data_4H1V
# 
_entry.id   4H1V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4H1V         
RCSB  RCSB074913   
WWPDB D_1000074913 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4H1U 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        4H1V 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-09-11 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wenger, J.'       1 
'Klinglmayr, E.'   2 
'Eibl, C.'         3 
'Hessenberger, M.' 4 
'Goettig, P.'      5 
# 
_citation.id                        primary 
_citation.title                     'Functional Mapping of Human Dynamin-1-Like GTPase Domain Based on X-ray Structure Analyses.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                e71835 
_citation.page_last                 e71835 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23977156 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0071835 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wenger, J.'       1 
primary 'Klinglmayr, E.'   2 
primary 'Frohlich, C.'     3 
primary 'Eibl, C.'         4 
primary 'Gimeno, A.'       5 
primary 'Hessenberger, M.' 6 
primary 'Puehringer, S.'   7 
primary 'Daumke, O.'       8 
primary 'Goettig, P.'      9 
# 
_cell.entry_id           4H1V 
_cell.length_a           53.420 
_cell.length_b           151.310 
_cell.length_c           43.060 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4H1V 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dynamin-1-like protein'                      40978.852 1   3.6.5.5 ? 
'GTPase-GED fusion (unp residues 1-327 and 711-736)' ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   1   ?       ? ? ? 
3 water       nat water                                         18.015    122 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Dnm1p/Vps1p-like protein, DVLP, Dynamin family member proline-rich carboxyl-terminal domain less, Dymple, Dynamin-like protein, Dynamin-like protein 4, Dynamin-like protein IV, HdynIV, Dynamin-related protein 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTG
EENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPK
DIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLN
SYGEPVDGSGSGSGSKEAADMLKALQGASQIIAEIRETHLWLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTG
EENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPK
DIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLN
SYGEPVDGSGSGSGSKEAADMLKALQGASQIIAEIRETHLWLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ALA n 
1 4   LEU n 
1 5   ILE n 
1 6   PRO n 
1 7   VAL n 
1 8   ILE n 
1 9   ASN n 
1 10  LYS n 
1 11  LEU n 
1 12  GLN n 
1 13  ASP n 
1 14  VAL n 
1 15  PHE n 
1 16  ASN n 
1 17  THR n 
1 18  VAL n 
1 19  GLY n 
1 20  ALA n 
1 21  ASP n 
1 22  ILE n 
1 23  ILE n 
1 24  GLN n 
1 25  LEU n 
1 26  PRO n 
1 27  GLN n 
1 28  ILE n 
1 29  VAL n 
1 30  VAL n 
1 31  VAL n 
1 32  GLY n 
1 33  THR n 
1 34  GLN n 
1 35  SER n 
1 36  SER n 
1 37  GLY n 
1 38  LYS n 
1 39  SER n 
1 40  SER n 
1 41  VAL n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  VAL n 
1 47  GLY n 
1 48  ARG n 
1 49  ASP n 
1 50  LEU n 
1 51  LEU n 
1 52  PRO n 
1 53  ARG n 
1 54  GLY n 
1 55  THR n 
1 56  GLY n 
1 57  ILE n 
1 58  VAL n 
1 59  THR n 
1 60  ARG n 
1 61  ARG n 
1 62  PRO n 
1 63  LEU n 
1 64  ILE n 
1 65  LEU n 
1 66  GLN n 
1 67  LEU n 
1 68  VAL n 
1 69  HIS n 
1 70  VAL n 
1 71  SER n 
1 72  GLN n 
1 73  GLU n 
1 74  ASP n 
1 75  LYS n 
1 76  ARG n 
1 77  LYS n 
1 78  THR n 
1 79  THR n 
1 80  GLY n 
1 81  GLU n 
1 82  GLU n 
1 83  ASN n 
1 84  GLY n 
1 85  VAL n 
1 86  GLU n 
1 87  ALA n 
1 88  GLU n 
1 89  GLU n 
1 90  TRP n 
1 91  GLY n 
1 92  LYS n 
1 93  PHE n 
1 94  LEU n 
1 95  HIS n 
1 96  THR n 
1 97  LYS n 
1 98  ASN n 
1 99  LYS n 
1 100 LEU n 
1 101 TYR n 
1 102 THR n 
1 103 ASP n 
1 104 PHE n 
1 105 ASP n 
1 106 GLU n 
1 107 ILE n 
1 108 ARG n 
1 109 GLN n 
1 110 GLU n 
1 111 ILE n 
1 112 GLU n 
1 113 ASN n 
1 114 GLU n 
1 115 THR n 
1 116 GLU n 
1 117 ARG n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 ASN n 
1 122 ASN n 
1 123 LYS n 
1 124 GLY n 
1 125 VAL n 
1 126 SER n 
1 127 PRO n 
1 128 GLU n 
1 129 PRO n 
1 130 ILE n 
1 131 HIS n 
1 132 LEU n 
1 133 LYS n 
1 134 ILE n 
1 135 PHE n 
1 136 SER n 
1 137 PRO n 
1 138 ASN n 
1 139 VAL n 
1 140 VAL n 
1 141 ASN n 
1 142 LEU n 
1 143 THR n 
1 144 LEU n 
1 145 VAL n 
1 146 ASP n 
1 147 LEU n 
1 148 PRO n 
1 149 GLY n 
1 150 MET n 
1 151 THR n 
1 152 LYS n 
1 153 VAL n 
1 154 PRO n 
1 155 VAL n 
1 156 GLY n 
1 157 ASP n 
1 158 GLN n 
1 159 PRO n 
1 160 LYS n 
1 161 ASP n 
1 162 ILE n 
1 163 GLU n 
1 164 LEU n 
1 165 GLN n 
1 166 ILE n 
1 167 ARG n 
1 168 GLU n 
1 169 LEU n 
1 170 ILE n 
1 171 LEU n 
1 172 ARG n 
1 173 PHE n 
1 174 ILE n 
1 175 SER n 
1 176 ASN n 
1 177 PRO n 
1 178 ASN n 
1 179 SER n 
1 180 ILE n 
1 181 ILE n 
1 182 LEU n 
1 183 ALA n 
1 184 VAL n 
1 185 THR n 
1 186 ALA n 
1 187 ALA n 
1 188 ASN n 
1 189 THR n 
1 190 ASP n 
1 191 MET n 
1 192 ALA n 
1 193 THR n 
1 194 SER n 
1 195 GLU n 
1 196 ALA n 
1 197 LEU n 
1 198 LYS n 
1 199 ILE n 
1 200 SER n 
1 201 ARG n 
1 202 GLU n 
1 203 VAL n 
1 204 ASP n 
1 205 PRO n 
1 206 ASP n 
1 207 GLY n 
1 208 ARG n 
1 209 ARG n 
1 210 THR n 
1 211 LEU n 
1 212 ALA n 
1 213 VAL n 
1 214 ILE n 
1 215 THR n 
1 216 LYS n 
1 217 LEU n 
1 218 ASP n 
1 219 LEU n 
1 220 MET n 
1 221 ASP n 
1 222 ALA n 
1 223 GLY n 
1 224 THR n 
1 225 ASP n 
1 226 ALA n 
1 227 MET n 
1 228 ASP n 
1 229 VAL n 
1 230 LEU n 
1 231 MET n 
1 232 GLY n 
1 233 ARG n 
1 234 VAL n 
1 235 ILE n 
1 236 PRO n 
1 237 VAL n 
1 238 LYS n 
1 239 LEU n 
1 240 GLY n 
1 241 ILE n 
1 242 ILE n 
1 243 GLY n 
1 244 VAL n 
1 245 VAL n 
1 246 ASN n 
1 247 ARG n 
1 248 SER n 
1 249 GLN n 
1 250 LEU n 
1 251 ASP n 
1 252 ILE n 
1 253 ASN n 
1 254 ASN n 
1 255 LYS n 
1 256 LYS n 
1 257 SER n 
1 258 VAL n 
1 259 THR n 
1 260 ASP n 
1 261 SER n 
1 262 ILE n 
1 263 ARG n 
1 264 ASP n 
1 265 GLU n 
1 266 TYR n 
1 267 ALA n 
1 268 PHE n 
1 269 LEU n 
1 270 GLN n 
1 271 LYS n 
1 272 LYS n 
1 273 TYR n 
1 274 PRO n 
1 275 SER n 
1 276 LEU n 
1 277 ALA n 
1 278 ASN n 
1 279 ARG n 
1 280 ASN n 
1 281 GLY n 
1 282 THR n 
1 283 LYS n 
1 284 TYR n 
1 285 LEU n 
1 286 ALA n 
1 287 ARG n 
1 288 THR n 
1 289 LEU n 
1 290 ASN n 
1 291 ARG n 
1 292 LEU n 
1 293 LEU n 
1 294 MET n 
1 295 HIS n 
1 296 HIS n 
1 297 ILE n 
1 298 ARG n 
1 299 ASP n 
1 300 CYS n 
1 301 LEU n 
1 302 PRO n 
1 303 GLU n 
1 304 LEU n 
1 305 LYS n 
1 306 THR n 
1 307 ARG n 
1 308 ILE n 
1 309 ASN n 
1 310 VAL n 
1 311 LEU n 
1 312 ALA n 
1 313 ALA n 
1 314 GLN n 
1 315 TYR n 
1 316 GLN n 
1 317 SER n 
1 318 LEU n 
1 319 LEU n 
1 320 ASN n 
1 321 SER n 
1 322 TYR n 
1 323 GLY n 
1 324 GLU n 
1 325 PRO n 
1 326 VAL n 
1 327 ASP n 
1 328 GLY n 
1 329 SER n 
1 330 GLY n 
1 331 SER n 
1 332 GLY n 
1 333 SER n 
1 334 GLY n 
1 335 SER n 
1 336 LYS n 
1 337 GLU n 
1 338 ALA n 
1 339 ALA n 
1 340 ASP n 
1 341 MET n 
1 342 LEU n 
1 343 LYS n 
1 344 ALA n 
1 345 LEU n 
1 346 GLN n 
1 347 GLY n 
1 348 ALA n 
1 349 SER n 
1 350 GLN n 
1 351 ILE n 
1 352 ILE n 
1 353 ALA n 
1 354 GLU n 
1 355 ILE n 
1 356 ARG n 
1 357 GLU n 
1 358 THR n 
1 359 HIS n 
1 360 LEU n 
1 361 TRP n 
1 362 LEU n 
1 363 GLU n 
1 364 HIS n 
1 365 HIS n 
1 366 HIS n 
1 367 HIS n 
1 368 HIS n 
1 369 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   327 human ? 'DNM1L, DLP1, DRP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 336 361 human ? 'DNM1L, DLP1, DRP1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DNM1L_HUMAN O00429 1 
;MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTG
EENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPK
DIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLN
SYGEPVD
;
1   ? 
2 UNP DNM1L_HUMAN O00429 1 KEAADMLKALQGASQIIAEIRETHLW 711 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4H1V A 1   ? 327 ? O00429 1   ? 327 ? 1   327 
2 2 4H1V A 336 ? 361 ? O00429 711 ? 736 ? 711 736 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4H1V GLY A 328 ? UNP O00429 ? ? LINKER           703 1  
1 4H1V SER A 329 ? UNP O00429 ? ? LINKER           704 2  
1 4H1V GLY A 330 ? UNP O00429 ? ? LINKER           705 3  
1 4H1V SER A 331 ? UNP O00429 ? ? LINKER           706 4  
1 4H1V GLY A 332 ? UNP O00429 ? ? LINKER           707 5  
1 4H1V SER A 333 ? UNP O00429 ? ? LINKER           708 6  
1 4H1V GLY A 334 ? UNP O00429 ? ? LINKER           709 7  
1 4H1V SER A 335 ? UNP O00429 ? ? LINKER           710 8  
1 4H1V LEU A 362 ? UNP O00429 ? ? 'EXPRESSION TAG' 737 9  
1 4H1V GLU A 363 ? UNP O00429 ? ? 'EXPRESSION TAG' 738 10 
1 4H1V HIS A 364 ? UNP O00429 ? ? 'EXPRESSION TAG' 739 11 
1 4H1V HIS A 365 ? UNP O00429 ? ? 'EXPRESSION TAG' 740 12 
1 4H1V HIS A 366 ? UNP O00429 ? ? 'EXPRESSION TAG' 741 13 
1 4H1V HIS A 367 ? UNP O00429 ? ? 'EXPRESSION TAG' 742 14 
1 4H1V HIS A 368 ? UNP O00429 ? ? 'EXPRESSION TAG' 743 15 
1 4H1V HIS A 369 ? UNP O00429 ? ? 'EXPRESSION TAG' 744 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4H1V 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M sodium citrate, 27.5 % PEG 3000 , pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX-225' 
_diffrn_detector.pdbx_collection_date   2012-07-03 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91841 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
# 
_reflns.entry_id                     4H1V 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             75.655 
_reflns.number_all                   15894 
_reflns.number_obs                   15894 
_reflns.pdbx_netI_over_sigmaI        8.400 
_reflns.pdbx_Rsym_value              0.128 
_reflns.pdbx_redundancy              4.100 
_reflns.percent_possible_obs         98.100 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300 2.420  ? 6133 ? 0.537 2.1    0.537 ? 3.000 ? 2027 88.800  1  1 
2.420 2.570  ? 8467 ? 0.440 1.600  0.440 ? 3.900 ? 2161 99.100  2  1 
2.570 2.750  ? 9277 ? 0.347 2.200  0.347 ? 4.400 ? 2088 100.000 3  1 
2.750 2.970  ? 8546 ? 0.242 3.200  0.242 ? 4.400 ? 1936 99.800  4  1 
2.970 3.250  ? 7803 ? 0.160 4.700  0.160 ? 4.400 ? 1767 99.500  5  1 
3.250 3.640  ? 7108 ? 0.102 7.200  0.102 ? 4.400 ? 1624 99.700  6  1 
3.640 4.200  ? 6325 ? 0.075 9.600  0.075 ? 4.400 ? 1448 100.000 7  1 
4.200 5.140  ? 5520 ? 0.068 9.500  0.068 ? 4.400 ? 1248 100.000 8  1 
5.140 7.270  ? 4431 ? 0.081 8.200  0.081 ? 4.400 ? 1006 99.900  9  1 
7.270 37.423 ? 2328 ? 0.035 16.000 0.035 ? 4.000 ? 589  98.900  10 1 
# 
_refine.entry_id                                 4H1V 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             19.9690 
_refine.pdbx_ls_sigma_F                          1.380 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.8300 
_refine.ls_number_reflns_obs                     15820 
_refine.ls_number_reflns_all                     15823 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2294 
_refine.ls_R_factor_R_work                       0.2270 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2777 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9700 
_refine.ls_number_reflns_R_free                  786 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               43.9329 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3SNH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8141 
_refine.B_iso_max                                116.550 
_refine.B_iso_min                                18.110 
_refine.pdbx_overall_phase_error                 25.1800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.100 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2766 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             122 
_refine_hist.number_atoms_total               2920 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        19.9690 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           2834 0.010  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          3843 1.097  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     458  0.072  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      494  0.006  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 1093 17.625 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.3000 2.3821  10 85.0000  1256 . 0.2674 0.3165 . 66 . 1322 . . 'X-RAY DIFFRACTION' 
2.3821 2.4773  10 96.0000  1443 . 0.2560 0.3312 . 79 . 1522 . . 'X-RAY DIFFRACTION' 
2.4773 2.5898  10 100.0000 1491 . 0.2673 0.3607 . 91 . 1582 . . 'X-RAY DIFFRACTION' 
2.5898 2.7261  10 100.0000 1503 . 0.2567 0.2608 . 90 . 1593 . . 'X-RAY DIFFRACTION' 
2.7261 2.8964  10 100.0000 1517 . 0.2510 0.2899 . 78 . 1595 . . 'X-RAY DIFFRACTION' 
2.8964 3.1192  10 99.0000  1526 . 0.2395 0.2827 . 83 . 1609 . . 'X-RAY DIFFRACTION' 
3.1192 3.4317  10 99.0000  1506 . 0.2282 0.2684 . 74 . 1580 . . 'X-RAY DIFFRACTION' 
3.4317 3.9250  10 100.0000 1556 . 0.2128 0.2667 . 73 . 1629 . . 'X-RAY DIFFRACTION' 
3.9250 4.9328  10 100.0000 1572 . 0.1924 0.2391 . 76 . 1648 . . 'X-RAY DIFFRACTION' 
4.9328 19.9699 10 100.0000 1664 . 0.2133 0.2626 . 76 . 1740 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4H1V 
_struct.title                     'GMP-PNP bound dynamin-1-like protein GTPase-GED fusion' 
_struct.pdbx_descriptor           'Dynamin-1-like protein (E.C.3.6.5.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4H1V 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'GTPase domain, GTPase, Cytosol, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;AUTHORS INDICATE THAT THE QUATERNARY STRUCTURE IS MOST  
LIKELY TO BE TETRAMERIC IN SOLUTION
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 4   ? PHE A 15  ? LEU A 4   PHE A 15  1 ? 12 
HELX_P HELX_P2  2  ALA A 20  ? GLN A 24  ? ALA A 20  GLN A 24  5 ? 5  
HELX_P HELX_P3  3  GLY A 37  ? GLY A 47  ? GLY A 37  GLY A 47  1 ? 11 
HELX_P HELX_P4  4  ASP A 103 ? THR A 115 ? ASP A 103 THR A 115 1 ? 13 
HELX_P HELX_P5  5  PRO A 154 ? GLN A 158 ? PRO A 154 GLN A 158 5 ? 5  
HELX_P HELX_P6  6  ILE A 162 ? SER A 175 ? ILE A 162 SER A 175 1 ? 14 
HELX_P HELX_P7  7  ASP A 190 ? THR A 193 ? ASP A 190 THR A 193 5 ? 4  
HELX_P HELX_P8  8  SER A 194 ? ARG A 201 ? SER A 194 ARG A 201 1 ? 8  
HELX_P HELX_P9  9  LYS A 216 ? MET A 220 ? LYS A 216 MET A 220 5 ? 5  
HELX_P HELX_P10 10 ALA A 226 ? GLY A 232 ? ALA A 226 GLY A 232 1 ? 7  
HELX_P HELX_P11 11 SER A 248 ? ASN A 254 ? SER A 248 ASN A 254 1 ? 7  
HELX_P HELX_P12 12 SER A 257 ? TYR A 273 ? SER A 257 TYR A 273 1 ? 17 
HELX_P HELX_P13 13 LEU A 276 ? ASN A 280 ? LEU A 276 ASN A 280 5 ? 5  
HELX_P HELX_P14 14 GLY A 281 ? GLY A 323 ? GLY A 281 GLY A 323 1 ? 43 
HELX_P HELX_P15 15 SER A 333 ? GLU A 354 ? SER A 708 GLU A 729 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            324 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     325 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 90  ? PHE A 93  ? TRP A 90  PHE A 93  
A 2 ILE A 130 ? SER A 136 ? ILE A 130 SER A 136 
A 3 LEU A 63  ? HIS A 69  ? LEU A 63  HIS A 69  
A 4 LEU A 142 ? ASP A 146 ? LEU A 142 ASP A 146 
A 5 GLN A 27  ? GLY A 32  ? GLN A 27  GLY A 32  
A 6 SER A 179 ? ALA A 186 ? SER A 179 ALA A 186 
A 7 THR A 210 ? THR A 215 ? THR A 210 THR A 215 
A 8 ILE A 241 ? GLY A 243 ? ILE A 241 GLY A 243 
B 1 ARG A 76  ? LYS A 77  ? ARG A 76  LYS A 77  
B 2 GLU A 86  ? ALA A 87  ? GLU A 86  ALA A 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 90  ? N TRP A 90  O PHE A 135 ? O PHE A 135 
A 2 3 O ILE A 130 ? O ILE A 130 N ILE A 64  ? N ILE A 64  
A 3 4 N LEU A 67  ? N LEU A 67  O LEU A 142 ? O LEU A 142 
A 4 5 O VAL A 145 ? O VAL A 145 N ILE A 28  ? N ILE A 28  
A 5 6 N VAL A 31  ? N VAL A 31  O VAL A 184 ? O VAL A 184 
A 6 7 N ILE A 181 ? N ILE A 181 O LEU A 211 ? O LEU A 211 
A 7 8 N ALA A 212 ? N ALA A 212 O ILE A 242 ? O ILE A 242 
B 1 2 N ARG A 76  ? N ARG A 76  O ALA A 87  ? O ALA A 87  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR RESIDUE GNP A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 THR A 33  ? THR A 33  . ? 1_555 ? 
2  AC1 15 GLN A 34  ? GLN A 34  . ? 1_555 ? 
3  AC1 15 SER A 35  ? SER A 35  . ? 1_555 ? 
4  AC1 15 SER A 36  ? SER A 36  . ? 1_555 ? 
5  AC1 15 GLY A 37  ? GLY A 37  . ? 1_555 ? 
6  AC1 15 LYS A 38  ? LYS A 38  . ? 1_555 ? 
7  AC1 15 SER A 39  ? SER A 39  . ? 1_555 ? 
8  AC1 15 SER A 40  ? SER A 40  . ? 1_555 ? 
9  AC1 15 LYS A 216 ? LYS A 216 . ? 1_555 ? 
10 AC1 15 ASP A 218 ? ASP A 218 . ? 1_555 ? 
11 AC1 15 LEU A 219 ? LEU A 219 . ? 1_555 ? 
12 AC1 15 VAL A 245 ? VAL A 245 . ? 1_555 ? 
13 AC1 15 ASN A 246 ? ASN A 246 . ? 1_555 ? 
14 AC1 15 SER A 248 ? SER A 248 . ? 1_555 ? 
15 AC1 15 GLN A 249 ? GLN A 249 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4H1V 
_atom_sites.fract_transf_matrix[1][1]   0.018720 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006609 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023223 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? -36.984 0.267   -12.292 1.00 68.18  ? 1    MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? -36.959 1.724   -12.336 1.00 66.62  ? 1    MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? -36.291 2.221   -13.610 1.00 59.66  ? 1    MET A C     1 
ATOM   4    O O     . MET A 1 1   ? -35.120 1.935   -13.859 1.00 60.52  ? 1    MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? -36.218 2.286   -11.124 1.00 67.28  ? 1    MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? -36.199 3.805   -11.072 1.00 67.82  ? 1    MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? -34.725 4.470   -10.273 1.00 86.34  ? 1    MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? -33.619 4.639   -11.675 1.00 58.34  ? 1    MET A CE    1 
ATOM   9    N N     . GLU A 1 2   ? -37.040 2.971   -14.410 1.00 53.18  ? 2    GLU A N     1 
ATOM   10   C CA    . GLU A 1 2   ? -36.518 3.513   -15.656 1.00 44.20  ? 2    GLU A CA    1 
ATOM   11   C C     . GLU A 1 2   ? -35.422 4.541   -15.401 1.00 41.81  ? 2    GLU A C     1 
ATOM   12   O O     . GLU A 1 2   ? -35.541 5.379   -14.507 1.00 39.84  ? 2    GLU A O     1 
ATOM   13   C CB    . GLU A 1 2   ? -37.642 4.151   -16.475 1.00 48.90  ? 2    GLU A CB    1 
ATOM   14   C CG    . GLU A 1 2   ? -37.894 3.472   -17.808 1.00 48.69  ? 2    GLU A CG    1 
ATOM   15   C CD    . GLU A 1 2   ? -38.193 4.461   -18.916 1.00 42.90  ? 2    GLU A CD    1 
ATOM   16   O OE1   . GLU A 1 2   ? -37.551 4.368   -19.984 1.00 39.92  ? 2    GLU A OE1   1 
ATOM   17   O OE2   . GLU A 1 2   ? -39.069 5.330   -18.722 1.00 49.05  ? 2    GLU A OE2   1 
ATOM   18   N N     . ALA A 1 3   ? -34.353 4.467   -16.187 1.00 39.62  ? 3    ALA A N     1 
ATOM   19   C CA    . ALA A 1 3   ? -33.295 5.467   -16.127 1.00 32.46  ? 3    ALA A CA    1 
ATOM   20   C C     . ALA A 1 3   ? -33.850 6.793   -16.627 1.00 30.75  ? 3    ALA A C     1 
ATOM   21   O O     . ALA A 1 3   ? -34.473 6.853   -17.686 1.00 29.64  ? 3    ALA A O     1 
ATOM   22   C CB    . ALA A 1 3   ? -32.106 5.034   -16.963 1.00 25.23  ? 3    ALA A CB    1 
ATOM   23   N N     . LEU A 1 4   ? -33.624 7.855   -15.861 1.00 27.80  ? 4    LEU A N     1 
ATOM   24   C CA    . LEU A 1 4   ? -34.236 9.146   -16.155 1.00 25.91  ? 4    LEU A CA    1 
ATOM   25   C C     . LEU A 1 4   ? -33.366 10.060  -17.016 1.00 27.72  ? 4    LEU A C     1 
ATOM   26   O O     . LEU A 1 4   ? -33.876 10.977  -17.659 1.00 24.98  ? 4    LEU A O     1 
ATOM   27   C CB    . LEU A 1 4   ? -34.637 9.852   -14.859 1.00 26.29  ? 4    LEU A CB    1 
ATOM   28   C CG    . LEU A 1 4   ? -35.758 9.180   -14.063 1.00 32.21  ? 4    LEU A CG    1 
ATOM   29   C CD1   . LEU A 1 4   ? -36.075 9.973   -12.806 1.00 29.49  ? 4    LEU A CD1   1 
ATOM   30   C CD2   . LEU A 1 4   ? -37.000 9.013   -14.924 1.00 28.36  ? 4    LEU A CD2   1 
ATOM   31   N N     . ILE A 1 5   ? -32.060 9.816   -17.022 1.00 26.85  ? 5    ILE A N     1 
ATOM   32   C CA    . ILE A 1 5   ? -31.147 10.559  -17.892 1.00 25.87  ? 5    ILE A CA    1 
ATOM   33   C C     . ILE A 1 5   ? -31.520 10.490  -19.387 1.00 24.22  ? 5    ILE A C     1 
ATOM   34   O O     . ILE A 1 5   ? -31.517 11.519  -20.065 1.00 26.08  ? 5    ILE A O     1 
ATOM   35   C CB    . ILE A 1 5   ? -29.665 10.150  -17.674 1.00 28.18  ? 5    ILE A CB    1 
ATOM   36   C CG1   . ILE A 1 5   ? -29.209 10.519  -16.261 1.00 29.75  ? 5    ILE A CG1   1 
ATOM   37   C CG2   . ILE A 1 5   ? -28.764 10.814  -18.701 1.00 21.71  ? 5    ILE A CG2   1 
ATOM   38   C CD1   . ILE A 1 5   ? -27.792 10.085  -15.945 1.00 27.18  ? 5    ILE A CD1   1 
ATOM   39   N N     . PRO A 1 6   ? -31.849 9.288   -19.908 1.00 27.10  ? 6    PRO A N     1 
ATOM   40   C CA    . PRO A 1 6   ? -32.280 9.251   -21.311 1.00 26.05  ? 6    PRO A CA    1 
ATOM   41   C C     . PRO A 1 6   ? -33.544 10.070  -21.571 1.00 28.61  ? 6    PRO A C     1 
ATOM   42   O O     . PRO A 1 6   ? -33.699 10.619  -22.663 1.00 28.87  ? 6    PRO A O     1 
ATOM   43   C CB    . PRO A 1 6   ? -32.567 7.765   -21.549 1.00 26.04  ? 6    PRO A CB    1 
ATOM   44   C CG    . PRO A 1 6   ? -31.708 7.059   -20.571 1.00 27.15  ? 6    PRO A CG    1 
ATOM   45   C CD    . PRO A 1 6   ? -31.712 7.928   -19.351 1.00 26.19  ? 6    PRO A CD    1 
ATOM   46   N N     . VAL A 1 7   ? -34.429 10.151  -20.583 1.00 23.31  ? 7    VAL A N     1 
ATOM   47   C CA    . VAL A 1 7   ? -35.658 10.924  -20.723 1.00 25.11  ? 7    VAL A CA    1 
ATOM   48   C C     . VAL A 1 7   ? -35.358 12.410  -20.901 1.00 29.48  ? 7    VAL A C     1 
ATOM   49   O O     . VAL A 1 7   ? -35.872 13.052  -21.819 1.00 26.74  ? 7    VAL A O     1 
ATOM   50   C CB    . VAL A 1 7   ? -36.593 10.733  -19.512 1.00 29.05  ? 7    VAL A CB    1 
ATOM   51   C CG1   . VAL A 1 7   ? -37.825 11.614  -19.650 1.00 27.09  ? 7    VAL A CG1   1 
ATOM   52   C CG2   . VAL A 1 7   ? -36.991 9.269   -19.369 1.00 22.52  ? 7    VAL A CG2   1 
ATOM   53   N N     . ILE A 1 8   ? -34.516 12.949  -20.024 1.00 24.31  ? 8    ILE A N     1 
ATOM   54   C CA    . ILE A 1 8   ? -34.140 14.357  -20.088 1.00 22.97  ? 8    ILE A CA    1 
ATOM   55   C C     . ILE A 1 8   ? -33.337 14.662  -21.355 1.00 24.11  ? 8    ILE A C     1 
ATOM   56   O O     . ILE A 1 8   ? -33.446 15.752  -21.917 1.00 24.54  ? 8    ILE A O     1 
ATOM   57   C CB    . ILE A 1 8   ? -33.358 14.790  -18.832 1.00 22.18  ? 8    ILE A CB    1 
ATOM   58   C CG1   . ILE A 1 8   ? -34.172 14.477  -17.576 1.00 24.76  ? 8    ILE A CG1   1 
ATOM   59   C CG2   . ILE A 1 8   ? -33.026 16.274  -18.883 1.00 21.00  ? 8    ILE A CG2   1 
ATOM   60   C CD1   . ILE A 1 8   ? -35.508 15.191  -17.518 1.00 23.40  ? 8    ILE A CD1   1 
ATOM   61   N N     . ASN A 1 9   ? -32.540 13.694  -21.803 1.00 26.62  ? 9    ASN A N     1 
ATOM   62   C CA    . ASN A 1 9   ? -31.848 13.811  -23.083 1.00 25.28  ? 9    ASN A CA    1 
ATOM   63   C C     . ASN A 1 9   ? -32.834 14.068  -24.215 1.00 23.95  ? 9    ASN A C     1 
ATOM   64   O O     . ASN A 1 9   ? -32.637 14.962  -25.036 1.00 27.33  ? 9    ASN A O     1 
ATOM   65   C CB    . ASN A 1 9   ? -31.044 12.546  -23.391 1.00 23.23  ? 9    ASN A CB    1 
ATOM   66   C CG    . ASN A 1 9   ? -29.711 12.506  -22.670 1.00 23.89  ? 9    ASN A CG    1 
ATOM   67   O OD1   . ASN A 1 9   ? -29.278 13.495  -22.082 1.00 23.19  ? 9    ASN A OD1   1 
ATOM   68   N ND2   . ASN A 1 9   ? -29.044 11.358  -22.726 1.00 25.61  ? 9    ASN A ND2   1 
ATOM   69   N N     . LYS A 1 10  ? -33.902 13.276  -24.242 1.00 26.44  ? 10   LYS A N     1 
ATOM   70   C CA    . LYS A 1 10  ? -34.927 13.387  -25.273 1.00 24.16  ? 10   LYS A CA    1 
ATOM   71   C C     . LYS A 1 10  ? -35.701 14.697  -25.166 1.00 26.00  ? 10   LYS A C     1 
ATOM   72   O O     . LYS A 1 10  ? -36.107 15.269  -26.178 1.00 28.72  ? 10   LYS A O     1 
ATOM   73   C CB    . LYS A 1 10  ? -35.882 12.194  -25.201 1.00 26.68  ? 10   LYS A CB    1 
ATOM   74   C CG    . LYS A 1 10  ? -35.219 10.862  -25.527 1.00 27.79  ? 10   LYS A CG    1 
ATOM   75   C CD    . LYS A 1 10  ? -36.052 9.687   -25.047 1.00 31.29  ? 10   LYS A CD    1 
ATOM   76   C CE    . LYS A 1 10  ? -37.415 9.656   -25.716 1.00 39.24  ? 10   LYS A CE    1 
ATOM   77   N NZ    . LYS A 1 10  ? -37.311 9.435   -27.184 1.00 37.07  ? 10   LYS A NZ    1 
ATOM   78   N N     . LEU A 1 11  ? -35.906 15.167  -23.940 1.00 25.63  ? 11   LEU A N     1 
ATOM   79   C CA    . LEU A 1 11  ? -36.568 16.447  -23.724 1.00 25.10  ? 11   LEU A CA    1 
ATOM   80   C C     . LEU A 1 11  ? -35.700 17.593  -24.236 1.00 25.21  ? 11   LEU A C     1 
ATOM   81   O O     . LEU A 1 11  ? -36.203 18.541  -24.839 1.00 25.88  ? 11   LEU A O     1 
ATOM   82   C CB    . LEU A 1 11  ? -36.907 16.645  -22.244 1.00 26.48  ? 11   LEU A CB    1 
ATOM   83   C CG    . LEU A 1 11  ? -37.971 15.700  -21.681 1.00 23.52  ? 11   LEU A CG    1 
ATOM   84   C CD1   . LEU A 1 11  ? -38.282 16.028  -20.228 1.00 26.80  ? 11   LEU A CD1   1 
ATOM   85   C CD2   . LEU A 1 11  ? -39.230 15.755  -22.526 1.00 23.80  ? 11   LEU A CD2   1 
ATOM   86   N N     . GLN A 1 12  ? -34.396 17.494  -23.993 1.00 26.32  ? 12   GLN A N     1 
ATOM   87   C CA    . GLN A 1 12  ? -33.439 18.468  -24.505 1.00 26.81  ? 12   GLN A CA    1 
ATOM   88   C C     . GLN A 1 12  ? -33.514 18.549  -26.026 1.00 28.89  ? 12   GLN A C     1 
ATOM   89   O O     . GLN A 1 12  ? -33.506 19.638  -26.600 1.00 31.52  ? 12   GLN A O     1 
ATOM   90   C CB    . GLN A 1 12  ? -32.015 18.106  -24.072 1.00 23.03  ? 12   GLN A CB    1 
ATOM   91   C CG    . GLN A 1 12  ? -31.718 18.362  -22.604 1.00 19.93  ? 12   GLN A CG    1 
ATOM   92   C CD    . GLN A 1 12  ? -30.325 17.913  -22.202 1.00 25.25  ? 12   GLN A CD    1 
ATOM   93   O OE1   . GLN A 1 12  ? -29.773 16.972  -22.774 1.00 25.23  ? 12   GLN A OE1   1 
ATOM   94   N NE2   . GLN A 1 12  ? -29.748 18.590  -21.216 1.00 19.20  ? 12   GLN A NE2   1 
ATOM   95   N N     . ASP A 1 13  ? -33.591 17.389  -26.672 1.00 24.87  ? 13   ASP A N     1 
ATOM   96   C CA    . ASP A 1 13  ? -33.700 17.326  -28.125 1.00 28.71  ? 13   ASP A CA    1 
ATOM   97   C C     . ASP A 1 13  ? -35.013 17.928  -28.606 1.00 28.66  ? 13   ASP A C     1 
ATOM   98   O O     . ASP A 1 13  ? -35.052 18.620  -29.622 1.00 30.47  ? 13   ASP A O     1 
ATOM   99   C CB    . ASP A 1 13  ? -33.586 15.881  -28.614 1.00 25.85  ? 13   ASP A CB    1 
ATOM   100  C CG    . ASP A 1 13  ? -32.223 15.281  -28.345 1.00 31.45  ? 13   ASP A CG    1 
ATOM   101  O OD1   . ASP A 1 13  ? -31.265 16.055  -28.134 1.00 28.69  ? 13   ASP A OD1   1 
ATOM   102  O OD2   . ASP A 1 13  ? -32.109 14.037  -28.351 1.00 32.50  ? 13   ASP A OD2   1 
ATOM   103  N N     . VAL A 1 14  ? -36.083 17.658  -27.866 1.00 28.06  ? 14   VAL A N     1 
ATOM   104  C CA    . VAL A 1 14  ? -37.422 18.116  -28.226 1.00 26.76  ? 14   VAL A CA    1 
ATOM   105  C C     . VAL A 1 14  ? -37.555 19.642  -28.223 1.00 27.26  ? 14   VAL A C     1 
ATOM   106  O O     . VAL A 1 14  ? -38.202 20.218  -29.099 1.00 25.93  ? 14   VAL A O     1 
ATOM   107  C CB    . VAL A 1 14  ? -38.495 17.457  -27.317 1.00 24.26  ? 14   VAL A CB    1 
ATOM   108  C CG1   . VAL A 1 14  ? -39.657 18.404  -27.047 1.00 29.95  ? 14   VAL A CG1   1 
ATOM   109  C CG2   . VAL A 1 14  ? -38.984 16.160  -27.932 1.00 23.53  ? 14   VAL A CG2   1 
ATOM   110  N N     . PHE A 1 15  ? -36.923 20.290  -27.250 1.00 30.83  ? 15   PHE A N     1 
ATOM   111  C CA    . PHE A 1 15  ? -37.013 21.742  -27.111 1.00 32.74  ? 15   PHE A CA    1 
ATOM   112  C C     . PHE A 1 15  ? -35.798 22.475  -27.669 1.00 40.56  ? 15   PHE A C     1 
ATOM   113  O O     . PHE A 1 15  ? -35.414 23.525  -27.175 1.00 42.62  ? 15   PHE A O     1 
ATOM   114  C CB    . PHE A 1 15  ? -37.162 22.129  -25.644 1.00 34.68  ? 15   PHE A CB    1 
ATOM   115  C CG    . PHE A 1 15  ? -38.457 21.704  -25.029 1.00 34.06  ? 15   PHE A CG    1 
ATOM   116  C CD1   . PHE A 1 15  ? -39.647 22.285  -25.425 1.00 31.85  ? 15   PHE A CD1   1 
ATOM   117  C CD2   . PHE A 1 15  ? -38.484 20.732  -24.044 1.00 27.38  ? 15   PHE A CD2   1 
ATOM   118  C CE1   . PHE A 1 15  ? -40.845 21.901  -24.858 1.00 30.31  ? 15   PHE A CE1   1 
ATOM   119  C CE2   . PHE A 1 15  ? -39.676 20.343  -23.471 1.00 30.74  ? 15   PHE A CE2   1 
ATOM   120  C CZ    . PHE A 1 15  ? -40.860 20.928  -23.877 1.00 28.33  ? 15   PHE A CZ    1 
ATOM   121  N N     . ASN A 1 16  ? -35.198 21.914  -28.709 1.00 38.43  ? 16   ASN A N     1 
ATOM   122  C CA    . ASN A 1 16  ? -33.957 22.448  -29.265 1.00 39.74  ? 16   ASN A CA    1 
ATOM   123  C C     . ASN A 1 16  ? -34.091 23.834  -29.909 1.00 50.96  ? 16   ASN A C     1 
ATOM   124  O O     . ASN A 1 16  ? -33.516 24.808  -29.426 1.00 52.61  ? 16   ASN A O     1 
ATOM   125  C CB    . ASN A 1 16  ? -33.336 21.463  -30.248 1.00 42.15  ? 16   ASN A CB    1 
ATOM   126  C CG    . ASN A 1 16  ? -32.113 22.034  -30.961 1.00 44.78  ? 16   ASN A CG    1 
ATOM   127  O OD1   . ASN A 1 16  ? -31.425 22.925  -30.454 1.00 44.88  ? 16   ASN A OD1   1 
ATOM   128  N ND2   . ASN A 1 16  ? -31.832 21.503  -32.142 1.00 46.82  ? 16   ASN A ND2   1 
ATOM   129  N N     . THR A 1 17  ? -34.818 23.915  -31.018 1.00 44.56  ? 17   THR A N     1 
ATOM   130  C CA    . THR A 1 17  ? -34.979 25.186  -31.720 1.00 53.70  ? 17   THR A CA    1 
ATOM   131  C C     . THR A 1 17  ? -36.142 26.022  -31.181 1.00 49.94  ? 17   THR A C     1 
ATOM   132  O O     . THR A 1 17  ? -36.270 27.205  -31.499 1.00 57.04  ? 17   THR A O     1 
ATOM   133  C CB    . THR A 1 17  ? -35.167 24.999  -33.236 1.00 57.08  ? 17   THR A CB    1 
ATOM   134  O OG1   . THR A 1 17  ? -36.243 24.087  -33.480 1.00 58.73  ? 17   THR A OG1   1 
ATOM   135  C CG2   . THR A 1 17  ? -33.895 24.478  -33.883 1.00 53.50  ? 17   THR A CG2   1 
ATOM   136  N N     . VAL A 1 18  ? -36.992 25.432  -30.373 1.00 44.48  ? 18   VAL A N     1 
ATOM   137  C CA    . VAL A 1 18  ? -38.235 26.065  -29.983 1.00 46.65  ? 18   VAL A CA    1 
ATOM   138  C C     . VAL A 1 18  ? -38.159 26.899  -28.715 1.00 49.55  ? 18   VAL A C     1 
ATOM   139  O O     . VAL A 1 18  ? -39.001 27.698  -28.454 1.00 61.20  ? 18   VAL A O     1 
ATOM   140  C CB    . VAL A 1 18  ? -39.318 25.008  -29.831 1.00 47.04  ? 18   VAL A CB    1 
ATOM   141  C CG1   . VAL A 1 18  ? -39.511 24.655  -28.416 1.00 43.22  ? 18   VAL A CG1   1 
ATOM   142  C CG2   . VAL A 1 18  ? -40.556 25.471  -30.406 1.00 42.83  ? 18   VAL A CG2   1 
ATOM   143  N N     . GLY A 1 19  ? -37.135 26.726  -27.932 1.00 44.73  ? 19   GLY A N     1 
ATOM   144  C CA    . GLY A 1 19  ? -36.974 27.484  -26.703 1.00 45.29  ? 19   GLY A CA    1 
ATOM   145  C C     . GLY A 1 19  ? -37.117 26.614  -25.469 1.00 43.20  ? 19   GLY A C     1 
ATOM   146  O O     . GLY A 1 19  ? -38.230 26.322  -25.028 1.00 37.05  ? 19   GLY A O     1 
ATOM   147  N N     . ALA A 1 20  ? -35.985 26.207  -24.902 1.00 38.70  ? 20   ALA A N     1 
ATOM   148  C CA    . ALA A 1 20  ? -35.979 25.288  -23.768 1.00 38.32  ? 20   ALA A CA    1 
ATOM   149  C C     . ALA A 1 20  ? -35.855 25.996  -22.422 1.00 34.31  ? 20   ALA A C     1 
ATOM   150  O O     . ALA A 1 20  ? -36.013 25.373  -21.372 1.00 34.80  ? 20   ALA A O     1 
ATOM   151  C CB    . ALA A 1 20  ? -34.860 24.265  -23.924 1.00 32.38  ? 20   ALA A CB    1 
ATOM   152  N N     . ASP A 1 21  ? -35.579 27.295  -22.459 1.00 30.38  ? 21   ASP A N     1 
ATOM   153  C CA    . ASP A 1 21  ? -35.316 28.067  -21.246 1.00 33.62  ? 21   ASP A CA    1 
ATOM   154  C C     . ASP A 1 21  ? -36.482 28.062  -20.264 1.00 33.06  ? 21   ASP A C     1 
ATOM   155  O O     . ASP A 1 21  ? -36.285 27.912  -19.060 1.00 37.95  ? 21   ASP A O     1 
ATOM   156  C CB    . ASP A 1 21  ? -34.961 29.509  -21.605 1.00 32.80  ? 21   ASP A CB    1 
ATOM   157  C CG    . ASP A 1 21  ? -33.738 29.604  -22.489 1.00 33.05  ? 21   ASP A CG    1 
ATOM   158  O OD1   . ASP A 1 21  ? -33.845 29.279  -23.691 1.00 38.08  ? 21   ASP A OD1   1 
ATOM   159  O OD2   . ASP A 1 21  ? -32.671 30.011  -21.985 1.00 35.90  ? 21   ASP A OD2   1 
ATOM   160  N N     . ILE A 1 22  ? -37.694 28.229  -20.782 1.00 28.64  ? 22   ILE A N     1 
ATOM   161  C CA    . ILE A 1 22  ? -38.878 28.325  -19.935 1.00 32.44  ? 22   ILE A CA    1 
ATOM   162  C C     . ILE A 1 22  ? -39.255 26.974  -19.325 1.00 32.39  ? 22   ILE A C     1 
ATOM   163  O O     . ILE A 1 22  ? -40.047 26.904  -18.385 1.00 31.65  ? 22   ILE A O     1 
ATOM   164  C CB    . ILE A 1 22  ? -40.072 28.925  -20.713 1.00 35.74  ? 22   ILE A CB    1 
ATOM   165  C CG1   . ILE A 1 22  ? -41.116 29.491  -19.749 1.00 35.34  ? 22   ILE A CG1   1 
ATOM   166  C CG2   . ILE A 1 22  ? -40.672 27.897  -21.661 1.00 33.02  ? 22   ILE A CG2   1 
ATOM   167  C CD1   . ILE A 1 22  ? -42.190 30.284  -20.430 1.00 37.09  ? 22   ILE A CD1   1 
ATOM   168  N N     . ILE A 1 23  ? -38.672 25.903  -19.855 1.00 29.92  ? 23   ILE A N     1 
ATOM   169  C CA    . ILE A 1 23  ? -38.915 24.563  -19.333 1.00 31.13  ? 23   ILE A CA    1 
ATOM   170  C C     . ILE A 1 23  ? -38.145 24.341  -18.032 1.00 29.55  ? 23   ILE A C     1 
ATOM   171  O O     . ILE A 1 23  ? -38.597 23.608  -17.149 1.00 30.83  ? 23   ILE A O     1 
ATOM   172  C CB    . ILE A 1 23  ? -38.525 23.479  -20.358 1.00 30.77  ? 23   ILE A CB    1 
ATOM   173  C CG1   . ILE A 1 23  ? -39.133 23.797  -21.724 1.00 29.74  ? 23   ILE A CG1   1 
ATOM   174  C CG2   . ILE A 1 23  ? -38.975 22.103  -19.887 1.00 27.01  ? 23   ILE A CG2   1 
ATOM   175  C CD1   . ILE A 1 23  ? -40.645 23.849  -21.717 1.00 28.27  ? 23   ILE A CD1   1 
ATOM   176  N N     . GLN A 1 24  ? -36.986 24.987  -17.923 1.00 30.22  ? 24   GLN A N     1 
ATOM   177  C CA    . GLN A 1 24  ? -36.123 24.874  -16.747 1.00 34.91  ? 24   GLN A CA    1 
ATOM   178  C C     . GLN A 1 24  ? -35.735 23.426  -16.462 1.00 30.50  ? 24   GLN A C     1 
ATOM   179  O O     . GLN A 1 24  ? -35.927 22.927  -15.353 1.00 28.00  ? 24   GLN A O     1 
ATOM   180  C CB    . GLN A 1 24  ? -36.785 25.504  -15.516 1.00 31.42  ? 24   GLN A CB    1 
ATOM   181  C CG    . GLN A 1 24  ? -37.116 26.979  -15.671 1.00 31.48  ? 24   GLN A CG    1 
ATOM   182  C CD    . GLN A 1 24  ? -37.715 27.576  -14.413 1.00 34.32  ? 24   GLN A CD    1 
ATOM   183  O OE1   . GLN A 1 24  ? -37.882 26.889  -13.404 1.00 32.02  ? 24   GLN A OE1   1 
ATOM   184  N NE2   . GLN A 1 24  ? -38.040 28.863  -14.464 1.00 35.57  ? 24   GLN A NE2   1 
ATOM   185  N N     . LEU A 1 25  ? -35.183 22.764  -17.474 1.00 30.60  ? 25   LEU A N     1 
ATOM   186  C CA    . LEU A 1 25  ? -34.812 21.357  -17.380 1.00 25.76  ? 25   LEU A CA    1 
ATOM   187  C C     . LEU A 1 25  ? -33.714 21.106  -16.352 1.00 27.02  ? 25   LEU A C     1 
ATOM   188  O O     . LEU A 1 25  ? -32.834 21.945  -16.160 1.00 29.04  ? 25   LEU A O     1 
ATOM   189  C CB    . LEU A 1 25  ? -34.361 20.841  -18.749 1.00 29.45  ? 25   LEU A CB    1 
ATOM   190  C CG    . LEU A 1 25  ? -35.444 20.685  -19.816 1.00 29.36  ? 25   LEU A CG    1 
ATOM   191  C CD1   . LEU A 1 25  ? -34.817 20.485  -21.185 1.00 26.04  ? 25   LEU A CD1   1 
ATOM   192  C CD2   . LEU A 1 25  ? -36.360 19.520  -19.472 1.00 25.07  ? 25   LEU A CD2   1 
ATOM   193  N N     . PRO A 1 26  ? -33.770 19.945  -15.680 1.00 24.33  ? 26   PRO A N     1 
ATOM   194  C CA    . PRO A 1 26  ? -32.692 19.530  -14.778 1.00 26.50  ? 26   PRO A CA    1 
ATOM   195  C C     . PRO A 1 26  ? -31.471 19.090  -15.577 1.00 24.66  ? 26   PRO A C     1 
ATOM   196  O O     . PRO A 1 26  ? -31.521 18.081  -16.279 1.00 23.10  ? 26   PRO A O     1 
ATOM   197  C CB    . PRO A 1 26  ? -33.300 18.342  -14.026 1.00 24.83  ? 26   PRO A CB    1 
ATOM   198  C CG    . PRO A 1 26  ? -34.339 17.804  -14.945 1.00 29.76  ? 26   PRO A CG    1 
ATOM   199  C CD    . PRO A 1 26  ? -34.893 18.989  -15.682 1.00 26.84  ? 26   PRO A CD    1 
ATOM   200  N N     . GLN A 1 27  ? -30.387 19.851  -15.475 1.00 24.42  ? 27   GLN A N     1 
ATOM   201  C CA    . GLN A 1 27  ? -29.187 19.567  -16.249 1.00 22.87  ? 27   GLN A CA    1 
ATOM   202  C C     . GLN A 1 27  ? -27.953 20.199  -15.623 1.00 26.49  ? 27   GLN A C     1 
ATOM   203  O O     . GLN A 1 27  ? -28.053 21.147  -14.843 1.00 24.43  ? 27   GLN A O     1 
ATOM   204  C CB    . GLN A 1 27  ? -29.356 20.065  -17.687 1.00 29.51  ? 27   GLN A CB    1 
ATOM   205  C CG    . GLN A 1 27  ? -29.628 21.558  -17.794 1.00 27.31  ? 27   GLN A CG    1 
ATOM   206  C CD    . GLN A 1 27  ? -29.957 21.993  -19.210 1.00 27.44  ? 27   GLN A CD    1 
ATOM   207  O OE1   . GLN A 1 27  ? -30.295 21.171  -20.062 1.00 28.33  ? 27   GLN A OE1   1 
ATOM   208  N NE2   . GLN A 1 27  ? -29.858 23.292  -19.467 1.00 28.92  ? 27   GLN A NE2   1 
ATOM   209  N N     . ILE A 1 28  ? -26.787 19.664  -15.967 1.00 24.39  ? 28   ILE A N     1 
ATOM   210  C CA    . ILE A 1 28  ? -25.529 20.224  -15.502 1.00 22.34  ? 28   ILE A CA    1 
ATOM   211  C C     . ILE A 1 28  ? -24.982 21.194  -16.539 1.00 25.34  ? 28   ILE A C     1 
ATOM   212  O O     . ILE A 1 28  ? -24.895 20.870  -17.724 1.00 24.16  ? 28   ILE A O     1 
ATOM   213  C CB    . ILE A 1 28  ? -24.485 19.130  -15.219 1.00 22.32  ? 28   ILE A CB    1 
ATOM   214  C CG1   . ILE A 1 28  ? -25.017 18.146  -14.175 1.00 20.32  ? 28   ILE A CG1   1 
ATOM   215  C CG2   . ILE A 1 28  ? -23.179 19.750  -14.746 1.00 25.68  ? 28   ILE A CG2   1 
ATOM   216  C CD1   . ILE A 1 28  ? -24.074 17.001  -13.878 1.00 23.80  ? 28   ILE A CD1   1 
ATOM   217  N N     . VAL A 1 29  ? -24.624 22.389  -16.084 1.00 23.32  ? 29   VAL A N     1 
ATOM   218  C CA    . VAL A 1 29  ? -24.094 23.418  -16.965 1.00 21.89  ? 29   VAL A CA    1 
ATOM   219  C C     . VAL A 1 29  ? -22.634 23.694  -16.628 1.00 26.13  ? 29   VAL A C     1 
ATOM   220  O O     . VAL A 1 29  ? -22.310 24.080  -15.507 1.00 24.85  ? 29   VAL A O     1 
ATOM   221  C CB    . VAL A 1 29  ? -24.908 24.716  -16.849 1.00 24.73  ? 29   VAL A CB    1 
ATOM   222  C CG1   . VAL A 1 29  ? -24.281 25.808  -17.684 1.00 24.80  ? 29   VAL A CG1   1 
ATOM   223  C CG2   . VAL A 1 29  ? -26.350 24.474  -17.274 1.00 21.67  ? 29   VAL A CG2   1 
ATOM   224  N N     . VAL A 1 30  ? -21.755 23.490  -17.603 1.00 24.39  ? 30   VAL A N     1 
ATOM   225  C CA    . VAL A 1 30  ? -20.322 23.626  -17.372 1.00 21.63  ? 30   VAL A CA    1 
ATOM   226  C C     . VAL A 1 30  ? -19.829 25.048  -17.625 1.00 27.36  ? 30   VAL A C     1 
ATOM   227  O O     . VAL A 1 30  ? -19.855 25.539  -18.755 1.00 24.22  ? 30   VAL A O     1 
ATOM   228  C CB    . VAL A 1 30  ? -19.516 22.645  -18.241 1.00 26.80  ? 30   VAL A CB    1 
ATOM   229  C CG1   . VAL A 1 30  ? -18.073 22.585  -17.765 1.00 21.29  ? 30   VAL A CG1   1 
ATOM   230  C CG2   . VAL A 1 30  ? -20.148 21.262  -18.199 1.00 24.25  ? 30   VAL A CG2   1 
ATOM   231  N N     . VAL A 1 31  ? -19.381 25.704  -16.560 1.00 26.33  ? 31   VAL A N     1 
ATOM   232  C CA    . VAL A 1 31  ? -18.838 27.051  -16.660 1.00 26.05  ? 31   VAL A CA    1 
ATOM   233  C C     . VAL A 1 31  ? -17.339 27.033  -16.407 1.00 29.88  ? 31   VAL A C     1 
ATOM   234  O O     . VAL A 1 31  ? -16.882 26.624  -15.340 1.00 27.48  ? 31   VAL A O     1 
ATOM   235  C CB    . VAL A 1 31  ? -19.503 28.013  -15.660 1.00 23.53  ? 31   VAL A CB    1 
ATOM   236  C CG1   . VAL A 1 31  ? -18.827 29.374  -15.707 1.00 25.78  ? 31   VAL A CG1   1 
ATOM   237  C CG2   . VAL A 1 31  ? -20.989 28.141  -15.954 1.00 25.85  ? 31   VAL A CG2   1 
ATOM   238  N N     . GLY A 1 32  ? -16.576 27.472  -17.399 1.00 27.44  ? 32   GLY A N     1 
ATOM   239  C CA    . GLY A 1 32  ? -15.134 27.517  -17.280 1.00 31.56  ? 32   GLY A CA    1 
ATOM   240  C C     . GLY A 1 32  ? -14.580 28.741  -17.972 1.00 34.67  ? 32   GLY A C     1 
ATOM   241  O O     . GLY A 1 32  ? -15.274 29.397  -18.748 1.00 34.69  ? 32   GLY A O     1 
ATOM   242  N N     . THR A 1 33  ? -13.324 29.056  -17.690 1.00 35.12  ? 33   THR A N     1 
ATOM   243  C CA    . THR A 1 33  ? -12.691 30.205  -18.309 1.00 41.77  ? 33   THR A CA    1 
ATOM   244  C C     . THR A 1 33  ? -11.679 29.733  -19.344 1.00 44.75  ? 33   THR A C     1 
ATOM   245  O O     . THR A 1 33  ? -11.441 28.532  -19.480 1.00 42.59  ? 33   THR A O     1 
ATOM   246  C CB    . THR A 1 33  ? -12.001 31.091  -17.256 1.00 40.36  ? 33   THR A CB    1 
ATOM   247  O OG1   . THR A 1 33  ? -11.805 32.404  -17.790 1.00 50.19  ? 33   THR A OG1   1 
ATOM   248  C CG2   . THR A 1 33  ? -10.661 30.499  -16.836 1.00 41.70  ? 33   THR A CG2   1 
ATOM   249  N N     . GLN A 1 34  ? -11.104 30.672  -20.090 1.00 48.14  ? 34   GLN A N     1 
ATOM   250  C CA    . GLN A 1 34  ? -9.980  30.351  -20.966 1.00 51.82  ? 34   GLN A CA    1 
ATOM   251  C C     . GLN A 1 34  ? -8.812  29.796  -20.153 1.00 49.13  ? 34   GLN A C     1 
ATOM   252  O O     . GLN A 1 34  ? -8.476  30.327  -19.094 1.00 48.43  ? 34   GLN A O     1 
ATOM   253  C CB    . GLN A 1 34  ? -9.530  31.574  -21.771 1.00 55.23  ? 34   GLN A CB    1 
ATOM   254  C CG    . GLN A 1 34  ? -10.096 31.623  -23.183 1.00 61.94  ? 34   GLN A CG    1 
ATOM   255  C CD    . GLN A 1 34  ? -10.055 30.270  -23.871 1.00 64.59  ? 34   GLN A CD    1 
ATOM   256  O OE1   . GLN A 1 34  ? -8.880  29.883  -24.358 1.00 70.74  ? 34   GLN A OE1   1 
ATOM   257  N NE2   . GLN A 1 34  ? -11.071 29.580  -23.962 1.00 63.88  ? 34   GLN A NE2   1 
ATOM   258  N N     . SER A 1 35  ? -8.216  28.718  -20.656 1.00 52.16  ? 35   SER A N     1 
ATOM   259  C CA    . SER A 1 35  ? -7.092  28.041  -20.002 1.00 49.11  ? 35   SER A CA    1 
ATOM   260  C C     . SER A 1 35  ? -7.441  27.346  -18.678 1.00 46.41  ? 35   SER A C     1 
ATOM   261  O O     . SER A 1 35  ? -6.550  26.999  -17.899 1.00 42.28  ? 35   SER A O     1 
ATOM   262  C CB    . SER A 1 35  ? -5.901  28.993  -19.829 1.00 45.69  ? 35   SER A CB    1 
ATOM   263  O OG    . SER A 1 35  ? -4.729  28.418  -20.378 1.00 51.53  ? 35   SER A OG    1 
ATOM   264  N N     . SER A 1 36  ? -8.733  27.122  -18.442 1.00 43.88  ? 36   SER A N     1 
ATOM   265  C CA    . SER A 1 36  ? -9.195  26.421  -17.243 1.00 38.31  ? 36   SER A CA    1 
ATOM   266  C C     . SER A 1 36  ? -9.115  24.901  -17.394 1.00 35.75  ? 36   SER A C     1 
ATOM   267  O O     . SER A 1 36  ? -8.967  24.177  -16.409 1.00 30.81  ? 36   SER A O     1 
ATOM   268  C CB    . SER A 1 36  ? -10.628 26.834  -16.883 1.00 36.14  ? 36   SER A CB    1 
ATOM   269  O OG    . SER A 1 36  ? -11.561 26.368  -17.843 1.00 37.94  ? 36   SER A OG    1 
ATOM   270  N N     . GLY A 1 37  ? -9.219  24.427  -18.632 1.00 37.45  ? 37   GLY A N     1 
ATOM   271  C CA    . GLY A 1 37  ? -9.126  23.007  -18.916 1.00 33.59  ? 37   GLY A CA    1 
ATOM   272  C C     . GLY A 1 37  ? -10.463 22.296  -18.868 1.00 35.72  ? 37   GLY A C     1 
ATOM   273  O O     . GLY A 1 37  ? -10.519 21.099  -18.592 1.00 35.95  ? 37   GLY A O     1 
ATOM   274  N N     . LYS A 1 38  ? -11.543 23.023  -19.139 1.00 33.73  ? 38   LYS A N     1 
ATOM   275  C CA    . LYS A 1 38  ? -12.873 22.424  -19.074 1.00 37.00  ? 38   LYS A CA    1 
ATOM   276  C C     . LYS A 1 38  ? -13.157 21.529  -20.277 1.00 30.35  ? 38   LYS A C     1 
ATOM   277  O O     . LYS A 1 38  ? -13.887 20.547  -20.163 1.00 32.98  ? 38   LYS A O     1 
ATOM   278  C CB    . LYS A 1 38  ? -13.969 23.483  -18.903 1.00 34.79  ? 38   LYS A CB    1 
ATOM   279  C CG    . LYS A 1 38  ? -14.436 24.151  -20.180 1.00 36.64  ? 38   LYS A CG    1 
ATOM   280  C CD    . LYS A 1 38  ? -15.652 25.017  -19.911 1.00 38.00  ? 38   LYS A CD    1 
ATOM   281  C CE    . LYS A 1 38  ? -15.820 26.079  -20.982 1.00 36.69  ? 38   LYS A CE    1 
ATOM   282  N NZ    . LYS A 1 38  ? -16.042 25.491  -22.332 1.00 34.64  ? 38   LYS A NZ    1 
ATOM   283  N N     . SER A 1 39  ? -12.575 21.863  -21.425 1.00 33.72  ? 39   SER A N     1 
ATOM   284  C CA    . SER A 1 39  ? -12.695 21.013  -22.603 1.00 37.11  ? 39   SER A CA    1 
ATOM   285  C C     . SER A 1 39  ? -11.991 19.686  -22.347 1.00 34.25  ? 39   SER A C     1 
ATOM   286  O O     . SER A 1 39  ? -12.446 18.632  -22.789 1.00 33.86  ? 39   SER A O     1 
ATOM   287  C CB    . SER A 1 39  ? -12.103 21.697  -23.837 1.00 40.87  ? 39   SER A CB    1 
ATOM   288  O OG    . SER A 1 39  ? -12.919 22.770  -24.272 1.00 41.80  ? 39   SER A OG    1 
ATOM   289  N N     . SER A 1 40  ? -10.880 19.750  -21.622 1.00 32.19  ? 40   SER A N     1 
ATOM   290  C CA    . SER A 1 40  ? -10.129 18.555  -21.258 1.00 34.25  ? 40   SER A CA    1 
ATOM   291  C C     . SER A 1 40  ? -10.898 17.714  -20.242 1.00 32.21  ? 40   SER A C     1 
ATOM   292  O O     . SER A 1 40  ? -10.814 16.486  -20.254 1.00 30.35  ? 40   SER A O     1 
ATOM   293  C CB    . SER A 1 40  ? -8.757  18.936  -20.700 1.00 36.57  ? 40   SER A CB    1 
ATOM   294  O OG    . SER A 1 40  ? -8.007  19.668  -21.652 1.00 41.06  ? 40   SER A OG    1 
ATOM   295  N N     . VAL A 1 41  ? -11.640 18.381  -19.362 1.00 29.18  ? 41   VAL A N     1 
ATOM   296  C CA    . VAL A 1 41  ? -12.492 17.688  -18.401 1.00 30.63  ? 41   VAL A CA    1 
ATOM   297  C C     . VAL A 1 41  ? -13.528 16.853  -19.139 1.00 28.41  ? 41   VAL A C     1 
ATOM   298  O O     . VAL A 1 41  ? -13.736 15.682  -18.827 1.00 31.90  ? 41   VAL A O     1 
ATOM   299  C CB    . VAL A 1 41  ? -13.212 18.675  -17.459 1.00 33.31  ? 41   VAL A CB    1 
ATOM   300  C CG1   . VAL A 1 41  ? -14.329 17.974  -16.695 1.00 28.62  ? 41   VAL A CG1   1 
ATOM   301  C CG2   . VAL A 1 41  ? -12.225 19.311  -16.500 1.00 28.31  ? 41   VAL A CG2   1 
ATOM   302  N N     . LEU A 1 42  ? -14.166 17.466  -20.131 1.00 29.49  ? 42   LEU A N     1 
ATOM   303  C CA    . LEU A 1 42  ? -15.152 16.782  -20.958 1.00 28.98  ? 42   LEU A CA    1 
ATOM   304  C C     . LEU A 1 42  ? -14.538 15.586  -21.679 1.00 30.14  ? 42   LEU A C     1 
ATOM   305  O O     . LEU A 1 42  ? -15.124 14.506  -21.713 1.00 30.11  ? 42   LEU A O     1 
ATOM   306  C CB    . LEU A 1 42  ? -15.751 17.756  -21.972 1.00 26.94  ? 42   LEU A CB    1 
ATOM   307  C CG    . LEU A 1 42  ? -16.480 18.961  -21.374 1.00 28.37  ? 42   LEU A CG    1 
ATOM   308  C CD1   . LEU A 1 42  ? -16.503 20.109  -22.358 1.00 32.20  ? 42   LEU A CD1   1 
ATOM   309  C CD2   . LEU A 1 42  ? -17.892 18.585  -20.974 1.00 25.00  ? 42   LEU A CD2   1 
ATOM   310  N N     . GLU A 1 43  ? -13.353 15.783  -22.247 1.00 33.20  ? 43   GLU A N     1 
ATOM   311  C CA    . GLU A 1 43  ? -12.657 14.715  -22.957 1.00 30.53  ? 43   GLU A CA    1 
ATOM   312  C C     . GLU A 1 43  ? -12.201 13.603  -22.013 1.00 30.18  ? 43   GLU A C     1 
ATOM   313  O O     . GLU A 1 43  ? -12.124 12.440  -22.407 1.00 27.22  ? 43   GLU A O     1 
ATOM   314  C CB    . GLU A 1 43  ? -11.471 15.274  -23.746 1.00 33.29  ? 43   GLU A CB    1 
ATOM   315  C CG    . GLU A 1 43  ? -11.877 16.088  -24.965 1.00 39.93  ? 43   GLU A CG    1 
ATOM   316  C CD    . GLU A 1 43  ? -10.692 16.714  -25.675 1.00 40.91  ? 43   GLU A CD    1 
ATOM   317  O OE1   . GLU A 1 43  ? -9.608  16.799  -25.063 1.00 40.98  ? 43   GLU A OE1   1 
ATOM   318  O OE2   . GLU A 1 43  ? -10.845 17.120  -26.847 1.00 42.88  ? 43   GLU A OE2   1 
ATOM   319  N N     . SER A 1 44  ? -11.901 13.964  -20.768 1.00 35.76  ? 44   SER A N     1 
ATOM   320  C CA    . SER A 1 44  ? -11.552 12.974  -19.755 1.00 30.17  ? 44   SER A CA    1 
ATOM   321  C C     . SER A 1 44  ? -12.745 12.070  -19.473 1.00 32.94  ? 44   SER A C     1 
ATOM   322  O O     . SER A 1 44  ? -12.594 10.865  -19.268 1.00 29.88  ? 44   SER A O     1 
ATOM   323  C CB    . SER A 1 44  ? -11.095 13.655  -18.465 1.00 33.96  ? 44   SER A CB    1 
ATOM   324  O OG    . SER A 1 44  ? -9.834  14.280  -18.630 1.00 44.87  ? 44   SER A OG    1 
ATOM   325  N N     . LEU A 1 45  ? -13.934 12.664  -19.474 1.00 30.47  ? 45   LEU A N     1 
ATOM   326  C CA    . LEU A 1 45  ? -15.166 11.923  -19.234 1.00 29.36  ? 45   LEU A CA    1 
ATOM   327  C C     . LEU A 1 45  ? -15.551 11.069  -20.440 1.00 31.90  ? 45   LEU A C     1 
ATOM   328  O O     . LEU A 1 45  ? -16.094 9.973   -20.288 1.00 30.99  ? 45   LEU A O     1 
ATOM   329  C CB    . LEU A 1 45  ? -16.298 12.885  -18.873 1.00 25.77  ? 45   LEU A CB    1 
ATOM   330  C CG    . LEU A 1 45  ? -16.068 13.688  -17.590 1.00 29.18  ? 45   LEU A CG    1 
ATOM   331  C CD1   . LEU A 1 45  ? -17.087 14.803  -17.453 1.00 22.57  ? 45   LEU A CD1   1 
ATOM   332  C CD2   . LEU A 1 45  ? -16.114 12.777  -16.379 1.00 25.02  ? 45   LEU A CD2   1 
ATOM   333  N N     . VAL A 1 46  ? -15.267 11.572  -21.638 1.00 27.25  ? 46   VAL A N     1 
ATOM   334  C CA    . VAL A 1 46  ? -15.532 10.819  -22.858 1.00 27.05  ? 46   VAL A CA    1 
ATOM   335  C C     . VAL A 1 46  ? -14.554 9.655   -23.005 1.00 37.29  ? 46   VAL A C     1 
ATOM   336  O O     . VAL A 1 46  ? -14.945 8.542   -23.359 1.00 37.11  ? 46   VAL A O     1 
ATOM   337  C CB    . VAL A 1 46  ? -15.443 11.712  -24.111 1.00 30.33  ? 46   VAL A CB    1 
ATOM   338  C CG1   . VAL A 1 46  ? -15.615 10.875  -25.368 1.00 33.22  ? 46   VAL A CG1   1 
ATOM   339  C CG2   . VAL A 1 46  ? -16.488 12.813  -24.054 1.00 28.51  ? 46   VAL A CG2   1 
ATOM   340  N N     . GLY A 1 47  ? -13.282 9.915   -22.720 1.00 34.97  ? 47   GLY A N     1 
ATOM   341  C CA    . GLY A 1 47  ? -12.248 8.907   -22.872 1.00 34.25  ? 47   GLY A CA    1 
ATOM   342  C C     . GLY A 1 47  ? -11.553 9.046   -24.211 1.00 38.91  ? 47   GLY A C     1 
ATOM   343  O O     . GLY A 1 47  ? -10.657 8.274   -24.549 1.00 40.01  ? 47   GLY A O     1 
ATOM   344  N N     . ARG A 1 48  ? -11.985 10.039  -24.980 1.00 41.24  ? 48   ARG A N     1 
ATOM   345  C CA    . ARG A 1 48  ? -11.388 10.346  -26.272 1.00 46.21  ? 48   ARG A CA    1 
ATOM   346  C C     . ARG A 1 48  ? -11.238 11.855  -26.375 1.00 44.60  ? 48   ARG A C     1 
ATOM   347  O O     . ARG A 1 48  ? -11.973 12.598  -25.725 1.00 46.85  ? 48   ARG A O     1 
ATOM   348  C CB    . ARG A 1 48  ? -12.292 9.865   -27.412 1.00 46.62  ? 48   ARG A CB    1 
ATOM   349  C CG    . ARG A 1 48  ? -12.748 8.418   -27.314 1.00 44.61  ? 48   ARG A CG    1 
ATOM   350  C CD    . ARG A 1 48  ? -11.713 7.462   -27.877 1.00 48.71  ? 48   ARG A CD    1 
ATOM   351  N NE    . ARG A 1 48  ? -11.499 7.672   -29.306 1.00 53.77  ? 48   ARG A NE    1 
ATOM   352  C CZ    . ARG A 1 48  ? -12.237 7.117   -30.263 1.00 51.52  ? 48   ARG A CZ    1 
ATOM   353  N NH1   . ARG A 1 48  ? -13.246 6.317   -29.945 1.00 49.75  ? 48   ARG A NH1   1 
ATOM   354  N NH2   . ARG A 1 48  ? -11.967 7.363   -31.538 1.00 46.67  ? 48   ARG A NH2   1 
ATOM   355  N N     . ASP A 1 49  ? -10.287 12.312  -27.182 1.00 44.27  ? 49   ASP A N     1 
ATOM   356  C CA    . ASP A 1 49  ? -10.245 13.721  -27.547 1.00 47.72  ? 49   ASP A CA    1 
ATOM   357  C C     . ASP A 1 49  ? -11.223 13.904  -28.698 1.00 50.90  ? 49   ASP A C     1 
ATOM   358  O O     . ASP A 1 49  ? -11.170 13.164  -29.680 1.00 59.16  ? 49   ASP A O     1 
ATOM   359  C CB    . ASP A 1 49  ? -8.840  14.153  -27.979 1.00 48.14  ? 49   ASP A CB    1 
ATOM   360  C CG    . ASP A 1 49  ? -7.783  13.105  -27.683 1.00 53.53  ? 49   ASP A CG    1 
ATOM   361  O OD1   . ASP A 1 49  ? -7.307  13.043  -26.530 1.00 51.73  ? 49   ASP A OD1   1 
ATOM   362  O OD2   . ASP A 1 49  ? -7.418  12.351  -28.611 1.00 51.54  ? 49   ASP A OD2   1 
ATOM   363  N N     . LEU A 1 50  ? -12.100 14.878  -28.561 1.00 42.80  ? 50   LEU A N     1 
ATOM   364  C CA    . LEU A 1 50  ? -13.103 15.095  -29.567 1.00 48.79  ? 50   LEU A CA    1 
ATOM   365  C C     . LEU A 1 50  ? -13.442 16.558  -29.774 1.00 49.59  ? 50   LEU A C     1 
ATOM   366  O O     . LEU A 1 50  ? -14.073 16.918  -30.735 1.00 46.56  ? 50   LEU A O     1 
ATOM   367  C CB    . LEU A 1 50  ? -14.349 14.254  -29.270 1.00 49.20  ? 50   LEU A CB    1 
ATOM   368  C CG    . LEU A 1 50  ? -15.438 14.692  -28.308 1.00 45.87  ? 50   LEU A CG    1 
ATOM   369  C CD1   . LEU A 1 50  ? -16.450 15.433  -29.060 1.00 47.37  ? 50   LEU A CD1   1 
ATOM   370  C CD2   . LEU A 1 50  ? -16.100 13.545  -27.684 1.00 46.23  ? 50   LEU A CD2   1 
ATOM   371  N N     . LEU A 1 51  ? -13.016 17.389  -28.851 1.00 44.11  ? 51   LEU A N     1 
ATOM   372  C CA    . LEU A 1 51  ? -13.338 18.809  -28.880 1.00 48.24  ? 51   LEU A CA    1 
ATOM   373  C C     . LEU A 1 51  ? -12.355 19.578  -29.750 1.00 53.94  ? 51   LEU A C     1 
ATOM   374  O O     . LEU A 1 51  ? -11.146 19.376  -29.643 1.00 54.51  ? 51   LEU A O     1 
ATOM   375  C CB    . LEU A 1 51  ? -13.375 19.374  -27.462 1.00 45.11  ? 51   LEU A CB    1 
ATOM   376  C CG    . LEU A 1 51  ? -14.421 18.673  -26.596 1.00 46.83  ? 51   LEU A CG    1 
ATOM   377  C CD1   . LEU A 1 51  ? -14.490 19.290  -25.219 1.00 42.54  ? 51   LEU A CD1   1 
ATOM   378  C CD2   . LEU A 1 51  ? -15.783 18.713  -27.272 1.00 43.45  ? 51   LEU A CD2   1 
ATOM   379  N N     . PRO A 1 52  ? -12.841 20.554  -30.507 1.00 60.02  ? 52   PRO A N     1 
ATOM   380  C CA    . PRO A 1 52  ? -11.966 21.298  -31.421 1.00 58.83  ? 52   PRO A CA    1 
ATOM   381  C C     . PRO A 1 52  ? -10.822 21.982  -30.671 1.00 64.81  ? 52   PRO A C     1 
ATOM   382  O O     . PRO A 1 52  ? -11.010 22.469  -29.556 1.00 65.81  ? 52   PRO A O     1 
ATOM   383  C CB    . PRO A 1 52  ? -12.904 22.346  -32.021 1.00 59.51  ? 52   PRO A CB    1 
ATOM   384  C CG    . PRO A 1 52  ? -13.940 22.560  -30.971 1.00 63.05  ? 52   PRO A CG    1 
ATOM   385  C CD    . PRO A 1 52  ? -14.139 21.224  -30.313 1.00 55.14  ? 52   PRO A CD    1 
ATOM   386  N N     . ARG A 1 53  ? -9.696  22.060  -31.350 1.00 69.41  ? 53   ARG A N     1 
ATOM   387  C CA    . ARG A 1 53  ? -8.429  22.112  -30.694 1.00 74.25  ? 53   ARG A CA    1 
ATOM   388  C C     . ARG A 1 53  ? -8.250  23.354  -29.893 1.00 79.00  ? 53   ARG A C     1 
ATOM   389  O O     . ARG A 1 53  ? -7.934  23.277  -28.713 1.00 77.57  ? 53   ARG A O     1 
ATOM   390  C CB    . ARG A 1 53  ? -7.349  22.132  -31.750 1.00 76.91  ? 53   ARG A CB    1 
ATOM   391  C CG    . ARG A 1 53  ? -6.650  23.470  -31.859 1.00 79.82  ? 53   ARG A CG    1 
ATOM   392  C CD    . ARG A 1 53  ? -5.872  23.597  -33.165 0.10 81.96  ? 53   ARG A CD    1 
ATOM   393  N NE    . ARG A 1 53  ? -4.419  23.477  -32.984 1.00 85.24  ? 53   ARG A NE    1 
ATOM   394  C CZ    . ARG A 1 53  ? -3.634  22.653  -33.676 0.10 81.52  ? 53   ARG A CZ    1 
ATOM   395  N NH1   . ARG A 1 53  ? -4.157  21.866  -34.595 1.00 80.99  ? 53   ARG A NH1   1 
ATOM   396  N NH2   . ARG A 1 53  ? -2.327  22.611  -33.441 1.00 77.16  ? 53   ARG A NH2   1 
ATOM   397  N N     . GLY A 1 54  ? -8.504  24.507  -30.500 1.00 81.43  ? 54   GLY A N     1 
ATOM   398  C CA    . GLY A 1 54  ? -7.407  25.455  -30.643 1.00 83.39  ? 54   GLY A CA    1 
ATOM   399  C C     . GLY A 1 54  ? -7.348  26.345  -31.862 1.00 86.00  ? 54   GLY A C     1 
ATOM   400  O O     . GLY A 1 54  ? -8.380  26.756  -32.375 1.00 85.16  ? 54   GLY A O     1 
ATOM   401  N N     . THR A 1 55  ? -6.121  26.610  -32.320 1.00 89.54  ? 55   THR A N     1 
ATOM   402  C CA    . THR A 1 55  ? -5.353  27.855  -32.120 1.00 89.66  ? 55   THR A CA    1 
ATOM   403  C C     . THR A 1 55  ? -5.853  29.041  -32.946 1.00 91.25  ? 55   THR A C     1 
ATOM   404  O O     . THR A 1 55  ? -6.215  28.863  -34.089 1.00 92.21  ? 55   THR A O     1 
ATOM   405  C CB    . THR A 1 55  ? -3.877  27.613  -32.464 1.00 85.82  ? 55   THR A CB    1 
ATOM   406  O OG1   . THR A 1 55  ? -3.323  26.654  -31.557 1.00 81.59  ? 55   THR A OG1   1 
ATOM   407  C CG2   . THR A 1 55  ? -3.078  28.884  -32.367 1.00 82.34  ? 55   THR A CG2   1 
ATOM   408  N N     . GLY A 1 56  ? -5.918  30.233  -32.354 1.00 92.37  ? 56   GLY A N     1 
ATOM   409  C CA    . GLY A 1 56  ? -6.960  30.451  -31.371 1.00 86.81  ? 56   GLY A CA    1 
ATOM   410  C C     . GLY A 1 56  ? -8.313  30.617  -32.032 1.00 88.45  ? 56   GLY A C     1 
ATOM   411  O O     . GLY A 1 56  ? -8.829  29.674  -32.634 1.00 91.37  ? 56   GLY A O     1 
ATOM   412  N N     . ILE A 1 57  ? -8.895  31.805  -31.928 0.67 90.38  ? 57   ILE A N     1 
ATOM   413  C CA    . ILE A 1 57  ? -10.183 31.921  -31.254 0.67 90.83  ? 57   ILE A CA    1 
ATOM   414  C C     . ILE A 1 57  ? -11.123 30.792  -31.661 0.67 92.03  ? 57   ILE A C     1 
ATOM   415  O O     . ILE A 1 57  ? -11.078 30.310  -32.793 0.67 92.87  ? 57   ILE A O     1 
ATOM   416  C CB    . ILE A 1 57  ? -10.858 33.272  -31.556 0.67 89.87  ? 57   ILE A CB    1 
ATOM   417  C CG1   . ILE A 1 57  ? -9.895  34.425  -31.267 0.67 89.99  ? 57   ILE A CG1   1 
ATOM   418  C CG2   . ILE A 1 57  ? -12.135 33.422  -30.745 0.67 91.07  ? 57   ILE A CG2   1 
ATOM   419  C CD1   . ILE A 1 57  ? -8.577  34.320  -32.003 0.67 87.42  ? 57   ILE A CD1   1 
ATOM   420  N N     . VAL A 1 58  ? -11.975 30.374  -30.730 0.86 91.55  ? 58   VAL A N     1 
ATOM   421  C CA    . VAL A 1 58  ? -12.940 29.291  -30.992 0.86 89.51  ? 58   VAL A CA    1 
ATOM   422  C C     . VAL A 1 58  ? -14.099 29.018  -30.007 0.86 88.59  ? 58   VAL A C     1 
ATOM   423  O O     . VAL A 1 58  ? -14.180 29.605  -28.928 0.86 87.59  ? 58   VAL A O     1 
ATOM   424  C CB    . VAL A 1 58  ? -12.207 27.955  -31.238 0.86 90.67  ? 58   VAL A CB    1 
ATOM   425  C CG1   . VAL A 1 58  ? -11.235 28.089  -32.400 0.86 88.81  ? 58   VAL A CG1   1 
ATOM   426  C CG2   . VAL A 1 58  ? -11.483 27.508  -29.977 0.86 85.71  ? 58   VAL A CG2   1 
ATOM   427  N N     . THR A 1 59  ? -14.979 28.100  -30.420 1.00 85.69  ? 59   THR A N     1 
ATOM   428  C CA    . THR A 1 59  ? -16.063 27.529  -29.596 1.00 76.59  ? 59   THR A CA    1 
ATOM   429  C C     . THR A 1 59  ? -17.162 28.425  -28.997 1.00 69.87  ? 59   THR A C     1 
ATOM   430  O O     . THR A 1 59  ? -17.474 28.317  -27.811 1.00 70.87  ? 59   THR A O     1 
ATOM   431  C CB    . THR A 1 59  ? -15.482 26.673  -28.450 1.00 85.45  ? 59   THR A CB    1 
ATOM   432  O OG1   . THR A 1 59  ? -16.544 26.216  -27.604 1.00 82.41  ? 59   THR A OG1   1 
ATOM   433  C CG2   . THR A 1 59  ? -14.496 27.486  -27.626 1.00 87.21  ? 59   THR A CG2   1 
ATOM   434  N N     . ARG A 1 60  ? -17.740 29.302  -29.812 1.00 68.14  ? 60   ARG A N     1 
ATOM   435  C CA    . ARG A 1 60  ? -18.797 30.215  -29.356 1.00 65.12  ? 60   ARG A CA    1 
ATOM   436  C C     . ARG A 1 60  ? -20.133 29.618  -28.845 1.00 61.72  ? 60   ARG A C     1 
ATOM   437  O O     . ARG A 1 60  ? -20.669 30.105  -27.850 1.00 68.46  ? 60   ARG A O     1 
ATOM   438  C CB    . ARG A 1 60  ? -19.090 31.257  -30.442 1.00 67.29  ? 60   ARG A CB    1 
ATOM   439  C CG    . ARG A 1 60  ? -18.568 30.881  -31.819 1.00 66.97  ? 60   ARG A CG    1 
ATOM   440  C CD    . ARG A 1 60  ? -18.448 32.103  -32.716 1.00 74.62  ? 60   ARG A CD    1 
ATOM   441  N NE    . ARG A 1 60  ? -17.070 32.338  -33.137 1.00 77.33  ? 60   ARG A NE    1 
ATOM   442  C CZ    . ARG A 1 60  ? -16.510 33.541  -33.223 1.00 79.86  ? 60   ARG A CZ    1 
ATOM   443  N NH1   . ARG A 1 60  ? -17.211 34.624  -32.916 1.00 76.01  ? 60   ARG A NH1   1 
ATOM   444  N NH2   . ARG A 1 60  ? -15.249 33.661  -33.615 1.00 79.38  ? 60   ARG A NH2   1 
ATOM   445  N N     . ARG A 1 61  ? -20.680 28.594  -29.506 1.00 48.34  ? 61   ARG A N     1 
ATOM   446  C CA    . ARG A 1 61  ? -22.007 28.092  -29.137 1.00 47.58  ? 61   ARG A CA    1 
ATOM   447  C C     . ARG A 1 61  ? -22.012 26.938  -28.148 1.00 43.92  ? 61   ARG A C     1 
ATOM   448  O O     . ARG A 1 61  ? -21.095 26.140  -28.117 1.00 43.67  ? 61   ARG A O     1 
ATOM   449  C CB    . ARG A 1 61  ? -22.893 27.789  -30.344 1.00 41.65  ? 61   ARG A CB    1 
ATOM   450  C CG    . ARG A 1 61  ? -22.485 26.654  -31.188 1.00 43.17  ? 61   ARG A CG    1 
ATOM   451  C CD    . ARG A 1 61  ? -23.213 26.683  -32.515 1.00 51.99  ? 61   ARG A CD    1 
ATOM   452  N NE    . ARG A 1 61  ? -24.630 26.415  -32.381 1.00 48.63  ? 61   ARG A NE    1 
ATOM   453  C CZ    . ARG A 1 61  ? -25.368 25.820  -33.301 1.00 54.68  ? 61   ARG A CZ    1 
ATOM   454  N NH1   . ARG A 1 61  ? -24.840 25.430  -34.440 1.00 59.60  ? 61   ARG A NH1   1 
ATOM   455  N NH2   . ARG A 1 61  ? -26.638 25.599  -33.088 1.00 52.02  ? 61   ARG A NH2   1 
ATOM   456  N N     . PRO A 1 62  ? -23.057 26.868  -27.329 1.00 36.53  ? 62   PRO A N     1 
ATOM   457  C CA    . PRO A 1 62  ? -23.116 25.783  -26.345 1.00 33.99  ? 62   PRO A CA    1 
ATOM   458  C C     . PRO A 1 62  ? -23.082 24.401  -26.985 1.00 35.20  ? 62   PRO A C     1 
ATOM   459  O O     . PRO A 1 62  ? -23.532 24.225  -28.117 1.00 35.04  ? 62   PRO A O     1 
ATOM   460  C CB    . PRO A 1 62  ? -24.465 26.009  -25.662 1.00 35.25  ? 62   PRO A CB    1 
ATOM   461  C CG    . PRO A 1 62  ? -24.715 27.463  -25.806 1.00 32.47  ? 62   PRO A CG    1 
ATOM   462  C CD    . PRO A 1 62  ? -24.152 27.837  -27.145 1.00 36.89  ? 62   PRO A CD    1 
ATOM   463  N N     . LEU A 1 63  ? -22.537 23.435  -26.256 1.00 30.30  ? 63   LEU A N     1 
ATOM   464  C CA    . LEU A 1 63  ? -22.517 22.051  -26.703 1.00 26.31  ? 63   LEU A CA    1 
ATOM   465  C C     . LEU A 1 63  ? -23.171 21.164  -25.655 1.00 27.42  ? 63   LEU A C     1 
ATOM   466  O O     . LEU A 1 63  ? -22.662 21.026  -24.541 1.00 31.72  ? 63   LEU A O     1 
ATOM   467  C CB    . LEU A 1 63  ? -21.080 21.585  -26.958 1.00 28.34  ? 63   LEU A CB    1 
ATOM   468  C CG    . LEU A 1 63  ? -20.888 20.119  -27.362 1.00 26.11  ? 63   LEU A CG    1 
ATOM   469  C CD1   . LEU A 1 63  ? -21.415 19.860  -28.767 1.00 24.24  ? 63   LEU A CD1   1 
ATOM   470  C CD2   . LEU A 1 63  ? -19.427 19.708  -27.251 1.00 24.65  ? 63   LEU A CD2   1 
ATOM   471  N N     . ILE A 1 64  ? -24.308 20.574  -26.004 1.00 24.38  ? 64   ILE A N     1 
ATOM   472  C CA    . ILE A 1 64  ? -24.955 19.621  -25.114 1.00 22.74  ? 64   ILE A CA    1 
ATOM   473  C C     . ILE A 1 64  ? -24.414 18.226  -25.399 1.00 25.13  ? 64   ILE A C     1 
ATOM   474  O O     . ILE A 1 64  ? -24.801 17.579  -26.372 1.00 23.87  ? 64   ILE A O     1 
ATOM   475  C CB    . ILE A 1 64  ? -26.491 19.657  -25.237 1.00 24.05  ? 64   ILE A CB    1 
ATOM   476  C CG1   . ILE A 1 64  ? -27.016 21.038  -24.838 1.00 24.22  ? 64   ILE A CG1   1 
ATOM   477  C CG2   . ILE A 1 64  ? -27.123 18.585  -24.364 1.00 24.16  ? 64   ILE A CG2   1 
ATOM   478  C CD1   . ILE A 1 64  ? -28.529 21.147  -24.831 1.00 27.65  ? 64   ILE A CD1   1 
ATOM   479  N N     . LEU A 1 65  ? -23.493 17.786  -24.548 1.00 25.21  ? 65   LEU A N     1 
ATOM   480  C CA    . LEU A 1 65  ? -22.826 16.502  -24.712 1.00 25.42  ? 65   LEU A CA    1 
ATOM   481  C C     . LEU A 1 65  ? -23.554 15.418  -23.926 1.00 26.18  ? 65   LEU A C     1 
ATOM   482  O O     . LEU A 1 65  ? -23.588 15.446  -22.696 1.00 24.09  ? 65   LEU A O     1 
ATOM   483  C CB    . LEU A 1 65  ? -21.372 16.609  -24.247 1.00 23.09  ? 65   LEU A CB    1 
ATOM   484  C CG    . LEU A 1 65  ? -20.483 15.370  -24.353 1.00 27.52  ? 65   LEU A CG    1 
ATOM   485  C CD1   . LEU A 1 65  ? -20.379 14.900  -25.795 1.00 29.25  ? 65   LEU A CD1   1 
ATOM   486  C CD2   . LEU A 1 65  ? -19.104 15.666  -23.785 1.00 21.63  ? 65   LEU A CD2   1 
ATOM   487  N N     . GLN A 1 66  ? -24.139 14.466  -24.645 1.00 24.28  ? 66   GLN A N     1 
ATOM   488  C CA    . GLN A 1 66  ? -24.902 13.392  -24.020 1.00 23.96  ? 66   GLN A CA    1 
ATOM   489  C C     . GLN A 1 66  ? -24.176 12.055  -24.134 1.00 22.03  ? 66   GLN A C     1 
ATOM   490  O O     . GLN A 1 66  ? -24.176 11.427  -25.190 1.00 23.66  ? 66   GLN A O     1 
ATOM   491  C CB    . GLN A 1 66  ? -26.295 13.300  -24.649 1.00 20.15  ? 66   GLN A CB    1 
ATOM   492  C CG    . GLN A 1 66  ? -27.152 14.536  -24.420 1.00 22.28  ? 66   GLN A CG    1 
ATOM   493  C CD    . GLN A 1 66  ? -28.313 14.637  -25.392 1.00 26.89  ? 66   GLN A CD    1 
ATOM   494  O OE1   . GLN A 1 66  ? -28.259 14.104  -26.499 1.00 27.78  ? 66   GLN A OE1   1 
ATOM   495  N NE2   . GLN A 1 66  ? -29.370 15.329  -24.982 1.00 25.07  ? 66   GLN A NE2   1 
ATOM   496  N N     . LEU A 1 67  ? -23.556 11.628  -23.040 1.00 20.57  ? 67   LEU A N     1 
ATOM   497  C CA    . LEU A 1 67  ? -22.822 10.368  -23.020 1.00 22.04  ? 67   LEU A CA    1 
ATOM   498  C C     . LEU A 1 67  ? -23.756 9.209   -22.697 1.00 21.35  ? 67   LEU A C     1 
ATOM   499  O O     . LEU A 1 67  ? -24.348 9.159   -21.619 1.00 21.97  ? 67   LEU A O     1 
ATOM   500  C CB    . LEU A 1 67  ? -21.682 10.425  -22.002 1.00 21.28  ? 67   LEU A CB    1 
ATOM   501  C CG    . LEU A 1 67  ? -20.724 11.612  -22.128 1.00 24.22  ? 67   LEU A CG    1 
ATOM   502  C CD1   . LEU A 1 67  ? -19.596 11.504  -21.109 1.00 24.42  ? 67   LEU A CD1   1 
ATOM   503  C CD2   . LEU A 1 67  ? -20.168 11.708  -23.540 1.00 22.48  ? 67   LEU A CD2   1 
ATOM   504  N N     . VAL A 1 68  ? -23.881 8.280   -23.640 1.00 20.08  ? 68   VAL A N     1 
ATOM   505  C CA    . VAL A 1 68  ? -24.769 7.133   -23.487 1.00 22.82  ? 68   VAL A CA    1 
ATOM   506  C C     . VAL A 1 68  ? -23.970 5.842   -23.370 1.00 26.77  ? 68   VAL A C     1 
ATOM   507  O O     . VAL A 1 68  ? -23.241 5.471   -24.290 1.00 25.56  ? 68   VAL A O     1 
ATOM   508  C CB    . VAL A 1 68  ? -25.733 7.011   -24.683 1.00 23.65  ? 68   VAL A CB    1 
ATOM   509  C CG1   . VAL A 1 68  ? -26.653 5.812   -24.506 1.00 21.58  ? 68   VAL A CG1   1 
ATOM   510  C CG2   . VAL A 1 68  ? -26.537 8.293   -24.853 1.00 18.11  ? 68   VAL A CG2   1 
ATOM   511  N N     . HIS A 1 69  ? -24.103 5.158   -22.239 1.00 27.96  ? 69   HIS A N     1 
ATOM   512  C CA    . HIS A 1 69  ? -23.382 3.908   -22.038 1.00 26.73  ? 69   HIS A CA    1 
ATOM   513  C C     . HIS A 1 69  ? -24.009 2.765   -22.826 1.00 33.11  ? 69   HIS A C     1 
ATOM   514  O O     . HIS A 1 69  ? -25.230 2.601   -22.845 1.00 32.27  ? 69   HIS A O     1 
ATOM   515  C CB    . HIS A 1 69  ? -23.316 3.531   -20.558 1.00 27.60  ? 69   HIS A CB    1 
ATOM   516  C CG    . HIS A 1 69  ? -22.608 2.232   -20.304 1.00 30.98  ? 69   HIS A CG    1 
ATOM   517  N ND1   . HIS A 1 69  ? -21.240 2.140   -20.224 1.00 31.64  ? 69   HIS A ND1   1 
ATOM   518  C CD2   . HIS A 1 69  ? -23.089 0.977   -20.137 1.00 29.04  ? 69   HIS A CD2   1 
ATOM   519  C CE1   . HIS A 1 69  ? -20.900 0.876   -20.003 1.00 32.11  ? 69   HIS A CE1   1 
ATOM   520  N NE2   . HIS A 1 69  ? -22.001 0.156   -19.949 1.00 30.66  ? 69   HIS A NE2   1 
ATOM   521  N N     . VAL A 1 70  ? -23.160 1.979   -23.477 1.00 27.86  ? 70   VAL A N     1 
ATOM   522  C CA    . VAL A 1 70  ? -23.608 0.796   -24.194 1.00 27.55  ? 70   VAL A CA    1 
ATOM   523  C C     . VAL A 1 70  ? -22.776 -0.402  -23.757 1.00 27.15  ? 70   VAL A C     1 
ATOM   524  O O     . VAL A 1 70  ? -21.673 -0.243  -23.237 1.00 24.96  ? 70   VAL A O     1 
ATOM   525  C CB    . VAL A 1 70  ? -23.485 0.972   -25.722 1.00 30.56  ? 70   VAL A CB    1 
ATOM   526  C CG1   . VAL A 1 70  ? -24.310 2.161   -26.189 1.00 24.93  ? 70   VAL A CG1   1 
ATOM   527  C CG2   . VAL A 1 70  ? -22.027 1.138   -26.128 1.00 26.99  ? 70   VAL A CG2   1 
ATOM   528  N N     . SER A 1 71  ? -23.313 -1.600  -23.952 1.00 29.06  ? 71   SER A N     1 
ATOM   529  C CA    . SER A 1 71  ? -22.569 -2.816  -23.656 1.00 30.30  ? 71   SER A CA    1 
ATOM   530  C C     . SER A 1 71  ? -21.454 -2.983  -24.679 1.00 27.59  ? 71   SER A C     1 
ATOM   531  O O     . SER A 1 71  ? -21.573 -2.516  -25.813 1.00 28.27  ? 71   SER A O     1 
ATOM   532  C CB    . SER A 1 71  ? -23.496 -4.031  -23.684 1.00 27.39  ? 71   SER A CB    1 
ATOM   533  O OG    . SER A 1 71  ? -22.767 -5.230  -23.497 1.00 25.59  ? 71   SER A OG    1 
ATOM   534  N N     . GLN A 1 72  ? -20.373 -3.647  -24.284 1.00 24.50  ? 72   GLN A N     1 
ATOM   535  C CA    . GLN A 1 72  ? -19.257 -3.878  -25.197 1.00 28.44  ? 72   GLN A CA    1 
ATOM   536  C C     . GLN A 1 72  ? -19.657 -4.792  -26.356 1.00 26.29  ? 72   GLN A C     1 
ATOM   537  O O     . GLN A 1 72  ? -18.965 -4.859  -27.372 1.00 26.21  ? 72   GLN A O     1 
ATOM   538  C CB    . GLN A 1 72  ? -18.046 -4.451  -24.457 1.00 28.27  ? 72   GLN A CB    1 
ATOM   539  C CG    . GLN A 1 72  ? -18.291 -5.788  -23.780 1.00 28.62  ? 72   GLN A CG    1 
ATOM   540  C CD    . GLN A 1 72  ? -16.999 -6.504  -23.429 1.00 31.51  ? 72   GLN A CD    1 
ATOM   541  O OE1   . GLN A 1 72  ? -16.061 -6.542  -24.227 1.00 29.55  ? 72   GLN A OE1   1 
ATOM   542  N NE2   . GLN A 1 72  ? -16.943 -7.072  -22.231 1.00 34.68  ? 72   GLN A NE2   1 
ATOM   543  N N     . GLU A 1 73  ? -20.777 -5.490  -26.197 1.00 24.45  ? 73   GLU A N     1 
ATOM   544  C CA    . GLU A 1 73  ? -21.313 -6.341  -27.252 1.00 26.11  ? 73   GLU A CA    1 
ATOM   545  C C     . GLU A 1 73  ? -22.185 -5.540  -28.208 1.00 27.40  ? 73   GLU A C     1 
ATOM   546  O O     . GLU A 1 73  ? -22.578 -6.029  -29.266 1.00 30.96  ? 73   GLU A O     1 
ATOM   547  C CB    . GLU A 1 73  ? -22.138 -7.479  -26.655 1.00 25.61  ? 73   GLU A CB    1 
ATOM   548  C CG    . GLU A 1 73  ? -21.350 -8.437  -25.789 1.00 29.65  ? 73   GLU A CG    1 
ATOM   549  C CD    . GLU A 1 73  ? -22.120 -9.706  -25.501 1.00 27.05  ? 73   GLU A CD    1 
ATOM   550  O OE1   . GLU A 1 73  ? -23.122 -9.642  -24.757 1.00 24.37  ? 73   GLU A OE1   1 
ATOM   551  O OE2   . GLU A 1 73  ? -21.730 -10.767 -26.030 1.00 26.01  ? 73   GLU A OE2   1 
ATOM   552  N N     . ASP A 1 74  ? -22.493 -4.308  -27.820 1.00 27.68  ? 74   ASP A N     1 
ATOM   553  C CA    . ASP A 1 74  ? -23.365 -3.448  -28.606 1.00 28.47  ? 74   ASP A CA    1 
ATOM   554  C C     . ASP A 1 74  ? -22.540 -2.539  -29.508 1.00 30.66  ? 74   ASP A C     1 
ATOM   555  O O     . ASP A 1 74  ? -21.958 -1.556  -29.051 1.00 27.77  ? 74   ASP A O     1 
ATOM   556  C CB    . ASP A 1 74  ? -24.247 -2.625  -27.672 1.00 32.13  ? 74   ASP A CB    1 
ATOM   557  C CG    . ASP A 1 74  ? -25.192 -1.710  -28.413 1.00 29.91  ? 74   ASP A CG    1 
ATOM   558  O OD1   . ASP A 1 74  ? -25.489 -1.967  -29.599 1.00 32.89  ? 74   ASP A OD1   1 
ATOM   559  O OD2   . ASP A 1 74  ? -25.645 -0.732  -27.793 1.00 27.91  ? 74   ASP A OD2   1 
ATOM   560  N N     . LYS A 1 75  ? -22.494 -2.877  -30.794 1.00 32.48  ? 75   LYS A N     1 
ATOM   561  C CA    . LYS A 1 75  ? -21.594 -2.215  -31.732 1.00 34.42  ? 75   LYS A CA    1 
ATOM   562  C C     . LYS A 1 75  ? -22.309 -1.808  -33.024 1.00 37.30  ? 75   LYS A C     1 
ATOM   563  O O     . LYS A 1 75  ? -23.468 -2.164  -33.239 1.00 36.62  ? 75   LYS A O     1 
ATOM   564  C CB    . LYS A 1 75  ? -20.404 -3.133  -32.034 1.00 34.98  ? 75   LYS A CB    1 
ATOM   565  C CG    . LYS A 1 75  ? -19.652 -3.600  -30.793 1.00 34.86  ? 75   LYS A CG    1 
ATOM   566  C CD    . LYS A 1 75  ? -18.812 -4.842  -31.056 1.00 34.02  ? 75   LYS A CD    1 
ATOM   567  C CE    . LYS A 1 75  ? -17.481 -4.500  -31.701 1.00 46.91  ? 75   LYS A CE    1 
ATOM   568  N NZ    . LYS A 1 75  ? -16.588 -5.693  -31.766 1.00 47.43  ? 75   LYS A NZ    1 
ATOM   569  N N     . ARG A 1 76  ? -21.616 -1.059  -33.879 1.00 39.38  ? 76   ARG A N     1 
ATOM   570  C CA    . ARG A 1 76  ? -22.213 -0.547  -35.112 1.00 40.46  ? 76   ARG A CA    1 
ATOM   571  C C     . ARG A 1 76  ? -21.391 -0.878  -36.349 1.00 48.78  ? 76   ARG A C     1 
ATOM   572  O O     . ARG A 1 76  ? -20.166 -0.745  -36.343 1.00 52.60  ? 76   ARG A O     1 
ATOM   573  C CB    . ARG A 1 76  ? -22.377 0.971   -35.037 1.00 39.06  ? 76   ARG A CB    1 
ATOM   574  C CG    . ARG A 1 76  ? -23.456 1.450   -34.090 1.00 37.37  ? 76   ARG A CG    1 
ATOM   575  C CD    . ARG A 1 76  ? -24.828 0.982   -34.530 1.00 37.97  ? 76   ARG A CD    1 
ATOM   576  N NE    . ARG A 1 76  ? -25.855 1.967   -34.206 1.00 42.39  ? 76   ARG A NE    1 
ATOM   577  C CZ    . ARG A 1 76  ? -26.836 2.318   -35.031 1.00 47.63  ? 76   ARG A CZ    1 
ATOM   578  N NH1   . ARG A 1 76  ? -26.928 1.758   -36.230 1.00 50.46  ? 76   ARG A NH1   1 
ATOM   579  N NH2   . ARG A 1 76  ? -27.727 3.227   -34.659 1.00 36.65  ? 76   ARG A NH2   1 
ATOM   580  N N     . LYS A 1 77  ? -22.070 -1.300  -37.412 1.00 48.30  ? 77   LYS A N     1 
ATOM   581  C CA    . LYS A 1 77  ? -21.430 -1.418  -38.712 1.00 53.45  ? 77   LYS A CA    1 
ATOM   582  C C     . LYS A 1 77  ? -21.084 -0.002  -39.150 1.00 61.89  ? 77   LYS A C     1 
ATOM   583  O O     . LYS A 1 77  ? -21.949 0.876   -39.194 1.00 65.27  ? 77   LYS A O     1 
ATOM   584  C CB    . LYS A 1 77  ? -22.353 -2.101  -39.723 1.00 55.15  ? 77   LYS A CB    1 
ATOM   585  C CG    . LYS A 1 77  ? -21.763 -2.241  -41.121 1.00 67.33  ? 77   LYS A CG    1 
ATOM   586  C CD    . LYS A 1 77  ? -20.471 -3.047  -41.087 1.00 67.06  ? 77   LYS A CD    1 
ATOM   587  C CE    . LYS A 1 77  ? -20.084 -3.554  -42.468 1.00 73.05  ? 77   LYS A CE    1 
ATOM   588  N NZ    . LYS A 1 77  ? -19.873 -2.444  -43.439 1.00 81.38  ? 77   LYS A NZ    1 
ATOM   589  N N     . THR A 1 78  ? -19.810 0.217   -39.457 1.00 60.95  ? 78   THR A N     1 
ATOM   590  C CA    . THR A 1 78  ? -19.282 1.570   -39.628 1.00 62.71  ? 78   THR A CA    1 
ATOM   591  C C     . THR A 1 78  ? -19.365 2.154   -41.030 1.00 71.39  ? 78   THR A C     1 
ATOM   592  O O     . THR A 1 78  ? -18.939 1.520   -41.996 1.00 68.59  ? 78   THR A O     1 
ATOM   593  C CB    . THR A 1 78  ? -17.805 1.657   -39.214 1.00 62.26  ? 78   THR A CB    1 
ATOM   594  O OG1   . THR A 1 78  ? -17.201 2.756   -39.901 1.00 68.26  ? 78   THR A OG1   1 
ATOM   595  C CG2   . THR A 1 78  ? -17.063 0.399   -39.605 1.00 64.54  ? 78   THR A CG2   1 
ATOM   596  N N     . THR A 1 79  ? -19.845 3.391   -41.134 0.71 71.65  ? 79   THR A N     1 
ATOM   597  C CA    . THR A 1 79  ? -19.883 4.158   -42.383 0.71 73.81  ? 79   THR A CA    1 
ATOM   598  C C     . THR A 1 79  ? -20.533 3.403   -43.525 0.71 75.10  ? 79   THR A C     1 
ATOM   599  O O     . THR A 1 79  ? -21.591 2.791   -43.371 0.71 74.67  ? 79   THR A O     1 
ATOM   600  C CB    . THR A 1 79  ? -18.455 4.583   -42.851 0.71 73.95  ? 79   THR A CB    1 
ATOM   601  O OG1   . THR A 1 79  ? -17.502 4.373   -41.802 0.71 73.20  ? 79   THR A OG1   1 
ATOM   602  C CG2   . THR A 1 79  ? -18.426 6.037   -43.276 0.71 72.56  ? 79   THR A CG2   1 
ATOM   603  N N     . GLY A 1 80  ? -19.883 3.506   -44.682 0.75 77.09  ? 80   GLY A N     1 
ATOM   604  C CA    . GLY A 1 80  ? -19.991 2.557   -45.770 0.75 79.03  ? 80   GLY A CA    1 
ATOM   605  C C     . GLY A 1 80  ? -18.548 2.163   -46.001 0.75 79.25  ? 80   GLY A C     1 
ATOM   606  O O     . GLY A 1 80  ? -18.125 1.061   -45.652 0.75 79.28  ? 80   GLY A O     1 
ATOM   607  N N     . GLU A 1 81  ? -17.793 3.088   -46.587 0.77 79.65  ? 81   GLU A N     1 
ATOM   608  C CA    . GLU A 1 81  ? -16.330 3.076   -46.537 0.77 79.93  ? 81   GLU A CA    1 
ATOM   609  C C     . GLU A 1 81  ? -15.653 1.826   -47.111 0.77 80.48  ? 81   GLU A C     1 
ATOM   610  O O     . GLU A 1 81  ? -14.426 1.733   -47.118 0.77 81.94  ? 81   GLU A O     1 
ATOM   611  C CB    . GLU A 1 81  ? -15.860 3.321   -45.098 0.77 78.99  ? 81   GLU A CB    1 
ATOM   612  C CG    . GLU A 1 81  ? -14.495 3.985   -44.982 0.77 78.51  ? 81   GLU A CG    1 
ATOM   613  C CD    . GLU A 1 81  ? -13.381 2.979   -44.781 0.77 76.93  ? 81   GLU A CD    1 
ATOM   614  O OE1   . GLU A 1 81  ? -13.651 1.915   -44.186 0.77 75.57  ? 81   GLU A OE1   1 
ATOM   615  O OE2   . GLU A 1 81  ? -12.247 3.240   -45.233 0.77 77.72  ? 81   GLU A OE2   1 
ATOM   616  N N     . GLU A 1 82  ? -16.457 0.878   -47.590 0.75 79.58  ? 82   GLU A N     1 
ATOM   617  C CA    . GLU A 1 82  ? -15.971 -0.367  -48.193 0.75 79.96  ? 82   GLU A CA    1 
ATOM   618  C C     . GLU A 1 82  ? -15.328 -1.335  -47.194 0.75 81.72  ? 82   GLU A C     1 
ATOM   619  O O     . GLU A 1 82  ? -14.456 -2.118  -47.567 0.75 81.50  ? 82   GLU A O     1 
ATOM   620  C CB    . GLU A 1 82  ? -14.992 -0.087  -49.346 0.75 81.03  ? 82   GLU A CB    1 
ATOM   621  C CG    . GLU A 1 82  ? -15.447 0.977   -50.337 0.75 77.25  ? 82   GLU A CG    1 
ATOM   622  C CD    . GLU A 1 82  ? -16.424 0.445   -51.363 0.75 74.41  ? 82   GLU A CD    1 
ATOM   623  O OE1   . GLU A 1 82  ? -16.774 -0.752  -51.291 0.75 73.85  ? 82   GLU A OE1   1 
ATOM   624  O OE2   . GLU A 1 82  ? -16.837 1.224   -52.247 0.75 67.95  ? 82   GLU A OE2   1 
ATOM   625  N N     . ASN A 1 83  ? -15.759 -1.295  -45.936 0.65 80.46  ? 83   ASN A N     1 
ATOM   626  C CA    . ASN A 1 83  ? -15.191 -2.184  -44.920 0.65 78.17  ? 83   ASN A CA    1 
ATOM   627  C C     . ASN A 1 83  ? -16.208 -3.074  -44.203 0.65 78.67  ? 83   ASN A C     1 
ATOM   628  O O     . ASN A 1 83  ? -16.675 -4.067  -44.761 0.65 79.44  ? 83   ASN A O     1 
ATOM   629  C CB    . ASN A 1 83  ? -14.369 -1.395  -43.898 0.65 79.24  ? 83   ASN A CB    1 
ATOM   630  C CG    . ASN A 1 83  ? -12.975 -1.076  -44.395 0.65 77.67  ? 83   ASN A CG    1 
ATOM   631  O OD1   . ASN A 1 83  ? -12.504 -1.659  -45.372 0.65 78.37  ? 83   ASN A OD1   1 
ATOM   632  N ND2   . ASN A 1 83  ? -12.300 -0.155  -43.717 0.65 79.24  ? 83   ASN A ND2   1 
ATOM   633  N N     . GLY A 1 84  ? -16.529 -2.723  -42.959 0.64 76.24  ? 84   GLY A N     1 
ATOM   634  C CA    . GLY A 1 84  ? -17.471 -3.492  -42.161 0.64 73.69  ? 84   GLY A CA    1 
ATOM   635  C C     . GLY A 1 84  ? -16.947 -3.995  -40.824 0.64 69.54  ? 84   GLY A C     1 
ATOM   636  O O     . GLY A 1 84  ? -17.601 -4.806  -40.166 0.64 68.84  ? 84   GLY A O     1 
ATOM   637  N N     . VAL A 1 85  ? -15.784 -3.499  -40.423 1.00 67.48  ? 85   VAL A N     1 
ATOM   638  C CA    . VAL A 1 85  ? -15.257 -3.751  -39.094 1.00 66.80  ? 85   VAL A CA    1 
ATOM   639  C C     . VAL A 1 85  ? -16.237 -3.169  -38.108 1.00 59.77  ? 85   VAL A C     1 
ATOM   640  O O     . VAL A 1 85  ? -16.573 -2.003  -38.188 1.00 56.34  ? 85   VAL A O     1 
ATOM   641  C CB    . VAL A 1 85  ? -13.930 -3.060  -38.889 1.00 63.13  ? 85   VAL A CB    1 
ATOM   642  C CG1   . VAL A 1 85  ? -13.299 -3.525  -37.616 1.00 59.21  ? 85   VAL A CG1   1 
ATOM   643  C CG2   . VAL A 1 85  ? -13.026 -3.344  -40.051 1.00 68.81  ? 85   VAL A CG2   1 
ATOM   644  N N     . GLU A 1 86  ? -16.714 -3.931  -37.161 1.00 58.92  ? 86   GLU A N     1 
ATOM   645  C CA    . GLU A 1 86  ? -17.709 -3.359  -36.293 1.00 58.31  ? 86   GLU A CA    1 
ATOM   646  C C     . GLU A 1 86  ? -17.114 -2.378  -35.294 1.00 51.61  ? 86   GLU A C     1 
ATOM   647  O O     . GLU A 1 86  ? -16.142 -2.651  -34.639 1.00 55.86  ? 86   GLU A O     1 
ATOM   648  C CB    . GLU A 1 86  ? -18.511 -4.456  -35.629 1.00 55.07  ? 86   GLU A CB    1 
ATOM   649  C CG    . GLU A 1 86  ? -19.910 -4.065  -35.355 1.00 51.20  ? 86   GLU A CG    1 
ATOM   650  C CD    . GLU A 1 86  ? -20.882 -5.016  -35.896 1.00 47.60  ? 86   GLU A CD    1 
ATOM   651  O OE1   . GLU A 1 86  ? -21.513 -5.707  -35.091 1.00 47.71  ? 86   GLU A OE1   1 
ATOM   652  O OE2   . GLU A 1 86  ? -21.041 -5.035  -37.109 1.00 49.46  ? 86   GLU A OE2   1 
ATOM   653  N N     . ALA A 1 87  ? -17.733 -1.221  -35.203 1.00 52.19  ? 87   ALA A N     1 
ATOM   654  C CA    . ALA A 1 87  ? -17.244 -0.113  -34.384 1.00 46.50  ? 87   ALA A CA    1 
ATOM   655  C C     . ALA A 1 87  ? -17.789 -0.151  -32.956 1.00 39.85  ? 87   ALA A C     1 
ATOM   656  O O     . ALA A 1 87  ? -18.960 -0.451  -32.732 1.00 41.54  ? 87   ALA A O     1 
ATOM   657  C CB    . ALA A 1 87  ? -17.567 1.216   -35.048 1.00 48.39  ? 87   ALA A CB    1 
ATOM   658  N N     . GLU A 1 88  ? -16.929 0.175   -31.996 1.00 41.55  ? 88   GLU A N     1 
ATOM   659  C CA    . GLU A 1 88  ? -17.273 0.077   -30.580 1.00 38.00  ? 88   GLU A CA    1 
ATOM   660  C C     . GLU A 1 88  ? -17.842 1.378   -30.018 1.00 38.41  ? 88   GLU A C     1 
ATOM   661  O O     . GLU A 1 88  ? -18.554 1.371   -29.013 1.00 32.27  ? 88   GLU A O     1 
ATOM   662  C CB    . GLU A 1 88  ? -16.042 -0.340  -29.776 1.00 38.11  ? 88   GLU A CB    1 
ATOM   663  C CG    . GLU A 1 88  ? -15.433 -1.657  -30.226 1.00 48.39  ? 88   GLU A CG    1 
ATOM   664  C CD    . GLU A 1 88  ? -13.988 -1.805  -29.795 1.00 59.05  ? 88   GLU A CD    1 
ATOM   665  O OE1   . GLU A 1 88  ? -13.351 -0.776  -29.487 1.00 65.57  ? 88   GLU A OE1   1 
ATOM   666  O OE2   . GLU A 1 88  ? -13.489 -2.950  -29.765 1.00 69.10  ? 88   GLU A OE2   1 
ATOM   667  N N     . GLU A 1 89  ? -17.514 2.493   -30.664 1.00 35.61  ? 89   GLU A N     1 
ATOM   668  C CA    . GLU A 1 89  ? -17.978 3.803   -30.222 1.00 33.06  ? 89   GLU A CA    1 
ATOM   669  C C     . GLU A 1 89  ? -18.463 4.629   -31.408 1.00 33.57  ? 89   GLU A C     1 
ATOM   670  O O     . GLU A 1 89  ? -17.839 4.632   -32.468 1.00 37.57  ? 89   GLU A O     1 
ATOM   671  C CB    . GLU A 1 89  ? -16.859 4.548   -29.490 1.00 35.27  ? 89   GLU A CB    1 
ATOM   672  C CG    . GLU A 1 89  ? -16.366 3.855   -28.229 1.00 36.94  ? 89   GLU A CG    1 
ATOM   673  C CD    . GLU A 1 89  ? -15.190 4.566   -27.593 1.00 36.67  ? 89   GLU A CD    1 
ATOM   674  O OE1   . GLU A 1 89  ? -14.247 4.933   -28.326 1.00 40.09  ? 89   GLU A OE1   1 
ATOM   675  O OE2   . GLU A 1 89  ? -15.209 4.762   -26.360 1.00 38.89  ? 89   GLU A OE2   1 
ATOM   676  N N     . TRP A 1 90  ? -19.578 5.329   -31.228 1.00 28.25  ? 90   TRP A N     1 
ATOM   677  C CA    . TRP A 1 90  ? -20.116 6.172   -32.289 1.00 30.22  ? 90   TRP A CA    1 
ATOM   678  C C     . TRP A 1 90  ? -20.788 7.430   -31.752 1.00 32.77  ? 90   TRP A C     1 
ATOM   679  O O     . TRP A 1 90  ? -20.981 7.578   -30.545 1.00 31.14  ? 90   TRP A O     1 
ATOM   680  C CB    . TRP A 1 90  ? -21.079 5.383   -33.185 1.00 34.27  ? 90   TRP A CB    1 
ATOM   681  C CG    . TRP A 1 90  ? -22.268 4.800   -32.475 1.00 32.13  ? 90   TRP A CG    1 
ATOM   682  C CD1   . TRP A 1 90  ? -23.527 5.320   -32.424 1.00 35.58  ? 90   TRP A CD1   1 
ATOM   683  C CD2   . TRP A 1 90  ? -22.306 3.575   -31.727 1.00 29.10  ? 90   TRP A CD2   1 
ATOM   684  N NE1   . TRP A 1 90  ? -24.348 4.498   -31.689 1.00 30.28  ? 90   TRP A NE1   1 
ATOM   685  C CE2   . TRP A 1 90  ? -23.628 3.425   -31.254 1.00 29.70  ? 90   TRP A CE2   1 
ATOM   686  C CE3   . TRP A 1 90  ? -21.359 2.599   -31.417 1.00 33.80  ? 90   TRP A CE3   1 
ATOM   687  C CZ2   . TRP A 1 90  ? -24.015 2.331   -30.478 1.00 30.10  ? 90   TRP A CZ2   1 
ATOM   688  C CZ3   . TRP A 1 90  ? -21.749 1.516   -30.649 1.00 33.41  ? 90   TRP A CZ3   1 
ATOM   689  C CH2   . TRP A 1 90  ? -23.066 1.391   -30.188 1.00 34.57  ? 90   TRP A CH2   1 
ATOM   690  N N     . GLY A 1 91  ? -21.137 8.336   -32.661 1.00 33.09  ? 91   GLY A N     1 
ATOM   691  C CA    . GLY A 1 91  ? -21.758 9.591   -32.286 1.00 28.69  ? 91   GLY A CA    1 
ATOM   692  C C     . GLY A 1 91  ? -22.853 10.009  -33.250 1.00 32.20  ? 91   GLY A C     1 
ATOM   693  O O     . GLY A 1 91  ? -22.860 9.606   -34.411 1.00 33.18  ? 91   GLY A O     1 
ATOM   694  N N     . LYS A 1 92  ? -23.787 10.815  -32.757 1.00 28.80  ? 92   LYS A N     1 
ATOM   695  C CA    . LYS A 1 92  ? -24.879 11.322  -33.578 1.00 31.39  ? 92   LYS A CA    1 
ATOM   696  C C     . LYS A 1 92  ? -25.183 12.774  -33.236 1.00 31.52  ? 92   LYS A C     1 
ATOM   697  O O     . LYS A 1 92  ? -25.245 13.145  -32.063 1.00 26.64  ? 92   LYS A O     1 
ATOM   698  C CB    . LYS A 1 92  ? -26.134 10.461  -33.390 1.00 34.76  ? 92   LYS A CB    1 
ATOM   699  C CG    . LYS A 1 92  ? -25.995 9.025   -33.868 1.00 39.20  ? 92   LYS A CG    1 
ATOM   700  C CD    . LYS A 1 92  ? -27.214 8.187   -33.507 1.00 38.22  ? 92   LYS A CD    1 
ATOM   701  C CE    . LYS A 1 92  ? -28.445 8.625   -34.279 1.00 46.52  ? 92   LYS A CE    1 
ATOM   702  N NZ    . LYS A 1 92  ? -29.646 8.741   -33.403 1.00 40.67  ? 92   LYS A NZ    1 
ATOM   703  N N     . PHE A 1 93  ? -25.360 13.594  -34.267 1.00 33.11  ? 93   PHE A N     1 
ATOM   704  C CA    . PHE A 1 93  ? -25.749 14.988  -34.085 1.00 30.24  ? 93   PHE A CA    1 
ATOM   705  C C     . PHE A 1 93  ? -27.233 15.140  -34.390 1.00 34.46  ? 93   PHE A C     1 
ATOM   706  O O     . PHE A 1 93  ? -27.744 14.531  -35.332 1.00 36.24  ? 93   PHE A O     1 
ATOM   707  C CB    . PHE A 1 93  ? -24.940 15.903  -35.005 1.00 31.99  ? 93   PHE A CB    1 
ATOM   708  C CG    . PHE A 1 93  ? -23.489 16.020  -34.631 1.00 31.52  ? 93   PHE A CG    1 
ATOM   709  C CD1   . PHE A 1 93  ? -22.569 15.085  -35.071 1.00 31.26  ? 93   PHE A CD1   1 
ATOM   710  C CD2   . PHE A 1 93  ? -23.043 17.076  -33.852 1.00 32.68  ? 93   PHE A CD2   1 
ATOM   711  C CE1   . PHE A 1 93  ? -21.233 15.192  -34.733 1.00 32.19  ? 93   PHE A CE1   1 
ATOM   712  C CE2   . PHE A 1 93  ? -21.707 17.189  -33.511 1.00 37.00  ? 93   PHE A CE2   1 
ATOM   713  C CZ    . PHE A 1 93  ? -20.801 16.245  -33.954 1.00 35.46  ? 93   PHE A CZ    1 
ATOM   714  N N     . LEU A 1 94  ? -27.924 15.950  -33.595 1.00 31.91  ? 94   LEU A N     1 
ATOM   715  C CA    . LEU A 1 94  ? -29.348 16.180  -33.806 1.00 34.02  ? 94   LEU A CA    1 
ATOM   716  C C     . LEU A 1 94  ? -29.581 16.946  -35.105 1.00 37.21  ? 94   LEU A C     1 
ATOM   717  O O     . LEU A 1 94  ? -30.617 16.793  -35.751 1.00 38.06  ? 94   LEU A O     1 
ATOM   718  C CB    . LEU A 1 94  ? -29.953 16.939  -32.623 1.00 33.73  ? 94   LEU A CB    1 
ATOM   719  C CG    . LEU A 1 94  ? -31.478 17.046  -32.583 1.00 31.99  ? 94   LEU A CG    1 
ATOM   720  C CD1   . LEU A 1 94  ? -32.110 15.668  -32.457 1.00 28.26  ? 94   LEU A CD1   1 
ATOM   721  C CD2   . LEU A 1 94  ? -31.925 17.950  -31.446 1.00 32.35  ? 94   LEU A CD2   1 
ATOM   722  N N     . HIS A 1 95  ? -28.605 17.765  -35.486 1.00 37.76  ? 95   HIS A N     1 
ATOM   723  C CA    . HIS A 1 95  ? -28.701 18.554  -36.709 1.00 41.74  ? 95   HIS A CA    1 
ATOM   724  C C     . HIS A 1 95  ? -28.589 17.676  -37.953 1.00 43.18  ? 95   HIS A C     1 
ATOM   725  O O     . HIS A 1 95  ? -29.132 18.008  -39.006 1.00 46.17  ? 95   HIS A O     1 
ATOM   726  C CB    . HIS A 1 95  ? -27.626 19.644  -36.734 1.00 46.75  ? 95   HIS A CB    1 
ATOM   727  C CG    . HIS A 1 95  ? -27.718 20.556  -37.918 0.13 44.88  ? 95   HIS A CG    1 
ATOM   728  N ND1   . HIS A 1 95  ? -26.996 20.350  -39.074 0.49 44.65  ? 95   HIS A ND1   1 
ATOM   729  C CD2   . HIS A 1 95  ? -28.448 21.676  -38.125 1.00 50.09  ? 95   HIS A CD2   1 
ATOM   730  C CE1   . HIS A 1 95  ? -27.276 21.305  -39.942 1.00 41.33  ? 95   HIS A CE1   1 
ATOM   731  N NE2   . HIS A 1 95  ? -28.156 22.125  -39.390 0.10 44.89  ? 95   HIS A NE2   1 
ATOM   732  N N     . THR A 1 96  ? -27.883 16.557  -37.827 1.00 46.92  ? 96   THR A N     1 
ATOM   733  C CA    . THR A 1 96  ? -27.719 15.626  -38.940 1.00 44.62  ? 96   THR A CA    1 
ATOM   734  C C     . THR A 1 96  ? -28.577 14.380  -38.734 1.00 45.24  ? 96   THR A C     1 
ATOM   735  O O     . THR A 1 96  ? -28.430 13.386  -39.445 1.00 43.85  ? 96   THR A O     1 
ATOM   736  C CB    . THR A 1 96  ? -26.247 15.219  -39.127 1.00 43.92  ? 96   THR A CB    1 
ATOM   737  O OG1   . THR A 1 96  ? -25.810 14.454  -37.997 1.00 46.08  ? 96   THR A OG1   1 
ATOM   738  C CG2   . THR A 1 96  ? -25.370 16.454  -39.267 1.00 40.43  ? 96   THR A CG2   1 
ATOM   739  N N     . LYS A 1 97  ? -29.464 14.453  -37.747 1.00 45.91  ? 97   LYS A N     1 
ATOM   740  C CA    . LYS A 1 97  ? -30.447 13.405  -37.470 1.00 46.39  ? 97   LYS A CA    1 
ATOM   741  C C     . LYS A 1 97  ? -29.849 12.019  -37.207 1.00 50.10  ? 97   LYS A C     1 
ATOM   742  O O     . LYS A 1 97  ? -29.113 11.828  -36.236 1.00 46.79  ? 97   LYS A O     1 
ATOM   743  C CB    . LYS A 1 97  ? -31.512 13.356  -38.572 1.00 46.31  ? 97   LYS A CB    1 
ATOM   744  C CG    . LYS A 1 97  ? -32.216 14.694  -38.775 1.00 50.45  ? 97   LYS A CG    1 
ATOM   745  C CD    . LYS A 1 97  ? -33.548 14.549  -39.492 1.00 54.94  ? 97   LYS A CD    1 
ATOM   746  C CE    . LYS A 1 97  ? -34.256 15.893  -39.591 1.00 54.90  ? 97   LYS A CE    1 
ATOM   747  N NZ    . LYS A 1 97  ? -35.608 15.779  -40.205 1.00 62.80  ? 97   LYS A NZ    1 
ATOM   748  N N     . ASN A 1 98  ? -30.171 11.056  -38.065 1.00 45.56  ? 98   ASN A N     1 
ATOM   749  C CA    . ASN A 1 98  ? -29.800 9.664   -37.819 1.00 44.19  ? 98   ASN A CA    1 
ATOM   750  C C     . ASN A 1 98  ? -28.483 9.222   -38.451 1.00 48.23  ? 98   ASN A C     1 
ATOM   751  O O     . ASN A 1 98  ? -28.177 8.031   -38.488 1.00 52.88  ? 98   ASN A O     1 
ATOM   752  C CB    . ASN A 1 98  ? -30.933 8.725   -38.245 1.00 45.19  ? 98   ASN A CB    1 
ATOM   753  C CG    . ASN A 1 98  ? -32.129 8.800   -37.316 1.00 48.03  ? 98   ASN A CG    1 
ATOM   754  O OD1   . ASN A 1 98  ? -31.981 8.993   -36.110 1.00 49.00  ? 98   ASN A OD1   1 
ATOM   755  N ND2   . ASN A 1 98  ? -33.323 8.648   -37.876 1.00 40.84  ? 98   ASN A ND2   1 
ATOM   756  N N     . LYS A 1 99  ? -27.728 10.158  -39.003 1.00 43.58  ? 99   LYS A N     1 
ATOM   757  C CA    . LYS A 1 99  ? -26.401 9.869   -39.505 1.00 39.95  ? 99   LYS A CA    1 
ATOM   758  C C     . LYS A 1 99  ? -25.478 9.349   -38.412 1.00 43.37  ? 99   LYS A C     1 
ATOM   759  O O     . LYS A 1 99  ? -25.526 9.826   -37.302 1.00 45.42  ? 99   LYS A O     1 
ATOM   760  C CB    . LYS A 1 99  ? -25.797 11.115  -40.133 1.00 42.61  ? 99   LYS A CB    1 
ATOM   761  C CG    . LYS A 1 99  ? -24.491 10.904  -40.842 1.00 45.74  ? 99   LYS A CG    1 
ATOM   762  C CD    . LYS A 1 99  ? -23.867 12.181  -41.301 1.00 46.52  ? 99   LYS A CD    1 
ATOM   763  C CE    . LYS A 1 99  ? -22.494 11.975  -41.901 1.00 47.34  ? 99   LYS A CE    1 
ATOM   764  N NZ    . LYS A 1 99  ? -21.772 13.222  -42.238 1.00 45.81  ? 99   LYS A NZ    1 
ATOM   765  N N     . LEU A 1 100 ? -24.622 8.392   -38.738 1.00 41.64  ? 100  LEU A N     1 
ATOM   766  C CA    . LEU A 1 100 ? -23.714 7.799   -37.761 1.00 38.35  ? 100  LEU A CA    1 
ATOM   767  C C     . LEU A 1 100 ? -22.271 8.242   -37.965 1.00 39.72  ? 100  LEU A C     1 
ATOM   768  O O     . LEU A 1 100 ? -21.766 8.260   -39.086 1.00 43.40  ? 100  LEU A O     1 
ATOM   769  C CB    . LEU A 1 100 ? -23.791 6.271   -37.807 1.00 46.66  ? 100  LEU A CB    1 
ATOM   770  C CG    . LEU A 1 100 ? -25.110 5.614   -37.403 1.00 44.69  ? 100  LEU A CG    1 
ATOM   771  C CD1   . LEU A 1 100 ? -24.933 4.110   -37.322 1.00 46.84  ? 100  LEU A CD1   1 
ATOM   772  C CD2   . LEU A 1 100 ? -25.605 6.166   -36.079 1.00 44.78  ? 100  LEU A CD2   1 
ATOM   773  N N     . TYR A 1 101 ? -21.611 8.589   -36.865 1.00 40.20  ? 101  TYR A N     1 
ATOM   774  C CA    . TYR A 1 101 ? -20.205 8.968   -36.895 1.00 41.76  ? 101  TYR A CA    1 
ATOM   775  C C     . TYR A 1 101 ? -19.387 7.957   -36.103 1.00 38.23  ? 101  TYR A C     1 
ATOM   776  O O     . TYR A 1 101 ? -19.463 7.915   -34.877 1.00 38.38  ? 101  TYR A O     1 
ATOM   777  C CB    . TYR A 1 101 ? -20.011 10.364  -36.300 1.00 38.73  ? 101  TYR A CB    1 
ATOM   778  C CG    . TYR A 1 101 ? -20.754 11.464  -37.025 1.00 36.24  ? 101  TYR A CG    1 
ATOM   779  C CD1   . TYR A 1 101 ? -20.099 12.294  -37.926 1.00 42.36  ? 101  TYR A CD1   1 
ATOM   780  C CD2   . TYR A 1 101 ? -22.108 11.677  -36.804 1.00 35.84  ? 101  TYR A CD2   1 
ATOM   781  C CE1   . TYR A 1 101 ? -20.773 13.303  -38.589 1.00 38.59  ? 101  TYR A CE1   1 
ATOM   782  C CE2   . TYR A 1 101 ? -22.791 12.680  -37.463 1.00 41.52  ? 101  TYR A CE2   1 
ATOM   783  C CZ    . TYR A 1 101 ? -22.119 13.491  -38.353 1.00 40.44  ? 101  TYR A CZ    1 
ATOM   784  O OH    . TYR A 1 101 ? -22.798 14.492  -39.008 1.00 45.21  ? 101  TYR A OH    1 
ATOM   785  N N     . THR A 1 102 ? -18.609 7.141   -36.805 1.00 41.35  ? 102  THR A N     1 
ATOM   786  C CA    . THR A 1 102 ? -17.775 6.136   -36.153 1.00 43.57  ? 102  THR A CA    1 
ATOM   787  C C     . THR A 1 102 ? -16.331 6.614   -36.041 1.00 45.91  ? 102  THR A C     1 
ATOM   788  O O     . THR A 1 102 ? -15.508 5.989   -35.372 1.00 46.18  ? 102  THR A O     1 
ATOM   789  C CB    . THR A 1 102 ? -17.823 4.792   -36.901 1.00 46.10  ? 102  THR A CB    1 
ATOM   790  O OG1   . THR A 1 102 ? -17.441 4.988   -38.268 1.00 51.88  ? 102  THR A OG1   1 
ATOM   791  C CG2   . THR A 1 102 ? -19.228 4.210   -36.855 1.00 47.53  ? 102  THR A CG2   1 
ATOM   792  N N     . ASP A 1 103 ? -16.044 7.762   -36.636 1.00 43.06  ? 103  ASP A N     1 
ATOM   793  C CA    . ASP A 1 103 ? -14.713 8.357   -36.605 1.00 46.48  ? 103  ASP A CA    1 
ATOM   794  C C     . ASP A 1 103 ? -14.799 9.625   -35.810 1.00 45.61  ? 103  ASP A C     1 
ATOM   795  O O     . ASP A 1 103 ? -15.516 10.510  -36.155 1.00 45.87  ? 103  ASP A O     1 
ATOM   796  C CB    . ASP A 1 103 ? -14.218 8.650   -38.031 1.00 47.86  ? 103  ASP A CB    1 
ATOM   797  C CG    . ASP A 1 103 ? -12.767 9.106   -38.096 1.00 53.87  ? 103  ASP A CG    1 
ATOM   798  O OD1   . ASP A 1 103 ? -12.168 9.538   -37.111 1.00 52.24  ? 103  ASP A OD1   1 
ATOM   799  O OD2   . ASP A 1 103 ? -12.202 9.021   -39.181 1.00 59.04  ? 103  ASP A OD2   1 
ATOM   800  N N     . PHE A 1 104 ? -14.060 9.702   -34.739 1.00 39.25  ? 104  PHE A N     1 
ATOM   801  C CA    . PHE A 1 104 ? -14.131 10.846  -33.837 1.00 47.84  ? 104  PHE A CA    1 
ATOM   802  C C     . PHE A 1 104 ? -13.462 12.096  -34.402 1.00 48.44  ? 104  PHE A C     1 
ATOM   803  O O     . PHE A 1 104 ? -13.612 13.189  -33.856 1.00 45.33  ? 104  PHE A O     1 
ATOM   804  C CB    . PHE A 1 104 ? -13.562 10.490  -32.462 1.00 43.04  ? 104  PHE A CB    1 
ATOM   805  C CG    . PHE A 1 104 ? -14.561 9.840   -31.550 1.00 42.51  ? 104  PHE A CG    1 
ATOM   806  C CD1   . PHE A 1 104 ? -15.147 8.633   -31.893 1.00 43.47  ? 104  PHE A CD1   1 
ATOM   807  C CD2   . PHE A 1 104 ? -14.919 10.436  -30.353 1.00 42.84  ? 104  PHE A CD2   1 
ATOM   808  C CE1   . PHE A 1 104 ? -16.072 8.032   -31.061 1.00 41.10  ? 104  PHE A CE1   1 
ATOM   809  C CE2   . PHE A 1 104 ? -15.841 9.839   -29.513 1.00 41.40  ? 104  PHE A CE2   1 
ATOM   810  C CZ    . PHE A 1 104 ? -16.418 8.635   -29.868 1.00 40.19  ? 104  PHE A CZ    1 
ATOM   811  N N     . ASP A 1 105 ? -12.795 11.922  -35.518 1.00 49.49  ? 105  ASP A N     1 
ATOM   812  C CA    . ASP A 1 105 ? -12.175 13.021  -36.188 1.00 54.41  ? 105  ASP A CA    1 
ATOM   813  C C     . ASP A 1 105 ? -13.221 13.709  -37.067 1.00 51.43  ? 105  ASP A C     1 
ATOM   814  O O     . ASP A 1 105 ? -13.188 14.899  -37.275 1.00 49.43  ? 105  ASP A O     1 
ATOM   815  C CB    . ASP A 1 105 ? -10.942 12.527  -36.957 1.00 54.40  ? 105  ASP A CB    1 
ATOM   816  C CG    . ASP A 1 105 ? -10.132 13.641  -37.520 1.00 64.28  ? 105  ASP A CG    1 
ATOM   817  O OD1   . ASP A 1 105 ? -9.467  14.323  -36.727 1.00 71.54  ? 105  ASP A OD1   1 
ATOM   818  O OD2   . ASP A 1 105 ? -10.174 13.881  -38.738 1.00 61.65  ? 105  ASP A OD2   1 
ATOM   819  N N     . GLU A 1 106 ? -14.180 12.935  -37.534 1.00 48.11  ? 106  GLU A N     1 
ATOM   820  C CA    . GLU A 1 106 ? -15.328 13.463  -38.259 1.00 48.96  ? 106  GLU A CA    1 
ATOM   821  C C     . GLU A 1 106 ? -16.312 14.075  -37.266 1.00 43.71  ? 106  GLU A C     1 
ATOM   822  O O     . GLU A 1 106 ? -17.052 15.001  -37.598 1.00 44.48  ? 106  GLU A O     1 
ATOM   823  C CB    . GLU A 1 106 ? -16.003 12.366  -39.083 1.00 45.96  ? 106  GLU A CB    1 
ATOM   824  C CG    . GLU A 1 106 ? -17.125 12.865  -39.982 1.00 50.81  ? 106  GLU A CG    1 
ATOM   825  C CD    . GLU A 1 106 ? -17.743 11.759  -40.816 1.00 50.43  ? 106  GLU A CD    1 
ATOM   826  O OE1   . GLU A 1 106 ? -17.117 10.685  -40.941 1.00 48.00  ? 106  GLU A OE1   1 
ATOM   827  O OE2   . GLU A 1 106 ? -18.856 11.963  -41.345 1.00 53.80  ? 106  GLU A OE2   1 
ATOM   828  N N     . ILE A 1 107 ? -16.311 13.550  -36.044 1.00 42.60  ? 107  ILE A N     1 
ATOM   829  C CA    . ILE A 1 107 ? -17.104 14.125  -34.964 1.00 40.93  ? 107  ILE A CA    1 
ATOM   830  C C     . ILE A 1 107 ? -16.563 15.503  -34.607 1.00 38.40  ? 107  ILE A C     1 
ATOM   831  O O     . ILE A 1 107 ? -17.319 16.465  -34.481 1.00 35.43  ? 107  ILE A O     1 
ATOM   832  C CB    . ILE A 1 107 ? -17.084 13.238  -33.705 1.00 43.20  ? 107  ILE A CB    1 
ATOM   833  C CG1   . ILE A 1 107 ? -17.760 11.896  -33.984 1.00 41.47  ? 107  ILE A CG1   1 
ATOM   834  C CG2   . ILE A 1 107 ? -17.770 13.943  -32.544 1.00 40.62  ? 107  ILE A CG2   1 
ATOM   835  C CD1   . ILE A 1 107 ? -17.938 11.034  -32.752 1.00 38.00  ? 107  ILE A CD1   1 
ATOM   836  N N     . ARG A 1 108 ? -15.245 15.588  -34.451 1.00 39.47  ? 108  ARG A N     1 
ATOM   837  C CA    . ARG A 1 108 ? -14.581 16.849  -34.143 1.00 42.16  ? 108  ARG A CA    1 
ATOM   838  C C     . ARG A 1 108 ? -14.767 17.849  -35.277 1.00 42.30  ? 108  ARG A C     1 
ATOM   839  O O     . ARG A 1 108 ? -14.885 19.052  -35.046 1.00 42.23  ? 108  ARG A O     1 
ATOM   840  C CB    . ARG A 1 108 ? -13.088 16.619  -33.899 1.00 50.00  ? 108  ARG A CB    1 
ATOM   841  C CG    . ARG A 1 108 ? -12.327 17.861  -33.460 1.00 52.08  ? 108  ARG A CG    1 
ATOM   842  C CD    . ARG A 1 108 ? -10.826 17.609  -33.379 1.00 58.41  ? 108  ARG A CD    1 
ATOM   843  N NE    . ARG A 1 108 ? -10.504 16.422  -32.591 1.00 62.44  ? 108  ARG A NE    1 
ATOM   844  C CZ    . ARG A 1 108 ? -10.077 15.274  -33.109 1.00 64.24  ? 108  ARG A CZ    1 
ATOM   845  N NH1   . ARG A 1 108 ? -9.811  14.245  -32.316 1.00 61.82  ? 108  ARG A NH1   1 
ATOM   846  N NH2   . ARG A 1 108 ? -9.914  15.156  -34.420 1.00 64.68  ? 108  ARG A NH2   1 
ATOM   847  N N     . GLN A 1 109 ? -14.798 17.341  -36.504 1.00 45.70  ? 109  GLN A N     1 
ATOM   848  C CA    . GLN A 1 109 ? -14.939 18.188  -37.681 1.00 47.45  ? 109  GLN A CA    1 
ATOM   849  C C     . GLN A 1 109 ? -16.362 18.722  -37.826 1.00 45.42  ? 109  GLN A C     1 
ATOM   850  O O     . GLN A 1 109 ? -16.564 19.866  -38.231 1.00 45.78  ? 109  GLN A O     1 
ATOM   851  C CB    . GLN A 1 109 ? -14.519 17.427  -38.940 1.00 50.66  ? 109  GLN A CB    1 
ATOM   852  C CG    . GLN A 1 109 ? -14.493 18.271  -40.203 1.00 52.27  ? 109  GLN A CG    1 
ATOM   853  C CD    . GLN A 1 109 ? -13.558 17.708  -41.254 1.00 54.83  ? 109  GLN A CD    1 
ATOM   854  O OE1   . GLN A 1 109 ? -12.558 17.066  -40.930 1.00 53.67  ? 109  GLN A OE1   1 
ATOM   855  N NE2   . GLN A 1 109 ? -13.879 17.944  -42.521 1.00 58.77  ? 109  GLN A NE2   1 
ATOM   856  N N     . GLU A 1 110 ? -17.345 17.892  -37.489 1.00 43.68  ? 110  GLU A N     1 
ATOM   857  C CA    . GLU A 1 110 ? -18.742 18.306  -37.558 1.00 43.46  ? 110  GLU A CA    1 
ATOM   858  C C     . GLU A 1 110 ? -19.052 19.365  -36.503 1.00 43.01  ? 110  GLU A C     1 
ATOM   859  O O     . GLU A 1 110 ? -19.877 20.250  -36.727 1.00 45.96  ? 110  GLU A O     1 
ATOM   860  C CB    . GLU A 1 110 ? -19.678 17.103  -37.408 1.00 39.46  ? 110  GLU A CB    1 
ATOM   861  C CG    . GLU A 1 110 ? -21.160 17.446  -37.522 1.00 37.12  ? 110  GLU A CG    1 
ATOM   862  C CD    . GLU A 1 110 ? -21.526 18.050  -38.867 1.00 43.09  ? 110  GLU A CD    1 
ATOM   863  O OE1   . GLU A 1 110 ? -20.848 17.744  -39.871 1.00 46.97  ? 110  GLU A OE1   1 
ATOM   864  O OE2   . GLU A 1 110 ? -22.497 18.834  -38.922 1.00 45.81  ? 110  GLU A OE2   1 
ATOM   865  N N     . ILE A 1 111 ? -18.388 19.270  -35.355 1.00 37.42  ? 111  ILE A N     1 
ATOM   866  C CA    . ILE A 1 111 ? -18.517 20.287  -34.318 1.00 39.78  ? 111  ILE A CA    1 
ATOM   867  C C     . ILE A 1 111 ? -17.999 21.621  -34.842 1.00 47.74  ? 111  ILE A C     1 
ATOM   868  O O     . ILE A 1 111 ? -18.655 22.653  -34.700 1.00 45.41  ? 111  ILE A O     1 
ATOM   869  C CB    . ILE A 1 111 ? -17.746 19.907  -33.043 1.00 37.84  ? 111  ILE A CB    1 
ATOM   870  C CG1   . ILE A 1 111 ? -18.370 18.672  -32.392 1.00 41.84  ? 111  ILE A CG1   1 
ATOM   871  C CG2   . ILE A 1 111 ? -17.734 21.066  -32.060 1.00 38.02  ? 111  ILE A CG2   1 
ATOM   872  C CD1   . ILE A 1 111 ? -17.707 18.268  -31.098 1.00 36.50  ? 111  ILE A CD1   1 
ATOM   873  N N     . GLU A 1 112 ? -16.818 21.586  -35.454 1.00 47.30  ? 112  GLU A N     1 
ATOM   874  C CA    . GLU A 1 112 ? -16.256 22.759  -36.112 1.00 48.41  ? 112  GLU A CA    1 
ATOM   875  C C     . GLU A 1 112 ? -17.195 23.266  -37.204 1.00 50.29  ? 112  GLU A C     1 
ATOM   876  O O     . GLU A 1 112 ? -17.378 24.472  -37.367 1.00 51.27  ? 112  GLU A O     1 
ATOM   877  C CB    . GLU A 1 112 ? -14.889 22.431  -36.718 1.00 48.24  ? 112  GLU A CB    1 
ATOM   878  C CG    . GLU A 1 112 ? -13.765 22.273  -35.708 1.00 45.20  ? 112  GLU A CG    1 
ATOM   879  C CD    . GLU A 1 112 ? -12.773 23.419  -35.760 1.00 54.08  ? 112  GLU A CD    1 
ATOM   880  O OE1   . GLU A 1 112 ? -13.212 24.579  -35.902 1.00 47.40  ? 112  GLU A OE1   1 
ATOM   881  O OE2   . GLU A 1 112 ? -11.554 23.160  -35.670 1.00 67.07  ? 112  GLU A OE2   1 
ATOM   882  N N     . ASN A 1 113 ? -17.788 22.334  -37.945 1.00 47.71  ? 113  ASN A N     1 
ATOM   883  C CA    . ASN A 1 113 ? -18.706 22.669  -39.032 1.00 51.88  ? 113  ASN A CA    1 
ATOM   884  C C     . ASN A 1 113 ? -19.999 23.305  -38.532 1.00 54.67  ? 113  ASN A C     1 
ATOM   885  O O     . ASN A 1 113 ? -20.611 24.121  -39.224 1.00 53.28  ? 113  ASN A O     1 
ATOM   886  C CB    . ASN A 1 113 ? -19.028 21.422  -39.860 1.00 51.50  ? 113  ASN A CB    1 
ATOM   887  C CG    . ASN A 1 113 ? -19.906 21.728  -41.062 1.00 55.17  ? 113  ASN A CG    1 
ATOM   888  O OD1   . ASN A 1 113 ? -19.778 22.782  -41.686 1.00 55.30  ? 113  ASN A OD1   1 
ATOM   889  N ND2   . ASN A 1 113 ? -20.804 20.808  -41.389 1.00 54.41  ? 113  ASN A ND2   1 
ATOM   890  N N     . GLU A 1 114 ? -20.416 22.921  -37.330 1.00 53.07  ? 114  GLU A N     1 
ATOM   891  C CA    . GLU A 1 114 ? -21.640 23.455  -36.743 1.00 49.40  ? 114  GLU A CA    1 
ATOM   892  C C     . GLU A 1 114 ? -21.367 24.682  -35.875 1.00 55.22  ? 114  GLU A C     1 
ATOM   893  O O     . GLU A 1 114 ? -22.286 25.424  -35.530 1.00 54.61  ? 114  GLU A O     1 
ATOM   894  C CB    . GLU A 1 114 ? -22.387 22.376  -35.956 1.00 44.36  ? 114  GLU A CB    1 
ATOM   895  C CG    . GLU A 1 114 ? -22.934 21.257  -36.832 1.00 45.40  ? 114  GLU A CG    1 
ATOM   896  C CD    . GLU A 1 114 ? -23.887 20.340  -36.091 1.00 41.74  ? 114  GLU A CD    1 
ATOM   897  O OE1   . GLU A 1 114 ? -24.342 20.715  -34.991 1.00 44.70  ? 114  GLU A OE1   1 
ATOM   898  O OE2   . GLU A 1 114 ? -24.184 19.244  -36.611 1.00 40.71  ? 114  GLU A OE2   1 
ATOM   899  N N     . THR A 1 115 ? -20.101 24.893  -35.528 1.00 57.65  ? 115  THR A N     1 
ATOM   900  C CA    . THR A 1 115 ? -19.693 26.113  -34.839 1.00 58.33  ? 115  THR A CA    1 
ATOM   901  C C     . THR A 1 115 ? -19.085 27.099  -35.826 1.00 68.23  ? 115  THR A C     1 
ATOM   902  O O     . THR A 1 115 ? -18.981 26.816  -37.020 1.00 72.91  ? 115  THR A O     1 
ATOM   903  C CB    . THR A 1 115 ? -18.639 25.845  -33.741 1.00 60.74  ? 115  THR A CB    1 
ATOM   904  O OG1   . THR A 1 115 ? -17.549 25.094  -34.291 1.00 62.49  ? 115  THR A OG1   1 
ATOM   905  C CG2   . THR A 1 115 ? -19.242 25.080  -32.578 1.00 52.99  ? 115  THR A CG2   1 
ATOM   906  N N     . GLU A 1 116 ? -18.699 28.264  -35.315 1.00 73.22  ? 116  GLU A N     1 
ATOM   907  C CA    . GLU A 1 116 ? -17.902 29.242  -36.062 1.00 79.35  ? 116  GLU A CA    1 
ATOM   908  C C     . GLU A 1 116 ? -18.553 29.865  -37.294 1.00 86.14  ? 116  GLU A C     1 
ATOM   909  O O     . GLU A 1 116 ? -17.983 30.766  -37.913 1.00 89.84  ? 116  GLU A O     1 
ATOM   910  C CB    . GLU A 1 116 ? -16.531 28.664  -36.427 1.00 83.11  ? 116  GLU A CB    1 
ATOM   911  C CG    . GLU A 1 116 ? -15.492 28.790  -35.324 1.00 84.75  ? 116  GLU A CG    1 
ATOM   912  C CD    . GLU A 1 116 ? -15.098 30.232  -35.041 1.00 88.88  ? 116  GLU A CD    1 
ATOM   913  O OE1   . GLU A 1 116 ? -14.348 30.461  -34.070 1.00 92.86  ? 116  GLU A OE1   1 
ATOM   914  O OE2   . GLU A 1 116 ? -15.531 31.142  -35.783 1.00 84.65  ? 116  GLU A OE2   1 
ATOM   915  N N     . ARG A 1 117 ? -19.733 29.379  -37.657 1.00 84.72  ? 117  ARG A N     1 
ATOM   916  C CA    . ARG A 1 117 ? -20.539 30.041  -38.666 1.00 89.66  ? 117  ARG A CA    1 
ATOM   917  C C     . ARG A 1 117 ? -20.970 31.367  -38.066 1.00 90.81  ? 117  ARG A C     1 
ATOM   918  O O     . ARG A 1 117 ? -21.026 31.508  -36.844 1.00 89.97  ? 117  ARG A O     1 
ATOM   919  C CB    . ARG A 1 117 ? -21.779 29.204  -38.981 1.00 89.59  ? 117  ARG A CB    1 
ATOM   920  C CG    . ARG A 1 117 ? -22.625 28.942  -37.750 1.00 83.84  ? 117  ARG A CG    1 
ATOM   921  C CD    . ARG A 1 117 ? -23.978 28.308  -38.055 1.00 82.93  ? 117  ARG A CD    1 
ATOM   922  N NE    . ARG A 1 117 ? -24.776 28.238  -36.832 1.00 76.84  ? 117  ARG A NE    1 
ATOM   923  C CZ    . ARG A 1 117 ? -25.995 27.712  -36.736 1.00 75.36  ? 117  ARG A CZ    1 
ATOM   924  N NH1   . ARG A 1 117 ? -26.600 27.191  -37.797 1.00 73.21  ? 117  ARG A NH1   1 
ATOM   925  N NH2   . ARG A 1 117 ? -26.620 27.709  -35.564 1.00 72.30  ? 117  ARG A NH2   1 
ATOM   926  N N     . ILE A 1 118 ? -21.260 32.340  -38.924 1.00 92.33  ? 118  ILE A N     1 
ATOM   927  C CA    . ILE A 1 118 ? -22.046 33.505  -38.529 1.00 91.20  ? 118  ILE A CA    1 
ATOM   928  C C     . ILE A 1 118 ? -23.462 33.118  -38.114 1.00 93.14  ? 118  ILE A C     1 
ATOM   929  O O     . ILE A 1 118 ? -24.000 33.647  -37.141 1.00 92.67  ? 118  ILE A O     1 
ATOM   930  C CB    . ILE A 1 118 ? -22.121 34.544  -39.663 1.00 89.55  ? 118  ILE A CB    1 
ATOM   931  C CG1   . ILE A 1 118 ? -23.215 35.574  -39.371 1.00 90.60  ? 118  ILE A CG1   1 
ATOM   932  C CG2   . ILE A 1 118 ? -22.371 33.859  -40.998 1.00 80.94  ? 118  ILE A CG2   1 
ATOM   933  C CD1   . ILE A 1 118 ? -22.733 36.767  -38.576 1.00 85.82  ? 118  ILE A CD1   1 
ATOM   934  N N     . SER A 1 119 ? -24.060 32.192  -38.856 0.66 90.54  ? 119  SER A N     1 
ATOM   935  C CA    . SER A 1 119 ? -25.352 31.625  -38.484 0.66 89.10  ? 119  SER A CA    1 
ATOM   936  C C     . SER A 1 119 ? -26.506 32.536  -38.896 0.66 88.90  ? 119  SER A C     1 
ATOM   937  O O     . SER A 1 119 ? -27.661 32.277  -38.561 0.66 91.28  ? 119  SER A O     1 
ATOM   938  C CB    . SER A 1 119 ? -25.405 31.358  -36.978 0.66 88.25  ? 119  SER A CB    1 
ATOM   939  O OG    . SER A 1 119 ? -26.230 32.304  -36.321 0.66 86.07  ? 119  SER A OG    1 
ATOM   940  N N     . GLY A 1 120 ? -26.186 33.602  -39.622 0.48 89.42  ? 120  GLY A N     1 
ATOM   941  C CA    . GLY A 1 120 ? -27.187 34.354  -40.357 0.48 89.88  ? 120  GLY A CA    1 
ATOM   942  C C     . GLY A 1 120 ? -27.937 35.335  -39.477 0.48 91.71  ? 120  GLY A C     1 
ATOM   943  O O     . GLY A 1 120 ? -28.896 35.971  -39.914 0.48 91.38  ? 120  GLY A O     1 
ATOM   944  N N     . ASN A 1 121 ? -27.494 35.456  -38.230 0.87 93.47  ? 121  ASN A N     1 
ATOM   945  C CA    . ASN A 1 121 ? -27.898 36.552  -37.370 0.87 90.74  ? 121  ASN A CA    1 
ATOM   946  C C     . ASN A 1 121 ? -26.663 37.380  -37.082 0.87 91.87  ? 121  ASN A C     1 
ATOM   947  O O     . ASN A 1 121 ? -25.543 36.911  -37.279 0.87 91.40  ? 121  ASN A O     1 
ATOM   948  C CB    . ASN A 1 121 ? -28.463 36.023  -36.051 0.87 88.34  ? 121  ASN A CB    1 
ATOM   949  C CG    . ASN A 1 121 ? -29.172 34.693  -36.205 0.87 89.08  ? 121  ASN A CG    1 
ATOM   950  O OD1   . ASN A 1 121 ? -29.551 34.299  -37.305 0.87 88.09  ? 121  ASN A OD1   1 
ATOM   951  N ND2   . ASN A 1 121 ? -29.362 33.994  -35.092 0.87 88.17  ? 121  ASN A ND2   1 
ATOM   952  N N     . ASN A 1 122 ? -26.852 38.602  -36.605 1.00 88.35  ? 122  ASN A N     1 
ATOM   953  C CA    . ASN A 1 122 ? -25.722 39.465  -36.322 1.00 91.80  ? 122  ASN A CA    1 
ATOM   954  C C     . ASN A 1 122 ? -25.242 39.360  -34.892 1.00 94.03  ? 122  ASN A C     1 
ATOM   955  O O     . ASN A 1 122 ? -25.571 40.179  -34.046 1.00 94.00  ? 122  ASN A O     1 
ATOM   956  C CB    . ASN A 1 122 ? -26.038 40.911  -36.650 1.00 94.44  ? 122  ASN A CB    1 
ATOM   957  C CG    . ASN A 1 122 ? -24.888 41.618  -37.295 1.00 93.89  ? 122  ASN A CG    1 
ATOM   958  O OD1   . ASN A 1 122 ? -23.751 41.501  -36.862 1.00 88.98  ? 122  ASN A OD1   1 
ATOM   959  N ND2   . ASN A 1 122 ? -25.177 42.342  -38.364 1.00 95.06  ? 122  ASN A ND2   1 
ATOM   960  N N     . LYS A 1 123 ? -24.405 38.361  -34.643 1.00 91.92  ? 123  LYS A N     1 
ATOM   961  C CA    . LYS A 1 123 ? -23.724 38.236  -33.374 1.00 87.67  ? 123  LYS A CA    1 
ATOM   962  C C     . LYS A 1 123 ? -22.380 37.553  -33.553 1.00 84.46  ? 123  LYS A C     1 
ATOM   963  O O     . LYS A 1 123 ? -21.994 37.183  -34.661 1.00 80.68  ? 123  LYS A O     1 
ATOM   964  C CB    . LYS A 1 123 ? -24.583 37.473  -32.366 1.00 83.10  ? 123  LYS A CB    1 
ATOM   965  C CG    . LYS A 1 123 ? -25.720 38.280  -31.787 1.00 86.96  ? 123  LYS A CG    1 
ATOM   966  C CD    . LYS A 1 123 ? -26.698 37.435  -31.010 1.00 90.31  ? 123  LYS A CD    1 
ATOM   967  C CE    . LYS A 1 123 ? -27.975 38.228  -30.690 1.00 89.18  ? 123  LYS A CE    1 
ATOM   968  N NZ    . LYS A 1 123 ? -28.834 38.520  -31.889 1.00 88.95  ? 123  LYS A NZ    1 
ATOM   969  N N     . GLY A 1 124 ? -21.660 37.424  -32.446 1.00 81.70  ? 124  GLY A N     1 
ATOM   970  C CA    . GLY A 1 124 ? -20.444 36.632  -32.408 1.00 75.80  ? 124  GLY A CA    1 
ATOM   971  C C     . GLY A 1 124 ? -20.680 35.395  -31.566 1.00 70.98  ? 124  GLY A C     1 
ATOM   972  O O     . GLY A 1 124 ? -19.885 34.453  -31.567 1.00 68.44  ? 124  GLY A O     1 
ATOM   973  N N     . VAL A 1 125 ? -21.792 35.410  -30.838 1.00 67.89  ? 125  VAL A N     1 
ATOM   974  C CA    . VAL A 1 125 ? -22.172 34.309  -29.964 1.00 59.51  ? 125  VAL A CA    1 
ATOM   975  C C     . VAL A 1 125 ? -23.609 33.868  -30.238 1.00 59.68  ? 125  VAL A C     1 
ATOM   976  O O     . VAL A 1 125 ? -24.521 34.692  -30.278 1.00 60.29  ? 125  VAL A O     1 
ATOM   977  C CB    . VAL A 1 125 ? -22.064 34.709  -28.479 1.00 58.50  ? 125  VAL A CB    1 
ATOM   978  C CG1   . VAL A 1 125 ? -22.198 33.485  -27.597 1.00 56.32  ? 125  VAL A CG1   1 
ATOM   979  C CG2   . VAL A 1 125 ? -20.745 35.417  -28.204 1.00 61.07  ? 125  VAL A CG2   1 
ATOM   980  N N     . SER A 1 126 ? -23.807 32.568  -30.427 1.00 56.35  ? 126  SER A N     1 
ATOM   981  C CA    . SER A 1 126 ? -25.144 32.014  -30.617 1.00 47.59  ? 126  SER A CA    1 
ATOM   982  C C     . SER A 1 126 ? -25.573 31.211  -29.396 1.00 41.51  ? 126  SER A C     1 
ATOM   983  O O     . SER A 1 126 ? -24.791 30.427  -28.864 1.00 40.97  ? 126  SER A O     1 
ATOM   984  C CB    . SER A 1 126 ? -25.190 31.126  -31.861 1.00 46.81  ? 126  SER A CB    1 
ATOM   985  O OG    . SER A 1 126 ? -26.387 30.365  -31.895 1.00 54.26  ? 126  SER A OG    1 
ATOM   986  N N     . PRO A 1 127 ? -26.820 31.409  -28.945 1.00 44.58  ? 127  PRO A N     1 
ATOM   987  C CA    . PRO A 1 127 ? -27.344 30.695  -27.776 1.00 44.05  ? 127  PRO A CA    1 
ATOM   988  C C     . PRO A 1 127 ? -27.778 29.270  -28.108 1.00 39.52  ? 127  PRO A C     1 
ATOM   989  O O     . PRO A 1 127 ? -27.938 28.456  -27.201 1.00 40.69  ? 127  PRO A O     1 
ATOM   990  C CB    . PRO A 1 127 ? -28.572 31.527  -27.374 1.00 42.62  ? 127  PRO A CB    1 
ATOM   991  C CG    . PRO A 1 127 ? -28.484 32.803  -28.171 1.00 46.59  ? 127  PRO A CG    1 
ATOM   992  C CD    . PRO A 1 127 ? -27.757 32.438  -29.419 1.00 48.46  ? 127  PRO A CD    1 
ATOM   993  N N     . GLU A 1 128 ? -27.874 28.962  -29.382 1.00 39.50  ? 128  GLU A N     1 
ATOM   994  C CA    . GLU A 1 128 ? -28.366 27.685  -29.825 1.00 39.90  ? 128  GLU A CA    1 
ATOM   995  C C     . GLU A 1 128 ? -27.366 26.553  -29.678 1.00 39.46  ? 128  GLU A C     1 
ATOM   996  O O     . GLU A 1 128 ? -26.361 26.523  -30.346 1.00 39.94  ? 128  GLU A O     1 
ATOM   997  C CB    . GLU A 1 128 ? -28.840 27.788  -31.256 1.00 48.25  ? 128  GLU A CB    1 
ATOM   998  C CG    . GLU A 1 128 ? -29.999 28.738  -31.471 1.00 51.70  ? 128  GLU A CG    1 
ATOM   999  C CD    . GLU A 1 128 ? -29.860 29.567  -32.728 1.00 59.05  ? 128  GLU A CD    1 
ATOM   1000 O OE1   . GLU A 1 128 ? -30.283 29.114  -33.791 1.00 59.99  ? 128  GLU A OE1   1 
ATOM   1001 O OE2   . GLU A 1 128 ? -29.318 30.672  -32.654 1.00 61.05  ? 128  GLU A OE2   1 
ATOM   1002 N N     . PRO A 1 129 ? -27.665 25.612  -28.796 1.00 33.74  ? 129  PRO A N     1 
ATOM   1003 C CA    . PRO A 1 129 ? -26.704 24.549  -28.485 1.00 37.66  ? 129  PRO A CA    1 
ATOM   1004 C C     . PRO A 1 129 ? -26.560 23.523  -29.604 1.00 35.68  ? 129  PRO A C     1 
ATOM   1005 O O     . PRO A 1 129 ? -27.480 23.334  -30.400 1.00 35.66  ? 129  PRO A O     1 
ATOM   1006 C CB    . PRO A 1 129 ? -27.314 23.872  -27.247 1.00 33.34  ? 129  PRO A CB    1 
ATOM   1007 C CG    . PRO A 1 129 ? -28.366 24.819  -26.744 1.00 39.70  ? 129  PRO A CG    1 
ATOM   1008 C CD    . PRO A 1 129 ? -28.873 25.517  -27.961 1.00 35.13  ? 129  PRO A CD    1 
ATOM   1009 N N     . ILE A 1 130 ? -25.400 22.876  -29.658 1.00 29.95  ? 130  ILE A N     1 
ATOM   1010 C CA    . ILE A 1 130 ? -25.203 21.715  -30.512 1.00 31.17  ? 130  ILE A CA    1 
ATOM   1011 C C     . ILE A 1 130 ? -25.525 20.480  -29.685 1.00 29.50  ? 130  ILE A C     1 
ATOM   1012 O O     . ILE A 1 130 ? -25.081 20.364  -28.543 1.00 33.24  ? 130  ILE A O     1 
ATOM   1013 C CB    . ILE A 1 130 ? -23.745 21.610  -30.994 1.00 33.11  ? 130  ILE A CB    1 
ATOM   1014 C CG1   . ILE A 1 130 ? -23.339 22.862  -31.768 1.00 38.87  ? 130  ILE A CG1   1 
ATOM   1015 C CG2   . ILE A 1 130 ? -23.545 20.369  -31.852 1.00 32.98  ? 130  ILE A CG2   1 
ATOM   1016 C CD1   . ILE A 1 130 ? -21.902 22.836  -32.221 1.00 44.10  ? 130  ILE A CD1   1 
ATOM   1017 N N     . HIS A 1 131 ? -26.302 19.564  -30.251 1.00 29.80  ? 131  HIS A N     1 
ATOM   1018 C CA    . HIS A 1 131 ? -26.663 18.339  -29.546 1.00 26.88  ? 131  HIS A CA    1 
ATOM   1019 C C     . HIS A 1 131 ? -25.883 17.145  -30.081 1.00 28.11  ? 131  HIS A C     1 
ATOM   1020 O O     . HIS A 1 131 ? -26.053 16.743  -31.232 1.00 28.39  ? 131  HIS A O     1 
ATOM   1021 C CB    . HIS A 1 131 ? -28.167 18.084  -29.645 1.00 27.95  ? 131  HIS A CB    1 
ATOM   1022 C CG    . HIS A 1 131 ? -29.001 19.138  -28.984 1.00 32.75  ? 131  HIS A CG    1 
ATOM   1023 N ND1   . HIS A 1 131 ? -29.041 20.441  -29.430 1.00 32.58  ? 131  HIS A ND1   1 
ATOM   1024 C CD2   . HIS A 1 131 ? -29.822 19.081  -27.909 1.00 30.37  ? 131  HIS A CD2   1 
ATOM   1025 C CE1   . HIS A 1 131 ? -29.852 21.143  -28.657 1.00 36.78  ? 131  HIS A CE1   1 
ATOM   1026 N NE2   . HIS A 1 131 ? -30.340 20.340  -27.728 1.00 35.84  ? 131  HIS A NE2   1 
ATOM   1027 N N     . LEU A 1 132 ? -25.025 16.582  -29.237 1.00 26.61  ? 132  LEU A N     1 
ATOM   1028 C CA    . LEU A 1 132 ? -24.188 15.457  -29.632 1.00 26.43  ? 132  LEU A CA    1 
ATOM   1029 C C     . LEU A 1 132 ? -24.314 14.300  -28.649 1.00 25.38  ? 132  LEU A C     1 
ATOM   1030 O O     . LEU A 1 132 ? -24.045 14.455  -27.458 1.00 23.34  ? 132  LEU A O     1 
ATOM   1031 C CB    . LEU A 1 132 ? -22.723 15.893  -29.739 1.00 21.88  ? 132  LEU A CB    1 
ATOM   1032 C CG    . LEU A 1 132 ? -21.698 14.792  -30.029 1.00 26.51  ? 132  LEU A CG    1 
ATOM   1033 C CD1   . LEU A 1 132 ? -21.987 14.115  -31.360 1.00 27.33  ? 132  LEU A CD1   1 
ATOM   1034 C CD2   . LEU A 1 132 ? -20.283 15.349  -30.008 1.00 28.68  ? 132  LEU A CD2   1 
ATOM   1035 N N     . LYS A 1 133 ? -24.731 13.142  -29.154 1.00 22.21  ? 133  LYS A N     1 
ATOM   1036 C CA    . LYS A 1 133 ? -24.772 11.928  -28.350 1.00 23.29  ? 133  LYS A CA    1 
ATOM   1037 C C     . LYS A 1 133 ? -23.525 11.097  -28.609 1.00 26.44  ? 133  LYS A C     1 
ATOM   1038 O O     . LYS A 1 133 ? -23.142 10.887  -29.758 1.00 26.71  ? 133  LYS A O     1 
ATOM   1039 C CB    . LYS A 1 133 ? -26.006 11.089  -28.686 1.00 26.45  ? 133  LYS A CB    1 
ATOM   1040 C CG    . LYS A 1 133 ? -27.333 11.794  -28.491 1.00 23.77  ? 133  LYS A CG    1 
ATOM   1041 C CD    . LYS A 1 133 ? -28.487 10.836  -28.742 1.00 21.71  ? 133  LYS A CD    1 
ATOM   1042 C CE    . LYS A 1 133 ? -29.813 11.571  -28.826 1.00 26.78  ? 133  LYS A CE    1 
ATOM   1043 N NZ    . LYS A 1 133 ? -30.090 12.355  -27.594 1.00 27.16  ? 133  LYS A NZ    1 
ATOM   1044 N N     . ILE A 1 134 ? -22.892 10.628  -27.541 1.00 25.39  ? 134  ILE A N     1 
ATOM   1045 C CA    . ILE A 1 134 ? -21.753 9.730   -27.671 1.00 25.66  ? 134  ILE A CA    1 
ATOM   1046 C C     . ILE A 1 134 ? -22.094 8.375   -27.068 1.00 27.47  ? 134  ILE A C     1 
ATOM   1047 O O     . ILE A 1 134 ? -22.321 8.264   -25.864 1.00 22.41  ? 134  ILE A O     1 
ATOM   1048 C CB    . ILE A 1 134 ? -20.495 10.291  -26.981 1.00 28.88  ? 134  ILE A CB    1 
ATOM   1049 C CG1   . ILE A 1 134 ? -20.083 11.622  -27.613 1.00 29.24  ? 134  ILE A CG1   1 
ATOM   1050 C CG2   . ILE A 1 134 ? -19.355 9.291   -27.064 1.00 24.83  ? 134  ILE A CG2   1 
ATOM   1051 C CD1   . ILE A 1 134 ? -19.667 11.507  -29.062 1.00 26.99  ? 134  ILE A CD1   1 
ATOM   1052 N N     . PHE A 1 135 ? -22.142 7.351   -27.914 1.00 31.13  ? 135  PHE A N     1 
ATOM   1053 C CA    . PHE A 1 135 ? -22.416 5.991   -27.465 1.00 23.16  ? 135  PHE A CA    1 
ATOM   1054 C C     . PHE A 1 135 ? -21.103 5.241   -27.283 1.00 26.86  ? 135  PHE A C     1 
ATOM   1055 O O     . PHE A 1 135 ? -20.327 5.098   -28.230 1.00 26.47  ? 135  PHE A O     1 
ATOM   1056 C CB    . PHE A 1 135 ? -23.300 5.258   -28.476 1.00 27.62  ? 135  PHE A CB    1 
ATOM   1057 C CG    . PHE A 1 135 ? -24.651 5.888   -28.682 1.00 27.87  ? 135  PHE A CG    1 
ATOM   1058 C CD1   . PHE A 1 135 ? -25.770 5.382   -28.041 1.00 24.91  ? 135  PHE A CD1   1 
ATOM   1059 C CD2   . PHE A 1 135 ? -24.803 6.980   -29.522 1.00 26.94  ? 135  PHE A CD2   1 
ATOM   1060 C CE1   . PHE A 1 135 ? -27.015 5.957   -28.229 1.00 25.47  ? 135  PHE A CE1   1 
ATOM   1061 C CE2   . PHE A 1 135 ? -26.045 7.560   -29.712 1.00 26.84  ? 135  PHE A CE2   1 
ATOM   1062 C CZ    . PHE A 1 135 ? -27.152 7.047   -29.065 1.00 26.02  ? 135  PHE A CZ    1 
ATOM   1063 N N     . SER A 1 136 ? -20.856 4.760   -26.068 1.00 26.62  ? 136  SER A N     1 
ATOM   1064 C CA    . SER A 1 136 ? -19.587 4.112   -25.751 1.00 25.40  ? 136  SER A CA    1 
ATOM   1065 C C     . SER A 1 136 ? -19.677 3.241   -24.500 1.00 29.34  ? 136  SER A C     1 
ATOM   1066 O O     . SER A 1 136 ? -20.383 3.581   -23.551 1.00 29.22  ? 136  SER A O     1 
ATOM   1067 C CB    . SER A 1 136 ? -18.491 5.166   -25.569 1.00 27.26  ? 136  SER A CB    1 
ATOM   1068 O OG    . SER A 1 136 ? -17.305 4.589   -25.053 1.00 29.40  ? 136  SER A OG    1 
ATOM   1069 N N     . PRO A 1 137 ? -18.956 2.108   -24.498 1.00 31.44  ? 137  PRO A N     1 
ATOM   1070 C CA    . PRO A 1 137 ? -18.885 1.242   -23.319 1.00 28.73  ? 137  PRO A CA    1 
ATOM   1071 C C     . PRO A 1 137 ? -17.895 1.782   -22.296 1.00 28.71  ? 137  PRO A C     1 
ATOM   1072 O O     . PRO A 1 137 ? -17.759 1.222   -21.208 1.00 30.95  ? 137  PRO A O     1 
ATOM   1073 C CB    . PRO A 1 137 ? -18.372 -0.078  -23.895 1.00 28.98  ? 137  PRO A CB    1 
ATOM   1074 C CG    . PRO A 1 137 ? -17.543 0.333   -25.060 1.00 30.07  ? 137  PRO A CG    1 
ATOM   1075 C CD    . PRO A 1 137 ? -18.237 1.532   -25.650 1.00 30.35  ? 137  PRO A CD    1 
ATOM   1076 N N     . ASN A 1 138 ? -17.214 2.867   -22.648 1.00 27.76  ? 138  ASN A N     1 
ATOM   1077 C CA    . ASN A 1 138 ? -16.187 3.443   -21.790 1.00 31.76  ? 138  ASN A CA    1 
ATOM   1078 C C     . ASN A 1 138 ? -16.674 4.661   -21.011 1.00 29.99  ? 138  ASN A C     1 
ATOM   1079 O O     . ASN A 1 138 ? -15.959 5.186   -20.157 1.00 35.83  ? 138  ASN A O     1 
ATOM   1080 C CB    . ASN A 1 138 ? -14.956 3.809   -22.620 1.00 35.23  ? 138  ASN A CB    1 
ATOM   1081 C CG    . ASN A 1 138 ? -14.394 2.622   -23.377 1.00 34.18  ? 138  ASN A CG    1 
ATOM   1082 O OD1   . ASN A 1 138 ? -14.156 1.560   -22.800 1.00 35.51  ? 138  ASN A OD1   1 
ATOM   1083 N ND2   . ASN A 1 138 ? -14.194 2.790   -24.679 1.00 31.10  ? 138  ASN A ND2   1 
ATOM   1084 N N     . VAL A 1 139 ? -17.891 5.106   -21.305 1.00 29.94  ? 139  VAL A N     1 
ATOM   1085 C CA    . VAL A 1 139 ? -18.456 6.270   -20.634 1.00 29.53  ? 139  VAL A CA    1 
ATOM   1086 C C     . VAL A 1 139 ? -19.556 5.882   -19.657 1.00 32.02  ? 139  VAL A C     1 
ATOM   1087 O O     . VAL A 1 139 ? -20.172 4.823   -19.781 1.00 32.82  ? 139  VAL A O     1 
ATOM   1088 C CB    . VAL A 1 139 ? -19.035 7.288   -21.640 1.00 27.48  ? 139  VAL A CB    1 
ATOM   1089 C CG1   . VAL A 1 139 ? -17.957 7.768   -22.595 1.00 24.98  ? 139  VAL A CG1   1 
ATOM   1090 C CG2   . VAL A 1 139 ? -20.201 6.681   -22.407 1.00 25.45  ? 139  VAL A CG2   1 
ATOM   1091 N N     . VAL A 1 140 ? -19.790 6.745   -18.676 1.00 27.74  ? 140  VAL A N     1 
ATOM   1092 C CA    . VAL A 1 140 ? -20.931 6.598   -17.789 1.00 29.06  ? 140  VAL A CA    1 
ATOM   1093 C C     . VAL A 1 140 ? -22.094 7.375   -18.390 1.00 25.51  ? 140  VAL A C     1 
ATOM   1094 O O     . VAL A 1 140 ? -21.894 8.244   -19.239 1.00 29.69  ? 140  VAL A O     1 
ATOM   1095 C CB    . VAL A 1 140 ? -20.632 7.145   -16.380 1.00 29.43  ? 140  VAL A CB    1 
ATOM   1096 C CG1   . VAL A 1 140 ? -19.457 6.404   -15.757 1.00 26.41  ? 140  VAL A CG1   1 
ATOM   1097 C CG2   . VAL A 1 140 ? -20.352 8.641   -16.438 1.00 22.91  ? 140  VAL A CG2   1 
ATOM   1098 N N     . ASN A 1 141 ? -23.311 7.056   -17.968 1.00 24.58  ? 141  ASN A N     1 
ATOM   1099 C CA    . ASN A 1 141 ? -24.467 7.833   -18.386 1.00 29.08  ? 141  ASN A CA    1 
ATOM   1100 C C     . ASN A 1 141 ? -24.400 9.222   -17.767 1.00 24.56  ? 141  ASN A C     1 
ATOM   1101 O O     . ASN A 1 141 ? -24.498 9.373   -16.551 1.00 28.59  ? 141  ASN A O     1 
ATOM   1102 C CB    . ASN A 1 141 ? -25.762 7.124   -17.997 1.00 28.65  ? 141  ASN A CB    1 
ATOM   1103 C CG    . ASN A 1 141 ? -25.999 5.870   -18.808 1.00 29.13  ? 141  ASN A CG    1 
ATOM   1104 O OD1   . ASN A 1 141 ? -25.994 5.904   -20.039 1.00 26.58  ? 141  ASN A OD1   1 
ATOM   1105 N ND2   . ASN A 1 141 ? -26.194 4.748   -18.122 1.00 29.46  ? 141  ASN A ND2   1 
ATOM   1106 N N     . LEU A 1 142 ? -24.217 10.231  -18.612 1.00 25.88  ? 142  LEU A N     1 
ATOM   1107 C CA    . LEU A 1 142 ? -23.996 11.594  -18.144 1.00 22.49  ? 142  LEU A CA    1 
ATOM   1108 C C     . LEU A 1 142 ? -24.199 12.600  -19.271 1.00 22.37  ? 142  LEU A C     1 
ATOM   1109 O O     . LEU A 1 142 ? -23.726 12.398  -20.388 1.00 22.36  ? 142  LEU A O     1 
ATOM   1110 C CB    . LEU A 1 142 ? -22.579 11.730  -17.582 1.00 24.39  ? 142  LEU A CB    1 
ATOM   1111 C CG    . LEU A 1 142 ? -22.134 13.115  -17.107 1.00 27.77  ? 142  LEU A CG    1 
ATOM   1112 C CD1   . LEU A 1 142 ? -22.948 13.560  -15.899 1.00 22.59  ? 142  LEU A CD1   1 
ATOM   1113 C CD2   . LEU A 1 142 ? -20.644 13.117  -16.790 1.00 24.71  ? 142  LEU A CD2   1 
ATOM   1114 N N     . THR A 1 143 ? -24.904 13.684  -18.968 1.00 26.68  ? 143  THR A N     1 
ATOM   1115 C CA    . THR A 1 143 ? -25.116 14.757  -19.930 1.00 24.68  ? 143  THR A CA    1 
ATOM   1116 C C     . THR A 1 143 ? -24.587 16.072  -19.370 1.00 24.32  ? 143  THR A C     1 
ATOM   1117 O O     . THR A 1 143 ? -24.819 16.396  -18.206 1.00 26.08  ? 143  THR A O     1 
ATOM   1118 C CB    . THR A 1 143 ? -26.607 14.901  -20.295 1.00 22.92  ? 143  THR A CB    1 
ATOM   1119 O OG1   . THR A 1 143 ? -27.025 13.756  -21.048 1.00 21.75  ? 143  THR A OG1   1 
ATOM   1120 C CG2   . THR A 1 143 ? -26.841 16.152  -21.127 1.00 22.76  ? 143  THR A CG2   1 
ATOM   1121 N N     . LEU A 1 144 ? -23.866 16.821  -20.199 1.00 23.62  ? 144  LEU A N     1 
ATOM   1122 C CA    . LEU A 1 144 ? -23.298 18.096  -19.781 1.00 22.57  ? 144  LEU A CA    1 
ATOM   1123 C C     . LEU A 1 144 ? -23.561 19.187  -20.813 1.00 22.08  ? 144  LEU A C     1 
ATOM   1124 O O     . LEU A 1 144 ? -23.397 18.973  -22.015 1.00 23.18  ? 144  LEU A O     1 
ATOM   1125 C CB    . LEU A 1 144 ? -21.792 17.955  -19.552 1.00 25.11  ? 144  LEU A CB    1 
ATOM   1126 C CG    . LEU A 1 144 ? -21.353 16.908  -18.528 1.00 24.56  ? 144  LEU A CG    1 
ATOM   1127 C CD1   . LEU A 1 144 ? -19.853 16.744  -18.561 1.00 23.33  ? 144  LEU A CD1   1 
ATOM   1128 C CD2   . LEU A 1 144 ? -21.816 17.291  -17.134 1.00 23.99  ? 144  LEU A CD2   1 
ATOM   1129 N N     . VAL A 1 145 ? -23.973 20.357  -20.338 1.00 23.40  ? 145  VAL A N     1 
ATOM   1130 C CA    . VAL A 1 145 ? -24.166 21.506  -21.212 1.00 21.10  ? 145  VAL A CA    1 
ATOM   1131 C C     . VAL A 1 145 ? -22.922 22.389  -21.194 1.00 24.32  ? 145  VAL A C     1 
ATOM   1132 O O     . VAL A 1 145 ? -22.784 23.275  -20.351 1.00 25.56  ? 145  VAL A O     1 
ATOM   1133 C CB    . VAL A 1 145 ? -25.400 22.330  -20.806 1.00 25.13  ? 145  VAL A CB    1 
ATOM   1134 C CG1   . VAL A 1 145 ? -25.651 23.442  -21.816 1.00 26.20  ? 145  VAL A CG1   1 
ATOM   1135 C CG2   . VAL A 1 145 ? -26.622 21.430  -20.690 1.00 22.41  ? 145  VAL A CG2   1 
ATOM   1136 N N     . ASP A 1 146 ? -22.012 22.129  -22.126 1.00 29.43  ? 146  ASP A N     1 
ATOM   1137 C CA    . ASP A 1 146 ? -20.760 22.870  -22.211 1.00 24.77  ? 146  ASP A CA    1 
ATOM   1138 C C     . ASP A 1 146 ? -20.979 24.258  -22.804 1.00 27.52  ? 146  ASP A C     1 
ATOM   1139 O O     . ASP A 1 146 ? -21.429 24.390  -23.939 1.00 32.80  ? 146  ASP A O     1 
ATOM   1140 C CB    . ASP A 1 146 ? -19.751 22.095  -23.058 1.00 26.10  ? 146  ASP A CB    1 
ATOM   1141 C CG    . ASP A 1 146 ? -18.401 22.776  -23.125 1.00 28.74  ? 146  ASP A CG    1 
ATOM   1142 O OD1   . ASP A 1 146 ? -17.982 23.379  -22.115 1.00 27.05  ? 146  ASP A OD1   1 
ATOM   1143 O OD2   . ASP A 1 146 ? -17.753 22.699  -24.189 1.00 36.09  ? 146  ASP A OD2   1 
ATOM   1144 N N     . LEU A 1 147 ? -20.658 25.288  -22.028 1.00 25.20  ? 147  LEU A N     1 
ATOM   1145 C CA    . LEU A 1 147 ? -20.818 26.668  -22.471 1.00 27.14  ? 147  LEU A CA    1 
ATOM   1146 C C     . LEU A 1 147 ? -19.489 27.244  -22.945 1.00 29.69  ? 147  LEU A C     1 
ATOM   1147 O O     . LEU A 1 147 ? -18.432 26.798  -22.508 1.00 31.94  ? 147  LEU A O     1 
ATOM   1148 C CB    . LEU A 1 147 ? -21.377 27.529  -21.337 1.00 27.21  ? 147  LEU A CB    1 
ATOM   1149 C CG    . LEU A 1 147 ? -22.779 27.202  -20.825 1.00 29.28  ? 147  LEU A CG    1 
ATOM   1150 C CD1   . LEU A 1 147 ? -23.273 28.328  -19.937 1.00 31.34  ? 147  LEU A CD1   1 
ATOM   1151 C CD2   . LEU A 1 147 ? -23.738 26.963  -21.979 1.00 27.38  ? 147  LEU A CD2   1 
ATOM   1152 N N     . PRO A 1 148 ? -19.540 28.237  -23.849 1.00 35.97  ? 148  PRO A N     1 
ATOM   1153 C CA    . PRO A 1 148 ? -18.325 28.914  -24.316 1.00 35.04  ? 148  PRO A CA    1 
ATOM   1154 C C     . PRO A 1 148 ? -17.541 29.530  -23.160 1.00 29.40  ? 148  PRO A C     1 
ATOM   1155 O O     . PRO A 1 148 ? -18.133 30.148  -22.275 1.00 29.52  ? 148  PRO A O     1 
ATOM   1156 C CB    . PRO A 1 148 ? -18.871 30.013  -25.230 1.00 34.85  ? 148  PRO A CB    1 
ATOM   1157 C CG    . PRO A 1 148 ? -20.169 29.479  -25.716 1.00 38.65  ? 148  PRO A CG    1 
ATOM   1158 C CD    . PRO A 1 148 ? -20.740 28.710  -24.562 1.00 36.21  ? 148  PRO A CD    1 
ATOM   1159 N N     . GLY A 1 149 ? -16.223 29.359  -23.176 1.00 32.50  ? 149  GLY A N     1 
ATOM   1160 C CA    . GLY A 1 149 ? -15.376 29.814  -22.088 1.00 31.20  ? 149  GLY A CA    1 
ATOM   1161 C C     . GLY A 1 149 ? -15.195 31.318  -22.010 1.00 34.35  ? 149  GLY A C     1 
ATOM   1162 O O     . GLY A 1 149 ? -15.180 32.009  -23.027 1.00 35.24  ? 149  GLY A O     1 
ATOM   1163 N N     . MET A 1 150 ? -15.058 31.821  -20.787 1.00 35.02  ? 150  MET A N     1 
ATOM   1164 C CA    . MET A 1 150 ? -14.794 33.236  -20.557 1.00 39.06  ? 150  MET A CA    1 
ATOM   1165 C C     . MET A 1 150 ? -13.300 33.507  -20.613 1.00 41.49  ? 150  MET A C     1 
ATOM   1166 O O     . MET A 1 150 ? -12.490 32.580  -20.588 1.00 41.99  ? 150  MET A O     1 
ATOM   1167 C CB    . MET A 1 150 ? -15.313 33.655  -19.181 1.00 35.93  ? 150  MET A CB    1 
ATOM   1168 C CG    . MET A 1 150 ? -16.805 33.512  -19.001 1.00 40.55  ? 150  MET A CG    1 
ATOM   1169 S SD    . MET A 1 150 ? -17.310 33.726  -17.284 1.00 43.21  ? 150  MET A SD    1 
ATOM   1170 C CE    . MET A 1 150 ? -16.481 32.338  -16.518 1.00 30.55  ? 150  MET A CE    1 
ATOM   1171 N N     . THR A 1 151 ? -12.937 34.783  -20.683 1.00 36.71  ? 151  THR A N     1 
ATOM   1172 C CA    . THR A 1 151 ? -11.546 35.184  -20.522 1.00 38.98  ? 151  THR A CA    1 
ATOM   1173 C C     . THR A 1 151 ? -11.185 35.054  -19.045 1.00 42.12  ? 151  THR A C     1 
ATOM   1174 O O     . THR A 1 151 ? -12.035 35.259  -18.179 1.00 38.74  ? 151  THR A O     1 
ATOM   1175 C CB    . THR A 1 151 ? -11.323 36.632  -20.987 1.00 37.07  ? 151  THR A CB    1 
ATOM   1176 O OG1   . THR A 1 151 ? -12.268 37.493  -20.339 1.00 37.96  ? 151  THR A OG1   1 
ATOM   1177 C CG2   . THR A 1 151 ? -11.505 36.741  -22.493 1.00 39.82  ? 151  THR A CG2   1 
ATOM   1178 N N     . LYS A 1 152 ? -9.934  34.707  -18.753 1.00 44.05  ? 152  LYS A N     1 
ATOM   1179 C CA    . LYS A 1 152 ? -9.527  34.448  -17.371 1.00 43.85  ? 152  LYS A CA    1 
ATOM   1180 C C     . LYS A 1 152 ? -9.352  35.725  -16.556 1.00 46.48  ? 152  LYS A C     1 
ATOM   1181 O O     . LYS A 1 152 ? -9.140  35.680  -15.344 1.00 44.81  ? 152  LYS A O     1 
ATOM   1182 C CB    . LYS A 1 152 ? -8.260  33.591  -17.314 1.00 45.40  ? 152  LYS A CB    1 
ATOM   1183 C CG    . LYS A 1 152 ? -6.988  34.302  -17.732 1.00 46.90  ? 152  LYS A CG    1 
ATOM   1184 C CD    . LYS A 1 152 ? -5.767  33.494  -17.315 1.00 53.84  ? 152  LYS A CD    1 
ATOM   1185 C CE    . LYS A 1 152 ? -4.476  34.150  -17.774 1.00 59.25  ? 152  LYS A CE    1 
ATOM   1186 N NZ    . LYS A 1 152 ? -4.369  34.185  -19.259 1.00 59.10  ? 152  LYS A NZ    1 
ATOM   1187 N N     . VAL A 1 153 ? -9.446  36.861  -17.234 1.00 48.50  ? 153  VAL A N     1 
ATOM   1188 C CA    . VAL A 1 153 ? -9.360  38.163  -16.592 1.00 42.13  ? 153  VAL A CA    1 
ATOM   1189 C C     . VAL A 1 153 ? -10.763 38.774  -16.649 1.00 38.46  ? 153  VAL A C     1 
ATOM   1190 O O     . VAL A 1 153 ? -11.565 38.388  -17.502 1.00 39.93  ? 153  VAL A O     1 
ATOM   1191 C CB    . VAL A 1 153 ? -8.317  39.050  -17.323 1.00 41.46  ? 153  VAL A CB    1 
ATOM   1192 C CG1   . VAL A 1 153 ? -8.972  39.892  -18.410 1.00 36.52  ? 153  VAL A CG1   1 
ATOM   1193 C CG2   . VAL A 1 153 ? -7.518  39.904  -16.341 1.00 45.65  ? 153  VAL A CG2   1 
ATOM   1194 N N     . PRO A 1 154 ? -11.088 39.688  -15.715 1.00 40.37  ? 154  PRO A N     1 
ATOM   1195 C CA    . PRO A 1 154 ? -12.387 40.369  -15.778 1.00 41.21  ? 154  PRO A CA    1 
ATOM   1196 C C     . PRO A 1 154 ? -12.638 41.018  -17.136 1.00 43.55  ? 154  PRO A C     1 
ATOM   1197 O O     . PRO A 1 154 ? -11.697 41.489  -17.776 1.00 42.88  ? 154  PRO A O     1 
ATOM   1198 C CB    . PRO A 1 154 ? -12.264 41.436  -14.693 1.00 40.63  ? 154  PRO A CB    1 
ATOM   1199 C CG    . PRO A 1 154 ? -11.378 40.809  -13.680 1.00 41.97  ? 154  PRO A CG    1 
ATOM   1200 C CD    . PRO A 1 154 ? -10.383 39.980  -14.454 1.00 40.27  ? 154  PRO A CD    1 
ATOM   1201 N N     . VAL A 1 155 ? -13.899 41.031  -17.559 1.00 46.34  ? 155  VAL A N     1 
ATOM   1202 C CA    . VAL A 1 155 ? -14.290 41.500  -18.889 1.00 40.65  ? 155  VAL A CA    1 
ATOM   1203 C C     . VAL A 1 155 ? -13.726 42.882  -19.237 1.00 43.40  ? 155  VAL A C     1 
ATOM   1204 O O     . VAL A 1 155 ? -13.352 43.138  -20.383 1.00 43.22  ? 155  VAL A O     1 
ATOM   1205 C CB    . VAL A 1 155 ? -15.832 41.478  -19.051 1.00 42.14  ? 155  VAL A CB    1 
ATOM   1206 C CG1   . VAL A 1 155 ? -16.506 42.135  -17.856 1.00 43.25  ? 155  VAL A CG1   1 
ATOM   1207 C CG2   . VAL A 1 155 ? -16.259 42.137  -20.355 1.00 41.04  ? 155  VAL A CG2   1 
ATOM   1208 N N     . GLY A 1 156 ? -13.639 43.759  -18.242 1.00 40.43  ? 156  GLY A N     1 
ATOM   1209 C CA    . GLY A 1 156 ? -13.103 45.092  -18.450 1.00 36.01  ? 156  GLY A CA    1 
ATOM   1210 C C     . GLY A 1 156 ? -11.597 45.120  -18.650 1.00 40.48  ? 156  GLY A C     1 
ATOM   1211 O O     . GLY A 1 156 ? -11.051 46.098  -19.160 1.00 37.94  ? 156  GLY A O     1 
ATOM   1212 N N     . ASP A 1 157 ? -10.922 44.046  -18.251 1.00 38.34  ? 157  ASP A N     1 
ATOM   1213 C CA    . ASP A 1 157 ? -9.466  43.976  -18.355 1.00 39.48  ? 157  ASP A CA    1 
ATOM   1214 C C     . ASP A 1 157 ? -8.995  43.334  -19.661 1.00 37.61  ? 157  ASP A C     1 
ATOM   1215 O O     . ASP A 1 157 ? -7.844  42.915  -19.774 1.00 36.75  ? 157  ASP A O     1 
ATOM   1216 C CB    . ASP A 1 157 ? -8.873  43.228  -17.156 1.00 40.77  ? 157  ASP A CB    1 
ATOM   1217 C CG    . ASP A 1 157 ? -9.014  43.998  -15.858 1.00 44.47  ? 157  ASP A CG    1 
ATOM   1218 O OD1   . ASP A 1 157 ? -9.320  43.368  -14.823 1.00 45.89  ? 157  ASP A OD1   1 
ATOM   1219 O OD2   . ASP A 1 157 ? -8.814  45.231  -15.870 1.00 49.67  ? 157  ASP A OD2   1 
ATOM   1220 N N     . GLN A 1 158 ? -9.890  43.264  -20.642 1.00 38.66  ? 158  GLN A N     1 
ATOM   1221 C CA    . GLN A 1 158 ? -9.562  42.731  -21.962 1.00 37.89  ? 158  GLN A CA    1 
ATOM   1222 C C     . GLN A 1 158 ? -10.267 43.580  -23.028 1.00 37.40  ? 158  GLN A C     1 
ATOM   1223 O O     . GLN A 1 158 ? -11.258 44.241  -22.726 1.00 36.86  ? 158  GLN A O     1 
ATOM   1224 C CB    . GLN A 1 158 ? -9.938  41.245  -22.050 1.00 36.56  ? 158  GLN A CB    1 
ATOM   1225 C CG    . GLN A 1 158 ? -11.401 40.936  -21.793 1.00 38.64  ? 158  GLN A CG    1 
ATOM   1226 C CD    . GLN A 1 158 ? -12.266 41.152  -23.017 1.00 41.31  ? 158  GLN A CD    1 
ATOM   1227 O OE1   . GLN A 1 158 ? -11.898 40.767  -24.128 1.00 41.05  ? 158  GLN A OE1   1 
ATOM   1228 N NE2   . GLN A 1 158 ? -13.419 41.781  -22.822 1.00 38.27  ? 158  GLN A NE2   1 
ATOM   1229 N N     . PRO A 1 159 ? -9.764  43.571  -24.277 1.00 37.55  ? 159  PRO A N     1 
ATOM   1230 C CA    . PRO A 1 159 ? -10.239 44.586  -25.226 1.00 38.31  ? 159  PRO A CA    1 
ATOM   1231 C C     . PRO A 1 159 ? -11.496 44.236  -26.027 1.00 36.21  ? 159  PRO A C     1 
ATOM   1232 O O     . PRO A 1 159 ? -12.010 45.105  -26.729 1.00 35.86  ? 159  PRO A O     1 
ATOM   1233 C CB    . PRO A 1 159 ? -9.047  44.751  -26.176 1.00 37.26  ? 159  PRO A CB    1 
ATOM   1234 C CG    . PRO A 1 159 ? -8.257  43.461  -26.061 1.00 36.05  ? 159  PRO A CG    1 
ATOM   1235 C CD    . PRO A 1 159 ? -8.785  42.663  -24.898 1.00 33.90  ? 159  PRO A CD    1 
ATOM   1236 N N     . LYS A 1 160 ? -12.011 43.039  -25.906 1.00 34.15  ? 160  LYS A N     1 
ATOM   1237 C CA    . LYS A 1 160 ? -13.144 42.611  -26.713 1.00 39.29  ? 160  LYS A CA    1 
ATOM   1238 C C     . LYS A 1 160 ? -14.508 42.732  -26.051 1.00 37.60  ? 160  LYS A C     1 
ATOM   1239 O O     . LYS A 1 160 ? -14.822 42.066  -25.128 1.00 33.44  ? 160  LYS A O     1 
ATOM   1240 C CB    . LYS A 1 160 ? -12.917 41.203  -27.215 1.00 40.82  ? 160  LYS A CB    1 
ATOM   1241 C CG    . LYS A 1 160 ? -13.251 41.048  -28.653 1.00 50.35  ? 160  LYS A CG    1 
ATOM   1242 C CD    . LYS A 1 160 ? -14.245 42.172  -29.140 1.00 50.27  ? 160  LYS A CD    1 
ATOM   1243 C CE    . LYS A 1 160 ? -15.140 41.840  -30.277 1.00 45.85  ? 160  LYS A CE    1 
ATOM   1244 N NZ    . LYS A 1 160 ? -16.294 42.750  -30.150 1.00 49.14  ? 160  LYS A NZ    1 
ATOM   1245 N N     . ASP A 1 161 ? -15.295 43.572  -26.685 1.00 40.54  ? 161  ASP A N     1 
ATOM   1246 C CA    . ASP A 1 161 ? -16.640 43.920  -26.333 1.00 39.57  ? 161  ASP A CA    1 
ATOM   1247 C C     . ASP A 1 161 ? -17.563 42.719  -26.310 1.00 41.96  ? 161  ASP A C     1 
ATOM   1248 O O     . ASP A 1 161 ? -18.567 42.714  -25.638 1.00 44.14  ? 161  ASP A O     1 
ATOM   1249 C CB    . ASP A 1 161 ? -17.120 44.866  -27.392 1.00 35.35  ? 161  ASP A CB    1 
ATOM   1250 C CG    . ASP A 1 161 ? -18.523 45.207  -27.228 1.00 50.04  ? 161  ASP A CG    1 
ATOM   1251 O OD1   . ASP A 1 161 ? -18.825 45.875  -26.242 1.00 53.33  ? 161  ASP A OD1   1 
ATOM   1252 O OD2   . ASP A 1 161 ? -19.344 44.820  -28.057 1.00 50.45  ? 161  ASP A OD2   1 
ATOM   1253 N N     . ILE A 1 162 ? -17.220 41.720  -27.100 1.00 40.20  ? 162  ILE A N     1 
ATOM   1254 C CA    . ILE A 1 162 ? -17.993 40.518  -27.274 1.00 40.88  ? 162  ILE A CA    1 
ATOM   1255 C C     . ILE A 1 162 ? -18.019 39.664  -26.029 1.00 44.12  ? 162  ILE A C     1 
ATOM   1256 O O     . ILE A 1 162 ? -18.869 38.819  -25.889 1.00 45.82  ? 162  ILE A O     1 
ATOM   1257 C CB    . ILE A 1 162 ? -17.422 39.680  -28.453 1.00 44.29  ? 162  ILE A CB    1 
ATOM   1258 C CG1   . ILE A 1 162 ? -18.315 38.509  -28.807 1.00 50.93  ? 162  ILE A CG1   1 
ATOM   1259 C CG2   . ILE A 1 162 ? -16.074 39.117  -28.131 1.00 39.25  ? 162  ILE A CG2   1 
ATOM   1260 C CD1   . ILE A 1 162 ? -19.599 38.885  -29.461 1.00 57.78  ? 162  ILE A CD1   1 
ATOM   1261 N N     . GLU A 1 163 ? -17.085 39.883  -25.127 1.00 38.35  ? 163  GLU A N     1 
ATOM   1262 C CA    . GLU A 1 163 ? -17.025 39.132  -23.878 1.00 36.15  ? 163  GLU A CA    1 
ATOM   1263 C C     . GLU A 1 163 ? -18.279 39.349  -23.037 1.00 37.05  ? 163  GLU A C     1 
ATOM   1264 O O     . GLU A 1 163 ? -18.697 38.459  -22.299 1.00 34.04  ? 163  GLU A O     1 
ATOM   1265 C CB    . GLU A 1 163 ? -15.773 39.514  -23.084 1.00 33.95  ? 163  GLU A CB    1 
ATOM   1266 C CG    . GLU A 1 163 ? -15.599 38.776  -21.763 1.00 37.24  ? 163  GLU A CG    1 
ATOM   1267 C CD    . GLU A 1 163 ? -15.303 37.297  -21.939 1.00 40.15  ? 163  GLU A CD    1 
ATOM   1268 O OE1   . GLU A 1 163 ? -14.881 36.893  -23.044 1.00 38.00  ? 163  GLU A OE1   1 
ATOM   1269 O OE2   . GLU A 1 163 ? -15.495 36.537  -20.966 1.00 38.87  ? 163  GLU A OE2   1 
ATOM   1270 N N     . LEU A 1 164 ? -18.878 40.531  -23.161 1.00 41.00  ? 164  LEU A N     1 
ATOM   1271 C CA    . LEU A 1 164 ? -20.126 40.833  -22.467 1.00 39.11  ? 164  LEU A CA    1 
ATOM   1272 C C     . LEU A 1 164 ? -21.223 39.844  -22.841 1.00 39.27  ? 164  LEU A C     1 
ATOM   1273 O O     . LEU A 1 164 ? -21.878 39.276  -21.971 1.00 40.80  ? 164  LEU A O     1 
ATOM   1274 C CB    . LEU A 1 164 ? -20.598 42.258  -22.767 1.00 39.98  ? 164  LEU A CB    1 
ATOM   1275 C CG    . LEU A 1 164 ? -20.003 43.408  -21.950 1.00 40.81  ? 164  LEU A CG    1 
ATOM   1276 C CD1   . LEU A 1 164 ? -19.857 43.019  -20.487 1.00 38.83  ? 164  LEU A CD1   1 
ATOM   1277 C CD2   . LEU A 1 164 ? -18.679 43.860  -22.530 1.00 41.25  ? 164  LEU A CD2   1 
ATOM   1278 N N     . GLN A 1 165 ? -21.415 39.634  -24.139 1.00 36.79  ? 165  GLN A N     1 
ATOM   1279 C CA    . GLN A 1 165 ? -22.469 38.744  -24.610 1.00 43.40  ? 165  GLN A CA    1 
ATOM   1280 C C     . GLN A 1 165 ? -22.162 37.281  -24.313 1.00 39.96  ? 165  GLN A C     1 
ATOM   1281 O O     . GLN A 1 165 ? -23.054 36.435  -24.332 1.00 37.05  ? 165  GLN A O     1 
ATOM   1282 C CB    . GLN A 1 165 ? -22.731 38.967  -26.097 1.00 45.18  ? 165  GLN A CB    1 
ATOM   1283 C CG    . GLN A 1 165 ? -23.870 38.113  -26.610 1.00 62.99  ? 165  GLN A CG    1 
ATOM   1284 C CD    . GLN A 1 165 ? -25.138 38.896  -26.839 1.00 70.01  ? 165  GLN A CD    1 
ATOM   1285 O OE1   . GLN A 1 165 ? -25.845 39.249  -25.895 1.00 64.76  ? 165  GLN A OE1   1 
ATOM   1286 N NE2   . GLN A 1 165 ? -25.440 39.171  -28.102 1.00 74.09  ? 165  GLN A NE2   1 
ATOM   1287 N N     . ILE A 1 166 ? -20.895 36.995  -24.035 1.00 39.58  ? 166  ILE A N     1 
ATOM   1288 C CA    . ILE A 1 166 ? -20.496 35.676  -23.568 1.00 38.65  ? 166  ILE A CA    1 
ATOM   1289 C C     . ILE A 1 166 ? -20.941 35.498  -22.120 1.00 38.52  ? 166  ILE A C     1 
ATOM   1290 O O     . ILE A 1 166 ? -21.419 34.430  -21.731 1.00 34.01  ? 166  ILE A O     1 
ATOM   1291 C CB    . ILE A 1 166 ? -18.973 35.476  -23.681 1.00 40.53  ? 166  ILE A CB    1 
ATOM   1292 C CG1   . ILE A 1 166 ? -18.569 35.333  -25.149 1.00 47.45  ? 166  ILE A CG1   1 
ATOM   1293 C CG2   . ILE A 1 166 ? -18.523 34.256  -22.891 1.00 33.51  ? 166  ILE A CG2   1 
ATOM   1294 C CD1   . ILE A 1 166 ? -17.090 35.099  -25.355 1.00 43.62  ? 166  ILE A CD1   1 
ATOM   1295 N N     . ARG A 1 167 ? -20.793 36.558  -21.329 1.00 35.47  ? 167  ARG A N     1 
ATOM   1296 C CA    . ARG A 1 167 ? -21.240 36.545  -19.941 1.00 29.41  ? 167  ARG A CA    1 
ATOM   1297 C C     . ARG A 1 167 ? -22.762 36.471  -19.879 1.00 32.77  ? 167  ARG A C     1 
ATOM   1298 O O     . ARG A 1 167 ? -23.322 35.791  -19.021 1.00 29.95  ? 167  ARG A O     1 
ATOM   1299 C CB    . ARG A 1 167 ? -20.746 37.788  -19.197 1.00 32.99  ? 167  ARG A CB    1 
ATOM   1300 C CG    . ARG A 1 167 ? -19.244 38.023  -19.274 1.00 34.77  ? 167  ARG A CG    1 
ATOM   1301 C CD    . ARG A 1 167 ? -18.454 36.820  -18.790 1.00 40.04  ? 167  ARG A CD    1 
ATOM   1302 N NE    . ARG A 1 167 ? -17.015 37.013  -18.952 1.00 41.26  ? 167  ARG A NE    1 
ATOM   1303 C CZ    . ARG A 1 167 ? -16.204 37.444  -17.991 1.00 41.03  ? 167  ARG A CZ    1 
ATOM   1304 N NH1   . ARG A 1 167 ? -16.688 37.728  -16.789 1.00 42.57  ? 167  ARG A NH1   1 
ATOM   1305 N NH2   . ARG A 1 167 ? -14.908 37.590  -18.230 1.00 39.74  ? 167  ARG A NH2   1 
ATOM   1306 N N     . GLU A 1 168 ? -23.424 37.176  -20.794 1.00 34.79  ? 168  GLU A N     1 
ATOM   1307 C CA    . GLU A 1 168 ? -24.881 37.154  -20.876 1.00 37.20  ? 168  GLU A CA    1 
ATOM   1308 C C     . GLU A 1 168 ? -25.376 35.743  -21.176 1.00 34.31  ? 168  GLU A C     1 
ATOM   1309 O O     . GLU A 1 168 ? -26.344 35.275  -20.575 1.00 35.80  ? 168  GLU A O     1 
ATOM   1310 C CB    . GLU A 1 168 ? -25.379 38.114  -21.960 1.00 35.50  ? 168  GLU A CB    1 
ATOM   1311 C CG    . GLU A 1 168 ? -24.998 39.571  -21.745 1.00 49.54  ? 168  GLU A CG    1 
ATOM   1312 C CD    . GLU A 1 168 ? -26.171 40.438  -21.325 1.00 58.33  ? 168  GLU A CD    1 
ATOM   1313 O OE1   . GLU A 1 168 ? -27.260 39.886  -21.058 1.00 57.15  ? 168  GLU A OE1   1 
ATOM   1314 O OE2   . GLU A 1 168 ? -26.004 41.675  -21.267 1.00 58.39  ? 168  GLU A OE2   1 
ATOM   1315 N N     . LEU A 1 169 ? -24.703 35.073  -22.107 1.00 31.18  ? 169  LEU A N     1 
ATOM   1316 C CA    . LEU A 1 169 ? -25.077 33.721  -22.509 1.00 34.46  ? 169  LEU A CA    1 
ATOM   1317 C C     . LEU A 1 169 ? -24.981 32.738  -21.347 1.00 31.92  ? 169  LEU A C     1 
ATOM   1318 O O     . LEU A 1 169 ? -25.882 31.929  -21.128 1.00 30.19  ? 169  LEU A O     1 
ATOM   1319 C CB    . LEU A 1 169 ? -24.197 33.237  -23.661 1.00 29.56  ? 169  LEU A CB    1 
ATOM   1320 C CG    . LEU A 1 169 ? -24.467 31.785  -24.061 1.00 34.42  ? 169  LEU A CG    1 
ATOM   1321 C CD1   . LEU A 1 169 ? -25.889 31.642  -24.574 1.00 33.72  ? 169  LEU A CD1   1 
ATOM   1322 C CD2   . LEU A 1 169 ? -23.468 31.287  -25.090 1.00 31.11  ? 169  LEU A CD2   1 
ATOM   1323 N N     . ILE A 1 170 ? -23.879 32.813  -20.611 1.00 30.30  ? 170  ILE A N     1 
ATOM   1324 C CA    . ILE A 1 170 ? -23.659 31.947  -19.461 1.00 28.35  ? 170  ILE A CA    1 
ATOM   1325 C C     . ILE A 1 170 ? -24.690 32.211  -18.372 1.00 29.23  ? 170  ILE A C     1 
ATOM   1326 O O     . ILE A 1 170 ? -25.281 31.279  -17.828 1.00 27.22  ? 170  ILE A O     1 
ATOM   1327 C CB    . ILE A 1 170 ? -22.237 32.123  -18.907 1.00 26.25  ? 170  ILE A CB    1 
ATOM   1328 C CG1   . ILE A 1 170 ? -21.237 31.463  -19.855 1.00 25.67  ? 170  ILE A CG1   1 
ATOM   1329 C CG2   . ILE A 1 170 ? -22.120 31.528  -17.513 1.00 26.08  ? 170  ILE A CG2   1 
ATOM   1330 C CD1   . ILE A 1 170 ? -19.851 32.012  -19.751 1.00 29.72  ? 170  ILE A CD1   1 
ATOM   1331 N N     . LEU A 1 171 ? -24.909 33.487  -18.073 1.00 32.46  ? 171  LEU A N     1 
ATOM   1332 C CA    . LEU A 1 171 ? -25.904 33.893  -17.089 1.00 34.42  ? 171  LEU A CA    1 
ATOM   1333 C C     . LEU A 1 171 ? -27.292 33.384  -17.461 1.00 33.05  ? 171  LEU A C     1 
ATOM   1334 O O     . LEU A 1 171 ? -28.046 32.939  -16.598 1.00 34.33  ? 171  LEU A O     1 
ATOM   1335 C CB    . LEU A 1 171 ? -25.921 35.415  -16.944 1.00 33.75  ? 171  LEU A CB    1 
ATOM   1336 C CG    . LEU A 1 171 ? -24.768 36.015  -16.139 1.00 33.31  ? 171  LEU A CG    1 
ATOM   1337 C CD1   . LEU A 1 171 ? -24.623 37.492  -16.448 1.00 34.68  ? 171  LEU A CD1   1 
ATOM   1338 C CD2   . LEU A 1 171 ? -24.998 35.795  -14.653 1.00 31.40  ? 171  LEU A CD2   1 
ATOM   1339 N N     . ARG A 1 172 ? -27.615 33.448  -18.749 1.00 30.41  ? 172  ARG A N     1 
ATOM   1340 C CA    . ARG A 1 172 ? -28.897 32.964  -19.248 1.00 31.28  ? 172  ARG A CA    1 
ATOM   1341 C C     . ARG A 1 172 ? -29.098 31.485  -18.932 1.00 32.57  ? 172  ARG A C     1 
ATOM   1342 O O     . ARG A 1 172 ? -30.187 31.066  -18.544 1.00 32.60  ? 172  ARG A O     1 
ATOM   1343 C CB    . ARG A 1 172 ? -29.004 33.193  -20.758 1.00 32.46  ? 172  ARG A CB    1 
ATOM   1344 C CG    . ARG A 1 172 ? -30.167 32.461  -21.411 1.00 35.89  ? 172  ARG A CG    1 
ATOM   1345 C CD    . ARG A 1 172 ? -30.221 32.711  -22.909 1.00 35.19  ? 172  ARG A CD    1 
ATOM   1346 N NE    . ARG A 1 172 ? -31.169 31.819  -23.570 1.00 35.81  ? 172  ARG A NE    1 
ATOM   1347 C CZ    . ARG A 1 172 ? -31.522 31.915  -24.847 1.00 38.39  ? 172  ARG A CZ    1 
ATOM   1348 N NH1   . ARG A 1 172 ? -31.010 32.873  -25.607 1.00 41.66  ? 172  ARG A NH1   1 
ATOM   1349 N NH2   . ARG A 1 172 ? -32.391 31.058  -25.363 1.00 30.68  ? 172  ARG A NH2   1 
ATOM   1350 N N     . PHE A 1 173 ? -28.037 30.702  -19.090 1.00 30.57  ? 173  PHE A N     1 
ATOM   1351 C CA    . PHE A 1 173 ? -28.109 29.264  -18.864 1.00 31.65  ? 173  PHE A CA    1 
ATOM   1352 C C     . PHE A 1 173 ? -28.099 28.882  -17.386 1.00 30.01  ? 173  PHE A C     1 
ATOM   1353 O O     . PHE A 1 173 ? -28.851 28.003  -16.965 1.00 29.73  ? 173  PHE A O     1 
ATOM   1354 C CB    . PHE A 1 173 ? -26.976 28.548  -19.600 1.00 27.86  ? 173  PHE A CB    1 
ATOM   1355 C CG    . PHE A 1 173 ? -27.321 28.156  -21.008 1.00 27.36  ? 173  PHE A CG    1 
ATOM   1356 C CD1   . PHE A 1 173 ? -27.767 26.876  -21.293 1.00 29.69  ? 173  PHE A CD1   1 
ATOM   1357 C CD2   . PHE A 1 173 ? -27.204 29.065  -22.045 1.00 29.75  ? 173  PHE A CD2   1 
ATOM   1358 C CE1   . PHE A 1 173 ? -28.087 26.509  -22.586 1.00 29.06  ? 173  PHE A CE1   1 
ATOM   1359 C CE2   . PHE A 1 173 ? -27.524 28.705  -23.340 1.00 34.31  ? 173  PHE A CE2   1 
ATOM   1360 C CZ    . PHE A 1 173 ? -27.965 27.425  -23.611 1.00 31.87  ? 173  PHE A CZ    1 
ATOM   1361 N N     . ILE A 1 174 ? -27.250 29.537  -16.599 1.00 25.25  ? 174  ILE A N     1 
ATOM   1362 C CA    . ILE A 1 174 ? -27.099 29.171  -15.193 1.00 28.03  ? 174  ILE A CA    1 
ATOM   1363 C C     . ILE A 1 174 ? -28.132 29.832  -14.280 1.00 31.07  ? 174  ILE A C     1 
ATOM   1364 O O     . ILE A 1 174 ? -28.165 29.566  -13.079 1.00 30.04  ? 174  ILE A O     1 
ATOM   1365 C CB    . ILE A 1 174 ? -25.679 29.461  -14.666 1.00 27.65  ? 174  ILE A CB    1 
ATOM   1366 C CG1   . ILE A 1 174 ? -25.410 30.966  -14.628 1.00 25.53  ? 174  ILE A CG1   1 
ATOM   1367 C CG2   . ILE A 1 174 ? -24.640 28.740  -15.513 1.00 25.24  ? 174  ILE A CG2   1 
ATOM   1368 C CD1   . ILE A 1 174 ? -24.080 31.325  -14.006 1.00 27.14  ? 174  ILE A CD1   1 
ATOM   1369 N N     . SER A 1 175 ? -28.978 30.687  -14.849 1.00 29.58  ? 175  SER A N     1 
ATOM   1370 C CA    . SER A 1 175 ? -30.067 31.284  -14.084 1.00 30.49  ? 175  SER A CA    1 
ATOM   1371 C C     . SER A 1 175 ? -31.227 30.299  -13.989 1.00 32.33  ? 175  SER A C     1 
ATOM   1372 O O     . SER A 1 175 ? -32.191 30.527  -13.259 1.00 32.42  ? 175  SER A O     1 
ATOM   1373 C CB    . SER A 1 175 ? -30.528 32.601  -14.710 1.00 31.21  ? 175  SER A CB    1 
ATOM   1374 O OG    . SER A 1 175 ? -31.028 32.397  -16.018 1.00 35.20  ? 175  SER A OG    1 
ATOM   1375 N N     . ASN A 1 176 ? -31.123 29.212  -14.749 1.00 30.90  ? 176  ASN A N     1 
ATOM   1376 C CA    . ASN A 1 176 ? -32.045 28.090  -14.644 1.00 29.06  ? 176  ASN A CA    1 
ATOM   1377 C C     . ASN A 1 176 ? -31.996 27.544  -13.224 1.00 28.81  ? 176  ASN A C     1 
ATOM   1378 O O     . ASN A 1 176 ? -30.970 27.012  -12.802 1.00 29.19  ? 176  ASN A O     1 
ATOM   1379 C CB    . ASN A 1 176 ? -31.649 26.998  -15.644 1.00 28.40  ? 176  ASN A CB    1 
ATOM   1380 C CG    . ASN A 1 176 ? -32.620 25.825  -15.667 1.00 27.98  ? 176  ASN A CG    1 
ATOM   1381 O OD1   . ASN A 1 176 ? -33.524 25.725  -14.839 1.00 27.34  ? 176  ASN A OD1   1 
ATOM   1382 N ND2   . ASN A 1 176 ? -32.423 24.921  -16.621 1.00 29.10  ? 176  ASN A ND2   1 
ATOM   1383 N N     . PRO A 1 177 ? -33.108 27.676  -12.482 1.00 27.84  ? 177  PRO A N     1 
ATOM   1384 C CA    . PRO A 1 177 ? -33.182 27.257  -11.077 1.00 27.69  ? 177  PRO A CA    1 
ATOM   1385 C C     . PRO A 1 177 ? -32.840 25.781  -10.900 1.00 30.13  ? 177  PRO A C     1 
ATOM   1386 O O     . PRO A 1 177 ? -32.342 25.385  -9.845  1.00 29.36  ? 177  PRO A O     1 
ATOM   1387 C CB    . PRO A 1 177 ? -34.653 27.496  -10.719 1.00 29.30  ? 177  PRO A CB    1 
ATOM   1388 C CG    . PRO A 1 177 ? -35.122 28.519  -11.688 1.00 32.65  ? 177  PRO A CG    1 
ATOM   1389 C CD    . PRO A 1 177 ? -34.388 28.226  -12.959 1.00 31.54  ? 177  PRO A CD    1 
ATOM   1390 N N     . ASN A 1 178 ? -33.100 24.984  -11.930 1.00 27.54  ? 178  ASN A N     1 
ATOM   1391 C CA    . ASN A 1 178 ? -32.860 23.548  -11.867 1.00 26.36  ? 178  ASN A CA    1 
ATOM   1392 C C     . ASN A 1 178 ? -31.563 23.134  -12.552 1.00 28.43  ? 178  ASN A C     1 
ATOM   1393 O O     . ASN A 1 178 ? -31.348 21.954  -12.829 1.00 29.67  ? 178  ASN A O     1 
ATOM   1394 C CB    . ASN A 1 178 ? -34.041 22.790  -12.470 1.00 25.69  ? 178  ASN A CB    1 
ATOM   1395 C CG    . ASN A 1 178 ? -35.351 23.138  -11.799 1.00 31.39  ? 178  ASN A CG    1 
ATOM   1396 O OD1   . ASN A 1 178 ? -35.412 23.297  -10.580 1.00 33.03  ? 178  ASN A OD1   1 
ATOM   1397 N ND2   . ASN A 1 178 ? -36.408 23.270  -12.593 1.00 28.82  ? 178  ASN A ND2   1 
ATOM   1398 N N     . SER A 1 179 ? -30.701 24.106  -12.826 1.00 28.68  ? 179  SER A N     1 
ATOM   1399 C CA    . SER A 1 179 ? -29.400 23.810  -13.407 1.00 27.63  ? 179  SER A CA    1 
ATOM   1400 C C     . SER A 1 179 ? -28.367 23.621  -12.306 1.00 26.47  ? 179  SER A C     1 
ATOM   1401 O O     . SER A 1 179 ? -28.363 24.348  -11.313 1.00 26.01  ? 179  SER A O     1 
ATOM   1402 C CB    . SER A 1 179 ? -28.951 24.929  -14.348 1.00 27.57  ? 179  SER A CB    1 
ATOM   1403 O OG    . SER A 1 179 ? -28.547 26.079  -13.622 1.00 24.05  ? 179  SER A OG    1 
ATOM   1404 N N     . ILE A 1 180 ? -27.502 22.629  -12.480 1.00 26.10  ? 180  ILE A N     1 
ATOM   1405 C CA    . ILE A 1 180 ? -26.370 22.445  -11.588 1.00 27.14  ? 180  ILE A CA    1 
ATOM   1406 C C     . ILE A 1 180 ? -25.131 23.022  -12.254 1.00 25.64  ? 180  ILE A C     1 
ATOM   1407 O O     . ILE A 1 180 ? -24.802 22.665  -13.385 1.00 25.84  ? 180  ILE A O     1 
ATOM   1408 C CB    . ILE A 1 180 ? -26.144 20.963  -11.246 1.00 29.17  ? 180  ILE A CB    1 
ATOM   1409 C CG1   . ILE A 1 180 ? -27.283 20.451  -10.363 1.00 27.81  ? 180  ILE A CG1   1 
ATOM   1410 C CG2   . ILE A 1 180 ? -24.804 20.775  -10.548 1.00 22.98  ? 180  ILE A CG2   1 
ATOM   1411 C CD1   . ILE A 1 180 ? -27.172 18.987  -10.006 1.00 30.95  ? 180  ILE A CD1   1 
ATOM   1412 N N     . ILE A 1 181 ? -24.456 23.927  -11.556 1.00 24.02  ? 181  ILE A N     1 
ATOM   1413 C CA    . ILE A 1 181 ? -23.317 24.629  -12.127 1.00 23.36  ? 181  ILE A CA    1 
ATOM   1414 C C     . ILE A 1 181 ? -22.006 23.896  -11.875 1.00 30.25  ? 181  ILE A C     1 
ATOM   1415 O O     . ILE A 1 181 ? -21.562 23.765  -10.734 1.00 28.71  ? 181  ILE A O     1 
ATOM   1416 C CB    . ILE A 1 181 ? -23.205 26.058  -11.569 1.00 28.43  ? 181  ILE A CB    1 
ATOM   1417 C CG1   . ILE A 1 181 ? -24.536 26.796  -11.732 1.00 26.81  ? 181  ILE A CG1   1 
ATOM   1418 C CG2   . ILE A 1 181 ? -22.072 26.809  -12.256 1.00 27.44  ? 181  ILE A CG2   1 
ATOM   1419 C CD1   . ILE A 1 181 ? -24.581 28.130  -11.022 1.00 28.10  ? 181  ILE A CD1   1 
ATOM   1420 N N     . LEU A 1 182 ? -21.393 23.416  -12.951 1.00 25.19  ? 182  LEU A N     1 
ATOM   1421 C CA    . LEU A 1 182 ? -20.079 22.802  -12.864 1.00 28.00  ? 182  LEU A CA    1 
ATOM   1422 C C     . LEU A 1 182 ? -19.024 23.859  -13.176 1.00 26.76  ? 182  LEU A C     1 
ATOM   1423 O O     . LEU A 1 182 ? -18.751 24.153  -14.340 1.00 25.06  ? 182  LEU A O     1 
ATOM   1424 C CB    . LEU A 1 182 ? -19.970 21.627  -13.837 1.00 25.66  ? 182  LEU A CB    1 
ATOM   1425 C CG    . LEU A 1 182 ? -18.814 20.657  -13.599 1.00 29.36  ? 182  LEU A CG    1 
ATOM   1426 C CD1   . LEU A 1 182 ? -18.921 20.053  -12.210 1.00 33.11  ? 182  LEU A CD1   1 
ATOM   1427 C CD2   . LEU A 1 182 ? -18.801 19.568  -14.659 1.00 27.69  ? 182  LEU A CD2   1 
ATOM   1428 N N     . ALA A 1 183 ? -18.446 24.438  -12.128 1.00 24.38  ? 183  ALA A N     1 
ATOM   1429 C CA    . ALA A 1 183 ? -17.477 25.516  -12.286 1.00 27.44  ? 183  ALA A CA    1 
ATOM   1430 C C     . ALA A 1 183 ? -16.055 24.979  -12.397 1.00 27.23  ? 183  ALA A C     1 
ATOM   1431 O O     . ALA A 1 183 ? -15.534 24.371  -11.462 1.00 30.79  ? 183  ALA A O     1 
ATOM   1432 C CB    . ALA A 1 183 ? -17.588 26.502  -11.132 1.00 29.27  ? 183  ALA A CB    1 
ATOM   1433 N N     . VAL A 1 184 ? -15.432 25.212  -13.547 1.00 27.34  ? 184  VAL A N     1 
ATOM   1434 C CA    . VAL A 1 184 ? -14.087 24.716  -13.810 1.00 27.00  ? 184  VAL A CA    1 
ATOM   1435 C C     . VAL A 1 184 ? -13.040 25.808  -13.621 1.00 30.02  ? 184  VAL A C     1 
ATOM   1436 O O     . VAL A 1 184 ? -13.145 26.889  -14.200 1.00 32.14  ? 184  VAL A O     1 
ATOM   1437 C CB    . VAL A 1 184 ? -13.970 24.154  -15.239 1.00 31.94  ? 184  VAL A CB    1 
ATOM   1438 C CG1   . VAL A 1 184 ? -12.564 23.631  -15.491 1.00 28.97  ? 184  VAL A CG1   1 
ATOM   1439 C CG2   . VAL A 1 184 ? -15.004 23.059  -15.463 1.00 27.48  ? 184  VAL A CG2   1 
ATOM   1440 N N     . THR A 1 185 ? -12.030 25.517  -12.808 1.00 28.75  ? 185  THR A N     1 
ATOM   1441 C CA    . THR A 1 185 ? -10.945 26.458  -12.565 1.00 30.44  ? 185  THR A CA    1 
ATOM   1442 C C     . THR A 1 185 ? -9.628  25.729  -12.319 1.00 31.34  ? 185  THR A C     1 
ATOM   1443 O O     . THR A 1 185 ? -9.600  24.658  -11.714 1.00 33.37  ? 185  THR A O     1 
ATOM   1444 C CB    . THR A 1 185 ? -11.254 27.392  -11.376 1.00 32.31  ? 185  THR A CB    1 
ATOM   1445 O OG1   . THR A 1 185 ? -10.049 28.044  -10.951 1.00 34.48  ? 185  THR A OG1   1 
ATOM   1446 C CG2   . THR A 1 185 ? -11.831 26.603  -10.217 1.00 36.96  ? 185  THR A CG2   1 
ATOM   1447 N N     . ALA A 1 186 ? -8.537  26.317  -12.795 1.00 32.43  ? 186  ALA A N     1 
ATOM   1448 C CA    . ALA A 1 186 ? -7.225  25.696  -12.675 1.00 31.69  ? 186  ALA A CA    1 
ATOM   1449 C C     . ALA A 1 186 ? -6.607  25.944  -11.306 1.00 33.12  ? 186  ALA A C     1 
ATOM   1450 O O     . ALA A 1 186 ? -6.695  27.046  -10.765 1.00 37.40  ? 186  ALA A O     1 
ATOM   1451 C CB    . ALA A 1 186 ? -6.300  26.199  -13.771 1.00 31.68  ? 186  ALA A CB    1 
ATOM   1452 N N     . ALA A 1 187 ? -5.969  24.915  -10.755 1.00 35.98  ? 187  ALA A N     1 
ATOM   1453 C CA    . ALA A 1 187 ? -5.213  25.053  -9.515  1.00 39.61  ? 187  ALA A CA    1 
ATOM   1454 C C     . ALA A 1 187 ? -4.047  26.008  -9.733  1.00 40.37  ? 187  ALA A C     1 
ATOM   1455 O O     . ALA A 1 187 ? -3.463  26.532  -8.785  1.00 41.75  ? 187  ALA A O     1 
ATOM   1456 C CB    . ALA A 1 187 ? -4.706  23.700  -9.056  1.00 41.46  ? 187  ALA A CB    1 
ATOM   1457 N N     . ASN A 1 188 ? -3.651  26.161  -10.971 1.00 38.87  ? 188  ASN A N     1 
ATOM   1458 C CA    . ASN A 1 188 ? -2.597  27.051  -11.395 1.00 42.55  ? 188  ASN A CA    1 
ATOM   1459 C C     . ASN A 1 188 ? -2.825  28.536  -11.127 1.00 42.86  ? 188  ASN A C     1 
ATOM   1460 O O     . ASN A 1 188 ? -1.979  29.334  -11.407 1.00 43.65  ? 188  ASN A O     1 
ATOM   1461 C CB    . ASN A 1 188 ? -2.472  26.863  -12.899 1.00 44.22  ? 188  ASN A CB    1 
ATOM   1462 C CG    . ASN A 1 188 ? -1.099  26.812  -13.344 1.00 44.65  ? 188  ASN A CG    1 
ATOM   1463 O OD1   . ASN A 1 188 ? -0.200  26.653  -12.557 1.00 49.26  ? 188  ASN A OD1   1 
ATOM   1464 N ND2   . ASN A 1 188 ? -0.905  26.942  -14.619 1.00 43.54  ? 188  ASN A ND2   1 
ATOM   1465 N N     . THR A 1 189 ? -3.991  28.898  -10.628 1.00 43.05  ? 189  THR A N     1 
ATOM   1466 C CA    . THR A 1 189 ? -4.342  30.298  -10.425 1.00 41.65  ? 189  THR A CA    1 
ATOM   1467 C C     . THR A 1 189 ? -4.780  30.602  -8.992  1.00 44.10  ? 189  THR A C     1 
ATOM   1468 O O     . THR A 1 189 ? -4.932  29.699  -8.170  1.00 44.64  ? 189  THR A O     1 
ATOM   1469 C CB    . THR A 1 189 ? -5.479  30.718  -11.377 1.00 40.92  ? 189  THR A CB    1 
ATOM   1470 O OG1   . THR A 1 189 ? -6.648  29.940  -11.093 1.00 39.53  ? 189  THR A OG1   1 
ATOM   1471 C CG2   . THR A 1 189 ? -5.076  30.507  -12.829 1.00 35.04  ? 189  THR A CG2   1 
ATOM   1472 N N     . ASP A 1 190 ? -4.971  31.887  -8.704  1.00 45.20  ? 190  ASP A N     1 
ATOM   1473 C CA    . ASP A 1 190 ? -5.610  32.315  -7.470  1.00 44.27  ? 190  ASP A CA    1 
ATOM   1474 C C     . ASP A 1 190 ? -7.057  31.876  -7.584  1.00 43.47  ? 190  ASP A C     1 
ATOM   1475 O O     . ASP A 1 190 ? -7.843  32.507  -8.281  1.00 44.56  ? 190  ASP A O     1 
ATOM   1476 C CB    . ASP A 1 190 ? -5.532  33.836  -7.347  1.00 45.98  ? 190  ASP A CB    1 
ATOM   1477 C CG    . ASP A 1 190 ? -6.101  34.351  -6.039  1.00 46.59  ? 190  ASP A CG    1 
ATOM   1478 O OD1   . ASP A 1 190 ? -6.022  33.627  -5.023  1.00 44.73  ? 190  ASP A OD1   1 
ATOM   1479 O OD2   . ASP A 1 190 ? -6.618  35.489  -6.026  1.00 48.33  ? 190  ASP A OD2   1 
ATOM   1480 N N     . MET A 1 191 ? -7.409  30.783  -6.920  1.00 47.54  ? 191  MET A N     1 
ATOM   1481 C CA    . MET A 1 191 ? -8.695  30.144  -7.171  1.00 47.85  ? 191  MET A CA    1 
ATOM   1482 C C     . MET A 1 191 ? -9.884  30.928  -6.606  1.00 46.51  ? 191  MET A C     1 
ATOM   1483 O O     . MET A 1 191 ? -11.016 30.765  -7.067  1.00 50.78  ? 191  MET A O     1 
ATOM   1484 C CB    . MET A 1 191 ? -8.672  28.698  -6.678  1.00 48.01  ? 191  MET A CB    1 
ATOM   1485 C CG    . MET A 1 191 ? -7.792  27.803  -7.542  1.00 44.35  ? 191  MET A CG    1 
ATOM   1486 S SD    . MET A 1 191 ? -7.608  26.123  -6.931  1.00 58.12  ? 191  MET A SD    1 
ATOM   1487 C CE    . MET A 1 191 ? -5.986  26.225  -6.178  1.00 53.17  ? 191  MET A CE    1 
ATOM   1488 N N     . ALA A 1 192 ? -9.622  31.790  -5.624  1.00 48.64  ? 192  ALA A N     1 
ATOM   1489 C CA    . ALA A 1 192 ? -10.656 32.683  -5.101  1.00 46.37  ? 192  ALA A CA    1 
ATOM   1490 C C     . ALA A 1 192 ? -10.857 33.923  -5.967  1.00 50.38  ? 192  ALA A C     1 
ATOM   1491 O O     . ALA A 1 192 ? -11.580 34.851  -5.585  1.00 54.18  ? 192  ALA A O     1 
ATOM   1492 C CB    . ALA A 1 192 ? -10.365 33.069  -3.666  1.00 47.14  ? 192  ALA A CB    1 
ATOM   1493 N N     . THR A 1 193 ? -10.258 33.968  -7.145  1.00 51.77  ? 193  THR A N     1 
ATOM   1494 C CA    . THR A 1 193 ? -10.596 35.004  -8.122  1.00 45.53  ? 193  THR A CA    1 
ATOM   1495 C C     . THR A 1 193 ? -11.081 34.464  -9.444  1.00 43.32  ? 193  THR A C     1 
ATOM   1496 O O     . THR A 1 193 ? -11.232 35.208  -10.384 1.00 45.46  ? 193  THR A O     1 
ATOM   1497 C CB    . THR A 1 193 ? -9.446  36.001  -8.431  1.00 49.95  ? 193  THR A CB    1 
ATOM   1498 O OG1   . THR A 1 193 ? -8.371  35.355  -9.120  1.00 48.29  ? 193  THR A OG1   1 
ATOM   1499 C CG2   . THR A 1 193 ? -8.968  36.594  -7.212  1.00 46.38  ? 193  THR A CG2   1 
ATOM   1500 N N     . SER A 1 194 ? -11.299 33.172  -9.505  1.00 42.78  ? 194  SER A N     1 
ATOM   1501 C CA    . SER A 1 194 ? -11.840 32.540  -10.723 1.00 39.43  ? 194  SER A CA    1 
ATOM   1502 C C     . SER A 1 194 ? -13.089 33.253  -11.233 1.00 38.79  ? 194  SER A C     1 
ATOM   1503 O O     . SER A 1 194 ? -14.019 33.522  -10.474 1.00 34.20  ? 194  SER A O     1 
ATOM   1504 C CB    . SER A 1 194 ? -12.151 31.065  -10.467 1.00 40.95  ? 194  SER A CB    1 
ATOM   1505 O OG    . SER A 1 194 ? -12.690 30.465  -11.625 1.00 36.61  ? 194  SER A OG    1 
ATOM   1506 N N     . GLU A 1 195 ? -13.087 33.578  -12.520 1.00 34.29  ? 195  GLU A N     1 
ATOM   1507 C CA    . GLU A 1 195 ? -14.240 34.209  -13.144 1.00 35.50  ? 195  GLU A CA    1 
ATOM   1508 C C     . GLU A 1 195 ? -15.428 33.252  -13.180 1.00 37.35  ? 195  GLU A C     1 
ATOM   1509 O O     . GLU A 1 195 ? -16.586 33.677  -13.198 1.00 36.49  ? 195  GLU A O     1 
ATOM   1510 C CB    . GLU A 1 195 ? -13.904 34.677  -14.564 1.00 33.28  ? 195  GLU A CB    1 
ATOM   1511 C CG    . GLU A 1 195 ? -12.857 35.780  -14.625 1.00 39.51  ? 195  GLU A CG    1 
ATOM   1512 C CD    . GLU A 1 195 ? -13.381 37.111  -14.128 1.00 38.40  ? 195  GLU A CD    1 
ATOM   1513 O OE1   . GLU A 1 195 ? -14.436 37.556  -14.628 1.00 36.43  ? 195  GLU A OE1   1 
ATOM   1514 O OE2   . GLU A 1 195 ? -12.743 37.709  -13.237 1.00 41.16  ? 195  GLU A OE2   1 
ATOM   1515 N N     . ALA A 1 196 ? -15.125 31.958  -13.188 1.00 32.75  ? 196  ALA A N     1 
ATOM   1516 C CA    . ALA A 1 196 ? -16.139 30.915  -13.223 1.00 32.27  ? 196  ALA A CA    1 
ATOM   1517 C C     . ALA A 1 196 ? -16.947 30.904  -11.932 1.00 34.74  ? 196  ALA A C     1 
ATOM   1518 O O     . ALA A 1 196 ? -18.177 30.883  -11.961 1.00 33.53  ? 196  ALA A O     1 
ATOM   1519 C CB    . ALA A 1 196 ? -15.489 29.561  -13.459 1.00 31.54  ? 196  ALA A CB    1 
ATOM   1520 N N     . LEU A 1 197 ? -16.249 30.924  -10.801 1.00 30.93  ? 197  LEU A N     1 
ATOM   1521 C CA    . LEU A 1 197 ? -16.897 30.940  -9.495  1.00 35.53  ? 197  LEU A CA    1 
ATOM   1522 C C     . LEU A 1 197 ? -17.643 32.251  -9.264  1.00 38.44  ? 197  LEU A C     1 
ATOM   1523 O O     . LEU A 1 197 ? -18.733 32.267  -8.693  1.00 39.43  ? 197  LEU A O     1 
ATOM   1524 C CB    . LEU A 1 197 ? -15.861 30.726  -8.392  1.00 34.15  ? 197  LEU A CB    1 
ATOM   1525 C CG    . LEU A 1 197 ? -15.085 29.409  -8.442  1.00 34.23  ? 197  LEU A CG    1 
ATOM   1526 C CD1   . LEU A 1 197 ? -13.977 29.418  -7.410  1.00 41.42  ? 197  LEU A CD1   1 
ATOM   1527 C CD2   . LEU A 1 197 ? -16.011 28.228  -8.218  1.00 30.65  ? 197  LEU A CD2   1 
ATOM   1528 N N     . LYS A 1 198 ? -17.073 33.354  -9.718  1.00 39.47  ? 198  LYS A N     1 
ATOM   1529 C CA    . LYS A 1 198 ? -17.663 34.661  -9.530  1.00 38.81  ? 198  LYS A CA    1 
ATOM   1530 C C     . LYS A 1 198 ? -18.973 34.860  -10.276 1.00 36.97  ? 198  LYS A C     1 
ATOM   1531 O O     . LYS A 1 198 ? -19.910 35.396  -9.763  1.00 35.27  ? 198  LYS A O     1 
ATOM   1532 C CB    . LYS A 1 198 ? -16.687 35.758  -9.929  1.00 39.61  ? 198  LYS A CB    1 
ATOM   1533 C CG    . LYS A 1 198 ? -15.596 35.954  -8.964  1.00 47.09  ? 198  LYS A CG    1 
ATOM   1534 C CD    . LYS A 1 198 ? -14.410 36.792  -9.493  1.00 51.60  ? 198  LYS A CD    1 
ATOM   1535 C CE    . LYS A 1 198 ? -14.787 38.192  -9.862  1.00 53.73  ? 198  LYS A CE    1 
ATOM   1536 N NZ    . LYS A 1 198 ? -13.617 38.982  -10.303 1.00 54.67  ? 198  LYS A NZ    1 
ATOM   1537 N N     . ILE A 1 199 ? -19.005 34.426  -11.504 1.00 34.81  ? 199  ILE A N     1 
ATOM   1538 C CA    . ILE A 1 199 ? -20.215 34.580  -12.293 1.00 33.06  ? 199  ILE A CA    1 
ATOM   1539 C C     . ILE A 1 199 ? -21.279 33.608  -11.795 1.00 36.26  ? 199  ILE A C     1 
ATOM   1540 O O     . ILE A 1 199 ? -22.474 33.845  -11.961 1.00 34.69  ? 199  ILE A O     1 
ATOM   1541 C CB    . ILE A 1 199 ? -19.954 34.395  -13.807 1.00 33.21  ? 199  ILE A CB    1 
ATOM   1542 C CG1   . ILE A 1 199 ? -21.029 35.118  -14.623 1.00 30.54  ? 199  ILE A CG1   1 
ATOM   1543 C CG2   . ILE A 1 199 ? -19.880 32.921  -14.177 1.00 30.23  ? 199  ILE A CG2   1 
ATOM   1544 C CD1   . ILE A 1 199 ? -20.755 35.150  -16.107 1.00 33.62  ? 199  ILE A CD1   1 
ATOM   1545 N N     . SER A 1 200 ? -20.839 32.528  -11.156 1.00 34.68  ? 200  SER A N     1 
ATOM   1546 C CA    . SER A 1 200 ? -21.753 31.534  -10.609 1.00 33.68  ? 200  SER A CA    1 
ATOM   1547 C C     . SER A 1 200 ? -22.443 32.057  -9.352  1.00 34.15  ? 200  SER A C     1 
ATOM   1548 O O     . SER A 1 200 ? -23.584 31.694  -9.067  1.00 32.81  ? 200  SER A O     1 
ATOM   1549 C CB    . SER A 1 200 ? -21.011 30.229  -10.302 1.00 31.46  ? 200  SER A CB    1 
ATOM   1550 O OG    . SER A 1 200 ? -20.510 29.637  -11.487 1.00 29.47  ? 200  SER A OG    1 
ATOM   1551 N N     . ARG A 1 201 ? -21.749 32.869  -8.579  1.00 36.44  ? 201  ARG A N     1 
ATOM   1552 C CA    . ARG A 1 201 ? -22.315 33.475  -7.399  1.00 37.70  ? 201  ARG A CA    1 
ATOM   1553 C C     . ARG A 1 201 ? -23.315 34.567  -7.718  1.00 38.40  ? 201  ARG A C     1 
ATOM   1554 O O     . ARG A 1 201 ? -23.942 35.083  -6.848  1.00 39.85  ? 201  ARG A O     1 
ATOM   1555 C CB    . ARG A 1 201 ? -21.245 34.063  -6.519  1.00 36.50  ? 201  ARG A CB    1 
ATOM   1556 C CG    . ARG A 1 201 ? -20.294 33.110  -5.954  1.00 42.38  ? 201  ARG A CG    1 
ATOM   1557 C CD    . ARG A 1 201 ? -19.251 33.816  -5.119  1.00 45.62  ? 201  ARG A CD    1 
ATOM   1558 N NE    . ARG A 1 201 ? -18.010 33.070  -5.020  1.00 52.42  ? 201  ARG A NE    1 
ATOM   1559 C CZ    . ARG A 1 201 ? -16.852 33.465  -5.511  1.00 48.55  ? 201  ARG A CZ    1 
ATOM   1560 N NH1   . ARG A 1 201 ? -16.744 34.607  -6.143  1.00 43.50  ? 201  ARG A NH1   1 
ATOM   1561 N NH2   . ARG A 1 201 ? -15.797 32.705  -5.354  1.00 48.24  ? 201  ARG A NH2   1 
ATOM   1562 N N     . GLU A 1 202 ? -23.464 34.906  -8.979  1.00 37.20  ? 202  GLU A N     1 
ATOM   1563 C CA    . GLU A 1 202 ? -24.379 35.961  -9.376  1.00 38.22  ? 202  GLU A CA    1 
ATOM   1564 C C     . GLU A 1 202 ? -25.810 35.434  -9.474  1.00 39.57  ? 202  GLU A C     1 
ATOM   1565 O O     . GLU A 1 202 ? -26.773 36.195  -9.382  1.00 42.26  ? 202  GLU A O     1 
ATOM   1566 C CB    . GLU A 1 202 ? -23.911 36.595  -10.686 1.00 39.88  ? 202  GLU A CB    1 
ATOM   1567 C CG    . GLU A 1 202 ? -22.586 37.339  -10.542 1.00 43.54  ? 202  GLU A CG    1 
ATOM   1568 C CD    . GLU A 1 202 ? -22.719 38.569  -9.668  1.00 48.55  ? 202  GLU A CD    1 
ATOM   1569 O OE1   . GLU A 1 202 ? -23.781 39.219  -9.733  1.00 50.21  ? 202  GLU A OE1   1 
ATOM   1570 O OE2   . GLU A 1 202 ? -21.776 38.880  -8.911  1.00 49.91  ? 202  GLU A OE2   1 
ATOM   1571 N N     . VAL A 1 203 ? -25.940 34.122  -9.634  1.00 36.97  ? 203  VAL A N     1 
ATOM   1572 C CA    . VAL A 1 203 ? -27.246 33.475  -9.656  1.00 36.65  ? 203  VAL A CA    1 
ATOM   1573 C C     . VAL A 1 203 ? -27.350 32.488  -8.499  1.00 34.97  ? 203  VAL A C     1 
ATOM   1574 O O     . VAL A 1 203 ? -28.443 32.098  -8.095  1.00 38.75  ? 203  VAL A O     1 
ATOM   1575 C CB    . VAL A 1 203 ? -27.489 32.739  -10.986 1.00 36.04  ? 203  VAL A CB    1 
ATOM   1576 C CG1   . VAL A 1 203 ? -27.475 33.727  -12.144 1.00 33.92  ? 203  VAL A CG1   1 
ATOM   1577 C CG2   . VAL A 1 203 ? -26.443 31.652  -11.192 1.00 33.34  ? 203  VAL A CG2   1 
ATOM   1578 N N     . ASP A 1 204 ? -26.194 32.094  -7.975  1.00 38.21  ? 204  ASP A N     1 
ATOM   1579 C CA    . ASP A 1 204 ? -26.111 31.183  -6.845  1.00 36.54  ? 204  ASP A CA    1 
ATOM   1580 C C     . ASP A 1 204 ? -25.128 31.787  -5.851  1.00 38.33  ? 204  ASP A C     1 
ATOM   1581 O O     . ASP A 1 204 ? -24.025 31.264  -5.677  1.00 38.59  ? 204  ASP A O     1 
ATOM   1582 C CB    . ASP A 1 204 ? -25.622 29.810  -7.320  1.00 36.53  ? 204  ASP A CB    1 
ATOM   1583 C CG    . ASP A 1 204 ? -25.854 28.711  -6.301  1.00 38.82  ? 204  ASP A CG    1 
ATOM   1584 O OD1   . ASP A 1 204 ? -26.829 28.796  -5.524  1.00 42.46  ? 204  ASP A OD1   1 
ATOM   1585 O OD2   . ASP A 1 204 ? -25.059 27.748  -6.290  1.00 34.05  ? 204  ASP A OD2   1 
ATOM   1586 N N     . PRO A 1 205 ? -25.550 32.804  -5.101  1.00 39.18  ? 205  PRO A N     1 
ATOM   1587 C CA    . PRO A 1 205 ? -24.681 33.623  -4.258  1.00 42.37  ? 205  PRO A CA    1 
ATOM   1588 C C     . PRO A 1 205 ? -23.922 32.839  -3.240  1.00 42.07  ? 205  PRO A C     1 
ATOM   1589 O O     . PRO A 1 205 ? -22.719 32.843  -3.124  1.00 45.65  ? 205  PRO A O     1 
ATOM   1590 C CB    . PRO A 1 205 ? -25.654 34.562  -3.575  1.00 39.76  ? 205  PRO A CB    1 
ATOM   1591 C CG    . PRO A 1 205 ? -26.923 34.039  -3.789  1.00 36.71  ? 205  PRO A CG    1 
ATOM   1592 C CD    . PRO A 1 205 ? -26.932 33.251  -4.996  1.00 39.65  ? 205  PRO A CD    1 
ATOM   1593 N N     . ASP A 1 206 ? -24.693 32.165  -2.447  1.00 47.92  ? 206  ASP A N     1 
ATOM   1594 C CA    . ASP A 1 206 ? -24.157 31.025  -1.723  1.00 47.44  ? 206  ASP A CA    1 
ATOM   1595 C C     . ASP A 1 206 ? -24.163 29.885  -2.734  1.00 48.61  ? 206  ASP A C     1 
ATOM   1596 O O     . ASP A 1 206 ? -25.130 29.715  -3.473  1.00 55.16  ? 206  ASP A O     1 
ATOM   1597 C CB    . ASP A 1 206 ? -25.019 30.710  -0.491  1.00 46.91  ? 206  ASP A CB    1 
ATOM   1598 C CG    . ASP A 1 206 ? -25.365 29.234  -0.362  1.00 57.92  ? 206  ASP A CG    1 
ATOM   1599 O OD1   . ASP A 1 206 ? -24.451 28.381  -0.388  1.00 60.86  ? 206  ASP A OD1   1 
ATOM   1600 O OD2   . ASP A 1 206 ? -26.569 28.934  -0.228  1.00 60.84  ? 206  ASP A OD2   1 
ATOM   1601 N N     . GLY A 1 207 ? -23.082 29.115  -2.784  1.00 46.30  ? 207  GLY A N     1 
ATOM   1602 C CA    . GLY A 1 207 ? -22.905 28.141  -3.847  1.00 42.16  ? 207  GLY A CA    1 
ATOM   1603 C C     . GLY A 1 207 ? -23.552 26.792  -3.600  1.00 43.28  ? 207  GLY A C     1 
ATOM   1604 O O     . GLY A 1 207 ? -22.863 25.776  -3.505  1.00 38.87  ? 207  GLY A O     1 
ATOM   1605 N N     . ARG A 1 208 ? -24.878 26.775  -3.516  1.00 44.17  ? 208  ARG A N     1 
ATOM   1606 C CA    . ARG A 1 208 ? -25.603 25.546  -3.207  1.00 40.73  ? 208  ARG A CA    1 
ATOM   1607 C C     . ARG A 1 208 ? -25.949 24.732  -4.452  1.00 38.80  ? 208  ARG A C     1 
ATOM   1608 O O     . ARG A 1 208 ? -26.309 23.560  -4.351  1.00 34.97  ? 208  ARG A O     1 
ATOM   1609 C CB    . ARG A 1 208 ? -26.873 25.853  -2.409  1.00 41.62  ? 208  ARG A CB    1 
ATOM   1610 C CG    . ARG A 1 208 ? -27.933 26.619  -3.182  1.00 46.41  ? 208  ARG A CG    1 
ATOM   1611 C CD    . ARG A 1 208 ? -29.112 26.964  -2.284  1.00 54.79  ? 208  ARG A CD    1 
ATOM   1612 N NE    . ARG A 1 208 ? -28.696 27.765  -1.136  1.00 53.69  ? 208  ARG A NE    1 
ATOM   1613 C CZ    . ARG A 1 208 ? -29.485 28.078  -0.113  1.00 57.88  ? 208  ARG A CZ    1 
ATOM   1614 N NH1   . ARG A 1 208 ? -30.741 27.654  -0.084  1.00 62.90  ? 208  ARG A NH1   1 
ATOM   1615 N NH2   . ARG A 1 208 ? -29.015 28.813  0.886   1.00 57.44  ? 208  ARG A NH2   1 
ATOM   1616 N N     . ARG A 1 209 ? -25.839 25.358  -5.621  1.00 42.24  ? 209  ARG A N     1 
ATOM   1617 C CA    . ARG A 1 209 ? -26.111 24.686  -6.889  1.00 34.06  ? 209  ARG A CA    1 
ATOM   1618 C C     . ARG A 1 209 ? -24.823 24.407  -7.649  1.00 30.69  ? 209  ARG A C     1 
ATOM   1619 O O     . ARG A 1 209 ? -24.857 23.964  -8.796  1.00 25.98  ? 209  ARG A O     1 
ATOM   1620 C CB    . ARG A 1 209 ? -27.020 25.546  -7.774  1.00 38.87  ? 209  ARG A CB    1 
ATOM   1621 C CG    . ARG A 1 209 ? -28.483 25.538  -7.390  1.00 36.90  ? 209  ARG A CG    1 
ATOM   1622 C CD    . ARG A 1 209 ? -29.363 25.994  -8.551  1.00 34.57  ? 209  ARG A CD    1 
ATOM   1623 N NE    . ARG A 1 209 ? -29.225 27.418  -8.856  1.00 33.81  ? 209  ARG A NE    1 
ATOM   1624 C CZ    . ARG A 1 209 ? -28.739 27.899  -9.997  1.00 30.10  ? 209  ARG A CZ    1 
ATOM   1625 N NH1   . ARG A 1 209 ? -28.335 27.074  -10.952 1.00 29.29  ? 209  ARG A NH1   1 
ATOM   1626 N NH2   . ARG A 1 209 ? -28.659 29.209  -10.186 1.00 35.19  ? 209  ARG A NH2   1 
ATOM   1627 N N     . THR A 1 210 ? -23.689 24.671  -7.009  1.00 30.82  ? 210  THR A N     1 
ATOM   1628 C CA    . THR A 1 210 ? -22.410 24.662  -7.708  1.00 30.31  ? 210  THR A CA    1 
ATOM   1629 C C     . THR A 1 210 ? -21.480 23.541  -7.253  1.00 32.60  ? 210  THR A C     1 
ATOM   1630 O O     . THR A 1 210 ? -21.379 23.245  -6.063  1.00 34.21  ? 210  THR A O     1 
ATOM   1631 C CB    . THR A 1 210 ? -21.689 26.022  -7.553  1.00 31.66  ? 210  THR A CB    1 
ATOM   1632 O OG1   . THR A 1 210 ? -22.599 27.085  -7.862  1.00 31.87  ? 210  THR A OG1   1 
ATOM   1633 C CG2   . THR A 1 210 ? -20.483 26.110  -8.477  1.00 27.80  ? 210  THR A CG2   1 
ATOM   1634 N N     . LEU A 1 211 ? -20.815 22.912  -8.217  1.00 29.87  ? 211  LEU A N     1 
ATOM   1635 C CA    . LEU A 1 211 ? -19.753 21.959  -7.932  1.00 28.56  ? 211  LEU A CA    1 
ATOM   1636 C C     . LEU A 1 211 ? -18.477 22.470  -8.589  1.00 31.27  ? 211  LEU A C     1 
ATOM   1637 O O     . LEU A 1 211 ? -18.479 22.829  -9.766  1.00 29.68  ? 211  LEU A O     1 
ATOM   1638 C CB    . LEU A 1 211 ? -20.115 20.567  -8.457  1.00 28.20  ? 211  LEU A CB    1 
ATOM   1639 C CG    . LEU A 1 211 ? -19.373 19.365  -7.860  1.00 34.32  ? 211  LEU A CG    1 
ATOM   1640 C CD1   . LEU A 1 211 ? -20.216 18.107  -7.997  1.00 30.83  ? 211  LEU A CD1   1 
ATOM   1641 C CD2   . LEU A 1 211 ? -18.009 19.158  -8.506  1.00 29.55  ? 211  LEU A CD2   1 
ATOM   1642 N N     . ALA A 1 212 ? -17.391 22.512  -7.824  1.00 26.29  ? 212  ALA A N     1 
ATOM   1643 C CA    . ALA A 1 212 ? -16.131 23.046  -8.325  1.00 26.51  ? 212  ALA A CA    1 
ATOM   1644 C C     . ALA A 1 212 ? -15.190 21.939  -8.779  1.00 32.14  ? 212  ALA A C     1 
ATOM   1645 O O     . ALA A 1 212 ? -14.925 20.992  -8.039  1.00 28.31  ? 212  ALA A O     1 
ATOM   1646 C CB    . ALA A 1 212 ? -15.461 23.910  -7.265  1.00 27.94  ? 212  ALA A CB    1 
ATOM   1647 N N     . VAL A 1 213 ? -14.692 22.062  -10.005 1.00 33.39  ? 213  VAL A N     1 
ATOM   1648 C CA    . VAL A 1 213 ? -13.692 21.135  -10.518 1.00 27.92  ? 213  VAL A CA    1 
ATOM   1649 C C     . VAL A 1 213 ? -12.343 21.832  -10.630 1.00 32.88  ? 213  VAL A C     1 
ATOM   1650 O O     . VAL A 1 213 ? -12.201 22.827  -11.341 1.00 33.00  ? 213  VAL A O     1 
ATOM   1651 C CB    . VAL A 1 213 ? -14.089 20.556  -11.887 1.00 29.59  ? 213  VAL A CB    1 
ATOM   1652 C CG1   . VAL A 1 213 ? -12.931 19.772  -12.488 1.00 27.27  ? 213  VAL A CG1   1 
ATOM   1653 C CG2   . VAL A 1 213 ? -15.324 19.678  -11.751 1.00 26.66  ? 213  VAL A CG2   1 
ATOM   1654 N N     . ILE A 1 214 ? -11.357 21.308  -9.912  1.00 32.64  ? 214  ILE A N     1 
ATOM   1655 C CA    . ILE A 1 214 ? -10.020 21.884  -9.911  1.00 33.67  ? 214  ILE A CA    1 
ATOM   1656 C C     . ILE A 1 214 ? -9.102  21.101  -10.843 1.00 32.29  ? 214  ILE A C     1 
ATOM   1657 O O     . ILE A 1 214 ? -8.793  19.937  -10.593 1.00 26.90  ? 214  ILE A O     1 
ATOM   1658 C CB    . ILE A 1 214 ? -9.421  21.893  -8.492  1.00 34.25  ? 214  ILE A CB    1 
ATOM   1659 C CG1   . ILE A 1 214 ? -10.355 22.618  -7.522  1.00 36.86  ? 214  ILE A CG1   1 
ATOM   1660 C CG2   . ILE A 1 214 ? -8.053  22.547  -8.497  1.00 36.31  ? 214  ILE A CG2   1 
ATOM   1661 C CD1   . ILE A 1 214 ? -10.581 24.073  -7.865  1.00 35.34  ? 214  ILE A CD1   1 
ATOM   1662 N N     . THR A 1 215 ? -8.669  21.745  -11.922 1.00 33.25  ? 215  THR A N     1 
ATOM   1663 C CA    . THR A 1 215 ? -7.796  21.095  -12.891 1.00 29.08  ? 215  THR A CA    1 
ATOM   1664 C C     . THR A 1 215 ? -6.349  21.545  -12.727 1.00 32.84  ? 215  THR A C     1 
ATOM   1665 O O     . THR A 1 215 ? -6.053  22.437  -11.930 1.00 32.70  ? 215  THR A O     1 
ATOM   1666 C CB    . THR A 1 215 ? -8.239  21.389  -14.335 1.00 31.48  ? 215  THR A CB    1 
ATOM   1667 O OG1   . THR A 1 215 ? -8.027  22.776  -14.630 1.00 33.23  ? 215  THR A OG1   1 
ATOM   1668 C CG2   . THR A 1 215 ? -9.710  21.052  -14.521 1.00 27.27  ? 215  THR A CG2   1 
ATOM   1669 N N     . LYS A 1 216 ? -5.458  20.910  -13.485 1.00 31.14  ? 216  LYS A N     1 
ATOM   1670 C CA    . LYS A 1 216 ? -4.049  21.290  -13.548 1.00 31.20  ? 216  LYS A CA    1 
ATOM   1671 C C     . LYS A 1 216 ? -3.333  21.229  -12.201 1.00 36.24  ? 216  LYS A C     1 
ATOM   1672 O O     . LYS A 1 216 ? -2.569  22.130  -11.853 1.00 37.06  ? 216  LYS A O     1 
ATOM   1673 C CB    . LYS A 1 216 ? -3.893  22.678  -14.177 1.00 32.22  ? 216  LYS A CB    1 
ATOM   1674 C CG    . LYS A 1 216 ? -4.479  22.783  -15.575 1.00 31.54  ? 216  LYS A CG    1 
ATOM   1675 C CD    . LYS A 1 216 ? -4.149  24.116  -16.222 1.00 38.73  ? 216  LYS A CD    1 
ATOM   1676 C CE    . LYS A 1 216 ? -4.539  24.120  -17.692 1.00 41.24  ? 216  LYS A CE    1 
ATOM   1677 N NZ    . LYS A 1 216 ? -4.054  25.341  -18.390 1.00 44.94  ? 216  LYS A NZ    1 
ATOM   1678 N N     . LEU A 1 217 ? -3.575  20.156  -11.454 1.00 28.16  ? 217  LEU A N     1 
ATOM   1679 C CA    . LEU A 1 217 ? -2.913  19.950  -10.172 1.00 37.71  ? 217  LEU A CA    1 
ATOM   1680 C C     . LEU A 1 217 ? -1.421  19.691  -10.356 1.00 35.76  ? 217  LEU A C     1 
ATOM   1681 O O     . LEU A 1 217 ? -0.625  19.908  -9.443  1.00 38.48  ? 217  LEU A O     1 
ATOM   1682 C CB    . LEU A 1 217 ? -3.557  18.784  -9.419  1.00 39.14  ? 217  LEU A CB    1 
ATOM   1683 C CG    . LEU A 1 217 ? -4.996  18.991  -8.946  1.00 36.81  ? 217  LEU A CG    1 
ATOM   1684 C CD1   . LEU A 1 217 ? -5.563  17.698  -8.379  1.00 38.15  ? 217  LEU A CD1   1 
ATOM   1685 C CD2   . LEU A 1 217 ? -5.058  20.104  -7.915  1.00 38.73  ? 217  LEU A CD2   1 
ATOM   1686 N N     . ASP A 1 218 ? -1.049  19.230  -11.545 1.00 33.46  ? 218  ASP A N     1 
ATOM   1687 C CA    . ASP A 1 218 ? 0.340   18.907  -11.851 1.00 38.91  ? 218  ASP A CA    1 
ATOM   1688 C C     . ASP A 1 218 ? 1.146   20.137  -12.272 1.00 37.50  ? 218  ASP A C     1 
ATOM   1689 O O     . ASP A 1 218 ? 2.345   20.039  -12.534 1.00 34.52  ? 218  ASP A O     1 
ATOM   1690 C CB    . ASP A 1 218 ? 0.400   17.849  -12.956 1.00 32.94  ? 218  ASP A CB    1 
ATOM   1691 C CG    . ASP A 1 218 ? -0.314  18.287  -14.223 1.00 36.46  ? 218  ASP A CG    1 
ATOM   1692 O OD1   . ASP A 1 218 ? 0.226   18.049  -15.324 1.00 40.96  ? 218  ASP A OD1   1 
ATOM   1693 O OD2   . ASP A 1 218 ? -1.415  18.869  -14.120 1.00 34.50  ? 218  ASP A OD2   1 
ATOM   1694 N N     . LEU A 1 219 ? 0.489   21.291  -12.328 1.00 36.09  ? 219  LEU A N     1 
ATOM   1695 C CA    . LEU A 1 219 ? 1.115   22.496  -12.866 1.00 37.92  ? 219  LEU A CA    1 
ATOM   1696 C C     . LEU A 1 219 ? 1.368   23.585  -11.827 1.00 33.62  ? 219  LEU A C     1 
ATOM   1697 O O     . LEU A 1 219 ? 1.773   24.693  -12.175 1.00 33.65  ? 219  LEU A O     1 
ATOM   1698 C CB    . LEU A 1 219 ? 0.264   23.071  -14.001 1.00 36.24  ? 219  LEU A CB    1 
ATOM   1699 C CG    . LEU A 1 219 ? 0.156   22.227  -15.270 1.00 38.22  ? 219  LEU A CG    1 
ATOM   1700 C CD1   . LEU A 1 219 ? -0.680  22.944  -16.315 1.00 33.21  ? 219  LEU A CD1   1 
ATOM   1701 C CD2   . LEU A 1 219 ? 1.540   21.920  -15.808 1.00 37.99  ? 219  LEU A CD2   1 
ATOM   1702 N N     . MET A 1 220 ? 1.137   23.274  -10.557 1.00 35.63  ? 220  MET A N     1 
ATOM   1703 C CA    . MET A 1 220 ? 1.241   24.282  -9.506  1.00 39.21  ? 220  MET A CA    1 
ATOM   1704 C C     . MET A 1 220 ? 2.681   24.688  -9.207  1.00 38.93  ? 220  MET A C     1 
ATOM   1705 O O     . MET A 1 220 ? 3.621   23.962  -9.526  1.00 39.00  ? 220  MET A O     1 
ATOM   1706 C CB    . MET A 1 220 ? 0.556   23.793  -8.231  1.00 35.46  ? 220  MET A CB    1 
ATOM   1707 C CG    . MET A 1 220 ? -0.883  23.374  -8.443  1.00 39.70  ? 220  MET A CG    1 
ATOM   1708 S SD    . MET A 1 220 ? -1.774  23.227  -6.891  1.00 41.97  ? 220  MET A SD    1 
ATOM   1709 C CE    . MET A 1 220 ? -1.630  24.903  -6.275  1.00 46.46  ? 220  MET A CE    1 
ATOM   1710 N N     . ASP A 1 221 ? 2.839   25.857  -8.589  1.00 43.23  ? 221  ASP A N     1 
ATOM   1711 C CA    . ASP A 1 221 ? 4.154   26.363  -8.209  1.00 44.86  ? 221  ASP A CA    1 
ATOM   1712 C C     . ASP A 1 221 ? 4.851   25.418  -7.235  1.00 46.82  ? 221  ASP A C     1 
ATOM   1713 O O     . ASP A 1 221 ? 4.210   24.573  -6.609  1.00 48.75  ? 221  ASP A O     1 
ATOM   1714 C CB    . ASP A 1 221 ? 4.039   27.758  -7.588  1.00 41.49  ? 221  ASP A CB    1 
ATOM   1715 C CG    . ASP A 1 221 ? 3.542   28.798  -8.575  1.00 50.68  ? 221  ASP A CG    1 
ATOM   1716 O OD1   . ASP A 1 221 ? 3.702   28.584  -9.795  1.00 51.52  ? 221  ASP A OD1   1 
ATOM   1717 O OD2   . ASP A 1 221 ? 2.997   29.830  -8.130  1.00 49.36  ? 221  ASP A OD2   1 
ATOM   1718 N N     . ALA A 1 222 ? 6.166   25.570  -7.115  1.00 48.19  ? 222  ALA A N     1 
ATOM   1719 C CA    . ALA A 1 222 ? 6.972   24.723  -6.244  1.00 49.14  ? 222  ALA A CA    1 
ATOM   1720 C C     . ALA A 1 222 ? 6.557   24.849  -4.785  1.00 50.70  ? 222  ALA A C     1 
ATOM   1721 O O     . ALA A 1 222 ? 6.621   25.932  -4.205  1.00 45.97  ? 222  ALA A O     1 
ATOM   1722 C CB    . ALA A 1 222 ? 8.441   25.069  -6.395  1.00 51.55  ? 222  ALA A CB    1 
ATOM   1723 N N     . GLY A 1 223 ? 6.137   23.742  -4.187  1.00 52.03  ? 223  GLY A N     1 
ATOM   1724 C CA    . GLY A 1 223 ? 5.797   23.746  -2.777  1.00 55.74  ? 223  GLY A CA    1 
ATOM   1725 C C     . GLY A 1 223 ? 4.491   24.452  -2.481  1.00 57.28  ? 223  GLY A C     1 
ATOM   1726 O O     . GLY A 1 223 ? 4.309   25.009  -1.396  1.00 63.12  ? 223  GLY A O     1 
ATOM   1727 N N     . THR A 1 224 ? 3.572   24.410  -3.438  1.00 56.20  ? 224  THR A N     1 
ATOM   1728 C CA    . THR A 1 224 ? 2.152   24.437  -3.124  1.00 55.07  ? 224  THR A CA    1 
ATOM   1729 C C     . THR A 1 224 ? 1.524   23.078  -3.398  1.00 59.56  ? 224  THR A C     1 
ATOM   1730 O O     . THR A 1 224 ? 1.677   22.517  -4.483  1.00 60.29  ? 224  THR A O     1 
ATOM   1731 C CB    . THR A 1 224 ? 1.412   25.510  -3.943  1.00 56.11  ? 224  THR A CB    1 
ATOM   1732 O OG1   . THR A 1 224 ? 1.821   25.435  -5.314  1.00 52.33  ? 224  THR A OG1   1 
ATOM   1733 C CG2   . THR A 1 224 ? 1.718   26.898  -3.402  1.00 59.57  ? 224  THR A CG2   1 
ATOM   1734 N N     . ASP A 1 225 ? 0.816   22.553  -2.404  1.00 66.89  ? 225  ASP A N     1 
ATOM   1735 C CA    . ASP A 1 225 ? -0.358  21.733  -2.660  1.00 62.66  ? 225  ASP A CA    1 
ATOM   1736 C C     . ASP A 1 225 ? -1.621  22.462  -2.222  1.00 69.75  ? 225  ASP A C     1 
ATOM   1737 O O     . ASP A 1 225 ? -1.726  22.923  -1.086  1.00 76.99  ? 225  ASP A O     1 
ATOM   1738 C CB    . ASP A 1 225 ? -0.245  20.393  -1.932  1.00 68.38  ? 225  ASP A CB    1 
ATOM   1739 C CG    . ASP A 1 225 ? -0.257  20.546  -0.424  1.00 74.94  ? 225  ASP A CG    1 
ATOM   1740 O OD1   . ASP A 1 225 ? -1.345  20.431  0.179   1.00 79.01  ? 225  ASP A OD1   1 
ATOM   1741 O OD2   . ASP A 1 225 ? 0.822   20.781  0.160   1.00 81.18  ? 225  ASP A OD2   1 
ATOM   1742 N N     . ALA A 1 226 ? -2.607  22.495  -3.111  1.00 62.48  ? 226  ALA A N     1 
ATOM   1743 C CA    . ALA A 1 226 ? -3.919  22.977  -2.732  1.00 67.01  ? 226  ALA A CA    1 
ATOM   1744 C C     . ALA A 1 226 ? -4.603  21.813  -2.047  1.00 64.47  ? 226  ALA A C     1 
ATOM   1745 O O     . ALA A 1 226 ? -5.543  21.214  -2.569  1.00 60.16  ? 226  ALA A O     1 
ATOM   1746 C CB    . ALA A 1 226 ? -4.702  23.414  -3.958  1.00 63.30  ? 226  ALA A CB    1 
ATOM   1747 N N     . MET A 1 227 ? -4.101  21.508  -0.855  1.00 63.94  ? 227  MET A N     1 
ATOM   1748 C CA    . MET A 1 227 ? -4.876  20.832  0.166   1.00 65.91  ? 227  MET A CA    1 
ATOM   1749 C C     . MET A 1 227 ? -6.060  21.699  0.555   1.00 61.45  ? 227  MET A C     1 
ATOM   1750 O O     . MET A 1 227 ? -7.158  21.189  0.777   1.00 61.31  ? 227  MET A O     1 
ATOM   1751 C CB    . MET A 1 227 ? -4.010  20.540  1.393   1.00 65.45  ? 227  MET A CB    1 
ATOM   1752 C CG    . MET A 1 227 ? -3.815  19.059  1.676   1.00 60.72  ? 227  MET A CG    1 
ATOM   1753 S SD    . MET A 1 227 ? -2.114  18.654  2.118   1.00 80.62  ? 227  MET A SD    1 
ATOM   1754 C CE    . MET A 1 227 ? -1.842  17.195  1.116   1.00 62.75  ? 227  MET A CE    1 
ATOM   1755 N N     . ASP A 1 228 ? -5.848  23.010  0.639   1.00 57.98  ? 228  ASP A N     1 
ATOM   1756 C CA    . ASP A 1 228 ? -6.984  23.889  0.891   1.00 63.29  ? 228  ASP A CA    1 
ATOM   1757 C C     . ASP A 1 228 ? -8.024  23.778  -0.219  1.00 65.24  ? 228  ASP A C     1 
ATOM   1758 O O     . ASP A 1 228 ? -9.227  23.770  0.042   1.00 62.78  ? 228  ASP A O     1 
ATOM   1759 C CB    . ASP A 1 228 ? -6.518  25.339  1.033   1.00 67.92  ? 228  ASP A CB    1 
ATOM   1760 C CG    . ASP A 1 228 ? -5.599  25.542  2.221   1.00 64.74  ? 228  ASP A CG    1 
ATOM   1761 O OD1   . ASP A 1 228 ? -5.704  24.768  3.195   1.00 62.64  ? 228  ASP A OD1   1 
ATOM   1762 O OD2   . ASP A 1 228 ? -4.772  26.477  2.181   1.00 70.95  ? 228  ASP A OD2   1 
ATOM   1763 N N     . VAL A 1 229 ? -7.552  23.693  -1.459  1.00 68.99  ? 229  VAL A N     1 
ATOM   1764 C CA    . VAL A 1 229 ? -8.431  23.466  -2.599  1.00 62.29  ? 229  VAL A CA    1 
ATOM   1765 C C     . VAL A 1 229 ? -9.135  22.117  -2.494  1.00 64.14  ? 229  VAL A C     1 
ATOM   1766 O O     . VAL A 1 229 ? -10.319 21.998  -2.806  1.00 64.99  ? 229  VAL A O     1 
ATOM   1767 C CB    . VAL A 1 229 ? -7.658  23.528  -3.930  1.00 68.21  ? 229  VAL A CB    1 
ATOM   1768 C CG1   . VAL A 1 229 ? -8.622  23.502  -5.105  1.00 65.43  ? 229  VAL A CG1   1 
ATOM   1769 C CG2   . VAL A 1 229 ? -6.783  24.771  -3.977  1.00 69.44  ? 229  VAL A CG2   1 
ATOM   1770 N N     . LEU A 1 230 ? -8.397  21.104  -2.051  1.00 63.41  ? 230  LEU A N     1 
ATOM   1771 C CA    . LEU A 1 230 ? -8.979  19.797  -1.774  1.00 58.17  ? 230  LEU A CA    1 
ATOM   1772 C C     . LEU A 1 230 ? -10.011 19.879  -0.654  1.00 61.70  ? 230  LEU A C     1 
ATOM   1773 O O     . LEU A 1 230 ? -11.064 19.244  -0.718  1.00 53.44  ? 230  LEU A O     1 
ATOM   1774 C CB    . LEU A 1 230 ? -7.887  18.790  -1.408  1.00 65.15  ? 230  LEU A CB    1 
ATOM   1775 C CG    . LEU A 1 230 ? -7.039  18.260  -2.566  1.00 63.85  ? 230  LEU A CG    1 
ATOM   1776 C CD1   . LEU A 1 230 ? -7.025  16.739  -2.570  1.00 64.56  ? 230  LEU A CD1   1 
ATOM   1777 C CD2   . LEU A 1 230 ? -7.548  18.798  -3.895  1.00 54.42  ? 230  LEU A CD2   1 
ATOM   1778 N N     . MET A 1 231 ? -9.702  20.666  0.372   1.00 60.43  ? 231  MET A N     1 
ATOM   1779 C CA    . MET A 1 231 ? -10.567 20.776  1.541   1.00 61.68  ? 231  MET A CA    1 
ATOM   1780 C C     . MET A 1 231 ? -11.928 21.354  1.168   1.00 61.21  ? 231  MET A C     1 
ATOM   1781 O O     . MET A 1 231 ? -12.961 20.906  1.665   1.00 64.56  ? 231  MET A O     1 
ATOM   1782 C CB    . MET A 1 231 ? -9.905  21.639  2.617   1.00 72.57  ? 231  MET A CB    1 
ATOM   1783 C CG    . MET A 1 231 ? -8.683  21.003  3.258   1.00 76.00  ? 231  MET A CG    1 
ATOM   1784 S SD    . MET A 1 231 ? -8.945  20.586  4.993   1.00 103.39 ? 231  MET A SD    1 
ATOM   1785 C CE    . MET A 1 231 ? -8.247  18.938  5.053   1.00 75.92  ? 231  MET A CE    1 
ATOM   1786 N N     . GLY A 1 232 ? -11.921 22.351  0.290   1.00 62.29  ? 232  GLY A N     1 
ATOM   1787 C CA    . GLY A 1 232 ? -12.965 23.359  0.272   1.00 67.96  ? 232  GLY A CA    1 
ATOM   1788 C C     . GLY A 1 232 ? -13.090 24.089  1.595   1.00 64.65  ? 232  GLY A C     1 
ATOM   1789 O O     . GLY A 1 232 ? -14.193 24.408  2.037   1.00 65.71  ? 232  GLY A O     1 
ATOM   1790 N N     . ARG A 1 233 ? -11.952 24.353  2.228   1.00 61.46  ? 233  ARG A N     1 
ATOM   1791 C CA    . ARG A 1 233 ? -11.838 25.461  3.169   1.00 62.79  ? 233  ARG A CA    1 
ATOM   1792 C C     . ARG A 1 233 ? -12.069 26.799  2.475   1.00 64.94  ? 233  ARG A C     1 
ATOM   1793 O O     . ARG A 1 233 ? -12.722 27.688  3.022   1.00 75.86  ? 233  ARG A O     1 
ATOM   1794 C CB    . ARG A 1 233 ? -10.467 25.450  3.847   1.00 64.21  ? 233  ARG A CB    1 
ATOM   1795 C CG    . ARG A 1 233 ? -10.509 25.111  5.328   1.00 70.27  ? 233  ARG A CG    1 
ATOM   1796 C CD    . ARG A 1 233 ? -9.131  25.221  5.960   1.00 71.09  ? 233  ARG A CD    1 
ATOM   1797 N NE    . ARG A 1 233 ? -8.716  23.971  6.590   1.00 74.58  ? 233  ARG A NE    1 
ATOM   1798 C CZ    . ARG A 1 233 ? -7.736  23.196  6.138   1.00 81.12  ? 233  ARG A CZ    1 
ATOM   1799 N NH1   . ARG A 1 233 ? -7.065  23.540  5.048   1.00 80.90  ? 233  ARG A NH1   1 
ATOM   1800 N NH2   . ARG A 1 233 ? -7.427  22.075  6.776   1.00 82.89  ? 233  ARG A NH2   1 
ATOM   1801 N N     . VAL A 1 234 ? -11.528 26.936  1.269   1.00 61.71  ? 234  VAL A N     1 
ATOM   1802 C CA    . VAL A 1 234 ? -11.416 28.245  0.619   1.00 58.49  ? 234  VAL A CA    1 
ATOM   1803 C C     . VAL A 1 234 ? -12.573 28.591  -0.327  1.00 52.32  ? 234  VAL A C     1 
ATOM   1804 O O     . VAL A 1 234 ? -13.065 29.721  -0.318  1.00 54.12  ? 234  VAL A O     1 
ATOM   1805 C CB    . VAL A 1 234 ? -10.033 28.447  -0.085  1.00 58.19  ? 234  VAL A CB    1 
ATOM   1806 C CG1   . VAL A 1 234 ? -8.932  27.715  0.650   1.00 59.58  ? 234  VAL A CG1   1 
ATOM   1807 C CG2   . VAL A 1 234 ? -10.081 28.029  -1.555  1.00 52.20  ? 234  VAL A CG2   1 
ATOM   1808 N N     . ILE A 1 235 ? -13.014 27.627  -1.131  1.00 50.58  ? 235  ILE A N     1 
ATOM   1809 C CA    . ILE A 1 235 ? -14.060 27.892  -2.117  1.00 46.76  ? 235  ILE A CA    1 
ATOM   1810 C C     . ILE A 1 235 ? -15.461 27.601  -1.578  1.00 44.29  ? 235  ILE A C     1 
ATOM   1811 O O     . ILE A 1 235 ? -15.793 26.453  -1.283  1.00 45.85  ? 235  ILE A O     1 
ATOM   1812 C CB    . ILE A 1 235 ? -13.822 27.111  -3.428  1.00 44.12  ? 235  ILE A CB    1 
ATOM   1813 C CG1   . ILE A 1 235 ? -12.512 27.558  -4.080  1.00 48.15  ? 235  ILE A CG1   1 
ATOM   1814 C CG2   . ILE A 1 235 ? -14.986 27.311  -4.388  1.00 40.43  ? 235  ILE A CG2   1 
ATOM   1815 C CD1   . ILE A 1 235 ? -12.234 26.900  -5.414  1.00 48.41  ? 235  ILE A CD1   1 
ATOM   1816 N N     . PRO A 1 236 ? -16.288 28.651  -1.453  1.00 40.89  ? 236  PRO A N     1 
ATOM   1817 C CA    . PRO A 1 236 ? -17.653 28.550  -0.923  1.00 43.51  ? 236  PRO A CA    1 
ATOM   1818 C C     . PRO A 1 236 ? -18.597 27.822  -1.880  1.00 43.90  ? 236  PRO A C     1 
ATOM   1819 O O     . PRO A 1 236 ? -19.359 28.460  -2.604  1.00 47.65  ? 236  PRO A O     1 
ATOM   1820 C CB    . PRO A 1 236 ? -18.077 30.013  -0.775  1.00 45.72  ? 236  PRO A CB    1 
ATOM   1821 C CG    . PRO A 1 236 ? -17.256 30.747  -1.779  1.00 45.11  ? 236  PRO A CG    1 
ATOM   1822 C CD    . PRO A 1 236 ? -15.939 30.033  -1.829  1.00 45.62  ? 236  PRO A CD    1 
ATOM   1823 N N     . VAL A 1 237 ? -18.547 26.494  -1.862  1.00 44.24  ? 237  VAL A N     1 
ATOM   1824 C CA    . VAL A 1 237 ? -19.309 25.669  -2.793  1.00 40.90  ? 237  VAL A CA    1 
ATOM   1825 C C     . VAL A 1 237 ? -19.811 24.394  -2.112  1.00 40.38  ? 237  VAL A C     1 
ATOM   1826 O O     . VAL A 1 237 ? -19.070 23.747  -1.375  1.00 46.02  ? 237  VAL A O     1 
ATOM   1827 C CB    . VAL A 1 237 ? -18.474 25.359  -4.063  1.00 41.54  ? 237  VAL A CB    1 
ATOM   1828 C CG1   . VAL A 1 237 ? -18.744 23.948  -4.576  1.00 36.17  ? 237  VAL A CG1   1 
ATOM   1829 C CG2   . VAL A 1 237 ? -18.739 26.407  -5.141  1.00 39.41  ? 237  VAL A CG2   1 
ATOM   1830 N N     . LYS A 1 238 ? -21.064 24.057  -2.361  1.00 35.17  ? 238  LYS A N     1 
ATOM   1831 C CA    . LYS A 1 238 ? -21.706 23.012  -1.597  1.00 38.59  ? 238  LYS A CA    1 
ATOM   1832 C C     . LYS A 1 238 ? -21.763 21.626  -2.179  1.00 37.57  ? 238  LYS A C     1 
ATOM   1833 O O     . LYS A 1 238 ? -21.802 20.691  -1.457  1.00 41.13  ? 238  LYS A O     1 
ATOM   1834 C CB    . LYS A 1 238 ? -23.128 23.380  -1.166  1.00 42.70  ? 238  LYS A CB    1 
ATOM   1835 C CG    . LYS A 1 238 ? -23.327 24.691  -0.515  1.00 41.20  ? 238  LYS A CG    1 
ATOM   1836 C CD    . LYS A 1 238 ? -22.916 24.591  0.853   1.00 48.98  ? 238  LYS A CD    1 
ATOM   1837 C CE    . LYS A 1 238 ? -23.095 25.867  1.542   1.00 56.60  ? 238  LYS A CE    1 
ATOM   1838 N NZ    . LYS A 1 238 ? -24.512 26.152  1.813   1.00 67.95  ? 238  LYS A NZ    1 
ATOM   1839 N N     . LEU A 1 239 ? -21.802 21.481  -3.483  1.00 32.92  ? 239  LEU A N     1 
ATOM   1840 C CA    . LEU A 1 239 ? -21.945 20.172  -4.125  1.00 32.78  ? 239  LEU A CA    1 
ATOM   1841 C C     . LEU A 1 239 ? -20.650 19.358  -4.208  1.00 29.37  ? 239  LEU A C     1 
ATOM   1842 O O     . LEU A 1 239 ? -20.664 18.191  -4.608  1.00 31.53  ? 239  LEU A O     1 
ATOM   1843 C CB    . LEU A 1 239 ? -22.593 20.311  -5.507  1.00 33.22  ? 239  LEU A CB    1 
ATOM   1844 C CG    . LEU A 1 239 ? -24.008 20.887  -5.468  1.00 35.83  ? 239  LEU A CG    1 
ATOM   1845 C CD1   . LEU A 1 239 ? -24.615 20.935  -6.859  1.00 36.23  ? 239  LEU A CD1   1 
ATOM   1846 C CD2   . LEU A 1 239 ? -24.884 20.075  -4.525  1.00 33.99  ? 239  LEU A CD2   1 
ATOM   1847 N N     . GLY A 1 240 ? -19.540 19.974  -3.816  1.00 31.79  ? 240  GLY A N     1 
ATOM   1848 C CA    . GLY A 1 240 ? -18.267 19.281  -3.761  1.00 30.81  ? 240  GLY A CA    1 
ATOM   1849 C C     . GLY A 1 240 ? -17.120 19.981  -4.466  1.00 33.44  ? 240  GLY A C     1 
ATOM   1850 O O     . GLY A 1 240 ? -17.326 20.809  -5.352  1.00 29.48  ? 240  GLY A O     1 
ATOM   1851 N N     . ILE A 1 241 ? -15.904 19.630  -4.091  1.00 35.74  ? 241  ILE A N     1 
ATOM   1852 C CA    . ILE A 1 241 ? -14.718 20.084  -4.754  1.00 31.35  ? 241  ILE A CA    1 
ATOM   1853 C C     . ILE A 1 241 ? -13.985 18.887  -5.264  1.00 33.05  ? 241  ILE A C     1 
ATOM   1854 O O     . ILE A 1 241 ? -13.531 18.091  -4.493  1.00 37.72  ? 241  ILE A O     1 
ATOM   1855 C CB    . ILE A 1 241 ? -13.745 20.790  -3.797  1.00 39.56  ? 241  ILE A CB    1 
ATOM   1856 C CG1   . ILE A 1 241 ? -14.442 21.775  -2.885  1.00 41.50  ? 241  ILE A CG1   1 
ATOM   1857 C CG2   . ILE A 1 241 ? -12.706 21.489  -4.532  1.00 39.48  ? 241  ILE A CG2   1 
ATOM   1858 C CD1   . ILE A 1 241 ? -14.571 23.147  -3.417  1.00 43.60  ? 241  ILE A CD1   1 
ATOM   1859 N N     . ILE A 1 242 ? -13.824 18.775  -6.564  1.00 33.11  ? 242  ILE A N     1 
ATOM   1860 C CA    . ILE A 1 242 ? -13.139 17.627  -7.149  1.00 33.08  ? 242  ILE A CA    1 
ATOM   1861 C C     . ILE A 1 242 ? -11.937 18.053  -7.985  1.00 31.75  ? 242  ILE A C     1 
ATOM   1862 O O     . ILE A 1 242 ? -12.072 18.786  -8.965  1.00 36.88  ? 242  ILE A O     1 
ATOM   1863 C CB    . ILE A 1 242 ? -14.093 16.748  -7.979  1.00 30.69  ? 242  ILE A CB    1 
ATOM   1864 C CG1   . ILE A 1 242 ? -15.259 16.275  -7.107  1.00 29.12  ? 242  ILE A CG1   1 
ATOM   1865 C CG2   . ILE A 1 242 ? -13.349 15.555  -8.561  1.00 32.58  ? 242  ILE A CG2   1 
ATOM   1866 C CD1   . ILE A 1 242 ? -16.273 15.423  -7.830  1.00 34.18  ? 242  ILE A CD1   1 
ATOM   1867 N N     . GLY A 1 243 ? -10.759 17.596  -7.574  1.00 34.53  ? 243  GLY A N     1 
ATOM   1868 C CA    . GLY A 1 243 ? -9.528  17.899  -8.277  1.00 30.52  ? 243  GLY A CA    1 
ATOM   1869 C C     . GLY A 1 243 ? -9.165  16.800  -9.254  1.00 34.59  ? 243  GLY A C     1 
ATOM   1870 O O     . GLY A 1 243 ? -9.258  15.615  -8.935  1.00 38.60  ? 243  GLY A O     1 
ATOM   1871 N N     . VAL A 1 244 ? -8.761  17.194  -10.457 1.00 34.82  ? 244  VAL A N     1 
ATOM   1872 C CA    . VAL A 1 244 ? -8.366  16.235  -11.479 1.00 30.54  ? 244  VAL A CA    1 
ATOM   1873 C C     . VAL A 1 244 ? -7.064  16.650  -12.148 1.00 34.44  ? 244  VAL A C     1 
ATOM   1874 O O     . VAL A 1 244 ? -6.609  17.786  -12.005 1.00 33.61  ? 244  VAL A O     1 
ATOM   1875 C CB    . VAL A 1 244 ? -9.439  16.093  -12.579 1.00 33.57  ? 244  VAL A CB    1 
ATOM   1876 C CG1   . VAL A 1 244 ? -10.759 15.608  -11.993 1.00 30.53  ? 244  VAL A CG1   1 
ATOM   1877 C CG2   . VAL A 1 244 ? -9.622  17.413  -13.318 1.00 32.33  ? 244  VAL A CG2   1 
ATOM   1878 N N     . VAL A 1 245 ? -6.465  15.712  -12.872 1.00 33.02  ? 245  VAL A N     1 
ATOM   1879 C CA    . VAL A 1 245 ? -5.331  16.007  -13.734 1.00 35.33  ? 245  VAL A CA    1 
ATOM   1880 C C     . VAL A 1 245 ? -5.622  15.445  -15.118 1.00 33.98  ? 245  VAL A C     1 
ATOM   1881 O O     . VAL A 1 245 ? -5.541  14.236  -15.337 1.00 35.03  ? 245  VAL A O     1 
ATOM   1882 C CB    . VAL A 1 245 ? -4.022  15.398  -13.198 1.00 36.37  ? 245  VAL A CB    1 
ATOM   1883 C CG1   . VAL A 1 245 ? -2.889  15.617  -14.193 1.00 31.09  ? 245  VAL A CG1   1 
ATOM   1884 C CG2   . VAL A 1 245 ? -3.671  15.997  -11.846 1.00 33.76  ? 245  VAL A CG2   1 
ATOM   1885 N N     . ASN A 1 246 ? -5.985  16.322  -16.046 1.00 32.12  ? 246  ASN A N     1 
ATOM   1886 C CA    . ASN A 1 246 ? -6.274  15.898  -17.407 1.00 30.99  ? 246  ASN A CA    1 
ATOM   1887 C C     . ASN A 1 246 ? -4.994  15.713  -18.204 1.00 33.95  ? 246  ASN A C     1 
ATOM   1888 O O     . ASN A 1 246 ? -3.901  16.014  -17.725 1.00 28.77  ? 246  ASN A O     1 
ATOM   1889 C CB    . ASN A 1 246 ? -7.175  16.911  -18.112 1.00 31.79  ? 246  ASN A CB    1 
ATOM   1890 C CG    . ASN A 1 246 ? -8.448  17.190  -17.346 1.00 33.98  ? 246  ASN A CG    1 
ATOM   1891 O OD1   . ASN A 1 246 ? -8.788  18.346  -17.091 1.00 37.08  ? 246  ASN A OD1   1 
ATOM   1892 N ND2   . ASN A 1 246 ? -9.161  16.134  -16.971 1.00 30.17  ? 246  ASN A ND2   1 
ATOM   1893 N N     . ARG A 1 247 ? -5.137  15.214  -19.425 1.00 35.50  ? 247  ARG A N     1 
ATOM   1894 C CA    . ARG A 1 247 ? -4.005  15.090  -20.326 1.00 36.21  ? 247  ARG A CA    1 
ATOM   1895 C C     . ARG A 1 247 ? -3.661  16.470  -20.868 1.00 39.63  ? 247  ARG A C     1 
ATOM   1896 O O     . ARG A 1 247 ? -4.548  17.286  -21.113 1.00 36.74  ? 247  ARG A O     1 
ATOM   1897 C CB    . ARG A 1 247 ? -4.342  14.141  -21.473 1.00 38.49  ? 247  ARG A CB    1 
ATOM   1898 C CG    . ARG A 1 247 ? -5.339  13.059  -21.098 1.00 41.96  ? 247  ARG A CG    1 
ATOM   1899 C CD    . ARG A 1 247 ? -5.289  11.905  -22.080 1.00 47.92  ? 247  ARG A CD    1 
ATOM   1900 N NE    . ARG A 1 247 ? -5.387  12.351  -23.465 1.00 47.56  ? 247  ARG A NE    1 
ATOM   1901 C CZ    . ARG A 1 247 ? -5.211  11.556  -24.514 1.00 52.63  ? 247  ARG A CZ    1 
ATOM   1902 N NH1   . ARG A 1 247 ? -4.926  10.275  -24.331 1.00 58.02  ? 247  ARG A NH1   1 
ATOM   1903 N NH2   . ARG A 1 247 ? -5.316  12.039  -25.744 1.00 52.02  ? 247  ARG A NH2   1 
ATOM   1904 N N     . SER A 1 248 ? -2.372  16.734  -21.044 1.00 36.18  ? 248  SER A N     1 
ATOM   1905 C CA    . SER A 1 248 ? -1.933  18.012  -21.584 1.00 37.79  ? 248  SER A CA    1 
ATOM   1906 C C     . SER A 1 248 ? -1.968  17.976  -23.105 1.00 41.87  ? 248  SER A C     1 
ATOM   1907 O O     . SER A 1 248 ? -2.197  16.923  -23.703 1.00 40.07  ? 248  SER A O     1 
ATOM   1908 C CB    . SER A 1 248 ? -0.523  18.345  -21.098 1.00 42.72  ? 248  SER A CB    1 
ATOM   1909 O OG    . SER A 1 248 ? 0.415   17.393  -21.566 1.00 39.40  ? 248  SER A OG    1 
ATOM   1910 N N     . GLN A 1 249 ? -1.747  19.129  -23.728 1.00 43.29  ? 249  GLN A N     1 
ATOM   1911 C CA    . GLN A 1 249 ? -1.679  19.206  -25.181 1.00 42.06  ? 249  GLN A CA    1 
ATOM   1912 C C     . GLN A 1 249 ? -0.494  18.383  -25.672 1.00 42.15  ? 249  GLN A C     1 
ATOM   1913 O O     . GLN A 1 249 ? -0.540  17.787  -26.748 1.00 40.78  ? 249  GLN A O     1 
ATOM   1914 C CB    . GLN A 1 249 ? -1.541  20.657  -25.640 1.00 43.94  ? 249  GLN A CB    1 
ATOM   1915 C CG    . GLN A 1 249 ? -1.725  20.847  -27.136 1.00 47.95  ? 249  GLN A CG    1 
ATOM   1916 C CD    . GLN A 1 249 ? -3.120  20.474  -27.598 1.00 52.85  ? 249  GLN A CD    1 
ATOM   1917 O OE1   . GLN A 1 249 ? -4.080  21.210  -27.367 1.00 55.15  ? 249  GLN A OE1   1 
ATOM   1918 N NE2   . GLN A 1 249 ? -3.241  19.323  -28.251 1.00 51.81  ? 249  GLN A NE2   1 
ATOM   1919 N N     . LEU A 1 250 ? 0.563   18.358  -24.867 1.00 39.73  ? 250  LEU A N     1 
ATOM   1920 C CA    . LEU A 1 250 ? 1.730   17.530  -25.140 1.00 40.92  ? 250  LEU A CA    1 
ATOM   1921 C C     . LEU A 1 250 ? 1.331   16.063  -25.228 1.00 37.19  ? 250  LEU A C     1 
ATOM   1922 O O     . LEU A 1 250 ? 1.766   15.344  -26.125 1.00 36.26  ? 250  LEU A O     1 
ATOM   1923 C CB    . LEU A 1 250 ? 2.781   17.715  -24.044 1.00 41.53  ? 250  LEU A CB    1 
ATOM   1924 C CG    . LEU A 1 250 ? 3.905   18.723  -24.298 1.00 39.31  ? 250  LEU A CG    1 
ATOM   1925 C CD1   . LEU A 1 250 ? 3.369   20.022  -24.872 1.00 39.90  ? 250  LEU A CD1   1 
ATOM   1926 C CD2   . LEU A 1 250 ? 4.699   18.974  -23.024 1.00 33.97  ? 250  LEU A CD2   1 
ATOM   1927 N N     . ASP A 1 251 ? 0.490   15.633  -24.292 1.00 37.57  ? 251  ASP A N     1 
ATOM   1928 C CA    . ASP A 1 251 ? 0.034   14.248  -24.240 1.00 40.40  ? 251  ASP A CA    1 
ATOM   1929 C C     . ASP A 1 251 ? -0.805  13.868  -25.457 1.00 41.69  ? 251  ASP A C     1 
ATOM   1930 O O     . ASP A 1 251 ? -0.657  12.775  -26.000 1.00 45.35  ? 251  ASP A O     1 
ATOM   1931 C CB    . ASP A 1 251 ? -0.756  13.991  -22.954 1.00 41.35  ? 251  ASP A CB    1 
ATOM   1932 C CG    . ASP A 1 251 ? 0.111   14.068  -21.715 1.00 41.59  ? 251  ASP A CG    1 
ATOM   1933 O OD1   . ASP A 1 251 ? -0.442  14.271  -20.613 1.00 45.26  ? 251  ASP A OD1   1 
ATOM   1934 O OD2   . ASP A 1 251 ? 1.345   13.931  -21.844 1.00 43.44  ? 251  ASP A OD2   1 
ATOM   1935 N N     . ILE A 1 252 ? -1.683  14.771  -25.879 1.00 44.18  ? 252  ILE A N     1 
ATOM   1936 C CA    . ILE A 1 252 ? -2.531  14.523  -27.041 1.00 44.17  ? 252  ILE A CA    1 
ATOM   1937 C C     . ILE A 1 252 ? -1.699  14.416  -28.315 1.00 41.66  ? 252  ILE A C     1 
ATOM   1938 O O     . ILE A 1 252 ? -1.857  13.473  -29.091 1.00 43.84  ? 252  ILE A O     1 
ATOM   1939 C CB    . ILE A 1 252 ? -3.598  15.621  -27.213 1.00 43.37  ? 252  ILE A CB    1 
ATOM   1940 C CG1   . ILE A 1 252 ? -4.491  15.694  -25.973 1.00 45.44  ? 252  ILE A CG1   1 
ATOM   1941 C CG2   . ILE A 1 252 ? -4.436  15.360  -28.457 1.00 42.94  ? 252  ILE A CG2   1 
ATOM   1942 C CD1   . ILE A 1 252 ? -5.521  16.801  -26.028 1.00 42.99  ? 252  ILE A CD1   1 
ATOM   1943 N N     . ASN A 1 253 ? -0.813  15.386  -28.523 1.00 42.43  ? 253  ASN A N     1 
ATOM   1944 C CA    . ASN A 1 253 ? 0.081   15.371  -29.677 1.00 41.22  ? 253  ASN A CA    1 
ATOM   1945 C C     . ASN A 1 253 ? 0.983   14.141  -29.673 1.00 38.73  ? 253  ASN A C     1 
ATOM   1946 O O     . ASN A 1 253 ? 1.325   13.608  -30.728 1.00 48.20  ? 253  ASN A O     1 
ATOM   1947 C CB    . ASN A 1 253 ? 0.928   16.644  -29.722 1.00 39.33  ? 253  ASN A CB    1 
ATOM   1948 C CG    . ASN A 1 253 ? 0.088   17.904  -29.727 1.00 42.10  ? 253  ASN A CG    1 
ATOM   1949 O OD1   . ASN A 1 253 ? -1.119  17.858  -29.963 1.00 44.53  ? 253  ASN A OD1   1 
ATOM   1950 N ND2   . ASN A 1 253 ? 0.724   19.041  -29.470 1.00 42.29  ? 253  ASN A ND2   1 
ATOM   1951 N N     . ASN A 1 254 ? 1.362   13.695  -28.479 1.00 40.14  ? 254  ASN A N     1 
ATOM   1952 C CA    . ASN A 1 254 ? 2.167   12.487  -28.326 1.00 42.35  ? 254  ASN A CA    1 
ATOM   1953 C C     . ASN A 1 254 ? 1.326   11.220  -28.386 1.00 45.56  ? 254  ASN A C     1 
ATOM   1954 O O     . ASN A 1 254 ? 1.858   10.112  -28.318 1.00 43.37  ? 254  ASN A O     1 
ATOM   1955 C CB    . ASN A 1 254 ? 2.941   12.516  -27.007 1.00 38.83  ? 254  ASN A CB    1 
ATOM   1956 C CG    . ASN A 1 254 ? 4.228   13.301  -27.105 1.00 35.81  ? 254  ASN A CG    1 
ATOM   1957 O OD1   . ASN A 1 254 ? 4.822   13.404  -28.177 1.00 36.86  ? 254  ASN A OD1   1 
ATOM   1958 N ND2   . ASN A 1 254 ? 4.673   13.855  -25.982 1.00 35.18  ? 254  ASN A ND2   1 
ATOM   1959 N N     . LYS A 1 255 ? 0.018   11.394  -28.474 1.00 46.52  ? 255  LYS A N     1 
ATOM   1960 C CA    . LYS A 1 255 ? -0.921  10.299  -28.501 1.00 48.47  ? 255  LYS A CA    1 
ATOM   1961 C C     . LYS A 1 255 ? -0.838  9.453   -27.249 1.00 51.51  ? 255  LYS A C     1 
ATOM   1962 O O     . LYS A 1 255 ? -0.806  8.239   -27.319 1.00 56.23  ? 255  LYS A O     1 
ATOM   1963 C CB    . LYS A 1 255 ? -0.729  9.434   -29.739 1.00 45.30  ? 255  LYS A CB    1 
ATOM   1964 C CG    . LYS A 1 255 ? -0.876  10.163  -31.029 1.00 49.18  ? 255  LYS A CG    1 
ATOM   1965 C CD    . LYS A 1 255 ? -1.337  9.231   -32.117 1.00 53.18  ? 255  LYS A CD    1 
ATOM   1966 C CE    . LYS A 1 255 ? -2.096  9.942   -33.231 1.00 54.42  ? 255  LYS A CE    1 
ATOM   1967 N NZ    . LYS A 1 255 ? -3.533  10.183  -32.976 1.00 48.54  ? 255  LYS A NZ    1 
ATOM   1968 N N     . LYS A 1 256 ? -0.784  10.116  -26.106 1.00 51.34  ? 256  LYS A N     1 
ATOM   1969 C CA    . LYS A 1 256 ? -0.776  9.463   -24.804 1.00 55.59  ? 256  LYS A CA    1 
ATOM   1970 C C     . LYS A 1 256 ? -2.012  8.582   -24.684 1.00 58.84  ? 256  LYS A C     1 
ATOM   1971 O O     . LYS A 1 256 ? -3.132  9.056   -24.866 1.00 56.17  ? 256  LYS A O     1 
ATOM   1972 C CB    . LYS A 1 256 ? -0.785  10.522  -23.698 1.00 53.35  ? 256  LYS A CB    1 
ATOM   1973 C CG    . LYS A 1 256 ? -0.775  9.987   -22.274 1.00 55.81  ? 256  LYS A CG    1 
ATOM   1974 C CD    . LYS A 1 256 ? 0.637   9.701   -21.792 1.00 54.57  ? 256  LYS A CD    1 
ATOM   1975 C CE    . LYS A 1 256 ? 0.682   9.525   -20.280 1.00 51.46  ? 256  LYS A CE    1 
ATOM   1976 N NZ    . LYS A 1 256 ? 0.383   10.794  -19.557 1.00 47.19  ? 256  LYS A NZ    1 
ATOM   1977 N N     . SER A 1 257 ? -1.815  7.305   -24.386 1.00 58.17  ? 257  SER A N     1 
ATOM   1978 C CA    . SER A 1 257 ? -2.928  6.393   -24.181 1.00 61.04  ? 257  SER A CA    1 
ATOM   1979 C C     . SER A 1 257 ? -3.741  6.788   -22.965 1.00 60.59  ? 257  SER A C     1 
ATOM   1980 O O     . SER A 1 257 ? -3.192  7.097   -21.945 1.00 64.38  ? 257  SER A O     1 
ATOM   1981 C CB    . SER A 1 257 ? -2.412  4.977   -24.034 1.00 57.13  ? 257  SER A CB    1 
ATOM   1982 O OG    . SER A 1 257 ? -1.975  4.738   -22.731 1.00 60.06  ? 257  SER A OG    1 
ATOM   1983 N N     . VAL A 1 258 ? -5.055  6.714   -23.051 1.00 62.58  ? 258  VAL A N     1 
ATOM   1984 C CA    . VAL A 1 258 ? -5.896  7.179   -21.947 1.00 58.97  ? 258  VAL A CA    1 
ATOM   1985 C C     . VAL A 1 258 ? -5.806  6.292   -20.738 1.00 57.10  ? 258  VAL A C     1 
ATOM   1986 O O     . VAL A 1 258 ? -6.033  6.700   -19.624 1.00 53.44  ? 258  VAL A O     1 
ATOM   1987 C CB    . VAL A 1 258 ? -7.347  7.304   -22.356 1.00 56.64  ? 258  VAL A CB    1 
ATOM   1988 C CG1   . VAL A 1 258 ? -7.485  8.381   -23.358 1.00 52.99  ? 258  VAL A CG1   1 
ATOM   1989 C CG2   . VAL A 1 258 ? -7.855  5.999   -22.895 1.00 51.98  ? 258  VAL A CG2   1 
ATOM   1990 N N     . THR A 1 259 ? -5.476  5.052   -20.988 1.00 59.73  ? 259  THR A N     1 
ATOM   1991 C CA    . THR A 1 259 ? -5.247  4.113   -19.890 1.00 59.91  ? 259  THR A CA    1 
ATOM   1992 C C     . THR A 1 259 ? -3.973  4.460   -19.121 1.00 62.06  ? 259  THR A C     1 
ATOM   1993 O O     . THR A 1 259 ? -3.870  4.198   -17.921 1.00 58.78  ? 259  THR A O     1 
ATOM   1994 C CB    . THR A 1 259 ? -5.187  2.639   -20.375 1.00 61.80  ? 259  THR A CB    1 
ATOM   1995 O OG1   . THR A 1 259 ? -3.894  2.086   -20.096 1.00 68.96  ? 259  THR A OG1   1 
ATOM   1996 C CG2   . THR A 1 259 ? -5.465  2.548   -21.867 1.00 57.62  ? 259  THR A CG2   1 
ATOM   1997 N N     . ASP A 1 260 ? -3.031  5.079   -19.816 1.00 58.77  ? 260  ASP A N     1 
ATOM   1998 C CA    . ASP A 1 260 ? -1.803  5.519   -19.202 1.00 58.65  ? 260  ASP A CA    1 
ATOM   1999 C C     . ASP A 1 260 ? -1.959  6.840   -18.498 1.00 56.03  ? 260  ASP A C     1 
ATOM   2000 O O     . ASP A 1 260 ? -1.367  7.061   -17.475 1.00 58.51  ? 260  ASP A O     1 
ATOM   2001 C CB    . ASP A 1 260 ? -0.702  5.628   -20.235 1.00 62.99  ? 260  ASP A CB    1 
ATOM   2002 C CG    . ASP A 1 260 ? 0.010   4.318   -20.488 1.00 64.15  ? 260  ASP A CG    1 
ATOM   2003 O OD1   . ASP A 1 260 ? -0.482  3.259   -20.095 1.00 66.70  ? 260  ASP A OD1   1 
ATOM   2004 O OD2   . ASP A 1 260 ? 1.075   4.352   -21.103 1.00 65.94  ? 260  ASP A OD2   1 
ATOM   2005 N N     . SER A 1 261 ? -2.761  7.719   -19.049 1.00 49.89  ? 261  SER A N     1 
ATOM   2006 C CA    . SER A 1 261 ? -3.009  9.024   -18.444 1.00 55.83  ? 261  SER A CA    1 
ATOM   2007 C C     . SER A 1 261 ? -3.912  8.905   -17.217 1.00 47.63  ? 261  SER A C     1 
ATOM   2008 O O     . SER A 1 261 ? -3.875  9.748   -16.321 1.00 48.52  ? 261  SER A O     1 
ATOM   2009 C CB    . SER A 1 261 ? -3.620  9.994   -19.459 1.00 50.23  ? 261  SER A CB    1 
ATOM   2010 O OG    . SER A 1 261 ? -4.980  9.691   -19.698 1.00 59.87  ? 261  SER A OG    1 
ATOM   2011 N N     . ILE A 1 262 ? -4.719  7.849   -17.181 1.00 51.45  ? 262  ILE A N     1 
ATOM   2012 C CA    . ILE A 1 262 ? -5.612  7.598   -16.053 1.00 51.61  ? 262  ILE A CA    1 
ATOM   2013 C C     . ILE A 1 262 ? -4.831  7.184   -14.810 1.00 44.62  ? 262  ILE A C     1 
ATOM   2014 O O     . ILE A 1 262 ? -5.027  7.742   -13.732 1.00 45.59  ? 262  ILE A O     1 
ATOM   2015 C CB    . ILE A 1 262 ? -6.674  6.527   -16.393 1.00 54.92  ? 262  ILE A CB    1 
ATOM   2016 C CG1   . ILE A 1 262 ? -7.816  7.149   -17.200 1.00 53.55  ? 262  ILE A CG1   1 
ATOM   2017 C CG2   . ILE A 1 262 ? -7.234  5.898   -15.127 1.00 48.35  ? 262  ILE A CG2   1 
ATOM   2018 C CD1   . ILE A 1 262 ? -8.753  6.130   -17.814 1.00 51.71  ? 262  ILE A CD1   1 
ATOM   2019 N N     . ARG A 1 263 ? -3.938  6.212   -14.966 1.00 46.79  ? 263  ARG A N     1 
ATOM   2020 C CA    . ARG A 1 263 ? -3.140  5.734   -13.843 1.00 50.64  ? 263  ARG A CA    1 
ATOM   2021 C C     . ARG A 1 263 ? -2.095  6.761   -13.416 1.00 45.50  ? 263  ARG A C     1 
ATOM   2022 O O     . ARG A 1 263 ? -1.720  6.825   -12.246 1.00 47.57  ? 263  ARG A O     1 
ATOM   2023 C CB    . ARG A 1 263 ? -2.475  4.397   -14.174 1.00 59.56  ? 263  ARG A CB    1 
ATOM   2024 C CG    . ARG A 1 263 ? -1.684  4.398   -15.467 1.00 60.03  ? 263  ARG A CG    1 
ATOM   2025 C CD    . ARG A 1 263 ? -0.819  3.151   -15.569 1.00 66.32  ? 263  ARG A CD    1 
ATOM   2026 N NE    . ARG A 1 263 ? -0.025  3.130   -16.789 1.00 69.86  ? 263  ARG A NE    1 
ATOM   2027 C CZ    . ARG A 1 263 ? 1.097   3.819   -16.964 1.00 73.78  ? 263  ARG A CZ    1 
ATOM   2028 N NH1   . ARG A 1 263 ? 1.551   4.601   -15.998 1.00 69.77  ? 263  ARG A NH1   1 
ATOM   2029 N NH2   . ARG A 1 263 ? 1.765   3.733   -18.109 1.00 73.98  ? 263  ARG A NH2   1 
ATOM   2030 N N     . ASP A 1 264 ? -1.629  7.563   -14.370 1.00 46.69  ? 264  ASP A N     1 
ATOM   2031 C CA    . ASP A 1 264 ? -0.704  8.649   -14.065 1.00 44.39  ? 264  ASP A CA    1 
ATOM   2032 C C     . ASP A 1 264 ? -1.370  9.684   -13.166 1.00 45.57  ? 264  ASP A C     1 
ATOM   2033 O O     . ASP A 1 264 ? -0.751  10.197  -12.234 1.00 47.18  ? 264  ASP A O     1 
ATOM   2034 C CB    . ASP A 1 264 ? -0.199  9.310   -15.349 1.00 45.91  ? 264  ASP A CB    1 
ATOM   2035 C CG    . ASP A 1 264 ? 0.871   8.494   -16.043 1.00 46.85  ? 264  ASP A CG    1 
ATOM   2036 O OD1   . ASP A 1 264 ? 1.018   7.299   -15.712 1.00 52.49  ? 264  ASP A OD1   1 
ATOM   2037 O OD2   . ASP A 1 264 ? 1.562   9.047   -16.924 1.00 47.73  ? 264  ASP A OD2   1 
ATOM   2038 N N     . GLU A 1 265 ? -2.634  9.986   -13.454 1.00 45.26  ? 265  GLU A N     1 
ATOM   2039 C CA    . GLU A 1 265 ? -3.418  10.884  -12.613 1.00 43.10  ? 265  GLU A CA    1 
ATOM   2040 C C     . GLU A 1 265 ? -3.603  10.277  -11.230 1.00 41.78  ? 265  GLU A C     1 
ATOM   2041 O O     . GLU A 1 265 ? -3.409  10.946  -10.214 1.00 41.32  ? 265  GLU A O     1 
ATOM   2042 C CB    . GLU A 1 265 ? -4.788  11.152  -13.236 1.00 39.91  ? 265  GLU A CB    1 
ATOM   2043 C CG    . GLU A 1 265 ? -5.734  11.907  -12.315 1.00 34.91  ? 265  GLU A CG    1 
ATOM   2044 C CD    . GLU A 1 265 ? -7.143  12.002  -12.864 1.00 36.76  ? 265  GLU A CD    1 
ATOM   2045 O OE1   . GLU A 1 265 ? -7.670  10.974  -13.341 1.00 36.33  ? 265  GLU A OE1   1 
ATOM   2046 O OE2   . GLU A 1 265 ? -7.723  13.107  -12.818 1.00 37.68  ? 265  GLU A OE2   1 
ATOM   2047 N N     . TYR A 1 266 ? -3.984  9.004   -11.208 1.00 40.20  ? 266  TYR A N     1 
ATOM   2048 C CA    . TYR A 1 266 ? -4.193  8.266   -9.968  1.00 45.58  ? 266  TYR A CA    1 
ATOM   2049 C C     . TYR A 1 266 ? -2.925  8.242   -9.122  1.00 46.09  ? 266  TYR A C     1 
ATOM   2050 O O     . TYR A 1 266 ? -2.963  8.520   -7.924  1.00 51.57  ? 266  TYR A O     1 
ATOM   2051 C CB    . TYR A 1 266 ? -4.646  6.836   -10.283 1.00 48.86  ? 266  TYR A CB    1 
ATOM   2052 C CG    . TYR A 1 266 ? -4.869  5.963   -9.068  1.00 60.72  ? 266  TYR A CG    1 
ATOM   2053 C CD1   . TYR A 1 266 ? -6.112  5.903   -8.451  1.00 62.55  ? 266  TYR A CD1   1 
ATOM   2054 C CD2   . TYR A 1 266 ? -3.841  5.187   -8.545  1.00 62.22  ? 266  TYR A CD2   1 
ATOM   2055 C CE1   . TYR A 1 266 ? -6.321  5.103   -7.341  1.00 67.35  ? 266  TYR A CE1   1 
ATOM   2056 C CE2   . TYR A 1 266 ? -4.040  4.385   -7.438  1.00 60.20  ? 266  TYR A CE2   1 
ATOM   2057 C CZ    . TYR A 1 266 ? -5.282  4.347   -6.840  1.00 66.45  ? 266  TYR A CZ    1 
ATOM   2058 O OH    . TYR A 1 266 ? -5.483  3.549   -5.737  1.00 75.96  ? 266  TYR A OH    1 
ATOM   2059 N N     . ALA A 1 267 ? -1.805  7.908   -9.756  1.00 43.65  ? 267  ALA A N     1 
ATOM   2060 C CA    . ALA A 1 267 ? -0.519  7.839   -9.071  1.00 41.60  ? 267  ALA A CA    1 
ATOM   2061 C C     . ALA A 1 267 ? -0.107  9.199   -8.519  1.00 45.91  ? 267  ALA A C     1 
ATOM   2062 O O     . ALA A 1 267 ? 0.451   9.290   -7.426  1.00 46.78  ? 267  ALA A O     1 
ATOM   2063 C CB    . ALA A 1 267 ? 0.552   7.298   -10.006 1.00 42.94  ? 267  ALA A CB    1 
ATOM   2064 N N     . PHE A 1 268 ? -0.382  10.252  -9.283  1.00 47.46  ? 268  PHE A N     1 
ATOM   2065 C CA    . PHE A 1 268 ? -0.097  11.613  -8.843  1.00 45.04  ? 268  PHE A CA    1 
ATOM   2066 C C     . PHE A 1 268 ? -0.912  11.947  -7.600  1.00 46.06  ? 268  PHE A C     1 
ATOM   2067 O O     . PHE A 1 268 ? -0.405  12.557  -6.657  1.00 45.77  ? 268  PHE A O     1 
ATOM   2068 C CB    . PHE A 1 268 ? -0.398  12.615  -9.961  1.00 43.67  ? 268  PHE A CB    1 
ATOM   2069 C CG    . PHE A 1 268 ? -0.185  14.052  -9.566  1.00 46.05  ? 268  PHE A CG    1 
ATOM   2070 C CD1   . PHE A 1 268 ? 1.074   14.626  -9.643  1.00 43.55  ? 268  PHE A CD1   1 
ATOM   2071 C CD2   . PHE A 1 268 ? -1.244  14.830  -9.126  1.00 41.30  ? 268  PHE A CD2   1 
ATOM   2072 C CE1   . PHE A 1 268 ? 1.273   15.947  -9.283  1.00 45.95  ? 268  PHE A CE1   1 
ATOM   2073 C CE2   . PHE A 1 268 ? -1.051  16.149  -8.764  1.00 42.05  ? 268  PHE A CE2   1 
ATOM   2074 C CZ    . PHE A 1 268 ? 0.209   16.709  -8.842  1.00 40.70  ? 268  PHE A CZ    1 
ATOM   2075 N N     . LEU A 1 269 ? -2.177  11.538  -7.604  1.00 42.99  ? 269  LEU A N     1 
ATOM   2076 C CA    . LEU A 1 269 ? -3.072  11.790  -6.482  1.00 46.02  ? 269  LEU A CA    1 
ATOM   2077 C C     . LEU A 1 269 ? -2.659  11.007  -5.241  1.00 47.88  ? 269  LEU A C     1 
ATOM   2078 O O     . LEU A 1 269 ? -2.692  11.534  -4.130  1.00 51.84  ? 269  LEU A O     1 
ATOM   2079 C CB    . LEU A 1 269 ? -4.516  11.461  -6.861  1.00 42.79  ? 269  LEU A CB    1 
ATOM   2080 C CG    . LEU A 1 269 ? -5.171  12.436  -7.839  1.00 45.53  ? 269  LEU A CG    1 
ATOM   2081 C CD1   . LEU A 1 269 ? -6.581  11.988  -8.176  1.00 36.86  ? 269  LEU A CD1   1 
ATOM   2082 C CD2   . LEU A 1 269 ? -5.173  13.843  -7.260  1.00 37.71  ? 269  LEU A CD2   1 
ATOM   2083 N N     . GLN A 1 270 ? -2.289  9.759   -5.441  1.00 46.35  ? 270  GLN A N     1 
ATOM   2084 C CA    . GLN A 1 270 ? -1.810  8.943   -4.356  1.00 53.23  ? 270  GLN A CA    1 
ATOM   2085 C C     . GLN A 1 270 ? -0.574  9.541   -3.700  1.00 51.20  ? 270  GLN A C     1 
ATOM   2086 O O     . GLN A 1 270 ? -0.453  9.533   -2.517  1.00 49.97  ? 270  GLN A O     1 
ATOM   2087 C CB    . GLN A 1 270 ? -1.472  7.549   -4.845  1.00 54.71  ? 270  GLN A CB    1 
ATOM   2088 C CG    . GLN A 1 270 ? -2.655  6.701   -5.211  1.00 59.00  ? 270  GLN A CG    1 
ATOM   2089 C CD    . GLN A 1 270 ? -3.571  6.430   -4.062  1.00 65.48  ? 270  GLN A CD    1 
ATOM   2090 O OE1   . GLN A 1 270 ? -3.154  5.935   -3.023  1.00 68.73  ? 270  GLN A OE1   1 
ATOM   2091 N NE2   . GLN A 1 270 ? -4.842  6.726   -4.244  1.00 63.63  ? 270  GLN A NE2   1 
ATOM   2092 N N     . LYS A 1 271 ? 0.330   10.087  -4.492  1.00 50.39  ? 271  LYS A N     1 
ATOM   2093 C CA    . LYS A 1 271 ? 1.569   10.650  -3.989  1.00 48.33  ? 271  LYS A CA    1 
ATOM   2094 C C     . LYS A 1 271 ? 1.347   11.966  -3.299  1.00 54.87  ? 271  LYS A C     1 
ATOM   2095 O O     . LYS A 1 271 ? 1.724   12.129  -2.157  1.00 59.23  ? 271  LYS A O     1 
ATOM   2096 C CB    . LYS A 1 271 ? 2.572   10.778  -5.120  1.00 48.91  ? 271  LYS A CB    1 
ATOM   2097 C CG    . LYS A 1 271 ? 3.937   11.302  -4.759  1.00 56.95  ? 271  LYS A CG    1 
ATOM   2098 C CD    . LYS A 1 271 ? 4.690   10.415  -3.742  1.00 69.48  ? 271  LYS A CD    1 
ATOM   2099 C CE    . LYS A 1 271 ? 6.176   10.809  -3.539  1.00 65.58  ? 271  LYS A CE    1 
ATOM   2100 N NZ    . LYS A 1 271 ? 6.362   12.274  -3.317  1.00 67.18  ? 271  LYS A NZ    1 
ATOM   2101 N N     . LYS A 1 272 ? 0.679   12.889  -3.970  1.00 53.31  ? 272  LYS A N     1 
ATOM   2102 C CA    . LYS A 1 272 ? 0.525   14.239  -3.448  1.00 50.70  ? 272  LYS A CA    1 
ATOM   2103 C C     . LYS A 1 272 ? -0.606  14.456  -2.468  1.00 50.99  ? 272  LYS A C     1 
ATOM   2104 O O     . LYS A 1 272 ? -0.500  15.277  -1.594  1.00 49.06  ? 272  LYS A O     1 
ATOM   2105 C CB    . LYS A 1 272 ? 0.350   15.206  -4.579  1.00 50.03  ? 272  LYS A CB    1 
ATOM   2106 C CG    . LYS A 1 272 ? 1.512   16.080  -4.821  1.00 57.92  ? 272  LYS A CG    1 
ATOM   2107 C CD    . LYS A 1 272 ? 2.552   15.408  -5.656  1.00 56.42  ? 272  LYS A CD    1 
ATOM   2108 C CE    . LYS A 1 272 ? 3.521   16.435  -6.223  1.00 56.91  ? 272  LYS A CE    1 
ATOM   2109 N NZ    . LYS A 1 272 ? 4.169   17.261  -5.199  1.00 57.51  ? 272  LYS A NZ    1 
ATOM   2110 N N     . TYR A 1 273 ? -1.670  13.689  -2.601  1.00 52.13  ? 273  TYR A N     1 
ATOM   2111 C CA    . TYR A 1 273 ? -2.828  13.881  -1.764  1.00 51.99  ? 273  TYR A CA    1 
ATOM   2112 C C     . TYR A 1 273 ? -3.356  12.547  -1.295  1.00 56.62  ? 273  TYR A C     1 
ATOM   2113 O O     . TYR A 1 273 ? -4.368  12.103  -1.773  1.00 53.71  ? 273  TYR A O     1 
ATOM   2114 C CB    . TYR A 1 273 ? -3.930  14.607  -2.538  1.00 50.61  ? 273  TYR A CB    1 
ATOM   2115 C CG    . TYR A 1 273 ? -3.522  15.881  -3.209  1.00 47.78  ? 273  TYR A CG    1 
ATOM   2116 C CD1   . TYR A 1 273 ? -3.069  15.884  -4.498  1.00 47.55  ? 273  TYR A CD1   1 
ATOM   2117 C CD2   . TYR A 1 273 ? -3.599  17.065  -2.561  1.00 48.85  ? 273  TYR A CD2   1 
ATOM   2118 C CE1   . TYR A 1 273 ? -2.698  17.012  -5.091  1.00 47.12  ? 273  TYR A CE1   1 
ATOM   2119 C CE2   . TYR A 1 273 ? -3.233  18.200  -3.148  1.00 53.14  ? 273  TYR A CE2   1 
ATOM   2120 C CZ    . TYR A 1 273 ? -2.784  18.178  -4.411  1.00 52.14  ? 273  TYR A CZ    1 
ATOM   2121 O OH    . TYR A 1 273 ? -2.409  19.337  -5.001  1.00 49.06  ? 273  TYR A OH    1 
ATOM   2122 N N     . PRO A 1 274 ? -2.693  11.945  -0.322  1.00 59.26  ? 274  PRO A N     1 
ATOM   2123 C CA    . PRO A 1 274 ? -3.001  10.573  0.018   1.00 56.08  ? 274  PRO A CA    1 
ATOM   2124 C C     . PRO A 1 274 ? -4.273  10.458  0.840   1.00 52.91  ? 274  PRO A C     1 
ATOM   2125 O O     . PRO A 1 274 ? -5.018  9.528   0.650   1.00 54.10  ? 274  PRO A O     1 
ATOM   2126 C CB    . PRO A 1 274 ? -1.777  10.158  0.789   1.00 54.09  ? 274  PRO A CB    1 
ATOM   2127 C CG    . PRO A 1 274 ? -1.348  11.336  1.388   1.00 55.91  ? 274  PRO A CG    1 
ATOM   2128 C CD    . PRO A 1 274 ? -1.619  12.461  0.513   1.00 53.23  ? 274  PRO A CD    1 
ATOM   2129 N N     . SER A 1 275 ? -4.537  11.420  1.697   1.00 52.37  ? 275  SER A N     1 
ATOM   2130 C CA    . SER A 1 275 ? -5.716  11.388  2.556   1.00 56.08  ? 275  SER A CA    1 
ATOM   2131 C C     . SER A 1 275 ? -6.978  11.834  1.819   1.00 60.46  ? 275  SER A C     1 
ATOM   2132 O O     . SER A 1 275 ? -8.080  11.786  2.367   1.00 59.90  ? 275  SER A O     1 
ATOM   2133 C CB    . SER A 1 275 ? -5.495  12.257  3.798   1.00 58.81  ? 275  SER A CB    1 
ATOM   2134 O OG    . SER A 1 275 ? -5.311  13.614  3.443   1.00 66.98  ? 275  SER A OG    1 
ATOM   2135 N N     . LEU A 1 276 ? -6.813  12.257  0.569   1.00 56.65  ? 276  LEU A N     1 
ATOM   2136 C CA    . LEU A 1 276 ? -7.917  12.812  -0.206  1.00 51.70  ? 276  LEU A CA    1 
ATOM   2137 C C     . LEU A 1 276 ? -8.113  12.108  -1.548  1.00 48.51  ? 276  LEU A C     1 
ATOM   2138 O O     . LEU A 1 276 ? -9.142  12.284  -2.198  1.00 48.13  ? 276  LEU A O     1 
ATOM   2139 C CB    . LEU A 1 276 ? -7.688  14.306  -0.450  1.00 53.61  ? 276  LEU A CB    1 
ATOM   2140 C CG    . LEU A 1 276 ? -8.266  15.348  0.512   1.00 56.06  ? 276  LEU A CG    1 
ATOM   2141 C CD1   . LEU A 1 276 ? -7.799  15.136  1.941   1.00 57.82  ? 276  LEU A CD1   1 
ATOM   2142 C CD2   . LEU A 1 276 ? -7.883  16.734  0.030   1.00 56.22  ? 276  LEU A CD2   1 
ATOM   2143 N N     . ALA A 1 277 ? -7.125  11.309  -1.946  1.00 51.16  ? 277  ALA A N     1 
ATOM   2144 C CA    . ALA A 1 277 ? -7.074  10.709  -3.282  1.00 47.63  ? 277  ALA A CA    1 
ATOM   2145 C C     . ALA A 1 277 ? -8.340  9.968   -3.708  1.00 47.24  ? 277  ALA A C     1 
ATOM   2146 O O     . ALA A 1 277 ? -8.698  9.966   -4.886  1.00 47.41  ? 277  ALA A O     1 
ATOM   2147 C CB    . ALA A 1 277 ? -5.866  9.787   -3.402  1.00 49.43  ? 277  ALA A CB    1 
ATOM   2148 N N     . ASN A 1 278 ? -9.014  9.341   -2.751  1.00 47.50  ? 278  ASN A N     1 
ATOM   2149 C CA    . ASN A 1 278 ? -10.185 8.527   -3.060  1.00 47.38  ? 278  ASN A CA    1 
ATOM   2150 C C     . ASN A 1 278 ? -11.429 9.340   -3.427  1.00 45.16  ? 278  ASN A C     1 
ATOM   2151 O O     . ASN A 1 278 ? -12.392 8.798   -3.963  1.00 45.18  ? 278  ASN A O     1 
ATOM   2152 C CB    . ASN A 1 278 ? -10.486 7.562   -1.909  1.00 45.43  ? 278  ASN A CB    1 
ATOM   2153 C CG    . ASN A 1 278 ? -10.794 8.279   -0.608  1.00 52.47  ? 278  ASN A CG    1 
ATOM   2154 O OD1   . ASN A 1 278 ? -10.423 9.438   -0.418  1.00 53.75  ? 278  ASN A OD1   1 
ATOM   2155 N ND2   . ASN A 1 278 ? -11.474 7.588   0.299   1.00 56.87  ? 278  ASN A ND2   1 
ATOM   2156 N N     . ARG A 1 279 ? -11.403 10.639  -3.140  1.00 47.50  ? 279  ARG A N     1 
ATOM   2157 C CA    . ARG A 1 279 ? -12.512 11.519  -3.497  1.00 42.76  ? 279  ARG A CA    1 
ATOM   2158 C C     . ARG A 1 279 ? -12.068 12.593  -4.488  1.00 39.07  ? 279  ARG A C     1 
ATOM   2159 O O     . ARG A 1 279 ? -12.555 13.722  -4.457  1.00 39.17  ? 279  ARG A O     1 
ATOM   2160 C CB    . ARG A 1 279 ? -13.145 12.139  -2.244  1.00 48.41  ? 279  ARG A CB    1 
ATOM   2161 C CG    . ARG A 1 279 ? -13.910 11.138  -1.376  1.00 46.13  ? 279  ARG A CG    1 
ATOM   2162 C CD    . ARG A 1 279 ? -14.508 11.775  -0.122  1.00 56.55  ? 279  ARG A CD    1 
ATOM   2163 N NE    . ARG A 1 279 ? -13.485 12.321  0.766   1.00 61.57  ? 279  ARG A NE    1 
ATOM   2164 C CZ    . ARG A 1 279 ? -13.209 13.616  0.876   1.00 56.10  ? 279  ARG A CZ    1 
ATOM   2165 N NH1   . ARG A 1 279 ? -13.892 14.498  0.163   1.00 53.59  ? 279  ARG A NH1   1 
ATOM   2166 N NH2   . ARG A 1 279 ? -12.257 14.028  1.702   1.00 49.98  ? 279  ARG A NH2   1 
ATOM   2167 N N     . ASN A 1 280 ? -11.134 12.221  -5.359  1.00 39.18  ? 280  ASN A N     1 
ATOM   2168 C CA    . ASN A 1 280 ? -10.673 13.079  -6.447  1.00 36.48  ? 280  ASN A CA    1 
ATOM   2169 C C     . ASN A 1 280 ? -10.266 12.241  -7.652  1.00 32.22  ? 280  ASN A C     1 
ATOM   2170 O O     . ASN A 1 280 ? -10.124 11.024  -7.546  1.00 32.26  ? 280  ASN A O     1 
ATOM   2171 C CB    . ASN A 1 280 ? -9.499  13.956  -6.005  1.00 36.66  ? 280  ASN A CB    1 
ATOM   2172 C CG    . ASN A 1 280 ? -9.927  15.087  -5.097  1.00 35.85  ? 280  ASN A CG    1 
ATOM   2173 O OD1   . ASN A 1 280 ? -10.442 16.106  -5.558  1.00 34.85  ? 280  ASN A OD1   1 
ATOM   2174 N ND2   . ASN A 1 280 ? -9.719  14.913  -3.799  1.00 43.53  ? 280  ASN A ND2   1 
ATOM   2175 N N     . GLY A 1 281 ? -10.077 12.890  -8.797  1.00 32.36  ? 281  GLY A N     1 
ATOM   2176 C CA    . GLY A 1 281 ? -9.706  12.183  -10.007 1.00 32.19  ? 281  GLY A CA    1 
ATOM   2177 C C     . GLY A 1 281 ? -10.816 12.157  -11.037 1.00 31.68  ? 281  GLY A C     1 
ATOM   2178 O O     . GLY A 1 281 ? -11.966 12.473  -10.737 1.00 28.84  ? 281  GLY A O     1 
ATOM   2179 N N     . THR A 1 282 ? -10.461 11.776  -12.259 1.00 32.39  ? 282  THR A N     1 
ATOM   2180 C CA    . THR A 1 282 ? -11.400 11.740  -13.373 1.00 30.45  ? 282  THR A CA    1 
ATOM   2181 C C     . THR A 1 282 ? -12.483 10.682  -13.178 1.00 31.17  ? 282  THR A C     1 
ATOM   2182 O O     . THR A 1 282 ? -13.664 10.934  -13.424 1.00 30.33  ? 282  THR A O     1 
ATOM   2183 C CB    . THR A 1 282 ? -10.661 11.480  -14.700 1.00 32.88  ? 282  THR A CB    1 
ATOM   2184 O OG1   . THR A 1 282 ? -9.840  12.611  -15.019 1.00 36.38  ? 282  THR A OG1   1 
ATOM   2185 C CG2   . THR A 1 282 ? -11.646 11.242  -15.831 1.00 44.15  ? 282  THR A CG2   1 
ATOM   2186 N N     . LYS A 1 283 ? -12.078 9.499   -12.727 1.00 29.95  ? 283  LYS A N     1 
ATOM   2187 C CA    . LYS A 1 283 ? -13.006 8.385   -12.568 1.00 34.19  ? 283  LYS A CA    1 
ATOM   2188 C C     . LYS A 1 283 ? -14.013 8.664   -11.457 1.00 35.08  ? 283  LYS A C     1 
ATOM   2189 O O     . LYS A 1 283 ? -15.201 8.371   -11.599 1.00 36.04  ? 283  LYS A O     1 
ATOM   2190 C CB    . LYS A 1 283 ? -12.247 7.088   -12.283 1.00 31.80  ? 283  LYS A CB    1 
ATOM   2191 C CG    . LYS A 1 283 ? -10.966 6.929   -13.089 1.00 40.26  ? 283  LYS A CG    1 
ATOM   2192 C CD    . LYS A 1 283 ? -11.023 5.734   -14.033 1.00 44.87  ? 283  LYS A CD    1 
ATOM   2193 C CE    . LYS A 1 283 ? -11.890 6.015   -15.252 1.00 48.99  ? 283  LYS A CE    1 
ATOM   2194 N NZ    . LYS A 1 283 ? -11.840 4.889   -16.230 1.00 44.38  ? 283  LYS A NZ    1 
ATOM   2195 N N     . TYR A 1 284 ? -13.531 9.226   -10.351 1.00 30.61  ? 284  TYR A N     1 
ATOM   2196 C CA    . TYR A 1 284 ? -14.404 9.627   -9.254  1.00 33.01  ? 284  TYR A CA    1 
ATOM   2197 C C     . TYR A 1 284 ? -15.399 10.668  -9.747  1.00 33.74  ? 284  TYR A C     1 
ATOM   2198 O O     . TYR A 1 284 ? -16.604 10.508  -9.571  1.00 37.42  ? 284  TYR A O     1 
ATOM   2199 C CB    . TYR A 1 284 ? -13.586 10.176  -8.080  1.00 34.61  ? 284  TYR A CB    1 
ATOM   2200 C CG    . TYR A 1 284 ? -14.416 10.707  -6.927  1.00 36.24  ? 284  TYR A CG    1 
ATOM   2201 C CD1   . TYR A 1 284 ? -15.071 9.843   -6.057  1.00 37.50  ? 284  TYR A CD1   1 
ATOM   2202 C CD2   . TYR A 1 284 ? -14.529 12.073  -6.700  1.00 31.05  ? 284  TYR A CD2   1 
ATOM   2203 C CE1   . TYR A 1 284 ? -15.826 10.328  -4.999  1.00 35.96  ? 284  TYR A CE1   1 
ATOM   2204 C CE2   . TYR A 1 284 ? -15.278 12.566  -5.646  1.00 30.91  ? 284  TYR A CE2   1 
ATOM   2205 C CZ    . TYR A 1 284 ? -15.925 11.690  -4.800  1.00 37.03  ? 284  TYR A CZ    1 
ATOM   2206 O OH    . TYR A 1 284 ? -16.672 12.180  -3.752  1.00 38.55  ? 284  TYR A OH    1 
ATOM   2207 N N     . LEU A 1 285 ? -14.886 11.717  -10.385 1.00 29.38  ? 285  LEU A N     1 
ATOM   2208 C CA    . LEU A 1 285 ? -15.718 12.788  -10.929 1.00 33.57  ? 285  LEU A CA    1 
ATOM   2209 C C     . LEU A 1 285 ? -16.833 12.254  -11.823 1.00 29.34  ? 285  LEU A C     1 
ATOM   2210 O O     . LEU A 1 285 ? -17.969 12.715  -11.751 1.00 29.04  ? 285  LEU A O     1 
ATOM   2211 C CB    . LEU A 1 285 ? -14.862 13.788  -11.711 1.00 28.76  ? 285  LEU A CB    1 
ATOM   2212 C CG    . LEU A 1 285 ? -15.617 14.903  -12.439 1.00 30.31  ? 285  LEU A CG    1 
ATOM   2213 C CD1   . LEU A 1 285 ? -16.329 15.813  -11.451 1.00 27.42  ? 285  LEU A CD1   1 
ATOM   2214 C CD2   . LEU A 1 285 ? -14.678 15.705  -13.329 1.00 19.07  ? 285  LEU A CD2   1 
ATOM   2215 N N     . ALA A 1 286 ? -16.500 11.276  -12.658 1.00 28.86  ? 286  ALA A N     1 
ATOM   2216 C CA    . ALA A 1 286 ? -17.476 10.667  -13.553 1.00 30.13  ? 286  ALA A CA    1 
ATOM   2217 C C     . ALA A 1 286 ? -18.581 9.964   -12.771 1.00 34.55  ? 286  ALA A C     1 
ATOM   2218 O O     . ALA A 1 286 ? -19.744 9.979   -13.174 1.00 34.20  ? 286  ALA A O     1 
ATOM   2219 C CB    . ALA A 1 286 ? -16.792 9.692   -14.500 1.00 29.40  ? 286  ALA A CB    1 
ATOM   2220 N N     . ARG A 1 287 ? -18.213 9.354   -11.648 1.00 34.09  ? 287  ARG A N     1 
ATOM   2221 C CA    . ARG A 1 287 ? -19.176 8.606   -10.846 1.00 32.86  ? 287  ARG A CA    1 
ATOM   2222 C C     . ARG A 1 287 ? -20.111 9.496   -10.027 1.00 31.85  ? 287  ARG A C     1 
ATOM   2223 O O     . ARG A 1 287 ? -21.316 9.254   -9.990  1.00 30.15  ? 287  ARG A O     1 
ATOM   2224 C CB    . ARG A 1 287 ? -18.475 7.571   -9.956  1.00 41.87  ? 287  ARG A CB    1 
ATOM   2225 C CG    . ARG A 1 287 ? -18.189 6.252   -10.666 1.00 42.71  ? 287  ARG A CG    1 
ATOM   2226 C CD    . ARG A 1 287 ? -17.662 5.180   -9.718  1.00 52.38  ? 287  ARG A CD    1 
ATOM   2227 N NE    . ARG A 1 287 ? -16.252 5.369   -9.389  1.00 52.47  ? 287  ARG A NE    1 
ATOM   2228 C CZ    . ARG A 1 287 ? -15.813 5.905   -8.255  1.00 55.55  ? 287  ARG A CZ    1 
ATOM   2229 N NH1   . ARG A 1 287 ? -16.675 6.305   -7.330  1.00 58.47  ? 287  ARG A NH1   1 
ATOM   2230 N NH2   . ARG A 1 287 ? -14.510 6.037   -8.042  1.00 48.38  ? 287  ARG A NH2   1 
ATOM   2231 N N     . THR A 1 288 ? -19.573 10.524  -9.376  1.00 28.72  ? 288  THR A N     1 
ATOM   2232 C CA    . THR A 1 288 ? -20.426 11.403  -8.576  1.00 32.80  ? 288  THR A CA    1 
ATOM   2233 C C     . THR A 1 288 ? -21.300 12.296  -9.452  1.00 30.24  ? 288  THR A C     1 
ATOM   2234 O O     . THR A 1 288 ? -22.416 12.625  -9.069  1.00 32.96  ? 288  THR A O     1 
ATOM   2235 C CB    . THR A 1 288 ? -19.641 12.275  -7.568  1.00 35.86  ? 288  THR A CB    1 
ATOM   2236 O OG1   . THR A 1 288 ? -19.542 13.618  -8.058  1.00 42.55  ? 288  THR A OG1   1 
ATOM   2237 C CG2   . THR A 1 288 ? -18.259 11.712  -7.320  1.00 29.42  ? 288  THR A CG2   1 
ATOM   2238 N N     . LEU A 1 289 ? -20.795 12.683  -10.621 1.00 30.06  ? 289  LEU A N     1 
ATOM   2239 C CA    . LEU A 1 289 ? -21.591 13.464  -11.568 1.00 28.33  ? 289  LEU A CA    1 
ATOM   2240 C C     . LEU A 1 289 ? -22.771 12.646  -12.081 1.00 28.17  ? 289  LEU A C     1 
ATOM   2241 O O     . LEU A 1 289 ? -23.854 13.181  -12.318 1.00 29.52  ? 289  LEU A O     1 
ATOM   2242 C CB    . LEU A 1 289 ? -20.742 13.949  -12.745 1.00 28.57  ? 289  LEU A CB    1 
ATOM   2243 C CG    . LEU A 1 289 ? -19.844 15.170  -12.536 1.00 27.03  ? 289  LEU A CG    1 
ATOM   2244 C CD1   . LEU A 1 289 ? -19.132 15.522  -13.835 1.00 27.37  ? 289  LEU A CD1   1 
ATOM   2245 C CD2   . LEU A 1 289 ? -20.644 16.357  -12.020 1.00 24.94  ? 289  LEU A CD2   1 
ATOM   2246 N N     . ASN A 1 290 ? -22.552 11.347  -12.254 1.00 30.28  ? 290  ASN A N     1 
ATOM   2247 C CA    . ASN A 1 290 ? -23.615 10.441  -12.671 1.00 27.65  ? 290  ASN A CA    1 
ATOM   2248 C C     . ASN A 1 290 ? -24.684 10.303  -11.595 1.00 29.17  ? 290  ASN A C     1 
ATOM   2249 O O     . ASN A 1 290 ? -25.875 10.455  -11.866 1.00 31.13  ? 290  ASN A O     1 
ATOM   2250 C CB    . ASN A 1 290 ? -23.043 9.068   -13.024 1.00 28.27  ? 290  ASN A CB    1 
ATOM   2251 C CG    . ASN A 1 290 ? -24.120 8.013   -13.178 1.00 32.58  ? 290  ASN A CG    1 
ATOM   2252 O OD1   . ASN A 1 290 ? -24.470 7.323   -12.218 1.00 34.40  ? 290  ASN A OD1   1 
ATOM   2253 N ND2   . ASN A 1 290 ? -24.655 7.883   -14.387 1.00 28.28  ? 290  ASN A ND2   1 
ATOM   2254 N N     . ARG A 1 291 ? -24.250 10.014  -10.372 1.00 30.47  ? 291  ARG A N     1 
ATOM   2255 C CA    . ARG A 1 291 ? -25.161 9.899   -9.241  1.00 26.90  ? 291  ARG A CA    1 
ATOM   2256 C C     . ARG A 1 291 ? -25.880 11.214  -8.956  1.00 29.78  ? 291  ARG A C     1 
ATOM   2257 O O     . ARG A 1 291 ? -27.073 11.223  -8.652  1.00 32.91  ? 291  ARG A O     1 
ATOM   2258 C CB    . ARG A 1 291 ? -24.414 9.436   -7.990  1.00 33.47  ? 291  ARG A CB    1 
ATOM   2259 C CG    . ARG A 1 291 ? -24.303 7.928   -7.852  1.00 47.57  ? 291  ARG A CG    1 
ATOM   2260 C CD    . ARG A 1 291 ? -24.572 7.503   -6.417  1.00 56.30  ? 291  ARG A CD    1 
ATOM   2261 N NE    . ARG A 1 291 ? -25.565 6.435   -6.343  1.00 61.85  ? 291  ARG A NE    1 
ATOM   2262 C CZ    . ARG A 1 291 ? -26.303 6.174   -5.269  1.00 61.02  ? 291  ARG A CZ    1 
ATOM   2263 N NH1   . ARG A 1 291 ? -26.168 6.910   -4.173  1.00 56.09  ? 291  ARG A NH1   1 
ATOM   2264 N NH2   . ARG A 1 291 ? -27.183 5.181   -5.291  1.00 62.82  ? 291  ARG A NH2   1 
ATOM   2265 N N     . LEU A 1 292 ? -25.148 12.320  -9.054  1.00 24.93  ? 292  LEU A N     1 
ATOM   2266 C CA    . LEU A 1 292 ? -25.712 13.641  -8.800  1.00 30.66  ? 292  LEU A CA    1 
ATOM   2267 C C     . LEU A 1 292 ? -26.816 13.972  -9.793  1.00 30.78  ? 292  LEU A C     1 
ATOM   2268 O O     . LEU A 1 292 ? -27.881 14.450  -9.409  1.00 32.09  ? 292  LEU A O     1 
ATOM   2269 C CB    . LEU A 1 292 ? -24.623 14.715  -8.859  1.00 29.07  ? 292  LEU A CB    1 
ATOM   2270 C CG    . LEU A 1 292 ? -25.042 16.164  -8.613  1.00 32.01  ? 292  LEU A CG    1 
ATOM   2271 C CD1   . LEU A 1 292 ? -25.649 16.320  -7.228  1.00 33.35  ? 292  LEU A CD1   1 
ATOM   2272 C CD2   . LEU A 1 292 ? -23.850 17.094  -8.787  1.00 30.96  ? 292  LEU A CD2   1 
ATOM   2273 N N     . LEU A 1 293 ? -26.559 13.713  -11.071 1.00 25.63  ? 293  LEU A N     1 
ATOM   2274 C CA    . LEU A 1 293 ? -27.534 14.007  -12.113 1.00 28.72  ? 293  LEU A CA    1 
ATOM   2275 C C     . LEU A 1 293 ? -28.773 13.127  -11.982 1.00 27.04  ? 293  LEU A C     1 
ATOM   2276 O O     . LEU A 1 293 ? -29.894 13.598  -12.167 1.00 26.02  ? 293  LEU A O     1 
ATOM   2277 C CB    . LEU A 1 293 ? -26.915 13.850  -13.503 1.00 26.44  ? 293  LEU A CB    1 
ATOM   2278 C CG    . LEU A 1 293 ? -27.816 14.280  -14.662 1.00 23.49  ? 293  LEU A CG    1 
ATOM   2279 C CD1   . LEU A 1 293 ? -28.272 15.718  -14.471 1.00 20.91  ? 293  LEU A CD1   1 
ATOM   2280 C CD2   . LEU A 1 293 ? -27.104 14.113  -15.995 1.00 25.79  ? 293  LEU A CD2   1 
ATOM   2281 N N     . MET A 1 294 ? -28.567 11.854  -11.658 1.00 26.72  ? 294  MET A N     1 
ATOM   2282 C CA    . MET A 1 294 ? -29.680 10.927  -11.471 1.00 29.75  ? 294  MET A CA    1 
ATOM   2283 C C     . MET A 1 294 ? -30.571 11.359  -10.313 1.00 28.10  ? 294  MET A C     1 
ATOM   2284 O O     . MET A 1 294 ? -31.794 11.366  -10.432 1.00 29.37  ? 294  MET A O     1 
ATOM   2285 C CB    . MET A 1 294 ? -29.175 9.499   -11.241 1.00 26.68  ? 294  MET A CB    1 
ATOM   2286 C CG    . MET A 1 294 ? -28.573 8.843   -12.473 1.00 29.07  ? 294  MET A CG    1 
ATOM   2287 S SD    . MET A 1 294 ? -28.018 7.153   -12.162 1.00 36.70  ? 294  MET A SD    1 
ATOM   2288 C CE    . MET A 1 294 ? -29.577 6.355   -11.792 1.00 27.77  ? 294  MET A CE    1 
ATOM   2289 N N     . HIS A 1 295 ? -29.949 11.724  -9.195  1.00 29.71  ? 295  HIS A N     1 
ATOM   2290 C CA    . HIS A 1 295 ? -30.688 12.166  -8.018  1.00 32.20  ? 295  HIS A CA    1 
ATOM   2291 C C     . HIS A 1 295 ? -31.383 13.501  -8.262  1.00 34.55  ? 295  HIS A C     1 
ATOM   2292 O O     . HIS A 1 295 ? -32.500 13.723  -7.795  1.00 33.02  ? 295  HIS A O     1 
ATOM   2293 C CB    . HIS A 1 295 ? -29.760 12.277  -6.805  1.00 34.98  ? 295  HIS A CB    1 
ATOM   2294 C CG    . HIS A 1 295 ? -29.361 10.955  -6.223  1.00 43.86  ? 295  HIS A CG    1 
ATOM   2295 N ND1   . HIS A 1 295 ? -29.599 9.758   -6.863  1.00 48.53  ? 295  HIS A ND1   1 
ATOM   2296 C CD2   . HIS A 1 295 ? -28.745 10.645  -5.060  1.00 50.00  ? 295  HIS A CD2   1 
ATOM   2297 C CE1   . HIS A 1 295 ? -29.143 8.766   -6.118  1.00 47.62  ? 295  HIS A CE1   1 
ATOM   2298 N NE2   . HIS A 1 295 ? -28.620 9.277   -5.018  1.00 51.82  ? 295  HIS A NE2   1 
ATOM   2299 N N     . HIS A 1 296 ? -30.717 14.387  -8.994  1.00 32.20  ? 296  HIS A N     1 
ATOM   2300 C CA    . HIS A 1 296 ? -31.270 15.707  -9.277  1.00 32.41  ? 296  HIS A CA    1 
ATOM   2301 C C     . HIS A 1 296 ? -32.491 15.614  -10.185 1.00 28.85  ? 296  HIS A C     1 
ATOM   2302 O O     . HIS A 1 296 ? -33.482 16.314  -9.978  1.00 32.05  ? 296  HIS A O     1 
ATOM   2303 C CB    . HIS A 1 296 ? -30.212 16.614  -9.906  1.00 32.05  ? 296  HIS A CB    1 
ATOM   2304 C CG    . HIS A 1 296 ? -30.670 18.026  -10.111 1.00 28.00  ? 296  HIS A CG    1 
ATOM   2305 N ND1   . HIS A 1 296 ? -31.145 18.808  -9.079  1.00 35.55  ? 296  HIS A ND1   1 
ATOM   2306 C CD2   . HIS A 1 296 ? -30.724 18.794  -11.221 1.00 30.78  ? 296  HIS A CD2   1 
ATOM   2307 C CE1   . HIS A 1 296 ? -31.473 20.000  -9.549  1.00 32.96  ? 296  HIS A CE1   1 
ATOM   2308 N NE2   . HIS A 1 296 ? -31.227 20.015  -10.849 1.00 31.89  ? 296  HIS A NE2   1 
ATOM   2309 N N     . ILE A 1 297 ? -32.417 14.745  -11.188 1.00 29.90  ? 297  ILE A N     1 
ATOM   2310 C CA    . ILE A 1 297 ? -33.512 14.581  -12.139 1.00 29.88  ? 297  ILE A CA    1 
ATOM   2311 C C     . ILE A 1 297 ? -34.774 14.022  -11.480 1.00 31.17  ? 297  ILE A C     1 
ATOM   2312 O O     . ILE A 1 297 ? -35.875 14.519  -11.722 1.00 30.98  ? 297  ILE A O     1 
ATOM   2313 C CB    . ILE A 1 297 ? -33.102 13.699  -13.336 1.00 27.28  ? 297  ILE A CB    1 
ATOM   2314 C CG1   . ILE A 1 297 ? -32.089 14.436  -14.213 1.00 27.72  ? 297  ILE A CG1   1 
ATOM   2315 C CG2   . ILE A 1 297 ? -34.317 13.326  -14.163 1.00 23.08  ? 297  ILE A CG2   1 
ATOM   2316 C CD1   . ILE A 1 297 ? -31.494 13.583  -15.312 1.00 23.01  ? 297  ILE A CD1   1 
ATOM   2317 N N     . ARG A 1 298 ? -34.617 13.002  -10.640 1.00 29.06  ? 298  ARG A N     1 
ATOM   2318 C CA    . ARG A 1 298 ? -35.763 12.425  -9.941  1.00 34.38  ? 298  ARG A CA    1 
ATOM   2319 C C     . ARG A 1 298 ? -36.366 13.405  -8.934  1.00 32.01  ? 298  ARG A C     1 
ATOM   2320 O O     . ARG A 1 298 ? -37.553 13.333  -8.621  1.00 38.44  ? 298  ARG A O     1 
ATOM   2321 C CB    . ARG A 1 298 ? -35.401 11.095  -9.268  1.00 33.56  ? 298  ARG A CB    1 
ATOM   2322 C CG    . ARG A 1 298 ? -34.337 11.181  -8.185  1.00 45.83  ? 298  ARG A CG    1 
ATOM   2323 C CD    . ARG A 1 298 ? -34.917 10.871  -6.809  1.00 48.18  ? 298  ARG A CD    1 
ATOM   2324 N NE    . ARG A 1 298 ? -33.924 10.287  -5.910  1.00 51.52  ? 298  ARG A NE    1 
ATOM   2325 C CZ    . ARG A 1 298 ? -33.113 10.990  -5.124  1.00 48.67  ? 298  ARG A CZ    1 
ATOM   2326 N NH1   . ARG A 1 298 ? -33.170 12.314  -5.122  1.00 46.67  ? 298  ARG A NH1   1 
ATOM   2327 N NH2   . ARG A 1 298 ? -32.243 10.368  -4.340  1.00 54.62  ? 298  ARG A NH2   1 
ATOM   2328 N N     . ASP A 1 299 ? -35.541 14.321  -8.437  1.00 33.82  ? 299  ASP A N     1 
ATOM   2329 C CA    . ASP A 1 299 ? -36.013 15.384  -7.555  1.00 33.77  ? 299  ASP A CA    1 
ATOM   2330 C C     . ASP A 1 299 ? -36.886 16.379  -8.312  1.00 35.08  ? 299  ASP A C     1 
ATOM   2331 O O     . ASP A 1 299 ? -37.914 16.830  -7.806  1.00 33.23  ? 299  ASP A O     1 
ATOM   2332 C CB    . ASP A 1 299 ? -34.830 16.126  -6.929  1.00 35.28  ? 299  ASP A CB    1 
ATOM   2333 C CG    . ASP A 1 299 ? -34.227 15.381  -5.757  1.00 42.48  ? 299  ASP A CG    1 
ATOM   2334 O OD1   . ASP A 1 299 ? -34.465 14.160  -5.640  1.00 39.36  ? 299  ASP A OD1   1 
ATOM   2335 O OD2   . ASP A 1 299 ? -33.513 16.018  -4.953  1.00 44.63  ? 299  ASP A OD2   1 
ATOM   2336 N N     . CYS A 1 300 ? -36.470 16.712  -9.530  1.00 30.73  ? 300  CYS A N     1 
ATOM   2337 C CA    . CYS A 1 300 ? -37.132 17.747  -10.318 1.00 34.19  ? 300  CYS A CA    1 
ATOM   2338 C C     . CYS A 1 300 ? -38.238 17.201  -11.216 1.00 30.05  ? 300  CYS A C     1 
ATOM   2339 O O     . CYS A 1 300 ? -39.029 17.965  -11.767 1.00 31.61  ? 300  CYS A O     1 
ATOM   2340 C CB    . CYS A 1 300 ? -36.105 18.500  -11.166 1.00 29.41  ? 300  CYS A CB    1 
ATOM   2341 S SG    . CYS A 1 300 ? -34.774 19.264  -10.217 1.00 31.25  ? 300  CYS A SG    1 
ATOM   2342 N N     . LEU A 1 301 ? -38.285 15.879  -11.359 1.00 29.98  ? 301  LEU A N     1 
ATOM   2343 C CA    . LEU A 1 301 ? -39.241 15.222  -12.253 1.00 30.77  ? 301  LEU A CA    1 
ATOM   2344 C C     . LEU A 1 301 ? -40.719 15.568  -11.987 1.00 32.67  ? 301  LEU A C     1 
ATOM   2345 O O     . LEU A 1 301 ? -41.447 15.883  -12.929 1.00 34.83  ? 301  LEU A O     1 
ATOM   2346 C CB    . LEU A 1 301 ? -39.023 13.700  -12.256 1.00 34.41  ? 301  LEU A CB    1 
ATOM   2347 C CG    . LEU A 1 301 ? -39.333 12.862  -13.505 1.00 33.35  ? 301  LEU A CG    1 
ATOM   2348 C CD1   . LEU A 1 301 ? -40.239 11.690  -13.148 1.00 29.55  ? 301  LEU A CD1   1 
ATOM   2349 C CD2   . LEU A 1 301 ? -39.924 13.680  -14.650 1.00 35.43  ? 301  LEU A CD2   1 
ATOM   2350 N N     . PRO A 1 302 ? -41.173 15.508  -10.718 1.00 33.00  ? 302  PRO A N     1 
ATOM   2351 C CA    . PRO A 1 302 ? -42.586 15.846  -10.496 1.00 34.10  ? 302  PRO A CA    1 
ATOM   2352 C C     . PRO A 1 302 ? -42.949 17.274  -10.910 1.00 33.56  ? 302  PRO A C     1 
ATOM   2353 O O     . PRO A 1 302 ? -43.967 17.463  -11.573 1.00 28.42  ? 302  PRO A O     1 
ATOM   2354 C CB    . PRO A 1 302 ? -42.752 15.672  -8.984  1.00 33.26  ? 302  PRO A CB    1 
ATOM   2355 C CG    . PRO A 1 302 ? -41.709 14.681  -8.610  1.00 35.13  ? 302  PRO A CG    1 
ATOM   2356 C CD    . PRO A 1 302 ? -40.539 15.007  -9.484  1.00 30.66  ? 302  PRO A CD    1 
ATOM   2357 N N     . GLU A 1 303 ? -42.133 18.256  -10.537 1.00 33.54  ? 303  GLU A N     1 
ATOM   2358 C CA    . GLU A 1 303 ? -42.397 19.645  -10.910 1.00 36.04  ? 303  GLU A CA    1 
ATOM   2359 C C     . GLU A 1 303 ? -42.271 19.856  -12.418 1.00 33.11  ? 303  GLU A C     1 
ATOM   2360 O O     . GLU A 1 303 ? -43.025 20.627  -13.009 1.00 32.75  ? 303  GLU A O     1 
ATOM   2361 C CB    . GLU A 1 303 ? -41.470 20.601  -10.153 1.00 35.83  ? 303  GLU A CB    1 
ATOM   2362 C CG    . GLU A 1 303 ? -41.554 22.057  -10.607 1.00 45.17  ? 303  GLU A CG    1 
ATOM   2363 C CD    . GLU A 1 303 ? -42.946 22.650  -10.451 1.00 55.15  ? 303  GLU A CD    1 
ATOM   2364 O OE1   . GLU A 1 303 ? -43.364 22.899  -9.300  1.00 62.80  ? 303  GLU A OE1   1 
ATOM   2365 O OE2   . GLU A 1 303 ? -43.620 22.870  -11.481 1.00 40.33  ? 303  GLU A OE2   1 
ATOM   2366 N N     . LEU A 1 304 ? -41.319 19.164  -13.036 1.00 32.41  ? 304  LEU A N     1 
ATOM   2367 C CA    . LEU A 1 304 ? -41.127 19.250  -14.480 1.00 29.58  ? 304  LEU A CA    1 
ATOM   2368 C C     . LEU A 1 304 ? -42.382 18.829  -15.236 1.00 32.53  ? 304  LEU A C     1 
ATOM   2369 O O     . LEU A 1 304 ? -42.748 19.445  -16.237 1.00 31.33  ? 304  LEU A O     1 
ATOM   2370 C CB    . LEU A 1 304 ? -39.937 18.393  -14.918 1.00 29.02  ? 304  LEU A CB    1 
ATOM   2371 C CG    . LEU A 1 304 ? -39.738 18.187  -16.422 1.00 27.71  ? 304  LEU A CG    1 
ATOM   2372 C CD1   . LEU A 1 304 ? -39.554 19.515  -17.141 1.00 25.60  ? 304  LEU A CD1   1 
ATOM   2373 C CD2   . LEU A 1 304 ? -38.555 17.266  -16.685 1.00 28.24  ? 304  LEU A CD2   1 
ATOM   2374 N N     . LYS A 1 305 ? -43.043 17.784  -14.747 1.00 29.87  ? 305  LYS A N     1 
ATOM   2375 C CA    . LYS A 1 305 ? -44.234 17.261  -15.408 1.00 31.23  ? 305  LYS A CA    1 
ATOM   2376 C C     . LYS A 1 305 ? -45.400 18.246  -15.363 1.00 32.59  ? 305  LYS A C     1 
ATOM   2377 O O     . LYS A 1 305 ? -46.081 18.454  -16.368 1.00 32.79  ? 305  LYS A O     1 
ATOM   2378 C CB    . LYS A 1 305 ? -44.655 15.918  -14.804 1.00 37.12  ? 305  LYS A CB    1 
ATOM   2379 C CG    . LYS A 1 305 ? -45.732 15.205  -15.612 1.00 46.00  ? 305  LYS A CG    1 
ATOM   2380 C CD    . LYS A 1 305 ? -46.062 13.829  -15.050 1.00 45.70  ? 305  LYS A CD    1 
ATOM   2381 C CE    . LYS A 1 305 ? -47.187 13.891  -14.030 1.00 47.57  ? 305  LYS A CE    1 
ATOM   2382 N NZ    . LYS A 1 305 ? -47.592 12.528  -13.583 1.00 54.19  ? 305  LYS A NZ    1 
ATOM   2383 N N     . THR A 1 306 ? -45.631 18.850  -14.201 1.00 33.48  ? 306  THR A N     1 
ATOM   2384 C CA    . THR A 1 306 ? -46.730 19.799  -14.059 1.00 33.54  ? 306  THR A CA    1 
ATOM   2385 C C     . THR A 1 306 ? -46.438 21.089  -14.815 1.00 28.15  ? 306  THR A C     1 
ATOM   2386 O O     . THR A 1 306 ? -47.344 21.696  -15.380 1.00 31.08  ? 306  THR A O     1 
ATOM   2387 C CB    . THR A 1 306 ? -47.037 20.140  -12.584 1.00 30.10  ? 306  THR A CB    1 
ATOM   2388 O OG1   . THR A 1 306 ? -46.283 21.290  -12.183 1.00 42.43  ? 306  THR A OG1   1 
ATOM   2389 C CG2   . THR A 1 306 ? -46.709 18.971  -11.678 1.00 26.95  ? 306  THR A CG2   1 
ATOM   2390 N N     . ARG A 1 307 ? -45.174 21.502  -14.825 1.00 31.76  ? 307  ARG A N     1 
ATOM   2391 C CA    . ARG A 1 307 ? -44.784 22.729  -15.513 1.00 29.40  ? 307  ARG A CA    1 
ATOM   2392 C C     . ARG A 1 307 ? -45.046 22.633  -17.010 1.00 29.11  ? 307  ARG A C     1 
ATOM   2393 O O     . ARG A 1 307 ? -45.500 23.593  -17.630 1.00 32.60  ? 307  ARG A O     1 
ATOM   2394 C CB    . ARG A 1 307 ? -43.314 23.070  -15.261 1.00 28.46  ? 307  ARG A CB    1 
ATOM   2395 C CG    . ARG A 1 307 ? -42.881 24.361  -15.941 1.00 32.47  ? 307  ARG A CG    1 
ATOM   2396 C CD    . ARG A 1 307 ? -41.495 24.805  -15.512 1.00 31.45  ? 307  ARG A CD    1 
ATOM   2397 N NE    . ARG A 1 307 ? -41.156 26.108  -16.079 1.00 39.89  ? 307  ARG A NE    1 
ATOM   2398 C CZ    . ARG A 1 307 ? -41.386 27.270  -15.474 1.00 40.06  ? 307  ARG A CZ    1 
ATOM   2399 N NH1   . ARG A 1 307 ? -41.951 27.297  -14.275 1.00 35.02  ? 307  ARG A NH1   1 
ATOM   2400 N NH2   . ARG A 1 307 ? -41.047 28.408  -16.067 1.00 39.31  ? 307  ARG A NH2   1 
ATOM   2401 N N     . ILE A 1 308 ? -44.757 21.469  -17.584 1.00 30.23  ? 308  ILE A N     1 
ATOM   2402 C CA    . ILE A 1 308 ? -45.023 21.222  -18.996 1.00 29.36  ? 308  ILE A CA    1 
ATOM   2403 C C     . ILE A 1 308 ? -46.518 21.335  -19.284 1.00 29.49  ? 308  ILE A C     1 
ATOM   2404 O O     . ILE A 1 308 ? -46.924 21.883  -20.310 1.00 29.85  ? 308  ILE A O     1 
ATOM   2405 C CB    . ILE A 1 308 ? -44.486 19.842  -19.433 1.00 32.07  ? 308  ILE A CB    1 
ATOM   2406 C CG1   . ILE A 1 308 ? -42.962 19.894  -19.566 1.00 29.32  ? 308  ILE A CG1   1 
ATOM   2407 C CG2   . ILE A 1 308 ? -45.113 19.401  -20.749 1.00 29.63  ? 308  ILE A CG2   1 
ATOM   2408 C CD1   . ILE A 1 308 ? -42.331 18.571  -19.929 1.00 26.90  ? 308  ILE A CD1   1 
ATOM   2409 N N     . ASN A 1 309 ? -47.333 20.835  -18.361 1.00 29.94  ? 309  ASN A N     1 
ATOM   2410 C CA    . ASN A 1 309 ? -48.782 20.933  -18.490 1.00 32.81  ? 309  ASN A CA    1 
ATOM   2411 C C     . ASN A 1 309 ? -49.291 22.357  -18.269 1.00 29.50  ? 309  ASN A C     1 
ATOM   2412 O O     . ASN A 1 309 ? -50.169 22.827  -18.992 1.00 33.38  ? 309  ASN A O     1 
ATOM   2413 C CB    . ASN A 1 309 ? -49.477 19.962  -17.533 1.00 32.78  ? 309  ASN A CB    1 
ATOM   2414 C CG    . ASN A 1 309 ? -49.330 18.517  -17.962 1.00 35.88  ? 309  ASN A CG    1 
ATOM   2415 O OD1   . ASN A 1 309 ? -49.175 18.221  -19.148 1.00 38.13  ? 309  ASN A OD1   1 
ATOM   2416 N ND2   . ASN A 1 309 ? -49.383 17.605  -16.997 1.00 32.85  ? 309  ASN A ND2   1 
ATOM   2417 N N     . VAL A 1 310 ? -48.734 23.037  -17.270 1.00 28.83  ? 310  VAL A N     1 
ATOM   2418 C CA    . VAL A 1 310 ? -49.090 24.426  -16.989 1.00 27.28  ? 310  VAL A CA    1 
ATOM   2419 C C     . VAL A 1 310 ? -48.701 25.332  -18.157 1.00 30.41  ? 310  VAL A C     1 
ATOM   2420 O O     . VAL A 1 310 ? -49.472 26.202  -18.564 1.00 31.56  ? 310  VAL A O     1 
ATOM   2421 C CB    . VAL A 1 310 ? -48.426 24.928  -15.685 1.00 28.35  ? 310  VAL A CB    1 
ATOM   2422 C CG1   . VAL A 1 310 ? -48.545 26.441  -15.562 1.00 25.92  ? 310  VAL A CG1   1 
ATOM   2423 C CG2   . VAL A 1 310 ? -49.042 24.241  -14.475 1.00 30.01  ? 310  VAL A CG2   1 
ATOM   2424 N N     . LEU A 1 311 ? -47.505 25.115  -18.694 1.00 26.79  ? 311  LEU A N     1 
ATOM   2425 C CA    . LEU A 1 311 ? -47.033 25.859  -19.856 1.00 29.62  ? 311  LEU A CA    1 
ATOM   2426 C C     . LEU A 1 311 ? -47.942 25.628  -21.056 1.00 29.90  ? 311  LEU A C     1 
ATOM   2427 O O     . LEU A 1 311 ? -48.238 26.554  -21.810 1.00 29.70  ? 311  LEU A O     1 
ATOM   2428 C CB    . LEU A 1 311 ? -45.600 25.449  -20.202 1.00 26.42  ? 311  LEU A CB    1 
ATOM   2429 C CG    . LEU A 1 311 ? -44.479 26.423  -19.834 1.00 31.08  ? 311  LEU A CG    1 
ATOM   2430 C CD1   . LEU A 1 311 ? -44.829 27.213  -18.585 1.00 36.04  ? 311  LEU A CD1   1 
ATOM   2431 C CD2   . LEU A 1 311 ? -43.174 25.671  -19.637 1.00 26.51  ? 311  LEU A CD2   1 
ATOM   2432 N N     . ALA A 1 312 ? -48.384 24.386  -21.220 1.00 34.08  ? 312  ALA A N     1 
ATOM   2433 C CA    . ALA A 1 312 ? -49.242 24.009  -22.336 1.00 34.59  ? 312  ALA A CA    1 
ATOM   2434 C C     . ALA A 1 312 ? -50.562 24.770  -22.318 1.00 33.90  ? 312  ALA A C     1 
ATOM   2435 O O     . ALA A 1 312 ? -50.994 25.303  -23.340 1.00 34.32  ? 312  ALA A O     1 
ATOM   2436 C CB    . ALA A 1 312 ? -49.497 22.512  -22.317 1.00 28.47  ? 312  ALA A CB    1 
ATOM   2437 N N     . ALA A 1 313 ? -51.197 24.814  -21.151 1.00 34.35  ? 313  ALA A N     1 
ATOM   2438 C CA    . ALA A 1 313 ? -52.479 25.491  -20.995 1.00 32.38  ? 313  ALA A CA    1 
ATOM   2439 C C     . ALA A 1 313 ? -52.352 26.993  -21.235 1.00 36.04  ? 313  ALA A C     1 
ATOM   2440 O O     . ALA A 1 313 ? -53.247 27.617  -21.806 1.00 37.59  ? 313  ALA A O     1 
ATOM   2441 C CB    . ALA A 1 313 ? -53.055 25.220  -19.616 1.00 32.98  ? 313  ALA A CB    1 
ATOM   2442 N N     . GLN A 1 314 ? -51.235 27.566  -20.797 1.00 36.41  ? 314  GLN A N     1 
ATOM   2443 C CA    . GLN A 1 314 ? -50.985 28.993  -20.971 1.00 34.58  ? 314  GLN A CA    1 
ATOM   2444 C C     . GLN A 1 314 ? -50.787 29.352  -22.440 1.00 39.54  ? 314  GLN A C     1 
ATOM   2445 O O     . GLN A 1 314 ? -51.392 30.300  -22.941 1.00 40.98  ? 314  GLN A O     1 
ATOM   2446 C CB    . GLN A 1 314 ? -49.766 29.430  -20.156 1.00 32.58  ? 314  GLN A CB    1 
ATOM   2447 C CG    . GLN A 1 314 ? -49.995 29.452  -18.654 1.00 36.56  ? 314  GLN A CG    1 
ATOM   2448 C CD    . GLN A 1 314 ? -48.720 29.713  -17.876 1.00 41.56  ? 314  GLN A CD    1 
ATOM   2449 O OE1   . GLN A 1 314 ? -47.619 29.576  -18.407 1.00 48.73  ? 314  GLN A OE1   1 
ATOM   2450 N NE2   . GLN A 1 314 ? -48.864 30.091  -16.612 1.00 41.34  ? 314  GLN A NE2   1 
ATOM   2451 N N     . TYR A 1 315 ? -49.937 28.591  -23.123 1.00 34.63  ? 315  TYR A N     1 
ATOM   2452 C CA    . TYR A 1 315 ? -49.663 28.821  -24.537 1.00 37.38  ? 315  TYR A CA    1 
ATOM   2453 C C     . TYR A 1 315 ? -50.914 28.660  -25.397 1.00 36.80  ? 315  TYR A C     1 
ATOM   2454 O O     . TYR A 1 315 ? -51.095 29.377  -26.379 1.00 39.14  ? 315  TYR A O     1 
ATOM   2455 C CB    . TYR A 1 315 ? -48.558 27.886  -25.035 1.00 34.08  ? 315  TYR A CB    1 
ATOM   2456 C CG    . TYR A 1 315 ? -47.158 28.434  -24.864 1.00 33.17  ? 315  TYR A CG    1 
ATOM   2457 C CD1   . TYR A 1 315 ? -46.600 29.272  -25.821 1.00 34.31  ? 315  TYR A CD1   1 
ATOM   2458 C CD2   . TYR A 1 315 ? -46.392 28.110  -23.751 1.00 27.70  ? 315  TYR A CD2   1 
ATOM   2459 C CE1   . TYR A 1 315 ? -45.322 29.775  -25.674 1.00 35.49  ? 315  TYR A CE1   1 
ATOM   2460 C CE2   . TYR A 1 315 ? -45.113 28.608  -23.594 1.00 31.46  ? 315  TYR A CE2   1 
ATOM   2461 C CZ    . TYR A 1 315 ? -44.583 29.440  -24.559 1.00 35.65  ? 315  TYR A CZ    1 
ATOM   2462 O OH    . TYR A 1 315 ? -43.309 29.938  -24.410 1.00 37.04  ? 315  TYR A OH    1 
ATOM   2463 N N     . GLN A 1 316 ? -51.775 27.719  -25.020 1.00 38.79  ? 316  GLN A N     1 
ATOM   2464 C CA    . GLN A 1 316 ? -53.005 27.472  -25.764 1.00 45.19  ? 316  GLN A CA    1 
ATOM   2465 C C     . GLN A 1 316 ? -53.997 28.619  -25.596 1.00 44.71  ? 316  GLN A C     1 
ATOM   2466 O O     . GLN A 1 316 ? -54.627 29.051  -26.561 1.00 47.01  ? 316  GLN A O     1 
ATOM   2467 C CB    . GLN A 1 316 ? -53.646 26.152  -25.333 1.00 41.25  ? 316  GLN A CB    1 
ATOM   2468 C CG    . GLN A 1 316 ? -54.905 25.792  -26.110 1.00 42.10  ? 316  GLN A CG    1 
ATOM   2469 C CD    . GLN A 1 316 ? -54.623 25.468  -27.565 1.00 44.66  ? 316  GLN A CD    1 
ATOM   2470 O OE1   . GLN A 1 316 ? -55.061 26.180  -28.469 1.00 46.99  ? 316  GLN A OE1   1 
ATOM   2471 N NE2   . GLN A 1 316 ? -53.892 24.384  -27.797 1.00 50.92  ? 316  GLN A NE2   1 
ATOM   2472 N N     . SER A 1 317 ? -54.134 29.110  -24.368 1.00 42.72  ? 317  SER A N     1 
ATOM   2473 C CA    . SER A 1 317 ? -55.035 30.222  -24.090 1.00 49.14  ? 317  SER A CA    1 
ATOM   2474 C C     . SER A 1 317 ? -54.469 31.507  -24.681 1.00 50.52  ? 317  SER A C     1 
ATOM   2475 O O     . SER A 1 317 ? -55.208 32.442  -24.988 1.00 54.45  ? 317  SER A O     1 
ATOM   2476 C CB    . SER A 1 317 ? -55.247 30.388  -22.585 1.00 47.58  ? 317  SER A CB    1 
ATOM   2477 O OG    . SER A 1 317 ? -54.180 31.113  -22.000 1.00 47.30  ? 317  SER A OG    1 
ATOM   2478 N N     . LEU A 1 318 ? -53.150 31.547  -24.833 1.00 46.72  ? 318  LEU A N     1 
ATOM   2479 C CA    . LEU A 1 318 ? -52.480 32.688  -25.440 1.00 50.75  ? 318  LEU A CA    1 
ATOM   2480 C C     . LEU A 1 318 ? -52.721 32.682  -26.947 1.00 54.23  ? 318  LEU A C     1 
ATOM   2481 O O     . LEU A 1 318 ? -52.754 33.731  -27.592 1.00 55.51  ? 318  LEU A O     1 
ATOM   2482 C CB    . LEU A 1 318 ? -50.983 32.647  -25.139 1.00 46.94  ? 318  LEU A CB    1 
ATOM   2483 C CG    . LEU A 1 318 ? -50.237 33.940  -25.469 1.00 55.57  ? 318  LEU A CG    1 
ATOM   2484 C CD1   . LEU A 1 318 ? -50.844 35.095  -24.689 1.00 55.72  ? 318  LEU A CD1   1 
ATOM   2485 C CD2   . LEU A 1 318 ? -48.752 33.816  -25.181 1.00 54.62  ? 318  LEU A CD2   1 
ATOM   2486 N N     . LEU A 1 319 ? -52.900 31.484  -27.499 1.00 55.18  ? 319  LEU A N     1 
ATOM   2487 C CA    . LEU A 1 319 ? -53.209 31.321  -28.918 1.00 51.46  ? 319  LEU A CA    1 
ATOM   2488 C C     . LEU A 1 319 ? -54.630 31.782  -29.232 1.00 55.87  ? 319  LEU A C     1 
ATOM   2489 O O     . LEU A 1 319 ? -54.990 31.934  -30.396 1.00 60.62  ? 319  LEU A O     1 
ATOM   2490 C CB    . LEU A 1 319 ? -53.026 29.861  -29.344 1.00 50.91  ? 319  LEU A CB    1 
ATOM   2491 C CG    . LEU A 1 319 ? -51.951 29.579  -30.400 1.00 47.07  ? 319  LEU A CG    1 
ATOM   2492 C CD1   . LEU A 1 319 ? -51.689 28.090  -30.569 1.00 43.33  ? 319  LEU A CD1   1 
ATOM   2493 C CD2   . LEU A 1 319 ? -52.339 30.196  -31.726 1.00 51.51  ? 319  LEU A CD2   1 
ATOM   2494 N N     . ASN A 1 320 ? -55.430 31.988  -28.186 1.00 58.51  ? 320  ASN A N     1 
ATOM   2495 C CA    . ASN A 1 320 ? -56.812 32.447  -28.326 1.00 61.76  ? 320  ASN A CA    1 
ATOM   2496 C C     . ASN A 1 320 ? -56.925 33.931  -27.974 1.00 60.64  ? 320  ASN A C     1 
ATOM   2497 O O     . ASN A 1 320 ? -58.008 34.518  -28.003 1.00 63.20  ? 320  ASN A O     1 
ATOM   2498 C CB    . ASN A 1 320 ? -57.755 31.618  -27.446 1.00 60.09  ? 320  ASN A CB    1 
ATOM   2499 C CG    . ASN A 1 320 ? -57.571 30.116  -27.633 1.00 62.29  ? 320  ASN A CG    1 
ATOM   2500 O OD1   . ASN A 1 320 ? -57.140 29.654  -28.689 1.00 67.88  ? 320  ASN A OD1   1 
ATOM   2501 N ND2   . ASN A 1 320 ? -57.905 29.348  -26.599 1.00 59.44  ? 320  ASN A ND2   1 
ATOM   2502 N N     . SER A 1 321 ? -55.781 34.514  -27.682 1.00 57.75  ? 321  SER A N     1 
ATOM   2503 C CA    . SER A 1 321 ? -55.666 35.932  -27.441 1.00 55.79  ? 321  SER A CA    1 
ATOM   2504 C C     . SER A 1 321 ? -55.074 36.575  -28.666 1.00 54.91  ? 321  SER A C     1 
ATOM   2505 O O     . SER A 1 321 ? -55.454 37.634  -29.056 1.00 58.29  ? 321  SER A O     1 
ATOM   2506 C CB    . SER A 1 321 ? -54.808 36.208  -26.209 1.00 50.87  ? 321  SER A CB    1 
ATOM   2507 O OG    . SER A 1 321 ? -54.770 37.573  -25.919 1.00 55.02  ? 321  SER A OG    1 
ATOM   2508 N N     . TYR A 1 322 ? -54.193 35.850  -29.298 1.00 59.82  ? 322  TYR A N     1 
ATOM   2509 C CA    . TYR A 1 322 ? -53.701 36.194  -30.596 1.00 57.41  ? 322  TYR A CA    1 
ATOM   2510 C C     . TYR A 1 322 ? -54.862 35.886  -31.499 1.00 61.40  ? 322  TYR A C     1 
ATOM   2511 O O     . TYR A 1 322 ? -55.515 36.784  -31.988 1.00 64.60  ? 322  TYR A O     1 
ATOM   2512 C CB    . TYR A 1 322 ? -52.532 35.296  -30.957 1.00 55.85  ? 322  TYR A CB    1 
ATOM   2513 C CG    . TYR A 1 322 ? -51.195 35.444  -30.229 1.00 51.64  ? 322  TYR A CG    1 
ATOM   2514 C CD1   . TYR A 1 322 ? -50.658 36.674  -29.914 1.00 51.81  ? 322  TYR A CD1   1 
ATOM   2515 C CD2   . TYR A 1 322 ? -50.467 34.344  -29.920 1.00 49.26  ? 322  TYR A CD2   1 
ATOM   2516 C CE1   . TYR A 1 322 ? -49.441 36.783  -29.281 1.00 48.55  ? 322  TYR A CE1   1 
ATOM   2517 C CE2   . TYR A 1 322 ? -49.266 34.441  -29.287 1.00 51.55  ? 322  TYR A CE2   1 
ATOM   2518 C CZ    . TYR A 1 322 ? -48.741 35.645  -28.971 1.00 48.29  ? 322  TYR A CZ    1 
ATOM   2519 O OH    . TYR A 1 322 ? -47.534 35.689  -28.348 1.00 44.90  ? 322  TYR A OH    1 
ATOM   2520 N N     . GLY A 1 323 ? -55.064 34.589  -31.702 1.00 67.01  ? 323  GLY A N     1 
ATOM   2521 C CA    . GLY A 1 323 ? -56.230 33.956  -32.305 1.00 79.82  ? 323  GLY A CA    1 
ATOM   2522 C C     . GLY A 1 323 ? -56.868 34.367  -33.616 1.00 88.63  ? 323  GLY A C     1 
ATOM   2523 O O     . GLY A 1 323 ? -58.061 34.659  -33.606 1.00 94.05  ? 323  GLY A O     1 
ATOM   2524 N N     . GLU A 1 324 ? -56.054 34.317  -34.681 1.00 91.99  ? 324  GLU A N     1 
ATOM   2525 C CA    . GLU A 1 324 ? -56.486 34.479  -36.069 1.00 96.29  ? 324  GLU A CA    1 
ATOM   2526 C C     . GLU A 1 324 ? -55.363 34.312  -37.108 1.00 101.72 ? 324  GLU A C     1 
ATOM   2527 O O     . GLU A 1 324 ? -54.229 34.022  -36.755 1.00 94.30  ? 324  GLU A O     1 
ATOM   2528 C CB    . GLU A 1 324 ? -57.214 35.795  -36.259 1.00 95.60  ? 324  GLU A CB    1 
ATOM   2529 C CG    . GLU A 1 324 ? -58.723 35.695  -36.204 1.00 99.35  ? 324  GLU A CG    1 
ATOM   2530 C CD    . GLU A 1 324 ? -59.301 34.371  -36.675 1.00 106.02 ? 324  GLU A CD    1 
ATOM   2531 O OE1   . GLU A 1 324 ? -59.096 33.306  -36.051 1.00 102.50 ? 324  GLU A OE1   1 
ATOM   2532 O OE2   . GLU A 1 324 ? -60.043 34.417  -37.669 1.00 110.71 ? 324  GLU A OE2   1 
ATOM   2533 N N     . PRO A 1 325 ? -55.702 34.499  -38.379 1.00 107.38 ? 325  PRO A N     1 
ATOM   2534 C CA    . PRO A 1 325 ? -57.074 34.843  -38.769 1.00 107.54 ? 325  PRO A CA    1 
ATOM   2535 C C     . PRO A 1 325 ? -57.867 33.611  -39.190 1.00 108.82 ? 325  PRO A C     1 
ATOM   2536 O O     . PRO A 1 325 ? -58.924 33.740  -39.807 1.00 109.50 ? 325  PRO A O     1 
ATOM   2537 C CB    . PRO A 1 325 ? -56.870 35.772  -39.966 1.00 104.84 ? 325  PRO A CB    1 
ATOM   2538 C CG    . PRO A 1 325 ? -55.569 35.340  -40.552 1.00 104.29 ? 325  PRO A CG    1 
ATOM   2539 C CD    . PRO A 1 325 ? -54.716 34.920  -39.390 1.00 102.67 ? 325  PRO A CD    1 
ATOM   2540 N N     . VAL A 1 326 ? -57.336 32.436  -38.870 1.00 109.64 ? 326  VAL A N     1 
ATOM   2541 C CA    . VAL A 1 326 ? -57.884 31.176  -39.348 1.00 107.95 ? 326  VAL A CA    1 
ATOM   2542 C C     . VAL A 1 326 ? -57.328 30.911  -40.742 1.00 109.98 ? 326  VAL A C     1 
ATOM   2543 O O     . VAL A 1 326 ? -57.663 29.914  -41.382 1.00 108.66 ? 326  VAL A O     1 
ATOM   2544 C CB    . VAL A 1 326 ? -59.421 31.212  -39.410 1.00 107.66 ? 326  VAL A CB    1 
ATOM   2545 C CG1   . VAL A 1 326 ? -59.905 30.833  -40.801 1.00 102.45 ? 326  VAL A CG1   1 
ATOM   2546 C CG2   . VAL A 1 326 ? -60.016 30.286  -38.360 1.00 103.98 ? 326  VAL A CG2   1 
ATOM   2547 N N     . ASP A 1 327 ? -56.470 31.818  -41.199 1.00 113.37 ? 327  ASP A N     1 
ATOM   2548 C CA    . ASP A 1 327 ? -55.805 31.688  -42.490 1.00 111.70 ? 327  ASP A CA    1 
ATOM   2549 C C     . ASP A 1 327 ? -54.769 30.569  -42.473 1.00 111.88 ? 327  ASP A C     1 
ATOM   2550 O O     . ASP A 1 327 ? -54.119 30.330  -41.455 1.00 113.82 ? 327  ASP A O     1 
ATOM   2551 C CB    . ASP A 1 327 ? -55.145 33.009  -42.889 1.00 113.58 ? 327  ASP A CB    1 
ATOM   2552 C CG    . ASP A 1 327 ? -56.129 33.992  -43.493 1.00 114.37 ? 327  ASP A CG    1 
ATOM   2553 O OD1   . ASP A 1 327 ? -57.313 33.971  -43.095 1.00 107.85 ? 327  ASP A OD1   1 
ATOM   2554 O OD2   . ASP A 1 327 ? -55.718 34.787  -44.364 1.00 116.55 ? 327  ASP A OD2   1 
ATOM   2555 N N     . GLY A 1 328 ? -54.616 29.889  -43.604 1.00 112.90 ? 703  GLY A N     1 
ATOM   2556 C CA    . GLY A 1 328 ? -53.645 28.818  -43.721 1.00 107.67 ? 703  GLY A CA    1 
ATOM   2557 C C     . GLY A 1 328 ? -52.212 29.289  -43.548 1.00 108.01 ? 703  GLY A C     1 
ATOM   2558 O O     . GLY A 1 328 ? -51.404 28.618  -42.906 1.00 106.83 ? 703  GLY A O     1 
ATOM   2559 N N     . SER A 1 329 ? -51.895 30.444  -44.126 1.00 105.99 ? 704  SER A N     1 
ATOM   2560 C CA    . SER A 1 329 ? -50.540 30.984  -44.062 1.00 105.04 ? 704  SER A CA    1 
ATOM   2561 C C     . SER A 1 329 ? -50.520 32.477  -43.738 1.00 105.85 ? 704  SER A C     1 
ATOM   2562 O O     . SER A 1 329 ? -51.464 33.203  -44.048 1.00 105.83 ? 704  SER A O     1 
ATOM   2563 C CB    . SER A 1 329 ? -49.800 30.724  -45.376 1.00 102.96 ? 704  SER A CB    1 
ATOM   2564 O OG    . SER A 1 329 ? -48.402 30.892  -45.216 1.00 97.25  ? 704  SER A OG    1 
ATOM   2565 N N     . GLY A 1 330 ? -49.433 32.925  -43.116 0.80 102.79 ? 705  GLY A N     1 
ATOM   2566 C CA    . GLY A 1 330 ? -49.258 34.326  -42.785 0.80 97.43  ? 705  GLY A CA    1 
ATOM   2567 C C     . GLY A 1 330 ? -50.042 34.678  -41.539 0.80 95.90  ? 705  GLY A C     1 
ATOM   2568 O O     . GLY A 1 330 ? -50.273 35.853  -41.246 0.80 93.48  ? 705  GLY A O     1 
ATOM   2569 N N     . SER A 1 331 ? -50.449 33.643  -40.809 1.00 94.92  ? 706  SER A N     1 
ATOM   2570 C CA    . SER A 1 331 ? -51.246 33.793  -39.598 1.00 93.81  ? 706  SER A CA    1 
ATOM   2571 C C     . SER A 1 331 ? -50.587 34.729  -38.599 1.00 88.15  ? 706  SER A C     1 
ATOM   2572 O O     . SER A 1 331 ? -51.190 35.700  -38.137 1.00 86.83  ? 706  SER A O     1 
ATOM   2573 C CB    . SER A 1 331 ? -51.485 32.430  -38.944 1.00 94.25  ? 706  SER A CB    1 
ATOM   2574 O OG    . SER A 1 331 ? -52.273 32.557  -37.772 1.00 93.31  ? 706  SER A OG    1 
ATOM   2575 N N     . GLY A 1 332 ? -49.340 34.423  -38.275 1.00 81.99  ? 707  GLY A N     1 
ATOM   2576 C CA    . GLY A 1 332 ? -48.559 35.232  -37.368 1.00 70.83  ? 707  GLY A CA    1 
ATOM   2577 C C     . GLY A 1 332 ? -47.197 34.605  -37.182 1.00 61.83  ? 707  GLY A C     1 
ATOM   2578 O O     . GLY A 1 332 ? -47.003 33.422  -37.466 1.00 62.76  ? 707  GLY A O     1 
ATOM   2579 N N     . SER A 1 333 ? -46.248 35.410  -36.719 1.00 59.41  ? 708  SER A N     1 
ATOM   2580 C CA    . SER A 1 333 ? -44.940 34.902  -36.335 1.00 51.95  ? 708  SER A CA    1 
ATOM   2581 C C     . SER A 1 333 ? -44.994 34.578  -34.851 1.00 53.47  ? 708  SER A C     1 
ATOM   2582 O O     . SER A 1 333 ? -44.368 33.628  -34.387 1.00 56.56  ? 708  SER A O     1 
ATOM   2583 C CB    . SER A 1 333 ? -43.854 35.938  -36.616 1.00 52.17  ? 708  SER A CB    1 
ATOM   2584 O OG    . SER A 1 333 ? -42.586 35.459  -36.205 1.00 52.58  ? 708  SER A OG    1 
ATOM   2585 N N     . GLY A 1 334 ? -45.761 35.375  -34.114 1.00 54.42  ? 709  GLY A N     1 
ATOM   2586 C CA    . GLY A 1 334 ? -45.981 35.121  -32.704 1.00 47.18  ? 709  GLY A CA    1 
ATOM   2587 C C     . GLY A 1 334 ? -46.938 33.962  -32.506 1.00 49.95  ? 709  GLY A C     1 
ATOM   2588 O O     . GLY A 1 334 ? -46.802 33.187  -31.559 1.00 50.20  ? 709  GLY A O     1 
ATOM   2589 N N     . SER A 1 335 ? -47.912 33.845  -33.402 1.00 46.71  ? 710  SER A N     1 
ATOM   2590 C CA    . SER A 1 335 ? -48.831 32.715  -33.383 1.00 47.51  ? 710  SER A CA    1 
ATOM   2591 C C     . SER A 1 335 ? -48.110 31.429  -33.773 1.00 43.18  ? 710  SER A C     1 
ATOM   2592 O O     . SER A 1 335 ? -48.452 30.349  -33.288 1.00 44.30  ? 710  SER A O     1 
ATOM   2593 C CB    . SER A 1 335 ? -50.010 32.954  -34.328 1.00 54.45  ? 710  SER A CB    1 
ATOM   2594 O OG    . SER A 1 335 ? -50.857 33.984  -33.852 1.00 55.29  ? 710  SER A OG    1 
ATOM   2595 N N     . LYS A 1 336 ? -47.179 31.539  -34.715 1.00 44.88  ? 711  LYS A N     1 
ATOM   2596 C CA    . LYS A 1 336 ? -46.338 30.428  -35.146 1.00 42.82  ? 711  LYS A CA    1 
ATOM   2597 C C     . LYS A 1 336 ? -45.433 29.903  -34.048 1.00 42.76  ? 711  LYS A C     1 
ATOM   2598 O O     . LYS A 1 336 ? -45.243 28.729  -33.938 1.00 40.76  ? 711  LYS A O     1 
ATOM   2599 C CB    . LYS A 1 336 ? -45.528 30.823  -36.378 1.00 45.73  ? 711  LYS A CB    1 
ATOM   2600 C CG    . LYS A 1 336 ? -44.762 29.739  -37.108 1.00 41.46  ? 711  LYS A CG    1 
ATOM   2601 C CD    . LYS A 1 336 ? -45.603 28.535  -37.439 1.00 47.32  ? 711  LYS A CD    1 
ATOM   2602 C CE    . LYS A 1 336 ? -44.798 27.462  -38.226 1.00 55.59  ? 711  LYS A CE    1 
ATOM   2603 N NZ    . LYS A 1 336 ? -43.598 26.864  -37.550 1.00 52.87  ? 711  LYS A NZ    1 
ATOM   2604 N N     . GLU A 1 337 ? -44.827 30.796  -33.285 1.00 41.65  ? 712  GLU A N     1 
ATOM   2605 C CA    . GLU A 1 337 ? -44.095 30.407  -32.092 1.00 41.91  ? 712  GLU A CA    1 
ATOM   2606 C C     . GLU A 1 337 ? -44.894 29.567  -31.096 1.00 39.46  ? 712  GLU A C     1 
ATOM   2607 O O     . GLU A 1 337 ? -44.451 28.542  -30.683 1.00 40.03  ? 712  GLU A O     1 
ATOM   2608 C CB    . GLU A 1 337 ? -43.555 31.611  -31.335 1.00 46.98  ? 712  GLU A CB    1 
ATOM   2609 C CG    . GLU A 1 337 ? -42.246 32.174  -31.783 1.00 51.08  ? 712  GLU A CG    1 
ATOM   2610 C CD    . GLU A 1 337 ? -41.835 33.366  -30.942 1.00 58.30  ? 712  GLU A CD    1 
ATOM   2611 O OE1   . GLU A 1 337 ? -42.303 33.478  -29.795 1.00 51.58  ? 712  GLU A OE1   1 
ATOM   2612 O OE2   . GLU A 1 337 ? -41.057 34.198  -31.434 1.00 57.68  ? 712  GLU A OE2   1 
ATOM   2613 N N     . ALA A 1 338 ? -46.040 30.060  -30.679 1.00 37.09  ? 713  ALA A N     1 
ATOM   2614 C CA    . ALA A 1 338 ? -46.894 29.398  -29.705 1.00 35.90  ? 713  ALA A CA    1 
ATOM   2615 C C     . ALA A 1 338 ? -47.347 28.024  -30.193 1.00 38.68  ? 713  ALA A C     1 
ATOM   2616 O O     . ALA A 1 338 ? -47.448 27.082  -29.407 1.00 39.40  ? 713  ALA A O     1 
ATOM   2617 C CB    . ALA A 1 338 ? -48.096 30.273  -29.383 1.00 36.87  ? 713  ALA A CB    1 
ATOM   2618 N N     . ALA A 1 339 ? -47.616 27.915  -31.490 1.00 37.63  ? 714  ALA A N     1 
ATOM   2619 C CA    . ALA A 1 339 ? -48.029 26.645  -32.075 1.00 35.48  ? 714  ALA A CA    1 
ATOM   2620 C C     . ALA A 1 339 ? -46.869 25.654  -32.098 1.00 35.00  ? 714  ALA A C     1 
ATOM   2621 O O     . ALA A 1 339 ? -47.042 24.475  -31.790 1.00 38.46  ? 714  ALA A O     1 
ATOM   2622 C CB    . ALA A 1 339 ? -48.579 26.856  -33.476 1.00 32.81  ? 714  ALA A CB    1 
ATOM   2623 N N     . ASP A 1 340 ? -45.689 26.141  -32.469 1.00 33.33  ? 715  ASP A N     1 
ATOM   2624 C CA    . ASP A 1 340 ? -44.488 25.315  -32.475 1.00 36.36  ? 715  ASP A CA    1 
ATOM   2625 C C     . ASP A 1 340 ? -44.121 24.889  -31.057 1.00 35.51  ? 715  ASP A C     1 
ATOM   2626 O O     . ASP A 1 340 ? -43.676 23.764  -30.835 1.00 36.82  ? 715  ASP A O     1 
ATOM   2627 C CB    . ASP A 1 340 ? -43.323 26.066  -33.125 1.00 36.25  ? 715  ASP A CB    1 
ATOM   2628 C CG    . ASP A 1 340 ? -43.422 26.101  -34.639 1.00 37.91  ? 715  ASP A CG    1 
ATOM   2629 O OD1   . ASP A 1 340 ? -44.492 25.749  -35.175 1.00 37.95  ? 715  ASP A OD1   1 
ATOM   2630 O OD2   . ASP A 1 340 ? -42.429 26.483  -35.293 1.00 39.58  ? 715  ASP A OD2   1 
ATOM   2631 N N     . MET A 1 341 ? -44.314 25.795  -30.104 1.00 35.67  ? 716  MET A N     1 
ATOM   2632 C CA    . MET A 1 341 ? -44.042 25.504  -28.702 1.00 33.04  ? 716  MET A CA    1 
ATOM   2633 C C     . MET A 1 341 ? -45.014 24.455  -28.178 1.00 32.83  ? 716  MET A C     1 
ATOM   2634 O O     . MET A 1 341 ? -44.617 23.520  -27.484 1.00 34.37  ? 716  MET A O     1 
ATOM   2635 C CB    . MET A 1 341 ? -44.144 26.776  -27.861 1.00 31.57  ? 716  MET A CB    1 
ATOM   2636 C CG    . MET A 1 341 ? -43.725 26.590  -26.414 1.00 38.43  ? 716  MET A CG    1 
ATOM   2637 S SD    . MET A 1 341 ? -41.999 26.090  -26.272 1.00 36.06  ? 716  MET A SD    1 
ATOM   2638 C CE    . MET A 1 341 ? -41.853 25.877  -24.501 1.00 35.44  ? 716  MET A CE    1 
ATOM   2639 N N     . LEU A 1 342 ? -46.290 24.616  -28.516 1.00 31.57  ? 717  LEU A N     1 
ATOM   2640 C CA    . LEU A 1 342 ? -47.317 23.663  -28.110 1.00 33.85  ? 717  LEU A CA    1 
ATOM   2641 C C     . LEU A 1 342 ? -47.048 22.266  -28.661 1.00 34.11  ? 717  LEU A C     1 
ATOM   2642 O O     . LEU A 1 342 ? -47.309 21.264  -27.994 1.00 34.87  ? 717  LEU A O     1 
ATOM   2643 C CB    . LEU A 1 342 ? -48.703 24.148  -28.543 1.00 33.32  ? 717  LEU A CB    1 
ATOM   2644 C CG    . LEU A 1 342 ? -49.428 25.050  -27.543 1.00 38.87  ? 717  LEU A CG    1 
ATOM   2645 C CD1   . LEU A 1 342 ? -50.744 25.539  -28.117 1.00 44.09  ? 717  LEU A CD1   1 
ATOM   2646 C CD2   . LEU A 1 342 ? -49.658 24.308  -26.235 1.00 34.67  ? 717  LEU A CD2   1 
ATOM   2647 N N     . LYS A 1 343 ? -46.524 22.202  -29.880 1.00 36.35  ? 718  LYS A N     1 
ATOM   2648 C CA    . LYS A 1 343 ? -46.195 20.919  -30.494 1.00 39.23  ? 718  LYS A CA    1 
ATOM   2649 C C     . LYS A 1 343 ? -45.051 20.237  -29.748 1.00 36.05  ? 718  LYS A C     1 
ATOM   2650 O O     . LYS A 1 343 ? -45.063 19.028  -29.533 1.00 34.50  ? 718  LYS A O     1 
ATOM   2651 C CB    . LYS A 1 343 ? -45.833 21.114  -31.968 1.00 36.89  ? 718  LYS A CB    1 
ATOM   2652 C CG    . LYS A 1 343 ? -45.673 19.811  -32.726 1.00 40.50  ? 718  LYS A CG    1 
ATOM   2653 C CD    . LYS A 1 343 ? -46.997 19.061  -32.783 1.00 49.98  ? 718  LYS A CD    1 
ATOM   2654 C CE    . LYS A 1 343 ? -46.803 17.602  -33.180 1.00 52.28  ? 718  LYS A CE    1 
ATOM   2655 N NZ    . LYS A 1 343 ? -48.102 16.904  -33.408 1.00 50.19  ? 718  LYS A NZ    1 
ATOM   2656 N N     . ALA A 1 344 ? -44.065 21.031  -29.348 1.00 33.61  ? 719  ALA A N     1 
ATOM   2657 C CA    . ALA A 1 344 ? -42.924 20.517  -28.602 1.00 30.93  ? 719  ALA A CA    1 
ATOM   2658 C C     . ALA A 1 344 ? -43.349 20.045  -27.214 1.00 30.59  ? 719  ALA A C     1 
ATOM   2659 O O     . ALA A 1 344 ? -42.877 19.018  -26.725 1.00 30.46  ? 719  ALA A O     1 
ATOM   2660 C CB    . ALA A 1 344 ? -41.842 21.573  -28.496 1.00 30.29  ? 719  ALA A CB    1 
ATOM   2661 N N     . LEU A 1 345 ? -44.238 20.807  -26.582 1.00 30.39  ? 720  LEU A N     1 
ATOM   2662 C CA    . LEU A 1 345 ? -44.766 20.444  -25.271 1.00 33.73  ? 720  LEU A CA    1 
ATOM   2663 C C     . LEU A 1 345 ? -45.550 19.141  -25.349 1.00 31.52  ? 720  LEU A C     1 
ATOM   2664 O O     . LEU A 1 345 ? -45.535 18.342  -24.413 1.00 31.58  ? 720  LEU A O     1 
ATOM   2665 C CB    . LEU A 1 345 ? -45.651 21.565  -24.722 1.00 30.27  ? 720  LEU A CB    1 
ATOM   2666 C CG    . LEU A 1 345 ? -44.935 22.868  -24.355 1.00 27.52  ? 720  LEU A CG    1 
ATOM   2667 C CD1   . LEU A 1 345 ? -45.932 23.997  -24.157 1.00 27.46  ? 720  LEU A CD1   1 
ATOM   2668 C CD2   . LEU A 1 345 ? -44.087 22.679  -23.107 1.00 28.01  ? 720  LEU A CD2   1 
ATOM   2669 N N     . GLN A 1 346 ? -46.234 18.937  -26.471 1.00 33.38  ? 721  GLN A N     1 
ATOM   2670 C CA    . GLN A 1 346 ? -46.967 17.701  -26.715 1.00 33.05  ? 721  GLN A CA    1 
ATOM   2671 C C     . GLN A 1 346 ? -46.012 16.514  -26.746 1.00 31.30  ? 721  GLN A C     1 
ATOM   2672 O O     . GLN A 1 346 ? -46.275 15.475  -26.138 1.00 32.11  ? 721  GLN A O     1 
ATOM   2673 C CB    . GLN A 1 346 ? -47.731 17.788  -28.036 1.00 35.69  ? 721  GLN A CB    1 
ATOM   2674 C CG    . GLN A 1 346 ? -48.489 16.523  -28.391 1.00 32.50  ? 721  GLN A CG    1 
ATOM   2675 C CD    . GLN A 1 346 ? -49.067 16.557  -29.792 1.00 39.07  ? 721  GLN A CD    1 
ATOM   2676 O OE1   . GLN A 1 346 ? -49.328 17.627  -30.342 1.00 38.97  ? 721  GLN A OE1   1 
ATOM   2677 N NE2   . GLN A 1 346 ? -49.266 15.382  -30.379 1.00 34.86  ? 721  GLN A NE2   1 
ATOM   2678 N N     . GLY A 1 347 ? -44.902 16.677  -27.458 1.00 30.01  ? 722  GLY A N     1 
ATOM   2679 C CA    . GLY A 1 347 ? -43.883 15.647  -27.527 1.00 27.11  ? 722  GLY A CA    1 
ATOM   2680 C C     . GLY A 1 347 ? -43.246 15.400  -26.174 1.00 33.49  ? 722  GLY A C     1 
ATOM   2681 O O     . GLY A 1 347 ? -42.858 14.278  -25.857 1.00 34.84  ? 722  GLY A O     1 
ATOM   2682 N N     . ALA A 1 348 ? -43.147 16.454  -25.371 1.00 26.20  ? 723  ALA A N     1 
ATOM   2683 C CA    . ALA A 1 348 ? -42.558 16.355  -24.042 1.00 29.11  ? 723  ALA A CA    1 
ATOM   2684 C C     . ALA A 1 348 ? -43.422 15.522  -23.097 1.00 31.84  ? 723  ALA A C     1 
ATOM   2685 O O     . ALA A 1 348 ? -42.922 14.631  -22.412 1.00 29.04  ? 723  ALA A O     1 
ATOM   2686 C CB    . ALA A 1 348 ? -42.323 17.738  -23.466 1.00 25.27  ? 723  ALA A CB    1 
ATOM   2687 N N     . SER A 1 349 ? -44.718 15.816  -23.062 1.00 33.15  ? 724  SER A N     1 
ATOM   2688 C CA    . SER A 1 349 ? -45.639 15.082  -22.201 1.00 32.32  ? 724  SER A CA    1 
ATOM   2689 C C     . SER A 1 349 ? -45.755 13.624  -22.638 1.00 32.75  ? 724  SER A C     1 
ATOM   2690 O O     . SER A 1 349 ? -45.924 12.731  -21.809 1.00 35.54  ? 724  SER A O     1 
ATOM   2691 C CB    . SER A 1 349 ? -47.017 15.748  -22.183 1.00 35.71  ? 724  SER A CB    1 
ATOM   2692 O OG    . SER A 1 349 ? -47.577 15.805  -23.483 1.00 36.57  ? 724  SER A OG    1 
ATOM   2693 N N     . GLN A 1 350 ? -45.661 13.393  -23.944 1.00 31.99  ? 725  GLN A N     1 
ATOM   2694 C CA    . GLN A 1 350 ? -45.671 12.040  -24.491 1.00 34.79  ? 725  GLN A CA    1 
ATOM   2695 C C     . GLN A 1 350 ? -44.481 11.238  -23.973 1.00 36.60  ? 725  GLN A C     1 
ATOM   2696 O O     . GLN A 1 350 ? -44.634 10.100  -23.532 1.00 33.61  ? 725  GLN A O     1 
ATOM   2697 C CB    . GLN A 1 350 ? -45.655 12.084  -26.022 1.00 36.86  ? 725  GLN A CB    1 
ATOM   2698 C CG    . GLN A 1 350 ? -45.421 10.737  -26.695 1.00 37.23  ? 725  GLN A CG    1 
ATOM   2699 C CD    . GLN A 1 350 ? -46.582 9.773   -26.521 1.00 40.66  ? 725  GLN A CD    1 
ATOM   2700 O OE1   . GLN A 1 350 ? -47.680 10.166  -26.129 1.00 46.98  ? 725  GLN A OE1   1 
ATOM   2701 N NE2   . GLN A 1 350 ? -46.341 8.501   -26.817 1.00 46.64  ? 725  GLN A NE2   1 
ATOM   2702 N N     . ILE A 1 351 ? -43.300 11.846  -24.028 1.00 34.31  ? 726  ILE A N     1 
ATOM   2703 C CA    . ILE A 1 351 ? -42.076 11.227  -23.528 1.00 33.65  ? 726  ILE A CA    1 
ATOM   2704 C C     . ILE A 1 351 ? -42.175 10.940  -22.030 1.00 35.87  ? 726  ILE A C     1 
ATOM   2705 O O     . ILE A 1 351 ? -41.739 9.890   -21.554 1.00 36.51  ? 726  ILE A O     1 
ATOM   2706 C CB    . ILE A 1 351 ? -40.850 12.125  -23.810 1.00 30.20  ? 726  ILE A CB    1 
ATOM   2707 C CG1   . ILE A 1 351 ? -40.575 12.191  -25.313 1.00 29.38  ? 726  ILE A CG1   1 
ATOM   2708 C CG2   . ILE A 1 351 ? -39.620 11.614  -23.079 1.00 30.29  ? 726  ILE A CG2   1 
ATOM   2709 C CD1   . ILE A 1 351 ? -39.524 13.210  -25.700 1.00 23.50  ? 726  ILE A CD1   1 
ATOM   2710 N N     . ILE A 1 352 ? -42.763 11.876  -21.295 1.00 33.92  ? 727  ILE A N     1 
ATOM   2711 C CA    . ILE A 1 352 ? -42.928 11.733  -19.852 1.00 36.22  ? 727  ILE A CA    1 
ATOM   2712 C C     . ILE A 1 352 ? -43.961 10.659  -19.499 1.00 41.09  ? 727  ILE A C     1 
ATOM   2713 O O     . ILE A 1 352 ? -43.792 9.915   -18.531 1.00 45.40  ? 727  ILE A O     1 
ATOM   2714 C CB    . ILE A 1 352 ? -43.281 13.089  -19.197 1.00 37.72  ? 727  ILE A CB    1 
ATOM   2715 C CG1   . ILE A 1 352 ? -42.006 13.901  -18.952 1.00 37.19  ? 727  ILE A CG1   1 
ATOM   2716 C CG2   . ILE A 1 352 ? -44.027 12.893  -17.890 1.00 41.27  ? 727  ILE A CG2   1 
ATOM   2717 C CD1   . ILE A 1 352 ? -42.245 15.228  -18.268 1.00 36.81  ? 727  ILE A CD1   1 
ATOM   2718 N N     . ALA A 1 353 ? -45.017 10.563  -20.302 1.00 34.24  ? 728  ALA A N     1 
ATOM   2719 C CA    . ALA A 1 353 ? -46.064 9.573   -20.069 1.00 39.54  ? 728  ALA A CA    1 
ATOM   2720 C C     . ALA A 1 353 ? -45.574 8.148   -20.317 1.00 42.17  ? 728  ALA A C     1 
ATOM   2721 O O     . ALA A 1 353 ? -46.122 7.191   -19.770 1.00 45.46  ? 728  ALA A O     1 
ATOM   2722 C CB    . ALA A 1 353 ? -47.279 9.872   -20.935 1.00 34.10  ? 728  ALA A CB    1 
ATOM   2723 N N     . GLU A 1 354 ? -44.570 8.015   -21.164 1.00 42.13  ? 729  GLU A N     1 
ATOM   2724 C CA    . GLU A 1 354 ? -43.969 6.745   -21.524 1.00 42.63  ? 729  GLU A CA    1 
ATOM   2725 C C     . GLU A 1 354 ? -43.054 6.128   -20.448 1.00 42.38  ? 729  GLU A C     1 
ATOM   2726 O O     . GLU A 1 354 ? -42.505 5.075   -20.626 1.00 40.53  ? 729  GLU A O     1 
ATOM   2727 C CB    . GLU A 1 354 ? -43.268 6.871   -22.865 1.00 37.11  ? 729  GLU A CB    1 
ATOM   2728 C CG    . GLU A 1 354 ? -44.226 6.937   -23.963 1.00 39.33  ? 729  GLU A CG    1 
ATOM   2729 C CD    . GLU A 1 354 ? -43.604 7.235   -25.278 1.00 44.17  ? 729  GLU A CD    1 
ATOM   2730 O OE1   . GLU A 1 354 ? -44.259 7.003   -26.285 1.00 45.01  ? 729  GLU A OE1   1 
ATOM   2731 O OE2   . GLU A 1 354 ? -42.472 7.703   -25.320 1.00 45.31  ? 729  GLU A OE2   1 
ATOM   2732 N N     . ILE A 1 355 ? -42.903 6.813   -19.325 1.00 44.64  ? 730  ILE A N     1 
ATOM   2733 C CA    . ILE A 1 355 ? -42.320 6.254   -18.126 1.00 44.37  ? 730  ILE A CA    1 
ATOM   2734 C C     . ILE A 1 355 ? -43.430 5.526   -17.358 1.00 49.95  ? 730  ILE A C     1 
ATOM   2735 O O     . ILE A 1 355 ? -44.580 5.847   -17.509 1.00 55.62  ? 730  ILE A O     1 
ATOM   2736 C CB    . ILE A 1 355 ? -41.739 7.382   -17.269 1.00 43.56  ? 730  ILE A CB    1 
ATOM   2737 C CG1   . ILE A 1 355 ? -40.940 8.354   -18.115 1.00 43.83  ? 730  ILE A CG1   1 
ATOM   2738 C CG2   . ILE A 1 355 ? -40.821 6.873   -16.233 1.00 46.80  ? 730  ILE A CG2   1 
ATOM   2739 C CD1   . ILE A 1 355 ? -40.510 9.535   -17.393 1.00 37.24  ? 730  ILE A CD1   1 
ATOM   2740 N N     . ARG A 1 356 ? -43.131 4.422   -16.717 1.00 61.07  ? 731  ARG A N     1 
ATOM   2741 C CA    . ARG A 1 356 ? -44.215 3.847   -15.926 1.00 70.10  ? 731  ARG A CA    1 
ATOM   2742 C C     . ARG A 1 356 ? -43.863 3.270   -14.617 1.00 72.56  ? 731  ARG A C     1 
ATOM   2743 O O     . ARG A 1 356 ? -44.699 3.166   -13.759 1.00 76.62  ? 731  ARG A O     1 
ATOM   2744 C CB    . ARG A 1 356 ? -45.057 2.847   -16.693 1.00 68.93  ? 731  ARG A CB    1 
ATOM   2745 C CG    . ARG A 1 356 ? -45.823 1.908   -15.786 1.00 71.94  ? 731  ARG A CG    1 
ATOM   2746 C CD    . ARG A 1 356 ? -46.975 2.581   -15.056 1.00 74.78  ? 731  ARG A CD    1 
ATOM   2747 N NE    . ARG A 1 356 ? -48.194 1.767   -14.934 0.52 75.18  ? 731  ARG A NE    1 
ATOM   2748 C CZ    . ARG A 1 356 ? -48.570 1.091   -13.844 0.37 76.00  ? 731  ARG A CZ    1 
ATOM   2749 N NH1   . ARG A 1 356 ? -47.830 1.091   -12.743 1.00 79.26  ? 731  ARG A NH1   1 
ATOM   2750 N NH2   . ARG A 1 356 ? -49.694 0.403   -13.852 1.00 72.08  ? 731  ARG A NH2   1 
ATOM   2751 N N     . GLU A 1 357 ? -42.631 2.883   -14.431 1.00 74.01  ? 732  GLU A N     1 
ATOM   2752 C CA    . GLU A 1 357 ? -42.398 2.011   -13.310 1.00 85.23  ? 732  GLU A CA    1 
ATOM   2753 C C     . GLU A 1 357 ? -42.793 2.811   -12.071 1.00 87.83  ? 732  GLU A C     1 
ATOM   2754 O O     . GLU A 1 357 ? -42.662 4.017   -12.045 1.00 88.82  ? 732  GLU A O     1 
ATOM   2755 C CB    . GLU A 1 357 ? -40.937 1.558   -13.262 1.00 82.73  ? 732  GLU A CB    1 
ATOM   2756 C CG    . GLU A 1 357 ? -40.289 1.477   -14.642 1.00 75.24  ? 732  GLU A CG    1 
ATOM   2757 C CD    . GLU A 1 357 ? -39.193 0.441   -14.685 1.00 73.10  ? 732  GLU A CD    1 
ATOM   2758 O OE1   . GLU A 1 357 ? -38.808 -0.034  -13.592 1.00 73.19  ? 732  GLU A OE1   1 
ATOM   2759 O OE2   . GLU A 1 357 ? -38.733 0.101   -15.801 1.00 65.07  ? 732  GLU A OE2   1 
ATOM   2760 N N     . THR A 1 358 ? -43.342 2.132   -11.078 1.00 91.95  ? 733  THR A N     1 
ATOM   2761 C CA    . THR A 1 358 ? -43.855 2.764   -9.871  1.00 95.65  ? 733  THR A CA    1 
ATOM   2762 C C     . THR A 1 358 ? -43.074 4.016   -9.418  1.00 97.89  ? 733  THR A C     1 
ATOM   2763 O O     . THR A 1 358 ? -43.650 5.086   -9.160  1.00 98.06  ? 733  THR A O     1 
ATOM   2764 C CB    . THR A 1 358 ? -43.879 1.731   -8.747  1.00 93.77  ? 733  THR A CB    1 
ATOM   2765 O OG1   . THR A 1 358 ? -42.974 2.133   -7.715  1.00 104.49 ? 733  THR A OG1   1 
ATOM   2766 C CG2   . THR A 1 358 ? -43.461 0.376   -9.284  1.00 83.47  ? 733  THR A CG2   1 
HETATM 2767 P PG    . GNP B 2 .   ? -9.792  26.517  -24.660 1.00 86.27  ? 801  GNP A PG    1 
HETATM 2768 O O1G   . GNP B 2 .   ? -10.830 27.302  -25.424 1.00 79.24  ? 801  GNP A O1G   1 
HETATM 2769 O O2G   . GNP B 2 .   ? -8.881  27.335  -23.776 1.00 69.63  ? 801  GNP A O2G   1 
HETATM 2770 O O3G   . GNP B 2 .   ? -9.098  25.705  -25.728 1.00 75.16  ? 801  GNP A O3G   1 
HETATM 2771 N N3B   . GNP B 2 .   ? -10.559 25.452  -23.766 1.00 67.28  ? 801  GNP A N3B   1 
HETATM 2772 P PB    . GNP B 2 .   ? -10.494 25.309  -22.186 1.00 56.68  ? 801  GNP A PB    1 
HETATM 2773 O O1B   . GNP B 2 .   ? -9.553  26.244  -21.530 1.00 55.94  ? 801  GNP A O1B   1 
HETATM 2774 O O2B   . GNP B 2 .   ? -11.902 25.338  -21.730 1.00 53.40  ? 801  GNP A O2B   1 
HETATM 2775 O O3A   . GNP B 2 .   ? -9.980  23.907  -21.910 1.00 50.15  ? 801  GNP A O3A   1 
HETATM 2776 P PA    . GNP B 2 .   ? -8.692  23.416  -22.551 1.00 47.23  ? 801  GNP A PA    1 
HETATM 2777 O O1A   . GNP B 2 .   ? -8.376  22.107  -21.938 1.00 51.28  ? 801  GNP A O1A   1 
HETATM 2778 O O2A   . GNP B 2 .   ? -8.801  23.470  -24.025 1.00 55.26  ? 801  GNP A O2A   1 
HETATM 2779 O "O5'" . GNP B 2 .   ? -7.543  24.417  -22.135 1.00 52.47  ? 801  GNP A "O5'" 1 
HETATM 2780 C "C5'" . GNP B 2 .   ? -6.557  24.000  -21.202 1.00 47.72  ? 801  GNP A "C5'" 1 
HETATM 2781 C "C4'" . GNP B 2 .   ? -5.226  23.719  -21.874 1.00 46.25  ? 801  GNP A "C4'" 1 
HETATM 2782 O "O4'" . GNP B 2 .   ? -4.307  23.208  -20.880 1.00 48.73  ? 801  GNP A "O4'" 1 
HETATM 2783 C "C3'" . GNP B 2 .   ? -5.251  22.671  -22.979 1.00 47.47  ? 801  GNP A "C3'" 1 
HETATM 2784 O "O3'" . GNP B 2 .   ? -4.281  22.985  -23.972 1.00 48.40  ? 801  GNP A "O3'" 1 
HETATM 2785 C "C2'" . GNP B 2 .   ? -4.912  21.363  -22.264 1.00 44.34  ? 801  GNP A "C2'" 1 
HETATM 2786 O "O2'" . GNP B 2 .   ? -4.053  20.547  -23.037 1.00 49.45  ? 801  GNP A "O2'" 1 
HETATM 2787 C "C1'" . GNP B 2 .   ? -4.189  21.802  -20.992 1.00 43.16  ? 801  GNP A "C1'" 1 
HETATM 2788 N N9    . GNP B 2 .   ? -4.729  21.186  -19.782 1.00 42.20  ? 801  GNP A N9    1 
HETATM 2789 C C8    . GNP B 2 .   ? -6.048  21.114  -19.403 1.00 42.17  ? 801  GNP A C8    1 
HETATM 2790 N N7    . GNP B 2 .   ? -6.232  20.501  -18.267 1.00 37.36  ? 801  GNP A N7    1 
HETATM 2791 C C5    . GNP B 2 .   ? -4.952  20.143  -17.863 1.00 38.68  ? 801  GNP A C5    1 
HETATM 2792 C C6    . GNP B 2 .   ? -4.522  19.455  -16.703 1.00 36.17  ? 801  GNP A C6    1 
HETATM 2793 O O6    . GNP B 2 .   ? -5.213  19.012  -15.774 1.00 31.94  ? 801  GNP A O6    1 
HETATM 2794 N N1    . GNP B 2 .   ? -3.138  19.298  -16.682 1.00 34.30  ? 801  GNP A N1    1 
HETATM 2795 C C2    . GNP B 2 .   ? -2.280  19.750  -17.658 1.00 38.36  ? 801  GNP A C2    1 
HETATM 2796 N N2    . GNP B 2 .   ? -0.975  19.507  -17.465 1.00 40.96  ? 801  GNP A N2    1 
HETATM 2797 N N3    . GNP B 2 .   ? -2.671  20.396  -18.749 1.00 35.81  ? 801  GNP A N3    1 
HETATM 2798 C C4    . GNP B 2 .   ? -4.016  20.557  -18.785 1.00 38.41  ? 801  GNP A C4    1 
HETATM 2799 O O     . HOH C 3 .   ? -8.380  20.618  -25.804 1.00 59.28  ? 900  HOH A O     1 
HETATM 2800 O O     . HOH C 3 .   ? -29.699 25.702  -18.100 1.00 23.05  ? 901  HOH A O     1 
HETATM 2801 O O     . HOH C 3 .   ? -26.524 11.076  -21.234 1.00 27.71  ? 902  HOH A O     1 
HETATM 2802 O O     . HOH C 3 .   ? -27.082 17.691  -17.946 1.00 21.61  ? 903  HOH A O     1 
HETATM 2803 O O     . HOH C 3 .   ? -28.814 14.944  -29.047 1.00 31.42  ? 904  HOH A O     1 
HETATM 2804 O O     . HOH C 3 .   ? -28.289 13.324  -31.642 1.00 31.92  ? 905  HOH A O     1 
HETATM 2805 O O     . HOH C 3 .   ? -17.676 8.640   -18.489 1.00 28.67  ? 906  HOH A O     1 
HETATM 2806 O O     . HOH C 3 .   ? -30.602 23.082  -9.328  1.00 35.96  ? 907  HOH A O     1 
HETATM 2807 O O     . HOH C 3 .   ? -19.688 -1.163  -27.833 1.00 26.12  ? 908  HOH A O     1 
HETATM 2808 O O     . HOH C 3 .   ? -30.517 7.873   -15.264 1.00 29.18  ? 909  HOH A O     1 
HETATM 2809 O O     . HOH C 3 .   ? -10.781 8.928   -9.430  1.00 34.33  ? 910  HOH A O     1 
HETATM 2810 O O     . HOH C 3 .   ? -39.421 22.665  -14.363 1.00 31.39  ? 911  HOH A O     1 
HETATM 2811 O O     . HOH C 3 .   ? -38.212 20.642  -12.349 1.00 31.27  ? 912  HOH A O     1 
HETATM 2812 O O     . HOH C 3 .   ? -42.438 21.965  -32.495 1.00 38.59  ? 913  HOH A O     1 
HETATM 2813 O O     . HOH C 3 .   ? -52.307 20.961  -19.680 1.00 39.01  ? 914  HOH A O     1 
HETATM 2814 O O     . HOH C 3 .   ? -23.893 -7.151  -23.182 1.00 28.94  ? 915  HOH A O     1 
HETATM 2815 O O     . HOH C 3 .   ? -27.725 8.258   -21.100 1.00 28.72  ? 916  HOH A O     1 
HETATM 2816 O O     . HOH C 3 .   ? -40.098 18.254  -8.355  1.00 32.62  ? 917  HOH A O     1 
HETATM 2817 O O     . HOH C 3 .   ? -17.885 28.434  -19.905 1.00 29.33  ? 918  HOH A O     1 
HETATM 2818 O O     . HOH C 3 .   ? -21.835 29.509  -6.772  1.00 34.39  ? 919  HOH A O     1 
HETATM 2819 O O     . HOH C 3 .   ? -12.136 29.664  -14.218 1.00 37.19  ? 920  HOH A O     1 
HETATM 2820 O O     . HOH C 3 .   ? -5.966  17.923  -23.002 1.00 39.72  ? 921  HOH A O     1 
HETATM 2821 O O     . HOH C 3 .   ? -26.382 12.417  -36.881 1.00 36.87  ? 922  HOH A O     1 
HETATM 2822 O O     . HOH C 3 .   ? -32.665 22.055  -25.565 1.00 36.13  ? 923  HOH A O     1 
HETATM 2823 O O     . HOH C 3 .   ? -23.635 4.947   -15.839 1.00 33.58  ? 924  HOH A O     1 
HETATM 2824 O O     . HOH C 3 .   ? -8.819  29.083  -14.065 1.00 34.82  ? 925  HOH A O     1 
HETATM 2825 O O     . HOH C 3 .   ? -8.642  32.048  -11.211 1.00 42.49  ? 926  HOH A O     1 
HETATM 2826 O O     . HOH C 3 .   ? -34.027 27.936  -17.865 1.00 37.15  ? 927  HOH A O     1 
HETATM 2827 O O     . HOH C 3 .   ? 3.828   18.639  -10.315 1.00 41.17  ? 928  HOH A O     1 
HETATM 2828 O O     . HOH C 3 .   ? -40.034 5.698   -21.557 1.00 35.54  ? 929  HOH A O     1 
HETATM 2829 O O     . HOH C 3 .   ? -15.219 4.557   -33.106 1.00 41.78  ? 930  HOH A O     1 
HETATM 2830 O O     . HOH C 3 .   ? 0.555   27.525  -8.394  1.00 41.84  ? 931  HOH A O     1 
HETATM 2831 O O     . HOH C 3 .   ? -20.099 37.477  -8.289  1.00 36.87  ? 932  HOH A O     1 
HETATM 2832 O O     . HOH C 3 .   ? 2.341   10.591  -12.065 1.00 44.47  ? 933  HOH A O     1 
HETATM 2833 O O     . HOH C 3 .   ? -10.462 33.501  -13.721 1.00 41.81  ? 934  HOH A O     1 
HETATM 2834 O O     . HOH C 3 .   ? -36.501 2.469   -21.733 1.00 38.24  ? 935  HOH A O     1 
HETATM 2835 O O     . HOH C 3 .   ? -23.758 -5.573  -31.470 1.00 32.34  ? 936  HOH A O     1 
HETATM 2836 O O     . HOH C 3 .   ? -14.407 7.304   -19.987 1.00 36.17  ? 937  HOH A O     1 
HETATM 2837 O O     . HOH C 3 .   ? -13.639 6.433   -25.144 1.00 36.82  ? 938  HOH A O     1 
HETATM 2838 O O     . HOH C 3 .   ? -41.629 28.382  -30.636 1.00 38.47  ? 939  HOH A O     1 
HETATM 2839 O O     . HOH C 3 .   ? -34.099 12.504  -30.239 1.00 34.80  ? 940  HOH A O     1 
HETATM 2840 O O     . HOH C 3 .   ? -57.989 34.625  -25.187 1.00 53.99  ? 941  HOH A O     1 
HETATM 2841 O O     . HOH C 3 .   ? -0.801  19.448  -7.005  1.00 41.86  ? 942  HOH A O     1 
HETATM 2842 O O     . HOH C 3 .   ? -17.088 -6.697  -27.707 1.00 33.86  ? 943  HOH A O     1 
HETATM 2843 O O     . HOH C 3 .   ? -19.296 25.272  -25.855 1.00 38.36  ? 944  HOH A O     1 
HETATM 2844 O O     . HOH C 3 .   ? -19.803 -3.812  -21.399 1.00 31.34  ? 945  HOH A O     1 
HETATM 2845 O O     . HOH C 3 .   ? -13.592 -4.933  -24.396 1.00 36.15  ? 946  HOH A O     1 
HETATM 2846 O O     . HOH C 3 .   ? -46.444 16.009  -10.821 1.00 34.79  ? 947  HOH A O     1 
HETATM 2847 O O     . HOH C 3 .   ? -26.213 -1.356  -24.447 1.00 34.12  ? 948  HOH A O     1 
HETATM 2848 O O     . HOH C 3 .   ? -33.552 22.387  -8.432  1.00 39.14  ? 949  HOH A O     1 
HETATM 2849 O O     . HOH C 3 .   ? -18.624 25.676  0.947   1.00 47.85  ? 950  HOH A O     1 
HETATM 2850 O O     . HOH C 3 .   ? -39.214 11.137  -8.806  1.00 44.84  ? 951  HOH A O     1 
HETATM 2851 O O     . HOH C 3 .   ? -6.634  37.665  -3.964  1.00 45.87  ? 952  HOH A O     1 
HETATM 2852 O O     . HOH C 3 .   ? 0.983   29.353  -10.850 1.00 46.60  ? 953  HOH A O     1 
HETATM 2853 O O     . HOH C 3 .   ? -15.772 6.304   -13.819 1.00 31.41  ? 954  HOH A O     1 
HETATM 2854 O O     . HOH C 3 .   ? -3.187  12.224  -16.195 1.00 40.86  ? 955  HOH A O     1 
HETATM 2855 O O     . HOH C 3 .   ? -45.493 13.375  -10.603 1.00 33.04  ? 956  HOH A O     1 
HETATM 2856 O O     . HOH C 3 .   ? -15.803 7.444   -16.933 1.00 37.94  ? 957  HOH A O     1 
HETATM 2857 O O     . HOH C 3 .   ? -29.740 16.478  -17.490 1.00 30.95  ? 958  HOH A O     1 
HETATM 2858 O O     . HOH C 3 .   ? -30.154 14.692  -19.814 1.00 27.64  ? 959  HOH A O     1 
HETATM 2859 O O     . HOH C 3 .   ? -29.809 12.325  -33.494 1.00 37.04  ? 960  HOH A O     1 
HETATM 2860 O O     . HOH C 3 .   ? -20.311 -10.034 -28.405 1.00 24.38  ? 961  HOH A O     1 
HETATM 2861 O O     . HOH C 3 .   ? -21.889 -8.627  -30.390 1.00 30.79  ? 962  HOH A O     1 
HETATM 2862 O O     . HOH C 3 .   ? -31.593 22.323  -22.801 1.00 36.96  ? 963  HOH A O     1 
HETATM 2863 O O     . HOH C 3 .   ? -26.043 4.643   -15.049 1.00 35.35  ? 964  HOH A O     1 
HETATM 2864 O O     . HOH C 3 .   ? -31.200 27.765  -22.397 1.00 43.56  ? 965  HOH A O     1 
HETATM 2865 O O     . HOH C 3 .   ? -40.094 30.402  -13.147 1.00 41.09  ? 966  HOH A O     1 
HETATM 2866 O O     . HOH C 3 .   ? -31.390 17.961  -6.261  1.00 39.62  ? 967  HOH A O     1 
HETATM 2867 O O     . HOH C 3 .   ? -28.541 6.353   -15.633 1.00 40.61  ? 968  HOH A O     1 
HETATM 2868 O O     . HOH C 3 .   ? -31.629 26.260  -19.756 1.00 36.84  ? 969  HOH A O     1 
HETATM 2869 O O     . HOH C 3 .   ? -27.256 3.949   -31.544 1.00 30.26  ? 970  HOH A O     1 
HETATM 2870 O O     . HOH C 3 .   ? -26.710 0.000   -32.041 0.50 38.76  ? 971  HOH A O     1 
HETATM 2871 O O     . HOH C 3 .   ? -31.076 24.961  -24.914 1.00 38.23  ? 972  HOH A O     1 
HETATM 2872 O O     . HOH C 3 .   ? 3.958   12.722  -23.440 1.00 41.82  ? 973  HOH A O     1 
HETATM 2873 O O     . HOH C 3 .   ? -29.284 28.900  -6.209  1.00 43.48  ? 974  HOH A O     1 
HETATM 2874 O O     . HOH C 3 .   ? -10.404 37.308  -12.506 1.00 44.24  ? 975  HOH A O     1 
HETATM 2875 O O     . HOH C 3 .   ? -31.932 23.562  -27.608 1.00 45.10  ? 976  HOH A O     1 
HETATM 2876 O O     . HOH C 3 .   ? -13.752 15.704  -3.306  1.00 42.01  ? 977  HOH A O     1 
HETATM 2877 O O     . HOH C 3 .   ? 1.100   5.949   -23.648 1.00 50.75  ? 978  HOH A O     1 
HETATM 2878 O O     . HOH C 3 .   ? -56.007 39.053  -32.542 1.00 51.32  ? 979  HOH A O     1 
HETATM 2879 O O     . HOH C 3 .   ? -35.279 5.655   -19.908 1.00 30.04  ? 980  HOH A O     1 
HETATM 2880 O O     . HOH C 3 .   ? -13.829 34.318  -24.048 1.00 31.94  ? 981  HOH A O     1 
HETATM 2881 O O     . HOH C 3 .   ? -30.896 24.264  -21.931 1.00 41.71  ? 982  HOH A O     1 
HETATM 2882 O O     . HOH C 3 .   ? -42.036 17.529  -6.475  1.00 43.96  ? 983  HOH A O     1 
HETATM 2883 O O     . HOH C 3 .   ? -27.762 39.383  -24.101 1.00 45.97  ? 984  HOH A O     1 
HETATM 2884 O O     . HOH C 3 .   ? -15.439 -5.559  -35.431 1.00 54.12  ? 985  HOH A O     1 
HETATM 2885 O O     . HOH C 3 .   ? -10.135 9.163   -19.906 1.00 42.32  ? 986  HOH A O     1 
HETATM 2886 O O     . HOH C 3 .   ? -22.307 -2.720  -20.102 1.00 40.17  ? 987  HOH A O     1 
HETATM 2887 O O     . HOH C 3 .   ? -26.710 0.000   -21.423 0.50 35.77  ? 988  HOH A O     1 
HETATM 2888 O O     . HOH C 3 .   ? -26.227 1.631   -19.164 1.00 39.41  ? 989  HOH A O     1 
HETATM 2889 O O     . HOH C 3 .   ? -57.718 40.900  -31.809 1.00 45.11  ? 990  HOH A O     1 
HETATM 2890 O O     . HOH C 3 .   ? 1.982   20.916  -6.556  1.00 44.51  ? 991  HOH A O     1 
HETATM 2891 O O     . HOH C 3 .   ? -30.929 29.986  -7.879  1.00 45.02  ? 992  HOH A O     1 
HETATM 2892 O O     . HOH C 3 .   ? -34.094 24.399  -19.989 1.00 38.43  ? 993  HOH A O     1 
HETATM 2893 O O     . HOH C 3 .   ? -39.736 24.435  -12.860 1.00 39.11  ? 994  HOH A O     1 
HETATM 2894 O O     . HOH C 3 .   ? -46.296 16.728  -18.849 1.00 39.66  ? 995  HOH A O     1 
HETATM 2895 O O     . HOH C 3 .   ? -18.571 2.809   -17.988 1.00 43.25  ? 996  HOH A O     1 
HETATM 2896 O O     . HOH C 3 .   ? -17.968 8.738   -39.246 1.00 45.84  ? 997  HOH A O     1 
HETATM 2897 O O     . HOH C 3 .   ? -26.973 22.303  -1.466  1.00 46.36  ? 998  HOH A O     1 
HETATM 2898 O O     . HOH C 3 .   ? -22.272 2.876   -17.217 1.00 43.73  ? 999  HOH A O     1 
HETATM 2899 O O     . HOH C 3 .   ? -52.792 22.629  -24.237 1.00 42.41  ? 1000 HOH A O     1 
HETATM 2900 O O     . HOH C 3 .   ? -23.441 0.255   -16.831 1.00 46.57  ? 1001 HOH A O     1 
HETATM 2901 O O     . HOH C 3 .   ? -52.227 22.005  -27.060 1.00 43.95  ? 1002 HOH A O     1 
HETATM 2902 O O     . HOH C 3 .   ? -14.103 33.827  -7.604  1.00 45.99  ? 1003 HOH A O     1 
HETATM 2903 O O     . HOH C 3 .   ? -35.912 25.176  -8.359  1.00 44.27  ? 1004 HOH A O     1 
HETATM 2904 O O     . HOH C 3 .   ? -9.382  38.944  -24.879 1.00 42.85  ? 1005 HOH A O     1 
HETATM 2905 O O     . HOH C 3 .   ? -45.246 12.328  -7.573  1.00 45.24  ? 1006 HOH A O     1 
HETATM 2906 O O     . HOH C 3 .   ? -6.256  40.832  -21.861 1.00 39.52  ? 1007 HOH A O     1 
HETATM 2907 O O     . HOH C 3 .   ? -11.689 6.643   -20.759 1.00 42.79  ? 1008 HOH A O     1 
HETATM 2908 O O     . HOH C 3 .   ? -15.398 31.635  -26.203 1.00 47.79  ? 1009 HOH A O     1 
HETATM 2909 O O     . HOH C 3 .   ? -6.267  30.527  -3.473  1.00 50.31  ? 1010 HOH A O     1 
HETATM 2910 O O     . HOH C 3 .   ? -1.214  1.563   -22.903 1.00 55.74  ? 1011 HOH A O     1 
HETATM 2911 O O     . HOH C 3 .   ? -32.525 7.750   -12.733 1.00 31.41  ? 1012 HOH A O     1 
HETATM 2912 O O     . HOH C 3 .   ? -42.949 12.389  -28.132 1.00 38.06  ? 1013 HOH A O     1 
HETATM 2913 O O     . HOH C 3 .   ? -5.584  40.812  -24.791 1.00 38.13  ? 1014 HOH A O     1 
HETATM 2914 O O     . HOH C 3 .   ? -15.127 44.860  -16.160 1.00 45.29  ? 1015 HOH A O     1 
HETATM 2915 O O     . HOH C 3 .   ? -28.285 20.538  -32.726 1.00 35.95  ? 1016 HOH A O     1 
HETATM 2916 O O     . HOH C 3 .   ? -34.888 1.636   -19.829 1.00 43.42  ? 1017 HOH A O     1 
HETATM 2917 O O     . HOH C 3 .   ? -42.789 35.599  -27.686 1.00 45.66  ? 1018 HOH A O     1 
HETATM 2918 O O     . HOH C 3 .   ? -50.751 14.784  -17.798 1.00 46.62  ? 1019 HOH A O     1 
HETATM 2919 O O     . HOH C 3 .   ? -19.909 -1.887  -17.958 1.00 43.26  ? 1020 HOH A O     1 
HETATM 2920 O O     . HOH C 3 .   ? -29.228 26.546  -34.203 1.00 55.65  ? 1021 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  TRP 90  90  90  TRP TRP A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 MET 150 150 150 MET MET A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 PRO 205 205 205 PRO PRO A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 MET 220 220 220 MET MET A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 GLY 223 223 223 GLY GLY A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 MET 227 227 227 MET MET A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 ILE 235 235 235 ILE ILE A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 PHE 268 268 268 PHE PHE A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 PRO 274 274 274 PRO PRO A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 MET 294 294 294 MET MET A . n 
A 1 295 HIS 295 295 295 HIS HIS A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 CYS 300 300 300 CYS CYS A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 LYS 305 305 305 LYS LYS A . n 
A 1 306 THR 306 306 306 THR THR A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 GLN 314 314 314 GLN GLN A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 GLY 328 703 703 GLY GLY A . n 
A 1 329 SER 329 704 704 SER SER A . n 
A 1 330 GLY 330 705 705 GLY GLY A . n 
A 1 331 SER 331 706 706 SER SER A . n 
A 1 332 GLY 332 707 707 GLY GLY A . n 
A 1 333 SER 333 708 708 SER SER A . n 
A 1 334 GLY 334 709 709 GLY GLY A . n 
A 1 335 SER 335 710 710 SER SER A . n 
A 1 336 LYS 336 711 711 LYS LYS A . n 
A 1 337 GLU 337 712 712 GLU GLU A . n 
A 1 338 ALA 338 713 713 ALA ALA A . n 
A 1 339 ALA 339 714 714 ALA ALA A . n 
A 1 340 ASP 340 715 715 ASP ASP A . n 
A 1 341 MET 341 716 716 MET MET A . n 
A 1 342 LEU 342 717 717 LEU LEU A . n 
A 1 343 LYS 343 718 718 LYS LYS A . n 
A 1 344 ALA 344 719 719 ALA ALA A . n 
A 1 345 LEU 345 720 720 LEU LEU A . n 
A 1 346 GLN 346 721 721 GLN GLN A . n 
A 1 347 GLY 347 722 722 GLY GLY A . n 
A 1 348 ALA 348 723 723 ALA ALA A . n 
A 1 349 SER 349 724 724 SER SER A . n 
A 1 350 GLN 350 725 725 GLN GLN A . n 
A 1 351 ILE 351 726 726 ILE ILE A . n 
A 1 352 ILE 352 727 727 ILE ILE A . n 
A 1 353 ALA 353 728 728 ALA ALA A . n 
A 1 354 GLU 354 729 729 GLU GLU A . n 
A 1 355 ILE 355 730 730 ILE ILE A . n 
A 1 356 ARG 356 731 731 ARG ARG A . n 
A 1 357 GLU 357 732 732 GLU GLU A . n 
A 1 358 THR 358 733 733 THR THR A . n 
A 1 359 HIS 359 734 ?   ?   ?   A . n 
A 1 360 LEU 360 735 ?   ?   ?   A . n 
A 1 361 TRP 361 736 ?   ?   ?   A . n 
A 1 362 LEU 362 737 ?   ?   ?   A . n 
A 1 363 GLU 363 738 ?   ?   ?   A . n 
A 1 364 HIS 364 739 ?   ?   ?   A . n 
A 1 365 HIS 365 740 ?   ?   ?   A . n 
A 1 366 HIS 366 741 ?   ?   ?   A . n 
A 1 367 HIS 367 742 ?   ?   ?   A . n 
A 1 368 HIS 368 743 ?   ?   ?   A . n 
A 1 369 HIS 369 744 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GNP 1   801  1   GNP GNP A . 
C 3 HOH 1   900  1   HOH MG  A . 
C 3 HOH 2   901  1   HOH HOH A . 
C 3 HOH 3   902  2   HOH HOH A . 
C 3 HOH 4   903  3   HOH HOH A . 
C 3 HOH 5   904  4   HOH HOH A . 
C 3 HOH 6   905  5   HOH HOH A . 
C 3 HOH 7   906  6   HOH HOH A . 
C 3 HOH 8   907  7   HOH HOH A . 
C 3 HOH 9   908  8   HOH HOH A . 
C 3 HOH 10  909  9   HOH HOH A . 
C 3 HOH 11  910  10  HOH HOH A . 
C 3 HOH 12  911  11  HOH HOH A . 
C 3 HOH 13  912  12  HOH HOH A . 
C 3 HOH 14  913  13  HOH HOH A . 
C 3 HOH 15  914  14  HOH HOH A . 
C 3 HOH 16  915  15  HOH HOH A . 
C 3 HOH 17  916  16  HOH HOH A . 
C 3 HOH 18  917  17  HOH HOH A . 
C 3 HOH 19  918  18  HOH HOH A . 
C 3 HOH 20  919  19  HOH HOH A . 
C 3 HOH 21  920  20  HOH HOH A . 
C 3 HOH 22  921  21  HOH HOH A . 
C 3 HOH 23  922  22  HOH HOH A . 
C 3 HOH 24  923  23  HOH HOH A . 
C 3 HOH 25  924  24  HOH HOH A . 
C 3 HOH 26  925  25  HOH HOH A . 
C 3 HOH 27  926  26  HOH HOH A . 
C 3 HOH 28  927  27  HOH HOH A . 
C 3 HOH 29  928  28  HOH HOH A . 
C 3 HOH 30  929  29  HOH HOH A . 
C 3 HOH 31  930  30  HOH HOH A . 
C 3 HOH 32  931  31  HOH HOH A . 
C 3 HOH 33  932  32  HOH HOH A . 
C 3 HOH 34  933  33  HOH HOH A . 
C 3 HOH 35  934  34  HOH HOH A . 
C 3 HOH 36  935  35  HOH HOH A . 
C 3 HOH 37  936  36  HOH HOH A . 
C 3 HOH 38  937  37  HOH HOH A . 
C 3 HOH 39  938  38  HOH HOH A . 
C 3 HOH 40  939  39  HOH HOH A . 
C 3 HOH 41  940  40  HOH HOH A . 
C 3 HOH 42  941  41  HOH HOH A . 
C 3 HOH 43  942  42  HOH HOH A . 
C 3 HOH 44  943  43  HOH HOH A . 
C 3 HOH 45  944  44  HOH HOH A . 
C 3 HOH 46  945  45  HOH HOH A . 
C 3 HOH 47  946  46  HOH HOH A . 
C 3 HOH 48  947  47  HOH HOH A . 
C 3 HOH 49  948  48  HOH HOH A . 
C 3 HOH 50  949  49  HOH HOH A . 
C 3 HOH 51  950  50  HOH HOH A . 
C 3 HOH 52  951  51  HOH HOH A . 
C 3 HOH 53  952  52  HOH HOH A . 
C 3 HOH 54  953  53  HOH HOH A . 
C 3 HOH 55  954  54  HOH HOH A . 
C 3 HOH 56  955  55  HOH HOH A . 
C 3 HOH 57  956  56  HOH HOH A . 
C 3 HOH 58  957  57  HOH HOH A . 
C 3 HOH 59  958  58  HOH HOH A . 
C 3 HOH 60  959  59  HOH HOH A . 
C 3 HOH 61  960  60  HOH HOH A . 
C 3 HOH 62  961  61  HOH HOH A . 
C 3 HOH 63  962  62  HOH HOH A . 
C 3 HOH 64  963  63  HOH HOH A . 
C 3 HOH 65  964  64  HOH HOH A . 
C 3 HOH 66  965  65  HOH HOH A . 
C 3 HOH 67  966  66  HOH HOH A . 
C 3 HOH 68  967  67  HOH HOH A . 
C 3 HOH 69  968  68  HOH HOH A . 
C 3 HOH 70  969  69  HOH HOH A . 
C 3 HOH 71  970  70  HOH HOH A . 
C 3 HOH 72  971  71  HOH HOH A . 
C 3 HOH 73  972  72  HOH HOH A . 
C 3 HOH 74  973  73  HOH HOH A . 
C 3 HOH 75  974  74  HOH HOH A . 
C 3 HOH 76  975  75  HOH HOH A . 
C 3 HOH 77  976  76  HOH HOH A . 
C 3 HOH 78  977  77  HOH HOH A . 
C 3 HOH 79  978  78  HOH HOH A . 
C 3 HOH 80  979  79  HOH HOH A . 
C 3 HOH 81  980  80  HOH HOH A . 
C 3 HOH 82  981  81  HOH HOH A . 
C 3 HOH 83  982  82  HOH HOH A . 
C 3 HOH 84  983  83  HOH HOH A . 
C 3 HOH 85  984  84  HOH HOH A . 
C 3 HOH 86  985  85  HOH HOH A . 
C 3 HOH 87  986  86  HOH HOH A . 
C 3 HOH 88  987  87  HOH HOH A . 
C 3 HOH 89  988  88  HOH HOH A . 
C 3 HOH 90  989  89  HOH HOH A . 
C 3 HOH 91  990  90  HOH HOH A . 
C 3 HOH 92  991  91  HOH HOH A . 
C 3 HOH 93  992  92  HOH HOH A . 
C 3 HOH 94  993  93  HOH HOH A . 
C 3 HOH 95  994  94  HOH HOH A . 
C 3 HOH 96  995  95  HOH HOH A . 
C 3 HOH 97  996  96  HOH HOH A . 
C 3 HOH 98  997  97  HOH HOH A . 
C 3 HOH 99  998  98  HOH HOH A . 
C 3 HOH 100 999  99  HOH HOH A . 
C 3 HOH 101 1000 100 HOH HOH A . 
C 3 HOH 102 1001 101 HOH HOH A . 
C 3 HOH 103 1002 102 HOH HOH A . 
C 3 HOH 104 1003 103 HOH HOH A . 
C 3 HOH 105 1004 104 HOH HOH A . 
C 3 HOH 106 1005 105 HOH HOH A . 
C 3 HOH 107 1006 106 HOH HOH A . 
C 3 HOH 108 1007 107 HOH HOH A . 
C 3 HOH 109 1008 108 HOH HOH A . 
C 3 HOH 110 1009 109 HOH HOH A . 
C 3 HOH 111 1010 110 HOH HOH A . 
C 3 HOH 112 1011 111 HOH HOH A . 
C 3 HOH 113 1012 112 HOH HOH A . 
C 3 HOH 114 1013 113 HOH HOH A . 
C 3 HOH 115 1014 114 HOH HOH A . 
C 3 HOH 116 1015 115 HOH HOH A . 
C 3 HOH 117 1016 116 HOH HOH A . 
C 3 HOH 118 1017 117 HOH HOH A . 
C 3 HOH 119 1018 118 HOH HOH A . 
C 3 HOH 120 1019 119 HOH HOH A . 
C 3 HOH 121 1020 120 HOH HOH A . 
C 3 HOH 122 1021 121 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 971 ? C HOH . 
2 1 A HOH 988 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-08-21 
2 'Structure model' 1 1 2013-09-11 
3 'Structure model' 1 2 2017-08-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
# 
_pdbx_phasing_MR.entry_id                     4H1V 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           37.420 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        37.420 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .        ?                                 package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction' 
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/  ?          ? 
2 SCALA       3.3.20   2011/05/18                        other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling' 
http://www.ccp4.ac.uk/dist/html/scala.html  Fortran_77 ? 
3 PHASER      2.3.0    'Mon Jun 27 09:33:44 2011 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing 
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 
4 PHENIX      1.8_1069 ?                                 package 'Paul D. Adams'      PDAdams@lbl.gov             refinement 
http://www.phenix-online.org/               C++        ? 
5 PDB_EXTRACT 3.11     'April 22, 2011'                  package PDB                  deposit@deposit.rcsb.org    
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++        ? 
6 MxCuBE      .        ?                                 ?       ?                    ?                           
'data collection' ?                                           ?          ? 
# 
_pdbx_entry_details.entry_id             4H1V 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'THE PROTEIN IS A FUSION CONSTRUCT BETWEEN THE DOMAINS INDICATED IN COMPND, FRAGMENT REMARK' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 50  ? ? -144.79 -13.96  
2  1 THR A 79  ? ? 51.84   -136.41 
3  1 GLU A 81  ? ? 58.91   -0.28   
4  1 ASN A 83  ? ? -123.11 -104.80 
5  1 LYS A 97  ? ? 57.07   -117.23 
6  1 GLU A 116 ? ? 64.36   -6.12   
7  1 SER A 119 ? ? 81.32   6.30    
8  1 TYR A 322 ? ? -72.93  -74.13  
9  1 GLU A 324 ? ? -177.25 -177.65 
10 1 VAL A 326 ? ? 83.63   1.77    
11 1 ARG A 731 ? ? -140.82 -23.20  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ARG A 53  ? ? GLY A 54  ? ? -117.88 
2 1 GLY A 54  ? ? THR A 55  ? ? -102.04 
3 1 THR A 55  ? ? GLY A 56  ? ? -72.37  
4 1 GLY A 56  ? ? ILE A 57  ? ? -118.61 
5 1 GLY A 223 ? ? THR A 224 ? ? 149.96  
6 1 THR A 224 ? ? ASP A 225 ? ? 146.49  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 734 ? A HIS 359 
2  1 Y 1 A LEU 735 ? A LEU 360 
3  1 Y 1 A TRP 736 ? A TRP 361 
4  1 Y 1 A LEU 737 ? A LEU 362 
5  1 Y 1 A GLU 738 ? A GLU 363 
6  1 Y 1 A HIS 739 ? A HIS 364 
7  1 Y 1 A HIS 740 ? A HIS 365 
8  1 Y 1 A HIS 741 ? A HIS 366 
9  1 Y 1 A HIS 742 ? A HIS 367 
10 1 Y 1 A HIS 743 ? A HIS 368 
11 1 Y 1 A HIS 744 ? A HIS 369 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
3 water                                         HOH 
#