE E 104 ? 0.8197 0.8648 0.8851 0.0477  -0.1244 0.1271  104 PHE E CB  
4799 C CG  . PHE E 104 ? 0.7762 0.8033 0.8415 0.0426  -0.1179 0.1274  104 PHE E CG  
4800 C CD1 . PHE E 104 ? 0.7824 0.8053 0.8363 0.0384  -0.1159 0.1382  104 PHE E CD1 
4801 C CD2 . PHE E 104 ? 0.7363 0.7531 0.8130 0.0420  -0.1138 0.1170  104 PHE E CD2 
4802 C CE1 . PHE E 104 ? 0.7795 0.7879 0.8333 0.0334  -0.1098 0.1383  104 PHE E CE1 
4803 C CE2 . PHE E 104 ? 0.7482 0.7510 0.8250 0.0374  -0.1078 0.1167  104 PHE E CE2 
4804 C CZ  . PHE E 104 ? 0.7723 0.7706 0.8376 0.0329  -0.1058 0.1272  104 PHE E CZ  
4805 N N   . LYS E 105 ? 0.9395 1.0265 1.0044 0.0537  -0.1339 0.1158  105 LYS E N   
4806 C CA  . LYS E 105 ? 0.9610 1.0691 1.0259 0.0589  -0.1412 0.1181  105 LYS E CA  
4807 C C   . LYS E 105 ? 0.9118 1.0372 0.9694 0.0543  -0.1399 0.1049  105 LYS E C   
4808 O O   . LYS E 105 ? 0.9118 1.0310 0.9691 0.0483  -0.1337 0.0926  105 LYS E O   
4809 C CB  . LYS E 105 ? 0.9854 1.0944 1.0667 0.0664  -0.1459 0.1170  105 LYS E CB  
4810 C CG  . LYS E 105 ? 1.0542 1.1824 1.1369 0.0743  -0.1544 0.1255  105 LYS E CG  
4811 C CD  . LYS E 105 ? 1.0791 1.2043 1.1781 0.0831  -0.1588 0.1268  105 LYS E CD  
4812 C CE  . LYS E 105 ? 1.1048 1.2502 1.2052 0.0920  -0.1671 0.1364  105 LYS E CE  
4813 N NZ  . LYS E 105 ? 1.1073 1.2502 1.2235 0.1019  -0.1714 0.1373  105 LYS E NZ  
4814 N N   . SER E 106 ? 0.8659 1.0132 0.9178 0.0571  -0.1456 0.1077  106 SER E N   
4815 C CA  . SER E 106 ? 0.8755 1.0413 0.9217 0.0530  -0.1457 0.0943  106 SER E CA  
4816 C C   . SER E 106 ? 0.8605 1.0216 0.8932 0.0455  -0.1394 0.0877  106 SER E C   
4817 O O   . SER E 106 ? 0.8455 0.9996 0.8797 0.0398  -0.1341 0.0744  106 SER E O   
4818 C CB  . SER E 106 ? 0.8990 1.0679 0.9582 0.0519  -0.1454 0.0804  106 SER E CB  
4819 O OG  . SER E 106 ? 0.9611 1.1490 1.0164 0.0478  -0.1466 0.0681  106 SER E OG  
4820 N N   . PHE E 107 ? 0.8422 1.0081 0.8618 0.0461  -0.1402 0.0974  107 PHE E N   
4821 C CA  . PHE E 107 ? 0.7657 0.9291 0.7712 0.0405  -0.1347 0.0921  107 PHE E CA  
4822 C C   . PHE E 107 ? 0.7760 0.9573 0.7757 0.0377  -0.1358 0.0774  107 PHE E C   
4823 O O   . PHE E 107 ? 0.8074 1.0114 0.8053 0.0409  -0.1423 0.0784  107 PHE E O   
4824 C CB  . PHE E 107 ? 0.7219 0.8886 0.7154 0.0424  -0.1358 0.1075  107 PHE E CB  
4825 C CG  . PHE E 107 ? 0.7548 0.9143 0.7347 0.0376  -0.1291 0.1044  107 PHE E CG  
4826 C CD1 . PHE E 107 ? 0.7317 0.8702 0.7116 0.0350  -0.1231 0.1096  107 PHE E CD1 
4827 C CD2 . PHE E 107 ? 0.7578 0.9326 0.7252 0.0361  -0.1289 0.0957  107 PHE E CD2 
4828 C CE1 . PHE E 107 ? 0.6908 0.8245 0.6580 0.0313  -0.1169 0.1070  107 PHE E CE1 
4829 C CE2 . PHE E 107 ? 0.7397 0.9082 0.6945 0.0329  -0.1228 0.0927  107 PHE E CE2 
4830 C CZ  . PHE E 107 ? 0.6941 0.8425 0.6487 0.0306  -0.1167 0.0988  107 PHE E CZ  
4831 N N   . PRO E 108 ? 0.8262 0.9975 0.8232 0.0315  -0.1294 0.0638  108 PRO E N   
4832 C CA  . PRO E 108 ? 0.8648 1.0487 0.8565 0.0277  -0.1297 0.0484  108 PRO E CA  
4833 C C   . PRO E 108 ? 0.9237 1.1203 0.8985 0.0285  -0.1306 0.0495  108 PRO E C   
4834 O O   . PRO E 108 ? 0.8831 1.0689 0.8481 0.0258  -0.1247 0.0461  108 PRO E O   
4835 C CB  . PRO E 108 ? 0.7977 0.9617 0.7929 0.0214  -0.1217 0.0367  108 PRO E CB  
4836 C CG  . PRO E 108 ? 0.7701 0.9142 0.7644 0.0222  -0.1163 0.0470  108 PRO E CG  
4837 C CD  . PRO E 108 ? 0.7746 0.9215 0.7751 0.0279  -0.1215 0.0619  108 PRO E CD  
4838 N N   . GLU E 109 ? 1.0108 1.2322 0.9822 0.0328  -0.1380 0.0541  109 GLU E N   
4839 C CA  . GLU E 109 ? 1.0321 1.2705 0.9878 0.0350  -0.1399 0.0576  109 GLU E CA  
4840 C C   . GLU E 109 ? 1.0288 1.2699 0.9744 0.0308  -0.1368 0.0403  109 GLU E C   
4841 O O   . GLU E 109 ? 0.9935 1.2391 0.9251 0.0320  -0.1351 0.0421  109 GLU E O   
4842 C CB  . GLU E 109 ? 1.0614 1.3296 1.0174 0.0406  -0.1487 0.0650  109 GLU E CB  
4843 C CG  . GLU E 109 ? 1.1001 1.3664 1.0644 0.0462  -0.1523 0.0846  109 GLU E CG  
4844 C CD  . GLU E 109 ? 1.1280 1.3865 1.0839 0.0480  -0.1504 0.1021  109 GLU E CD  
4845 O OE1 . GLU E 109 ? 1.1219 1.3851 1.0639 0.0464  -0.1478 0.1002  109 GLU E OE1 
4846 O OE2 . GLU E 109 ? 1.1412 1.3891 1.1047 0.0511  -0.1517 0.1175  109 GLU E OE2 
4847 N N   . LYS E 110 ? 1.0419 1.2804 0.9951 0.0260  -0.1360 0.0236  110 LYS E N   
4848 C CA  . LYS E 110 ? 1.0321 1.2734 0.9775 0.0219  -0.1341 0.0057  110 LYS E CA  
4849 C C   . LYS E 110 ? 1.0237 1.2368 0.9676 0.0172  -0.1251 -0.0015 110 LYS E C   
4850 O O   . LYS E 110 ? 1.0490 1.2598 0.9856 0.0145  -0.1225 -0.0152 110 LYS E O   
4851 C CB  . LYS E 110 ? 1.0398 1.2957 0.9940 0.0183  -0.1386 -0.0091 110 LYS E CB  
4852 C CG  . LYS E 110 ? 1.0733 1.3613 1.0286 0.0231  -0.1476 -0.0039 110 LYS E CG  
4853 C CD  . LYS E 110 ? 1.1522 1.4488 1.1219 0.0198  -0.1511 -0.0128 110 LYS E CD  
4854 C CE  . LYS E 110 ? 1.1823 1.4566 1.1658 0.0187  -0.1477 -0.0064 110 LYS E CE  
4855 N NZ  . LYS E 110 ? 1.1838 1.4642 1.1813 0.0141  -0.1497 -0.0175 110 LYS E NZ  
4856 N N   . ASP E 111 ? 0.9998 1.1919 0.9508 0.0167  -0.1203 0.0074  111 ASP E N   
4857 C CA  . ASP E 111 ? 0.9917 1.1587 0.9426 0.0128  -0.1115 0.0021  111 ASP E CA  
4858 C C   . ASP E 111 ? 0.9669 1.1241 0.9066 0.0158  -0.1066 0.0136  111 ASP E C   
4859 O O   . ASP E 111 ? 0.9935 1.1392 0.9248 0.0146  -0.1004 0.0079  111 ASP E O   
4860 C CB  . ASP E 111 ? 0.9885 1.1405 0.9559 0.0094  -0.1087 0.0016  111 ASP E CB  
4861 C CG  . ASP E 111 ? 0.9993 1.1592 0.9777 0.0047  -0.1119 -0.0117 111 ASP E CG  
4862 O OD1 . ASP E 111 ? 1.0095 1.1591 0.9893 -0.0010 -0.1076 -0.0246 111 ASP E OD1 
4863 O OD2 . ASP E 111 ? 1.0216 1.1981 1.0074 0.0067  -0.1187 -0.0090 111 ASP E OD2 
4864 N N   . LEU E 112 ? 0.9144 1.0762 0.8544 0.0198  -0.1095 0.0299  112 LEU E N   
4865 C CA  . LEU E 112 ? 0.8714 1.0245 0.8026 0.0216  -0.1051 0.0421  112 LEU E CA  
4866 C C   . LEU E 112 ? 0.8717 1.0449 0.7906 0.0261  -0.1100 0.0530  112 LEU E C   
4867 O O   . LEU E 112 ? 0.8936 1.0870 0.8137 0.0287  -0.1174 0.0554  112 LEU E O   
4868 C CB  . LEU E 112 ? 0.8280 0.9661 0.7707 0.0213  -0.1032 0.0532  112 LEU E CB  
4869 C CG  . LEU E 112 ? 0.7828 0.9036 0.7395 0.0176  -0.0987 0.0452  112 LEU E CG  
4870 C CD1 . LEU E 112 ? 0.7293 0.8380 0.6954 0.0184  -0.0973 0.0567  112 LEU E CD1 
4871 C CD2 . LEU E 112 ? 0.8441 0.9518 0.7952 0.0143  -0.0905 0.0349  112 LEU E CD2 
4872 N N   . LEU E 113 ? 0.8929 1.0623 0.8001 0.0270  -0.1056 0.0603  113 LEU E N   
4873 C CA  . LEU E 113 ? 0.8457 1.0333 0.7420 0.0308  -0.1095 0.0742  113 LEU E CA  
4874 C C   . LEU E 113 ? 0.8494 1.0275 0.7525 0.0306  -0.1095 0.0923  113 LEU E C   
4875 O O   . LEU E 113 ? 0.8361 0.9931 0.7441 0.0278  -0.1035 0.0934  113 LEU E O   
4876 C CB  . LEU E 113 ? 0.8152 1.0060 0.6946 0.0318  -0.1047 0.0719  113 LEU E CB  
4877 C CG  . LEU E 113 ? 0.8299 1.0217 0.7021 0.0318  -0.1023 0.0523  113 LEU E CG  
4878 C CD1 . LEU E 113 ? 0.8042 1.0021 0.6588 0.0346  -0.0984 0.0529  113 LEU E CD1 
4879 C CD2 . LEU E 113 ? 0.8699 1.0824 0.7435 0.0330  -0.1098 0.0426  113 LEU E CD2 
4880 N N   . HIS E 114 ? 0.8342 1.0281 0.7379 0.0337  -0.1163 0.1064  114 HIS E N   
4881 C CA  . HIS E 114 ? 0.8383 1.0227 0.7487 0.0335  -0.1170 0.1244  114 HIS E CA  
4882 C C   . HIS E 114 ? 0.8876 1.0636 0.7886 0.0311  -0.1110 0.1325  114 HIS E C   
4883 O O   . HIS E 114 ? 0.8866 1.0732 0.7730 0.0316  -0.1086 0.1294  114 HIS E O   
4884 C CB  . HIS E 114 ? 0.8784 1.0834 0.7892 0.0377  -0.1254 0.1394  114 HIS E CB  
4885 C CG  . HIS E 114 ? 0.9241 1.1391 0.8453 0.0407  -0.1316 0.1337  114 HIS E CG  
4886 N ND1 . HIS E 114 ? 0.9218 1.1242 0.8590 0.0416  -0.1338 0.1376  114 HIS E ND1 
4887 C CD2 . HIS E 114 ? 0.9223 1.1602 0.8400 0.0430  -0.1361 0.1240  114 HIS E CD2 
4888 C CE1 . HIS E 114 ? 0.9382 1.1558 0.8811 0.0446  -0.1393 0.1312  114 HIS E CE1 
4889 N NE2 . HIS E 114 ? 0.9385 1.1781 0.8700 0.0451  -0.1408 0.1228  114 HIS E NE2 
4890 N N   . CYS E 115 ? 0.9165 1.0741 0.8262 0.0287  -0.1088 0.1422  115 CYS E N   
4891 C CA  . CYS E 115 ? 0.9010 1.0516 0.8032 0.0256  -0.1034 0.1509  115 CYS E CA  
4892 C C   . CYS E 115 ? 0.9500 1.0983 0.8578 0.0247  -0.1071 0.1710  115 CYS E C   
4893 O O   . CYS E 115 ? 0.9713 1.0996 0.8903 0.0220  -0.1050 0.1746  115 CYS E O   
4894 C CB  . CYS E 115 ? 0.8784 1.0066 0.7855 0.0220  -0.0952 0.1409  115 CYS E CB  
4895 S SG  . CYS E 115 ? 0.8790 1.0026 0.7745 0.0184  -0.0874 0.1478  115 CYS E SG  
4896 N N   . PRO E 116 ? 0.9883 1.1577 0.8887 0.0271  -0.1127