data_4I2D
# 
_entry.id   4I2D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4I2D         
RCSB  RCSB076216   
WWPDB D_1000076216 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4I27 . unspecified 
PDB 4I28 . unspecified 
PDB 4I29 . unspecified 
PDB 4I2A . unspecified 
PDB 4I2B . unspecified 
PDB 4I2C . unspecified 
PDB 4I2E . unspecified 
PDB 4I2F . unspecified 
PDB 4I2G . unspecified 
PDB 4I2H . unspecified 
PDB 4I2I . unspecified 
PDB 4I2J . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4I2D 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gouge, J.'   1 
'Delarue, M.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of Intermediates along the Catalytic Cycle of Terminal Deoxynucleotidyltransferase: Dynamical Aspects of the Two-Metal Ion Mechanism.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            425 
_citation.page_first                4334 
_citation.page_last                 4352 
_citation.year                      2013 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23856622 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2013.07.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gouge, J.'   1 
primary 'Rosario, S.' 2 
primary 'Romain, F.'  3 
primary 'Beguin, P.'  4 
primary 'Delarue, M.' 5 
# 
_cell.entry_id           4I2D 
_cell.length_a           46.880 
_cell.length_b           84.470 
_cell.length_c           113.910 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4I2D 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA nucleotidylexotransferase'                 45704.008 1   2.7.7.31 ? 'SEE REMARK 999' ? 
2 non-polymer syn 'MAGNESIUM ION'                                 24.305    1   ?        ? ?                ? 
3 non-polymer syn 'SODIUM ION'                                    22.990    1   ?        ? ?                ? 
4 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   1   ?        ? ?                ? 
5 non-polymer syn 'ZINC ION'                                      65.409    1   ?        ? ?                ? 
6 water       nat water                                           18.015    262 ?        ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Terminal addition enzyme, Terminal deoxynucleotidyltransferase, TDT, Terminal transferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLA
FMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMG
FRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITS
PEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKA
IRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLA
FMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMG
FRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITS
PEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKA
IRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  PRO n 
1 24  SER n 
1 25  PRO n 
1 26  VAL n 
1 27  PRO n 
1 28  GLY n 
1 29  SER n 
1 30  GLN n 
1 31  ASN n 
1 32  VAL n 
1 33  PRO n 
1 34  ALA n 
1 35  PRO n 
1 36  ALA n 
1 37  VAL n 
1 38  LYS n 
1 39  LYS n 
1 40  ILE n 
1 41  SER n 
1 42  GLN n 
1 43  TYR n 
1 44  ALA n 
1 45  CYS n 
1 46  GLN n 
1 47  ARG n 
1 48  ARG n 
1 49  THR n 
1 50  THR n 
1 51  LEU n 
1 52  ASN n 
1 53  ASN n 
1 54  TYR n 
1 55  ASN n 
1 56  GLN n 
1 57  LEU n 
1 58  PHE n 
1 59  THR n 
1 60  ASP n 
1 61  ALA n 
1 62  LEU n 
1 63  ASP n 
1 64  ILE n 
1 65  LEU n 
1 66  ALA n 
1 67  GLU n 
1 68  ASN n 
1 69  ASP n 
1 70  GLU n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  ASN n 
1 75  GLU n 
1 76  GLY n 
1 77  SER n 
1 78  CYS n 
1 79  LEU n 
1 80  ALA n 
1 81  PHE n 
1 82  MET n 
1 83  ARG n 
1 84  ALA n 
1 85  SER n 
1 86  SER n 
1 87  VAL n 
1 88  LEU n 
1 89  LYS n 
1 90  SER n 
1 91  LEU n 
1 92  PRO n 
1 93  PHE n 
1 94  PRO n 
1 95  ILE n 
1 96  THR n 
1 97  SER n 
1 98  MET n 
1 99  LYS n 
1 100 ASP n 
1 101 THR n 
1 102 GLU n 
1 103 GLY n 
1 104 ILE n 
1 105 PRO n 
1 106 CYS n 
1 107 LEU n 
1 108 GLY n 
1 109 ASP n 
1 110 LYS n 
1 111 VAL n 
1 112 LYS n 
1 113 SER n 
1 114 ILE n 
1 115 ILE n 
1 116 GLU n 
1 117 GLY n 
1 118 ILE n 
1 119 ILE n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 SER n 
1 125 SER n 
1 126 GLU n 
1 127 ALA n 
1 128 LYS n 
1 129 ALA n 
1 130 VAL n 
1 131 LEU n 
1 132 ASN n 
1 133 ASP n 
1 134 GLU n 
1 135 ARG n 
1 136 TYR n 
1 137 LYS n 
1 138 SER n 
1 139 PHE n 
1 140 LYS n 
1 141 LEU n 
1 142 PHE n 
1 143 THR n 
1 144 SER n 
1 145 VAL n 
1 146 PHE n 
1 147 GLY n 
1 148 VAL n 
1 149 GLY n 
1 150 LEU n 
1 151 LYS n 
1 152 THR n 
1 153 ALA n 
1 154 GLU n 
1 155 LYS n 
1 156 TRP n 
1 157 PHE n 
1 158 ARG n 
1 159 MET n 
1 160 GLY n 
1 161 PHE n 
1 162 ARG n 
1 163 THR n 
1 164 LEU n 
1 165 SER n 
1 166 LYS n 
1 167 ILE n 
1 168 GLN n 
1 169 SER n 
1 170 ASP n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ARG n 
1 175 PHE n 
1 176 THR n 
1 177 GLN n 
1 178 MET n 
1 179 GLN n 
1 180 LYS n 
1 181 ALA n 
1 182 GLY n 
1 183 PHE n 
1 184 LEU n 
1 185 TYR n 
1 186 TYR n 
1 187 GLU n 
1 188 ASP n 
1 189 LEU n 
1 190 VAL n 
1 191 SER n 
1 192 CYS n 
1 193 VAL n 
1 194 ASN n 
1 195 ARG n 
1 196 PRO n 
1 197 GLU n 
1 198 ALA n 
1 199 GLU n 
1 200 ALA n 
1 201 VAL n 
1 202 SER n 
1 203 MET n 
1 204 LEU n 
1 205 VAL n 
1 206 LYS n 
1 207 GLU n 
1 208 ALA n 
1 209 VAL n 
1 210 VAL n 
1 211 THR n 
1 212 PHE n 
1 213 LEU n 
1 214 PRO n 
1 215 ASP n 
1 216 ALA n 
1 217 LEU n 
1 218 VAL n 
1 219 THR n 
1 220 MET n 
1 221 THR n 
1 222 GLY n 
1 223 GLY n 
1 224 PHE n 
1 225 ARG n 
1 226 ARG n 
1 227 GLY n 
1 228 LYS n 
1 229 MET n 
1 230 THR n 
1 231 GLY n 
1 232 HIS n 
1 233 ASP n 
1 234 VAL n 
1 235 ASP n 
1 236 PHE n 
1 237 LEU n 
1 238 ILE n 
1 239 THR n 
1 240 SER n 
1 241 PRO n 
1 242 GLU n 
1 243 ALA n 
1 244 THR n 
1 245 GLU n 
1 246 ASP n 
1 247 GLU n 
1 248 GLU n 
1 249 GLN n 
1 250 GLN n 
1 251 LEU n 
1 252 LEU n 
1 253 HIS n 
1 254 LYS n 
1 255 VAL n 
1 256 THR n 
1 257 ASP n 
1 258 PHE n 
1 259 TRP n 
1 260 LYS n 
1 261 GLN n 
1 262 GLN n 
1 263 GLY n 
1 264 LEU n 
1 265 LEU n 
1 266 LEU n 
1 267 TYR n 
1 268 CYS n 
1 269 ASP n 
1 270 ILE n 
1 271 LEU n 
1 272 GLU n 
1 273 SER n 
1 274 THR n 
1 275 PHE n 
1 276 GLU n 
1 277 LYS n 
1 278 PHE n 
1 279 LYS n 
1 280 GLN n 
1 281 PRO n 
1 282 SER n 
1 283 ARG n 
1 284 LYS n 
1 285 VAL n 
1 286 ASP n 
1 287 ALA n 
1 288 LEU n 
1 289 ASP n 
1 290 HIS n 
1 291 PHE n 
1 292 GLN n 
1 293 LYS n 
1 294 CYS n 
1 295 PHE n 
1 296 LEU n 
1 297 ILE n 
1 298 LEU n 
1 299 LYS n 
1 300 LEU n 
1 301 ASP n 
1 302 HIS n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 HIS n 
1 307 SER n 
1 308 GLU n 
1 309 LYS n 
1 310 SER n 
1 311 GLY n 
1 312 GLN n 
1 313 GLN n 
1 314 GLU n 
1 315 GLY n 
1 316 LYS n 
1 317 GLY n 
1 318 TRP n 
1 319 LYS n 
1 320 ALA n 
1 321 ILE n 
1 322 ARG n 
1 323 VAL n 
1 324 ASP n 
1 325 LEU n 
1 326 VAL n 
1 327 MET n 
1 328 CYS n 
1 329 PRO n 
1 330 TYR n 
1 331 ASP n 
1 332 ARG n 
1 333 ARG n 
1 334 ALA n 
1 335 PHE n 
1 336 ALA n 
1 337 LEU n 
1 338 LEU n 
1 339 GLY n 
1 340 TRP n 
1 341 THR n 
1 342 GLY n 
1 343 SER n 
1 344 ARG n 
1 345 GLN n 
1 346 PHE n 
1 347 GLU n 
1 348 ARG n 
1 349 ASP n 
1 350 LEU n 
1 351 ARG n 
1 352 ARG n 
1 353 TYR n 
1 354 ALA n 
1 355 THR n 
1 356 HIS n 
1 357 GLU n 
1 358 ARG n 
1 359 LYS n 
1 360 MET n 
1 361 MET n 
1 362 LEU n 
1 363 ASP n 
1 364 ASN n 
1 365 HIS n 
1 366 ALA n 
1 367 LEU n 
1 368 TYR n 
1 369 ASP n 
1 370 ARG n 
1 371 THR n 
1 372 LYS n 
1 373 ARG n 
1 374 VAL n 
1 375 PHE n 
1 376 LEU n 
1 377 GLU n 
1 378 ALA n 
1 379 GLU n 
1 380 SER n 
1 381 GLU n 
1 382 GLU n 
1 383 GLU n 
1 384 ILE n 
1 385 PHE n 
1 386 ALA n 
1 387 HIS n 
1 388 LEU n 
1 389 GLY n 
1 390 LEU n 
1 391 ASP n 
1 392 TYR n 
1 393 ILE n 
1 394 GLU n 
1 395 PRO n 
1 396 TRP n 
1 397 GLU n 
1 398 ARG n 
1 399 ASN n 
1 400 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 22  372 mouse ? 'Dntt, Tdt' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 373 400 mouse ? 'Dntt, Tdt' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TDT_MOUSE P09838 1 
;SPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDT
EGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKA
GFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQ
QGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPYDRRAFALLGWT
GSRQFERDLRRYATHERKMMLDNHALYDRTK
;
132 ? 
2 UNP TDT_MOUSE P09838 1 RVFLEAESEEEIFAHLGLDYIEPWERNA 503 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4I2D A 22  ? 372 ? P09838 132 ? 482 ? 132 482 
2 2 4I2D A 373 ? 400 ? P09838 503 ? 530 ? 483 510 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4I2D MET A 1  ? UNP P09838 ? ? 'EXPRESSION TAG' 111 1  
1 4I2D GLY A 2  ? UNP P09838 ? ? 'EXPRESSION TAG' 112 2  
1 4I2D SER A 3  ? UNP P09838 ? ? 'EXPRESSION TAG' 113 3  
1 4I2D SER A 4  ? UNP P09838 ? ? 'EXPRESSION TAG' 114 4  
1 4I2D HIS A 5  ? UNP P09838 ? ? 'EXPRESSION TAG' 115 5  
1 4I2D HIS A 6  ? UNP P09838 ? ? 'EXPRESSION TAG' 116 6  
1 4I2D HIS A 7  ? UNP P09838 ? ? 'EXPRESSION TAG' 117 7  
1 4I2D HIS A 8  ? UNP P09838 ? ? 'EXPRESSION TAG' 118 8  
1 4I2D HIS A 9  ? UNP P09838 ? ? 'EXPRESSION TAG' 119 9  
1 4I2D HIS A 10 ? UNP P09838 ? ? 'EXPRESSION TAG' 120 10 
1 4I2D SER A 11 ? UNP P09838 ? ? 'EXPRESSION TAG' 121 11 
1 4I2D SER A 12 ? UNP P09838 ? ? 'EXPRESSION TAG' 122 12 
1 4I2D GLY A 13 ? UNP P09838 ? ? 'EXPRESSION TAG' 123 13 
1 4I2D LEU A 14 ? UNP P09838 ? ? 'EXPRESSION TAG' 124 14 
1 4I2D VAL A 15 ? UNP P09838 ? ? 'EXPRESSION TAG' 125 15 
1 4I2D PRO A 16 ? UNP P09838 ? ? 'EXPRESSION TAG' 126 16 
1 4I2D ARG A 17 ? UNP P09838 ? ? 'EXPRESSION TAG' 127 17 
1 4I2D GLY A 18 ? UNP P09838 ? ? 'EXPRESSION TAG' 128 18 
1 4I2D SER A 19 ? UNP P09838 ? ? 'EXPRESSION TAG' 129 19 
1 4I2D HIS A 20 ? UNP P09838 ? ? 'EXPRESSION TAG' 130 20 
1 4I2D MET A 21 ? UNP P09838 ? ? 'EXPRESSION TAG' 131 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
NA  non-polymer         . 'SODIUM ION'                                    ?                                               'Na 1' 
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                      ?                                               'Zn 2' 
65.409  
# 
_exptl.entry_id          4I2D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'20-26% PEG4000, 100 mM HEPES, 200 mM ammonium acetate, pH 6.0-7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   6.0-7.5 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'channel cut' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9150 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9150 
# 
_reflns.entry_id                     4I2D 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   20328 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        45.65 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.695 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2936 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4I2D 
_refine.ls_number_reflns_obs                     20282 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             23.93 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    97.67 
_refine.ls_R_factor_obs                          0.2028 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2011 
_refine.ls_R_factor_R_free                       0.2356 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_number_reflns_R_free                  1043 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8851 
_refine.correlation_coeff_Fo_to_Fc_free          0.8756 
_refine.B_iso_mean                               49.88 
_refine.aniso_B[1][1]                            13.6920 
_refine.aniso_B[2][2]                            15.0795 
_refine.aniso_B[3][3]                            -28.7715 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JMS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.295 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.2140 
_refine.pdbx_overall_SU_R_Blow_DPI               0.3340 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.2210 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.entry_id                        4I2D 
_refine_analyze.Luzzati_coordinate_error_obs    0.308 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2830 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             262 
_refine_hist.number_atoms_total               3126 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        23.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  2927 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               0.97  ? 2.00  3957 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  1362 SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  77   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  425  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 2927 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? 5.00  2    SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_omega_torsion           2.99  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           2.71  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  377  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  3440 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.42 
_refine_ls_shell.number_reflns_R_work             2752 
_refine_ls_shell.R_factor_R_work                  0.2435 
_refine_ls_shell.percent_reflns_obs               97.67 
_refine_ls_shell.R_factor_R_free                  0.2833 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.20 
_refine_ls_shell.number_reflns_R_free             182 
_refine_ls_shell.number_reflns_all                2934 
_refine_ls_shell.R_factor_all                     0.2460 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4I2D 
_struct.title                     'Binary complex of mouse TdT with AMPcPP' 
_struct.pdbx_descriptor           'DNA nucleotidylexotransferase (E.C.2.7.7.31)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4I2D 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Terminal transferase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 43  ? ARG A 47  ? TYR A 153 ARG A 157 5 ? 5  
HELX_P HELX_P2  2  ASN A 55  ? ARG A 72  ? ASN A 165 ARG A 182 1 ? 18 
HELX_P HELX_P3  3  ASN A 74  ? SER A 90  ? ASN A 184 SER A 200 1 ? 17 
HELX_P HELX_P4  4  SER A 97  ? GLU A 102 ? SER A 207 GLU A 212 5 ? 6  
HELX_P HELX_P5  5  GLY A 108 ? GLY A 122 ? GLY A 218 GLY A 232 1 ? 15 
HELX_P HELX_P6  6  SER A 124 ? ASP A 133 ? SER A 234 ASP A 243 1 ? 10 
HELX_P HELX_P7  7  ASP A 133 ? SER A 144 ? ASP A 243 SER A 254 1 ? 12 
HELX_P HELX_P8  8  GLY A 149 ? MET A 159 ? GLY A 259 MET A 269 1 ? 11 
HELX_P HELX_P9  9  THR A 163 ? ASP A 170 ? THR A 273 ASP A 280 1 ? 8  
HELX_P HELX_P10 10 THR A 176 ? TYR A 185 ? THR A 286 TYR A 295 1 ? 10 
HELX_P HELX_P11 11 TYR A 185 ? SER A 191 ? TYR A 295 SER A 301 1 ? 7  
HELX_P HELX_P12 12 ARG A 195 ? LEU A 213 ? ARG A 305 LEU A 323 1 ? 19 
HELX_P HELX_P13 13 THR A 221 ? ARG A 226 ? THR A 331 ARG A 336 1 ? 6  
HELX_P HELX_P14 14 THR A 244 ? GLY A 263 ? THR A 354 GLY A 373 1 ? 20 
HELX_P HELX_P15 15 GLY A 303 ? VAL A 305 ? GLY A 413 VAL A 415 5 ? 3  
HELX_P HELX_P16 16 PRO A 329 ? ASP A 331 ? PRO A 439 ASP A 441 5 ? 3  
HELX_P HELX_P17 17 ARG A 332 ? GLY A 342 ? ARG A 442 GLY A 452 1 ? 11 
HELX_P HELX_P18 18 SER A 343 ? LYS A 359 ? SER A 453 LYS A 469 1 ? 17 
HELX_P HELX_P19 19 SER A 380 ? LEU A 388 ? SER A 490 LEU A 498 1 ? 9  
HELX_P HELX_P20 20 GLU A 394 ? ARG A 398 ? GLU A 504 ARG A 508 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B MG  .   MG  ? ? ? 1_555 D APC . O2B ? ? A MG  601 A APC 603 1_555 ? ? ? ? ? ? ? 1.937 ? 
metalc2  metalc ? ? B MG  .   MG  ? ? ? 1_555 D APC . O2A ? ? A MG  601 A APC 603 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc3  metalc ? ? B MG  .   MG  ? ? ? 1_555 D APC . O2G ? ? A MG  601 A APC 603 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc4  metalc ? ? A ASP 233 OD2 ? ? ? 1_555 E ZN  . ZN  ? ? A ASP 343 A ZN  604 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc5  metalc ? ? A ASP 233 OD1 ? ? ? 1_555 B MG  . MG  ? ? A ASP 343 A MG  601 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc6  metalc ? ? B MG  .   MG  ? ? ? 1_555 F HOH . O   ? ? A MG  601 A HOH 840 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc7  metalc ? ? A ASP 324 OD2 ? ? ? 1_555 E ZN  . ZN  ? ? A ASP 434 A ZN  604 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc8  metalc ? ? A ASP 235 OD1 ? ? ? 1_555 E ZN  . ZN  ? ? A ASP 345 A ZN  604 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc9  metalc ? ? A THR 143 O   ? ? ? 1_555 C NA  . NA  ? ? A THR 253 A NA  602 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc10 metalc ? ? D APC .   O2A ? ? ? 1_555 E ZN  . ZN  ? ? A APC 603 A ZN  604 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc11 metalc ? ? A VAL 148 O   ? ? ? 1_555 C NA  . NA  ? ? A VAL 258 A NA  602 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc12 metalc ? ? C NA  .   NA  ? ? ? 1_555 F HOH . O   ? ? A NA  602 A HOH 929 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc13 metalc ? ? A ASP 235 OD2 ? ? ? 1_555 E ZN  . ZN  ? ? A ASP 345 A ZN  604 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc14 metalc ? ? A VAL 145 O   ? ? ? 1_555 C NA  . NA  ? ? A VAL 255 A NA  602 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc15 metalc ? ? A ASP 235 OD2 ? ? ? 1_555 B MG  . MG  ? ? A ASP 345 A MG  601 1_555 ? ? ? ? ? ? ? 2.733 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           342 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            452 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    343 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     453 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.63 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 193 ? ASN A 194 ? VAL A 303 ASN A 304 
A 2 THR A 230 ? GLY A 231 ? THR A 340 GLY A 341 
B 1 LEU A 217 ? MET A 220 ? LEU A 327 MET A 330 
B 2 VAL A 234 ? THR A 239 ? VAL A 344 THR A 349 
B 3 TRP A 318 ? MET A 327 ? TRP A 428 MET A 437 
B 4 GLN A 292 ? ASP A 301 ? GLN A 402 ASP A 411 
B 5 LEU A 265 ? LEU A 271 ? LEU A 375 LEU A 381 
C 1 MET A 360 ? LEU A 362 ? MET A 470 LEU A 472 
C 2 LEU A 367 ? ASP A 369 ? LEU A 477 ASP A 479 
C 3 VAL A 374 ? LEU A 376 ? VAL A 484 LEU A 486 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 193 ? N VAL A 303 O GLY A 231 ? O GLY A 341 
B 1 2 N LEU A 217 ? N LEU A 327 O THR A 239 ? O THR A 349 
B 2 3 N ILE A 238 ? N ILE A 348 O VAL A 326 ? O VAL A 436 
B 3 4 O VAL A 323 ? O VAL A 433 N LEU A 296 ? N LEU A 406 
B 4 5 O LYS A 293 ? O LYS A 403 N LEU A 271 ? N LEU A 381 
C 1 2 N MET A 361 ? N MET A 471 O TYR A 368 ? O TYR A 478 
C 2 3 N LEU A 367 ? N LEU A 477 O LEU A 376 ? O LEU A 486 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 601'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 602'  
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE APC A 603' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 604'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 233 ? ASP A 343 . ? 1_555 ? 
2  AC1 4  ASP A 235 ? ASP A 345 . ? 1_555 ? 
3  AC1 4  APC D .   ? APC A 603 . ? 1_555 ? 
4  AC1 4  HOH F .   ? HOH A 840 . ? 1_555 ? 
5  AC2 4  THR A 143 ? THR A 253 . ? 1_555 ? 
6  AC2 4  VAL A 145 ? VAL A 255 . ? 1_555 ? 
7  AC2 4  VAL A 148 ? VAL A 258 . ? 1_555 ? 
8  AC2 4  HOH F .   ? HOH A 929 . ? 1_555 ? 
9  AC3 16 GLY A 222 ? GLY A 332 . ? 1_555 ? 
10 AC3 16 GLY A 223 ? GLY A 333 . ? 1_555 ? 
11 AC3 16 ARG A 226 ? ARG A 336 . ? 1_555 ? 
12 AC3 16 GLY A 231 ? GLY A 341 . ? 1_555 ? 
13 AC3 16 HIS A 232 ? HIS A 342 . ? 1_555 ? 
14 AC3 16 ASP A 233 ? ASP A 343 . ? 1_555 ? 
15 AC3 16 ASP A 235 ? ASP A 345 . ? 1_555 ? 
16 AC3 16 ASP A 289 ? ASP A 399 . ? 1_555 ? 
17 AC3 16 GLY A 339 ? GLY A 449 . ? 1_555 ? 
18 AC3 16 TRP A 340 ? TRP A 450 . ? 1_555 ? 
19 AC3 16 GLY A 342 ? GLY A 452 . ? 1_555 ? 
20 AC3 16 ASN A 364 ? ASN A 474 . ? 1_555 ? 
21 AC3 16 MG  B .   ? MG  A 601 . ? 1_555 ? 
22 AC3 16 ZN  E .   ? ZN  A 604 . ? 1_555 ? 
23 AC3 16 HOH F .   ? HOH A 840 . ? 1_555 ? 
24 AC3 16 HOH F .   ? HOH A 917 . ? 1_555 ? 
25 AC4 4  ASP A 233 ? ASP A 343 . ? 1_555 ? 
26 AC4 4  ASP A 235 ? ASP A 345 . ? 1_555 ? 
27 AC4 4  ASP A 324 ? ASP A 434 . ? 1_555 ? 
28 AC4 4  APC D .   ? APC A 603 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4I2D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4I2D 
_atom_sites.fract_transf_matrix[1][1]   0.021331 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011839 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008779 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 39  ? 23.950  -3.880  -4.123  1.00 56.62  ? 149 LYS A N     1 
ATOM   2    C  CA    . LYS A 1 39  ? 23.809  -2.420  -4.203  1.00 55.83  ? 149 LYS A CA    1 
ATOM   3    C  C     . LYS A 1 39  ? 23.190  -1.849  -2.918  1.00 57.80  ? 149 LYS A C     1 
ATOM   4    O  O     . LYS A 1 39  ? 22.158  -2.354  -2.450  1.00 60.24  ? 149 LYS A O     1 
ATOM   5    C  CB    . LYS A 1 39  ? 22.966  -2.023  -5.428  1.00 58.24  ? 149 LYS A CB    1 
ATOM   6    N  N     . ILE A 1 40  ? 23.823  -0.802  -2.348  1.00 49.25  ? 150 ILE A N     1 
ATOM   7    C  CA    . ILE A 1 40  ? 23.358  -0.151  -1.118  1.00 46.47  ? 150 ILE A CA    1 
ATOM   8    C  C     . ILE A 1 40  ? 22.040  0.581   -1.385  1.00 46.24  ? 150 ILE A C     1 
ATOM   9    O  O     . ILE A 1 40  ? 21.964  1.438   -2.271  1.00 44.19  ? 150 ILE A O     1 
ATOM   10   C  CB    . ILE A 1 40  ? 24.420  0.811   -0.496  1.00 48.09  ? 150 ILE A CB    1 
ATOM   11   C  CG1   . ILE A 1 40  ? 25.782  0.096   -0.258  1.00 47.13  ? 150 ILE A CG1   1 
ATOM   12   C  CG2   . ILE A 1 40  ? 23.882  1.474   0.798   1.00 45.48  ? 150 ILE A CG2   1 
ATOM   13   C  CD1   . ILE A 1 40  ? 26.926  1.054   -0.074  1.00 49.63  ? 150 ILE A CD1   1 
ATOM   14   N  N     . SER A 1 41  ? 21.015  0.233   -0.603  1.00 41.43  ? 151 SER A N     1 
ATOM   15   C  CA    . SER A 1 41  ? 19.709  0.860   -0.700  1.00 40.95  ? 151 SER A CA    1 
ATOM   16   C  C     . SER A 1 41  ? 19.737  2.272   -0.121  1.00 43.32  ? 151 SER A C     1 
ATOM   17   O  O     . SER A 1 41  ? 20.489  2.552   0.819   1.00 40.59  ? 151 SER A O     1 
ATOM   18   C  CB    . SER A 1 41  ? 18.654  0.025   0.021   1.00 43.82  ? 151 SER A CB    1 
ATOM   19   O  OG    . SER A 1 41  ? 17.438  0.743   0.124   1.00 52.71  ? 151 SER A OG    1 
ATOM   20   N  N     . GLN A 1 42  ? 18.853  3.143   -0.654  1.00 39.15  ? 152 GLN A N     1 
ATOM   21   C  CA    . GLN A 1 42  ? 18.663  4.500   -0.182  1.00 38.30  ? 152 GLN A CA    1 
ATOM   22   C  C     . GLN A 1 42  ? 17.858  4.499   1.149   1.00 40.35  ? 152 GLN A C     1 
ATOM   23   O  O     . GLN A 1 42  ? 17.749  5.528   1.800   1.00 39.47  ? 152 GLN A O     1 
ATOM   24   C  CB    . GLN A 1 42  ? 17.932  5.338   -1.250  1.00 40.28  ? 152 GLN A CB    1 
ATOM   25   C  CG    . GLN A 1 42  ? 16.456  4.916   -1.436  1.00 60.61  ? 152 GLN A CG    1 
ATOM   26   C  CD    . GLN A 1 42  ? 15.642  5.828   -2.311  1.00 80.05  ? 152 GLN A CD    1 
ATOM   27   O  OE1   . GLN A 1 42  ? 14.976  5.373   -3.243  1.00 77.30  ? 152 GLN A OE1   1 
ATOM   28   N  NE2   . GLN A 1 42  ? 15.609  7.116   -1.987  1.00 72.49  ? 152 GLN A NE2   1 
ATOM   29   N  N     . TYR A 1 43  ? 17.270  3.360   1.520   1.00 36.88  ? 153 TYR A N     1 
ATOM   30   C  CA    . TYR A 1 43  ? 16.473  3.228   2.728   1.00 36.83  ? 153 TYR A CA    1 
ATOM   31   C  C     . TYR A 1 43  ? 17.257  2.604   3.855   1.00 40.24  ? 153 TYR A C     1 
ATOM   32   O  O     . TYR A 1 43  ? 17.802  1.515   3.690   1.00 38.40  ? 153 TYR A O     1 
ATOM   33   C  CB    . TYR A 1 43  ? 15.216  2.361   2.445   1.00 38.24  ? 153 TYR A CB    1 
ATOM   34   C  CG    . TYR A 1 43  ? 14.238  2.951   1.459   1.00 39.15  ? 153 TYR A CG    1 
ATOM   35   C  CD1   . TYR A 1 43  ? 14.149  2.464   0.161   1.00 41.29  ? 153 TYR A CD1   1 
ATOM   36   C  CD2   . TYR A 1 43  ? 13.360  3.964   1.838   1.00 40.20  ? 153 TYR A CD2   1 
ATOM   37   C  CE1   . TYR A 1 43  ? 13.217  2.975   -0.743  1.00 41.97  ? 153 TYR A CE1   1 
ATOM   38   C  CE2   . TYR A 1 43  ? 12.419  4.480   0.946   1.00 41.08  ? 153 TYR A CE2   1 
ATOM   39   C  CZ    . TYR A 1 43  ? 12.350  3.979   -0.345  1.00 48.44  ? 153 TYR A CZ    1 
ATOM   40   O  OH    . TYR A 1 43  ? 11.411  4.459   -1.222  1.00 48.61  ? 153 TYR A OH    1 
ATOM   41   N  N     . ALA A 1 44  ? 17.274  3.260   5.022   1.00 39.90  ? 154 ALA A N     1 
ATOM   42   C  CA    . ALA A 1 44  ? 17.953  2.744   6.221   1.00 40.02  ? 154 ALA A CA    1 
ATOM   43   C  C     . ALA A 1 44  ? 17.374  1.394   6.655   1.00 43.91  ? 154 ALA A C     1 
ATOM   44   O  O     . ALA A 1 44  ? 18.121  0.579   7.189   1.00 45.55  ? 154 ALA A O     1 
ATOM   45   C  CB    . ALA A 1 44  ? 17.840  3.742   7.361   1.00 40.86  ? 154 ALA A CB    1 
ATOM   46   N  N     . CYS A 1 45  ? 16.062  1.152   6.423   1.00 37.80  ? 155 CYS A N     1 
ATOM   47   C  CA    . CYS A 1 45  ? 15.387  -0.096  6.799   1.00 37.23  ? 155 CYS A CA    1 
ATOM   48   C  C     . CYS A 1 45  ? 15.836  -1.277  5.914   1.00 43.25  ? 155 CYS A C     1 
ATOM   49   O  O     . CYS A 1 45  ? 15.518  -2.419  6.228   1.00 45.71  ? 155 CYS A O     1 
ATOM   50   C  CB    . CYS A 1 45  ? 13.859  0.071   6.802   1.00 36.76  ? 155 CYS A CB    1 
ATOM   51   S  SG    . CYS A 1 45  ? 13.162  0.586   5.219   1.00 39.70  ? 155 CYS A SG    1 
ATOM   52   N  N     . GLN A 1 46  ? 16.587  -1.020  4.831   1.00 39.52  ? 156 GLN A N     1 
ATOM   53   C  CA    . GLN A 1 46  ? 17.176  -2.053  3.967   1.00 37.41  ? 156 GLN A CA    1 
ATOM   54   C  C     . GLN A 1 46  ? 18.727  -2.071  4.129   1.00 39.76  ? 156 GLN A C     1 
ATOM   55   O  O     . GLN A 1 46  ? 19.448  -2.569  3.259   1.00 41.15  ? 156 GLN A O     1 
ATOM   56   C  CB    . GLN A 1 46  ? 16.780  -1.821  2.506   1.00 38.31  ? 156 GLN A CB    1 
ATOM   57   C  CG    . GLN A 1 46  ? 15.312  -2.107  2.205   1.00 32.83  ? 156 GLN A CG    1 
ATOM   58   C  CD    . GLN A 1 46  ? 15.030  -2.003  0.726   1.00 46.20  ? 156 GLN A CD    1 
ATOM   59   O  OE1   . GLN A 1 46  ? 15.329  -0.998  0.066   1.00 39.84  ? 156 GLN A OE1   1 
ATOM   60   N  NE2   . GLN A 1 46  ? 14.459  -3.053  0.170   1.00 41.42  ? 156 GLN A NE2   1 
ATOM   61   N  N     . ARG A 1 47  ? 19.228  -1.522  5.245   1.00 33.80  ? 157 ARG A N     1 
ATOM   62   C  CA    . ARG A 1 47  ? 20.657  -1.464  5.578   1.00 33.69  ? 157 ARG A CA    1 
ATOM   63   C  C     . ARG A 1 47  ? 20.838  -1.913  7.002   1.00 40.14  ? 157 ARG A C     1 
ATOM   64   O  O     . ARG A 1 47  ? 19.930  -1.767  7.811   1.00 40.55  ? 157 ARG A O     1 
ATOM   65   C  CB    . ARG A 1 47  ? 21.281  -0.038  5.399   1.00 27.20  ? 157 ARG A CB    1 
ATOM   66   C  CG    . ARG A 1 47  ? 21.167  0.584   4.014   1.00 38.18  ? 157 ARG A CG    1 
ATOM   67   C  CD    . ARG A 1 47  ? 21.935  1.902   3.881   1.00 44.10  ? 157 ARG A CD    1 
ATOM   68   N  NE    . ARG A 1 47  ? 21.539  2.934   4.848   1.00 42.97  ? 157 ARG A NE    1 
ATOM   69   C  CZ    . ARG A 1 47  ? 20.898  4.056   4.542   1.00 43.83  ? 157 ARG A CZ    1 
ATOM   70   N  NH1   . ARG A 1 47  ? 20.520  4.292   3.292   1.00 28.73  ? 157 ARG A NH1   1 
ATOM   71   N  NH2   . ARG A 1 47  ? 20.616  4.941   5.484   1.00 29.64  ? 157 ARG A NH2   1 
ATOM   72   N  N     . ARG A 1 48  ? 21.991  -2.465  7.313   1.00 37.13  ? 158 ARG A N     1 
ATOM   73   C  CA    . ARG A 1 48  ? 22.320  -2.881  8.672   1.00 36.13  ? 158 ARG A CA    1 
ATOM   74   C  C     . ARG A 1 48  ? 23.313  -1.849  9.164   1.00 36.33  ? 158 ARG A C     1 
ATOM   75   O  O     . ARG A 1 48  ? 24.361  -1.688  8.541   1.00 35.65  ? 158 ARG A O     1 
ATOM   76   C  CB    . ARG A 1 48  ? 22.882  -4.319  8.695   1.00 33.13  ? 158 ARG A CB    1 
ATOM   77   C  CG    . ARG A 1 48  ? 21.853  -5.356  8.270   1.00 45.54  ? 158 ARG A CG    1 
ATOM   78   C  CD    . ARG A 1 48  ? 22.342  -6.798  8.361   1.00 51.33  ? 158 ARG A CD    1 
ATOM   79   N  NE    . ARG A 1 48  ? 21.502  -7.665  7.534   1.00 61.92  ? 158 ARG A NE    1 
ATOM   80   C  CZ    . ARG A 1 48  ? 20.346  -8.206  7.924   1.00 73.75  ? 158 ARG A CZ    1 
ATOM   81   N  NH1   . ARG A 1 48  ? 19.891  -8.004  9.160   1.00 52.42  ? 158 ARG A NH1   1 
ATOM   82   N  NH2   . ARG A 1 48  ? 19.638  -8.955  7.083   1.00 55.99  ? 158 ARG A NH2   1 
ATOM   83   N  N     . THR A 1 49  ? 22.949  -1.089  10.200  1.00 29.23  ? 159 THR A N     1 
ATOM   84   C  CA    . THR A 1 49  ? 23.766  -0.027  10.732  1.00 27.70  ? 159 THR A CA    1 
ATOM   85   C  C     . THR A 1 49  ? 24.101  -0.341  12.184  1.00 32.77  ? 159 THR A C     1 
ATOM   86   O  O     . THR A 1 49  ? 23.288  -0.138  13.083  1.00 29.25  ? 159 THR A O     1 
ATOM   87   C  CB    . THR A 1 49  ? 23.137  1.345   10.531  1.00 34.35  ? 159 THR A CB    1 
ATOM   88   O  OG1   . THR A 1 49  ? 22.505  1.406   9.247   1.00 35.33  ? 159 THR A OG1   1 
ATOM   89   C  CG2   . THR A 1 49  ? 24.179  2.483   10.666  1.00 31.31  ? 159 THR A CG2   1 
ATOM   90   N  N     . THR A 1 50  ? 25.349  -0.802  12.404  1.00 33.83  ? 160 THR A N     1 
ATOM   91   C  CA    . THR A 1 50  ? 25.846  -1.215  13.722  1.00 34.01  ? 160 THR A CA    1 
ATOM   92   C  C     . THR A 1 50  ? 26.653  -0.069  14.336  1.00 39.58  ? 160 THR A C     1 
ATOM   93   O  O     . THR A 1 50  ? 26.929  0.911   13.645  1.00 39.02  ? 160 THR A O     1 
ATOM   94   C  CB    . THR A 1 50  ? 26.607  -2.538  13.594  1.00 34.37  ? 160 THR A CB    1 
ATOM   95   O  OG1   . THR A 1 50  ? 27.565  -2.395  12.552  1.00 42.19  ? 160 THR A OG1   1 
ATOM   96   C  CG2   . THR A 1 50  ? 25.694  -3.704  13.227  1.00 21.63  ? 160 THR A CG2   1 
ATOM   97   N  N     . LEU A 1 51  ? 27.023  -0.180  15.630  1.00 38.08  ? 161 LEU A N     1 
ATOM   98   C  CA    . LEU A 1 51  ? 27.730  0.911   16.322  1.00 37.63  ? 161 LEU A CA    1 
ATOM   99   C  C     . LEU A 1 51  ? 29.235  1.010   15.960  1.00 41.28  ? 161 LEU A C     1 
ATOM   100  O  O     . LEU A 1 51  ? 29.870  1.993   16.321  1.00 41.44  ? 161 LEU A O     1 
ATOM   101  C  CB    . LEU A 1 51  ? 27.510  0.835   17.846  1.00 36.51  ? 161 LEU A CB    1 
ATOM   102  C  CG    . LEU A 1 51  ? 26.067  1.131   18.301  1.00 38.60  ? 161 LEU A CG    1 
ATOM   103  C  CD1   . LEU A 1 51  ? 25.867  0.755   19.740  1.00 37.78  ? 161 LEU A CD1   1 
ATOM   104  C  CD2   . LEU A 1 51  ? 25.680  2.595   18.109  1.00 38.74  ? 161 LEU A CD2   1 
ATOM   105  N  N     . ASN A 1 52  ? 29.768  0.078   15.167  1.00 37.86  ? 162 ASN A N     1 
ATOM   106  C  CA    . ASN A 1 52  ? 31.142  0.170   14.689  1.00 38.07  ? 162 ASN A CA    1 
ATOM   107  C  C     . ASN A 1 52  ? 31.134  1.067   13.436  1.00 41.37  ? 162 ASN A C     1 
ATOM   108  O  O     . ASN A 1 52  ? 31.111  0.595   12.295  1.00 40.35  ? 162 ASN A O     1 
ATOM   109  C  CB    . ASN A 1 52  ? 31.778  -1.224  14.433  1.00 40.44  ? 162 ASN A CB    1 
ATOM   110  C  CG    . ASN A 1 52  ? 30.992  -2.121  13.540  1.00 67.48  ? 162 ASN A CG    1 
ATOM   111  O  OD1   . ASN A 1 52  ? 29.765  -2.097  13.538  1.00 69.42  ? 162 ASN A OD1   1 
ATOM   112  N  ND2   . ASN A 1 52  ? 31.685  -2.944  12.777  1.00 57.53  ? 162 ASN A ND2   1 
ATOM   113  N  N     . ASN A 1 53  ? 31.095  2.373   13.675  1.00 37.72  ? 163 ASN A N     1 
ATOM   114  C  CA    . ASN A 1 53  ? 31.091  3.376   12.604  1.00 37.15  ? 163 ASN A CA    1 
ATOM   115  C  C     . ASN A 1 53  ? 32.527  3.655   12.155  1.00 38.92  ? 163 ASN A C     1 
ATOM   116  O  O     . ASN A 1 53  ? 33.313  4.201   12.923  1.00 39.39  ? 163 ASN A O     1 
ATOM   117  C  CB    . ASN A 1 53  ? 30.381  4.684   13.060  1.00 29.25  ? 163 ASN A CB    1 
ATOM   118  C  CG    . ASN A 1 53  ? 30.311  5.732   11.976  1.00 33.77  ? 163 ASN A CG    1 
ATOM   119  O  OD1   . ASN A 1 53  ? 30.609  5.493   10.797  1.00 27.88  ? 163 ASN A OD1   1 
ATOM   120  N  ND2   . ASN A 1 53  ? 29.936  6.929   12.342  1.00 28.84  ? 163 ASN A ND2   1 
ATOM   121  N  N     . TYR A 1 54  ? 32.862  3.292   10.912  1.00 34.25  ? 164 TYR A N     1 
ATOM   122  C  CA    . TYR A 1 54  ? 34.210  3.484   10.374  1.00 33.41  ? 164 TYR A CA    1 
ATOM   123  C  C     . TYR A 1 54  ? 34.405  4.864   9.735   1.00 35.08  ? 164 TYR A C     1 
ATOM   124  O  O     . TYR A 1 54  ? 35.502  5.187   9.295   1.00 35.50  ? 164 TYR A O     1 
ATOM   125  C  CB    . TYR A 1 54  ? 34.499  2.410   9.319   1.00 35.05  ? 164 TYR A CB    1 
ATOM   126  C  CG    . TYR A 1 54  ? 34.534  1.012   9.872   1.00 36.68  ? 164 TYR A CG    1 
ATOM   127  C  CD1   . TYR A 1 54  ? 33.466  0.143   9.679   1.00 37.66  ? 164 TYR A CD1   1 
ATOM   128  C  CD2   . TYR A 1 54  ? 35.628  0.557   10.612  1.00 37.89  ? 164 TYR A CD2   1 
ATOM   129  C  CE1   . TYR A 1 54  ? 33.474  -1.144  10.202  1.00 37.84  ? 164 TYR A CE1   1 
ATOM   130  C  CE2   . TYR A 1 54  ? 35.654  -0.744  11.132  1.00 39.38  ? 164 TYR A CE2   1 
ATOM   131  C  CZ    . TYR A 1 54  ? 34.569  -1.589  10.923  1.00 46.90  ? 164 TYR A CZ    1 
ATOM   132  O  OH    . TYR A 1 54  ? 34.552  -2.881  11.386  1.00 50.07  ? 164 TYR A OH    1 
ATOM   133  N  N     . ASN A 1 55  ? 33.335  5.654   9.649   1.00 29.85  ? 165 ASN A N     1 
ATOM   134  C  CA    . ASN A 1 55  ? 33.338  6.948   8.992   1.00 28.06  ? 165 ASN A CA    1 
ATOM   135  C  C     . ASN A 1 55  ? 32.928  8.080   9.898   1.00 31.24  ? 165 ASN A C     1 
ATOM   136  O  O     . ASN A 1 55  ? 32.382  9.065   9.413   1.00 30.99  ? 165 ASN A O     1 
ATOM   137  C  CB    . ASN A 1 55  ? 32.409  6.866   7.805   1.00 30.05  ? 165 ASN A CB    1 
ATOM   138  C  CG    . ASN A 1 55  ? 32.946  5.932   6.769   1.00 38.55  ? 165 ASN A CG    1 
ATOM   139  O  OD1   . ASN A 1 55  ? 33.856  6.285   6.049   1.00 33.26  ? 165 ASN A OD1   1 
ATOM   140  N  ND2   . ASN A 1 55  ? 32.512  4.696   6.768   1.00 34.00  ? 165 ASN A ND2   1 
ATOM   141  N  N     . GLN A 1 56  ? 33.255  7.997   11.202  1.00 30.93  ? 166 GLN A N     1 
ATOM   142  C  CA    . GLN A 1 56  ? 32.897  9.020   12.194  1.00 32.09  ? 166 GLN A CA    1 
ATOM   143  C  C     . GLN A 1 56  ? 33.434  10.400  11.840  1.00 40.22  ? 166 GLN A C     1 
ATOM   144  O  O     . GLN A 1 56  ? 32.764  11.379  12.142  1.00 41.46  ? 166 GLN A O     1 
ATOM   145  C  CB    . GLN A 1 56  ? 33.380  8.620   13.580  1.00 34.18  ? 166 GLN A CB    1 
ATOM   146  C  CG    . GLN A 1 56  ? 32.557  9.202   14.710  1.00 55.73  ? 166 GLN A CG    1 
ATOM   147  C  CD    . GLN A 1 56  ? 32.692  8.349   15.937  1.00 85.11  ? 166 GLN A CD    1 
ATOM   148  O  OE1   . GLN A 1 56  ? 31.771  7.616   16.286  1.00 89.78  ? 166 GLN A OE1   1 
ATOM   149  N  NE2   . GLN A 1 56  ? 33.866  8.332   16.564  1.00 73.40  ? 166 GLN A NE2   1 
ATOM   150  N  N     . LEU A 1 57  ? 34.602  10.497  11.178  1.00 38.63  ? 167 LEU A N     1 
ATOM   151  C  CA    . LEU A 1 57  ? 35.180  11.775  10.731  1.00 39.30  ? 167 LEU A CA    1 
ATOM   152  C  C     . LEU A 1 57  ? 34.213  12.481  9.780   1.00 41.55  ? 167 LEU A C     1 
ATOM   153  O  O     . LEU A 1 57  ? 33.984  13.689  9.919   1.00 42.01  ? 167 LEU A O     1 
ATOM   154  C  CB    . LEU A 1 57  ? 36.538  11.516  10.034  1.00 40.54  ? 167 LEU A CB    1 
ATOM   155  C  CG    . LEU A 1 57  ? 37.682  12.520  10.239  1.00 47.42  ? 167 LEU A CG    1 
ATOM   156  C  CD1   . LEU A 1 57  ? 37.982  12.757  11.726  1.00 49.24  ? 167 LEU A CD1   1 
ATOM   157  C  CD2   . LEU A 1 57  ? 38.928  12.020  9.578   1.00 48.59  ? 167 LEU A CD2   1 
ATOM   158  N  N     . PHE A 1 58  ? 33.603  11.717  8.851   1.00 36.09  ? 168 PHE A N     1 
ATOM   159  C  CA    . PHE A 1 58  ? 32.648  12.265  7.885   1.00 36.04  ? 168 PHE A CA    1 
ATOM   160  C  C     . PHE A 1 58  ? 31.309  12.512  8.516   1.00 42.92  ? 168 PHE A C     1 
ATOM   161  O  O     . PHE A 1 58  ? 30.767  13.607  8.347   1.00 43.76  ? 168 PHE A O     1 
ATOM   162  C  CB    . PHE A 1 58  ? 32.483  11.335  6.672   1.00 36.79  ? 168 PHE A CB    1 
ATOM   163  C  CG    . PHE A 1 58  ? 33.805  11.033  5.995   1.00 37.88  ? 168 PHE A CG    1 
ATOM   164  C  CD1   . PHE A 1 58  ? 34.409  9.793   6.136   1.00 40.14  ? 168 PHE A CD1   1 
ATOM   165  C  CD2   . PHE A 1 58  ? 34.467  12.010  5.262   1.00 38.97  ? 168 PHE A CD2   1 
ATOM   166  C  CE1   . PHE A 1 58  ? 35.637  9.520   5.531   1.00 41.27  ? 168 PHE A CE1   1 
ATOM   167  C  CE2   . PHE A 1 58  ? 35.693  11.737  4.647   1.00 41.80  ? 168 PHE A CE2   1 
ATOM   168  C  CZ    . PHE A 1 58  ? 36.285  10.499  4.804   1.00 39.90  ? 168 PHE A CZ    1 
ATOM   169  N  N     . THR A 1 59  ? 30.750  11.499  9.226   1.00 38.32  ? 169 THR A N     1 
ATOM   170  C  CA    . THR A 1 59  ? 29.408  11.577  9.808   1.00 36.06  ? 169 THR A CA    1 
ATOM   171  C  C     . THR A 1 59  ? 29.315  12.559  10.966  1.00 37.23  ? 169 THR A C     1 
ATOM   172  O  O     . THR A 1 59  ? 28.283  13.182  11.079  1.00 38.04  ? 169 THR A O     1 
ATOM   173  C  CB    . THR A 1 59  ? 28.868  10.181  10.177  1.00 39.65  ? 169 THR A CB    1 
ATOM   174  O  OG1   . THR A 1 59  ? 29.508  9.657   11.337  1.00 37.81  ? 169 THR A OG1   1 
ATOM   175  C  CG2   . THR A 1 59  ? 28.966  9.187   9.007   1.00 30.75  ? 169 THR A CG2   1 
ATOM   176  N  N     . ASP A 1 60  ? 30.344  12.733  11.799  1.00 33.83  ? 170 ASP A N     1 
ATOM   177  C  CA    . ASP A 1 60  ? 30.268  13.762  12.853  1.00 34.09  ? 170 ASP A CA    1 
ATOM   178  C  C     . ASP A 1 60  ? 30.130  15.156  12.235  1.00 38.71  ? 170 ASP A C     1 
ATOM   179  O  O     . ASP A 1 60  ? 29.348  15.959  12.727  1.00 37.94  ? 170 ASP A O     1 
ATOM   180  C  CB    . ASP A 1 60  ? 31.495  13.735  13.776  1.00 35.43  ? 170 ASP A CB    1 
ATOM   181  C  CG    . ASP A 1 60  ? 31.495  12.631  14.798  1.00 44.81  ? 170 ASP A CG    1 
ATOM   182  O  OD1   . ASP A 1 60  ? 30.458  11.927  14.918  1.00 45.00  ? 170 ASP A OD1   1 
ATOM   183  O  OD2   . ASP A 1 60  ? 32.523  12.474  15.496  1.00 55.02  ? 170 ASP A OD2   1 
ATOM   184  N  N     . ALA A 1 61  ? 30.868  15.428  11.136  1.00 35.10  ? 171 ALA A N     1 
ATOM   185  C  CA    . ALA A 1 61  ? 30.799  16.705  10.411  1.00 32.92  ? 171 ALA A CA    1 
ATOM   186  C  C     . ALA A 1 61  ? 29.431  16.884  9.755   1.00 38.02  ? 171 ALA A C     1 
ATOM   187  O  O     . ALA A 1 61  ? 28.833  17.944  9.913   1.00 38.97  ? 171 ALA A O     1 
ATOM   188  C  CB    . ALA A 1 61  ? 31.894  16.772  9.361   1.00 32.84  ? 171 ALA A CB    1 
ATOM   189  N  N     . LEU A 1 62  ? 28.895  15.832  9.094   1.00 34.55  ? 172 LEU A N     1 
ATOM   190  C  CA    . LEU A 1 62  ? 27.576  15.859  8.434   1.00 33.76  ? 172 LEU A CA    1 
ATOM   191  C  C     . LEU A 1 62  ? 26.449  16.013  9.460   1.00 36.24  ? 172 LEU A C     1 
ATOM   192  O  O     . LEU A 1 62  ? 25.498  16.727  9.187   1.00 34.76  ? 172 LEU A O     1 
ATOM   193  C  CB    . LEU A 1 62  ? 27.358  14.600  7.591   1.00 34.06  ? 172 LEU A CB    1 
ATOM   194  C  CG    . LEU A 1 62  ? 28.003  14.498  6.218   1.00 39.29  ? 172 LEU A CG    1 
ATOM   195  C  CD1   . LEU A 1 62  ? 29.302  15.160  6.105   1.00 46.93  ? 172 LEU A CD1   1 
ATOM   196  C  CD2   . LEU A 1 62  ? 28.066  13.053  5.751   1.00 38.44  ? 172 LEU A CD2   1 
ATOM   197  N  N     . ASP A 1 63  ? 26.586  15.398  10.662  1.00 34.34  ? 173 ASP A N     1 
ATOM   198  C  CA    . ASP A 1 63  ? 25.604  15.512  11.747  1.00 34.66  ? 173 ASP A CA    1 
ATOM   199  C  C     . ASP A 1 63  ? 25.549  16.956  12.292  1.00 39.46  ? 173 ASP A C     1 
ATOM   200  O  O     . ASP A 1 63  ? 24.467  17.417  12.652  1.00 40.55  ? 173 ASP A O     1 
ATOM   201  C  CB    . ASP A 1 63  ? 25.902  14.517  12.897  1.00 36.62  ? 173 ASP A CB    1 
ATOM   202  C  CG    . ASP A 1 63  ? 25.633  13.048  12.587  1.00 47.96  ? 173 ASP A CG    1 
ATOM   203  O  OD1   . ASP A 1 63  ? 24.992  12.764  11.547  1.00 52.88  ? 173 ASP A OD1   1 
ATOM   204  O  OD2   . ASP A 1 63  ? 26.077  12.183  13.375  1.00 48.10  ? 173 ASP A OD2   1 
ATOM   205  N  N     . ILE A 1 64  ? 26.693  17.652  12.348  1.00 34.64  ? 174 ILE A N     1 
ATOM   206  C  CA    . ILE A 1 64  ? 26.804  19.045  12.810  1.00 34.35  ? 174 ILE A CA    1 
ATOM   207  C  C     . ILE A 1 64  ? 26.134  19.957  11.769  1.00 40.22  ? 174 ILE A C     1 
ATOM   208  O  O     . ILE A 1 64  ? 25.374  20.842  12.132  1.00 41.13  ? 174 ILE A O     1 
ATOM   209  C  CB    . ILE A 1 64  ? 28.309  19.414  13.065  1.00 36.46  ? 174 ILE A CB    1 
ATOM   210  C  CG1   . ILE A 1 64  ? 28.849  18.731  14.337  1.00 36.31  ? 174 ILE A CG1   1 
ATOM   211  C  CG2   . ILE A 1 64  ? 28.551  20.935  13.138  1.00 35.33  ? 174 ILE A CG2   1 
ATOM   212  C  CD1   . ILE A 1 64  ? 30.379  18.726  14.431  1.00 35.14  ? 174 ILE A CD1   1 
ATOM   213  N  N     . LEU A 1 65  ? 26.411  19.728  10.489  1.00 38.95  ? 175 LEU A N     1 
ATOM   214  C  CA    . LEU A 1 65  ? 25.845  20.500  9.387   1.00 38.60  ? 175 LEU A CA    1 
ATOM   215  C  C     . LEU A 1 65  ? 24.342  20.296  9.309   1.00 43.94  ? 175 LEU A C     1 
ATOM   216  O  O     . LEU A 1 65  ? 23.629  21.268  9.112   1.00 43.47  ? 175 LEU A O     1 
ATOM   217  C  CB    . LEU A 1 65  ? 26.529  20.176  8.040   1.00 37.82  ? 175 LEU A CB    1 
ATOM   218  C  CG    . LEU A 1 65  ? 28.032  20.550  7.964   1.00 40.38  ? 175 LEU A CG    1 
ATOM   219  C  CD1   . LEU A 1 65  ? 28.672  19.904  6.805   1.00 39.88  ? 175 LEU A CD1   1 
ATOM   220  C  CD2   . LEU A 1 65  ? 28.253  22.051  7.898   1.00 42.47  ? 175 LEU A CD2   1 
ATOM   221  N  N     . ALA A 1 66  ? 23.857  19.069  9.534   1.00 43.31  ? 176 ALA A N     1 
ATOM   222  C  CA    . ALA A 1 66  ? 22.426  18.767  9.560   1.00 43.33  ? 176 ALA A CA    1 
ATOM   223  C  C     . ALA A 1 66  ? 21.741  19.480  10.731  1.00 48.36  ? 176 ALA A C     1 
ATOM   224  O  O     . ALA A 1 66  ? 20.683  20.063  10.544  1.00 49.31  ? 176 ALA A O     1 
ATOM   225  C  CB    . ALA A 1 66  ? 22.213  17.269  9.673   1.00 44.05  ? 176 ALA A CB    1 
ATOM   226  N  N     . GLU A 1 67  ? 22.364  19.464  11.921  1.00 45.12  ? 177 GLU A N     1 
ATOM   227  C  CA    . GLU A 1 67  ? 21.852  20.089  13.138  1.00 45.54  ? 177 GLU A CA    1 
ATOM   228  C  C     . GLU A 1 67  ? 21.769  21.606  12.977  1.00 50.45  ? 177 GLU A C     1 
ATOM   229  O  O     . GLU A 1 67  ? 20.791  22.211  13.405  1.00 50.33  ? 177 GLU A O     1 
ATOM   230  C  CB    . GLU A 1 67  ? 22.745  19.708  14.318  1.00 47.24  ? 177 GLU A CB    1 
ATOM   231  C  CG    . GLU A 1 67  ? 22.183  20.091  15.666  1.00 61.98  ? 177 GLU A CG    1 
ATOM   232  C  CD    . GLU A 1 67  ? 22.771  19.309  16.825  1.00 81.45  ? 177 GLU A CD    1 
ATOM   233  O  OE1   . GLU A 1 67  ? 21.974  18.825  17.661  1.00 84.09  ? 177 GLU A OE1   1 
ATOM   234  O  OE2   . GLU A 1 67  ? 24.019  19.203  16.919  1.00 55.02  ? 177 GLU A OE2   1 
ATOM   235  N  N     . ASN A 1 68  ? 22.767  22.210  12.317  1.00 47.31  ? 178 ASN A N     1 
ATOM   236  C  CA    . ASN A 1 68  ? 22.770  23.636  12.036  1.00 47.64  ? 178 ASN A CA    1 
ATOM   237  C  C     . ASN A 1 68  ? 21.637  23.986  11.074  1.00 52.28  ? 178 ASN A C     1 
ATOM   238  O  O     . ASN A 1 68  ? 20.964  24.984  11.291  1.00 53.50  ? 178 ASN A O     1 
ATOM   239  C  CB    . ASN A 1 68  ? 24.113  24.057  11.457  1.00 46.75  ? 178 ASN A CB    1 
ATOM   240  C  CG    . ASN A 1 68  ? 24.231  25.533  11.233  1.00 53.53  ? 178 ASN A CG    1 
ATOM   241  O  OD1   . ASN A 1 68  ? 24.217  26.341  12.165  1.00 53.28  ? 178 ASN A OD1   1 
ATOM   242  N  ND2   . ASN A 1 68  ? 24.361  25.902  9.979   1.00 42.46  ? 178 ASN A ND2   1 
ATOM   243  N  N     . ASP A 1 69  ? 21.410  23.166  10.032  1.00 48.07  ? 179 ASP A N     1 
ATOM   244  C  CA    . ASP A 1 69  ? 20.323  23.398  9.086   1.00 48.41  ? 179 ASP A CA    1 
ATOM   245  C  C     . ASP A 1 69  ? 18.958  23.291  9.765   1.00 54.02  ? 179 ASP A C     1 
ATOM   246  O  O     . ASP A 1 69  ? 18.038  23.961  9.336   1.00 52.07  ? 179 ASP A O     1 
ATOM   247  C  CB    . ASP A 1 69  ? 20.391  22.428  7.916   1.00 49.62  ? 179 ASP A CB    1 
ATOM   248  C  CG    . ASP A 1 69  ? 21.478  22.731  6.926   1.00 63.81  ? 179 ASP A CG    1 
ATOM   249  O  OD1   . ASP A 1 69  ? 21.920  23.900  6.863   1.00 65.47  ? 179 ASP A OD1   1 
ATOM   250  O  OD2   . ASP A 1 69  ? 21.881  21.810  6.205   1.00 72.81  ? 179 ASP A OD2   1 
ATOM   251  N  N     . GLU A 1 70  ? 18.842  22.468  10.830  1.00 53.41  ? 180 GLU A N     1 
ATOM   252  C  CA    . GLU A 1 70  ? 17.621  22.327  11.628  1.00 54.88  ? 180 GLU A CA    1 
ATOM   253  C  C     . GLU A 1 70  ? 17.383  23.633  12.369  1.00 59.74  ? 180 GLU A C     1 
ATOM   254  O  O     . GLU A 1 70  ? 16.284  24.188  12.301  1.00 61.16  ? 180 GLU A O     1 
ATOM   255  C  CB    . GLU A 1 70  ? 17.746  21.139  12.607  1.00 56.63  ? 180 GLU A CB    1 
ATOM   256  C  CG    . GLU A 1 70  ? 16.448  20.677  13.236  1.00 70.24  ? 180 GLU A CG    1 
ATOM   257  C  CD    . GLU A 1 70  ? 16.663  19.785  14.443  1.00 108.03 ? 180 GLU A CD    1 
ATOM   258  O  OE1   . GLU A 1 70  ? 16.686  18.544  14.270  1.00 113.01 ? 180 GLU A OE1   1 
ATOM   259  O  OE2   . GLU A 1 70  ? 16.864  20.329  15.553  1.00 107.34 ? 180 GLU A OE2   1 
ATOM   260  N  N     . LEU A 1 71  ? 18.443  24.158  13.007  1.00 55.66  ? 181 LEU A N     1 
ATOM   261  C  CA    . LEU A 1 71  ? 18.439  25.409  13.748  1.00 55.58  ? 181 LEU A CA    1 
ATOM   262  C  C     . LEU A 1 71  ? 18.131  26.595  12.836  1.00 61.14  ? 181 LEU A C     1 
ATOM   263  O  O     . LEU A 1 71  ? 17.381  27.471  13.250  1.00 61.24  ? 181 LEU A O     1 
ATOM   264  C  CB    . LEU A 1 71  ? 19.785  25.607  14.439  1.00 55.60  ? 181 LEU A CB    1 
ATOM   265  N  N     . ARG A 1 72  ? 18.671  26.605  11.588  1.00 58.41  ? 182 ARG A N     1 
ATOM   266  C  CA    . ARG A 1 72  ? 18.470  27.684  10.602  1.00 57.94  ? 182 ARG A CA    1 
ATOM   267  C  C     . ARG A 1 72  ? 17.164  27.500  9.811   1.00 63.62  ? 182 ARG A C     1 
ATOM   268  O  O     . ARG A 1 72  ? 16.923  28.234  8.848   1.00 63.74  ? 182 ARG A O     1 
ATOM   269  C  CB    . ARG A 1 72  ? 19.670  27.779  9.644   1.00 55.25  ? 182 ARG A CB    1 
ATOM   270  C  CG    . ARG A 1 72  ? 20.988  28.122  10.334  1.00 56.33  ? 182 ARG A CG    1 
ATOM   271  C  CD    . ARG A 1 72  ? 21.406  29.553  10.106  1.00 70.06  ? 182 ARG A CD    1 
ATOM   272  N  N     . GLU A 1 73  ? 16.326  26.517  10.227  1.00 61.65  ? 183 GLU A N     1 
ATOM   273  C  CA    . GLU A 1 73  ? 15.026  26.167  9.647   1.00 62.22  ? 183 GLU A CA    1 
ATOM   274  C  C     . GLU A 1 73  ? 15.130  25.788  8.160   1.00 64.94  ? 183 GLU A C     1 
ATOM   275  O  O     . GLU A 1 73  ? 14.168  25.958  7.404   1.00 65.90  ? 183 GLU A O     1 
ATOM   276  C  CB    . GLU A 1 73  ? 13.997  27.299  9.833   1.00 63.94  ? 183 GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 73  ? 13.566  27.519  11.266  1.00 79.01  ? 183 GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 73  ? 12.524  28.612  11.403  1.00 106.23 ? 183 GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 73  ? 12.876  29.804  11.237  1.00 97.00  ? 183 GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 73  ? 11.347  28.271  11.660  1.00 104.07 ? 183 GLU A OE2   1 
ATOM   281  N  N     . ASN A 1 74  ? 16.279  25.265  7.750   1.00 59.37  ? 184 ASN A N     1 
ATOM   282  C  CA    . ASN A 1 74  ? 16.486  24.777  6.401   1.00 58.79  ? 184 ASN A CA    1 
ATOM   283  C  C     . ASN A 1 74  ? 16.271  23.248  6.407   1.00 62.98  ? 184 ASN A C     1 
ATOM   284  O  O     . ASN A 1 74  ? 17.233  22.475  6.451   1.00 62.53  ? 184 ASN A O     1 
ATOM   285  C  CB    . ASN A 1 74  ? 17.864  25.173  5.878   1.00 58.22  ? 184 ASN A CB    1 
ATOM   286  C  CG    . ASN A 1 74  ? 18.011  24.931  4.392   1.00 87.44  ? 184 ASN A CG    1 
ATOM   287  O  OD1   . ASN A 1 74  ? 17.357  24.054  3.793   1.00 70.40  ? 184 ASN A OD1   1 
ATOM   288  N  ND2   . ASN A 1 74  ? 18.879  25.709  3.764   1.00 87.91  ? 184 ASN A ND2   1 
ATOM   289  N  N     . GLU A 1 75  ? 14.992  22.835  6.390   1.00 59.97  ? 185 GLU A N     1 
ATOM   290  C  CA    . GLU A 1 75  ? 14.546  21.443  6.450   1.00 60.19  ? 185 GLU A CA    1 
ATOM   291  C  C     . GLU A 1 75  ? 15.119  20.565  5.309   1.00 62.89  ? 185 GLU A C     1 
ATOM   292  O  O     . GLU A 1 75  ? 15.487  19.426  5.562   1.00 63.09  ? 185 GLU A O     1 
ATOM   293  C  CB    . GLU A 1 75  ? 13.013  21.373  6.457   1.00 61.83  ? 185 GLU A CB    1 
ATOM   294  N  N     . GLY A 1 76  ? 15.194  21.104  4.095   1.00 58.24  ? 186 GLY A N     1 
ATOM   295  C  CA    . GLY A 1 76  ? 15.678  20.394  2.916   1.00 57.15  ? 186 GLY A CA    1 
ATOM   296  C  C     . GLY A 1 76  ? 17.137  20.011  3.003   1.00 61.33  ? 186 GLY A C     1 
ATOM   297  O  O     . GLY A 1 76  ? 17.489  18.848  2.787   1.00 61.63  ? 186 GLY A O     1 
ATOM   298  N  N     . SER A 1 77  ? 17.996  20.994  3.336   1.00 56.08  ? 187 SER A N     1 
ATOM   299  C  CA    . SER A 1 77  ? 19.435  20.802  3.480   1.00 53.51  ? 187 SER A CA    1 
ATOM   300  C  C     . SER A 1 77  ? 19.707  19.896  4.671   1.00 53.67  ? 187 SER A C     1 
ATOM   301  O  O     . SER A 1 77  ? 20.601  19.049  4.588   1.00 50.65  ? 187 SER A O     1 
ATOM   302  C  CB    . SER A 1 77  ? 20.140  22.138  3.635   1.00 55.70  ? 187 SER A CB    1 
ATOM   303  O  OG    . SER A 1 77  ? 21.534  21.990  3.445   1.00 66.15  ? 187 SER A OG    1 
ATOM   304  N  N     . CYS A 1 78  ? 18.868  20.013  5.736   1.00 49.02  ? 188 CYS A N     1 
ATOM   305  C  CA    . CYS A 1 78  ? 18.947  19.164  6.921   1.00 49.34  ? 188 CYS A CA    1 
ATOM   306  C  C     . CYS A 1 78  ? 18.747  17.693  6.538   1.00 53.83  ? 188 CYS A C     1 
ATOM   307  O  O     . CYS A 1 78  ? 19.582  16.857  6.881   1.00 53.26  ? 188 CYS A O     1 
ATOM   308  C  CB    . CYS A 1 78  ? 17.934  19.596  7.969   1.00 49.84  ? 188 CYS A CB    1 
ATOM   309  S  SG    . CYS A 1 78  ? 17.995  18.621  9.484   1.00 54.31  ? 188 CYS A SG    1 
ATOM   310  N  N     . LEU A 1 79  ? 17.662  17.398  5.805   1.00 51.30  ? 189 LEU A N     1 
ATOM   311  C  CA    . LEU A 1 79  ? 17.312  16.052  5.355   1.00 51.60  ? 189 LEU A CA    1 
ATOM   312  C  C     . LEU A 1 79  ? 18.423  15.446  4.476   1.00 51.72  ? 189 LEU A C     1 
ATOM   313  O  O     . LEU A 1 79  ? 18.752  14.277  4.662   1.00 49.74  ? 189 LEU A O     1 
ATOM   314  C  CB    . LEU A 1 79  ? 15.970  16.045  4.591   1.00 52.15  ? 189 LEU A CB    1 
ATOM   315  C  CG    . LEU A 1 79  ? 14.701  16.383  5.388   1.00 59.08  ? 189 LEU A CG    1 
ATOM   316  C  CD1   . LEU A 1 79  ? 13.546  16.751  4.457   1.00 60.15  ? 189 LEU A CD1   1 
ATOM   317  C  CD2   . LEU A 1 79  ? 14.282  15.265  6.304   1.00 62.51  ? 189 LEU A CD2   1 
ATOM   318  N  N     . ALA A 1 80  ? 18.991  16.238  3.532   1.00 46.43  ? 190 ALA A N     1 
ATOM   319  C  CA    . ALA A 1 80  ? 20.059  15.770  2.648   1.00 44.88  ? 190 ALA A CA    1 
ATOM   320  C  C     . ALA A 1 80  ? 21.304  15.361  3.450   1.00 44.71  ? 190 ALA A C     1 
ATOM   321  O  O     . ALA A 1 80  ? 21.886  14.316  3.167   1.00 44.09  ? 190 ALA A O     1 
ATOM   322  C  CB    . ALA A 1 80  ? 20.416  16.836  1.616   1.00 45.34  ? 190 ALA A CB    1 
ATOM   323  N  N     . PHE A 1 81  ? 21.694  16.158  4.457   1.00 39.82  ? 191 PHE A N     1 
ATOM   324  C  CA    . PHE A 1 81  ? 22.851  15.828  5.271   1.00 39.84  ? 191 PHE A CA    1 
ATOM   325  C  C     . PHE A 1 81  ? 22.540  14.608  6.163   1.00 42.45  ? 191 PHE A C     1 
ATOM   326  O  O     . PHE A 1 81  ? 23.429  13.789  6.365   1.00 40.42  ? 191 PHE A O     1 
ATOM   327  C  CB    . PHE A 1 81  ? 23.340  17.023  6.111   1.00 42.02  ? 191 PHE A CB    1 
ATOM   328  C  CG    . PHE A 1 81  ? 24.050  18.141  5.373   1.00 45.45  ? 191 PHE A CG    1 
ATOM   329  C  CD1   . PHE A 1 81  ? 25.128  17.876  4.536   1.00 49.18  ? 191 PHE A CD1   1 
ATOM   330  C  CD2   . PHE A 1 81  ? 23.708  19.469  5.594   1.00 48.55  ? 191 PHE A CD2   1 
ATOM   331  C  CE1   . PHE A 1 81  ? 25.802  18.917  3.882   1.00 49.48  ? 191 PHE A CE1   1 
ATOM   332  C  CE2   . PHE A 1 81  ? 24.380  20.501  4.934   1.00 51.09  ? 191 PHE A CE2   1 
ATOM   333  C  CZ    . PHE A 1 81  ? 25.420  20.218  4.087   1.00 48.92  ? 191 PHE A CZ    1 
ATOM   334  N  N     . MET A 1 82  ? 21.298  14.476  6.674   1.00 41.28  ? 192 MET A N     1 
ATOM   335  C  CA    . MET A 1 82  ? 20.929  13.332  7.541   1.00 42.05  ? 192 MET A CA    1 
ATOM   336  C  C     . MET A 1 82  ? 20.971  12.001  6.786   1.00 39.78  ? 192 MET A C     1 
ATOM   337  O  O     . MET A 1 82  ? 21.433  11.029  7.337   1.00 36.85  ? 192 MET A O     1 
ATOM   338  C  CB    . MET A 1 82  ? 19.550  13.517  8.195   1.00 44.93  ? 192 MET A CB    1 
ATOM   339  C  CG    . MET A 1 82  ? 19.592  14.439  9.407   1.00 49.87  ? 192 MET A CG    1 
ATOM   340  S  SD    . MET A 1 82  ? 18.038  14.561  10.342  1.00 55.33  ? 192 MET A SD    1 
ATOM   341  C  CE    . MET A 1 82  ? 16.896  14.913  9.000   1.00 52.24  ? 192 MET A CE    1 
ATOM   342  N  N     . ARG A 1 83  ? 20.527  11.981  5.521   1.00 35.48  ? 193 ARG A N     1 
ATOM   343  C  CA    . ARG A 1 83  ? 20.490  10.779  4.682   1.00 34.57  ? 193 ARG A CA    1 
ATOM   344  C  C     . ARG A 1 83  ? 21.900  10.367  4.273   1.00 36.04  ? 193 ARG A C     1 
ATOM   345  O  O     . ARG A 1 83  ? 22.213  9.188   4.289   1.00 36.15  ? 193 ARG A O     1 
ATOM   346  C  CB    . ARG A 1 83  ? 19.580  10.997  3.453   1.00 37.35  ? 193 ARG A CB    1 
ATOM   347  C  CG    . ARG A 1 83  ? 18.087  11.084  3.820   1.00 51.51  ? 193 ARG A CG    1 
ATOM   348  C  CD    . ARG A 1 83  ? 17.162  11.270  2.627   1.00 71.92  ? 193 ARG A CD    1 
ATOM   349  N  NE    . ARG A 1 83  ? 15.746  11.189  3.019   1.00 84.77  ? 193 ARG A NE    1 
ATOM   350  C  CZ    . ARG A 1 83  ? 14.718  11.478  2.225   1.00 96.64  ? 193 ARG A CZ    1 
ATOM   351  N  NH1   . ARG A 1 83  ? 13.474  11.359  2.670   1.00 88.42  ? 193 ARG A NH1   1 
ATOM   352  N  NH2   . ARG A 1 83  ? 14.926  11.892  0.981   1.00 75.52  ? 193 ARG A NH2   1 
ATOM   353  N  N     . ALA A 1 84  ? 22.765  11.334  3.974   1.00 33.61  ? 194 ALA A N     1 
ATOM   354  C  CA    . ALA A 1 84  ? 24.174  11.102  3.624   1.00 32.16  ? 194 ALA A CA    1 
ATOM   355  C  C     . ALA A 1 84  ? 24.921  10.539  4.827   1.00 34.97  ? 194 ALA A C     1 
ATOM   356  O  O     . ALA A 1 84  ? 25.639  9.565   4.700   1.00 32.38  ? 194 ALA A O     1 
ATOM   357  C  CB    . ALA A 1 84  ? 24.811  12.402  3.190   1.00 31.95  ? 194 ALA A CB    1 
ATOM   358  N  N     . SER A 1 85  ? 24.744  11.157  6.007   1.00 31.90  ? 195 SER A N     1 
ATOM   359  C  CA    . SER A 1 85  ? 25.395  10.711  7.241   1.00 30.44  ? 195 SER A CA    1 
ATOM   360  C  C     . SER A 1 85  ? 24.986  9.279   7.545   1.00 34.27  ? 195 SER A C     1 
ATOM   361  O  O     . SER A 1 85  ? 25.842  8.447   7.841   1.00 34.29  ? 195 SER A O     1 
ATOM   362  C  CB    . SER A 1 85  ? 25.015  11.647  8.393   1.00 30.16  ? 195 SER A CB    1 
ATOM   363  O  OG    . SER A 1 85  ? 25.656  11.241  9.581   1.00 44.99  ? 195 SER A OG    1 
ATOM   364  N  N     . SER A 1 86  ? 23.651  8.999   7.457   1.00 32.30  ? 196 SER A N     1 
ATOM   365  C  CA    . SER A 1 86  ? 23.037  7.700   7.702   1.00 31.17  ? 196 SER A CA    1 
ATOM   366  C  C     . SER A 1 86  ? 23.642  6.612   6.817   1.00 31.99  ? 196 SER A C     1 
ATOM   367  O  O     . SER A 1 86  ? 24.035  5.577   7.340   1.00 30.75  ? 196 SER A O     1 
ATOM   368  C  CB    . SER A 1 86  ? 21.526  7.781   7.472   1.00 34.39  ? 196 SER A CB    1 
ATOM   369  O  OG    . SER A 1 86  ? 20.886  6.609   7.934   1.00 44.55  ? 196 SER A OG    1 
ATOM   370  N  N     . VAL A 1 87  ? 23.721  6.840   5.487   1.00 29.46  ? 197 VAL A N     1 
ATOM   371  C  CA    . VAL A 1 87  ? 24.257  5.821   4.575   1.00 30.47  ? 197 VAL A CA    1 
ATOM   372  C  C     . VAL A 1 87  ? 25.769  5.535   4.885   1.00 37.58  ? 197 VAL A C     1 
ATOM   373  O  O     . VAL A 1 87  ? 26.163  4.361   4.886   1.00 40.37  ? 197 VAL A O     1 
ATOM   374  C  CB    . VAL A 1 87  ? 23.992  6.109   3.070   1.00 34.22  ? 197 VAL A CB    1 
ATOM   375  C  CG1   . VAL A 1 87  ? 24.742  7.332   2.567   1.00 33.72  ? 197 VAL A CG1   1 
ATOM   376  C  CG2   . VAL A 1 87  ? 24.320  4.884   2.213   1.00 34.28  ? 197 VAL A CG2   1 
ATOM   377  N  N     . LEU A 1 88  ? 26.571  6.559   5.220   1.00 31.13  ? 198 LEU A N     1 
ATOM   378  C  CA    . LEU A 1 88  ? 27.991  6.325   5.533   1.00 30.66  ? 198 LEU A CA    1 
ATOM   379  C  C     . LEU A 1 88  ? 28.133  5.534   6.826   1.00 35.14  ? 198 LEU A C     1 
ATOM   380  O  O     . LEU A 1 88  ? 29.027  4.704   6.922   1.00 35.19  ? 198 LEU A O     1 
ATOM   381  C  CB    . LEU A 1 88  ? 28.763  7.656   5.634   1.00 30.52  ? 198 LEU A CB    1 
ATOM   382  C  CG    . LEU A 1 88  ? 28.747  8.569   4.401   1.00 35.06  ? 198 LEU A CG    1 
ATOM   383  C  CD1   . LEU A 1 88  ? 29.600  9.798   4.652   1.00 34.66  ? 198 LEU A CD1   1 
ATOM   384  C  CD2   . LEU A 1 88  ? 29.229  7.820   3.126   1.00 36.23  ? 198 LEU A CD2   1 
ATOM   385  N  N     . LYS A 1 89  ? 27.214  5.738   7.802   1.00 32.62  ? 199 LYS A N     1 
ATOM   386  C  CA    . LYS A 1 89  ? 27.228  4.974   9.071   1.00 31.19  ? 199 LYS A CA    1 
ATOM   387  C  C     . LYS A 1 89  ? 27.075  3.475   8.810   1.00 33.87  ? 199 LYS A C     1 
ATOM   388  O  O     . LYS A 1 89  ? 27.557  2.681   9.614   1.00 30.45  ? 199 LYS A O     1 
ATOM   389  C  CB    . LYS A 1 89  ? 26.114  5.461   10.037  1.00 32.33  ? 199 LYS A CB    1 
ATOM   390  C  CG    . LYS A 1 89  ? 26.420  6.796   10.661  1.00 24.44  ? 199 LYS A CG    1 
ATOM   391  C  CD    . LYS A 1 89  ? 25.320  7.335   11.567  1.00 35.13  ? 199 LYS A CD    1 
ATOM   392  C  CE    . LYS A 1 89  ? 25.767  8.701   12.070  1.00 50.43  ? 199 LYS A CE    1 
ATOM   393  N  NZ    . LYS A 1 89  ? 24.679  9.491   12.682  1.00 59.82  ? 199 LYS A NZ    1 
ATOM   394  N  N     . SER A 1 90  ? 26.395  3.086   7.679   1.00 32.12  ? 200 SER A N     1 
ATOM   395  C  CA    . SER A 1 90  ? 26.145  1.680   7.344   1.00 32.87  ? 200 SER A CA    1 
ATOM   396  C  C     . SER A 1 90  ? 27.350  0.973   6.694   1.00 37.98  ? 200 SER A C     1 
ATOM   397  O  O     . SER A 1 90  ? 27.330  -0.253  6.562   1.00 37.48  ? 200 SER A O     1 
ATOM   398  C  CB    . SER A 1 90  ? 24.944  1.558   6.407   1.00 35.25  ? 200 SER A CB    1 
ATOM   399  O  OG    . SER A 1 90  ? 25.313  1.839   5.064   1.00 30.89  ? 200 SER A OG    1 
ATOM   400  N  N     . LEU A 1 91  ? 28.342  1.727   6.219   1.00 35.00  ? 201 LEU A N     1 
ATOM   401  C  CA    . LEU A 1 91  ? 29.512  1.147   5.533   1.00 34.43  ? 201 LEU A CA    1 
ATOM   402  C  C     . LEU A 1 91  ? 30.363  0.271   6.420   1.00 36.76  ? 201 LEU A C     1 
ATOM   403  O  O     . LEU A 1 91  ? 30.614  0.624   7.577   1.00 36.32  ? 201 LEU A O     1 
ATOM   404  C  CB    . LEU A 1 91  ? 30.398  2.220   4.914   1.00 34.42  ? 201 LEU A CB    1 
ATOM   405  C  CG    . LEU A 1 91  ? 29.765  3.038   3.782   1.00 36.72  ? 201 LEU A CG    1 
ATOM   406  C  CD1   . LEU A 1 91  ? 30.757  4.056   3.271   1.00 35.16  ? 201 LEU A CD1   1 
ATOM   407  C  CD2   . LEU A 1 91  ? 29.297  2.138   2.643   1.00 38.81  ? 201 LEU A CD2   1 
ATOM   408  N  N     . PRO A 1 92  ? 30.827  -0.882  5.870   1.00 33.89  ? 202 PRO A N     1 
ATOM   409  C  CA    . PRO A 1 92  ? 31.670  -1.795  6.667   1.00 32.72  ? 202 PRO A CA    1 
ATOM   410  C  C     . PRO A 1 92  ? 33.168  -1.441  6.592   1.00 39.52  ? 202 PRO A C     1 
ATOM   411  O  O     . PRO A 1 92  ? 34.021  -2.203  7.066   1.00 41.67  ? 202 PRO A O     1 
ATOM   412  C  CB    . PRO A 1 92  ? 31.387  -3.155  6.015   1.00 33.08  ? 202 PRO A CB    1 
ATOM   413  C  CG    . PRO A 1 92  ? 31.124  -2.837  4.569   1.00 36.28  ? 202 PRO A CG    1 
ATOM   414  C  CD    . PRO A 1 92  ? 30.591  -1.422  4.500   1.00 33.31  ? 202 PRO A CD    1 
ATOM   415  N  N     . PHE A 1 93  ? 33.492  -0.306  5.966   1.00 34.49  ? 203 PHE A N     1 
ATOM   416  C  CA    . PHE A 1 93  ? 34.866  0.145   5.775   1.00 33.57  ? 203 PHE A CA    1 
ATOM   417  C  C     . PHE A 1 93  ? 34.945  1.678   5.797   1.00 36.62  ? 203 PHE A C     1 
ATOM   418  O  O     . PHE A 1 93  ? 33.945  2.327   5.479   1.00 33.81  ? 203 PHE A O     1 
ATOM   419  C  CB    . PHE A 1 93  ? 35.408  -0.396  4.429   1.00 34.50  ? 203 PHE A CB    1 
ATOM   420  C  CG    . PHE A 1 93  ? 34.785  0.252   3.218   1.00 34.32  ? 203 PHE A CG    1 
ATOM   421  C  CD1   . PHE A 1 93  ? 33.622  -0.264  2.653   1.00 34.20  ? 203 PHE A CD1   1 
ATOM   422  C  CD2   . PHE A 1 93  ? 35.363  1.374   2.637   1.00 35.98  ? 203 PHE A CD2   1 
ATOM   423  C  CE1   . PHE A 1 93  ? 33.029  0.356   1.544   1.00 35.20  ? 203 PHE A CE1   1 
ATOM   424  C  CE2   . PHE A 1 93  ? 34.760  2.006   1.547   1.00 38.98  ? 203 PHE A CE2   1 
ATOM   425  C  CZ    . PHE A 1 93  ? 33.599  1.487   1.000   1.00 36.10  ? 203 PHE A CZ    1 
ATOM   426  N  N     . PRO A 1 94  ? 36.138  2.283   6.097   1.00 34.47  ? 204 PRO A N     1 
ATOM   427  C  CA    . PRO A 1 94  ? 36.231  3.762   6.067   1.00 34.91  ? 204 PRO A CA    1 
ATOM   428  C  C     . PRO A 1 94  ? 36.447  4.294   4.658   1.00 40.74  ? 204 PRO A C     1 
ATOM   429  O  O     . PRO A 1 94  ? 37.220  3.692   3.899   1.00 40.50  ? 204 PRO A O     1 
ATOM   430  C  CB    . PRO A 1 94  ? 37.457  4.059   6.930   1.00 36.81  ? 204 PRO A CB    1 
ATOM   431  C  CG    . PRO A 1 94  ? 38.320  2.819   6.844   1.00 39.27  ? 204 PRO A CG    1 
ATOM   432  C  CD    . PRO A 1 94  ? 37.407  1.658   6.541   1.00 34.54  ? 204 PRO A CD    1 
ATOM   433  N  N     . ILE A 1 95  ? 35.806  5.432   4.305   1.00 39.24  ? 205 ILE A N     1 
ATOM   434  C  CA    . ILE A 1 95  ? 36.060  6.112   3.017   1.00 39.79  ? 205 ILE A CA    1 
ATOM   435  C  C     . ILE A 1 95  ? 37.486  6.673   3.116   1.00 43.18  ? 205 ILE A C     1 
ATOM   436  O  O     . ILE A 1 95  ? 37.795  7.368   4.102   1.00 42.01  ? 205 ILE A O     1 
ATOM   437  C  CB    . ILE A 1 95  ? 35.022  7.231   2.673   1.00 43.11  ? 205 ILE A CB    1 
ATOM   438  C  CG1   . ILE A 1 95  ? 33.572  6.697   2.494   1.00 45.27  ? 205 ILE A CG1   1 
ATOM   439  C  CG2   . ILE A 1 95  ? 35.467  8.127   1.496   1.00 42.02  ? 205 ILE A CG2   1 
ATOM   440  C  CD1   . ILE A 1 95  ? 33.297  5.796   1.303   1.00 62.48  ? 205 ILE A CD1   1 
ATOM   441  N  N     . THR A 1 96  ? 38.359  6.359   2.141   1.00 39.73  ? 206 THR A N     1 
ATOM   442  C  CA    . THR A 1 96  ? 39.736  6.891   2.180   1.00 39.16  ? 206 THR A CA    1 
ATOM   443  C  C     . THR A 1 96  ? 40.056  7.615   0.881   1.00 43.82  ? 206 THR A C     1 
ATOM   444  O  O     . THR A 1 96  ? 41.097  8.246   0.786   1.00 45.42  ? 206 THR A O     1 
ATOM   445  C  CB    . THR A 1 96  ? 40.788  5.823   2.542   1.00 38.42  ? 206 THR A CB    1 
ATOM   446  O  OG1   . THR A 1 96  ? 40.753  4.757   1.585   1.00 40.01  ? 206 THR A OG1   1 
ATOM   447  C  CG2   . THR A 1 96  ? 40.622  5.289   3.975   1.00 30.72  ? 206 THR A CG2   1 
ATOM   448  N  N     . SER A 1 97  ? 39.147  7.588   -0.093  1.00 39.63  ? 207 SER A N     1 
ATOM   449  C  CA    . SER A 1 97  ? 39.306  8.326   -1.356  1.00 38.49  ? 207 SER A CA    1 
ATOM   450  C  C     . SER A 1 97  ? 37.928  8.592   -1.947  1.00 40.26  ? 207 SER A C     1 
ATOM   451  O  O     . SER A 1 97  ? 36.967  7.926   -1.571  1.00 39.84  ? 207 SER A O     1 
ATOM   452  C  CB    . SER A 1 97  ? 40.201  7.574   -2.342  1.00 40.12  ? 207 SER A CB    1 
ATOM   453  O  OG    . SER A 1 97  ? 39.546  6.425   -2.846  1.00 50.73  ? 207 SER A OG    1 
ATOM   454  N  N     . MET A 1 98  ? 37.825  9.521   -2.894  1.00 38.92  ? 208 MET A N     1 
ATOM   455  C  CA    . MET A 1 98  ? 36.539  9.851   -3.509  1.00 40.72  ? 208 MET A CA    1 
ATOM   456  C  C     . MET A 1 98  ? 35.991  8.687   -4.316  1.00 47.44  ? 208 MET A C     1 
ATOM   457  O  O     . MET A 1 98  ? 34.769  8.528   -4.380  1.00 48.50  ? 208 MET A O     1 
ATOM   458  C  CB    . MET A 1 98  ? 36.623  11.132  -4.351  1.00 43.75  ? 208 MET A CB    1 
ATOM   459  C  CG    . MET A 1 98  ? 36.604  12.399  -3.498  1.00 48.54  ? 208 MET A CG    1 
ATOM   460  S  SD    . MET A 1 98  ? 35.262  12.540  -2.255  1.00 54.70  ? 208 MET A SD    1 
ATOM   461  C  CE    . MET A 1 98  ? 33.807  12.485  -3.318  1.00 51.47  ? 208 MET A CE    1 
ATOM   462  N  N     . LYS A 1 99  ? 36.886  7.827   -4.853  1.00 45.68  ? 209 LYS A N     1 
ATOM   463  C  CA    . LYS A 1 99  ? 36.537  6.621   -5.607  1.00 46.33  ? 209 LYS A CA    1 
ATOM   464  C  C     . LYS A 1 99  ? 35.664  5.686   -4.755  1.00 51.58  ? 209 LYS A C     1 
ATOM   465  O  O     . LYS A 1 99  ? 34.734  5.075   -5.286  1.00 52.69  ? 209 LYS A O     1 
ATOM   466  C  CB    . LYS A 1 99  ? 37.814  5.897   -6.093  1.00 48.32  ? 209 LYS A CB    1 
ATOM   467  N  N     . ASP A 1 100 ? 35.926  5.624   -3.427  1.00 47.66  ? 210 ASP A N     1 
ATOM   468  C  CA    . ASP A 1 100 ? 35.161  4.794   -2.485  1.00 46.00  ? 210 ASP A CA    1 
ATOM   469  C  C     . ASP A 1 100 ? 33.692  5.220   -2.375  1.00 51.30  ? 210 ASP A C     1 
ATOM   470  O  O     . ASP A 1 100 ? 32.895  4.454   -1.844  1.00 50.62  ? 210 ASP A O     1 
ATOM   471  C  CB    . ASP A 1 100 ? 35.793  4.839   -1.093  1.00 46.47  ? 210 ASP A CB    1 
ATOM   472  C  CG    . ASP A 1 100 ? 37.139  4.201   -0.987  1.00 49.87  ? 210 ASP A CG    1 
ATOM   473  O  OD1   . ASP A 1 100 ? 37.908  4.601   -0.092  1.00 50.87  ? 210 ASP A OD1   1 
ATOM   474  O  OD2   . ASP A 1 100 ? 37.413  3.261   -1.769  1.00 58.62  ? 210 ASP A OD2   1 
ATOM   475  N  N     . THR A 1 101 ? 33.320  6.433   -2.859  1.00 50.35  ? 211 THR A N     1 
ATOM   476  C  CA    . THR A 1 101 ? 31.926  6.902   -2.764  1.00 49.49  ? 211 THR A CA    1 
ATOM   477  C  C     . THR A 1 101 ? 31.081  6.454   -3.981  1.00 56.03  ? 211 THR A C     1 
ATOM   478  O  O     . THR A 1 101 ? 29.867  6.664   -3.973  1.00 56.85  ? 211 THR A O     1 
ATOM   479  C  CB    . THR A 1 101 ? 31.836  8.419   -2.559  1.00 47.12  ? 211 THR A CB    1 
ATOM   480  O  OG1   . THR A 1 101 ? 32.200  9.102   -3.764  1.00 45.14  ? 211 THR A OG1   1 
ATOM   481  C  CG2   . THR A 1 101 ? 32.634  8.914   -1.354  1.00 41.22  ? 211 THR A CG2   1 
ATOM   482  N  N     . GLU A 1 102 ? 31.707  5.836   -5.008  1.00 53.83  ? 212 GLU A N     1 
ATOM   483  C  CA    . GLU A 1 102 ? 31.011  5.362   -6.210  1.00 54.74  ? 212 GLU A CA    1 
ATOM   484  C  C     . GLU A 1 102 ? 29.959  4.302   -5.864  1.00 57.42  ? 212 GLU A C     1 
ATOM   485  O  O     . GLU A 1 102 ? 30.239  3.350   -5.122  1.00 58.69  ? 212 GLU A O     1 
ATOM   486  C  CB    . GLU A 1 102 ? 32.003  4.793   -7.243  1.00 56.80  ? 212 GLU A CB    1 
ATOM   487  C  CG    . GLU A 1 102 ? 32.827  5.861   -7.949  1.00 72.57  ? 212 GLU A CG    1 
ATOM   488  C  CD    . GLU A 1 102 ? 33.852  5.374   -8.961  1.00 105.67 ? 212 GLU A CD    1 
ATOM   489  O  OE1   . GLU A 1 102 ? 33.657  4.279   -9.538  1.00 110.60 ? 212 GLU A OE1   1 
ATOM   490  O  OE2   . GLU A 1 102 ? 34.830  6.115   -9.213  1.00 100.73 ? 212 GLU A OE2   1 
ATOM   491  N  N     . GLY A 1 103 ? 28.753  4.513   -6.374  1.00 51.27  ? 213 GLY A N     1 
ATOM   492  C  CA    . GLY A 1 103 ? 27.626  3.622   -6.155  1.00 49.87  ? 213 GLY A CA    1 
ATOM   493  C  C     . GLY A 1 103 ? 26.897  3.837   -4.847  1.00 52.48  ? 213 GLY A C     1 
ATOM   494  O  O     . GLY A 1 103 ? 25.877  3.186   -4.617  1.00 53.30  ? 213 GLY A O     1 
ATOM   495  N  N     . ILE A 1 104 ? 27.387  4.751   -3.976  1.00 46.28  ? 214 ILE A N     1 
ATOM   496  C  CA    . ILE A 1 104 ? 26.718  5.020   -2.693  1.00 43.42  ? 214 ILE A CA    1 
ATOM   497  C  C     . ILE A 1 104 ? 25.590  6.044   -2.944  1.00 46.32  ? 214 ILE A C     1 
ATOM   498  O  O     . ILE A 1 104 ? 25.845  7.132   -3.454  1.00 45.85  ? 214 ILE A O     1 
ATOM   499  C  CB    . ILE A 1 104 ? 27.682  5.455   -1.546  1.00 45.01  ? 214 ILE A CB    1 
ATOM   500  C  CG1   . ILE A 1 104 ? 28.824  4.447   -1.338  1.00 45.43  ? 214 ILE A CG1   1 
ATOM   501  C  CG2   . ILE A 1 104 ? 26.922  5.706   -0.229  1.00 43.79  ? 214 ILE A CG2   1 
ATOM   502  C  CD1   . ILE A 1 104 ? 29.905  4.880   -0.331  1.00 47.67  ? 214 ILE A CD1   1 
ATOM   503  N  N     . PRO A 1 105 ? 24.332  5.705   -2.596  1.00 42.77  ? 215 PRO A N     1 
ATOM   504  C  CA    . PRO A 1 105 ? 23.238  6.656   -2.798  1.00 43.03  ? 215 PRO A CA    1 
ATOM   505  C  C     . PRO A 1 105 ? 23.245  7.758   -1.733  1.00 49.66  ? 215 PRO A C     1 
ATOM   506  O  O     . PRO A 1 105 ? 23.998  7.665   -0.755  1.00 48.94  ? 215 PRO A O     1 
ATOM   507  C  CB    . PRO A 1 105 ? 21.992  5.768   -2.667  1.00 43.99  ? 215 PRO A CB    1 
ATOM   508  C  CG    . PRO A 1 105 ? 22.395  4.719   -1.696  1.00 47.57  ? 215 PRO A CG    1 
ATOM   509  C  CD    . PRO A 1 105 ? 23.849  4.449   -1.974  1.00 43.96  ? 215 PRO A CD    1 
ATOM   510  N  N     . CYS A 1 106 ? 22.385  8.795   -1.922  1.00 46.97  ? 216 CYS A N     1 
ATOM   511  C  CA    . CYS A 1 106 ? 22.180  9.899   -0.985  1.00 47.39  ? 216 CYS A CA    1 
ATOM   512  C  C     . CYS A 1 106 ? 23.437  10.778  -0.813  1.00 51.56  ? 216 CYS A C     1 
ATOM   513  O  O     . CYS A 1 106 ? 23.571  11.441  0.222   1.00 52.13  ? 216 CYS A O     1 
ATOM   514  C  CB    . CYS A 1 106 ? 21.691  9.361   0.360   1.00 48.13  ? 216 CYS A CB    1 
ATOM   515  S  SG    . CYS A 1 106 ? 20.352  8.141   0.220   1.00 52.41  ? 216 CYS A SG    1 
ATOM   516  N  N     . LEU A 1 107 ? 24.357  10.781  -1.811  1.00 46.28  ? 217 LEU A N     1 
ATOM   517  C  CA    . LEU A 1 107 ? 25.558  11.608  -1.744  1.00 44.33  ? 217 LEU A CA    1 
ATOM   518  C  C     . LEU A 1 107 ? 25.537  12.609  -2.892  1.00 52.79  ? 217 LEU A C     1 
ATOM   519  O  O     . LEU A 1 107 ? 26.084  12.357  -3.974  1.00 54.62  ? 217 LEU A O     1 
ATOM   520  C  CB    . LEU A 1 107 ? 26.878  10.802  -1.729  1.00 42.38  ? 217 LEU A CB    1 
ATOM   521  C  CG    . LEU A 1 107 ? 27.069  9.673   -0.720  1.00 44.85  ? 217 LEU A CG    1 
ATOM   522  C  CD1   . LEU A 1 107 ? 28.409  9.046   -0.914  1.00 44.15  ? 217 LEU A CD1   1 
ATOM   523  C  CD2   . LEU A 1 107 ? 26.900  10.141  0.732   1.00 45.49  ? 217 LEU A CD2   1 
ATOM   524  N  N     . GLY A 1 108 ? 24.901  13.738  -2.640  1.00 50.03  ? 218 GLY A N     1 
ATOM   525  C  CA    . GLY A 1 108 ? 24.830  14.833  -3.598  1.00 51.79  ? 218 GLY A CA    1 
ATOM   526  C  C     . GLY A 1 108 ? 26.150  15.571  -3.733  1.00 57.18  ? 218 GLY A C     1 
ATOM   527  O  O     . GLY A 1 108 ? 27.100  15.283  -3.002  1.00 57.18  ? 218 GLY A O     1 
ATOM   528  N  N     . ASP A 1 109 ? 26.226  16.521  -4.669  1.00 55.08  ? 219 ASP A N     1 
ATOM   529  C  CA    . ASP A 1 109 ? 27.447  17.293  -4.947  1.00 55.18  ? 219 ASP A CA    1 
ATOM   530  C  C     . ASP A 1 109 ? 27.947  18.084  -3.726  1.00 55.59  ? 219 ASP A C     1 
ATOM   531  O  O     . ASP A 1 109 ? 29.147  18.076  -3.479  1.00 54.01  ? 219 ASP A O     1 
ATOM   532  C  CB    . ASP A 1 109 ? 27.241  18.235  -6.146  1.00 57.98  ? 219 ASP A CB    1 
ATOM   533  C  CG    . ASP A 1 109 ? 27.238  17.516  -7.484  1.00 71.92  ? 219 ASP A CG    1 
ATOM   534  O  OD1   . ASP A 1 109 ? 27.684  16.341  -7.532  1.00 68.37  ? 219 ASP A OD1   1 
ATOM   535  O  OD2   . ASP A 1 109 ? 26.778  18.123  -8.483  1.00 85.85  ? 219 ASP A OD2   1 
ATOM   536  N  N     . LYS A 1 110 ? 27.044  18.731  -2.958  1.00 50.32  ? 220 LYS A N     1 
ATOM   537  C  CA    . LYS A 1 110 ? 27.416  19.485  -1.755  1.00 49.44  ? 220 LYS A CA    1 
ATOM   538  C  C     . LYS A 1 110 ? 28.047  18.539  -0.733  1.00 51.36  ? 220 LYS A C     1 
ATOM   539  O  O     . LYS A 1 110 ? 29.099  18.862  -0.190  1.00 51.75  ? 220 LYS A O     1 
ATOM   540  C  CB    . LYS A 1 110 ? 26.198  20.224  -1.154  1.00 51.29  ? 220 LYS A CB    1 
ATOM   541  C  CG    . LYS A 1 110 ? 26.484  21.067  0.080   1.00 56.89  ? 220 LYS A CG    1 
ATOM   542  C  CD    . LYS A 1 110 ? 25.234  21.762  0.562   1.00 65.00  ? 220 LYS A CD    1 
ATOM   543  N  N     . VAL A 1 111 ? 27.443  17.351  -0.520  1.00 46.02  ? 221 VAL A N     1 
ATOM   544  C  CA    . VAL A 1 111 ? 27.938  16.351  0.438   1.00 44.06  ? 221 VAL A CA    1 
ATOM   545  C  C     . VAL A 1 111 ? 29.320  15.857  -0.007  1.00 47.13  ? 221 VAL A C     1 
ATOM   546  O  O     . VAL A 1 111 ? 30.208  15.756  0.831   1.00 47.26  ? 221 VAL A O     1 
ATOM   547  C  CB    . VAL A 1 111 ? 26.923  15.184  0.612   1.00 46.98  ? 221 VAL A CB    1 
ATOM   548  C  CG1   . VAL A 1 111 ? 27.555  13.960  1.280   1.00 45.55  ? 221 VAL A CG1   1 
ATOM   549  C  CG2   . VAL A 1 111 ? 25.687  15.646  1.383   1.00 46.72  ? 221 VAL A CG2   1 
ATOM   550  N  N     . LYS A 1 112 ? 29.506  15.586  -1.314  1.00 43.34  ? 222 LYS A N     1 
ATOM   551  C  CA    . LYS A 1 112 ? 30.770  15.092  -1.850  1.00 43.31  ? 222 LYS A CA    1 
ATOM   552  C  C     . LYS A 1 112 ? 31.889  16.115  -1.661  1.00 47.29  ? 222 LYS A C     1 
ATOM   553  O  O     . LYS A 1 112 ? 32.990  15.693  -1.313  1.00 46.86  ? 222 LYS A O     1 
ATOM   554  C  CB    . LYS A 1 112 ? 30.637  14.629  -3.307  1.00 45.77  ? 222 LYS A CB    1 
ATOM   555  C  CG    . LYS A 1 112 ? 29.901  13.296  -3.376  1.00 54.43  ? 222 LYS A CG    1 
ATOM   556  C  CD    . LYS A 1 112 ? 29.930  12.649  -4.737  1.00 66.64  ? 222 LYS A CD    1 
ATOM   557  C  CE    . LYS A 1 112 ? 29.350  11.264  -4.636  1.00 75.35  ? 222 LYS A CE    1 
ATOM   558  N  NZ    . LYS A 1 112 ? 28.701  10.846  -5.900  1.00 83.29  ? 222 LYS A NZ    1 
ATOM   559  N  N     . SER A 1 113 ? 31.600  17.438  -1.748  1.00 43.29  ? 223 SER A N     1 
ATOM   560  C  CA    . SER A 1 113 ? 32.601  18.477  -1.467  1.00 43.10  ? 223 SER A CA    1 
ATOM   561  C  C     . SER A 1 113 ? 33.028  18.431  0.004   1.00 43.95  ? 223 SER A C     1 
ATOM   562  O  O     . SER A 1 113 ? 34.197  18.624  0.309   1.00 40.98  ? 223 SER A O     1 
ATOM   563  C  CB    . SER A 1 113 ? 32.070  19.870  -1.800  1.00 48.65  ? 223 SER A CB    1 
ATOM   564  O  OG    . SER A 1 113 ? 31.826  19.968  -3.192  1.00 63.05  ? 223 SER A OG    1 
ATOM   565  N  N     . ILE A 1 114 ? 32.089  18.152  0.911   1.00 42.31  ? 224 ILE A N     1 
ATOM   566  C  CA    . ILE A 1 114 ? 32.415  18.060  2.340   1.00 42.68  ? 224 ILE A CA    1 
ATOM   567  C  C     . ILE A 1 114 ? 33.313  16.831  2.597   1.00 46.47  ? 224 ILE A C     1 
ATOM   568  O  O     . ILE A 1 114 ? 34.317  16.958  3.310   1.00 47.14  ? 224 ILE A O     1 
ATOM   569  C  CB    . ILE A 1 114 ? 31.126  18.080  3.227   1.00 44.46  ? 224 ILE A CB    1 
ATOM   570  C  CG1   . ILE A 1 114 ? 30.565  19.511  3.286   1.00 43.07  ? 224 ILE A CG1   1 
ATOM   571  C  CG2   . ILE A 1 114 ? 31.395  17.543  4.648   1.00 43.18  ? 224 ILE A CG2   1 
ATOM   572  C  CD1   . ILE A 1 114 ? 29.156  19.585  3.089   1.00 57.53  ? 224 ILE A CD1   1 
ATOM   573  N  N     . ILE A 1 115 ? 32.966  15.673  2.001   1.00 42.44  ? 225 ILE A N     1 
ATOM   574  C  CA    . ILE A 1 115 ? 33.753  14.430  2.126   1.00 41.62  ? 225 ILE A CA    1 
ATOM   575  C  C     . ILE A 1 115 ? 35.189  14.666  1.565   1.00 43.57  ? 225 ILE A C     1 
ATOM   576  O  O     . ILE A 1 115 ? 36.165  14.275  2.198   1.00 43.47  ? 225 ILE A O     1 
ATOM   577  C  CB    . ILE A 1 115 ? 33.032  13.262  1.405   1.00 43.68  ? 225 ILE A CB    1 
ATOM   578  C  CG1   . ILE A 1 115 ? 31.690  12.910  2.081   1.00 42.90  ? 225 ILE A CG1   1 
ATOM   579  C  CG2   . ILE A 1 115 ? 33.951  12.020  1.248   1.00 44.71  ? 225 ILE A CG2   1 
ATOM   580  C  CD1   . ILE A 1 115 ? 30.824  11.834  1.303   1.00 43.57  ? 225 ILE A CD1   1 
ATOM   581  N  N     . GLU A 1 116 ? 35.292  15.290  0.384   1.00 39.89  ? 226 GLU A N     1 
ATOM   582  C  CA    . GLU A 1 116 ? 36.567  15.608  -0.277  1.00 40.50  ? 226 GLU A CA    1 
ATOM   583  C  C     . GLU A 1 116 ? 37.476  16.437  0.652   1.00 44.13  ? 226 GLU A C     1 
ATOM   584  O  O     . GLU A 1 116 ? 38.650  16.140  0.766   1.00 45.30  ? 226 GLU A O     1 
ATOM   585  C  CB    . GLU A 1 116 ? 36.279  16.370  -1.577  1.00 41.90  ? 226 GLU A CB    1 
ATOM   586  C  CG    . GLU A 1 116 ? 37.487  16.778  -2.386  1.00 57.87  ? 226 GLU A CG    1 
ATOM   587  C  CD    . GLU A 1 116 ? 37.065  17.702  -3.512  1.00 92.91  ? 226 GLU A CD    1 
ATOM   588  O  OE1   . GLU A 1 116 ? 36.977  18.933  -3.281  1.00 70.25  ? 226 GLU A OE1   1 
ATOM   589  O  OE2   . GLU A 1 116 ? 36.707  17.177  -4.591  1.00 96.55  ? 226 GLU A OE2   1 
ATOM   590  N  N     . GLY A 1 117 ? 36.911  17.441  1.301   1.00 40.42  ? 227 GLY A N     1 
ATOM   591  C  CA    . GLY A 1 117 ? 37.634  18.305  2.225   1.00 41.27  ? 227 GLY A CA    1 
ATOM   592  C  C     . GLY A 1 117 ? 38.183  17.580  3.436   1.00 46.43  ? 227 GLY A C     1 
ATOM   593  O  O     . GLY A 1 117 ? 39.274  17.902  3.899   1.00 47.21  ? 227 GLY A O     1 
ATOM   594  N  N     . ILE A 1 118 ? 37.430  16.615  3.967   1.00 41.79  ? 228 ILE A N     1 
ATOM   595  C  CA    . ILE A 1 118 ? 37.842  15.826  5.140   1.00 40.32  ? 228 ILE A CA    1 
ATOM   596  C  C     . ILE A 1 118 ? 38.961  14.860  4.721   1.00 44.58  ? 228 ILE A C     1 
ATOM   597  O  O     . ILE A 1 118 ? 39.897  14.674  5.488   1.00 45.32  ? 228 ILE A O     1 
ATOM   598  C  CB    . ILE A 1 118 ? 36.643  15.111  5.825   1.00 41.15  ? 228 ILE A CB    1 
ATOM   599  C  CG1   . ILE A 1 118 ? 35.658  16.148  6.393   1.00 39.91  ? 228 ILE A CG1   1 
ATOM   600  C  CG2   . ILE A 1 118 ? 37.130  14.186  6.950   1.00 42.36  ? 228 ILE A CG2   1 
ATOM   601  C  CD1   . ILE A 1 118 ? 34.188  15.634  6.658   1.00 37.54  ? 228 ILE A CD1   1 
ATOM   602  N  N     . ILE A 1 119 ? 38.884  14.275  3.505   1.00 41.05  ? 229 ILE A N     1 
ATOM   603  C  CA    . ILE A 1 119 ? 39.919  13.384  2.966   1.00 40.67  ? 229 ILE A CA    1 
ATOM   604  C  C     . ILE A 1 119 ? 41.232  14.168  2.867   1.00 48.79  ? 229 ILE A C     1 
ATOM   605  O  O     . ILE A 1 119 ? 42.282  13.647  3.246   1.00 50.14  ? 229 ILE A O     1 
ATOM   606  C  CB    . ILE A 1 119 ? 39.510  12.761  1.588   1.00 42.31  ? 229 ILE A CB    1 
ATOM   607  C  CG1   . ILE A 1 119 ? 38.342  11.791  1.723   1.00 41.58  ? 229 ILE A CG1   1 
ATOM   608  C  CG2   . ILE A 1 119 ? 40.714  12.082  0.878   1.00 42.44  ? 229 ILE A CG2   1 
ATOM   609  C  CD1   . ILE A 1 119 ? 37.722  11.350  0.390   1.00 44.78  ? 229 ILE A CD1   1 
ATOM   610  N  N     . GLU A 1 120 ? 41.154  15.420  2.405   1.00 48.00  ? 230 GLU A N     1 
ATOM   611  C  CA    . GLU A 1 120 ? 42.303  16.320  2.202   1.00 50.28  ? 230 GLU A CA    1 
ATOM   612  C  C     . GLU A 1 120 ? 43.136  16.626  3.451   1.00 58.44  ? 230 GLU A C     1 
ATOM   613  O  O     . GLU A 1 120 ? 44.365  16.503  3.384   1.00 57.49  ? 230 GLU A O     1 
ATOM   614  C  CB    . GLU A 1 120 ? 41.854  17.638  1.587   1.00 51.60  ? 230 GLU A CB    1 
ATOM   615  C  CG    . GLU A 1 120 ? 41.339  17.361  0.198   1.00 67.16  ? 230 GLU A CG    1 
ATOM   616  C  CD    . GLU A 1 120 ? 41.550  18.435  -0.832  1.00 92.77  ? 230 GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1 120 ? 42.661  18.462  -1.406  1.00 82.54  ? 230 GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1 120 ? 40.558  19.106  -1.198  1.00 101.25 ? 230 GLU A OE2   1 
ATOM   619  N  N     . ASP A 1 121 ? 42.506  17.047  4.573   1.00 57.36  ? 231 ASP A N     1 
ATOM   620  C  CA    . ASP A 1 121 ? 43.305  17.387  5.748   1.00 58.87  ? 231 ASP A CA    1 
ATOM   621  C  C     . ASP A 1 121 ? 42.736  16.877  7.089   1.00 61.01  ? 231 ASP A C     1 
ATOM   622  O  O     . ASP A 1 121 ? 43.105  17.421  8.141   1.00 62.53  ? 231 ASP A O     1 
ATOM   623  C  CB    . ASP A 1 121 ? 43.507  18.916  5.814   1.00 62.32  ? 231 ASP A CB    1 
ATOM   624  C  CG    . ASP A 1 121 ? 42.249  19.729  6.019   1.00 83.15  ? 231 ASP A CG    1 
ATOM   625  O  OD1   . ASP A 1 121 ? 41.158  19.130  6.069   1.00 86.11  ? 231 ASP A OD1   1 
ATOM   626  O  OD2   . ASP A 1 121 ? 42.359  20.966  6.158   1.00 93.97  ? 231 ASP A OD2   1 
ATOM   627  N  N     . GLY A 1 122 ? 41.862  15.865  7.041   1.00 53.56  ? 232 GLY A N     1 
ATOM   628  C  CA    . GLY A 1 122 ? 41.239  15.262  8.220   1.00 52.08  ? 232 GLY A CA    1 
ATOM   629  C  C     . GLY A 1 122 ? 40.223  16.117  8.967   1.00 54.69  ? 232 GLY A C     1 
ATOM   630  O  O     . GLY A 1 122 ? 39.778  15.738  10.052  1.00 55.88  ? 232 GLY A O     1 
ATOM   631  N  N     . GLU A 1 123 ? 39.850  17.267  8.412   1.00 48.56  ? 233 GLU A N     1 
ATOM   632  C  CA    . GLU A 1 123 ? 38.906  18.193  9.020   1.00 47.69  ? 233 GLU A CA    1 
ATOM   633  C  C     . GLU A 1 123 ? 37.880  18.695  8.033   1.00 49.20  ? 233 GLU A C     1 
ATOM   634  O  O     . GLU A 1 123 ? 38.159  18.817  6.837   1.00 48.80  ? 233 GLU A O     1 
ATOM   635  C  CB    . GLU A 1 123 ? 39.653  19.439  9.553   1.00 49.69  ? 233 GLU A CB    1 
ATOM   636  C  CG    . GLU A 1 123 ? 40.378  19.312  10.873  1.00 64.69  ? 233 GLU A CG    1 
ATOM   637  C  CD    . GLU A 1 123 ? 40.995  20.637  11.272  1.00 88.21  ? 233 GLU A CD    1 
ATOM   638  O  OE1   . GLU A 1 123 ? 40.308  21.429  11.957  1.00 82.40  ? 233 GLU A OE1   1 
ATOM   639  O  OE2   . GLU A 1 123 ? 42.130  20.920  10.826  1.00 91.16  ? 233 GLU A OE2   1 
ATOM   640  N  N     . SER A 1 124 ? 36.736  19.092  8.550   1.00 45.61  ? 234 SER A N     1 
ATOM   641  C  CA    . SER A 1 124 ? 35.717  19.771  7.772   1.00 45.38  ? 234 SER A CA    1 
ATOM   642  C  C     . SER A 1 124 ? 35.747  21.246  8.156   1.00 49.16  ? 234 SER A C     1 
ATOM   643  O  O     . SER A 1 124 ? 35.458  21.590  9.309   1.00 46.29  ? 234 SER A O     1 
ATOM   644  C  CB    . SER A 1 124 ? 34.340  19.178  8.024   1.00 48.78  ? 234 SER A CB    1 
ATOM   645  O  OG    . SER A 1 124 ? 33.351  19.956  7.364   1.00 59.57  ? 234 SER A OG    1 
ATOM   646  N  N     . SER A 1 125 ? 36.139  22.107  7.208   1.00 48.15  ? 235 SER A N     1 
ATOM   647  C  CA    . SER A 1 125 ? 36.195  23.548  7.410   1.00 48.66  ? 235 SER A CA    1 
ATOM   648  C  C     . SER A 1 125 ? 34.773  24.080  7.654   1.00 51.72  ? 235 SER A C     1 
ATOM   649  O  O     . SER A 1 125 ? 34.582  24.961  8.496   1.00 51.34  ? 235 SER A O     1 
ATOM   650  C  CB    . SER A 1 125 ? 36.855  24.224  6.207   1.00 53.00  ? 235 SER A CB    1 
ATOM   651  O  OG    . SER A 1 125 ? 36.033  24.159  5.052   1.00 63.71  ? 235 SER A OG    1 
ATOM   652  N  N     . GLU A 1 126 ? 33.782  23.494  6.950   1.00 48.79  ? 236 GLU A N     1 
ATOM   653  C  CA    . GLU A 1 126 ? 32.348  23.822  7.071   1.00 48.20  ? 236 GLU A CA    1 
ATOM   654  C  C     . GLU A 1 126 ? 31.823  23.492  8.473   1.00 49.81  ? 236 GLU A C     1 
ATOM   655  O  O     . GLU A 1 126 ? 31.161  24.345  9.067   1.00 50.52  ? 236 GLU A O     1 
ATOM   656  C  CB    . GLU A 1 126 ? 31.485  23.088  6.009   1.00 49.53  ? 236 GLU A CB    1 
ATOM   657  C  CG    . GLU A 1 126 ? 31.909  23.298  4.560   1.00 60.13  ? 236 GLU A CG    1 
ATOM   658  C  CD    . GLU A 1 126 ? 32.972  22.352  4.027   1.00 74.17  ? 236 GLU A CD    1 
ATOM   659  O  OE1   . GLU A 1 126 ? 33.263  22.424  2.812   1.00 66.51  ? 236 GLU A OE1   1 
ATOM   660  O  OE2   . GLU A 1 126 ? 33.479  21.510  4.803   1.00 62.17  ? 236 GLU A OE2   1 
ATOM   661  N  N     . ALA A 1 127 ? 32.107  22.270  8.999   1.00 43.43  ? 237 ALA A N     1 
ATOM   662  C  CA    . ALA A 1 127 ? 31.644  21.874  10.344  1.00 43.32  ? 237 ALA A CA    1 
ATOM   663  C  C     . ALA A 1 127 ? 32.362  22.678  11.450  1.00 46.81  ? 237 ALA A C     1 
ATOM   664  O  O     . ALA A 1 127 ? 31.725  23.047  12.456  1.00 43.46  ? 237 ALA A O     1 
ATOM   665  C  CB    . ALA A 1 127 ? 31.821  20.390  10.566  1.00 43.52  ? 237 ALA A CB    1 
ATOM   666  N  N     . LYS A 1 128 ? 33.676  22.987  11.233  1.00 44.53  ? 238 LYS A N     1 
ATOM   667  C  CA    . LYS A 1 128 ? 34.503  23.840  12.117  1.00 43.36  ? 238 LYS A CA    1 
ATOM   668  C  C     . LYS A 1 128 ? 33.866  25.242  12.281  1.00 45.08  ? 238 LYS A C     1 
ATOM   669  O  O     . LYS A 1 128 ? 33.760  25.741  13.405  1.00 43.99  ? 238 LYS A O     1 
ATOM   670  C  CB    . LYS A 1 128 ? 35.923  23.975  11.556  1.00 45.33  ? 238 LYS A CB    1 
ATOM   671  C  CG    . LYS A 1 128 ? 36.936  24.486  12.579  1.00 65.61  ? 238 LYS A CG    1 
ATOM   672  N  N     . ALA A 1 129 ? 33.405  25.836  11.163  1.00 40.83  ? 239 ALA A N     1 
ATOM   673  C  CA    . ALA A 1 129 ? 32.754  27.139  11.151  1.00 41.24  ? 239 ALA A CA    1 
ATOM   674  C  C     . ALA A 1 129 ? 31.425  27.094  11.916  1.00 46.45  ? 239 ALA A C     1 
ATOM   675  O  O     . ALA A 1 129 ? 31.114  28.057  12.615  1.00 47.58  ? 239 ALA A O     1 
ATOM   676  C  CB    . ALA A 1 129 ? 32.534  27.612  9.714   1.00 41.84  ? 239 ALA A CB    1 
ATOM   677  N  N     . VAL A 1 130 ? 30.671  25.971  11.836  1.00 41.04  ? 240 VAL A N     1 
ATOM   678  C  CA    . VAL A 1 130 ? 29.391  25.824  12.558  1.00 39.00  ? 240 VAL A CA    1 
ATOM   679  C  C     . VAL A 1 130 ? 29.696  25.733  14.095  1.00 42.59  ? 240 VAL A C     1 
ATOM   680  O  O     . VAL A 1 130 ? 29.024  26.371  14.904  1.00 43.19  ? 240 VAL A O     1 
ATOM   681  C  CB    . VAL A 1 130 ? 28.566  24.599  12.037  1.00 41.31  ? 240 VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 130 ? 27.394  24.272  12.951  1.00 40.88  ? 240 VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 130 ? 28.085  24.810  10.607  1.00 40.30  ? 240 VAL A CG2   1 
ATOM   684  N  N     . LEU A 1 131 ? 30.716  24.968  14.472  1.00 39.05  ? 241 LEU A N     1 
ATOM   685  C  CA    . LEU A 1 131 ? 31.091  24.793  15.867  1.00 39.55  ? 241 LEU A CA    1 
ATOM   686  C  C     . LEU A 1 131 ? 31.545  26.104  16.531  1.00 47.22  ? 241 LEU A C     1 
ATOM   687  O  O     . LEU A 1 131 ? 31.443  26.240  17.754  1.00 47.24  ? 241 LEU A O     1 
ATOM   688  C  CB    . LEU A 1 131 ? 32.200  23.747  15.977  1.00 39.10  ? 241 LEU A CB    1 
ATOM   689  C  CG    . LEU A 1 131 ? 31.804  22.289  15.757  1.00 41.87  ? 241 LEU A CG    1 
ATOM   690  C  CD1   . LEU A 1 131 ? 33.044  21.384  15.813  1.00 40.91  ? 241 LEU A CD1   1 
ATOM   691  C  CD2   . LEU A 1 131 ? 30.655  21.830  16.733  1.00 37.12  ? 241 LEU A CD2   1 
ATOM   692  N  N     . ASN A 1 132 ? 32.026  27.073  15.716  1.00 45.78  ? 242 ASN A N     1 
ATOM   693  C  CA    . ASN A 1 132 ? 32.492  28.373  16.184  1.00 46.11  ? 242 ASN A CA    1 
ATOM   694  C  C     . ASN A 1 132 ? 31.418  29.459  16.016  1.00 49.55  ? 242 ASN A C     1 
ATOM   695  O  O     . ASN A 1 132 ? 31.606  30.564  16.530  1.00 49.66  ? 242 ASN A O     1 
ATOM   696  C  CB    . ASN A 1 132 ? 33.806  28.775  15.484  1.00 49.10  ? 242 ASN A CB    1 
ATOM   697  C  CG    . ASN A 1 132 ? 34.981  27.884  15.857  1.00 73.22  ? 242 ASN A CG    1 
ATOM   698  O  OD1   . ASN A 1 132 ? 35.320  27.686  17.035  1.00 60.85  ? 242 ASN A OD1   1 
ATOM   699  N  ND2   . ASN A 1 132 ? 35.614  27.301  14.857  1.00 68.63  ? 242 ASN A ND2   1 
ATOM   700  N  N     . ASP A 1 133 ? 30.277  29.132  15.365  1.00 44.99  ? 243 ASP A N     1 
ATOM   701  C  CA    . ASP A 1 133 ? 29.155  30.050  15.154  1.00 44.42  ? 243 ASP A CA    1 
ATOM   702  C  C     . ASP A 1 133 ? 28.437  30.315  16.469  1.00 49.73  ? 243 ASP A C     1 
ATOM   703  O  O     . ASP A 1 133 ? 28.124  29.371  17.193  1.00 49.25  ? 243 ASP A O     1 
ATOM   704  C  CB    . ASP A 1 133 ? 28.183  29.495  14.115  1.00 45.42  ? 243 ASP A CB    1 
ATOM   705  C  CG    . ASP A 1 133 ? 27.012  30.390  13.815  1.00 53.72  ? 243 ASP A CG    1 
ATOM   706  O  OD1   . ASP A 1 133 ? 27.187  31.322  13.046  1.00 58.75  ? 243 ASP A OD1   1 
ATOM   707  O  OD2   . ASP A 1 133 ? 25.882  30.087  14.286  1.00 56.88  ? 243 ASP A OD2   1 
ATOM   708  N  N     . GLU A 1 134 ? 28.172  31.596  16.772  1.00 47.04  ? 244 GLU A N     1 
ATOM   709  C  CA    . GLU A 1 134 ? 27.547  32.021  18.023  1.00 45.94  ? 244 GLU A CA    1 
ATOM   710  C  C     . GLU A 1 134 ? 26.128  31.558  18.154  1.00 45.37  ? 244 GLU A C     1 
ATOM   711  O  O     . GLU A 1 134 ? 25.763  31.163  19.247  1.00 44.37  ? 244 GLU A O     1 
ATOM   712  C  CB    . GLU A 1 134 ? 27.633  33.541  18.207  1.00 47.97  ? 244 GLU A CB    1 
ATOM   713  C  CG    . GLU A 1 134 ? 29.057  33.977  18.516  1.00 63.07  ? 244 GLU A CG    1 
ATOM   714  C  CD    . GLU A 1 134 ? 29.786  33.404  19.726  1.00 80.32  ? 244 GLU A CD    1 
ATOM   715  O  OE1   . GLU A 1 134 ? 29.247  33.507  20.852  1.00 58.91  ? 244 GLU A OE1   1 
ATOM   716  O  OE2   . GLU A 1 134 ? 30.951  32.969  19.559  1.00 71.32  ? 244 GLU A OE2   1 
ATOM   717  N  N     . ARG A 1 135 ? 25.330  31.580  17.074  1.00 42.65  ? 245 ARG A N     1 
ATOM   718  C  CA    . ARG A 1 135 ? 23.945  31.115  17.126  1.00 43.25  ? 245 ARG A CA    1 
ATOM   719  C  C     . ARG A 1 135 ? 23.920  29.602  17.375  1.00 49.76  ? 245 ARG A C     1 
ATOM   720  O  O     . ARG A 1 135 ? 23.153  29.143  18.220  1.00 51.30  ? 245 ARG A O     1 
ATOM   721  C  CB    . ARG A 1 135 ? 23.168  31.485  15.848  1.00 43.20  ? 245 ARG A CB    1 
ATOM   722  C  CG    . ARG A 1 135 ? 21.690  31.146  15.898  1.00 49.52  ? 245 ARG A CG    1 
ATOM   723  C  CD    . ARG A 1 135 ? 20.894  31.923  14.869  1.00 68.47  ? 245 ARG A CD    1 
ATOM   724  N  NE    . ARG A 1 135 ? 19.713  31.177  14.439  1.00 83.19  ? 245 ARG A NE    1 
ATOM   725  C  CZ    . ARG A 1 135 ? 18.463  31.414  14.823  1.00 105.15 ? 245 ARG A CZ    1 
ATOM   726  N  NH1   . ARG A 1 135 ? 18.193  32.414  15.655  1.00 100.34 ? 245 ARG A NH1   1 
ATOM   727  N  NH2   . ARG A 1 135 ? 17.473  30.654  14.378  1.00 90.11  ? 245 ARG A NH2   1 
ATOM   728  N  N     . TYR A 1 136 ? 24.769  28.841  16.670  1.00 44.56  ? 246 TYR A N     1 
ATOM   729  C  CA    . TYR A 1 136 ? 24.820  27.404  16.836  1.00 43.05  ? 246 TYR A CA    1 
ATOM   730  C  C     . TYR A 1 136 ? 25.228  27.040  18.256  1.00 43.07  ? 246 TYR A C     1 
ATOM   731  O  O     . TYR A 1 136 ? 24.599  26.181  18.855  1.00 43.01  ? 246 TYR A O     1 
ATOM   732  C  CB    . TYR A 1 136 ? 25.764  26.745  15.816  1.00 44.80  ? 246 TYR A CB    1 
ATOM   733  C  CG    . TYR A 1 136 ? 25.880  25.246  15.998  1.00 44.84  ? 246 TYR A CG    1 
ATOM   734  C  CD1   . TYR A 1 136 ? 24.925  24.383  15.466  1.00 47.19  ? 246 TYR A CD1   1 
ATOM   735  C  CD2   . TYR A 1 136 ? 26.933  24.693  16.719  1.00 45.16  ? 246 TYR A CD2   1 
ATOM   736  C  CE1   . TYR A 1 136 ? 25.026  22.999  15.630  1.00 49.67  ? 246 TYR A CE1   1 
ATOM   737  C  CE2   . TYR A 1 136 ? 27.043  23.315  16.898  1.00 46.52  ? 246 TYR A CE2   1 
ATOM   738  C  CZ    . TYR A 1 136 ? 26.097  22.469  16.337  1.00 54.84  ? 246 TYR A CZ    1 
ATOM   739  O  OH    . TYR A 1 136 ? 26.206  21.114  16.506  1.00 54.31  ? 246 TYR A OH    1 
ATOM   740  N  N     . LYS A 1 137 ? 26.266  27.662  18.784  1.00 38.90  ? 247 LYS A N     1 
ATOM   741  C  CA    . LYS A 1 137 ? 26.760  27.403  20.145  1.00 38.44  ? 247 LYS A CA    1 
ATOM   742  C  C     . LYS A 1 137 ? 25.689  27.677  21.192  1.00 41.55  ? 247 LYS A C     1 
ATOM   743  O  O     . LYS A 1 137 ? 25.527  26.877  22.107  1.00 42.60  ? 247 LYS A O     1 
ATOM   744  C  CB    . LYS A 1 137 ? 28.001  28.250  20.437  1.00 39.36  ? 247 LYS A CB    1 
ATOM   745  C  CG    . LYS A 1 137 ? 29.284  27.672  19.868  1.00 42.56  ? 247 LYS A CG    1 
ATOM   746  C  CD    . LYS A 1 137 ? 30.522  28.421  20.393  1.00 49.16  ? 247 LYS A CD    1 
ATOM   747  C  CE    . LYS A 1 137 ? 30.763  29.740  19.700  1.00 61.45  ? 247 LYS A CE    1 
ATOM   748  N  NZ    . LYS A 1 137 ? 31.901  30.468  20.313  1.00 67.73  ? 247 LYS A NZ    1 
ATOM   749  N  N     . SER A 1 138 ? 24.932  28.772  21.022  1.00 39.27  ? 248 SER A N     1 
ATOM   750  C  CA    . SER A 1 138 ? 23.838  29.152  21.911  1.00 38.69  ? 248 SER A CA    1 
ATOM   751  C  C     . SER A 1 138 ? 22.686  28.165  21.836  1.00 43.34  ? 248 SER A C     1 
ATOM   752  O  O     . SER A 1 138 ? 22.165  27.784  22.882  1.00 42.81  ? 248 SER A O     1 
ATOM   753  C  CB    . SER A 1 138 ? 23.335  30.551  21.592  1.00 39.50  ? 248 SER A CB    1 
ATOM   754  O  OG    . SER A 1 138 ? 24.347  31.448  21.994  1.00 53.46  ? 248 SER A OG    1 
ATOM   755  N  N     . PHE A 1 139 ? 22.281  27.750  20.627  1.00 40.62  ? 249 PHE A N     1 
ATOM   756  C  CA    . PHE A 1 139 ? 21.169  26.821  20.474  1.00 42.85  ? 249 PHE A CA    1 
ATOM   757  C  C     . PHE A 1 139 ? 21.496  25.455  21.069  1.00 46.02  ? 249 PHE A C     1 
ATOM   758  O  O     . PHE A 1 139 ? 20.654  24.913  21.775  1.00 47.12  ? 249 PHE A O     1 
ATOM   759  C  CB    . PHE A 1 139 ? 20.732  26.743  19.016  1.00 47.20  ? 249 PHE A CB    1 
ATOM   760  C  CG    . PHE A 1 139 ? 19.859  27.943  18.620  1.00 51.29  ? 249 PHE A CG    1 
ATOM   761  C  CD1   . PHE A 1 139 ? 18.673  27.763  17.916  1.00 56.66  ? 249 PHE A CD1   1 
ATOM   762  C  CD2   . PHE A 1 139 ? 20.192  29.238  19.021  1.00 54.08  ? 249 PHE A CD2   1 
ATOM   763  C  CE1   . PHE A 1 139 ? 17.860  28.862  17.589  1.00 58.15  ? 249 PHE A CE1   1 
ATOM   764  C  CE2   . PHE A 1 139 ? 19.389  30.329  18.681  1.00 57.36  ? 249 PHE A CE2   1 
ATOM   765  C  CZ    . PHE A 1 139 ? 18.239  30.133  17.954  1.00 56.29  ? 249 PHE A CZ    1 
ATOM   766  N  N     . LYS A 1 140 ? 22.738  24.956  20.890  1.00 39.82  ? 250 LYS A N     1 
ATOM   767  C  CA    . LYS A 1 140 ? 23.159  23.695  21.471  1.00 38.68  ? 250 LYS A CA    1 
ATOM   768  C  C     . LYS A 1 140 ? 23.146  23.772  22.988  1.00 42.64  ? 250 LYS A C     1 
ATOM   769  O  O     . LYS A 1 140 ? 22.601  22.883  23.653  1.00 42.38  ? 250 LYS A O     1 
ATOM   770  C  CB    . LYS A 1 140 ? 24.569  23.294  20.991  1.00 39.56  ? 250 LYS A CB    1 
ATOM   771  C  CG    . LYS A 1 140 ? 24.616  22.696  19.597  1.00 55.61  ? 250 LYS A CG    1 
ATOM   772  C  CD    . LYS A 1 140 ? 23.673  21.486  19.416  1.00 69.31  ? 250 LYS A CD    1 
ATOM   773  C  CE    . LYS A 1 140 ? 24.154  20.215  20.078  1.00 87.08  ? 250 LYS A CE    1 
ATOM   774  N  NZ    . LYS A 1 140 ? 23.073  19.198  20.139  1.00 101.32 ? 250 LYS A NZ    1 
ATOM   775  N  N     . LEU A 1 141 ? 23.730  24.839  23.526  1.00 38.42  ? 251 LEU A N     1 
ATOM   776  C  CA    . LEU A 1 141 ? 23.851  25.059  24.956  1.00 38.80  ? 251 LEU A CA    1 
ATOM   777  C  C     . LEU A 1 141 ? 22.479  25.226  25.600  1.00 43.31  ? 251 LEU A C     1 
ATOM   778  O  O     . LEU A 1 141 ? 22.217  24.570  26.603  1.00 44.61  ? 251 LEU A O     1 
ATOM   779  C  CB    . LEU A 1 141 ? 24.748  26.290  25.219  1.00 39.89  ? 251 LEU A CB    1 
ATOM   780  C  CG    . LEU A 1 141 ? 24.991  26.699  26.680  1.00 45.65  ? 251 LEU A CG    1 
ATOM   781  C  CD1   . LEU A 1 141 ? 25.760  25.614  27.458  1.00 45.29  ? 251 LEU A CD1   1 
ATOM   782  C  CD2   . LEU A 1 141 ? 25.759  28.003  26.752  1.00 45.46  ? 251 LEU A CD2   1 
ATOM   783  N  N     . PHE A 1 142 ? 21.592  26.047  25.017  1.00 37.20  ? 252 PHE A N     1 
ATOM   784  C  CA    . PHE A 1 142 ? 20.290  26.307  25.628  1.00 36.38  ? 252 PHE A CA    1 
ATOM   785  C  C     . PHE A 1 142 ? 19.360  25.096  25.548  1.00 41.08  ? 252 PHE A C     1 
ATOM   786  O  O     . PHE A 1 142 ? 18.723  24.786  26.554  1.00 39.35  ? 252 PHE A O     1 
ATOM   787  C  CB    . PHE A 1 142 ? 19.611  27.571  25.053  1.00 37.00  ? 252 PHE A CB    1 
ATOM   788  C  CG    . PHE A 1 142 ? 20.362  28.897  25.173  1.00 37.78  ? 252 PHE A CG    1 
ATOM   789  C  CD1   . PHE A 1 142 ? 19.963  30.010  24.438  1.00 39.15  ? 252 PHE A CD1   1 
ATOM   790  C  CD2   . PHE A 1 142 ? 21.490  29.015  25.989  1.00 38.86  ? 252 PHE A CD2   1 
ATOM   791  C  CE1   . PHE A 1 142 ? 20.674  31.208  24.524  1.00 40.85  ? 252 PHE A CE1   1 
ATOM   792  C  CE2   . PHE A 1 142 ? 22.216  30.207  26.042  1.00 40.74  ? 252 PHE A CE2   1 
ATOM   793  C  CZ    . PHE A 1 142 ? 21.790  31.299  25.332  1.00 38.92  ? 252 PHE A CZ    1 
ATOM   794  N  N     . THR A 1 143 ? 19.297  24.400  24.393  1.00 38.55  ? 253 THR A N     1 
ATOM   795  C  CA    . THR A 1 143 ? 18.422  23.220  24.265  1.00 38.72  ? 253 THR A CA    1 
ATOM   796  C  C     . THR A 1 143 ? 18.987  21.993  25.053  1.00 41.89  ? 253 THR A C     1 
ATOM   797  O  O     . THR A 1 143 ? 18.277  21.026  25.229  1.00 41.25  ? 253 THR A O     1 
ATOM   798  C  CB    . THR A 1 143 ? 18.142  22.871  22.809  1.00 44.81  ? 253 THR A CB    1 
ATOM   799  O  OG1   . THR A 1 143 ? 19.385  22.550  22.179  1.00 47.98  ? 253 THR A OG1   1 
ATOM   800  C  CG2   . THR A 1 143 ? 17.404  23.992  22.066  1.00 42.76  ? 253 THR A CG2   1 
ATOM   801  N  N     . SER A 1 144 ? 20.212  22.069  25.591  1.00 40.92  ? 254 SER A N     1 
ATOM   802  C  CA    . SER A 1 144 ? 20.809  21.015  26.431  1.00 40.56  ? 254 SER A CA    1 
ATOM   803  C  C     . SER A 1 144 ? 20.107  21.003  27.808  1.00 46.30  ? 254 SER A C     1 
ATOM   804  O  O     . SER A 1 144 ? 20.322  20.086  28.596  1.00 48.02  ? 254 SER A O     1 
ATOM   805  C  CB    . SER A 1 144 ? 22.326  21.198  26.576  1.00 41.45  ? 254 SER A CB    1 
ATOM   806  O  OG    . SER A 1 144 ? 22.692  22.149  27.567  1.00 50.17  ? 254 SER A OG    1 
ATOM   807  N  N     . VAL A 1 145 ? 19.279  22.032  28.084  1.00 41.57  ? 255 VAL A N     1 
ATOM   808  C  CA    . VAL A 1 145 ? 18.474  22.142  29.292  1.00 40.83  ? 255 VAL A CA    1 
ATOM   809  C  C     . VAL A 1 145 ? 17.142  21.436  29.020  1.00 45.26  ? 255 VAL A C     1 
ATOM   810  O  O     . VAL A 1 145 ? 16.488  21.723  28.014  1.00 42.52  ? 255 VAL A O     1 
ATOM   811  C  CB    . VAL A 1 145 ? 18.260  23.632  29.743  1.00 43.71  ? 255 VAL A CB    1 
ATOM   812  C  CG1   . VAL A 1 145 ? 17.407  23.728  31.017  1.00 43.29  ? 255 VAL A CG1   1 
ATOM   813  C  CG2   . VAL A 1 145 ? 19.578  24.360  29.943  1.00 42.44  ? 255 VAL A CG2   1 
ATOM   814  N  N     . PHE A 1 146 ? 16.740  20.511  29.920  1.00 44.63  ? 256 PHE A N     1 
ATOM   815  C  CA    . PHE A 1 146 ? 15.448  19.841  29.821  1.00 45.15  ? 256 PHE A CA    1 
ATOM   816  C  C     . PHE A 1 146 ? 14.334  20.922  29.943  1.00 49.60  ? 256 PHE A C     1 
ATOM   817  O  O     . PHE A 1 146 ? 14.346  21.726  30.880  1.00 49.41  ? 256 PHE A O     1 
ATOM   818  C  CB    . PHE A 1 146 ? 15.335  18.749  30.908  1.00 47.07  ? 256 PHE A CB    1 
ATOM   819  C  CG    . PHE A 1 146 ? 13.993  18.061  31.068  1.00 48.54  ? 256 PHE A CG    1 
ATOM   820  C  CD1   . PHE A 1 146 ? 13.488  17.237  30.065  1.00 50.45  ? 256 PHE A CD1   1 
ATOM   821  C  CD2   . PHE A 1 146 ? 13.252  18.204  32.241  1.00 51.05  ? 256 PHE A CD2   1 
ATOM   822  C  CE1   . PHE A 1 146 ? 12.250  16.590  30.227  1.00 51.06  ? 256 PHE A CE1   1 
ATOM   823  C  CE2   . PHE A 1 146 ? 12.034  17.529  32.414  1.00 53.61  ? 256 PHE A CE2   1 
ATOM   824  C  CZ    . PHE A 1 146 ? 11.537  16.736  31.402  1.00 50.85  ? 256 PHE A CZ    1 
ATOM   825  N  N     . GLY A 1 147 ? 13.442  20.969  28.960  1.00 44.76  ? 257 GLY A N     1 
ATOM   826  C  CA    . GLY A 1 147 ? 12.354  21.939  28.936  1.00 44.26  ? 257 GLY A CA    1 
ATOM   827  C  C     . GLY A 1 147 ? 12.562  23.097  27.981  1.00 47.76  ? 257 GLY A C     1 
ATOM   828  O  O     . GLY A 1 147 ? 11.661  23.917  27.799  1.00 48.25  ? 257 GLY A O     1 
ATOM   829  N  N     . VAL A 1 148 ? 13.748  23.179  27.363  1.00 43.80  ? 258 VAL A N     1 
ATOM   830  C  CA    . VAL A 1 148 ? 14.079  24.261  26.442  1.00 42.93  ? 258 VAL A CA    1 
ATOM   831  C  C     . VAL A 1 148 ? 14.141  23.713  25.018  1.00 48.55  ? 258 VAL A C     1 
ATOM   832  O  O     . VAL A 1 148 ? 14.970  22.852  24.708  1.00 48.57  ? 258 VAL A O     1 
ATOM   833  C  CB    . VAL A 1 148 ? 15.396  24.993  26.841  1.00 44.84  ? 258 VAL A CB    1 
ATOM   834  C  CG1   . VAL A 1 148 ? 15.726  26.114  25.863  1.00 44.28  ? 258 VAL A CG1   1 
ATOM   835  C  CG2   . VAL A 1 148 ? 15.336  25.509  28.273  1.00 43.92  ? 258 VAL A CG2   1 
ATOM   836  N  N     . GLY A 1 149 ? 13.279  24.260  24.176  1.00 46.07  ? 259 GLY A N     1 
ATOM   837  C  CA    . GLY A 1 149 ? 13.206  23.930  22.763  1.00 46.66  ? 259 GLY A CA    1 
ATOM   838  C  C     . GLY A 1 149 ? 13.699  25.060  21.889  1.00 51.15  ? 259 GLY A C     1 
ATOM   839  O  O     . GLY A 1 149 ? 14.232  26.045  22.395  1.00 50.28  ? 259 GLY A O     1 
ATOM   840  N  N     . LEU A 1 150 ? 13.544  24.910  20.572  1.00 49.28  ? 260 LEU A N     1 
ATOM   841  C  CA    . LEU A 1 150 ? 13.994  25.871  19.572  1.00 49.84  ? 260 LEU A CA    1 
ATOM   842  C  C     . LEU A 1 150 ? 13.466  27.285  19.802  1.00 54.84  ? 260 LEU A C     1 
ATOM   843  O  O     . LEU A 1 150 ? 14.260  28.214  19.734  1.00 56.32  ? 260 LEU A O     1 
ATOM   844  C  CB    . LEU A 1 150 ? 13.621  25.419  18.159  1.00 50.30  ? 260 LEU A CB    1 
ATOM   845  C  CG    . LEU A 1 150 ? 14.660  24.600  17.406  1.00 55.61  ? 260 LEU A CG    1 
ATOM   846  C  CD1   . LEU A 1 150 ? 14.057  23.990  16.185  1.00 56.36  ? 260 LEU A CD1   1 
ATOM   847  C  CD2   . LEU A 1 150 ? 15.818  25.463  16.955  1.00 59.20  ? 260 LEU A CD2   1 
ATOM   848  N  N     . LYS A 1 151 ? 12.166  27.456  20.086  1.00 51.88  ? 261 LYS A N     1 
ATOM   849  C  CA    . LYS A 1 151 ? 11.555  28.775  20.295  1.00 51.88  ? 261 LYS A CA    1 
ATOM   850  C  C     . LYS A 1 151 ? 12.113  29.508  21.530  1.00 54.37  ? 261 LYS A C     1 
ATOM   851  O  O     . LYS A 1 151 ? 12.442  30.687  21.402  1.00 56.34  ? 261 LYS A O     1 
ATOM   852  C  CB    . LYS A 1 151 ? 10.034  28.686  20.382  1.00 55.15  ? 261 LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 151 ? 9.362   28.768  19.027  1.00 75.14  ? 261 LYS A CG    1 
ATOM   854  N  N     . THR A 1 152 ? 12.232  28.841  22.696  1.00 48.04  ? 262 THR A N     1 
ATOM   855  C  CA    . THR A 1 152 ? 12.799  29.460  23.905  1.00 46.97  ? 262 THR A CA    1 
ATOM   856  C  C     . THR A 1 152 ? 14.315  29.763  23.709  1.00 48.80  ? 262 THR A C     1 
ATOM   857  O  O     . THR A 1 152 ? 14.778  30.823  24.129  1.00 49.59  ? 262 THR A O     1 
ATOM   858  C  CB    . THR A 1 152 ? 12.545  28.590  25.134  1.00 50.72  ? 262 THR A CB    1 
ATOM   859  O  OG1   . THR A 1 152 ? 11.133  28.385  25.241  1.00 55.34  ? 262 THR A OG1   1 
ATOM   860  C  CG2   . THR A 1 152 ? 13.044  29.227  26.409  1.00 42.63  ? 262 THR A CG2   1 
ATOM   861  N  N     . ALA A 1 153 ? 15.058  28.878  23.032  1.00 41.28  ? 263 ALA A N     1 
ATOM   862  C  CA    . ALA A 1 153 ? 16.485  29.090  22.781  1.00 39.82  ? 263 ALA A CA    1 
ATOM   863  C  C     . ALA A 1 153 ? 16.683  30.324  21.887  1.00 42.60  ? 263 ALA A C     1 
ATOM   864  O  O     . ALA A 1 153 ? 17.577  31.112  22.145  1.00 40.88  ? 263 ALA A O     1 
ATOM   865  C  CB    . ALA A 1 153 ? 17.117  27.845  22.149  1.00 39.88  ? 263 ALA A CB    1 
ATOM   866  N  N     . GLU A 1 154 ? 15.827  30.496  20.865  1.00 41.50  ? 264 GLU A N     1 
ATOM   867  C  CA    . GLU A 1 154 ? 15.831  31.631  19.929  1.00 42.05  ? 264 GLU A CA    1 
ATOM   868  C  C     . GLU A 1 154 ? 15.481  32.932  20.653  1.00 44.05  ? 264 GLU A C     1 
ATOM   869  O  O     . GLU A 1 154 ? 16.109  33.946  20.408  1.00 43.00  ? 264 GLU A O     1 
ATOM   870  C  CB    . GLU A 1 154 ? 14.832  31.368  18.800  1.00 43.91  ? 264 GLU A CB    1 
ATOM   871  C  CG    . GLU A 1 154 ? 14.862  32.356  17.656  1.00 63.49  ? 264 GLU A CG    1 
ATOM   872  C  CD    . GLU A 1 154 ? 13.847  31.987  16.595  1.00 107.80 ? 264 GLU A CD    1 
ATOM   873  O  OE1   . GLU A 1 154 ? 12.697  32.470  16.696  1.00 115.26 ? 264 GLU A OE1   1 
ATOM   874  O  OE2   . GLU A 1 154 ? 14.170  31.147  15.722  1.00 109.97 ? 264 GLU A OE2   1 
ATOM   875  N  N     . LYS A 1 155 ? 14.497  32.886  21.547  1.00 40.99  ? 265 LYS A N     1 
ATOM   876  C  CA    . LYS A 1 155 ? 14.057  34.009  22.365  1.00 41.51  ? 265 LYS A CA    1 
ATOM   877  C  C     . LYS A 1 155 ? 15.221  34.516  23.233  1.00 44.85  ? 265 LYS A C     1 
ATOM   878  O  O     . LYS A 1 155 ? 15.502  35.722  23.233  1.00 45.01  ? 265 LYS A O     1 
ATOM   879  C  CB    . LYS A 1 155 ? 12.860  33.576  23.243  1.00 44.78  ? 265 LYS A CB    1 
ATOM   880  C  CG    . LYS A 1 155 ? 12.418  34.629  24.259  1.00 63.95  ? 265 LYS A CG    1 
ATOM   881  C  CD    . LYS A 1 155 ? 11.340  34.104  25.198  1.00 76.37  ? 265 LYS A CD    1 
ATOM   882  C  CE    . LYS A 1 155 ? 11.210  34.955  26.435  1.00 95.07  ? 265 LYS A CE    1 
ATOM   883  N  NZ    . LYS A 1 155 ? 9.973   34.650  27.200  1.00 108.80 ? 265 LYS A NZ    1 
ATOM   884  N  N     . TRP A 1 156 ? 15.897  33.598  23.955  1.00 40.30  ? 266 TRP A N     1 
ATOM   885  C  CA    . TRP A 1 156 ? 16.999  33.945  24.843  1.00 39.57  ? 266 TRP A CA    1 
ATOM   886  C  C     . TRP A 1 156 ? 18.178  34.510  24.071  1.00 42.19  ? 266 TRP A C     1 
ATOM   887  O  O     . TRP A 1 156 ? 18.793  35.471  24.533  1.00 41.68  ? 266 TRP A O     1 
ATOM   888  C  CB    . TRP A 1 156 ? 17.410  32.740  25.688  1.00 38.18  ? 266 TRP A CB    1 
ATOM   889  C  CG    . TRP A 1 156 ? 16.374  32.347  26.708  1.00 39.68  ? 266 TRP A CG    1 
ATOM   890  C  CD1   . TRP A 1 156 ? 15.317  33.100  27.141  1.00 42.76  ? 266 TRP A CD1   1 
ATOM   891  C  CD2   . TRP A 1 156 ? 16.332  31.122  27.466  1.00 39.22  ? 266 TRP A CD2   1 
ATOM   892  N  NE1   . TRP A 1 156 ? 14.619  32.418  28.111  1.00 42.47  ? 266 TRP A NE1   1 
ATOM   893  C  CE2   . TRP A 1 156 ? 15.233  31.212  28.344  1.00 43.58  ? 266 TRP A CE2   1 
ATOM   894  C  CE3   . TRP A 1 156 ? 17.137  29.966  27.504  1.00 40.31  ? 266 TRP A CE3   1 
ATOM   895  C  CZ2   . TRP A 1 156 ? 14.903  30.180  29.239  1.00 43.13  ? 266 TRP A CZ2   1 
ATOM   896  C  CZ3   . TRP A 1 156 ? 16.808  28.944  28.384  1.00 41.98  ? 266 TRP A CZ3   1 
ATOM   897  C  CH2   . TRP A 1 156 ? 15.695  29.047  29.228  1.00 42.60  ? 266 TRP A CH2   1 
ATOM   898  N  N     . PHE A 1 157 ? 18.470  33.954  22.880  1.00 37.47  ? 267 PHE A N     1 
ATOM   899  C  CA    . PHE A 1 157 ? 19.561  34.425  22.029  1.00 35.51  ? 267 PHE A CA    1 
ATOM   900  C  C     . PHE A 1 157 ? 19.296  35.873  21.577  1.00 41.60  ? 267 PHE A C     1 
ATOM   901  O  O     . PHE A 1 157 ? 20.185  36.718  21.679  1.00 43.67  ? 267 PHE A O     1 
ATOM   902  C  CB    . PHE A 1 157 ? 19.771  33.483  20.829  1.00 35.21  ? 267 PHE A CB    1 
ATOM   903  C  CG    . PHE A 1 157 ? 20.828  33.937  19.840  1.00 34.25  ? 267 PHE A CG    1 
ATOM   904  C  CD1   . PHE A 1 157 ? 22.177  33.693  20.076  1.00 35.47  ? 267 PHE A CD1   1 
ATOM   905  C  CD2   . PHE A 1 157 ? 20.473  34.603  18.669  1.00 33.02  ? 267 PHE A CD2   1 
ATOM   906  C  CE1   . PHE A 1 157 ? 23.149  34.072  19.135  1.00 36.39  ? 267 PHE A CE1   1 
ATOM   907  C  CE2   . PHE A 1 157 ? 21.437  34.961  17.732  1.00 33.89  ? 267 PHE A CE2   1 
ATOM   908  C  CZ    . PHE A 1 157 ? 22.771  34.718  17.978  1.00 32.14  ? 267 PHE A CZ    1 
ATOM   909  N  N     . ARG A 1 158 ? 18.077  36.172  21.133  1.00 39.16  ? 268 ARG A N     1 
ATOM   910  C  CA    . ARG A 1 158 ? 17.700  37.525  20.678  1.00 38.65  ? 268 ARG A CA    1 
ATOM   911  C  C     . ARG A 1 158 ? 17.567  38.527  21.864  1.00 41.97  ? 268 ARG A C     1 
ATOM   912  O  O     . ARG A 1 158 ? 17.531  39.736  21.646  1.00 40.57  ? 268 ARG A O     1 
ATOM   913  C  CB    . ARG A 1 158 ? 16.421  37.469  19.865  1.00 41.29  ? 268 ARG A CB    1 
ATOM   914  C  CG    . ARG A 1 158 ? 16.604  36.822  18.485  1.00 54.48  ? 268 ARG A CG    1 
ATOM   915  C  CD    . ARG A 1 158 ? 15.265  36.720  17.762  1.00 64.74  ? 268 ARG A CD    1 
ATOM   916  N  NE    . ARG A 1 158 ? 15.389  36.052  16.472  1.00 75.48  ? 268 ARG A NE    1 
ATOM   917  N  N     . MET A 1 159 ? 17.537  38.027  23.118  1.00 38.01  ? 269 MET A N     1 
ATOM   918  C  CA    . MET A 1 159 ? 17.576  38.873  24.311  1.00 35.92  ? 269 MET A CA    1 
ATOM   919  C  C     . MET A 1 159 ? 19.023  39.190  24.684  1.00 42.67  ? 269 MET A C     1 
ATOM   920  O  O     . MET A 1 159 ? 19.255  40.020  25.569  1.00 44.79  ? 269 MET A O     1 
ATOM   921  C  CB    . MET A 1 159 ? 16.865  38.222  25.476  1.00 38.11  ? 269 MET A CB    1 
ATOM   922  C  CG    . MET A 1 159 ? 15.353  38.319  25.386  1.00 42.41  ? 269 MET A CG    1 
ATOM   923  S  SD    . MET A 1 159 ? 14.589  37.378  26.711  1.00 47.19  ? 269 MET A SD    1 
ATOM   924  C  CE    . MET A 1 159 ? 14.533  38.626  27.983  1.00 44.09  ? 269 MET A CE    1 
ATOM   925  N  N     . GLY A 1 160 ? 19.979  38.528  24.027  1.00 37.34  ? 270 GLY A N     1 
ATOM   926  C  CA    . GLY A 1 160 ? 21.406  38.740  24.256  1.00 36.10  ? 270 GLY A CA    1 
ATOM   927  C  C     . GLY A 1 160 ? 22.071  37.773  25.209  1.00 41.35  ? 270 GLY A C     1 
ATOM   928  O  O     . GLY A 1 160 ? 23.243  37.972  25.567  1.00 42.43  ? 270 GLY A O     1 
ATOM   929  N  N     . PHE A 1 161 ? 21.350  36.711  25.640  1.00 39.15  ? 271 PHE A N     1 
ATOM   930  C  CA    . PHE A 1 161 ? 21.928  35.692  26.524  1.00 38.90  ? 271 PHE A CA    1 
ATOM   931  C  C     . PHE A 1 161 ? 22.840  34.763  25.748  1.00 41.87  ? 271 PHE A C     1 
ATOM   932  O  O     . PHE A 1 161 ? 22.517  34.398  24.602  1.00 38.93  ? 271 PHE A O     1 
ATOM   933  C  CB    . PHE A 1 161 ? 20.848  34.870  27.215  1.00 40.70  ? 271 PHE A CB    1 
ATOM   934  C  CG    . PHE A 1 161 ? 20.005  35.649  28.184  1.00 41.75  ? 271 PHE A CG    1 
ATOM   935  C  CD1   . PHE A 1 161 ? 20.494  35.987  29.441  1.00 44.01  ? 271 PHE A CD1   1 
ATOM   936  C  CD2   . PHE A 1 161 ? 18.694  35.990  27.867  1.00 42.54  ? 271 PHE A CD2   1 
ATOM   937  C  CE1   . PHE A 1 161 ? 19.700  36.691  30.347  1.00 45.08  ? 271 PHE A CE1   1 
ATOM   938  C  CE2   . PHE A 1 161 ? 17.904  36.697  28.770  1.00 45.55  ? 271 PHE A CE2   1 
ATOM   939  C  CZ    . PHE A 1 161 ? 18.403  37.025  30.016  1.00 44.11  ? 271 PHE A CZ    1 
ATOM   940  N  N     . ARG A 1 162 ? 23.989  34.388  26.366  1.00 39.26  ? 272 ARG A N     1 
ATOM   941  C  CA    . ARG A 1 162 ? 24.963  33.473  25.756  1.00 38.23  ? 272 ARG A CA    1 
ATOM   942  C  C     . ARG A 1 162 ? 25.387  32.354  26.706  1.00 44.51  ? 272 ARG A C     1 
ATOM   943  O  O     . ARG A 1 162 ? 26.023  31.386  26.266  1.00 46.14  ? 272 ARG A O     1 
ATOM   944  C  CB    . ARG A 1 162 ? 26.213  34.237  25.280  1.00 36.29  ? 272 ARG A CB    1 
ATOM   945  C  CG    . ARG A 1 162 ? 25.968  35.213  24.147  1.00 39.92  ? 272 ARG A CG    1 
ATOM   946  C  CD    . ARG A 1 162 ? 25.368  34.580  22.920  1.00 33.01  ? 272 ARG A CD    1 
ATOM   947  N  NE    . ARG A 1 162 ? 25.192  35.532  21.821  1.00 32.38  ? 272 ARG A NE    1 
ATOM   948  C  CZ    . ARG A 1 162 ? 24.082  36.224  21.566  1.00 36.58  ? 272 ARG A CZ    1 
ATOM   949  N  NH1   . ARG A 1 162 ? 24.016  37.006  20.508  1.00 32.08  ? 272 ARG A NH1   1 
ATOM   950  N  NH2   . ARG A 1 162 ? 23.015  36.098  22.341  1.00 30.14  ? 272 ARG A NH2   1 
ATOM   951  N  N     . THR A 1 163 ? 25.134  32.502  28.011  1.00 40.75  ? 273 THR A N     1 
ATOM   952  C  CA    . THR A 1 163 ? 25.556  31.471  28.971  1.00 40.81  ? 273 THR A CA    1 
ATOM   953  C  C     . THR A 1 163 ? 24.374  31.054  29.850  1.00 44.53  ? 273 THR A C     1 
ATOM   954  O  O     . THR A 1 163 ? 23.450  31.834  30.055  1.00 44.62  ? 273 THR A O     1 
ATOM   955  C  CB    . THR A 1 163 ? 26.759  31.912  29.820  1.00 45.94  ? 273 THR A CB    1 
ATOM   956  O  OG1   . THR A 1 163 ? 26.338  32.878  30.776  1.00 45.79  ? 273 THR A OG1   1 
ATOM   957  C  CG2   . THR A 1 163 ? 27.900  32.485  28.986  1.00 48.45  ? 273 THR A CG2   1 
ATOM   958  N  N     . LEU A 1 164 ? 24.404  29.826  30.360  1.00 39.97  ? 274 LEU A N     1 
ATOM   959  C  CA    . LEU A 1 164 ? 23.348  29.304  31.223  1.00 38.58  ? 274 LEU A CA    1 
ATOM   960  C  C     . LEU A 1 164 ? 23.389  29.993  32.570  1.00 38.77  ? 274 LEU A C     1 
ATOM   961  O  O     . LEU A 1 164 ? 22.351  30.173  33.169  1.00 39.27  ? 274 LEU A O     1 
ATOM   962  C  CB    . LEU A 1 164 ? 23.462  27.780  31.381  1.00 38.76  ? 274 LEU A CB    1 
ATOM   963  C  CG    . LEU A 1 164 ? 23.162  26.929  30.127  1.00 44.47  ? 274 LEU A CG    1 
ATOM   964  C  CD1   . LEU A 1 164 ? 23.292  25.447  30.449  1.00 45.70  ? 274 LEU A CD1   1 
ATOM   965  C  CD2   . LEU A 1 164 ? 21.783  27.247  29.533  1.00 43.79  ? 274 LEU A CD2   1 
ATOM   966  N  N     . SER A 1 165 ? 24.566  30.386  33.040  1.00 36.11  ? 275 SER A N     1 
ATOM   967  C  CA    . SER A 1 165 ? 24.732  31.137  34.305  1.00 37.31  ? 275 SER A CA    1 
ATOM   968  C  C     . SER A 1 165 ? 23.958  32.459  34.267  1.00 40.07  ? 275 SER A C     1 
ATOM   969  O  O     . SER A 1 165 ? 23.300  32.808  35.239  1.00 39.75  ? 275 SER A O     1 
ATOM   970  C  CB    . SER A 1 165 ? 26.214  31.422  34.553  1.00 40.51  ? 275 SER A CB    1 
ATOM   971  O  OG    . SER A 1 165 ? 26.351  32.123  35.776  1.00 53.91  ? 275 SER A OG    1 
ATOM   972  N  N     . LYS A 1 166 ? 24.021  33.175  33.119  1.00 37.80  ? 276 LYS A N     1 
ATOM   973  C  CA    . LYS A 1 166 ? 23.345  34.450  32.946  1.00 37.89  ? 276 LYS A CA    1 
ATOM   974  C  C     . LYS A 1 166 ? 21.842  34.240  32.816  1.00 40.22  ? 276 LYS A C     1 
ATOM   975  O  O     . LYS A 1 166 ? 21.076  35.083  33.273  1.00 39.06  ? 276 LYS A O     1 
ATOM   976  C  CB    . LYS A 1 166 ? 23.915  35.241  31.751  1.00 40.85  ? 276 LYS A CB    1 
ATOM   977  C  CG    . LYS A 1 166 ? 25.322  35.810  31.969  1.00 50.58  ? 276 LYS A CG    1 
ATOM   978  C  CD    . LYS A 1 166 ? 25.337  37.223  32.543  1.00 61.90  ? 276 LYS A CD    1 
ATOM   979  C  CE    . LYS A 1 166 ? 26.698  37.852  32.434  1.00 69.14  ? 276 LYS A CE    1 
ATOM   980  N  NZ    . LYS A 1 166 ? 26.960  38.386  31.065  1.00 80.94  ? 276 LYS A NZ    1 
ATOM   981  N  N     . ILE A 1 167 ? 21.405  33.129  32.220  1.00 37.86  ? 277 ILE A N     1 
ATOM   982  C  CA    . ILE A 1 167 ? 19.961  32.833  32.104  1.00 36.28  ? 277 ILE A CA    1 
ATOM   983  C  C     . ILE A 1 167 ? 19.357  32.529  33.495  1.00 39.28  ? 277 ILE A C     1 
ATOM   984  O  O     . ILE A 1 167 ? 18.355  33.126  33.871  1.00 38.07  ? 277 ILE A O     1 
ATOM   985  C  CB    . ILE A 1 167 ? 19.707  31.690  31.091  1.00 38.53  ? 277 ILE A CB    1 
ATOM   986  C  CG1   . ILE A 1 167 ? 19.963  32.215  29.676  1.00 38.91  ? 277 ILE A CG1   1 
ATOM   987  C  CG2   . ILE A 1 167 ? 18.262  31.097  31.219  1.00 38.60  ? 277 ILE A CG2   1 
ATOM   988  C  CD1   . ILE A 1 167 ? 20.418  31.178  28.737  1.00 37.92  ? 277 ILE A CD1   1 
ATOM   989  N  N     . GLN A 1 168 ? 19.970  31.627  34.232  1.00 39.34  ? 278 GLN A N     1 
ATOM   990  C  CA    . GLN A 1 168 ? 19.500  31.177  35.553  1.00 41.38  ? 278 GLN A CA    1 
ATOM   991  C  C     . GLN A 1 168 ? 19.441  32.276  36.587  1.00 43.94  ? 278 GLN A C     1 
ATOM   992  O  O     . GLN A 1 168 ? 18.590  32.213  37.452  1.00 42.02  ? 278 GLN A O     1 
ATOM   993  C  CB    . GLN A 1 168 ? 20.444  30.098  36.107  1.00 43.09  ? 278 GLN A CB    1 
ATOM   994  C  CG    . GLN A 1 168 ? 20.143  28.713  35.673  1.00 56.21  ? 278 GLN A CG    1 
ATOM   995  C  CD    . GLN A 1 168 ? 21.240  27.768  36.128  1.00 74.89  ? 278 GLN A CD    1 
ATOM   996  O  OE1   . GLN A 1 168 ? 22.322  27.687  35.529  1.00 72.26  ? 278 GLN A OE1   1 
ATOM   997  N  NE2   . GLN A 1 168 ? 21.031  27.096  37.250  1.00 63.02  ? 278 GLN A NE2   1 
ATOM   998  N  N     . SER A 1 169 ? 20.415  33.208  36.564  1.00 41.29  ? 279 SER A N     1 
ATOM   999  C  CA    . SER A 1 169 ? 20.522  34.260  37.553  1.00 40.69  ? 279 SER A CA    1 
ATOM   1000 C  C     . SER A 1 169 ? 19.723  35.510  37.179  1.00 44.57  ? 279 SER A C     1 
ATOM   1001 O  O     . SER A 1 169 ? 19.623  36.405  38.013  1.00 42.09  ? 279 SER A O     1 
ATOM   1002 C  CB    . SER A 1 169 ? 21.980  34.630  37.775  1.00 42.70  ? 279 SER A CB    1 
ATOM   1003 O  OG    . SER A 1 169 ? 22.582  35.083  36.574  1.00 48.45  ? 279 SER A OG    1 
ATOM   1004 N  N     . ASP A 1 170 ? 19.141  35.580  35.958  1.00 41.19  ? 280 ASP A N     1 
ATOM   1005 C  CA    . ASP A 1 170 ? 18.347  36.732  35.541  1.00 40.32  ? 280 ASP A CA    1 
ATOM   1006 C  C     . ASP A 1 170 ? 17.086  36.850  36.414  1.00 48.24  ? 280 ASP A C     1 
ATOM   1007 O  O     . ASP A 1 170 ? 16.423  35.840  36.674  1.00 48.14  ? 280 ASP A O     1 
ATOM   1008 C  CB    . ASP A 1 170 ? 17.963  36.615  34.080  1.00 41.62  ? 280 ASP A CB    1 
ATOM   1009 C  CG    . ASP A 1 170 ? 17.497  37.936  33.519  1.00 54.66  ? 280 ASP A CG    1 
ATOM   1010 O  OD1   . ASP A 1 170 ? 16.271  38.219  33.589  1.00 55.36  ? 280 ASP A OD1   1 
ATOM   1011 O  OD2   . ASP A 1 170 ? 18.349  38.693  33.009  1.00 58.41  ? 280 ASP A OD2   1 
ATOM   1012 N  N     . LYS A 1 171 ? 16.778  38.068  36.907  1.00 45.69  ? 281 LYS A N     1 
ATOM   1013 C  CA    . LYS A 1 171 ? 15.653  38.245  37.820  1.00 45.41  ? 281 LYS A CA    1 
ATOM   1014 C  C     . LYS A 1 171 ? 14.340  38.588  37.092  1.00 47.67  ? 281 LYS A C     1 
ATOM   1015 O  O     . LYS A 1 171 ? 13.303  38.564  37.741  1.00 48.78  ? 281 LYS A O     1 
ATOM   1016 C  CB    . LYS A 1 171 ? 15.996  39.297  38.897  1.00 48.05  ? 281 LYS A CB    1 
ATOM   1017 C  CG    . LYS A 1 171 ? 17.183  38.894  39.797  1.00 44.67  ? 281 LYS A CG    1 
ATOM   1018 C  CD    . LYS A 1 171 ? 16.862  37.692  40.723  1.00 47.78  ? 281 LYS A CD    1 
ATOM   1019 C  CE    . LYS A 1 171 ? 18.117  37.069  41.298  1.00 65.06  ? 281 LYS A CE    1 
ATOM   1020 N  NZ    . LYS A 1 171 ? 17.821  36.139  42.422  1.00 76.97  ? 281 LYS A NZ    1 
ATOM   1021 N  N     . SER A 1 172 ? 14.365  38.804  35.755  1.00 41.54  ? 282 SER A N     1 
ATOM   1022 C  CA    . SER A 1 172 ? 13.156  39.101  34.978  1.00 41.52  ? 282 SER A CA    1 
ATOM   1023 C  C     . SER A 1 172 ? 12.586  37.870  34.279  1.00 45.05  ? 282 SER A C     1 
ATOM   1024 O  O     . SER A 1 172 ? 11.380  37.810  34.094  1.00 44.56  ? 282 SER A O     1 
ATOM   1025 C  CB    . SER A 1 172 ? 13.424  40.198  33.951  1.00 45.52  ? 282 SER A CB    1 
ATOM   1026 O  OG    . SER A 1 172 ? 13.767  41.396  34.628  1.00 57.58  ? 282 SER A OG    1 
ATOM   1027 N  N     . LEU A 1 173 ? 13.435  36.890  33.919  1.00 41.02  ? 283 LEU A N     1 
ATOM   1028 C  CA    . LEU A 1 173 ? 13.030  35.663  33.228  1.00 40.09  ? 283 LEU A CA    1 
ATOM   1029 C  C     . LEU A 1 173 ? 12.083  34.796  34.046  1.00 44.65  ? 283 LEU A C     1 
ATOM   1030 O  O     . LEU A 1 173 ? 12.238  34.679  35.273  1.00 44.89  ? 283 LEU A O     1 
ATOM   1031 C  CB    . LEU A 1 173 ? 14.258  34.823  32.834  1.00 39.27  ? 283 LEU A CB    1 
ATOM   1032 C  CG    . LEU A 1 173 ? 15.107  35.283  31.649  1.00 41.77  ? 283 LEU A CG    1 
ATOM   1033 C  CD1   . LEU A 1 173 ? 16.127  34.246  31.321  1.00 40.80  ? 283 LEU A CD1   1 
ATOM   1034 C  CD2   . LEU A 1 173 ? 14.270  35.530  30.390  1.00 41.40  ? 283 LEU A CD2   1 
ATOM   1035 N  N     . ARG A 1 174 ? 11.097  34.190  33.351  1.00 40.33  ? 284 ARG A N     1 
ATOM   1036 C  CA    . ARG A 1 174 ? 10.122  33.287  33.958  1.00 40.51  ? 284 ARG A CA    1 
ATOM   1037 C  C     . ARG A 1 174 ? 10.287  31.936  33.319  1.00 45.82  ? 284 ARG A C     1 
ATOM   1038 O  O     . ARG A 1 174 ? 10.367  31.816  32.083  1.00 46.57  ? 284 ARG A O     1 
ATOM   1039 C  CB    . ARG A 1 174 ? 8.679   33.807  33.837  1.00 42.96  ? 284 ARG A CB    1 
ATOM   1040 C  CG    . ARG A 1 174 ? 8.400   35.032  34.701  1.00 57.27  ? 284 ARG A CG    1 
ATOM   1041 C  CD    . ARG A 1 174 ? 6.914   35.370  34.824  1.00 78.84  ? 284 ARG A CD    1 
ATOM   1042 N  NE    . ARG A 1 174 ? 6.244   35.580  33.533  1.00 92.56  ? 284 ARG A NE    1 
ATOM   1043 C  CZ    . ARG A 1 174 ? 6.160   36.750  32.904  1.00 106.69 ? 284 ARG A CZ    1 
ATOM   1044 N  NH1   . ARG A 1 174 ? 6.711   37.838  33.431  1.00 92.91  ? 284 ARG A NH1   1 
ATOM   1045 N  NH2   . ARG A 1 174 ? 5.532   36.838  31.738  1.00 91.97  ? 284 ARG A NH2   1 
ATOM   1046 N  N     . PHE A 1 175 ? 10.404  30.913  34.161  1.00 42.50  ? 285 PHE A N     1 
ATOM   1047 C  CA    . PHE A 1 175 ? 10.656  29.554  33.674  1.00 41.74  ? 285 PHE A CA    1 
ATOM   1048 C  C     . PHE A 1 175 ? 9.476   28.625  33.883  1.00 46.00  ? 285 PHE A C     1 
ATOM   1049 O  O     . PHE A 1 175 ? 8.814   28.698  34.922  1.00 46.65  ? 285 PHE A O     1 
ATOM   1050 C  CB    . PHE A 1 175 ? 11.885  28.966  34.388  1.00 42.49  ? 285 PHE A CB    1 
ATOM   1051 C  CG    . PHE A 1 175 ? 13.129  29.801  34.270  1.00 43.64  ? 285 PHE A CG    1 
ATOM   1052 C  CD1   . PHE A 1 175 ? 13.480  30.703  35.273  1.00 46.90  ? 285 PHE A CD1   1 
ATOM   1053 C  CD2   . PHE A 1 175 ? 13.943  29.707  33.148  1.00 44.69  ? 285 PHE A CD2   1 
ATOM   1054 C  CE1   . PHE A 1 175 ? 14.628  31.497  35.149  1.00 47.83  ? 285 PHE A CE1   1 
ATOM   1055 C  CE2   . PHE A 1 175 ? 15.080  30.503  33.025  1.00 47.04  ? 285 PHE A CE2   1 
ATOM   1056 C  CZ    . PHE A 1 175 ? 15.424  31.381  34.029  1.00 45.41  ? 285 PHE A CZ    1 
ATOM   1057 N  N     . THR A 1 176 ? 9.268   27.689  32.928  1.00 40.99  ? 286 THR A N     1 
ATOM   1058 C  CA    . THR A 1 176 ? 8.242   26.644  33.036  1.00 39.72  ? 286 THR A CA    1 
ATOM   1059 C  C     . THR A 1 176 ? 8.708   25.625  34.103  1.00 42.00  ? 286 THR A C     1 
ATOM   1060 O  O     . THR A 1 176 ? 9.889   25.581  34.414  1.00 42.63  ? 286 THR A O     1 
ATOM   1061 C  CB    . THR A 1 176 ? 7.958   25.966  31.680  1.00 36.52  ? 286 THR A CB    1 
ATOM   1062 O  OG1   . THR A 1 176 ? 9.095   25.225  31.270  1.00 42.60  ? 286 THR A OG1   1 
ATOM   1063 C  CG2   . THR A 1 176 ? 7.538   26.935  30.599  1.00 29.25  ? 286 THR A CG2   1 
ATOM   1064 N  N     . GLN A 1 177 ? 7.807   24.829  34.657  1.00 39.01  ? 287 GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 177 ? 8.156   23.823  35.667  1.00 40.82  ? 287 GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 177 ? 9.179   22.801  35.107  1.00 45.29  ? 287 GLN A C     1 
ATOM   1067 O  O     . GLN A 1 177 ? 10.090  22.379  35.829  1.00 43.09  ? 287 GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 177 ? 6.885   23.122  36.186  1.00 43.03  ? 287 GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 177 ? 6.887   22.883  37.707  1.00 64.27  ? 287 GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 177 ? 7.003   24.118  38.573  1.00 78.48  ? 287 GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 177 ? 6.596   25.227  38.211  1.00 71.96  ? 287 GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 177 ? 7.540   23.936  39.766  1.00 73.99  ? 287 GLN A NE2   1 
ATOM   1073 N  N     . MET A 1 178 ? 9.075   22.485  33.792  1.00 43.67  ? 288 MET A N     1 
ATOM   1074 C  CA    . MET A 1 178 ? 9.997   21.604  33.072  1.00 43.31  ? 288 MET A CA    1 
ATOM   1075 C  C     . MET A 1 178 ? 11.423  22.205  33.061  1.00 43.76  ? 288 MET A C     1 
ATOM   1076 O  O     . MET A 1 178 ? 12.379  21.508  33.410  1.00 43.48  ? 288 MET A O     1 
ATOM   1077 C  CB    . MET A 1 178 ? 9.474   21.366  31.639  1.00 46.30  ? 288 MET A CB    1 
ATOM   1078 C  CG    . MET A 1 178 ? 9.933   20.048  31.049  1.00 50.94  ? 288 MET A CG    1 
ATOM   1079 S  SD    . MET A 1 178 ? 9.503   19.732  29.313  1.00 56.07  ? 288 MET A SD    1 
ATOM   1080 C  CE    . MET A 1 178 ? 7.723   19.878  29.393  1.00 53.60  ? 288 MET A CE    1 
ATOM   1081 N  N     . GLN A 1 179 ? 11.551  23.514  32.751  1.00 39.02  ? 289 GLN A N     1 
ATOM   1082 C  CA    . GLN A 1 179 ? 12.836  24.255  32.723  1.00 37.61  ? 289 GLN A CA    1 
ATOM   1083 C  C     . GLN A 1 179 ? 13.467  24.386  34.112  1.00 39.16  ? 289 GLN A C     1 
ATOM   1084 O  O     . GLN A 1 179 ? 14.682  24.243  34.240  1.00 37.99  ? 289 GLN A O     1 
ATOM   1085 C  CB    . GLN A 1 179 ? 12.647  25.630  32.109  1.00 38.66  ? 289 GLN A CB    1 
ATOM   1086 C  CG    . GLN A 1 179 ? 12.320  25.578  30.620  1.00 41.51  ? 289 GLN A CG    1 
ATOM   1087 C  CD    . GLN A 1 179 ? 11.692  26.856  30.134  1.00 52.28  ? 289 GLN A CD    1 
ATOM   1088 O  OE1   . GLN A 1 179 ? 11.524  27.823  30.887  1.00 49.25  ? 289 GLN A OE1   1 
ATOM   1089 N  NE2   . GLN A 1 179 ? 11.374  26.906  28.843  1.00 30.73  ? 289 GLN A NE2   1 
ATOM   1090 N  N     . LYS A 1 180 ? 12.649  24.619  35.148  1.00 37.56  ? 290 LYS A N     1 
ATOM   1091 C  CA    . LYS A 1 180 ? 13.107  24.674  36.552  1.00 38.47  ? 290 LYS A CA    1 
ATOM   1092 C  C     . LYS A 1 180 ? 13.807  23.361  36.927  1.00 43.36  ? 290 LYS A C     1 
ATOM   1093 O  O     . LYS A 1 180 ? 14.921  23.388  37.462  1.00 43.70  ? 290 LYS A O     1 
ATOM   1094 C  CB    . LYS A 1 180 ? 11.937  24.951  37.509  1.00 41.05  ? 290 LYS A CB    1 
ATOM   1095 C  CG    . LYS A 1 180 ? 11.439  26.388  37.478  1.00 53.77  ? 290 LYS A CG    1 
ATOM   1096 C  CD    . LYS A 1 180 ? 10.271  26.586  38.422  1.00 63.59  ? 290 LYS A CD    1 
ATOM   1097 C  CE    . LYS A 1 180 ? 9.679   27.964  38.274  1.00 76.59  ? 290 LYS A CE    1 
ATOM   1098 N  NZ    . LYS A 1 180 ? 8.584   28.205  39.247  1.00 88.80  ? 290 LYS A NZ    1 
ATOM   1099 N  N     . ALA A 1 181 ? 13.186  22.212  36.564  1.00 40.34  ? 291 ALA A N     1 
ATOM   1100 C  CA    . ALA A 1 181 ? 13.747  20.867  36.767  1.00 38.94  ? 291 ALA A CA    1 
ATOM   1101 C  C     . ALA A 1 181 ? 14.994  20.686  35.900  1.00 41.15  ? 291 ALA A C     1 
ATOM   1102 O  O     . ALA A 1 181 ? 15.990  20.166  36.377  1.00 39.92  ? 291 ALA A O     1 
ATOM   1103 C  CB    . ALA A 1 181 ? 12.702  19.806  36.446  1.00 39.01  ? 291 ALA A CB    1 
ATOM   1104 N  N     . GLY A 1 182 ? 14.949  21.177  34.661  1.00 39.38  ? 292 GLY A N     1 
ATOM   1105 C  CA    . GLY A 1 182 ? 16.080  21.158  33.738  1.00 38.92  ? 292 GLY A CA    1 
ATOM   1106 C  C     . GLY A 1 182 ? 17.309  21.864  34.290  1.00 45.65  ? 292 GLY A C     1 
ATOM   1107 O  O     . GLY A 1 182 ? 18.431  21.376  34.130  1.00 48.21  ? 292 GLY A O     1 
ATOM   1108 N  N     . PHE A 1 183 ? 17.109  23.007  34.974  1.00 39.94  ? 293 PHE A N     1 
ATOM   1109 C  CA    . PHE A 1 183 ? 18.206  23.756  35.586  1.00 36.54  ? 293 PHE A CA    1 
ATOM   1110 C  C     . PHE A 1 183 ? 18.632  23.147  36.909  1.00 39.92  ? 293 PHE A C     1 
ATOM   1111 O  O     . PHE A 1 183 ? 19.833  23.103  37.184  1.00 40.64  ? 293 PHE A O     1 
ATOM   1112 C  CB    . PHE A 1 183 ? 17.830  25.250  35.794  1.00 36.23  ? 293 PHE A CB    1 
ATOM   1113 C  CG    . PHE A 1 183 ? 17.950  26.074  34.547  1.00 35.61  ? 293 PHE A CG    1 
ATOM   1114 C  CD1   . PHE A 1 183 ? 16.835  26.654  33.974  1.00 38.10  ? 293 PHE A CD1   1 
ATOM   1115 C  CD2   . PHE A 1 183 ? 19.166  26.202  33.894  1.00 37.25  ? 293 PHE A CD2   1 
ATOM   1116 C  CE1   . PHE A 1 183 ? 16.940  27.387  32.793  1.00 38.86  ? 293 PHE A CE1   1 
ATOM   1117 C  CE2   . PHE A 1 183 ? 19.278  26.968  32.732  1.00 39.19  ? 293 PHE A CE2   1 
ATOM   1118 C  CZ    . PHE A 1 183 ? 18.166  27.554  32.191  1.00 36.68  ? 293 PHE A CZ    1 
ATOM   1119 N  N     . LEU A 1 184 ? 17.672  22.723  37.750  1.00 37.55  ? 294 LEU A N     1 
ATOM   1120 C  CA    . LEU A 1 184 ? 17.999  22.158  39.073  1.00 38.95  ? 294 LEU A CA    1 
ATOM   1121 C  C     . LEU A 1 184 ? 18.830  20.866  38.970  1.00 45.88  ? 294 LEU A C     1 
ATOM   1122 O  O     . LEU A 1 184 ? 19.740  20.669  39.775  1.00 47.36  ? 294 LEU A O     1 
ATOM   1123 C  CB    . LEU A 1 184 ? 16.716  21.901  39.889  1.00 38.88  ? 294 LEU A CB    1 
ATOM   1124 C  CG    . LEU A 1 184 ? 16.889  21.396  41.346  1.00 43.25  ? 294 LEU A CG    1 
ATOM   1125 C  CD1   . LEU A 1 184 ? 17.815  22.304  42.186  1.00 42.20  ? 294 LEU A CD1   1 
ATOM   1126 C  CD2   . LEU A 1 184 ? 15.540  21.201  42.023  1.00 44.90  ? 294 LEU A CD2   1 
ATOM   1127 N  N     . TYR A 1 185 ? 18.529  20.003  37.974  1.00 41.73  ? 295 TYR A N     1 
ATOM   1128 C  CA    . TYR A 1 185 ? 19.209  18.711  37.801  1.00 40.81  ? 295 TYR A CA    1 
ATOM   1129 C  C     . TYR A 1 185 ? 20.109  18.706  36.562  1.00 44.96  ? 295 TYR A C     1 
ATOM   1130 O  O     . TYR A 1 185 ? 20.449  17.641  36.072  1.00 46.25  ? 295 TYR A O     1 
ATOM   1131 C  CB    . TYR A 1 185 ? 18.128  17.610  37.705  1.00 40.86  ? 295 TYR A CB    1 
ATOM   1132 C  CG    . TYR A 1 185 ? 17.158  17.611  38.880  1.00 39.40  ? 295 TYR A CG    1 
ATOM   1133 C  CD1   . TYR A 1 185 ? 15.814  17.913  38.698  1.00 40.75  ? 295 TYR A CD1   1 
ATOM   1134 C  CD2   . TYR A 1 185 ? 17.608  17.391  40.186  1.00 38.72  ? 295 TYR A CD2   1 
ATOM   1135 C  CE1   . TYR A 1 185 ? 14.931  17.973  39.777  1.00 41.24  ? 295 TYR A CE1   1 
ATOM   1136 C  CE2   . TYR A 1 185 ? 16.738  17.453  41.272  1.00 38.37  ? 295 TYR A CE2   1 
ATOM   1137 C  CZ    . TYR A 1 185 ? 15.397  17.733  41.062  1.00 50.39  ? 295 TYR A CZ    1 
ATOM   1138 O  OH    . TYR A 1 185 ? 14.507  17.751  42.120  1.00 54.20  ? 295 TYR A OH    1 
ATOM   1139 N  N     . TYR A 1 186 ? 20.522  19.900  36.079  1.00 40.26  ? 296 TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 186 ? 21.319  20.083  34.867  1.00 38.38  ? 296 TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 186 ? 22.563  19.169  34.773  1.00 44.24  ? 296 TYR A C     1 
ATOM   1142 O  O     . TYR A 1 186 ? 22.721  18.498  33.750  1.00 45.54  ? 296 TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 186 ? 21.736  21.573  34.666  1.00 36.38  ? 296 TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 186 ? 22.423  21.791  33.328  1.00 33.51  ? 296 TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 186 ? 21.683  21.910  32.152  1.00 34.38  ? 296 TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 186 ? 23.810  21.793  33.226  1.00 32.74  ? 296 TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 186 ? 22.310  22.004  30.910  1.00 30.49  ? 296 TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 186 ? 24.446  21.910  31.991  1.00 32.06  ? 296 TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 186 ? 23.687  21.977  30.835  1.00 32.07  ? 296 TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 186 ? 24.305  22.096  29.623  1.00 34.83  ? 296 TYR A OH    1 
ATOM   1151 N  N     . GLU A 1 187 ? 23.466  19.207  35.768  1.00 41.73  ? 297 GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 187 ? 24.726  18.465  35.712  1.00 42.16  ? 297 GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 187 ? 24.508  16.949  35.586  1.00 45.69  ? 297 GLU A C     1 
ATOM   1154 O  O     . GLU A 1 187 ? 25.176  16.320  34.783  1.00 46.60  ? 297 GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 187 ? 25.618  18.775  36.915  1.00 44.45  ? 297 GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 187 ? 26.140  20.195  36.970  1.00 64.01  ? 297 GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 187 ? 26.070  20.738  38.380  1.00 102.95 ? 297 GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 187 ? 26.930  20.350  39.204  1.00 106.86 ? 297 GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 187 ? 25.119  21.495  38.680  1.00 108.40 ? 297 GLU A OE2   1 
ATOM   1160 N  N     . ASP A 1 188 ? 23.548  16.382  36.324  1.00 41.36  ? 298 ASP A N     1 
ATOM   1161 C  CA    . ASP A 1 188 ? 23.178  14.961  36.255  1.00 38.54  ? 298 ASP A CA    1 
ATOM   1162 C  C     . ASP A 1 188 ? 22.583  14.610  34.890  1.00 40.84  ? 298 ASP A C     1 
ATOM   1163 O  O     . ASP A 1 188 ? 22.983  13.615  34.301  1.00 40.12  ? 298 ASP A O     1 
ATOM   1164 C  CB    . ASP A 1 188 ? 22.172  14.625  37.352  1.00 38.59  ? 298 ASP A CB    1 
ATOM   1165 C  CG    . ASP A 1 188 ? 22.786  14.366  38.714  1.00 53.41  ? 298 ASP A CG    1 
ATOM   1166 O  OD1   . ASP A 1 188 ? 24.034  14.364  38.817  1.00 54.22  ? 298 ASP A OD1   1 
ATOM   1167 O  OD2   . ASP A 1 188 ? 22.019  14.102  39.670  1.00 60.18  ? 298 ASP A OD2   1 
ATOM   1168 N  N     . LEU A 1 189 ? 21.663  15.430  34.379  1.00 35.89  ? 299 LEU A N     1 
ATOM   1169 C  CA    . LEU A 1 189 ? 21.014  15.196  33.091  1.00 35.36  ? 299 LEU A CA    1 
ATOM   1170 C  C     . LEU A 1 189 ? 21.978  15.352  31.899  1.00 41.85  ? 299 LEU A C     1 
ATOM   1171 O  O     . LEU A 1 189 ? 21.781  14.701  30.878  1.00 41.76  ? 299 LEU A O     1 
ATOM   1172 C  CB    . LEU A 1 189 ? 19.801  16.111  32.910  1.00 34.22  ? 299 LEU A CB    1 
ATOM   1173 C  CG    . LEU A 1 189 ? 18.623  15.953  33.907  1.00 38.30  ? 299 LEU A CG    1 
ATOM   1174 C  CD1   . LEU A 1 189 ? 17.361  16.665  33.379  1.00 38.96  ? 299 LEU A CD1   1 
ATOM   1175 C  CD2   . LEU A 1 189 ? 18.282  14.495  34.215  1.00 34.08  ? 299 LEU A CD2   1 
ATOM   1176 N  N     . VAL A 1 190 ? 23.015  16.189  32.025  1.00 39.70  ? 300 VAL A N     1 
ATOM   1177 C  CA    . VAL A 1 190 ? 23.939  16.402  30.926  1.00 39.98  ? 300 VAL A CA    1 
ATOM   1178 C  C     . VAL A 1 190 ? 25.037  15.296  30.919  1.00 45.44  ? 300 VAL A C     1 
ATOM   1179 O  O     . VAL A 1 190 ? 25.611  15.035  29.855  1.00 43.74  ? 300 VAL A O     1 
ATOM   1180 C  CB    . VAL A 1 190 ? 24.500  17.853  30.897  1.00 43.11  ? 300 VAL A CB    1 
ATOM   1181 C  CG1   . VAL A 1 190 ? 25.732  18.021  31.785  1.00 42.48  ? 300 VAL A CG1   1 
ATOM   1182 C  CG2   . VAL A 1 190 ? 24.780  18.293  29.466  1.00 42.71  ? 300 VAL A CG2   1 
ATOM   1183 N  N     . SER A 1 191 ? 25.325  14.659  32.084  1.00 43.51  ? 301 SER A N     1 
ATOM   1184 C  CA    . SER A 1 191 ? 26.242  13.508  32.140  1.00 45.08  ? 301 SER A CA    1 
ATOM   1185 C  C     . SER A 1 191 ? 25.411  12.337  31.567  1.00 55.68  ? 301 SER A C     1 
ATOM   1186 O  O     . SER A 1 191 ? 24.326  12.077  32.091  1.00 58.08  ? 301 SER A O     1 
ATOM   1187 C  CB    . SER A 1 191 ? 26.714  13.282  33.572  1.00 48.00  ? 301 SER A CB    1 
ATOM   1188 O  OG    . SER A 1 191 ? 25.671  12.766  34.381  1.00 63.35  ? 301 SER A OG    1 
ATOM   1189 N  N     A CYS A 1 192 ? 25.783  11.751  30.439  0.50 53.09  ? 302 CYS A N     1 
ATOM   1190 N  N     B CYS A 1 192 ? 25.837  11.717  30.461  0.50 53.68  ? 302 CYS A N     1 
ATOM   1191 C  CA    A CYS A 1 192 ? 24.862  10.760  29.872  0.50 52.81  ? 302 CYS A CA    1 
ATOM   1192 C  CA    B CYS A 1 192 ? 24.999  10.671  29.857  0.50 53.74  ? 302 CYS A CA    1 
ATOM   1193 C  C     A CYS A 1 192 ? 24.858  9.418   30.638  0.50 54.70  ? 302 CYS A C     1 
ATOM   1194 C  C     B CYS A 1 192 ? 24.863  9.422   30.765  0.50 55.19  ? 302 CYS A C     1 
ATOM   1195 O  O     A CYS A 1 192 ? 25.907  8.938   31.077  0.50 55.86  ? 302 CYS A O     1 
ATOM   1196 O  O     B CYS A 1 192 ? 25.822  9.023   31.430  0.50 56.52  ? 302 CYS A O     1 
ATOM   1197 C  CB    A CYS A 1 192 ? 25.104  10.575  28.379  0.50 53.15  ? 302 CYS A CB    1 
ATOM   1198 C  CB    B CYS A 1 192 ? 25.450  10.298  28.440  0.50 54.36  ? 302 CYS A CB    1 
ATOM   1199 S  SG    A CYS A 1 192 ? 24.476  11.946  27.373  0.50 56.81  ? 302 CYS A SG    1 
ATOM   1200 S  SG    B CYS A 1 192 ? 27.229  10.472  28.118  0.50 58.27  ? 302 CYS A SG    1 
ATOM   1201 N  N     . VAL A 1 193 ? 23.636  8.868   30.823  1.00 47.57  ? 303 VAL A N     1 
ATOM   1202 C  CA    . VAL A 1 193 ? 23.234  7.637   31.547  1.00 44.00  ? 303 VAL A CA    1 
ATOM   1203 C  C     . VAL A 1 193 ? 24.003  6.426   30.996  1.00 42.34  ? 303 VAL A C     1 
ATOM   1204 O  O     . VAL A 1 193 ? 24.093  6.266   29.776  1.00 41.74  ? 303 VAL A O     1 
ATOM   1205 C  CB    . VAL A 1 193 ? 21.679  7.432   31.415  1.00 46.05  ? 303 VAL A CB    1 
ATOM   1206 C  CG1   . VAL A 1 193 ? 21.178  6.187   32.173  1.00 45.20  ? 303 VAL A CG1   1 
ATOM   1207 C  CG2   . VAL A 1 193 ? 20.924  8.673   31.858  1.00 44.99  ? 303 VAL A CG2   1 
ATOM   1208 N  N     . ASN A 1 194 ? 24.607  5.620   31.874  1.00 35.10  ? 304 ASN A N     1 
ATOM   1209 C  CA    . ASN A 1 194 ? 25.363  4.451   31.405  1.00 33.34  ? 304 ASN A CA    1 
ATOM   1210 C  C     . ASN A 1 194 ? 24.479  3.161   31.558  1.00 33.66  ? 304 ASN A C     1 
ATOM   1211 O  O     . ASN A 1 194 ? 23.361  3.256   32.056  1.00 32.45  ? 304 ASN A O     1 
ATOM   1212 C  CB    . ASN A 1 194 ? 26.730  4.357   32.095  1.00 28.46  ? 304 ASN A CB    1 
ATOM   1213 C  CG    . ASN A 1 194 ? 26.684  4.195   33.596  1.00 50.30  ? 304 ASN A CG    1 
ATOM   1214 O  OD1   . ASN A 1 194 ? 25.710  3.718   34.192  1.00 45.44  ? 304 ASN A OD1   1 
ATOM   1215 N  ND2   . ASN A 1 194 ? 27.757  4.553   34.249  1.00 46.62  ? 304 ASN A ND2   1 
ATOM   1216 N  N     . ARG A 1 195 ? 24.940  1.998   31.087  1.00 30.45  ? 305 ARG A N     1 
ATOM   1217 C  CA    . ARG A 1 195 ? 24.153  0.749   31.123  1.00 30.07  ? 305 ARG A CA    1 
ATOM   1218 C  C     . ARG A 1 195 ? 23.875  0.280   32.578  1.00 34.89  ? 305 ARG A C     1 
ATOM   1219 O  O     . ARG A 1 195 ? 22.714  -0.030  32.849  1.00 35.07  ? 305 ARG A O     1 
ATOM   1220 C  CB    . ARG A 1 195 ? 24.825  -0.353  30.307  1.00 31.78  ? 305 ARG A CB    1 
ATOM   1221 C  CG    . ARG A 1 195 ? 24.791  -0.064  28.818  1.00 44.34  ? 305 ARG A CG    1 
ATOM   1222 C  CD    . ARG A 1 195 ? 25.500  -1.127  28.019  1.00 46.58  ? 305 ARG A CD    1 
ATOM   1223 N  NE    . ARG A 1 195 ? 26.962  -1.065  28.153  1.00 38.88  ? 305 ARG A NE    1 
ATOM   1224 C  CZ    . ARG A 1 195 ? 27.808  -1.540  27.254  1.00 52.77  ? 305 ARG A CZ    1 
ATOM   1225 N  NH1   . ARG A 1 195 ? 27.353  -2.099  26.134  1.00 37.42  ? 305 ARG A NH1   1 
ATOM   1226 N  NH2   . ARG A 1 195 ? 29.121  -1.457  27.458  1.00 47.85  ? 305 ARG A NH2   1 
ATOM   1227 N  N     . PRO A 1 196 ? 24.848  0.288   33.544  1.00 31.68  ? 306 PRO A N     1 
ATOM   1228 C  CA    . PRO A 1 196 ? 24.496  -0.073  34.933  1.00 32.75  ? 306 PRO A CA    1 
ATOM   1229 C  C     . PRO A 1 196 ? 23.349  0.810   35.485  1.00 38.44  ? 306 PRO A C     1 
ATOM   1230 O  O     . PRO A 1 196 ? 22.453  0.291   36.137  1.00 38.36  ? 306 PRO A O     1 
ATOM   1231 C  CB    . PRO A 1 196 ? 25.821  0.153   35.683  1.00 33.00  ? 306 PRO A CB    1 
ATOM   1232 C  CG    . PRO A 1 196 ? 26.847  -0.087  34.654  1.00 35.44  ? 306 PRO A CG    1 
ATOM   1233 C  CD    . PRO A 1 196 ? 26.299  0.555   33.438  1.00 30.63  ? 306 PRO A CD    1 
ATOM   1234 N  N     . GLU A 1 197 ? 23.335  2.120   35.165  1.00 36.85  ? 307 GLU A N     1 
ATOM   1235 C  CA    . GLU A 1 197 ? 22.268  3.028   35.596  1.00 35.97  ? 307 GLU A CA    1 
ATOM   1236 C  C     . GLU A 1 197 ? 20.946  2.694   34.894  1.00 38.59  ? 307 GLU A C     1 
ATOM   1237 O  O     . GLU A 1 197 ? 19.920  2.623   35.565  1.00 38.64  ? 307 GLU A O     1 
ATOM   1238 C  CB    . GLU A 1 197 ? 22.652  4.489   35.334  1.00 37.45  ? 307 GLU A CB    1 
ATOM   1239 C  CG    . GLU A 1 197 ? 23.626  5.063   36.347  1.00 36.54  ? 307 GLU A CG    1 
ATOM   1240 C  CD    . GLU A 1 197 ? 24.393  6.279   35.873  1.00 55.82  ? 307 GLU A CD    1 
ATOM   1241 O  OE1   . GLU A 1 197 ? 24.180  6.717   34.716  1.00 33.26  ? 307 GLU A OE1   1 
ATOM   1242 O  OE2   . GLU A 1 197 ? 25.212  6.796   36.668  1.00 52.63  ? 307 GLU A OE2   1 
ATOM   1243 N  N     . ALA A 1 198 ? 20.969  2.433   33.564  1.00 33.70  ? 308 ALA A N     1 
ATOM   1244 C  CA    . ALA A 1 198 ? 19.772  2.062   32.798  1.00 32.18  ? 308 ALA A CA    1 
ATOM   1245 C  C     . ALA A 1 198 ? 19.162  0.785   33.361  1.00 38.94  ? 308 ALA A C     1 
ATOM   1246 O  O     . ALA A 1 198 ? 17.940  0.695   33.491  1.00 41.02  ? 308 ALA A O     1 
ATOM   1247 C  CB    . ALA A 1 198 ? 20.112  1.884   31.318  1.00 32.12  ? 308 ALA A CB    1 
ATOM   1248 N  N     . GLU A 1 199 ? 20.011  -0.185  33.749  1.00 35.18  ? 309 GLU A N     1 
ATOM   1249 C  CA    . GLU A 1 199 ? 19.556  -1.453  34.310  1.00 33.63  ? 309 GLU A CA    1 
ATOM   1250 C  C     . GLU A 1 199 ? 18.947  -1.244  35.689  1.00 35.16  ? 309 GLU A C     1 
ATOM   1251 O  O     . GLU A 1 199 ? 17.954  -1.890  36.015  1.00 33.74  ? 309 GLU A O     1 
ATOM   1252 C  CB    . GLU A 1 199 ? 20.717  -2.486  34.361  1.00 34.82  ? 309 GLU A CB    1 
ATOM   1253 C  CG    . GLU A 1 199 ? 21.024  -3.137  33.021  1.00 41.66  ? 309 GLU A CG    1 
ATOM   1254 C  CD    . GLU A 1 199 ? 19.866  -3.727  32.234  1.00 59.94  ? 309 GLU A CD    1 
ATOM   1255 O  OE1   . GLU A 1 199 ? 18.859  -4.166  32.845  1.00 50.75  ? 309 GLU A OE1   1 
ATOM   1256 O  OE2   . GLU A 1 199 ? 20.003  -3.806  30.992  1.00 54.12  ? 309 GLU A OE2   1 
ATOM   1257 N  N     . ALA A 1 200 ? 19.549  -0.360  36.494  1.00 32.48  ? 310 ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 200 ? 19.055  -0.034  37.833  1.00 33.37  ? 310 ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 200 ? 17.693  0.638   37.735  1.00 41.03  ? 310 ALA A C     1 
ATOM   1260 O  O     . ALA A 1 200 ? 16.803  0.326   38.524  1.00 40.48  ? 310 ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 200 ? 20.049  0.857   38.549  1.00 34.21  ? 310 ALA A CB    1 
ATOM   1262 N  N     . VAL A 1 201 ? 17.493  1.492   36.700  1.00 40.99  ? 311 VAL A N     1 
ATOM   1263 C  CA    . VAL A 1 201 ? 16.209  2.162   36.431  1.00 39.58  ? 311 VAL A CA    1 
ATOM   1264 C  C     . VAL A 1 201 ? 15.195  1.097   36.003  1.00 46.05  ? 311 VAL A C     1 
ATOM   1265 O  O     . VAL A 1 201 ? 14.068  1.125   36.496  1.00 46.99  ? 311 VAL A O     1 
ATOM   1266 C  CB    . VAL A 1 201 ? 16.351  3.313   35.393  1.00 41.32  ? 311 VAL A CB    1 
ATOM   1267 C  CG1   . VAL A 1 201 ? 14.990  3.841   34.941  1.00 40.01  ? 311 VAL A CG1   1 
ATOM   1268 C  CG2   . VAL A 1 201 ? 17.193  4.443   35.967  1.00 41.30  ? 311 VAL A CG2   1 
ATOM   1269 N  N     . SER A 1 202 ? 15.595  0.138   35.125  1.00 43.12  ? 312 SER A N     1 
ATOM   1270 C  CA    . SER A 1 202 ? 14.722  -0.966  34.669  1.00 41.86  ? 312 SER A CA    1 
ATOM   1271 C  C     . SER A 1 202 ? 14.144  -1.750  35.845  1.00 46.49  ? 312 SER A C     1 
ATOM   1272 O  O     . SER A 1 202 ? 12.955  -2.055  35.848  1.00 46.02  ? 312 SER A O     1 
ATOM   1273 C  CB    . SER A 1 202 ? 15.473  -1.914  33.741  1.00 42.34  ? 312 SER A CB    1 
ATOM   1274 O  OG    . SER A 1 202 ? 14.574  -2.816  33.116  1.00 50.63  ? 312 SER A OG    1 
ATOM   1275 N  N     . MET A 1 203 ? 14.975  -2.041  36.847  1.00 45.55  ? 313 MET A N     1 
ATOM   1276 C  CA    . MET A 1 203 ? 14.586  -2.738  38.074  1.00 47.57  ? 313 MET A CA    1 
ATOM   1277 C  C     . MET A 1 203 ? 13.512  -1.958  38.820  1.00 49.60  ? 313 MET A C     1 
ATOM   1278 O  O     . MET A 1 203 ? 12.502  -2.544  39.196  1.00 49.50  ? 313 MET A O     1 
ATOM   1279 C  CB    . MET A 1 203 ? 15.813  -2.939  38.983  1.00 51.88  ? 313 MET A CB    1 
ATOM   1280 C  CG    . MET A 1 203 ? 16.789  -3.957  38.475  1.00 58.48  ? 313 MET A CG    1 
ATOM   1281 S  SD    . MET A 1 203 ? 15.995  -5.562  38.404  1.00 65.76  ? 313 MET A SD    1 
ATOM   1282 C  CE    . MET A 1 203 ? 15.693  -5.813  40.218  1.00 62.81  ? 313 MET A CE    1 
ATOM   1283 N  N     . LEU A 1 204 ? 13.722  -0.636  39.009  1.00 45.12  ? 314 LEU A N     1 
ATOM   1284 C  CA    . LEU A 1 204 ? 12.785  0.269   39.665  1.00 44.30  ? 314 LEU A CA    1 
ATOM   1285 C  C     . LEU A 1 204 ? 11.448  0.305   38.923  1.00 45.33  ? 314 LEU A C     1 
ATOM   1286 O  O     . LEU A 1 204 ? 10.401  0.218   39.563  1.00 45.27  ? 314 LEU A O     1 
ATOM   1287 C  CB    . LEU A 1 204 ? 13.367  1.700   39.747  1.00 45.38  ? 314 LEU A CB    1 
ATOM   1288 C  CG    . LEU A 1 204 ? 14.301  2.038   40.916  1.00 51.36  ? 314 LEU A CG    1 
ATOM   1289 C  CD1   . LEU A 1 204 ? 14.847  3.452   40.765  1.00 51.88  ? 314 LEU A CD1   1 
ATOM   1290 C  CD2   . LEU A 1 204 ? 13.585  1.942   42.257  1.00 53.12  ? 314 LEU A CD2   1 
ATOM   1291 N  N     . VAL A 1 205 ? 11.480  0.411   37.581  1.00 39.48  ? 315 VAL A N     1 
ATOM   1292 C  CA    . VAL A 1 205 ? 10.286  0.465   36.747  1.00 39.23  ? 315 VAL A CA    1 
ATOM   1293 C  C     . VAL A 1 205 ? 9.507   -0.836  36.897  1.00 47.36  ? 315 VAL A C     1 
ATOM   1294 O  O     . VAL A 1 205 ? 8.316   -0.791  37.204  1.00 46.57  ? 315 VAL A O     1 
ATOM   1295 C  CB    . VAL A 1 205 ? 10.598  0.793   35.250  1.00 42.11  ? 315 VAL A CB    1 
ATOM   1296 C  CG1   . VAL A 1 205 ? 9.333   0.729   34.387  1.00 40.94  ? 315 VAL A CG1   1 
ATOM   1297 C  CG2   . VAL A 1 205 ? 11.267  2.168   35.107  1.00 41.81  ? 315 VAL A CG2   1 
ATOM   1298 N  N     . LYS A 1 206 ? 10.176  -1.991  36.706  1.00 47.81  ? 316 LYS A N     1 
ATOM   1299 C  CA    . LYS A 1 206 ? 9.551   -3.318  36.801  1.00 47.82  ? 316 LYS A CA    1 
ATOM   1300 C  C     . LYS A 1 206 ? 8.941   -3.546  38.194  1.00 53.79  ? 316 LYS A C     1 
ATOM   1301 O  O     . LYS A 1 206 ? 7.781   -3.942  38.263  1.00 54.08  ? 316 LYS A O     1 
ATOM   1302 C  CB    . LYS A 1 206 ? 10.563  -4.422  36.445  1.00 50.22  ? 316 LYS A CB    1 
ATOM   1303 C  CG    . LYS A 1 206 ? 10.867  -4.490  34.947  1.00 53.18  ? 316 LYS A CG    1 
ATOM   1304 C  CD    . LYS A 1 206 ? 12.021  -5.430  34.652  1.00 65.71  ? 316 LYS A CD    1 
ATOM   1305 C  CE    . LYS A 1 206 ? 12.352  -5.487  33.184  1.00 74.68  ? 316 LYS A CE    1 
ATOM   1306 N  NZ    . LYS A 1 206 ? 13.500  -6.394  32.930  1.00 81.31  ? 316 LYS A NZ    1 
ATOM   1307 N  N     . GLU A 1 207 ? 9.673   -3.216  39.281  1.00 52.43  ? 317 GLU A N     1 
ATOM   1308 C  CA    . GLU A 1 207 ? 9.203   -3.351  40.671  1.00 53.69  ? 317 GLU A CA    1 
ATOM   1309 C  C     . GLU A 1 207 ? 7.934   -2.560  40.917  1.00 60.37  ? 317 GLU A C     1 
ATOM   1310 O  O     . GLU A 1 207 ? 7.023   -3.063  41.558  1.00 62.11  ? 317 GLU A O     1 
ATOM   1311 C  CB    . GLU A 1 207 ? 10.274  -2.886  41.680  1.00 55.71  ? 317 GLU A CB    1 
ATOM   1312 C  CG    . GLU A 1 207 ? 11.365  -3.917  41.953  1.00 71.70  ? 317 GLU A CG    1 
ATOM   1313 C  CD    . GLU A 1 207 ? 12.523  -3.472  42.831  1.00 96.68  ? 317 GLU A CD    1 
ATOM   1314 O  OE1   . GLU A 1 207 ? 12.479  -2.343  43.373  1.00 97.47  ? 317 GLU A OE1   1 
ATOM   1315 O  OE2   . GLU A 1 207 ? 13.472  -4.271  42.994  1.00 93.26  ? 317 GLU A OE2   1 
ATOM   1316 N  N     . ALA A 1 208 ? 7.870   -1.323  40.419  1.00 56.66  ? 318 ALA A N     1 
ATOM   1317 C  CA    . ALA A 1 208 ? 6.710   -0.458  40.577  1.00 56.02  ? 318 ALA A CA    1 
ATOM   1318 C  C     . ALA A 1 208 ? 5.513   -0.962  39.757  1.00 59.46  ? 318 ALA A C     1 
ATOM   1319 O  O     . ALA A 1 208 ? 4.414   -1.100  40.304  1.00 59.53  ? 318 ALA A O     1 
ATOM   1320 C  CB    . ALA A 1 208 ? 7.063   0.961   40.168  1.00 56.58  ? 318 ALA A CB    1 
ATOM   1321 N  N     . VAL A 1 209 ? 5.738   -1.265  38.460  1.00 54.11  ? 319 VAL A N     1 
ATOM   1322 C  CA    . VAL A 1 209 ? 4.721   -1.705  37.517  1.00 53.31  ? 319 VAL A CA    1 
ATOM   1323 C  C     . VAL A 1 209 ? 4.024   -3.023  37.979  1.00 59.33  ? 319 VAL A C     1 
ATOM   1324 O  O     . VAL A 1 209 ? 2.795   -3.046  38.038  1.00 56.90  ? 319 VAL A O     1 
ATOM   1325 C  CB    . VAL A 1 209 ? 5.318   -1.824  36.097  1.00 56.87  ? 319 VAL A CB    1 
ATOM   1326 C  CG1   . VAL A 1 209 ? 4.404   -2.610  35.165  1.00 57.08  ? 319 VAL A CG1   1 
ATOM   1327 C  CG2   . VAL A 1 209 ? 5.610   -0.448  35.510  1.00 56.56  ? 319 VAL A CG2   1 
ATOM   1328 N  N     . VAL A 1 210 ? 4.798   -4.084  38.333  1.00 59.48  ? 320 VAL A N     1 
ATOM   1329 C  CA    . VAL A 1 210 ? 4.225   -5.381  38.730  1.00 61.08  ? 320 VAL A CA    1 
ATOM   1330 C  C     . VAL A 1 210 ? 3.453   -5.287  40.065  1.00 66.26  ? 320 VAL A C     1 
ATOM   1331 O  O     . VAL A 1 210 ? 2.602   -6.141  40.312  1.00 66.27  ? 320 VAL A O     1 
ATOM   1332 C  CB    . VAL A 1 210 ? 5.206   -6.589  38.724  1.00 65.86  ? 320 VAL A CB    1 
ATOM   1333 C  CG1   . VAL A 1 210 ? 5.866   -6.764  37.356  1.00 65.86  ? 320 VAL A CG1   1 
ATOM   1334 C  CG2   . VAL A 1 210 ? 6.239   -6.508  39.844  1.00 65.88  ? 320 VAL A CG2   1 
ATOM   1335 N  N     . THR A 1 211 ? 3.700   -4.239  40.881  1.00 62.88  ? 321 THR A N     1 
ATOM   1336 C  CA    . THR A 1 211 ? 2.984   -3.990  42.138  1.00 62.38  ? 321 THR A CA    1 
ATOM   1337 C  C     . THR A 1 211 ? 1.486   -3.766  41.836  1.00 64.82  ? 321 THR A C     1 
ATOM   1338 O  O     . THR A 1 211 ? 0.640   -4.208  42.607  1.00 64.99  ? 321 THR A O     1 
ATOM   1339 C  CB    . THR A 1 211 ? 3.626   -2.788  42.872  1.00 71.10  ? 321 THR A CB    1 
ATOM   1340 O  OG1   . THR A 1 211 ? 4.979   -3.108  43.190  1.00 72.94  ? 321 THR A OG1   1 
ATOM   1341 C  CG2   . THR A 1 211 ? 2.882   -2.378  44.146  1.00 66.62  ? 321 THR A CG2   1 
ATOM   1342 N  N     . PHE A 1 212 ? 1.169   -3.121  40.702  1.00 59.91  ? 322 PHE A N     1 
ATOM   1343 C  CA    . PHE A 1 212 ? -0.202  -2.794  40.307  1.00 58.66  ? 322 PHE A CA    1 
ATOM   1344 C  C     . PHE A 1 212 ? -0.737  -3.705  39.176  1.00 61.92  ? 322 PHE A C     1 
ATOM   1345 O  O     . PHE A 1 212 ? -1.917  -4.036  39.194  1.00 62.29  ? 322 PHE A O     1 
ATOM   1346 C  CB    . PHE A 1 212 ? -0.307  -1.315  39.922  1.00 60.12  ? 322 PHE A CB    1 
ATOM   1347 C  CG    . PHE A 1 212 ? 0.272   -0.388  40.973  1.00 61.92  ? 322 PHE A CG    1 
ATOM   1348 C  CD1   . PHE A 1 212 ? 1.514   0.209   40.789  1.00 64.69  ? 322 PHE A CD1   1 
ATOM   1349 C  CD2   . PHE A 1 212 ? -0.407  -0.145  42.164  1.00 64.84  ? 322 PHE A CD2   1 
ATOM   1350 C  CE1   . PHE A 1 212 ? 2.060   1.048   41.768  1.00 66.08  ? 322 PHE A CE1   1 
ATOM   1351 C  CE2   . PHE A 1 212 ? 0.141   0.696   43.146  1.00 68.03  ? 322 PHE A CE2   1 
ATOM   1352 C  CZ    . PHE A 1 212 ? 1.364   1.298   42.934  1.00 65.92  ? 322 PHE A CZ    1 
ATOM   1353 N  N     . LEU A 1 213 ? 0.120   -4.131  38.231  1.00 57.31  ? 323 LEU A N     1 
ATOM   1354 C  CA    . LEU A 1 213 ? -0.197  -5.049  37.124  1.00 56.05  ? 323 LEU A CA    1 
ATOM   1355 C  C     . LEU A 1 213 ? 0.831   -6.198  37.101  1.00 60.59  ? 323 LEU A C     1 
ATOM   1356 O  O     . LEU A 1 213 ? 1.833   -6.089  36.388  1.00 61.02  ? 323 LEU A O     1 
ATOM   1357 C  CB    . LEU A 1 213 ? -0.226  -4.327  35.766  1.00 55.59  ? 323 LEU A CB    1 
ATOM   1358 C  CG    . LEU A 1 213 ? -1.477  -3.550  35.412  1.00 61.03  ? 323 LEU A CG    1 
ATOM   1359 C  CD1   . LEU A 1 213 ? -1.294  -2.822  34.091  1.00 60.77  ? 323 LEU A CD1   1 
ATOM   1360 C  CD2   . LEU A 1 213 ? -2.711  -4.466  35.352  1.00 63.55  ? 323 LEU A CD2   1 
ATOM   1361 N  N     . PRO A 1 214 ? 0.623   -7.309  37.855  1.00 56.37  ? 324 PRO A N     1 
ATOM   1362 C  CA    . PRO A 1 214 ? 1.668   -8.356  37.902  1.00 55.42  ? 324 PRO A CA    1 
ATOM   1363 C  C     . PRO A 1 214 ? 1.941   -9.079  36.575  1.00 57.64  ? 324 PRO A C     1 
ATOM   1364 O  O     . PRO A 1 214 ? 3.043   -9.629  36.424  1.00 57.34  ? 324 PRO A O     1 
ATOM   1365 C  CB    . PRO A 1 214 ? 1.178   -9.320  38.983  1.00 57.40  ? 324 PRO A CB    1 
ATOM   1366 C  CG    . PRO A 1 214 ? -0.283  -9.030  39.140  1.00 62.01  ? 324 PRO A CG    1 
ATOM   1367 C  CD    . PRO A 1 214 ? -0.479  -7.593  38.803  1.00 57.21  ? 324 PRO A CD    1 
ATOM   1368 N  N     . ASP A 1 215 ? 1.006   -9.034  35.600  1.00 52.62  ? 325 ASP A N     1 
ATOM   1369 C  CA    . ASP A 1 215 ? 1.238   -9.698  34.308  1.00 52.26  ? 325 ASP A CA    1 
ATOM   1370 C  C     . ASP A 1 215 ? 1.880   -8.768  33.251  1.00 55.24  ? 325 ASP A C     1 
ATOM   1371 O  O     . ASP A 1 215 ? 1.988   -9.157  32.076  1.00 54.47  ? 325 ASP A O     1 
ATOM   1372 C  CB    . ASP A 1 215 ? -0.088  -10.251 33.760  1.00 54.42  ? 325 ASP A CB    1 
ATOM   1373 C  CG    . ASP A 1 215 ? -1.006  -9.240  33.106  1.00 69.68  ? 325 ASP A CG    1 
ATOM   1374 O  OD1   . ASP A 1 215 ? -1.803  -9.643  32.246  1.00 72.75  ? 325 ASP A OD1   1 
ATOM   1375 O  OD2   . ASP A 1 215 ? -0.939  -8.046  33.472  1.00 78.96  ? 325 ASP A OD2   1 
ATOM   1376 N  N     . ALA A 1 216 ? 2.218   -7.520  33.641  1.00 50.85  ? 326 ALA A N     1 
ATOM   1377 C  CA    . ALA A 1 216 ? 2.742   -6.530  32.698  1.00 49.29  ? 326 ALA A CA    1 
ATOM   1378 C  C     . ALA A 1 216 ? 4.116   -6.885  32.177  1.00 49.84  ? 326 ALA A C     1 
ATOM   1379 O  O     . ALA A 1 216 ? 4.943   -7.442  32.892  1.00 49.22  ? 326 ALA A O     1 
ATOM   1380 C  CB    . ALA A 1 216 ? 2.767   -5.152  33.319  1.00 49.52  ? 326 ALA A CB    1 
ATOM   1381 N  N     . LEU A 1 217 ? 4.320   -6.585  30.903  1.00 45.32  ? 327 LEU A N     1 
ATOM   1382 C  CA    . LEU A 1 217 ? 5.569   -6.754  30.188  1.00 45.65  ? 327 LEU A CA    1 
ATOM   1383 C  C     . LEU A 1 217 ? 6.226   -5.383  30.054  1.00 47.45  ? 327 LEU A C     1 
ATOM   1384 O  O     . LEU A 1 217 ? 5.613   -4.455  29.547  1.00 47.34  ? 327 LEU A O     1 
ATOM   1385 C  CB    . LEU A 1 217 ? 5.318   -7.392  28.818  1.00 46.43  ? 327 LEU A CB    1 
ATOM   1386 C  CG    . LEU A 1 217 ? 4.518   -8.684  28.799  1.00 52.67  ? 327 LEU A CG    1 
ATOM   1387 C  CD1   . LEU A 1 217 ? 4.151   -9.048  27.375  1.00 52.81  ? 327 LEU A CD1   1 
ATOM   1388 C  CD2   . LEU A 1 217 ? 5.298   -9.831  29.465  1.00 56.81  ? 327 LEU A CD2   1 
ATOM   1389 N  N     . VAL A 1 218 ? 7.436   -5.244  30.577  1.00 43.29  ? 328 VAL A N     1 
ATOM   1390 C  CA    . VAL A 1 218 ? 8.202   -3.997  30.562  1.00 42.35  ? 328 VAL A CA    1 
ATOM   1391 C  C     . VAL A 1 218 ? 9.441   -4.229  29.706  1.00 46.27  ? 328 VAL A C     1 
ATOM   1392 O  O     . VAL A 1 218 ? 10.211  -5.156  29.976  1.00 47.16  ? 328 VAL A O     1 
ATOM   1393 C  CB    . VAL A 1 218 ? 8.553   -3.512  32.001  1.00 45.83  ? 328 VAL A CB    1 
ATOM   1394 C  CG1   . VAL A 1 218 ? 9.328   -2.202  31.976  1.00 45.40  ? 328 VAL A CG1   1 
ATOM   1395 C  CG2   . VAL A 1 218 ? 7.297   -3.368  32.862  1.00 45.84  ? 328 VAL A CG2   1 
ATOM   1396 N  N     . THR A 1 219 ? 9.628   -3.402  28.666  1.00 40.17  ? 329 THR A N     1 
ATOM   1397 C  CA    . THR A 1 219 ? 10.777  -3.526  27.773  1.00 37.86  ? 329 THR A CA    1 
ATOM   1398 C  C     . THR A 1 219 ? 11.516  -2.211  27.685  1.00 38.72  ? 329 THR A C     1 
ATOM   1399 O  O     . THR A 1 219 ? 10.906  -1.196  27.391  1.00 37.70  ? 329 THR A O     1 
ATOM   1400 C  CB    . THR A 1 219 ? 10.305  -3.988  26.371  1.00 41.17  ? 329 THR A CB    1 
ATOM   1401 O  OG1   . THR A 1 219 ? 9.496   -5.151  26.512  1.00 39.95  ? 329 THR A OG1   1 
ATOM   1402 C  CG2   . THR A 1 219 ? 11.464  -4.283  25.410  1.00 34.90  ? 329 THR A CG2   1 
ATOM   1403 N  N     . MET A 1 220 ? 12.845  -2.241  27.832  1.00 35.68  ? 330 MET A N     1 
ATOM   1404 C  CA    . MET A 1 220 ? 13.681  -1.060  27.649  1.00 33.13  ? 330 MET A CA    1 
ATOM   1405 C  C     . MET A 1 220 ? 13.804  -0.831  26.137  1.00 37.20  ? 330 MET A C     1 
ATOM   1406 O  O     . MET A 1 220 ? 14.119  -1.767  25.398  1.00 36.50  ? 330 MET A O     1 
ATOM   1407 C  CB    . MET A 1 220 ? 15.044  -1.250  28.312  1.00 34.68  ? 330 MET A CB    1 
ATOM   1408 C  CG    . MET A 1 220 ? 15.866  0.038   28.391  1.00 37.96  ? 330 MET A CG    1 
ATOM   1409 S  SD    . MET A 1 220 ? 17.559  -0.292  28.942  1.00 42.25  ? 330 MET A SD    1 
ATOM   1410 C  CE    . MET A 1 220 ? 17.277  -0.654  30.633  1.00 39.68  ? 330 MET A CE    1 
ATOM   1411 N  N     . THR A 1 221 ? 13.465  0.372   25.666  1.00 34.13  ? 331 THR A N     1 
ATOM   1412 C  CA    . THR A 1 221 ? 13.506  0.682   24.224  1.00 33.64  ? 331 THR A CA    1 
ATOM   1413 C  C     . THR A 1 221 ? 14.641  1.729   23.972  1.00 34.54  ? 331 THR A C     1 
ATOM   1414 O  O     . THR A 1 221 ? 15.616  1.785   24.734  1.00 33.12  ? 331 THR A O     1 
ATOM   1415 C  CB    . THR A 1 221 ? 12.103  1.121   23.735  1.00 42.05  ? 331 THR A CB    1 
ATOM   1416 O  OG1   . THR A 1 221 ? 11.716  2.301   24.424  1.00 49.51  ? 331 THR A OG1   1 
ATOM   1417 C  CG2   . THR A 1 221 ? 11.061  0.078   23.987  1.00 43.58  ? 331 THR A CG2   1 
ATOM   1418 N  N     . GLY A 1 222 ? 14.504  2.529   22.913  1.00 32.28  ? 332 GLY A N     1 
ATOM   1419 C  CA    . GLY A 1 222 ? 15.458  3.577   22.542  1.00 30.66  ? 332 GLY A CA    1 
ATOM   1420 C  C     . GLY A 1 222 ? 16.839  3.034   22.262  1.00 33.98  ? 332 GLY A C     1 
ATOM   1421 O  O     . GLY A 1 222 ? 16.979  1.857   21.920  1.00 32.40  ? 332 GLY A O     1 
ATOM   1422 N  N     . GLY A 1 223 ? 17.840  3.893   22.438  1.00 31.00  ? 333 GLY A N     1 
ATOM   1423 C  CA    . GLY A 1 223 ? 19.247  3.641   22.170  1.00 29.71  ? 333 GLY A CA    1 
ATOM   1424 C  C     . GLY A 1 223 ? 19.847  2.445   22.861  1.00 33.26  ? 333 GLY A C     1 
ATOM   1425 O  O     . GLY A 1 223 ? 20.625  1.720   22.237  1.00 33.23  ? 333 GLY A O     1 
ATOM   1426 N  N     . PHE A 1 224 ? 19.509  2.230   24.159  1.00 29.10  ? 334 PHE A N     1 
ATOM   1427 C  CA    . PHE A 1 224 ? 20.015  1.073   24.918  1.00 28.98  ? 334 PHE A CA    1 
ATOM   1428 C  C     . PHE A 1 224 ? 19.578  -0.226  24.288  1.00 34.48  ? 334 PHE A C     1 
ATOM   1429 O  O     . PHE A 1 224 ? 20.369  -1.160  24.247  1.00 36.26  ? 334 PHE A O     1 
ATOM   1430 C  CB    . PHE A 1 224 ? 19.581  1.125   26.391  1.00 31.33  ? 334 PHE A CB    1 
ATOM   1431 C  CG    . PHE A 1 224 ? 20.315  2.205   27.169  1.00 33.11  ? 334 PHE A CG    1 
ATOM   1432 C  CD1   . PHE A 1 224 ? 19.646  3.342   27.607  1.00 34.91  ? 334 PHE A CD1   1 
ATOM   1433 C  CD2   . PHE A 1 224 ? 21.688  2.112   27.401  1.00 33.67  ? 334 PHE A CD2   1 
ATOM   1434 C  CE1   . PHE A 1 224 ? 20.317  4.342   28.305  1.00 35.27  ? 334 PHE A CE1   1 
ATOM   1435 C  CE2   . PHE A 1 224 ? 22.360  3.116   28.104  1.00 36.77  ? 334 PHE A CE2   1 
ATOM   1436 C  CZ    . PHE A 1 224 ? 21.671  4.228   28.539  1.00 35.89  ? 334 PHE A CZ    1 
ATOM   1437 N  N     . ARG A 1 225 ? 18.353  -0.298  23.755  1.00 30.98  ? 335 ARG A N     1 
ATOM   1438 C  CA    . ARG A 1 225 ? 17.900  -1.506  23.061  1.00 30.61  ? 335 ARG A CA    1 
ATOM   1439 C  C     . ARG A 1 225 ? 18.700  -1.698  21.753  1.00 35.77  ? 335 ARG A C     1 
ATOM   1440 O  O     . ARG A 1 225 ? 18.880  -2.820  21.320  1.00 36.64  ? 335 ARG A O     1 
ATOM   1441 C  CB    . ARG A 1 225 ? 16.391  -1.448  22.776  1.00 28.87  ? 335 ARG A CB    1 
ATOM   1442 C  CG    . ARG A 1 225 ? 15.854  -2.771  22.255  1.00 31.06  ? 335 ARG A CG    1 
ATOM   1443 C  CD    . ARG A 1 225 ? 14.340  -2.871  22.239  1.00 31.05  ? 335 ARG A CD    1 
ATOM   1444 N  NE    . ARG A 1 225 ? 13.994  -4.242  21.910  1.00 33.60  ? 335 ARG A NE    1 
ATOM   1445 C  CZ    . ARG A 1 225 ? 13.540  -4.623  20.733  1.00 44.78  ? 335 ARG A CZ    1 
ATOM   1446 N  NH1   . ARG A 1 225 ? 13.229  -3.721  19.813  1.00 34.39  ? 335 ARG A NH1   1 
ATOM   1447 N  NH2   . ARG A 1 225 ? 13.323  -5.905  20.487  1.00 34.68  ? 335 ARG A NH2   1 
ATOM   1448 N  N     . ARG A 1 226 ? 19.233  -0.610  21.163  1.00 31.56  ? 336 ARG A N     1 
ATOM   1449 C  CA    . ARG A 1 226 ? 20.037  -0.704  19.938  1.00 30.45  ? 336 ARG A CA    1 
ATOM   1450 C  C     . ARG A 1 226 ? 21.537  -0.979  20.221  1.00 31.99  ? 336 ARG A C     1 
ATOM   1451 O  O     . ARG A 1 226 ? 22.340  -0.918  19.296  1.00 30.14  ? 336 ARG A O     1 
ATOM   1452 C  CB    . ARG A 1 226 ? 19.892  0.553   19.088  1.00 28.12  ? 336 ARG A CB    1 
ATOM   1453 C  CG    . ARG A 1 226 ? 18.441  0.888   18.619  1.00 27.04  ? 336 ARG A CG    1 
ATOM   1454 C  CD    . ARG A 1 226 ? 18.456  1.953   17.508  1.00 28.18  ? 336 ARG A CD    1 
ATOM   1455 N  NE    . ARG A 1 226 ? 19.230  3.158   17.855  1.00 36.90  ? 336 ARG A NE    1 
ATOM   1456 C  CZ    . ARG A 1 226 ? 18.737  4.216   18.500  1.00 45.02  ? 336 ARG A CZ    1 
ATOM   1457 N  NH1   . ARG A 1 226 ? 19.511  5.254   18.773  1.00 25.68  ? 336 ARG A NH1   1 
ATOM   1458 N  NH2   . ARG A 1 226 ? 17.467  4.246   18.867  1.00 32.26  ? 336 ARG A NH2   1 
ATOM   1459 N  N     . GLY A 1 227 ? 21.890  -1.264  21.479  1.00 27.73  ? 337 GLY A N     1 
ATOM   1460 C  CA    . GLY A 1 227 ? 23.253  -1.592  21.882  1.00 26.66  ? 337 GLY A CA    1 
ATOM   1461 C  C     . GLY A 1 227 ? 24.116  -0.459  22.410  1.00 35.66  ? 337 GLY A C     1 
ATOM   1462 O  O     . GLY A 1 227 ? 25.298  -0.681  22.711  1.00 37.14  ? 337 GLY A O     1 
ATOM   1463 N  N     . LYS A 1 228 ? 23.559  0.765   22.554  1.00 31.12  ? 338 LYS A N     1 
ATOM   1464 C  CA    . LYS A 1 228 ? 24.373  1.893   22.991  1.00 30.06  ? 338 LYS A CA    1 
ATOM   1465 C  C     . LYS A 1 228 ? 24.856  1.735   24.446  1.00 32.94  ? 338 LYS A C     1 
ATOM   1466 O  O     . LYS A 1 228 ? 24.164  1.168   25.282  1.00 29.84  ? 338 LYS A O     1 
ATOM   1467 C  CB    . LYS A 1 228 ? 23.613  3.218   22.817  1.00 31.54  ? 338 LYS A CB    1 
ATOM   1468 C  CG    . LYS A 1 228 ? 23.437  3.643   21.353  1.00 35.63  ? 338 LYS A CG    1 
ATOM   1469 C  CD    . LYS A 1 228 ? 22.576  4.922   21.205  1.00 49.06  ? 338 LYS A CD    1 
ATOM   1470 C  CE    . LYS A 1 228 ? 23.248  6.208   21.630  1.00 68.61  ? 338 LYS A CE    1 
ATOM   1471 N  NZ    . LYS A 1 228 ? 24.337  6.609   20.700  1.00 86.96  ? 338 LYS A NZ    1 
ATOM   1472 N  N     . MET A 1 229 ? 26.044  2.267   24.720  1.00 31.85  ? 339 MET A N     1 
ATOM   1473 C  CA    . MET A 1 229 ? 26.646  2.264   26.037  1.00 34.42  ? 339 MET A CA    1 
ATOM   1474 C  C     . MET A 1 229 ? 26.107  3.376   26.888  1.00 36.71  ? 339 MET A C     1 
ATOM   1475 O  O     . MET A 1 229 ? 26.136  3.294   28.119  1.00 35.61  ? 339 MET A O     1 
ATOM   1476 C  CB    . MET A 1 229 ? 28.164  2.423   25.925  1.00 38.65  ? 339 MET A CB    1 
ATOM   1477 C  CG    . MET A 1 229 ? 28.868  1.222   25.330  1.00 44.59  ? 339 MET A CG    1 
ATOM   1478 S  SD    . MET A 1 229 ? 30.652  1.575   25.127  1.00 50.71  ? 339 MET A SD    1 
ATOM   1479 C  CE    . MET A 1 229 ? 31.111  1.985   26.844  1.00 47.32  ? 339 MET A CE    1 
ATOM   1480 N  N     . THR A 1 230 ? 25.690  4.463   26.250  1.00 34.04  ? 340 THR A N     1 
ATOM   1481 C  CA    . THR A 1 230 ? 25.151  5.618   26.952  1.00 34.08  ? 340 THR A CA    1 
ATOM   1482 C  C     . THR A 1 230 ? 23.891  6.126   26.271  1.00 35.70  ? 340 THR A C     1 
ATOM   1483 O  O     . THR A 1 230 ? 23.607  5.777   25.120  1.00 35.25  ? 340 THR A O     1 
ATOM   1484 C  CB    . THR A 1 230 ? 26.211  6.760   27.059  1.00 40.78  ? 340 THR A CB    1 
ATOM   1485 O  OG1   . THR A 1 230 ? 26.585  7.157   25.741  1.00 46.76  ? 340 THR A OG1   1 
ATOM   1486 C  CG2   . THR A 1 230 ? 27.447  6.370   27.875  1.00 34.07  ? 340 THR A CG2   1 
ATOM   1487 N  N     . GLY A 1 231 ? 23.185  6.993   26.974  1.00 31.91  ? 341 GLY A N     1 
ATOM   1488 C  CA    . GLY A 1 231 ? 21.991  7.665   26.475  1.00 31.56  ? 341 GLY A CA    1 
ATOM   1489 C  C     . GLY A 1 231 ? 21.624  8.860   27.314  1.00 38.10  ? 341 GLY A C     1 
ATOM   1490 O  O     . GLY A 1 231 ? 22.101  8.981   28.445  1.00 37.84  ? 341 GLY A O     1 
ATOM   1491 N  N     . HIS A 1 232 ? 20.780  9.748   26.776  1.00 38.72  ? 342 HIS A N     1 
ATOM   1492 C  CA    . HIS A 1 232 ? 20.343  10.966  27.498  1.00 41.67  ? 342 HIS A CA    1 
ATOM   1493 C  C     . HIS A 1 232 ? 19.191  10.640  28.457  1.00 40.73  ? 342 HIS A C     1 
ATOM   1494 O  O     . HIS A 1 232 ? 18.954  11.365  29.423  1.00 37.39  ? 342 HIS A O     1 
ATOM   1495 C  CB    . HIS A 1 232 ? 19.912  12.093  26.532  1.00 45.04  ? 342 HIS A CB    1 
ATOM   1496 C  CG    . HIS A 1 232 ? 20.962  12.509  25.541  1.00 52.07  ? 342 HIS A CG    1 
ATOM   1497 N  ND1   . HIS A 1 232 ? 22.102  13.222  25.924  1.00 56.17  ? 342 HIS A ND1   1 
ATOM   1498 C  CD2   . HIS A 1 232 ? 20.991  12.342  24.196  1.00 56.73  ? 342 HIS A CD2   1 
ATOM   1499 C  CE1   . HIS A 1 232 ? 22.787  13.444  24.806  1.00 56.68  ? 342 HIS A CE1   1 
ATOM   1500 N  NE2   . HIS A 1 232 ? 22.164  12.933  23.741  1.00 57.17  ? 342 HIS A NE2   1 
ATOM   1501 N  N     . ASP A 1 233 ? 18.499  9.524   28.183  1.00 35.51  ? 343 ASP A N     1 
ATOM   1502 C  CA    . ASP A 1 233 ? 17.378  9.033   28.971  1.00 33.54  ? 343 ASP A CA    1 
ATOM   1503 C  C     . ASP A 1 233 ? 17.273  7.499   28.926  1.00 34.35  ? 343 ASP A C     1 
ATOM   1504 O  O     . ASP A 1 233 ? 18.066  6.843   28.263  1.00 29.84  ? 343 ASP A O     1 
ATOM   1505 C  CB    . ASP A 1 233 ? 16.085  9.655   28.442  1.00 32.78  ? 343 ASP A CB    1 
ATOM   1506 C  CG    . ASP A 1 233 ? 15.611  9.204   27.066  1.00 34.75  ? 343 ASP A CG    1 
ATOM   1507 O  OD1   . ASP A 1 233 ? 16.151  8.174   26.521  1.00 31.57  ? 343 ASP A OD1   1 
ATOM   1508 O  OD2   . ASP A 1 233 ? 14.535  9.643   26.658  1.00 41.89  ? 343 ASP A OD2   1 
ATOM   1509 N  N     . VAL A 1 234 ? 16.254  6.951   29.607  1.00 32.10  ? 344 VAL A N     1 
ATOM   1510 C  CA    . VAL A 1 234 ? 15.941  5.525   29.614  1.00 31.13  ? 344 VAL A CA    1 
ATOM   1511 C  C     . VAL A 1 234 ? 14.463  5.433   29.326  1.00 36.49  ? 344 VAL A C     1 
ATOM   1512 O  O     . VAL A 1 234 ? 13.653  5.992   30.070  1.00 34.95  ? 344 VAL A O     1 
ATOM   1513 C  CB    . VAL A 1 234 ? 16.359  4.723   30.870  1.00 33.32  ? 344 VAL A CB    1 
ATOM   1514 C  CG1   . VAL A 1 234 ? 16.490  3.244   30.514  1.00 31.99  ? 344 VAL A CG1   1 
ATOM   1515 C  CG2   . VAL A 1 234 ? 17.658  5.239   31.467  1.00 32.02  ? 344 VAL A CG2   1 
ATOM   1516 N  N     . ASP A 1 235 ? 14.119  4.753   28.217  1.00 35.05  ? 345 ASP A N     1 
ATOM   1517 C  CA    . ASP A 1 235 ? 12.754  4.601   27.756  1.00 35.73  ? 345 ASP A CA    1 
ATOM   1518 C  C     . ASP A 1 235 ? 12.263  3.196   27.920  1.00 39.18  ? 345 ASP A C     1 
ATOM   1519 O  O     . ASP A 1 235 ? 13.013  2.248   27.737  1.00 38.83  ? 345 ASP A O     1 
ATOM   1520 C  CB    . ASP A 1 235 ? 12.649  5.009   26.286  1.00 39.23  ? 345 ASP A CB    1 
ATOM   1521 C  CG    . ASP A 1 235 ? 13.174  6.389   25.956  1.00 58.37  ? 345 ASP A CG    1 
ATOM   1522 O  OD1   . ASP A 1 235 ? 13.109  7.278   26.834  1.00 61.87  ? 345 ASP A OD1   1 
ATOM   1523 O  OD2   . ASP A 1 235 ? 13.630  6.585   24.816  1.00 66.55  ? 345 ASP A OD2   1 
ATOM   1524 N  N     . PHE A 1 236 ? 10.997  3.061   28.285  1.00 36.46  ? 346 PHE A N     1 
ATOM   1525 C  CA    . PHE A 1 236 ? 10.356  1.772   28.509  1.00 35.18  ? 346 PHE A CA    1 
ATOM   1526 C  C     . PHE A 1 236 ? 8.997   1.701   27.874  1.00 37.84  ? 346 PHE A C     1 
ATOM   1527 O  O     . PHE A 1 236 ? 8.248   2.676   27.873  1.00 34.19  ? 346 PHE A O     1 
ATOM   1528 C  CB    . PHE A 1 236 ? 10.192  1.497   30.011  1.00 35.74  ? 346 PHE A CB    1 
ATOM   1529 C  CG    . PHE A 1 236 ? 11.491  1.435   30.759  1.00 35.31  ? 346 PHE A CG    1 
ATOM   1530 C  CD1   . PHE A 1 236 ? 12.060  2.588   31.292  1.00 35.52  ? 346 PHE A CD1   1 
ATOM   1531 C  CD2   . PHE A 1 236 ? 12.155  0.226   30.924  1.00 35.66  ? 346 PHE A CD2   1 
ATOM   1532 C  CE1   . PHE A 1 236 ? 13.277  2.533   31.965  1.00 37.56  ? 346 PHE A CE1   1 
ATOM   1533 C  CE2   . PHE A 1 236 ? 13.381  0.171   31.581  1.00 39.06  ? 346 PHE A CE2   1 
ATOM   1534 C  CZ    . PHE A 1 236 ? 13.939  1.328   32.103  1.00 37.49  ? 346 PHE A CZ    1 
ATOM   1535 N  N     . LEU A 1 237 ? 8.684   0.530   27.357  1.00 37.04  ? 347 LEU A N     1 
ATOM   1536 C  CA    . LEU A 1 237 ? 7.369   0.235   26.832  1.00 37.91  ? 347 LEU A CA    1 
ATOM   1537 C  C     . LEU A 1 237 ? 6.729   -0.732  27.821  1.00 43.21  ? 347 LEU A C     1 
ATOM   1538 O  O     . LEU A 1 237 ? 7.367   -1.690  28.234  1.00 43.12  ? 347 LEU A O     1 
ATOM   1539 C  CB    . LEU A 1 237 ? 7.441   -0.322  25.403  1.00 37.81  ? 347 LEU A CB    1 
ATOM   1540 C  CG    . LEU A 1 237 ? 6.121   -0.776  24.785  1.00 42.06  ? 347 LEU A CG    1 
ATOM   1541 C  CD1   . LEU A 1 237 ? 5.166   0.383   24.594  1.00 38.22  ? 347 LEU A CD1   1 
ATOM   1542 C  CD2   . LEU A 1 237 ? 6.368   -1.503  23.461  1.00 42.87  ? 347 LEU A CD2   1 
ATOM   1543 N  N     . ILE A 1 238 ? 5.533   -0.408  28.291  1.00 42.09  ? 348 ILE A N     1 
ATOM   1544 C  CA    . ILE A 1 238 ? 4.780   -1.224  29.246  1.00 42.31  ? 348 ILE A CA    1 
ATOM   1545 C  C     . ILE A 1 238 ? 3.501   -1.664  28.561  1.00 45.91  ? 348 ILE A C     1 
ATOM   1546 O  O     . ILE A 1 238 ? 2.865   -0.855  27.884  1.00 45.41  ? 348 ILE A O     1 
ATOM   1547 C  CB    . ILE A 1 238 ? 4.478   -0.468  30.573  1.00 45.48  ? 348 ILE A CB    1 
ATOM   1548 C  CG1   . ILE A 1 238 ? 5.747   0.188   31.197  1.00 45.52  ? 348 ILE A CG1   1 
ATOM   1549 C  CG2   . ILE A 1 238 ? 3.748   -1.383  31.571  1.00 46.42  ? 348 ILE A CG2   1 
ATOM   1550 C  CD1   . ILE A 1 238 ? 5.430   1.393   32.162  1.00 54.36  ? 348 ILE A CD1   1 
ATOM   1551 N  N     . THR A 1 239 ? 3.143   -2.937  28.708  1.00 43.34  ? 349 THR A N     1 
ATOM   1552 C  CA    . THR A 1 239 ? 1.918   -3.498  28.131  1.00 43.86  ? 349 THR A CA    1 
ATOM   1553 C  C     . THR A 1 239 ? 1.427   -4.658  29.012  1.00 47.30  ? 349 THR A C     1 
ATOM   1554 O  O     . THR A 1 239 ? 2.230   -5.310  29.671  1.00 44.96  ? 349 THR A O     1 
ATOM   1555 C  CB    . THR A 1 239 ? 2.081   -3.892  26.626  1.00 49.24  ? 349 THR A CB    1 
ATOM   1556 O  OG1   . THR A 1 239 ? 0.787   -4.112  26.090  1.00 51.89  ? 349 THR A OG1   1 
ATOM   1557 C  CG2   . THR A 1 239 ? 2.948   -5.100  26.394  1.00 43.07  ? 349 THR A CG2   1 
ATOM   1558 N  N     . SER A 1 240 ? 0.108   -4.896  29.031  1.00 45.76  ? 350 SER A N     1 
ATOM   1559 C  CA    . SER A 1 240 ? -0.446  -5.973  29.847  1.00 46.93  ? 350 SER A CA    1 
ATOM   1560 C  C     . SER A 1 240 ? -1.471  -6.799  29.062  1.00 52.12  ? 350 SER A C     1 
ATOM   1561 O  O     . SER A 1 240 ? -2.443  -6.241  28.561  1.00 50.53  ? 350 SER A O     1 
ATOM   1562 C  CB    . SER A 1 240 ? -1.059  -5.410  31.126  1.00 49.46  ? 350 SER A CB    1 
ATOM   1563 O  OG    . SER A 1 240 ? -1.839  -6.368  31.814  1.00 49.62  ? 350 SER A OG    1 
ATOM   1564 N  N     . PRO A 1 241 ? -1.286  -8.131  28.955  1.00 52.27  ? 351 PRO A N     1 
ATOM   1565 C  CA    . PRO A 1 241 ? -2.262  -8.936  28.194  1.00 53.27  ? 351 PRO A CA    1 
ATOM   1566 C  C     . PRO A 1 241 ? -3.660  -9.033  28.831  1.00 56.95  ? 351 PRO A C     1 
ATOM   1567 O  O     . PRO A 1 241 ? -4.622  -9.177  28.077  1.00 54.95  ? 351 PRO A O     1 
ATOM   1568 C  CB    . PRO A 1 241 ? -1.604  -10.320 28.089  1.00 54.87  ? 351 PRO A CB    1 
ATOM   1569 C  CG    . PRO A 1 241 ? -0.572  -10.346 29.138  1.00 59.08  ? 351 PRO A CG    1 
ATOM   1570 C  CD    . PRO A 1 241 ? -0.157  -8.952  29.448  1.00 53.99  ? 351 PRO A CD    1 
ATOM   1571 N  N     . GLU A 1 242 ? -3.794  -8.877  30.170  1.00 55.52  ? 352 GLU A N     1 
ATOM   1572 C  CA    . GLU A 1 242 ? -5.103  -9.018  30.810  1.00 57.04  ? 352 GLU A CA    1 
ATOM   1573 C  C     . GLU A 1 242 ? -5.718  -7.712  31.384  1.00 65.20  ? 352 GLU A C     1 
ATOM   1574 O  O     . GLU A 1 242 ? -6.906  -7.733  31.734  1.00 66.28  ? 352 GLU A O     1 
ATOM   1575 C  CB    . GLU A 1 242 ? -5.050  -10.103 31.910  1.00 58.37  ? 352 GLU A CB    1 
ATOM   1576 N  N     . ALA A 1 243 ? -4.966  -6.591  31.452  1.00 62.85  ? 353 ALA A N     1 
ATOM   1577 C  CA    . ALA A 1 243 ? -5.493  -5.325  31.990  1.00 63.04  ? 353 ALA A CA    1 
ATOM   1578 C  C     . ALA A 1 243 ? -6.662  -4.781  31.175  1.00 69.06  ? 353 ALA A C     1 
ATOM   1579 O  O     . ALA A 1 243 ? -6.695  -4.938  29.952  1.00 69.60  ? 353 ALA A O     1 
ATOM   1580 C  CB    . ALA A 1 243 ? -4.397  -4.272  32.049  1.00 63.78  ? 353 ALA A CB    1 
ATOM   1581 N  N     . THR A 1 244 ? -7.610  -4.120  31.853  1.00 65.75  ? 354 THR A N     1 
ATOM   1582 C  CA    . THR A 1 244 ? -8.762  -3.477  31.200  1.00 65.79  ? 354 THR A CA    1 
ATOM   1583 C  C     . THR A 1 244 ? -8.318  -2.115  30.628  1.00 70.68  ? 354 THR A C     1 
ATOM   1584 O  O     . THR A 1 244 ? -7.179  -1.697  30.874  1.00 70.60  ? 354 THR A O     1 
ATOM   1585 C  CB    . THR A 1 244 ? -9.919  -3.307  32.201  1.00 71.20  ? 354 THR A CB    1 
ATOM   1586 O  OG1   . THR A 1 244 ? -9.490  -2.434  33.242  1.00 70.79  ? 354 THR A OG1   1 
ATOM   1587 C  CG2   . THR A 1 244 ? -10.378 -4.620  32.817  1.00 68.01  ? 354 THR A CG2   1 
ATOM   1588 N  N     . GLU A 1 245 ? -9.210  -1.411  29.901  1.00 67.04  ? 355 GLU A N     1 
ATOM   1589 C  CA    . GLU A 1 245 ? -8.923  -0.079  29.349  1.00 67.08  ? 355 GLU A CA    1 
ATOM   1590 C  C     . GLU A 1 245 ? -8.651  0.919   30.484  1.00 71.88  ? 355 GLU A C     1 
ATOM   1591 O  O     . GLU A 1 245 ? -7.728  1.724   30.376  1.00 72.82  ? 355 GLU A O     1 
ATOM   1592 C  CB    . GLU A 1 245 ? -10.072 0.413   28.459  1.00 68.47  ? 355 GLU A CB    1 
ATOM   1593 N  N     . ASP A 1 246 ? -9.420  0.820   31.587  1.00 67.72  ? 356 ASP A N     1 
ATOM   1594 C  CA    . ASP A 1 246 ? -9.275  1.657   32.776  1.00 67.05  ? 356 ASP A CA    1 
ATOM   1595 C  C     . ASP A 1 246 ? -8.001  1.305   33.547  1.00 67.75  ? 356 ASP A C     1 
ATOM   1596 O  O     . ASP A 1 246 ? -7.312  2.219   33.974  1.00 67.34  ? 356 ASP A O     1 
ATOM   1597 C  CB    . ASP A 1 246 ? -10.507 1.541   33.694  1.00 69.46  ? 356 ASP A CB    1 
ATOM   1598 C  CG    . ASP A 1 246 ? -11.650 2.456   33.295  1.00 84.84  ? 356 ASP A CG    1 
ATOM   1599 O  OD1   . ASP A 1 246 ? -11.561 3.672   33.573  1.00 88.72  ? 356 ASP A OD1   1 
ATOM   1600 O  OD2   . ASP A 1 246 ? -12.640 1.956   32.721  1.00 87.95  ? 356 ASP A OD2   1 
ATOM   1601 N  N     . GLU A 1 247 ? -7.691  0.004   33.735  1.00 62.70  ? 357 GLU A N     1 
ATOM   1602 C  CA    . GLU A 1 247 ? -6.470  -0.431  34.432  1.00 62.03  ? 357 GLU A CA    1 
ATOM   1603 C  C     . GLU A 1 247 ? -5.223  0.083   33.705  1.00 63.74  ? 357 GLU A C     1 
ATOM   1604 O  O     . GLU A 1 247 ? -4.290  0.567   34.350  1.00 62.52  ? 357 GLU A O     1 
ATOM   1605 C  CB    . GLU A 1 247 ? -6.413  -1.958  34.550  1.00 63.53  ? 357 GLU A CB    1 
ATOM   1606 C  CG    . GLU A 1 247 ? -7.159  -2.532  35.748  1.00 75.51  ? 357 GLU A CG    1 
ATOM   1607 C  CD    . GLU A 1 247 ? -7.005  -4.032  35.930  1.00 97.14  ? 357 GLU A CD    1 
ATOM   1608 O  OE1   . GLU A 1 247 ? -7.220  -4.780  34.949  1.00 85.23  ? 357 GLU A OE1   1 
ATOM   1609 O  OE2   . GLU A 1 247 ? -6.663  -4.460  37.055  1.00 96.23  ? 357 GLU A OE2   1 
ATOM   1610 N  N     . GLU A 1 248 ? -5.237  -0.004  32.349  1.00 59.24  ? 358 GLU A N     1 
ATOM   1611 C  CA    . GLU A 1 248 ? -4.198  0.473   31.428  1.00 57.59  ? 358 GLU A CA    1 
ATOM   1612 C  C     . GLU A 1 248 ? -3.989  1.963   31.583  1.00 58.55  ? 358 GLU A C     1 
ATOM   1613 O  O     . GLU A 1 248 ? -2.863  2.420   31.484  1.00 58.67  ? 358 GLU A O     1 
ATOM   1614 C  CB    . GLU A 1 248 ? -4.581  0.183   29.959  1.00 58.60  ? 358 GLU A CB    1 
ATOM   1615 C  CG    . GLU A 1 248 ? -4.062  -1.135  29.413  1.00 66.17  ? 358 GLU A CG    1 
ATOM   1616 C  CD    . GLU A 1 248 ? -4.476  -1.463  27.987  1.00 88.71  ? 358 GLU A CD    1 
ATOM   1617 O  OE1   . GLU A 1 248 ? -4.515  -0.539  27.139  1.00 67.60  ? 358 GLU A OE1   1 
ATOM   1618 O  OE2   . GLU A 1 248 ? -4.735  -2.658  27.712  1.00 85.58  ? 358 GLU A OE2   1 
ATOM   1619 N  N     . GLN A 1 249 ? -5.070  2.715   31.792  1.00 53.00  ? 359 GLN A N     1 
ATOM   1620 C  CA    . GLN A 1 249 ? -5.064  4.165   31.947  1.00 52.41  ? 359 GLN A CA    1 
ATOM   1621 C  C     . GLN A 1 249 ? -4.491  4.570   33.320  1.00 56.35  ? 359 GLN A C     1 
ATOM   1622 O  O     . GLN A 1 249 ? -3.795  5.574   33.428  1.00 55.93  ? 359 GLN A O     1 
ATOM   1623 C  CB    . GLN A 1 249 ? -6.504  4.714   31.767  1.00 53.84  ? 359 GLN A CB    1 
ATOM   1624 C  CG    . GLN A 1 249 ? -6.641  6.243   31.703  1.00 71.79  ? 359 GLN A CG    1 
ATOM   1625 C  CD    . GLN A 1 249 ? -6.585  6.951   33.052  1.00 95.84  ? 359 GLN A CD    1 
ATOM   1626 O  OE1   . GLN A 1 249 ? -6.948  6.405   34.100  1.00 88.09  ? 359 GLN A OE1   1 
ATOM   1627 N  NE2   . GLN A 1 249 ? -6.085  8.181   33.062  1.00 93.53  ? 359 GLN A NE2   1 
ATOM   1628 N  N     . GLN A 1 250 ? -4.793  3.807   34.361  1.00 53.26  ? 360 GLN A N     1 
ATOM   1629 C  CA    . GLN A 1 250 ? -4.425  4.169   35.723  1.00 52.66  ? 360 GLN A CA    1 
ATOM   1630 C  C     . GLN A 1 250 ? -3.005  3.789   36.133  1.00 55.66  ? 360 GLN A C     1 
ATOM   1631 O  O     . GLN A 1 250 ? -2.514  4.345   37.114  1.00 55.58  ? 360 GLN A O     1 
ATOM   1632 C  CB    . GLN A 1 250 ? -5.434  3.540   36.702  1.00 53.77  ? 360 GLN A CB    1 
ATOM   1633 C  CG    . GLN A 1 250 ? -6.832  4.179   36.627  1.00 66.74  ? 360 GLN A CG    1 
ATOM   1634 C  CD    . GLN A 1 250 ? -7.954  3.313   37.168  1.00 98.93  ? 360 GLN A CD    1 
ATOM   1635 O  OE1   . GLN A 1 250 ? -7.755  2.413   37.998  1.00 97.63  ? 360 GLN A OE1   1 
ATOM   1636 N  NE2   . GLN A 1 250 ? -9.181  3.588   36.722  1.00 93.47  ? 360 GLN A NE2   1 
ATOM   1637 N  N     . LEU A 1 251 ? -2.360  2.836   35.439  1.00 52.31  ? 361 LEU A N     1 
ATOM   1638 C  CA    . LEU A 1 251 ? -1.036  2.344   35.826  1.00 51.74  ? 361 LEU A CA    1 
ATOM   1639 C  C     . LEU A 1 251 ? 0.032   3.455   35.990  1.00 53.08  ? 361 LEU A C     1 
ATOM   1640 O  O     . LEU A 1 251 ? 0.713   3.471   37.021  1.00 52.85  ? 361 LEU A O     1 
ATOM   1641 C  CB    . LEU A 1 251 ? -0.520  1.274   34.858  1.00 52.15  ? 361 LEU A CB    1 
ATOM   1642 C  CG    . LEU A 1 251 ? 0.797   0.622   35.274  1.00 58.98  ? 361 LEU A CG    1 
ATOM   1643 C  CD1   . LEU A 1 251 ? 0.597   -0.353  36.422  1.00 59.75  ? 361 LEU A CD1   1 
ATOM   1644 C  CD2   . LEU A 1 251 ? 1.449   -0.065  34.116  1.00 63.95  ? 361 LEU A CD2   1 
ATOM   1645 N  N     . LEU A 1 252 ? 0.187   4.363   35.005  1.00 46.63  ? 362 LEU A N     1 
ATOM   1646 C  CA    . LEU A 1 252 ? 1.229   5.405   35.091  1.00 45.99  ? 362 LEU A CA    1 
ATOM   1647 C  C     . LEU A 1 252 ? 0.975   6.357   36.276  1.00 52.83  ? 362 LEU A C     1 
ATOM   1648 O  O     . LEU A 1 252 ? 1.941   6.742   36.926  1.00 52.69  ? 362 LEU A O     1 
ATOM   1649 C  CB    . LEU A 1 252 ? 1.412   6.176   33.762  1.00 44.33  ? 362 LEU A CB    1 
ATOM   1650 C  CG    . LEU A 1 252 ? 1.937   5.345   32.550  1.00 47.38  ? 362 LEU A CG    1 
ATOM   1651 C  CD1   . LEU A 1 252 ? 2.115   6.204   31.323  1.00 46.49  ? 362 LEU A CD1   1 
ATOM   1652 C  CD2   . LEU A 1 252 ? 3.258   4.612   32.853  1.00 46.72  ? 362 LEU A CD2   1 
ATOM   1653 N  N     . HIS A 1 253 ? -0.311  6.633   36.617  1.00 50.38  ? 363 HIS A N     1 
ATOM   1654 C  CA    . HIS A 1 253 ? -0.704  7.445   37.778  1.00 50.91  ? 363 HIS A CA    1 
ATOM   1655 C  C     . HIS A 1 253 ? -0.358  6.704   39.084  1.00 55.77  ? 363 HIS A C     1 
ATOM   1656 O  O     . HIS A 1 253 ? 0.209   7.320   39.987  1.00 56.74  ? 363 HIS A O     1 
ATOM   1657 C  CB    . HIS A 1 253 ? -2.210  7.802   37.743  1.00 51.70  ? 363 HIS A CB    1 
ATOM   1658 C  CG    . HIS A 1 253 ? -2.597  8.662   36.585  1.00 54.94  ? 363 HIS A CG    1 
ATOM   1659 N  ND1   . HIS A 1 253 ? -2.412  10.046  36.609  1.00 56.58  ? 363 HIS A ND1   1 
ATOM   1660 C  CD2   . HIS A 1 253 ? -3.100  8.308   35.381  1.00 56.71  ? 363 HIS A CD2   1 
ATOM   1661 C  CE1   . HIS A 1 253 ? -2.810  10.483  35.422  1.00 56.19  ? 363 HIS A CE1   1 
ATOM   1662 N  NE2   . HIS A 1 253 ? -3.246  9.481   34.652  1.00 56.66  ? 363 HIS A NE2   1 
ATOM   1663 N  N     . LYS A 1 254 ? -0.642  5.384   39.166  1.00 50.76  ? 364 LYS A N     1 
ATOM   1664 C  CA    . LYS A 1 254 ? -0.341  4.583   40.361  1.00 51.00  ? 364 LYS A CA    1 
ATOM   1665 C  C     . LYS A 1 254 ? 1.174   4.470   40.603  1.00 57.40  ? 364 LYS A C     1 
ATOM   1666 O  O     . LYS A 1 254 ? 1.644   4.639   41.732  1.00 58.18  ? 364 LYS A O     1 
ATOM   1667 C  CB    . LYS A 1 254 ? -0.956  3.176   40.246  1.00 53.62  ? 364 LYS A CB    1 
ATOM   1668 C  CG    . LYS A 1 254 ? -2.478  3.144   40.375  1.00 53.40  ? 364 LYS A CG    1 
ATOM   1669 C  CD    . LYS A 1 254 ? -3.041  1.806   39.937  1.00 64.86  ? 364 LYS A CD    1 
ATOM   1670 C  CE    . LYS A 1 254 ? -4.540  1.741   40.114  1.00 75.97  ? 364 LYS A CE    1 
ATOM   1671 N  NZ    . LYS A 1 254 ? -5.091  0.417   39.715  1.00 83.63  ? 364 LYS A NZ    1 
ATOM   1672 N  N     . VAL A 1 255 ? 1.932   4.200   39.543  1.00 54.66  ? 365 VAL A N     1 
ATOM   1673 C  CA    . VAL A 1 255 ? 3.385   4.027   39.612  1.00 55.02  ? 365 VAL A CA    1 
ATOM   1674 C  C     . VAL A 1 255 ? 4.081   5.346   40.032  1.00 59.69  ? 365 VAL A C     1 
ATOM   1675 O  O     . VAL A 1 255 ? 4.967   5.311   40.895  1.00 60.54  ? 365 VAL A O     1 
ATOM   1676 C  CB    . VAL A 1 255 ? 3.921   3.461   38.267  1.00 58.13  ? 365 VAL A CB    1 
ATOM   1677 C  CG1   . VAL A 1 255 ? 5.407   3.721   38.080  1.00 57.71  ? 365 VAL A CG1   1 
ATOM   1678 C  CG2   . VAL A 1 255 ? 3.616   1.973   38.161  1.00 57.59  ? 365 VAL A CG2   1 
ATOM   1679 N  N     . THR A 1 256 ? 3.663   6.490   39.463  1.00 55.04  ? 366 THR A N     1 
ATOM   1680 C  CA    . THR A 1 256 ? 4.278   7.776   39.785  1.00 54.78  ? 366 THR A CA    1 
ATOM   1681 C  C     . THR A 1 256 ? 3.877   8.227   41.207  1.00 60.52  ? 366 THR A C     1 
ATOM   1682 O  O     . THR A 1 256 ? 4.735   8.786   41.894  1.00 59.53  ? 366 THR A O     1 
ATOM   1683 C  CB    . THR A 1 256 ? 4.017   8.824   38.692  1.00 55.44  ? 366 THR A CB    1 
ATOM   1684 O  OG1   . THR A 1 256 ? 2.620   8.927   38.428  1.00 53.09  ? 366 THR A OG1   1 
ATOM   1685 C  CG2   . THR A 1 256 ? 4.757   8.490   37.392  1.00 51.21  ? 366 THR A CG2   1 
ATOM   1686 N  N     . ASP A 1 257 ? 2.617   7.947   41.669  1.00 57.78  ? 367 ASP A N     1 
ATOM   1687 C  CA    . ASP A 1 257 ? 2.194   8.260   43.046  1.00 57.80  ? 367 ASP A CA    1 
ATOM   1688 C  C     . ASP A 1 257 ? 3.029   7.440   44.047  1.00 61.82  ? 367 ASP A C     1 
ATOM   1689 O  O     . ASP A 1 257 ? 3.441   7.970   45.075  1.00 62.30  ? 367 ASP A O     1 
ATOM   1690 C  CB    . ASP A 1 257 ? 0.690   8.002   43.267  1.00 60.09  ? 367 ASP A CB    1 
ATOM   1691 C  CG    . ASP A 1 257 ? -0.273  8.985   42.607  1.00 74.84  ? 367 ASP A CG    1 
ATOM   1692 O  OD1   . ASP A 1 257 ? -1.450  8.605   42.382  1.00 76.52  ? 367 ASP A OD1   1 
ATOM   1693 O  OD2   . ASP A 1 257 ? 0.148   10.132  42.307  1.00 80.30  ? 367 ASP A OD2   1 
ATOM   1694 N  N     . PHE A 1 258 ? 3.315   6.164   43.718  1.00 57.75  ? 368 PHE A N     1 
ATOM   1695 C  CA    . PHE A 1 258 ? 4.136   5.266   44.529  1.00 57.36  ? 368 PHE A CA    1 
ATOM   1696 C  C     . PHE A 1 258 ? 5.541   5.844   44.687  1.00 59.14  ? 368 PHE A C     1 
ATOM   1697 O  O     . PHE A 1 258 ? 6.048   5.892   45.805  1.00 59.45  ? 368 PHE A O     1 
ATOM   1698 C  CB    . PHE A 1 258 ? 4.173   3.860   43.902  1.00 60.00  ? 368 PHE A CB    1 
ATOM   1699 C  CG    . PHE A 1 258 ? 5.170   2.904   44.513  1.00 62.75  ? 368 PHE A CG    1 
ATOM   1700 C  CD1   . PHE A 1 258 ? 4.984   2.404   45.798  1.00 66.97  ? 368 PHE A CD1   1 
ATOM   1701 C  CD2   . PHE A 1 258 ? 6.288   2.491   43.799  1.00 65.45  ? 368 PHE A CD2   1 
ATOM   1702 C  CE1   . PHE A 1 258 ? 5.911   1.522   46.363  1.00 68.20  ? 368 PHE A CE1   1 
ATOM   1703 C  CE2   . PHE A 1 258 ? 7.215   1.608   44.365  1.00 68.88  ? 368 PHE A CE2   1 
ATOM   1704 C  CZ    . PHE A 1 258 ? 7.018   1.128   45.641  1.00 67.36  ? 368 PHE A CZ    1 
ATOM   1705 N  N     . TRP A 1 259 ? 6.146   6.326   43.580  1.00 53.19  ? 369 TRP A N     1 
ATOM   1706 C  CA    . TRP A 1 259 ? 7.473   6.952   43.577  1.00 51.17  ? 369 TRP A CA    1 
ATOM   1707 C  C     . TRP A 1 259 ? 7.456   8.303   44.323  1.00 55.82  ? 369 TRP A C     1 
ATOM   1708 O  O     . TRP A 1 259 ? 8.422   8.622   45.025  1.00 54.97  ? 369 TRP A O     1 
ATOM   1709 C  CB    . TRP A 1 259 ? 7.979   7.125   42.145  1.00 48.24  ? 369 TRP A CB    1 
ATOM   1710 C  CG    . TRP A 1 259 ? 8.423   5.843   41.513  1.00 48.30  ? 369 TRP A CG    1 
ATOM   1711 C  CD1   . TRP A 1 259 ? 8.910   4.734   42.150  1.00 50.52  ? 369 TRP A CD1   1 
ATOM   1712 C  CD2   . TRP A 1 259 ? 8.470   5.552   40.112  1.00 47.80  ? 369 TRP A CD2   1 
ATOM   1713 N  NE1   . TRP A 1 259 ? 9.255   3.774   41.231  1.00 48.25  ? 369 TRP A NE1   1 
ATOM   1714 C  CE2   . TRP A 1 259 ? 8.987   4.242   39.974  1.00 49.99  ? 369 TRP A CE2   1 
ATOM   1715 C  CE3   . TRP A 1 259 ? 8.151   6.280   38.953  1.00 48.65  ? 369 TRP A CE3   1 
ATOM   1716 C  CZ2   . TRP A 1 259 ? 9.182   3.647   38.729  1.00 49.25  ? 369 TRP A CZ2   1 
ATOM   1717 C  CZ3   . TRP A 1 259 ? 8.346   5.685   37.718  1.00 49.82  ? 369 TRP A CZ3   1 
ATOM   1718 C  CH2   . TRP A 1 259 ? 8.855   4.386   37.613  1.00 50.34  ? 369 TRP A CH2   1 
ATOM   1719 N  N     . LYS A 1 260 ? 6.347   9.073   44.196  1.00 52.89  ? 370 LYS A N     1 
ATOM   1720 C  CA    . LYS A 1 260 ? 6.156   10.345  44.901  1.00 53.27  ? 370 LYS A CA    1 
ATOM   1721 C  C     . LYS A 1 260 ? 6.178   10.082  46.425  1.00 60.66  ? 370 LYS A C     1 
ATOM   1722 O  O     . LYS A 1 260 ? 6.864   10.795  47.152  1.00 61.37  ? 370 LYS A O     1 
ATOM   1723 C  CB    . LYS A 1 260 ? 4.845   11.015  44.465  1.00 54.42  ? 370 LYS A CB    1 
ATOM   1724 C  CG    . LYS A 1 260 ? 4.820   12.517  44.643  1.00 57.82  ? 370 LYS A CG    1 
ATOM   1725 N  N     . GLN A 1 261 ? 5.483   9.013   46.882  1.00 58.15  ? 371 GLN A N     1 
ATOM   1726 C  CA    . GLN A 1 261 ? 5.435   8.568   48.281  1.00 59.48  ? 371 GLN A CA    1 
ATOM   1727 C  C     . GLN A 1 261 ? 6.814   8.134   48.765  1.00 67.71  ? 371 GLN A C     1 
ATOM   1728 O  O     . GLN A 1 261 ? 7.158   8.398   49.914  1.00 70.11  ? 371 GLN A O     1 
ATOM   1729 C  CB    . GLN A 1 261 ? 4.462   7.388   48.452  1.00 61.10  ? 371 GLN A CB    1 
ATOM   1730 C  CG    . GLN A 1 261 ? 2.978   7.727   48.357  1.00 76.51  ? 371 GLN A CG    1 
ATOM   1731 C  CD    . GLN A 1 261 ? 2.141   6.468   48.195  1.00 99.69  ? 371 GLN A CD    1 
ATOM   1732 O  OE1   . GLN A 1 261 ? 1.763   6.077   47.083  1.00 93.54  ? 371 GLN A OE1   1 
ATOM   1733 N  NE2   . GLN A 1 261 ? 1.875   5.771   49.296  1.00 95.48  ? 371 GLN A NE2   1 
ATOM   1734 N  N     . GLN A 1 262 ? 7.588   7.447   47.888  1.00 64.14  ? 372 GLN A N     1 
ATOM   1735 C  CA    . GLN A 1 262 ? 8.955   6.958   48.127  1.00 63.31  ? 372 GLN A CA    1 
ATOM   1736 C  C     . GLN A 1 262 ? 9.996   8.090   48.222  1.00 65.34  ? 372 GLN A C     1 
ATOM   1737 O  O     . GLN A 1 262 ? 11.043  7.905   48.843  1.00 65.53  ? 372 GLN A O     1 
ATOM   1738 C  CB    . GLN A 1 262 ? 9.382   5.999   46.998  1.00 64.82  ? 372 GLN A CB    1 
ATOM   1739 C  CG    . GLN A 1 262 ? 8.584   4.691   46.889  1.00 77.05  ? 372 GLN A CG    1 
ATOM   1740 C  CD    . GLN A 1 262 ? 8.717   3.826   48.110  1.00 87.46  ? 372 GLN A CD    1 
ATOM   1741 O  OE1   . GLN A 1 262 ? 9.731   3.152   48.304  1.00 82.51  ? 372 GLN A OE1   1 
ATOM   1742 N  NE2   . GLN A 1 262 ? 7.708   3.858   48.973  1.00 74.79  ? 372 GLN A NE2   1 
ATOM   1743 N  N     . GLY A 1 263 ? 9.706   9.223   47.578  1.00 59.73  ? 373 GLY A N     1 
ATOM   1744 C  CA    . GLY A 1 263 ? 10.577  10.393  47.504  1.00 57.97  ? 373 GLY A CA    1 
ATOM   1745 C  C     . GLY A 1 263 ? 11.544  10.314  46.335  1.00 58.56  ? 373 GLY A C     1 
ATOM   1746 O  O     . GLY A 1 263 ? 12.634  10.908  46.375  1.00 56.12  ? 373 GLY A O     1 
ATOM   1747 N  N     . LEU A 1 264 ? 11.128  9.587   45.269  1.00 53.06  ? 374 LEU A N     1 
ATOM   1748 C  CA    . LEU A 1 264 ? 11.948  9.329   44.087  1.00 51.44  ? 374 LEU A CA    1 
ATOM   1749 C  C     . LEU A 1 264 ? 11.529  10.124  42.870  1.00 53.89  ? 374 LEU A C     1 
ATOM   1750 O  O     . LEU A 1 264 ? 12.292  10.177  41.903  1.00 54.44  ? 374 LEU A O     1 
ATOM   1751 C  CB    . LEU A 1 264 ? 11.906  7.819   43.749  1.00 51.01  ? 374 LEU A CB    1 
ATOM   1752 C  CG    . LEU A 1 264 ? 12.487  6.865   44.803  1.00 55.23  ? 374 LEU A CG    1 
ATOM   1753 C  CD1   . LEU A 1 264 ? 12.306  5.434   44.395  1.00 54.45  ? 374 LEU A CD1   1 
ATOM   1754 C  CD2   . LEU A 1 264 ? 13.980  7.161   45.100  1.00 59.11  ? 374 LEU A CD2   1 
ATOM   1755 N  N     . LEU A 1 265 ? 10.322  10.711  42.888  1.00 49.31  ? 375 LEU A N     1 
ATOM   1756 C  CA    . LEU A 1 265 ? 9.811   11.466  41.749  1.00 48.53  ? 375 LEU A CA    1 
ATOM   1757 C  C     . LEU A 1 265 ? 10.277  12.917  41.844  1.00 52.13  ? 375 LEU A C     1 
ATOM   1758 O  O     . LEU A 1 265 ? 9.828   13.662  42.724  1.00 53.32  ? 375 LEU A O     1 
ATOM   1759 C  CB    . LEU A 1 265 ? 8.274   11.356  41.699  1.00 48.30  ? 375 LEU A CB    1 
ATOM   1760 C  CG    . LEU A 1 265 ? 7.568   11.682  40.385  1.00 52.25  ? 375 LEU A CG    1 
ATOM   1761 C  CD1   . LEU A 1 265 ? 7.904   10.668  39.312  1.00 51.97  ? 375 LEU A CD1   1 
ATOM   1762 C  CD2   . LEU A 1 265 ? 6.060   11.697  40.599  1.00 57.16  ? 375 LEU A CD2   1 
ATOM   1763 N  N     . LEU A 1 266 ? 11.212  13.296  40.966  1.00 45.41  ? 376 LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 266 ? 11.769  14.655  40.905  1.00 42.49  ? 376 LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 266 ? 11.005  15.522  39.892  1.00 46.20  ? 376 LEU A C     1 
ATOM   1766 O  O     . LEU A 1 266 ? 10.912  16.731  40.059  1.00 46.12  ? 376 LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 266 ? 13.254  14.603  40.564  1.00 41.52  ? 376 LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 266 ? 14.123  13.749  41.507  1.00 46.27  ? 376 LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 266 ? 15.577  13.776  41.077  1.00 45.98  ? 376 LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 266 ? 13.994  14.199  42.970  1.00 48.93  ? 376 LEU A CD2   1 
ATOM   1771 N  N     . TYR A 1 267 ? 10.449  14.914  38.855  1.00 42.92  ? 377 TYR A N     1 
ATOM   1772 C  CA    . TYR A 1 267 ? 9.657   15.597  37.825  1.00 41.44  ? 377 TYR A CA    1 
ATOM   1773 C  C     . TYR A 1 267 ? 8.723   14.588  37.213  1.00 46.78  ? 377 TYR A C     1 
ATOM   1774 O  O     . TYR A 1 267 ? 9.118   13.454  37.040  1.00 46.55  ? 377 TYR A O     1 
ATOM   1775 C  CB    . TYR A 1 267 ? 10.522  16.293  36.741  1.00 40.21  ? 377 TYR A CB    1 
ATOM   1776 C  CG    . TYR A 1 267 ? 9.705   16.933  35.632  1.00 40.76  ? 377 TYR A CG    1 
ATOM   1777 C  CD1   . TYR A 1 267 ? 9.181   18.210  35.774  1.00 41.74  ? 377 TYR A CD1   1 
ATOM   1778 C  CD2   . TYR A 1 267 ? 9.403   16.233  34.461  1.00 41.82  ? 377 TYR A CD2   1 
ATOM   1779 C  CE1   . TYR A 1 267 ? 8.382   18.781  34.781  1.00 44.35  ? 377 TYR A CE1   1 
ATOM   1780 C  CE2   . TYR A 1 267 ? 8.598   16.789  33.467  1.00 42.49  ? 377 TYR A CE2   1 
ATOM   1781 C  CZ    . TYR A 1 267 ? 8.099   18.071  33.623  1.00 50.72  ? 377 TYR A CZ    1 
ATOM   1782 O  OH    . TYR A 1 267 ? 7.331   18.635  32.621  1.00 48.20  ? 377 TYR A OH    1 
ATOM   1783 N  N     . CYS A 1 268 ? 7.500   14.995  36.860  1.00 47.05  ? 378 CYS A N     1 
ATOM   1784 C  CA    . CYS A 1 268 ? 6.519   14.097  36.262  1.00 48.89  ? 378 CYS A CA    1 
ATOM   1785 C  C     . CYS A 1 268 ? 5.533   14.881  35.398  1.00 52.38  ? 378 CYS A C     1 
ATOM   1786 O  O     . CYS A 1 268 ? 4.955   15.861  35.856  1.00 53.71  ? 378 CYS A O     1 
ATOM   1787 C  CB    . CYS A 1 268 ? 5.799   13.318  37.358  1.00 50.54  ? 378 CYS A CB    1 
ATOM   1788 S  SG    . CYS A 1 268 ? 4.505   12.217  36.760  1.00 55.85  ? 378 CYS A SG    1 
ATOM   1789 N  N     . ASP A 1 269 ? 5.356   14.446  34.154  1.00 46.11  ? 379 ASP A N     1 
ATOM   1790 C  CA    . ASP A 1 269 ? 4.403   14.983  33.208  1.00 45.94  ? 379 ASP A CA    1 
ATOM   1791 C  C     . ASP A 1 269 ? 3.765   13.793  32.515  1.00 52.87  ? 379 ASP A C     1 
ATOM   1792 O  O     . ASP A 1 269 ? 4.467   13.081  31.801  1.00 51.33  ? 379 ASP A O     1 
ATOM   1793 C  CB    . ASP A 1 269 ? 5.068   15.938  32.201  1.00 48.36  ? 379 ASP A CB    1 
ATOM   1794 C  CG    . ASP A 1 269 ? 4.126   16.629  31.205  1.00 65.20  ? 379 ASP A CG    1 
ATOM   1795 O  OD1   . ASP A 1 269 ? 2.916   16.769  31.517  1.00 67.71  ? 379 ASP A OD1   1 
ATOM   1796 O  OD2   . ASP A 1 269 ? 4.608   17.065  30.133  1.00 72.15  ? 379 ASP A OD2   1 
ATOM   1797 N  N     . ILE A 1 270 ? 2.460   13.532  32.774  1.00 51.43  ? 380 ILE A N     1 
ATOM   1798 C  CA    . ILE A 1 270 ? 1.735   12.401  32.182  1.00 51.18  ? 380 ILE A CA    1 
ATOM   1799 C  C     . ILE A 1 270 ? 0.855   12.930  31.068  1.00 57.30  ? 380 ILE A C     1 
ATOM   1800 O  O     . ILE A 1 270 ? 0.042   13.829  31.296  1.00 59.04  ? 380 ILE A O     1 
ATOM   1801 C  CB    . ILE A 1 270 ? 0.911   11.614  33.240  1.00 54.12  ? 380 ILE A CB    1 
ATOM   1802 C  CG1   . ILE A 1 270 ? 1.799   11.050  34.356  1.00 54.31  ? 380 ILE A CG1   1 
ATOM   1803 C  CG2   . ILE A 1 270 ? 0.073   10.501  32.592  1.00 55.87  ? 380 ILE A CG2   1 
ATOM   1804 C  CD1   . ILE A 1 270 ? 1.051   10.709  35.674  1.00 62.27  ? 380 ILE A CD1   1 
ATOM   1805 N  N     . LEU A 1 271 ? 1.048   12.414  29.862  1.00 53.67  ? 381 LEU A N     1 
ATOM   1806 C  CA    . LEU A 1 271 ? 0.235   12.757  28.700  1.00 53.87  ? 381 LEU A CA    1 
ATOM   1807 C  C     . LEU A 1 271 ? -0.790  11.668  28.514  1.00 57.62  ? 381 LEU A C     1 
ATOM   1808 O  O     . LEU A 1 271 ? -0.427  10.513  28.278  1.00 56.52  ? 381 LEU A O     1 
ATOM   1809 C  CB    . LEU A 1 271 ? 1.071   12.948  27.417  1.00 54.62  ? 381 LEU A CB    1 
ATOM   1810 C  CG    . LEU A 1 271 ? 2.033   14.140  27.355  1.00 60.94  ? 381 LEU A CG    1 
ATOM   1811 C  CD1   . LEU A 1 271 ? 2.632   14.248  25.980  1.00 61.28  ? 381 LEU A CD1   1 
ATOM   1812 C  CD2   . LEU A 1 271 ? 1.318   15.457  27.664  1.00 66.73  ? 381 LEU A CD2   1 
ATOM   1813 N  N     . GLU A 1 272 ? -2.077  12.017  28.667  1.00 55.16  ? 382 GLU A N     1 
ATOM   1814 C  CA    . GLU A 1 272 ? -3.162  11.058  28.500  1.00 54.73  ? 382 GLU A CA    1 
ATOM   1815 C  C     . GLU A 1 272 ? -3.208  10.582  27.055  1.00 58.53  ? 382 GLU A C     1 
ATOM   1816 O  O     . GLU A 1 272 ? -2.776  11.295  26.134  1.00 58.32  ? 382 GLU A O     1 
ATOM   1817 C  CB    . GLU A 1 272 ? -4.521  11.651  28.929  1.00 56.13  ? 382 GLU A CB    1 
ATOM   1818 C  CG    . GLU A 1 272 ? -4.696  11.787  30.432  1.00 63.09  ? 382 GLU A CG    1 
ATOM   1819 C  CD    . GLU A 1 272 ? -4.411  10.539  31.254  1.00 74.37  ? 382 GLU A CD    1 
ATOM   1820 O  OE1   . GLU A 1 272 ? -4.930  9.452   30.910  1.00 66.94  ? 382 GLU A OE1   1 
ATOM   1821 O  OE2   . GLU A 1 272 ? -3.677  10.658  32.260  1.00 58.13  ? 382 GLU A OE2   1 
ATOM   1822 N  N     . SER A 1 273 ? -3.709  9.365   26.867  1.00 54.81  ? 383 SER A N     1 
ATOM   1823 C  CA    . SER A 1 273 ? -3.816  8.790   25.540  1.00 54.25  ? 383 SER A CA    1 
ATOM   1824 C  C     . SER A 1 273 ? -4.838  9.535   24.675  1.00 58.58  ? 383 SER A C     1 
ATOM   1825 O  O     . SER A 1 273 ? -5.837  10.031  25.179  1.00 58.44  ? 383 SER A O     1 
ATOM   1826 C  CB    . SER A 1 273 ? -4.197  7.321   25.643  1.00 54.78  ? 383 SER A CB    1 
ATOM   1827 O  OG    . SER A 1 273 ? -4.721  6.874   24.406  1.00 60.93  ? 383 SER A OG    1 
ATOM   1828 N  N     . THR A 1 274 ? -4.566  9.622   23.383  1.00 56.23  ? 384 THR A N     1 
ATOM   1829 C  CA    . THR A 1 274 ? -5.469  10.178  22.374  1.00 56.33  ? 384 THR A CA    1 
ATOM   1830 C  C     . THR A 1 274 ? -5.606  9.071   21.309  1.00 60.84  ? 384 THR A C     1 
ATOM   1831 O  O     . THR A 1 274 ? -6.034  9.327   20.183  1.00 60.95  ? 384 THR A O     1 
ATOM   1832 C  CB    . THR A 1 274 ? -4.963  11.543  21.840  1.00 66.70  ? 384 THR A CB    1 
ATOM   1833 O  OG1   . THR A 1 274 ? -3.641  11.394  21.323  1.00 68.95  ? 384 THR A OG1   1 
ATOM   1834 C  CG2   . THR A 1 274 ? -4.969  12.640  22.902  1.00 65.54  ? 384 THR A CG2   1 
ATOM   1835 N  N     . PHE A 1 275 ? -5.221  7.828   21.690  1.00 58.47  ? 385 PHE A N     1 
ATOM   1836 C  CA    . PHE A 1 275 ? -5.238  6.635   20.838  1.00 59.05  ? 385 PHE A CA    1 
ATOM   1837 C  C     . PHE A 1 275 ? -6.639  6.336   20.353  1.00 64.11  ? 385 PHE A C     1 
ATOM   1838 O  O     . PHE A 1 275 ? -7.594  6.369   21.129  1.00 63.31  ? 385 PHE A O     1 
ATOM   1839 C  CB    . PHE A 1 275 ? -4.647  5.395   21.569  1.00 60.50  ? 385 PHE A CB    1 
ATOM   1840 C  CG    . PHE A 1 275 ? -4.822  4.060   20.881  1.00 61.69  ? 385 PHE A CG    1 
ATOM   1841 C  CD1   . PHE A 1 275 ? -4.161  3.777   19.690  1.00 64.17  ? 385 PHE A CD1   1 
ATOM   1842 C  CD2   . PHE A 1 275 ? -5.638  3.080   21.429  1.00 64.22  ? 385 PHE A CD2   1 
ATOM   1843 C  CE1   . PHE A 1 275 ? -4.338  2.544   19.046  1.00 64.82  ? 385 PHE A CE1   1 
ATOM   1844 C  CE2   . PHE A 1 275 ? -5.810  1.847   20.787  1.00 66.38  ? 385 PHE A CE2   1 
ATOM   1845 C  CZ    . PHE A 1 275 ? -5.143  1.581   19.612  1.00 63.89  ? 385 PHE A CZ    1 
ATOM   1846 N  N     . GLU A 1 276 ? -6.747  6.068   19.054  1.00 62.09  ? 386 GLU A N     1 
ATOM   1847 C  CA    . GLU A 1 276 ? -7.992  5.695   18.398  1.00 62.32  ? 386 GLU A CA    1 
ATOM   1848 C  C     . GLU A 1 276 ? -7.792  4.325   17.742  1.00 65.40  ? 386 GLU A C     1 
ATOM   1849 O  O     . GLU A 1 276 ? -7.027  4.198   16.783  1.00 64.67  ? 386 GLU A O     1 
ATOM   1850 C  CB    . GLU A 1 276 ? -8.437  6.765   17.391  1.00 64.06  ? 386 GLU A CB    1 
ATOM   1851 C  CG    . GLU A 1 276 ? -8.877  8.078   18.022  1.00 75.93  ? 386 GLU A CG    1 
ATOM   1852 C  CD    . GLU A 1 276 ? -9.175  9.183   17.026  1.00 101.55 ? 386 GLU A CD    1 
ATOM   1853 O  OE1   . GLU A 1 276 ? -9.938  8.929   16.065  1.00 95.04  ? 386 GLU A OE1   1 
ATOM   1854 O  OE2   . GLU A 1 276 ? -8.652  10.308  17.209  1.00 98.09  ? 386 GLU A OE2   1 
ATOM   1855 N  N     . LYS A 1 277 ? -8.464  3.296   18.297  1.00 61.62  ? 387 LYS A N     1 
ATOM   1856 C  CA    . LYS A 1 277 ? -8.400  1.896   17.875  1.00 60.84  ? 387 LYS A CA    1 
ATOM   1857 C  C     . LYS A 1 277 ? -8.636  1.696   16.361  1.00 63.37  ? 387 LYS A C     1 
ATOM   1858 O  O     . LYS A 1 277 ? -7.963  0.857   15.751  1.00 63.32  ? 387 LYS A O     1 
ATOM   1859 C  CB    . LYS A 1 277 ? -9.422  1.064   18.675  1.00 63.09  ? 387 LYS A CB    1 
ATOM   1860 C  CG    . LYS A 1 277 ? -9.087  -0.413  18.773  1.00 77.57  ? 387 LYS A CG    1 
ATOM   1861 N  N     . PHE A 1 278 ? -9.562  2.458   15.754  1.00 59.16  ? 388 PHE A N     1 
ATOM   1862 C  CA    . PHE A 1 278 ? -9.894  2.239   14.346  1.00 59.00  ? 388 PHE A CA    1 
ATOM   1863 C  C     . PHE A 1 278 ? -9.454  3.370   13.370  1.00 64.85  ? 388 PHE A C     1 
ATOM   1864 O  O     . PHE A 1 278 ? -9.847  3.341   12.197  1.00 64.01  ? 388 PHE A O     1 
ATOM   1865 C  CB    . PHE A 1 278 ? -11.392 1.924   14.214  1.00 60.25  ? 388 PHE A CB    1 
ATOM   1866 C  CG    . PHE A 1 278 ? -11.791 0.729   15.060  1.00 61.49  ? 388 PHE A CG    1 
ATOM   1867 C  CD1   . PHE A 1 278 ? -12.530 0.897   16.225  1.00 64.33  ? 388 PHE A CD1   1 
ATOM   1868 C  CD2   . PHE A 1 278 ? -11.336 -0.551  14.747  1.00 63.03  ? 388 PHE A CD2   1 
ATOM   1869 C  CE1   . PHE A 1 278 ? -12.852 -0.200  17.037  1.00 64.96  ? 388 PHE A CE1   1 
ATOM   1870 C  CE2   . PHE A 1 278 ? -11.647 -1.644  15.568  1.00 65.75  ? 388 PHE A CE2   1 
ATOM   1871 C  CZ    . PHE A 1 278 ? -12.405 -1.462  16.706  1.00 63.44  ? 388 PHE A CZ    1 
ATOM   1872 N  N     . LYS A 1 279 ? -8.547  4.281   13.805  1.00 63.13  ? 389 LYS A N     1 
ATOM   1873 C  CA    . LYS A 1 279 ? -8.027  5.319   12.903  1.00 63.19  ? 389 LYS A CA    1 
ATOM   1874 C  C     . LYS A 1 279 ? -6.904  4.750   11.996  1.00 67.40  ? 389 LYS A C     1 
ATOM   1875 O  O     . LYS A 1 279 ? -6.121  3.894   12.435  1.00 66.15  ? 389 LYS A O     1 
ATOM   1876 C  CB    . LYS A 1 279 ? -7.545  6.559   13.682  1.00 65.73  ? 389 LYS A CB    1 
ATOM   1877 C  CG    . LYS A 1 279 ? -6.250  6.366   14.455  1.00 86.54  ? 389 LYS A CG    1 
ATOM   1878 N  N     . GLN A 1 280 ? -6.837  5.225   10.734  1.00 65.71  ? 390 GLN A N     1 
ATOM   1879 C  CA    . GLN A 1 280 ? -5.789  4.842   9.773   1.00 66.14  ? 390 GLN A CA    1 
ATOM   1880 C  C     . GLN A 1 280 ? -4.430  5.361   10.296  1.00 73.01  ? 390 GLN A C     1 
ATOM   1881 O  O     . GLN A 1 280 ? -4.406  6.419   10.936  1.00 70.43  ? 390 GLN A O     1 
ATOM   1882 C  CB    . GLN A 1 280 ? -6.090  5.412   8.359   1.00 67.31  ? 390 GLN A CB    1 
ATOM   1883 C  CG    . GLN A 1 280 ? -5.974  6.948   8.253   1.00 74.82  ? 390 GLN A CG    1 
ATOM   1884 C  CD    . GLN A 1 280 ? -6.456  7.545   6.946   1.00 88.97  ? 390 GLN A CD    1 
ATOM   1885 O  OE1   . GLN A 1 280 ? -5.656  7.939   6.086   1.00 86.88  ? 390 GLN A OE1   1 
ATOM   1886 N  NE2   . GLN A 1 280 ? -7.775  7.707   6.797   1.00 64.48  ? 390 GLN A NE2   1 
ATOM   1887 N  N     . PRO A 1 281 ? -3.288  4.665   10.054  1.00 73.85  ? 391 PRO A N     1 
ATOM   1888 C  CA    . PRO A 1 281 ? -1.996  5.204   10.525  1.00 74.91  ? 391 PRO A CA    1 
ATOM   1889 C  C     . PRO A 1 281 ? -1.623  6.528   9.838   1.00 82.34  ? 391 PRO A C     1 
ATOM   1890 O  O     . PRO A 1 281 ? -2.147  6.857   8.770   1.00 82.32  ? 391 PRO A O     1 
ATOM   1891 C  CB    . PRO A 1 281 ? -0.993  4.085   10.194  1.00 75.87  ? 391 PRO A CB    1 
ATOM   1892 C  CG    . PRO A 1 281 ? -1.833  2.868   9.968   1.00 79.66  ? 391 PRO A CG    1 
ATOM   1893 C  CD    . PRO A 1 281 ? -3.089  3.387   9.347   1.00 75.08  ? 391 PRO A CD    1 
ATOM   1894 N  N     . SER A 1 282 ? -0.740  7.298   10.492  1.00 81.22  ? 392 SER A N     1 
ATOM   1895 C  CA    . SER A 1 282 ? -0.259  8.612   10.070  1.00 81.92  ? 392 SER A CA    1 
ATOM   1896 C  C     . SER A 1 282 ? 0.356   8.618   8.662   1.00 86.87  ? 392 SER A C     1 
ATOM   1897 O  O     . SER A 1 282 ? 1.017   7.659   8.246   1.00 86.32  ? 392 SER A O     1 
ATOM   1898 C  CB    . SER A 1 282 ? 0.768   9.138   11.067  1.00 86.25  ? 392 SER A CB    1 
ATOM   1899 O  OG    . SER A 1 282 ? 1.075   10.503  10.827  1.00 98.09  ? 392 SER A OG    1 
ATOM   1900 N  N     . ARG A 1 283 ? 0.112   9.723   7.942   1.00 84.30  ? 393 ARG A N     1 
ATOM   1901 C  CA    . ARG A 1 283 ? 0.639   10.002  6.606   1.00 84.32  ? 393 ARG A CA    1 
ATOM   1902 C  C     . ARG A 1 283 ? 1.868   10.943  6.731   1.00 89.35  ? 393 ARG A C     1 
ATOM   1903 O  O     . ARG A 1 283 ? 2.648   11.067  5.784   1.00 89.36  ? 393 ARG A O     1 
ATOM   1904 C  CB    . ARG A 1 283 ? -0.455  10.621  5.716   1.00 83.57  ? 393 ARG A CB    1 
ATOM   1905 C  CG    . ARG A 1 283 ? -0.149  10.546  4.228   1.00 92.80  ? 393 ARG A CG    1 
ATOM   1906 N  N     . LYS A 1 284 ? 2.043   11.575  7.915   1.00 86.21  ? 394 LYS A N     1 
ATOM   1907 C  CA    . LYS A 1 284 ? 3.137   12.495  8.245   1.00 86.45  ? 394 LYS A CA    1 
ATOM   1908 C  C     . LYS A 1 284 ? 4.520   11.859  8.078   1.00 92.15  ? 394 LYS A C     1 
ATOM   1909 O  O     . LYS A 1 284 ? 4.682   10.652  8.288   1.00 91.66  ? 394 LYS A O     1 
ATOM   1910 C  CB    . LYS A 1 284 ? 3.008   13.008  9.690   1.00 88.16  ? 394 LYS A CB    1 
ATOM   1911 C  CG    . LYS A 1 284 ? 2.007   14.135  9.867   1.00 95.35  ? 394 LYS A CG    1 
ATOM   1912 C  CD    . LYS A 1 284 ? 2.072   14.696  11.279  1.00 102.10 ? 394 LYS A CD    1 
ATOM   1913 C  CE    . LYS A 1 284 ? 1.011   15.739  11.516  1.00 112.51 ? 394 LYS A CE    1 
ATOM   1914 N  NZ    . LYS A 1 284 ? 1.029   16.234  12.919  1.00 124.24 ? 394 LYS A NZ    1 
ATOM   1915 N  N     . VAL A 1 285 ? 5.517   12.699  7.713   1.00 89.93  ? 395 VAL A N     1 
ATOM   1916 C  CA    . VAL A 1 285 ? 6.919   12.325  7.533   1.00 90.10  ? 395 VAL A CA    1 
ATOM   1917 C  C     . VAL A 1 285 ? 7.464   11.799  8.875   1.00 93.89  ? 395 VAL A C     1 
ATOM   1918 O  O     . VAL A 1 285 ? 8.047   10.705  8.933   1.00 92.66  ? 395 VAL A O     1 
ATOM   1919 C  CB    . VAL A 1 285 ? 7.713   13.535  6.996   1.00 94.02  ? 395 VAL A CB    1 
ATOM   1920 N  N     . ASP A 1 286 ? 7.182   12.561  9.957   1.00 90.53  ? 396 ASP A N     1 
ATOM   1921 C  CA    . ASP A 1 286 ? 7.506   12.239  11.343  1.00 90.20  ? 396 ASP A CA    1 
ATOM   1922 C  C     . ASP A 1 286 ? 6.184   12.023  12.076  1.00 93.13  ? 396 ASP A C     1 
ATOM   1923 O  O     . ASP A 1 286 ? 5.447   12.979  12.340  1.00 92.70  ? 396 ASP A O     1 
ATOM   1924 C  CB    . ASP A 1 286 ? 8.375   13.338  11.990  1.00 92.24  ? 396 ASP A CB    1 
ATOM   1925 C  CG    . ASP A 1 286 ? 9.834   13.314  11.549  1.00 101.20 ? 396 ASP A CG    1 
ATOM   1926 O  OD1   . ASP A 1 286 ? 10.519  12.288  11.796  1.00 100.64 ? 396 ASP A OD1   1 
ATOM   1927 O  OD2   . ASP A 1 286 ? 10.301  14.329  10.988  1.00 106.56 ? 396 ASP A OD2   1 
ATOM   1928 N  N     . ALA A 1 287 ? 5.847   10.742  12.316  1.00 89.08  ? 397 ALA A N     1 
ATOM   1929 C  CA    . ALA A 1 287 ? 4.585   10.337  12.935  1.00 87.92  ? 397 ALA A CA    1 
ATOM   1930 C  C     . ALA A 1 287 ? 4.568   10.595  14.452  1.00 87.59  ? 397 ALA A C     1 
ATOM   1931 O  O     . ALA A 1 287 ? 5.554   10.339  15.150  1.00 86.67  ? 397 ALA A O     1 
ATOM   1932 C  CB    . ALA A 1 287 ? 4.297   8.870   12.640  1.00 88.68  ? 397 ALA A CB    1 
ATOM   1933 N  N     . LEU A 1 288 ? 3.423   11.119  14.934  1.00 80.88  ? 398 LEU A N     1 
ATOM   1934 C  CA    . LEU A 1 288 ? 3.103   11.411  16.335  1.00 78.79  ? 398 LEU A CA    1 
ATOM   1935 C  C     . LEU A 1 288 ? 2.609   10.137  17.039  1.00 75.36  ? 398 LEU A C     1 
ATOM   1936 O  O     . LEU A 1 288 ? 1.941   9.296   16.424  1.00 74.72  ? 398 LEU A O     1 
ATOM   1937 C  CB    . LEU A 1 288 ? 2.015   12.517  16.380  1.00 79.33  ? 398 LEU A CB    1 
ATOM   1938 C  CG    . LEU A 1 288 ? 1.507   13.064  17.721  1.00 84.67  ? 398 LEU A CG    1 
ATOM   1939 C  CD1   . LEU A 1 288 ? 2.632   13.714  18.526  1.00 85.58  ? 398 LEU A CD1   1 
ATOM   1940 C  CD2   . LEU A 1 288 ? 0.427   14.088  17.485  1.00 87.24  ? 398 LEU A CD2   1 
ATOM   1941 N  N     . ASP A 1 289 ? 2.955   9.993   18.321  1.00 66.71  ? 399 ASP A N     1 
ATOM   1942 C  CA    . ASP A 1 289 ? 2.553   8.841   19.125  1.00 64.09  ? 399 ASP A CA    1 
ATOM   1943 C  C     . ASP A 1 289 ? 1.382   9.268   20.033  1.00 63.62  ? 399 ASP A C     1 
ATOM   1944 O  O     . ASP A 1 289 ? 1.505   10.213  20.820  1.00 62.03  ? 399 ASP A O     1 
ATOM   1945 C  CB    . ASP A 1 289 ? 3.752   8.295   19.914  1.00 64.79  ? 399 ASP A CB    1 
ATOM   1946 C  CG    . ASP A 1 289 ? 3.467   7.092   20.774  1.00 62.40  ? 399 ASP A CG    1 
ATOM   1947 O  OD1   . ASP A 1 289 ? 2.706   7.229   21.744  1.00 59.73  ? 399 ASP A OD1   1 
ATOM   1948 O  OD2   . ASP A 1 289 ? 4.109   6.050   20.560  1.00 67.45  ? 399 ASP A OD2   1 
ATOM   1949 N  N     . HIS A 1 290 ? 0.258   8.551   19.922  1.00 57.12  ? 400 HIS A N     1 
ATOM   1950 C  CA    . HIS A 1 290 ? -0.957  8.886   20.651  1.00 55.73  ? 400 HIS A CA    1 
ATOM   1951 C  C     . HIS A 1 290 ? -1.154  8.048   21.929  1.00 54.87  ? 400 HIS A C     1 
ATOM   1952 O  O     . HIS A 1 290 ? -2.170  8.225   22.603  1.00 53.72  ? 400 HIS A O     1 
ATOM   1953 C  CB    . HIS A 1 290 ? -2.172  8.753   19.715  1.00 56.61  ? 400 HIS A CB    1 
ATOM   1954 C  CG    . HIS A 1 290 ? -2.110  9.689   18.540  1.00 60.43  ? 400 HIS A CG    1 
ATOM   1955 N  ND1   . HIS A 1 290 ? -2.209  11.069  18.703  1.00 62.03  ? 400 HIS A ND1   1 
ATOM   1956 C  CD2   . HIS A 1 290 ? -1.949  9.418   17.222  1.00 62.73  ? 400 HIS A CD2   1 
ATOM   1957 C  CE1   . HIS A 1 290 ? -2.106  11.586  17.489  1.00 61.77  ? 400 HIS A CE1   1 
ATOM   1958 N  NE2   . HIS A 1 290 ? -1.942  10.637  16.563  1.00 62.50  ? 400 HIS A NE2   1 
ATOM   1959 N  N     . PHE A 1 291 ? -0.185  7.179   22.287  1.00 48.04  ? 401 PHE A N     1 
ATOM   1960 C  CA    . PHE A 1 291 ? -0.331  6.344   23.491  1.00 47.11  ? 401 PHE A CA    1 
ATOM   1961 C  C     . PHE A 1 291 ? -0.150  7.177   24.761  1.00 49.15  ? 401 PHE A C     1 
ATOM   1962 O  O     . PHE A 1 291 ? 0.488   8.217   24.725  1.00 47.58  ? 401 PHE A O     1 
ATOM   1963 C  CB    . PHE A 1 291 ? 0.677   5.154   23.490  1.00 48.21  ? 401 PHE A CB    1 
ATOM   1964 C  CG    . PHE A 1 291 ? 0.469   4.145   22.380  1.00 49.28  ? 401 PHE A CG    1 
ATOM   1965 C  CD1   . PHE A 1 291 ? -0.772  3.555   22.180  1.00 52.80  ? 401 PHE A CD1   1 
ATOM   1966 C  CD2   . PHE A 1 291 ? 1.508   3.804   21.515  1.00 49.59  ? 401 PHE A CD2   1 
ATOM   1967 C  CE1   . PHE A 1 291 ? -0.975  2.639   21.134  1.00 52.94  ? 401 PHE A CE1   1 
ATOM   1968 C  CE2   . PHE A 1 291 ? 1.310   2.864   20.488  1.00 52.36  ? 401 PHE A CE2   1 
ATOM   1969 C  CZ    . PHE A 1 291 ? 0.075   2.278   20.317  1.00 50.48  ? 401 PHE A CZ    1 
ATOM   1970 N  N     . GLN A 1 292 ? -0.683  6.694   25.887  1.00 45.53  ? 402 GLN A N     1 
ATOM   1971 C  CA    . GLN A 1 292 ? -0.477  7.324   27.186  1.00 43.59  ? 402 GLN A CA    1 
ATOM   1972 C  C     . GLN A 1 292 ? 1.015   7.223   27.527  1.00 48.96  ? 402 GLN A C     1 
ATOM   1973 O  O     . GLN A 1 292 ? 1.607   6.153   27.377  1.00 49.10  ? 402 GLN A O     1 
ATOM   1974 C  CB    . GLN A 1 292 ? -1.340  6.642   28.264  1.00 43.65  ? 402 GLN A CB    1 
ATOM   1975 C  CG    . GLN A 1 292 ? -1.303  7.399   29.594  1.00 54.59  ? 402 GLN A CG    1 
ATOM   1976 C  CD    . GLN A 1 292 ? -1.785  6.568   30.745  1.00 77.03  ? 402 GLN A CD    1 
ATOM   1977 O  OE1   . GLN A 1 292 ? -1.505  5.353   30.843  1.00 73.76  ? 402 GLN A OE1   1 
ATOM   1978 N  NE2   . GLN A 1 292 ? -2.497  7.216   31.663  1.00 61.80  ? 402 GLN A NE2   1 
ATOM   1979 N  N     . LYS A 1 293 ? 1.632   8.329   27.940  1.00 46.70  ? 403 LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 293 ? 3.058   8.316   28.253  1.00 46.48  ? 403 LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 293 ? 3.396   9.297   29.348  1.00 53.46  ? 403 LYS A C     1 
ATOM   1982 O  O     . LYS A 1 293 ? 2.585   10.178  29.661  1.00 54.67  ? 403 LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 293 ? 3.896   8.632   27.000  1.00 47.50  ? 403 LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 293 ? 3.610   9.991   26.357  1.00 46.81  ? 403 LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 293 ? 4.399   10.198  25.071  1.00 48.45  ? 403 LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 293 ? 4.098   9.190   23.980  1.00 41.08  ? 403 LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 293 ? 2.758   9.429   23.370  1.00 43.00  ? 403 LYS A NZ    1 
ATOM   1988 N  N     . CYS A 1 294 ? 4.596   9.157   29.934  1.00 48.78  ? 404 CYS A N     1 
ATOM   1989 C  CA    . CYS A 1 294 ? 5.048   10.115  30.927  1.00 49.32  ? 404 CYS A CA    1 
ATOM   1990 C  C     . CYS A 1 294 ? 6.526   10.371  30.775  1.00 50.05  ? 404 CYS A C     1 
ATOM   1991 O  O     . CYS A 1 294 ? 7.295   9.475   30.421  1.00 48.03  ? 404 CYS A O     1 
ATOM   1992 C  CB    . CYS A 1 294 ? 4.686   9.716   32.353  1.00 51.36  ? 404 CYS A CB    1 
ATOM   1993 S  SG    . CYS A 1 294 ? 5.420   8.168   32.908  1.00 56.65  ? 404 CYS A SG    1 
ATOM   1994 N  N     . PHE A 1 295 ? 6.894   11.635  30.972  1.00 45.14  ? 405 PHE A N     1 
ATOM   1995 C  CA    . PHE A 1 295 ? 8.245   12.158  30.932  1.00 43.24  ? 405 PHE A CA    1 
ATOM   1996 C  C     . PHE A 1 295 ? 8.603   12.421  32.367  1.00 45.04  ? 405 PHE A C     1 
ATOM   1997 O  O     . PHE A 1 295 ? 7.905   13.158  33.058  1.00 45.25  ? 405 PHE A O     1 
ATOM   1998 C  CB    . PHE A 1 295 ? 8.321   13.406  30.043  1.00 45.08  ? 405 PHE A CB    1 
ATOM   1999 C  CG    . PHE A 1 295 ? 7.720   13.200  28.669  1.00 46.96  ? 405 PHE A CG    1 
ATOM   2000 C  CD1   . PHE A 1 295 ? 6.528   13.827  28.309  1.00 50.39  ? 405 PHE A CD1   1 
ATOM   2001 C  CD2   . PHE A 1 295 ? 8.320   12.349  27.751  1.00 48.67  ? 405 PHE A CD2   1 
ATOM   2002 C  CE1   . PHE A 1 295 ? 5.981   13.644  27.036  1.00 51.21  ? 405 PHE A CE1   1 
ATOM   2003 C  CE2   . PHE A 1 295 ? 7.757   12.145  26.494  1.00 52.02  ? 405 PHE A CE2   1 
ATOM   2004 C  CZ    . PHE A 1 295 ? 6.603   12.811  26.137  1.00 50.49  ? 405 PHE A CZ    1 
ATOM   2005 N  N     . LEU A 1 296 ? 9.603   11.717  32.860  1.00 40.00  ? 406 LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 296 ? 9.974   11.782  34.266  1.00 38.82  ? 406 LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 296 ? 11.414  12.080  34.497  1.00 42.59  ? 406 LEU A C     1 
ATOM   2008 O  O     . LEU A 1 296 ? 12.264  11.925  33.609  1.00 41.39  ? 406 LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 296 ? 9.698   10.412  34.951  1.00 39.01  ? 406 LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 296 ? 8.408   9.678   34.675  1.00 44.38  ? 406 LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 296 ? 8.492   8.261   35.195  1.00 44.18  ? 406 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 296 ? 7.206   10.416  35.261  1.00 49.77  ? 406 LEU A CD2   1 
ATOM   2013 N  N     . ILE A 1 297 ? 11.688  12.466  35.740  1.00 39.99  ? 407 ILE A N     1 
ATOM   2014 C  CA    . ILE A 1 297 ? 13.016  12.585  36.318  1.00 40.26  ? 407 ILE A CA    1 
ATOM   2015 C  C     . ILE A 1 297 ? 12.934  11.777  37.630  1.00 46.68  ? 407 ILE A C     1 
ATOM   2016 O  O     . ILE A 1 297 ? 12.116  12.085  38.514  1.00 44.76  ? 407 ILE A O     1 
ATOM   2017 C  CB    . ILE A 1 297 ? 13.596  14.012  36.507  1.00 41.98  ? 407 ILE A CB    1 
ATOM   2018 C  CG1   . ILE A 1 297 ? 13.675  14.770  35.173  1.00 41.89  ? 407 ILE A CG1   1 
ATOM   2019 C  CG2   . ILE A 1 297 ? 14.994  13.917  37.155  1.00 41.61  ? 407 ILE A CG2   1 
ATOM   2020 C  CD1   . ILE A 1 297 ? 14.047  16.279  35.291  1.00 43.57  ? 407 ILE A CD1   1 
ATOM   2021 N  N     . LEU A 1 298 ? 13.742  10.727  37.726  1.00 44.57  ? 408 LEU A N     1 
ATOM   2022 C  CA    . LEU A 1 298 ? 13.769  9.886   38.908  1.00 44.56  ? 408 LEU A CA    1 
ATOM   2023 C  C     . LEU A 1 298 ? 15.032  10.088  39.704  1.00 46.62  ? 408 LEU A C     1 
ATOM   2024 O  O     . LEU A 1 298 ? 16.090  10.380  39.143  1.00 46.92  ? 408 LEU A O     1 
ATOM   2025 C  CB    . LEU A 1 298 ? 13.642  8.402   38.519  1.00 45.22  ? 408 LEU A CB    1 
ATOM   2026 C  CG    . LEU A 1 298 ? 12.267  7.956   37.984  1.00 51.50  ? 408 LEU A CG    1 
ATOM   2027 N  N     . LYS A 1 299 ? 14.929  9.897   41.014  1.00 42.26  ? 409 LYS A N     1 
ATOM   2028 C  CA    . LYS A 1 299 ? 16.064  9.924   41.918  1.00 42.54  ? 409 LYS A CA    1 
ATOM   2029 C  C     . LYS A 1 299 ? 16.623  8.507   41.956  1.00 50.21  ? 409 LYS A C     1 
ATOM   2030 O  O     . LYS A 1 299 ? 15.931  7.596   42.416  1.00 50.97  ? 409 LYS A O     1 
ATOM   2031 C  CB    . LYS A 1 299 ? 15.635  10.426  43.318  1.00 44.44  ? 409 LYS A CB    1 
ATOM   2032 C  CG    . LYS A 1 299 ? 16.755  10.415  44.356  1.00 46.21  ? 409 LYS A CG    1 
ATOM   2033 C  CD    . LYS A 1 299 ? 16.332  11.073  45.626  1.00 51.23  ? 409 LYS A CD    1 
ATOM   2034 C  CE    . LYS A 1 299 ? 17.363  10.881  46.697  1.00 63.78  ? 409 LYS A CE    1 
ATOM   2035 N  NZ    . LYS A 1 299 ? 16.947  11.510  47.969  1.00 77.06  ? 409 LYS A NZ    1 
ATOM   2036 N  N     . LEU A 1 300 ? 17.841  8.303   41.422  1.00 47.80  ? 410 LEU A N     1 
ATOM   2037 C  CA    . LEU A 1 300 ? 18.479  6.987   41.395  1.00 46.83  ? 410 LEU A CA    1 
ATOM   2038 C  C     . LEU A 1 300 ? 19.599  6.920   42.437  1.00 52.46  ? 410 LEU A C     1 
ATOM   2039 O  O     . LEU A 1 300 ? 20.685  7.485   42.232  1.00 50.17  ? 410 LEU A O     1 
ATOM   2040 C  CB    . LEU A 1 300 ? 19.004  6.650   39.977  1.00 45.95  ? 410 LEU A CB    1 
ATOM   2041 C  CG    . LEU A 1 300 ? 19.738  5.309   39.781  1.00 48.88  ? 410 LEU A CG    1 
ATOM   2042 C  CD1   . LEU A 1 300 ? 18.811  4.102   39.991  1.00 48.78  ? 410 LEU A CD1   1 
ATOM   2043 C  CD2   . LEU A 1 300 ? 20.358  5.250   38.408  1.00 49.33  ? 410 LEU A CD2   1 
ATOM   2044 N  N     . ASP A 1 301 ? 19.333  6.212   43.547  1.00 52.70  ? 411 ASP A N     1 
ATOM   2045 C  CA    . ASP A 1 301 ? 20.315  6.052   44.620  1.00 55.15  ? 411 ASP A CA    1 
ATOM   2046 C  C     . ASP A 1 301 ? 21.519  5.230   44.134  1.00 61.11  ? 411 ASP A C     1 
ATOM   2047 O  O     . ASP A 1 301 ? 21.334  4.273   43.384  1.00 60.63  ? 411 ASP A O     1 
ATOM   2048 C  CB    . ASP A 1 301 ? 19.661  5.432   45.868  1.00 58.31  ? 411 ASP A CB    1 
ATOM   2049 C  CG    . ASP A 1 301 ? 18.987  6.504   46.733  1.00 76.37  ? 411 ASP A CG    1 
ATOM   2050 O  OD1   . ASP A 1 301 ? 17.841  6.893   46.417  1.00 77.55  ? 411 ASP A OD1   1 
ATOM   2051 O  OD2   . ASP A 1 301 ? 19.683  7.091   47.615  1.00 81.74  ? 411 ASP A OD2   1 
ATOM   2052 N  N     . HIS A 1 302 ? 22.749  5.652   44.501  1.00 60.20  ? 412 HIS A N     1 
ATOM   2053 C  CA    . HIS A 1 302 ? 24.016  5.018   44.096  1.00 61.20  ? 412 HIS A CA    1 
ATOM   2054 C  C     . HIS A 1 302 ? 24.050  3.518   44.446  1.00 61.08  ? 412 HIS A C     1 
ATOM   2055 O  O     . HIS A 1 302 ? 24.521  2.727   43.639  1.00 59.78  ? 412 HIS A O     1 
ATOM   2056 C  CB    . HIS A 1 302 ? 25.240  5.725   44.727  1.00 63.82  ? 412 HIS A CB    1 
ATOM   2057 C  CG    . HIS A 1 302 ? 25.674  7.041   44.115  1.00 68.73  ? 412 HIS A CG    1 
ATOM   2058 N  ND1   . HIS A 1 302 ? 26.867  7.651   44.505  1.00 71.24  ? 412 HIS A ND1   1 
ATOM   2059 C  CD2   . HIS A 1 302 ? 25.071  7.838   43.195  1.00 71.03  ? 412 HIS A CD2   1 
ATOM   2060 C  CE1   . HIS A 1 302 ? 26.947  8.778   43.813  1.00 70.63  ? 412 HIS A CE1   1 
ATOM   2061 N  NE2   . HIS A 1 302 ? 25.895  8.937   43.010  1.00 70.95  ? 412 HIS A NE2   1 
ATOM   2062 N  N     . GLY A 1 303 ? 23.503  3.150   45.602  1.00 56.05  ? 413 GLY A N     1 
ATOM   2063 C  CA    . GLY A 1 303 ? 23.422  1.773   46.081  1.00 55.35  ? 413 GLY A CA    1 
ATOM   2064 C  C     . GLY A 1 303 ? 22.706  0.785   45.171  1.00 58.41  ? 413 GLY A C     1 
ATOM   2065 O  O     . GLY A 1 303 ? 22.986  -0.414  45.225  1.00 61.29  ? 413 GLY A O     1 
ATOM   2066 N  N     . ARG A 1 304 ? 21.805  1.273   44.322  1.00 50.83  ? 414 ARG A N     1 
ATOM   2067 C  CA    . ARG A 1 304 ? 21.016  0.494   43.368  1.00 49.63  ? 414 ARG A CA    1 
ATOM   2068 C  C     . ARG A 1 304 ? 21.788  0.173   42.078  1.00 51.43  ? 414 ARG A C     1 
ATOM   2069 O  O     . ARG A 1 304 ? 21.368  -0.701  41.317  1.00 50.86  ? 414 ARG A O     1 
ATOM   2070 C  CB    . ARG A 1 304 ? 19.730  1.276   43.005  1.00 50.42  ? 414 ARG A CB    1 
ATOM   2071 C  CG    . ARG A 1 304 ? 18.877  1.652   44.218  1.00 60.58  ? 414 ARG A CG    1 
ATOM   2072 C  CD    . ARG A 1 304 ? 17.431  2.001   43.880  1.00 65.17  ? 414 ARG A CD    1 
ATOM   2073 N  NE    . ARG A 1 304 ? 16.702  0.853   43.340  1.00 77.08  ? 414 ARG A NE    1 
ATOM   2074 C  CZ    . ARG A 1 304 ? 16.019  -0.026  44.066  1.00 89.91  ? 414 ARG A CZ    1 
ATOM   2075 N  NH1   . ARG A 1 304 ? 15.935  0.115   45.384  1.00 79.45  ? 414 ARG A NH1   1 
ATOM   2076 N  NH2   . ARG A 1 304 ? 15.415  -1.054  43.481  1.00 69.22  ? 414 ARG A NH2   1 
ATOM   2077 N  N     . VAL A 1 305 ? 22.908  0.885   41.838  1.00 47.90  ? 415 VAL A N     1 
ATOM   2078 C  CA    . VAL A 1 305 ? 23.732  0.782   40.629  1.00 47.46  ? 415 VAL A CA    1 
ATOM   2079 C  C     . VAL A 1 305 ? 24.877  -0.187  40.860  1.00 53.43  ? 415 VAL A C     1 
ATOM   2080 O  O     . VAL A 1 305 ? 25.674  0.027   41.771  1.00 55.65  ? 415 VAL A O     1 
ATOM   2081 C  CB    . VAL A 1 305 ? 24.235  2.182   40.165  1.00 50.07  ? 415 VAL A CB    1 
ATOM   2082 C  CG1   . VAL A 1 305 ? 24.972  2.097   38.829  1.00 49.69  ? 415 VAL A CG1   1 
ATOM   2083 C  CG2   . VAL A 1 305 ? 23.076  3.167   40.064  1.00 49.20  ? 415 VAL A CG2   1 
ATOM   2084 N  N     . HIS A 1 306 ? 24.958  -1.258  40.039  1.00 49.47  ? 416 HIS A N     1 
ATOM   2085 C  CA    . HIS A 1 306 ? 26.019  -2.273  40.146  1.00 49.74  ? 416 HIS A CA    1 
ATOM   2086 C  C     . HIS A 1 306 ? 26.979  -2.094  38.990  1.00 53.54  ? 416 HIS A C     1 
ATOM   2087 O  O     . HIS A 1 306 ? 26.832  -2.701  37.932  1.00 52.02  ? 416 HIS A O     1 
ATOM   2088 C  CB    . HIS A 1 306 ? 25.445  -3.707  40.234  1.00 50.67  ? 416 HIS A CB    1 
ATOM   2089 C  CG    . HIS A 1 306 ? 24.419  -3.839  41.318  1.00 54.21  ? 416 HIS A CG    1 
ATOM   2090 N  ND1   . HIS A 1 306 ? 23.121  -4.188  41.032  1.00 56.47  ? 416 HIS A ND1   1 
ATOM   2091 C  CD2   . HIS A 1 306 ? 24.512  -3.536  42.638  1.00 55.94  ? 416 HIS A CD2   1 
ATOM   2092 C  CE1   . HIS A 1 306 ? 22.472  -4.125  42.187  1.00 55.94  ? 416 HIS A CE1   1 
ATOM   2093 N  NE2   . HIS A 1 306 ? 23.271  -3.729  43.179  1.00 55.98  ? 416 HIS A NE2   1 
ATOM   2094 N  N     . SER A 1 307 ? 27.942  -1.198  39.196  1.00 51.96  ? 417 SER A N     1 
ATOM   2095 C  CA    . SER A 1 307 ? 28.919  -0.827  38.186  1.00 52.89  ? 417 SER A CA    1 
ATOM   2096 C  C     . SER A 1 307 ? 30.335  -1.169  38.631  1.00 57.68  ? 417 SER A C     1 
ATOM   2097 O  O     . SER A 1 307 ? 30.525  -1.743  39.709  1.00 56.27  ? 417 SER A O     1 
ATOM   2098 C  CB    . SER A 1 307 ? 28.810  0.668   37.896  1.00 55.59  ? 417 SER A CB    1 
ATOM   2099 O  OG    . SER A 1 307 ? 29.268  1.415   39.010  1.00 65.88  ? 417 SER A OG    1 
ATOM   2100 N  N     . GLU A 1 308 ? 31.321  -0.800  37.794  1.00 55.75  ? 418 GLU A N     1 
ATOM   2101 C  CA    . GLU A 1 308 ? 32.747  -0.986  38.085  1.00 56.69  ? 418 GLU A CA    1 
ATOM   2102 C  C     . GLU A 1 308 ? 33.206  0.029   39.151  1.00 61.99  ? 418 GLU A C     1 
ATOM   2103 O  O     . GLU A 1 308 ? 34.099  -0.276  39.947  1.00 62.03  ? 418 GLU A O     1 
ATOM   2104 C  CB    . GLU A 1 308 ? 33.583  -0.840  36.809  1.00 58.07  ? 418 GLU A CB    1 
ATOM   2105 C  CG    . GLU A 1 308 ? 33.333  -1.931  35.782  1.00 68.58  ? 418 GLU A CG    1 
ATOM   2106 C  CD    . GLU A 1 308 ? 33.989  -1.668  34.440  1.00 92.72  ? 418 GLU A CD    1 
ATOM   2107 O  OE1   . GLU A 1 308 ? 33.267  -1.584  33.419  1.00 83.29  ? 418 GLU A OE1   1 
ATOM   2108 O  OE2   . GLU A 1 308 ? 35.230  -1.505  34.419  1.00 92.05  ? 418 GLU A OE2   1 
ATOM   2109 N  N     . LYS A 1 309 ? 32.572  1.228   39.170  1.00 58.17  ? 419 LYS A N     1 
ATOM   2110 C  CA    . LYS A 1 309 ? 32.857  2.288   40.133  1.00 95.46  ? 419 LYS A CA    1 
ATOM   2111 C  C     . LYS A 1 309 ? 31.873  2.213   41.301  1.00 128.76 ? 419 LYS A C     1 
ATOM   2112 O  O     . LYS A 1 309 ? 32.243  1.788   42.396  1.00 90.69  ? 419 LYS A O     1 
ATOM   2113 C  CB    . LYS A 1 309 ? 32.796  3.667   39.455  1.00 97.89  ? 419 LYS A CB    1 
ATOM   2114 N  N     . GLY A 1 315 ? 29.517  11.836  45.522  1.00 68.80  ? 425 GLY A N     1 
ATOM   2115 C  CA    . GLY A 1 315 ? 28.998  13.118  45.981  1.00 68.06  ? 425 GLY A CA    1 
ATOM   2116 C  C     . GLY A 1 315 ? 27.781  13.006  46.883  1.00 70.08  ? 425 GLY A C     1 
ATOM   2117 O  O     . GLY A 1 315 ? 27.890  12.502  48.006  1.00 69.45  ? 425 GLY A O     1 
ATOM   2118 N  N     . LYS A 1 316 ? 26.609  13.490  46.387  1.00 64.46  ? 426 LYS A N     1 
ATOM   2119 C  CA    . LYS A 1 316 ? 25.299  13.479  47.074  1.00 62.68  ? 426 LYS A CA    1 
ATOM   2120 C  C     . LYS A 1 316 ? 24.743  12.053  47.302  1.00 64.96  ? 426 LYS A C     1 
ATOM   2121 O  O     . LYS A 1 316 ? 23.859  11.872  48.141  1.00 64.43  ? 426 LYS A O     1 
ATOM   2122 C  CB    . LYS A 1 316 ? 24.256  14.335  46.327  1.00 63.72  ? 426 LYS A CB    1 
ATOM   2123 C  CG    . LYS A 1 316 ? 24.271  14.231  44.802  1.00 67.22  ? 426 LYS A CG    1 
ATOM   2124 C  CD    . LYS A 1 316 ? 23.035  14.865  44.170  1.00 69.85  ? 426 LYS A CD    1 
ATOM   2125 C  CE    . LYS A 1 316 ? 23.149  15.188  42.697  1.00 76.17  ? 426 LYS A CE    1 
ATOM   2126 N  NZ    . LYS A 1 316 ? 23.649  14.048  41.892  1.00 83.47  ? 426 LYS A NZ    1 
ATOM   2127 N  N     . GLY A 1 317 ? 25.262  11.069  46.560  1.00 60.13  ? 427 GLY A N     1 
ATOM   2128 C  CA    . GLY A 1 317 ? 24.872  9.666   46.676  1.00 58.10  ? 427 GLY A CA    1 
ATOM   2129 C  C     . GLY A 1 317 ? 23.693  9.237   45.830  1.00 58.21  ? 427 GLY A C     1 
ATOM   2130 O  O     . GLY A 1 317 ? 23.192  8.124   46.002  1.00 57.48  ? 427 GLY A O     1 
ATOM   2131 N  N     . TRP A 1 318 ? 23.238  10.103  44.911  1.00 51.75  ? 428 TRP A N     1 
ATOM   2132 C  CA    . TRP A 1 318 ? 22.153  9.800   43.984  1.00 50.56  ? 428 TRP A CA    1 
ATOM   2133 C  C     . TRP A 1 318 ? 22.336  10.587  42.689  1.00 52.53  ? 428 TRP A C     1 
ATOM   2134 O  O     . TRP A 1 318 ? 23.115  11.544  42.639  1.00 54.14  ? 428 TRP A O     1 
ATOM   2135 C  CB    . TRP A 1 318 ? 20.776  10.045  44.611  1.00 49.90  ? 428 TRP A CB    1 
ATOM   2136 C  CG    . TRP A 1 318 ? 20.544  11.456  45.073  1.00 51.76  ? 428 TRP A CG    1 
ATOM   2137 C  CD1   . TRP A 1 318 ? 20.817  11.970  46.307  1.00 54.80  ? 428 TRP A CD1   1 
ATOM   2138 C  CD2   . TRP A 1 318 ? 19.969  12.534  44.302  1.00 51.61  ? 428 TRP A CD2   1 
ATOM   2139 N  NE1   . TRP A 1 318 ? 20.502  13.312  46.339  1.00 54.62  ? 428 TRP A NE1   1 
ATOM   2140 C  CE2   . TRP A 1 318 ? 19.951  13.676  45.132  1.00 55.65  ? 428 TRP A CE2   1 
ATOM   2141 C  CE3   . TRP A 1 318 ? 19.498  12.651  42.975  1.00 52.58  ? 428 TRP A CE3   1 
ATOM   2142 C  CZ2   . TRP A 1 318 ? 19.455  14.912  44.692  1.00 54.69  ? 428 TRP A CZ2   1 
ATOM   2143 C  CZ3   . TRP A 1 318 ? 19.020  13.877  42.537  1.00 54.12  ? 428 TRP A CZ3   1 
ATOM   2144 C  CH2   . TRP A 1 318 ? 19.003  14.993  43.388  1.00 54.63  ? 428 TRP A CH2   1 
ATOM   2145 N  N     . LYS A 1 319 ? 21.640  10.173  41.637  1.00 45.87  ? 429 LYS A N     1 
ATOM   2146 C  CA    . LYS A 1 319 ? 21.721  10.813  40.333  1.00 44.15  ? 429 LYS A CA    1 
ATOM   2147 C  C     . LYS A 1 319 ? 20.314  10.986  39.762  1.00 46.21  ? 429 LYS A C     1 
ATOM   2148 O  O     . LYS A 1 319 ? 19.511  10.073  39.844  1.00 44.97  ? 429 LYS A O     1 
ATOM   2149 C  CB    . LYS A 1 319 ? 22.612  9.978   39.385  1.00 45.46  ? 429 LYS A CB    1 
ATOM   2150 C  CG    . LYS A 1 319 ? 22.918  10.635  38.048  1.00 41.83  ? 429 LYS A CG    1 
ATOM   2151 C  CD    . LYS A 1 319 ? 23.859  9.791   37.195  1.00 39.80  ? 429 LYS A CD    1 
ATOM   2152 C  CE    . LYS A 1 319 ? 23.840  10.248  35.750  1.00 41.74  ? 429 LYS A CE    1 
ATOM   2153 N  NZ    . LYS A 1 319 ? 24.972  9.700   34.959  1.00 47.12  ? 429 LYS A NZ    1 
ATOM   2154 N  N     . ALA A 1 320 ? 20.020  12.178  39.212  1.00 43.41  ? 430 ALA A N     1 
ATOM   2155 C  CA    . ALA A 1 320 ? 18.772  12.471  38.515  1.00 42.32  ? 430 ALA A CA    1 
ATOM   2156 C  C     . ALA A 1 320 ? 18.872  11.821  37.149  1.00 43.45  ? 430 ALA A C     1 
ATOM   2157 O  O     . ALA A 1 320 ? 19.929  11.916  36.506  1.00 42.08  ? 430 ALA A O     1 
ATOM   2158 C  CB    . ALA A 1 320 ? 18.573  13.975  38.387  1.00 43.13  ? 430 ALA A CB    1 
ATOM   2159 N  N     . ILE A 1 321 ? 17.824  11.061  36.756  1.00 37.72  ? 431 ILE A N     1 
ATOM   2160 C  CA    . ILE A 1 321 ? 17.776  10.331  35.490  1.00 35.96  ? 431 ILE A CA    1 
ATOM   2161 C  C     . ILE A 1 321 ? 16.488  10.630  34.765  1.00 39.60  ? 431 ILE A C     1 
ATOM   2162 O  O     . ILE A 1 321 ? 15.416  10.478  35.342  1.00 36.78  ? 431 ILE A O     1 
ATOM   2163 C  CB    . ILE A 1 321 ? 17.901  8.773   35.709  1.00 38.29  ? 431 ILE A CB    1 
ATOM   2164 C  CG1   . ILE A 1 321 ? 19.053  8.355   36.662  1.00 37.12  ? 431 ILE A CG1   1 
ATOM   2165 C  CG2   . ILE A 1 321 ? 17.903  7.987   34.370  1.00 39.09  ? 431 ILE A CG2   1 
ATOM   2166 C  CD1   . ILE A 1 321 ? 20.483  8.362   36.091  1.00 30.54  ? 431 ILE A CD1   1 
ATOM   2167 N  N     . ARG A 1 322 ? 16.585  10.975  33.475  1.00 37.64  ? 432 ARG A N     1 
ATOM   2168 C  CA    . ARG A 1 322 ? 15.415  11.173  32.629  1.00 36.33  ? 432 ARG A CA    1 
ATOM   2169 C  C     . ARG A 1 322 ? 14.886  9.805   32.241  1.00 40.64  ? 432 ARG A C     1 
ATOM   2170 O  O     . ARG A 1 322 ? 15.654  8.932   31.807  1.00 40.69  ? 432 ARG A O     1 
ATOM   2171 C  CB    . ARG A 1 322 ? 15.774  12.003  31.384  1.00 35.64  ? 432 ARG A CB    1 
ATOM   2172 C  CG    . ARG A 1 322 ? 15.689  13.510  31.592  1.00 32.35  ? 432 ARG A CG    1 
ATOM   2173 C  CD    . ARG A 1 322 ? 14.267  13.981  31.472  1.00 41.97  ? 432 ARG A CD    1 
ATOM   2174 N  NE    . ARG A 1 322 ? 13.761  13.786  30.113  1.00 52.28  ? 432 ARG A NE    1 
ATOM   2175 C  CZ    . ARG A 1 322 ? 12.791  12.944  29.784  1.00 59.34  ? 432 ARG A CZ    1 
ATOM   2176 N  NH1   . ARG A 1 322 ? 12.183  12.220  30.717  1.00 40.96  ? 432 ARG A NH1   1 
ATOM   2177 N  NH2   . ARG A 1 322 ? 12.421  12.817  28.515  1.00 47.20  ? 432 ARG A NH2   1 
ATOM   2178 N  N     . VAL A 1 323 ? 13.595  9.582   32.460  1.00 36.44  ? 433 VAL A N     1 
ATOM   2179 C  CA    . VAL A 1 323 ? 12.932  8.315   32.185  1.00 35.35  ? 433 VAL A CA    1 
ATOM   2180 C  C     . VAL A 1 323 ? 11.631  8.587   31.442  1.00 39.73  ? 433 VAL A C     1 
ATOM   2181 O  O     . VAL A 1 323 ? 10.834  9.417   31.897  1.00 38.07  ? 433 VAL A O     1 
ATOM   2182 C  CB    . VAL A 1 323 ? 12.641  7.523   33.509  1.00 39.54  ? 433 VAL A CB    1 
ATOM   2183 C  CG1   . VAL A 1 323 ? 11.859  6.232   33.242  1.00 39.17  ? 433 VAL A CG1   1 
ATOM   2184 C  CG2   . VAL A 1 323 ? 13.903  7.230   34.302  1.00 39.29  ? 433 VAL A CG2   1 
ATOM   2185 N  N     . ASP A 1 324 ? 11.380  7.859   30.351  1.00 37.11  ? 434 ASP A N     1 
ATOM   2186 C  CA    . ASP A 1 324 ? 10.094  7.941   29.661  1.00 37.51  ? 434 ASP A CA    1 
ATOM   2187 C  C     . ASP A 1 324 ? 9.403   6.598   29.718  1.00 41.83  ? 434 ASP A C     1 
ATOM   2188 O  O     . ASP A 1 324 ? 10.036  5.580   29.483  1.00 41.62  ? 434 ASP A O     1 
ATOM   2189 C  CB    . ASP A 1 324 ? 10.238  8.395   28.213  1.00 39.26  ? 434 ASP A CB    1 
ATOM   2190 C  CG    . ASP A 1 324 ? 10.952  9.710   28.044  1.00 47.19  ? 434 ASP A CG    1 
ATOM   2191 O  OD1   . ASP A 1 324 ? 10.780  10.590  28.898  1.00 45.10  ? 434 ASP A OD1   1 
ATOM   2192 O  OD2   . ASP A 1 324 ? 11.671  9.862   27.047  1.00 56.35  ? 434 ASP A OD2   1 
ATOM   2193 N  N     . LEU A 1 325 ? 8.127   6.590   30.065  1.00 39.47  ? 435 LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 325 ? 7.313   5.376   30.129  1.00 38.42  ? 435 LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 325 ? 6.186   5.530   29.157  1.00 41.75  ? 435 LEU A C     1 
ATOM   2196 O  O     . LEU A 1 325 ? 5.580   6.598   29.104  1.00 42.92  ? 435 LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 325 ? 6.762   5.100   31.549  1.00 38.15  ? 435 LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 325 ? 7.734   5.110   32.736  1.00 43.14  ? 435 LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 325 ? 6.998   4.845   34.040  1.00 44.53  ? 435 LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 325 ? 8.826   4.062   32.590  1.00 43.81  ? 435 LEU A CD2   1 
ATOM   2201 N  N     . VAL A 1 326 ? 5.939   4.503   28.357  1.00 36.92  ? 436 VAL A N     1 
ATOM   2202 C  CA    . VAL A 1 326 ? 4.859   4.440   27.375  1.00 37.66  ? 436 VAL A CA    1 
ATOM   2203 C  C     . VAL A 1 326 ? 4.008   3.221   27.687  1.00 44.60  ? 436 VAL A C     1 
ATOM   2204 O  O     . VAL A 1 326 ? 4.547   2.113   27.844  1.00 44.35  ? 436 VAL A O     1 
ATOM   2205 C  CB    . VAL A 1 326 ? 5.392   4.382   25.918  1.00 40.65  ? 436 VAL A CB    1 
ATOM   2206 C  CG1   . VAL A 1 326 ? 4.262   4.485   24.890  1.00 39.15  ? 436 VAL A CG1   1 
ATOM   2207 C  CG2   . VAL A 1 326 ? 6.448   5.445   25.679  1.00 40.34  ? 436 VAL A CG2   1 
ATOM   2208 N  N     . MET A 1 327 ? 2.681   3.419   27.781  1.00 43.65  ? 437 MET A N     1 
ATOM   2209 C  CA    . MET A 1 327 ? 1.733   2.332   28.008  1.00 44.91  ? 437 MET A CA    1 
ATOM   2210 C  C     . MET A 1 327 ? 0.953   2.110   26.718  1.00 48.66  ? 437 MET A C     1 
ATOM   2211 O  O     . MET A 1 327 ? 0.393   3.067   26.184  1.00 49.86  ? 437 MET A O     1 
ATOM   2212 C  CB    . MET A 1 327 ? 0.810   2.655   29.191  1.00 48.46  ? 437 MET A CB    1 
ATOM   2213 C  CG    . MET A 1 327 ? -0.201  1.549   29.487  1.00 53.78  ? 437 MET A CG    1 
ATOM   2214 S  SD    . MET A 1 327 ? 0.563   0.376   30.574  1.00 59.59  ? 437 MET A SD    1 
ATOM   2215 C  CE    . MET A 1 327 ? -0.518  -1.023  30.409  1.00 56.48  ? 437 MET A CE    1 
ATOM   2216 N  N     . CYS A 1 328 ? 0.936   0.889   26.193  1.00 45.30  ? 438 CYS A N     1 
ATOM   2217 C  CA    . CYS A 1 328 ? 0.165   0.659   24.968  1.00 45.27  ? 438 CYS A CA    1 
ATOM   2218 C  C     . CYS A 1 328 ? -0.786  -0.541  25.121  1.00 46.47  ? 438 CYS A C     1 
ATOM   2219 O  O     . CYS A 1 328 ? -0.520  -1.421  25.939  1.00 46.04  ? 438 CYS A O     1 
ATOM   2220 C  CB    . CYS A 1 328 ? 1.087   0.491   23.759  1.00 45.57  ? 438 CYS A CB    1 
ATOM   2221 S  SG    . CYS A 1 328 ? 1.905   -1.117  23.657  1.00 49.93  ? 438 CYS A SG    1 
ATOM   2222 N  N     . PRO A 1 329 ? -1.868  -0.614  24.304  1.00 43.02  ? 439 PRO A N     1 
ATOM   2223 C  CA    . PRO A 1 329 ? -2.723  -1.805  24.320  1.00 42.59  ? 439 PRO A CA    1 
ATOM   2224 C  C     . PRO A 1 329 ? -1.916  -3.024  23.849  1.00 48.08  ? 439 PRO A C     1 
ATOM   2225 O  O     . PRO A 1 329 ? -1.068  -2.915  22.952  1.00 47.07  ? 439 PRO A O     1 
ATOM   2226 C  CB    . PRO A 1 329 ? -3.845  -1.447  23.335  1.00 43.55  ? 439 PRO A CB    1 
ATOM   2227 C  CG    . PRO A 1 329 ? -3.768  0.004   23.141  1.00 47.31  ? 439 PRO A CG    1 
ATOM   2228 C  CD    . PRO A 1 329 ? -2.333  0.338   23.273  1.00 44.17  ? 439 PRO A CD    1 
ATOM   2229 N  N     . TYR A 1 330 ? -2.158  -4.172  24.468  1.00 45.51  ? 440 TYR A N     1 
ATOM   2230 C  CA    . TYR A 1 330 ? -1.432  -5.411  24.188  1.00 45.47  ? 440 TYR A CA    1 
ATOM   2231 C  C     . TYR A 1 330 ? -1.315  -5.767  22.696  1.00 47.61  ? 440 TYR A C     1 
ATOM   2232 O  O     . TYR A 1 330 ? -0.254  -6.201  22.283  1.00 46.92  ? 440 TYR A O     1 
ATOM   2233 C  CB    . TYR A 1 330 ? -2.081  -6.595  24.930  1.00 46.71  ? 440 TYR A CB    1 
ATOM   2234 C  CG    . TYR A 1 330 ? -1.209  -7.826  24.924  1.00 49.36  ? 440 TYR A CG    1 
ATOM   2235 C  CD1   . TYR A 1 330 ? 0.006   -7.844  25.600  1.00 51.98  ? 440 TYR A CD1   1 
ATOM   2236 C  CD2   . TYR A 1 330 ? -1.590  -8.974  24.232  1.00 50.61  ? 440 TYR A CD2   1 
ATOM   2237 C  CE1   . TYR A 1 330 ? 0.819   -8.973  25.604  1.00 53.87  ? 440 TYR A CE1   1 
ATOM   2238 C  CE2   . TYR A 1 330 ? -0.774  -10.113 24.215  1.00 52.32  ? 440 TYR A CE2   1 
ATOM   2239 C  CZ    . TYR A 1 330 ? 0.431   -10.107 24.908  1.00 61.52  ? 440 TYR A CZ    1 
ATOM   2240 O  OH    . TYR A 1 330 ? 1.266   -11.205 24.912  1.00 59.39  ? 440 TYR A OH    1 
ATOM   2241 N  N     . ASP A 1 331 ? -2.391  -5.646  21.919  1.00 44.05  ? 441 ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 331 ? -2.409  -6.004  20.498  1.00 43.60  ? 441 ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 331 ? -1.534  -5.080  19.637  1.00 44.97  ? 441 ASP A C     1 
ATOM   2244 O  O     . ASP A 1 331 ? -1.201  -5.464  18.518  1.00 44.71  ? 441 ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 331 ? -3.867  -6.012  19.960  1.00 45.53  ? 441 ASP A CB    1 
ATOM   2246 C  CG    . ASP A 1 331 ? -4.587  -4.674  19.946  1.00 55.60  ? 441 ASP A CG    1 
ATOM   2247 O  OD1   . ASP A 1 331 ? -5.286  -4.389  18.954  1.00 60.37  ? 441 ASP A OD1   1 
ATOM   2248 O  OD2   . ASP A 1 331 ? -4.501  -3.941  20.951  1.00 54.91  ? 441 ASP A OD2   1 
ATOM   2249 N  N     . ARG A 1 332 ? -1.163  -3.878  20.142  1.00 40.31  ? 442 ARG A N     1 
ATOM   2250 C  CA    . ARG A 1 332 ? -0.319  -2.939  19.371  1.00 40.44  ? 442 ARG A CA    1 
ATOM   2251 C  C     . ARG A 1 332 ? 1.155   -2.929  19.844  1.00 41.94  ? 442 ARG A C     1 
ATOM   2252 O  O     . ARG A 1 332 ? 1.940   -2.098  19.369  1.00 43.58  ? 442 ARG A O     1 
ATOM   2253 C  CB    . ARG A 1 332 ? -0.898  -1.505  19.428  1.00 40.99  ? 442 ARG A CB    1 
ATOM   2254 C  CG    . ARG A 1 332 ? -2.406  -1.405  19.164  1.00 52.75  ? 442 ARG A CG    1 
ATOM   2255 C  CD    . ARG A 1 332 ? -2.835  -2.104  17.878  1.00 61.44  ? 442 ARG A CD    1 
ATOM   2256 N  NE    . ARG A 1 332 ? -4.270  -1.963  17.661  1.00 70.83  ? 442 ARG A NE    1 
ATOM   2257 C  CZ    . ARG A 1 332 ? -4.835  -0.931  17.033  1.00 74.79  ? 442 ARG A CZ    1 
ATOM   2258 N  NH1   . ARG A 1 332 ? -4.084  0.050   16.536  1.00 52.19  ? 442 ARG A NH1   1 
ATOM   2259 N  NH2   . ARG A 1 332 ? -6.153  -0.876  16.888  1.00 44.88  ? 442 ARG A NH2   1 
ATOM   2260 N  N     . ARG A 1 333 ? 1.529   -3.851  20.756  1.00 34.23  ? 443 ARG A N     1 
ATOM   2261 C  CA    . ARG A 1 333 ? 2.855   -3.869  21.357  1.00 33.44  ? 443 ARG A CA    1 
ATOM   2262 C  C     . ARG A 1 333 ? 3.996   -3.961  20.346  1.00 38.23  ? 443 ARG A C     1 
ATOM   2263 O  O     . ARG A 1 333 ? 5.026   -3.334  20.578  1.00 38.00  ? 443 ARG A O     1 
ATOM   2264 C  CB    . ARG A 1 333 ? 2.983   -4.957  22.423  1.00 33.04  ? 443 ARG A CB    1 
ATOM   2265 C  CG    . ARG A 1 333 ? 3.077   -6.391  21.905  1.00 38.89  ? 443 ARG A CG    1 
ATOM   2266 C  CD    . ARG A 1 333 ? 2.715   -7.366  22.997  1.00 41.27  ? 443 ARG A CD    1 
ATOM   2267 N  NE    . ARG A 1 333 ? 2.828   -8.742  22.527  1.00 50.07  ? 443 ARG A NE    1 
ATOM   2268 C  CZ    . ARG A 1 333 ? 1.907   -9.388  21.823  1.00 65.27  ? 443 ARG A CZ    1 
ATOM   2269 N  NH1   . ARG A 1 333 ? 0.760   -8.793  21.508  1.00 47.12  ? 443 ARG A NH1   1 
ATOM   2270 N  NH2   . ARG A 1 333 ? 2.126   -10.632 21.422  1.00 58.22  ? 443 ARG A NH2   1 
ATOM   2271 N  N     . ALA A 1 334 ? 3.817   -4.695  19.219  1.00 34.85  ? 444 ALA A N     1 
ATOM   2272 C  CA    . ALA A 1 334 ? 4.901   -4.854  18.249  1.00 34.36  ? 444 ALA A CA    1 
ATOM   2273 C  C     . ALA A 1 334 ? 5.156   -3.554  17.503  1.00 38.48  ? 444 ALA A C     1 
ATOM   2274 O  O     . ALA A 1 334 ? 6.304   -3.237  17.221  1.00 39.45  ? 444 ALA A O     1 
ATOM   2275 C  CB    . ALA A 1 334 ? 4.605   -5.993  17.267  1.00 34.11  ? 444 ALA A CB    1 
ATOM   2276 N  N     . PHE A 1 335 ? 4.102   -2.818  17.166  1.00 34.73  ? 445 PHE A N     1 
ATOM   2277 C  CA    . PHE A 1 335 ? 4.193   -1.538  16.432  1.00 32.44  ? 445 PHE A CA    1 
ATOM   2278 C  C     . PHE A 1 335 ? 4.808   -0.494  17.295  1.00 34.74  ? 445 PHE A C     1 
ATOM   2279 O  O     . PHE A 1 335 ? 5.621   0.271   16.796  1.00 35.13  ? 445 PHE A O     1 
ATOM   2280 C  CB    . PHE A 1 335 ? 2.807   -1.083  15.931  1.00 32.91  ? 445 PHE A CB    1 
ATOM   2281 C  CG    . PHE A 1 335 ? 2.144   -2.123  15.068  1.00 32.91  ? 445 PHE A CG    1 
ATOM   2282 C  CD1   . PHE A 1 335 ? 1.190   -2.988  15.601  1.00 34.73  ? 445 PHE A CD1   1 
ATOM   2283 C  CD2   . PHE A 1 335 ? 2.507   -2.276  13.732  1.00 33.49  ? 445 PHE A CD2   1 
ATOM   2284 C  CE1   . PHE A 1 335 ? 0.619   -3.999  14.818  1.00 34.86  ? 445 PHE A CE1   1 
ATOM   2285 C  CE2   . PHE A 1 335 ? 1.925   -3.290  12.946  1.00 35.61  ? 445 PHE A CE2   1 
ATOM   2286 C  CZ    . PHE A 1 335 ? 0.977   -4.136  13.493  1.00 33.40  ? 445 PHE A CZ    1 
ATOM   2287 N  N     . ALA A 1 336 ? 4.424   -0.445  18.597  1.00 31.71  ? 446 ALA A N     1 
ATOM   2288 C  CA    . ALA A 1 336 ? 4.966   0.518   19.574  1.00 31.33  ? 446 ALA A CA    1 
ATOM   2289 C  C     . ALA A 1 336 ? 6.457   0.229   19.817  1.00 36.47  ? 446 ALA A C     1 
ATOM   2290 O  O     . ALA A 1 336 ? 7.263   1.144   19.755  1.00 36.99  ? 446 ALA A O     1 
ATOM   2291 C  CB    . ALA A 1 336 ? 4.181   0.451   20.889  1.00 31.91  ? 446 ALA A CB    1 
ATOM   2292 N  N     . LEU A 1 337 ? 6.830   -1.045  20.040  1.00 32.50  ? 447 LEU A N     1 
ATOM   2293 C  CA    . LEU A 1 337 ? 8.222   -1.453  20.243  1.00 31.00  ? 447 LEU A CA    1 
ATOM   2294 C  C     . LEU A 1 337 ? 9.107   -1.041  19.041  1.00 33.52  ? 447 LEU A C     1 
ATOM   2295 O  O     . LEU A 1 337 ? 10.187  -0.462  19.219  1.00 29.53  ? 447 LEU A O     1 
ATOM   2296 C  CB    . LEU A 1 337 ? 8.292   -2.982  20.460  1.00 29.99  ? 447 LEU A CB    1 
ATOM   2297 C  CG    . LEU A 1 337 ? 9.678   -3.561  20.722  1.00 32.58  ? 447 LEU A CG    1 
ATOM   2298 C  CD1   . LEU A 1 337 ? 10.342  -2.892  21.911  1.00 32.56  ? 447 LEU A CD1   1 
ATOM   2299 C  CD2   . LEU A 1 337 ? 9.621   -5.101  20.882  1.00 28.96  ? 447 LEU A CD2   1 
ATOM   2300 N  N     . LEU A 1 338 ? 8.621   -1.325  17.826  1.00 29.86  ? 448 LEU A N     1 
ATOM   2301 C  CA    . LEU A 1 338 ? 9.308   -0.971  16.601  1.00 29.60  ? 448 LEU A CA    1 
ATOM   2302 C  C     . LEU A 1 338 ? 9.490   0.555   16.492  1.00 34.43  ? 448 LEU A C     1 
ATOM   2303 O  O     . LEU A 1 338 ? 10.592  0.988   16.212  1.00 36.73  ? 448 LEU A O     1 
ATOM   2304 C  CB    . LEU A 1 338 ? 8.534   -1.538  15.390  1.00 29.37  ? 448 LEU A CB    1 
ATOM   2305 C  CG    . LEU A 1 338 ? 9.129   -1.292  14.014  1.00 33.73  ? 448 LEU A CG    1 
ATOM   2306 C  CD1   . LEU A 1 338 ? 10.473  -2.009  13.837  1.00 33.38  ? 448 LEU A CD1   1 
ATOM   2307 C  CD2   . LEU A 1 338 ? 8.189   -1.758  12.972  1.00 37.52  ? 448 LEU A CD2   1 
ATOM   2308 N  N     . GLY A 1 339 ? 8.467   1.342   16.810  1.00 31.09  ? 449 GLY A N     1 
ATOM   2309 C  CA    . GLY A 1 339 ? 8.562   2.803   16.789  1.00 30.69  ? 449 GLY A CA    1 
ATOM   2310 C  C     . GLY A 1 339 ? 9.434   3.394   17.880  1.00 36.04  ? 449 GLY A C     1 
ATOM   2311 O  O     . GLY A 1 339 ? 10.178  4.337   17.623  1.00 36.87  ? 449 GLY A O     1 
ATOM   2312 N  N     . TRP A 1 340 ? 9.374   2.847   19.095  1.00 33.99  ? 450 TRP A N     1 
ATOM   2313 C  CA    . TRP A 1 340 ? 10.163  3.366   20.218  1.00 36.18  ? 450 TRP A CA    1 
ATOM   2314 C  C     . TRP A 1 340 ? 11.607  2.842   20.252  1.00 41.99  ? 450 TRP A C     1 
ATOM   2315 O  O     . TRP A 1 340 ? 12.396  3.329   21.053  1.00 42.50  ? 450 TRP A O     1 
ATOM   2316 C  CB    . TRP A 1 340 ? 9.451   3.054   21.551  1.00 36.78  ? 450 TRP A CB    1 
ATOM   2317 C  CG    . TRP A 1 340 ? 8.365   4.048   21.804  1.00 39.88  ? 450 TRP A CG    1 
ATOM   2318 C  CD1   . TRP A 1 340 ? 7.085   3.988   21.341  1.00 42.96  ? 450 TRP A CD1   1 
ATOM   2319 C  CD2   . TRP A 1 340 ? 8.526   5.363   22.366  1.00 40.52  ? 450 TRP A CD2   1 
ATOM   2320 N  NE1   . TRP A 1 340 ? 6.427   5.160   21.623  1.00 43.54  ? 450 TRP A NE1   1 
ATOM   2321 C  CE2   . TRP A 1 340 ? 7.272   6.004   22.291  1.00 44.85  ? 450 TRP A CE2   1 
ATOM   2322 C  CE3   . TRP A 1 340 ? 9.594   6.033   22.994  1.00 42.41  ? 450 TRP A CE3   1 
ATOM   2323 C  CZ2   . TRP A 1 340 ? 7.059   7.301   22.776  1.00 44.59  ? 450 TRP A CZ2   1 
ATOM   2324 C  CZ3   . TRP A 1 340 ? 9.373   7.310   23.505  1.00 44.55  ? 450 TRP A CZ3   1 
ATOM   2325 C  CH2   . TRP A 1 340 ? 8.115   7.924   23.408  1.00 44.77  ? 450 TRP A CH2   1 
ATOM   2326 N  N     . THR A 1 341 ? 11.964  1.863   19.408  1.00 38.12  ? 451 THR A N     1 
ATOM   2327 C  CA    . THR A 1 341 ? 13.338  1.364   19.414  1.00 37.25  ? 451 THR A CA    1 
ATOM   2328 C  C     . THR A 1 341 ? 14.214  2.327   18.600  1.00 39.54  ? 451 THR A C     1 
ATOM   2329 O  O     . THR A 1 341 ? 15.403  2.479   18.892  1.00 38.98  ? 451 THR A O     1 
ATOM   2330 C  CB    . THR A 1 341 ? 13.399  -0.093  18.893  1.00 40.02  ? 451 THR A CB    1 
ATOM   2331 O  OG1   . THR A 1 341 ? 12.668  -0.913  19.809  1.00 40.03  ? 451 THR A OG1   1 
ATOM   2332 C  CG2   . THR A 1 341 ? 14.837  -0.617  18.753  1.00 32.54  ? 451 THR A CG2   1 
ATOM   2333 N  N     . GLY A 1 342 ? 13.631  2.920   17.564  1.00 33.51  ? 452 GLY A N     1 
ATOM   2334 C  CA    . GLY A 1 342 ? 14.341  3.809   16.657  1.00 31.89  ? 452 GLY A CA    1 
ATOM   2335 C  C     . GLY A 1 342 ? 15.376  3.086   15.783  1.00 33.65  ? 452 GLY A C     1 
ATOM   2336 O  O     . GLY A 1 342 ? 15.221  1.892   15.517  1.00 31.69  ? 452 GLY A O     1 
ATOM   2337 N  N     . SER A 1 343 ? 16.442  3.780   15.300  1.00 28.55  ? 453 SER A N     1 
ATOM   2338 C  CA    . SER A 1 343 ? 16.751  5.204   15.499  1.00 29.14  ? 453 SER A CA    1 
ATOM   2339 C  C     . SER A 1 343 ? 15.718  6.072   14.784  1.00 36.18  ? 453 SER A C     1 
ATOM   2340 O  O     . SER A 1 343 ? 14.884  5.530   14.041  1.00 35.45  ? 453 SER A O     1 
ATOM   2341 C  CB    . SER A 1 343 ? 18.144  5.524   14.959  1.00 28.77  ? 453 SER A CB    1 
ATOM   2342 O  OG    . SER A 1 343 ? 18.124  5.364   13.548  1.00 36.97  ? 453 SER A OG    1 
ATOM   2343 N  N     . ARG A 1 344 ? 15.782  7.401   14.965  1.00 35.16  ? 454 ARG A N     1 
ATOM   2344 C  CA    . ARG A 1 344 ? 14.851  8.336   14.291  1.00 36.50  ? 454 ARG A CA    1 
ATOM   2345 C  C     . ARG A 1 344 ? 14.924  8.137   12.745  1.00 39.32  ? 454 ARG A C     1 
ATOM   2346 O  O     . ARG A 1 344 ? 13.891  8.034   12.102  1.00 41.13  ? 454 ARG A O     1 
ATOM   2347 C  CB    . ARG A 1 344 ? 15.200  9.799   14.691  1.00 37.94  ? 454 ARG A CB    1 
ATOM   2348 C  CG    . ARG A 1 344 ? 14.068  10.793  14.557  1.00 62.02  ? 454 ARG A CG    1 
ATOM   2349 C  CD    . ARG A 1 344 ? 14.453  12.208  14.999  1.00 83.20  ? 454 ARG A CD    1 
ATOM   2350 N  NE    . ARG A 1 344 ? 15.720  12.635  14.401  1.00 95.93  ? 454 ARG A NE    1 
ATOM   2351 C  CZ    . ARG A 1 344 ? 16.066  13.894  14.172  1.00 113.81 ? 454 ARG A CZ    1 
ATOM   2352 N  NH1   . ARG A 1 344 ? 15.237  14.885  14.478  1.00 100.18 ? 454 ARG A NH1   1 
ATOM   2353 N  NH2   . ARG A 1 344 ? 17.239  14.174  13.626  1.00 104.74 ? 454 ARG A NH2   1 
ATOM   2354 N  N     . GLN A 1 345 ? 16.128  8.036   12.178  1.00 33.95  ? 455 GLN A N     1 
ATOM   2355 C  CA    . GLN A 1 345 ? 16.313  7.856   10.733  1.00 34.02  ? 455 GLN A CA    1 
ATOM   2356 C  C     . GLN A 1 345 ? 15.810  6.493   10.258  1.00 37.32  ? 455 GLN A C     1 
ATOM   2357 O  O     . GLN A 1 345 ? 15.261  6.397   9.157   1.00 36.15  ? 455 GLN A O     1 
ATOM   2358 C  CB    . GLN A 1 345 ? 17.781  8.044   10.315  1.00 34.43  ? 455 GLN A CB    1 
ATOM   2359 C  CG    . GLN A 1 345 ? 17.980  8.161   8.796   1.00 45.36  ? 455 GLN A CG    1 
ATOM   2360 C  CD    . GLN A 1 345 ? 17.346  9.389   8.167   1.00 57.72  ? 455 GLN A CD    1 
ATOM   2361 O  OE1   . GLN A 1 345 ? 17.049  10.398  8.820   1.00 43.91  ? 455 GLN A OE1   1 
ATOM   2362 N  NE2   . GLN A 1 345 ? 17.083  9.305   6.873   1.00 57.31  ? 455 GLN A NE2   1 
ATOM   2363 N  N     . PHE A 1 346 ? 15.994  5.447   11.069  1.00 34.13  ? 456 PHE A N     1 
ATOM   2364 C  CA    . PHE A 1 346 ? 15.483  4.118   10.730  1.00 34.27  ? 456 PHE A CA    1 
ATOM   2365 C  C     . PHE A 1 346 ? 13.938  4.139   10.646  1.00 37.24  ? 456 PHE A C     1 
ATOM   2366 O  O     . PHE A 1 346 ? 13.373  3.564   9.708   1.00 36.29  ? 456 PHE A O     1 
ATOM   2367 C  CB    . PHE A 1 346 ? 15.935  3.073   11.762  1.00 36.26  ? 456 PHE A CB    1 
ATOM   2368 C  CG    . PHE A 1 346 ? 15.645  1.654   11.316  1.00 38.22  ? 456 PHE A CG    1 
ATOM   2369 C  CD1   . PHE A 1 346 ? 16.566  0.950   10.546  1.00 40.15  ? 456 PHE A CD1   1 
ATOM   2370 C  CD2   . PHE A 1 346 ? 14.433  1.032   11.640  1.00 39.70  ? 456 PHE A CD2   1 
ATOM   2371 C  CE1   . PHE A 1 346 ? 16.318  -0.364  10.163  1.00 40.56  ? 456 PHE A CE1   1 
ATOM   2372 C  CE2   . PHE A 1 346 ? 14.183  -0.287  11.237  1.00 41.69  ? 456 PHE A CE2   1 
ATOM   2373 C  CZ    . PHE A 1 346 ? 15.123  -0.964  10.486  1.00 39.44  ? 456 PHE A CZ    1 
ATOM   2374 N  N     . GLU A 1 347 ? 13.272  4.803   11.623  1.00 33.82  ? 457 GLU A N     1 
ATOM   2375 C  CA    . GLU A 1 347 ? 11.807  4.969   11.669  1.00 34.32  ? 457 GLU A CA    1 
ATOM   2376 C  C     . GLU A 1 347 ? 11.294  5.757   10.462  1.00 35.94  ? 457 GLU A C     1 
ATOM   2377 O  O     . GLU A 1 347 ? 10.314  5.338   9.865   1.00 36.42  ? 457 GLU A O     1 
ATOM   2378 C  CB    . GLU A 1 347 ? 11.339  5.692   12.949  1.00 35.77  ? 457 GLU A CB    1 
ATOM   2379 C  CG    . GLU A 1 347 ? 11.664  4.979   14.241  1.00 45.32  ? 457 GLU A CG    1 
ATOM   2380 C  CD    . GLU A 1 347 ? 11.118  3.575   14.357  1.00 78.07  ? 457 GLU A CD    1 
ATOM   2381 O  OE1   . GLU A 1 347 ? 11.902  2.685   14.755  1.00 90.24  ? 457 GLU A OE1   1 
ATOM   2382 O  OE2   . GLU A 1 347 ? 9.944   3.344   13.984  1.00 77.22  ? 457 GLU A OE2   1 
ATOM   2383 N  N     . ARG A 1 348 ? 11.920  6.896   10.144  1.00 32.03  ? 458 ARG A N     1 
ATOM   2384 C  CA    . ARG A 1 348 ? 11.555  7.731   8.989   1.00 32.43  ? 458 ARG A CA    1 
ATOM   2385 C  C     . ARG A 1 348 ? 11.604  6.914   7.691   1.00 37.13  ? 458 ARG A C     1 
ATOM   2386 O  O     . ARG A 1 348 ? 10.646  6.946   6.929   1.00 38.60  ? 458 ARG A O     1 
ATOM   2387 C  CB    . ARG A 1 348 ? 12.485  8.940   8.850   1.00 30.09  ? 458 ARG A CB    1 
ATOM   2388 C  CG    . ARG A 1 348 ? 12.123  10.150  9.662   1.00 44.09  ? 458 ARG A CG    1 
ATOM   2389 C  CD    . ARG A 1 348 ? 13.003  11.354  9.303   1.00 43.71  ? 458 ARG A CD    1 
ATOM   2390 N  NE    . ARG A 1 348 ? 14.391  11.163  9.726   1.00 69.66  ? 458 ARG A NE    1 
ATOM   2391 C  CZ    . ARG A 1 348 ? 14.915  11.707  10.819  1.00 88.41  ? 458 ARG A CZ    1 
ATOM   2392 N  NH1   . ARG A 1 348 ? 14.188  12.515  11.581  1.00 83.10  ? 458 ARG A NH1   1 
ATOM   2393 N  NH2   . ARG A 1 348 ? 16.180  11.463  11.148  1.00 60.29  ? 458 ARG A NH2   1 
ATOM   2394 N  N     . ASP A 1 349 ? 12.697  6.177   7.454   1.00 34.07  ? 459 ASP A N     1 
ATOM   2395 C  CA    . ASP A 1 349 ? 12.850  5.372   6.238   1.00 35.17  ? 459 ASP A CA    1 
ATOM   2396 C  C     . ASP A 1 349 ? 11.896  4.163   6.195   1.00 40.73  ? 459 ASP A C     1 
ATOM   2397 O  O     . ASP A 1 349 ? 11.419  3.836   5.110   1.00 39.15  ? 459 ASP A O     1 
ATOM   2398 C  CB    . ASP A 1 349 ? 14.304  4.943   6.028   1.00 37.22  ? 459 ASP A CB    1 
ATOM   2399 C  CG    . ASP A 1 349 ? 15.137  6.046   5.387   1.00 49.88  ? 459 ASP A CG    1 
ATOM   2400 O  OD1   . ASP A 1 349 ? 16.353  5.853   5.236   1.00 49.90  ? 459 ASP A OD1   1 
ATOM   2401 O  OD2   . ASP A 1 349 ? 14.552  7.085   4.981   1.00 57.73  ? 459 ASP A OD2   1 
ATOM   2402 N  N     . LEU A 1 350 ? 11.591  3.536   7.351   1.00 38.60  ? 460 LEU A N     1 
ATOM   2403 C  CA    . LEU A 1 350 ? 10.615  2.442   7.443   1.00 38.48  ? 460 LEU A CA    1 
ATOM   2404 C  C     . LEU A 1 350 ? 9.261   2.897   6.921   1.00 42.27  ? 460 LEU A C     1 
ATOM   2405 O  O     . LEU A 1 350 ? 8.626   2.207   6.123   1.00 43.28  ? 460 LEU A O     1 
ATOM   2406 C  CB    . LEU A 1 350 ? 10.441  2.057   8.923   1.00 38.82  ? 460 LEU A CB    1 
ATOM   2407 C  CG    . LEU A 1 350 ? 11.089  0.811   9.492   1.00 43.75  ? 460 LEU A CG    1 
ATOM   2408 C  CD1   . LEU A 1 350 ? 10.688  0.651   10.953  1.00 44.40  ? 460 LEU A CD1   1 
ATOM   2409 C  CD2   . LEU A 1 350 ? 10.635  -0.438  8.762   1.00 43.47  ? 460 LEU A CD2   1 
ATOM   2410 N  N     . ARG A 1 351 ? 8.798   4.059   7.423   1.00 37.21  ? 461 ARG A N     1 
ATOM   2411 C  CA    . ARG A 1 351 ? 7.497   4.634   7.071   1.00 35.35  ? 461 ARG A CA    1 
ATOM   2412 C  C     . ARG A 1 351 ? 7.488   5.090   5.601   1.00 37.73  ? 461 ARG A C     1 
ATOM   2413 O  O     . ARG A 1 351 ? 6.492   4.882   4.918   1.00 35.89  ? 461 ARG A O     1 
ATOM   2414 C  CB    . ARG A 1 351 ? 7.147   5.788   8.013   1.00 32.45  ? 461 ARG A CB    1 
ATOM   2415 C  CG    . ARG A 1 351 ? 6.920   5.335   9.443   1.00 45.61  ? 461 ARG A CG    1 
ATOM   2416 C  CD    . ARG A 1 351 ? 6.405   6.428   10.364  1.00 63.05  ? 461 ARG A CD    1 
ATOM   2417 N  NE    . ARG A 1 351 ? 6.108   5.826   11.659  1.00 82.37  ? 461 ARG A NE    1 
ATOM   2418 C  CZ    . ARG A 1 351 ? 6.772   6.063   12.784  1.00 103.94 ? 461 ARG A CZ    1 
ATOM   2419 N  NH1   . ARG A 1 351 ? 6.433   5.441   13.903  1.00 85.85  ? 461 ARG A NH1   1 
ATOM   2420 N  NH2   . ARG A 1 351 ? 7.782   6.926   12.799  1.00 99.24  ? 461 ARG A NH2   1 
ATOM   2421 N  N     . ARG A 1 352 ? 8.603   5.649   5.119   1.00 34.77  ? 462 ARG A N     1 
ATOM   2422 C  CA    . ARG A 1 352 ? 8.760   6.120   3.737   1.00 35.75  ? 462 ARG A CA    1 
ATOM   2423 C  C     . ARG A 1 352 ? 8.749   4.927   2.780   1.00 41.04  ? 462 ARG A C     1 
ATOM   2424 O  O     . ARG A 1 352 ? 8.020   4.969   1.793   1.00 42.80  ? 462 ARG A O     1 
ATOM   2425 C  CB    . ARG A 1 352 ? 10.042  6.968   3.593   1.00 35.00  ? 462 ARG A CB    1 
ATOM   2426 C  CG    . ARG A 1 352 ? 10.212  7.650   2.241   1.00 42.38  ? 462 ARG A CG    1 
ATOM   2427 C  CD    . ARG A 1 352 ? 11.404  8.603   2.245   1.00 60.12  ? 462 ARG A CD    1 
ATOM   2428 N  NE    . ARG A 1 352 ? 12.688  7.975   2.601   1.00 70.86  ? 462 ARG A NE    1 
ATOM   2429 C  CZ    . ARG A 1 352 ? 13.717  7.819   1.770   1.00 86.22  ? 462 ARG A CZ    1 
ATOM   2430 N  NH1   . ARG A 1 352 ? 13.625  8.207   0.505   1.00 72.55  ? 462 ARG A NH1   1 
ATOM   2431 N  NH2   . ARG A 1 352 ? 14.846  7.272   2.200   1.00 77.38  ? 462 ARG A NH2   1 
ATOM   2432 N  N     . TYR A 1 353 ? 9.502   3.860   3.089   1.00 36.61  ? 463 TYR A N     1 
ATOM   2433 C  CA    . TYR A 1 353 ? 9.510   2.606   2.328   1.00 35.78  ? 463 TYR A CA    1 
ATOM   2434 C  C     . TYR A 1 353 ? 8.081   1.995   2.306   1.00 39.03  ? 463 TYR A C     1 
ATOM   2435 O  O     . TYR A 1 353 ? 7.583   1.649   1.227   1.00 35.98  ? 463 TYR A O     1 
ATOM   2436 C  CB    . TYR A 1 353 ? 10.515  1.602   2.943   1.00 36.67  ? 463 TYR A CB    1 
ATOM   2437 C  CG    . TYR A 1 353 ? 10.513  0.243   2.275   1.00 37.87  ? 463 TYR A CG    1 
ATOM   2438 C  CD1   . TYR A 1 353 ? 11.335  -0.018  1.184   1.00 40.96  ? 463 TYR A CD1   1 
ATOM   2439 C  CD2   . TYR A 1 353 ? 9.689   -0.783  2.735   1.00 37.90  ? 463 TYR A CD2   1 
ATOM   2440 C  CE1   . TYR A 1 353 ? 11.313  -1.254  0.541   1.00 43.36  ? 463 TYR A CE1   1 
ATOM   2441 C  CE2   . TYR A 1 353 ? 9.634   -2.011  2.083   1.00 39.31  ? 463 TYR A CE2   1 
ATOM   2442 C  CZ    . TYR A 1 353 ? 10.468  -2.250  0.999   1.00 53.13  ? 463 TYR A CZ    1 
ATOM   2443 O  OH    . TYR A 1 353 ? 10.459  -3.468  0.368   1.00 56.22  ? 463 TYR A OH    1 
ATOM   2444 N  N     . ALA A 1 354 ? 7.427   1.851   3.488   1.00 36.57  ? 464 ALA A N     1 
ATOM   2445 C  CA    . ALA A 1 354 ? 6.046   1.321   3.563   1.00 37.49  ? 464 ALA A CA    1 
ATOM   2446 C  C     . ALA A 1 354 ? 5.115   2.049   2.599   1.00 46.09  ? 464 ALA A C     1 
ATOM   2447 O  O     . ALA A 1 354 ? 4.421   1.387   1.837   1.00 47.27  ? 464 ALA A O     1 
ATOM   2448 C  CB    . ALA A 1 354 ? 5.494   1.412   4.983   1.00 38.06  ? 464 ALA A CB    1 
ATOM   2449 N  N     . THR A 1 355 ? 5.151   3.392   2.578   1.00 44.78  ? 465 THR A N     1 
ATOM   2450 C  CA    . THR A 1 355 ? 4.286   4.210   1.734   1.00 45.69  ? 465 THR A CA    1 
ATOM   2451 C  C     . THR A 1 355 ? 4.644   4.115   0.255   1.00 50.92  ? 465 THR A C     1 
ATOM   2452 O  O     . THR A 1 355 ? 3.797   3.728   -0.541  1.00 51.74  ? 465 THR A O     1 
ATOM   2453 C  CB    . THR A 1 355 ? 4.312   5.681   2.206   1.00 56.10  ? 465 THR A CB    1 
ATOM   2454 O  OG1   . THR A 1 355 ? 3.877   5.731   3.562   1.00 52.63  ? 465 THR A OG1   1 
ATOM   2455 C  CG2   . THR A 1 355 ? 3.420   6.592   1.362   1.00 57.32  ? 465 THR A CG2   1 
ATOM   2456 N  N     . HIS A 1 356 ? 5.877   4.460   -0.102  1.00 47.59  ? 466 HIS A N     1 
ATOM   2457 C  CA    . HIS A 1 356 ? 6.336   4.596   -1.468  1.00 47.65  ? 466 HIS A CA    1 
ATOM   2458 C  C     . HIS A 1 356 ? 6.545   3.299   -2.186  1.00 46.42  ? 466 HIS A C     1 
ATOM   2459 O  O     . HIS A 1 356 ? 6.285   3.255   -3.385  1.00 47.35  ? 466 HIS A O     1 
ATOM   2460 C  CB    . HIS A 1 356 ? 7.626   5.417   -1.501  1.00 50.56  ? 466 HIS A CB    1 
ATOM   2461 C  CG    . HIS A 1 356 ? 7.903   6.045   -2.824  1.00 56.41  ? 466 HIS A CG    1 
ATOM   2462 N  ND1   . HIS A 1 356 ? 8.610   5.370   -3.815  1.00 59.62  ? 466 HIS A ND1   1 
ATOM   2463 C  CD2   . HIS A 1 356 ? 7.585   7.278   -3.274  1.00 59.50  ? 466 HIS A CD2   1 
ATOM   2464 C  CE1   . HIS A 1 356 ? 8.685   6.212   -4.833  1.00 59.46  ? 466 HIS A CE1   1 
ATOM   2465 N  NE2   . HIS A 1 356 ? 8.095   7.377   -4.548  1.00 59.73  ? 466 HIS A NE2   1 
ATOM   2466 N  N     . GLU A 1 357 ? 7.032   2.253   -1.505  1.00 40.08  ? 467 GLU A N     1 
ATOM   2467 C  CA    . GLU A 1 357 ? 7.316   0.972   -2.167  1.00 38.60  ? 467 GLU A CA    1 
ATOM   2468 C  C     . GLU A 1 357 ? 6.199   -0.069  -2.017  1.00 45.09  ? 467 GLU A C     1 
ATOM   2469 O  O     . GLU A 1 357 ? 6.005   -0.877  -2.930  1.00 46.01  ? 467 GLU A O     1 
ATOM   2470 C  CB    . GLU A 1 357 ? 8.657   0.352   -1.671  1.00 38.85  ? 467 GLU A CB    1 
ATOM   2471 C  CG    . GLU A 1 357 ? 9.874   1.258   -1.777  1.00 42.06  ? 467 GLU A CG    1 
ATOM   2472 C  CD    . GLU A 1 357 ? 10.206  1.799   -3.156  1.00 62.16  ? 467 GLU A CD    1 
ATOM   2473 O  OE1   . GLU A 1 357 ? 10.697  2.950   -3.245  1.00 52.97  ? 467 GLU A OE1   1 
ATOM   2474 O  OE2   . GLU A 1 357 ? 9.938   1.087   -4.152  1.00 51.34  ? 467 GLU A OE2   1 
ATOM   2475 N  N     . ARG A 1 358 ? 5.496   -0.089  -0.877  1.00 42.13  ? 468 ARG A N     1 
ATOM   2476 C  CA    . ARG A 1 358 ? 4.501   -1.127  -0.598  1.00 42.61  ? 468 ARG A CA    1 
ATOM   2477 C  C     . ARG A 1 358 ? 3.042   -0.653  -0.538  1.00 45.37  ? 468 ARG A C     1 
ATOM   2478 O  O     . ARG A 1 358 ? 2.165   -1.477  -0.359  1.00 45.26  ? 468 ARG A O     1 
ATOM   2479 C  CB    . ARG A 1 358 ? 4.838   -1.809  0.744   1.00 43.25  ? 468 ARG A CB    1 
ATOM   2480 C  CG    . ARG A 1 358 ? 6.165   -2.529  0.774   1.00 52.02  ? 468 ARG A CG    1 
ATOM   2481 C  CD    . ARG A 1 358 ? 6.127   -3.811  -0.044  1.00 68.03  ? 468 ARG A CD    1 
ATOM   2482 N  NE    . ARG A 1 358 ? 7.326   -4.625  0.145   1.00 86.19  ? 468 ARG A NE    1 
ATOM   2483 C  CZ    . ARG A 1 358 ? 8.027   -5.191  -0.835  1.00 95.67  ? 468 ARG A CZ    1 
ATOM   2484 N  NH1   . ARG A 1 358 ? 7.662   -5.028  -2.103  1.00 72.56  ? 468 ARG A NH1   1 
ATOM   2485 N  NH2   . ARG A 1 358 ? 9.106   -5.910  -0.557  1.00 80.83  ? 468 ARG A NH2   1 
ATOM   2486 N  N     . LYS A 1 359 ? 2.788   0.646   -0.650  1.00 43.17  ? 469 LYS A N     1 
ATOM   2487 C  CA    . LYS A 1 359 ? 1.448   1.266   -0.552  1.00 41.84  ? 469 LYS A CA    1 
ATOM   2488 C  C     . LYS A 1 359 ? 0.818   0.838   0.783   1.00 44.86  ? 469 LYS A C     1 
ATOM   2489 O  O     . LYS A 1 359 ? -0.353  0.482   0.846   1.00 45.15  ? 469 LYS A O     1 
ATOM   2490 C  CB    . LYS A 1 359 ? 0.565   0.964   -1.785  1.00 41.96  ? 469 LYS A CB    1 
ATOM   2491 C  CG    . LYS A 1 359 ? 1.141   1.628   -3.056  1.00 50.33  ? 469 LYS A CG    1 
ATOM   2492 C  CD    . LYS A 1 359 ? 0.485   1.158   -4.338  1.00 55.75  ? 469 LYS A CD    1 
ATOM   2493 N  N     . MET A 1 360 ? 1.639   0.855   1.850   1.00 39.58  ? 470 MET A N     1 
ATOM   2494 C  CA    . MET A 1 360 ? 1.245   0.552   3.219   1.00 38.88  ? 470 MET A CA    1 
ATOM   2495 C  C     . MET A 1 360 ? 1.447   1.775   4.090   1.00 44.39  ? 470 MET A C     1 
ATOM   2496 O  O     . MET A 1 360 ? 2.177   2.686   3.706   1.00 44.04  ? 470 MET A O     1 
ATOM   2497 C  CB    . MET A 1 360 ? 1.995   -0.648  3.763   1.00 41.55  ? 470 MET A CB    1 
ATOM   2498 C  CG    . MET A 1 360 ? 1.583   -1.941  3.113   1.00 46.01  ? 470 MET A CG    1 
ATOM   2499 S  SD    . MET A 1 360 ? 2.504   -3.332  3.741   1.00 52.33  ? 470 MET A SD    1 
ATOM   2500 C  CE    . MET A 1 360 ? 1.972   -4.596  2.617   1.00 48.50  ? 470 MET A CE    1 
ATOM   2501 N  N     . MET A 1 361 ? 0.716   1.858   5.209   1.00 39.75  ? 471 MET A N     1 
ATOM   2502 C  CA    . MET A 1 361 ? 0.778   3.019   6.095   1.00 38.61  ? 471 MET A CA    1 
ATOM   2503 C  C     . MET A 1 361 ? 1.191   2.532   7.448   1.00 41.11  ? 471 MET A C     1 
ATOM   2504 O  O     . MET A 1 361 ? 0.502   1.721   8.054   1.00 40.88  ? 471 MET A O     1 
ATOM   2505 C  CB    . MET A 1 361 ? -0.563  3.786   6.137   1.00 41.02  ? 471 MET A CB    1 
ATOM   2506 C  CG    . MET A 1 361 ? -0.998  4.300   4.793   1.00 45.86  ? 471 MET A CG    1 
ATOM   2507 S  SD    . MET A 1 361 ? -2.656  5.008   4.890   1.00 51.64  ? 471 MET A SD    1 
ATOM   2508 C  CE    . MET A 1 361 ? -2.304  6.691   5.369   1.00 47.53  ? 471 MET A CE    1 
ATOM   2509 N  N     . LEU A 1 362 ? 2.343   2.975   7.906   1.00 38.26  ? 472 LEU A N     1 
ATOM   2510 C  CA    . LEU A 1 362 ? 2.887   2.478   9.159   1.00 39.16  ? 472 LEU A CA    1 
ATOM   2511 C  C     . LEU A 1 362 ? 3.122   3.589   10.137  1.00 40.68  ? 472 LEU A C     1 
ATOM   2512 O  O     . LEU A 1 362 ? 3.602   4.626   9.740   1.00 40.83  ? 472 LEU A O     1 
ATOM   2513 C  CB    . LEU A 1 362 ? 4.247   1.744   8.862   1.00 39.18  ? 472 LEU A CB    1 
ATOM   2514 C  CG    . LEU A 1 362 ? 5.076   1.218   10.061  1.00 43.00  ? 472 LEU A CG    1 
ATOM   2515 C  CD1   . LEU A 1 362 ? 4.403   -0.011  10.723  1.00 41.44  ? 472 LEU A CD1   1 
ATOM   2516 C  CD2   . LEU A 1 362 ? 6.496   0.885   9.613   1.00 45.08  ? 472 LEU A CD2   1 
ATOM   2517 N  N     . ASP A 1 363 ? 2.843   3.345   11.416  1.00 35.40  ? 473 ASP A N     1 
ATOM   2518 C  CA    . ASP A 1 363 ? 3.135   4.253   12.516  1.00 33.44  ? 473 ASP A CA    1 
ATOM   2519 C  C     . ASP A 1 363 ? 3.293   3.399   13.785  1.00 35.75  ? 473 ASP A C     1 
ATOM   2520 O  O     . ASP A 1 363 ? 3.379   2.173   13.675  1.00 36.61  ? 473 ASP A O     1 
ATOM   2521 C  CB    . ASP A 1 363 ? 2.103   5.409   12.649  1.00 35.19  ? 473 ASP A CB    1 
ATOM   2522 C  CG    . ASP A 1 363 ? 0.716   5.068   13.190  1.00 50.27  ? 473 ASP A CG    1 
ATOM   2523 O  OD1   . ASP A 1 363 ? 0.477   3.891   13.550  1.00 49.86  ? 473 ASP A OD1   1 
ATOM   2524 O  OD2   . ASP A 1 363 ? -0.114  5.990   13.301  1.00 61.45  ? 473 ASP A OD2   1 
ATOM   2525 N  N     . ASN A 1 364 ? 3.384   4.015   14.959  1.00 32.31  ? 474 ASN A N     1 
ATOM   2526 C  CA    . ASN A 1 364 ? 3.601   3.304   16.229  1.00 33.21  ? 474 ASN A CA    1 
ATOM   2527 C  C     . ASN A 1 364 ? 2.410   2.485   16.699  1.00 41.53  ? 474 ASN A C     1 
ATOM   2528 O  O     . ASN A 1 364 ? 2.539   1.725   17.659  1.00 41.87  ? 474 ASN A O     1 
ATOM   2529 C  CB    . ASN A 1 364 ? 3.925   4.323   17.322  1.00 32.69  ? 474 ASN A CB    1 
ATOM   2530 C  CG    . ASN A 1 364 ? 5.301   4.913   17.224  1.00 51.67  ? 474 ASN A CG    1 
ATOM   2531 O  OD1   . ASN A 1 364 ? 6.004   4.790   16.207  1.00 42.62  ? 474 ASN A OD1   1 
ATOM   2532 N  ND2   . ASN A 1 364 ? 5.726   5.518   18.310  1.00 40.47  ? 474 ASN A ND2   1 
ATOM   2533 N  N     . HIS A 1 365 ? 1.236   2.692   16.103  1.00 40.54  ? 475 HIS A N     1 
ATOM   2534 C  CA    . HIS A 1 365 ? 0.022   2.026   16.567  1.00 40.75  ? 475 HIS A CA    1 
ATOM   2535 C  C     . HIS A 1 365 ? -0.453  0.915   15.619  1.00 42.55  ? 475 HIS A C     1 
ATOM   2536 O  O     . HIS A 1 365 ? -1.142  0.021   16.086  1.00 43.43  ? 475 HIS A O     1 
ATOM   2537 C  CB    . HIS A 1 365 ? -1.122  3.064   16.780  1.00 42.11  ? 475 HIS A CB    1 
ATOM   2538 C  CG    . HIS A 1 365 ? -0.663  4.462   17.162  1.00 46.39  ? 475 HIS A CG    1 
ATOM   2539 N  ND1   . HIS A 1 365 ? -0.376  5.427   16.194  1.00 48.34  ? 475 HIS A ND1   1 
ATOM   2540 C  CD2   . HIS A 1 365 ? -0.465  5.012   18.387  1.00 48.33  ? 475 HIS A CD2   1 
ATOM   2541 C  CE1   . HIS A 1 365 ? 0.009   6.509   16.862  1.00 47.90  ? 475 HIS A CE1   1 
ATOM   2542 N  NE2   . HIS A 1 365 ? -0.020  6.306   18.182  1.00 48.23  ? 475 HIS A NE2   1 
ATOM   2543 N  N     . ALA A 1 366 ? -0.128  0.961   14.308  1.00 36.67  ? 476 ALA A N     1 
ATOM   2544 C  CA    . ALA A 1 366 ? -0.685  -0.010  13.358  1.00 34.33  ? 476 ALA A CA    1 
ATOM   2545 C  C     . ALA A 1 366 ? 0.020   -0.016  11.989  1.00 35.84  ? 476 ALA A C     1 
ATOM   2546 O  O     . ALA A 1 366 ? 0.803   0.868   11.682  1.00 35.67  ? 476 ALA A O     1 
ATOM   2547 C  CB    . ALA A 1 366 ? -2.181  0.337   13.134  1.00 34.81  ? 476 ALA A CB    1 
ATOM   2548 N  N     . LEU A 1 367 ? -0.359  -0.982  11.142  1.00 33.88  ? 477 LEU A N     1 
ATOM   2549 C  CA    . LEU A 1 367 ? 0.100   -1.157  9.764   1.00 33.89  ? 477 LEU A CA    1 
ATOM   2550 C  C     . LEU A 1 367 ? -1.114  -1.417  8.917   1.00 39.61  ? 477 LEU A C     1 
ATOM   2551 O  O     . LEU A 1 367 ? -1.838  -2.381  9.175   1.00 39.57  ? 477 LEU A O     1 
ATOM   2552 C  CB    . LEU A 1 367 ? 1.130   -2.313  9.617   1.00 32.78  ? 477 LEU A CB    1 
ATOM   2553 C  CG    . LEU A 1 367 ? 1.619   -2.635  8.180   1.00 35.60  ? 477 LEU A CG    1 
ATOM   2554 C  CD1   . LEU A 1 367 ? 2.279   -1.424  7.494   1.00 32.66  ? 477 LEU A CD1   1 
ATOM   2555 C  CD2   . LEU A 1 367 ? 2.617   -3.758  8.203   1.00 36.48  ? 477 LEU A CD2   1 
ATOM   2556 N  N     . TYR A 1 368 ? -1.350  -0.544  7.936   1.00 35.74  ? 478 TYR A N     1 
ATOM   2557 C  CA    . TYR A 1 368 ? -2.502  -0.627  7.082   1.00 35.56  ? 478 TYR A CA    1 
ATOM   2558 C  C     . TYR A 1 368 ? -2.093  -0.825  5.642   1.00 40.85  ? 478 TYR A C     1 
ATOM   2559 O  O     . TYR A 1 368 ? -1.297  -0.058  5.129   1.00 40.33  ? 478 TYR A O     1 
ATOM   2560 C  CB    . TYR A 1 368 ? -3.384  0.635   7.238   1.00 35.88  ? 478 TYR A CB    1 
ATOM   2561 C  CG    . TYR A 1 368 ? -4.587  0.650   6.317   1.00 34.45  ? 478 TYR A CG    1 
ATOM   2562 C  CD1   . TYR A 1 368 ? -5.653  -0.227  6.516   1.00 37.64  ? 478 TYR A CD1   1 
ATOM   2563 C  CD2   . TYR A 1 368 ? -4.621  1.478   5.201   1.00 31.91  ? 478 TYR A CD2   1 
ATOM   2564 C  CE1   . TYR A 1 368 ? -6.731  -0.268  5.628   1.00 37.59  ? 478 TYR A CE1   1 
ATOM   2565 C  CE2   . TYR A 1 368 ? -5.655  1.407   4.286   1.00 32.67  ? 478 TYR A CE2   1 
ATOM   2566 C  CZ    . TYR A 1 368 ? -6.731  0.564   4.522   1.00 39.52  ? 478 TYR A CZ    1 
ATOM   2567 O  OH    . TYR A 1 368 ? -7.772  0.575   3.643   1.00 37.89  ? 478 TYR A OH    1 
ATOM   2568 N  N     . ASP A 1 369 ? -2.710  -1.813  4.981   1.00 39.05  ? 479 ASP A N     1 
ATOM   2569 C  CA    . ASP A 1 369 ? -2.490  -2.158  3.573   1.00 39.30  ? 479 ASP A CA    1 
ATOM   2570 C  C     . ASP A 1 369 ? -3.586  -1.489  2.737   1.00 45.95  ? 479 ASP A C     1 
ATOM   2571 O  O     . ASP A 1 369 ? -4.750  -1.908  2.811   1.00 46.00  ? 479 ASP A O     1 
ATOM   2572 C  CB    . ASP A 1 369 ? -2.495  -3.698  3.388   1.00 39.81  ? 479 ASP A CB    1 
ATOM   2573 C  CG    . ASP A 1 369 ? -2.080  -4.208  2.007   1.00 53.51  ? 479 ASP A CG    1 
ATOM   2574 O  OD1   . ASP A 1 369 ? -2.304  -3.491  1.003   1.00 54.41  ? 479 ASP A OD1   1 
ATOM   2575 O  OD2   . ASP A 1 369 ? -1.580  -5.343  1.921   1.00 63.57  ? 479 ASP A OD2   1 
ATOM   2576 N  N     . ARG A 1 370 ? -3.209  -0.470  1.942   1.00 42.99  ? 480 ARG A N     1 
ATOM   2577 C  CA    . ARG A 1 370 ? -4.134  0.304   1.128   1.00 44.46  ? 480 ARG A CA    1 
ATOM   2578 C  C     . ARG A 1 370 ? -4.700  -0.502  -0.058  1.00 51.76  ? 480 ARG A C     1 
ATOM   2579 O  O     . ARG A 1 370 ? -5.814  -0.220  -0.510  1.00 51.75  ? 480 ARG A O     1 
ATOM   2580 C  CB    . ARG A 1 370 ? -3.471  1.600   0.636   1.00 43.32  ? 480 ARG A CB    1 
ATOM   2581 C  CG    . ARG A 1 370 ? -3.071  2.564   1.759   1.00 46.48  ? 480 ARG A CG    1 
ATOM   2582 C  CD    . ARG A 1 370 ? -2.456  3.867   1.249   1.00 49.91  ? 480 ARG A CD    1 
ATOM   2583 N  NE    . ARG A 1 370 ? -3.261  4.480   0.186   1.00 46.89  ? 480 ARG A NE    1 
ATOM   2584 C  CZ    . ARG A 1 370 ? -2.773  4.940   -0.965  1.00 67.79  ? 480 ARG A CZ    1 
ATOM   2585 N  NH1   . ARG A 1 370 ? -3.587  5.438   -1.886  1.00 64.55  ? 480 ARG A NH1   1 
ATOM   2586 N  NH2   . ARG A 1 370 ? -1.467  4.911   -1.201  1.00 55.30  ? 480 ARG A NH2   1 
ATOM   2587 N  N     . THR A 1 371 ? -3.955  -1.503  -0.552  1.00 49.17  ? 481 THR A N     1 
ATOM   2588 C  CA    . THR A 1 371 ? -4.408  -2.336  -1.682  1.00 48.41  ? 481 THR A CA    1 
ATOM   2589 C  C     . THR A 1 371 ? -5.404  -3.391  -1.185  1.00 50.31  ? 481 THR A C     1 
ATOM   2590 O  O     . THR A 1 371 ? -6.468  -3.554  -1.781  1.00 50.33  ? 481 THR A O     1 
ATOM   2591 C  CB    . THR A 1 371 ? -3.202  -2.961  -2.411  1.00 58.12  ? 481 THR A CB    1 
ATOM   2592 O  OG1   . THR A 1 371 ? -2.303  -1.917  -2.789  1.00 61.10  ? 481 THR A OG1   1 
ATOM   2593 C  CG2   . THR A 1 371 ? -3.603  -3.747  -3.658  1.00 56.61  ? 481 THR A CG2   1 
ATOM   2594 N  N     . LYS A 1 372 ? -5.066  -4.095  -0.093  1.00 45.02  ? 482 LYS A N     1 
ATOM   2595 C  CA    . LYS A 1 372 ? -5.929  -5.128  0.471   1.00 43.56  ? 482 LYS A CA    1 
ATOM   2596 C  C     . LYS A 1 372 ? -7.051  -4.535  1.314   1.00 45.63  ? 482 LYS A C     1 
ATOM   2597 O  O     . LYS A 1 372 ? -7.970  -5.262  1.673   1.00 47.06  ? 482 LYS A O     1 
ATOM   2598 C  CB    . LYS A 1 372 ? -5.102  -6.121  1.309   1.00 46.86  ? 482 LYS A CB    1 
ATOM   2599 C  CG    . LYS A 1 372 ? -4.160  -6.994  0.481   1.00 56.11  ? 482 LYS A CG    1 
ATOM   2600 C  CD    . LYS A 1 372 ? -3.583  -8.123  1.316   1.00 59.49  ? 482 LYS A CD    1 
ATOM   2601 C  CE    . LYS A 1 372 ? -2.598  -8.937  0.511   1.00 68.05  ? 482 LYS A CE    1 
ATOM   2602 N  NZ    . LYS A 1 372 ? -2.478  -10.331 1.021   1.00 72.03  ? 482 LYS A NZ    1 
ATOM   2603 N  N     . ARG A 1 373 ? -6.956  -3.229  1.665   1.00 40.64  ? 483 ARG A N     1 
ATOM   2604 C  CA    . ARG A 1 373 ? -7.903  -2.471  2.488   1.00 39.47  ? 483 ARG A CA    1 
ATOM   2605 C  C     . ARG A 1 373 ? -8.103  -3.154  3.838   1.00 44.11  ? 483 ARG A C     1 
ATOM   2606 O  O     . ARG A 1 373 ? -9.234  -3.254  4.325   1.00 43.98  ? 483 ARG A O     1 
ATOM   2607 C  CB    . ARG A 1 373 ? -9.238  -2.247  1.760   1.00 36.73  ? 483 ARG A CB    1 
ATOM   2608 C  CG    . ARG A 1 373 ? -9.139  -1.194  0.688   1.00 41.06  ? 483 ARG A CG    1 
ATOM   2609 C  CD    . ARG A 1 373 ? -10.354 -1.273  -0.183  1.00 49.75  ? 483 ARG A CD    1 
ATOM   2610 N  NE    . ARG A 1 373 ? -10.410 -0.161  -1.128  1.00 57.93  ? 483 ARG A NE    1 
ATOM   2611 C  CZ    . ARG A 1 373 ? -11.463 0.116   -1.895  1.00 72.67  ? 483 ARG A CZ    1 
ATOM   2612 N  NH1   . ARG A 1 373 ? -12.554 -0.642  -1.840  1.00 70.23  ? 483 ARG A NH1   1 
ATOM   2613 N  NH2   . ARG A 1 373 ? -11.428 1.144   -2.731  1.00 50.10  ? 483 ARG A NH2   1 
ATOM   2614 N  N     . VAL A 1 374 ? -6.988  -3.630  4.436   1.00 40.11  ? 484 VAL A N     1 
ATOM   2615 C  CA    . VAL A 1 374 ? -6.991  -4.290  5.737   1.00 39.75  ? 484 VAL A CA    1 
ATOM   2616 C  C     . VAL A 1 374 ? -5.837  -3.806  6.617   1.00 41.31  ? 484 VAL A C     1 
ATOM   2617 O  O     . VAL A 1 374 ? -4.757  -3.484  6.120   1.00 38.13  ? 484 VAL A O     1 
ATOM   2618 C  CB    . VAL A 1 374 ? -6.966  -5.852  5.659   1.00 44.27  ? 484 VAL A CB    1 
ATOM   2619 C  CG1   . VAL A 1 374 ? -8.241  -6.424  5.033   1.00 43.86  ? 484 VAL A CG1   1 
ATOM   2620 C  CG2   . VAL A 1 374 ? -5.703  -6.385  4.974   1.00 43.97  ? 484 VAL A CG2   1 
ATOM   2621 N  N     . PHE A 1 375 ? -6.059  -3.837  7.943   1.00 38.46  ? 485 PHE A N     1 
ATOM   2622 C  CA    . PHE A 1 375 ? -5.015  -3.607  8.924   1.00 37.99  ? 485 PHE A CA    1 
ATOM   2623 C  C     . PHE A 1 375 ? -4.279  -4.930  9.103   1.00 42.48  ? 485 PHE A C     1 
ATOM   2624 O  O     . PHE A 1 375 ? -4.913  -5.989  9.168   1.00 41.35  ? 485 PHE A O     1 
ATOM   2625 C  CB    . PHE A 1 375 ? -5.573  -3.098  10.253  1.00 40.32  ? 485 PHE A CB    1 
ATOM   2626 C  CG    . PHE A 1 375 ? -5.964  -1.641  10.251  1.00 41.79  ? 485 PHE A CG    1 
ATOM   2627 C  CD1   . PHE A 1 375 ? -5.019  -0.652  10.497  1.00 45.98  ? 485 PHE A CD1   1 
ATOM   2628 C  CD2   . PHE A 1 375 ? -7.281  -1.256  10.000  1.00 42.13  ? 485 PHE A CD2   1 
ATOM   2629 C  CE1   . PHE A 1 375 ? -5.390  0.708   10.511  1.00 46.33  ? 485 PHE A CE1   1 
ATOM   2630 C  CE2   . PHE A 1 375 ? -7.643  0.093   9.985   1.00 44.60  ? 485 PHE A CE2   1 
ATOM   2631 C  CZ    . PHE A 1 375 ? -6.707  1.066   10.282  1.00 43.47  ? 485 PHE A CZ    1 
ATOM   2632 N  N     . LEU A 1 376 ? -2.945  -4.881  9.131   1.00 39.74  ? 486 LEU A N     1 
ATOM   2633 C  CA    . LEU A 1 376 ? -2.129  -6.097  9.266   1.00 38.66  ? 486 LEU A CA    1 
ATOM   2634 C  C     . LEU A 1 376 ? -1.732  -6.270  10.719  1.00 43.47  ? 486 LEU A C     1 
ATOM   2635 O  O     . LEU A 1 376 ? -1.292  -5.322  11.367  1.00 44.62  ? 486 LEU A O     1 
ATOM   2636 C  CB    . LEU A 1 376 ? -0.918  -6.033  8.328   1.00 37.86  ? 486 LEU A CB    1 
ATOM   2637 C  CG    . LEU A 1 376 ? -1.299  -5.897  6.818   1.00 41.65  ? 486 LEU A CG    1 
ATOM   2638 C  CD1   . LEU A 1 376 ? -0.114  -5.598  5.973   1.00 40.94  ? 486 LEU A CD1   1 
ATOM   2639 C  CD2   . LEU A 1 376 ? -1.994  -7.144  6.286   1.00 42.52  ? 486 LEU A CD2   1 
ATOM   2640 N  N     . GLU A 1 377 ? -1.976  -7.455  11.248  1.00 40.19  ? 487 GLU A N     1 
ATOM   2641 C  CA    . GLU A 1 377 ? -1.712  -7.811  12.639  1.00 40.69  ? 487 GLU A CA    1 
ATOM   2642 C  C     . GLU A 1 377 ? -0.297  -8.323  12.789  1.00 40.88  ? 487 GLU A C     1 
ATOM   2643 O  O     . GLU A 1 377 ? 0.243   -8.923  11.861  1.00 38.91  ? 487 GLU A O     1 
ATOM   2644 C  CB    . GLU A 1 377 ? -2.711  -8.899  13.107  1.00 42.95  ? 487 GLU A CB    1 
ATOM   2645 N  N     . ALA A 1 378 ? 0.294   -8.091  13.962  1.00 36.20  ? 488 ALA A N     1 
ATOM   2646 C  CA    . ALA A 1 378 ? 1.653   -8.530  14.252  1.00 36.46  ? 488 ALA A CA    1 
ATOM   2647 C  C     . ALA A 1 378 ? 1.813   -8.766  15.746  1.00 42.32  ? 488 ALA A C     1 
ATOM   2648 O  O     . ALA A 1 378 ? 1.372   -7.965  16.557  1.00 41.50  ? 488 ALA A O     1 
ATOM   2649 C  CB    . ALA A 1 378 ? 2.665   -7.496  13.764  1.00 36.19  ? 488 ALA A CB    1 
ATOM   2650 N  N     . GLU A 1 379 ? 2.449   -9.857  16.099  1.00 41.35  ? 489 GLU A N     1 
ATOM   2651 C  CA    . GLU A 1 379 ? 2.725   -10.208 17.495  1.00 42.09  ? 489 GLU A CA    1 
ATOM   2652 C  C     . GLU A 1 379 ? 4.184   -9.926  17.809  1.00 44.06  ? 489 GLU A C     1 
ATOM   2653 O  O     . GLU A 1 379 ? 4.571   -9.946  18.976  1.00 44.20  ? 489 GLU A O     1 
ATOM   2654 C  CB    . GLU A 1 379 ? 2.380   -11.697 17.772  1.00 43.92  ? 489 GLU A CB    1 
ATOM   2655 C  CG    . GLU A 1 379 ? 0.880   -11.978 17.780  1.00 60.92  ? 489 GLU A CG    1 
ATOM   2656 C  CD    . GLU A 1 379 ? 0.166   -11.642 19.078  1.00 94.86  ? 489 GLU A CD    1 
ATOM   2657 O  OE1   . GLU A 1 379 ? 0.246   -12.459 20.025  1.00 90.42  ? 489 GLU A OE1   1 
ATOM   2658 O  OE2   . GLU A 1 379 ? -0.464  -10.560 19.153  1.00 98.72  ? 489 GLU A OE2   1 
ATOM   2659 N  N     . SER A 1 380 ? 4.989   -9.631  16.765  1.00 39.25  ? 490 SER A N     1 
ATOM   2660 C  CA    . SER A 1 380 ? 6.430   -9.355  16.890  1.00 37.92  ? 490 SER A CA    1 
ATOM   2661 C  C     . SER A 1 380 ? 6.892   -8.386  15.828  1.00 39.29  ? 490 SER A C     1 
ATOM   2662 O  O     . SER A 1 380 ? 6.188   -8.205  14.826  1.00 38.19  ? 490 SER A O     1 
ATOM   2663 C  CB    . SER A 1 380 ? 7.211   -10.659 16.750  1.00 41.43  ? 490 SER A CB    1 
ATOM   2664 O  OG    . SER A 1 380 ? 7.016   -11.189 15.448  1.00 47.96  ? 490 SER A OG    1 
ATOM   2665 N  N     . GLU A 1 381 ? 8.111   -7.808  15.996  1.00 34.35  ? 491 GLU A N     1 
ATOM   2666 C  CA    . GLU A 1 381 ? 8.694   -6.902  15.014  1.00 31.65  ? 491 GLU A CA    1 
ATOM   2667 C  C     . GLU A 1 381 ? 8.977   -7.690  13.715  1.00 36.20  ? 491 GLU A C     1 
ATOM   2668 O  O     . GLU A 1 381 ? 8.735   -7.176  12.617  1.00 35.42  ? 491 GLU A O     1 
ATOM   2669 C  CB    . GLU A 1 381 ? 9.976   -6.283  15.554  1.00 33.21  ? 491 GLU A CB    1 
ATOM   2670 C  CG    . GLU A 1 381 ? 9.813   -5.302  16.697  1.00 38.89  ? 491 GLU A CG    1 
ATOM   2671 C  CD    . GLU A 1 381 ? 11.127  -4.719  17.195  1.00 55.14  ? 491 GLU A CD    1 
ATOM   2672 O  OE1   . GLU A 1 381 ? 12.044  -5.513  17.508  1.00 53.31  ? 491 GLU A OE1   1 
ATOM   2673 O  OE2   . GLU A 1 381 ? 11.232  -3.475  17.301  1.00 39.88  ? 491 GLU A OE2   1 
ATOM   2674 N  N     . GLU A 1 382 ? 9.446   -8.965  13.845  1.00 32.68  ? 492 GLU A N     1 
ATOM   2675 C  CA    . GLU A 1 382 ? 9.739   -9.861  12.722  1.00 32.11  ? 492 GLU A CA    1 
ATOM   2676 C  C     . GLU A 1 382 ? 8.537   -9.958  11.765  1.00 37.12  ? 492 GLU A C     1 
ATOM   2677 O  O     . GLU A 1 382 ? 8.717   -9.849  10.548  1.00 37.50  ? 492 GLU A O     1 
ATOM   2678 C  CB    . GLU A 1 382 ? 10.122  -11.247 13.233  1.00 34.03  ? 492 GLU A CB    1 
ATOM   2679 C  CG    . GLU A 1 382 ? 11.486  -11.312 13.906  1.00 41.97  ? 492 GLU A CG    1 
ATOM   2680 C  CD    . GLU A 1 382 ? 11.520  -11.096 15.410  1.00 56.93  ? 492 GLU A CD    1 
ATOM   2681 O  OE1   . GLU A 1 382 ? 10.560  -10.512 15.964  1.00 29.69  ? 492 GLU A OE1   1 
ATOM   2682 O  OE2   . GLU A 1 382 ? 12.525  -11.506 16.035  1.00 50.44  ? 492 GLU A OE2   1 
ATOM   2683 N  N     . GLU A 1 383 ? 7.306   -10.106 12.315  1.00 33.73  ? 493 GLU A N     1 
ATOM   2684 C  CA    . GLU A 1 383 ? 6.072   -10.150 11.518  1.00 34.22  ? 493 GLU A CA    1 
ATOM   2685 C  C     . GLU A 1 383 ? 5.830   -8.820  10.776  1.00 35.76  ? 493 GLU A C     1 
ATOM   2686 O  O     . GLU A 1 383 ? 5.368   -8.857  9.630   1.00 34.19  ? 493 GLU A O     1 
ATOM   2687 C  CB    . GLU A 1 383 ? 4.850   -10.516 12.372  1.00 35.76  ? 493 GLU A CB    1 
ATOM   2688 C  CG    . GLU A 1 383 ? 4.878   -11.968 12.826  1.00 46.36  ? 493 GLU A CG    1 
ATOM   2689 C  CD    . GLU A 1 383 ? 3.678   -12.477 13.607  1.00 59.82  ? 493 GLU A CD    1 
ATOM   2690 O  OE1   . GLU A 1 383 ? 3.595   -13.705 13.833  1.00 70.60  ? 493 GLU A OE1   1 
ATOM   2691 O  OE2   . GLU A 1 383 ? 2.833   -11.650 14.015  1.00 51.57  ? 493 GLU A OE2   1 
ATOM   2692 N  N     . ILE A 1 384 ? 6.193   -7.657  11.399  1.00 30.20  ? 494 ILE A N     1 
ATOM   2693 C  CA    . ILE A 1 384 ? 6.024   -6.361  10.734  1.00 29.71  ? 494 ILE A CA    1 
ATOM   2694 C  C     . ILE A 1 384 ? 6.961   -6.318  9.511   1.00 35.17  ? 494 ILE A C     1 
ATOM   2695 O  O     . ILE A 1 384 ? 6.506   -5.981  8.415   1.00 35.21  ? 494 ILE A O     1 
ATOM   2696 C  CB    . ILE A 1 384 ? 6.208   -5.134  11.678  1.00 33.27  ? 494 ILE A CB    1 
ATOM   2697 C  CG1   . ILE A 1 384 ? 5.251   -5.199  12.911  1.00 32.72  ? 494 ILE A CG1   1 
ATOM   2698 C  CG2   . ILE A 1 384 ? 5.995   -3.807  10.903  1.00 34.99  ? 494 ILE A CG2   1 
ATOM   2699 C  CD1   . ILE A 1 384 ? 5.559   -4.220  14.041  1.00 30.73  ? 494 ILE A CD1   1 
ATOM   2700 N  N     . PHE A 1 385 ? 8.248   -6.670  9.695   1.00 30.57  ? 495 PHE A N     1 
ATOM   2701 C  CA    . PHE A 1 385 ? 9.213   -6.700  8.620   1.00 31.54  ? 495 PHE A CA    1 
ATOM   2702 C  C     . PHE A 1 385 ? 8.741   -7.645  7.500   1.00 35.36  ? 495 PHE A C     1 
ATOM   2703 O  O     . PHE A 1 385 ? 8.776   -7.248  6.336   1.00 33.87  ? 495 PHE A O     1 
ATOM   2704 C  CB    . PHE A 1 385 ? 10.616  -7.127  9.149   1.00 34.04  ? 495 PHE A CB    1 
ATOM   2705 C  CG    . PHE A 1 385 ? 11.398  -6.015  9.810   1.00 35.42  ? 495 PHE A CG    1 
ATOM   2706 C  CD1   . PHE A 1 385 ? 11.182  -5.684  11.148  1.00 39.85  ? 495 PHE A CD1   1 
ATOM   2707 C  CD2   . PHE A 1 385 ? 12.352  -5.299  9.099   1.00 35.55  ? 495 PHE A CD2   1 
ATOM   2708 C  CE1   . PHE A 1 385 ? 11.945  -4.674  11.767  1.00 40.40  ? 495 PHE A CE1   1 
ATOM   2709 C  CE2   . PHE A 1 385 ? 13.093  -4.282  9.711   1.00 37.08  ? 495 PHE A CE2   1 
ATOM   2710 C  CZ    . PHE A 1 385 ? 12.892  -3.983  11.041  1.00 35.91  ? 495 PHE A CZ    1 
ATOM   2711 N  N     . ALA A 1 386 ? 8.259   -8.866  7.848   1.00 33.62  ? 496 ALA A N     1 
ATOM   2712 C  CA    . ALA A 1 386 ? 7.743   -9.822  6.861   1.00 33.87  ? 496 ALA A CA    1 
ATOM   2713 C  C     . ALA A 1 386 ? 6.556   -9.225  6.052   1.00 40.95  ? 496 ALA A C     1 
ATOM   2714 O  O     . ALA A 1 386 ? 6.568   -9.341  4.815   1.00 42.40  ? 496 ALA A O     1 
ATOM   2715 C  CB    . ALA A 1 386 ? 7.342   -11.129 7.525   1.00 33.68  ? 496 ALA A CB    1 
ATOM   2716 N  N     . HIS A 1 387 ? 5.596   -8.523  6.731   1.00 36.30  ? 497 HIS A N     1 
ATOM   2717 C  CA    . HIS A 1 387 ? 4.454   -7.846  6.064   1.00 36.26  ? 497 HIS A CA    1 
ATOM   2718 C  C     . HIS A 1 387 ? 4.933   -6.804  5.036   1.00 38.88  ? 497 HIS A C     1 
ATOM   2719 O  O     . HIS A 1 387 ? 4.299   -6.628  4.006   1.00 38.80  ? 497 HIS A O     1 
ATOM   2720 C  CB    . HIS A 1 387 ? 3.523   -7.131  7.071   1.00 37.33  ? 497 HIS A CB    1 
ATOM   2721 C  CG    . HIS A 1 387 ? 2.579   -8.015  7.833   1.00 41.05  ? 497 HIS A CG    1 
ATOM   2722 N  ND1   . HIS A 1 387 ? 1.730   -8.918  7.189   1.00 43.01  ? 497 HIS A ND1   1 
ATOM   2723 C  CD2   . HIS A 1 387 ? 2.303   -8.025  9.159   1.00 42.53  ? 497 HIS A CD2   1 
ATOM   2724 C  CE1   . HIS A 1 387 ? 1.014   -9.477  8.152   1.00 42.16  ? 497 HIS A CE1   1 
ATOM   2725 N  NE2   . HIS A 1 387 ? 1.333   -8.976  9.356   1.00 42.43  ? 497 HIS A NE2   1 
ATOM   2726 N  N     . LEU A 1 388 ? 6.028   -6.105  5.342   1.00 35.10  ? 498 LEU A N     1 
ATOM   2727 C  CA    . LEU A 1 388 ? 6.617   -5.059  4.516   1.00 35.40  ? 498 LEU A CA    1 
ATOM   2728 C  C     . LEU A 1 388 ? 7.513   -5.575  3.382   1.00 39.91  ? 498 LEU A C     1 
ATOM   2729 O  O     . LEU A 1 388 ? 7.961   -4.768  2.593   1.00 39.37  ? 498 LEU A O     1 
ATOM   2730 C  CB    . LEU A 1 388 ? 7.448   -4.118  5.398   1.00 35.01  ? 498 LEU A CB    1 
ATOM   2731 C  CG    . LEU A 1 388 ? 6.671   -3.198  6.372   1.00 39.20  ? 498 LEU A CG    1 
ATOM   2732 C  CD1   . LEU A 1 388 ? 7.636   -2.468  7.339   1.00 37.87  ? 498 LEU A CD1   1 
ATOM   2733 C  CD2   . LEU A 1 388 ? 5.849   -2.172  5.633   1.00 37.98  ? 498 LEU A CD2   1 
ATOM   2734 N  N     . GLY A 1 389 ? 7.810   -6.873  3.364   1.00 39.84  ? 499 GLY A N     1 
ATOM   2735 C  CA    . GLY A 1 389 ? 8.690   -7.499  2.385   1.00 40.10  ? 499 GLY A CA    1 
ATOM   2736 C  C     . GLY A 1 389 ? 10.146  -7.171  2.632   1.00 44.50  ? 499 GLY A C     1 
ATOM   2737 O  O     . GLY A 1 389 ? 10.930  -7.037  1.686   1.00 45.61  ? 499 GLY A O     1 
ATOM   2738 N  N     . LEU A 1 390 ? 10.507  -6.981  3.914   1.00 38.75  ? 500 LEU A N     1 
ATOM   2739 C  CA    . LEU A 1 390 ? 11.859  -6.619  4.336   1.00 36.69  ? 500 LEU A CA    1 
ATOM   2740 C  C     . LEU A 1 390 ? 12.529  -7.722  5.109   1.00 40.05  ? 500 LEU A C     1 
ATOM   2741 O  O     . LEU A 1 390 ? 11.887  -8.353  5.955   1.00 38.47  ? 500 LEU A O     1 
ATOM   2742 C  CB    . LEU A 1 390 ? 11.826  -5.361  5.249   1.00 36.41  ? 500 LEU A CB    1 
ATOM   2743 C  CG    . LEU A 1 390 ? 11.409  -4.000  4.671   1.00 39.46  ? 500 LEU A CG    1 
ATOM   2744 C  CD1   . LEU A 1 390 ? 11.252  -2.968  5.791   1.00 38.00  ? 500 LEU A CD1   1 
ATOM   2745 C  CD2   . LEU A 1 390 ? 12.442  -3.474  3.677   1.00 43.55  ? 500 LEU A CD2   1 
ATOM   2746 N  N     . ASP A 1 391 ? 13.857  -7.894  4.915   1.00 39.51  ? 501 ASP A N     1 
ATOM   2747 C  CA    . ASP A 1 391 ? 14.618  -8.845  5.741   1.00 39.24  ? 501 ASP A CA    1 
ATOM   2748 C  C     . ASP A 1 391 ? 14.670  -8.239  7.118   1.00 39.71  ? 501 ASP A C     1 
ATOM   2749 O  O     . ASP A 1 391 ? 14.738  -7.014  7.243   1.00 41.09  ? 501 ASP A O     1 
ATOM   2750 C  CB    . ASP A 1 391 ? 16.038  -9.108  5.182   1.00 42.65  ? 501 ASP A CB    1 
ATOM   2751 C  CG    . ASP A 1 391 ? 16.064  -9.786  3.821   1.00 56.81  ? 501 ASP A CG    1 
ATOM   2752 O  OD1   . ASP A 1 391 ? 15.215  -10.679 3.585   1.00 58.18  ? 501 ASP A OD1   1 
ATOM   2753 O  OD2   . ASP A 1 391 ? 16.918  -9.404  2.978   1.00 62.90  ? 501 ASP A OD2   1 
ATOM   2754 N  N     . TYR A 1 392 ? 14.556  -9.051  8.140   1.00 33.20  ? 502 TYR A N     1 
ATOM   2755 C  CA    . TYR A 1 392 ? 14.562  -8.556  9.508   1.00 32.03  ? 502 TYR A CA    1 
ATOM   2756 C  C     . TYR A 1 392 ? 15.905  -7.882  9.875   1.00 37.77  ? 502 TYR A C     1 
ATOM   2757 O  O     . TYR A 1 392 ? 16.972  -8.436  9.609   1.00 38.38  ? 502 TYR A O     1 
ATOM   2758 C  CB    . TYR A 1 392 ? 14.275  -9.701  10.491  1.00 31.58  ? 502 TYR A CB    1 
ATOM   2759 C  CG    . TYR A 1 392 ? 14.143  -9.214  11.911  1.00 30.03  ? 502 TYR A CG    1 
ATOM   2760 C  CD1   . TYR A 1 392 ? 13.162  -8.300  12.261  1.00 29.67  ? 502 TYR A CD1   1 
ATOM   2761 C  CD2   . TYR A 1 392 ? 15.019  -9.651  12.905  1.00 31.63  ? 502 TYR A CD2   1 
ATOM   2762 C  CE1   . TYR A 1 392 ? 13.044  -7.827  13.560  1.00 31.70  ? 502 TYR A CE1   1 
ATOM   2763 C  CE2   . TYR A 1 392 ? 14.897  -9.202  14.221  1.00 32.65  ? 502 TYR A CE2   1 
ATOM   2764 C  CZ    . TYR A 1 392 ? 13.883  -8.311  14.545  1.00 41.95  ? 502 TYR A CZ    1 
ATOM   2765 O  OH    . TYR A 1 392 ? 13.715  -7.849  15.820  1.00 49.90  ? 502 TYR A OH    1 
ATOM   2766 N  N     . ILE A 1 393 ? 15.829  -6.662  10.421  1.00 32.66  ? 503 ILE A N     1 
ATOM   2767 C  CA    . ILE A 1 393 ? 16.966  -5.886  10.875  1.00 31.32  ? 503 ILE A CA    1 
ATOM   2768 C  C     . ILE A 1 393 ? 16.914  -5.944  12.401  1.00 35.56  ? 503 ILE A C     1 
ATOM   2769 O  O     . ILE A 1 393 ? 15.912  -5.535  12.995  1.00 35.02  ? 503 ILE A O     1 
ATOM   2770 C  CB    . ILE A 1 393 ? 16.941  -4.430  10.309  1.00 35.10  ? 503 ILE A CB    1 
ATOM   2771 C  CG1   . ILE A 1 393 ? 16.811  -4.355  8.747   1.00 35.53  ? 503 ILE A CG1   1 
ATOM   2772 C  CG2   . ILE A 1 393 ? 18.127  -3.584  10.811  1.00 36.53  ? 503 ILE A CG2   1 
ATOM   2773 C  CD1   . ILE A 1 393 ? 17.898  -5.082  7.894   1.00 37.24  ? 503 ILE A CD1   1 
ATOM   2774 N  N     . GLU A 1 394 ? 17.957  -6.488  13.033  1.00 32.54  ? 504 GLU A N     1 
ATOM   2775 C  CA    . GLU A 1 394 ? 18.060  -6.615  14.503  1.00 31.47  ? 504 GLU A CA    1 
ATOM   2776 C  C     . GLU A 1 394 ? 18.106  -5.241  15.155  1.00 37.73  ? 504 GLU A C     1 
ATOM   2777 O  O     . GLU A 1 394 ? 18.618  -4.323  14.512  1.00 34.73  ? 504 GLU A O     1 
ATOM   2778 C  CB    . GLU A 1 394 ? 19.330  -7.391  14.892  1.00 32.02  ? 504 GLU A CB    1 
ATOM   2779 C  CG    . GLU A 1 394 ? 19.390  -8.802  14.314  1.00 36.03  ? 504 GLU A CG    1 
ATOM   2780 C  CD    . GLU A 1 394 ? 18.461  -9.818  14.942  1.00 50.95  ? 504 GLU A CD    1 
ATOM   2781 O  OE1   . GLU A 1 394 ? 17.841  -9.511  15.991  1.00 42.75  ? 504 GLU A OE1   1 
ATOM   2782 O  OE2   . GLU A 1 394 ? 18.355  -10.933 14.375  1.00 53.98  ? 504 GLU A OE2   1 
ATOM   2783 N  N     . PRO A 1 395 ? 17.639  -5.070  16.431  1.00 36.77  ? 505 PRO A N     1 
ATOM   2784 C  CA    . PRO A 1 395 ? 17.660  -3.737  17.053  1.00 36.73  ? 505 PRO A CA    1 
ATOM   2785 C  C     . PRO A 1 395 ? 19.028  -3.054  17.017  1.00 41.48  ? 505 PRO A C     1 
ATOM   2786 O  O     . PRO A 1 395 ? 19.082  -1.864  16.699  1.00 41.52  ? 505 PRO A O     1 
ATOM   2787 C  CB    . PRO A 1 395 ? 17.203  -4.023  18.483  1.00 37.64  ? 505 PRO A CB    1 
ATOM   2788 C  CG    . PRO A 1 395 ? 16.319  -5.193  18.344  1.00 40.80  ? 505 PRO A CG    1 
ATOM   2789 C  CD    . PRO A 1 395 ? 17.007  -6.048  17.340  1.00 37.23  ? 505 PRO A CD    1 
ATOM   2790 N  N     . TRP A 1 396 ? 20.135  -3.810  17.233  1.00 38.96  ? 506 TRP A N     1 
ATOM   2791 C  CA    . TRP A 1 396 ? 21.507  -3.272  17.228  1.00 37.01  ? 506 TRP A CA    1 
ATOM   2792 C  C     . TRP A 1 396 ? 21.970  -2.916  15.823  1.00 33.41  ? 506 TRP A C     1 
ATOM   2793 O  O     . TRP A 1 396 ? 23.056  -2.364  15.675  1.00 30.66  ? 506 TRP A O     1 
ATOM   2794 C  CB    . TRP A 1 396 ? 22.515  -4.240  17.893  1.00 37.65  ? 506 TRP A CB    1 
ATOM   2795 C  CG    . TRP A 1 396 ? 22.576  -5.609  17.281  1.00 40.25  ? 506 TRP A CG    1 
ATOM   2796 C  CD1   . TRP A 1 396 ? 23.424  -6.035  16.298  1.00 43.66  ? 506 TRP A CD1   1 
ATOM   2797 C  CD2   . TRP A 1 396 ? 21.807  -6.749  17.670  1.00 40.89  ? 506 TRP A CD2   1 
ATOM   2798 N  NE1   . TRP A 1 396 ? 23.201  -7.366  16.025  1.00 44.61  ? 506 TRP A NE1   1 
ATOM   2799 C  CE2   . TRP A 1 396 ? 22.230  -7.837  16.870  1.00 45.60  ? 506 TRP A CE2   1 
ATOM   2800 C  CE3   . TRP A 1 396 ? 20.813  -6.967  18.633  1.00 43.11  ? 506 TRP A CE3   1 
ATOM   2801 C  CZ2   . TRP A 1 396 ? 21.677  -9.115  16.986  1.00 45.09  ? 506 TRP A CZ2   1 
ATOM   2802 C  CZ3   . TRP A 1 396 ? 20.234  -8.231  18.721  1.00 45.19  ? 506 TRP A CZ3   1 
ATOM   2803 C  CH2   . TRP A 1 396 ? 20.658  -9.286  17.897  1.00 45.57  ? 506 TRP A CH2   1 
ATOM   2804 N  N     . GLU A 1 397 ? 21.165  -3.231  14.805  1.00 29.82  ? 507 GLU A N     1 
ATOM   2805 C  CA    . GLU A 1 397 ? 21.461  -2.920  13.401  1.00 30.16  ? 507 GLU A CA    1 
ATOM   2806 C  C     . GLU A 1 397 ? 20.614  -1.743  12.916  1.00 33.37  ? 507 GLU A C     1 
ATOM   2807 O  O     . GLU A 1 397 ? 20.605  -1.423  11.717  1.00 33.48  ? 507 GLU A O     1 
ATOM   2808 C  CB    . GLU A 1 397 ? 21.207  -4.148  12.515  1.00 31.09  ? 507 GLU A CB    1 
ATOM   2809 C  CG    . GLU A 1 397 ? 22.145  -5.319  12.740  1.00 33.98  ? 507 GLU A CG    1 
ATOM   2810 C  CD    . GLU A 1 397 ? 21.720  -6.573  12.004  1.00 36.87  ? 507 GLU A CD    1 
ATOM   2811 O  OE1   . GLU A 1 397 ? 20.501  -6.811  11.817  1.00 36.51  ? 507 GLU A OE1   1 
ATOM   2812 O  OE2   . GLU A 1 397 ? 22.625  -7.354  11.653  1.00 40.92  ? 507 GLU A OE2   1 
ATOM   2813 N  N     . ARG A 1 398 ? 19.889  -1.113  13.832  1.00 29.34  ? 508 ARG A N     1 
ATOM   2814 C  CA    . ARG A 1 398 ? 19.012  0.007   13.469  1.00 31.04  ? 508 ARG A CA    1 
ATOM   2815 C  C     . ARG A 1 398 ? 19.600  1.346   13.882  1.00 34.42  ? 508 ARG A C     1 
ATOM   2816 O  O     . ARG A 1 398 ? 18.852  2.303   14.036  1.00 34.20  ? 508 ARG A O     1 
ATOM   2817 C  CB    . ARG A 1 398 ? 17.611  -0.171  14.090  1.00 32.57  ? 508 ARG A CB    1 
ATOM   2818 C  CG    . ARG A 1 398 ? 16.934  -1.483  13.691  1.00 26.58  ? 508 ARG A CG    1 
ATOM   2819 C  CD    . ARG A 1 398 ? 15.586  -1.617  14.358  1.00 25.59  ? 508 ARG A CD    1 
ATOM   2820 N  NE    . ARG A 1 398 ? 15.158  -3.006  14.378  1.00 28.31  ? 508 ARG A NE    1 
ATOM   2821 C  CZ    . ARG A 1 398 ? 14.190  -3.487  15.134  1.00 32.84  ? 508 ARG A CZ    1 
ATOM   2822 N  NH1   . ARG A 1 398 ? 13.515  -2.686  15.946  1.00 27.75  ? 508 ARG A NH1   1 
ATOM   2823 N  NH2   . ARG A 1 398 ? 13.924  -4.786  15.129  1.00 26.79  ? 508 ARG A NH2   1 
ATOM   2824 N  N     . ASN A 1 399 ? 20.932  1.433   14.057  1.00 31.10  ? 509 ASN A N     1 
ATOM   2825 C  CA    . ASN A 1 399 ? 21.587  2.690   14.462  1.00 31.10  ? 509 ASN A CA    1 
ATOM   2826 C  C     . ASN A 1 399 ? 21.836  3.646   13.241  1.00 37.24  ? 509 ASN A C     1 
ATOM   2827 O  O     . ASN A 1 399 ? 22.924  4.203   13.079  1.00 35.41  ? 509 ASN A O     1 
ATOM   2828 C  CB    . ASN A 1 399 ? 22.869  2.319   15.176  1.00 25.39  ? 509 ASN A CB    1 
ATOM   2829 C  CG    . ASN A 1 399 ? 22.576  1.704   16.516  1.00 39.69  ? 509 ASN A CG    1 
ATOM   2830 O  OD1   . ASN A 1 399 ? 22.038  2.377   17.412  1.00 27.75  ? 509 ASN A OD1   1 
ATOM   2831 N  ND2   . ASN A 1 399 ? 22.896  0.402   16.674  1.00 26.61  ? 509 ASN A ND2   1 
ATOM   2832 N  N     . ALA A 1 400 ? 20.807  3.825   12.385  1.00 35.59  ? 510 ALA A N     1 
ATOM   2833 C  CA    . ALA A 1 400 ? 20.909  4.624   11.160  1.00 39.66  ? 510 ALA A CA    1 
ATOM   2834 C  C     . ALA A 1 400 ? 21.039  6.129   11.440  1.00 42.72  ? 510 ALA A C     1 
ATOM   2835 O  O     . ALA A 1 400 ? 20.455  6.633   12.407  1.00 49.38  ? 510 ALA A O     1 
ATOM   2836 C  CB    . ALA A 1 400 ? 19.697  4.353   10.283  1.00 39.45  ? 510 ALA A CB    1 
HETATM 2837 MG MG    . MG  B 2 .   ? 16.224  7.388   24.506  1.00 21.32  2 601 MG  A MG    1 
HETATM 2838 NA NA    . NA  C 3 .   ? 15.946  20.699  25.564  1.00 68.15  1 602 NA  A NA    1 
HETATM 2839 P  PG    . APC D 4 .   ? 19.018  8.856   23.313  1.00 67.20  ? 603 APC A PG    1 
HETATM 2840 O  O1G   . APC D 4 .   ? 18.650  10.437  22.919  1.00 69.56  ? 603 APC A O1G   1 
HETATM 2841 O  O2G   . APC D 4 .   ? 17.952  8.341   24.482  1.00 65.16  ? 603 APC A O2G   1 
HETATM 2842 O  O3G   . APC D 4 .   ? 20.377  8.974   23.914  1.00 62.88  ? 603 APC A O3G   1 
HETATM 2843 P  PB    . APC D 4 .   ? 17.261  7.490   21.614  1.00 59.39  ? 603 APC A PB    1 
HETATM 2844 O  O1B   . APC D 4 .   ? 17.012  6.660   20.244  1.00 58.95  ? 603 APC A O1B   1 
HETATM 2845 O  O2B   . APC D 4 .   ? 16.724  6.721   22.758  1.00 54.16  ? 603 APC A O2B   1 
HETATM 2846 O  O3B   . APC D 4 .   ? 18.859  7.934   21.910  1.00 63.50  ? 603 APC A O3B   1 
HETATM 2847 P  PA    . APC D 4 .   ? 14.754  9.333   22.413  1.00 65.01  ? 603 APC A PA    1 
HETATM 2848 O  O1A   . APC D 4 .   ? 14.214  10.721  22.499  1.00 66.12  ? 603 APC A O1A   1 
HETATM 2849 O  O2A   . APC D 4 .   ? 15.008  8.788   23.928  1.00 60.83  ? 603 APC A O2A   1 
HETATM 2850 C  C3A   . APC D 4 .   ? 16.245  9.080   21.369  1.00 62.86  ? 603 APC A C3A   1 
HETATM 2851 O  "O5'" . APC D 4 .   ? 13.604  8.429   21.815  1.00 69.68  ? 603 APC A "O5'" 1 
HETATM 2852 C  "C5'" . APC D 4 .   ? 13.941  7.034   21.734  1.00 71.77  ? 603 APC A "C5'" 1 
HETATM 2853 C  "C4'" . APC D 4 .   ? 13.432  6.448   20.428  1.00 74.54  ? 603 APC A "C4'" 1 
HETATM 2854 O  "O4'" . APC D 4 .   ? 11.984  6.385   20.553  1.00 76.11  ? 603 APC A "O4'" 1 
HETATM 2855 C  "C3'" . APC D 4 .   ? 13.770  7.467   19.322  1.00 76.90  ? 603 APC A "C3'" 1 
HETATM 2856 O  "O3'" . APC D 4 .   ? 15.089  7.319   18.700  1.00 79.17  ? 603 APC A "O3'" 1 
HETATM 2857 C  "C2'" . APC D 4 .   ? 12.457  7.538   18.495  1.00 76.80  ? 603 APC A "C2'" 1 
HETATM 2858 O  "O2'" . APC D 4 .   ? 12.443  6.458   17.554  1.00 75.24  ? 603 APC A "O2'" 1 
HETATM 2859 C  "C1'" . APC D 4 .   ? 11.371  7.284   19.594  1.00 76.77  ? 603 APC A "C1'" 1 
HETATM 2860 N  N9    . APC D 4 .   ? 10.574  8.394   20.194  1.00 79.38  ? 603 APC A N9    1 
HETATM 2861 C  C8    . APC D 4 .   ? 10.881  9.343   21.183  1.00 80.58  ? 603 APC A C8    1 
HETATM 2862 N  N7    . APC D 4 .   ? 9.881   10.174  21.446  1.00 80.81  ? 603 APC A N7    1 
HETATM 2863 C  C5    . APC D 4 .   ? 8.842   9.829   20.655  1.00 81.68  ? 603 APC A C5    1 
HETATM 2864 C  C6    . APC D 4 .   ? 7.514   10.311  20.477  1.00 84.84  ? 603 APC A C6    1 
HETATM 2865 N  N6    . APC D 4 .   ? 7.009   11.386  21.217  1.00 83.98  ? 603 APC A N6    1 
HETATM 2866 N  N1    . APC D 4 .   ? 6.725   9.664   19.559  1.00 86.81  ? 603 APC A N1    1 
HETATM 2867 C  C2    . APC D 4 .   ? 7.147   8.605   18.817  1.00 85.30  ? 603 APC A C2    1 
HETATM 2868 N  N3    . APC D 4 .   ? 8.380   8.125   18.949  1.00 83.68  ? 603 APC A N3    1 
HETATM 2869 C  C4    . APC D 4 .   ? 9.257   8.686   19.845  1.00 82.14  ? 603 APC A C4    1 
HETATM 2870 ZN ZN    . ZN  E 5 .   ? 13.075  9.161   25.393  1.00 52.30  2 604 ZN  A ZN    1 
HETATM 2871 O  O     . HOH F 6 .   ? 30.934  3.065   8.752   1.00 31.05  ? 701 HOH A O     1 
HETATM 2872 O  O     . HOH F 6 .   ? 34.905  19.568  4.691   1.00 46.69  ? 702 HOH A O     1 
HETATM 2873 O  O     . HOH F 6 .   ? 21.089  11.469  34.049  1.00 36.21  ? 703 HOH A O     1 
HETATM 2874 O  O     . HOH F 6 .   ? 22.799  -1.187  25.106  1.00 35.74  ? 704 HOH A O     1 
HETATM 2875 O  O     . HOH F 6 .   ? 17.226  -0.528  41.088  1.00 36.01  ? 705 HOH A O     1 
HETATM 2876 O  O     . HOH F 6 .   ? 19.897  0.627   9.610   1.00 34.22  ? 706 HOH A O     1 
HETATM 2877 O  O     . HOH F 6 .   ? 22.082  3.454   7.498   1.00 40.89  ? 707 HOH A O     1 
HETATM 2878 O  O     . HOH F 6 .   ? 23.118  -1.804  38.041  1.00 38.60  ? 708 HOH A O     1 
HETATM 2879 O  O     . HOH F 6 .   ? 25.681  -2.410  16.791  1.00 31.87  ? 709 HOH A O     1 
HETATM 2880 O  O     . HOH F 6 .   ? 11.293  -10.685 7.852   1.00 30.90  ? 710 HOH A O     1 
HETATM 2881 O  O     . HOH F 6 .   ? -2.241  4.127   25.596  1.00 45.86  ? 711 HOH A O     1 
HETATM 2882 O  O     . HOH F 6 .   ? 27.409  4.076   22.471  1.00 46.93  ? 712 HOH A O     1 
HETATM 2883 O  O     . HOH F 6 .   ? 18.556  19.903  31.907  1.00 52.14  ? 713 HOH A O     1 
HETATM 2884 O  O     . HOH F 6 .   ? 4.244   8.185   -4.174  1.00 58.62  ? 714 HOH A O     1 
HETATM 2885 O  O     . HOH F 6 .   ? 13.040  0.153   15.465  1.00 35.55  ? 715 HOH A O     1 
HETATM 2886 O  O     . HOH F 6 .   ? 28.436  10.569  13.541  1.00 44.14  ? 716 HOH A O     1 
HETATM 2887 O  O     . HOH F 6 .   ? 3.884   4.650   6.488   1.00 38.02  ? 717 HOH A O     1 
HETATM 2888 O  O     . HOH F 6 .   ? 14.321  -6.698  24.021  1.00 60.48  ? 718 HOH A O     1 
HETATM 2889 O  O     . HOH F 6 .   ? 26.635  36.498  19.165  1.00 35.10  ? 719 HOH A O     1 
HETATM 2890 O  O     . HOH F 6 .   ? 36.542  8.071   10.435  1.00 39.32  ? 720 HOH A O     1 
HETATM 2891 O  O     . HOH F 6 .   ? 10.546  31.321  37.453  1.00 52.74  ? 721 HOH A O     1 
HETATM 2892 O  O     . HOH F 6 .   ? 18.680  8.834   13.259  1.00 44.14  ? 722 HOH A O     1 
HETATM 2893 O  O     . HOH F 6 .   ? 22.379  37.646  35.676  1.00 45.16  ? 723 HOH A O     1 
HETATM 2894 O  O     . HOH F 6 .   ? 6.487   16.959  38.735  1.00 59.34  ? 724 HOH A O     1 
HETATM 2895 O  O     . HOH F 6 .   ? -7.956  2.619   1.882   1.00 42.79  ? 725 HOH A O     1 
HETATM 2896 O  O     . HOH F 6 .   ? 27.172  -0.202  10.581  1.00 42.69  ? 726 HOH A O     1 
HETATM 2897 O  O     . HOH F 6 .   ? 3.255   7.167   15.234  1.00 47.02  ? 727 HOH A O     1 
HETATM 2898 O  O     . HOH F 6 .   ? 29.968  -0.711  9.854   1.00 52.75  ? 728 HOH A O     1 
HETATM 2899 O  O     . HOH F 6 .   ? 15.368  -6.091  2.757   1.00 46.56  ? 729 HOH A O     1 
HETATM 2900 O  O     . HOH F 6 .   ? 24.957  35.412  28.817  1.00 33.58  ? 730 HOH A O     1 
HETATM 2901 O  O     . HOH F 6 .   ? 29.693  31.054  33.024  1.00 49.26  ? 731 HOH A O     1 
HETATM 2902 O  O     . HOH F 6 .   ? 15.499  -5.091  5.677   1.00 39.67  ? 732 HOH A O     1 
HETATM 2903 O  O     . HOH F 6 .   ? 17.858  41.739  26.933  1.00 47.31  ? 733 HOH A O     1 
HETATM 2904 O  O     . HOH F 6 .   ? 22.959  17.853  38.713  1.00 75.06  ? 734 HOH A O     1 
HETATM 2905 O  O     . HOH F 6 .   ? 8.435   -7.663  33.830  1.00 52.27  ? 735 HOH A O     1 
HETATM 2906 O  O     . HOH F 6 .   ? 27.654  25.212  22.635  1.00 39.92  ? 736 HOH A O     1 
HETATM 2907 O  O     . HOH F 6 .   ? 21.473  -2.181  1.594   1.00 37.05  ? 737 HOH A O     1 
HETATM 2908 O  O     . HOH F 6 .   ? 28.537  15.265  15.470  1.00 51.93  ? 738 HOH A O     1 
HETATM 2909 O  O     . HOH F 6 .   ? 17.772  15.815  29.493  1.00 56.40  ? 739 HOH A O     1 
HETATM 2910 O  O     . HOH F 6 .   ? 20.769  -3.209  38.806  1.00 44.72  ? 740 HOH A O     1 
HETATM 2911 O  O     . HOH F 6 .   ? 18.393  -3.598  -1.425  1.00 55.15  ? 741 HOH A O     1 
HETATM 2912 O  O     . HOH F 6 .   ? 23.595  24.979  34.762  1.00 52.23  ? 742 HOH A O     1 
HETATM 2913 O  O     . HOH F 6 .   ? 1.506   -6.094  18.422  1.00 39.68  ? 743 HOH A O     1 
HETATM 2914 O  O     . HOH F 6 .   ? 10.605  -8.023  23.753  1.00 46.87  ? 744 HOH A O     1 
HETATM 2915 O  O     . HOH F 6 .   ? 6.591   -4.144  26.483  1.00 42.98  ? 745 HOH A O     1 
HETATM 2916 O  O     . HOH F 6 .   ? 21.663  6.526   15.360  1.00 45.92  ? 746 HOH A O     1 
HETATM 2917 O  O     . HOH F 6 .   ? 28.289  28.497  8.906   1.00 52.24  ? 747 HOH A O     1 
HETATM 2918 O  O     . HOH F 6 .   ? 35.165  18.655  11.205  1.00 59.12  ? 748 HOH A O     1 
HETATM 2919 O  O     . HOH F 6 .   ? -9.866  -2.781  6.813   1.00 49.67  ? 749 HOH A O     1 
HETATM 2920 O  O     . HOH F 6 .   ? 14.934  16.861  11.362  1.00 63.60  ? 750 HOH A O     1 
HETATM 2921 O  O     . HOH F 6 .   ? 11.879  36.443  19.628  1.00 52.72  ? 751 HOH A O     1 
HETATM 2922 O  O     . HOH F 6 .   ? 27.409  29.123  32.099  1.00 40.71  ? 752 HOH A O     1 
HETATM 2923 O  O     . HOH F 6 .   ? 7.283   9.156   -0.155  1.00 59.89  ? 753 HOH A O     1 
HETATM 2924 O  O     . HOH F 6 .   ? 11.283  -10.745 4.632   1.00 43.41  ? 754 HOH A O     1 
HETATM 2925 O  O     . HOH F 6 .   ? 14.275  -5.135  28.027  1.00 39.75  ? 755 HOH A O     1 
HETATM 2926 O  O     . HOH F 6 .   ? 14.088  -12.048 6.809   1.00 43.08  ? 756 HOH A O     1 
HETATM 2927 O  O     . HOH F 6 .   ? 24.384  9.222   -4.767  1.00 53.30  ? 757 HOH A O     1 
HETATM 2928 O  O     . HOH F 6 .   ? 23.284  31.354  37.498  1.00 48.53  ? 758 HOH A O     1 
HETATM 2929 O  O     . HOH F 6 .   ? 20.214  -5.987  3.317   1.00 70.38  ? 759 HOH A O     1 
HETATM 2930 O  O     . HOH F 6 .   ? 18.443  8.687   16.564  1.00 48.83  ? 760 HOH A O     1 
HETATM 2931 O  O     . HOH F 6 .   ? 2.354   8.501   -7.085  1.00 37.57  ? 761 HOH A O     1 
HETATM 2932 O  O     . HOH F 6 .   ? 26.364  30.446  23.824  1.00 61.40  ? 762 HOH A O     1 
HETATM 2933 O  O     . HOH F 6 .   ? 17.861  -10.810 8.232   1.00 43.79  ? 763 HOH A O     1 
HETATM 2934 O  O     . HOH F 6 .   ? 23.310  6.721   41.223  1.00 47.39  ? 764 HOH A O     1 
HETATM 2935 O  O     . HOH F 6 .   ? 0.219   8.497   14.283  1.00 63.75  ? 765 HOH A O     1 
HETATM 2936 O  O     . HOH F 6 .   ? 15.307  -4.384  30.553  1.00 56.35  ? 766 HOH A O     1 
HETATM 2937 O  O     . HOH F 6 .   ? 17.992  2.562   -3.249  1.00 64.96  ? 767 HOH A O     1 
HETATM 2938 O  O     . HOH F 6 .   ? -9.097  -4.111  9.328   1.00 36.92  ? 768 HOH A O     1 
HETATM 2939 O  O     . HOH F 6 .   ? 23.858  -2.151  2.985   1.00 40.91  ? 769 HOH A O     1 
HETATM 2940 O  O     . HOH F 6 .   ? 21.834  5.189   17.631  1.00 40.20  ? 770 HOH A O     1 
HETATM 2941 O  O     . HOH F 6 .   ? 5.169   -9.797  34.607  1.00 55.09  ? 771 HOH A O     1 
HETATM 2942 O  O     . HOH F 6 .   ? 7.315   30.458  30.340  1.00 47.19  ? 772 HOH A O     1 
HETATM 2943 O  O     . HOH F 6 .   ? 4.594   25.555  33.349  1.00 47.25  ? 773 HOH A O     1 
HETATM 2944 O  O     . HOH F 6 .   ? 18.751  40.118  37.227  1.00 41.08  ? 774 HOH A O     1 
HETATM 2945 O  O     . HOH F 6 .   ? 23.902  7.943   14.817  1.00 72.82  ? 775 HOH A O     1 
HETATM 2946 O  O     . HOH F 6 .   ? 19.120  11.510  32.174  1.00 33.15  ? 776 HOH A O     1 
HETATM 2947 O  O     . HOH F 6 .   ? 27.688  1.841   29.785  1.00 42.88  ? 777 HOH A O     1 
HETATM 2948 O  O     . HOH F 6 .   ? 5.708   0.867   13.983  1.00 38.38  ? 778 HOH A O     1 
HETATM 2949 O  O     . HOH F 6 .   ? 27.921  8.380   -4.498  1.00 48.29  ? 779 HOH A O     1 
HETATM 2950 O  O     . HOH F 6 .   ? 35.334  6.091   12.449  1.00 57.14  ? 780 HOH A O     1 
HETATM 2951 O  O     . HOH F 6 .   ? -2.452  -3.363  12.628  1.00 35.20  ? 781 HOH A O     1 
HETATM 2952 O  O     . HOH F 6 .   ? 30.142  29.888  35.850  1.00 42.86  ? 782 HOH A O     1 
HETATM 2953 O  O     . HOH F 6 .   ? 22.015  38.968  20.714  1.00 41.98  ? 783 HOH A O     1 
HETATM 2954 O  O     . HOH F 6 .   ? 4.905   20.874  34.046  1.00 72.93  ? 784 HOH A O     1 
HETATM 2955 O  O     . HOH F 6 .   ? 24.985  23.673  8.271   1.00 44.75  ? 785 HOH A O     1 
HETATM 2956 O  O     . HOH F 6 .   ? 21.136  16.558  40.224  1.00 59.28  ? 786 HOH A O     1 
HETATM 2957 O  O     . HOH F 6 .   ? 9.010   -8.013  18.758  1.00 47.37  ? 787 HOH A O     1 
HETATM 2958 O  O     . HOH F 6 .   ? 16.515  33.572  37.608  1.00 41.64  ? 788 HOH A O     1 
HETATM 2959 O  O     . HOH F 6 .   ? 23.748  -3.154  5.317   1.00 55.97  ? 789 HOH A O     1 
HETATM 2960 O  O     . HOH F 6 .   ? 9.941   -11.337 19.107  1.00 61.16  ? 790 HOH A O     1 
HETATM 2961 O  O     . HOH F 6 .   ? 27.302  14.369  42.312  1.00 68.23  ? 791 HOH A O     1 
HETATM 2962 O  O     . HOH F 6 .   ? 29.937  33.563  26.314  1.00 64.79  ? 792 HOH A O     1 
HETATM 2963 O  O     . HOH F 6 .   ? 17.637  7.797   3.450   1.00 42.70  ? 793 HOH A O     1 
HETATM 2964 O  O     . HOH F 6 .   ? 5.204   31.433  32.231  1.00 62.33  ? 794 HOH A O     1 
HETATM 2965 O  O     . HOH F 6 .   ? 27.063  27.528  34.607  1.00 46.02  ? 795 HOH A O     1 
HETATM 2966 O  O     . HOH F 6 .   ? 37.318  20.791  4.781   1.00 49.26  ? 796 HOH A O     1 
HETATM 2967 O  O     . HOH F 6 .   ? 26.383  36.403  16.432  1.00 43.44  ? 797 HOH A O     1 
HETATM 2968 O  O     . HOH F 6 .   ? 17.324  14.700  -0.860  1.00 68.32  ? 798 HOH A O     1 
HETATM 2969 O  O     . HOH F 6 .   ? 18.483  -5.329  1.178   1.00 83.89  ? 799 HOH A O     1 
HETATM 2970 O  O     . HOH F 6 .   ? 22.195  9.081   11.359  1.00 45.23  ? 800 HOH A O     1 
HETATM 2971 O  O     . HOH F 6 .   ? -2.908  14.989  28.669  1.00 47.80  ? 801 HOH A O     1 
HETATM 2972 O  O     . HOH F 6 .   ? 22.346  20.303  22.964  1.00 47.61  ? 802 HOH A O     1 
HETATM 2973 O  O     . HOH F 6 .   ? 15.663  28.217  37.560  1.00 58.29  ? 803 HOH A O     1 
HETATM 2974 O  O     . HOH F 6 .   ? 26.975  28.122  29.918  1.00 41.61  ? 804 HOH A O     1 
HETATM 2975 O  O     . HOH F 6 .   ? 1.125   14.951  35.675  1.00 52.61  ? 805 HOH A O     1 
HETATM 2976 O  O     . HOH F 6 .   ? -11.951 -4.238  4.110   1.00 55.83  ? 806 HOH A O     1 
HETATM 2977 O  O     . HOH F 6 .   ? 8.774   3.000   24.727  1.00 37.51  ? 807 HOH A O     1 
HETATM 2978 O  O     . HOH F 6 .   ? -3.771  -4.390  14.964  1.00 58.21  ? 808 HOH A O     1 
HETATM 2979 O  O     . HOH F 6 .   ? 23.010  26.893  1.743   1.00 61.48  ? 809 HOH A O     1 
HETATM 2980 O  O     . HOH F 6 .   ? 28.577  30.404  38.104  1.00 68.05  ? 810 HOH A O     1 
HETATM 2981 O  O     . HOH F 6 .   ? -1.274  11.754  13.805  1.00 69.20  ? 811 HOH A O     1 
HETATM 2982 O  O     . HOH F 6 .   ? 34.449  2.226   -5.817  1.00 73.83  ? 812 HOH A O     1 
HETATM 2983 O  O     . HOH F 6 .   ? 27.025  15.050  38.448  1.00 65.94  ? 813 HOH A O     1 
HETATM 2984 O  O     . HOH F 6 .   ? 5.226   11.114  -2.592  1.00 65.23  ? 814 HOH A O     1 
HETATM 2985 O  O     . HOH F 6 .   ? 32.525  4.089   15.835  1.00 55.77  ? 815 HOH A O     1 
HETATM 2986 O  O     . HOH F 6 .   ? 8.956   9.058   6.731   1.00 48.73  ? 816 HOH A O     1 
HETATM 2987 O  O     . HOH F 6 .   ? 16.050  42.178  22.381  1.00 51.72  ? 817 HOH A O     1 
HETATM 2988 O  O     . HOH F 6 .   ? 18.622  -11.289 11.697  1.00 64.54  ? 818 HOH A O     1 
HETATM 2989 O  O     . HOH F 6 .   ? 15.925  31.359  11.297  1.00 69.34  ? 819 HOH A O     1 
HETATM 2990 O  O     . HOH F 6 .   ? 15.925  -12.542 0.742   1.00 74.61  ? 820 HOH A O     1 
HETATM 2991 O  O     . HOH F 6 .   ? 14.172  -0.202  -2.268  1.00 65.54  ? 821 HOH A O     1 
HETATM 2992 O  O     . HOH F 6 .   ? 6.632   16.007  41.364  1.00 59.70  ? 822 HOH A O     1 
HETATM 2993 O  O     . HOH F 6 .   ? 12.823  -10.564 19.476  1.00 63.94  ? 823 HOH A O     1 
HETATM 2994 O  O     . HOH F 6 .   ? 25.964  -2.617  6.705   1.00 48.26  ? 824 HOH A O     1 
HETATM 2995 O  O     . HOH F 6 .   ? 28.319  36.673  21.518  1.00 49.23  ? 825 HOH A O     1 
HETATM 2996 O  O     . HOH F 6 .   ? 10.358  35.286  30.085  1.00 54.80  ? 826 HOH A O     1 
HETATM 2997 O  O     . HOH F 6 .   ? 24.474  6.070   -7.442  1.00 68.70  ? 827 HOH A O     1 
HETATM 2998 O  O     . HOH F 6 .   ? 35.510  6.501   15.138  1.00 56.78  ? 828 HOH A O     1 
HETATM 2999 O  O     . HOH F 6 .   ? 6.407   -6.025  23.476  1.00 45.32  ? 829 HOH A O     1 
HETATM 3000 O  O     . HOH F 6 .   ? 6.297   22.893  32.869  1.00 63.30  ? 830 HOH A O     1 
HETATM 3001 O  O     . HOH F 6 .   ? 10.083  21.347  39.017  1.00 54.40  ? 831 HOH A O     1 
HETATM 3002 O  O     . HOH F 6 .   ? 25.808  -3.047  19.330  1.00 39.75  ? 832 HOH A O     1 
HETATM 3003 O  O     . HOH F 6 .   ? 0.091   13.976  37.933  1.00 72.88  ? 833 HOH A O     1 
HETATM 3004 O  O     . HOH F 6 .   ? -1.766  -6.737  16.016  1.00 51.14  ? 834 HOH A O     1 
HETATM 3005 O  O     . HOH F 6 .   ? 24.932  10.005  25.117  1.00 51.43  ? 835 HOH A O     1 
HETATM 3006 O  O     . HOH F 6 .   ? 31.196  1.745   -2.403  1.00 57.96  ? 836 HOH A O     1 
HETATM 3007 O  O     . HOH F 6 .   ? 35.075  10.208  45.407  1.00 63.23  ? 837 HOH A O     1 
HETATM 3008 O  O     . HOH F 6 .   ? 19.460  16.652  12.935  1.00 64.39  ? 838 HOH A O     1 
HETATM 3009 O  O     . HOH F 6 .   ? 30.850  12.584  33.316  1.00 62.36  ? 839 HOH A O     1 
HETATM 3010 O  O     . HOH F 6 .   ? 17.601  6.068   25.575  1.00 44.82  ? 840 HOH A O     1 
HETATM 3011 O  O     . HOH F 6 .   ? 16.376  3.521   26.547  1.00 30.25  ? 841 HOH A O     1 
HETATM 3012 O  O     . HOH F 6 .   ? 27.582  2.984   12.324  1.00 29.28  ? 842 HOH A O     1 
HETATM 3013 O  O     . HOH F 6 .   ? 7.865   -13.892 14.689  1.00 57.24  ? 843 HOH A O     1 
HETATM 3014 O  O     . HOH F 6 .   ? 11.751  32.826  29.616  1.00 54.19  ? 844 HOH A O     1 
HETATM 3015 O  O     . HOH F 6 .   ? -1.358  13.907  35.231  1.00 57.89  ? 845 HOH A O     1 
HETATM 3016 O  O     . HOH F 6 .   ? 10.224  30.052  29.026  1.00 77.79  ? 846 HOH A O     1 
HETATM 3017 O  O     . HOH F 6 .   ? 13.807  -5.683  0.557   1.00 53.67  ? 847 HOH A O     1 
HETATM 3018 O  O     . HOH F 6 .   ? 1.146   10.943  39.560  1.00 65.31  ? 848 HOH A O     1 
HETATM 3019 O  O     . HOH F 6 .   ? -3.774  8.943   2.460   1.00 54.21  ? 849 HOH A O     1 
HETATM 3020 O  O     . HOH F 6 .   ? 37.939  16.960  14.141  1.00 59.40  ? 850 HOH A O     1 
HETATM 3021 O  O     . HOH F 6 .   ? -7.263  -1.225  -3.253  1.00 61.40  ? 851 HOH A O     1 
HETATM 3022 O  O     . HOH F 6 .   ? 8.188   -14.020 11.979  1.00 72.45  ? 852 HOH A O     1 
HETATM 3023 O  O     . HOH F 6 .   ? 34.890  16.222  42.358  1.00 60.64  ? 853 HOH A O     1 
HETATM 3024 O  O     . HOH F 6 .   ? 6.977   30.461  27.429  1.00 53.01  ? 854 HOH A O     1 
HETATM 3025 O  O     . HOH F 6 .   ? 0.631   11.877  23.303  1.00 63.44  ? 855 HOH A O     1 
HETATM 3026 O  O     . HOH F 6 .   ? 1.281   -9.184  4.181   1.00 65.96  ? 856 HOH A O     1 
HETATM 3027 O  O     . HOH F 6 .   ? 38.218  18.732  56.764  1.00 78.45  ? 857 HOH A O     1 
HETATM 3028 O  O     . HOH F 6 .   ? -0.227  16.449  30.550  1.00 71.93  ? 858 HOH A O     1 
HETATM 3029 O  O     . HOH F 6 .   ? -8.367  -9.292  34.812  1.00 60.88  ? 859 HOH A O     1 
HETATM 3030 O  O     . HOH F 6 .   ? 14.127  19.324  10.516  1.00 74.72  ? 860 HOH A O     1 
HETATM 3031 O  O     . HOH F 6 .   ? 21.077  10.999  10.115  1.00 58.44  ? 861 HOH A O     1 
HETATM 3032 O  O     . HOH F 6 .   ? 21.604  13.372  0.894   1.00 43.20  ? 862 HOH A O     1 
HETATM 3033 O  O     . HOH F 6 .   ? 31.076  9.285   -6.514  1.00 60.14  ? 863 HOH A O     1 
HETATM 3034 O  O     . HOH F 6 .   ? 27.161  3.247   -9.461  1.00 73.71  ? 864 HOH A O     1 
HETATM 3035 O  O     . HOH F 6 .   ? 19.360  13.025  -0.503  1.00 65.34  ? 865 HOH A O     1 
HETATM 3036 O  O     . HOH F 6 .   ? 33.407  17.886  13.335  1.00 63.78  ? 866 HOH A O     1 
HETATM 3037 O  O     . HOH F 6 .   ? 26.088  29.271  10.090  1.00 60.88  ? 867 HOH A O     1 
HETATM 3038 O  O     . HOH F 6 .   ? 19.303  13.834  29.573  1.00 54.59  ? 868 HOH A O     1 
HETATM 3039 O  O     . HOH F 6 .   ? 9.020   -7.580  36.760  1.00 55.04  ? 869 HOH A O     1 
HETATM 3040 O  O     . HOH F 6 .   ? -2.553  3.555   28.159  1.00 55.79  ? 870 HOH A O     1 
HETATM 3041 O  O     . HOH F 6 .   ? -4.258  6.906   17.278  1.00 58.35  ? 871 HOH A O     1 
HETATM 3042 O  O     . HOH F 6 .   ? -9.405  -2.952  -3.336  1.00 74.40  ? 872 HOH A O     1 
HETATM 3043 O  O     . HOH F 6 .   ? 4.671   -10.011 2.110   1.00 74.25  ? 873 HOH A O     1 
HETATM 3044 O  O     . HOH F 6 .   ? 27.044  13.019  15.940  1.00 56.64  ? 874 HOH A O     1 
HETATM 3045 O  O     . HOH F 6 .   ? 19.965  10.651  49.932  1.00 75.66  ? 875 HOH A O     1 
HETATM 3046 O  O     . HOH F 6 .   ? 14.982  -9.324  17.417  1.00 67.35  ? 876 HOH A O     1 
HETATM 3047 O  O     . HOH F 6 .   ? 9.073   -8.772  21.708  1.00 65.14  ? 877 HOH A O     1 
HETATM 3048 O  O     . HOH F 6 .   ? 8.751   -7.856  31.088  1.00 44.18  ? 878 HOH A O     1 
HETATM 3049 O  O     . HOH F 6 .   ? 10.773  22.038  9.658   1.00 59.81  ? 879 HOH A O     1 
HETATM 3050 O  O     . HOH F 6 .   ? 5.663   19.054  37.182  1.00 54.90  ? 880 HOH A O     1 
HETATM 3051 O  O     . HOH F 6 .   ? 19.223  -2.146  41.190  1.00 54.03  ? 881 HOH A O     1 
HETATM 3052 O  O     . HOH F 6 .   ? 13.369  22.554  9.583   1.00 69.99  ? 882 HOH A O     1 
HETATM 3053 O  O     . HOH F 6 .   ? 27.450  31.869  21.762  1.00 39.30  ? 883 HOH A O     1 
HETATM 3054 O  O     . HOH F 6 .   ? 11.832  -10.756 1.435   1.00 66.44  ? 884 HOH A O     1 
HETATM 3055 O  O     . HOH F 6 .   ? 6.610   -7.386  20.619  1.00 44.32  ? 885 HOH A O     1 
HETATM 3056 O  O     . HOH F 6 .   ? 27.891  7.905   35.455  1.00 56.50  ? 886 HOH A O     1 
HETATM 3057 O  O     . HOH F 6 .   ? -2.754  14.278  25.770  1.00 58.14  ? 887 HOH A O     1 
HETATM 3058 O  O     . HOH F 6 .   ? 11.639  -2.963  -2.224  1.00 61.59  ? 888 HOH A O     1 
HETATM 3059 O  O     . HOH F 6 .   ? 0.043   7.492   -7.707  1.00 74.68  ? 889 HOH A O     1 
HETATM 3060 O  O     . HOH F 6 .   ? -7.387  -1.098  13.289  1.00 69.55  ? 890 HOH A O     1 
HETATM 3061 O  O     . HOH F 6 .   ? 25.735  16.706  16.676  1.00 61.36  ? 891 HOH A O     1 
HETATM 3062 O  O     . HOH F 6 .   ? 28.743  20.259  56.897  1.00 61.23  ? 892 HOH A O     1 
HETATM 3063 O  O     . HOH F 6 .   ? 33.795  -4.745  8.865   1.00 46.06  ? 893 HOH A O     1 
HETATM 3064 O  O     . HOH F 6 .   ? -2.063  16.921  32.962  1.00 71.05  ? 894 HOH A O     1 
HETATM 3065 O  O     . HOH F 6 .   ? 19.987  8.552   -3.456  1.00 57.43  ? 895 HOH A O     1 
HETATM 3066 O  O     . HOH F 6 .   ? -2.153  6.351   -8.491  1.00 76.95  ? 896 HOH A O     1 
HETATM 3067 O  O     . HOH F 6 .   ? -2.232  6.285   -4.734  1.00 55.20  ? 897 HOH A O     1 
HETATM 3068 O  O     . HOH F 6 .   ? 22.603  -5.368  47.826  1.00 67.95  ? 898 HOH A O     1 
HETATM 3069 O  O     . HOH F 6 .   ? 27.671  -4.436  4.615   1.00 53.57  ? 899 HOH A O     1 
HETATM 3070 O  O     . HOH F 6 .   ? 22.090  24.373  36.850  1.00 48.44  ? 900 HOH A O     1 
HETATM 3071 O  O     . HOH F 6 .   ? 28.797  28.772  28.451  1.00 50.60  ? 901 HOH A O     1 
HETATM 3072 O  O     . HOH F 6 .   ? 10.177  25.879  23.941  1.00 52.82  ? 902 HOH A O     1 
HETATM 3073 O  O     . HOH F 6 .   ? 0.764   7.720   -5.088  1.00 85.19  ? 903 HOH A O     1 
HETATM 3074 O  O     . HOH F 6 .   ? 15.788  42.353  25.550  1.00 58.60  ? 904 HOH A O     1 
HETATM 3075 O  O     . HOH F 6 .   ? 10.092  11.996  24.284  1.00 38.50  ? 905 HOH A O     1 
HETATM 3076 O  O     . HOH F 6 .   ? -3.028  6.307   14.530  1.00 88.71  ? 906 HOH A O     1 
HETATM 3077 O  O     . HOH F 6 .   ? 10.539  20.746  25.478  1.00 64.46  ? 907 HOH A O     1 
HETATM 3078 O  O     . HOH F 6 .   ? 16.337  -8.818  19.618  1.00 56.45  ? 908 HOH A O     1 
HETATM 3079 O  O     . HOH F 6 .   ? 10.797  -7.557  28.078  1.00 63.76  ? 909 HOH A O     1 
HETATM 3080 O  O     . HOH F 6 .   ? 15.848  20.795  19.774  1.00 60.05  ? 910 HOH A O     1 
HETATM 3081 O  O     . HOH F 6 .   ? -3.993  1.591   -4.104  1.00 58.90  ? 911 HOH A O     1 
HETATM 3082 O  O     . HOH F 6 .   ? 4.712   6.978   -7.557  1.00 58.93  ? 912 HOH A O     1 
HETATM 3083 O  O     . HOH F 6 .   ? 4.929   -6.434  1.436   1.00 57.03  ? 913 HOH A O     1 
HETATM 3084 O  O     . HOH F 6 .   ? 25.619  2.514   -12.178 1.00 56.79  ? 914 HOH A O     1 
HETATM 3085 O  O     . HOH F 6 .   ? 9.532   -14.191 16.782  1.00 65.50  ? 915 HOH A O     1 
HETATM 3086 O  O     . HOH F 6 .   ? 34.456  8.998   -7.269  1.00 66.05  ? 916 HOH A O     1 
HETATM 3087 O  O     . HOH F 6 .   ? 16.756  11.283  24.490  1.00 47.49  ? 917 HOH A O     1 
HETATM 3088 O  O     . HOH F 6 .   ? 16.832  14.195  1.569   1.00 50.63  ? 918 HOH A O     1 
HETATM 3089 O  O     . HOH F 6 .   ? 10.027  1.153   42.207  1.00 41.33  ? 919 HOH A O     1 
HETATM 3090 O  O     . HOH F 6 .   ? 26.104  17.210  40.516  1.00 67.24  ? 920 HOH A O     1 
HETATM 3091 O  O     . HOH F 6 .   ? 20.501  20.237  20.366  1.00 61.69  ? 921 HOH A O     1 
HETATM 3092 O  O     . HOH F 6 .   ? 0.570   4.583   0.564   1.00 45.93  ? 922 HOH A O     1 
HETATM 3093 O  O     . HOH F 6 .   ? 40.292  2.386   -2.763  1.00 59.12  ? 923 HOH A O     1 
HETATM 3094 O  O     . HOH F 6 .   ? 19.121  11.547  11.947  1.00 59.88  ? 924 HOH A O     1 
HETATM 3095 O  O     . HOH F 6 .   ? 12.513  21.860  19.752  1.00 64.67  ? 925 HOH A O     1 
HETATM 3096 O  O     . HOH F 6 .   ? 26.344  11.673  43.200  1.00 71.51  ? 926 HOH A O     1 
HETATM 3097 O  O     . HOH F 6 .   ? 15.345  25.605  39.198  1.00 59.16  ? 927 HOH A O     1 
HETATM 3098 O  O     . HOH F 6 .   ? 25.277  -6.079  6.082   1.00 71.68  ? 928 HOH A O     1 
HETATM 3099 O  O     . HOH F 6 .   ? 13.708  19.606  26.566  1.00 55.95  ? 929 HOH A O     1 
HETATM 3100 O  O     . HOH F 6 .   ? 28.838  29.313  25.499  1.00 61.87  ? 930 HOH A O     1 
HETATM 3101 O  O     . HOH F 6 .   ? 22.331  15.639  13.328  1.00 52.83  ? 931 HOH A O     1 
HETATM 3102 O  O     . HOH F 6 .   ? 25.704  -0.358  3.284   1.00 45.15  ? 932 HOH A O     1 
HETATM 3103 O  O     . HOH F 6 .   ? 26.923  -2.999  9.605   1.00 63.84  ? 933 HOH A O     1 
HETATM 3104 O  O     . HOH F 6 .   ? 15.429  12.440  6.720   1.00 49.29  ? 934 HOH A O     1 
HETATM 3105 O  O     . HOH F 6 .   ? 12.593  -1.150  -4.599  1.00 77.39  ? 935 HOH A O     1 
HETATM 3106 O  O     . HOH F 6 .   ? 19.011  23.610  17.634  1.00 49.32  ? 936 HOH A O     1 
HETATM 3107 O  O     . HOH F 6 .   ? 20.476  8.154   18.261  1.00 49.72  ? 937 HOH A O     1 
HETATM 3108 O  O     . HOH F 6 .   ? 10.398  12.938  8.020   1.00 50.51  ? 938 HOH A O     1 
HETATM 3109 O  O     . HOH F 6 .   ? -6.502  -1.782  20.728  1.00 54.65  ? 939 HOH A O     1 
HETATM 3110 O  O     . HOH F 6 .   ? -7.473  0.463   -6.253  1.00 80.30  ? 940 HOH A O     1 
HETATM 3111 O  O     . HOH F 6 .   ? -5.051  2.425   15.261  1.00 55.19  ? 941 HOH A O     1 
HETATM 3112 O  O     . HOH F 6 .   ? -1.691  11.133  39.247  1.00 59.46  ? 942 HOH A O     1 
HETATM 3113 O  O     . HOH F 6 .   ? 24.433  17.515  -1.508  1.00 53.30  ? 943 HOH A O     1 
HETATM 3114 O  O     . HOH F 6 .   ? 8.412   17.268  42.999  1.00 70.43  ? 944 HOH A O     1 
HETATM 3115 O  O     . HOH F 6 .   ? 24.649  -2.714  25.580  1.00 58.40  ? 945 HOH A O     1 
HETATM 3116 O  O     . HOH F 6 .   ? 44.722  17.208  53.097  1.00 71.28  ? 946 HOH A O     1 
HETATM 3117 O  O     . HOH F 6 .   ? 7.555   2.552   12.913  1.00 61.96  ? 947 HOH A O     1 
HETATM 3118 O  O     . HOH F 6 .   ? 18.960  40.826  34.545  1.00 55.69  ? 948 HOH A O     1 
HETATM 3119 O  O     . HOH F 6 .   ? 29.564  -0.748  42.176  1.00 72.38  ? 949 HOH A O     1 
HETATM 3120 O  O     . HOH F 6 .   ? 15.270  14.546  27.930  1.00 54.32  ? 950 HOH A O     1 
HETATM 3121 O  O     . HOH F 6 .   ? 35.893  23.528  17.518  1.00 61.09  ? 951 HOH A O     1 
HETATM 3122 O  O     . HOH F 6 .   ? 25.409  -4.899  45.750  1.00 68.78  ? 952 HOH A O     1 
HETATM 3123 O  O     . HOH F 6 .   ? 18.251  39.099  10.955  1.00 65.54  ? 953 HOH A O     1 
HETATM 3124 O  O     . HOH F 6 .   ? 9.789   25.166  20.641  1.00 57.07  ? 954 HOH A O     1 
HETATM 3125 O  O     . HOH F 6 .   ? 14.370  31.069  9.003   1.00 70.96  ? 955 HOH A O     1 
HETATM 3126 O  O     . HOH F 6 .   ? 10.586  10.020  13.180  1.00 79.56  ? 956 HOH A O     1 
HETATM 3127 O  O     . HOH F 6 .   ? 29.367  35.629  28.066  1.00 80.89  ? 957 HOH A O     1 
HETATM 3128 O  O     . HOH F 6 .   ? 12.143  -13.104 20.186  1.00 69.99  ? 958 HOH A O     1 
HETATM 3129 O  O     . HOH F 6 .   ? 16.647  5.258   44.018  1.00 65.08  ? 959 HOH A O     1 
HETATM 3130 O  O     . HOH F 6 .   ? 44.787  12.055  2.241   1.00 62.06  ? 960 HOH A O     1 
HETATM 3131 O  O     . HOH F 6 .   ? 32.378  30.404  13.040  1.00 65.09  ? 961 HOH A O     1 
HETATM 3132 O  O     . HOH F 6 .   ? -2.495  13.699  31.852  1.00 85.23  ? 962 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   111 ?   ?   ?   A . n 
A 1 2   GLY 2   112 ?   ?   ?   A . n 
A 1 3   SER 3   113 ?   ?   ?   A . n 
A 1 4   SER 4   114 ?   ?   ?   A . n 
A 1 5   HIS 5   115 ?   ?   ?   A . n 
A 1 6   HIS 6   116 ?   ?   ?   A . n 
A 1 7   HIS 7   117 ?   ?   ?   A . n 
A 1 8   HIS 8   118 ?   ?   ?   A . n 
A 1 9   HIS 9   119 ?   ?   ?   A . n 
A 1 10  HIS 10  120 ?   ?   ?   A . n 
A 1 11  SER 11  121 ?   ?   ?   A . n 
A 1 12  SER 12  122 ?   ?   ?   A . n 
A 1 13  GLY 13  123 ?   ?   ?   A . n 
A 1 14  LEU 14  124 ?   ?   ?   A . n 
A 1 15  VAL 15  125 ?   ?   ?   A . n 
A 1 16  PRO 16  126 ?   ?   ?   A . n 
A 1 17  ARG 17  127 ?   ?   ?   A . n 
A 1 18  GLY 18  128 ?   ?   ?   A . n 
A 1 19  SER 19  129 ?   ?   ?   A . n 
A 1 20  HIS 20  130 ?   ?   ?   A . n 
A 1 21  MET 21  131 ?   ?   ?   A . n 
A 1 22  SER 22  132 ?   ?   ?   A . n 
A 1 23  PRO 23  133 ?   ?   ?   A . n 
A 1 24  SER 24  134 ?   ?   ?   A . n 
A 1 25  PRO 25  135 ?   ?   ?   A . n 
A 1 26  VAL 26  136 ?   ?   ?   A . n 
A 1 27  PRO 27  137 ?   ?   ?   A . n 
A 1 28  GLY 28  138 ?   ?   ?   A . n 
A 1 29  SER 29  139 ?   ?   ?   A . n 
A 1 30  GLN 30  140 ?   ?   ?   A . n 
A 1 31  ASN 31  141 ?   ?   ?   A . n 
A 1 32  VAL 32  142 ?   ?   ?   A . n 
A 1 33  PRO 33  143 ?   ?   ?   A . n 
A 1 34  ALA 34  144 ?   ?   ?   A . n 
A 1 35  PRO 35  145 ?   ?   ?   A . n 
A 1 36  ALA 36  146 ?   ?   ?   A . n 
A 1 37  VAL 37  147 ?   ?   ?   A . n 
A 1 38  LYS 38  148 ?   ?   ?   A . n 
A 1 39  LYS 39  149 149 LYS LYS A . n 
A 1 40  ILE 40  150 150 ILE ILE A . n 
A 1 41  SER 41  151 151 SER SER A . n 
A 1 42  GLN 42  152 152 GLN GLN A . n 
A 1 43  TYR 43  153 153 TYR TYR A . n 
A 1 44  ALA 44  154 154 ALA ALA A . n 
A 1 45  CYS 45  155 155 CYS CYS A . n 
A 1 46  GLN 46  156 156 GLN GLN A . n 
A 1 47  ARG 47  157 157 ARG ARG A . n 
A 1 48  ARG 48  158 158 ARG ARG A . n 
A 1 49  THR 49  159 159 THR THR A . n 
A 1 50  THR 50  160 160 THR THR A . n 
A 1 51  LEU 51  161 161 LEU LEU A . n 
A 1 52  ASN 52  162 162 ASN ASN A . n 
A 1 53  ASN 53  163 163 ASN ASN A . n 
A 1 54  TYR 54  164 164 TYR TYR A . n 
A 1 55  ASN 55  165 165 ASN ASN A . n 
A 1 56  GLN 56  166 166 GLN GLN A . n 
A 1 57  LEU 57  167 167 LEU LEU A . n 
A 1 58  PHE 58  168 168 PHE PHE A . n 
A 1 59  THR 59  169 169 THR THR A . n 
A 1 60  ASP 60  170 170 ASP ASP A . n 
A 1 61  ALA 61  171 171 ALA ALA A . n 
A 1 62  LEU 62  172 172 LEU LEU A . n 
A 1 63  ASP 63  173 173 ASP ASP A . n 
A 1 64  ILE 64  174 174 ILE ILE A . n 
A 1 65  LEU 65  175 175 LEU LEU A . n 
A 1 66  ALA 66  176 176 ALA ALA A . n 
A 1 67  GLU 67  177 177 GLU GLU A . n 
A 1 68  ASN 68  178 178 ASN ASN A . n 
A 1 69  ASP 69  179 179 ASP ASP A . n 
A 1 70  GLU 70  180 180 GLU GLU A . n 
A 1 71  LEU 71  181 181 LEU LEU A . n 
A 1 72  ARG 72  182 182 ARG ARG A . n 
A 1 73  GLU 73  183 183 GLU GLU A . n 
A 1 74  ASN 74  184 184 ASN ASN A . n 
A 1 75  GLU 75  185 185 GLU GLU A . n 
A 1 76  GLY 76  186 186 GLY GLY A . n 
A 1 77  SER 77  187 187 SER SER A . n 
A 1 78  CYS 78  188 188 CYS CYS A . n 
A 1 79  LEU 79  189 189 LEU LEU A . n 
A 1 80  ALA 80  190 190 ALA ALA A . n 
A 1 81  PHE 81  191 191 PHE PHE A . n 
A 1 82  MET 82  192 192 MET MET A . n 
A 1 83  ARG 83  193 193 ARG ARG A . n 
A 1 84  ALA 84  194 194 ALA ALA A . n 
A 1 85  SER 85  195 195 SER SER A . n 
A 1 86  SER 86  196 196 SER SER A . n 
A 1 87  VAL 87  197 197 VAL VAL A . n 
A 1 88  LEU 88  198 198 LEU LEU A . n 
A 1 89  LYS 89  199 199 LYS LYS A . n 
A 1 90  SER 90  200 200 SER SER A . n 
A 1 91  LEU 91  201 201 LEU LEU A . n 
A 1 92  PRO 92  202 202 PRO PRO A . n 
A 1 93  PHE 93  203 203 PHE PHE A . n 
A 1 94  PRO 94  204 204 PRO PRO A . n 
A 1 95  ILE 95  205 205 ILE ILE A . n 
A 1 96  THR 96  206 206 THR THR A . n 
A 1 97  SER 97  207 207 SER SER A . n 
A 1 98  MET 98  208 208 MET MET A . n 
A 1 99  LYS 99  209 209 LYS LYS A . n 
A 1 100 ASP 100 210 210 ASP ASP A . n 
A 1 101 THR 101 211 211 THR THR A . n 
A 1 102 GLU 102 212 212 GLU GLU A . n 
A 1 103 GLY 103 213 213 GLY GLY A . n 
A 1 104 ILE 104 214 214 ILE ILE A . n 
A 1 105 PRO 105 215 215 PRO PRO A . n 
A 1 106 CYS 106 216 216 CYS CYS A . n 
A 1 107 LEU 107 217 217 LEU LEU A . n 
A 1 108 GLY 108 218 218 GLY GLY A . n 
A 1 109 ASP 109 219 219 ASP ASP A . n 
A 1 110 LYS 110 220 220 LYS LYS A . n 
A 1 111 VAL 111 221 221 VAL VAL A . n 
A 1 112 LYS 112 222 222 LYS LYS A . n 
A 1 113 SER 113 223 223 SER SER A . n 
A 1 114 ILE 114 224 224 ILE ILE A . n 
A 1 115 ILE 115 225 225 ILE ILE A . n 
A 1 116 GLU 116 226 226 GLU GLU A . n 
A 1 117 GLY 117 227 227 GLY GLY A . n 
A 1 118 ILE 118 228 228 ILE ILE A . n 
A 1 119 ILE 119 229 229 ILE ILE A . n 
A 1 120 GLU 120 230 230 GLU GLU A . n 
A 1 121 ASP 121 231 231 ASP ASP A . n 
A 1 122 GLY 122 232 232 GLY GLY A . n 
A 1 123 GLU 123 233 233 GLU GLU A . n 
A 1 124 SER 124 234 234 SER SER A . n 
A 1 125 SER 125 235 235 SER SER A . n 
A 1 126 GLU 126 236 236 GLU GLU A . n 
A 1 127 ALA 127 237 237 ALA ALA A . n 
A 1 128 LYS 128 238 238 LYS LYS A . n 
A 1 129 ALA 129 239 239 ALA ALA A . n 
A 1 130 VAL 130 240 240 VAL VAL A . n 
A 1 131 LEU 131 241 241 LEU LEU A . n 
A 1 132 ASN 132 242 242 ASN ASN A . n 
A 1 133 ASP 133 243 243 ASP ASP A . n 
A 1 134 GLU 134 244 244 GLU GLU A . n 
A 1 135 ARG 135 245 245 ARG ARG A . n 
A 1 136 TYR 136 246 246 TYR TYR A . n 
A 1 137 LYS 137 247 247 LYS LYS A . n 
A 1 138 SER 138 248 248 SER SER A . n 
A 1 139 PHE 139 249 249 PHE PHE A . n 
A 1 140 LYS 140 250 250 LYS LYS A . n 
A 1 141 LEU 141 251 251 LEU LEU A . n 
A 1 142 PHE 142 252 252 PHE PHE A . n 
A 1 143 THR 143 253 253 THR THR A . n 
A 1 144 SER 144 254 254 SER SER A . n 
A 1 145 VAL 145 255 255 VAL VAL A . n 
A 1 146 PHE 146 256 256 PHE PHE A . n 
A 1 147 GLY 147 257 257 GLY GLY A . n 
A 1 148 VAL 148 258 258 VAL VAL A . n 
A 1 149 GLY 149 259 259 GLY GLY A . n 
A 1 150 LEU 150 260 260 LEU LEU A . n 
A 1 151 LYS 151 261 261 LYS LYS A . n 
A 1 152 THR 152 262 262 THR THR A . n 
A 1 153 ALA 153 263 263 ALA ALA A . n 
A 1 154 GLU 154 264 264 GLU GLU A . n 
A 1 155 LYS 155 265 265 LYS LYS A . n 
A 1 156 TRP 156 266 266 TRP TRP A . n 
A 1 157 PHE 157 267 267 PHE PHE A . n 
A 1 158 ARG 158 268 268 ARG ARG A . n 
A 1 159 MET 159 269 269 MET MET A . n 
A 1 160 GLY 160 270 270 GLY GLY A . n 
A 1 161 PHE 161 271 271 PHE PHE A . n 
A 1 162 ARG 162 272 272 ARG ARG A . n 
A 1 163 THR 163 273 273 THR THR A . n 
A 1 164 LEU 164 274 274 LEU LEU A . n 
A 1 165 SER 165 275 275 SER SER A . n 
A 1 166 LYS 166 276 276 LYS LYS A . n 
A 1 167 ILE 167 277 277 ILE ILE A . n 
A 1 168 GLN 168 278 278 GLN GLN A . n 
A 1 169 SER 169 279 279 SER SER A . n 
A 1 170 ASP 170 280 280 ASP ASP A . n 
A 1 171 LYS 171 281 281 LYS LYS A . n 
A 1 172 SER 172 282 282 SER SER A . n 
A 1 173 LEU 173 283 283 LEU LEU A . n 
A 1 174 ARG 174 284 284 ARG ARG A . n 
A 1 175 PHE 175 285 285 PHE PHE A . n 
A 1 176 THR 176 286 286 THR THR A . n 
A 1 177 GLN 177 287 287 GLN GLN A . n 
A 1 178 MET 178 288 288 MET MET A . n 
A 1 179 GLN 179 289 289 GLN GLN A . n 
A 1 180 LYS 180 290 290 LYS LYS A . n 
A 1 181 ALA 181 291 291 ALA ALA A . n 
A 1 182 GLY 182 292 292 GLY GLY A . n 
A 1 183 PHE 183 293 293 PHE PHE A . n 
A 1 184 LEU 184 294 294 LEU LEU A . n 
A 1 185 TYR 185 295 295 TYR TYR A . n 
A 1 186 TYR 186 296 296 TYR TYR A . n 
A 1 187 GLU 187 297 297 GLU GLU A . n 
A 1 188 ASP 188 298 298 ASP ASP A . n 
A 1 189 LEU 189 299 299 LEU LEU A . n 
A 1 190 VAL 190 300 300 VAL VAL A . n 
A 1 191 SER 191 301 301 SER SER A . n 
A 1 192 CYS 192 302 302 CYS CYS A . n 
A 1 193 VAL 193 303 303 VAL VAL A . n 
A 1 194 ASN 194 304 304 ASN ASN A . n 
A 1 195 ARG 195 305 305 ARG ARG A . n 
A 1 196 PRO 196 306 306 PRO PRO A . n 
A 1 197 GLU 197 307 307 GLU GLU A . n 
A 1 198 ALA 198 308 308 ALA ALA A . n 
A 1 199 GLU 199 309 309 GLU GLU A . n 
A 1 200 ALA 200 310 310 ALA ALA A . n 
A 1 201 VAL 201 311 311 VAL VAL A . n 
A 1 202 SER 202 312 312 SER SER A . n 
A 1 203 MET 203 313 313 MET MET A . n 
A 1 204 LEU 204 314 314 LEU LEU A . n 
A 1 205 VAL 205 315 315 VAL VAL A . n 
A 1 206 LYS 206 316 316 LYS LYS A . n 
A 1 207 GLU 207 317 317 GLU GLU A . n 
A 1 208 ALA 208 318 318 ALA ALA A . n 
A 1 209 VAL 209 319 319 VAL VAL A . n 
A 1 210 VAL 210 320 320 VAL VAL A . n 
A 1 211 THR 211 321 321 THR THR A . n 
A 1 212 PHE 212 322 322 PHE PHE A . n 
A 1 213 LEU 213 323 323 LEU LEU A . n 
A 1 214 PRO 214 324 324 PRO PRO A . n 
A 1 215 ASP 215 325 325 ASP ASP A . n 
A 1 216 ALA 216 326 326 ALA ALA A . n 
A 1 217 LEU 217 327 327 LEU LEU A . n 
A 1 218 VAL 218 328 328 VAL VAL A . n 
A 1 219 THR 219 329 329 THR THR A . n 
A 1 220 MET 220 330 330 MET MET A . n 
A 1 221 THR 221 331 331 THR THR A . n 
A 1 222 GLY 222 332 332 GLY GLY A . n 
A 1 223 GLY 223 333 333 GLY GLY A . n 
A 1 224 PHE 224 334 334 PHE PHE A . n 
A 1 225 ARG 225 335 335 ARG ARG A . n 
A 1 226 ARG 226 336 336 ARG ARG A . n 
A 1 227 GLY 227 337 337 GLY GLY A . n 
A 1 228 LYS 228 338 338 LYS LYS A . n 
A 1 229 MET 229 339 339 MET MET A . n 
A 1 230 THR 230 340 340 THR THR A . n 
A 1 231 GLY 231 341 341 GLY GLY A . n 
A 1 232 HIS 232 342 342 HIS HIS A . n 
A 1 233 ASP 233 343 343 ASP ASP A . n 
A 1 234 VAL 234 344 344 VAL VAL A . n 
A 1 235 ASP 235 345 345 ASP ASP A . n 
A 1 236 PHE 236 346 346 PHE PHE A . n 
A 1 237 LEU 237 347 347 LEU LEU A . n 
A 1 238 ILE 238 348 348 ILE ILE A . n 
A 1 239 THR 239 349 349 THR THR A . n 
A 1 240 SER 240 350 350 SER SER A . n 
A 1 241 PRO 241 351 351 PRO PRO A . n 
A 1 242 GLU 242 352 352 GLU GLU A . n 
A 1 243 ALA 243 353 353 ALA ALA A . n 
A 1 244 THR 244 354 354 THR THR A . n 
A 1 245 GLU 245 355 355 GLU GLU A . n 
A 1 246 ASP 246 356 356 ASP ASP A . n 
A 1 247 GLU 247 357 357 GLU GLU A . n 
A 1 248 GLU 248 358 358 GLU GLU A . n 
A 1 249 GLN 249 359 359 GLN GLN A . n 
A 1 250 GLN 250 360 360 GLN GLN A . n 
A 1 251 LEU 251 361 361 LEU LEU A . n 
A 1 252 LEU 252 362 362 LEU LEU A . n 
A 1 253 HIS 253 363 363 HIS HIS A . n 
A 1 254 LYS 254 364 364 LYS LYS A . n 
A 1 255 VAL 255 365 365 VAL VAL A . n 
A 1 256 THR 256 366 366 THR THR A . n 
A 1 257 ASP 257 367 367 ASP ASP A . n 
A 1 258 PHE 258 368 368 PHE PHE A . n 
A 1 259 TRP 259 369 369 TRP TRP A . n 
A 1 260 LYS 260 370 370 LYS LYS A . n 
A 1 261 GLN 261 371 371 GLN GLN A . n 
A 1 262 GLN 262 372 372 GLN GLN A . n 
A 1 263 GLY 263 373 373 GLY GLY A . n 
A 1 264 LEU 264 374 374 LEU LEU A . n 
A 1 265 LEU 265 375 375 LEU LEU A . n 
A 1 266 LEU 266 376 376 LEU LEU A . n 
A 1 267 TYR 267 377 377 TYR TYR A . n 
A 1 268 CYS 268 378 378 CYS CYS A . n 
A 1 269 ASP 269 379 379 ASP ASP A . n 
A 1 270 ILE 270 380 380 ILE ILE A . n 
A 1 271 LEU 271 381 381 LEU LEU A . n 
A 1 272 GLU 272 382 382 GLU GLU A . n 
A 1 273 SER 273 383 383 SER SER A . n 
A 1 274 THR 274 384 384 THR THR A . n 
A 1 275 PHE 275 385 385 PHE PHE A . n 
A 1 276 GLU 276 386 386 GLU GLU A . n 
A 1 277 LYS 277 387 387 LYS LYS A . n 
A 1 278 PHE 278 388 388 PHE PHE A . n 
A 1 279 LYS 279 389 389 LYS LYS A . n 
A 1 280 GLN 280 390 390 GLN GLN A . n 
A 1 281 PRO 281 391 391 PRO PRO A . n 
A 1 282 SER 282 392 392 SER SER A . n 
A 1 283 ARG 283 393 393 ARG ARG A . n 
A 1 284 LYS 284 394 394 LYS LYS A . n 
A 1 285 VAL 285 395 395 VAL VAL A . n 
A 1 286 ASP 286 396 396 ASP ASP A . n 
A 1 287 ALA 287 397 397 ALA ALA A . n 
A 1 288 LEU 288 398 398 LEU LEU A . n 
A 1 289 ASP 289 399 399 ASP ASP A . n 
A 1 290 HIS 290 400 400 HIS HIS A . n 
A 1 291 PHE 291 401 401 PHE PHE A . n 
A 1 292 GLN 292 402 402 GLN GLN A . n 
A 1 293 LYS 293 403 403 LYS LYS A . n 
A 1 294 CYS 294 404 404 CYS CYS A . n 
A 1 295 PHE 295 405 405 PHE PHE A . n 
A 1 296 LEU 296 406 406 LEU LEU A . n 
A 1 297 ILE 297 407 407 ILE ILE A . n 
A 1 298 LEU 298 408 408 LEU LEU A . n 
A 1 299 LYS 299 409 409 LYS LYS A . n 
A 1 300 LEU 300 410 410 LEU LEU A . n 
A 1 301 ASP 301 411 411 ASP ASP A . n 
A 1 302 HIS 302 412 412 HIS HIS A . n 
A 1 303 GLY 303 413 413 GLY GLY A . n 
A 1 304 ARG 304 414 414 ARG ARG A . n 
A 1 305 VAL 305 415 415 VAL VAL A . n 
A 1 306 HIS 306 416 416 HIS HIS A . n 
A 1 307 SER 307 417 417 SER SER A . n 
A 1 308 GLU 308 418 418 GLU GLU A . n 
A 1 309 LYS 309 419 419 LYS LYS A . n 
A 1 310 SER 310 420 ?   ?   ?   A . n 
A 1 311 GLY 311 421 ?   ?   ?   A . n 
A 1 312 GLN 312 422 ?   ?   ?   A . n 
A 1 313 GLN 313 423 ?   ?   ?   A . n 
A 1 314 GLU 314 424 ?   ?   ?   A . n 
A 1 315 GLY 315 425 425 GLY GLY A . n 
A 1 316 LYS 316 426 426 LYS LYS A . n 
A 1 317 GLY 317 427 427 GLY GLY A . n 
A 1 318 TRP 318 428 428 TRP TRP A . n 
A 1 319 LYS 319 429 429 LYS LYS A . n 
A 1 320 ALA 320 430 430 ALA ALA A . n 
A 1 321 ILE 321 431 431 ILE ILE A . n 
A 1 322 ARG 322 432 432 ARG ARG A . n 
A 1 323 VAL 323 433 433 VAL VAL A . n 
A 1 324 ASP 324 434 434 ASP ASP A . n 
A 1 325 LEU 325 435 435 LEU LEU A . n 
A 1 326 VAL 326 436 436 VAL VAL A . n 
A 1 327 MET 327 437 437 MET MET A . n 
A 1 328 CYS 328 438 438 CYS CYS A . n 
A 1 329 PRO 329 439 439 PRO PRO A . n 
A 1 330 TYR 330 440 440 TYR TYR A . n 
A 1 331 ASP 331 441 441 ASP ASP A . n 
A 1 332 ARG 332 442 442 ARG ARG A . n 
A 1 333 ARG 333 443 443 ARG ARG A . n 
A 1 334 ALA 334 444 444 ALA ALA A . n 
A 1 335 PHE 335 445 445 PHE PHE A . n 
A 1 336 ALA 336 446 446 ALA ALA A . n 
A 1 337 LEU 337 447 447 LEU LEU A . n 
A 1 338 LEU 338 448 448 LEU LEU A . n 
A 1 339 GLY 339 449 449 GLY GLY A . n 
A 1 340 TRP 340 450 450 TRP TRP A . n 
A 1 341 THR 341 451 451 THR THR A . n 
A 1 342 GLY 342 452 452 GLY GLY A . n 
A 1 343 SER 343 453 453 SER SER A . n 
A 1 344 ARG 344 454 454 ARG ARG A . n 
A 1 345 GLN 345 455 455 GLN GLN A . n 
A 1 346 PHE 346 456 456 PHE PHE A . n 
A 1 347 GLU 347 457 457 GLU GLU A . n 
A 1 348 ARG 348 458 458 ARG ARG A . n 
A 1 349 ASP 349 459 459 ASP ASP A . n 
A 1 350 LEU 350 460 460 LEU LEU A . n 
A 1 351 ARG 351 461 461 ARG ARG A . n 
A 1 352 ARG 352 462 462 ARG ARG A . n 
A 1 353 TYR 353 463 463 TYR TYR A . n 
A 1 354 ALA 354 464 464 ALA ALA A . n 
A 1 355 THR 355 465 465 THR THR A . n 
A 1 356 HIS 356 466 466 HIS HIS A . n 
A 1 357 GLU 357 467 467 GLU GLU A . n 
A 1 358 ARG 358 468 468 ARG ARG A . n 
A 1 359 LYS 359 469 469 LYS LYS A . n 
A 1 360 MET 360 470 470 MET MET A . n 
A 1 361 MET 361 471 471 MET MET A . n 
A 1 362 LEU 362 472 472 LEU LEU A . n 
A 1 363 ASP 363 473 473 ASP ASP A . n 
A 1 364 ASN 364 474 474 ASN ASN A . n 
A 1 365 HIS 365 475 475 HIS HIS A . n 
A 1 366 ALA 366 476 476 ALA ALA A . n 
A 1 367 LEU 367 477 477 LEU LEU A . n 
A 1 368 TYR 368 478 478 TYR TYR A . n 
A 1 369 ASP 369 479 479 ASP ASP A . n 
A 1 370 ARG 370 480 480 ARG ARG A . n 
A 1 371 THR 371 481 481 THR THR A . n 
A 1 372 LYS 372 482 482 LYS LYS A . n 
A 1 373 ARG 373 483 483 ARG ARG A . n 
A 1 374 VAL 374 484 484 VAL VAL A . n 
A 1 375 PHE 375 485 485 PHE PHE A . n 
A 1 376 LEU 376 486 486 LEU LEU A . n 
A 1 377 GLU 377 487 487 GLU GLU A . n 
A 1 378 ALA 378 488 488 ALA ALA A . n 
A 1 379 GLU 379 489 489 GLU GLU A . n 
A 1 380 SER 380 490 490 SER SER A . n 
A 1 381 GLU 381 491 491 GLU GLU A . n 
A 1 382 GLU 382 492 492 GLU GLU A . n 
A 1 383 GLU 383 493 493 GLU GLU A . n 
A 1 384 ILE 384 494 494 ILE ILE A . n 
A 1 385 PHE 385 495 495 PHE PHE A . n 
A 1 386 ALA 386 496 496 ALA ALA A . n 
A 1 387 HIS 387 497 497 HIS HIS A . n 
A 1 388 LEU 388 498 498 LEU LEU A . n 
A 1 389 GLY 389 499 499 GLY GLY A . n 
A 1 390 LEU 390 500 500 LEU LEU A . n 
A 1 391 ASP 391 501 501 ASP ASP A . n 
A 1 392 TYR 392 502 502 TYR TYR A . n 
A 1 393 ILE 393 503 503 ILE ILE A . n 
A 1 394 GLU 394 504 504 GLU GLU A . n 
A 1 395 PRO 395 505 505 PRO PRO A . n 
A 1 396 TRP 396 506 506 TRP TRP A . n 
A 1 397 GLU 397 507 507 GLU GLU A . n 
A 1 398 ARG 398 508 508 ARG ARG A . n 
A 1 399 ASN 399 509 509 ASN ASN A . n 
A 1 400 ALA 400 510 510 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   601 1   MG  MG  A . 
C 3 NA  1   602 1   NA  NA  A . 
D 4 APC 1   603 1   APC APC A . 
E 5 ZN  1   604 1   ZN  ZN  A . 
F 6 HOH 1   701 1   HOH HOH A . 
F 6 HOH 2   702 2   HOH HOH A . 
F 6 HOH 3   703 3   HOH HOH A . 
F 6 HOH 4   704 4   HOH HOH A . 
F 6 HOH 5   705 5   HOH HOH A . 
F 6 HOH 6   706 6   HOH HOH A . 
F 6 HOH 7   707 7   HOH HOH A . 
F 6 HOH 8   708 8   HOH HOH A . 
F 6 HOH 9   709 9   HOH HOH A . 
F 6 HOH 10  710 10  HOH HOH A . 
F 6 HOH 11  711 11  HOH HOH A . 
F 6 HOH 12  712 12  HOH HOH A . 
F 6 HOH 13  713 13  HOH HOH A . 
F 6 HOH 14  714 14  HOH HOH A . 
F 6 HOH 15  715 15  HOH HOH A . 
F 6 HOH 16  716 16  HOH HOH A . 
F 6 HOH 17  717 17  HOH HOH A . 
F 6 HOH 18  718 18  HOH HOH A . 
F 6 HOH 19  719 19  HOH HOH A . 
F 6 HOH 20  720 20  HOH HOH A . 
F 6 HOH 21  721 21  HOH HOH A . 
F 6 HOH 22  722 22  HOH HOH A . 
F 6 HOH 23  723 23  HOH HOH A . 
F 6 HOH 24  724 24  HOH HOH A . 
F 6 HOH 25  725 25  HOH HOH A . 
F 6 HOH 26  726 26  HOH HOH A . 
F 6 HOH 27  727 27  HOH HOH A . 
F 6 HOH 28  728 28  HOH HOH A . 
F 6 HOH 29  729 29  HOH HOH A . 
F 6 HOH 30  730 30  HOH HOH A . 
F 6 HOH 31  731 31  HOH HOH A . 
F 6 HOH 32  732 32  HOH HOH A . 
F 6 HOH 33  733 33  HOH HOH A . 
F 6 HOH 34  734 34  HOH HOH A . 
F 6 HOH 35  735 35  HOH HOH A . 
F 6 HOH 36  736 36  HOH HOH A . 
F 6 HOH 37  737 37  HOH HOH A . 
F 6 HOH 38  738 38  HOH HOH A . 
F 6 HOH 39  739 39  HOH HOH A . 
F 6 HOH 40  740 40  HOH HOH A . 
F 6 HOH 41  741 41  HOH HOH A . 
F 6 HOH 42  742 42  HOH HOH A . 
F 6 HOH 43  743 43  HOH HOH A . 
F 6 HOH 44  744 44  HOH HOH A . 
F 6 HOH 45  745 45  HOH HOH A . 
F 6 HOH 46  746 46  HOH HOH A . 
F 6 HOH 47  747 47  HOH HOH A . 
F 6 HOH 48  748 48  HOH HOH A . 
F 6 HOH 49  749 49  HOH HOH A . 
F 6 HOH 50  750 50  HOH HOH A . 
F 6 HOH 51  751 51  HOH HOH A . 
F 6 HOH 52  752 52  HOH HOH A . 
F 6 HOH 53  753 53  HOH HOH A . 
F 6 HOH 54  754 54  HOH HOH A . 
F 6 HOH 55  755 55  HOH HOH A . 
F 6 HOH 56  756 56  HOH HOH A . 
F 6 HOH 57  757 57  HOH HOH A . 
F 6 HOH 58  758 58  HOH HOH A . 
F 6 HOH 59  759 59  HOH HOH A . 
F 6 HOH 60  760 60  HOH HOH A . 
F 6 HOH 61  761 61  HOH HOH A . 
F 6 HOH 62  762 62  HOH HOH A . 
F 6 HOH 63  763 63  HOH HOH A . 
F 6 HOH 64  764 64  HOH HOH A . 
F 6 HOH 65  765 65  HOH HOH A . 
F 6 HOH 66  766 66  HOH HOH A . 
F 6 HOH 67  767 67  HOH HOH A . 
F 6 HOH 68  768 68  HOH HOH A . 
F 6 HOH 69  769 69  HOH HOH A . 
F 6 HOH 70  770 70  HOH HOH A . 
F 6 HOH 71  771 71  HOH HOH A . 
F 6 HOH 72  772 72  HOH HOH A . 
F 6 HOH 73  773 73  HOH HOH A . 
F 6 HOH 74  774 74  HOH HOH A . 
F 6 HOH 75  775 75  HOH HOH A . 
F 6 HOH 76  776 76  HOH HOH A . 
F 6 HOH 77  777 77  HOH HOH A . 
F 6 HOH 78  778 78  HOH HOH A . 
F 6 HOH 79  779 79  HOH HOH A . 
F 6 HOH 80  780 80  HOH HOH A . 
F 6 HOH 81  781 81  HOH HOH A . 
F 6 HOH 82  782 82  HOH HOH A . 
F 6 HOH 83  783 83  HOH HOH A . 
F 6 HOH 84  784 84  HOH HOH A . 
F 6 HOH 85  785 85  HOH HOH A . 
F 6 HOH 86  786 86  HOH HOH A . 
F 6 HOH 87  787 87  HOH HOH A . 
F 6 HOH 88  788 88  HOH HOH A . 
F 6 HOH 89  789 89  HOH HOH A . 
F 6 HOH 90  790 90  HOH HOH A . 
F 6 HOH 91  791 91  HOH HOH A . 
F 6 HOH 92  792 92  HOH HOH A . 
F 6 HOH 93  793 93  HOH HOH A . 
F 6 HOH 94  794 94  HOH HOH A . 
F 6 HOH 95  795 95  HOH HOH A . 
F 6 HOH 96  796 96  HOH HOH A . 
F 6 HOH 97  797 97  HOH HOH A . 
F 6 HOH 98  798 98  HOH HOH A . 
F 6 HOH 99  799 99  HOH HOH A . 
F 6 HOH 100 800 100 HOH HOH A . 
F 6 HOH 101 801 101 HOH HOH A . 
F 6 HOH 102 802 102 HOH HOH A . 
F 6 HOH 103 803 103 HOH HOH A . 
F 6 HOH 104 804 104 HOH HOH A . 
F 6 HOH 105 805 105 HOH HOH A . 
F 6 HOH 106 806 106 HOH HOH A . 
F 6 HOH 107 807 107 HOH HOH A . 
F 6 HOH 108 808 108 HOH HOH A . 
F 6 HOH 109 809 109 HOH HOH A . 
F 6 HOH 110 810 110 HOH HOH A . 
F 6 HOH 111 811 111 HOH HOH A . 
F 6 HOH 112 812 112 HOH HOH A . 
F 6 HOH 113 813 113 HOH HOH A . 
F 6 HOH 114 814 114 HOH HOH A . 
F 6 HOH 115 815 115 HOH HOH A . 
F 6 HOH 116 816 116 HOH HOH A . 
F 6 HOH 117 817 117 HOH HOH A . 
F 6 HOH 118 818 118 HOH HOH A . 
F 6 HOH 119 819 119 HOH HOH A . 
F 6 HOH 120 820 120 HOH HOH A . 
F 6 HOH 121 821 121 HOH HOH A . 
F 6 HOH 122 822 122 HOH HOH A . 
F 6 HOH 123 823 123 HOH HOH A . 
F 6 HOH 124 824 124 HOH HOH A . 
F 6 HOH 125 825 125 HOH HOH A . 
F 6 HOH 126 826 126 HOH HOH A . 
F 6 HOH 127 827 127 HOH HOH A . 
F 6 HOH 128 828 128 HOH HOH A . 
F 6 HOH 129 829 129 HOH HOH A . 
F 6 HOH 130 830 130 HOH HOH A . 
F 6 HOH 131 831 131 HOH HOH A . 
F 6 HOH 132 832 132 HOH HOH A . 
F 6 HOH 133 833 133 HOH HOH A . 
F 6 HOH 134 834 134 HOH HOH A . 
F 6 HOH 135 835 135 HOH HOH A . 
F 6 HOH 136 836 136 HOH HOH A . 
F 6 HOH 137 837 137 HOH HOH A . 
F 6 HOH 138 838 138 HOH HOH A . 
F 6 HOH 139 839 139 HOH HOH A . 
F 6 HOH 140 840 140 HOH HOH A . 
F 6 HOH 141 841 141 HOH HOH A . 
F 6 HOH 142 842 142 HOH HOH A . 
F 6 HOH 143 843 143 HOH HOH A . 
F 6 HOH 144 844 144 HOH HOH A . 
F 6 HOH 145 845 145 HOH HOH A . 
F 6 HOH 146 846 146 HOH HOH A . 
F 6 HOH 147 847 147 HOH HOH A . 
F 6 HOH 148 848 148 HOH HOH A . 
F 6 HOH 149 849 149 HOH HOH A . 
F 6 HOH 150 850 150 HOH HOH A . 
F 6 HOH 151 851 151 HOH HOH A . 
F 6 HOH 152 852 152 HOH HOH A . 
F 6 HOH 153 853 153 HOH HOH A . 
F 6 HOH 154 854 154 HOH HOH A . 
F 6 HOH 155 855 155 HOH HOH A . 
F 6 HOH 156 856 156 HOH HOH A . 
F 6 HOH 157 857 157 HOH HOH A . 
F 6 HOH 158 858 158 HOH HOH A . 
F 6 HOH 159 859 159 HOH HOH A . 
F 6 HOH 160 860 160 HOH HOH A . 
F 6 HOH 161 861 161 HOH HOH A . 
F 6 HOH 162 862 162 HOH HOH A . 
F 6 HOH 163 863 163 HOH HOH A . 
F 6 HOH 164 864 164 HOH HOH A . 
F 6 HOH 165 865 165 HOH HOH A . 
F 6 HOH 166 866 166 HOH HOH A . 
F 6 HOH 167 867 167 HOH HOH A . 
F 6 HOH 168 868 168 HOH HOH A . 
F 6 HOH 169 869 169 HOH HOH A . 
F 6 HOH 170 870 170 HOH HOH A . 
F 6 HOH 171 871 171 HOH HOH A . 
F 6 HOH 172 872 172 HOH HOH A . 
F 6 HOH 173 873 173 HOH HOH A . 
F 6 HOH 174 874 174 HOH HOH A . 
F 6 HOH 175 875 175 HOH HOH A . 
F 6 HOH 176 876 176 HOH HOH A . 
F 6 HOH 177 877 177 HOH HOH A . 
F 6 HOH 178 878 178 HOH HOH A . 
F 6 HOH 179 879 179 HOH HOH A . 
F 6 HOH 180 880 180 HOH HOH A . 
F 6 HOH 181 881 181 HOH HOH A . 
F 6 HOH 182 882 182 HOH HOH A . 
F 6 HOH 183 883 183 HOH HOH A . 
F 6 HOH 184 884 184 HOH HOH A . 
F 6 HOH 185 885 185 HOH HOH A . 
F 6 HOH 186 886 186 HOH HOH A . 
F 6 HOH 187 887 187 HOH HOH A . 
F 6 HOH 188 888 188 HOH HOH A . 
F 6 HOH 189 889 189 HOH HOH A . 
F 6 HOH 190 890 190 HOH HOH A . 
F 6 HOH 191 891 191 HOH HOH A . 
F 6 HOH 192 892 192 HOH HOH A . 
F 6 HOH 193 893 193 HOH HOH A . 
F 6 HOH 194 894 194 HOH HOH A . 
F 6 HOH 195 895 195 HOH HOH A . 
F 6 HOH 196 896 196 HOH HOH A . 
F 6 HOH 197 897 197 HOH HOH A . 
F 6 HOH 198 898 198 HOH HOH A . 
F 6 HOH 199 899 199 HOH HOH A . 
F 6 HOH 200 900 200 HOH HOH A . 
F 6 HOH 201 901 201 HOH HOH A . 
F 6 HOH 202 902 202 HOH HOH A . 
F 6 HOH 203 903 203 HOH HOH A . 
F 6 HOH 204 904 204 HOH HOH A . 
F 6 HOH 205 905 205 HOH HOH A . 
F 6 HOH 206 906 206 HOH HOH A . 
F 6 HOH 207 907 207 HOH HOH A . 
F 6 HOH 208 908 208 HOH HOH A . 
F 6 HOH 209 909 209 HOH HOH A . 
F 6 HOH 210 910 210 HOH HOH A . 
F 6 HOH 211 911 211 HOH HOH A . 
F 6 HOH 212 912 212 HOH HOH A . 
F 6 HOH 213 913 213 HOH HOH A . 
F 6 HOH 214 914 214 HOH HOH A . 
F 6 HOH 215 915 215 HOH HOH A . 
F 6 HOH 216 916 216 HOH HOH A . 
F 6 HOH 217 917 217 HOH HOH A . 
F 6 HOH 218 918 218 HOH HOH A . 
F 6 HOH 219 919 219 HOH HOH A . 
F 6 HOH 220 920 220 HOH HOH A . 
F 6 HOH 221 921 221 HOH HOH A . 
F 6 HOH 222 922 222 HOH HOH A . 
F 6 HOH 223 923 223 HOH HOH A . 
F 6 HOH 224 924 224 HOH HOH A . 
F 6 HOH 225 925 225 HOH HOH A . 
F 6 HOH 226 926 226 HOH HOH A . 
F 6 HOH 227 927 227 HOH HOH A . 
F 6 HOH 228 928 228 HOH HOH A . 
F 6 HOH 229 929 229 HOH HOH A . 
F 6 HOH 230 930 230 HOH HOH A . 
F 6 HOH 231 931 231 HOH HOH A . 
F 6 HOH 232 932 232 HOH HOH A . 
F 6 HOH 233 933 233 HOH HOH A . 
F 6 HOH 234 934 234 HOH HOH A . 
F 6 HOH 235 935 235 HOH HOH A . 
F 6 HOH 236 936 236 HOH HOH A . 
F 6 HOH 237 937 237 HOH HOH A . 
F 6 HOH 238 938 238 HOH HOH A . 
F 6 HOH 239 939 239 HOH HOH A . 
F 6 HOH 240 940 240 HOH HOH A . 
F 6 HOH 241 941 241 HOH HOH A . 
F 6 HOH 242 942 242 HOH HOH A . 
F 6 HOH 243 943 243 HOH HOH A . 
F 6 HOH 244 944 244 HOH HOH A . 
F 6 HOH 245 945 245 HOH HOH A . 
F 6 HOH 246 946 246 HOH HOH A . 
F 6 HOH 247 947 247 HOH HOH A . 
F 6 HOH 248 948 248 HOH HOH A . 
F 6 HOH 249 949 249 HOH HOH A . 
F 6 HOH 250 950 250 HOH HOH A . 
F 6 HOH 251 951 251 HOH HOH A . 
F 6 HOH 252 952 252 HOH HOH A . 
F 6 HOH 253 953 253 HOH HOH A . 
F 6 HOH 254 954 254 HOH HOH A . 
F 6 HOH 255 955 255 HOH HOH A . 
F 6 HOH 256 956 256 HOH HOH A . 
F 6 HOH 257 957 257 HOH HOH A . 
F 6 HOH 258 958 258 HOH HOH A . 
F 6 HOH 259 959 259 HOH HOH A . 
F 6 HOH 260 960 260 HOH HOH A . 
F 6 HOH 261 961 261 HOH HOH A . 
F 6 HOH 262 962 262 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2B ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O2A ? D APC .   ? A APC 603 ? 1_555 98.1  ? 
2  O2B ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O2G ? D APC .   ? A APC 603 ? 1_555 85.9  ? 
3  O2A ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O2G ? D APC .   ? A APC 603 ? 1_555 101.3 ? 
4  O2B ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 167.0 ? 
5  O2A ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 89.7  ? 
6  O2G ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 82.3  ? 
7  O2B ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? F HOH .   ? A HOH 840 ? 1_555 94.1  ? 
8  O2A ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? F HOH .   ? A HOH 840 ? 1_555 167.1 ? 
9  O2G ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? F HOH .   ? A HOH 840 ? 1_555 75.3  ? 
10 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O   ? F HOH .   ? A HOH 840 ? 1_555 77.6  ? 
11 O2B ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 104.3 ? 
12 O2A ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 69.6  ? 
13 O2G ? D APC .   ? A APC 603 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 167.0 ? 
14 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 88.2  ? 
15 O   ? F HOH .   ? A HOH 840 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 111.4 ? 
16 OD2 ? A ASP 233 ? A ASP 343 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 85.2  ? 
17 OD2 ? A ASP 233 ? A ASP 343 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 78.2  ? 
18 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 79.2  ? 
19 OD2 ? A ASP 233 ? A ASP 343 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 O2A ? D APC .   ? A APC 603 ? 1_555 80.7  ? 
20 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 O2A ? D APC .   ? A APC 603 ? 1_555 164.8 ? 
21 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 O2A ? D APC .   ? A APC 603 ? 1_555 103.3 ? 
22 OD2 ? A ASP 233 ? A ASP 343 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 102.5 ? 
23 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 125.1 ? 
24 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 50.9  ? 
25 O2A ? D APC .   ? A APC 603 ? 1_555 ZN ? E ZN . ? A ZN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 64.2  ? 
26 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? A VAL 148 ? A VAL 258 ? 1_555 102.4 ? 
27 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? F HOH .   ? A HOH 929 ? 1_555 157.8 ? 
28 O   ? A VAL 148 ? A VAL 258 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? F HOH .   ? A HOH 929 ? 1_555 98.7  ? 
29 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 83.1  ? 
30 O   ? A VAL 148 ? A VAL 258 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 93.5  ? 
31 O   ? F HOH .   ? A HOH 929 ? 1_555 NA ? C NA . ? A NA 602 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 89.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-07-24 
2 'Structure model' 1 1 2013-07-31 
3 'Structure model' 1 2 2013-11-13 
4 'Structure model' 1 3 2017-07-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum ? 1 
PHASER phasing           .       ? 2 
BUSTER refinement        2.11.2  ? 3 
XDS    'data reduction'  .       ? 4 
SCALA  'data scaling'    .       ? 5 
# 
_pdbx_entry_details.entry_id             4I2D 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'PROTEIN FRAGMENT IS THE CATALYTIC CORE OF THE TDT-S (TDT-SMALL) ISOFORM (UNP RESIDUES 132-482, 503-530).' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 331 ? ? -112.46 -153.27 
2 1 ASN A 509 ? ? -82.37  46.40   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 149 ? CG  ? A LYS 39  CG  
2  1 Y 1 A LYS 149 ? CD  ? A LYS 39  CD  
3  1 Y 1 A LYS 149 ? CE  ? A LYS 39  CE  
4  1 Y 1 A LYS 149 ? NZ  ? A LYS 39  NZ  
5  1 Y 1 A LEU 181 ? CG  ? A LEU 71  CG  
6  1 Y 1 A LEU 181 ? CD1 ? A LEU 71  CD1 
7  1 Y 1 A LEU 181 ? CD2 ? A LEU 71  CD2 
8  1 Y 1 A ARG 182 ? NE  ? A ARG 72  NE  
9  1 Y 1 A ARG 182 ? CZ  ? A ARG 72  CZ  
10 1 Y 1 A ARG 182 ? NH1 ? A ARG 72  NH1 
11 1 Y 1 A ARG 182 ? NH2 ? A ARG 72  NH2 
12 1 Y 1 A GLU 185 ? CG  ? A GLU 75  CG  
13 1 Y 1 A GLU 185 ? CD  ? A GLU 75  CD  
14 1 Y 1 A GLU 185 ? OE1 ? A GLU 75  OE1 
15 1 Y 1 A GLU 185 ? OE2 ? A GLU 75  OE2 
16 1 Y 1 A LYS 209 ? CG  ? A LYS 99  CG  
17 1 Y 1 A LYS 209 ? CD  ? A LYS 99  CD  
18 1 Y 1 A LYS 209 ? CE  ? A LYS 99  CE  
19 1 Y 1 A LYS 209 ? NZ  ? A LYS 99  NZ  
20 1 Y 1 A LYS 220 ? CE  ? A LYS 110 CE  
21 1 Y 1 A LYS 220 ? NZ  ? A LYS 110 NZ  
22 1 Y 1 A LYS 238 ? CD  ? A LYS 128 CD  
23 1 Y 1 A LYS 238 ? CE  ? A LYS 128 CE  
24 1 Y 1 A LYS 238 ? NZ  ? A LYS 128 NZ  
25 1 Y 1 A LYS 261 ? CD  ? A LYS 151 CD  
26 1 Y 1 A LYS 261 ? CE  ? A LYS 151 CE  
27 1 Y 1 A LYS 261 ? NZ  ? A LYS 151 NZ  
28 1 Y 1 A ARG 268 ? CZ  ? A ARG 158 CZ  
29 1 Y 1 A ARG 268 ? NH1 ? A ARG 158 NH1 
30 1 Y 1 A ARG 268 ? NH2 ? A ARG 158 NH2 
31 1 Y 1 A GLU 352 ? CG  ? A GLU 242 CG  
32 1 Y 1 A GLU 352 ? CD  ? A GLU 242 CD  
33 1 Y 1 A GLU 352 ? OE1 ? A GLU 242 OE1 
34 1 Y 1 A GLU 352 ? OE2 ? A GLU 242 OE2 
35 1 Y 1 A GLU 355 ? CG  ? A GLU 245 CG  
36 1 Y 1 A GLU 355 ? CD  ? A GLU 245 CD  
37 1 Y 1 A GLU 355 ? OE1 ? A GLU 245 OE1 
38 1 Y 1 A GLU 355 ? OE2 ? A GLU 245 OE2 
39 1 Y 1 A LYS 370 ? CD  ? A LYS 260 CD  
40 1 Y 1 A LYS 370 ? CE  ? A LYS 260 CE  
41 1 Y 1 A LYS 370 ? NZ  ? A LYS 260 NZ  
42 1 Y 1 A LYS 387 ? CD  ? A LYS 277 CD  
43 1 Y 1 A LYS 387 ? CE  ? A LYS 277 CE  
44 1 Y 1 A LYS 387 ? NZ  ? A LYS 277 NZ  
45 1 Y 1 A LYS 389 ? CD  ? A LYS 279 CD  
46 1 Y 1 A LYS 389 ? CE  ? A LYS 279 CE  
47 1 Y 1 A LYS 389 ? NZ  ? A LYS 279 NZ  
48 1 Y 1 A ARG 393 ? CD  ? A ARG 283 CD  
49 1 Y 1 A ARG 393 ? NE  ? A ARG 283 NE  
50 1 Y 1 A ARG 393 ? CZ  ? A ARG 283 CZ  
51 1 Y 1 A ARG 393 ? NH1 ? A ARG 283 NH1 
52 1 Y 1 A ARG 393 ? NH2 ? A ARG 283 NH2 
53 1 Y 1 A VAL 395 ? CG1 ? A VAL 285 CG1 
54 1 Y 1 A VAL 395 ? CG2 ? A VAL 285 CG2 
55 1 Y 1 A LEU 408 ? CD1 ? A LEU 298 CD1 
56 1 Y 1 A LEU 408 ? CD2 ? A LEU 298 CD2 
57 1 Y 1 A LYS 419 ? CG  ? A LYS 309 CG  
58 1 Y 1 A LYS 419 ? CD  ? A LYS 309 CD  
59 1 Y 1 A LYS 419 ? CE  ? A LYS 309 CE  
60 1 Y 1 A LYS 419 ? NZ  ? A LYS 309 NZ  
61 1 Y 1 A LYS 469 ? CE  ? A LYS 359 CE  
62 1 Y 1 A LYS 469 ? NZ  ? A LYS 359 NZ  
63 1 Y 1 A GLU 487 ? CG  ? A GLU 377 CG  
64 1 Y 1 A GLU 487 ? CD  ? A GLU 377 CD  
65 1 Y 1 A GLU 487 ? OE1 ? A GLU 377 OE1 
66 1 Y 1 A GLU 487 ? OE2 ? A GLU 377 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 111 ? A MET 1   
2  1 Y 1 A GLY 112 ? A GLY 2   
3  1 Y 1 A SER 113 ? A SER 3   
4  1 Y 1 A SER 114 ? A SER 4   
5  1 Y 1 A HIS 115 ? A HIS 5   
6  1 Y 1 A HIS 116 ? A HIS 6   
7  1 Y 1 A HIS 117 ? A HIS 7   
8  1 Y 1 A HIS 118 ? A HIS 8   
9  1 Y 1 A HIS 119 ? A HIS 9   
10 1 Y 1 A HIS 120 ? A HIS 10  
11 1 Y 1 A SER 121 ? A SER 11  
12 1 Y 1 A SER 122 ? A SER 12  
13 1 Y 1 A GLY 123 ? A GLY 13  
14 1 Y 1 A LEU 124 ? A LEU 14  
15 1 Y 1 A VAL 125 ? A VAL 15  
16 1 Y 1 A PRO 126 ? A PRO 16  
17 1 Y 1 A ARG 127 ? A ARG 17  
18 1 Y 1 A GLY 128 ? A GLY 18  
19 1 Y 1 A SER 129 ? A SER 19  
20 1 Y 1 A HIS 130 ? A HIS 20  
21 1 Y 1 A MET 131 ? A MET 21  
22 1 Y 1 A SER 132 ? A SER 22  
23 1 Y 1 A PRO 133 ? A PRO 23  
24 1 Y 1 A SER 134 ? A SER 24  
25 1 Y 1 A PRO 135 ? A PRO 25  
26 1 Y 1 A VAL 136 ? A VAL 26  
27 1 Y 1 A PRO 137 ? A PRO 27  
28 1 Y 1 A GLY 138 ? A GLY 28  
29 1 Y 1 A SER 139 ? A SER 29  
30 1 Y 1 A GLN 140 ? A GLN 30  
31 1 Y 1 A ASN 141 ? A ASN 31  
32 1 Y 1 A VAL 142 ? A VAL 32  
33 1 Y 1 A PRO 143 ? A PRO 33  
34 1 Y 1 A ALA 144 ? A ALA 34  
35 1 Y 1 A PRO 145 ? A PRO 35  
36 1 Y 1 A ALA 146 ? A ALA 36  
37 1 Y 1 A VAL 147 ? A VAL 37  
38 1 Y 1 A LYS 148 ? A LYS 38  
39 1 Y 1 A SER 420 ? A SER 310 
40 1 Y 1 A GLY 421 ? A GLY 311 
41 1 Y 1 A GLN 422 ? A GLN 312 
42 1 Y 1 A GLN 423 ? A GLN 313 
43 1 Y 1 A GLU 424 ? A GLU 314 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                 MG  
3 'SODIUM ION'                                    NA  
4 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' APC 
5 'ZINC ION'                                      ZN  
6 water                                           HOH 
#