data_4IGM
# 
_entry.id   4IGM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IGM         
RCSB  RCSB076726   
WWPDB D_1000076726 
# 
_pdbx_database_status.entry_id                        4IGM 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, F.' 1 
'Liu, A.' 2 
# 
_citation.id                        primary 
_citation.title                     '2.39 Angstrom X-ray Crystal structure of human ACMSD' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, F.' 1 
primary 'Liu, A.' 2 
# 
_cell.length_a           89.112 
_cell.length_b           101.878 
_cell.length_c           233.455 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4IGM 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4IGM 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '2-amino-3-carboxymuconate-6-semialdehyde decarboxylase' 37550.629 6   4.1.1.45 ? ? ? 
2 non-polymer syn 'ZINC ION'                                               65.409    6   ?        ? ? ? 
3 water       nat water                                                    18.015    478 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Picolinate carboxylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMF
SYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPV
YAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLK
AGNALAFLGLER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMF
SYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPV
YAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLK
AGNALAFLGLER
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ILE n 
1 4   ASP n 
1 5   ILE n 
1 6   HIS n 
1 7   SER n 
1 8   HIS n 
1 9   ILE n 
1 10  LEU n 
1 11  PRO n 
1 12  LYS n 
1 13  GLU n 
1 14  TRP n 
1 15  PRO n 
1 16  ASP n 
1 17  LEU n 
1 18  LYS n 
1 19  LYS n 
1 20  ARG n 
1 21  PHE n 
1 22  GLY n 
1 23  TYR n 
1 24  GLY n 
1 25  GLY n 
1 26  TRP n 
1 27  VAL n 
1 28  GLN n 
1 29  LEU n 
1 30  GLN n 
1 31  HIS n 
1 32  HIS n 
1 33  SER n 
1 34  LYS n 
1 35  GLY n 
1 36  GLU n 
1 37  ALA n 
1 38  LYS n 
1 39  LEU n 
1 40  LEU n 
1 41  LYS n 
1 42  ASP n 
1 43  GLY n 
1 44  LYS n 
1 45  VAL n 
1 46  PHE n 
1 47  ARG n 
1 48  VAL n 
1 49  VAL n 
1 50  ARG n 
1 51  GLU n 
1 52  ASN n 
1 53  CYS n 
1 54  TRP n 
1 55  ASP n 
1 56  PRO n 
1 57  GLU n 
1 58  VAL n 
1 59  ARG n 
1 60  ILE n 
1 61  ARG n 
1 62  GLU n 
1 63  MET n 
1 64  ASP n 
1 65  GLN n 
1 66  LYS n 
1 67  GLY n 
1 68  VAL n 
1 69  THR n 
1 70  VAL n 
1 71  GLN n 
1 72  ALA n 
1 73  LEU n 
1 74  SER n 
1 75  THR n 
1 76  VAL n 
1 77  PRO n 
1 78  VAL n 
1 79  MET n 
1 80  PHE n 
1 81  SER n 
1 82  TYR n 
1 83  TRP n 
1 84  ALA n 
1 85  LYS n 
1 86  PRO n 
1 87  GLU n 
1 88  ASP n 
1 89  THR n 
1 90  LEU n 
1 91  ASN n 
1 92  LEU n 
1 93  CYS n 
1 94  GLN n 
1 95  LEU n 
1 96  LEU n 
1 97  ASN n 
1 98  ASN n 
1 99  ASP n 
1 100 LEU n 
1 101 ALA n 
1 102 SER n 
1 103 THR n 
1 104 VAL n 
1 105 VAL n 
1 106 SER n 
1 107 TYR n 
1 108 PRO n 
1 109 ARG n 
1 110 ARG n 
1 111 PHE n 
1 112 VAL n 
1 113 GLY n 
1 114 LEU n 
1 115 GLY n 
1 116 THR n 
1 117 LEU n 
1 118 PRO n 
1 119 MET n 
1 120 GLN n 
1 121 ALA n 
1 122 PRO n 
1 123 GLU n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 LYS n 
1 128 GLU n 
1 129 MET n 
1 130 GLU n 
1 131 ARG n 
1 132 CYS n 
1 133 VAL n 
1 134 LYS n 
1 135 GLU n 
1 136 LEU n 
1 137 GLY n 
1 138 PHE n 
1 139 PRO n 
1 140 GLY n 
1 141 VAL n 
1 142 GLN n 
1 143 ILE n 
1 144 GLY n 
1 145 THR n 
1 146 HIS n 
1 147 VAL n 
1 148 ASN n 
1 149 GLU n 
1 150 TRP n 
1 151 ASP n 
1 152 LEU n 
1 153 ASN n 
1 154 ALA n 
1 155 GLN n 
1 156 GLU n 
1 157 LEU n 
1 158 PHE n 
1 159 PRO n 
1 160 VAL n 
1 161 TYR n 
1 162 ALA n 
1 163 ALA n 
1 164 ALA n 
1 165 GLU n 
1 166 ARG n 
1 167 LEU n 
1 168 LYS n 
1 169 CYS n 
1 170 SER n 
1 171 LEU n 
1 172 PHE n 
1 173 VAL n 
1 174 HIS n 
1 175 PRO n 
1 176 TRP n 
1 177 ASP n 
1 178 MET n 
1 179 GLN n 
1 180 MET n 
1 181 ASP n 
1 182 GLY n 
1 183 ARG n 
1 184 MET n 
1 185 ALA n 
1 186 LYS n 
1 187 TYR n 
1 188 TRP n 
1 189 LEU n 
1 190 PRO n 
1 191 TRP n 
1 192 LEU n 
1 193 VAL n 
1 194 GLY n 
1 195 MET n 
1 196 PRO n 
1 197 ALA n 
1 198 GLU n 
1 199 THR n 
1 200 THR n 
1 201 ILE n 
1 202 ALA n 
1 203 ILE n 
1 204 CYS n 
1 205 SER n 
1 206 MET n 
1 207 ILE n 
1 208 MET n 
1 209 GLY n 
1 210 GLY n 
1 211 VAL n 
1 212 PHE n 
1 213 GLU n 
1 214 LYS n 
1 215 PHE n 
1 216 PRO n 
1 217 LYS n 
1 218 LEU n 
1 219 LYS n 
1 220 VAL n 
1 221 CYS n 
1 222 PHE n 
1 223 ALA n 
1 224 HIS n 
1 225 GLY n 
1 226 GLY n 
1 227 GLY n 
1 228 ALA n 
1 229 PHE n 
1 230 PRO n 
1 231 PHE n 
1 232 THR n 
1 233 VAL n 
1 234 GLY n 
1 235 ARG n 
1 236 ILE n 
1 237 SER n 
1 238 HIS n 
1 239 GLY n 
1 240 PHE n 
1 241 SER n 
1 242 MET n 
1 243 ARG n 
1 244 PRO n 
1 245 ASP n 
1 246 LEU n 
1 247 CYS n 
1 248 ALA n 
1 249 GLN n 
1 250 ASP n 
1 251 ASN n 
1 252 PRO n 
1 253 MET n 
1 254 ASN n 
1 255 PRO n 
1 256 LYS n 
1 257 LYS n 
1 258 TYR n 
1 259 LEU n 
1 260 GLY n 
1 261 SER n 
1 262 PHE n 
1 263 TYR n 
1 264 THR n 
1 265 ASP n 
1 266 ALA n 
1 267 LEU n 
1 268 VAL n 
1 269 HIS n 
1 270 ASP n 
1 271 PRO n 
1 272 LEU n 
1 273 SER n 
1 274 LEU n 
1 275 LYS n 
1 276 LEU n 
1 277 LEU n 
1 278 THR n 
1 279 ASP n 
1 280 VAL n 
1 281 ILE n 
1 282 GLY n 
1 283 LYS n 
1 284 ASP n 
1 285 LYS n 
1 286 VAL n 
1 287 ILE n 
1 288 LEU n 
1 289 GLY n 
1 290 THR n 
1 291 ASP n 
1 292 TYR n 
1 293 PRO n 
1 294 PHE n 
1 295 PRO n 
1 296 LEU n 
1 297 GLY n 
1 298 GLU n 
1 299 LEU n 
1 300 GLU n 
1 301 PRO n 
1 302 GLY n 
1 303 LYS n 
1 304 LEU n 
1 305 ILE n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 GLU n 
1 310 GLU n 
1 311 PHE n 
1 312 ASP n 
1 313 GLU n 
1 314 GLU n 
1 315 THR n 
1 316 LYS n 
1 317 ASN n 
1 318 LYS n 
1 319 LEU n 
1 320 LYS n 
1 321 ALA n 
1 322 GLY n 
1 323 ASN n 
1 324 ALA n 
1 325 LEU n 
1 326 ALA n 
1 327 PHE n 
1 328 LEU n 
1 329 GLY n 
1 330 LEU n 
1 331 GLU n 
1 332 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ACMSD, human' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACMSD_HUMAN 
_struct_ref.pdbx_db_accession          Q8TDX5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMF
SYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPV
YAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLK
AGNALAFLGLER
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IGM A 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
2 1 4IGM B 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
3 1 4IGM C 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
4 1 4IGM D 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
5 1 4IGM E 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
6 1 4IGM F 1 ? 332 ? Q8TDX5 1 ? 332 ? 1 332 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          4IGM 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.70 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M Bis-Tris 7.0, 20% PEG 3350, 0.2 M lithium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-12-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     4IGM 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.391 
_reflns.d_resolution_low             45.00 
_reflns.number_all                   84793 
_reflns.number_obs                   80491 
_reflns.percent_possible_obs         94.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.391 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   87.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4IGM 
_refine.ls_d_res_high                            2.3910 
_refine.ls_d_res_low                             45 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    94.8400 
_refine.ls_number_reflns_obs                     80491 
_refine.ls_number_reflns_all                     84870 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          0.2122 
_refine.ls_R_factor_obs                          0.2122 
_refine.ls_R_factor_R_work                       0.2081 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2895 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  4033 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               28.0871 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.4800 
_refine.aniso_B[2][2]                            0.1800 
_refine.aniso_B[3][3]                            -0.6600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9290 
_refine.correlation_coeff_Fo_to_Fc_free          0.8690 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.6190 
_refine.pdbx_overall_ESU_R_Free                  0.3310 
_refine.overall_SU_ML                            0.2230 
_refine.overall_SU_B                             9.4020 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                108.960 
_refine.B_iso_min                                8.790 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15810 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             478 
_refine_hist.number_atoms_total               16294 
_refine_hist.d_res_high                       2.3910 
_refine_hist.d_res_low                        45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       16236 0.014  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    21972 1.805  1.969  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 1986  6.636  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 696   37.463 24.138 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 2862  19.537 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 78    22.388 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         2352  0.116  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   12228 0.009  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.3910 
_refine_ls_shell.d_res_low                        2.4530 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               89.1900 
_refine_ls_shell.number_reflns_R_work             5038 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2430 
_refine_ls_shell.R_factor_R_free                  0.3430 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             225 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                5263 
_refine_ls_shell.number_reflns_obs                7127 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IGM 
_struct.title                     '2.39 Angstrom X-ray Crystal structure of human ACMSD' 
_struct.pdbx_descriptor           '2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (E.C.4.1.1.45)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IGM 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'TIM barrel, neurological disorder, zinc-dependent decarboxylase, kynurenine pathway, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 16  ? GLY A 22  ? ASP A 16  GLY A 22  1 ? 7  
HELX_P HELX_P2   2   ASN A 52  ? TRP A 54  ? ASN A 52  TRP A 54  5 ? 3  
HELX_P HELX_P3   3   ASP A 55  ? GLY A 67  ? ASP A 55  GLY A 67  1 ? 13 
HELX_P HELX_P4   4   VAL A 76  ? PHE A 80  ? VAL A 76  PHE A 80  5 ? 5  
HELX_P HELX_P5   5   LYS A 85  ? SER A 106 ? LYS A 85  SER A 106 1 ? 22 
HELX_P HELX_P6   6   ALA A 121 ? GLU A 135 ? ALA A 121 GLU A 135 1 ? 15 
HELX_P HELX_P7   7   LEU A 157 ? LEU A 167 ? LEU A 157 LEU A 167 1 ? 11 
HELX_P HELX_P8   8   ASP A 181 ? ALA A 185 ? ASP A 181 ALA A 185 5 ? 5  
HELX_P HELX_P9   9   TRP A 188 ? VAL A 193 ? TRP A 188 VAL A 193 1 ? 6  
HELX_P HELX_P10  10  VAL A 193 ? GLY A 209 ? VAL A 193 GLY A 209 1 ? 17 
HELX_P HELX_P11  11  GLY A 210 ? PHE A 215 ? GLY A 210 PHE A 215 1 ? 6  
HELX_P HELX_P12  12  HIS A 224 ? GLY A 227 ? HIS A 224 GLY A 227 5 ? 4  
HELX_P HELX_P13  13  ALA A 228 ? ARG A 243 ? ALA A 228 ARG A 243 1 ? 16 
HELX_P HELX_P14  14  ARG A 243 ? ALA A 248 ? ARG A 243 ALA A 248 1 ? 6  
HELX_P HELX_P15  15  ASN A 254 ? LEU A 259 ? ASN A 254 LEU A 259 5 ? 6  
HELX_P HELX_P16  16  ASP A 270 ? ILE A 281 ? ASP A 270 ILE A 281 1 ? 12 
HELX_P HELX_P17  17  GLY A 302 ? SER A 307 ? GLY A 302 SER A 307 1 ? 6  
HELX_P HELX_P18  18  ASP A 312 ? ALA A 321 ? ASP A 312 ALA A 321 1 ? 10 
HELX_P HELX_P19  19  ALA A 321 ? GLY A 329 ? ALA A 321 GLY A 329 1 ? 9  
HELX_P HELX_P20  20  ASP B 16  ? GLY B 22  ? ASP B 16  GLY B 22  1 ? 7  
HELX_P HELX_P21  21  ASN B 52  ? TRP B 54  ? ASN B 52  TRP B 54  5 ? 3  
HELX_P HELX_P22  22  ASP B 55  ? GLY B 67  ? ASP B 55  GLY B 67  1 ? 13 
HELX_P HELX_P23  23  PRO B 77  ? SER B 81  ? PRO B 77  SER B 81  5 ? 5  
HELX_P HELX_P24  24  LYS B 85  ? TYR B 107 ? LYS B 85  TYR B 107 1 ? 23 
HELX_P HELX_P25  25  ALA B 121 ? GLU B 135 ? ALA B 121 GLU B 135 1 ? 15 
HELX_P HELX_P26  26  ALA B 154 ? GLU B 156 ? ALA B 154 GLU B 156 5 ? 3  
HELX_P HELX_P27  27  LEU B 157 ? LYS B 168 ? LEU B 157 LYS B 168 1 ? 12 
HELX_P HELX_P28  28  ASP B 181 ? LYS B 186 ? ASP B 181 LYS B 186 5 ? 6  
HELX_P HELX_P29  29  TRP B 188 ? VAL B 193 ? TRP B 188 VAL B 193 1 ? 6  
HELX_P HELX_P30  30  VAL B 193 ? GLY B 209 ? VAL B 193 GLY B 209 1 ? 17 
HELX_P HELX_P31  31  GLY B 210 ? PHE B 215 ? GLY B 210 PHE B 215 1 ? 6  
HELX_P HELX_P32  32  HIS B 224 ? GLY B 227 ? HIS B 224 GLY B 227 5 ? 4  
HELX_P HELX_P33  33  ALA B 228 ? ARG B 243 ? ALA B 228 ARG B 243 1 ? 16 
HELX_P HELX_P34  34  ARG B 243 ? ALA B 248 ? ARG B 243 ALA B 248 1 ? 6  
HELX_P HELX_P35  35  ASN B 254 ? LEU B 259 ? ASN B 254 LEU B 259 5 ? 6  
HELX_P HELX_P36  36  ASP B 270 ? GLY B 282 ? ASP B 270 GLY B 282 1 ? 13 
HELX_P HELX_P37  37  GLY B 302 ? SER B 307 ? GLY B 302 SER B 307 1 ? 6  
HELX_P HELX_P38  38  ASP B 312 ? ALA B 321 ? ASP B 312 ALA B 321 1 ? 10 
HELX_P HELX_P39  39  ALA B 321 ? GLY B 329 ? ALA B 321 GLY B 329 1 ? 9  
HELX_P HELX_P40  40  ASP C 16  ? GLY C 22  ? ASP C 16  GLY C 22  1 ? 7  
HELX_P HELX_P41  41  ASN C 52  ? TRP C 54  ? ASN C 52  TRP C 54  5 ? 3  
HELX_P HELX_P42  42  ASP C 55  ? GLY C 67  ? ASP C 55  GLY C 67  1 ? 13 
HELX_P HELX_P43  43  VAL C 76  ? PHE C 80  ? VAL C 76  PHE C 80  5 ? 5  
HELX_P HELX_P44  44  LYS C 85  ? TYR C 107 ? LYS C 85  TYR C 107 1 ? 23 
HELX_P HELX_P45  45  ALA C 121 ? GLU C 135 ? ALA C 121 GLU C 135 1 ? 15 
HELX_P HELX_P46  46  ALA C 154 ? GLU C 156 ? ALA C 154 GLU C 156 5 ? 3  
HELX_P HELX_P47  47  LEU C 157 ? LEU C 167 ? LEU C 157 LEU C 167 1 ? 11 
HELX_P HELX_P48  48  ASP C 181 ? LYS C 186 ? ASP C 181 LYS C 186 5 ? 6  
HELX_P HELX_P49  49  TRP C 188 ? VAL C 193 ? TRP C 188 VAL C 193 1 ? 6  
HELX_P HELX_P50  50  VAL C 193 ? GLY C 209 ? VAL C 193 GLY C 209 1 ? 17 
HELX_P HELX_P51  51  GLY C 210 ? PHE C 215 ? GLY C 210 PHE C 215 1 ? 6  
HELX_P HELX_P52  52  HIS C 224 ? GLY C 227 ? HIS C 224 GLY C 227 5 ? 4  
HELX_P HELX_P53  53  ALA C 228 ? ARG C 243 ? ALA C 228 ARG C 243 1 ? 16 
HELX_P HELX_P54  54  ARG C 243 ? ALA C 248 ? ARG C 243 ALA C 248 1 ? 6  
HELX_P HELX_P55  55  ASN C 254 ? LEU C 259 ? ASN C 254 LEU C 259 5 ? 6  
HELX_P HELX_P56  56  ASP C 270 ? GLY C 282 ? ASP C 270 GLY C 282 1 ? 13 
HELX_P HELX_P57  57  GLY C 302 ? MET C 308 ? GLY C 302 MET C 308 1 ? 7  
HELX_P HELX_P58  58  ASP C 312 ? ALA C 321 ? ASP C 312 ALA C 321 1 ? 10 
HELX_P HELX_P59  59  ALA C 321 ? GLY C 329 ? ALA C 321 GLY C 329 1 ? 9  
HELX_P HELX_P60  60  ASP D 16  ? GLY D 22  ? ASP D 16  GLY D 22  1 ? 7  
HELX_P HELX_P61  61  ASN D 52  ? TRP D 54  ? ASN D 52  TRP D 54  5 ? 3  
HELX_P HELX_P62  62  ASP D 55  ? GLY D 67  ? ASP D 55  GLY D 67  1 ? 13 
HELX_P HELX_P63  63  VAL D 76  ? PHE D 80  ? VAL D 76  PHE D 80  5 ? 5  
HELX_P HELX_P64  64  LYS D 85  ? TYR D 107 ? LYS D 85  TYR D 107 1 ? 23 
HELX_P HELX_P65  65  ALA D 121 ? GLU D 135 ? ALA D 121 GLU D 135 1 ? 15 
HELX_P HELX_P66  66  ALA D 154 ? GLU D 156 ? ALA D 154 GLU D 156 5 ? 3  
HELX_P HELX_P67  67  LEU D 157 ? LYS D 168 ? LEU D 157 LYS D 168 1 ? 12 
HELX_P HELX_P68  68  ASP D 181 ? LYS D 186 ? ASP D 181 LYS D 186 5 ? 6  
HELX_P HELX_P69  69  TRP D 188 ? VAL D 193 ? TRP D 188 VAL D 193 1 ? 6  
HELX_P HELX_P70  70  VAL D 193 ? GLY D 209 ? VAL D 193 GLY D 209 1 ? 17 
HELX_P HELX_P71  71  GLY D 210 ? PHE D 215 ? GLY D 210 PHE D 215 1 ? 6  
HELX_P HELX_P72  72  HIS D 224 ? GLY D 227 ? HIS D 224 GLY D 227 5 ? 4  
HELX_P HELX_P73  73  ALA D 228 ? ARG D 243 ? ALA D 228 ARG D 243 1 ? 16 
HELX_P HELX_P74  74  ARG D 243 ? ALA D 248 ? ARG D 243 ALA D 248 1 ? 6  
HELX_P HELX_P75  75  ASN D 254 ? LEU D 259 ? ASN D 254 LEU D 259 5 ? 6  
HELX_P HELX_P76  76  ASP D 270 ? GLY D 282 ? ASP D 270 GLY D 282 1 ? 13 
HELX_P HELX_P77  77  GLY D 302 ? SER D 307 ? GLY D 302 SER D 307 1 ? 6  
HELX_P HELX_P78  78  ASP D 312 ? ALA D 321 ? ASP D 312 ALA D 321 1 ? 10 
HELX_P HELX_P79  79  ALA D 321 ? GLY D 329 ? ALA D 321 GLY D 329 1 ? 9  
HELX_P HELX_P80  80  ASP E 16  ? GLY E 22  ? ASP E 16  GLY E 22  1 ? 7  
HELX_P HELX_P81  81  ASN E 52  ? TRP E 54  ? ASN E 52  TRP E 54  5 ? 3  
HELX_P HELX_P82  82  ASP E 55  ? LYS E 66  ? ASP E 55  LYS E 66  1 ? 12 
HELX_P HELX_P83  83  VAL E 76  ? PHE E 80  ? VAL E 76  PHE E 80  5 ? 5  
HELX_P HELX_P84  84  LYS E 85  ? TYR E 107 ? LYS E 85  TYR E 107 1 ? 23 
HELX_P HELX_P85  85  ALA E 121 ? GLU E 135 ? ALA E 121 GLU E 135 1 ? 15 
HELX_P HELX_P86  86  ALA E 154 ? GLU E 156 ? ALA E 154 GLU E 156 5 ? 3  
HELX_P HELX_P87  87  LEU E 157 ? LEU E 167 ? LEU E 157 LEU E 167 1 ? 11 
HELX_P HELX_P88  88  ASP E 181 ? LYS E 186 ? ASP E 181 LYS E 186 5 ? 6  
HELX_P HELX_P89  89  TRP E 188 ? VAL E 193 ? TRP E 188 VAL E 193 1 ? 6  
HELX_P HELX_P90  90  VAL E 193 ? GLY E 209 ? VAL E 193 GLY E 209 1 ? 17 
HELX_P HELX_P91  91  HIS E 224 ? GLY E 227 ? HIS E 224 GLY E 227 5 ? 4  
HELX_P HELX_P92  92  ALA E 228 ? ARG E 243 ? ALA E 228 ARG E 243 1 ? 16 
HELX_P HELX_P93  93  ARG E 243 ? ALA E 248 ? ARG E 243 ALA E 248 1 ? 6  
HELX_P HELX_P94  94  ASN E 254 ? TYR E 258 ? ASN E 254 TYR E 258 5 ? 5  
HELX_P HELX_P95  95  ASP E 270 ? GLY E 282 ? ASP E 270 GLY E 282 1 ? 13 
HELX_P HELX_P96  96  GLY E 302 ? MET E 308 ? GLY E 302 MET E 308 1 ? 7  
HELX_P HELX_P97  97  ASP E 312 ? ALA E 321 ? ASP E 312 ALA E 321 1 ? 10 
HELX_P HELX_P98  98  ALA E 321 ? GLY E 329 ? ALA E 321 GLY E 329 1 ? 9  
HELX_P HELX_P99  99  ASP F 16  ? PHE F 21  ? ASP F 16  PHE F 21  1 ? 6  
HELX_P HELX_P100 100 ASN F 52  ? TRP F 54  ? ASN F 52  TRP F 54  5 ? 3  
HELX_P HELX_P101 101 ASP F 55  ? GLY F 67  ? ASP F 55  GLY F 67  1 ? 13 
HELX_P HELX_P102 102 VAL F 76  ? PHE F 80  ? VAL F 76  PHE F 80  5 ? 5  
HELX_P HELX_P103 103 LYS F 85  ? TYR F 107 ? LYS F 85  TYR F 107 1 ? 23 
HELX_P HELX_P104 104 ALA F 121 ? GLU F 135 ? ALA F 121 GLU F 135 1 ? 15 
HELX_P HELX_P105 105 ALA F 154 ? GLU F 156 ? ALA F 154 GLU F 156 5 ? 3  
HELX_P HELX_P106 106 LEU F 157 ? LEU F 167 ? LEU F 157 LEU F 167 1 ? 11 
HELX_P HELX_P107 107 ASP F 181 ? LYS F 186 ? ASP F 181 LYS F 186 5 ? 6  
HELX_P HELX_P108 108 TRP F 188 ? VAL F 193 ? TRP F 188 VAL F 193 1 ? 6  
HELX_P HELX_P109 109 VAL F 193 ? GLY F 209 ? VAL F 193 GLY F 209 1 ? 17 
HELX_P HELX_P110 110 HIS F 224 ? GLY F 227 ? HIS F 224 GLY F 227 5 ? 4  
HELX_P HELX_P111 111 ALA F 228 ? ARG F 243 ? ALA F 228 ARG F 243 1 ? 16 
HELX_P HELX_P112 112 ARG F 243 ? ALA F 248 ? ARG F 243 ALA F 248 1 ? 6  
HELX_P HELX_P113 113 ASN F 254 ? LEU F 259 ? ASN F 254 LEU F 259 5 ? 6  
HELX_P HELX_P114 114 ASP F 270 ? GLY F 282 ? ASP F 270 GLY F 282 1 ? 13 
HELX_P HELX_P115 115 GLY F 302 ? SER F 307 ? GLY F 302 SER F 307 1 ? 6  
HELX_P HELX_P116 116 ASP F 312 ? ALA F 321 ? ASP F 312 ALA F 321 1 ? 10 
HELX_P HELX_P117 117 ALA F 321 ? GLY F 329 ? ALA F 321 GLY F 329 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 291 OD1 ? ? ? 1_555 H ZN  . ZN ? ? B ASP 291 B ZN  401 1_555 ? ? ? ? ? ? ? 1.964 ? 
metalc2  metalc ? ? F ASP 291 OD1 ? ? ? 1_555 L ZN  . ZN ? ? F ASP 291 F ZN  401 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc3  metalc ? ? C HIS 174 NE2 ? ? ? 1_555 I ZN  . ZN ? ? C HIS 174 C ZN  401 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc4  metalc ? ? D HIS 6   NE2 ? ? ? 1_555 J ZN  . ZN ? ? D HIS 6   D ZN  401 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc5  metalc ? ? A HIS 174 NE2 ? ? ? 1_555 G ZN  . ZN ? ? A HIS 174 A ZN  401 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc6  metalc ? ? F HIS 6   NE2 ? ? ? 1_555 L ZN  . ZN ? ? F HIS 6   F ZN  401 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc7  metalc ? ? C HIS 6   NE2 ? ? ? 1_555 I ZN  . ZN ? ? C HIS 6   C ZN  401 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc8  metalc ? ? F HIS 174 NE2 ? ? ? 1_555 L ZN  . ZN ? ? F HIS 174 F ZN  401 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc9  metalc ? ? D HIS 174 NE2 ? ? ? 1_555 J ZN  . ZN ? ? D HIS 174 D ZN  401 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc10 metalc ? ? B HIS 8   NE2 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 8   B ZN  401 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc11 metalc ? ? F HIS 8   NE2 ? ? ? 1_555 L ZN  . ZN ? ? F HIS 8   F ZN  401 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc12 metalc ? ? E HIS 174 NE2 ? ? ? 1_555 K ZN  . ZN ? ? E HIS 174 E ZN  401 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc13 metalc ? ? A HIS 6   NE2 ? ? ? 1_555 G ZN  . ZN ? ? A HIS 6   A ZN  401 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc14 metalc ? ? C ASP 291 OD1 ? ? ? 1_555 I ZN  . ZN ? ? C ASP 291 C ZN  401 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc15 metalc ? ? B HIS 174 NE2 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 174 B ZN  401 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc16 metalc ? ? E HIS 6   NE2 ? ? ? 1_555 K ZN  . ZN ? ? E HIS 6   E ZN  401 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc17 metalc ? ? D ASP 291 OD1 ? ? ? 1_555 J ZN  . ZN ? ? D ASP 291 D ZN  401 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc18 metalc ? ? A ASP 291 OD1 ? ? ? 1_555 G ZN  . ZN ? ? A ASP 291 A ZN  401 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc19 metalc ? ? C HIS 8   NE2 ? ? ? 1_555 I ZN  . ZN ? ? C HIS 8   C ZN  401 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc20 metalc ? ? B HIS 6   NE2 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 6   B ZN  401 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc21 metalc ? ? E ASP 291 OD1 ? ? ? 1_555 K ZN  . ZN ? ? E ASP 291 E ZN  401 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc22 metalc ? ? E HIS 8   NE2 ? ? ? 1_555 K ZN  . ZN ? ? E HIS 8   E ZN  401 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc23 metalc ? ? G ZN  .   ZN  ? ? ? 1_555 M HOH . O  ? ? A ZN  401 A HOH 577 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc24 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 P HOH . O  ? ? D ZN  401 D HOH 591 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc25 metalc ? ? I ZN  .   ZN  ? ? ? 1_555 O HOH . O  ? ? C ZN  401 C HOH 579 1_555 ? ? ? ? ? ? ? 2.411 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 292 A . ? TYR 292 A PRO 293 A ? PRO 293 A 1 -1.42 
2 TYR 292 B . ? TYR 292 B PRO 293 B ? PRO 293 B 1 9.00  
3 TYR 292 C . ? TYR 292 C PRO 293 C ? PRO 293 C 1 2.71  
4 TYR 292 D . ? TYR 292 D PRO 293 D ? PRO 293 D 1 1.88  
5 TYR 292 E . ? TYR 292 E PRO 293 E ? PRO 293 E 1 1.26  
6 TYR 292 F . ? TYR 292 F PRO 293 F ? PRO 293 F 1 4.97  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 3 ? 
C ? 2 ? 
D ? 8 ? 
E ? 3 ? 
F ? 2 ? 
G ? 8 ? 
H ? 3 ? 
I ? 2 ? 
J ? 8 ? 
K ? 3 ? 
L ? 2 ? 
M ? 8 ? 
N ? 3 ? 
O ? 2 ? 
P ? 8 ? 
Q ? 3 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
G 7 8 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
J 7 8 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
M 6 7 ? parallel      
M 7 8 ? parallel      
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
P 6 7 ? parallel      
P 7 8 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 3   ? HIS A 8   ? ILE A 3   HIS A 8   
A 2 VAL A 70  ? SER A 74  ? VAL A 70  SER A 74  
A 3 PHE A 111 ? GLY A 115 ? PHE A 111 GLY A 115 
A 4 GLY A 140 ? GLY A 144 ? GLY A 140 GLY A 144 
A 5 SER A 170 ? HIS A 174 ? SER A 170 HIS A 174 
A 6 VAL A 220 ? PHE A 222 ? VAL A 220 PHE A 222 
A 7 TYR A 263 ? ASP A 265 ? TYR A 263 ASP A 265 
A 8 VAL A 286 ? ILE A 287 ? VAL A 286 ILE A 287 
B 1 VAL A 27  ? GLN A 30  ? VAL A 27  GLN A 30  
B 2 GLU A 36  ? LYS A 41  ? GLU A 36  LYS A 41  
B 3 LYS A 44  ? ARG A 50  ? LYS A 44  ARG A 50  
C 1 HIS A 146 ? VAL A 147 ? HIS A 146 VAL A 147 
C 2 TRP A 150 ? ASP A 151 ? TRP A 150 ASP A 151 
D 1 ILE B 3   ? ILE B 9   ? ILE B 3   ILE B 9   
D 2 VAL B 70  ? THR B 75  ? VAL B 70  THR B 75  
D 3 PHE B 111 ? GLY B 115 ? PHE B 111 GLY B 115 
D 4 GLY B 140 ? GLY B 144 ? GLY B 140 GLY B 144 
D 5 SER B 170 ? HIS B 174 ? SER B 170 HIS B 174 
D 6 VAL B 220 ? PHE B 222 ? VAL B 220 PHE B 222 
D 7 TYR B 263 ? ASP B 265 ? TYR B 263 ASP B 265 
D 8 VAL B 286 ? ILE B 287 ? VAL B 286 ILE B 287 
E 1 VAL B 27  ? HIS B 31  ? VAL B 27  HIS B 31  
E 2 GLU B 36  ? LYS B 41  ? GLU B 36  LYS B 41  
E 3 LYS B 44  ? ARG B 50  ? LYS B 44  ARG B 50  
F 1 HIS B 146 ? VAL B 147 ? HIS B 146 VAL B 147 
F 2 TRP B 150 ? ASP B 151 ? TRP B 150 ASP B 151 
G 1 ILE C 3   ? HIS C 8   ? ILE C 3   HIS C 8   
G 2 VAL C 70  ? SER C 74  ? VAL C 70  SER C 74  
G 3 PHE C 111 ? GLY C 115 ? PHE C 111 GLY C 115 
G 4 GLY C 140 ? GLY C 144 ? GLY C 140 GLY C 144 
G 5 SER C 170 ? HIS C 174 ? SER C 170 HIS C 174 
G 6 VAL C 220 ? PHE C 222 ? VAL C 220 PHE C 222 
G 7 TYR C 263 ? ASP C 265 ? TYR C 263 ASP C 265 
G 8 VAL C 286 ? ILE C 287 ? VAL C 286 ILE C 287 
H 1 GLN C 28  ? HIS C 31  ? GLN C 28  HIS C 31  
H 2 GLU C 36  ? LEU C 40  ? GLU C 36  LEU C 40  
H 3 VAL C 45  ? ARG C 50  ? VAL C 45  ARG C 50  
I 1 HIS C 146 ? VAL C 147 ? HIS C 146 VAL C 147 
I 2 TRP C 150 ? ASP C 151 ? TRP C 150 ASP C 151 
J 1 ILE D 3   ? HIS D 8   ? ILE D 3   HIS D 8   
J 2 VAL D 70  ? SER D 74  ? VAL D 70  SER D 74  
J 3 PHE D 111 ? GLY D 115 ? PHE D 111 GLY D 115 
J 4 GLY D 140 ? GLY D 144 ? GLY D 140 GLY D 144 
J 5 SER D 170 ? HIS D 174 ? SER D 170 HIS D 174 
J 6 VAL D 220 ? PHE D 222 ? VAL D 220 PHE D 222 
J 7 TYR D 263 ? ASP D 265 ? TYR D 263 ASP D 265 
J 8 VAL D 286 ? ILE D 287 ? VAL D 286 ILE D 287 
K 1 VAL D 27  ? SER D 33  ? VAL D 27  SER D 33  
K 2 GLU D 36  ? LYS D 41  ? GLU D 36  LYS D 41  
K 3 LYS D 44  ? ARG D 50  ? LYS D 44  ARG D 50  
L 1 HIS D 146 ? VAL D 147 ? HIS D 146 VAL D 147 
L 2 TRP D 150 ? ASP D 151 ? TRP D 150 ASP D 151 
M 1 ILE E 3   ? ASP E 4   ? ILE E 3   ASP E 4   
M 2 VAL E 70  ? LEU E 73  ? VAL E 70  LEU E 73  
M 3 PHE E 111 ? THR E 116 ? PHE E 111 THR E 116 
M 4 GLY E 140 ? GLY E 144 ? GLY E 140 GLY E 144 
M 5 SER E 170 ? HIS E 174 ? SER E 170 HIS E 174 
M 6 VAL E 220 ? PHE E 222 ? VAL E 220 PHE E 222 
M 7 TYR E 263 ? ASP E 265 ? TYR E 263 ASP E 265 
M 8 VAL E 286 ? ILE E 287 ? VAL E 286 ILE E 287 
N 1 VAL E 27  ? HIS E 31  ? VAL E 27  HIS E 31  
N 2 GLU E 36  ? LYS E 41  ? GLU E 36  LYS E 41  
N 3 LYS E 44  ? ARG E 50  ? LYS E 44  ARG E 50  
O 1 HIS E 146 ? VAL E 147 ? HIS E 146 VAL E 147 
O 2 TRP E 150 ? ASP E 151 ? TRP E 150 ASP E 151 
P 1 ILE F 3   ? HIS F 8   ? ILE F 3   HIS F 8   
P 2 VAL F 70  ? SER F 74  ? VAL F 70  SER F 74  
P 3 PHE F 111 ? GLY F 115 ? PHE F 111 GLY F 115 
P 4 GLY F 140 ? GLY F 144 ? GLY F 140 GLY F 144 
P 5 SER F 170 ? HIS F 174 ? SER F 170 HIS F 174 
P 6 VAL F 220 ? PHE F 222 ? VAL F 220 PHE F 222 
P 7 TYR F 263 ? ASP F 265 ? TYR F 263 ASP F 265 
P 8 VAL F 286 ? ILE F 287 ? VAL F 286 ILE F 287 
Q 1 GLN F 28  ? GLN F 30  ? GLN F 28  GLN F 30  
Q 2 GLU F 36  ? LEU F 40  ? GLU F 36  LEU F 40  
Q 3 ARG F 47  ? ARG F 50  ? ARG F 47  ARG F 50  
R 1 HIS F 146 ? VAL F 147 ? HIS F 146 VAL F 147 
R 2 TRP F 150 ? ASP F 151 ? TRP F 150 ASP F 151 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 4   ? N ASP A 4   O VAL A 70  ? O VAL A 70  
A 2 3 N LEU A 73  ? N LEU A 73  O VAL A 112 ? O VAL A 112 
A 3 4 N GLY A 115 ? N GLY A 115 O GLN A 142 ? O GLN A 142 
A 4 5 N ILE A 143 ? N ILE A 143 O HIS A 174 ? O HIS A 174 
A 5 6 N VAL A 173 ? N VAL A 173 O CYS A 221 ? O CYS A 221 
A 6 7 N VAL A 220 ? N VAL A 220 O TYR A 263 ? O TYR A 263 
A 7 8 N THR A 264 ? N THR A 264 O ILE A 287 ? O ILE A 287 
B 1 2 N GLN A 30  ? N GLN A 30  O LYS A 38  ? O LYS A 38  
B 2 3 N ALA A 37  ? N ALA A 37  O VAL A 49  ? O VAL A 49  
C 1 2 N VAL A 147 ? N VAL A 147 O TRP A 150 ? O TRP A 150 
D 1 2 N ASP B 4   ? N ASP B 4   O ALA B 72  ? O ALA B 72  
D 2 3 N LEU B 73  ? N LEU B 73  O VAL B 112 ? O VAL B 112 
D 3 4 N GLY B 115 ? N GLY B 115 O GLN B 142 ? O GLN B 142 
D 4 5 N VAL B 141 ? N VAL B 141 O PHE B 172 ? O PHE B 172 
D 5 6 N VAL B 173 ? N VAL B 173 O CYS B 221 ? O CYS B 221 
D 6 7 N VAL B 220 ? N VAL B 220 O TYR B 263 ? O TYR B 263 
D 7 8 N THR B 264 ? N THR B 264 O ILE B 287 ? O ILE B 287 
E 1 2 N GLN B 30  ? N GLN B 30  O LYS B 38  ? O LYS B 38  
E 2 3 N LYS B 41  ? N LYS B 41  O LYS B 44  ? O LYS B 44  
F 1 2 N VAL B 147 ? N VAL B 147 O TRP B 150 ? O TRP B 150 
G 1 2 N ASP C 4   ? N ASP C 4   O VAL C 70  ? O VAL C 70  
G 2 3 N LEU C 73  ? N LEU C 73  O VAL C 112 ? O VAL C 112 
G 3 4 N GLY C 115 ? N GLY C 115 O GLN C 142 ? O GLN C 142 
G 4 5 N ILE C 143 ? N ILE C 143 O HIS C 174 ? O HIS C 174 
G 5 6 N VAL C 173 ? N VAL C 173 O CYS C 221 ? O CYS C 221 
G 6 7 N VAL C 220 ? N VAL C 220 O TYR C 263 ? O TYR C 263 
G 7 8 N THR C 264 ? N THR C 264 O ILE C 287 ? O ILE C 287 
H 1 2 N GLN C 28  ? N GLN C 28  O LEU C 40  ? O LEU C 40  
H 2 3 N LEU C 39  ? N LEU C 39  O ARG C 47  ? O ARG C 47  
I 1 2 N VAL C 147 ? N VAL C 147 O TRP C 150 ? O TRP C 150 
J 1 2 N ASP D 4   ? N ASP D 4   O ALA D 72  ? O ALA D 72  
J 2 3 N LEU D 73  ? N LEU D 73  O LEU D 114 ? O LEU D 114 
J 3 4 N GLY D 115 ? N GLY D 115 O GLN D 142 ? O GLN D 142 
J 4 5 N ILE D 143 ? N ILE D 143 O HIS D 174 ? O HIS D 174 
J 5 6 N VAL D 173 ? N VAL D 173 O CYS D 221 ? O CYS D 221 
J 6 7 N VAL D 220 ? N VAL D 220 O TYR D 263 ? O TYR D 263 
J 7 8 N THR D 264 ? N THR D 264 O ILE D 287 ? O ILE D 287 
K 1 2 N GLN D 28  ? N GLN D 28  O LEU D 40  ? O LEU D 40  
K 2 3 N LEU D 39  ? N LEU D 39  O ARG D 47  ? O ARG D 47  
L 1 2 N VAL D 147 ? N VAL D 147 O TRP D 150 ? O TRP D 150 
M 1 2 N ASP E 4   ? N ASP E 4   O ALA E 72  ? O ALA E 72  
M 2 3 N LEU E 73  ? N LEU E 73  O LEU E 114 ? O LEU E 114 
M 3 4 N GLY E 115 ? N GLY E 115 O GLN E 142 ? O GLN E 142 
M 4 5 N VAL E 141 ? N VAL E 141 O PHE E 172 ? O PHE E 172 
M 5 6 N VAL E 173 ? N VAL E 173 O CYS E 221 ? O CYS E 221 
M 6 7 N VAL E 220 ? N VAL E 220 O TYR E 263 ? O TYR E 263 
M 7 8 N THR E 264 ? N THR E 264 O ILE E 287 ? O ILE E 287 
N 1 2 N GLN E 30  ? N GLN E 30  O LYS E 38  ? O LYS E 38  
N 2 3 N LEU E 39  ? N LEU E 39  O ARG E 47  ? O ARG E 47  
O 1 2 N VAL E 147 ? N VAL E 147 O TRP E 150 ? O TRP E 150 
P 1 2 N ASP F 4   ? N ASP F 4   O VAL F 70  ? O VAL F 70  
P 2 3 N LEU F 73  ? N LEU F 73  O VAL F 112 ? O VAL F 112 
P 3 4 N GLY F 115 ? N GLY F 115 O GLN F 142 ? O GLN F 142 
P 4 5 N ILE F 143 ? N ILE F 143 O HIS F 174 ? O HIS F 174 
P 5 6 N VAL F 173 ? N VAL F 173 O CYS F 221 ? O CYS F 221 
P 6 7 N VAL F 220 ? N VAL F 220 O TYR F 263 ? O TYR F 263 
P 7 8 N THR F 264 ? N THR F 264 O ILE F 287 ? O ILE F 287 
Q 1 2 N GLN F 30  ? N GLN F 30  O LYS F 38  ? O LYS F 38  
Q 2 3 N LEU F 39  ? N LEU F 39  O ARG F 47  ? O ARG F 47  
R 1 2 N VAL F 147 ? N VAL F 147 O TRP F 150 ? O TRP F 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 401' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 401' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN C 401' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN D 401' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN E 401' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN F 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 6   ? HIS A 6   . ? 1_555 ? 
2  AC1 5 HIS A 8   ? HIS A 8   . ? 1_555 ? 
3  AC1 5 HIS A 174 ? HIS A 174 . ? 1_555 ? 
4  AC1 5 ASP A 291 ? ASP A 291 . ? 1_555 ? 
5  AC1 5 HOH M .   ? HOH A 577 . ? 1_555 ? 
6  AC2 5 HIS B 6   ? HIS B 6   . ? 1_555 ? 
7  AC2 5 HIS B 8   ? HIS B 8   . ? 1_555 ? 
8  AC2 5 HIS B 174 ? HIS B 174 . ? 1_555 ? 
9  AC2 5 ASP B 291 ? ASP B 291 . ? 1_555 ? 
10 AC2 5 HOH N .   ? HOH B 597 . ? 1_555 ? 
11 AC3 5 HIS C 6   ? HIS C 6   . ? 1_555 ? 
12 AC3 5 HIS C 8   ? HIS C 8   . ? 1_555 ? 
13 AC3 5 HIS C 174 ? HIS C 174 . ? 1_555 ? 
14 AC3 5 ASP C 291 ? ASP C 291 . ? 1_555 ? 
15 AC3 5 HOH O .   ? HOH C 579 . ? 1_555 ? 
16 AC4 5 HIS D 6   ? HIS D 6   . ? 1_555 ? 
17 AC4 5 HIS D 8   ? HIS D 8   . ? 1_555 ? 
18 AC4 5 HIS D 174 ? HIS D 174 . ? 1_555 ? 
19 AC4 5 ASP D 291 ? ASP D 291 . ? 1_555 ? 
20 AC4 5 HOH P .   ? HOH D 591 . ? 1_555 ? 
21 AC5 4 HIS E 6   ? HIS E 6   . ? 1_555 ? 
22 AC5 4 HIS E 8   ? HIS E 8   . ? 1_555 ? 
23 AC5 4 HIS E 174 ? HIS E 174 . ? 1_555 ? 
24 AC5 4 ASP E 291 ? ASP E 291 . ? 1_555 ? 
25 AC6 5 HIS F 6   ? HIS F 6   . ? 1_555 ? 
26 AC6 5 HIS F 8   ? HIS F 8   . ? 1_555 ? 
27 AC6 5 HIS F 174 ? HIS F 174 . ? 1_555 ? 
28 AC6 5 ASP F 291 ? ASP F 291 . ? 1_555 ? 
29 AC6 5 HOH R .   ? HOH F 554 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4IGM 
_atom_sites.fract_transf_matrix[1][1]   0.011222 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009816 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004283 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A 1 1   ? 61.555  5.829   16.307  1.00 45.63  ? 1   MET A N   1 
ATOM   2     C  CA  . MET A 1 1   ? 62.218  5.096   17.392  1.00 44.24  ? 1   MET A CA  1 
ATOM   3     C  C   . MET A 1 1   ? 63.278  6.008   18.009  1.00 39.76  ? 1   MET A C   1 
ATOM   4     O  O   . MET A 1 1   ? 64.331  5.540   18.421  1.00 47.47  ? 1   MET A O   1 
ATOM   5     C  CB  . MET A 1 1   ? 62.818  3.795   16.846  1.00 51.45  ? 1   MET A CB  1 
ATOM   6     C  CG  . MET A 1 1   ? 62.704  2.582   17.766  1.00 63.98  ? 1   MET A CG  1 
ATOM   7     S  SD  . MET A 1 1   ? 64.226  2.080   18.632  1.00 72.69  ? 1   MET A SD  1 
ATOM   8     C  CE  . MET A 1 1   ? 63.599  0.756   19.676  1.00 72.65  ? 1   MET A CE  1 
ATOM   9     N  N   . LYS A 1 2   ? 63.019  7.314   18.012  1.00 29.72  ? 2   LYS A N   1 
ATOM   10    C  CA  . LYS A 1 2   ? 63.656  8.271   18.941  1.00 26.62  ? 2   LYS A CA  1 
ATOM   11    C  C   . LYS A 1 2   ? 62.732  9.486   18.947  1.00 22.24  ? 2   LYS A C   1 
ATOM   12    O  O   . LYS A 1 2   ? 61.907  9.561   19.815  1.00 20.48  ? 2   LYS A O   1 
ATOM   13    C  CB  . LYS A 1 2   ? 65.116  8.661   18.640  1.00 24.41  ? 2   LYS A CB  1 
ATOM   14    C  CG  . LYS A 1 2   ? 66.200  7.794   19.203  1.00 21.99  ? 2   LYS A CG  1 
ATOM   15    C  CD  . LYS A 1 2   ? 66.684  8.185   20.607  1.00 22.72  ? 2   LYS A CD  1 
ATOM   16    C  CE  . LYS A 1 2   ? 67.525  7.022   21.164  1.00 21.33  ? 2   LYS A CE  1 
ATOM   17    N  NZ  . LYS A 1 2   ? 66.981  5.666   20.786  1.00 17.79  ? 2   LYS A NZ  1 
ATOM   18    N  N   . ILE A 1 3   ? 62.818  10.388  17.978  1.00 19.68  ? 3   ILE A N   1 
ATOM   19    C  CA  . ILE A 1 3   ? 61.939  11.552  17.990  1.00 19.41  ? 3   ILE A CA  1 
ATOM   20    C  C   . ILE A 1 3   ? 60.916  11.496  16.850  1.00 21.16  ? 3   ILE A C   1 
ATOM   21    O  O   . ILE A 1 3   ? 61.262  11.229  15.720  1.00 23.54  ? 3   ILE A O   1 
ATOM   22    C  CB  . ILE A 1 3   ? 62.699  12.890  17.915  1.00 18.98  ? 3   ILE A CB  1 
ATOM   23    C  CG1 . ILE A 1 3   ? 63.709  13.039  19.056  1.00 21.17  ? 3   ILE A CG1 1 
ATOM   24    C  CG2 . ILE A 1 3   ? 61.736  14.060  18.001  1.00 18.78  ? 3   ILE A CG2 1 
ATOM   25    C  CD1 . ILE A 1 3   ? 64.539  14.316  18.946  1.00 21.67  ? 3   ILE A CD1 1 
ATOM   26    N  N   . ASP A 1 4   ? 59.657  11.784  17.156  1.00 21.79  ? 4   ASP A N   1 
ATOM   27    C  CA  . ASP A 1 4   ? 58.623  11.826  16.166  1.00 21.67  ? 4   ASP A CA  1 
ATOM   28    C  C   . ASP A 1 4   ? 58.162  13.259  16.016  1.00 20.65  ? 4   ASP A C   1 
ATOM   29    O  O   . ASP A 1 4   ? 57.532  13.852  16.907  1.00 20.13  ? 4   ASP A O   1 
ATOM   30    C  CB  . ASP A 1 4   ? 57.488  10.934  16.595  1.00 24.77  ? 4   ASP A CB  1 
ATOM   31    C  CG  . ASP A 1 4   ? 56.381  10.836  15.555  1.00 30.15  ? 4   ASP A CG  1 
ATOM   32    O  OD1 . ASP A 1 4   ? 56.493  11.380  14.417  1.00 27.67  ? 4   ASP A OD1 1 
ATOM   33    O  OD2 . ASP A 1 4   ? 55.363  10.179  15.905  1.00 36.71  ? 4   ASP A OD2 1 
ATOM   34    N  N   . ILE A 1 5   ? 58.475  13.815  14.869  1.00 18.45  ? 5   ILE A N   1 
ATOM   35    C  CA  . ILE A 1 5   ? 58.200  15.209  14.623  1.00 17.14  ? 5   ILE A CA  1 
ATOM   36    C  C   . ILE A 1 5   ? 56.750  15.480  14.254  1.00 15.45  ? 5   ILE A C   1 
ATOM   37    O  O   . ILE A 1 5   ? 56.354  16.642  14.242  1.00 16.43  ? 5   ILE A O   1 
ATOM   38    C  CB  . ILE A 1 5   ? 59.099  15.738  13.488  1.00 17.08  ? 5   ILE A CB  1 
ATOM   39    C  CG1 . ILE A 1 5   ? 59.246  17.245  13.566  1.00 17.72  ? 5   ILE A CG1 1 
ATOM   40    C  CG2 . ILE A 1 5   ? 58.593  15.302  12.123  1.00 16.87  ? 5   ILE A CG2 1 
ATOM   41    C  CD1 . ILE A 1 5   ? 59.886  17.690  14.878  1.00 17.89  ? 5   ILE A CD1 1 
ATOM   42    N  N   . HIS A 1 6   ? 55.972  14.447  13.936  1.00 13.38  ? 6   HIS A N   1 
ATOM   43    C  CA  . HIS A 1 6   ? 54.652  14.655  13.346  1.00 13.10  ? 6   HIS A CA  1 
ATOM   44    C  C   . HIS A 1 6   ? 53.622  13.896  14.134  1.00 13.59  ? 6   HIS A C   1 
ATOM   45    O  O   . HIS A 1 6   ? 53.443  12.695  13.958  1.00 15.45  ? 6   HIS A O   1 
ATOM   46    C  CB  . HIS A 1 6   ? 54.723  14.178  11.908  1.00 12.53  ? 6   HIS A CB  1 
ATOM   47    C  CG  . HIS A 1 6   ? 53.451  14.338  11.113  1.00 11.63  ? 6   HIS A CG  1 
ATOM   48    N  ND1 . HIS A 1 6   ? 53.413  14.109  9.800   1.00 10.59  ? 6   HIS A ND1 1 
ATOM   49    C  CD2 . HIS A 1 6   ? 52.146  14.679  11.496  1.00 11.68  ? 6   HIS A CD2 1 
ATOM   50    C  CE1 . HIS A 1 6   ? 52.156  14.303  9.355   1.00 11.36  ? 6   HIS A CE1 1 
ATOM   51    N  NE2 . HIS A 1 6   ? 51.384  14.665  10.397  1.00 10.65  ? 6   HIS A NE2 1 
ATOM   52    N  N   . SER A 1 7   ? 52.929  14.556  15.054  1.00 13.69  ? 7   SER A N   1 
ATOM   53    C  CA  . SER A 1 7   ? 51.927  13.843  15.810  1.00 13.13  ? 7   SER A CA  1 
ATOM   54    C  C   . SER A 1 7   ? 50.919  14.766  16.403  1.00 12.39  ? 7   SER A C   1 
ATOM   55    O  O   . SER A 1 7   ? 51.248  15.870  16.766  1.00 12.67  ? 7   SER A O   1 
ATOM   56    C  CB  . SER A 1 7   ? 52.540  12.904  16.868  1.00 14.41  ? 7   SER A CB  1 
ATOM   57    O  OG  . SER A 1 7   ? 52.572  13.472  18.151  1.00 15.26  ? 7   SER A OG  1 
ATOM   58    N  N   . HIS A 1 8   ? 49.685  14.295  16.486  1.00 11.18  ? 8   HIS A N   1 
ATOM   59    C  CA  . HIS A 1 8   ? 48.564  15.124  16.764  1.00 11.55  ? 8   HIS A CA  1 
ATOM   60    C  C   . HIS A 1 8   ? 47.864  14.704  18.013  1.00 11.93  ? 8   HIS A C   1 
ATOM   61    O  O   . HIS A 1 8   ? 47.813  13.518  18.326  1.00 11.56  ? 8   HIS A O   1 
ATOM   62    C  CB  . HIS A 1 8   ? 47.588  15.042  15.624  1.00 10.91  ? 8   HIS A CB  1 
ATOM   63    C  CG  . HIS A 1 8   ? 48.140  15.573  14.370  1.00 11.50  ? 8   HIS A CG  1 
ATOM   64    N  ND1 . HIS A 1 8   ? 48.424  14.799  13.324  1.00 11.45  ? 8   HIS A ND1 1 
ATOM   65    C  CD2 . HIS A 1 8   ? 48.520  16.844  14.029  1.00 11.49  ? 8   HIS A CD2 1 
ATOM   66    C  CE1 . HIS A 1 8   ? 48.928  15.533  12.348  1.00 11.84  ? 8   HIS A CE1 1 
ATOM   67    N  NE2 . HIS A 1 8   ? 48.990  16.785  12.777  1.00 12.83  ? 8   HIS A NE2 1 
ATOM   68    N  N   . ILE A 1 9   ? 47.274  15.684  18.680  1.00 11.65  ? 9   ILE A N   1 
ATOM   69    C  CA  . ILE A 1 9   ? 46.612  15.474  19.912  1.00 12.38  ? 9   ILE A CA  1 
ATOM   70    C  C   . ILE A 1 9   ? 45.469  16.462  19.988  1.00 12.74  ? 9   ILE A C   1 
ATOM   71    O  O   . ILE A 1 9   ? 45.501  17.510  19.344  1.00 12.62  ? 9   ILE A O   1 
ATOM   72    C  CB  . ILE A 1 9   ? 47.588  15.659  21.093  1.00 12.93  ? 9   ILE A CB  1 
ATOM   73    C  CG1 . ILE A 1 9   ? 46.929  15.196  22.420  1.00 13.24  ? 9   ILE A CG1 1 
ATOM   74    C  CG2 . ILE A 1 9   ? 48.061  17.119  21.205  1.00 13.30  ? 9   ILE A CG2 1 
ATOM   75    C  CD1 . ILE A 1 9   ? 47.869  14.646  23.468  1.00 12.50  ? 9   ILE A CD1 1 
ATOM   76    N  N   . LEU A 1 10  ? 44.448  16.116  20.745  1.00 13.17  ? 10  LEU A N   1 
ATOM   77    C  CA  . LEU A 1 10  ? 43.340  17.027  21.041  1.00 14.31  ? 10  LEU A CA  1 
ATOM   78    C  C   . LEU A 1 10  ? 43.186  17.139  22.553  1.00 15.10  ? 10  LEU A C   1 
ATOM   79    O  O   . LEU A 1 10  ? 43.564  16.215  23.275  1.00 14.78  ? 10  LEU A O   1 
ATOM   80    C  CB  . LEU A 1 10  ? 42.018  16.475  20.504  1.00 13.99  ? 10  LEU A CB  1 
ATOM   81    C  CG  . LEU A 1 10  ? 41.903  16.544  18.988  1.00 15.65  ? 10  LEU A CG  1 
ATOM   82    C  CD1 . LEU A 1 10  ? 40.769  15.661  18.477  1.00 15.85  ? 10  LEU A CD1 1 
ATOM   83    C  CD2 . LEU A 1 10  ? 41.799  17.962  18.413  1.00 15.20  ? 10  LEU A CD2 1 
ATOM   84    N  N   . PRO A 1 11  ? 42.571  18.240  23.033  1.00 16.12  ? 11  PRO A N   1 
ATOM   85    C  CA  . PRO A 1 11  ? 42.152  18.275  24.437  1.00 17.00  ? 11  PRO A CA  1 
ATOM   86    C  C   . PRO A 1 11  ? 41.019  17.286  24.625  1.00 17.15  ? 11  PRO A C   1 
ATOM   87    O  O   . PRO A 1 11  ? 40.333  16.982  23.659  1.00 16.19  ? 11  PRO A O   1 
ATOM   88    C  CB  . PRO A 1 11  ? 41.638  19.714  24.637  1.00 16.17  ? 11  PRO A CB  1 
ATOM   89    C  CG  . PRO A 1 11  ? 41.946  20.432  23.340  1.00 16.40  ? 11  PRO A CG  1 
ATOM   90    C  CD  . PRO A 1 11  ? 42.060  19.401  22.280  1.00 15.50  ? 11  PRO A CD  1 
ATOM   91    N  N   . LYS A 1 12  ? 40.812  16.776  25.836  1.00 20.86  ? 12  LYS A N   1 
ATOM   92    C  CA  . LYS A 1 12  ? 39.706  15.857  26.006  1.00 23.69  ? 12  LYS A CA  1 
ATOM   93    C  C   . LYS A 1 12  ? 38.333  16.533  25.806  1.00 23.52  ? 12  LYS A C   1 
ATOM   94    O  O   . LYS A 1 12  ? 37.375  15.901  25.316  1.00 21.67  ? 12  LYS A O   1 
ATOM   95    C  CB  . LYS A 1 12  ? 39.843  15.007  27.275  1.00 28.36  ? 12  LYS A CB  1 
ATOM   96    C  CG  . LYS A 1 12  ? 39.196  15.545  28.542  1.00 36.16  ? 12  LYS A CG  1 
ATOM   97    C  CD  . LYS A 1 12  ? 40.074  16.572  29.276  1.00 42.92  ? 12  LYS A CD  1 
ATOM   98    C  CE  . LYS A 1 12  ? 39.408  17.102  30.556  1.00 41.31  ? 12  LYS A CE  1 
ATOM   99    N  NZ  . LYS A 1 12  ? 40.331  18.034  31.257  1.00 41.42  ? 12  LYS A NZ  1 
ATOM   100   N  N   . GLU A 1 13  ? 38.255  17.827  26.111  1.00 23.61  ? 13  GLU A N   1 
ATOM   101   C  CA  . GLU A 1 13  ? 37.005  18.559  25.960  1.00 25.63  ? 13  GLU A CA  1 
ATOM   102   C  C   . GLU A 1 13  ? 37.246  20.027  25.686  1.00 22.46  ? 13  GLU A C   1 
ATOM   103   O  O   . GLU A 1 13  ? 38.256  20.583  26.087  1.00 21.06  ? 13  GLU A O   1 
ATOM   104   C  CB  . GLU A 1 13  ? 36.084  18.375  27.180  1.00 30.35  ? 13  GLU A CB  1 
ATOM   105   C  CG  . GLU A 1 13  ? 35.189  17.146  27.019  1.00 43.11  ? 13  GLU A CG  1 
ATOM   106   C  CD  . GLU A 1 13  ? 34.041  17.038  28.029  1.00 54.25  ? 13  GLU A CD  1 
ATOM   107   O  OE1 . GLU A 1 13  ? 33.190  17.972  28.103  1.00 59.92  ? 13  GLU A OE1 1 
ATOM   108   O  OE2 . GLU A 1 13  ? 33.973  15.992  28.728  1.00 56.60  ? 13  GLU A OE2 1 
ATOM   109   N  N   . TRP A 1 14  ? 36.335  20.650  24.958  1.00 20.30  ? 14  TRP A N   1 
ATOM   110   C  CA  . TRP A 1 14  ? 36.415  22.070  24.817  1.00 19.61  ? 14  TRP A CA  1 
ATOM   111   C  C   . TRP A 1 14  ? 35.052  22.687  24.715  1.00 19.54  ? 14  TRP A C   1 
ATOM   112   O  O   . TRP A 1 14  ? 34.079  21.986  24.466  1.00 19.88  ? 14  TRP A O   1 
ATOM   113   C  CB  . TRP A 1 14  ? 37.368  22.427  23.686  1.00 19.36  ? 14  TRP A CB  1 
ATOM   114   C  CG  . TRP A 1 14  ? 36.959  21.978  22.294  1.00 20.21  ? 14  TRP A CG  1 
ATOM   115   C  CD1 . TRP A 1 14  ? 36.107  22.642  21.402  1.00 19.91  ? 14  TRP A CD1 1 
ATOM   116   C  CD2 . TRP A 1 14  ? 37.396  20.774  21.577  1.00 18.51  ? 14  TRP A CD2 1 
ATOM   117   N  NE1 . TRP A 1 14  ? 35.993  21.945  20.226  1.00 19.68  ? 14  TRP A NE1 1 
ATOM   118   C  CE2 . TRP A 1 14  ? 36.754  20.825  20.259  1.00 19.09  ? 14  TRP A CE2 1 
ATOM   119   C  CE3 . TRP A 1 14  ? 38.251  19.725  21.866  1.00 18.27  ? 14  TRP A CE3 1 
ATOM   120   C  CZ2 . TRP A 1 14  ? 36.967  19.841  19.292  1.00 17.83  ? 14  TRP A CZ2 1 
ATOM   121   C  CZ3 . TRP A 1 14  ? 38.459  18.746  20.885  1.00 17.51  ? 14  TRP A CZ3 1 
ATOM   122   C  CH2 . TRP A 1 14  ? 37.829  18.807  19.630  1.00 17.29  ? 14  TRP A CH2 1 
ATOM   123   N  N   . PRO A 1 15  ? 34.931  24.006  24.918  1.00 21.12  ? 15  PRO A N   1 
ATOM   124   C  CA  . PRO A 1 15  ? 33.530  24.506  24.887  1.00 22.88  ? 15  PRO A CA  1 
ATOM   125   C  C   . PRO A 1 15  ? 32.813  24.331  23.540  1.00 22.75  ? 15  PRO A C   1 
ATOM   126   O  O   . PRO A 1 15  ? 33.469  24.158  22.491  1.00 22.39  ? 15  PRO A O   1 
ATOM   127   C  CB  . PRO A 1 15  ? 33.675  25.977  25.242  1.00 22.19  ? 15  PRO A CB  1 
ATOM   128   C  CG  . PRO A 1 15  ? 34.937  26.019  26.053  1.00 23.80  ? 15  PRO A CG  1 
ATOM   129   C  CD  . PRO A 1 15  ? 35.865  25.066  25.337  1.00 21.86  ? 15  PRO A CD  1 
ATOM   130   N  N   . ASP A 1 16  ? 31.482  24.297  23.586  1.00 22.85  ? 16  ASP A N   1 
ATOM   131   C  CA  . ASP A 1 16  ? 30.692  24.400  22.365  1.00 23.40  ? 16  ASP A CA  1 
ATOM   132   C  C   . ASP A 1 16  ? 31.042  25.730  21.654  1.00 21.39  ? 16  ASP A C   1 
ATOM   133   O  O   . ASP A 1 16  ? 30.677  26.785  22.113  1.00 20.69  ? 16  ASP A O   1 
ATOM   134   C  CB  . ASP A 1 16  ? 29.193  24.304  22.690  1.00 26.38  ? 16  ASP A CB  1 
ATOM   135   C  CG  . ASP A 1 16  ? 28.334  24.336  21.436  1.00 32.12  ? 16  ASP A CG  1 
ATOM   136   O  OD1 . ASP A 1 16  ? 28.461  25.334  20.668  1.00 33.29  ? 16  ASP A OD1 1 
ATOM   137   O  OD2 . ASP A 1 16  ? 27.565  23.363  21.194  1.00 32.71  ? 16  ASP A OD2 1 
ATOM   138   N  N   . LEU A 1 17  ? 31.777  25.673  20.550  1.00 20.08  ? 17  LEU A N   1 
ATOM   139   C  CA  . LEU A 1 17  ? 32.258  26.887  19.907  1.00 19.27  ? 17  LEU A CA  1 
ATOM   140   C  C   . LEU A 1 17  ? 31.183  27.730  19.193  1.00 19.67  ? 17  LEU A C   1 
ATOM   141   O  O   . LEU A 1 17  ? 31.281  28.965  19.140  1.00 19.51  ? 17  LEU A O   1 
ATOM   142   C  CB  . LEU A 1 17  ? 33.421  26.573  18.971  1.00 18.11  ? 17  LEU A CB  1 
ATOM   143   C  CG  . LEU A 1 17  ? 34.567  25.850  19.685  1.00 17.66  ? 17  LEU A CG  1 
ATOM   144   C  CD1 . LEU A 1 17  ? 35.652  25.514  18.680  1.00 16.15  ? 17  LEU A CD1 1 
ATOM   145   C  CD2 . LEU A 1 17  ? 35.116  26.682  20.870  1.00 16.53  ? 17  LEU A CD2 1 
ATOM   146   N  N   . LYS A 1 18  ? 30.162  27.077  18.657  1.00 20.62  ? 18  LYS A N   1 
ATOM   147   C  CA  . LYS A 1 18  ? 29.024  27.794  18.114  1.00 23.24  ? 18  LYS A CA  1 
ATOM   148   C  C   . LYS A 1 18  ? 28.448  28.724  19.190  1.00 24.55  ? 18  LYS A C   1 
ATOM   149   O  O   . LYS A 1 18  ? 28.260  29.940  18.961  1.00 25.28  ? 18  LYS A O   1 
ATOM   150   C  CB  . LYS A 1 18  ? 27.956  26.811  17.633  1.00 24.33  ? 18  LYS A CB  1 
ATOM   151   C  CG  . LYS A 1 18  ? 26.703  27.456  17.021  1.00 26.61  ? 18  LYS A CG  1 
ATOM   152   C  CD  . LYS A 1 18  ? 25.892  26.391  16.277  1.00 30.64  ? 18  LYS A CD  1 
ATOM   153   C  CE  . LYS A 1 18  ? 24.702  26.950  15.519  1.00 34.73  ? 18  LYS A CE  1 
ATOM   154   N  NZ  . LYS A 1 18  ? 23.596  27.469  16.403  1.00 40.52  ? 18  LYS A NZ  1 
ATOM   155   N  N   . LYS A 1 19  ? 28.165  28.161  20.362  1.00 24.53  ? 19  LYS A N   1 
ATOM   156   C  CA  . LYS A 1 19  ? 27.701  28.979  21.459  1.00 26.40  ? 19  LYS A CA  1 
ATOM   157   C  C   . LYS A 1 19  ? 28.686  30.115  21.773  1.00 26.67  ? 19  LYS A C   1 
ATOM   158   O  O   . LYS A 1 19  ? 28.260  31.249  21.978  1.00 26.18  ? 19  LYS A O   1 
ATOM   159   C  CB  . LYS A 1 19  ? 27.372  28.120  22.664  1.00 26.72  ? 19  LYS A CB  1 
ATOM   160   C  CG  . LYS A 1 19  ? 26.057  27.402  22.419  1.00 30.27  ? 19  LYS A CG  1 
ATOM   161   C  CD  . LYS A 1 19  ? 25.802  26.235  23.360  1.00 35.37  ? 19  LYS A CD  1 
ATOM   162   C  CE  . LYS A 1 19  ? 24.618  25.436  22.819  1.00 38.79  ? 19  LYS A CE  1 
ATOM   163   N  NZ  . LYS A 1 19  ? 23.525  25.214  23.813  1.00 39.46  ? 19  LYS A NZ  1 
ATOM   164   N  N   . ARG A 1 20  ? 29.991  29.821  21.756  1.00 24.57  ? 20  ARG A N   1 
ATOM   165   C  CA  . ARG A 1 20  ? 30.957  30.768  22.286  1.00 23.64  ? 20  ARG A CA  1 
ATOM   166   C  C   . ARG A 1 20  ? 31.169  31.923  21.285  1.00 22.93  ? 20  ARG A C   1 
ATOM   167   O  O   . ARG A 1 20  ? 31.371  33.076  21.687  1.00 22.27  ? 20  ARG A O   1 
ATOM   168   C  CB  . ARG A 1 20  ? 32.280  30.083  22.720  1.00 22.28  ? 20  ARG A CB  1 
ATOM   169   C  CG  . ARG A 1 20  ? 33.395  31.077  23.044  1.00 23.48  ? 20  ARG A CG  1 
ATOM   170   C  CD  . ARG A 1 20  ? 34.786  30.462  23.010  1.00 24.69  ? 20  ARG A CD  1 
ATOM   171   N  NE  . ARG A 1 20  ? 34.985  29.728  24.235  1.00 29.04  ? 20  ARG A NE  1 
ATOM   172   C  CZ  . ARG A 1 20  ? 35.946  29.913  25.113  1.00 28.22  ? 20  ARG A CZ  1 
ATOM   173   N  NH1 . ARG A 1 20  ? 36.913  30.782  24.903  1.00 28.77  ? 20  ARG A NH1 1 
ATOM   174   N  NH2 . ARG A 1 20  ? 35.940  29.166  26.200  1.00 29.48  ? 20  ARG A NH2 1 
ATOM   175   N  N   . PHE A 1 21  ? 31.085  31.631  19.994  1.00 21.68  ? 21  PHE A N   1 
ATOM   176   C  CA  . PHE A 1 21  ? 31.431  32.633  18.995  1.00 21.29  ? 21  PHE A CA  1 
ATOM   177   C  C   . PHE A 1 21  ? 30.281  33.239  18.198  1.00 21.84  ? 21  PHE A C   1 
ATOM   178   O  O   . PHE A 1 21  ? 30.492  34.255  17.506  1.00 23.56  ? 21  PHE A O   1 
ATOM   179   C  CB  . PHE A 1 21  ? 32.508  32.116  18.021  1.00 20.35  ? 21  PHE A CB  1 
ATOM   180   C  CG  . PHE A 1 21  ? 33.787  31.710  18.680  1.00 18.42  ? 21  PHE A CG  1 
ATOM   181   C  CD1 . PHE A 1 21  ? 34.347  30.468  18.418  1.00 17.38  ? 21  PHE A CD1 1 
ATOM   182   C  CD2 . PHE A 1 21  ? 34.420  32.551  19.583  1.00 19.52  ? 21  PHE A CD2 1 
ATOM   183   C  CE1 . PHE A 1 21  ? 35.526  30.070  19.031  1.00 16.74  ? 21  PHE A CE1 1 
ATOM   184   C  CE2 . PHE A 1 21  ? 35.621  32.177  20.188  1.00 18.76  ? 21  PHE A CE2 1 
ATOM   185   C  CZ  . PHE A 1 21  ? 36.167  30.924  19.905  1.00 17.18  ? 21  PHE A CZ  1 
ATOM   186   N  N   . GLY A 1 22  ? 29.097  32.626  18.255  1.00 22.33  ? 22  GLY A N   1 
ATOM   187   C  CA  . GLY A 1 22  ? 27.908  33.125  17.504  1.00 23.23  ? 22  GLY A CA  1 
ATOM   188   C  C   . GLY A 1 22  ? 27.588  32.511  16.128  1.00 25.03  ? 22  GLY A C   1 
ATOM   189   O  O   . GLY A 1 22  ? 26.625  32.923  15.497  1.00 25.09  ? 22  GLY A O   1 
ATOM   190   N  N   . TYR A 1 23  ? 28.362  31.529  15.648  1.00 25.10  ? 23  TYR A N   1 
ATOM   191   C  CA  . TYR A 1 23  ? 28.140  30.936  14.286  1.00 24.60  ? 23  TYR A CA  1 
ATOM   192   C  C   . TYR A 1 23  ? 28.843  29.596  14.198  1.00 24.69  ? 23  TYR A C   1 
ATOM   193   O  O   . TYR A 1 23  ? 29.846  29.370  14.897  1.00 26.61  ? 23  TYR A O   1 
ATOM   194   C  CB  . TYR A 1 23  ? 28.675  31.855  13.156  1.00 23.67  ? 23  TYR A CB  1 
ATOM   195   C  CG  . TYR A 1 23  ? 30.136  32.246  13.340  1.00 23.87  ? 23  TYR A CG  1 
ATOM   196   C  CD1 . TYR A 1 23  ? 31.169  31.479  12.788  1.00 24.30  ? 23  TYR A CD1 1 
ATOM   197   C  CD2 . TYR A 1 23  ? 30.495  33.368  14.084  1.00 23.34  ? 23  TYR A CD2 1 
ATOM   198   C  CE1 . TYR A 1 23  ? 32.511  31.831  12.953  1.00 21.82  ? 23  TYR A CE1 1 
ATOM   199   C  CE2 . TYR A 1 23  ? 31.840  33.720  14.258  1.00 22.83  ? 23  TYR A CE2 1 
ATOM   200   C  CZ  . TYR A 1 23  ? 32.845  32.944  13.679  1.00 23.10  ? 23  TYR A CZ  1 
ATOM   201   O  OH  . TYR A 1 23  ? 34.203  33.275  13.853  1.00 23.52  ? 23  TYR A OH  1 
ATOM   202   N  N   . GLY A 1 24  ? 28.320  28.719  13.338  1.00 24.54  ? 24  GLY A N   1 
ATOM   203   C  CA  . GLY A 1 24  ? 28.763  27.338  13.213  1.00 23.58  ? 24  GLY A CA  1 
ATOM   204   C  C   . GLY A 1 24  ? 29.937  27.097  12.270  1.00 25.75  ? 24  GLY A C   1 
ATOM   205   O  O   . GLY A 1 24  ? 30.645  28.039  11.868  1.00 27.37  ? 24  GLY A O   1 
ATOM   206   N  N   . GLY A 1 25  ? 30.147  25.822  11.921  1.00 24.43  ? 25  GLY A N   1 
ATOM   207   C  CA  . GLY A 1 25  ? 31.298  25.398  11.133  1.00 22.01  ? 25  GLY A CA  1 
ATOM   208   C  C   . GLY A 1 25  ? 32.445  24.810  11.979  1.00 21.67  ? 25  GLY A C   1 
ATOM   209   O  O   . GLY A 1 25  ? 33.432  24.317  11.423  1.00 21.76  ? 25  GLY A O   1 
ATOM   210   N  N   . TRP A 1 26  ? 32.326  24.842  13.308  1.00 18.84  ? 26  TRP A N   1 
ATOM   211   C  CA  . TRP A 1 26  ? 33.420  24.390  14.174  1.00 18.04  ? 26  TRP A CA  1 
ATOM   212   C  C   . TRP A 1 26  ? 33.312  22.916  14.394  1.00 19.48  ? 26  TRP A C   1 
ATOM   213   O  O   . TRP A 1 26  ? 32.245  22.332  14.190  1.00 19.48  ? 26  TRP A O   1 
ATOM   214   C  CB  . TRP A 1 26  ? 33.363  25.088  15.540  1.00 15.28  ? 26  TRP A CB  1 
ATOM   215   C  CG  . TRP A 1 26  ? 33.433  26.587  15.437  1.00 13.95  ? 26  TRP A CG  1 
ATOM   216   C  CD1 . TRP A 1 26  ? 32.364  27.492  15.353  1.00 13.19  ? 26  TRP A CD1 1 
ATOM   217   C  CD2 . TRP A 1 26  ? 34.647  27.413  15.354  1.00 12.98  ? 26  TRP A CD2 1 
ATOM   218   N  NE1 . TRP A 1 26  ? 32.824  28.764  15.239  1.00 12.77  ? 26  TRP A NE1 1 
ATOM   219   C  CE2 . TRP A 1 26  ? 34.187  28.792  15.233  1.00 12.66  ? 26  TRP A CE2 1 
ATOM   220   C  CE3 . TRP A 1 26  ? 36.004  27.153  15.394  1.00 12.52  ? 26  TRP A CE3 1 
ATOM   221   C  CZ2 . TRP A 1 26  ? 35.062  29.847  15.178  1.00 12.66  ? 26  TRP A CZ2 1 
ATOM   222   C  CZ3 . TRP A 1 26  ? 36.880  28.223  15.313  1.00 13.26  ? 26  TRP A CZ3 1 
ATOM   223   C  CH2 . TRP A 1 26  ? 36.415  29.549  15.217  1.00 12.92  ? 26  TRP A CH2 1 
ATOM   224   N  N   . VAL A 1 27  ? 34.395  22.302  14.873  1.00 20.11  ? 27  VAL A N   1 
ATOM   225   C  CA  . VAL A 1 27  ? 34.340  20.908  15.254  1.00 20.98  ? 27  VAL A CA  1 
ATOM   226   C  C   . VAL A 1 27  ? 34.224  20.688  16.746  1.00 20.54  ? 27  VAL A C   1 
ATOM   227   O  O   . VAL A 1 27  ? 34.808  21.389  17.529  1.00 21.67  ? 27  VAL A O   1 
ATOM   228   C  CB  . VAL A 1 27  ? 35.431  20.007  14.564  1.00 22.76  ? 27  VAL A CB  1 
ATOM   229   C  CG1 . VAL A 1 27  ? 36.351  20.787  13.646  1.00 21.17  ? 27  VAL A CG1 1 
ATOM   230   C  CG2 . VAL A 1 27  ? 36.205  19.144  15.563  1.00 22.00  ? 27  VAL A CG2 1 
ATOM   231   N  N   . GLN A 1 28  ? 33.425  19.703  17.117  1.00 22.27  ? 28  GLN A N   1 
ATOM   232   C  CA  . GLN A 1 28  ? 33.316  19.271  18.506  1.00 23.13  ? 28  GLN A CA  1 
ATOM   233   C  C   . GLN A 1 28  ? 33.733  17.812  18.693  1.00 23.28  ? 28  GLN A C   1 
ATOM   234   O  O   . GLN A 1 28  ? 33.627  16.991  17.767  1.00 22.67  ? 28  GLN A O   1 
ATOM   235   C  CB  . GLN A 1 28  ? 31.891  19.511  19.016  1.00 22.12  ? 28  GLN A CB  1 
ATOM   236   C  CG  . GLN A 1 28  ? 31.366  20.960  18.870  1.00 21.92  ? 28  GLN A CG  1 
ATOM   237   C  CD  . GLN A 1 28  ? 32.083  22.038  19.713  1.00 23.01  ? 28  GLN A CD  1 
ATOM   238   O  OE1 . GLN A 1 28  ? 31.994  23.232  19.384  1.00 24.14  ? 28  GLN A OE1 1 
ATOM   239   N  NE2 . GLN A 1 28  ? 32.769  21.644  20.807  1.00 22.81  ? 28  GLN A NE2 1 
ATOM   240   N  N   . LEU A 1 29  ? 34.210  17.485  19.891  1.00 23.05  ? 29  LEU A N   1 
ATOM   241   C  CA  . LEU A 1 29  ? 34.570  16.114  20.220  1.00 21.31  ? 29  LEU A CA  1 
ATOM   242   C  C   . LEU A 1 29  ? 33.485  15.525  21.140  1.00 21.43  ? 29  LEU A C   1 
ATOM   243   O  O   . LEU A 1 29  ? 33.210  16.096  22.172  1.00 19.48  ? 29  LEU A O   1 
ATOM   244   C  CB  . LEU A 1 29  ? 35.963  16.077  20.867  1.00 20.81  ? 29  LEU A CB  1 
ATOM   245   C  CG  . LEU A 1 29  ? 36.626  14.682  21.024  1.00 21.75  ? 29  LEU A CG  1 
ATOM   246   C  CD1 . LEU A 1 29  ? 36.918  13.990  19.686  1.00 20.30  ? 29  LEU A CD1 1 
ATOM   247   C  CD2 . LEU A 1 29  ? 37.897  14.766  21.835  1.00 20.78  ? 29  LEU A CD2 1 
ATOM   248   N  N   . GLN A 1 30  ? 32.833  14.416  20.771  1.00 23.21  ? 30  GLN A N   1 
ATOM   249   C  CA  . GLN A 1 30  ? 31.816  13.842  21.690  1.00 24.86  ? 30  GLN A CA  1 
ATOM   250   C  C   . GLN A 1 30  ? 32.275  12.531  22.267  1.00 23.88  ? 30  GLN A C   1 
ATOM   251   O  O   . GLN A 1 30  ? 32.761  11.674  21.511  1.00 22.37  ? 30  GLN A O   1 
ATOM   252   C  CB  . GLN A 1 30  ? 30.473  13.551  21.019  1.00 27.70  ? 30  GLN A CB  1 
ATOM   253   C  CG  . GLN A 1 30  ? 29.855  14.642  20.192  1.00 34.05  ? 30  GLN A CG  1 
ATOM   254   C  CD  . GLN A 1 30  ? 28.499  14.216  19.632  1.00 37.33  ? 30  GLN A CD  1 
ATOM   255   O  OE1 . GLN A 1 30  ? 28.365  13.174  18.974  1.00 36.45  ? 30  GLN A OE1 1 
ATOM   256   N  NE2 . GLN A 1 30  ? 27.493  15.039  19.870  1.00 39.77  ? 30  GLN A NE2 1 
ATOM   257   N  N   . HIS A 1 31  ? 32.098  12.371  23.580  1.00 23.24  ? 31  HIS A N   1 
ATOM   258   C  CA  . HIS A 1 31  ? 32.415  11.124  24.264  1.00 25.66  ? 31  HIS A CA  1 
ATOM   259   C  C   . HIS A 1 31  ? 31.159  10.372  24.646  1.00 28.97  ? 31  HIS A C   1 
ATOM   260   O  O   . HIS A 1 31  ? 30.520  10.649  25.666  1.00 27.88  ? 31  HIS A O   1 
ATOM   261   C  CB  . HIS A 1 31  ? 33.232  11.381  25.510  1.00 22.98  ? 31  HIS A CB  1 
ATOM   262   C  CG  . HIS A 1 31  ? 34.541  12.091  25.256  1.00 24.07  ? 31  HIS A CG  1 
ATOM   263   N  ND1 . HIS A 1 31  ? 35.735  11.430  25.145  1.00 22.84  ? 31  HIS A ND1 1 
ATOM   264   C  CD2 . HIS A 1 31  ? 34.829  13.446  25.154  1.00 21.37  ? 31  HIS A CD2 1 
ATOM   265   C  CE1 . HIS A 1 31  ? 36.708  12.319  24.975  1.00 21.57  ? 31  HIS A CE1 1 
ATOM   266   N  NE2 . HIS A 1 31  ? 36.151  13.558  24.989  1.00 22.69  ? 31  HIS A NE2 1 
ATOM   267   N  N   . HIS A 1 32  ? 30.811  9.395   23.833  1.00 33.49  ? 32  HIS A N   1 
ATOM   268   C  CA  . HIS A 1 32  ? 29.571  8.636   24.013  1.00 39.73  ? 32  HIS A CA  1 
ATOM   269   C  C   . HIS A 1 32  ? 29.776  7.192   24.536  1.00 36.32  ? 32  HIS A C   1 
ATOM   270   O  O   . HIS A 1 32  ? 29.205  6.837   25.549  1.00 33.58  ? 32  HIS A O   1 
ATOM   271   C  CB  . HIS A 1 32  ? 28.746  8.698   22.715  1.00 50.30  ? 32  HIS A CB  1 
ATOM   272   C  CG  . HIS A 1 32  ? 29.317  7.851   21.582  1.00 70.19  ? 32  HIS A CG  1 
ATOM   273   N  ND1 . HIS A 1 32  ? 30.655  7.783   21.308  1.00 76.96  ? 32  HIS A ND1 1 
ATOM   274   C  CD2 . HIS A 1 32  ? 28.684  7.006   20.655  1.00 79.75  ? 32  HIS A CD2 1 
ATOM   275   C  CE1 . HIS A 1 32  ? 30.859  6.941   20.269  1.00 80.25  ? 32  HIS A CE1 1 
ATOM   276   N  NE2 . HIS A 1 32  ? 29.653  6.468   19.868  1.00 86.95  ? 32  HIS A NE2 1 
ATOM   277   N  N   . SER A 1 33  ? 30.575  6.355   23.867  1.00 35.09  ? 33  SER A N   1 
ATOM   278   C  CA  . SER A 1 33  ? 30.869  5.000   24.358  1.00 38.25  ? 33  SER A CA  1 
ATOM   279   C  C   . SER A 1 33  ? 32.317  4.980   24.707  1.00 36.69  ? 33  SER A C   1 
ATOM   280   O  O   . SER A 1 33  ? 33.030  5.859   24.262  1.00 36.10  ? 33  SER A O   1 
ATOM   281   C  CB  . SER A 1 33  ? 30.579  3.933   23.298  1.00 37.25  ? 33  SER A CB  1 
ATOM   282   O  OG  . SER A 1 33  ? 31.493  4.016   22.243  1.00 38.49  ? 33  SER A OG  1 
ATOM   283   N  N   . LYS A 1 34  ? 32.771  3.978   25.462  1.00 39.61  ? 34  LYS A N   1 
ATOM   284   C  CA  . LYS A 1 34  ? 34.104  4.065   26.111  1.00 43.32  ? 34  LYS A CA  1 
ATOM   285   C  C   . LYS A 1 34  ? 35.345  3.749   25.221  1.00 42.54  ? 34  LYS A C   1 
ATOM   286   O  O   . LYS A 1 34  ? 35.276  2.923   24.296  1.00 40.29  ? 34  LYS A O   1 
ATOM   287   C  CB  . LYS A 1 34  ? 34.120  3.304   27.454  1.00 51.22  ? 34  LYS A CB  1 
ATOM   288   C  CG  . LYS A 1 34  ? 32.936  3.618   28.399  1.00 57.68  ? 34  LYS A CG  1 
ATOM   289   C  CD  . LYS A 1 34  ? 32.745  5.123   28.653  1.00 56.24  ? 34  LYS A CD  1 
ATOM   290   C  CE  . LYS A 1 34  ? 32.085  5.436   30.000  1.00 57.59  ? 34  LYS A CE  1 
ATOM   291   N  NZ  . LYS A 1 34  ? 30.601  5.603   29.956  1.00 51.38  ? 34  LYS A NZ  1 
ATOM   292   N  N   . GLY A 1 35  ? 36.446  4.465   25.497  1.00 38.69  ? 35  GLY A N   1 
ATOM   293   C  CA  . GLY A 1 35  ? 37.705  4.410   24.725  1.00 37.26  ? 35  GLY A CA  1 
ATOM   294   C  C   . GLY A 1 35  ? 37.666  4.985   23.304  1.00 34.90  ? 35  GLY A C   1 
ATOM   295   O  O   . GLY A 1 35  ? 38.393  4.540   22.422  1.00 33.14  ? 35  GLY A O   1 
ATOM   296   N  N   . GLU A 1 36  ? 36.818  5.974   23.072  1.00 31.80  ? 36  GLU A N   1 
ATOM   297   C  CA  . GLU A 1 36  ? 36.438  6.324   21.706  1.00 30.76  ? 36  GLU A CA  1 
ATOM   298   C  C   . GLU A 1 36  ? 35.760  7.688   21.730  1.00 24.58  ? 36  GLU A C   1 
ATOM   299   O  O   . GLU A 1 36  ? 35.012  7.984   22.655  1.00 22.96  ? 36  GLU A O   1 
ATOM   300   C  CB  . GLU A 1 36  ? 35.505  5.220   21.149  1.00 34.72  ? 36  GLU A CB  1 
ATOM   301   C  CG  . GLU A 1 36  ? 35.043  5.348   19.701  1.00 42.25  ? 36  GLU A CG  1 
ATOM   302   C  CD  . GLU A 1 36  ? 34.426  4.052   19.127  1.00 49.80  ? 36  GLU A CD  1 
ATOM   303   O  OE1 . GLU A 1 36  ? 34.995  2.954   19.344  1.00 57.56  ? 36  GLU A OE1 1 
ATOM   304   O  OE2 . GLU A 1 36  ? 33.387  4.113   18.420  1.00 51.65  ? 36  GLU A OE2 1 
ATOM   305   N  N   . ALA A 1 37  ? 36.053  8.542   20.764  1.00 20.63  ? 37  ALA A N   1 
ATOM   306   C  CA  . ALA A 1 37  ? 35.302  9.793   20.660  1.00 21.49  ? 37  ALA A CA  1 
ATOM   307   C  C   . ALA A 1 37  ? 35.001  10.136  19.217  1.00 21.40  ? 37  ALA A C   1 
ATOM   308   O  O   . ALA A 1 37  ? 35.753  9.777   18.318  1.00 21.66  ? 37  ALA A O   1 
ATOM   309   C  CB  . ALA A 1 37  ? 36.027  10.945  21.341  1.00 19.17  ? 37  ALA A CB  1 
ATOM   310   N  N   . LYS A 1 38  ? 33.910  10.847  19.004  1.00 22.81  ? 38  LYS A N   1 
ATOM   311   C  CA  . LYS A 1 38  ? 33.543  11.265  17.668  1.00 24.44  ? 38  LYS A CA  1 
ATOM   312   C  C   . LYS A 1 38  ? 33.859  12.737  17.464  1.00 23.59  ? 38  LYS A C   1 
ATOM   313   O  O   . LYS A 1 38  ? 33.495  13.575  18.288  1.00 24.61  ? 38  LYS A O   1 
ATOM   314   C  CB  . LYS A 1 38  ? 32.060  11.000  17.406  1.00 27.08  ? 38  LYS A CB  1 
ATOM   315   C  CG  . LYS A 1 38  ? 31.544  9.642   17.864  1.00 33.50  ? 38  LYS A CG  1 
ATOM   316   C  CD  . LYS A 1 38  ? 30.463  9.082   16.937  1.00 38.65  ? 38  LYS A CD  1 
ATOM   317   C  CE  . LYS A 1 38  ? 30.994  7.832   16.206  1.00 42.89  ? 38  LYS A CE  1 
ATOM   318   N  NZ  . LYS A 1 38  ? 30.249  7.384   14.993  1.00 41.82  ? 38  LYS A NZ  1 
ATOM   319   N  N   . LEU A 1 39  ? 34.541  13.057  16.377  1.00 23.58  ? 39  LEU A N   1 
ATOM   320   C  CA  . LEU A 1 39  ? 34.642  14.449  15.937  1.00 26.00  ? 39  LEU A CA  1 
ATOM   321   C  C   . LEU A 1 39  ? 33.494  14.753  14.966  1.00 27.65  ? 39  LEU A C   1 
ATOM   322   O  O   . LEU A 1 39  ? 33.359  14.070  13.944  1.00 28.95  ? 39  LEU A O   1 
ATOM   323   C  CB  . LEU A 1 39  ? 35.981  14.713  15.255  1.00 24.81  ? 39  LEU A CB  1 
ATOM   324   C  CG  . LEU A 1 39  ? 37.312  14.783  16.018  1.00 25.02  ? 39  LEU A CG  1 
ATOM   325   C  CD1 . LEU A 1 39  ? 38.461  14.996  15.036  1.00 25.29  ? 39  LEU A CD1 1 
ATOM   326   C  CD2 . LEU A 1 39  ? 37.328  15.888  17.065  1.00 24.88  ? 39  LEU A CD2 1 
ATOM   327   N  N   . LEU A 1 40  ? 32.638  15.722  15.310  1.00 29.19  ? 40  LEU A N   1 
ATOM   328   C  CA  . LEU A 1 40  ? 31.658  16.255  14.349  1.00 33.56  ? 40  LEU A CA  1 
ATOM   329   C  C   . LEU A 1 40  ? 31.928  17.683  13.889  1.00 33.07  ? 40  LEU A C   1 
ATOM   330   O  O   . LEU A 1 40  ? 32.297  18.537  14.691  1.00 29.76  ? 40  LEU A O   1 
ATOM   331   C  CB  . LEU A 1 40  ? 30.200  16.163  14.813  1.00 34.86  ? 40  LEU A CB  1 
ATOM   332   C  CG  . LEU A 1 40  ? 29.777  16.051  16.247  1.00 35.12  ? 40  LEU A CG  1 
ATOM   333   C  CD1 . LEU A 1 40  ? 28.638  17.021  16.558  1.00 35.00  ? 40  LEU A CD1 1 
ATOM   334   C  CD2 . LEU A 1 40  ? 29.336  14.592  16.345  1.00 39.50  ? 40  LEU A CD2 1 
ATOM   335   N  N   . LYS A 1 41  ? 31.731  17.908  12.588  1.00 35.07  ? 41  LYS A N   1 
ATOM   336   C  CA  . LYS A 1 41  ? 31.777  19.230  11.992  1.00 38.71  ? 41  LYS A CA  1 
ATOM   337   C  C   . LYS A 1 41  ? 30.381  19.503  11.477  1.00 42.77  ? 41  LYS A C   1 
ATOM   338   O  O   . LYS A 1 41  ? 29.852  18.692  10.724  1.00 45.03  ? 41  LYS A O   1 
ATOM   339   C  CB  . LYS A 1 41  ? 32.778  19.265  10.851  1.00 37.97  ? 41  LYS A CB  1 
ATOM   340   C  CG  . LYS A 1 41  ? 33.235  20.674  10.524  1.00 41.81  ? 41  LYS A CG  1 
ATOM   341   C  CD  . LYS A 1 41  ? 33.855  20.818  9.143   1.00 42.96  ? 41  LYS A CD  1 
ATOM   342   C  CE  . LYS A 1 41  ? 35.142  20.022  8.994   1.00 46.46  ? 41  LYS A CE  1 
ATOM   343   N  NZ  . LYS A 1 41  ? 35.544  19.921  7.555   1.00 56.51  ? 41  LYS A NZ  1 
ATOM   344   N  N   . ASP A 1 42  ? 29.801  20.650  11.852  1.00 50.95  ? 42  ASP A N   1 
ATOM   345   C  CA  . ASP A 1 42  ? 28.336  20.881  11.706  1.00 50.17  ? 42  ASP A CA  1 
ATOM   346   C  C   . ASP A 1 42  ? 27.663  19.803  10.820  1.00 51.80  ? 42  ASP A C   1 
ATOM   347   O  O   . ASP A 1 42  ? 27.916  19.711  9.593   1.00 50.80  ? 42  ASP A O   1 
ATOM   348   C  CB  . ASP A 1 42  ? 27.953  22.341  11.323  1.00 45.99  ? 42  ASP A CB  1 
ATOM   349   C  CG  . ASP A 1 42  ? 27.598  23.253  12.553  1.00 38.49  ? 42  ASP A CG  1 
ATOM   350   O  OD1 . ASP A 1 42  ? 28.299  24.240  12.736  1.00 36.33  ? 42  ASP A OD1 1 
ATOM   351   O  OD2 . ASP A 1 42  ? 26.622  23.055  13.294  1.00 31.00  ? 42  ASP A OD2 1 
ATOM   352   N  N   . GLY A 1 43  ? 26.853  18.979  11.501  1.00 45.99  ? 43  GLY A N   1 
ATOM   353   C  CA  . GLY A 1 43  ? 26.128  17.882  10.922  1.00 44.71  ? 43  GLY A CA  1 
ATOM   354   C  C   . GLY A 1 43  ? 26.667  16.537  11.383  1.00 45.22  ? 43  GLY A C   1 
ATOM   355   O  O   . GLY A 1 43  ? 26.190  15.935  12.364  1.00 42.48  ? 43  GLY A O   1 
ATOM   356   N  N   . LYS A 1 44  ? 27.692  16.095  10.670  1.00 43.80  ? 44  LYS A N   1 
ATOM   357   C  CA  . LYS A 1 44  ? 28.102  14.697  10.642  1.00 45.81  ? 44  LYS A CA  1 
ATOM   358   C  C   . LYS A 1 44  ? 29.341  14.399  11.473  1.00 41.99  ? 44  LYS A C   1 
ATOM   359   O  O   . LYS A 1 44  ? 30.271  15.209  11.555  1.00 39.26  ? 44  LYS A O   1 
ATOM   360   C  CB  . LYS A 1 44  ? 28.380  14.259  9.191   1.00 49.23  ? 44  LYS A CB  1 
ATOM   361   C  CG  . LYS A 1 44  ? 27.327  14.700  8.175   1.00 54.71  ? 44  LYS A CG  1 
ATOM   362   C  CD  . LYS A 1 44  ? 27.943  15.233  6.874   1.00 55.62  ? 44  LYS A CD  1 
ATOM   363   C  CE  . LYS A 1 44  ? 27.419  16.648  6.611   1.00 56.22  ? 44  LYS A CE  1 
ATOM   364   N  NZ  . LYS A 1 44  ? 27.686  17.252  5.280   1.00 50.78  ? 44  LYS A NZ  1 
ATOM   365   N  N   . VAL A 1 45  ? 29.323  13.217  12.085  1.00 38.22  ? 45  VAL A N   1 
ATOM   366   C  CA  . VAL A 1 45  ? 30.525  12.527  12.524  1.00 37.05  ? 45  VAL A CA  1 
ATOM   367   C  C   . VAL A 1 45  ? 31.490  12.287  11.360  1.00 38.09  ? 45  VAL A C   1 
ATOM   368   O  O   . VAL A 1 45  ? 31.214  11.460  10.501  1.00 36.29  ? 45  VAL A O   1 
ATOM   369   C  CB  . VAL A 1 45  ? 30.166  11.138  13.058  1.00 35.76  ? 45  VAL A CB  1 
ATOM   370   C  CG1 . VAL A 1 45  ? 31.425  10.426  13.538  1.00 35.59  ? 45  VAL A CG1 1 
ATOM   371   C  CG2 . VAL A 1 45  ? 29.131  11.247  14.169  1.00 34.49  ? 45  VAL A CG2 1 
ATOM   372   N  N   . PHE A 1 46  ? 32.625  12.975  11.322  1.00 37.32  ? 46  PHE A N   1 
ATOM   373   C  CA  . PHE A 1 46  ? 33.558  12.753  10.212  1.00 36.24  ? 46  PHE A CA  1 
ATOM   374   C  C   . PHE A 1 46  ? 34.854  12.007  10.588  1.00 34.76  ? 46  PHE A C   1 
ATOM   375   O  O   . PHE A 1 46  ? 35.719  11.775  9.723   1.00 35.61  ? 46  PHE A O   1 
ATOM   376   C  CB  . PHE A 1 46  ? 33.910  14.079  9.542   1.00 38.90  ? 46  PHE A CB  1 
ATOM   377   C  CG  . PHE A 1 46  ? 34.888  14.894  10.320  1.00 38.86  ? 46  PHE A CG  1 
ATOM   378   C  CD1 . PHE A 1 46  ? 36.240  14.828  10.027  1.00 39.47  ? 46  PHE A CD1 1 
ATOM   379   C  CD2 . PHE A 1 46  ? 34.456  15.719  11.347  1.00 37.66  ? 46  PHE A CD2 1 
ATOM   380   C  CE1 . PHE A 1 46  ? 37.157  15.563  10.731  1.00 38.46  ? 46  PHE A CE1 1 
ATOM   381   C  CE2 . PHE A 1 46  ? 35.370  16.470  12.055  1.00 39.15  ? 46  PHE A CE2 1 
ATOM   382   C  CZ  . PHE A 1 46  ? 36.724  16.379  11.754  1.00 39.44  ? 46  PHE A CZ  1 
ATOM   383   N  N   . ARG A 1 47  ? 35.001  11.636  11.856  1.00 29.76  ? 47  ARG A N   1 
ATOM   384   C  CA  . ARG A 1 47  ? 36.173  10.894  12.269  1.00 27.02  ? 47  ARG A CA  1 
ATOM   385   C  C   . ARG A 1 47  ? 36.006  10.318  13.672  1.00 27.11  ? 47  ARG A C   1 
ATOM   386   O  O   . ARG A 1 47  ? 35.538  10.999  14.568  1.00 27.41  ? 47  ARG A O   1 
ATOM   387   C  CB  . ARG A 1 47  ? 37.395  11.783  12.167  1.00 25.70  ? 47  ARG A CB  1 
ATOM   388   C  CG  . ARG A 1 47  ? 38.692  11.072  12.416  1.00 28.59  ? 47  ARG A CG  1 
ATOM   389   C  CD  . ARG A 1 47  ? 39.873  11.943  12.023  1.00 28.89  ? 47  ARG A CD  1 
ATOM   390   N  NE  . ARG A 1 47  ? 40.861  11.111  11.345  1.00 30.21  ? 47  ARG A NE  1 
ATOM   391   C  CZ  . ARG A 1 47  ? 41.965  11.567  10.775  1.00 30.08  ? 47  ARG A CZ  1 
ATOM   392   N  NH1 . ARG A 1 47  ? 42.259  12.872  10.821  1.00 32.38  ? 47  ARG A NH1 1 
ATOM   393   N  NH2 . ARG A 1 47  ? 42.772  10.711  10.173  1.00 27.63  ? 47  ARG A NH2 1 
ATOM   394   N  N   . VAL A 1 48  ? 36.377  9.052   13.864  1.00 27.49  ? 48  VAL A N   1 
ATOM   395   C  CA  . VAL A 1 48  ? 36.294  8.440   15.185  1.00 26.30  ? 48  VAL A CA  1 
ATOM   396   C  C   . VAL A 1 48  ? 37.695  8.257   15.694  1.00 24.47  ? 48  VAL A C   1 
ATOM   397   O  O   . VAL A 1 48  ? 38.501  7.627   15.019  1.00 22.63  ? 48  VAL A O   1 
ATOM   398   C  CB  . VAL A 1 48  ? 35.573  7.080   15.152  1.00 28.27  ? 48  VAL A CB  1 
ATOM   399   C  CG1 . VAL A 1 48  ? 35.593  6.435   16.535  1.00 28.98  ? 48  VAL A CG1 1 
ATOM   400   C  CG2 . VAL A 1 48  ? 34.121  7.246   14.692  1.00 28.71  ? 48  VAL A CG2 1 
ATOM   401   N  N   . VAL A 1 49  ? 37.984  8.825   16.869  1.00 22.82  ? 49  VAL A N   1 
ATOM   402   C  CA  . VAL A 1 49  ? 39.327  8.730   17.441  1.00 24.09  ? 49  VAL A CA  1 
ATOM   403   C  C   . VAL A 1 49  ? 39.322  8.040   18.798  1.00 24.24  ? 49  VAL A C   1 
ATOM   404   O  O   . VAL A 1 49  ? 38.312  8.032   19.499  1.00 24.87  ? 49  VAL A O   1 
ATOM   405   C  CB  . VAL A 1 49  ? 40.088  10.093  17.476  1.00 23.48  ? 49  VAL A CB  1 
ATOM   406   C  CG1 . VAL A 1 49  ? 39.943  10.836  16.146  1.00 23.09  ? 49  VAL A CG1 1 
ATOM   407   C  CG2 . VAL A 1 49  ? 39.626  10.965  18.636  1.00 23.25  ? 49  VAL A CG2 1 
ATOM   408   N  N   . ARG A 1 50  ? 40.457  7.443   19.140  1.00 25.24  ? 50  ARG A N   1 
ATOM   409   C  CA  . ARG A 1 50  ? 40.583  6.613   20.345  1.00 26.49  ? 50  ARG A CA  1 
ATOM   410   C  C   . ARG A 1 50  ? 41.231  7.447   21.412  1.00 24.63  ? 50  ARG A C   1 
ATOM   411   O  O   . ARG A 1 50  ? 41.614  8.577   21.135  1.00 25.05  ? 50  ARG A O   1 
ATOM   412   C  CB  . ARG A 1 50  ? 41.387  5.329   20.062  1.00 29.65  ? 50  ARG A CB  1 
ATOM   413   C  CG  . ARG A 1 50  ? 40.621  4.302   19.220  1.00 35.77  ? 50  ARG A CG  1 
ATOM   414   C  CD  . ARG A 1 50  ? 41.318  2.943   19.212  1.00 42.95  ? 50  ARG A CD  1 
ATOM   415   N  NE  . ARG A 1 50  ? 40.643  1.942   18.368  1.00 50.95  ? 50  ARG A NE  1 
ATOM   416   C  CZ  . ARG A 1 50  ? 41.092  0.702   18.102  1.00 52.09  ? 50  ARG A CZ  1 
ATOM   417   N  NH1 . ARG A 1 50  ? 42.246  0.255   18.603  1.00 53.62  ? 50  ARG A NH1 1 
ATOM   418   N  NH2 . ARG A 1 50  ? 40.362  -0.112  17.348  1.00 44.79  ? 50  ARG A NH2 1 
ATOM   419   N  N   . GLU A 1 51  ? 41.376  6.896   22.612  1.00 22.38  ? 51  GLU A N   1 
ATOM   420   C  CA  . GLU A 1 51  ? 41.925  7.644   23.736  1.00 24.53  ? 51  GLU A CA  1 
ATOM   421   C  C   . GLU A 1 51  ? 43.376  8.145   23.569  1.00 20.95  ? 51  GLU A C   1 
ATOM   422   O  O   . GLU A 1 51  ? 43.776  9.105   24.240  1.00 17.91  ? 51  GLU A O   1 
ATOM   423   C  CB  . GLU A 1 51  ? 41.765  6.876   25.050  1.00 26.48  ? 51  GLU A CB  1 
ATOM   424   C  CG  . GLU A 1 51  ? 42.312  5.471   24.978  1.00 34.71  ? 51  GLU A CG  1 
ATOM   425   C  CD  . GLU A 1 51  ? 41.942  4.586   26.174  1.00 44.05  ? 51  GLU A CD  1 
ATOM   426   O  OE1 . GLU A 1 51  ? 41.427  5.098   27.216  1.00 43.55  ? 51  GLU A OE1 1 
ATOM   427   O  OE2 . GLU A 1 51  ? 42.180  3.352   26.063  1.00 47.27  ? 51  GLU A OE2 1 
ATOM   428   N  N   . ASN A 1 52  ? 44.145  7.517   22.679  1.00 17.80  ? 52  ASN A N   1 
ATOM   429   C  CA  . ASN A 1 52  ? 45.534  7.937   22.502  1.00 18.04  ? 52  ASN A CA  1 
ATOM   430   C  C   . ASN A 1 52  ? 45.587  9.314   21.832  1.00 18.38  ? 52  ASN A C   1 
ATOM   431   O  O   . ASN A 1 52  ? 46.645  9.973   21.739  1.00 19.58  ? 52  ASN A O   1 
ATOM   432   C  CB  . ASN A 1 52  ? 46.352  6.891   21.732  1.00 15.50  ? 52  ASN A CB  1 
ATOM   433   C  CG  . ASN A 1 52  ? 45.698  6.467   20.443  1.00 15.18  ? 52  ASN A CG  1 
ATOM   434   O  OD1 . ASN A 1 52  ? 44.638  6.921   20.071  1.00 13.84  ? 52  ASN A OD1 1 
ATOM   435   N  ND2 . ASN A 1 52  ? 46.348  5.587   19.745  1.00 16.29  ? 52  ASN A ND2 1 
ATOM   436   N  N   . CYS A 1 53  ? 44.427  9.757   21.390  1.00 18.50  ? 53  CYS A N   1 
ATOM   437   C  CA  . CYS A 1 53  ? 44.346  11.014  20.712  1.00 20.10  ? 53  CYS A CA  1 
ATOM   438   C  C   . CYS A 1 53  ? 44.164  12.156  21.705  1.00 19.82  ? 53  CYS A C   1 
ATOM   439   O  O   . CYS A 1 53  ? 44.338  13.307  21.330  1.00 21.16  ? 53  CYS A O   1 
ATOM   440   C  CB  . CYS A 1 53  ? 43.238  10.976  19.672  1.00 21.56  ? 53  CYS A CB  1 
ATOM   441   S  SG  . CYS A 1 53  ? 43.159  12.447  18.634  1.00 28.85  ? 53  CYS A SG  1 
ATOM   442   N  N   . TRP A 1 54  ? 43.848  11.854  22.959  1.00 18.25  ? 54  TRP A N   1 
ATOM   443   C  CA  . TRP A 1 54  ? 43.672  12.903  23.957  1.00 18.73  ? 54  TRP A CA  1 
ATOM   444   C  C   . TRP A 1 54  ? 44.326  12.662  25.279  1.00 18.21  ? 54  TRP A C   1 
ATOM   445   O  O   . TRP A 1 54  ? 44.555  13.577  26.029  1.00 18.18  ? 54  TRP A O   1 
ATOM   446   C  CB  . TRP A 1 54  ? 42.177  13.268  24.149  1.00 20.01  ? 54  TRP A CB  1 
ATOM   447   C  CG  . TRP A 1 54  ? 41.191  12.122  23.952  1.00 21.21  ? 54  TRP A CG  1 
ATOM   448   C  CD1 . TRP A 1 54  ? 40.602  11.643  22.749  1.00 21.11  ? 54  TRP A CD1 1 
ATOM   449   C  CD2 . TRP A 1 54  ? 40.636  11.293  24.992  1.00 20.74  ? 54  TRP A CD2 1 
ATOM   450   N  NE1 . TRP A 1 54  ? 39.759  10.579  22.985  1.00 20.62  ? 54  TRP A NE1 1 
ATOM   451   C  CE2 . TRP A 1 54  ? 39.733  10.316  24.313  1.00 22.65  ? 54  TRP A CE2 1 
ATOM   452   C  CE3 . TRP A 1 54  ? 40.783  11.254  26.346  1.00 20.67  ? 54  TRP A CE3 1 
ATOM   453   C  CZ2 . TRP A 1 54  ? 39.042  9.367   25.009  1.00 23.51  ? 54  TRP A CZ2 1 
ATOM   454   C  CZ3 . TRP A 1 54  ? 40.088  10.300  27.040  1.00 25.07  ? 54  TRP A CZ3 1 
ATOM   455   C  CH2 . TRP A 1 54  ? 39.237  9.368   26.385  1.00 28.47  ? 54  TRP A CH2 1 
ATOM   456   N  N   . ASP A 1 55  ? 44.621  11.416  25.607  1.00 19.89  ? 55  ASP A N   1 
ATOM   457   C  CA  . ASP A 1 55  ? 45.035  11.076  26.988  1.00 20.62  ? 55  ASP A CA  1 
ATOM   458   C  C   . ASP A 1 55  ? 46.544  10.800  27.058  1.00 18.70  ? 55  ASP A C   1 
ATOM   459   O  O   . ASP A 1 55  ? 46.984  9.779   26.625  1.00 18.48  ? 55  ASP A O   1 
ATOM   460   C  CB  . ASP A 1 55  ? 44.172  9.912   27.499  1.00 21.56  ? 55  ASP A CB  1 
ATOM   461   C  CG  . ASP A 1 55  ? 44.564  9.412   28.897  1.00 24.93  ? 55  ASP A CG  1 
ATOM   462   O  OD1 . ASP A 1 55  ? 45.732  9.575   29.330  1.00 24.05  ? 55  ASP A OD1 1 
ATOM   463   O  OD2 . ASP A 1 55  ? 43.680  8.788   29.559  1.00 27.95  ? 55  ASP A OD2 1 
ATOM   464   N  N   . PRO A 1 56  ? 47.332  11.730  27.610  1.00 19.26  ? 56  PRO A N   1 
ATOM   465   C  CA  . PRO A 1 56  ? 48.787  11.583  27.512  1.00 19.49  ? 56  PRO A CA  1 
ATOM   466   C  C   . PRO A 1 56  ? 49.359  10.318  28.172  1.00 20.53  ? 56  PRO A C   1 
ATOM   467   O  O   . PRO A 1 56  ? 50.378  9.820   27.701  1.00 19.79  ? 56  PRO A O   1 
ATOM   468   C  CB  . PRO A 1 56  ? 49.349  12.858  28.172  1.00 19.16  ? 56  PRO A CB  1 
ATOM   469   C  CG  . PRO A 1 56  ? 48.219  13.537  28.821  1.00 19.42  ? 56  PRO A CG  1 
ATOM   470   C  CD  . PRO A 1 56  ? 46.919  12.953  28.333  1.00 19.35  ? 56  PRO A CD  1 
ATOM   471   N  N   . GLU A 1 57  ? 48.711  9.819   29.228  1.00 21.64  ? 57  GLU A N   1 
ATOM   472   C  CA  . GLU A 1 57  ? 49.125  8.589   29.904  1.00 24.56  ? 57  GLU A CA  1 
ATOM   473   C  C   . GLU A 1 57  ? 49.138  7.433   28.923  1.00 23.23  ? 57  GLU A C   1 
ATOM   474   O  O   . GLU A 1 57  ? 50.080  6.654   28.889  1.00 21.53  ? 57  GLU A O   1 
ATOM   475   C  CB  . GLU A 1 57  ? 48.168  8.222   31.061  1.00 28.71  ? 57  GLU A CB  1 
ATOM   476   C  CG  . GLU A 1 57  ? 48.589  8.603   32.485  1.00 36.43  ? 57  GLU A CG  1 
ATOM   477   C  CD  . GLU A 1 57  ? 47.501  8.277   33.555  1.00 43.55  ? 57  GLU A CD  1 
ATOM   478   O  OE1 . GLU A 1 57  ? 47.130  7.081   33.759  1.00 46.73  ? 57  GLU A OE1 1 
ATOM   479   O  OE2 . GLU A 1 57  ? 46.999  9.228   34.204  1.00 42.95  ? 57  GLU A OE2 1 
ATOM   480   N  N   . VAL A 1 58  ? 48.055  7.303   28.154  1.00 21.60  ? 58  VAL A N   1 
ATOM   481   C  CA  . VAL A 1 58  ? 47.965  6.306   27.127  1.00 20.40  ? 58  VAL A CA  1 
ATOM   482   C  C   . VAL A 1 58  ? 49.090  6.523   26.109  1.00 20.98  ? 58  VAL A C   1 
ATOM   483   O  O   . VAL A 1 58  ? 49.812  5.574   25.796  1.00 20.95  ? 58  VAL A O   1 
ATOM   484   C  CB  . VAL A 1 58  ? 46.573  6.297   26.480  1.00 21.22  ? 58  VAL A CB  1 
ATOM   485   C  CG1 . VAL A 1 58  ? 46.453  5.207   25.431  1.00 20.80  ? 58  VAL A CG1 1 
ATOM   486   C  CG2 . VAL A 1 58  ? 45.519  6.092   27.550  1.00 21.41  ? 58  VAL A CG2 1 
ATOM   487   N  N   . ARG A 1 59  ? 49.309  7.756   25.647  1.00 18.92  ? 59  ARG A N   1 
ATOM   488   C  CA  . ARG A 1 59  ? 50.380  7.944   24.643  1.00 19.72  ? 59  ARG A CA  1 
ATOM   489   C  C   . ARG A 1 59  ? 51.717  7.497   25.216  1.00 18.93  ? 59  ARG A C   1 
ATOM   490   O  O   . ARG A 1 59  ? 52.472  6.762   24.566  1.00 17.03  ? 59  ARG A O   1 
ATOM   491   C  CB  . ARG A 1 59  ? 50.448  9.369   24.048  1.00 17.27  ? 59  ARG A CB  1 
ATOM   492   C  CG  . ARG A 1 59  ? 49.139  9.862   23.488  1.00 16.41  ? 59  ARG A CG  1 
ATOM   493   C  CD  . ARG A 1 59  ? 49.237  11.332  23.148  1.00 15.88  ? 59  ARG A CD  1 
ATOM   494   N  NE  . ARG A 1 59  ? 49.967  11.640  21.909  1.00 15.04  ? 59  ARG A NE  1 
ATOM   495   C  CZ  . ARG A 1 59  ? 49.372  11.985  20.766  1.00 13.51  ? 59  ARG A CZ  1 
ATOM   496   N  NH1 . ARG A 1 59  ? 48.060  12.004  20.687  1.00 13.32  ? 59  ARG A NH1 1 
ATOM   497   N  NH2 . ARG A 1 59  ? 50.080  12.303  19.706  1.00 12.51  ? 59  ARG A NH2 1 
ATOM   498   N  N   . ILE A 1 60  ? 52.004  7.904   26.446  1.00 21.55  ? 60  ILE A N   1 
ATOM   499   C  CA  . ILE A 1 60  ? 53.248  7.438   27.044  1.00 24.63  ? 60  ILE A CA  1 
ATOM   500   C  C   . ILE A 1 60  ? 53.396  5.918   26.966  1.00 25.04  ? 60  ILE A C   1 
ATOM   501   O  O   . ILE A 1 60  ? 54.449  5.416   26.567  1.00 26.54  ? 60  ILE A O   1 
ATOM   502   C  CB  . ILE A 1 60  ? 53.527  8.025   28.442  1.00 27.48  ? 60  ILE A CB  1 
ATOM   503   C  CG1 . ILE A 1 60  ? 54.331  9.297   28.256  1.00 27.33  ? 60  ILE A CG1 1 
ATOM   504   C  CG2 . ILE A 1 60  ? 54.409  7.117   29.288  1.00 26.37  ? 60  ILE A CG2 1 
ATOM   505   C  CD1 . ILE A 1 60  ? 53.547  10.508  28.632  1.00 30.04  ? 60  ILE A CD1 1 
ATOM   506   N  N   . ARG A 1 61  ? 52.333  5.188   27.266  1.00 25.27  ? 61  ARG A N   1 
ATOM   507   C  CA  . ARG A 1 61  ? 52.390  3.728   27.194  1.00 26.93  ? 61  ARG A CA  1 
ATOM   508   C  C   . ARG A 1 61  ? 52.765  3.146   25.818  1.00 28.33  ? 61  ARG A C   1 
ATOM   509   O  O   . ARG A 1 61  ? 53.595  2.253   25.766  1.00 29.40  ? 61  ARG A O   1 
ATOM   510   C  CB  . ARG A 1 61  ? 51.112  3.106   27.760  1.00 26.95  ? 61  ARG A CB  1 
ATOM   511   C  CG  . ARG A 1 61  ? 51.332  2.696   29.205  1.00 32.43  ? 61  ARG A CG  1 
ATOM   512   C  CD  . ARG A 1 61  ? 50.184  2.936   30.193  1.00 34.35  ? 61  ARG A CD  1 
ATOM   513   N  NE  . ARG A 1 61  ? 48.825  3.067   29.649  1.00 31.28  ? 61  ARG A NE  1 
ATOM   514   C  CZ  . ARG A 1 61  ? 47.849  3.643   30.350  1.00 30.32  ? 61  ARG A CZ  1 
ATOM   515   N  NH1 . ARG A 1 61  ? 48.127  4.103   31.568  1.00 28.64  ? 61  ARG A NH1 1 
ATOM   516   N  NH2 . ARG A 1 61  ? 46.622  3.773   29.852  1.00 28.33  ? 61  ARG A NH2 1 
ATOM   517   N  N   . GLU A 1 62  ? 52.155  3.643   24.731  1.00 28.27  ? 62  GLU A N   1 
ATOM   518   C  CA  . GLU A 1 62  ? 52.496  3.233   23.372  1.00 29.54  ? 62  GLU A CA  1 
ATOM   519   C  C   . GLU A 1 62  ? 53.895  3.724   22.935  1.00 27.42  ? 62  GLU A C   1 
ATOM   520   O  O   . GLU A 1 62  ? 54.632  3.001   22.301  1.00 25.62  ? 62  GLU A O   1 
ATOM   521   C  CB  . GLU A 1 62  ? 51.411  3.663   22.377  1.00 34.75  ? 62  GLU A CB  1 
ATOM   522   C  CG  . GLU A 1 62  ? 50.015  3.147   22.729  1.00 43.57  ? 62  GLU A CG  1 
ATOM   523   C  CD  . GLU A 1 62  ? 48.956  3.364   21.627  1.00 52.20  ? 62  GLU A CD  1 
ATOM   524   O  OE1 . GLU A 1 62  ? 49.276  3.203   20.414  1.00 58.99  ? 62  GLU A OE1 1 
ATOM   525   O  OE2 . GLU A 1 62  ? 47.784  3.674   21.977  1.00 47.65  ? 62  GLU A OE2 1 
ATOM   526   N  N   . MET A 1 63  ? 54.260  4.952   23.280  1.00 25.29  ? 63  MET A N   1 
ATOM   527   C  CA  . MET A 1 63  ? 55.647  5.359   23.116  1.00 23.93  ? 63  MET A CA  1 
ATOM   528   C  C   . MET A 1 63  ? 56.621  4.427   23.843  1.00 22.78  ? 63  MET A C   1 
ATOM   529   O  O   . MET A 1 63  ? 57.618  4.000   23.249  1.00 21.54  ? 63  MET A O   1 
ATOM   530   C  CB  . MET A 1 63  ? 55.852  6.780   23.579  1.00 21.60  ? 63  MET A CB  1 
ATOM   531   C  CG  . MET A 1 63  ? 55.408  7.822   22.606  1.00 21.67  ? 63  MET A CG  1 
ATOM   532   S  SD  . MET A 1 63  ? 55.439  9.390   23.524  1.00 23.59  ? 63  MET A SD  1 
ATOM   533   C  CE  . MET A 1 63  ? 53.696  9.599   23.569  1.00 19.65  ? 63  MET A CE  1 
ATOM   534   N  N   . ASP A 1 64  ? 56.360  4.107   25.109  1.00 24.43  ? 64  ASP A N   1 
ATOM   535   C  CA  . ASP A 1 64  ? 57.198  3.081   25.777  1.00 28.25  ? 64  ASP A CA  1 
ATOM   536   C  C   . ASP A 1 64  ? 57.361  1.784   24.922  1.00 28.92  ? 64  ASP A C   1 
ATOM   537   O  O   . ASP A 1 64  ? 58.484  1.319   24.717  1.00 27.45  ? 64  ASP A O   1 
ATOM   538   C  CB  . ASP A 1 64  ? 56.720  2.754   27.189  1.00 27.80  ? 64  ASP A CB  1 
ATOM   539   C  CG  . ASP A 1 64  ? 56.907  3.921   28.165  1.00 32.13  ? 64  ASP A CG  1 
ATOM   540   O  OD1 . ASP A 1 64  ? 57.611  4.901   27.806  1.00 34.22  ? 64  ASP A OD1 1 
ATOM   541   O  OD2 . ASP A 1 64  ? 56.339  3.860   29.295  1.00 32.21  ? 64  ASP A OD2 1 
ATOM   542   N  N   . GLN A 1 65  ? 56.252  1.254   24.403  1.00 29.68  ? 65  GLN A N   1 
ATOM   543   C  CA  . GLN A 1 65  ? 56.262  0.071   23.548  1.00 32.76  ? 65  GLN A CA  1 
ATOM   544   C  C   . GLN A 1 65  ? 57.039  0.222   22.233  1.00 31.96  ? 65  GLN A C   1 
ATOM   545   O  O   . GLN A 1 65  ? 57.757  -0.672  21.853  1.00 31.59  ? 65  GLN A O   1 
ATOM   546   C  CB  . GLN A 1 65  ? 54.849  -0.303  23.176  1.00 36.96  ? 65  GLN A CB  1 
ATOM   547   C  CG  . GLN A 1 65  ? 54.252  -1.415  23.981  1.00 46.42  ? 65  GLN A CG  1 
ATOM   548   C  CD  . GLN A 1 65  ? 52.863  -1.762  23.477  1.00 54.62  ? 65  GLN A CD  1 
ATOM   549   O  OE1 . GLN A 1 65  ? 52.616  -1.789  22.253  1.00 53.01  ? 65  GLN A OE1 1 
ATOM   550   N  NE2 . GLN A 1 65  ? 51.934  -2.017  24.417  1.00 57.54  ? 65  GLN A NE2 1 
ATOM   551   N  N   . LYS A 1 66  ? 56.864  1.341   21.536  1.00 29.62  ? 66  LYS A N   1 
ATOM   552   C  CA  . LYS A 1 66  ? 57.417  1.544   20.208  1.00 27.39  ? 66  LYS A CA  1 
ATOM   553   C  C   . LYS A 1 66  ? 58.851  2.061   20.247  1.00 26.44  ? 66  LYS A C   1 
ATOM   554   O  O   . LYS A 1 66  ? 59.468  2.251   19.211  1.00 26.50  ? 66  LYS A O   1 
ATOM   555   C  CB  . LYS A 1 66  ? 56.525  2.515   19.407  1.00 27.14  ? 66  LYS A CB  1 
ATOM   556   C  CG  . LYS A 1 66  ? 55.050  2.130   19.386  1.00 30.57  ? 66  LYS A CG  1 
ATOM   557   C  CD  . LYS A 1 66  ? 54.803  0.745   18.777  1.00 35.78  ? 66  LYS A CD  1 
ATOM   558   C  CE  . LYS A 1 66  ? 53.392  0.224   19.081  1.00 39.95  ? 66  LYS A CE  1 
ATOM   559   N  NZ  . LYS A 1 66  ? 52.302  1.206   18.724  1.00 40.74  ? 66  LYS A NZ  1 
ATOM   560   N  N   . GLY A 1 67  ? 59.374  2.309   21.444  1.00 24.44  ? 67  GLY A N   1 
ATOM   561   C  CA  . GLY A 1 67  ? 60.679  2.937   21.578  1.00 20.81  ? 67  GLY A CA  1 
ATOM   562   C  C   . GLY A 1 67  ? 60.750  4.408   21.199  1.00 19.44  ? 67  GLY A C   1 
ATOM   563   O  O   . GLY A 1 67  ? 61.849  4.911   21.004  1.00 20.12  ? 67  GLY A O   1 
ATOM   564   N  N   . VAL A 1 68  ? 59.618  5.104   21.044  1.00 18.19  ? 68  VAL A N   1 
ATOM   565   C  CA  . VAL A 1 68  ? 59.655  6.565   20.767  1.00 16.68  ? 68  VAL A CA  1 
ATOM   566   C  C   . VAL A 1 68  ? 60.006  7.325   22.050  1.00 17.36  ? 68  VAL A C   1 
ATOM   567   O  O   . VAL A 1 68  ? 59.397  7.097   23.118  1.00 17.14  ? 68  VAL A O   1 
ATOM   568   C  CB  . VAL A 1 68  ? 58.308  7.114   20.243  1.00 15.33  ? 68  VAL A CB  1 
ATOM   569   C  CG1 . VAL A 1 68  ? 58.387  8.595   19.920  1.00 13.91  ? 68  VAL A CG1 1 
ATOM   570   C  CG2 . VAL A 1 68  ? 57.828  6.345   19.030  1.00 15.52  ? 68  VAL A CG2 1 
ATOM   571   N  N   . THR A 1 69  ? 60.972  8.230   21.961  1.00 16.84  ? 69  THR A N   1 
ATOM   572   C  CA  . THR A 1 69  ? 61.370  9.001   23.143  1.00 17.76  ? 69  THR A CA  1 
ATOM   573   C  C   . THR A 1 69  ? 60.656  10.352  23.311  1.00 17.57  ? 69  THR A C   1 
ATOM   574   O  O   . THR A 1 69  ? 60.197  10.692  24.406  1.00 17.16  ? 69  THR A O   1 
ATOM   575   C  CB  . THR A 1 69  ? 62.885  9.238   23.129  1.00 18.46  ? 69  THR A CB  1 
ATOM   576   O  OG1 . THR A 1 69  ? 63.521  8.044   22.650  1.00 18.20  ? 69  THR A OG1 1 
ATOM   577   C  CG2 . THR A 1 69  ? 63.359  9.561   24.523  1.00 18.73  ? 69  THR A CG2 1 
ATOM   578   N  N   . VAL A 1 70  ? 60.636  11.161  22.257  1.00 16.70  ? 70  VAL A N   1 
ATOM   579   C  CA  . VAL A 1 70  ? 59.784  12.315  22.273  1.00 16.84  ? 70  VAL A CA  1 
ATOM   580   C  C   . VAL A 1 70  ? 58.823  12.349  21.071  1.00 15.15  ? 70  VAL A C   1 
ATOM   581   O  O   . VAL A 1 70  ? 59.208  11.949  19.980  1.00 14.48  ? 70  VAL A O   1 
ATOM   582   C  CB  . VAL A 1 70  ? 60.549  13.638  22.661  1.00 18.31  ? 70  VAL A CB  1 
ATOM   583   C  CG1 . VAL A 1 70  ? 62.044  13.406  22.857  1.00 17.39  ? 70  VAL A CG1 1 
ATOM   584   C  CG2 . VAL A 1 70  ? 60.252  14.806  21.735  1.00 16.95  ? 70  VAL A CG2 1 
ATOM   585   N  N   . GLN A 1 71  ? 57.557  12.699  21.320  1.00 13.26  ? 71  GLN A N   1 
ATOM   586   C  CA  . GLN A 1 71  ? 56.666  13.216  20.272  1.00 12.98  ? 71  GLN A CA  1 
ATOM   587   C  C   . GLN A 1 71  ? 56.530  14.719  20.445  1.00 13.28  ? 71  GLN A C   1 
ATOM   588   O  O   . GLN A 1 71  ? 56.311  15.231  21.561  1.00 12.11  ? 71  GLN A O   1 
ATOM   589   C  CB  . GLN A 1 71  ? 55.239  12.711  20.343  1.00 12.87  ? 71  GLN A CB  1 
ATOM   590   C  CG  . GLN A 1 71  ? 55.011  11.212  20.417  1.00 12.71  ? 71  GLN A CG  1 
ATOM   591   C  CD  . GLN A 1 71  ? 53.528  10.882  20.576  1.00 12.83  ? 71  GLN A CD  1 
ATOM   592   O  OE1 . GLN A 1 71  ? 52.755  11.573  21.273  1.00 12.68  ? 71  GLN A OE1 1 
ATOM   593   N  NE2 . GLN A 1 71  ? 53.120  9.819   19.926  1.00 12.81  ? 71  GLN A NE2 1 
ATOM   594   N  N   . ALA A 1 72  ? 56.638  15.405  19.308  1.00 13.98  ? 72  ALA A N   1 
ATOM   595   C  CA  . ALA A 1 72  ? 56.346  16.828  19.146  1.00 14.01  ? 72  ALA A CA  1 
ATOM   596   C  C   . ALA A 1 72  ? 54.872  16.903  18.843  1.00 14.55  ? 72  ALA A C   1 
ATOM   597   O  O   . ALA A 1 72  ? 54.416  16.399  17.843  1.00 16.91  ? 72  ALA A O   1 
ATOM   598   C  CB  . ALA A 1 72  ? 57.149  17.395  17.997  1.00 12.92  ? 72  ALA A CB  1 
ATOM   599   N  N   . LEU A 1 73  ? 54.113  17.490  19.739  1.00 15.56  ? 73  LEU A N   1 
ATOM   600   C  CA  . LEU A 1 73  ? 52.668  17.449  19.664  1.00 15.55  ? 73  LEU A CA  1 
ATOM   601   C  C   . LEU A 1 73  ? 52.114  18.657  18.927  1.00 15.38  ? 73  LEU A C   1 
ATOM   602   O  O   . LEU A 1 73  ? 52.582  19.761  19.121  1.00 16.42  ? 73  LEU A O   1 
ATOM   603   C  CB  . LEU A 1 73  ? 52.095  17.418  21.078  1.00 14.67  ? 73  LEU A CB  1 
ATOM   604   C  CG  . LEU A 1 73  ? 52.440  16.265  22.023  1.00 15.12  ? 73  LEU A CG  1 
ATOM   605   C  CD1 . LEU A 1 73  ? 51.835  16.592  23.383  1.00 15.14  ? 73  LEU A CD1 1 
ATOM   606   C  CD2 . LEU A 1 73  ? 51.963  14.901  21.548  1.00 14.61  ? 73  LEU A CD2 1 
ATOM   607   N  N   . SER A 1 74  ? 51.076  18.454  18.126  1.00 15.34  ? 74  SER A N   1 
ATOM   608   C  CA  . SER A 1 74  ? 50.405  19.547  17.491  1.00 15.22  ? 74  SER A CA  1 
ATOM   609   C  C   . SER A 1 74  ? 48.907  19.242  17.395  1.00 15.10  ? 74  SER A C   1 
ATOM   610   O  O   . SER A 1 74  ? 48.458  18.112  17.509  1.00 15.48  ? 74  SER A O   1 
ATOM   611   C  CB  . SER A 1 74  ? 51.025  19.762  16.105  1.00 18.25  ? 74  SER A CB  1 
ATOM   612   O  OG  . SER A 1 74  ? 50.525  18.830  15.111  1.00 21.76  ? 74  SER A OG  1 
ATOM   613   N  N   . THR A 1 75  ? 48.106  20.255  17.197  1.00 15.01  ? 75  THR A N   1 
ATOM   614   C  CA  . THR A 1 75  ? 46.716  20.036  17.066  1.00 14.97  ? 75  THR A CA  1 
ATOM   615   C  C   . THR A 1 75  ? 46.375  19.272  15.771  1.00 15.74  ? 75  THR A C   1 
ATOM   616   O  O   . THR A 1 75  ? 47.223  19.130  14.899  1.00 16.55  ? 75  THR A O   1 
ATOM   617   C  CB  . THR A 1 75  ? 45.989  21.375  17.110  1.00 14.97  ? 75  THR A CB  1 
ATOM   618   O  OG1 . THR A 1 75  ? 44.640  21.115  17.498  1.00 15.12  ? 75  THR A OG1 1 
ATOM   619   C  CG2 . THR A 1 75  ? 46.031  22.058  15.762  1.00 13.70  ? 75  THR A CG2 1 
ATOM   620   N  N   . VAL A 1 76  ? 45.140  18.792  15.653  1.00 14.44  ? 76  VAL A N   1 
ATOM   621   C  CA  . VAL A 1 76  ? 44.678  18.202  14.421  1.00 14.44  ? 76  VAL A CA  1 
ATOM   622   C  C   . VAL A 1 76  ? 44.403  19.342  13.395  1.00 14.71  ? 76  VAL A C   1 
ATOM   623   O  O   . VAL A 1 76  ? 43.825  20.349  13.728  1.00 14.68  ? 76  VAL A O   1 
ATOM   624   C  CB  . VAL A 1 76  ? 43.446  17.265  14.682  1.00 14.26  ? 76  VAL A CB  1 
ATOM   625   C  CG1 . VAL A 1 76  ? 42.946  16.556  13.407  1.00 13.40  ? 76  VAL A CG1 1 
ATOM   626   C  CG2 . VAL A 1 76  ? 43.773  16.222  15.766  1.00 13.71  ? 76  VAL A CG2 1 
ATOM   627   N  N   . PRO A 1 77  ? 44.834  19.182  12.138  1.00 15.19  ? 77  PRO A N   1 
ATOM   628   C  CA  . PRO A 1 77  ? 44.736  20.243  11.120  1.00 15.62  ? 77  PRO A CA  1 
ATOM   629   C  C   . PRO A 1 77  ? 43.335  20.787  10.891  1.00 15.49  ? 77  PRO A C   1 
ATOM   630   O  O   . PRO A 1 77  ? 43.179  21.958  10.556  1.00 14.97  ? 77  PRO A O   1 
ATOM   631   C  CB  . PRO A 1 77  ? 45.220  19.546  9.842   1.00 16.23  ? 77  PRO A CB  1 
ATOM   632   C  CG  . PRO A 1 77  ? 46.155  18.509  10.355  1.00 15.83  ? 77  PRO A CG  1 
ATOM   633   C  CD  . PRO A 1 77  ? 45.430  17.965  11.564  1.00 15.63  ? 77  PRO A CD  1 
ATOM   634   N  N   . VAL A 1 78  ? 42.322  19.964  11.142  1.00 17.18  ? 78  VAL A N   1 
ATOM   635   C  CA  . VAL A 1 78  ? 40.935  20.412  11.013  1.00 16.98  ? 78  VAL A CA  1 
ATOM   636   C  C   . VAL A 1 78  ? 40.611  21.558  12.002  1.00 16.19  ? 78  VAL A C   1 
ATOM   637   O  O   . VAL A 1 78  ? 39.637  22.248  11.804  1.00 14.97  ? 78  VAL A O   1 
ATOM   638   C  CB  . VAL A 1 78  ? 39.945  19.230  11.162  1.00 18.77  ? 78  VAL A CB  1 
ATOM   639   C  CG1 . VAL A 1 78  ? 39.860  18.746  12.612  1.00 17.49  ? 78  VAL A CG1 1 
ATOM   640   C  CG2 . VAL A 1 78  ? 38.553  19.630  10.671  1.00 20.41  ? 78  VAL A CG2 1 
ATOM   641   N  N   . MET A 1 79  ? 41.414  21.707  13.060  1.00 15.45  ? 79  MET A N   1 
ATOM   642   C  CA  . MET A 1 79  ? 41.271  22.781  14.075  1.00 15.66  ? 79  MET A CA  1 
ATOM   643   C  C   . MET A 1 79  ? 41.924  24.092  13.648  1.00 15.47  ? 79  MET A C   1 
ATOM   644   O  O   . MET A 1 79  ? 41.853  25.088  14.374  1.00 15.23  ? 79  MET A O   1 
ATOM   645   C  CB  . MET A 1 79  ? 41.942  22.385  15.415  1.00 15.61  ? 79  MET A CB  1 
ATOM   646   C  CG  . MET A 1 79  ? 41.490  21.060  16.017  1.00 16.49  ? 79  MET A CG  1 
ATOM   647   S  SD  . MET A 1 79  ? 39.707  21.011  16.291  1.00 20.57  ? 79  MET A SD  1 
ATOM   648   C  CE  . MET A 1 79  ? 39.512  22.090  17.715  1.00 17.47  ? 79  MET A CE  1 
ATOM   649   N  N   . PHE A 1 80  ? 42.609  24.114  12.506  1.00 15.85  ? 80  PHE A N   1 
ATOM   650   C  CA  . PHE A 1 80  ? 43.350  25.333  12.146  1.00 14.50  ? 80  PHE A CA  1 
ATOM   651   C  C   . PHE A 1 80  ? 42.387  26.476  12.160  1.00 13.79  ? 80  PHE A C   1 
ATOM   652   O  O   . PHE A 1 80  ? 42.729  27.548  12.674  1.00 13.47  ? 80  PHE A O   1 
ATOM   653   C  CB  . PHE A 1 80  ? 43.999  25.243  10.792  1.00 14.76  ? 80  PHE A CB  1 
ATOM   654   C  CG  . PHE A 1 80  ? 45.264  24.442  10.776  1.00 15.52  ? 80  PHE A CG  1 
ATOM   655   C  CD1 . PHE A 1 80  ? 46.091  24.391  11.879  1.00 16.62  ? 80  PHE A CD1 1 
ATOM   656   C  CD2 . PHE A 1 80  ? 45.647  23.753  9.633   1.00 16.08  ? 80  PHE A CD2 1 
ATOM   657   C  CE1 . PHE A 1 80  ? 47.268  23.640  11.857  1.00 17.85  ? 80  PHE A CE1 1 
ATOM   658   C  CE2 . PHE A 1 80  ? 46.829  23.008  9.591   1.00 16.30  ? 80  PHE A CE2 1 
ATOM   659   C  CZ  . PHE A 1 80  ? 47.651  22.956  10.690  1.00 17.85  ? 80  PHE A CZ  1 
ATOM   660   N  N   . SER A 1 81  ? 41.171  26.238  11.666  1.00 13.01  ? 81  SER A N   1 
ATOM   661   C  CA  . SER A 1 81  ? 40.090  27.262  11.694  1.00 13.95  ? 81  SER A CA  1 
ATOM   662   C  C   . SER A 1 81  ? 40.439  28.603  10.968  1.00 15.20  ? 81  SER A C   1 
ATOM   663   O  O   . SER A 1 81  ? 39.940  29.700  11.348  1.00 14.90  ? 81  SER A O   1 
ATOM   664   C  CB  . SER A 1 81  ? 39.685  27.546  13.151  1.00 13.70  ? 81  SER A CB  1 
ATOM   665   O  OG  . SER A 1 81  ? 39.626  26.327  13.930  1.00 13.79  ? 81  SER A OG  1 
ATOM   666   N  N   . TYR A 1 82  ? 41.287  28.547  9.937   1.00 14.73  ? 82  TYR A N   1 
ATOM   667   C  CA  . TYR A 1 82  ? 41.672  29.775  9.254   1.00 15.41  ? 82  TYR A CA  1 
ATOM   668   C  C   . TYR A 1 82  ? 40.487  30.496  8.614   1.00 16.09  ? 82  TYR A C   1 
ATOM   669   O  O   . TYR A 1 82  ? 40.599  31.650  8.312   1.00 18.69  ? 82  TYR A O   1 
ATOM   670   C  CB  . TYR A 1 82  ? 42.711  29.522  8.191   1.00 14.74  ? 82  TYR A CB  1 
ATOM   671   C  CG  . TYR A 1 82  ? 44.025  29.020  8.693   1.00 15.29  ? 82  TYR A CG  1 
ATOM   672   C  CD1 . TYR A 1 82  ? 44.440  29.184  10.050  1.00 14.15  ? 82  TYR A CD1 1 
ATOM   673   C  CD2 . TYR A 1 82  ? 44.865  28.343  7.823   1.00 15.18  ? 82  TYR A CD2 1 
ATOM   674   C  CE1 . TYR A 1 82  ? 45.655  28.692  10.484  1.00 13.58  ? 82  TYR A CE1 1 
ATOM   675   C  CE2 . TYR A 1 82  ? 46.095  27.900  8.241   1.00 15.36  ? 82  TYR A CE2 1 
ATOM   676   C  CZ  . TYR A 1 82  ? 46.488  28.061  9.556   1.00 14.65  ? 82  TYR A CZ  1 
ATOM   677   O  OH  . TYR A 1 82  ? 47.749  27.563  9.842   1.00 15.01  ? 82  TYR A OH  1 
ATOM   678   N  N   . TRP A 1 83  ? 39.358  29.828  8.463   1.00 17.20  ? 83  TRP A N   1 
ATOM   679   C  CA  . TRP A 1 83  ? 38.167  30.398  7.854   1.00 19.50  ? 83  TRP A CA  1 
ATOM   680   C  C   . TRP A 1 83  ? 37.380  31.365  8.714   1.00 20.93  ? 83  TRP A C   1 
ATOM   681   O  O   . TRP A 1 83  ? 36.752  32.268  8.181   1.00 23.45  ? 83  TRP A O   1 
ATOM   682   C  CB  . TRP A 1 83  ? 37.257  29.276  7.403   1.00 18.31  ? 83  TRP A CB  1 
ATOM   683   C  CG  . TRP A 1 83  ? 36.871  28.358  8.532   1.00 20.09  ? 83  TRP A CG  1 
ATOM   684   C  CD1 . TRP A 1 83  ? 37.518  27.167  8.959   1.00 20.04  ? 83  TRP A CD1 1 
ATOM   685   C  CD2 . TRP A 1 83  ? 35.706  28.498  9.422   1.00 19.93  ? 83  TRP A CD2 1 
ATOM   686   N  NE1 . TRP A 1 83  ? 36.825  26.591  10.017  1.00 20.15  ? 83  TRP A NE1 1 
ATOM   687   C  CE2 . TRP A 1 83  ? 35.747  27.365  10.349  1.00 20.18  ? 83  TRP A CE2 1 
ATOM   688   C  CE3 . TRP A 1 83  ? 34.685  29.433  9.548   1.00 20.06  ? 83  TRP A CE3 1 
ATOM   689   C  CZ2 . TRP A 1 83  ? 34.801  27.215  11.342  1.00 21.27  ? 83  TRP A CZ2 1 
ATOM   690   C  CZ3 . TRP A 1 83  ? 33.739  29.258  10.549  1.00 18.54  ? 83  TRP A CZ3 1 
ATOM   691   C  CH2 . TRP A 1 83  ? 33.785  28.178  11.411  1.00 19.70  ? 83  TRP A CH2 1 
ATOM   692   N  N   . ALA A 1 84  ? 37.389  31.185  10.038  1.00 21.93  ? 84  ALA A N   1 
ATOM   693   C  CA  . ALA A 1 84  ? 36.610  32.022  11.006  1.00 19.94  ? 84  ALA A CA  1 
ATOM   694   C  C   . ALA A 1 84  ? 37.056  33.480  11.089  1.00 19.44  ? 84  ALA A C   1 
ATOM   695   O  O   . ALA A 1 84  ? 38.111  33.799  10.594  1.00 19.00  ? 84  ALA A O   1 
ATOM   696   C  CB  . ALA A 1 84  ? 36.741  31.394  12.379  1.00 20.20  ? 84  ALA A CB  1 
ATOM   697   N  N   . LYS A 1 85  ? 36.282  34.349  11.746  1.00 20.99  ? 85  LYS A N   1 
ATOM   698   C  CA  . LYS A 1 85  ? 36.738  35.732  12.091  1.00 23.17  ? 85  LYS A CA  1 
ATOM   699   C  C   . LYS A 1 85  ? 38.066  35.716  12.861  1.00 24.24  ? 85  LYS A C   1 
ATOM   700   O  O   . LYS A 1 85  ? 38.248  34.886  13.759  1.00 22.04  ? 85  LYS A O   1 
ATOM   701   C  CB  . LYS A 1 85  ? 35.748  36.482  12.977  1.00 25.76  ? 85  LYS A CB  1 
ATOM   702   C  CG  . LYS A 1 85  ? 34.301  36.555  12.536  1.00 28.48  ? 85  LYS A CG  1 
ATOM   703   C  CD  . LYS A 1 85  ? 33.612  37.650  13.357  1.00 31.23  ? 85  LYS A CD  1 
ATOM   704   C  CE  . LYS A 1 85  ? 32.324  38.162  12.700  1.00 34.71  ? 85  LYS A CE  1 
ATOM   705   N  NZ  . LYS A 1 85  ? 31.140  38.284  13.638  1.00 37.12  ? 85  LYS A NZ  1 
ATOM   706   N  N   . PRO A 1 86  ? 38.998  36.633  12.521  1.00 25.30  ? 86  PRO A N   1 
ATOM   707   C  CA  . PRO A 1 86  ? 40.335  36.579  13.136  1.00 24.73  ? 86  PRO A CA  1 
ATOM   708   C  C   . PRO A 1 86  ? 40.374  36.550  14.664  1.00 26.15  ? 86  PRO A C   1 
ATOM   709   O  O   . PRO A 1 86  ? 41.351  36.065  15.215  1.00 29.48  ? 86  PRO A O   1 
ATOM   710   C  CB  . PRO A 1 86  ? 40.995  37.861  12.627  1.00 24.66  ? 86  PRO A CB  1 
ATOM   711   C  CG  . PRO A 1 86  ? 40.323  38.137  11.308  1.00 23.57  ? 86  PRO A CG  1 
ATOM   712   C  CD  . PRO A 1 86  ? 38.963  37.508  11.330  1.00 22.21  ? 86  PRO A CD  1 
ATOM   713   N  N   . GLU A 1 87  ? 39.356  37.059  15.356  1.00 27.27  ? 87  GLU A N   1 
ATOM   714   C  CA  . GLU A 1 87  ? 39.421  37.140  16.832  1.00 27.76  ? 87  GLU A CA  1 
ATOM   715   C  C   . GLU A 1 87  ? 39.136  35.799  17.481  1.00 24.50  ? 87  GLU A C   1 
ATOM   716   O  O   . GLU A 1 87  ? 39.693  35.451  18.528  1.00 23.13  ? 87  GLU A O   1 
ATOM   717   C  CB  . GLU A 1 87  ? 38.438  38.186  17.390  1.00 33.19  ? 87  GLU A CB  1 
ATOM   718   C  CG  . GLU A 1 87  ? 38.549  39.594  16.805  1.00 39.09  ? 87  GLU A CG  1 
ATOM   719   C  CD  . GLU A 1 87  ? 39.943  40.183  16.960  1.00 42.83  ? 87  GLU A CD  1 
ATOM   720   O  OE1 . GLU A 1 87  ? 40.862  39.416  17.318  1.00 43.83  ? 87  GLU A OE1 1 
ATOM   721   O  OE2 . GLU A 1 87  ? 40.128  41.407  16.726  1.00 46.98  ? 87  GLU A OE2 1 
ATOM   722   N  N   . ASP A 1 88  ? 38.233  35.071  16.850  1.00 22.81  ? 88  ASP A N   1 
ATOM   723   C  CA  . ASP A 1 88  ? 37.743  33.803  17.366  1.00 22.84  ? 88  ASP A CA  1 
ATOM   724   C  C   . ASP A 1 88  ? 38.762  32.717  17.188  1.00 21.98  ? 88  ASP A C   1 
ATOM   725   O  O   . ASP A 1 88  ? 39.021  31.971  18.134  1.00 22.90  ? 88  ASP A O   1 
ATOM   726   C  CB  . ASP A 1 88  ? 36.402  33.417  16.730  1.00 24.20  ? 88  ASP A CB  1 
ATOM   727   C  CG  . ASP A 1 88  ? 35.366  34.587  16.740  1.00 25.25  ? 88  ASP A CG  1 
ATOM   728   O  OD1 . ASP A 1 88  ? 35.303  35.353  17.740  1.00 23.11  ? 88  ASP A OD1 1 
ATOM   729   O  OD2 . ASP A 1 88  ? 34.606  34.722  15.741  1.00 26.76  ? 88  ASP A OD2 1 
ATOM   730   N  N   . THR A 1 89  ? 39.393  32.664  16.011  1.00 20.21  ? 89  THR A N   1 
ATOM   731   C  CA  . THR A 1 89  ? 40.477  31.745  15.807  1.00 18.97  ? 89  THR A CA  1 
ATOM   732   C  C   . THR A 1 89  ? 41.554  31.971  16.878  1.00 18.41  ? 89  THR A C   1 
ATOM   733   O  O   . THR A 1 89  ? 42.065  31.018  17.478  1.00 18.34  ? 89  THR A O   1 
ATOM   734   C  CB  . THR A 1 89  ? 41.081  31.887  14.407  1.00 18.53  ? 89  THR A CB  1 
ATOM   735   O  OG1 . THR A 1 89  ? 40.058  31.637  13.463  1.00 17.62  ? 89  THR A OG1 1 
ATOM   736   C  CG2 . THR A 1 89  ? 42.161  30.843  14.201  1.00 17.90  ? 89  THR A CG2 1 
ATOM   737   N  N   . LEU A 1 90  ? 41.873  33.239  17.102  1.00 17.43  ? 90  LEU A N   1 
ATOM   738   C  CA  . LEU A 1 90  ? 42.822  33.634  18.091  1.00 16.90  ? 90  LEU A CA  1 
ATOM   739   C  C   . LEU A 1 90  ? 42.431  33.068  19.473  1.00 17.25  ? 90  LEU A C   1 
ATOM   740   O  O   . LEU A 1 90  ? 43.285  32.539  20.178  1.00 17.25  ? 90  LEU A O   1 
ATOM   741   C  CB  . LEU A 1 90  ? 42.947  35.161  18.119  1.00 16.90  ? 90  LEU A CB  1 
ATOM   742   C  CG  . LEU A 1 90  ? 43.874  35.694  19.242  1.00 16.65  ? 90  LEU A CG  1 
ATOM   743   C  CD1 . LEU A 1 90  ? 45.285  35.091  19.103  1.00 16.05  ? 90  LEU A CD1 1 
ATOM   744   C  CD2 . LEU A 1 90  ? 43.901  37.207  19.336  1.00 15.12  ? 90  LEU A CD2 1 
ATOM   745   N  N   . ASN A 1 91  ? 41.153  33.170  19.831  1.00 17.60  ? 91  ASN A N   1 
ATOM   746   C  CA  . ASN A 1 91  ? 40.628  32.652  21.095  1.00 17.81  ? 91  ASN A CA  1 
ATOM   747   C  C   . ASN A 1 91  ? 40.825  31.124  21.148  1.00 17.88  ? 91  ASN A C   1 
ATOM   748   O  O   . ASN A 1 91  ? 41.346  30.581  22.111  1.00 17.64  ? 91  ASN A O   1 
ATOM   749   C  CB  . ASN A 1 91  ? 39.136  33.029  21.183  1.00 20.19  ? 91  ASN A CB  1 
ATOM   750   C  CG  . ASN A 1 91  ? 38.492  32.664  22.535  1.00 23.75  ? 91  ASN A CG  1 
ATOM   751   O  OD1 . ASN A 1 91  ? 38.058  31.533  22.735  1.00 24.98  ? 91  ASN A OD1 1 
ATOM   752   N  ND2 . ASN A 1 91  ? 38.403  33.632  23.446  1.00 21.78  ? 91  ASN A ND2 1 
ATOM   753   N  N   . LEU A 1 92  ? 40.434  30.439  20.073  1.00 16.97  ? 92  LEU A N   1 
ATOM   754   C  CA  . LEU A 1 92  ? 40.580  29.010  19.978  1.00 15.35  ? 92  LEU A CA  1 
ATOM   755   C  C   . LEU A 1 92  ? 42.040  28.554  20.084  1.00 16.20  ? 92  LEU A C   1 
ATOM   756   O  O   . LEU A 1 92  ? 42.343  27.557  20.776  1.00 14.12  ? 92  LEU A O   1 
ATOM   757   C  CB  . LEU A 1 92  ? 39.901  28.494  18.711  1.00 14.50  ? 92  LEU A CB  1 
ATOM   758   C  CG  . LEU A 1 92  ? 40.062  26.972  18.508  1.00 14.41  ? 92  LEU A CG  1 
ATOM   759   C  CD1 . LEU A 1 92  ? 39.390  26.143  19.616  1.00 13.51  ? 92  LEU A CD1 1 
ATOM   760   C  CD2 . LEU A 1 92  ? 39.605  26.548  17.123  1.00 13.55  ? 92  LEU A CD2 1 
ATOM   761   N  N   . CYS A 1 93  ? 42.952  29.304  19.450  1.00 17.31  ? 93  CYS A N   1 
ATOM   762   C  CA  . CYS A 1 93  ? 44.365  28.944  19.486  1.00 18.12  ? 93  CYS A CA  1 
ATOM   763   C  C   . CYS A 1 93  ? 44.893  29.051  20.866  1.00 17.21  ? 93  CYS A C   1 
ATOM   764   O  O   . CYS A 1 93  ? 45.799  28.317  21.247  1.00 17.09  ? 93  CYS A O   1 
ATOM   765   C  CB  . CYS A 1 93  ? 45.221  29.894  18.646  1.00 20.62  ? 93  CYS A CB  1 
ATOM   766   S  SG  . CYS A 1 93  ? 44.979  29.602  16.903  1.00 29.65  ? 93  CYS A SG  1 
ATOM   767   N  N   . GLN A 1 94  ? 44.410  30.032  21.603  1.00 17.19  ? 94  GLN A N   1 
ATOM   768   C  CA  . GLN A 1 94  ? 44.903  30.179  22.972  1.00 17.75  ? 94  GLN A CA  1 
ATOM   769   C  C   . GLN A 1 94  ? 44.416  28.998  23.789  1.00 16.51  ? 94  GLN A C   1 
ATOM   770   O  O   . GLN A 1 94  ? 45.154  28.422  24.560  1.00 16.94  ? 94  GLN A O   1 
ATOM   771   C  CB  . GLN A 1 94  ? 44.500  31.529  23.575  1.00 18.64  ? 94  GLN A CB  1 
ATOM   772   C  CG  . GLN A 1 94  ? 45.128  32.694  22.801  1.00 20.43  ? 94  GLN A CG  1 
ATOM   773   C  CD  . GLN A 1 94  ? 44.575  34.058  23.198  1.00 22.80  ? 94  GLN A CD  1 
ATOM   774   O  OE1 . GLN A 1 94  ? 43.359  34.244  23.350  1.00 26.60  ? 94  GLN A OE1 1 
ATOM   775   N  NE2 . GLN A 1 94  ? 45.459  35.018  23.358  1.00 22.09  ? 94  GLN A NE2 1 
ATOM   776   N  N   . LEU A 1 95  ? 43.184  28.595  23.588  1.00 15.24  ? 95  LEU A N   1 
ATOM   777   C  CA  . LEU A 1 95  ? 42.729  27.411  24.283  1.00 16.38  ? 95  LEU A CA  1 
ATOM   778   C  C   . LEU A 1 95  ? 43.612  26.178  23.890  1.00 16.21  ? 95  LEU A C   1 
ATOM   779   O  O   . LEU A 1 95  ? 44.067  25.435  24.753  1.00 17.51  ? 95  LEU A O   1 
ATOM   780   C  CB  . LEU A 1 95  ? 41.233  27.217  23.994  1.00 17.76  ? 95  LEU A CB  1 
ATOM   781   C  CG  . LEU A 1 95  ? 40.451  26.114  24.689  1.00 19.44  ? 95  LEU A CG  1 
ATOM   782   C  CD1 . LEU A 1 95  ? 38.991  26.521  24.640  1.00 20.61  ? 95  LEU A CD1 1 
ATOM   783   C  CD2 . LEU A 1 95  ? 40.673  24.769  23.999  1.00 19.76  ? 95  LEU A CD2 1 
ATOM   784   N  N   . LEU A 1 96  ? 43.897  25.990  22.600  1.00 14.34  ? 96  LEU A N   1 
ATOM   785   C  CA  . LEU A 1 96  ? 44.591  24.783  22.165  1.00 12.47  ? 96  LEU A CA  1 
ATOM   786   C  C   . LEU A 1 96  ? 46.050  24.858  22.543  1.00 11.53  ? 96  LEU A C   1 
ATOM   787   O  O   . LEU A 1 96  ? 46.666  23.869  22.870  1.00 10.37  ? 96  LEU A O   1 
ATOM   788   C  CB  . LEU A 1 96  ? 44.448  24.538  20.655  1.00 11.72  ? 96  LEU A CB  1 
ATOM   789   C  CG  . LEU A 1 96  ? 43.074  24.297  19.993  1.00 12.04  ? 96  LEU A CG  1 
ATOM   790   C  CD1 . LEU A 1 96  ? 43.117  24.400  18.461  1.00 11.23  ? 96  LEU A CD1 1 
ATOM   791   C  CD2 . LEU A 1 96  ? 42.506  22.939  20.396  1.00 12.06  ? 96  LEU A CD2 1 
ATOM   792   N  N   . ASN A 1 97  ? 46.632  26.023  22.477  1.00 11.57  ? 97  ASN A N   1 
ATOM   793   C  CA  . ASN A 1 97  ? 48.034  26.096  22.831  1.00 11.75  ? 97  ASN A CA  1 
ATOM   794   C  C   . ASN A 1 97  ? 48.255  25.879  24.353  1.00 12.23  ? 97  ASN A C   1 
ATOM   795   O  O   . ASN A 1 97  ? 49.210  25.250  24.742  1.00 12.02  ? 97  ASN A O   1 
ATOM   796   C  CB  . ASN A 1 97  ? 48.613  27.402  22.328  1.00 12.38  ? 97  ASN A CB  1 
ATOM   797   C  CG  . ASN A 1 97  ? 48.722  27.443  20.767  1.00 13.85  ? 97  ASN A CG  1 
ATOM   798   O  OD1 . ASN A 1 97  ? 48.787  26.401  20.092  1.00 14.46  ? 97  ASN A OD1 1 
ATOM   799   N  ND2 . ASN A 1 97  ? 48.779  28.644  20.208  1.00 13.13  ? 97  ASN A ND2 1 
ATOM   800   N  N   . ASN A 1 98  ? 47.361  26.402  25.187  1.00 12.04  ? 98  ASN A N   1 
ATOM   801   C  CA  . ASN A 1 98  ? 47.328  26.161  26.618  1.00 13.37  ? 98  ASN A CA  1 
ATOM   802   C  C   . ASN A 1 98  ? 47.126  24.668  26.966  1.00 14.34  ? 98  ASN A C   1 
ATOM   803   O  O   . ASN A 1 98  ? 47.942  24.084  27.705  1.00 13.84  ? 98  ASN A O   1 
ATOM   804   C  CB  . ASN A 1 98  ? 46.243  27.047  27.245  1.00 13.58  ? 98  ASN A CB  1 
ATOM   805   C  CG  . ASN A 1 98  ? 46.656  28.529  27.267  1.00 14.40  ? 98  ASN A CG  1 
ATOM   806   O  OD1 . ASN A 1 98  ? 47.760  28.869  26.851  1.00 13.89  ? 98  ASN A OD1 1 
ATOM   807   N  ND2 . ASN A 1 98  ? 45.784  29.405  27.778  1.00 14.75  ? 98  ASN A ND2 1 
ATOM   808   N  N   . ASP A 1 99  ? 46.085  24.038  26.404  1.00 14.36  ? 99  ASP A N   1 
ATOM   809   C  CA  . ASP A 1 99  ? 45.961  22.598  26.534  1.00 15.82  ? 99  ASP A CA  1 
ATOM   810   C  C   . ASP A 1 99  ? 47.295  21.918  26.184  1.00 15.12  ? 99  ASP A C   1 
ATOM   811   O  O   . ASP A 1 99  ? 47.834  21.127  26.985  1.00 16.22  ? 99  ASP A O   1 
ATOM   812   C  CB  . ASP A 1 99  ? 44.825  22.042  25.674  1.00 18.57  ? 99  ASP A CB  1 
ATOM   813   C  CG  . ASP A 1 99  ? 44.849  20.505  25.607  1.00 22.79  ? 99  ASP A CG  1 
ATOM   814   O  OD1 . ASP A 1 99  ? 44.396  19.829  26.583  1.00 26.11  ? 99  ASP A OD1 1 
ATOM   815   O  OD2 . ASP A 1 99  ? 45.365  19.956  24.589  1.00 26.56  ? 99  ASP A OD2 1 
ATOM   816   N  N   . LEU A 1 100 ? 47.849  22.246  25.028  1.00 13.63  ? 100 LEU A N   1 
ATOM   817   C  CA  . LEU A 1 100 ? 49.130  21.677  24.565  1.00 13.29  ? 100 LEU A CA  1 
ATOM   818   C  C   . LEU A 1 100 ? 50.246  21.896  25.572  1.00 12.53  ? 100 LEU A C   1 
ATOM   819   O  O   . LEU A 1 100 ? 50.969  20.973  25.952  1.00 11.97  ? 100 LEU A O   1 
ATOM   820   C  CB  . LEU A 1 100 ? 49.520  22.371  23.267  1.00 13.60  ? 100 LEU A CB  1 
ATOM   821   C  CG  . LEU A 1 100 ? 50.233  21.643  22.188  1.00 15.47  ? 100 LEU A CG  1 
ATOM   822   C  CD1 . LEU A 1 100 ? 49.584  20.272  22.061  1.00 17.32  ? 100 LEU A CD1 1 
ATOM   823   C  CD2 . LEU A 1 100 ? 50.025  22.422  20.897  1.00 15.15  ? 100 LEU A CD2 1 
ATOM   824   N  N   . ALA A 1 101 ? 50.366  23.140  26.022  1.00 11.65  ? 101 ALA A N   1 
ATOM   825   C  CA  . ALA A 1 101 ? 51.379  23.548  26.984  1.00 11.39  ? 101 ALA A CA  1 
ATOM   826   C  C   . ALA A 1 101 ? 51.219  22.757  28.341  1.00 11.82  ? 101 ALA A C   1 
ATOM   827   O  O   . ALA A 1 101 ? 52.185  22.491  29.053  1.00 12.03  ? 101 ALA A O   1 
ATOM   828   C  CB  . ALA A 1 101 ? 51.273  25.060  27.197  1.00 10.77  ? 101 ALA A CB  1 
ATOM   829   N  N   . SER A 1 102 ? 49.999  22.374  28.661  1.00 11.74  ? 102 SER A N   1 
ATOM   830   C  CA  . SER A 1 102 ? 49.723  21.683  29.912  1.00 13.30  ? 102 SER A CA  1 
ATOM   831   C  C   . SER A 1 102 ? 50.193  20.235  29.817  1.00 13.48  ? 102 SER A C   1 
ATOM   832   O  O   . SER A 1 102 ? 50.821  19.748  30.721  1.00 13.98  ? 102 SER A O   1 
ATOM   833   C  CB  . SER A 1 102 ? 48.210  21.715  30.198  1.00 12.61  ? 102 SER A CB  1 
ATOM   834   O  OG  . SER A 1 102 ? 47.824  23.051  30.462  1.00 13.00  ? 102 SER A OG  1 
ATOM   835   N  N   . THR A 1 103 ? 49.895  19.589  28.685  1.00 13.49  ? 103 THR A N   1 
ATOM   836   C  CA  . THR A 1 103 ? 50.327  18.245  28.398  1.00 12.91  ? 103 THR A CA  1 
ATOM   837   C  C   . THR A 1 103 ? 51.835  18.138  28.470  1.00 13.04  ? 103 THR A C   1 
ATOM   838   O  O   . THR A 1 103 ? 52.344  17.201  29.066  1.00 12.18  ? 103 THR A O   1 
ATOM   839   C  CB  . THR A 1 103 ? 49.848  17.815  27.004  1.00 12.51  ? 103 THR A CB  1 
ATOM   840   O  OG1 . THR A 1 103 ? 48.412  17.874  26.958  1.00 13.41  ? 103 THR A OG1 1 
ATOM   841   C  CG2 . THR A 1 103 ? 50.240  16.470  26.749  1.00 12.06  ? 103 THR A CG2 1 
ATOM   842   N  N   . VAL A 1 104 ? 52.524  19.099  27.836  1.00 13.65  ? 104 VAL A N   1 
ATOM   843   C  CA  . VAL A 1 104 ? 53.965  19.131  27.736  1.00 14.10  ? 104 VAL A CA  1 
ATOM   844   C  C   . VAL A 1 104 ? 54.588  19.314  29.110  1.00 15.62  ? 104 VAL A C   1 
ATOM   845   O  O   . VAL A 1 104 ? 55.639  18.745  29.384  1.00 17.25  ? 104 VAL A O   1 
ATOM   846   C  CB  . VAL A 1 104 ? 54.469  20.297  26.825  1.00 14.01  ? 104 VAL A CB  1 
ATOM   847   C  CG1 . VAL A 1 104 ? 55.950  20.541  27.053  1.00 13.30  ? 104 VAL A CG1 1 
ATOM   848   C  CG2 . VAL A 1 104 ? 54.187  20.056  25.328  1.00 13.27  ? 104 VAL A CG2 1 
ATOM   849   N  N   . VAL A 1 105 ? 53.970  20.124  29.963  1.00 16.32  ? 105 VAL A N   1 
ATOM   850   C  CA  . VAL A 1 105 ? 54.591  20.457  31.245  1.00 18.44  ? 105 VAL A CA  1 
ATOM   851   C  C   . VAL A 1 105 ? 54.541  19.210  32.169  1.00 20.70  ? 105 VAL A C   1 
ATOM   852   O  O   . VAL A 1 105 ? 55.428  18.980  32.981  1.00 20.21  ? 105 VAL A O   1 
ATOM   853   C  CB  . VAL A 1 105 ? 53.959  21.742  31.864  1.00 18.70  ? 105 VAL A CB  1 
ATOM   854   C  CG1 . VAL A 1 105 ? 52.849  21.411  32.836  1.00 19.00  ? 105 VAL A CG1 1 
ATOM   855   C  CG2 . VAL A 1 105 ? 55.013  22.614  32.528  1.00 19.32  ? 105 VAL A CG2 1 
ATOM   856   N  N   . SER A 1 106 ? 53.554  18.357  31.967  1.00 20.20  ? 106 SER A N   1 
ATOM   857   C  CA  . SER A 1 106 ? 53.508  17.124  32.712  1.00 23.39  ? 106 SER A CA  1 
ATOM   858   C  C   . SER A 1 106 ? 54.548  16.106  32.272  1.00 25.21  ? 106 SER A C   1 
ATOM   859   O  O   . SER A 1 106 ? 54.812  15.137  33.014  1.00 25.48  ? 106 SER A O   1 
ATOM   860   C  CB  . SER A 1 106 ? 52.130  16.500  32.541  1.00 25.67  ? 106 SER A CB  1 
ATOM   861   O  OG  . SER A 1 106 ? 51.157  17.503  32.776  1.00 29.83  ? 106 SER A OG  1 
ATOM   862   N  N   . TYR A 1 107 ? 55.086  16.255  31.056  1.00 22.02  ? 107 TYR A N   1 
ATOM   863   C  CA  . TYR A 1 107 ? 56.100  15.320  30.638  1.00 23.06  ? 107 TYR A CA  1 
ATOM   864   C  C   . TYR A 1 107 ? 57.094  15.961  29.724  1.00 22.22  ? 107 TYR A C   1 
ATOM   865   O  O   . TYR A 1 107 ? 57.194  15.548  28.564  1.00 22.15  ? 107 TYR A O   1 
ATOM   866   C  CB  . TYR A 1 107 ? 55.516  14.132  29.882  1.00 24.51  ? 107 TYR A CB  1 
ATOM   867   C  CG  . TYR A 1 107 ? 54.457  13.370  30.605  1.00 26.47  ? 107 TYR A CG  1 
ATOM   868   C  CD1 . TYR A 1 107 ? 54.789  12.350  31.505  1.00 28.03  ? 107 TYR A CD1 1 
ATOM   869   C  CD2 . TYR A 1 107 ? 53.124  13.670  30.397  1.00 27.19  ? 107 TYR A CD2 1 
ATOM   870   C  CE1 . TYR A 1 107 ? 53.806  11.656  32.163  1.00 29.99  ? 107 TYR A CE1 1 
ATOM   871   C  CE2 . TYR A 1 107 ? 52.136  12.984  31.049  1.00 29.75  ? 107 TYR A CE2 1 
ATOM   872   C  CZ  . TYR A 1 107 ? 52.480  11.980  31.921  1.00 30.69  ? 107 TYR A CZ  1 
ATOM   873   O  OH  . TYR A 1 107 ? 51.468  11.323  32.576  1.00 39.07  ? 107 TYR A OH  1 
ATOM   874   N  N   . PRO A 1 108 ? 57.847  16.927  30.236  1.00 20.74  ? 108 PRO A N   1 
ATOM   875   C  CA  . PRO A 1 108 ? 58.743  17.719  29.381  1.00 21.85  ? 108 PRO A CA  1 
ATOM   876   C  C   . PRO A 1 108 ? 59.986  16.929  28.913  1.00 21.34  ? 108 PRO A C   1 
ATOM   877   O  O   . PRO A 1 108 ? 60.765  17.415  28.112  1.00 21.61  ? 108 PRO A O   1 
ATOM   878   C  CB  . PRO A 1 108 ? 59.142  18.915  30.278  1.00 20.20  ? 108 PRO A CB  1 
ATOM   879   C  CG  . PRO A 1 108 ? 58.569  18.614  31.630  1.00 21.73  ? 108 PRO A CG  1 
ATOM   880   C  CD  . PRO A 1 108 ? 58.072  17.196  31.660  1.00 20.30  ? 108 PRO A CD  1 
ATOM   881   N  N   . ARG A 1 109 ? 60.173  15.725  29.412  1.00 21.82  ? 109 ARG A N   1 
ATOM   882   C  CA  . ARG A 1 109 ? 61.150  14.845  28.786  1.00 24.25  ? 109 ARG A CA  1 
ATOM   883   C  C   . ARG A 1 109 ? 60.532  13.950  27.646  1.00 20.89  ? 109 ARG A C   1 
ATOM   884   O  O   . ARG A 1 109 ? 61.254  13.313  26.910  1.00 19.88  ? 109 ARG A O   1 
ATOM   885   C  CB  . ARG A 1 109 ? 61.928  14.046  29.867  1.00 30.13  ? 109 ARG A CB  1 
ATOM   886   C  CG  . ARG A 1 109 ? 61.335  12.678  30.243  1.00 38.61  ? 109 ARG A CG  1 
ATOM   887   C  CD  . ARG A 1 109 ? 61.817  12.183  31.617  1.00 50.11  ? 109 ARG A CD  1 
ATOM   888   N  NE  . ARG A 1 109 ? 61.776  10.717  31.801  1.00 52.69  ? 109 ARG A NE  1 
ATOM   889   C  CZ  . ARG A 1 109 ? 61.929  10.101  32.985  1.00 60.39  ? 109 ARG A CZ  1 
ATOM   890   N  NH1 . ARG A 1 109 ? 62.120  10.813  34.100  1.00 61.87  ? 109 ARG A NH1 1 
ATOM   891   N  NH2 . ARG A 1 109 ? 61.887  8.771   33.070  1.00 58.27  ? 109 ARG A NH2 1 
ATOM   892   N  N   . ARG A 1 110 ? 59.210  13.913  27.493  1.00 19.06  ? 110 ARG A N   1 
ATOM   893   C  CA  . ARG A 1 110 ? 58.620  13.054  26.465  1.00 18.23  ? 110 ARG A CA  1 
ATOM   894   C  C   . ARG A 1 110 ? 57.872  13.790  25.335  1.00 17.22  ? 110 ARG A C   1 
ATOM   895   O  O   . ARG A 1 110 ? 57.675  13.208  24.262  1.00 16.53  ? 110 ARG A O   1 
ATOM   896   C  CB  . ARG A 1 110 ? 57.792  11.921  27.076  1.00 18.80  ? 110 ARG A CB  1 
ATOM   897   C  CG  . ARG A 1 110 ? 58.429  11.193  28.271  1.00 20.52  ? 110 ARG A CG  1 
ATOM   898   C  CD  . ARG A 1 110 ? 59.606  10.256  27.924  1.00 20.85  ? 110 ARG A CD  1 
ATOM   899   N  NE  . ARG A 1 110 ? 59.313  9.328   26.816  1.00 20.66  ? 110 ARG A NE  1 
ATOM   900   C  CZ  . ARG A 1 110 ? 58.695  8.163   26.974  1.00 21.12  ? 110 ARG A CZ  1 
ATOM   901   N  NH1 . ARG A 1 110 ? 58.280  7.804   28.193  1.00 19.26  ? 110 ARG A NH1 1 
ATOM   902   N  NH2 . ARG A 1 110 ? 58.490  7.364   25.921  1.00 19.53  ? 110 ARG A NH2 1 
ATOM   903   N  N   . PHE A 1 111 ? 57.537  15.073  25.555  1.00 15.88  ? 111 PHE A N   1 
ATOM   904   C  CA  . PHE A 1 111 ? 56.792  15.882  24.598  1.00 15.32  ? 111 PHE A CA  1 
ATOM   905   C  C   . PHE A 1 111 ? 57.401  17.254  24.372  1.00 16.06  ? 111 PHE A C   1 
ATOM   906   O  O   . PHE A 1 111 ? 58.020  17.800  25.252  1.00 17.96  ? 111 PHE A O   1 
ATOM   907   C  CB  . PHE A 1 111 ? 55.345  16.115  25.052  1.00 14.82  ? 111 PHE A CB  1 
ATOM   908   C  CG  . PHE A 1 111 ? 54.560  14.863  25.289  1.00 14.63  ? 111 PHE A CG  1 
ATOM   909   C  CD1 . PHE A 1 111 ? 54.469  13.874  24.306  1.00 14.84  ? 111 PHE A CD1 1 
ATOM   910   C  CD2 . PHE A 1 111 ? 53.845  14.696  26.471  1.00 14.93  ? 111 PHE A CD2 1 
ATOM   911   C  CE1 . PHE A 1 111 ? 53.728  12.731  24.492  1.00 14.51  ? 111 PHE A CE1 1 
ATOM   912   C  CE2 . PHE A 1 111 ? 53.095  13.541  26.677  1.00 15.59  ? 111 PHE A CE2 1 
ATOM   913   C  CZ  . PHE A 1 111 ? 53.058  12.547  25.682  1.00 15.69  ? 111 PHE A CZ  1 
ATOM   914   N  N   . VAL A 1 112 ? 57.198  17.835  23.190  1.00 15.41  ? 112 VAL A N   1 
ATOM   915   C  CA  . VAL A 1 112 ? 57.454  19.251  22.987  1.00 13.93  ? 112 VAL A CA  1 
ATOM   916   C  C   . VAL A 1 112 ? 56.223  19.755  22.241  1.00 14.02  ? 112 VAL A C   1 
ATOM   917   O  O   . VAL A 1 112 ? 55.492  18.967  21.625  1.00 12.98  ? 112 VAL A O   1 
ATOM   918   C  CB  . VAL A 1 112 ? 58.781  19.520  22.235  1.00 14.45  ? 112 VAL A CB  1 
ATOM   919   C  CG1 . VAL A 1 112 ? 59.938  18.790  22.886  1.00 14.05  ? 112 VAL A CG1 1 
ATOM   920   C  CG2 . VAL A 1 112 ? 58.713  19.063  20.775  1.00 15.09  ? 112 VAL A CG2 1 
ATOM   921   N  N   . GLY A 1 113 ? 55.955  21.057  22.308  1.00 14.03  ? 113 GLY A N   1 
ATOM   922   C  CA  . GLY A 1 113 ? 54.688  21.561  21.779  1.00 14.15  ? 113 GLY A CA  1 
ATOM   923   C  C   . GLY A 1 113 ? 54.965  22.219  20.435  1.00 14.21  ? 113 GLY A C   1 
ATOM   924   O  O   . GLY A 1 113 ? 55.986  22.843  20.310  1.00 13.36  ? 113 GLY A O   1 
ATOM   925   N  N   . LEU A 1 114 ? 54.082  22.029  19.447  1.00 14.37  ? 114 LEU A N   1 
ATOM   926   C  CA  . LEU A 1 114 ? 54.058  22.846  18.215  1.00 15.22  ? 114 LEU A CA  1 
ATOM   927   C  C   . LEU A 1 114 ? 52.770  23.566  18.178  1.00 13.98  ? 114 LEU A C   1 
ATOM   928   O  O   . LEU A 1 114 ? 51.755  22.942  17.999  1.00 16.64  ? 114 LEU A O   1 
ATOM   929   C  CB  . LEU A 1 114 ? 54.162  21.978  16.954  1.00 15.49  ? 114 LEU A CB  1 
ATOM   930   C  CG  . LEU A 1 114 ? 55.521  21.259  16.832  1.00 16.87  ? 114 LEU A CG  1 
ATOM   931   C  CD1 . LEU A 1 114 ? 55.620  20.509  15.488  1.00 18.26  ? 114 LEU A CD1 1 
ATOM   932   C  CD2 . LEU A 1 114 ? 56.698  22.219  17.040  1.00 16.08  ? 114 LEU A CD2 1 
ATOM   933   N  N   . GLY A 1 115 ? 52.777  24.859  18.370  1.00 13.02  ? 115 GLY A N   1 
ATOM   934   C  CA  . GLY A 1 115 ? 51.510  25.560  18.520  1.00 13.46  ? 115 GLY A CA  1 
ATOM   935   C  C   . GLY A 1 115 ? 50.768  25.833  17.227  1.00 14.03  ? 115 GLY A C   1 
ATOM   936   O  O   . GLY A 1 115 ? 51.250  25.526  16.137  1.00 12.59  ? 115 GLY A O   1 
ATOM   937   N  N   . THR A 1 116 ? 49.578  26.402  17.362  1.00 15.69  ? 116 THR A N   1 
ATOM   938   C  CA  . THR A 1 116 ? 48.760  26.785  16.234  1.00 18.34  ? 116 THR A CA  1 
ATOM   939   C  C   . THR A 1 116 ? 48.518  28.338  16.256  1.00 18.79  ? 116 THR A C   1 
ATOM   940   O  O   . THR A 1 116 ? 48.675  28.953  17.302  1.00 18.73  ? 116 THR A O   1 
ATOM   941   C  CB  . THR A 1 116 ? 47.494  25.877  16.213  1.00 21.94  ? 116 THR A CB  1 
ATOM   942   O  OG1 . THR A 1 116 ? 46.981  25.735  14.876  1.00 27.33  ? 116 THR A OG1 1 
ATOM   943   C  CG2 . THR A 1 116 ? 46.397  26.373  17.125  1.00 22.84  ? 116 THR A CG2 1 
ATOM   944   N  N   . LEU A 1 117 ? 48.196  28.983  15.123  1.00 18.10  ? 117 LEU A N   1 
ATOM   945   C  CA  . LEU A 1 117 ? 48.105  30.461  15.061  1.00 17.99  ? 117 LEU A CA  1 
ATOM   946   C  C   . LEU A 1 117 ? 46.893  30.892  14.268  1.00 18.86  ? 117 LEU A C   1 
ATOM   947   O  O   . LEU A 1 117 ? 46.457  30.124  13.407  1.00 18.59  ? 117 LEU A O   1 
ATOM   948   C  CB  . LEU A 1 117 ? 49.330  31.076  14.364  1.00 17.76  ? 117 LEU A CB  1 
ATOM   949   C  CG  . LEU A 1 117 ? 50.731  30.699  14.863  1.00 18.80  ? 117 LEU A CG  1 
ATOM   950   C  CD1 . LEU A 1 117 ? 51.828  31.179  13.926  1.00 18.81  ? 117 LEU A CD1 1 
ATOM   951   C  CD2 . LEU A 1 117 ? 50.977  31.222  16.285  1.00 18.63  ? 117 LEU A CD2 1 
ATOM   952   N  N   . PRO A 1 118 ? 46.356  32.136  14.527  1.00 18.96  ? 118 PRO A N   1 
ATOM   953   C  CA  . PRO A 1 118 ? 45.379  32.723  13.561  1.00 17.33  ? 118 PRO A CA  1 
ATOM   954   C  C   . PRO A 1 118 ? 46.060  33.288  12.291  1.00 18.34  ? 118 PRO A C   1 
ATOM   955   O  O   . PRO A 1 118 ? 46.152  34.511  12.109  1.00 17.41  ? 118 PRO A O   1 
ATOM   956   C  CB  . PRO A 1 118 ? 44.692  33.837  14.369  1.00 16.44  ? 118 PRO A CB  1 
ATOM   957   C  CG  . PRO A 1 118 ? 45.647  34.185  15.467  1.00 15.73  ? 118 PRO A CG  1 
ATOM   958   C  CD  . PRO A 1 118 ? 46.461  32.953  15.772  1.00 16.45  ? 118 PRO A CD  1 
ATOM   959   N  N   . MET A 1 119 ? 46.502  32.384  11.413  1.00 18.76  ? 119 MET A N   1 
ATOM   960   C  CA  . MET A 1 119 ? 47.217  32.749  10.190  1.00 21.60  ? 119 MET A CA  1 
ATOM   961   C  C   . MET A 1 119 ? 46.533  33.763  9.268   1.00 20.74  ? 119 MET A C   1 
ATOM   962   O  O   . MET A 1 119 ? 47.221  34.475  8.532   1.00 22.02  ? 119 MET A O   1 
ATOM   963   C  CB  . MET A 1 119 ? 47.571  31.505  9.358   1.00 22.85  ? 119 MET A CB  1 
ATOM   964   C  CG  . MET A 1 119 ? 48.687  30.673  9.946   1.00 25.17  ? 119 MET A CG  1 
ATOM   965   S  SD  . MET A 1 119 ? 50.171  31.615  10.334  1.00 27.00  ? 119 MET A SD  1 
ATOM   966   C  CE  . MET A 1 119 ? 50.722  31.854  8.630   1.00 27.88  ? 119 MET A CE  1 
ATOM   967   N  N   . GLN A 1 120 ? 45.208  33.791  9.279   1.00 20.04  ? 120 GLN A N   1 
ATOM   968   C  CA  . GLN A 1 120 ? 44.454  34.720  8.434   1.00 19.97  ? 120 GLN A CA  1 
ATOM   969   C  C   . GLN A 1 120 ? 44.519  36.185  8.928   1.00 21.58  ? 120 GLN A C   1 
ATOM   970   O  O   . GLN A 1 120 ? 43.979  37.108  8.307   1.00 22.65  ? 120 GLN A O   1 
ATOM   971   C  CB  . GLN A 1 120 ? 43.005  34.232  8.256   1.00 18.53  ? 120 GLN A CB  1 
ATOM   972   C  CG  . GLN A 1 120 ? 42.082  34.578  9.403   1.00 19.65  ? 120 GLN A CG  1 
ATOM   973   C  CD  . GLN A 1 120 ? 41.946  33.464  10.466  1.00 19.20  ? 120 GLN A CD  1 
ATOM   974   O  OE1 . GLN A 1 120 ? 42.930  32.821  10.876  1.00 17.25  ? 120 GLN A OE1 1 
ATOM   975   N  NE2 . GLN A 1 120 ? 40.724  33.269  10.933  1.00 18.05  ? 120 GLN A NE2 1 
ATOM   976   N  N   . ALA A 1 121 ? 45.188  36.407  10.055  1.00 22.74  ? 121 ALA A N   1 
ATOM   977   C  CA  . ALA A 1 121 ? 45.359  37.749  10.564  1.00 21.77  ? 121 ALA A CA  1 
ATOM   978   C  C   . ALA A 1 121 ? 46.807  37.884  11.036  1.00 23.93  ? 121 ALA A C   1 
ATOM   979   O  O   . ALA A 1 121 ? 47.136  37.711  12.238  1.00 23.22  ? 121 ALA A O   1 
ATOM   980   C  CB  . ALA A 1 121 ? 44.371  38.031  11.662  1.00 20.71  ? 121 ALA A CB  1 
ATOM   981   N  N   . PRO A 1 122 ? 47.694  38.217  10.086  1.00 23.55  ? 122 PRO A N   1 
ATOM   982   C  CA  . PRO A 1 122 ? 49.123  38.223  10.362  1.00 24.99  ? 122 PRO A CA  1 
ATOM   983   C  C   . PRO A 1 122 ? 49.558  38.920  11.675  1.00 25.54  ? 122 PRO A C   1 
ATOM   984   O  O   . PRO A 1 122 ? 50.417  38.374  12.346  1.00 27.09  ? 122 PRO A O   1 
ATOM   985   C  CB  . PRO A 1 122 ? 49.727  38.884  9.108   1.00 23.68  ? 122 PRO A CB  1 
ATOM   986   C  CG  . PRO A 1 122 ? 48.715  38.639  8.043   1.00 24.91  ? 122 PRO A CG  1 
ATOM   987   C  CD  . PRO A 1 122 ? 47.380  38.664  8.722   1.00 24.23  ? 122 PRO A CD  1 
ATOM   988   N  N   . GLU A 1 123 ? 49.009  40.099  12.016  1.00 27.17  ? 123 GLU A N   1 
ATOM   989   C  CA  . GLU A 1 123 ? 49.325  40.789  13.294  1.00 29.73  ? 123 GLU A CA  1 
ATOM   990   C  C   . GLU A 1 123 ? 48.956  39.906  14.525  1.00 26.72  ? 123 GLU A C   1 
ATOM   991   O  O   . GLU A 1 123 ? 49.797  39.676  15.420  1.00 21.62  ? 123 GLU A O   1 
ATOM   992   C  CB  . GLU A 1 123 ? 48.677  42.207  13.359  1.00 36.68  ? 123 GLU A CB  1 
ATOM   993   C  CG  . GLU A 1 123 ? 48.343  42.797  14.761  1.00 44.60  ? 123 GLU A CG  1 
ATOM   994   C  CD  . GLU A 1 123 ? 49.425  43.725  15.399  1.00 52.61  ? 123 GLU A CD  1 
ATOM   995   O  OE1 . GLU A 1 123 ? 49.084  44.877  15.805  1.00 49.11  ? 123 GLU A OE1 1 
ATOM   996   O  OE2 . GLU A 1 123 ? 50.615  43.323  15.517  1.00 52.59  ? 123 GLU A OE2 1 
ATOM   997   N  N   . LEU A 1 124 ? 47.727  39.386  14.529  1.00 23.68  ? 124 LEU A N   1 
ATOM   998   C  CA  . LEU A 1 124 ? 47.285  38.495  15.600  1.00 22.90  ? 124 LEU A CA  1 
ATOM   999   C  C   . LEU A 1 124 ? 48.144  37.244  15.691  1.00 22.61  ? 124 LEU A C   1 
ATOM   1000  O  O   . LEU A 1 124 ? 48.498  36.815  16.783  1.00 24.68  ? 124 LEU A O   1 
ATOM   1001  C  CB  . LEU A 1 124 ? 45.811  38.153  15.477  1.00 22.30  ? 124 LEU A CB  1 
ATOM   1002  C  CG  . LEU A 1 124 ? 44.849  39.345  15.548  1.00 22.20  ? 124 LEU A CG  1 
ATOM   1003  C  CD1 . LEU A 1 124 ? 43.451  38.812  15.351  1.00 22.63  ? 124 LEU A CD1 1 
ATOM   1004  C  CD2 . LEU A 1 124 ? 44.928  40.124  16.857  1.00 20.24  ? 124 LEU A CD2 1 
ATOM   1005  N  N   . ALA A 1 125 ? 48.557  36.706  14.550  1.00 22.85  ? 125 ALA A N   1 
ATOM   1006  C  CA  . ALA A 1 125 ? 49.462  35.537  14.534  1.00 21.01  ? 125 ALA A CA  1 
ATOM   1007  C  C   . ALA A 1 125 ? 50.877  35.805  15.062  1.00 20.84  ? 125 ALA A C   1 
ATOM   1008  O  O   . ALA A 1 125 ? 51.469  34.911  15.667  1.00 20.61  ? 125 ALA A O   1 
ATOM   1009  C  CB  . ALA A 1 125 ? 49.509  34.899  13.149  1.00 19.83  ? 125 ALA A CB  1 
ATOM   1010  N  N   . VAL A 1 126 ? 51.422  37.013  14.867  1.00 21.59  ? 126 VAL A N   1 
ATOM   1011  C  CA  . VAL A 1 126 ? 52.740  37.338  15.452  1.00 21.72  ? 126 VAL A CA  1 
ATOM   1012  C  C   . VAL A 1 126 ? 52.647  37.389  16.967  1.00 22.94  ? 126 VAL A C   1 
ATOM   1013  O  O   . VAL A 1 126 ? 53.545  36.896  17.643  1.00 24.04  ? 126 VAL A O   1 
ATOM   1014  C  CB  . VAL A 1 126 ? 53.357  38.670  14.927  1.00 23.27  ? 126 VAL A CB  1 
ATOM   1015  C  CG1 . VAL A 1 126 ? 54.602  39.078  15.723  1.00 21.80  ? 126 VAL A CG1 1 
ATOM   1016  C  CG2 . VAL A 1 126 ? 53.696  38.587  13.453  1.00 21.42  ? 126 VAL A CG2 1 
ATOM   1017  N  N   . LYS A 1 127 ? 51.566  37.939  17.516  1.00 24.06  ? 127 LYS A N   1 
ATOM   1018  C  CA  . LYS A 1 127 ? 51.437  37.984  18.993  1.00 26.88  ? 127 LYS A CA  1 
ATOM   1019  C  C   . LYS A 1 127 ? 51.335  36.611  19.675  1.00 23.70  ? 127 LYS A C   1 
ATOM   1020  O  O   . LYS A 1 127 ? 52.033  36.352  20.669  1.00 21.09  ? 127 LYS A O   1 
ATOM   1021  C  CB  . LYS A 1 127 ? 50.291  38.897  19.443  1.00 34.63  ? 127 LYS A CB  1 
ATOM   1022  C  CG  . LYS A 1 127 ? 50.657  40.381  19.547  1.00 41.80  ? 127 LYS A CG  1 
ATOM   1023  C  CD  . LYS A 1 127 ? 51.560  40.686  20.759  1.00 49.46  ? 127 LYS A CD  1 
ATOM   1024  C  CE  . LYS A 1 127 ? 51.619  42.187  21.082  1.00 53.05  ? 127 LYS A CE  1 
ATOM   1025  N  NZ  . LYS A 1 127 ? 52.531  42.528  22.218  1.00 54.38  ? 127 LYS A NZ  1 
ATOM   1026  N  N   . GLU A 1 128 ? 50.511  35.727  19.100  1.00 23.70  ? 128 GLU A N   1 
ATOM   1027  C  CA  . GLU A 1 128 ? 50.386  34.354  19.572  1.00 24.14  ? 128 GLU A CA  1 
ATOM   1028  C  C   . GLU A 1 128 ? 51.702  33.576  19.430  1.00 25.51  ? 128 GLU A C   1 
ATOM   1029  O  O   . GLU A 1 128 ? 52.018  32.741  20.305  1.00 24.14  ? 128 GLU A O   1 
ATOM   1030  C  CB  . GLU A 1 128 ? 49.188  33.601  18.952  1.00 24.72  ? 128 GLU A CB  1 
ATOM   1031  C  CG  . GLU A 1 128 ? 49.028  32.144  19.464  1.00 26.08  ? 128 GLU A CG  1 
ATOM   1032  C  CD  . GLU A 1 128 ? 48.589  32.010  20.957  1.00 28.89  ? 128 GLU A CD  1 
ATOM   1033  O  OE1 . GLU A 1 128 ? 48.548  33.037  21.694  1.00 31.14  ? 128 GLU A OE1 1 
ATOM   1034  O  OE2 . GLU A 1 128 ? 48.268  30.884  21.420  1.00 24.09  ? 128 GLU A OE2 1 
ATOM   1035  N  N   . MET A 1 129 ? 52.470  33.846  18.361  1.00 24.62  ? 129 MET A N   1 
ATOM   1036  C  CA  . MET A 1 129 ? 53.796  33.242  18.251  1.00 23.85  ? 129 MET A CA  1 
ATOM   1037  C  C   . MET A 1 129 ? 54.692  33.744  19.380  1.00 23.70  ? 129 MET A C   1 
ATOM   1038  O  O   . MET A 1 129 ? 55.294  32.958  20.105  1.00 24.06  ? 129 MET A O   1 
ATOM   1039  C  CB  . MET A 1 129 ? 54.425  33.480  16.879  1.00 24.32  ? 129 MET A CB  1 
ATOM   1040  C  CG  . MET A 1 129 ? 55.689  32.642  16.644  1.00 28.65  ? 129 MET A CG  1 
ATOM   1041  S  SD  . MET A 1 129 ? 56.481  32.683  14.997  1.00 33.76  ? 129 MET A SD  1 
ATOM   1042  C  CE  . MET A 1 129 ? 55.052  33.086  13.982  1.00 28.85  ? 129 MET A CE  1 
ATOM   1043  N  N   . GLU A 1 130 ? 54.792  35.055  19.525  1.00 26.50  ? 130 GLU A N   1 
ATOM   1044  C  CA  . GLU A 1 130 ? 55.482  35.661  20.692  1.00 28.83  ? 130 GLU A CA  1 
ATOM   1045  C  C   . GLU A 1 130 ? 55.162  34.918  21.979  1.00 23.13  ? 130 GLU A C   1 
ATOM   1046  O  O   . GLU A 1 130 ? 56.046  34.509  22.700  1.00 22.39  ? 130 GLU A O   1 
ATOM   1047  C  CB  . GLU A 1 130 ? 55.144  37.161  20.851  1.00 31.93  ? 130 GLU A CB  1 
ATOM   1048  C  CG  . GLU A 1 130 ? 56.339  38.080  20.628  1.00 42.07  ? 130 GLU A CG  1 
ATOM   1049  C  CD  . GLU A 1 130 ? 56.079  39.177  19.579  1.00 49.90  ? 130 GLU A CD  1 
ATOM   1050  O  OE1 . GLU A 1 130 ? 55.049  39.908  19.666  1.00 54.30  ? 130 GLU A OE1 1 
ATOM   1051  O  OE2 . GLU A 1 130 ? 56.923  39.315  18.657  1.00 49.74  ? 130 GLU A OE2 1 
ATOM   1052  N  N   . ARG A 1 131 ? 53.883  34.718  22.214  1.00 21.51  ? 131 ARG A N   1 
ATOM   1053  C  CA  . ARG A 1 131 ? 53.391  34.101  23.423  1.00 20.46  ? 131 ARG A CA  1 
ATOM   1054  C  C   . ARG A 1 131 ? 53.722  32.593  23.493  1.00 21.39  ? 131 ARG A C   1 
ATOM   1055  O  O   . ARG A 1 131 ? 54.211  32.116  24.522  1.00 21.42  ? 131 ARG A O   1 
ATOM   1056  C  CB  . ARG A 1 131 ? 51.895  34.353  23.443  1.00 21.51  ? 131 ARG A CB  1 
ATOM   1057  C  CG  . ARG A 1 131 ? 51.185  34.127  24.772  1.00 21.28  ? 131 ARG A CG  1 
ATOM   1058  C  CD  . ARG A 1 131 ? 49.759  33.693  24.498  1.00 21.14  ? 131 ARG A CD  1 
ATOM   1059  N  NE  . ARG A 1 131 ? 49.476  32.794  25.572  1.00 22.86  ? 131 ARG A NE  1 
ATOM   1060  C  CZ  . ARG A 1 131 ? 48.739  31.700  25.557  1.00 21.12  ? 131 ARG A CZ  1 
ATOM   1061  N  NH1 . ARG A 1 131 ? 48.077  31.241  24.507  1.00 21.79  ? 131 ARG A NH1 1 
ATOM   1062  N  NH2 . ARG A 1 131 ? 48.665  31.073  26.683  1.00 23.23  ? 131 ARG A NH2 1 
ATOM   1063  N  N   . CYS A 1 132 ? 53.501  31.846  22.403  1.00 20.37  ? 132 CYS A N   1 
ATOM   1064  C  CA  . CYS A 1 132 ? 53.948  30.454  22.339  1.00 22.40  ? 132 CYS A CA  1 
ATOM   1065  C  C   . CYS A 1 132 ? 55.433  30.266  22.596  1.00 22.62  ? 132 CYS A C   1 
ATOM   1066  O  O   . CYS A 1 132 ? 55.833  29.284  23.254  1.00 21.16  ? 132 CYS A O   1 
ATOM   1067  C  CB  . CYS A 1 132 ? 53.694  29.842  20.965  1.00 24.52  ? 132 CYS A CB  1 
ATOM   1068  S  SG  . CYS A 1 132 ? 51.979  29.474  20.639  1.00 28.86  ? 132 CYS A SG  1 
ATOM   1069  N  N   . VAL A 1 133 ? 56.262  31.145  22.027  1.00 21.99  ? 133 VAL A N   1 
ATOM   1070  C  CA  . VAL A 1 133 ? 57.689  30.981  22.230  1.00 24.24  ? 133 VAL A CA  1 
ATOM   1071  C  C   . VAL A 1 133 ? 58.167  31.514  23.576  1.00 25.87  ? 133 VAL A C   1 
ATOM   1072  O  O   . VAL A 1 133 ? 59.055  30.937  24.153  1.00 26.83  ? 133 VAL A O   1 
ATOM   1073  C  CB  . VAL A 1 133 ? 58.542  31.556  21.072  1.00 25.84  ? 133 VAL A CB  1 
ATOM   1074  C  CG1 . VAL A 1 133 ? 60.029  31.618  21.472  1.00 22.63  ? 133 VAL A CG1 1 
ATOM   1075  C  CG2 . VAL A 1 133 ? 58.326  30.719  19.798  1.00 23.34  ? 133 VAL A CG2 1 
ATOM   1076  N  N   . LYS A 1 134 ? 57.602  32.608  24.070  1.00 29.23  ? 134 LYS A N   1 
ATOM   1077  C  CA  . LYS A 1 134 ? 58.143  33.244  25.289  1.00 32.46  ? 134 LYS A CA  1 
ATOM   1078  C  C   . LYS A 1 134 ? 57.496  32.740  26.583  1.00 34.08  ? 134 LYS A C   1 
ATOM   1079  O  O   . LYS A 1 134 ? 58.207  32.375  27.543  1.00 32.58  ? 134 LYS A O   1 
ATOM   1080  C  CB  . LYS A 1 134 ? 58.081  34.783  25.220  1.00 34.51  ? 134 LYS A CB  1 
ATOM   1081  C  CG  . LYS A 1 134 ? 58.938  35.385  24.108  1.00 37.41  ? 134 LYS A CG  1 
ATOM   1082  C  CD  . LYS A 1 134 ? 60.371  34.900  24.227  1.00 38.32  ? 134 LYS A CD  1 
ATOM   1083  C  CE  . LYS A 1 134 ? 61.196  35.138  22.963  1.00 38.84  ? 134 LYS A CE  1 
ATOM   1084  N  NZ  . LYS A 1 134 ? 61.846  36.483  22.905  1.00 38.37  ? 134 LYS A NZ  1 
ATOM   1085  N  N   . GLU A 1 135 ? 56.159  32.726  26.604  1.00 30.11  ? 135 GLU A N   1 
ATOM   1086  C  CA  . GLU A 1 135 ? 55.411  32.250  27.749  1.00 27.86  ? 135 GLU A CA  1 
ATOM   1087  C  C   . GLU A 1 135 ? 55.429  30.729  27.814  1.00 26.06  ? 135 GLU A C   1 
ATOM   1088  O  O   . GLU A 1 135 ? 55.802  30.144  28.827  1.00 26.31  ? 135 GLU A O   1 
ATOM   1089  C  CB  . GLU A 1 135 ? 53.958  32.686  27.629  1.00 31.66  ? 135 GLU A CB  1 
ATOM   1090  C  CG  . GLU A 1 135 ? 53.576  33.930  28.399  1.00 34.74  ? 135 GLU A CG  1 
ATOM   1091  C  CD  . GLU A 1 135 ? 52.059  34.103  28.566  1.00 37.05  ? 135 GLU A CD  1 
ATOM   1092  O  OE1 . GLU A 1 135 ? 51.272  33.085  28.491  1.00 37.38  ? 135 GLU A OE1 1 
ATOM   1093  O  OE2 . GLU A 1 135 ? 51.663  35.284  28.784  1.00 34.32  ? 135 GLU A OE2 1 
ATOM   1094  N  N   . LEU A 1 136 ? 55.003  30.109  26.716  1.00 21.46  ? 136 LEU A N   1 
ATOM   1095  C  CA  . LEU A 1 136 ? 54.781  28.695  26.658  1.00 18.26  ? 136 LEU A CA  1 
ATOM   1096  C  C   . LEU A 1 136 ? 56.018  27.872  26.345  1.00 17.52  ? 136 LEU A C   1 
ATOM   1097  O  O   . LEU A 1 136 ? 56.057  26.692  26.667  1.00 18.19  ? 136 LEU A O   1 
ATOM   1098  C  CB  . LEU A 1 136 ? 53.657  28.370  25.682  1.00 17.83  ? 136 LEU A CB  1 
ATOM   1099  C  CG  . LEU A 1 136 ? 52.379  29.154  25.958  1.00 17.57  ? 136 LEU A CG  1 
ATOM   1100  C  CD1 . LEU A 1 136 ? 51.303  28.723  24.990  1.00 16.06  ? 136 LEU A CD1 1 
ATOM   1101  C  CD2 . LEU A 1 136 ? 51.939  28.955  27.419  1.00 17.39  ? 136 LEU A CD2 1 
ATOM   1102  N  N   . GLY A 1 137 ? 57.029  28.472  25.730  1.00 16.77  ? 137 GLY A N   1 
ATOM   1103  C  CA  . GLY A 1 137 ? 58.301  27.777  25.505  1.00 15.30  ? 137 GLY A CA  1 
ATOM   1104  C  C   . GLY A 1 137 ? 58.295  26.740  24.376  1.00 15.13  ? 137 GLY A C   1 
ATOM   1105  O  O   . GLY A 1 137 ? 59.159  25.877  24.334  1.00 13.91  ? 137 GLY A O   1 
ATOM   1106  N  N   . PHE A 1 138 ? 57.311  26.804  23.492  1.00 14.44  ? 138 PHE A N   1 
ATOM   1107  C  CA  . PHE A 1 138 ? 57.276  25.925  22.325  1.00 14.94  ? 138 PHE A CA  1 
ATOM   1108  C  C   . PHE A 1 138 ? 58.458  26.194  21.448  1.00 13.85  ? 138 PHE A C   1 
ATOM   1109  O  O   . PHE A 1 138 ? 58.790  27.308  21.264  1.00 14.82  ? 138 PHE A O   1 
ATOM   1110  C  CB  . PHE A 1 138 ? 56.003  26.166  21.468  1.00 13.86  ? 138 PHE A CB  1 
ATOM   1111  C  CG  . PHE A 1 138 ? 54.722  25.790  22.170  1.00 13.31  ? 138 PHE A CG  1 
ATOM   1112  C  CD1 . PHE A 1 138 ? 54.742  24.960  23.286  1.00 13.17  ? 138 PHE A CD1 1 
ATOM   1113  C  CD2 . PHE A 1 138 ? 53.501  26.235  21.702  1.00 12.79  ? 138 PHE A CD2 1 
ATOM   1114  C  CE1 . PHE A 1 138 ? 53.553  24.602  23.938  1.00 13.03  ? 138 PHE A CE1 1 
ATOM   1115  C  CE2 . PHE A 1 138 ? 52.317  25.878  22.333  1.00 12.68  ? 138 PHE A CE2 1 
ATOM   1116  C  CZ  . PHE A 1 138 ? 52.337  25.068  23.463  1.00 12.52  ? 138 PHE A CZ  1 
ATOM   1117  N  N   . PRO A 1 139 ? 59.075  25.161  20.884  1.00 14.10  ? 139 PRO A N   1 
ATOM   1118  C  CA  . PRO A 1 139 ? 60.140  25.413  19.855  1.00 13.69  ? 139 PRO A CA  1 
ATOM   1119  C  C   . PRO A 1 139 ? 59.623  25.802  18.464  1.00 13.73  ? 139 PRO A C   1 
ATOM   1120  O  O   . PRO A 1 139 ? 60.416  26.225  17.583  1.00 15.32  ? 139 PRO A O   1 
ATOM   1121  C  CB  . PRO A 1 139 ? 60.909  24.080  19.773  1.00 12.87  ? 139 PRO A CB  1 
ATOM   1122  C  CG  . PRO A 1 139 ? 59.982  23.062  20.347  1.00 14.43  ? 139 PRO A CG  1 
ATOM   1123  C  CD  . PRO A 1 139 ? 58.957  23.734  21.257  1.00 13.56  ? 139 PRO A CD  1 
ATOM   1124  N  N   . GLY A 1 140 ? 58.331  25.666  18.224  1.00 13.69  ? 140 GLY A N   1 
ATOM   1125  C  CA  . GLY A 1 140 ? 57.808  26.024  16.901  1.00 13.62  ? 140 GLY A CA  1 
ATOM   1126  C  C   . GLY A 1 140 ? 56.308  25.998  16.792  1.00 14.05  ? 140 GLY A C   1 
ATOM   1127  O  O   . GLY A 1 140 ? 55.607  25.798  17.796  1.00 13.27  ? 140 GLY A O   1 
ATOM   1128  N  N   . VAL A 1 141 ? 55.816  26.225  15.566  1.00 13.79  ? 141 VAL A N   1 
ATOM   1129  C  CA  . VAL A 1 141 ? 54.412  26.144  15.297  1.00 13.70  ? 141 VAL A CA  1 
ATOM   1130  C  C   . VAL A 1 141 ? 54.126  25.231  14.092  1.00 14.79  ? 141 VAL A C   1 
ATOM   1131  O  O   . VAL A 1 141 ? 54.991  25.015  13.217  1.00 15.16  ? 141 VAL A O   1 
ATOM   1132  C  CB  . VAL A 1 141 ? 53.826  27.543  15.090  1.00 14.41  ? 141 VAL A CB  1 
ATOM   1133  C  CG1 . VAL A 1 141 ? 53.880  28.338  16.401  1.00 14.89  ? 141 VAL A CG1 1 
ATOM   1134  C  CG2 . VAL A 1 141 ? 54.598  28.296  14.042  1.00 14.21  ? 141 VAL A CG2 1 
ATOM   1135  N  N   . GLN A 1 142 ? 52.913  24.689  14.077  1.00 15.45  ? 142 GLN A N   1 
ATOM   1136  C  CA  . GLN A 1 142 ? 52.345  23.963  12.964  1.00 15.59  ? 142 GLN A CA  1 
ATOM   1137  C  C   . GLN A 1 142 ? 51.407  24.917  12.216  1.00 16.25  ? 142 GLN A C   1 
ATOM   1138  O  O   . GLN A 1 142 ? 50.596  25.575  12.845  1.00 17.13  ? 142 GLN A O   1 
ATOM   1139  C  CB  . GLN A 1 142 ? 51.561  22.749  13.468  1.00 16.31  ? 142 GLN A CB  1 
ATOM   1140  C  CG  . GLN A 1 142 ? 50.841  21.968  12.356  1.00 16.82  ? 142 GLN A CG  1 
ATOM   1141  C  CD  . GLN A 1 142 ? 50.039  20.795  12.874  1.00 18.81  ? 142 GLN A CD  1 
ATOM   1142  O  OE1 . GLN A 1 142 ? 49.232  20.901  13.854  1.00 18.90  ? 142 GLN A OE1 1 
ATOM   1143  N  NE2 . GLN A 1 142 ? 50.252  19.647  12.237  1.00 17.78  ? 142 GLN A NE2 1 
ATOM   1144  N  N   . ILE A 1 143 ? 51.534  25.002  10.885  1.00 15.50  ? 143 ILE A N   1 
ATOM   1145  C  CA  . ILE A 1 143 ? 50.659  25.808  10.065  1.00 15.14  ? 143 ILE A CA  1 
ATOM   1146  C  C   . ILE A 1 143 ? 50.253  24.994  8.821   1.00 15.82  ? 143 ILE A C   1 
ATOM   1147  O  O   . ILE A 1 143 ? 50.872  23.953  8.522   1.00 16.10  ? 143 ILE A O   1 
ATOM   1148  C  CB  . ILE A 1 143 ? 51.327  27.140  9.652   1.00 16.35  ? 143 ILE A CB  1 
ATOM   1149  C  CG1 . ILE A 1 143 ? 52.545  26.867  8.753   1.00 16.04  ? 143 ILE A CG1 1 
ATOM   1150  C  CG2 . ILE A 1 143 ? 51.699  27.994  10.888  1.00 15.69  ? 143 ILE A CG2 1 
ATOM   1151  C  CD1 . ILE A 1 143 ? 53.000  28.055  7.955   1.00 16.91  ? 143 ILE A CD1 1 
ATOM   1152  N  N   . GLY A 1 144 ? 49.179  25.431  8.156   1.00 15.15  ? 144 GLY A N   1 
ATOM   1153  C  CA  . GLY A 1 144 ? 48.669  24.807  6.963   1.00 15.87  ? 144 GLY A CA  1 
ATOM   1154  C  C   . GLY A 1 144 ? 49.526  25.134  5.735   1.00 16.53  ? 144 GLY A C   1 
ATOM   1155  O  O   . GLY A 1 144 ? 50.379  26.034  5.759   1.00 15.69  ? 144 GLY A O   1 
ATOM   1156  N  N   . THR A 1 145 ? 49.309  24.380  4.671   1.00 15.76  ? 145 THR A N   1 
ATOM   1157  C  CA  . THR A 1 145 ? 49.993  24.610  3.423   1.00 17.25  ? 145 THR A CA  1 
ATOM   1158  C  C   . THR A 1 145 ? 49.479  25.857  2.707   1.00 18.20  ? 145 THR A C   1 
ATOM   1159  O  O   . THR A 1 145 ? 50.152  26.364  1.827   1.00 18.73  ? 145 THR A O   1 
ATOM   1160  C  CB  . THR A 1 145 ? 49.796  23.428  2.468   1.00 17.15  ? 145 THR A CB  1 
ATOM   1161  O  OG1 . THR A 1 145 ? 48.432  22.981  2.579   1.00 17.12  ? 145 THR A OG1 1 
ATOM   1162  C  CG2 . THR A 1 145 ? 50.773  22.284  2.806   1.00 15.96  ? 145 THR A CG2 1 
ATOM   1163  N  N   . HIS A 1 146 ? 48.284  26.316  3.064   1.00 20.06  ? 146 HIS A N   1 
ATOM   1164  C  CA  . HIS A 1 146 ? 47.728  27.587  2.560   1.00 21.08  ? 146 HIS A CA  1 
ATOM   1165  C  C   . HIS A 1 146 ? 46.688  28.153  3.495   1.00 20.70  ? 146 HIS A C   1 
ATOM   1166  O  O   . HIS A 1 146 ? 46.085  27.431  4.283   1.00 22.56  ? 146 HIS A O   1 
ATOM   1167  C  CB  . HIS A 1 146 ? 47.087  27.354  1.201   1.00 19.97  ? 146 HIS A CB  1 
ATOM   1168  C  CG  . HIS A 1 146 ? 45.807  26.617  1.284   1.00 20.00  ? 146 HIS A CG  1 
ATOM   1169  N  ND1 . HIS A 1 146 ? 45.753  25.273  1.304   1.00 20.44  ? 146 HIS A ND1 1 
ATOM   1170  C  CD2 . HIS A 1 146 ? 44.489  27.074  1.396   1.00 20.61  ? 146 HIS A CD2 1 
ATOM   1171  C  CE1 . HIS A 1 146 ? 44.448  24.879  1.387   1.00 20.62  ? 146 HIS A CE1 1 
ATOM   1172  N  NE2 . HIS A 1 146 ? 43.684  25.985  1.458   1.00 21.32  ? 146 HIS A NE2 1 
ATOM   1173  N  N   . VAL A 1 147 ? 46.432  29.442  3.381   1.00 21.97  ? 147 VAL A N   1 
ATOM   1174  C  CA  . VAL A 1 147 ? 45.490  30.145  4.269   1.00 22.23  ? 147 VAL A CA  1 
ATOM   1175  C  C   . VAL A 1 147 ? 44.295  30.746  3.524   1.00 23.84  ? 147 VAL A C   1 
ATOM   1176  O  O   . VAL A 1 147 ? 44.321  31.886  3.161   1.00 23.10  ? 147 VAL A O   1 
ATOM   1177  C  CB  . VAL A 1 147 ? 46.238  31.281  5.010   1.00 21.21  ? 147 VAL A CB  1 
ATOM   1178  C  CG1 . VAL A 1 147 ? 45.367  31.910  6.089   1.00 18.45  ? 147 VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A 1 147 ? 47.580  30.784  5.550   1.00 18.76  ? 147 VAL A CG2 1 
ATOM   1180  N  N   . ASN A 1 148 ? 43.220  29.986  3.319   1.00 28.32  ? 148 ASN A N   1 
ATOM   1181  C  CA  . ASN A 1 148 ? 42.092  30.486  2.527   1.00 30.64  ? 148 ASN A CA  1 
ATOM   1182  C  C   . ASN A 1 148 ? 42.562  30.681  1.061   1.00 34.96  ? 148 ASN A C   1 
ATOM   1183  O  O   . ASN A 1 148 ? 43.064  29.729  0.460   1.00 37.07  ? 148 ASN A O   1 
ATOM   1184  C  CB  . ASN A 1 148 ? 41.508  31.784  3.135   1.00 28.28  ? 148 ASN A CB  1 
ATOM   1185  C  CG  . ASN A 1 148 ? 40.907  31.585  4.535   1.00 27.37  ? 148 ASN A CG  1 
ATOM   1186  O  OD1 . ASN A 1 148 ? 40.127  30.671  4.754   1.00 24.54  ? 148 ASN A OD1 1 
ATOM   1187  N  ND2 . ASN A 1 148 ? 41.266  32.466  5.479   1.00 23.97  ? 148 ASN A ND2 1 
ATOM   1188  N  N   . GLU A 1 149 ? 42.433  31.891  0.504   1.00 38.07  ? 149 GLU A N   1 
ATOM   1189  C  CA  . GLU A 1 149 ? 42.953  32.202  -0.846  1.00 41.69  ? 149 GLU A CA  1 
ATOM   1190  C  C   . GLU A 1 149 ? 44.499  32.438  -0.887  1.00 41.07  ? 149 GLU A C   1 
ATOM   1191  O  O   . GLU A 1 149 ? 45.120  32.250  -1.934  1.00 39.72  ? 149 GLU A O   1 
ATOM   1192  C  CB  . GLU A 1 149 ? 42.114  33.318  -1.540  1.00 47.56  ? 149 GLU A CB  1 
ATOM   1193  C  CG  . GLU A 1 149 ? 42.618  33.884  -2.896  1.00 59.65  ? 149 GLU A CG  1 
ATOM   1194  C  CD  . GLU A 1 149 ? 42.628  32.903  -4.101  1.00 68.15  ? 149 GLU A CD  1 
ATOM   1195  O  OE1 . GLU A 1 149 ? 43.346  33.181  -5.109  1.00 61.62  ? 149 GLU A OE1 1 
ATOM   1196  O  OE2 . GLU A 1 149 ? 41.929  31.854  -4.066  1.00 73.46  ? 149 GLU A OE2 1 
ATOM   1197  N  N   . TRP A 1 150 ? 45.126  32.787  0.240   1.00 34.57  ? 150 TRP A N   1 
ATOM   1198  C  CA  . TRP A 1 150 ? 46.594  32.932  0.273   1.00 31.51  ? 150 TRP A CA  1 
ATOM   1199  C  C   . TRP A 1 150 ? 47.415  31.660  0.132   1.00 30.61  ? 150 TRP A C   1 
ATOM   1200  O  O   . TRP A 1 150 ? 47.088  30.597  0.683   1.00 28.51  ? 150 TRP A O   1 
ATOM   1201  C  CB  . TRP A 1 150 ? 47.025  33.616  1.563   1.00 32.43  ? 150 TRP A CB  1 
ATOM   1202  C  CG  . TRP A 1 150 ? 46.442  34.997  1.796   1.00 33.47  ? 150 TRP A CG  1 
ATOM   1203  C  CD1 . TRP A 1 150 ? 45.854  35.857  0.857   1.00 31.91  ? 150 TRP A CD1 1 
ATOM   1204  C  CD2 . TRP A 1 150 ? 46.415  35.741  3.061   1.00 32.22  ? 150 TRP A CD2 1 
ATOM   1205  N  NE1 . TRP A 1 150 ? 45.448  37.022  1.450   1.00 34.49  ? 150 TRP A NE1 1 
ATOM   1206  C  CE2 . TRP A 1 150 ? 45.748  37.026  2.767   1.00 33.31  ? 150 TRP A CE2 1 
ATOM   1207  C  CE3 . TRP A 1 150 ? 46.833  35.474  4.364   1.00 30.87  ? 150 TRP A CE3 1 
ATOM   1208  C  CZ2 . TRP A 1 150 ? 45.537  37.994  3.750   1.00 33.43  ? 150 TRP A CZ2 1 
ATOM   1209  C  CZ3 . TRP A 1 150 ? 46.610  36.448  5.348   1.00 31.69  ? 150 TRP A CZ3 1 
ATOM   1210  C  CH2 . TRP A 1 150 ? 45.985  37.688  5.043   1.00 32.75  ? 150 TRP A CH2 1 
ATOM   1211  N  N   . ASP A 1 151 ? 48.523  31.733  -0.581  1.00 28.34  ? 151 ASP A N   1 
ATOM   1212  C  CA  . ASP A 1 151 ? 49.456  30.648  -0.428  1.00 29.54  ? 151 ASP A CA  1 
ATOM   1213  C  C   . ASP A 1 151 ? 50.713  31.149  0.264   1.00 28.15  ? 151 ASP A C   1 
ATOM   1214  O  O   . ASP A 1 151 ? 50.839  32.336  0.559   1.00 27.48  ? 151 ASP A O   1 
ATOM   1215  C  CB  . ASP A 1 151 ? 49.707  29.849  -1.719  1.00 32.40  ? 151 ASP A CB  1 
ATOM   1216  C  CG  . ASP A 1 151 ? 49.767  28.293  -1.459  1.00 38.22  ? 151 ASP A CG  1 
ATOM   1217  O  OD1 . ASP A 1 151 ? 50.621  27.800  -0.614  1.00 28.10  ? 151 ASP A OD1 1 
ATOM   1218  O  OD2 . ASP A 1 151 ? 48.918  27.596  -2.117  1.00 38.37  ? 151 ASP A OD2 1 
ATOM   1219  N  N   . LEU A 1 152 ? 51.613  30.234  0.577   1.00 28.04  ? 152 LEU A N   1 
ATOM   1220  C  CA  . LEU A 1 152 ? 52.763  30.555  1.437   1.00 28.78  ? 152 LEU A CA  1 
ATOM   1221  C  C   . LEU A 1 152 ? 53.720  31.632  0.909   1.00 28.11  ? 152 LEU A C   1 
ATOM   1222  O  O   . LEU A 1 152 ? 54.613  32.101  1.652   1.00 28.17  ? 152 LEU A O   1 
ATOM   1223  C  CB  . LEU A 1 152 ? 53.494  29.267  1.854   1.00 26.96  ? 152 LEU A CB  1 
ATOM   1224  C  CG  . LEU A 1 152 ? 52.997  28.622  3.165   1.00 29.03  ? 152 LEU A CG  1 
ATOM   1225  C  CD1 . LEU A 1 152 ? 51.578  29.015  3.600   1.00 26.60  ? 152 LEU A CD1 1 
ATOM   1226  C  CD2 . LEU A 1 152 ? 53.118  27.109  3.092   1.00 28.90  ? 152 LEU A CD2 1 
ATOM   1227  N  N   . ASN A 1 153 ? 53.501  32.052  -0.340  1.00 26.34  ? 153 ASN A N   1 
ATOM   1228  C  CA  . ASN A 1 153 ? 54.200  33.216  -0.936  1.00 29.41  ? 153 ASN A CA  1 
ATOM   1229  C  C   . ASN A 1 153 ? 53.602  34.557  -0.566  1.00 25.73  ? 153 ASN A C   1 
ATOM   1230  O  O   . ASN A 1 153 ? 54.269  35.574  -0.716  1.00 28.23  ? 153 ASN A O   1 
ATOM   1231  C  CB  . ASN A 1 153 ? 54.189  33.155  -2.479  1.00 29.75  ? 153 ASN A CB  1 
ATOM   1232  C  CG  . ASN A 1 153 ? 52.793  33.306  -3.043  1.00 32.68  ? 153 ASN A CG  1 
ATOM   1233  O  OD1 . ASN A 1 153 ? 51.875  32.576  -2.659  1.00 32.38  ? 153 ASN A OD1 1 
ATOM   1234  N  ND2 . ASN A 1 153 ? 52.603  34.288  -3.916  1.00 36.00  ? 153 ASN A ND2 1 
ATOM   1235  N  N   . ALA A 1 154 ? 52.341  34.573  -0.154  1.00 23.28  ? 154 ALA A N   1 
ATOM   1236  C  CA  . ALA A 1 154 ? 51.633  35.837  0.063   1.00 25.57  ? 154 ALA A CA  1 
ATOM   1237  C  C   . ALA A 1 154 ? 52.432  36.826  0.903   1.00 26.99  ? 154 ALA A C   1 
ATOM   1238  O  O   . ALA A 1 154 ? 53.097  36.462  1.909   1.00 25.49  ? 154 ALA A O   1 
ATOM   1239  C  CB  . ALA A 1 154 ? 50.260  35.617  0.691   1.00 24.59  ? 154 ALA A CB  1 
ATOM   1240  N  N   . GLN A 1 155 ? 52.331  38.081  0.490   1.00 29.50  ? 155 GLN A N   1 
ATOM   1241  C  CA  . GLN A 1 155 ? 53.029  39.214  1.134   1.00 31.62  ? 155 GLN A CA  1 
ATOM   1242  C  C   . GLN A 1 155 ? 52.521  39.501  2.544   1.00 26.74  ? 155 GLN A C   1 
ATOM   1243  O  O   . GLN A 1 155 ? 53.296  39.707  3.449   1.00 25.42  ? 155 GLN A O   1 
ATOM   1244  C  CB  . GLN A 1 155 ? 52.912  40.457  0.245   1.00 34.29  ? 155 GLN A CB  1 
ATOM   1245  C  CG  . GLN A 1 155 ? 53.709  40.325  -1.044  1.00 40.80  ? 155 GLN A CG  1 
ATOM   1246  C  CD  . GLN A 1 155 ? 55.207  40.113  -0.795  1.00 46.84  ? 155 GLN A CD  1 
ATOM   1247  O  OE1 . GLN A 1 155 ? 55.744  40.498  0.255   1.00 51.52  ? 155 GLN A OE1 1 
ATOM   1248  N  NE2 . GLN A 1 155 ? 55.887  39.488  -1.761  1.00 44.11  ? 155 GLN A NE2 1 
ATOM   1249  N  N   . GLU A 1 156 ? 51.206  39.500  2.703   1.00 26.86  ? 156 GLU A N   1 
ATOM   1250  C  CA  . GLU A 1 156 ? 50.541  39.614  4.011   1.00 28.19  ? 156 GLU A CA  1 
ATOM   1251  C  C   . GLU A 1 156 ? 51.080  38.597  5.035   1.00 28.51  ? 156 GLU A C   1 
ATOM   1252  O  O   . GLU A 1 156 ? 51.154  38.914  6.198   1.00 29.01  ? 156 GLU A O   1 
ATOM   1253  C  CB  . GLU A 1 156 ? 49.034  39.420  3.861   1.00 29.33  ? 156 GLU A CB  1 
ATOM   1254  C  CG  . GLU A 1 156 ? 48.384  40.279  2.787   1.00 31.61  ? 156 GLU A CG  1 
ATOM   1255  C  CD  . GLU A 1 156 ? 48.577  39.739  1.363   1.00 30.22  ? 156 GLU A CD  1 
ATOM   1256  O  OE1 . GLU A 1 156 ? 49.597  39.065  1.073   1.00 32.71  ? 156 GLU A OE1 1 
ATOM   1257  O  OE2 . GLU A 1 156 ? 47.705  40.002  0.519   1.00 29.29  ? 156 GLU A OE2 1 
ATOM   1258  N  N   . LEU A 1 157 ? 51.498  37.406  4.593   1.00 28.33  ? 157 LEU A N   1 
ATOM   1259  C  CA  . LEU A 1 157 ? 52.120  36.434  5.479   1.00 27.78  ? 157 LEU A CA  1 
ATOM   1260  C  C   . LEU A 1 157 ? 53.543  36.752  5.843   1.00 27.60  ? 157 LEU A C   1 
ATOM   1261  O  O   . LEU A 1 157 ? 54.068  36.178  6.800   1.00 29.00  ? 157 LEU A O   1 
ATOM   1262  C  CB  . LEU A 1 157 ? 52.067  35.015  4.899   1.00 27.94  ? 157 LEU A CB  1 
ATOM   1263  C  CG  . LEU A 1 157 ? 50.678  34.400  4.879   1.00 27.58  ? 157 LEU A CG  1 
ATOM   1264  C  CD1 . LEU A 1 157 ? 50.717  32.929  4.508   1.00 27.56  ? 157 LEU A CD1 1 
ATOM   1265  C  CD2 . LEU A 1 157 ? 50.003  34.607  6.221   1.00 28.67  ? 157 LEU A CD2 1 
ATOM   1266  N  N   . PHE A 1 158 ? 54.184  37.658  5.117   1.00 26.09  ? 158 PHE A N   1 
ATOM   1267  C  CA  . PHE A 1 158 ? 55.623  37.913  5.357   1.00 26.40  ? 158 PHE A CA  1 
ATOM   1268  C  C   . PHE A 1 158 ? 56.049  38.342  6.796   1.00 26.21  ? 158 PHE A C   1 
ATOM   1269  O  O   . PHE A 1 158 ? 57.098  37.900  7.284   1.00 25.85  ? 158 PHE A O   1 
ATOM   1270  C  CB  . PHE A 1 158 ? 56.162  38.914  4.323   1.00 25.57  ? 158 PHE A CB  1 
ATOM   1271  C  CG  . PHE A 1 158 ? 56.752  38.284  3.104   1.00 25.50  ? 158 PHE A CG  1 
ATOM   1272  C  CD1 . PHE A 1 158 ? 56.095  37.252  2.431   1.00 26.21  ? 158 PHE A CD1 1 
ATOM   1273  C  CD2 . PHE A 1 158 ? 57.954  38.749  2.595   1.00 26.03  ? 158 PHE A CD2 1 
ATOM   1274  C  CE1 . PHE A 1 158 ? 56.632  36.685  1.283   1.00 25.40  ? 158 PHE A CE1 1 
ATOM   1275  C  CE2 . PHE A 1 158 ? 58.499  38.189  1.445   1.00 26.77  ? 158 PHE A CE2 1 
ATOM   1276  C  CZ  . PHE A 1 158 ? 57.840  37.153  0.789   1.00 25.95  ? 158 PHE A CZ  1 
ATOM   1277  N  N   . PRO A 1 159 ? 55.267  39.233  7.453   1.00 25.87  ? 159 PRO A N   1 
ATOM   1278  C  CA  . PRO A 1 159 ? 55.562  39.610  8.855   1.00 26.73  ? 159 PRO A CA  1 
ATOM   1279  C  C   . PRO A 1 159 ? 55.578  38.429  9.831   1.00 25.92  ? 159 PRO A C   1 
ATOM   1280  O  O   . PRO A 1 159 ? 56.380  38.402  10.777  1.00 28.69  ? 159 PRO A O   1 
ATOM   1281  C  CB  . PRO A 1 159 ? 54.447  40.608  9.188   1.00 27.02  ? 159 PRO A CB  1 
ATOM   1282  C  CG  . PRO A 1 159 ? 54.139  41.241  7.853   1.00 25.58  ? 159 PRO A CG  1 
ATOM   1283  C  CD  . PRO A 1 159 ? 54.204  40.089  6.881   1.00 25.31  ? 159 PRO A CD  1 
ATOM   1284  N  N   . VAL A 1 160 ? 54.750  37.435  9.554   1.00 25.14  ? 160 VAL A N   1 
ATOM   1285  C  CA  . VAL A 1 160 ? 54.786  36.163  10.270  1.00 24.56  ? 160 VAL A CA  1 
ATOM   1286  C  C   . VAL A 1 160 ? 56.117  35.433  10.131  1.00 24.84  ? 160 VAL A C   1 
ATOM   1287  O  O   . VAL A 1 160 ? 56.747  35.099  11.173  1.00 25.97  ? 160 VAL A O   1 
ATOM   1288  C  CB  . VAL A 1 160 ? 53.612  35.281  9.865   1.00 25.46  ? 160 VAL A CB  1 
ATOM   1289  C  CG1 . VAL A 1 160 ? 53.407  34.146  10.842  1.00 26.56  ? 160 VAL A CG1 1 
ATOM   1290  C  CG2 . VAL A 1 160 ? 52.348  36.117  9.828   1.00 26.03  ? 160 VAL A CG2 1 
ATOM   1291  N  N   . TYR A 1 161 ? 56.576  35.196  8.891   1.00 22.61  ? 161 TYR A N   1 
ATOM   1292  C  CA  . TYR A 1 161 ? 57.937  34.626  8.686   1.00 23.32  ? 161 TYR A CA  1 
ATOM   1293  C  C   . TYR A 1 161 ? 59.071  35.416  9.359   1.00 22.81  ? 161 TYR A C   1 
ATOM   1294  O  O   . TYR A 1 161 ? 59.995  34.835  9.912   1.00 25.71  ? 161 TYR A O   1 
ATOM   1295  C  CB  . TYR A 1 161 ? 58.278  34.473  7.196   1.00 25.28  ? 161 TYR A CB  1 
ATOM   1296  C  CG  . TYR A 1 161 ? 57.253  33.709  6.375   1.00 27.21  ? 161 TYR A CG  1 
ATOM   1297  C  CD1 . TYR A 1 161 ? 56.636  32.549  6.866   1.00 27.67  ? 161 TYR A CD1 1 
ATOM   1298  C  CD2 . TYR A 1 161 ? 56.925  34.125  5.118   1.00 26.61  ? 161 TYR A CD2 1 
ATOM   1299  C  CE1 . TYR A 1 161 ? 55.708  31.851  6.118   1.00 27.41  ? 161 TYR A CE1 1 
ATOM   1300  C  CE2 . TYR A 1 161 ? 56.009  33.432  4.362   1.00 28.79  ? 161 TYR A CE2 1 
ATOM   1301  C  CZ  . TYR A 1 161 ? 55.404  32.296  4.854   1.00 28.56  ? 161 TYR A CZ  1 
ATOM   1302  O  OH  . TYR A 1 161 ? 54.484  31.634  4.049   1.00 28.54  ? 161 TYR A OH  1 
ATOM   1303  N  N   . ALA A 1 162 ? 58.997  36.736  9.298   1.00 22.08  ? 162 ALA A N   1 
ATOM   1304  C  CA  . ALA A 1 162 ? 59.965  37.626  9.955   1.00 22.74  ? 162 ALA A CA  1 
ATOM   1305  C  C   . ALA A 1 162 ? 59.941  37.422  11.460  1.00 22.57  ? 162 ALA A C   1 
ATOM   1306  O  O   . ALA A 1 162 ? 60.996  37.372  12.118  1.00 22.32  ? 162 ALA A O   1 
ATOM   1307  C  CB  . ALA A 1 162 ? 59.670  39.088  9.598   1.00 22.11  ? 162 ALA A CB  1 
ATOM   1308  N  N   . ALA A 1 163 ? 58.740  37.230  12.001  1.00 22.86  ? 163 ALA A N   1 
ATOM   1309  C  CA  . ALA A 1 163 ? 58.603  36.900  13.446  1.00 22.42  ? 163 ALA A CA  1 
ATOM   1310  C  C   . ALA A 1 163 ? 59.294  35.584  13.786  1.00 20.54  ? 163 ALA A C   1 
ATOM   1311  O  O   . ALA A 1 163 ? 60.069  35.473  14.762  1.00 20.67  ? 163 ALA A O   1 
ATOM   1312  C  CB  . ALA A 1 163 ? 57.135  36.842  13.843  1.00 20.50  ? 163 ALA A CB  1 
ATOM   1313  N  N   . ALA A 1 164 ? 59.034  34.586  12.965  1.00 19.45  ? 164 ALA A N   1 
ATOM   1314  C  CA  . ALA A 1 164 ? 59.492  33.235  13.302  1.00 19.83  ? 164 ALA A CA  1 
ATOM   1315  C  C   . ALA A 1 164 ? 60.960  33.210  13.249  1.00 20.20  ? 164 ALA A C   1 
ATOM   1316  O  O   . ALA A 1 164 ? 61.576  32.510  14.043  1.00 20.28  ? 164 ALA A O   1 
ATOM   1317  C  CB  . ALA A 1 164 ? 58.923  32.183  12.358  1.00 18.63  ? 164 ALA A CB  1 
ATOM   1318  N  N   . GLU A 1 165 ? 61.510  33.957  12.279  1.00 21.57  ? 165 GLU A N   1 
ATOM   1319  C  CA  . GLU A 1 165 ? 62.932  34.037  12.099  1.00 23.63  ? 165 GLU A CA  1 
ATOM   1320  C  C   . GLU A 1 165 ? 63.644  34.719  13.292  1.00 24.79  ? 165 GLU A C   1 
ATOM   1321  O  O   . GLU A 1 165 ? 64.594  34.149  13.812  1.00 24.22  ? 165 GLU A O   1 
ATOM   1322  C  CB  . GLU A 1 165 ? 63.271  34.717  10.766  1.00 25.21  ? 165 GLU A CB  1 
ATOM   1323  C  CG  . GLU A 1 165 ? 64.642  34.268  10.256  1.00 28.46  ? 165 GLU A CG  1 
ATOM   1324  C  CD  . GLU A 1 165 ? 65.171  35.099  9.097   1.00 30.98  ? 165 GLU A CD  1 
ATOM   1325  O  OE1 . GLU A 1 165 ? 64.849  36.297  9.078   1.00 31.31  ? 165 GLU A OE1 1 
ATOM   1326  O  OE2 . GLU A 1 165 ? 65.936  34.564  8.241   1.00 31.89  ? 165 GLU A OE2 1 
ATOM   1327  N  N   . ARG A 1 166 ? 63.184  35.920  13.693  1.00 25.65  ? 166 ARG A N   1 
ATOM   1328  C  CA  . ARG A 1 166 ? 63.604  36.596  14.929  1.00 29.15  ? 166 ARG A CA  1 
ATOM   1329  C  C   . ARG A 1 166 ? 63.535  35.668  16.114  1.00 30.78  ? 166 ARG A C   1 
ATOM   1330  O  O   . ARG A 1 166 ? 64.488  35.566  16.866  1.00 34.32  ? 166 ARG A O   1 
ATOM   1331  C  CB  . ARG A 1 166 ? 62.630  37.720  15.303  1.00 32.79  ? 166 ARG A CB  1 
ATOM   1332  C  CG  . ARG A 1 166 ? 63.058  39.144  15.061  1.00 35.08  ? 166 ARG A CG  1 
ATOM   1333  C  CD  . ARG A 1 166 ? 62.613  40.110  16.160  1.00 37.62  ? 166 ARG A CD  1 
ATOM   1334  N  NE  . ARG A 1 166 ? 61.444  39.759  16.992  1.00 40.52  ? 166 ARG A NE  1 
ATOM   1335  C  CZ  . ARG A 1 166 ? 60.162  39.840  16.628  1.00 41.29  ? 166 ARG A CZ  1 
ATOM   1336  N  NH1 . ARG A 1 166 ? 59.811  40.205  15.400  1.00 46.42  ? 166 ARG A NH1 1 
ATOM   1337  N  NH2 . ARG A 1 166 ? 59.219  39.524  17.497  1.00 41.31  ? 166 ARG A NH2 1 
ATOM   1338  N  N   . LEU A 1 167 ? 62.373  35.048  16.319  1.00 28.67  ? 167 LEU A N   1 
ATOM   1339  C  CA  . LEU A 1 167 ? 62.128  34.286  17.546  1.00 30.76  ? 167 LEU A CA  1 
ATOM   1340  C  C   . LEU A 1 167 ? 62.789  32.907  17.621  1.00 33.22  ? 167 LEU A C   1 
ATOM   1341  O  O   . LEU A 1 167 ? 62.592  32.200  18.619  1.00 32.36  ? 167 LEU A O   1 
ATOM   1342  C  CB  . LEU A 1 167 ? 60.627  34.108  17.774  1.00 26.12  ? 167 LEU A CB  1 
ATOM   1343  C  CG  . LEU A 1 167 ? 59.885  35.397  18.019  1.00 25.75  ? 167 LEU A CG  1 
ATOM   1344  C  CD1 . LEU A 1 167 ? 58.402  35.185  17.737  1.00 24.05  ? 167 LEU A CD1 1 
ATOM   1345  C  CD2 . LEU A 1 167 ? 60.181  35.890  19.438  1.00 25.61  ? 167 LEU A CD2 1 
ATOM   1346  N  N   . LYS A 1 168 ? 63.563  32.538  16.589  1.00 35.27  ? 168 LYS A N   1 
ATOM   1347  C  CA  . LYS A 1 168 ? 64.007  31.153  16.370  1.00 37.12  ? 168 LYS A CA  1 
ATOM   1348  C  C   . LYS A 1 168 ? 62.830  30.165  16.497  1.00 33.81  ? 168 LYS A C   1 
ATOM   1349  O  O   . LYS A 1 168 ? 62.915  29.144  17.145  1.00 34.97  ? 168 LYS A O   1 
ATOM   1350  C  CB  . LYS A 1 168 ? 65.164  30.770  17.300  1.00 46.11  ? 168 LYS A CB  1 
ATOM   1351  C  CG  . LYS A 1 168 ? 66.572  30.904  16.714  1.00 56.64  ? 168 LYS A CG  1 
ATOM   1352  C  CD  . LYS A 1 168 ? 67.541  29.889  17.348  1.00 57.74  ? 168 LYS A CD  1 
ATOM   1353  C  CE  . LYS A 1 168 ? 68.924  30.485  17.604  1.00 57.55  ? 168 LYS A CE  1 
ATOM   1354  N  NZ  . LYS A 1 168 ? 68.854  31.580  18.622  1.00 58.13  ? 168 LYS A NZ  1 
ATOM   1355  N  N   . CYS A 1 169 ? 61.724  30.491  15.857  1.00 29.63  ? 169 CYS A N   1 
ATOM   1356  C  CA  . CYS A 1 169 ? 60.555  29.666  15.914  1.00 26.32  ? 169 CYS A CA  1 
ATOM   1357  C  C   . CYS A 1 169 ? 60.387  28.845  14.631  1.00 25.12  ? 169 CYS A C   1 
ATOM   1358  O  O   . CYS A 1 169 ? 59.999  29.379  13.611  1.00 24.38  ? 169 CYS A O   1 
ATOM   1359  C  CB  . CYS A 1 169 ? 59.341  30.551  16.119  1.00 25.64  ? 169 CYS A CB  1 
ATOM   1360  S  SG  . CYS A 1 169 ? 57.855  29.566  16.116  1.00 30.98  ? 169 CYS A SG  1 
ATOM   1361  N  N   . SER A 1 170 ? 60.663  27.544  14.715  1.00 23.31  ? 170 SER A N   1 
ATOM   1362  C  CA  . SER A 1 170 ? 60.518  26.591  13.646  1.00 21.72  ? 170 SER A CA  1 
ATOM   1363  C  C   . SER A 1 170 ? 59.098  26.467  13.065  1.00 21.77  ? 170 SER A C   1 
ATOM   1364  O  O   . SER A 1 170 ? 58.100  26.549  13.808  1.00 21.37  ? 170 SER A O   1 
ATOM   1365  C  CB  . SER A 1 170 ? 60.861  25.252  14.240  1.00 24.39  ? 170 SER A CB  1 
ATOM   1366  O  OG  . SER A 1 170 ? 62.253  25.098  14.307  1.00 29.45  ? 170 SER A OG  1 
ATOM   1367  N  N   . LEU A 1 171 ? 58.997  26.262  11.743  1.00 19.52  ? 171 LEU A N   1 
ATOM   1368  C  CA  . LEU A 1 171 ? 57.687  26.078  11.115  1.00 17.61  ? 171 LEU A CA  1 
ATOM   1369  C  C   . LEU A 1 171 ? 57.487  24.656  10.611  1.00 17.17  ? 171 LEU A C   1 
ATOM   1370  O  O   . LEU A 1 171 ? 58.372  24.067  9.999   1.00 16.94  ? 171 LEU A O   1 
ATOM   1371  C  CB  . LEU A 1 171 ? 57.466  27.065  9.991   1.00 17.98  ? 171 LEU A CB  1 
ATOM   1372  C  CG  . LEU A 1 171 ? 57.542  28.573  10.270  1.00 19.70  ? 171 LEU A CG  1 
ATOM   1373  C  CD1 . LEU A 1 171 ? 57.038  29.287  9.030   1.00 19.54  ? 171 LEU A CD1 1 
ATOM   1374  C  CD2 . LEU A 1 171 ? 56.731  29.030  11.480  1.00 18.72  ? 171 LEU A CD2 1 
ATOM   1375  N  N   . PHE A 1 172 ? 56.339  24.082  10.946  1.00 17.18  ? 172 PHE A N   1 
ATOM   1376  C  CA  . PHE A 1 172 ? 55.976  22.775  10.476  1.00 16.45  ? 172 PHE A CA  1 
ATOM   1377  C  C   . PHE A 1 172 ? 54.733  22.948  9.632   1.00 15.16  ? 172 PHE A C   1 
ATOM   1378  O  O   . PHE A 1 172 ? 53.669  23.311  10.140  1.00 14.15  ? 172 PHE A O   1 
ATOM   1379  C  CB  . PHE A 1 172 ? 55.717  21.814  11.642  1.00 18.04  ? 172 PHE A CB  1 
ATOM   1380  C  CG  . PHE A 1 172 ? 55.409  20.411  11.194  1.00 20.32  ? 172 PHE A CG  1 
ATOM   1381  C  CD1 . PHE A 1 172 ? 56.380  19.639  10.579  1.00 21.63  ? 172 PHE A CD1 1 
ATOM   1382  C  CD2 . PHE A 1 172 ? 54.150  19.876  11.366  1.00 21.53  ? 172 PHE A CD2 1 
ATOM   1383  C  CE1 . PHE A 1 172 ? 56.109  18.364  10.142  1.00 22.30  ? 172 PHE A CE1 1 
ATOM   1384  C  CE2 . PHE A 1 172 ? 53.868  18.594  10.944  1.00 24.06  ? 172 PHE A CE2 1 
ATOM   1385  C  CZ  . PHE A 1 172 ? 54.848  17.838  10.314  1.00 24.06  ? 172 PHE A CZ  1 
ATOM   1386  N  N   . VAL A 1 173 ? 54.886  22.699  8.334   1.00 14.16  ? 173 VAL A N   1 
ATOM   1387  C  CA  . VAL A 1 173 ? 53.785  22.872  7.393   1.00 13.47  ? 173 VAL A CA  1 
ATOM   1388  C  C   . VAL A 1 173 ? 53.047  21.563  7.142   1.00 13.32  ? 173 VAL A C   1 
ATOM   1389  O  O   . VAL A 1 173 ? 53.645  20.604  6.709   1.00 13.75  ? 173 VAL A O   1 
ATOM   1390  C  CB  . VAL A 1 173 ? 54.300  23.461  6.076   1.00 13.48  ? 173 VAL A CB  1 
ATOM   1391  C  CG1 . VAL A 1 173 ? 53.181  23.591  5.046   1.00 12.23  ? 173 VAL A CG1 1 
ATOM   1392  C  CG2 . VAL A 1 173 ? 55.027  24.774  6.340   1.00 12.36  ? 173 VAL A CG2 1 
ATOM   1393  N  N   . HIS A 1 174 ? 51.743  21.558  7.412   1.00 13.10  ? 174 HIS A N   1 
ATOM   1394  C  CA  . HIS A 1 174 ? 50.883  20.423  7.245   1.00 14.02  ? 174 HIS A CA  1 
ATOM   1395  C  C   . HIS A 1 174 ? 49.775  20.733  6.253   1.00 15.27  ? 174 HIS A C   1 
ATOM   1396  O  O   . HIS A 1 174 ? 49.039  21.672  6.453   1.00 15.74  ? 174 HIS A O   1 
ATOM   1397  C  CB  . HIS A 1 174 ? 50.227  20.086  8.610   1.00 13.48  ? 174 HIS A CB  1 
ATOM   1398  C  CG  . HIS A 1 174 ? 49.702  18.682  8.688   1.00 12.75  ? 174 HIS A CG  1 
ATOM   1399  N  ND1 . HIS A 1 174 ? 48.729  18.236  7.893   1.00 13.26  ? 174 HIS A ND1 1 
ATOM   1400  C  CD2 . HIS A 1 174 ? 50.069  17.615  9.478   1.00 13.23  ? 174 HIS A CD2 1 
ATOM   1401  C  CE1 . HIS A 1 174 ? 48.476  16.935  8.165   1.00 12.07  ? 174 HIS A CE1 1 
ATOM   1402  N  NE2 . HIS A 1 174 ? 49.294  16.561  9.121   1.00 12.94  ? 174 HIS A NE2 1 
ATOM   1403  N  N   . PRO A 1 175 ? 49.590  19.924  5.201   1.00 16.43  ? 175 PRO A N   1 
ATOM   1404  C  CA  . PRO A 1 175 ? 48.511  20.136  4.158   1.00 18.13  ? 175 PRO A CA  1 
ATOM   1405  C  C   . PRO A 1 175 ? 46.998  20.083  4.670   1.00 21.05  ? 175 PRO A C   1 
ATOM   1406  O  O   . PRO A 1 175 ? 46.903  19.261  5.739   1.00 23.80  ? 175 PRO A O   1 
ATOM   1407  C  CB  . PRO A 1 175 ? 48.766  18.960  3.212   1.00 17.28  ? 175 PRO A CB  1 
ATOM   1408  C  CG  . PRO A 1 175 ? 49.605  17.956  3.958   1.00 17.53  ? 175 PRO A CG  1 
ATOM   1409  C  CD  . PRO A 1 175 ? 50.444  18.749  4.902   1.00 17.56  ? 175 PRO A CD  1 
ATOM   1410  N  N   . TRP A 1 176 ? 45.972  20.744  4.175   1.00 24.77  ? 176 TRP A N   1 
ATOM   1411  C  CA  . TRP A 1 176 ? 44.645  20.649  4.728   1.00 28.31  ? 176 TRP A CA  1 
ATOM   1412  C  C   . TRP A 1 176 ? 43.712  21.410  3.806   1.00 33.01  ? 176 TRP A C   1 
ATOM   1413  O  O   . TRP A 1 176 ? 44.228  22.286  3.160   1.00 34.49  ? 176 TRP A O   1 
ATOM   1414  C  CB  . TRP A 1 176 ? 44.707  21.237  6.139   1.00 20.00  ? 176 TRP A CB  1 
ATOM   1415  C  CG  . TRP A 1 176 ? 44.623  22.734  6.155   1.00 20.00  ? 176 TRP A CG  1 
ATOM   1416  C  CD1 . TRP A 1 176 ? 45.440  23.645  5.474   1.00 20.00  ? 176 TRP A CD1 1 
ATOM   1417  C  CD2 . TRP A 1 176 ? 43.564  23.542  6.728   1.00 20.00  ? 176 TRP A CD2 1 
ATOM   1418  N  NE1 . TRP A 1 176 ? 44.993  24.896  5.640   1.00 20.00  ? 176 TRP A NE1 1 
ATOM   1419  C  CE2 . TRP A 1 176 ? 43.876  24.915  6.386   1.00 20.00  ? 176 TRP A CE2 1 
ATOM   1420  C  CE3 . TRP A 1 176 ? 42.444  23.280  7.481   1.00 20.00  ? 176 TRP A CE3 1 
ATOM   1421  C  CZ2 . TRP A 1 176 ? 43.099  25.964  6.819   1.00 20.00  ? 176 TRP A CZ2 1 
ATOM   1422  C  CZ3 . TRP A 1 176 ? 41.681  24.362  7.939   1.00 20.00  ? 176 TRP A CZ3 1 
ATOM   1423  C  CH2 . TRP A 1 176 ? 41.994  25.661  7.607   1.00 20.00  ? 176 TRP A CH2 1 
ATOM   1424  N  N   . ASP A 1 177 ? 42.416  21.093  3.648   1.00 36.91  ? 177 ASP A N   1 
ATOM   1425  C  CA  . ASP A 1 177 ? 41.437  22.001  3.069   1.00 39.89  ? 177 ASP A CA  1 
ATOM   1426  C  C   . ASP A 1 177 ? 41.878  21.849  1.612   1.00 38.61  ? 177 ASP A C   1 
ATOM   1427  O  O   . ASP A 1 177 ? 42.253  22.812  0.910   1.00 36.57  ? 177 ASP A O   1 
ATOM   1428  C  CB  . ASP A 1 177 ? 41.799  23.444  3.539   1.00 41.83  ? 177 ASP A CB  1 
ATOM   1429  C  CG  . ASP A 1 177 ? 40.854  24.494  3.012   1.00 52.25  ? 177 ASP A CG  1 
ATOM   1430  O  OD1 . ASP A 1 177 ? 39.660  24.129  2.830   1.00 60.57  ? 177 ASP A OD1 1 
ATOM   1431  O  OD2 . ASP A 1 177 ? 41.294  25.675  2.794   1.00 49.86  ? 177 ASP A OD2 1 
ATOM   1432  N  N   . MET A 1 178 ? 41.997  20.578  1.233   1.00 39.12  ? 178 MET A N   1 
ATOM   1433  C  CA  . MET A 1 178 ? 42.113  20.154  -0.141  1.00 40.00  ? 178 MET A CA  1 
ATOM   1434  C  C   . MET A 1 178 ? 40.672  19.919  -0.514  1.00 39.20  ? 178 MET A C   1 
ATOM   1435  O  O   . MET A 1 178 ? 39.834  19.684  0.354   1.00 42.02  ? 178 MET A O   1 
ATOM   1436  C  CB  . MET A 1 178 ? 42.835  18.797  -0.259  1.00 41.78  ? 178 MET A CB  1 
ATOM   1437  C  CG  . MET A 1 178 ? 44.104  18.572  0.555   1.00 43.62  ? 178 MET A CG  1 
ATOM   1438  S  SD  . MET A 1 178 ? 43.996  17.822  2.211   1.00 51.78  ? 178 MET A SD  1 
ATOM   1439  C  CE  . MET A 1 178 ? 42.540  16.782  2.139   1.00 44.60  ? 178 MET A CE  1 
ATOM   1440  N  N   . GLN A 1 179 ? 40.382  19.984  -1.804  1.00 44.41  ? 179 GLN A N   1 
ATOM   1441  C  CA  . GLN A 1 179 ? 39.069  19.630  -2.325  1.00 42.10  ? 179 GLN A CA  1 
ATOM   1442  C  C   . GLN A 1 179 ? 38.627  18.249  -1.799  1.00 40.46  ? 179 GLN A C   1 
ATOM   1443  O  O   . GLN A 1 179 ? 39.370  17.280  -1.894  1.00 36.65  ? 179 GLN A O   1 
ATOM   1444  C  CB  . GLN A 1 179 ? 39.148  19.642  -3.844  1.00 40.87  ? 179 GLN A CB  1 
ATOM   1445  C  CG  . GLN A 1 179 ? 38.032  18.872  -4.536  1.00 43.36  ? 179 GLN A CG  1 
ATOM   1446  C  CD  . GLN A 1 179 ? 38.041  19.048  -6.034  1.00 40.52  ? 179 GLN A CD  1 
ATOM   1447  O  OE1 . GLN A 1 179 ? 38.802  19.858  -6.575  1.00 41.10  ? 179 GLN A OE1 1 
ATOM   1448  N  NE2 . GLN A 1 179 ? 37.187  18.299  -6.714  1.00 38.89  ? 179 GLN A NE2 1 
ATOM   1449  N  N   . MET A 1 180 ? 37.420  18.173  -1.249  1.00 43.89  ? 180 MET A N   1 
ATOM   1450  C  CA  . MET A 1 180 ? 36.919  16.933  -0.643  1.00 48.51  ? 180 MET A CA  1 
ATOM   1451  C  C   . MET A 1 180 ? 35.847  16.261  -1.495  1.00 51.03  ? 180 MET A C   1 
ATOM   1452  O  O   . MET A 1 180 ? 35.583  15.060  -1.347  1.00 51.13  ? 180 MET A O   1 
ATOM   1453  C  CB  . MET A 1 180 ? 36.334  17.203  0.753   1.00 54.05  ? 180 MET A CB  1 
ATOM   1454  C  CG  . MET A 1 180 ? 37.211  17.999  1.718   1.00 56.76  ? 180 MET A CG  1 
ATOM   1455  S  SD  . MET A 1 180 ? 38.831  17.272  2.093   1.00 58.66  ? 180 MET A SD  1 
ATOM   1456  C  CE  . MET A 1 180 ? 39.360  18.375  3.417   1.00 60.68  ? 180 MET A CE  1 
ATOM   1457  N  N   . ASP A 1 181 ? 35.233  17.044  -2.383  1.00 52.78  ? 181 ASP A N   1 
ATOM   1458  C  CA  . ASP A 1 181 ? 34.061  16.615  -3.165  1.00 54.06  ? 181 ASP A CA  1 
ATOM   1459  C  C   . ASP A 1 181 ? 34.361  16.516  -4.667  1.00 50.96  ? 181 ASP A C   1 
ATOM   1460  O  O   . ASP A 1 181 ? 35.492  16.743  -5.094  1.00 49.44  ? 181 ASP A O   1 
ATOM   1461  C  CB  . ASP A 1 181 ? 32.909  17.607  -2.927  1.00 61.21  ? 181 ASP A CB  1 
ATOM   1462  C  CG  . ASP A 1 181 ? 33.367  19.077  -2.974  1.00 71.75  ? 181 ASP A CG  1 
ATOM   1463  O  OD1 . ASP A 1 181 ? 34.333  19.404  -3.725  1.00 72.15  ? 181 ASP A OD1 1 
ATOM   1464  O  OD2 . ASP A 1 181 ? 32.753  19.905  -2.252  1.00 72.90  ? 181 ASP A OD2 1 
ATOM   1465  N  N   . GLY A 1 182 ? 33.341  16.201  -5.465  1.00 49.45  ? 182 GLY A N   1 
ATOM   1466  C  CA  . GLY A 1 182 ? 33.479  16.172  -6.912  1.00 41.46  ? 182 GLY A CA  1 
ATOM   1467  C  C   . GLY A 1 182 ? 34.261  14.942  -7.296  1.00 43.03  ? 182 GLY A C   1 
ATOM   1468  O  O   . GLY A 1 182 ? 33.972  13.837  -6.824  1.00 42.33  ? 182 GLY A O   1 
ATOM   1469  N  N   . ARG A 1 183 ? 35.270  15.123  -8.142  1.00 42.78  ? 183 ARG A N   1 
ATOM   1470  C  CA  . ARG A 1 183 ? 36.080  13.986  -8.593  1.00 40.32  ? 183 ARG A CA  1 
ATOM   1471  C  C   . ARG A 1 183 ? 36.919  13.394  -7.454  1.00 36.00  ? 183 ARG A C   1 
ATOM   1472  O  O   . ARG A 1 183 ? 37.098  12.190  -7.365  1.00 39.23  ? 183 ARG A O   1 
ATOM   1473  C  CB  . ARG A 1 183 ? 36.926  14.371  -9.816  1.00 43.35  ? 183 ARG A CB  1 
ATOM   1474  C  CG  . ARG A 1 183 ? 36.138  14.303  -11.122 1.00 43.70  ? 183 ARG A CG  1 
ATOM   1475  C  CD  . ARG A 1 183 ? 36.948  14.765  -12.322 1.00 47.03  ? 183 ARG A CD  1 
ATOM   1476  N  NE  . ARG A 1 183 ? 38.279  14.155  -12.371 1.00 48.43  ? 183 ARG A NE  1 
ATOM   1477  C  CZ  . ARG A 1 183 ? 39.425  14.837  -12.455 1.00 51.39  ? 183 ARG A CZ  1 
ATOM   1478  N  NH1 . ARG A 1 183 ? 39.431  16.171  -12.526 1.00 48.20  ? 183 ARG A NH1 1 
ATOM   1479  N  NH2 . ARG A 1 183 ? 40.575  14.174  -12.496 1.00 52.81  ? 183 ARG A NH2 1 
ATOM   1480  N  N   . MET A 1 184 ? 37.388  14.242  -6.561  1.00 34.94  ? 184 MET A N   1 
ATOM   1481  C  CA  . MET A 1 184 ? 38.094  13.814  -5.354  1.00 36.61  ? 184 MET A CA  1 
ATOM   1482  C  C   . MET A 1 184 ? 37.258  13.093  -4.277  1.00 35.96  ? 184 MET A C   1 
ATOM   1483  O  O   . MET A 1 184 ? 37.767  12.818  -3.207  1.00 38.47  ? 184 MET A O   1 
ATOM   1484  C  CB  . MET A 1 184 ? 38.771  15.031  -4.717  1.00 40.58  ? 184 MET A CB  1 
ATOM   1485  C  CG  . MET A 1 184 ? 39.767  15.740  -5.625  1.00 45.45  ? 184 MET A CG  1 
ATOM   1486  S  SD  . MET A 1 184 ? 41.097  14.619  -6.101  1.00 46.52  ? 184 MET A SD  1 
ATOM   1487  C  CE  . MET A 1 184 ? 42.343  15.042  -4.878  1.00 43.54  ? 184 MET A CE  1 
ATOM   1488  N  N   . ALA A 1 185 ? 35.997  12.768  -4.531  1.00 36.39  ? 185 ALA A N   1 
ATOM   1489  C  CA  . ALA A 1 185 ? 35.198  12.089  -3.492  1.00 37.38  ? 185 ALA A CA  1 
ATOM   1490  C  C   . ALA A 1 185 ? 35.122  10.577  -3.631  1.00 38.53  ? 185 ALA A C   1 
ATOM   1491  O  O   . ALA A 1 185 ? 34.047  9.990   -3.462  1.00 45.06  ? 185 ALA A O   1 
ATOM   1492  C  CB  . ALA A 1 185 ? 33.799  12.673  -3.406  1.00 34.65  ? 185 ALA A CB  1 
ATOM   1493  N  N   . LYS A 1 186 ? 36.242  9.934   -3.931  1.00 34.75  ? 186 LYS A N   1 
ATOM   1494  C  CA  . LYS A 1 186 ? 36.265  8.476   -3.946  1.00 30.19  ? 186 LYS A CA  1 
ATOM   1495  C  C   . LYS A 1 186 ? 37.647  7.977   -3.573  1.00 28.69  ? 186 LYS A C   1 
ATOM   1496  O  O   . LYS A 1 186 ? 38.583  8.772   -3.513  1.00 29.86  ? 186 LYS A O   1 
ATOM   1497  C  CB  . LYS A 1 186 ? 35.870  7.965   -5.327  1.00 32.56  ? 186 LYS A CB  1 
ATOM   1498  C  CG  . LYS A 1 186 ? 36.769  8.485   -6.438  1.00 30.64  ? 186 LYS A CG  1 
ATOM   1499  C  CD  . LYS A 1 186 ? 36.373  7.859   -7.752  1.00 31.26  ? 186 LYS A CD  1 
ATOM   1500  C  CE  . LYS A 1 186 ? 37.109  8.519   -8.897  1.00 29.91  ? 186 LYS A CE  1 
ATOM   1501  N  NZ  . LYS A 1 186 ? 36.653  9.943   -8.893  1.00 29.07  ? 186 LYS A NZ  1 
ATOM   1502  N  N   . TYR A 1 187 ? 37.766  6.669   -3.319  1.00 28.23  ? 187 TYR A N   1 
ATOM   1503  C  CA  . TYR A 1 187 ? 39.041  6.002   -2.994  1.00 27.78  ? 187 TYR A CA  1 
ATOM   1504  C  C   . TYR A 1 187 ? 39.997  6.805   -2.097  1.00 27.22  ? 187 TYR A C   1 
ATOM   1505  O  O   . TYR A 1 187 ? 41.214  6.632   -2.204  1.00 24.32  ? 187 TYR A O   1 
ATOM   1506  C  CB  . TYR A 1 187 ? 39.803  5.588   -4.270  1.00 29.01  ? 187 TYR A CB  1 
ATOM   1507  C  CG  . TYR A 1 187 ? 38.934  5.002   -5.347  1.00 29.74  ? 187 TYR A CG  1 
ATOM   1508  C  CD1 . TYR A 1 187 ? 39.029  5.456   -6.659  1.00 27.95  ? 187 TYR A CD1 1 
ATOM   1509  C  CD2 . TYR A 1 187 ? 37.977  4.010   -5.047  1.00 28.54  ? 187 TYR A CD2 1 
ATOM   1510  C  CE1 . TYR A 1 187 ? 38.218  4.921   -7.661  1.00 30.42  ? 187 TYR A CE1 1 
ATOM   1511  C  CE2 . TYR A 1 187 ? 37.151  3.491   -6.037  1.00 28.44  ? 187 TYR A CE2 1 
ATOM   1512  C  CZ  . TYR A 1 187 ? 37.278  3.955   -7.339  1.00 29.40  ? 187 TYR A CZ  1 
ATOM   1513  O  OH  . TYR A 1 187 ? 36.473  3.472   -8.323  1.00 31.73  ? 187 TYR A OH  1 
ATOM   1514  N  N   . TRP A 1 188 ? 39.454  7.684   -1.245  1.00 26.61  ? 188 TRP A N   1 
ATOM   1515  C  CA  . TRP A 1 188 ? 40.251  8.400   -0.263  1.00 27.75  ? 188 TRP A CA  1 
ATOM   1516  C  C   . TRP A 1 188 ? 41.338  9.234   -0.951  1.00 28.16  ? 188 TRP A C   1 
ATOM   1517  O  O   . TRP A 1 188 ? 42.414  9.478   -0.391  1.00 30.44  ? 188 TRP A O   1 
ATOM   1518  C  CB  . TRP A 1 188 ? 40.833  7.386   0.739   1.00 27.67  ? 188 TRP A CB  1 
ATOM   1519  C  CG  . TRP A 1 188 ? 41.102  7.907   2.134   1.00 28.26  ? 188 TRP A CG  1 
ATOM   1520  C  CD1 . TRP A 1 188 ? 40.617  9.064   2.710   1.00 29.66  ? 188 TRP A CD1 1 
ATOM   1521  C  CD2 . TRP A 1 188 ? 41.926  7.280   3.189   1.00 27.63  ? 188 TRP A CD2 1 
ATOM   1522  N  NE1 . TRP A 1 188 ? 41.078  9.199   4.002   1.00 31.81  ? 188 TRP A NE1 1 
ATOM   1523  C  CE2 . TRP A 1 188 ? 41.855  8.174   4.350   1.00 28.03  ? 188 TRP A CE2 1 
ATOM   1524  C  CE3 . TRP A 1 188 ? 42.678  6.110   3.282   1.00 27.16  ? 188 TRP A CE3 1 
ATOM   1525  C  CZ2 . TRP A 1 188 ? 42.524  7.903   5.544   1.00 29.25  ? 188 TRP A CZ2 1 
ATOM   1526  C  CZ3 . TRP A 1 188 ? 43.342  5.838   4.489   1.00 29.58  ? 188 TRP A CZ3 1 
ATOM   1527  C  CH2 . TRP A 1 188 ? 43.270  6.718   5.600   1.00 27.56  ? 188 TRP A CH2 1 
ATOM   1528  N  N   . LEU A 1 189 ? 41.046  9.692   -2.166  1.00 26.06  ? 189 LEU A N   1 
ATOM   1529  C  CA  . LEU A 1 189 ? 41.971  10.517  -2.980  1.00 24.54  ? 189 LEU A CA  1 
ATOM   1530  C  C   . LEU A 1 189 ? 42.515  11.789  -2.337  1.00 25.24  ? 189 LEU A C   1 
ATOM   1531  O  O   . LEU A 1 189 ? 43.722  12.071  -2.452  1.00 25.26  ? 189 LEU A O   1 
ATOM   1532  C  CB  . LEU A 1 189 ? 41.333  10.859  -4.314  1.00 21.92  ? 189 LEU A CB  1 
ATOM   1533  C  CG  . LEU A 1 189 ? 41.213  9.610   -5.184  1.00 22.47  ? 189 LEU A CG  1 
ATOM   1534  C  CD1 . LEU A 1 189 ? 40.478  9.915   -6.486  1.00 24.24  ? 189 LEU A CD1 1 
ATOM   1535  C  CD2 . LEU A 1 189 ? 42.568  8.988   -5.469  1.00 22.47  ? 189 LEU A CD2 1 
ATOM   1536  N  N   . PRO A 1 190 ? 41.649  12.555  -1.635  1.00 24.62  ? 190 PRO A N   1 
ATOM   1537  C  CA  . PRO A 1 190 ? 42.153  13.739  -0.917  1.00 24.69  ? 190 PRO A CA  1 
ATOM   1538  C  C   . PRO A 1 190 ? 43.330  13.462  0.032   1.00 24.34  ? 190 PRO A C   1 
ATOM   1539  O  O   . PRO A 1 190 ? 44.106  14.371  0.308   1.00 28.29  ? 190 PRO A O   1 
ATOM   1540  C  CB  . PRO A 1 190 ? 40.940  14.217  -0.095  1.00 24.90  ? 190 PRO A CB  1 
ATOM   1541  C  CG  . PRO A 1 190 ? 39.758  13.554  -0.704  1.00 26.57  ? 190 PRO A CG  1 
ATOM   1542  C  CD  . PRO A 1 190 ? 40.240  12.274  -1.323  1.00 25.15  ? 190 PRO A CD  1 
ATOM   1543  N  N   . TRP A 1 191 ? 43.452  12.235  0.516   1.00 22.18  ? 191 TRP A N   1 
ATOM   1544  C  CA  . TRP A 1 191 ? 44.464  11.879  1.481   1.00 23.48  ? 191 TRP A CA  1 
ATOM   1545  C  C   . TRP A 1 191 ? 45.604  11.142  0.817   1.00 22.64  ? 191 TRP A C   1 
ATOM   1546  O  O   . TRP A 1 191 ? 46.758  11.264  1.210   1.00 20.78  ? 191 TRP A O   1 
ATOM   1547  C  CB  . TRP A 1 191 ? 43.846  11.026  2.606   1.00 24.65  ? 191 TRP A CB  1 
ATOM   1548  C  CG  . TRP A 1 191 ? 43.322  11.833  3.777   1.00 26.88  ? 191 TRP A CG  1 
ATOM   1549  C  CD1 . TRP A 1 191 ? 44.002  12.144  4.953   1.00 28.12  ? 191 TRP A CD1 1 
ATOM   1550  C  CD2 . TRP A 1 191 ? 42.001  12.456  3.938   1.00 27.53  ? 191 TRP A CD2 1 
ATOM   1551  N  NE1 . TRP A 1 191 ? 43.233  12.900  5.781   1.00 27.84  ? 191 TRP A NE1 1 
ATOM   1552  C  CE2 . TRP A 1 191 ? 42.026  13.137  5.239   1.00 28.87  ? 191 TRP A CE2 1 
ATOM   1553  C  CE3 . TRP A 1 191 ? 40.847  12.528  3.167   1.00 29.73  ? 191 TRP A CE3 1 
ATOM   1554  C  CZ2 . TRP A 1 191 ? 40.923  13.860  5.730   1.00 29.69  ? 191 TRP A CZ2 1 
ATOM   1555  C  CZ3 . TRP A 1 191 ? 39.742  13.266  3.673   1.00 30.61  ? 191 TRP A CZ3 1 
ATOM   1556  C  CH2 . TRP A 1 191 ? 39.783  13.905  4.927   1.00 27.97  ? 191 TRP A CH2 1 
ATOM   1557  N  N   . LEU A 1 192 ? 45.295  10.332  -0.183  1.00 21.86  ? 192 LEU A N   1 
ATOM   1558  C  CA  . LEU A 1 192 ? 46.356  9.569   -0.827  1.00 20.67  ? 192 LEU A CA  1 
ATOM   1559  C  C   . LEU A 1 192 ? 47.124  10.472  -1.777  1.00 19.68  ? 192 LEU A C   1 
ATOM   1560  O  O   . LEU A 1 192 ? 48.356  10.413  -1.821  1.00 20.34  ? 192 LEU A O   1 
ATOM   1561  C  CB  . LEU A 1 192 ? 45.822  8.315   -1.525  1.00 18.84  ? 192 LEU A CB  1 
ATOM   1562  C  CG  . LEU A 1 192 ? 45.006  7.437   -0.619  1.00 18.98  ? 192 LEU A CG  1 
ATOM   1563  C  CD1 . LEU A 1 192 ? 44.738  6.154   -1.355  1.00 19.97  ? 192 LEU A CD1 1 
ATOM   1564  C  CD2 . LEU A 1 192 ? 45.798  7.173   0.656   1.00 20.06  ? 192 LEU A CD2 1 
ATOM   1565  N  N   . VAL A 1 193 ? 46.386  11.321  -2.481  1.00 17.90  ? 193 VAL A N   1 
ATOM   1566  C  CA  . VAL A 1 193 ? 46.916  12.159  -3.528  1.00 18.61  ? 193 VAL A CA  1 
ATOM   1567  C  C   . VAL A 1 193 ? 46.818  13.685  -3.220  1.00 20.16  ? 193 VAL A C   1 
ATOM   1568  O  O   . VAL A 1 193 ? 47.791  14.447  -3.407  1.00 21.65  ? 193 VAL A O   1 
ATOM   1569  C  CB  . VAL A 1 193 ? 46.119  11.874  -4.823  1.00 19.26  ? 193 VAL A CB  1 
ATOM   1570  C  CG1 . VAL A 1 193 ? 46.407  12.941  -5.889  1.00 19.74  ? 193 VAL A CG1 1 
ATOM   1571  C  CG2 . VAL A 1 193 ? 46.367  10.448  -5.319  1.00 17.44  ? 193 VAL A CG2 1 
ATOM   1572  N  N   . GLY A 1 194 ? 45.659  14.149  -2.755  1.00 18.78  ? 194 GLY A N   1 
ATOM   1573  C  CA  . GLY A 1 194 ? 45.462  15.579  -2.629  1.00 18.98  ? 194 GLY A CA  1 
ATOM   1574  C  C   . GLY A 1 194 ? 46.418  16.187  -1.628  1.00 20.40  ? 194 GLY A C   1 
ATOM   1575  O  O   . GLY A 1 194 ? 46.936  17.294  -1.829  1.00 19.33  ? 194 GLY A O   1 
ATOM   1576  N  N   . MET A 1 195 ? 46.681  15.444  -0.559  1.00 21.40  ? 195 MET A N   1 
ATOM   1577  C  CA  . MET A 1 195 ? 47.593  15.927  0.480   1.00 23.30  ? 195 MET A CA  1 
ATOM   1578  C  C   . MET A 1 195 ? 49.016  16.060  -0.006  1.00 21.56  ? 195 MET A C   1 
ATOM   1579  O  O   . MET A 1 195 ? 49.612  17.110  0.200   1.00 22.75  ? 195 MET A O   1 
ATOM   1580  C  CB  . MET A 1 195 ? 47.500  15.093  1.785   1.00 27.29  ? 195 MET A CB  1 
ATOM   1581  C  CG  . MET A 1 195 ? 46.298  15.464  2.638   1.00 27.12  ? 195 MET A CG  1 
ATOM   1582  S  SD  . MET A 1 195 ? 46.254  14.940  4.389   1.00 35.77  ? 195 MET A SD  1 
ATOM   1583  C  CE  . MET A 1 195 ? 47.806  14.123  4.689   1.00 30.73  ? 195 MET A CE  1 
ATOM   1584  N  N   . PRO A 1 196 ? 49.555  15.033  -0.700  1.00 21.99  ? 196 PRO A N   1 
ATOM   1585  C  CA  . PRO A 1 196 ? 50.910  15.260  -1.197  1.00 20.76  ? 196 PRO A CA  1 
ATOM   1586  C  C   . PRO A 1 196 ? 51.015  16.449  -2.168  1.00 19.66  ? 196 PRO A C   1 
ATOM   1587  O  O   . PRO A 1 196 ? 52.066  17.113  -2.187  1.00 18.35  ? 196 PRO A O   1 
ATOM   1588  C  CB  . PRO A 1 196 ? 51.267  13.947  -1.908  1.00 20.61  ? 196 PRO A CB  1 
ATOM   1589  C  CG  . PRO A 1 196 ? 50.409  12.918  -1.296  1.00 20.42  ? 196 PRO A CG  1 
ATOM   1590  C  CD  . PRO A 1 196 ? 49.138  13.621  -0.872  1.00 21.85  ? 196 PRO A CD  1 
ATOM   1591  N  N   . ALA A 1 197 ? 49.936  16.729  -2.912  1.00 17.94  ? 197 ALA A N   1 
ATOM   1592  C  CA  . ALA A 1 197 ? 49.917  17.799  -3.912  1.00 17.96  ? 197 ALA A CA  1 
ATOM   1593  C  C   . ALA A 1 197 ? 49.899  19.185  -3.262  1.00 18.92  ? 197 ALA A C   1 
ATOM   1594  O  O   . ALA A 1 197 ? 50.581  20.105  -3.711  1.00 18.60  ? 197 ALA A O   1 
ATOM   1595  C  CB  . ALA A 1 197 ? 48.725  17.627  -4.873  1.00 17.48  ? 197 ALA A CB  1 
ATOM   1596  N  N   . GLU A 1 198 ? 49.112  19.315  -2.197  1.00 19.67  ? 198 GLU A N   1 
ATOM   1597  C  CA  . GLU A 1 198 ? 49.066  20.500  -1.390  1.00 19.81  ? 198 GLU A CA  1 
ATOM   1598  C  C   . GLU A 1 198 ? 50.429  20.808  -0.859  1.00 18.36  ? 198 GLU A C   1 
ATOM   1599  O  O   . GLU A 1 198 ? 50.833  21.942  -0.807  1.00 18.09  ? 198 GLU A O   1 
ATOM   1600  C  CB  . GLU A 1 198 ? 48.155  20.266  -0.206  1.00 24.54  ? 198 GLU A CB  1 
ATOM   1601  C  CG  . GLU A 1 198 ? 46.707  20.553  -0.507  1.00 28.83  ? 198 GLU A CG  1 
ATOM   1602  C  CD  . GLU A 1 198 ? 46.487  21.980  -0.934  1.00 33.84  ? 198 GLU A CD  1 
ATOM   1603  O  OE1 . GLU A 1 198 ? 46.657  22.886  -0.081  1.00 41.16  ? 198 GLU A OE1 1 
ATOM   1604  O  OE2 . GLU A 1 198 ? 46.151  22.199  -2.120  1.00 37.80  ? 198 GLU A OE2 1 
ATOM   1605  N  N   . THR A 1 199 ? 51.159  19.809  -0.430  1.00 17.92  ? 199 THR A N   1 
ATOM   1606  C  CA  . THR A 1 199 ? 52.478  20.110  0.073   1.00 18.32  ? 199 THR A CA  1 
ATOM   1607  C  C   . THR A 1 199 ? 53.458  20.468  -1.034  1.00 19.56  ? 199 THR A C   1 
ATOM   1608  O  O   . THR A 1 199 ? 54.351  21.275  -0.798  1.00 20.92  ? 199 THR A O   1 
ATOM   1609  C  CB  . THR A 1 199 ? 53.003  18.924  0.823   1.00 17.81  ? 199 THR A CB  1 
ATOM   1610  O  OG1 . THR A 1 199 ? 52.010  18.567  1.771   1.00 17.15  ? 199 THR A OG1 1 
ATOM   1611  C  CG2 . THR A 1 199 ? 54.325  19.223  1.471   1.00 17.72  ? 199 THR A CG2 1 
ATOM   1612  N  N   . THR A 1 200 ? 53.303  19.884  -2.225  1.00 19.00  ? 200 THR A N   1 
ATOM   1613  C  CA  . THR A 1 200 ? 54.187  20.230  -3.364  1.00 19.86  ? 200 THR A CA  1 
ATOM   1614  C  C   . THR A 1 200 ? 54.001  21.703  -3.780  1.00 20.40  ? 200 THR A C   1 
ATOM   1615  O  O   . THR A 1 200 ? 54.956  22.419  -4.068  1.00 21.11  ? 200 THR A O   1 
ATOM   1616  C  CB  . THR A 1 200 ? 53.964  19.278  -4.574  1.00 20.61  ? 200 THR A CB  1 
ATOM   1617  O  OG1 . THR A 1 200 ? 54.203  17.896  -4.185  1.00 21.03  ? 200 THR A OG1 1 
ATOM   1618  C  CG2 . THR A 1 200 ? 54.896  19.656  -5.729  1.00 20.47  ? 200 THR A CG2 1 
ATOM   1619  N  N   . ILE A 1 201 ? 52.754  22.146  -3.787  1.00 20.76  ? 201 ILE A N   1 
ATOM   1620  C  CA  . ILE A 1 201 ? 52.383  23.519  -4.024  1.00 20.90  ? 201 ILE A CA  1 
ATOM   1621  C  C   . ILE A 1 201 ? 52.997  24.478  -2.979  1.00 21.83  ? 201 ILE A C   1 
ATOM   1622  O  O   . ILE A 1 201 ? 53.494  25.541  -3.308  1.00 26.10  ? 201 ILE A O   1 
ATOM   1623  C  CB  . ILE A 1 201 ? 50.840  23.586  -4.048  1.00 22.34  ? 201 ILE A CB  1 
ATOM   1624  C  CG1 . ILE A 1 201 ? 50.335  22.955  -5.350  1.00 22.78  ? 201 ILE A CG1 1 
ATOM   1625  C  CG2 . ILE A 1 201 ? 50.319  25.016  -3.913  1.00 23.81  ? 201 ILE A CG2 1 
ATOM   1626  C  CD1 . ILE A 1 201 ? 48.837  22.736  -5.413  1.00 24.02  ? 201 ILE A CD1 1 
ATOM   1627  N  N   . ALA A 1 202 ? 52.959  24.118  -1.712  1.00 20.50  ? 202 ALA A N   1 
ATOM   1628  C  CA  . ALA A 1 202 ? 53.521  24.963  -0.700  1.00 19.19  ? 202 ALA A CA  1 
ATOM   1629  C  C   . ALA A 1 202 ? 55.013  25.097  -0.901  1.00 19.90  ? 202 ALA A C   1 
ATOM   1630  O  O   . ALA A 1 202 ? 55.564  26.198  -0.753  1.00 20.47  ? 202 ALA A O   1 
ATOM   1631  C  CB  . ALA A 1 202 ? 53.273  24.356  0.679   1.00 20.07  ? 202 ALA A CB  1 
ATOM   1632  N  N   . ILE A 1 203 ? 55.702  23.977  -1.141  1.00 17.07  ? 203 ILE A N   1 
ATOM   1633  C  CA  . ILE A 1 203 ? 57.129  24.082  -1.283  1.00 17.17  ? 203 ILE A CA  1 
ATOM   1634  C  C   . ILE A 1 203 ? 57.456  25.007  -2.493  1.00 19.20  ? 203 ILE A C   1 
ATOM   1635  O  O   . ILE A 1 203 ? 58.393  25.815  -2.421  1.00 18.08  ? 203 ILE A O   1 
ATOM   1636  C  CB  . ILE A 1 203 ? 57.745  22.708  -1.430  1.00 16.03  ? 203 ILE A CB  1 
ATOM   1637  C  CG1 . ILE A 1 203 ? 57.673  21.979  -0.080  1.00 14.87  ? 203 ILE A CG1 1 
ATOM   1638  C  CG2 . ILE A 1 203 ? 59.164  22.791  -2.004  1.00 14.33  ? 203 ILE A CG2 1 
ATOM   1639  C  CD1 . ILE A 1 203 ? 57.990  20.488  -0.150  1.00 13.93  ? 203 ILE A CD1 1 
ATOM   1640  N  N   . CYS A 1 204 ? 56.648  24.892  -3.562  1.00 19.10  ? 204 CYS A N   1 
ATOM   1641  C  CA  . CYS A 1 204 ? 56.772  25.725  -4.741  1.00 21.65  ? 204 CYS A CA  1 
ATOM   1642  C  C   . CYS A 1 204 ? 56.522  27.186  -4.457  1.00 23.16  ? 204 CYS A C   1 
ATOM   1643  O  O   . CYS A 1 204 ? 57.256  28.061  -4.925  1.00 22.94  ? 204 CYS A O   1 
ATOM   1644  C  CB  . CYS A 1 204 ? 55.835  25.236  -5.847  1.00 21.27  ? 204 CYS A CB  1 
ATOM   1645  S  SG  . CYS A 1 204 ? 56.534  23.739  -6.597  1.00 25.60  ? 204 CYS A SG  1 
ATOM   1646  N  N   . SER A 1 205 ? 55.484  27.448  -3.679  1.00 25.52  ? 205 SER A N   1 
ATOM   1647  C  CA  . SER A 1 205 ? 55.143  28.817  -3.324  1.00 26.50  ? 205 SER A CA  1 
ATOM   1648  C  C   . SER A 1 205 ? 56.231  29.442  -2.478  1.00 27.39  ? 205 SER A C   1 
ATOM   1649  O  O   . SER A 1 205 ? 56.736  30.493  -2.812  1.00 30.09  ? 205 SER A O   1 
ATOM   1650  C  CB  . SER A 1 205 ? 53.789  28.845  -2.680  1.00 25.30  ? 205 SER A CB  1 
ATOM   1651  O  OG  . SER A 1 205 ? 52.889  28.358  -3.662  1.00 24.06  ? 205 SER A OG  1 
ATOM   1652  N  N   . MET A 1 206 ? 56.680  28.759  -1.444  1.00 27.53  ? 206 MET A N   1 
ATOM   1653  C  CA  . MET A 1 206 ? 57.800  29.292  -0.685  1.00 27.38  ? 206 MET A CA  1 
ATOM   1654  C  C   . MET A 1 206 ? 59.118  29.502  -1.458  1.00 26.96  ? 206 MET A C   1 
ATOM   1655  O  O   . MET A 1 206 ? 59.822  30.470  -1.222  1.00 28.31  ? 206 MET A O   1 
ATOM   1656  C  CB  . MET A 1 206 ? 58.003  28.468  0.570   1.00 28.13  ? 206 MET A CB  1 
ATOM   1657  C  CG  . MET A 1 206 ? 56.779  28.607  1.451   1.00 30.64  ? 206 MET A CG  1 
ATOM   1658  S  SD  . MET A 1 206 ? 56.955  27.888  3.076   1.00 36.56  ? 206 MET A SD  1 
ATOM   1659  C  CE  . MET A 1 206 ? 58.234  28.910  3.784   1.00 30.00  ? 206 MET A CE  1 
ATOM   1660  N  N   . ILE A 1 207 ? 59.458  28.617  -2.378  1.00 26.86  ? 207 ILE A N   1 
ATOM   1661  C  CA  . ILE A 1 207 ? 60.703  28.783  -3.119  1.00 27.43  ? 207 ILE A CA  1 
ATOM   1662  C  C   . ILE A 1 207 ? 60.613  29.888  -4.145  1.00 27.98  ? 207 ILE A C   1 
ATOM   1663  O  O   . ILE A 1 207 ? 61.379  30.858  -4.071  1.00 26.59  ? 207 ILE A O   1 
ATOM   1664  C  CB  . ILE A 1 207 ? 61.131  27.510  -3.823  1.00 27.75  ? 207 ILE A CB  1 
ATOM   1665  C  CG1 . ILE A 1 207 ? 61.656  26.502  -2.809  1.00 24.60  ? 207 ILE A CG1 1 
ATOM   1666  C  CG2 . ILE A 1 207 ? 62.184  27.835  -4.868  1.00 29.10  ? 207 ILE A CG2 1 
ATOM   1667  C  CD1 . ILE A 1 207 ? 61.558  25.111  -3.366  1.00 25.08  ? 207 ILE A CD1 1 
ATOM   1668  N  N   . MET A 1 208 ? 59.650  29.759  -5.059  1.00 27.85  ? 208 MET A N   1 
ATOM   1669  C  CA  . MET A 1 208 ? 59.492  30.728  -6.136  1.00 29.38  ? 208 MET A CA  1 
ATOM   1670  C  C   . MET A 1 208 ? 58.963  32.070  -5.629  1.00 29.17  ? 208 MET A C   1 
ATOM   1671  O  O   . MET A 1 208 ? 58.831  33.031  -6.388  1.00 30.64  ? 208 MET A O   1 
ATOM   1672  C  CB  . MET A 1 208 ? 58.608  30.155  -7.246  1.00 30.87  ? 208 MET A CB  1 
ATOM   1673  C  CG  . MET A 1 208 ? 59.282  29.015  -8.013  1.00 34.92  ? 208 MET A CG  1 
ATOM   1674  S  SD  . MET A 1 208 ? 58.301  28.279  -9.359  1.00 42.28  ? 208 MET A SD  1 
ATOM   1675  C  CE  . MET A 1 208 ? 57.494  26.873  -8.562  1.00 36.03  ? 208 MET A CE  1 
ATOM   1676  N  N   . GLY A 1 209 ? 58.653  32.142  -4.342  1.00 27.28  ? 209 GLY A N   1 
ATOM   1677  C  CA  . GLY A 1 209 ? 58.022  33.333  -3.796  1.00 24.43  ? 209 GLY A CA  1 
ATOM   1678  C  C   . GLY A 1 209 ? 59.061  34.131  -3.062  1.00 23.84  ? 209 GLY A C   1 
ATOM   1679  O  O   . GLY A 1 209 ? 58.789  35.193  -2.622  1.00 27.60  ? 209 GLY A O   1 
ATOM   1680  N  N   . GLY A 1 210 ? 60.252  33.589  -2.922  1.00 25.63  ? 210 GLY A N   1 
ATOM   1681  C  CA  . GLY A 1 210 ? 61.382  34.297  -2.351  1.00 26.76  ? 210 GLY A CA  1 
ATOM   1682  C  C   . GLY A 1 210 ? 61.629  34.063  -0.859  1.00 27.93  ? 210 GLY A C   1 
ATOM   1683  O  O   . GLY A 1 210 ? 62.634  34.543  -0.321  1.00 25.87  ? 210 GLY A O   1 
ATOM   1684  N  N   . VAL A 1 211 ? 60.764  33.259  -0.225  1.00 26.57  ? 211 VAL A N   1 
ATOM   1685  C  CA  . VAL A 1 211 ? 60.652  33.209  1.221   1.00 24.38  ? 211 VAL A CA  1 
ATOM   1686  C  C   . VAL A 1 211 ? 61.934  32.716  1.843   1.00 25.31  ? 211 VAL A C   1 
ATOM   1687  O  O   . VAL A 1 211 ? 62.385  33.237  2.857   1.00 27.19  ? 211 VAL A O   1 
ATOM   1688  C  CB  . VAL A 1 211 ? 59.451  32.338  1.644   1.00 24.10  ? 211 VAL A CB  1 
ATOM   1689  C  CG1 . VAL A 1 211 ? 59.524  32.008  3.138   1.00 22.28  ? 211 VAL A CG1 1 
ATOM   1690  C  CG2 . VAL A 1 211 ? 58.142  33.010  1.246   1.00 20.10  ? 211 VAL A CG2 1 
ATOM   1691  N  N   . PHE A 1 212 ? 62.548  31.735  1.211   1.00 26.47  ? 212 PHE A N   1 
ATOM   1692  C  CA  . PHE A 1 212 ? 63.807  31.203  1.705   1.00 28.41  ? 212 PHE A CA  1 
ATOM   1693  C  C   . PHE A 1 212 ? 64.985  32.130  1.474   1.00 30.30  ? 212 PHE A C   1 
ATOM   1694  O  O   . PHE A 1 212 ? 65.972  32.067  2.213   1.00 33.79  ? 212 PHE A O   1 
ATOM   1695  C  CB  . PHE A 1 212 ? 64.097  29.846  1.097   1.00 27.82  ? 212 PHE A CB  1 
ATOM   1696  C  CG  . PHE A 1 212 ? 63.159  28.767  1.538   1.00 27.51  ? 212 PHE A CG  1 
ATOM   1697  C  CD1 . PHE A 1 212 ? 63.085  28.387  2.883   1.00 28.33  ? 212 PHE A CD1 1 
ATOM   1698  C  CD2 . PHE A 1 212 ? 62.394  28.084  0.606   1.00 28.07  ? 212 PHE A CD2 1 
ATOM   1699  C  CE1 . PHE A 1 212 ? 62.231  27.367  3.282   1.00 29.62  ? 212 PHE A CE1 1 
ATOM   1700  C  CE2 . PHE A 1 212 ? 61.526  27.061  0.995   1.00 28.62  ? 212 PHE A CE2 1 
ATOM   1701  C  CZ  . PHE A 1 212 ? 61.439  26.704  2.334   1.00 28.77  ? 212 PHE A CZ  1 
ATOM   1702  N  N   . GLU A 1 213 ? 64.868  32.995  0.467   1.00 31.94  ? 213 GLU A N   1 
ATOM   1703  C  CA  . GLU A 1 213 ? 65.873  34.029  0.191   1.00 32.91  ? 213 GLU A CA  1 
ATOM   1704  C  C   . GLU A 1 213 ? 65.742  35.244  1.111   1.00 31.42  ? 213 GLU A C   1 
ATOM   1705  O  O   . GLU A 1 213 ? 66.746  35.781  1.543   1.00 30.91  ? 213 GLU A O   1 
ATOM   1706  C  CB  . GLU A 1 213 ? 65.782  34.482  -1.272  1.00 36.03  ? 213 GLU A CB  1 
ATOM   1707  C  CG  . GLU A 1 213 ? 67.020  35.195  -1.805  1.00 40.00  ? 213 GLU A CG  1 
ATOM   1708  C  CD  . GLU A 1 213 ? 68.257  34.289  -1.914  1.00 45.83  ? 213 GLU A CD  1 
ATOM   1709  O  OE1 . GLU A 1 213 ? 68.119  33.030  -2.120  1.00 41.63  ? 213 GLU A OE1 1 
ATOM   1710  O  OE2 . GLU A 1 213 ? 69.381  34.857  -1.791  1.00 46.68  ? 213 GLU A OE2 1 
ATOM   1711  N  N   . LYS A 1 214 ? 64.507  35.687  1.368   1.00 32.21  ? 214 LYS A N   1 
ATOM   1712  C  CA  . LYS A 1 214 ? 64.206  36.769  2.319   1.00 36.07  ? 214 LYS A CA  1 
ATOM   1713  C  C   . LYS A 1 214 ? 64.565  36.397  3.759   1.00 32.49  ? 214 LYS A C   1 
ATOM   1714  O  O   . LYS A 1 214 ? 64.922  37.258  4.544   1.00 33.21  ? 214 LYS A O   1 
ATOM   1715  C  CB  . LYS A 1 214 ? 62.708  37.142  2.279   1.00 40.65  ? 214 LYS A CB  1 
ATOM   1716  C  CG  . LYS A 1 214 ? 62.330  38.394  1.483   1.00 48.84  ? 214 LYS A CG  1 
ATOM   1717  C  CD  . LYS A 1 214 ? 62.170  38.108  -0.023  1.00 54.29  ? 214 LYS A CD  1 
ATOM   1718  C  CE  . LYS A 1 214 ? 63.510  38.057  -0.764  1.00 55.61  ? 214 LYS A CE  1 
ATOM   1719  N  NZ  . LYS A 1 214 ? 63.650  36.912  -1.716  1.00 53.19  ? 214 LYS A NZ  1 
ATOM   1720  N  N   . PHE A 1 215 ? 64.430  35.114  4.097   1.00 30.51  ? 215 PHE A N   1 
ATOM   1721  C  CA  . PHE A 1 215 ? 64.583  34.658  5.465   1.00 28.24  ? 215 PHE A CA  1 
ATOM   1722  C  C   . PHE A 1 215 ? 65.500  33.450  5.517   1.00 29.97  ? 215 PHE A C   1 
ATOM   1723  O  O   . PHE A 1 215 ? 65.078  32.377  5.914   1.00 32.09  ? 215 PHE A O   1 
ATOM   1724  C  CB  . PHE A 1 215 ? 63.215  34.334  6.091   1.00 23.82  ? 215 PHE A CB  1 
ATOM   1725  C  CG  . PHE A 1 215 ? 62.196  35.418  5.917   1.00 21.95  ? 215 PHE A CG  1 
ATOM   1726  C  CD1 . PHE A 1 215 ? 62.248  36.575  6.685   1.00 21.85  ? 215 PHE A CD1 1 
ATOM   1727  C  CD2 . PHE A 1 215 ? 61.191  35.298  4.972   1.00 21.52  ? 215 PHE A CD2 1 
ATOM   1728  C  CE1 . PHE A 1 215 ? 61.297  37.588  6.519   1.00 21.29  ? 215 PHE A CE1 1 
ATOM   1729  C  CE2 . PHE A 1 215 ? 60.238  36.310  4.787   1.00 20.68  ? 215 PHE A CE2 1 
ATOM   1730  C  CZ  . PHE A 1 215 ? 60.287  37.447  5.576   1.00 20.14  ? 215 PHE A CZ  1 
ATOM   1731  N  N   . PRO A 1 216 ? 66.779  33.629  5.163   1.00 31.48  ? 216 PRO A N   1 
ATOM   1732  C  CA  . PRO A 1 216 ? 67.695  32.486  5.051   1.00 31.01  ? 216 PRO A CA  1 
ATOM   1733  C  C   . PRO A 1 216 ? 67.763  31.627  6.322   1.00 31.21  ? 216 PRO A C   1 
ATOM   1734  O  O   . PRO A 1 216 ? 68.244  30.508  6.266   1.00 32.32  ? 216 PRO A O   1 
ATOM   1735  C  CB  . PRO A 1 216 ? 69.049  33.160  4.849   1.00 30.50  ? 216 PRO A CB  1 
ATOM   1736  C  CG  . PRO A 1 216 ? 68.897  34.466  5.584   1.00 32.16  ? 216 PRO A CG  1 
ATOM   1737  C  CD  . PRO A 1 216 ? 67.510  34.909  5.212   1.00 30.25  ? 216 PRO A CD  1 
ATOM   1738  N  N   . LYS A 1 217 ? 67.312  32.153  7.459   1.00 32.16  ? 217 LYS A N   1 
ATOM   1739  C  CA  . LYS A 1 217 ? 67.448  31.436  8.738   1.00 30.12  ? 217 LYS A CA  1 
ATOM   1740  C  C   . LYS A 1 217 ? 66.134  30.860  9.272   1.00 25.89  ? 217 LYS A C   1 
ATOM   1741  O  O   . LYS A 1 217 ? 66.110  30.119  10.225  1.00 25.86  ? 217 LYS A O   1 
ATOM   1742  C  CB  . LYS A 1 217 ? 68.217  32.276  9.772   1.00 33.21  ? 217 LYS A CB  1 
ATOM   1743  C  CG  . LYS A 1 217 ? 69.699  32.372  9.421   1.00 37.01  ? 217 LYS A CG  1 
ATOM   1744  C  CD  . LYS A 1 217 ? 70.500  33.069  10.509  1.00 42.20  ? 217 LYS A CD  1 
ATOM   1745  C  CE  . LYS A 1 217 ? 71.317  32.090  11.356  1.00 42.29  ? 217 LYS A CE  1 
ATOM   1746  N  NZ  . LYS A 1 217 ? 72.763  32.118  10.984  1.00 43.15  ? 217 LYS A NZ  1 
ATOM   1747  N  N   . LEU A 1 218 ? 65.040  31.183  8.618   1.00 24.21  ? 218 LEU A N   1 
ATOM   1748  C  CA  . LEU A 1 218 ? 63.801  30.476  8.850   1.00 23.01  ? 218 LEU A CA  1 
ATOM   1749  C  C   . LEU A 1 218 ? 63.977  28.952  8.667   1.00 23.59  ? 218 LEU A C   1 
ATOM   1750  O  O   . LEU A 1 218 ? 64.522  28.489  7.651   1.00 25.62  ? 218 LEU A O   1 
ATOM   1751  C  CB  . LEU A 1 218 ? 62.752  30.998  7.891   1.00 21.24  ? 218 LEU A CB  1 
ATOM   1752  C  CG  . LEU A 1 218 ? 61.319  30.537  8.080   1.00 20.57  ? 218 LEU A CG  1 
ATOM   1753  C  CD1 . LEU A 1 218 ? 60.707  31.088  9.356   1.00 21.96  ? 218 LEU A CD1 1 
ATOM   1754  C  CD2 . LEU A 1 218 ? 60.492  30.943  6.881   1.00 19.69  ? 218 LEU A CD2 1 
ATOM   1755  N  N   . LYS A 1 219 ? 63.538  28.169  9.645   1.00 21.27  ? 219 LYS A N   1 
ATOM   1756  C  CA  . LYS A 1 219 ? 63.547  26.722  9.455   1.00 21.35  ? 219 LYS A CA  1 
ATOM   1757  C  C   . LYS A 1 219 ? 62.139  26.187  9.313   1.00 19.39  ? 219 LYS A C   1 
ATOM   1758  O  O   . LYS A 1 219 ? 61.236  26.551  10.074  1.00 21.69  ? 219 LYS A O   1 
ATOM   1759  C  CB  . LYS A 1 219 ? 64.227  26.020  10.597  1.00 23.70  ? 219 LYS A CB  1 
ATOM   1760  C  CG  . LYS A 1 219 ? 64.782  26.908  11.699  1.00 25.24  ? 219 LYS A CG  1 
ATOM   1761  C  CD  . LYS A 1 219 ? 65.886  26.124  12.371  1.00 26.34  ? 219 LYS A CD  1 
ATOM   1762  C  CE  . LYS A 1 219 ? 66.919  25.682  11.350  1.00 23.89  ? 219 LYS A CE  1 
ATOM   1763  N  NZ  . LYS A 1 219 ? 68.189  25.446  12.080  1.00 25.09  ? 219 LYS A NZ  1 
ATOM   1764  N  N   . VAL A 1 220 ? 61.961  25.337  8.319   1.00 17.44  ? 220 VAL A N   1 
ATOM   1765  C  CA  . VAL A 1 220 ? 60.667  24.896  7.845   1.00 16.64  ? 220 VAL A CA  1 
ATOM   1766  C  C   . VAL A 1 220 ? 60.788  23.429  7.569   1.00 16.56  ? 220 VAL A C   1 
ATOM   1767  O  O   . VAL A 1 220 ? 61.779  22.984  7.029   1.00 18.16  ? 220 VAL A O   1 
ATOM   1768  C  CB  . VAL A 1 220 ? 60.275  25.622  6.551   1.00 16.63  ? 220 VAL A CB  1 
ATOM   1769  C  CG1 . VAL A 1 220 ? 58.819  25.356  6.220   1.00 15.79  ? 220 VAL A CG1 1 
ATOM   1770  C  CG2 . VAL A 1 220 ? 60.465  27.128  6.721   1.00 15.76  ? 220 VAL A CG2 1 
ATOM   1771  N  N   . CYS A 1 221 ? 59.797  22.667  8.003   1.00 16.76  ? 221 CYS A N   1 
ATOM   1772  C  CA  . CYS A 1 221 ? 59.702  21.250  7.732   1.00 16.39  ? 221 CYS A CA  1 
ATOM   1773  C  C   . CYS A 1 221 ? 58.389  21.025  6.996   1.00 16.99  ? 221 CYS A C   1 
ATOM   1774  O  O   . CYS A 1 221 ? 57.410  21.708  7.257   1.00 18.13  ? 221 CYS A O   1 
ATOM   1775  C  CB  . CYS A 1 221 ? 59.728  20.469  9.021   1.00 16.31  ? 221 CYS A CB  1 
ATOM   1776  S  SG  . CYS A 1 221 ? 59.651  18.664  8.890   1.00 17.51  ? 221 CYS A SG  1 
ATOM   1777  N  N   . PHE A 1 222 ? 58.360  20.076  6.070   1.00 17.23  ? 222 PHE A N   1 
ATOM   1778  C  CA  . PHE A 1 222 ? 57.127  19.784  5.335   1.00 16.93  ? 222 PHE A CA  1 
ATOM   1779  C  C   . PHE A 1 222 ? 56.688  18.366  5.648   1.00 18.58  ? 222 PHE A C   1 
ATOM   1780  O  O   . PHE A 1 222 ? 57.507  17.458  5.735   1.00 18.95  ? 222 PHE A O   1 
ATOM   1781  C  CB  . PHE A 1 222 ? 57.314  19.995  3.832   1.00 15.02  ? 222 PHE A CB  1 
ATOM   1782  C  CG  . PHE A 1 222 ? 57.568  21.425  3.458   1.00 15.11  ? 222 PHE A CG  1 
ATOM   1783  C  CD1 . PHE A 1 222 ? 56.516  22.300  3.221   1.00 14.54  ? 222 PHE A CD1 1 
ATOM   1784  C  CD2 . PHE A 1 222 ? 58.863  21.907  3.339   1.00 15.72  ? 222 PHE A CD2 1 
ATOM   1785  C  CE1 . PHE A 1 222 ? 56.749  23.609  2.860   1.00 14.57  ? 222 PHE A CE1 1 
ATOM   1786  C  CE2 . PHE A 1 222 ? 59.113  23.235  2.998   1.00 15.49  ? 222 PHE A CE2 1 
ATOM   1787  C  CZ  . PHE A 1 222 ? 58.048  24.091  2.764   1.00 14.90  ? 222 PHE A CZ  1 
ATOM   1788  N  N   . ALA A 1 223 ? 55.393  18.208  5.879   1.00 19.32  ? 223 ALA A N   1 
ATOM   1789  C  CA  . ALA A 1 223 ? 54.767  16.913  6.034   1.00 20.47  ? 223 ALA A CA  1 
ATOM   1790  C  C   . ALA A 1 223 ? 54.921  15.956  4.832   1.00 21.80  ? 223 ALA A C   1 
ATOM   1791  O  O   . ALA A 1 223 ? 55.099  16.393  3.661   1.00 21.58  ? 223 ALA A O   1 
ATOM   1792  C  CB  . ALA A 1 223 ? 53.297  17.121  6.328   1.00 21.20  ? 223 ALA A CB  1 
ATOM   1793  N  N   . HIS A 1 224 ? 54.873  14.650  5.147   1.00 21.30  ? 224 HIS A N   1 
ATOM   1794  C  CA  . HIS A 1 224 ? 54.853  13.545  4.154   1.00 21.09  ? 224 HIS A CA  1 
ATOM   1795  C  C   . HIS A 1 224 ? 55.942  13.515  3.101   1.00 20.94  ? 224 HIS A C   1 
ATOM   1796  O  O   . HIS A 1 224 ? 55.671  13.378  1.919   1.00 20.67  ? 224 HIS A O   1 
ATOM   1797  C  CB  . HIS A 1 224 ? 53.491  13.466  3.483   1.00 20.46  ? 224 HIS A CB  1 
ATOM   1798  C  CG  . HIS A 1 224 ? 52.335  13.676  4.422   1.00 21.52  ? 224 HIS A CG  1 
ATOM   1799  N  ND1 . HIS A 1 224 ? 52.010  12.783  5.417   1.00 23.19  ? 224 HIS A ND1 1 
ATOM   1800  C  CD2 . HIS A 1 224 ? 51.408  14.691  4.493   1.00 20.94  ? 224 HIS A CD2 1 
ATOM   1801  C  CE1 . HIS A 1 224 ? 50.930  13.244  6.079   1.00 22.10  ? 224 HIS A CE1 1 
ATOM   1802  N  NE2 . HIS A 1 224 ? 50.558  14.404  5.514   1.00 21.05  ? 224 HIS A NE2 1 
ATOM   1803  N  N   . GLY A 1 225 ? 57.196  13.599  3.515   1.00 21.27  ? 225 GLY A N   1 
ATOM   1804  C  CA  . GLY A 1 225 ? 58.293  13.669  2.552   1.00 21.79  ? 225 GLY A CA  1 
ATOM   1805  C  C   . GLY A 1 225 ? 58.148  14.786  1.528   1.00 24.49  ? 225 GLY A C   1 
ATOM   1806  O  O   . GLY A 1 225 ? 58.627  14.655  0.388   1.00 25.56  ? 225 GLY A O   1 
ATOM   1807  N  N   . GLY A 1 226 ? 57.477  15.888  1.892   1.00 23.15  ? 226 GLY A N   1 
ATOM   1808  C  CA  . GLY A 1 226 ? 57.293  16.943  0.924   1.00 20.19  ? 226 GLY A CA  1 
ATOM   1809  C  C   . GLY A 1 226 ? 56.374  16.571  -0.232  1.00 21.55  ? 226 GLY A C   1 
ATOM   1810  O  O   . GLY A 1 226 ? 56.413  17.223  -1.291  1.00 20.87  ? 226 GLY A O   1 
ATOM   1811  N  N   . GLY A 1 227 ? 55.510  15.567  -0.049  1.00 19.53  ? 227 GLY A N   1 
ATOM   1812  C  CA  . GLY A 1 227 ? 54.470  15.315  -1.039  1.00 20.14  ? 227 GLY A CA  1 
ATOM   1813  C  C   . GLY A 1 227 ? 55.009  14.598  -2.270  1.00 21.88  ? 227 GLY A C   1 
ATOM   1814  O  O   . GLY A 1 227 ? 55.357  13.418  -2.197  1.00 23.61  ? 227 GLY A O   1 
ATOM   1815  N  N   . ALA A 1 228 ? 55.089  15.318  -3.389  1.00 21.84  ? 228 ALA A N   1 
ATOM   1816  C  CA  . ALA A 1 228 ? 55.582  14.788  -4.681  1.00 21.87  ? 228 ALA A CA  1 
ATOM   1817  C  C   . ALA A 1 228 ? 56.913  15.426  -5.067  1.00 21.16  ? 228 ALA A C   1 
ATOM   1818  O  O   . ALA A 1 228 ? 57.674  14.888  -5.860  1.00 21.12  ? 228 ALA A O   1 
ATOM   1819  C  CB  . ALA A 1 228 ? 54.564  15.066  -5.784  1.00 22.33  ? 228 ALA A CB  1 
ATOM   1820  N  N   . PHE A 1 229 ? 57.146  16.608  -4.519  1.00 21.56  ? 229 PHE A N   1 
ATOM   1821  C  CA  . PHE A 1 229 ? 58.357  17.381  -4.719  1.00 20.70  ? 229 PHE A CA  1 
ATOM   1822  C  C   . PHE A 1 229 ? 59.619  16.587  -5.087  1.00 19.93  ? 229 PHE A C   1 
ATOM   1823  O  O   . PHE A 1 229 ? 60.164  16.819  -6.128  1.00 21.03  ? 229 PHE A O   1 
ATOM   1824  C  CB  . PHE A 1 229 ? 58.634  18.309  -3.515  1.00 19.31  ? 229 PHE A CB  1 
ATOM   1825  C  CG  . PHE A 1 229 ? 59.633  19.351  -3.831  1.00 19.02  ? 229 PHE A CG  1 
ATOM   1826  C  CD1 . PHE A 1 229 ? 59.308  20.374  -4.703  1.00 18.06  ? 229 PHE A CD1 1 
ATOM   1827  C  CD2 . PHE A 1 229 ? 60.926  19.260  -3.348  1.00 17.44  ? 229 PHE A CD2 1 
ATOM   1828  C  CE1 . PHE A 1 229 ? 60.262  21.316  -5.078  1.00 17.85  ? 229 PHE A CE1 1 
ATOM   1829  C  CE2 . PHE A 1 229 ? 61.870  20.212  -3.707  1.00 17.84  ? 229 PHE A CE2 1 
ATOM   1830  C  CZ  . PHE A 1 229 ? 61.546  21.241  -4.563  1.00 16.96  ? 229 PHE A CZ  1 
ATOM   1831  N  N   . PRO A 1 230 ? 60.070  15.648  -4.241  1.00 19.78  ? 230 PRO A N   1 
ATOM   1832  C  CA  . PRO A 1 230 ? 61.386  15.083  -4.443  1.00 20.78  ? 230 PRO A CA  1 
ATOM   1833  C  C   . PRO A 1 230 ? 61.509  14.309  -5.747  1.00 20.43  ? 230 PRO A C   1 
ATOM   1834  O  O   . PRO A 1 230 ? 62.590  14.205  -6.301  1.00 20.90  ? 230 PRO A O   1 
ATOM   1835  C  CB  . PRO A 1 230 ? 61.509  14.100  -3.265  1.00 21.42  ? 230 PRO A CB  1 
ATOM   1836  C  CG  . PRO A 1 230 ? 60.507  14.574  -2.283  1.00 19.80  ? 230 PRO A CG  1 
ATOM   1837  C  CD  . PRO A 1 230 ? 59.376  14.926  -3.172  1.00 19.70  ? 230 PRO A CD  1 
ATOM   1838  N  N   . PHE A 1 231 ? 60.398  13.765  -6.220  1.00 20.63  ? 231 PHE A N   1 
ATOM   1839  C  CA  . PHE A 1 231 ? 60.347  13.068  -7.492  1.00 19.61  ? 231 PHE A CA  1 
ATOM   1840  C  C   . PHE A 1 231 ? 60.130  14.028  -8.652  1.00 18.49  ? 231 PHE A C   1 
ATOM   1841  O  O   . PHE A 1 231 ? 60.514  13.720  -9.767  1.00 19.95  ? 231 PHE A O   1 
ATOM   1842  C  CB  . PHE A 1 231 ? 59.205  12.052  -7.472  1.00 19.40  ? 231 PHE A CB  1 
ATOM   1843  C  CG  . PHE A 1 231 ? 59.069  11.243  -8.748  1.00 18.39  ? 231 PHE A CG  1 
ATOM   1844  C  CD1 . PHE A 1 231 ? 59.946  10.202  -9.031  1.00 19.00  ? 231 PHE A CD1 1 
ATOM   1845  C  CD2 . PHE A 1 231 ? 58.050  11.503  -9.637  1.00 19.04  ? 231 PHE A CD2 1 
ATOM   1846  C  CE1 . PHE A 1 231 ? 59.833  9.442   -10.191 1.00 17.84  ? 231 PHE A CE1 1 
ATOM   1847  C  CE2 . PHE A 1 231 ? 57.928  10.756  -10.824 1.00 20.39  ? 231 PHE A CE2 1 
ATOM   1848  C  CZ  . PHE A 1 231 ? 58.813  9.715   -11.094 1.00 18.09  ? 231 PHE A CZ  1 
ATOM   1849  N  N   . THR A 1 232 ? 59.475  15.154  -8.412  1.00 16.64  ? 232 THR A N   1 
ATOM   1850  C  CA  . THR A 1 232 ? 59.063  16.019  -9.519  1.00 16.09  ? 232 THR A CA  1 
ATOM   1851  C  C   . THR A 1 232 ? 59.844  17.340  -9.505  1.00 16.69  ? 232 THR A C   1 
ATOM   1852  O  O   . THR A 1 232 ? 59.520  18.263  -10.254 1.00 15.33  ? 232 THR A O   1 
ATOM   1853  C  CB  . THR A 1 232 ? 57.552  16.357  -9.499  1.00 15.94  ? 232 THR A CB  1 
ATOM   1854  O  OG1 . THR A 1 232 ? 57.203  16.941  -8.236  1.00 16.03  ? 232 THR A OG1 1 
ATOM   1855  C  CG2 . THR A 1 232 ? 56.646  15.148  -9.812  1.00 15.61  ? 232 THR A CG2 1 
ATOM   1856  N  N   . VAL A 1 233 ? 60.868  17.422  -8.642  1.00 16.50  ? 233 VAL A N   1 
ATOM   1857  C  CA  . VAL A 1 233 ? 61.760  18.556  -8.631  1.00 17.03  ? 233 VAL A CA  1 
ATOM   1858  C  C   . VAL A 1 233 ? 62.418  18.762  -9.972  1.00 17.73  ? 233 VAL A C   1 
ATOM   1859  O  O   . VAL A 1 233 ? 62.674  19.882  -10.356 1.00 19.28  ? 233 VAL A O   1 
ATOM   1860  C  CB  . VAL A 1 233 ? 62.811  18.503  -7.474  1.00 18.05  ? 233 VAL A CB  1 
ATOM   1861  C  CG1 . VAL A 1 233 ? 63.699  17.272  -7.552  1.00 16.77  ? 233 VAL A CG1 1 
ATOM   1862  C  CG2 . VAL A 1 233 ? 63.640  19.816  -7.375  1.00 17.46  ? 233 VAL A CG2 1 
ATOM   1863  N  N   . GLY A 1 234 ? 62.670  17.698  -10.724 1.00 19.05  ? 234 GLY A N   1 
ATOM   1864  C  CA  . GLY A 1 234 ? 63.280  17.875  -12.049 1.00 17.97  ? 234 GLY A CA  1 
ATOM   1865  C  C   . GLY A 1 234 ? 62.364  18.716  -12.910 1.00 17.43  ? 234 GLY A C   1 
ATOM   1866  O  O   . GLY A 1 234 ? 62.751  19.760  -13.457 1.00 17.78  ? 234 GLY A O   1 
ATOM   1867  N  N   . ARG A 1 235 ? 61.125  18.278  -12.990 1.00 16.61  ? 235 ARG A N   1 
ATOM   1868  C  CA  . ARG A 1 235 ? 60.146  18.953  -13.815 1.00 15.80  ? 235 ARG A CA  1 
ATOM   1869  C  C   . ARG A 1 235 ? 59.922  20.384  -13.348 1.00 16.59  ? 235 ARG A C   1 
ATOM   1870  O  O   . ARG A 1 235 ? 59.822  21.263  -14.185 1.00 17.78  ? 235 ARG A O   1 
ATOM   1871  C  CB  . ARG A 1 235 ? 58.856  18.166  -13.825 1.00 14.76  ? 235 ARG A CB  1 
ATOM   1872  C  CG  . ARG A 1 235 ? 57.763  18.760  -14.667 1.00 14.94  ? 235 ARG A CG  1 
ATOM   1873  C  CD  . ARG A 1 235 ? 56.438  18.139  -14.342 1.00 15.48  ? 235 ARG A CD  1 
ATOM   1874  N  NE  . ARG A 1 235 ? 55.398  18.788  -15.114 1.00 17.00  ? 235 ARG A NE  1 
ATOM   1875  C  CZ  . ARG A 1 235 ? 55.088  18.449  -16.362 1.00 18.35  ? 235 ARG A CZ  1 
ATOM   1876  N  NH1 . ARG A 1 235 ? 55.774  17.458  -16.957 1.00 18.64  ? 235 ARG A NH1 1 
ATOM   1877  N  NH2 . ARG A 1 235 ? 54.141  19.117  -17.028 1.00 16.97  ? 235 ARG A NH2 1 
ATOM   1878  N  N   . ILE A 1 236 ? 59.875  20.633  -12.033 1.00 17.64  ? 236 ILE A N   1 
ATOM   1879  C  CA  . ILE A 1 236 ? 59.721  22.002  -11.489 1.00 17.94  ? 236 ILE A CA  1 
ATOM   1880  C  C   . ILE A 1 236 ? 60.926  22.863  -11.864 1.00 18.80  ? 236 ILE A C   1 
ATOM   1881  O  O   . ILE A 1 236 ? 60.759  23.997  -12.315 1.00 19.21  ? 236 ILE A O   1 
ATOM   1882  C  CB  . ILE A 1 236 ? 59.452  22.019  -9.951  1.00 17.75  ? 236 ILE A CB  1 
ATOM   1883  C  CG1 . ILE A 1 236 ? 58.003  21.573  -9.661  1.00 18.02  ? 236 ILE A CG1 1 
ATOM   1884  C  CG2 . ILE A 1 236 ? 59.647  23.415  -9.337  1.00 16.69  ? 236 ILE A CG2 1 
ATOM   1885  C  CD1 . ILE A 1 236 ? 57.836  20.745  -8.398  1.00 17.23  ? 236 ILE A CD1 1 
ATOM   1886  N  N   . SER A 1 237 ? 62.121  22.299  -11.696 1.00 20.48  ? 237 SER A N   1 
ATOM   1887  C  CA  . SER A 1 237 ? 63.390  22.969  -11.950 1.00 22.41  ? 237 SER A CA  1 
ATOM   1888  C  C   . SER A 1 237 ? 63.567  23.294  -13.423 1.00 24.48  ? 237 SER A C   1 
ATOM   1889  O  O   . SER A 1 237 ? 64.048  24.361  -13.778 1.00 23.67  ? 237 SER A O   1 
ATOM   1890  C  CB  . SER A 1 237 ? 64.535  22.054  -11.488 1.00 24.31  ? 237 SER A CB  1 
ATOM   1891  O  OG  . SER A 1 237 ? 65.828  22.564  -11.807 1.00 26.76  ? 237 SER A OG  1 
ATOM   1892  N  N   . HIS A 1 238 ? 63.194  22.350  -14.285 1.00 27.23  ? 238 HIS A N   1 
ATOM   1893  C  CA  . HIS A 1 238 ? 63.356  22.543  -15.712 1.00 28.04  ? 238 HIS A CA  1 
ATOM   1894  C  C   . HIS A 1 238 ? 62.392  23.561  -16.257 1.00 28.62  ? 238 HIS A C   1 
ATOM   1895  O  O   . HIS A 1 238 ? 62.782  24.420  -17.062 1.00 32.23  ? 238 HIS A O   1 
ATOM   1896  C  CB  . HIS A 1 238 ? 63.253  21.219  -16.449 1.00 28.92  ? 238 HIS A CB  1 
ATOM   1897  C  CG  . HIS A 1 238 ? 63.167  21.366  -17.945 1.00 31.39  ? 238 HIS A CG  1 
ATOM   1898  N  ND1 . HIS A 1 238 ? 64.252  21.570  -18.718 1.00 30.09  ? 238 HIS A ND1 1 
ATOM   1899  C  CD2 . HIS A 1 238 ? 62.071  21.354  -18.801 1.00 30.90  ? 238 HIS A CD2 1 
ATOM   1900  C  CE1 . HIS A 1 238 ? 63.868  21.672  -20.002 1.00 28.29  ? 238 HIS A CE1 1 
ATOM   1901  N  NE2 . HIS A 1 238 ? 62.539  21.534  -20.050 1.00 30.08  ? 238 HIS A NE2 1 
ATOM   1902  N  N   . GLY A 1 239 ? 61.137  23.482  -15.822 1.00 26.36  ? 239 GLY A N   1 
ATOM   1903  C  CA  . GLY A 1 239 ? 60.082  24.392  -16.276 1.00 25.77  ? 239 GLY A CA  1 
ATOM   1904  C  C   . GLY A 1 239 ? 60.344  25.801  -15.809 1.00 26.41  ? 239 GLY A C   1 
ATOM   1905  O  O   . GLY A 1 239 ? 60.132  26.747  -16.517 1.00 29.13  ? 239 GLY A O   1 
ATOM   1906  N  N   . PHE A 1 240 ? 60.822  25.934  -14.590 1.00 28.54  ? 240 PHE A N   1 
ATOM   1907  C  CA  . PHE A 1 240 ? 61.293  27.208  -14.097 1.00 28.22  ? 240 PHE A CA  1 
ATOM   1908  C  C   . PHE A 1 240 ? 62.297  27.793  -15.079 1.00 28.28  ? 240 PHE A C   1 
ATOM   1909  O  O   . PHE A 1 240 ? 62.150  28.947  -15.457 1.00 26.71  ? 240 PHE A O   1 
ATOM   1910  C  CB  . PHE A 1 240 ? 61.921  27.056  -12.702 1.00 27.36  ? 240 PHE A CB  1 
ATOM   1911  C  CG  . PHE A 1 240 ? 62.529  28.329  -12.157 1.00 28.50  ? 240 PHE A CG  1 
ATOM   1912  C  CD1 . PHE A 1 240 ? 61.819  29.130  -11.269 1.00 29.13  ? 240 PHE A CD1 1 
ATOM   1913  C  CD2 . PHE A 1 240 ? 63.811  28.710  -12.511 1.00 28.05  ? 240 PHE A CD2 1 
ATOM   1914  C  CE1 . PHE A 1 240 ? 62.375  30.294  -10.751 1.00 29.27  ? 240 PHE A CE1 1 
ATOM   1915  C  CE2 . PHE A 1 240 ? 64.378  29.867  -11.996 1.00 29.87  ? 240 PHE A CE2 1 
ATOM   1916  C  CZ  . PHE A 1 240 ? 63.668  30.658  -11.117 1.00 29.34  ? 240 PHE A CZ  1 
ATOM   1917  N  N   . SER A 1 241 ? 63.308  27.008  -15.474 1.00 28.93  ? 241 SER A N   1 
ATOM   1918  C  CA  . SER A 1 241 ? 64.316  27.500  -16.409 1.00 30.27  ? 241 SER A CA  1 
ATOM   1919  C  C   . SER A 1 241 ? 63.669  27.785  -17.739 1.00 30.74  ? 241 SER A C   1 
ATOM   1920  O  O   . SER A 1 241 ? 64.011  28.754  -18.359 1.00 32.66  ? 241 SER A O   1 
ATOM   1921  C  CB  . SER A 1 241 ? 65.470  26.528  -16.634 1.00 32.70  ? 241 SER A CB  1 
ATOM   1922  O  OG  . SER A 1 241 ? 65.813  25.812  -15.464 1.00 40.26  ? 241 SER A OG  1 
ATOM   1923  N  N   . MET A 1 242 ? 62.740  26.950  -18.189 1.00 32.80  ? 242 MET A N   1 
ATOM   1924  C  CA  . MET A 1 242 ? 62.113  27.187  -19.502 1.00 34.80  ? 242 MET A CA  1 
ATOM   1925  C  C   . MET A 1 242 ? 61.202  28.421  -19.574 1.00 35.75  ? 242 MET A C   1 
ATOM   1926  O  O   . MET A 1 242 ? 61.169  29.094  -20.598 1.00 36.12  ? 242 MET A O   1 
ATOM   1927  C  CB  . MET A 1 242 ? 61.363  25.954  -20.008 1.00 34.44  ? 242 MET A CB  1 
ATOM   1928  C  CG  . MET A 1 242 ? 62.261  24.755  -20.277 1.00 36.39  ? 242 MET A CG  1 
ATOM   1929  S  SD  . MET A 1 242 ? 63.525  24.948  -21.573 1.00 38.40  ? 242 MET A SD  1 
ATOM   1930  C  CE  . MET A 1 242 ? 64.927  25.682  -20.720 1.00 34.36  ? 242 MET A CE  1 
ATOM   1931  N  N   . ARG A 1 243 ? 60.453  28.732  -18.520 1.00 35.87  ? 243 ARG A N   1 
ATOM   1932  C  CA  . ARG A 1 243 ? 59.564  29.897  -18.616 1.00 36.69  ? 243 ARG A CA  1 
ATOM   1933  C  C   . ARG A 1 243 ? 59.681  30.892  -17.439 1.00 38.61  ? 243 ARG A C   1 
ATOM   1934  O  O   . ARG A 1 243 ? 58.777  30.980  -16.592 1.00 33.75  ? 243 ARG A O   1 
ATOM   1935  C  CB  . ARG A 1 243 ? 58.115  29.481  -18.912 1.00 37.50  ? 243 ARG A CB  1 
ATOM   1936  C  CG  . ARG A 1 243 ? 57.896  28.805  -20.267 1.00 38.23  ? 243 ARG A CG  1 
ATOM   1937  C  CD  . ARG A 1 243 ? 57.682  29.783  -21.405 1.00 37.92  ? 243 ARG A CD  1 
ATOM   1938  N  NE  . ARG A 1 243 ? 56.583  30.707  -21.101 1.00 41.88  ? 243 ARG A NE  1 
ATOM   1939  C  CZ  . ARG A 1 243 ? 55.279  30.416  -21.140 1.00 42.45  ? 243 ARG A CZ  1 
ATOM   1940  N  NH1 . ARG A 1 243 ? 54.846  29.205  -21.464 1.00 45.71  ? 243 ARG A NH1 1 
ATOM   1941  N  NH2 . ARG A 1 243 ? 54.388  31.348  -20.831 1.00 43.64  ? 243 ARG A NH2 1 
ATOM   1942  N  N   . PRO A 1 244 ? 60.799  31.664  -17.406 1.00 41.89  ? 244 PRO A N   1 
ATOM   1943  C  CA  . PRO A 1 244 ? 61.053  32.691  -16.392 1.00 41.97  ? 244 PRO A CA  1 
ATOM   1944  C  C   . PRO A 1 244 ? 59.996  33.799  -16.333 1.00 44.29  ? 244 PRO A C   1 
ATOM   1945  O  O   . PRO A 1 244 ? 59.782  34.368  -15.267 1.00 49.76  ? 244 PRO A O   1 
ATOM   1946  C  CB  . PRO A 1 244 ? 62.417  33.259  -16.802 1.00 43.23  ? 244 PRO A CB  1 
ATOM   1947  C  CG  . PRO A 1 244 ? 62.546  32.933  -18.252 1.00 43.13  ? 244 PRO A CG  1 
ATOM   1948  C  CD  . PRO A 1 244 ? 61.922  31.579  -18.360 1.00 41.72  ? 244 PRO A CD  1 
ATOM   1949  N  N   . ASP A 1 245 ? 59.337  34.108  -17.444 1.00 44.22  ? 245 ASP A N   1 
ATOM   1950  C  CA  . ASP A 1 245 ? 58.190  35.031  -17.405 1.00 46.26  ? 245 ASP A CA  1 
ATOM   1951  C  C   . ASP A 1 245 ? 57.115  34.615  -16.377 1.00 47.58  ? 245 ASP A C   1 
ATOM   1952  O  O   . ASP A 1 245 ? 56.611  35.443  -15.624 1.00 54.25  ? 245 ASP A O   1 
ATOM   1953  C  CB  . ASP A 1 245 ? 57.582  35.227  -18.803 1.00 45.39  ? 245 ASP A CB  1 
ATOM   1954  C  CG  . ASP A 1 245 ? 57.301  33.902  -19.520 1.00 50.49  ? 245 ASP A CG  1 
ATOM   1955  O  OD1 . ASP A 1 245 ? 58.242  33.083  -19.719 1.00 53.41  ? 245 ASP A OD1 1 
ATOM   1956  O  OD2 . ASP A 1 245 ? 56.132  33.682  -19.893 1.00 50.46  ? 245 ASP A OD2 1 
ATOM   1957  N  N   . LEU A 1 246 ? 56.788  33.328  -16.338 1.00 49.61  ? 246 LEU A N   1 
ATOM   1958  C  CA  . LEU A 1 246 ? 55.805  32.794  -15.400 1.00 47.31  ? 246 LEU A CA  1 
ATOM   1959  C  C   . LEU A 1 246 ? 56.365  32.451  -14.002 1.00 41.95  ? 246 LEU A C   1 
ATOM   1960  O  O   . LEU A 1 246 ? 55.604  32.374  -13.060 1.00 40.82  ? 246 LEU A O   1 
ATOM   1961  C  CB  . LEU A 1 246 ? 55.157  31.530  -15.971 1.00 48.73  ? 246 LEU A CB  1 
ATOM   1962  C  CG  . LEU A 1 246 ? 54.371  31.529  -17.287 1.00 53.00  ? 246 LEU A CG  1 
ATOM   1963  C  CD1 . LEU A 1 246 ? 54.477  30.150  -17.915 1.00 51.05  ? 246 LEU A CD1 1 
ATOM   1964  C  CD2 . LEU A 1 246 ? 52.903  31.910  -17.099 1.00 52.49  ? 246 LEU A CD2 1 
ATOM   1965  N  N   . CYS A 1 247 ? 57.676  32.271  -13.867 1.00 39.72  ? 247 CYS A N   1 
ATOM   1966  C  CA  . CYS A 1 247 ? 58.230  31.487  -12.739 1.00 41.14  ? 247 CYS A CA  1 
ATOM   1967  C  C   . CYS A 1 247 ? 59.302  32.157  -11.901 1.00 40.38  ? 247 CYS A C   1 
ATOM   1968  O  O   . CYS A 1 247 ? 59.432  31.879  -10.694 1.00 44.45  ? 247 CYS A O   1 
ATOM   1969  C  CB  . CYS A 1 247 ? 58.815  30.151  -13.242 1.00 40.25  ? 247 CYS A CB  1 
ATOM   1970  S  SG  . CYS A 1 247 ? 57.586  28.925  -13.736 1.00 39.43  ? 247 CYS A SG  1 
ATOM   1971  N  N   . ALA A 1 248 ? 60.096  32.991  -12.554 1.00 32.11  ? 248 ALA A N   1 
ATOM   1972  C  CA  . ALA A 1 248 ? 61.216  33.621  -11.915 1.00 31.63  ? 248 ALA A CA  1 
ATOM   1973  C  C   . ALA A 1 248 ? 60.918  35.094  -11.683 1.00 32.13  ? 248 ALA A C   1 
ATOM   1974  O  O   . ALA A 1 248 ? 61.823  35.865  -11.379 1.00 31.45  ? 248 ALA A O   1 
ATOM   1975  C  CB  . ALA A 1 248 ? 62.481  33.446  -12.760 1.00 30.83  ? 248 ALA A CB  1 
ATOM   1976  N  N   . GLN A 1 249 ? 59.655  35.496  -11.799 1.00 36.57  ? 249 GLN A N   1 
ATOM   1977  C  CA  . GLN A 1 249 ? 59.342  36.908  -11.598 1.00 43.46  ? 249 GLN A CA  1 
ATOM   1978  C  C   . GLN A 1 249 ? 59.506  37.411  -10.149 1.00 45.49  ? 249 GLN A C   1 
ATOM   1979  O  O   . GLN A 1 249 ? 59.634  38.620  -9.941  1.00 45.69  ? 249 GLN A O   1 
ATOM   1980  C  CB  . GLN A 1 249 ? 57.982  37.274  -12.194 1.00 49.33  ? 249 GLN A CB  1 
ATOM   1981  C  CG  . GLN A 1 249 ? 56.806  37.247  -11.237 1.00 56.07  ? 249 GLN A CG  1 
ATOM   1982  C  CD  . GLN A 1 249 ? 55.871  38.430  -11.470 1.00 60.19  ? 249 GLN A CD  1 
ATOM   1983  O  OE1 . GLN A 1 249 ? 55.707  38.896  -12.609 1.00 62.64  ? 249 GLN A OE1 1 
ATOM   1984  N  NE2 . GLN A 1 249 ? 55.266  38.935  -10.389 1.00 57.54  ? 249 GLN A NE2 1 
ATOM   1985  N  N   . ASP A 1 250 ? 59.528  36.490  -9.173  1.00 45.13  ? 250 ASP A N   1 
ATOM   1986  C  CA  . ASP A 1 250 ? 59.689  36.841  -7.742  1.00 46.14  ? 250 ASP A CA  1 
ATOM   1987  C  C   . ASP A 1 250 ? 61.012  36.417  -7.128  1.00 44.98  ? 250 ASP A C   1 
ATOM   1988  O  O   . ASP A 1 250 ? 61.439  36.999  -6.138  1.00 45.79  ? 250 ASP A O   1 
ATOM   1989  C  CB  . ASP A 1 250 ? 58.568  36.254  -6.890  1.00 45.18  ? 250 ASP A CB  1 
ATOM   1990  C  CG  . ASP A 1 250 ? 57.225  36.871  -7.188  1.00 50.63  ? 250 ASP A CG  1 
ATOM   1991  O  OD1 . ASP A 1 250 ? 57.153  37.843  -7.988  1.00 49.96  ? 250 ASP A OD1 1 
ATOM   1992  O  OD2 . ASP A 1 250 ? 56.234  36.380  -6.608  1.00 51.34  ? 250 ASP A OD2 1 
ATOM   1993  N  N   . ASN A 1 251 ? 61.647  35.397  -7.695  1.00 42.50  ? 251 ASN A N   1 
ATOM   1994  C  CA  . ASN A 1 251 ? 62.920  34.915  -7.156  1.00 42.54  ? 251 ASN A CA  1 
ATOM   1995  C  C   . ASN A 1 251 ? 63.809  34.253  -8.250  1.00 42.20  ? 251 ASN A C   1 
ATOM   1996  O  O   . ASN A 1 251 ? 63.460  33.200  -8.782  1.00 39.93  ? 251 ASN A O   1 
ATOM   1997  C  CB  . ASN A 1 251 ? 62.644  33.980  -5.974  1.00 38.40  ? 251 ASN A CB  1 
ATOM   1998  C  CG  . ASN A 1 251 ? 63.903  33.525  -5.287  1.00 39.60  ? 251 ASN A CG  1 
ATOM   1999  O  OD1 . ASN A 1 251 ? 64.641  34.324  -4.693  1.00 44.49  ? 251 ASN A OD1 1 
ATOM   2000  N  ND2 . ASN A 1 251 ? 64.168  32.231  -5.365  1.00 38.95  ? 251 ASN A ND2 1 
ATOM   2001  N  N   . PRO A 1 252 ? 64.949  34.887  -8.591  1.00 44.87  ? 252 PRO A N   1 
ATOM   2002  C  CA  . PRO A 1 252 ? 65.748  34.552  -9.798  1.00 42.90  ? 252 PRO A CA  1 
ATOM   2003  C  C   . PRO A 1 252 ? 66.522  33.232  -9.760  1.00 47.21  ? 252 PRO A C   1 
ATOM   2004  O  O   . PRO A 1 252 ? 67.229  32.902  -10.726 1.00 53.19  ? 252 PRO A O   1 
ATOM   2005  C  CB  . PRO A 1 252 ? 66.757  35.708  -9.878  1.00 39.75  ? 252 PRO A CB  1 
ATOM   2006  C  CG  . PRO A 1 252 ? 66.859  36.230  -8.486  1.00 41.39  ? 252 PRO A CG  1 
ATOM   2007  C  CD  . PRO A 1 252 ? 65.483  36.078  -7.893  1.00 41.35  ? 252 PRO A CD  1 
ATOM   2008  N  N   . MET A 1 253 ? 66.423  32.496  -8.658  1.00 49.35  ? 253 MET A N   1 
ATOM   2009  C  CA  . MET A 1 253 ? 67.177  31.245  -8.491  1.00 48.28  ? 253 MET A CA  1 
ATOM   2010  C  C   . MET A 1 253 ? 66.336  30.001  -8.805  1.00 43.56  ? 253 MET A C   1 
ATOM   2011  O  O   . MET A 1 253 ? 65.163  29.903  -8.445  1.00 42.16  ? 253 MET A O   1 
ATOM   2012  C  CB  . MET A 1 253 ? 67.761  31.127  -7.077  1.00 55.46  ? 253 MET A CB  1 
ATOM   2013  C  CG  . MET A 1 253 ? 68.957  32.020  -6.782  1.00 62.66  ? 253 MET A CG  1 
ATOM   2014  S  SD  . MET A 1 253 ? 68.576  33.794  -6.764  1.00 82.74  ? 253 MET A SD  1 
ATOM   2015  C  CE  . MET A 1 253 ? 67.438  33.937  -5.391  1.00 70.98  ? 253 MET A CE  1 
ATOM   2016  N  N   . ASN A 1 254 ? 66.958  29.066  -9.503  1.00 38.09  ? 254 ASN A N   1 
ATOM   2017  C  CA  . ASN A 1 254 ? 66.378  27.783  -9.754  1.00 37.52  ? 254 ASN A CA  1 
ATOM   2018  C  C   . ASN A 1 254 ? 66.060  27.025  -8.425  1.00 35.39  ? 254 ASN A C   1 
ATOM   2019  O  O   . ASN A 1 254 ? 66.824  27.095  -7.470  1.00 31.46  ? 254 ASN A O   1 
ATOM   2020  C  CB  . ASN A 1 254 ? 67.321  27.001  -10.654 1.00 35.87  ? 254 ASN A CB  1 
ATOM   2021  C  CG  . ASN A 1 254 ? 66.724  25.707  -11.109 1.00 37.13  ? 254 ASN A CG  1 
ATOM   2022  O  OD1 . ASN A 1 254 ? 66.759  24.724  -10.377 1.00 36.37  ? 254 ASN A OD1 1 
ATOM   2023  N  ND2 . ASN A 1 254 ? 66.159  25.696  -12.330 1.00 35.90  ? 254 ASN A ND2 1 
ATOM   2024  N  N   . PRO A 1 255 ? 64.901  26.350  -8.356  1.00 33.21  ? 255 PRO A N   1 
ATOM   2025  C  CA  . PRO A 1 255 ? 64.532  25.599  -7.157  1.00 31.63  ? 255 PRO A CA  1 
ATOM   2026  C  C   . PRO A 1 255 ? 65.614  24.652  -6.659  1.00 32.78  ? 255 PRO A C   1 
ATOM   2027  O  O   . PRO A 1 255 ? 65.766  24.463  -5.435  1.00 29.78  ? 255 PRO A O   1 
ATOM   2028  C  CB  . PRO A 1 255 ? 63.284  24.842  -7.602  1.00 29.32  ? 255 PRO A CB  1 
ATOM   2029  C  CG  . PRO A 1 255 ? 62.618  25.797  -8.553  1.00 28.03  ? 255 PRO A CG  1 
ATOM   2030  C  CD  . PRO A 1 255 ? 63.721  26.612  -9.204  1.00 31.90  ? 255 PRO A CD  1 
ATOM   2031  N  N   . LYS A 1 256 ? 66.385  24.085  -7.576  1.00 31.35  ? 256 LYS A N   1 
ATOM   2032  C  CA  . LYS A 1 256 ? 67.410  23.145  -7.173  1.00 33.21  ? 256 LYS A CA  1 
ATOM   2033  C  C   . LYS A 1 256 ? 68.357  23.756  -6.123  1.00 33.75  ? 256 LYS A C   1 
ATOM   2034  O  O   . LYS A 1 256 ? 68.900  23.062  -5.282  1.00 33.70  ? 256 LYS A O   1 
ATOM   2035  C  CB  . LYS A 1 256 ? 68.188  22.699  -8.403  1.00 36.99  ? 256 LYS A CB  1 
ATOM   2036  C  CG  . LYS A 1 256 ? 68.556  21.227  -8.414  1.00 39.71  ? 256 LYS A CG  1 
ATOM   2037  C  CD  . LYS A 1 256 ? 67.431  20.392  -9.013  1.00 38.54  ? 256 LYS A CD  1 
ATOM   2038  C  CE  . LYS A 1 256 ? 67.990  19.125  -9.640  1.00 37.98  ? 256 LYS A CE  1 
ATOM   2039  N  NZ  . LYS A 1 256 ? 67.436  18.944  -11.013 1.00 32.90  ? 256 LYS A NZ  1 
ATOM   2040  N  N   . LYS A 1 257 ? 68.539  25.066  -6.157  1.00 34.39  ? 257 LYS A N   1 
ATOM   2041  C  CA  . LYS A 1 257 ? 69.450  25.732  -5.214  1.00 37.01  ? 257 LYS A CA  1 
ATOM   2042  C  C   . LYS A 1 257 ? 68.932  25.681  -3.761  1.00 35.50  ? 257 LYS A C   1 
ATOM   2043  O  O   . LYS A 1 257 ? 69.689  25.809  -2.809  1.00 34.98  ? 257 LYS A O   1 
ATOM   2044  C  CB  . LYS A 1 257 ? 69.731  27.181  -5.674  1.00 37.64  ? 257 LYS A CB  1 
ATOM   2045  C  CG  . LYS A 1 257 ? 70.360  27.257  -7.075  1.00 42.54  ? 257 LYS A CG  1 
ATOM   2046  C  CD  . LYS A 1 257 ? 70.007  28.544  -7.835  1.00 45.37  ? 257 LYS A CD  1 
ATOM   2047  C  CE  . LYS A 1 257 ? 70.107  28.362  -9.357  1.00 48.50  ? 257 LYS A CE  1 
ATOM   2048  N  NZ  . LYS A 1 257 ? 69.490  29.421  -10.236 1.00 40.11  ? 257 LYS A NZ  1 
ATOM   2049  N  N   . TYR A 1 258 ? 67.629  25.484  -3.614  1.00 33.19  ? 258 TYR A N   1 
ATOM   2050  C  CA  . TYR A 1 258 ? 66.990  25.421  -2.320  1.00 30.73  ? 258 TYR A CA  1 
ATOM   2051  C  C   . TYR A 1 258 ? 66.917  24.034  -1.727  1.00 30.09  ? 258 TYR A C   1 
ATOM   2052  O  O   . TYR A 1 258 ? 66.390  23.854  -0.641  1.00 27.79  ? 258 TYR A O   1 
ATOM   2053  C  CB  . TYR A 1 258 ? 65.616  26.052  -2.412  1.00 31.88  ? 258 TYR A CB  1 
ATOM   2054  C  CG  . TYR A 1 258 ? 65.715  27.538  -2.656  1.00 32.88  ? 258 TYR A CG  1 
ATOM   2055  C  CD1 . TYR A 1 258 ? 66.016  28.407  -1.612  1.00 33.72  ? 258 TYR A CD1 1 
ATOM   2056  C  CD2 . TYR A 1 258 ? 65.564  28.070  -3.934  1.00 33.18  ? 258 TYR A CD2 1 
ATOM   2057  C  CE1 . TYR A 1 258 ? 66.145  29.774  -1.823  1.00 36.05  ? 258 TYR A CE1 1 
ATOM   2058  C  CE2 . TYR A 1 258 ? 65.669  29.442  -4.157  1.00 35.45  ? 258 TYR A CE2 1 
ATOM   2059  C  CZ  . TYR A 1 258 ? 65.954  30.296  -3.094  1.00 36.73  ? 258 TYR A CZ  1 
ATOM   2060  O  OH  . TYR A 1 258 ? 66.078  31.663  -3.287  1.00 36.92  ? 258 TYR A OH  1 
ATOM   2061  N  N   . LEU A 1 259 ? 67.467  23.049  -2.425  1.00 31.32  ? 259 LEU A N   1 
ATOM   2062  C  CA  . LEU A 1 259 ? 67.647  21.743  -1.818  1.00 32.01  ? 259 LEU A CA  1 
ATOM   2063  C  C   . LEU A 1 259 ? 68.703  21.853  -0.725  1.00 33.09  ? 259 LEU A C   1 
ATOM   2064  O  O   . LEU A 1 259 ? 69.811  22.356  -0.951  1.00 30.99  ? 259 LEU A O   1 
ATOM   2065  C  CB  . LEU A 1 259 ? 68.032  20.693  -2.852  1.00 31.18  ? 259 LEU A CB  1 
ATOM   2066  C  CG  . LEU A 1 259 ? 66.976  20.461  -3.928  1.00 30.08  ? 259 LEU A CG  1 
ATOM   2067  C  CD1 . LEU A 1 259 ? 67.586  19.629  -5.046  1.00 29.39  ? 259 LEU A CD1 1 
ATOM   2068  C  CD2 . LEU A 1 259 ? 65.747  19.798  -3.328  1.00 30.14  ? 259 LEU A CD2 1 
ATOM   2069  N  N   . GLY A 1 260 ? 68.331  21.403  0.470   1.00 32.46  ? 260 GLY A N   1 
ATOM   2070  C  CA  . GLY A 1 260 ? 69.181  21.518  1.640   1.00 30.81  ? 260 GLY A CA  1 
ATOM   2071  C  C   . GLY A 1 260 ? 68.748  22.697  2.493   1.00 31.37  ? 260 GLY A C   1 
ATOM   2072  O  O   . GLY A 1 260 ? 69.332  22.944  3.545   1.00 33.19  ? 260 GLY A O   1 
ATOM   2073  N  N   . SER A 1 261 ? 67.734  23.428  2.041   1.00 27.71  ? 261 SER A N   1 
ATOM   2074  C  CA  . SER A 1 261 ? 67.350  24.664  2.716   1.00 29.70  ? 261 SER A CA  1 
ATOM   2075  C  C   . SER A 1 261 ? 66.124  24.477  3.587   1.00 28.59  ? 261 SER A C   1 
ATOM   2076  O  O   . SER A 1 261 ? 65.646  25.442  4.204   1.00 27.73  ? 261 SER A O   1 
ATOM   2077  C  CB  . SER A 1 261 ? 67.073  25.803  1.720   1.00 30.39  ? 261 SER A CB  1 
ATOM   2078  O  OG  . SER A 1 261 ? 68.204  26.655  1.629   1.00 34.96  ? 261 SER A OG  1 
ATOM   2079  N  N   . PHE A 1 262 ? 65.595  23.256  3.590   1.00 24.20  ? 262 PHE A N   1 
ATOM   2080  C  CA  . PHE A 1 262 ? 64.401  22.980  4.346   1.00 21.59  ? 262 PHE A CA  1 
ATOM   2081  C  C   . PHE A 1 262 ? 64.326  21.532  4.709   1.00 20.65  ? 262 PHE A C   1 
ATOM   2082  O  O   . PHE A 1 262 ? 65.060  20.698  4.166   1.00 18.98  ? 262 PHE A O   1 
ATOM   2083  C  CB  . PHE A 1 262 ? 63.158  23.430  3.608   1.00 22.15  ? 262 PHE A CB  1 
ATOM   2084  C  CG  . PHE A 1 262 ? 62.933  22.744  2.292   1.00 23.15  ? 262 PHE A CG  1 
ATOM   2085  C  CD1 . PHE A 1 262 ? 62.319  21.498  2.236   1.00 21.14  ? 262 PHE A CD1 1 
ATOM   2086  C  CD2 . PHE A 1 262 ? 63.296  23.374  1.095   1.00 22.60  ? 262 PHE A CD2 1 
ATOM   2087  C  CE1 . PHE A 1 262 ? 62.117  20.878  1.012   1.00 22.52  ? 262 PHE A CE1 1 
ATOM   2088  C  CE2 . PHE A 1 262 ? 63.082  22.765  -0.130  1.00 22.82  ? 262 PHE A CE2 1 
ATOM   2089  C  CZ  . PHE A 1 262 ? 62.479  21.515  -0.172  1.00 23.01  ? 262 PHE A CZ  1 
ATOM   2090  N  N   . TYR A 1 263 ? 63.464  21.236  5.674   1.00 19.40  ? 263 TYR A N   1 
ATOM   2091  C  CA  . TYR A 1 263 ? 63.337  19.874  6.116   1.00 17.60  ? 263 TYR A CA  1 
ATOM   2092  C  C   . TYR A 1 263 ? 62.072  19.246  5.602   1.00 16.06  ? 263 TYR A C   1 
ATOM   2093  O  O   . TYR A 1 263 ? 61.125  19.947  5.271   1.00 15.06  ? 263 TYR A O   1 
ATOM   2094  C  CB  . TYR A 1 263 ? 63.318  19.868  7.618   1.00 18.29  ? 263 TYR A CB  1 
ATOM   2095  C  CG  . TYR A 1 263 ? 64.566  20.358  8.293   1.00 17.50  ? 263 TYR A CG  1 
ATOM   2096  C  CD1 . TYR A 1 263 ? 65.389  19.476  8.960   1.00 17.55  ? 263 TYR A CD1 1 
ATOM   2097  C  CD2 . TYR A 1 263 ? 64.885  21.704  8.318   1.00 18.38  ? 263 TYR A CD2 1 
ATOM   2098  C  CE1 . TYR A 1 263 ? 66.504  19.908  9.629   1.00 17.29  ? 263 TYR A CE1 1 
ATOM   2099  C  CE2 . TYR A 1 263 ? 66.000  22.154  8.998   1.00 18.08  ? 263 TYR A CE2 1 
ATOM   2100  C  CZ  . TYR A 1 263 ? 66.792  21.242  9.644   1.00 17.92  ? 263 TYR A CZ  1 
ATOM   2101  O  OH  . TYR A 1 263 ? 67.916  21.665  10.294  1.00 21.66  ? 263 TYR A OH  1 
ATOM   2102  N  N   . THR A 1 264 ? 62.037  17.920  5.564   1.00 15.55  ? 264 THR A N   1 
ATOM   2103  C  CA  . THR A 1 264 ? 60.769  17.222  5.415   1.00 15.97  ? 264 THR A CA  1 
ATOM   2104  C  C   . THR A 1 264 ? 60.729  16.094  6.429   1.00 17.66  ? 264 THR A C   1 
ATOM   2105  O  O   . THR A 1 264 ? 61.796  15.600  6.847   1.00 17.32  ? 264 THR A O   1 
ATOM   2106  C  CB  . THR A 1 264 ? 60.558  16.564  4.037   1.00 15.99  ? 264 THR A CB  1 
ATOM   2107  O  OG1 . THR A 1 264 ? 61.491  15.491  3.898   1.00 17.32  ? 264 THR A OG1 1 
ATOM   2108  C  CG2 . THR A 1 264 ? 60.682  17.550  2.865   1.00 15.45  ? 264 THR A CG2 1 
ATOM   2109  N  N   . ASP A 1 265 ? 59.513  15.675  6.815   1.00 18.66  ? 265 ASP A N   1 
ATOM   2110  C  CA  . ASP A 1 265 ? 59.356  14.470  7.612   1.00 21.36  ? 265 ASP A CA  1 
ATOM   2111  C  C   . ASP A 1 265 ? 59.649  13.263  6.709   1.00 20.54  ? 265 ASP A C   1 
ATOM   2112  O  O   . ASP A 1 265 ? 59.677  13.413  5.504   1.00 22.79  ? 265 ASP A O   1 
ATOM   2113  C  CB  . ASP A 1 265 ? 57.994  14.414  8.396   1.00 22.73  ? 265 ASP A CB  1 
ATOM   2114  C  CG  . ASP A 1 265 ? 56.814  14.011  7.529   1.00 26.79  ? 265 ASP A CG  1 
ATOM   2115  O  OD1 . ASP A 1 265 ? 57.026  13.400  6.436   1.00 29.39  ? 265 ASP A OD1 1 
ATOM   2116  O  OD2 . ASP A 1 265 ? 55.650  14.298  7.927   1.00 27.44  ? 265 ASP A OD2 1 
ATOM   2117  N  N   . ALA A 1 266 ? 59.895  12.096  7.287   1.00 19.53  ? 266 ALA A N   1 
ATOM   2118  C  CA  . ALA A 1 266 ? 60.262  10.889  6.533   1.00 19.43  ? 266 ALA A CA  1 
ATOM   2119  C  C   . ALA A 1 266 ? 59.085  9.962   6.223   1.00 19.11  ? 266 ALA A C   1 
ATOM   2120  O  O   . ALA A 1 266 ? 59.289  8.815   5.869   1.00 19.31  ? 266 ALA A O   1 
ATOM   2121  C  CB  . ALA A 1 266 ? 61.318  10.105  7.318   1.00 21.41  ? 266 ALA A CB  1 
ATOM   2122  N  N   . LEU A 1 267 ? 57.866  10.466  6.346   1.00 18.52  ? 267 LEU A N   1 
ATOM   2123  C  CA  . LEU A 1 267 ? 56.655  9.665   6.205   1.00 20.14  ? 267 LEU A CA  1 
ATOM   2124  C  C   . LEU A 1 267 ? 56.249  9.378   4.717   1.00 19.24  ? 267 LEU A C   1 
ATOM   2125  O  O   . LEU A 1 267 ? 55.397  10.074  4.151   1.00 17.37  ? 267 LEU A O   1 
ATOM   2126  C  CB  . LEU A 1 267 ? 55.508  10.349  6.998   1.00 21.02  ? 267 LEU A CB  1 
ATOM   2127  C  CG  . LEU A 1 267 ? 54.184  9.615   7.187   1.00 21.60  ? 267 LEU A CG  1 
ATOM   2128  C  CD1 . LEU A 1 267 ? 54.449  8.261   7.834   1.00 19.62  ? 267 LEU A CD1 1 
ATOM   2129  C  CD2 . LEU A 1 267 ? 53.276  10.473  8.071   1.00 21.85  ? 267 LEU A CD2 1 
ATOM   2130  N  N   . VAL A 1 268 ? 56.860  8.323   4.150   1.00 19.11  ? 268 VAL A N   1 
ATOM   2131  C  CA  . VAL A 1 268 ? 56.799  7.956   2.715   1.00 19.14  ? 268 VAL A CA  1 
ATOM   2132  C  C   . VAL A 1 268 ? 56.580  6.462   2.467   1.00 19.24  ? 268 VAL A C   1 
ATOM   2133  O  O   . VAL A 1 268 ? 56.342  6.070   1.321   1.00 18.84  ? 268 VAL A O   1 
ATOM   2134  C  CB  . VAL A 1 268 ? 58.107  8.347   1.942   1.00 20.32  ? 268 VAL A CB  1 
ATOM   2135  C  CG1 . VAL A 1 268 ? 58.303  9.874   1.908   1.00 19.95  ? 268 VAL A CG1 1 
ATOM   2136  C  CG2 . VAL A 1 268 ? 59.333  7.640   2.522   1.00 17.97  ? 268 VAL A CG2 1 
ATOM   2137  N  N   . HIS A 1 269 ? 56.695  5.638   3.518   1.00 18.59  ? 269 HIS A N   1 
ATOM   2138  C  CA  . HIS A 1 269 ? 56.268  4.211   3.498   1.00 19.74  ? 269 HIS A CA  1 
ATOM   2139  C  C   . HIS A 1 269 ? 57.144  3.216   2.796   1.00 20.38  ? 269 HIS A C   1 
ATOM   2140  O  O   . HIS A 1 269 ? 57.295  2.099   3.278   1.00 22.63  ? 269 HIS A O   1 
ATOM   2141  C  CB  . HIS A 1 269 ? 54.820  4.027   3.046   1.00 18.15  ? 269 HIS A CB  1 
ATOM   2142  C  CG  . HIS A 1 269 ? 53.852  4.851   3.813   1.00 19.08  ? 269 HIS A CG  1 
ATOM   2143  N  ND1 . HIS A 1 269 ? 53.561  6.127   3.475   1.00 19.30  ? 269 HIS A ND1 1 
ATOM   2144  C  CD2 . HIS A 1 269 ? 53.121  4.567   4.971   1.00 18.20  ? 269 HIS A CD2 1 
ATOM   2145  C  CE1 . HIS A 1 269 ? 52.674  6.624   4.362   1.00 18.54  ? 269 HIS A CE1 1 
ATOM   2146  N  NE2 . HIS A 1 269 ? 52.408  5.664   5.267   1.00 17.81  ? 269 HIS A NE2 1 
ATOM   2147  N  N   . ASP A 1 270 ? 57.758  3.578   1.685   1.00 20.11  ? 270 ASP A N   1 
ATOM   2148  C  CA  . ASP A 1 270 ? 58.634  2.598   1.000   1.00 21.24  ? 270 ASP A CA  1 
ATOM   2149  C  C   . ASP A 1 270 ? 60.138  2.913   1.101   1.00 18.23  ? 270 ASP A C   1 
ATOM   2150  O  O   . ASP A 1 270 ? 60.519  4.057   1.150   1.00 17.54  ? 270 ASP A O   1 
ATOM   2151  C  CB  . ASP A 1 270 ? 58.153  2.422   -0.452  1.00 24.74  ? 270 ASP A CB  1 
ATOM   2152  C  CG  . ASP A 1 270 ? 56.774  1.686   -0.533  1.00 32.54  ? 270 ASP A CG  1 
ATOM   2153  O  OD1 . ASP A 1 270 ? 56.222  1.275   0.560   1.00 32.12  ? 270 ASP A OD1 1 
ATOM   2154  O  OD2 . ASP A 1 270 ? 56.238  1.511   -1.689  1.00 33.74  ? 270 ASP A OD2 1 
ATOM   2155  N  N   . PRO A 1 271 ? 61.001  1.895   1.143   1.00 18.86  ? 271 PRO A N   1 
ATOM   2156  C  CA  . PRO A 1 271 ? 62.467  2.167   1.147   1.00 18.35  ? 271 PRO A CA  1 
ATOM   2157  C  C   . PRO A 1 271 ? 62.970  2.972   -0.062  1.00 17.61  ? 271 PRO A C   1 
ATOM   2158  O  O   . PRO A 1 271 ? 63.725  3.945   0.088   1.00 18.04  ? 271 PRO A O   1 
ATOM   2159  C  CB  . PRO A 1 271 ? 63.101  0.770   1.171   1.00 18.34  ? 271 PRO A CB  1 
ATOM   2160  C  CG  . PRO A 1 271 ? 61.965  -0.206  0.986   1.00 18.69  ? 271 PRO A CG  1 
ATOM   2161  C  CD  . PRO A 1 271 ? 60.708  0.467   1.407   1.00 19.03  ? 271 PRO A CD  1 
ATOM   2162  N  N   . LEU A 1 272 ? 62.506  2.624   -1.249  1.00 17.33  ? 272 LEU A N   1 
ATOM   2163  C  CA  . LEU A 1 272 ? 62.930  3.331   -2.437  1.00 16.06  ? 272 LEU A CA  1 
ATOM   2164  C  C   . LEU A 1 272 ? 62.591  4.812   -2.366  1.00 15.24  ? 272 LEU A C   1 
ATOM   2165  O  O   . LEU A 1 272 ? 63.415  5.621   -2.754  1.00 13.87  ? 272 LEU A O   1 
ATOM   2166  C  CB  . LEU A 1 272 ? 62.341  2.671   -3.679  1.00 18.04  ? 272 LEU A CB  1 
ATOM   2167  C  CG  . LEU A 1 272 ? 62.758  1.198   -3.814  1.00 19.23  ? 272 LEU A CG  1 
ATOM   2168  C  CD1 . LEU A 1 272 ? 62.002  0.556   -4.961  1.00 17.64  ? 272 LEU A CD1 1 
ATOM   2169  C  CD2 . LEU A 1 272 ? 64.281  1.036   -3.991  1.00 20.45  ? 272 LEU A CD2 1 
ATOM   2170  N  N   . SER A 1 273 ? 61.406  5.161   -1.827  1.00 14.69  ? 273 SER A N   1 
ATOM   2171  C  CA  . SER A 1 273 ? 61.003  6.561   -1.654  1.00 14.11  ? 273 SER A CA  1 
ATOM   2172  C  C   . SER A 1 273 ? 61.816  7.295   -0.619  1.00 13.20  ? 273 SER A C   1 
ATOM   2173  O  O   . SER A 1 273 ? 62.228  8.402   -0.835  1.00 12.96  ? 273 SER A O   1 
ATOM   2174  C  CB  . SER A 1 273 ? 59.535  6.703   -1.269  1.00 15.41  ? 273 SER A CB  1 
ATOM   2175  O  OG  . SER A 1 273 ? 58.706  6.104   -2.223  1.00 16.37  ? 273 SER A OG  1 
ATOM   2176  N  N   . LEU A 1 274 ? 62.026  6.668   0.514   1.00 13.67  ? 274 LEU A N   1 
ATOM   2177  C  CA  . LEU A 1 274 ? 62.939  7.170   1.505   1.00 14.13  ? 274 LEU A CA  1 
ATOM   2178  C  C   . LEU A 1 274 ? 64.330  7.409   0.920   1.00 14.43  ? 274 LEU A C   1 
ATOM   2179  O  O   . LEU A 1 274 ? 64.906  8.450   1.164   1.00 13.94  ? 274 LEU A O   1 
ATOM   2180  C  CB  . LEU A 1 274 ? 63.053  6.147   2.638   1.00 14.25  ? 274 LEU A CB  1 
ATOM   2181  C  CG  . LEU A 1 274 ? 63.770  6.634   3.918   1.00 13.95  ? 274 LEU A CG  1 
ATOM   2182  C  CD1 . LEU A 1 274 ? 63.178  7.924   4.507   1.00 13.96  ? 274 LEU A CD1 1 
ATOM   2183  C  CD2 . LEU A 1 274 ? 63.826  5.532   4.945   1.00 13.33  ? 274 LEU A CD2 1 
ATOM   2184  N  N   . LYS A 1 275 ? 64.864  6.450   0.148   1.00 15.61  ? 275 LYS A N   1 
ATOM   2185  C  CA  . LYS A 1 275 ? 66.232  6.594   -0.375  1.00 17.43  ? 275 LYS A CA  1 
ATOM   2186  C  C   . LYS A 1 275 ? 66.317  7.811   -1.295  1.00 18.25  ? 275 LYS A C   1 
ATOM   2187  O  O   . LYS A 1 275 ? 67.253  8.591   -1.207  1.00 20.83  ? 275 LYS A O   1 
ATOM   2188  C  CB  . LYS A 1 275 ? 66.716  5.320   -1.096  1.00 19.11  ? 275 LYS A CB  1 
ATOM   2189  C  CG  . LYS A 1 275 ? 68.208  5.307   -1.466  1.00 19.32  ? 275 LYS A CG  1 
ATOM   2190  C  CD  . LYS A 1 275 ? 69.133  5.741   -0.310  1.00 21.20  ? 275 LYS A CD  1 
ATOM   2191  C  CE  . LYS A 1 275 ? 70.619  5.596   -0.687  1.00 21.21  ? 275 LYS A CE  1 
ATOM   2192  N  NZ  . LYS A 1 275 ? 70.892  6.135   -2.060  1.00 21.40  ? 275 LYS A NZ  1 
ATOM   2193  N  N   . LEU A 1 276 ? 65.303  8.005   -2.122  1.00 17.13  ? 276 LEU A N   1 
ATOM   2194  C  CA  . LEU A 1 276 ? 65.227  9.167   -2.951  1.00 18.01  ? 276 LEU A CA  1 
ATOM   2195  C  C   . LEU A 1 276 ? 65.114  10.469  -2.187  1.00 18.51  ? 276 LEU A C   1 
ATOM   2196  O  O   . LEU A 1 276 ? 65.751  11.463  -2.525  1.00 18.34  ? 276 LEU A O   1 
ATOM   2197  C  CB  . LEU A 1 276 ? 64.006  9.026   -3.850  1.00 19.51  ? 276 LEU A CB  1 
ATOM   2198  C  CG  . LEU A 1 276 ? 63.939  10.089  -4.940  1.00 19.83  ? 276 LEU A CG  1 
ATOM   2199  C  CD1 . LEU A 1 276 ? 65.090  9.869   -5.902  1.00 21.31  ? 276 LEU A CD1 1 
ATOM   2200  C  CD2 . LEU A 1 276 ? 62.638  10.001  -5.686  1.00 19.26  ? 276 LEU A CD2 1 
ATOM   2201  N  N   . LEU A 1 277 ? 64.237  10.484  -1.189  1.00 19.05  ? 277 LEU A N   1 
ATOM   2202  C  CA  . LEU A 1 277 ? 64.064  11.646  -0.314  1.00 17.79  ? 277 LEU A CA  1 
ATOM   2203  C  C   . LEU A 1 277 ? 65.375  12.099  0.272   1.00 17.41  ? 277 LEU A C   1 
ATOM   2204  O  O   . LEU A 1 277 ? 65.676  13.277  0.230   1.00 18.89  ? 277 LEU A O   1 
ATOM   2205  C  CB  . LEU A 1 277 ? 63.033  11.335  0.765   1.00 16.92  ? 277 LEU A CB  1 
ATOM   2206  C  CG  . LEU A 1 277 ? 62.535  12.422  1.703   1.00 17.58  ? 277 LEU A CG  1 
ATOM   2207  C  CD1 . LEU A 1 277 ? 61.877  13.575  0.968   1.00 17.42  ? 277 LEU A CD1 1 
ATOM   2208  C  CD2 . LEU A 1 277 ? 61.562  11.798  2.697   1.00 17.15  ? 277 LEU A CD2 1 
ATOM   2209  N  N   . THR A 1 278 ? 66.204  11.196  0.766   1.00 18.04  ? 278 THR A N   1 
ATOM   2210  C  CA  . THR A 1 278 ? 67.459  11.696  1.361   1.00 20.93  ? 278 THR A CA  1 
ATOM   2211  C  C   . THR A 1 278 ? 68.566  11.965  0.328   1.00 23.84  ? 278 THR A C   1 
ATOM   2212  O  O   . THR A 1 278 ? 69.515  12.720  0.638   1.00 24.36  ? 278 THR A O   1 
ATOM   2213  C  CB  . THR A 1 278 ? 68.023  10.775  2.447   1.00 21.39  ? 278 THR A CB  1 
ATOM   2214  O  OG1 . THR A 1 278 ? 68.448  9.572   1.824   1.00 22.13  ? 278 THR A OG1 1 
ATOM   2215  C  CG2 . THR A 1 278 ? 66.947  10.436  3.579   1.00 20.27  ? 278 THR A CG2 1 
ATOM   2216  N  N   . ASP A 1 279 ? 68.458  11.363  -0.874  1.00 23.30  ? 279 ASP A N   1 
ATOM   2217  C  CA  . ASP A 1 279 ? 69.353  11.710  -1.988  1.00 24.55  ? 279 ASP A CA  1 
ATOM   2218  C  C   . ASP A 1 279 ? 69.086  13.139  -2.422  1.00 23.81  ? 279 ASP A C   1 
ATOM   2219  O  O   . ASP A 1 279 ? 70.016  13.879  -2.742  1.00 23.35  ? 279 ASP A O   1 
ATOM   2220  C  CB  . ASP A 1 279 ? 69.168  10.799  -3.221  1.00 27.48  ? 279 ASP A CB  1 
ATOM   2221  C  CG  . ASP A 1 279 ? 69.571  9.327   -2.974  1.00 29.87  ? 279 ASP A CG  1 
ATOM   2222  O  OD1 . ASP A 1 279 ? 70.057  8.974   -1.857  1.00 34.01  ? 279 ASP A OD1 1 
ATOM   2223  O  OD2 . ASP A 1 279 ? 69.370  8.504   -3.908  1.00 29.69  ? 279 ASP A OD2 1 
ATOM   2224  N  N   . VAL A 1 280 ? 67.810  13.514  -2.420  1.00 22.40  ? 280 VAL A N   1 
ATOM   2225  C  CA  . VAL A 1 280 ? 67.370  14.799  -2.948  1.00 22.45  ? 280 VAL A CA  1 
ATOM   2226  C  C   . VAL A 1 280 ? 67.378  15.918  -1.903  1.00 22.83  ? 280 VAL A C   1 
ATOM   2227  O  O   . VAL A 1 280 ? 67.818  17.000  -2.192  1.00 23.74  ? 280 VAL A O   1 
ATOM   2228  C  CB  . VAL A 1 280 ? 65.976  14.692  -3.599  1.00 21.62  ? 280 VAL A CB  1 
ATOM   2229  C  CG1 . VAL A 1 280 ? 65.445  16.062  -4.024  1.00 22.32  ? 280 VAL A CG1 1 
ATOM   2230  C  CG2 . VAL A 1 280 ? 66.037  13.798  -4.809  1.00 20.56  ? 280 VAL A CG2 1 
ATOM   2231  N  N   . ILE A 1 281 ? 66.894  15.647  -0.701  1.00 24.01  ? 281 ILE A N   1 
ATOM   2232  C  CA  . ILE A 1 281 ? 66.758  16.662  0.356   1.00 23.87  ? 281 ILE A CA  1 
ATOM   2233  C  C   . ILE A 1 281 ? 68.007  16.629  1.235   1.00 24.39  ? 281 ILE A C   1 
ATOM   2234  O  O   . ILE A 1 281 ? 68.373  17.644  1.824   1.00 24.96  ? 281 ILE A O   1 
ATOM   2235  C  CB  . ILE A 1 281 ? 65.469  16.383  1.192   1.00 23.68  ? 281 ILE A CB  1 
ATOM   2236  C  CG1 . ILE A 1 281 ? 64.225  16.383  0.277   1.00 22.15  ? 281 ILE A CG1 1 
ATOM   2237  C  CG2 . ILE A 1 281 ? 65.283  17.319  2.394   1.00 22.98  ? 281 ILE A CG2 1 
ATOM   2238  C  CD1 . ILE A 1 281 ? 63.740  17.733  -0.184  1.00 21.64  ? 281 ILE A CD1 1 
ATOM   2239  N  N   . GLY A 1 282 ? 68.666  15.476  1.314   1.00 22.80  ? 282 GLY A N   1 
ATOM   2240  C  CA  . GLY A 1 282 ? 69.860  15.360  2.116   1.00 24.30  ? 282 GLY A CA  1 
ATOM   2241  C  C   . GLY A 1 282 ? 69.615  14.608  3.406   1.00 26.08  ? 282 GLY A C   1 
ATOM   2242  O  O   . GLY A 1 282 ? 68.529  14.713  3.998   1.00 25.32  ? 282 GLY A O   1 
ATOM   2243  N  N   . LYS A 1 283 ? 70.632  13.861  3.841   1.00 26.54  ? 283 LYS A N   1 
ATOM   2244  C  CA  . LYS A 1 283 ? 70.586  13.064  5.062   1.00 28.05  ? 283 LYS A CA  1 
ATOM   2245  C  C   . LYS A 1 283 ? 70.414  13.917  6.335   1.00 27.79  ? 283 LYS A C   1 
ATOM   2246  O  O   . LYS A 1 283 ? 70.036  13.394  7.377   1.00 25.26  ? 283 LYS A O   1 
ATOM   2247  C  CB  . LYS A 1 283 ? 71.866  12.239  5.210   1.00 30.38  ? 283 LYS A CB  1 
ATOM   2248  C  CG  . LYS A 1 283 ? 72.100  11.210  4.123   1.00 34.85  ? 283 LYS A CG  1 
ATOM   2249  C  CD  . LYS A 1 283 ? 73.494  10.623  4.317   1.00 38.20  ? 283 LYS A CD  1 
ATOM   2250  C  CE  . LYS A 1 283 ? 73.537  9.112   4.110   1.00 39.73  ? 283 LYS A CE  1 
ATOM   2251  N  NZ  . LYS A 1 283 ? 72.902  8.628   2.848   1.00 43.17  ? 283 LYS A NZ  1 
ATOM   2252  N  N   . ASP A 1 284 ? 70.706  15.211  6.241   1.00 28.54  ? 284 ASP A N   1 
ATOM   2253  C  CA  . ASP A 1 284 ? 70.691  16.093  7.407   1.00 32.17  ? 284 ASP A CA  1 
ATOM   2254  C  C   . ASP A 1 284 ? 69.366  16.878  7.569   1.00 31.23  ? 284 ASP A C   1 
ATOM   2255  O  O   . ASP A 1 284 ? 69.207  17.670  8.508   1.00 31.55  ? 284 ASP A O   1 
ATOM   2256  C  CB  . ASP A 1 284 ? 71.935  17.005  7.396   1.00 34.76  ? 284 ASP A CB  1 
ATOM   2257  C  CG  . ASP A 1 284 ? 73.252  16.203  7.621   1.00 41.11  ? 284 ASP A CG  1 
ATOM   2258  O  OD1 . ASP A 1 284 ? 73.411  15.629  8.739   1.00 41.70  ? 284 ASP A OD1 1 
ATOM   2259  O  OD2 . ASP A 1 284 ? 74.116  16.128  6.689   1.00 40.93  ? 284 ASP A OD2 1 
ATOM   2260  N  N   . LYS A 1 285 ? 68.412  16.579  6.689   1.00 26.53  ? 285 LYS A N   1 
ATOM   2261  C  CA  . LYS A 1 285 ? 67.205  17.366  6.516   1.00 24.41  ? 285 LYS A CA  1 
ATOM   2262  C  C   . LYS A 1 285 ? 65.876  16.542  6.518   1.00 21.75  ? 285 LYS A C   1 
ATOM   2263  O  O   . LYS A 1 285 ? 64.797  17.110  6.421   1.00 23.26  ? 285 LYS A O   1 
ATOM   2264  C  CB  . LYS A 1 285 ? 67.367  18.164  5.216   1.00 24.90  ? 285 LYS A CB  1 
ATOM   2265  C  CG  . LYS A 1 285 ? 68.428  19.249  5.328   1.00 25.10  ? 285 LYS A CG  1 
ATOM   2266  C  CD  . LYS A 1 285 ? 67.793  20.624  5.600   1.00 25.58  ? 285 LYS A CD  1 
ATOM   2267  C  CE  . LYS A 1 285 ? 68.522  21.412  6.668   1.00 23.70  ? 285 LYS A CE  1 
ATOM   2268  N  NZ  . LYS A 1 285 ? 69.931  21.722  6.306   1.00 24.56  ? 285 LYS A NZ  1 
ATOM   2269  N  N   . VAL A 1 286 ? 65.972  15.224  6.635   1.00 19.21  ? 286 VAL A N   1 
ATOM   2270  C  CA  . VAL A 1 286 ? 64.823  14.313  6.765   1.00 18.16  ? 286 VAL A CA  1 
ATOM   2271  C  C   . VAL A 1 286 ? 64.617  13.959  8.242   1.00 17.97  ? 286 VAL A C   1 
ATOM   2272  O  O   . VAL A 1 286 ? 65.562  13.545  8.910   1.00 18.05  ? 286 VAL A O   1 
ATOM   2273  C  CB  . VAL A 1 286 ? 65.031  12.999  5.976   1.00 16.65  ? 286 VAL A CB  1 
ATOM   2274  C  CG1 . VAL A 1 286 ? 63.917  12.019  6.249   1.00 16.19  ? 286 VAL A CG1 1 
ATOM   2275  C  CG2 . VAL A 1 286 ? 65.103  13.268  4.480   1.00 17.94  ? 286 VAL A CG2 1 
ATOM   2276  N  N   . ILE A 1 287 ? 63.392  14.129  8.744   1.00 17.40  ? 287 ILE A N   1 
ATOM   2277  C  CA  . ILE A 1 287 ? 63.063  13.879  10.159  1.00 16.24  ? 287 ILE A CA  1 
ATOM   2278  C  C   . ILE A 1 287 ? 62.014  12.750  10.306  1.00 15.81  ? 287 ILE A C   1 
ATOM   2279  O  O   . ILE A 1 287 ? 61.014  12.725  9.609   1.00 15.70  ? 287 ILE A O   1 
ATOM   2280  C  CB  . ILE A 1 287 ? 62.513  15.168  10.819  1.00 16.09  ? 287 ILE A CB  1 
ATOM   2281  C  CG1 . ILE A 1 287 ? 63.459  16.357  10.607  1.00 16.21  ? 287 ILE A CG1 1 
ATOM   2282  C  CG2 . ILE A 1 287 ? 62.250  14.967  12.314  1.00 15.46  ? 287 ILE A CG2 1 
ATOM   2283  C  CD1 . ILE A 1 287 ? 62.790  17.697  10.887  1.00 15.82  ? 287 ILE A CD1 1 
ATOM   2284  N  N   . LEU A 1 288 ? 62.230  11.828  11.223  1.00 15.84  ? 288 LEU A N   1 
ATOM   2285  C  CA  . LEU A 1 288 ? 61.243  10.812  11.518  1.00 16.72  ? 288 LEU A CA  1 
ATOM   2286  C  C   . LEU A 1 288 ? 59.909  11.411  11.963  1.00 18.32  ? 288 LEU A C   1 
ATOM   2287  O  O   . LEU A 1 288 ? 59.810  12.170  12.939  1.00 18.85  ? 288 LEU A O   1 
ATOM   2288  C  CB  . LEU A 1 288 ? 61.757  9.819   12.542  1.00 16.22  ? 288 LEU A CB  1 
ATOM   2289  C  CG  . LEU A 1 288 ? 60.756  8.862   13.223  1.00 19.24  ? 288 LEU A CG  1 
ATOM   2290  C  CD1 . LEU A 1 288 ? 60.048  7.917   12.247  1.00 19.53  ? 288 LEU A CD1 1 
ATOM   2291  C  CD2 . LEU A 1 288 ? 61.493  8.048   14.277  1.00 18.39  ? 288 LEU A CD2 1 
ATOM   2292  N  N   . GLY A 1 289 ? 58.885  11.061  11.201  1.00 19.46  ? 289 GLY A N   1 
ATOM   2293  C  CA  . GLY A 1 289 ? 57.550  11.565  11.407  1.00 20.03  ? 289 GLY A CA  1 
ATOM   2294  C  C   . GLY A 1 289 ? 56.659  10.369  11.206  1.00 21.17  ? 289 GLY A C   1 
ATOM   2295  O  O   . GLY A 1 289 ? 56.964  9.486   10.393  1.00 22.19  ? 289 GLY A O   1 
ATOM   2296  N  N   . THR A 1 290 ? 55.535  10.376  11.901  1.00 20.51  ? 290 THR A N   1 
ATOM   2297  C  CA  . THR A 1 290 ? 54.719  9.207   12.064  1.00 20.65  ? 290 THR A CA  1 
ATOM   2298  C  C   . THR A 1 290 ? 53.234  9.447   11.839  1.00 18.36  ? 290 THR A C   1 
ATOM   2299  O  O   . THR A 1 290 ? 52.519  8.499   11.528  1.00 17.35  ? 290 THR A O   1 
ATOM   2300  C  CB  . THR A 1 290 ? 54.916  8.713   13.513  1.00 23.81  ? 290 THR A CB  1 
ATOM   2301  O  OG1 . THR A 1 290 ? 56.127  7.946   13.619  1.00 26.07  ? 290 THR A OG1 1 
ATOM   2302  C  CG2 . THR A 1 290 ? 53.745  7.984   14.032  1.00 22.53  ? 290 THR A CG2 1 
ATOM   2303  N  N   . ASP A 1 291 ? 52.744  10.667  12.072  1.00 16.72  ? 291 ASP A N   1 
ATOM   2304  C  CA  . ASP A 1 291 ? 51.306  10.932  11.972  1.00 16.50  ? 291 ASP A CA  1 
ATOM   2305  C  C   . ASP A 1 291 ? 50.431  10.155  12.985  1.00 15.11  ? 291 ASP A C   1 
ATOM   2306  O  O   . ASP A 1 291 ? 49.237  9.953   12.811  1.00 15.07  ? 291 ASP A O   1 
ATOM   2307  C  CB  . ASP A 1 291 ? 50.839  10.699  10.532  1.00 19.35  ? 291 ASP A CB  1 
ATOM   2308  C  CG  . ASP A 1 291 ? 49.493  11.366  10.210  1.00 23.52  ? 291 ASP A CG  1 
ATOM   2309  O  OD1 . ASP A 1 291 ? 49.233  12.503  10.687  1.00 26.05  ? 291 ASP A OD1 1 
ATOM   2310  O  OD2 . ASP A 1 291 ? 48.672  10.743  9.468   1.00 28.02  ? 291 ASP A OD2 1 
ATOM   2311  N  N   . TYR A 1 292 ? 51.034  9.729   14.069  1.00 15.42  ? 292 TYR A N   1 
ATOM   2312  C  CA  . TYR A 1 292 ? 50.323  9.180   15.197  1.00 15.77  ? 292 TYR A CA  1 
ATOM   2313  C  C   . TYR A 1 292 ? 49.287  10.200  15.680  1.00 15.23  ? 292 TYR A C   1 
ATOM   2314  O  O   . TYR A 1 292 ? 49.537  11.382  15.647  1.00 13.67  ? 292 TYR A O   1 
ATOM   2315  C  CB  . TYR A 1 292 ? 51.333  8.909   16.271  1.00 16.56  ? 292 TYR A CB  1 
ATOM   2316  C  CG  . TYR A 1 292 ? 50.810  8.327   17.553  1.00 17.73  ? 292 TYR A CG  1 
ATOM   2317  C  CD1 . TYR A 1 292 ? 50.886  6.961   17.798  1.00 17.68  ? 292 TYR A CD1 1 
ATOM   2318  C  CD2 . TYR A 1 292 ? 50.302  9.152   18.556  1.00 17.73  ? 292 TYR A CD2 1 
ATOM   2319  C  CE1 . TYR A 1 292 ? 50.453  6.432   18.993  1.00 17.87  ? 292 TYR A CE1 1 
ATOM   2320  C  CE2 . TYR A 1 292 ? 49.884  8.630   19.749  1.00 16.89  ? 292 TYR A CE2 1 
ATOM   2321  C  CZ  . TYR A 1 292 ? 49.962  7.280   19.960  1.00 17.36  ? 292 TYR A CZ  1 
ATOM   2322  O  OH  . TYR A 1 292 ? 49.538  6.776   21.153  1.00 19.44  ? 292 TYR A OH  1 
ATOM   2323  N  N   . PRO A 1 293 ? 48.105  9.726   16.102  1.00 15.73  ? 293 PRO A N   1 
ATOM   2324  C  CA  . PRO A 1 293 ? 47.728  8.311   16.105  1.00 16.14  ? 293 PRO A CA  1 
ATOM   2325  C  C   . PRO A 1 293 ? 46.875  7.902   14.913  1.00 16.88  ? 293 PRO A C   1 
ATOM   2326  O  O   . PRO A 1 293 ? 46.136  6.957   15.062  1.00 16.83  ? 293 PRO A O   1 
ATOM   2327  C  CB  . PRO A 1 293 ? 46.848  8.202   17.335  1.00 15.59  ? 293 PRO A CB  1 
ATOM   2328  C  CG  . PRO A 1 293 ? 46.143  9.523   17.370  1.00 15.78  ? 293 PRO A CG  1 
ATOM   2329  C  CD  . PRO A 1 293 ? 47.036  10.562  16.678  1.00 15.21  ? 293 PRO A CD  1 
ATOM   2330  N  N   . PHE A 1 294 ? 46.946  8.602   13.774  1.00 18.01  ? 294 PHE A N   1 
ATOM   2331  C  CA  . PHE A 1 294 ? 46.065  8.281   12.624  1.00 20.61  ? 294 PHE A CA  1 
ATOM   2332  C  C   . PHE A 1 294 ? 46.515  7.079   11.795  1.00 20.70  ? 294 PHE A C   1 
ATOM   2333  O  O   . PHE A 1 294 ? 47.699  6.765   11.704  1.00 18.90  ? 294 PHE A O   1 
ATOM   2334  C  CB  . PHE A 1 294 ? 45.725  9.519   11.762  1.00 21.49  ? 294 PHE A CB  1 
ATOM   2335  C  CG  . PHE A 1 294 ? 45.126  10.643  12.567  1.00 24.45  ? 294 PHE A CG  1 
ATOM   2336  C  CD1 . PHE A 1 294 ? 45.671  11.937  12.526  1.00 26.11  ? 294 PHE A CD1 1 
ATOM   2337  C  CD2 . PHE A 1 294 ? 44.069  10.405  13.428  1.00 24.94  ? 294 PHE A CD2 1 
ATOM   2338  C  CE1 . PHE A 1 294 ? 45.136  12.967  13.308  1.00 26.02  ? 294 PHE A CE1 1 
ATOM   2339  C  CE2 . PHE A 1 294 ? 43.533  11.435  14.211  1.00 26.84  ? 294 PHE A CE2 1 
ATOM   2340  C  CZ  . PHE A 1 294 ? 44.064  12.718  14.150  1.00 24.55  ? 294 PHE A CZ  1 
ATOM   2341  N  N   . PRO A 1 295 ? 45.550  6.387   11.190  1.00 24.59  ? 295 PRO A N   1 
ATOM   2342  C  CA  . PRO A 1 295 ? 45.932  5.076   10.626  1.00 24.89  ? 295 PRO A CA  1 
ATOM   2343  C  C   . PRO A 1 295 ? 46.804  5.176   9.367   1.00 25.35  ? 295 PRO A C   1 
ATOM   2344  O  O   . PRO A 1 295 ? 47.470  4.199   9.001   1.00 26.41  ? 295 PRO A O   1 
ATOM   2345  C  CB  . PRO A 1 295 ? 44.586  4.387   10.370  1.00 24.64  ? 295 PRO A CB  1 
ATOM   2346  C  CG  . PRO A 1 295 ? 43.528  5.456   10.512  1.00 25.78  ? 295 PRO A CG  1 
ATOM   2347  C  CD  . PRO A 1 295 ? 44.166  6.774   10.845  1.00 24.56  ? 295 PRO A CD  1 
ATOM   2348  N  N   . LEU A 1 296 ? 46.863  6.358   8.755   1.00 26.48  ? 296 LEU A N   1 
ATOM   2349  C  CA  . LEU A 1 296 ? 47.747  6.565   7.599   1.00 26.85  ? 296 LEU A CA  1 
ATOM   2350  C  C   . LEU A 1 296 ? 49.238  6.684   7.994   1.00 27.39  ? 296 LEU A C   1 
ATOM   2351  O  O   . LEU A 1 296 ? 50.115  6.713   7.134   1.00 26.66  ? 296 LEU A O   1 
ATOM   2352  C  CB  . LEU A 1 296 ? 47.354  7.818   6.856   1.00 25.55  ? 296 LEU A CB  1 
ATOM   2353  C  CG  . LEU A 1 296 ? 47.067  7.754   5.368   1.00 26.66  ? 296 LEU A CG  1 
ATOM   2354  C  CD1 . LEU A 1 296 ? 47.103  9.171   4.807   1.00 24.64  ? 296 LEU A CD1 1 
ATOM   2355  C  CD2 . LEU A 1 296 ? 47.955  6.781   4.563   1.00 29.44  ? 296 LEU A CD2 1 
ATOM   2356  N  N   . GLY A 1 297 ? 49.523  6.721   9.289   1.00 25.41  ? 297 GLY A N   1 
ATOM   2357  C  CA  . GLY A 1 297 ? 50.865  6.948   9.723   1.00 26.28  ? 297 GLY A CA  1 
ATOM   2358  C  C   . GLY A 1 297 ? 51.707  5.694   9.745   1.00 27.48  ? 297 GLY A C   1 
ATOM   2359  O  O   . GLY A 1 297 ? 51.276  4.640   9.311   1.00 27.58  ? 297 GLY A O   1 
ATOM   2360  N  N   . GLU A 1 298 ? 52.935  5.825   10.229  1.00 28.25  ? 298 GLU A N   1 
ATOM   2361  C  CA  . GLU A 1 298 ? 53.764  4.669   10.443  1.00 31.93  ? 298 GLU A CA  1 
ATOM   2362  C  C   . GLU A 1 298 ? 53.347  3.958   11.752  1.00 32.16  ? 298 GLU A C   1 
ATOM   2363  O  O   . GLU A 1 298 ? 53.303  4.562   12.828  1.00 32.94  ? 298 GLU A O   1 
ATOM   2364  C  CB  . GLU A 1 298 ? 55.253  5.041   10.412  1.00 32.58  ? 298 GLU A CB  1 
ATOM   2365  C  CG  . GLU A 1 298 ? 56.165  3.826   10.465  1.00 31.88  ? 298 GLU A CG  1 
ATOM   2366  C  CD  . GLU A 1 298 ? 57.651  4.170   10.490  1.00 36.30  ? 298 GLU A CD  1 
ATOM   2367  O  OE1 . GLU A 1 298 ? 58.057  5.104   11.244  1.00 36.19  ? 298 GLU A OE1 1 
ATOM   2368  O  OE2 . GLU A 1 298 ? 58.427  3.486   9.769   1.00 36.31  ? 298 GLU A OE2 1 
ATOM   2369  N  N   . LEU A 1 299 ? 53.039  2.676   11.625  1.00 32.72  ? 299 LEU A N   1 
ATOM   2370  C  CA  . LEU A 1 299 ? 52.529  1.871   12.720  1.00 34.52  ? 299 LEU A CA  1 
ATOM   2371  C  C   . LEU A 1 299 ? 53.674  1.441   13.616  1.00 33.99  ? 299 LEU A C   1 
ATOM   2372  O  O   . LEU A 1 299 ? 53.547  1.488   14.846  1.00 32.73  ? 299 LEU A O   1 
ATOM   2373  C  CB  . LEU A 1 299 ? 51.742  0.667   12.174  1.00 38.47  ? 299 LEU A CB  1 
ATOM   2374  C  CG  . LEU A 1 299 ? 50.944  0.941   10.869  1.00 43.85  ? 299 LEU A CG  1 
ATOM   2375  C  CD1 . LEU A 1 299 ? 50.513  -0.354  10.170  1.00 44.49  ? 299 LEU A CD1 1 
ATOM   2376  C  CD2 . LEU A 1 299 ? 49.759  1.918   11.065  1.00 43.76  ? 299 LEU A CD2 1 
ATOM   2377  N  N   . GLU A 1 300 ? 54.798  1.043   13.012  1.00 32.32  ? 300 GLU A N   1 
ATOM   2378  C  CA  . GLU A 1 300 ? 56.004  0.806   13.792  1.00 30.85  ? 300 GLU A CA  1 
ATOM   2379  C  C   . GLU A 1 300 ? 57.006  1.911   13.498  1.00 28.05  ? 300 GLU A C   1 
ATOM   2380  O  O   . GLU A 1 300 ? 57.770  1.812   12.548  1.00 30.28  ? 300 GLU A O   1 
ATOM   2381  C  CB  . GLU A 1 300 ? 56.628  -0.566  13.511  1.00 34.44  ? 300 GLU A CB  1 
ATOM   2382  C  CG  . GLU A 1 300 ? 55.666  -1.719  13.264  1.00 38.86  ? 300 GLU A CG  1 
ATOM   2383  C  CD  . GLU A 1 300 ? 54.694  -1.971  14.413  1.00 43.82  ? 300 GLU A CD  1 
ATOM   2384  O  OE1 . GLU A 1 300 ? 55.043  -1.719  15.603  1.00 48.31  ? 300 GLU A OE1 1 
ATOM   2385  O  OE2 . GLU A 1 300 ? 53.572  -2.450  14.122  1.00 45.93  ? 300 GLU A OE2 1 
ATOM   2386  N  N   . PRO A 1 301 ? 57.006  2.970   14.314  1.00 25.18  ? 301 PRO A N   1 
ATOM   2387  C  CA  . PRO A 1 301 ? 57.862  4.114   14.035  1.00 24.88  ? 301 PRO A CA  1 
ATOM   2388  C  C   . PRO A 1 301 ? 59.376  3.823   13.992  1.00 23.70  ? 301 PRO A C   1 
ATOM   2389  O  O   . PRO A 1 301 ? 59.938  3.194   14.862  1.00 21.00  ? 301 PRO A O   1 
ATOM   2390  C  CB  . PRO A 1 301 ? 57.481  5.114   15.137  1.00 24.19  ? 301 PRO A CB  1 
ATOM   2391  C  CG  . PRO A 1 301 ? 56.818  4.311   16.189  1.00 22.78  ? 301 PRO A CG  1 
ATOM   2392  C  CD  . PRO A 1 301 ? 56.104  3.228   15.452  1.00 24.45  ? 301 PRO A CD  1 
ATOM   2393  N  N   . GLY A 1 302 ? 60.022  4.278   12.937  1.00 26.19  ? 302 GLY A N   1 
ATOM   2394  C  CA  . GLY A 1 302 ? 61.450  4.063   12.790  1.00 27.12  ? 302 GLY A CA  1 
ATOM   2395  C  C   . GLY A 1 302 ? 61.792  2.828   12.006  1.00 27.32  ? 302 GLY A C   1 
ATOM   2396  O  O   . GLY A 1 302 ? 62.903  2.696   11.520  1.00 29.92  ? 302 GLY A O   1 
ATOM   2397  N  N   . LYS A 1 303 ? 60.826  1.932   11.876  1.00 29.41  ? 303 LYS A N   1 
ATOM   2398  C  CA  . LYS A 1 303 ? 61.043  0.626   11.280  1.00 31.82  ? 303 LYS A CA  1 
ATOM   2399  C  C   . LYS A 1 303 ? 61.446  0.703   9.799   1.00 29.91  ? 303 LYS A C   1 
ATOM   2400  O  O   . LYS A 1 303 ? 62.346  -0.018  9.372   1.00 32.13  ? 303 LYS A O   1 
ATOM   2401  C  CB  . LYS A 1 303 ? 59.798  -0.237  11.455  1.00 36.44  ? 303 LYS A CB  1 
ATOM   2402  C  CG  . LYS A 1 303 ? 60.053  -1.733  11.297  1.00 44.90  ? 303 LYS A CG  1 
ATOM   2403  C  CD  . LYS A 1 303 ? 58.750  -2.502  11.106  1.00 48.24  ? 303 LYS A CD  1 
ATOM   2404  C  CE  . LYS A 1 303 ? 58.761  -3.804  11.911  1.00 54.67  ? 303 LYS A CE  1 
ATOM   2405  N  NZ  . LYS A 1 303 ? 57.461  -4.550  11.860  1.00 57.26  ? 303 LYS A NZ  1 
ATOM   2406  N  N   . LEU A 1 304 ? 60.796  1.571   9.026   1.00 27.24  ? 304 LEU A N   1 
ATOM   2407  C  CA  . LEU A 1 304 ? 61.262  1.847   7.657   1.00 26.02  ? 304 LEU A CA  1 
ATOM   2408  C  C   . LEU A 1 304 ? 62.722  2.320   7.627   1.00 24.55  ? 304 LEU A C   1 
ATOM   2409  O  O   . LEU A 1 304 ? 63.491  1.818   6.831   1.00 24.08  ? 304 LEU A O   1 
ATOM   2410  C  CB  . LEU A 1 304 ? 60.341  2.799   6.858   1.00 24.26  ? 304 LEU A CB  1 
ATOM   2411  C  CG  . LEU A 1 304 ? 60.845  3.048   5.410   1.00 24.91  ? 304 LEU A CG  1 
ATOM   2412  C  CD1 . LEU A 1 304 ? 60.597  1.790   4.584   1.00 23.30  ? 304 LEU A CD1 1 
ATOM   2413  C  CD2 . LEU A 1 304 ? 60.241  4.285   4.727   1.00 22.67  ? 304 LEU A CD2 1 
ATOM   2414  N  N   . ILE A 1 305 ? 63.100  3.251   8.501   1.00 23.65  ? 305 ILE A N   1 
ATOM   2415  C  CA  . ILE A 1 305 ? 64.505  3.675   8.637   1.00 23.43  ? 305 ILE A CA  1 
ATOM   2416  C  C   . ILE A 1 305 ? 65.491  2.516   9.019   1.00 25.35  ? 305 ILE A C   1 
ATOM   2417  O  O   . ILE A 1 305 ? 66.520  2.318   8.335   1.00 23.68  ? 305 ILE A O   1 
ATOM   2418  C  CB  . ILE A 1 305 ? 64.650  4.896   9.586   1.00 21.02  ? 305 ILE A CB  1 
ATOM   2419  C  CG1 . ILE A 1 305 ? 64.018  6.159   8.966   1.00 19.79  ? 305 ILE A CG1 1 
ATOM   2420  C  CG2 . ILE A 1 305 ? 66.098  5.163   9.931   1.00 19.59  ? 305 ILE A CG2 1 
ATOM   2421  C  CD1 . ILE A 1 305 ? 63.827  7.304   9.949   1.00 18.85  ? 305 ILE A CD1 1 
ATOM   2422  N  N   . GLU A 1 306 ? 65.156  1.755   10.067  1.00 26.55  ? 306 GLU A N   1 
ATOM   2423  C  CA  . GLU A 1 306 ? 66.015  0.687   10.621  1.00 29.14  ? 306 GLU A CA  1 
ATOM   2424  C  C   . GLU A 1 306 ? 66.230  -0.462  9.654   1.00 30.60  ? 306 GLU A C   1 
ATOM   2425  O  O   . GLU A 1 306 ? 67.261  -1.136  9.705   1.00 28.74  ? 306 GLU A O   1 
ATOM   2426  C  CB  . GLU A 1 306 ? 65.436  0.137   11.932  1.00 33.86  ? 306 GLU A CB  1 
ATOM   2427  C  CG  . GLU A 1 306 ? 65.414  1.172   13.060  1.00 41.37  ? 306 GLU A CG  1 
ATOM   2428  C  CD  . GLU A 1 306 ? 64.413  0.904   14.205  1.00 48.05  ? 306 GLU A CD  1 
ATOM   2429  O  OE1 . GLU A 1 306 ? 63.704  -0.141  14.236  1.00 49.49  ? 306 GLU A OE1 1 
ATOM   2430  O  OE2 . GLU A 1 306 ? 64.339  1.774   15.106  1.00 50.40  ? 306 GLU A OE2 1 
ATOM   2431  N  N   . SER A 1 307 ? 65.241  -0.682  8.784   1.00 32.78  ? 307 SER A N   1 
ATOM   2432  C  CA  . SER A 1 307 ? 65.301  -1.712  7.738   1.00 31.85  ? 307 SER A CA  1 
ATOM   2433  C  C   . SER A 1 307 ? 66.250  -1.344  6.576   1.00 31.62  ? 307 SER A C   1 
ATOM   2434  O  O   . SER A 1 307 ? 66.601  -2.210  5.792   1.00 29.23  ? 307 SER A O   1 
ATOM   2435  C  CB  . SER A 1 307 ? 63.894  -2.017  7.199   1.00 30.80  ? 307 SER A CB  1 
ATOM   2436  O  OG  . SER A 1 307 ? 63.419  -1.019  6.271   1.00 32.03  ? 307 SER A OG  1 
ATOM   2437  N  N   . MET A 1 308 ? 66.656  -0.072  6.475   1.00 32.27  ? 308 MET A N   1 
ATOM   2438  C  CA  . MET A 1 308 ? 67.438  0.403   5.321   1.00 35.13  ? 308 MET A CA  1 
ATOM   2439  C  C   . MET A 1 308 ? 68.895  -0.004  5.421   1.00 38.14  ? 308 MET A C   1 
ATOM   2440  O  O   . MET A 1 308 ? 69.678  0.609   6.168   1.00 37.48  ? 308 MET A O   1 
ATOM   2441  C  CB  . MET A 1 308 ? 67.406  1.921   5.239   1.00 34.56  ? 308 MET A CB  1 
ATOM   2442  C  CG  . MET A 1 308 ? 66.028  2.521   5.159   1.00 32.72  ? 308 MET A CG  1 
ATOM   2443  S  SD  . MET A 1 308 ? 65.358  2.368   3.511   1.00 31.90  ? 308 MET A SD  1 
ATOM   2444  C  CE  . MET A 1 308 ? 66.343  3.529   2.560   1.00 31.44  ? 308 MET A CE  1 
ATOM   2445  N  N   . GLU A 1 309 ? 69.286  -1.011  4.665   1.00 41.46  ? 309 GLU A N   1 
ATOM   2446  C  CA  . GLU A 1 309 ? 70.625  -1.534  4.878   1.00 47.23  ? 309 GLU A CA  1 
ATOM   2447  C  C   . GLU A 1 309 ? 71.747  -0.680  4.272   1.00 44.41  ? 309 GLU A C   1 
ATOM   2448  O  O   . GLU A 1 309 ? 72.883  -0.806  4.701   1.00 46.39  ? 309 GLU A O   1 
ATOM   2449  C  CB  . GLU A 1 309 ? 70.728  -3.049  4.562   1.00 52.45  ? 309 GLU A CB  1 
ATOM   2450  C  CG  . GLU A 1 309 ? 70.991  -3.418  3.115   1.00 60.61  ? 309 GLU A CG  1 
ATOM   2451  C  CD  . GLU A 1 309 ? 69.828  -3.110  2.186   1.00 67.35  ? 309 GLU A CD  1 
ATOM   2452  O  OE1 . GLU A 1 309 ? 69.310  -1.972  2.215   1.00 67.77  ? 309 GLU A OE1 1 
ATOM   2453  O  OE2 . GLU A 1 309 ? 69.446  -4.012  1.403   1.00 72.58  ? 309 GLU A OE2 1 
ATOM   2454  N  N   . GLU A 1 310 ? 71.432  0.224   3.340   1.00 46.60  ? 310 GLU A N   1 
ATOM   2455  C  CA  . GLU A 1 310 ? 72.452  1.149   2.792   1.00 47.18  ? 310 GLU A CA  1 
ATOM   2456  C  C   . GLU A 1 310 ? 72.920  2.272   3.738   1.00 46.79  ? 310 GLU A C   1 
ATOM   2457  O  O   . GLU A 1 310 ? 74.028  2.801   3.563   1.00 48.02  ? 310 GLU A O   1 
ATOM   2458  C  CB  . GLU A 1 310 ? 72.019  1.806   1.473   1.00 52.15  ? 310 GLU A CB  1 
ATOM   2459  C  CG  . GLU A 1 310 ? 71.111  0.988   0.586   1.00 62.84  ? 310 GLU A CG  1 
ATOM   2460  C  CD  . GLU A 1 310 ? 69.662  1.312   0.845   1.00 68.30  ? 310 GLU A CD  1 
ATOM   2461  O  OE1 . GLU A 1 310 ? 69.137  0.869   1.894   1.00 72.73  ? 310 GLU A OE1 1 
ATOM   2462  O  OE2 . GLU A 1 310 ? 69.060  2.028   0.008   1.00 72.10  ? 310 GLU A OE2 1 
ATOM   2463  N  N   . PHE A 1 311 ? 72.087  2.664   4.705   1.00 40.31  ? 311 PHE A N   1 
ATOM   2464  C  CA  . PHE A 1 311 ? 72.444  3.771   5.603   1.00 37.79  ? 311 PHE A CA  1 
ATOM   2465  C  C   . PHE A 1 311 ? 73.379  3.317   6.713   1.00 35.73  ? 311 PHE A C   1 
ATOM   2466  O  O   . PHE A 1 311 ? 73.072  2.354   7.400   1.00 35.93  ? 311 PHE A O   1 
ATOM   2467  C  CB  . PHE A 1 311 ? 71.194  4.318   6.293   1.00 33.40  ? 311 PHE A CB  1 
ATOM   2468  C  CG  . PHE A 1 311 ? 70.260  5.039   5.396   1.00 29.63  ? 311 PHE A CG  1 
ATOM   2469  C  CD1 . PHE A 1 311 ? 70.708  5.660   4.254   1.00 30.42  ? 311 PHE A CD1 1 
ATOM   2470  C  CD2 . PHE A 1 311 ? 68.930  5.145   5.738   1.00 28.42  ? 311 PHE A CD2 1 
ATOM   2471  C  CE1 . PHE A 1 311 ? 69.830  6.353   3.445   1.00 30.50  ? 311 PHE A CE1 1 
ATOM   2472  C  CE2 . PHE A 1 311 ? 68.047  5.832   4.937   1.00 28.33  ? 311 PHE A CE2 1 
ATOM   2473  C  CZ  . PHE A 1 311 ? 68.491  6.427   3.786   1.00 30.18  ? 311 PHE A CZ  1 
ATOM   2474  N  N   . ASP A 1 312 ? 74.486  4.016   6.942   1.00 36.12  ? 312 ASP A N   1 
ATOM   2475  C  CA  . ASP A 1 312 ? 75.286  3.699   8.142   1.00 39.55  ? 312 ASP A CA  1 
ATOM   2476  C  C   . ASP A 1 312 ? 74.567  4.121   9.434   1.00 38.45  ? 312 ASP A C   1 
ATOM   2477  O  O   . ASP A 1 312 ? 73.482  4.674   9.398   1.00 36.00  ? 312 ASP A O   1 
ATOM   2478  C  CB  . ASP A 1 312 ? 76.708  4.269   8.068   1.00 40.16  ? 312 ASP A CB  1 
ATOM   2479  C  CG  . ASP A 1 312 ? 76.741  5.774   8.104   1.00 49.36  ? 312 ASP A CG  1 
ATOM   2480  O  OD1 . ASP A 1 312 ? 75.771  6.397   8.585   1.00 58.74  ? 312 ASP A OD1 1 
ATOM   2481  O  OD2 . ASP A 1 312 ? 77.752  6.358   7.653   1.00 56.12  ? 312 ASP A OD2 1 
ATOM   2482  N  N   . GLU A 1 313 ? 75.179  3.885   10.581  1.00 43.24  ? 313 GLU A N   1 
ATOM   2483  C  CA  . GLU A 1 313 ? 74.477  4.128   11.829  1.00 44.00  ? 313 GLU A CA  1 
ATOM   2484  C  C   . GLU A 1 313 ? 74.306  5.609   12.063  1.00 40.54  ? 313 GLU A C   1 
ATOM   2485  O  O   . GLU A 1 313 ? 73.259  6.019   12.531  1.00 42.90  ? 313 GLU A O   1 
ATOM   2486  C  CB  . GLU A 1 313 ? 75.182  3.458   13.020  1.00 51.49  ? 313 GLU A CB  1 
ATOM   2487  C  CG  . GLU A 1 313 ? 74.263  2.623   13.915  1.00 61.15  ? 313 GLU A CG  1 
ATOM   2488  C  CD  . GLU A 1 313 ? 73.762  1.327   13.247  1.00 66.30  ? 313 GLU A CD  1 
ATOM   2489  O  OE1 . GLU A 1 313 ? 73.957  0.243   13.841  1.00 66.32  ? 313 GLU A OE1 1 
ATOM   2490  O  OE2 . GLU A 1 313 ? 73.168  1.373   12.137  1.00 67.84  ? 313 GLU A OE2 1 
ATOM   2491  N  N   . GLU A 1 314 ? 75.321  6.402   11.718  1.00 35.17  ? 314 GLU A N   1 
ATOM   2492  C  CA  . GLU A 1 314 ? 75.286  7.836   11.957  1.00 35.94  ? 314 GLU A CA  1 
ATOM   2493  C  C   . GLU A 1 314 ? 74.059  8.397   11.233  1.00 33.58  ? 314 GLU A C   1 
ATOM   2494  O  O   . GLU A 1 314 ? 73.334  9.240   11.771  1.00 32.30  ? 314 GLU A O   1 
ATOM   2495  C  CB  . GLU A 1 314 ? 76.579  8.492   11.444  1.00 39.96  ? 314 GLU A CB  1 
ATOM   2496  C  CG  . GLU A 1 314 ? 77.287  9.426   12.427  1.00 46.04  ? 314 GLU A CG  1 
ATOM   2497  C  CD  . GLU A 1 314 ? 77.155  10.930  12.102  1.00 49.08  ? 314 GLU A CD  1 
ATOM   2498  O  OE1 . GLU A 1 314 ? 77.819  11.425  11.156  1.00 52.90  ? 314 GLU A OE1 1 
ATOM   2499  O  OE2 . GLU A 1 314 ? 76.409  11.644  12.812  1.00 47.92  ? 314 GLU A OE2 1 
ATOM   2500  N  N   . THR A 1 315 ? 73.828  7.891   10.017  1.00 30.89  ? 315 THR A N   1 
ATOM   2501  C  CA  . THR A 1 315 ? 72.711  8.287   9.178   1.00 28.12  ? 315 THR A CA  1 
ATOM   2502  C  C   . THR A 1 315 ? 71.374  7.952   9.835   1.00 26.72  ? 315 THR A C   1 
ATOM   2503  O  O   . THR A 1 315 ? 70.499  8.821   9.936   1.00 25.78  ? 315 THR A O   1 
ATOM   2504  C  CB  . THR A 1 315 ? 72.823  7.666   7.779   1.00 28.14  ? 315 THR A CB  1 
ATOM   2505  O  OG1 . THR A 1 315 ? 74.011  8.160   7.164   1.00 28.43  ? 315 THR A OG1 1 
ATOM   2506  C  CG2 . THR A 1 315 ? 71.650  8.042   6.910   1.00 26.96  ? 315 THR A CG2 1 
ATOM   2507  N  N   . LYS A 1 316 ? 71.242  6.719   10.312  1.00 24.72  ? 316 LYS A N   1 
ATOM   2508  C  CA  . LYS A 1 316 ? 70.014  6.289   10.962  1.00 26.52  ? 316 LYS A CA  1 
ATOM   2509  C  C   . LYS A 1 316 ? 69.686  7.162   12.184  1.00 27.61  ? 316 LYS A C   1 
ATOM   2510  O  O   . LYS A 1 316 ? 68.549  7.562   12.357  1.00 28.01  ? 316 LYS A O   1 
ATOM   2511  C  CB  . LYS A 1 316 ? 70.070  4.813   11.339  1.00 25.44  ? 316 LYS A CB  1 
ATOM   2512  C  CG  . LYS A 1 316 ? 69.898  3.864   10.158  1.00 27.42  ? 316 LYS A CG  1 
ATOM   2513  C  CD  . LYS A 1 316 ? 69.923  2.422   10.635  1.00 26.67  ? 316 LYS A CD  1 
ATOM   2514  C  CE  . LYS A 1 316 ? 70.054  1.484   9.458   1.00 29.01  ? 316 LYS A CE  1 
ATOM   2515  N  NZ  . LYS A 1 316 ? 70.806  0.269   9.904   1.00 30.98  ? 316 LYS A NZ  1 
ATOM   2516  N  N   . ASN A 1 317 ? 70.691  7.490   12.994  1.00 29.74  ? 317 ASN A N   1 
ATOM   2517  C  CA  . ASN A 1 317 ? 70.484  8.279   14.219  1.00 30.11  ? 317 ASN A CA  1 
ATOM   2518  C  C   . ASN A 1 317 ? 70.168  9.753   13.922  1.00 25.37  ? 317 ASN A C   1 
ATOM   2519  O  O   . ASN A 1 317 ? 69.547  10.442  14.712  1.00 22.90  ? 317 ASN A O   1 
ATOM   2520  C  CB  . ASN A 1 317 ? 71.643  8.048   15.237  1.00 32.73  ? 317 ASN A CB  1 
ATOM   2521  C  CG  . ASN A 1 317 ? 71.664  6.593   15.805  1.00 36.00  ? 317 ASN A CG  1 
ATOM   2522  O  OD1 . ASN A 1 317 ? 70.711  5.812   15.643  1.00 34.07  ? 317 ASN A OD1 1 
ATOM   2523  N  ND2 . ASN A 1 317 ? 72.765  6.231   16.455  1.00 37.91  ? 317 ASN A ND2 1 
ATOM   2524  N  N   . LYS A 1 318 ? 70.528  10.193  12.725  1.00 26.77  ? 318 LYS A N   1 
ATOM   2525  C  CA  . LYS A 1 318 ? 70.139  11.513  12.220  1.00 24.46  ? 318 LYS A CA  1 
ATOM   2526  C  C   . LYS A 1 318 ? 68.666  11.519  11.847  1.00 22.75  ? 318 LYS A C   1 
ATOM   2527  O  O   . LYS A 1 318 ? 67.935  12.487  12.128  1.00 21.94  ? 318 LYS A O   1 
ATOM   2528  C  CB  . LYS A 1 318 ? 70.973  11.872  10.997  1.00 26.15  ? 318 LYS A CB  1 
ATOM   2529  C  CG  . LYS A 1 318 ? 72.384  12.297  11.344  1.00 29.83  ? 318 LYS A CG  1 
ATOM   2530  C  CD  . LYS A 1 318 ? 73.246  12.280  10.098  1.00 35.12  ? 318 LYS A CD  1 
ATOM   2531  C  CE  . LYS A 1 318 ? 74.556  13.023  10.318  1.00 37.31  ? 318 LYS A CE  1 
ATOM   2532  N  NZ  . LYS A 1 318 ? 74.960  13.729  9.069   1.00 39.05  ? 318 LYS A NZ  1 
ATOM   2533  N  N   . LEU A 1 319 ? 68.215  10.448  11.216  1.00 18.87  ? 319 LEU A N   1 
ATOM   2534  C  CA  . LEU A 1 319 ? 66.853  10.463  10.734  1.00 18.90  ? 319 LEU A CA  1 
ATOM   2535  C  C   . LEU A 1 319 ? 65.876  10.217  11.912  1.00 19.79  ? 319 LEU A C   1 
ATOM   2536  O  O   . LEU A 1 319 ? 64.793  10.795  11.933  1.00 16.78  ? 319 LEU A O   1 
ATOM   2537  C  CB  . LEU A 1 319 ? 66.652  9.488   9.570   1.00 18.58  ? 319 LEU A CB  1 
ATOM   2538  C  CG  . LEU A 1 319 ? 67.629  9.656   8.382   1.00 19.31  ? 319 LEU A CG  1 
ATOM   2539  C  CD1 . LEU A 1 319 ? 67.524  8.467   7.451   1.00 21.46  ? 319 LEU A CD1 1 
ATOM   2540  C  CD2 . LEU A 1 319 ? 67.421  10.917  7.591   1.00 18.72  ? 319 LEU A CD2 1 
ATOM   2541  N  N   . LYS A 1 320 ? 66.324  9.427   12.896  1.00 19.51  ? 320 LYS A N   1 
ATOM   2542  C  CA  . LYS A 1 320 ? 65.572  9.110   14.087  1.00 21.77  ? 320 LYS A CA  1 
ATOM   2543  C  C   . LYS A 1 320 ? 65.535  10.213  15.145  1.00 21.27  ? 320 LYS A C   1 
ATOM   2544  O  O   . LYS A 1 320 ? 64.581  10.306  15.907  1.00 21.70  ? 320 LYS A O   1 
ATOM   2545  C  CB  . LYS A 1 320 ? 66.136  7.838   14.758  1.00 23.82  ? 320 LYS A CB  1 
ATOM   2546  C  CG  . LYS A 1 320 ? 65.915  6.564   13.993  1.00 27.91  ? 320 LYS A CG  1 
ATOM   2547  C  CD  . LYS A 1 320 ? 66.078  5.333   14.874  1.00 33.61  ? 320 LYS A CD  1 
ATOM   2548  C  CE  . LYS A 1 320 ? 67.515  4.825   15.000  1.00 35.38  ? 320 LYS A CE  1 
ATOM   2549  N  NZ  . LYS A 1 320 ? 67.508  3.394   15.466  1.00 40.62  ? 320 LYS A NZ  1 
ATOM   2550  N  N   . ALA A 1 321 ? 66.584  11.010  15.247  1.00 20.07  ? 321 ALA A N   1 
ATOM   2551  C  CA  . ALA A 1 321 ? 66.615  12.036  16.319  1.00 19.65  ? 321 ALA A CA  1 
ATOM   2552  C  C   . ALA A 1 321 ? 67.418  13.326  16.017  1.00 17.72  ? 321 ALA A C   1 
ATOM   2553  O  O   . ALA A 1 321 ? 66.911  14.414  16.260  1.00 17.48  ? 321 ALA A O   1 
ATOM   2554  C  CB  . ALA A 1 321 ? 67.105  11.417  17.652  1.00 18.78  ? 321 ALA A CB  1 
ATOM   2555  N  N   . GLY A 1 322 ? 68.651  13.186  15.521  1.00 15.87  ? 322 GLY A N   1 
ATOM   2556  C  CA  . GLY A 1 322 ? 69.581  14.310  15.368  1.00 16.14  ? 322 GLY A CA  1 
ATOM   2557  C  C   . GLY A 1 322 ? 69.000  15.440  14.573  1.00 16.84  ? 322 GLY A C   1 
ATOM   2558  O  O   . GLY A 1 322 ? 69.039  16.609  14.997  1.00 17.81  ? 322 GLY A O   1 
ATOM   2559  N  N   . ASN A 1 323 ? 68.415  15.094  13.422  1.00 17.88  ? 323 ASN A N   1 
ATOM   2560  C  CA  . ASN A 1 323 ? 67.802  16.082  12.529  1.00 17.02  ? 323 ASN A CA  1 
ATOM   2561  C  C   . ASN A 1 323 ? 66.641  16.819  13.179  1.00 16.93  ? 323 ASN A C   1 
ATOM   2562  O  O   . ASN A 1 323 ? 66.509  18.016  13.010  1.00 16.97  ? 323 ASN A O   1 
ATOM   2563  C  CB  . ASN A 1 323 ? 67.358  15.421  11.250  1.00 17.26  ? 323 ASN A CB  1 
ATOM   2564  C  CG  . ASN A 1 323 ? 68.532  14.900  10.412  1.00 18.47  ? 323 ASN A CG  1 
ATOM   2565  O  OD1 . ASN A 1 323 ? 69.714  15.094  10.749  1.00 17.46  ? 323 ASN A OD1 1 
ATOM   2566  N  ND2 . ASN A 1 323 ? 68.198  14.213  9.320   1.00 17.63  ? 323 ASN A ND2 1 
ATOM   2567  N  N   . ALA A 1 324 ? 65.806  16.088  13.905  1.00 16.70  ? 324 ALA A N   1 
ATOM   2568  C  CA  . ALA A 1 324 ? 64.698  16.653  14.659  1.00 18.07  ? 324 ALA A CA  1 
ATOM   2569  C  C   . ALA A 1 324 ? 65.224  17.691  15.664  1.00 18.79  ? 324 ALA A C   1 
ATOM   2570  O  O   . ALA A 1 324 ? 64.677  18.785  15.743  1.00 18.93  ? 324 ALA A O   1 
ATOM   2571  C  CB  . ALA A 1 324 ? 63.919  15.540  15.366  1.00 16.89  ? 324 ALA A CB  1 
ATOM   2572  N  N   . LEU A 1 325 ? 66.323  17.361  16.358  1.00 19.42  ? 325 LEU A N   1 
ATOM   2573  C  CA  . LEU A 1 325 ? 66.938  18.237  17.354  1.00 19.60  ? 325 LEU A CA  1 
ATOM   2574  C  C   . LEU A 1 325 ? 67.494  19.498  16.741  1.00 21.44  ? 325 LEU A C   1 
ATOM   2575  O  O   . LEU A 1 325 ? 67.369  20.612  17.326  1.00 21.52  ? 325 LEU A O   1 
ATOM   2576  C  CB  . LEU A 1 325 ? 68.015  17.512  18.149  1.00 19.50  ? 325 LEU A CB  1 
ATOM   2577  C  CG  . LEU A 1 325 ? 67.432  16.514  19.140  1.00 20.14  ? 325 LEU A CG  1 
ATOM   2578  C  CD1 . LEU A 1 325 ? 68.509  15.566  19.659  1.00 20.42  ? 325 LEU A CD1 1 
ATOM   2579  C  CD2 . LEU A 1 325 ? 66.689  17.192  20.289  1.00 19.82  ? 325 LEU A CD2 1 
ATOM   2580  N  N   . ALA A 1 326 ? 68.089  19.350  15.555  1.00 20.59  ? 326 ALA A N   1 
ATOM   2581  C  CA  . ALA A 1 326 ? 68.627  20.523  14.880  1.00 20.43  ? 326 ALA A CA  1 
ATOM   2582  C  C   . ALA A 1 326 ? 67.458  21.366  14.383  1.00 20.79  ? 326 ALA A C   1 
ATOM   2583  O  O   . ALA A 1 326 ? 67.476  22.588  14.502  1.00 24.29  ? 326 ALA A O   1 
ATOM   2584  C  CB  . ALA A 1 326 ? 69.575  20.150  13.731  1.00 19.61  ? 326 ALA A CB  1 
ATOM   2585  N  N   . PHE A 1 327 ? 66.434  20.727  13.832  1.00 19.58  ? 327 PHE A N   1 
ATOM   2586  C  CA  . PHE A 1 327 ? 65.297  21.487  13.341  1.00 18.40  ? 327 PHE A CA  1 
ATOM   2587  C  C   . PHE A 1 327 ? 64.562  22.193  14.508  1.00 18.51  ? 327 PHE A C   1 
ATOM   2588  O  O   . PHE A 1 327 ? 64.073  23.302  14.306  1.00 20.09  ? 327 PHE A O   1 
ATOM   2589  C  CB  . PHE A 1 327 ? 64.344  20.626  12.490  1.00 15.60  ? 327 PHE A CB  1 
ATOM   2590  C  CG  . PHE A 1 327 ? 62.969  21.250  12.270  1.00 14.67  ? 327 PHE A CG  1 
ATOM   2591  C  CD1 . PHE A 1 327 ? 62.789  22.287  11.365  1.00 13.73  ? 327 PHE A CD1 1 
ATOM   2592  C  CD2 . PHE A 1 327 ? 61.863  20.801  12.991  1.00 13.98  ? 327 PHE A CD2 1 
ATOM   2593  C  CE1 . PHE A 1 327 ? 61.536  22.867  11.171  1.00 13.67  ? 327 PHE A CE1 1 
ATOM   2594  C  CE2 . PHE A 1 327 ? 60.608  21.368  12.804  1.00 14.01  ? 327 PHE A CE2 1 
ATOM   2595  C  CZ  . PHE A 1 327 ? 60.446  22.410  11.889  1.00 14.55  ? 327 PHE A CZ  1 
ATOM   2596  N  N   . LEU A 1 328 ? 64.465  21.570  15.683  1.00 18.25  ? 328 LEU A N   1 
ATOM   2597  C  CA  . LEU A 1 328 ? 63.788  22.228  16.826  1.00 21.37  ? 328 LEU A CA  1 
ATOM   2598  C  C   . LEU A 1 328 ? 64.678  23.181  17.669  1.00 22.78  ? 328 LEU A C   1 
ATOM   2599  O  O   . LEU A 1 328 ? 64.175  24.037  18.388  1.00 23.87  ? 328 LEU A O   1 
ATOM   2600  C  CB  . LEU A 1 328 ? 63.036  21.221  17.724  1.00 19.05  ? 328 LEU A CB  1 
ATOM   2601  C  CG  . LEU A 1 328 ? 61.990  20.403  16.974  1.00 18.43  ? 328 LEU A CG  1 
ATOM   2602  C  CD1 . LEU A 1 328 ? 61.762  19.121  17.733  1.00 19.56  ? 328 LEU A CD1 1 
ATOM   2603  C  CD2 . LEU A 1 328 ? 60.683  21.145  16.772  1.00 17.70  ? 328 LEU A CD2 1 
ATOM   2604  N  N   . GLY A 1 329 ? 65.992  23.040  17.572  1.00 26.04  ? 329 GLY A N   1 
ATOM   2605  C  CA  . GLY A 1 329 ? 66.897  23.951  18.265  1.00 25.30  ? 329 GLY A CA  1 
ATOM   2606  C  C   . GLY A 1 329 ? 67.079  23.514  19.695  1.00 27.57  ? 329 GLY A C   1 
ATOM   2607  O  O   . GLY A 1 329 ? 67.226  24.363  20.591  1.00 31.49  ? 329 GLY A O   1 
ATOM   2608  N  N   . LEU A 1 330 ? 67.051  22.203  19.929  1.00 27.23  ? 330 LEU A N   1 
ATOM   2609  C  CA  . LEU A 1 330 ? 67.173  21.655  21.290  1.00 28.79  ? 330 LEU A CA  1 
ATOM   2610  C  C   . LEU A 1 330 ? 68.373  20.738  21.429  1.00 31.06  ? 330 LEU A C   1 
ATOM   2611  O  O   . LEU A 1 330 ? 69.121  20.540  20.494  1.00 31.60  ? 330 LEU A O   1 
ATOM   2612  C  CB  . LEU A 1 330 ? 65.930  20.879  21.660  1.00 26.65  ? 330 LEU A CB  1 
ATOM   2613  C  CG  . LEU A 1 330 ? 64.550  21.519  21.641  1.00 25.34  ? 330 LEU A CG  1 
ATOM   2614  C  CD1 . LEU A 1 330 ? 63.561  20.374  21.532  1.00 23.82  ? 330 LEU A CD1 1 
ATOM   2615  C  CD2 . LEU A 1 330 ? 64.259  22.377  22.867  1.00 23.23  ? 330 LEU A CD2 1 
ATOM   2616  N  N   . GLU A 1 331 ? 68.571  20.183  22.610  1.00 37.00  ? 331 GLU A N   1 
ATOM   2617  C  CA  . GLU A 1 331 ? 69.712  19.298  22.808  1.00 40.33  ? 331 GLU A CA  1 
ATOM   2618  C  C   . GLU A 1 331 ? 69.287  17.958  23.354  1.00 37.04  ? 331 GLU A C   1 
ATOM   2619  O  O   . GLU A 1 331 ? 68.250  17.867  23.999  1.00 34.09  ? 331 GLU A O   1 
ATOM   2620  C  CB  . GLU A 1 331 ? 70.729  19.939  23.739  1.00 51.41  ? 331 GLU A CB  1 
ATOM   2621  C  CG  . GLU A 1 331 ? 71.529  21.061  23.089  1.00 60.77  ? 331 GLU A CG  1 
ATOM   2622  C  CD  . GLU A 1 331 ? 72.572  21.645  24.026  1.00 66.49  ? 331 GLU A CD  1 
ATOM   2623  O  OE1 . GLU A 1 331 ? 72.609  21.242  25.218  1.00 64.76  ? 331 GLU A OE1 1 
ATOM   2624  O  OE2 . GLU A 1 331 ? 73.357  22.509  23.560  1.00 73.47  ? 331 GLU A OE2 1 
ATOM   2625  N  N   . ARG A 1 332 ? 70.085  16.928  23.066  1.00 37.17  ? 332 ARG A N   1 
ATOM   2626  C  CA  . ARG A 1 332 ? 69.842  15.575  23.547  1.00 41.16  ? 332 ARG A CA  1 
ATOM   2627  C  C   . ARG A 1 332 ? 69.660  15.586  25.059  1.00 38.90  ? 332 ARG A C   1 
ATOM   2628  O  O   . ARG A 1 332 ? 68.704  15.007  25.556  1.00 36.04  ? 332 ARG A O   1 
ATOM   2629  C  CB  . ARG A 1 332 ? 70.998  14.635  23.179  1.00 47.83  ? 332 ARG A CB  1 
ATOM   2630  C  CG  . ARG A 1 332 ? 71.802  15.029  21.947  1.00 55.93  ? 332 ARG A CG  1 
ATOM   2631  C  CD  . ARG A 1 332 ? 73.022  14.127  21.747  1.00 62.22  ? 332 ARG A CD  1 
ATOM   2632  N  NE  . ARG A 1 332 ? 74.197  14.848  21.219  1.00 69.60  ? 332 ARG A NE  1 
ATOM   2633  C  CZ  . ARG A 1 332 ? 75.198  15.350  21.961  1.00 72.56  ? 332 ARG A CZ  1 
ATOM   2634  N  NH1 . ARG A 1 332 ? 75.201  15.233  23.291  1.00 67.10  ? 332 ARG A NH1 1 
ATOM   2635  N  NH2 . ARG A 1 332 ? 76.212  15.978  21.371  1.00 68.58  ? 332 ARG A NH2 1 
ATOM   2636  N  N   . MET B 1 1   ? 42.338  42.701  49.741  1.00 48.69  ? 1   MET B N   1 
ATOM   2637  C  CA  . MET B 1 1   ? 42.532  42.764  48.283  1.00 50.08  ? 1   MET B CA  1 
ATOM   2638  C  C   . MET B 1 1   ? 43.572  41.725  47.851  1.00 46.16  ? 1   MET B C   1 
ATOM   2639  O  O   . MET B 1 1   ? 43.246  40.570  47.661  1.00 55.15  ? 1   MET B O   1 
ATOM   2640  C  CB  . MET B 1 1   ? 42.964  44.188  47.836  1.00 63.69  ? 1   MET B CB  1 
ATOM   2641  C  CG  . MET B 1 1   ? 42.865  44.504  46.323  1.00 65.31  ? 1   MET B CG  1 
ATOM   2642  S  SD  . MET B 1 1   ? 44.261  45.391  45.533  1.00 72.71  ? 1   MET B SD  1 
ATOM   2643  C  CE  . MET B 1 1   ? 43.988  44.993  43.799  1.00 66.83  ? 1   MET B CE  1 
ATOM   2644  N  N   . LYS B 1 2   ? 44.827  42.135  47.761  1.00 38.02  ? 2   LYS B N   1 
ATOM   2645  C  CA  . LYS B 1 2   ? 45.765  41.608  46.794  1.00 29.42  ? 2   LYS B CA  1 
ATOM   2646  C  C   . LYS B 1 2   ? 45.967  40.094  46.763  1.00 25.06  ? 2   LYS B C   1 
ATOM   2647  O  O   . LYS B 1 2   ? 45.483  39.451  45.850  1.00 20.19  ? 2   LYS B O   1 
ATOM   2648  C  CB  . LYS B 1 2   ? 47.096  42.292  47.002  1.00 31.43  ? 2   LYS B CB  1 
ATOM   2649  C  CG  . LYS B 1 2   ? 47.187  43.738  46.615  1.00 29.16  ? 2   LYS B CG  1 
ATOM   2650  C  CD  . LYS B 1 2   ? 48.094  43.863  45.381  1.00 28.03  ? 2   LYS B CD  1 
ATOM   2651  C  CE  . LYS B 1 2   ? 47.975  45.293  44.880  1.00 28.70  ? 2   LYS B CE  1 
ATOM   2652  N  NZ  . LYS B 1 2   ? 46.730  45.925  45.389  1.00 24.61  ? 2   LYS B NZ  1 
ATOM   2653  N  N   . ILE B 1 3   ? 46.708  39.511  47.704  1.00 22.45  ? 3   ILE B N   1 
ATOM   2654  C  CA  . ILE B 1 3   ? 47.083  38.077  47.523  1.00 21.68  ? 3   ILE B CA  1 
ATOM   2655  C  C   . ILE B 1 3   ? 46.458  37.110  48.524  1.00 22.15  ? 3   ILE B C   1 
ATOM   2656  O  O   . ILE B 1 3   ? 46.444  37.369  49.713  1.00 25.44  ? 3   ILE B O   1 
ATOM   2657  C  CB  . ILE B 1 3   ? 48.591  37.877  47.473  1.00 19.14  ? 3   ILE B CB  1 
ATOM   2658  C  CG1 . ILE B 1 3   ? 49.199  38.765  46.387  1.00 19.29  ? 3   ILE B CG1 1 
ATOM   2659  C  CG2 . ILE B 1 3   ? 48.902  36.434  47.201  1.00 19.81  ? 3   ILE B CG2 1 
ATOM   2660  C  CD1 . ILE B 1 3   ? 50.527  38.275  45.892  1.00 19.09  ? 3   ILE B CD1 1 
ATOM   2661  N  N   . ASP B 1 4   ? 45.916  36.011  48.026  1.00 21.91  ? 4   ASP B N   1 
ATOM   2662  C  CA  . ASP B 1 4   ? 45.188  35.036  48.840  1.00 20.24  ? 4   ASP B CA  1 
ATOM   2663  C  C   . ASP B 1 4   ? 46.021  33.765  48.848  1.00 18.51  ? 4   ASP B C   1 
ATOM   2664  O  O   . ASP B 1 4   ? 45.996  33.018  47.886  1.00 16.04  ? 4   ASP B O   1 
ATOM   2665  C  CB  . ASP B 1 4   ? 43.790  34.803  48.249  1.00 21.79  ? 4   ASP B CB  1 
ATOM   2666  C  CG  . ASP B 1 4   ? 42.835  33.997  49.187  1.00 26.92  ? 4   ASP B CG  1 
ATOM   2667  O  OD1 . ASP B 1 4   ? 43.324  33.255  50.096  1.00 26.00  ? 4   ASP B OD1 1 
ATOM   2668  O  OD2 . ASP B 1 4   ? 41.567  34.099  48.982  1.00 29.80  ? 4   ASP B OD2 1 
ATOM   2669  N  N   . ILE B 1 5   ? 46.790  33.548  49.921  1.00 16.66  ? 5   ILE B N   1 
ATOM   2670  C  CA  . ILE B 1 5   ? 47.680  32.360  50.022  1.00 15.53  ? 5   ILE B CA  1 
ATOM   2671  C  C   . ILE B 1 5   ? 46.960  31.005  50.319  1.00 14.69  ? 5   ILE B C   1 
ATOM   2672  O  O   . ILE B 1 5   ? 47.612  29.952  50.273  1.00 14.11  ? 5   ILE B O   1 
ATOM   2673  C  CB  . ILE B 1 5   ? 48.736  32.543  51.135  1.00 14.46  ? 5   ILE B CB  1 
ATOM   2674  C  CG1 . ILE B 1 5   ? 49.932  31.616  50.926  1.00 14.32  ? 5   ILE B CG1 1 
ATOM   2675  C  CG2 . ILE B 1 5   ? 48.117  32.277  52.488  1.00 12.71  ? 5   ILE B CG2 1 
ATOM   2676  C  CD1 . ILE B 1 5   ? 50.882  32.067  49.836  1.00 15.26  ? 5   ILE B CD1 1 
ATOM   2677  N  N   . HIS B 1 6   ? 45.655  31.052  50.640  1.00 14.37  ? 6   HIS B N   1 
ATOM   2678  C  CA  . HIS B 1 6   ? 44.893  29.934  51.205  1.00 13.55  ? 6   HIS B CA  1 
ATOM   2679  C  C   . HIS B 1 6   ? 43.587  29.787  50.450  1.00 13.89  ? 6   HIS B C   1 
ATOM   2680  O  O   . HIS B 1 6   ? 42.526  30.328  50.838  1.00 13.49  ? 6   HIS B O   1 
ATOM   2681  C  CB  . HIS B 1 6   ? 44.616  30.214  52.676  1.00 14.15  ? 6   HIS B CB  1 
ATOM   2682  C  CG  . HIS B 1 6   ? 43.958  29.066  53.442  1.00 14.06  ? 6   HIS B CG  1 
ATOM   2683  N  ND1 . HIS B 1 6   ? 43.945  29.019  54.794  1.00 13.64  ? 6   HIS B ND1 1 
ATOM   2684  C  CD2 . HIS B 1 6   ? 43.324  27.903  53.007  1.00 13.97  ? 6   HIS B CD2 1 
ATOM   2685  C  CE1 . HIS B 1 6   ? 43.327  27.900  55.194  1.00 13.74  ? 6   HIS B CE1 1 
ATOM   2686  N  NE2 . HIS B 1 6   ? 42.924  27.223  54.104  1.00 13.25  ? 6   HIS B NE2 1 
ATOM   2687  N  N   . SER B 1 7   ? 43.646  29.050  49.346  1.00 13.56  ? 7   SER B N   1 
ATOM   2688  C  CA  . SER B 1 7   ? 42.456  28.756  48.605  1.00 13.64  ? 7   SER B CA  1 
ATOM   2689  C  C   . SER B 1 7   ? 42.516  27.331  48.020  1.00 13.40  ? 7   SER B C   1 
ATOM   2690  O  O   . SER B 1 7   ? 43.575  26.847  47.638  1.00 14.14  ? 7   SER B O   1 
ATOM   2691  C  CB  . SER B 1 7   ? 42.200  29.865  47.567  1.00 14.09  ? 7   SER B CB  1 
ATOM   2692  O  OG  . SER B 1 7   ? 42.834  29.617  46.350  1.00 14.20  ? 7   SER B OG  1 
ATOM   2693  N  N   . HIS B 1 8   ? 41.392  26.640  47.994  1.00 12.86  ? 8   HIS B N   1 
ATOM   2694  C  CA  . HIS B 1 8   ? 41.371  25.248  47.521  1.00 12.74  ? 8   HIS B CA  1 
ATOM   2695  C  C   . HIS B 1 8   ? 40.626  25.152  46.199  1.00 12.45  ? 8   HIS B C   1 
ATOM   2696  O  O   . HIS B 1 8   ? 39.715  25.902  45.941  1.00 13.21  ? 8   HIS B O   1 
ATOM   2697  C  CB  . HIS B 1 8   ? 40.824  24.324  48.605  1.00 12.18  ? 8   HIS B CB  1 
ATOM   2698  C  CG  . HIS B 1 8   ? 41.518  24.498  49.935  1.00 13.31  ? 8   HIS B CG  1 
ATOM   2699  N  ND1 . HIS B 1 8   ? 42.779  24.045  50.169  1.00 13.80  ? 8   HIS B ND1 1 
ATOM   2700  C  CD2 . HIS B 1 8   ? 41.120  25.145  51.097  1.00 13.86  ? 8   HIS B CD2 1 
ATOM   2701  C  CE1 . HIS B 1 8   ? 43.166  24.401  51.402  1.00 14.04  ? 8   HIS B CE1 1 
ATOM   2702  N  NE2 . HIS B 1 8   ? 42.154  25.058  51.980  1.00 15.10  ? 8   HIS B NE2 1 
ATOM   2703  N  N   . ILE B 1 9   ? 41.035  24.251  45.333  1.00 12.49  ? 9   ILE B N   1 
ATOM   2704  C  CA  . ILE B 1 9   ? 40.387  24.026  44.056  1.00 12.51  ? 9   ILE B CA  1 
ATOM   2705  C  C   . ILE B 1 9   ? 40.445  22.508  43.888  1.00 13.34  ? 9   ILE B C   1 
ATOM   2706  O  O   . ILE B 1 9   ? 41.206  21.848  44.583  1.00 14.69  ? 9   ILE B O   1 
ATOM   2707  C  CB  . ILE B 1 9   ? 41.118  24.756  42.913  1.00 12.09  ? 9   ILE B CB  1 
ATOM   2708  C  CG1 . ILE B 1 9   ? 40.326  24.689  41.581  1.00 13.19  ? 9   ILE B CG1 1 
ATOM   2709  C  CG2 . ILE B 1 9   ? 42.501  24.190  42.706  1.00 11.52  ? 9   ILE B CG2 1 
ATOM   2710  C  CD1 . ILE B 1 9   ? 40.775  25.700  40.511  1.00 12.09  ? 9   ILE B CD1 1 
ATOM   2711  N  N   . LEU B 1 10  ? 39.621  21.961  43.013  1.00 13.98  ? 10  LEU B N   1 
ATOM   2712  C  CA  . LEU B 1 10  ? 39.664  20.563  42.603  1.00 15.04  ? 10  LEU B CA  1 
ATOM   2713  C  C   . LEU B 1 10  ? 39.584  20.481  41.074  1.00 16.20  ? 10  LEU B C   1 
ATOM   2714  O  O   . LEU B 1 10  ? 39.118  21.425  40.418  1.00 15.83  ? 10  LEU B O   1 
ATOM   2715  C  CB  . LEU B 1 10  ? 38.426  19.848  43.145  1.00 14.98  ? 10  LEU B CB  1 
ATOM   2716  C  CG  . LEU B 1 10  ? 38.363  19.610  44.648  1.00 15.31  ? 10  LEU B CG  1 
ATOM   2717  C  CD1 . LEU B 1 10  ? 36.950  19.260  45.036  1.00 15.66  ? 10  LEU B CD1 1 
ATOM   2718  C  CD2 . LEU B 1 10  ? 39.312  18.528  45.118  1.00 14.46  ? 10  LEU B CD2 1 
ATOM   2719  N  N   . PRO B 1 11  ? 40.002  19.341  40.486  1.00 17.13  ? 11  PRO B N   1 
ATOM   2720  C  CA  . PRO B 1 11  ? 39.649  19.186  39.061  1.00 18.01  ? 11  PRO B CA  1 
ATOM   2721  C  C   . PRO B 1 11  ? 38.140  19.009  38.974  1.00 19.66  ? 11  PRO B C   1 
ATOM   2722  O  O   . PRO B 1 11  ? 37.531  18.558  39.947  1.00 17.61  ? 11  PRO B O   1 
ATOM   2723  C  CB  . PRO B 1 11  ? 40.403  17.921  38.647  1.00 18.00  ? 11  PRO B CB  1 
ATOM   2724  C  CG  . PRO B 1 11  ? 41.431  17.682  39.764  1.00 17.96  ? 11  PRO B CG  1 
ATOM   2725  C  CD  . PRO B 1 11  ? 40.793  18.214  41.001  1.00 16.22  ? 11  PRO B CD  1 
ATOM   2726  N  N   . LYS B 1 12  ? 37.521  19.409  37.863  1.00 23.72  ? 12  LYS B N   1 
ATOM   2727  C  CA  . LYS B 1 12  ? 36.080  19.088  37.665  1.00 27.45  ? 12  LYS B CA  1 
ATOM   2728  C  C   . LYS B 1 12  ? 35.761  17.581  37.618  1.00 26.17  ? 12  LYS B C   1 
ATOM   2729  O  O   . LYS B 1 12  ? 34.678  17.169  38.046  1.00 26.62  ? 12  LYS B O   1 
ATOM   2730  C  CB  . LYS B 1 12  ? 35.438  19.826  36.472  1.00 31.51  ? 12  LYS B CB  1 
ATOM   2731  C  CG  . LYS B 1 12  ? 36.338  20.032  35.249  1.00 41.43  ? 12  LYS B CG  1 
ATOM   2732  C  CD  . LYS B 1 12  ? 37.388  21.155  35.451  1.00 42.97  ? 12  LYS B CD  1 
ATOM   2733  C  CE  . LYS B 1 12  ? 38.825  20.614  35.493  1.00 40.21  ? 12  LYS B CE  1 
ATOM   2734  N  NZ  . LYS B 1 12  ? 39.201  20.117  34.137  1.00 42.39  ? 12  LYS B NZ  1 
ATOM   2735  N  N   . GLU B 1 13  ? 36.699  16.760  37.155  1.00 24.39  ? 13  GLU B N   1 
ATOM   2736  C  CA  . GLU B 1 13  ? 36.481  15.294  37.121  1.00 24.79  ? 13  GLU B CA  1 
ATOM   2737  C  C   . GLU B 1 13  ? 37.805  14.570  37.305  1.00 21.78  ? 13  GLU B C   1 
ATOM   2738  O  O   . GLU B 1 13  ? 38.871  15.139  37.039  1.00 19.93  ? 13  GLU B O   1 
ATOM   2739  C  CB  . GLU B 1 13  ? 35.837  14.829  35.787  1.00 29.63  ? 13  GLU B CB  1 
ATOM   2740  C  CG  . GLU B 1 13  ? 34.352  15.191  35.610  1.00 40.01  ? 13  GLU B CG  1 
ATOM   2741  C  CD  . GLU B 1 13  ? 33.573  14.276  34.640  1.00 48.69  ? 13  GLU B CD  1 
ATOM   2742  O  OE1 . GLU B 1 13  ? 32.543  13.671  35.066  1.00 46.50  ? 13  GLU B OE1 1 
ATOM   2743  O  OE2 . GLU B 1 13  ? 33.983  14.157  33.448  1.00 54.10  ? 13  GLU B OE2 1 
ATOM   2744  N  N   . TRP B 1 14  ? 37.741  13.315  37.748  1.00 18.79  ? 14  TRP B N   1 
ATOM   2745  C  CA  . TRP B 1 14  ? 38.927  12.476  37.819  1.00 17.49  ? 14  TRP B CA  1 
ATOM   2746  C  C   . TRP B 1 14  ? 38.527  11.039  37.940  1.00 17.96  ? 14  TRP B C   1 
ATOM   2747  O  O   . TRP B 1 14  ? 37.386  10.735  38.318  1.00 19.16  ? 14  TRP B O   1 
ATOM   2748  C  CB  . TRP B 1 14  ? 39.868  12.930  38.955  1.00 15.76  ? 14  TRP B CB  1 
ATOM   2749  C  CG  . TRP B 1 14  ? 39.343  12.846  40.379  1.00 14.72  ? 14  TRP B CG  1 
ATOM   2750  C  CD1 . TRP B 1 14  ? 39.366  11.740  41.228  1.00 14.03  ? 14  TRP B CD1 1 
ATOM   2751  C  CD2 . TRP B 1 14  ? 38.703  13.919  41.180  1.00 14.05  ? 14  TRP B CD2 1 
ATOM   2752  N  NE1 . TRP B 1 14  ? 38.792  12.040  42.440  1.00 14.09  ? 14  TRP B NE1 1 
ATOM   2753  C  CE2 . TRP B 1 14  ? 38.386  13.325  42.486  1.00 14.07  ? 14  TRP B CE2 1 
ATOM   2754  C  CE3 . TRP B 1 14  ? 38.366  15.231  40.953  1.00 13.17  ? 14  TRP B CE3 1 
ATOM   2755  C  CZ2 . TRP B 1 14  ? 37.778  14.066  43.515  1.00 13.96  ? 14  TRP B CZ2 1 
ATOM   2756  C  CZ3 . TRP B 1 14  ? 37.751  15.958  41.999  1.00 13.74  ? 14  TRP B CZ3 1 
ATOM   2757  C  CH2 . TRP B 1 14  ? 37.476  15.395  43.244  1.00 12.78  ? 14  TRP B CH2 1 
ATOM   2758  N  N   . PRO B 1 15  ? 39.439  10.112  37.623  1.00 17.85  ? 15  PRO B N   1 
ATOM   2759  C  CA  . PRO B 1 15  ? 39.027  8.701   37.512  1.00 18.40  ? 15  PRO B CA  1 
ATOM   2760  C  C   . PRO B 1 15  ? 38.447  8.115   38.811  1.00 19.60  ? 15  PRO B C   1 
ATOM   2761  O  O   . PRO B 1 15  ? 38.609  8.671   39.886  1.00 21.40  ? 15  PRO B O   1 
ATOM   2762  C  CB  . PRO B 1 15  ? 40.341  7.986   37.155  1.00 18.92  ? 15  PRO B CB  1 
ATOM   2763  C  CG  . PRO B 1 15  ? 41.257  9.063   36.643  1.00 18.83  ? 15  PRO B CG  1 
ATOM   2764  C  CD  . PRO B 1 15  ? 40.893  10.277  37.460  1.00 17.96  ? 15  PRO B CD  1 
ATOM   2765  N  N   . ASP B 1 16  ? 37.732  7.018   38.708  1.00 21.24  ? 16  ASP B N   1 
ATOM   2766  C  CA  . ASP B 1 16  ? 37.235  6.296   39.868  1.00 22.41  ? 16  ASP B CA  1 
ATOM   2767  C  C   . ASP B 1 16  ? 38.459  5.697   40.563  1.00 20.93  ? 16  ASP B C   1 
ATOM   2768  O  O   . ASP B 1 16  ? 39.171  4.874   39.973  1.00 20.85  ? 16  ASP B O   1 
ATOM   2769  C  CB  . ASP B 1 16  ? 36.317  5.187   39.371  1.00 26.60  ? 16  ASP B CB  1 
ATOM   2770  C  CG  . ASP B 1 16  ? 35.626  4.431   40.505  1.00 32.73  ? 16  ASP B CG  1 
ATOM   2771  O  OD1 . ASP B 1 16  ? 36.305  3.857   41.415  1.00 34.08  ? 16  ASP B OD1 1 
ATOM   2772  O  OD2 . ASP B 1 16  ? 34.378  4.383   40.449  1.00 36.31  ? 16  ASP B OD2 1 
ATOM   2773  N  N   . LEU B 1 17  ? 38.748  6.121   41.793  1.00 18.50  ? 17  LEU B N   1 
ATOM   2774  C  CA  . LEU B 1 17  ? 40.020  5.729   42.378  1.00 17.82  ? 17  LEU B CA  1 
ATOM   2775  C  C   . LEU B 1 17  ? 39.965  4.338   42.993  1.00 17.48  ? 17  LEU B C   1 
ATOM   2776  O  O   . LEU B 1 17  ? 40.958  3.647   43.000  1.00 17.07  ? 17  LEU B O   1 
ATOM   2777  C  CB  . LEU B 1 17  ? 40.548  6.781   43.352  1.00 16.87  ? 17  LEU B CB  1 
ATOM   2778  C  CG  . LEU B 1 17  ? 40.654  8.180   42.757  1.00 17.01  ? 17  LEU B CG  1 
ATOM   2779  C  CD1 . LEU B 1 17  ? 41.100  9.137   43.841  1.00 16.99  ? 17  LEU B CD1 1 
ATOM   2780  C  CD2 . LEU B 1 17  ? 41.576  8.270   41.551  1.00 15.83  ? 17  LEU B CD2 1 
ATOM   2781  N  N   . LYS B 1 18  ? 38.808  3.960   43.509  1.00 18.09  ? 18  LYS B N   1 
ATOM   2782  C  CA  . LYS B 1 18  ? 38.586  2.652   44.070  1.00 21.48  ? 18  LYS B CA  1 
ATOM   2783  C  C   . LYS B 1 18  ? 38.915  1.602   43.015  1.00 23.74  ? 18  LYS B C   1 
ATOM   2784  O  O   . LYS B 1 18  ? 39.746  0.717   43.284  1.00 22.78  ? 18  LYS B O   1 
ATOM   2785  C  CB  . LYS B 1 18  ? 37.144  2.555   44.505  1.00 22.76  ? 18  LYS B CB  1 
ATOM   2786  C  CG  . LYS B 1 18  ? 36.798  1.257   45.197  1.00 26.19  ? 18  LYS B CG  1 
ATOM   2787  C  CD  . LYS B 1 18  ? 35.364  1.282   45.726  1.00 26.12  ? 18  LYS B CD  1 
ATOM   2788  C  CE  . LYS B 1 18  ? 35.199  0.216   46.830  1.00 31.10  ? 18  LYS B CE  1 
ATOM   2789  N  NZ  . LYS B 1 18  ? 35.986  -1.046  46.639  1.00 27.63  ? 18  LYS B NZ  1 
ATOM   2790  N  N   . LYS B 1 19  ? 38.315  1.753   41.811  1.00 25.04  ? 19  LYS B N   1 
ATOM   2791  C  CA  . LYS B 1 19  ? 38.649  0.969   40.619  1.00 27.95  ? 19  LYS B CA  1 
ATOM   2792  C  C   . LYS B 1 19  ? 40.126  1.095   40.234  1.00 29.03  ? 19  LYS B C   1 
ATOM   2793  O  O   . LYS B 1 19  ? 40.782  0.072   40.014  1.00 30.63  ? 19  LYS B O   1 
ATOM   2794  C  CB  . LYS B 1 19  ? 37.845  1.430   39.395  1.00 32.94  ? 19  LYS B CB  1 
ATOM   2795  C  CG  . LYS B 1 19  ? 36.343  1.185   39.385  1.00 36.84  ? 19  LYS B CG  1 
ATOM   2796  C  CD  . LYS B 1 19  ? 35.832  1.518   37.976  1.00 42.59  ? 19  LYS B CD  1 
ATOM   2797  C  CE  . LYS B 1 19  ? 34.450  2.168   37.958  1.00 45.63  ? 19  LYS B CE  1 
ATOM   2798  N  NZ  . LYS B 1 19  ? 33.342  1.199   38.244  1.00 48.55  ? 19  LYS B NZ  1 
ATOM   2799  N  N   . ARG B 1 20  ? 40.645  2.325   40.125  1.00 25.04  ? 20  ARG B N   1 
ATOM   2800  C  CA  . ARG B 1 20  ? 42.021  2.496   39.664  1.00 27.25  ? 20  ARG B CA  1 
ATOM   2801  C  C   . ARG B 1 20  ? 43.016  1.782   40.574  1.00 28.24  ? 20  ARG B C   1 
ATOM   2802  O  O   . ARG B 1 20  ? 43.986  1.203   40.099  1.00 31.53  ? 20  ARG B O   1 
ATOM   2803  C  CB  . ARG B 1 20  ? 42.424  3.995   39.481  1.00 29.77  ? 20  ARG B CB  1 
ATOM   2804  C  CG  . ARG B 1 20  ? 43.894  4.237   39.069  1.00 31.99  ? 20  ARG B CG  1 
ATOM   2805  C  CD  . ARG B 1 20  ? 44.343  5.713   38.942  1.00 34.14  ? 20  ARG B CD  1 
ATOM   2806  N  NE  . ARG B 1 20  ? 43.938  6.208   37.635  1.00 36.22  ? 20  ARG B NE  1 
ATOM   2807  C  CZ  . ARG B 1 20  ? 44.589  7.062   36.855  1.00 35.16  ? 20  ARG B CZ  1 
ATOM   2808  N  NH1 . ARG B 1 20  ? 45.753  7.603   37.199  1.00 31.03  ? 20  ARG B NH1 1 
ATOM   2809  N  NH2 . ARG B 1 20  ? 44.037  7.353   35.681  1.00 36.07  ? 20  ARG B NH2 1 
ATOM   2810  N  N   . PHE B 1 21  ? 42.772  1.810   41.877  1.00 25.44  ? 21  PHE B N   1 
ATOM   2811  C  CA  . PHE B 1 21  ? 43.825  1.536   42.828  1.00 23.87  ? 21  PHE B CA  1 
ATOM   2812  C  C   . PHE B 1 21  ? 43.619  0.199   43.510  1.00 23.90  ? 21  PHE B C   1 
ATOM   2813  O  O   . PHE B 1 21  ? 44.574  -0.407  43.996  1.00 23.35  ? 21  PHE B O   1 
ATOM   2814  C  CB  . PHE B 1 21  ? 43.885  2.651   43.878  1.00 23.39  ? 21  PHE B CB  1 
ATOM   2815  C  CG  . PHE B 1 21  ? 44.475  3.943   43.373  1.00 22.35  ? 21  PHE B CG  1 
ATOM   2816  C  CD1 . PHE B 1 21  ? 43.924  5.157   43.748  1.00 20.59  ? 21  PHE B CD1 1 
ATOM   2817  C  CD2 . PHE B 1 21  ? 45.598  3.942   42.545  1.00 22.20  ? 21  PHE B CD2 1 
ATOM   2818  C  CE1 . PHE B 1 21  ? 44.475  6.346   43.317  1.00 20.39  ? 21  PHE B CE1 1 
ATOM   2819  C  CE2 . PHE B 1 21  ? 46.151  5.145   42.097  1.00 22.94  ? 21  PHE B CE2 1 
ATOM   2820  C  CZ  . PHE B 1 21  ? 45.579  6.346   42.479  1.00 20.68  ? 21  PHE B CZ  1 
ATOM   2821  N  N   . GLY B 1 22  ? 42.374  -0.257  43.546  1.00 23.07  ? 22  GLY B N   1 
ATOM   2822  C  CA  . GLY B 1 22  ? 42.088  -1.566  44.123  1.00 22.00  ? 22  GLY B CA  1 
ATOM   2823  C  C   . GLY B 1 22  ? 41.289  -1.546  45.410  1.00 21.30  ? 22  GLY B C   1 
ATOM   2824  O  O   . GLY B 1 22  ? 40.800  -2.589  45.848  1.00 22.02  ? 22  GLY B O   1 
ATOM   2825  N  N   . TYR B 1 23  ? 41.142  -0.382  46.042  1.00 18.18  ? 23  TYR B N   1 
ATOM   2826  C  CA  . TYR B 1 23  ? 40.599  -0.387  47.402  1.00 16.27  ? 23  TYR B CA  1 
ATOM   2827  C  C   . TYR B 1 23  ? 39.986  0.925   47.693  1.00 15.18  ? 23  TYR B C   1 
ATOM   2828  O  O   . TYR B 1 23  ? 40.384  1.926   47.099  1.00 16.88  ? 23  TYR B O   1 
ATOM   2829  C  CB  . TYR B 1 23  ? 41.693  -0.748  48.437  1.00 15.44  ? 23  TYR B CB  1 
ATOM   2830  C  CG  . TYR B 1 23  ? 42.952  0.103   48.319  1.00 14.73  ? 23  TYR B CG  1 
ATOM   2831  C  CD1 . TYR B 1 23  ? 43.060  1.315   49.008  1.00 14.84  ? 23  TYR B CD1 1 
ATOM   2832  C  CD2 . TYR B 1 23  ? 44.026  -0.295  47.533  1.00 13.86  ? 23  TYR B CD2 1 
ATOM   2833  C  CE1 . TYR B 1 23  ? 44.218  2.109   48.908  1.00 15.03  ? 23  TYR B CE1 1 
ATOM   2834  C  CE2 . TYR B 1 23  ? 45.160  0.505   47.391  1.00 14.11  ? 23  TYR B CE2 1 
ATOM   2835  C  CZ  . TYR B 1 23  ? 45.259  1.714   48.088  1.00 14.68  ? 23  TYR B CZ  1 
ATOM   2836  O  OH  . TYR B 1 23  ? 46.386  2.532   48.010  1.00 14.24  ? 23  TYR B OH  1 
ATOM   2837  N  N   . GLY B 1 24  ? 39.003  0.904   48.578  1.00 13.85  ? 24  GLY B N   1 
ATOM   2838  C  CA  . GLY B 1 24  ? 38.161  2.029   48.899  1.00 13.89  ? 24  GLY B CA  1 
ATOM   2839  C  C   . GLY B 1 24  ? 38.848  3.003   49.841  1.00 14.67  ? 24  GLY B C   1 
ATOM   2840  O  O   . GLY B 1 24  ? 39.967  2.727   50.321  1.00 14.58  ? 24  GLY B O   1 
ATOM   2841  N  N   . GLY B 1 25  ? 38.189  4.148   50.052  1.00 14.38  ? 25  GLY B N   1 
ATOM   2842  C  CA  . GLY B 1 25  ? 38.640  5.209   50.929  1.00 15.75  ? 25  GLY B CA  1 
ATOM   2843  C  C   . GLY B 1 25  ? 38.843  6.579   50.270  1.00 16.51  ? 25  GLY B C   1 
ATOM   2844  O  O   . GLY B 1 25  ? 39.092  7.582   50.965  1.00 17.19  ? 25  GLY B O   1 
ATOM   2845  N  N   . TRP B 1 26  ? 38.743  6.620   48.939  1.00 15.42  ? 26  TRP B N   1 
ATOM   2846  C  CA  . TRP B 1 26  ? 39.039  7.821   48.168  1.00 14.69  ? 26  TRP B CA  1 
ATOM   2847  C  C   . TRP B 1 26  ? 37.865  8.725   48.053  1.00 15.29  ? 26  TRP B C   1 
ATOM   2848  O  O   . TRP B 1 26  ? 36.737  8.345   48.333  1.00 15.02  ? 26  TRP B O   1 
ATOM   2849  C  CB  . TRP B 1 26  ? 39.479  7.433   46.799  1.00 13.44  ? 26  TRP B CB  1 
ATOM   2850  C  CG  . TRP B 1 26  ? 40.609  6.475   46.849  1.00 12.46  ? 26  TRP B CG  1 
ATOM   2851  C  CD1 . TRP B 1 26  ? 40.537  5.092   46.813  1.00 12.26  ? 26  TRP B CD1 1 
ATOM   2852  C  CD2 . TRP B 1 26  ? 42.038  6.781   46.977  1.00 12.19  ? 26  TRP B CD2 1 
ATOM   2853  N  NE1 . TRP B 1 26  ? 41.789  4.517   46.928  1.00 12.15  ? 26  TRP B NE1 1 
ATOM   2854  C  CE2 . TRP B 1 26  ? 42.741  5.463   47.008  1.00 12.10  ? 26  TRP B CE2 1 
ATOM   2855  C  CE3 . TRP B 1 26  ? 42.781  7.935   47.073  1.00 11.23  ? 26  TRP B CE3 1 
ATOM   2856  C  CZ2 . TRP B 1 26  ? 44.121  5.367   47.104  1.00 11.24  ? 26  TRP B CZ2 1 
ATOM   2857  C  CZ3 . TRP B 1 26  ? 44.172  7.816   47.162  1.00 11.20  ? 26  TRP B CZ3 1 
ATOM   2858  C  CH2 . TRP B 1 26  ? 44.819  6.565   47.162  1.00 10.98  ? 26  TRP B CH2 1 
ATOM   2859  N  N   . VAL B 1 27  ? 38.109  9.969   47.679  1.00 16.71  ? 27  VAL B N   1 
ATOM   2860  C  CA  . VAL B 1 27  ? 36.975  10.838  47.442  1.00 16.83  ? 27  VAL B CA  1 
ATOM   2861  C  C   . VAL B 1 27  ? 36.680  10.957  45.952  1.00 17.68  ? 27  VAL B C   1 
ATOM   2862  O  O   . VAL B 1 27  ? 37.566  10.803  45.106  1.00 18.36  ? 27  VAL B O   1 
ATOM   2863  C  CB  . VAL B 1 27  ? 37.040  12.145  48.265  1.00 17.25  ? 27  VAL B CB  1 
ATOM   2864  C  CG1 . VAL B 1 27  ? 38.204  12.124  49.246  1.00 16.08  ? 27  VAL B CG1 1 
ATOM   2865  C  CG2 . VAL B 1 27  ? 37.001  13.379  47.392  1.00 16.55  ? 27  VAL B CG2 1 
ATOM   2866  N  N   . GLN B 1 28  ? 35.415  11.138  45.633  1.00 18.42  ? 28  GLN B N   1 
ATOM   2867  C  CA  . GLN B 1 28  ? 35.055  11.379  44.270  1.00 19.88  ? 28  GLN B CA  1 
ATOM   2868  C  C   . GLN B 1 28  ? 34.259  12.613  44.286  1.00 21.01  ? 28  GLN B C   1 
ATOM   2869  O  O   . GLN B 1 28  ? 33.697  12.985  45.310  1.00 20.28  ? 28  GLN B O   1 
ATOM   2870  C  CB  . GLN B 1 28  ? 34.234  10.219  43.664  1.00 20.40  ? 28  GLN B CB  1 
ATOM   2871  C  CG  . GLN B 1 28  ? 34.961  8.855   43.628  1.00 20.42  ? 28  GLN B CG  1 
ATOM   2872  C  CD  . GLN B 1 28  ? 36.232  8.811   42.755  1.00 21.35  ? 28  GLN B CD  1 
ATOM   2873  O  OE1 . GLN B 1 28  ? 37.067  7.932   42.918  1.00 22.88  ? 28  GLN B OE1 1 
ATOM   2874  N  NE2 . GLN B 1 28  ? 36.375  9.749   41.833  1.00 21.86  ? 28  GLN B NE2 1 
ATOM   2875  N  N   . LEU B 1 29  ? 34.227  13.273  43.139  1.00 23.41  ? 29  LEU B N   1 
ATOM   2876  C  CA  . LEU B 1 29  ? 33.336  14.394  42.949  1.00 24.23  ? 29  LEU B CA  1 
ATOM   2877  C  C   . LEU B 1 29  ? 32.098  13.995  42.128  1.00 24.84  ? 29  LEU B C   1 
ATOM   2878  O  O   . LEU B 1 29  ? 32.222  13.466  41.035  1.00 24.63  ? 29  LEU B O   1 
ATOM   2879  C  CB  . LEU B 1 29  ? 34.101  15.506  42.243  1.00 23.12  ? 29  LEU B CB  1 
ATOM   2880  C  CG  . LEU B 1 29  ? 33.297  16.787  42.184  1.00 23.59  ? 29  LEU B CG  1 
ATOM   2881  C  CD1 . LEU B 1 29  ? 32.725  17.124  43.555  1.00 24.46  ? 29  LEU B CD1 1 
ATOM   2882  C  CD2 . LEU B 1 29  ? 34.209  17.884  41.696  1.00 23.37  ? 29  LEU B CD2 1 
ATOM   2883  N  N   . GLN B 1 30  ? 30.910  14.268  42.642  1.00 28.19  ? 30  GLN B N   1 
ATOM   2884  C  CA  . GLN B 1 30  ? 29.674  13.923  41.932  1.00 29.65  ? 30  GLN B CA  1 
ATOM   2885  C  C   . GLN B 1 30  ? 28.788  15.172  41.645  1.00 30.89  ? 30  GLN B C   1 
ATOM   2886  O  O   . GLN B 1 30  ? 28.326  15.859  42.559  1.00 30.14  ? 30  GLN B O   1 
ATOM   2887  C  CB  . GLN B 1 30  ? 28.936  12.840  42.718  1.00 30.93  ? 30  GLN B CB  1 
ATOM   2888  C  CG  . GLN B 1 30  ? 27.569  12.429  42.181  1.00 36.77  ? 30  GLN B CG  1 
ATOM   2889  C  CD  . GLN B 1 30  ? 26.809  11.549  43.170  1.00 40.83  ? 30  GLN B CD  1 
ATOM   2890  O  OE1 . GLN B 1 30  ? 26.300  12.019  44.213  1.00 41.15  ? 30  GLN B OE1 1 
ATOM   2891  N  NE2 . GLN B 1 30  ? 26.730  10.259  42.850  1.00 40.84  ? 30  GLN B NE2 1 
ATOM   2892  N  N   . HIS B 1 31  ? 28.597  15.478  40.365  1.00 32.98  ? 31  HIS B N   1 
ATOM   2893  C  CA  . HIS B 1 31  ? 27.698  16.549  39.916  1.00 35.39  ? 31  HIS B CA  1 
ATOM   2894  C  C   . HIS B 1 31  ? 26.258  16.120  39.985  1.00 38.45  ? 31  HIS B C   1 
ATOM   2895  O  O   . HIS B 1 31  ? 25.904  15.056  39.507  1.00 37.61  ? 31  HIS B O   1 
ATOM   2896  C  CB  . HIS B 1 31  ? 28.093  16.963  38.522  1.00 33.72  ? 31  HIS B CB  1 
ATOM   2897  C  CG  . HIS B 1 31  ? 29.516  17.430  38.446  1.00 35.51  ? 31  HIS B CG  1 
ATOM   2898  N  ND1 . HIS B 1 31  ? 29.878  18.702  38.727  1.00 35.77  ? 31  HIS B ND1 1 
ATOM   2899  C  CD2 . HIS B 1 31  ? 30.695  16.731  38.181  1.00 36.31  ? 31  HIS B CD2 1 
ATOM   2900  C  CE1 . HIS B 1 31  ? 31.218  18.822  38.611  1.00 36.45  ? 31  HIS B CE1 1 
ATOM   2901  N  NE2 . HIS B 1 31  ? 31.718  17.607  38.283  1.00 38.40  ? 31  HIS B NE2 1 
ATOM   2902  N  N   . HIS B 1 32  ? 25.401  16.905  40.625  1.00 47.05  ? 32  HIS B N   1 
ATOM   2903  C  CA  . HIS B 1 32  ? 24.028  16.433  40.817  1.00 53.33  ? 32  HIS B CA  1 
ATOM   2904  C  C   . HIS B 1 32  ? 22.939  17.377  40.335  1.00 54.57  ? 32  HIS B C   1 
ATOM   2905  O  O   . HIS B 1 32  ? 21.756  16.991  40.264  1.00 51.18  ? 32  HIS B O   1 
ATOM   2906  C  CB  . HIS B 1 32  ? 23.819  15.970  42.259  1.00 60.97  ? 32  HIS B CB  1 
ATOM   2907  C  CG  . HIS B 1 32  ? 23.529  17.090  43.220  1.00 73.47  ? 32  HIS B CG  1 
ATOM   2908  N  ND1 . HIS B 1 32  ? 24.470  17.965  43.619  1.00 80.74  ? 32  HIS B ND1 1 
ATOM   2909  C  CD2 . HIS B 1 32  ? 22.340  17.468  43.859  1.00 80.19  ? 32  HIS B CD2 1 
ATOM   2910  C  CE1 . HIS B 1 32  ? 23.917  18.857  44.473  1.00 85.13  ? 32  HIS B CE1 1 
ATOM   2911  N  NE2 . HIS B 1 32  ? 22.612  18.553  44.613  1.00 82.76  ? 32  HIS B NE2 1 
ATOM   2912  N  N   . SER B 1 33  ? 23.319  18.601  39.962  1.00 56.29  ? 33  SER B N   1 
ATOM   2913  C  CA  . SER B 1 33  ? 22.332  19.619  39.564  1.00 65.97  ? 33  SER B CA  1 
ATOM   2914  C  C   . SER B 1 33  ? 22.961  20.826  38.872  1.00 71.21  ? 33  SER B C   1 
ATOM   2915  O  O   . SER B 1 33  ? 24.150  20.808  38.518  1.00 73.62  ? 33  SER B O   1 
ATOM   2916  C  CB  . SER B 1 33  ? 21.522  20.106  40.791  1.00 67.96  ? 33  SER B CB  1 
ATOM   2917  O  OG  . SER B 1 33  ? 22.221  21.093  41.554  1.00 63.24  ? 33  SER B OG  1 
ATOM   2918  N  N   . LYS B 1 34  ? 22.135  21.864  38.698  1.00 71.29  ? 34  LYS B N   1 
ATOM   2919  C  CA  . LYS B 1 34  ? 22.546  23.196  38.250  1.00 68.02  ? 34  LYS B CA  1 
ATOM   2920  C  C   . LYS B 1 34  ? 23.613  23.813  39.179  1.00 66.75  ? 34  LYS B C   1 
ATOM   2921  O  O   . LYS B 1 34  ? 23.289  24.502  40.166  1.00 61.76  ? 34  LYS B O   1 
ATOM   2922  C  CB  . LYS B 1 34  ? 21.312  24.128  38.136  1.00 71.72  ? 34  LYS B CB  1 
ATOM   2923  C  CG  . LYS B 1 34  ? 20.803  24.430  36.718  1.00 69.82  ? 34  LYS B CG  1 
ATOM   2924  C  CD  . LYS B 1 34  ? 21.836  25.201  35.891  1.00 68.10  ? 34  LYS B CD  1 
ATOM   2925  C  CE  . LYS B 1 34  ? 21.229  26.323  35.050  1.00 65.37  ? 34  LYS B CE  1 
ATOM   2926  N  NZ  . LYS B 1 34  ? 20.733  25.879  33.716  1.00 64.73  ? 34  LYS B NZ  1 
ATOM   2927  N  N   . GLY B 1 35  ? 24.882  23.532  38.855  1.00 62.02  ? 35  GLY B N   1 
ATOM   2928  C  CA  . GLY B 1 35  ? 26.051  24.111  39.538  1.00 55.05  ? 35  GLY B CA  1 
ATOM   2929  C  C   . GLY B 1 35  ? 26.560  23.486  40.838  1.00 49.07  ? 35  GLY B C   1 
ATOM   2930  O  O   . GLY B 1 35  ? 27.629  23.855  41.322  1.00 47.75  ? 35  GLY B O   1 
ATOM   2931  N  N   . GLU B 1 36  ? 25.789  22.579  41.427  1.00 46.00  ? 36  GLU B N   1 
ATOM   2932  C  CA  . GLU B 1 36  ? 26.179  21.937  42.686  1.00 43.91  ? 36  GLU B CA  1 
ATOM   2933  C  C   . GLU B 1 36  ? 26.969  20.655  42.394  1.00 37.86  ? 36  GLU B C   1 
ATOM   2934  O  O   . GLU B 1 36  ? 26.872  20.083  41.315  1.00 35.51  ? 36  GLU B O   1 
ATOM   2935  C  CB  . GLU B 1 36  ? 24.946  21.588  43.526  1.00 49.91  ? 36  GLU B CB  1 
ATOM   2936  C  CG  . GLU B 1 36  ? 24.005  22.745  43.861  1.00 58.52  ? 36  GLU B CG  1 
ATOM   2937  C  CD  . GLU B 1 36  ? 23.980  23.127  45.353  1.00 65.18  ? 36  GLU B CD  1 
ATOM   2938  O  OE1 . GLU B 1 36  ? 24.224  22.259  46.227  1.00 62.23  ? 36  GLU B OE1 1 
ATOM   2939  O  OE2 . GLU B 1 36  ? 23.691  24.309  45.661  1.00 67.71  ? 36  GLU B OE2 1 
ATOM   2940  N  N   . ALA B 1 37  ? 27.757  20.217  43.361  1.00 31.51  ? 37  ALA B N   1 
ATOM   2941  C  CA  . ALA B 1 37  ? 28.399  18.931  43.285  1.00 28.01  ? 37  ALA B CA  1 
ATOM   2942  C  C   . ALA B 1 37  ? 28.622  18.443  44.690  1.00 27.41  ? 37  ALA B C   1 
ATOM   2943  O  O   . ALA B 1 37  ? 28.549  19.219  45.629  1.00 29.97  ? 37  ALA B O   1 
ATOM   2944  C  CB  . ALA B 1 37  ? 29.713  19.028  42.531  1.00 27.82  ? 37  ALA B CB  1 
ATOM   2945  N  N   . LYS B 1 38  ? 28.888  17.156  44.849  1.00 25.38  ? 38  LYS B N   1 
ATOM   2946  C  CA  . LYS B 1 38  ? 29.080  16.600  46.163  1.00 24.42  ? 38  LYS B CA  1 
ATOM   2947  C  C   . LYS B 1 38  ? 30.347  15.795  46.186  1.00 22.65  ? 38  LYS B C   1 
ATOM   2948  O  O   . LYS B 1 38  ? 30.587  14.998  45.286  1.00 21.96  ? 38  LYS B O   1 
ATOM   2949  C  CB  . LYS B 1 38  ? 27.913  15.723  46.550  1.00 25.30  ? 38  LYS B CB  1 
ATOM   2950  C  CG  . LYS B 1 38  ? 26.680  16.514  46.895  1.00 30.24  ? 38  LYS B CG  1 
ATOM   2951  C  CD  . LYS B 1 38  ? 25.513  15.565  47.034  1.00 36.66  ? 38  LYS B CD  1 
ATOM   2952  C  CE  . LYS B 1 38  ? 24.189  16.305  47.141  1.00 40.48  ? 38  LYS B CE  1 
ATOM   2953  N  NZ  . LYS B 1 38  ? 23.140  15.286  46.828  1.00 45.93  ? 38  LYS B NZ  1 
ATOM   2954  N  N   . LEU B 1 39  ? 31.160  16.046  47.203  1.00 20.24  ? 39  LEU B N   1 
ATOM   2955  C  CA  . LEU B 1 39  ? 32.325  15.238  47.468  1.00 20.64  ? 39  LEU B CA  1 
ATOM   2956  C  C   . LEU B 1 39  ? 31.907  14.076  48.328  1.00 21.66  ? 39  LEU B C   1 
ATOM   2957  O  O   . LEU B 1 39  ? 31.235  14.275  49.344  1.00 23.14  ? 39  LEU B O   1 
ATOM   2958  C  CB  . LEU B 1 39  ? 33.348  16.057  48.208  1.00 18.91  ? 39  LEU B CB  1 
ATOM   2959  C  CG  . LEU B 1 39  ? 34.178  17.006  47.407  1.00 18.29  ? 39  LEU B CG  1 
ATOM   2960  C  CD1 . LEU B 1 39  ? 35.138  17.652  48.408  1.00 18.30  ? 39  LEU B CD1 1 
ATOM   2961  C  CD2 . LEU B 1 39  ? 34.929  16.248  46.312  1.00 17.55  ? 39  LEU B CD2 1 
ATOM   2962  N  N   . LEU B 1 40  ? 32.250  12.870  47.898  1.00 21.65  ? 40  LEU B N   1 
ATOM   2963  C  CA  . LEU B 1 40  ? 31.811  11.661  48.579  1.00 24.48  ? 40  LEU B CA  1 
ATOM   2964  C  C   . LEU B 1 40  ? 33.045  10.878  48.973  1.00 26.10  ? 40  LEU B C   1 
ATOM   2965  O  O   . LEU B 1 40  ? 34.005  10.787  48.184  1.00 25.96  ? 40  LEU B O   1 
ATOM   2966  C  CB  . LEU B 1 40  ? 30.958  10.752  47.652  1.00 24.10  ? 40  LEU B CB  1 
ATOM   2967  C  CG  . LEU B 1 40  ? 29.869  11.259  46.714  1.00 22.94  ? 40  LEU B CG  1 
ATOM   2968  C  CD1 . LEU B 1 40  ? 29.196  10.087  46.014  1.00 22.90  ? 40  LEU B CD1 1 
ATOM   2969  C  CD2 . LEU B 1 40  ? 28.857  11.999  47.523  1.00 22.46  ? 40  LEU B CD2 1 
ATOM   2970  N  N   . LYS B 1 41  ? 33.014  10.317  50.174  1.00 29.11  ? 41  LYS B N   1 
ATOM   2971  C  CA  . LYS B 1 41  ? 34.067  9.408   50.645  1.00 37.20  ? 41  LYS B CA  1 
ATOM   2972  C  C   . LYS B 1 41  ? 33.524  7.959   50.769  1.00 38.20  ? 41  LYS B C   1 
ATOM   2973  O  O   . LYS B 1 41  ? 32.882  7.576   51.738  1.00 36.11  ? 41  LYS B O   1 
ATOM   2974  C  CB  . LYS B 1 41  ? 34.716  9.921   51.929  1.00 39.66  ? 41  LYS B CB  1 
ATOM   2975  C  CG  . LYS B 1 41  ? 36.083  9.324   52.210  1.00 45.90  ? 41  LYS B CG  1 
ATOM   2976  C  CD  . LYS B 1 41  ? 36.430  9.410   53.695  1.00 54.95  ? 41  LYS B CD  1 
ATOM   2977  C  CE  . LYS B 1 41  ? 36.808  10.826  54.134  1.00 58.28  ? 41  LYS B CE  1 
ATOM   2978  N  NZ  . LYS B 1 41  ? 38.291  10.972  54.272  1.00 59.80  ? 41  LYS B NZ  1 
ATOM   2979  N  N   . ASP B 1 42  ? 33.790  7.189   49.725  1.00 42.94  ? 42  ASP B N   1 
ATOM   2980  C  CA  . ASP B 1 42  ? 33.136  5.908   49.459  1.00 50.20  ? 42  ASP B CA  1 
ATOM   2981  C  C   . ASP B 1 42  ? 31.581  5.954   49.567  1.00 51.73  ? 42  ASP B C   1 
ATOM   2982  O  O   . ASP B 1 42  ? 30.949  5.268   50.394  1.00 55.95  ? 42  ASP B O   1 
ATOM   2983  C  CB  . ASP B 1 42  ? 33.788  4.767   50.263  1.00 49.97  ? 42  ASP B CB  1 
ATOM   2984  C  CG  . ASP B 1 42  ? 33.953  3.517   49.436  1.00 49.61  ? 42  ASP B CG  1 
ATOM   2985  O  OD1 . ASP B 1 42  ? 35.095  3.199   49.069  1.00 47.84  ? 42  ASP B OD1 1 
ATOM   2986  O  OD2 . ASP B 1 42  ? 32.934  2.866   49.122  1.00 55.05  ? 42  ASP B OD2 1 
ATOM   2987  N  N   . GLY B 1 43  ? 30.975  6.773   48.714  1.00 45.23  ? 43  GLY B N   1 
ATOM   2988  C  CA  . GLY B 1 43  ? 29.513  6.825   48.632  1.00 42.16  ? 43  GLY B CA  1 
ATOM   2989  C  C   . GLY B 1 43  ? 28.777  7.682   49.653  1.00 37.59  ? 43  GLY B C   1 
ATOM   2990  O  O   . GLY B 1 43  ? 27.596  8.019   49.439  1.00 36.02  ? 43  GLY B O   1 
ATOM   2991  N  N   . LYS B 1 44  ? 29.442  8.026   50.762  1.00 34.58  ? 44  LYS B N   1 
ATOM   2992  C  CA  . LYS B 1 44  ? 28.834  8.941   51.735  1.00 32.38  ? 44  LYS B CA  1 
ATOM   2993  C  C   . LYS B 1 44  ? 29.236  10.395  51.460  1.00 28.49  ? 44  LYS B C   1 
ATOM   2994  O  O   . LYS B 1 44  ? 30.405  10.709  51.232  1.00 26.47  ? 44  LYS B O   1 
ATOM   2995  C  CB  . LYS B 1 44  ? 29.136  8.537   53.193  1.00 35.72  ? 44  LYS B CB  1 
ATOM   2996  C  CG  . LYS B 1 44  ? 28.465  9.480   54.221  1.00 41.60  ? 44  LYS B CG  1 
ATOM   2997  C  CD  . LYS B 1 44  ? 28.618  9.087   55.697  1.00 44.47  ? 44  LYS B CD  1 
ATOM   2998  C  CE  . LYS B 1 44  ? 27.919  7.770   56.017  1.00 51.38  ? 44  LYS B CE  1 
ATOM   2999  N  NZ  . LYS B 1 44  ? 28.233  7.216   57.373  1.00 52.16  ? 44  LYS B NZ  1 
ATOM   3000  N  N   . VAL B 1 45  ? 28.258  11.279  51.499  1.00 28.30  ? 45  VAL B N   1 
ATOM   3001  C  CA  . VAL B 1 45  ? 28.489  12.691  51.240  1.00 30.03  ? 45  VAL B CA  1 
ATOM   3002  C  C   . VAL B 1 45  ? 29.198  13.235  52.451  1.00 33.66  ? 45  VAL B C   1 
ATOM   3003  O  O   . VAL B 1 45  ? 28.824  12.881  53.571  1.00 39.46  ? 45  VAL B O   1 
ATOM   3004  C  CB  . VAL B 1 45  ? 27.156  13.452  51.061  1.00 28.81  ? 45  VAL B CB  1 
ATOM   3005  C  CG1 . VAL B 1 45  ? 27.353  14.967  51.153  1.00 29.23  ? 45  VAL B CG1 1 
ATOM   3006  C  CG2 . VAL B 1 45  ? 26.512  13.074  49.731  1.00 28.65  ? 45  VAL B CG2 1 
ATOM   3007  N  N   . PHE B 1 46  ? 30.215  14.071  52.257  1.00 32.65  ? 46  PHE B N   1 
ATOM   3008  C  CA  . PHE B 1 46  ? 30.804  14.733  53.408  1.00 34.56  ? 46  PHE B CA  1 
ATOM   3009  C  C   . PHE B 1 46  ? 31.039  16.218  53.221  1.00 30.06  ? 46  PHE B C   1 
ATOM   3010  O  O   . PHE B 1 46  ? 31.489  16.867  54.149  1.00 30.97  ? 46  PHE B O   1 
ATOM   3011  C  CB  . PHE B 1 46  ? 32.092  14.035  53.875  1.00 38.05  ? 46  PHE B CB  1 
ATOM   3012  C  CG  . PHE B 1 46  ? 33.265  14.295  52.972  1.00 38.11  ? 46  PHE B CG  1 
ATOM   3013  C  CD1 . PHE B 1 46  ? 33.980  15.490  53.068  1.00 36.15  ? 46  PHE B CD1 1 
ATOM   3014  C  CD2 . PHE B 1 46  ? 33.642  13.346  52.023  1.00 37.39  ? 46  PHE B CD2 1 
ATOM   3015  C  CE1 . PHE B 1 46  ? 35.042  15.752  52.230  1.00 37.58  ? 46  PHE B CE1 1 
ATOM   3016  C  CE2 . PHE B 1 46  ? 34.723  13.586  51.189  1.00 39.76  ? 46  PHE B CE2 1 
ATOM   3017  C  CZ  . PHE B 1 46  ? 35.429  14.795  51.296  1.00 38.53  ? 46  PHE B CZ  1 
ATOM   3018  N  N   . ARG B 1 47  ? 30.713  16.738  52.047  1.00 27.12  ? 47  ARG B N   1 
ATOM   3019  C  CA  . ARG B 1 47  ? 30.783  18.150  51.764  1.00 24.63  ? 47  ARG B CA  1 
ATOM   3020  C  C   . ARG B 1 47  ? 30.075  18.440  50.450  1.00 24.10  ? 47  ARG B C   1 
ATOM   3021  O  O   . ARG B 1 47  ? 30.087  17.599  49.557  1.00 26.37  ? 47  ARG B O   1 
ATOM   3022  C  CB  . ARG B 1 47  ? 32.238  18.605  51.710  1.00 25.75  ? 47  ARG B CB  1 
ATOM   3023  C  CG  . ARG B 1 47  ? 32.419  20.063  51.356  1.00 26.94  ? 47  ARG B CG  1 
ATOM   3024  C  CD  . ARG B 1 47  ? 33.847  20.534  51.559  1.00 27.67  ? 47  ARG B CD  1 
ATOM   3025  N  NE  . ARG B 1 47  ? 33.928  21.222  52.837  1.00 29.05  ? 47  ARG B NE  1 
ATOM   3026  C  CZ  . ARG B 1 47  ? 35.025  21.706  53.379  1.00 30.76  ? 47  ARG B CZ  1 
ATOM   3027  N  NH1 . ARG B 1 47  ? 36.198  21.592  52.767  1.00 34.08  ? 47  ARG B NH1 1 
ATOM   3028  N  NH2 . ARG B 1 47  ? 34.942  22.296  54.553  1.00 34.90  ? 47  ARG B NH2 1 
ATOM   3029  N  N   . VAL B 1 48  ? 29.422  19.604  50.350  1.00 23.37  ? 48  VAL B N   1 
ATOM   3030  C  CA  . VAL B 1 48  ? 28.750  20.050  49.125  1.00 22.93  ? 48  VAL B CA  1 
ATOM   3031  C  C   . VAL B 1 48  ? 29.449  21.294  48.628  1.00 23.04  ? 48  VAL B C   1 
ATOM   3032  O  O   . VAL B 1 48  ? 29.719  22.210  49.394  1.00 21.65  ? 48  VAL B O   1 
ATOM   3033  C  CB  . VAL B 1 48  ? 27.261  20.419  49.336  1.00 24.47  ? 48  VAL B CB  1 
ATOM   3034  C  CG1 . VAL B 1 48  ? 26.693  21.127  48.100  1.00 24.34  ? 48  VAL B CG1 1 
ATOM   3035  C  CG2 . VAL B 1 48  ? 26.429  19.199  49.722  1.00 23.64  ? 48  VAL B CG2 1 
ATOM   3036  N  N   . VAL B 1 49  ? 29.760  21.318  47.342  1.00 22.83  ? 49  VAL B N   1 
ATOM   3037  C  CA  . VAL B 1 49  ? 30.521  22.425  46.813  1.00 22.95  ? 49  VAL B CA  1 
ATOM   3038  C  C   . VAL B 1 49  ? 29.820  22.966  45.581  1.00 24.19  ? 49  VAL B C   1 
ATOM   3039  O  O   . VAL B 1 49  ? 28.840  22.384  45.105  1.00 23.78  ? 49  VAL B O   1 
ATOM   3040  C  CB  . VAL B 1 49  ? 32.006  22.029  46.534  1.00 22.72  ? 49  VAL B CB  1 
ATOM   3041  C  CG1 . VAL B 1 49  ? 32.622  21.352  47.748  1.00 20.47  ? 49  VAL B CG1 1 
ATOM   3042  C  CG2 . VAL B 1 49  ? 32.141  21.138  45.293  1.00 22.75  ? 49  VAL B CG2 1 
ATOM   3043  N  N   . ARG B 1 50  ? 30.309  24.090  45.079  1.00 26.33  ? 50  ARG B N   1 
ATOM   3044  C  CA  . ARG B 1 50  ? 29.745  24.709  43.887  1.00 28.08  ? 50  ARG B CA  1 
ATOM   3045  C  C   . ARG B 1 50  ? 30.826  25.003  42.836  1.00 25.78  ? 50  ARG B C   1 
ATOM   3046  O  O   . ARG B 1 50  ? 32.011  24.847  43.072  1.00 22.86  ? 50  ARG B O   1 
ATOM   3047  C  CB  . ARG B 1 50  ? 29.006  25.982  44.280  1.00 34.02  ? 50  ARG B CB  1 
ATOM   3048  C  CG  . ARG B 1 50  ? 27.663  25.725  44.930  1.00 38.63  ? 50  ARG B CG  1 
ATOM   3049  C  CD  . ARG B 1 50  ? 27.275  26.875  45.826  1.00 47.73  ? 50  ARG B CD  1 
ATOM   3050  N  NE  . ARG B 1 50  ? 27.795  26.639  47.173  1.00 55.69  ? 50  ARG B NE  1 
ATOM   3051  C  CZ  . ARG B 1 50  ? 28.853  27.249  47.705  1.00 56.94  ? 50  ARG B CZ  1 
ATOM   3052  N  NH1 . ARG B 1 50  ? 29.525  28.179  47.012  1.00 55.77  ? 50  ARG B NH1 1 
ATOM   3053  N  NH2 . ARG B 1 50  ? 29.229  26.931  48.947  1.00 51.47  ? 50  ARG B NH2 1 
ATOM   3054  N  N   . GLU B 1 51  ? 30.373  25.441  41.682  1.00 24.56  ? 51  GLU B N   1 
ATOM   3055  C  CA  . GLU B 1 51  ? 31.185  25.758  40.549  1.00 25.99  ? 51  GLU B CA  1 
ATOM   3056  C  C   . GLU B 1 51  ? 32.582  26.380  40.819  1.00 23.44  ? 51  GLU B C   1 
ATOM   3057  O  O   . GLU B 1 51  ? 33.573  26.024  40.127  1.00 21.46  ? 51  GLU B O   1 
ATOM   3058  C  CB  . GLU B 1 51  ? 30.350  26.693  39.676  1.00 31.58  ? 51  GLU B CB  1 
ATOM   3059  C  CG  . GLU B 1 51  ? 30.715  26.674  38.206  1.00 42.19  ? 51  GLU B CG  1 
ATOM   3060  C  CD  . GLU B 1 51  ? 29.545  27.038  37.287  1.00 49.84  ? 51  GLU B CD  1 
ATOM   3061  O  OE1 . GLU B 1 51  ? 29.367  26.351  36.249  1.00 55.62  ? 51  GLU B OE1 1 
ATOM   3062  O  OE2 . GLU B 1 51  ? 28.801  28.003  37.600  1.00 55.87  ? 51  GLU B OE2 1 
ATOM   3063  N  N   . ASN B 1 52  ? 32.650  27.335  41.752  1.00 19.49  ? 52  ASN B N   1 
ATOM   3064  C  CA  . ASN B 1 52  ? 33.910  28.079  42.017  1.00 20.21  ? 52  ASN B CA  1 
ATOM   3065  C  C   . ASN B 1 52  ? 34.989  27.176  42.600  1.00 19.47  ? 52  ASN B C   1 
ATOM   3066  O  O   . ASN B 1 52  ? 36.157  27.520  42.608  1.00 18.38  ? 52  ASN B O   1 
ATOM   3067  C  CB  . ASN B 1 52  ? 33.688  29.281  42.941  1.00 19.80  ? 52  ASN B CB  1 
ATOM   3068  C  CG  . ASN B 1 52  ? 32.938  28.913  44.209  1.00 20.26  ? 52  ASN B CG  1 
ATOM   3069  O  OD1 . ASN B 1 52  ? 32.685  27.744  44.461  1.00 21.66  ? 52  ASN B OD1 1 
ATOM   3070  N  ND2 . ASN B 1 52  ? 32.578  29.904  45.010  1.00 19.51  ? 52  ASN B ND2 1 
ATOM   3071  N  N   . CYS B 1 53  ? 34.573  26.001  43.056  1.00 18.67  ? 53  CYS B N   1 
ATOM   3072  C  CA  . CYS B 1 53  ? 35.494  25.003  43.495  1.00 20.49  ? 53  CYS B CA  1 
ATOM   3073  C  C   . CYS B 1 53  ? 36.304  24.296  42.364  1.00 20.10  ? 53  CYS B C   1 
ATOM   3074  O  O   . CYS B 1 53  ? 37.395  23.756  42.612  1.00 18.29  ? 53  CYS B O   1 
ATOM   3075  C  CB  . CYS B 1 53  ? 34.762  23.988  44.363  1.00 22.71  ? 53  CYS B CB  1 
ATOM   3076  S  SG  . CYS B 1 53  ? 35.839  23.047  45.450  1.00 26.77  ? 53  CYS B SG  1 
ATOM   3077  N  N   . TRP B 1 54  ? 35.788  24.284  41.142  1.00 19.59  ? 54  TRP B N   1 
ATOM   3078  C  CA  . TRP B 1 54  ? 36.549  23.655  40.059  1.00 19.61  ? 54  TRP B CA  1 
ATOM   3079  C  C   . TRP B 1 54  ? 36.725  24.508  38.835  1.00 20.40  ? 54  TRP B C   1 
ATOM   3080  O  O   . TRP B 1 54  ? 37.684  24.285  38.069  1.00 21.27  ? 54  TRP B O   1 
ATOM   3081  C  CB  . TRP B 1 54  ? 36.023  22.272  39.708  1.00 18.98  ? 54  TRP B CB  1 
ATOM   3082  C  CG  . TRP B 1 54  ? 34.523  22.131  39.857  1.00 21.59  ? 54  TRP B CG  1 
ATOM   3083  C  CD1 . TRP B 1 54  ? 33.791  21.675  40.989  1.00 22.01  ? 54  TRP B CD1 1 
ATOM   3084  C  CD2 . TRP B 1 54  ? 33.527  22.466  38.872  1.00 20.83  ? 54  TRP B CD2 1 
ATOM   3085  N  NE1 . TRP B 1 54  ? 32.430  21.706  40.763  1.00 22.45  ? 54  TRP B NE1 1 
ATOM   3086  C  CE2 . TRP B 1 54  ? 32.199  22.167  39.497  1.00 24.01  ? 54  TRP B CE2 1 
ATOM   3087  C  CE3 . TRP B 1 54  ? 33.584  22.927  37.602  1.00 21.18  ? 54  TRP B CE3 1 
ATOM   3088  C  CZ2 . TRP B 1 54  ? 31.019  22.358  38.827  1.00 23.11  ? 54  TRP B CZ2 1 
ATOM   3089  C  CZ3 . TRP B 1 54  ? 32.390  23.126  36.924  1.00 25.32  ? 54  TRP B CZ3 1 
ATOM   3090  C  CH2 . TRP B 1 54  ? 31.140  22.854  37.519  1.00 27.98  ? 54  TRP B CH2 1 
ATOM   3091  N  N   . ASP B 1 55  ? 35.837  25.475  38.613  1.00 21.05  ? 55  ASP B N   1 
ATOM   3092  C  CA  . ASP B 1 55  ? 35.878  26.219  37.324  1.00 24.18  ? 55  ASP B CA  1 
ATOM   3093  C  C   . ASP B 1 55  ? 36.708  27.511  37.448  1.00 22.69  ? 55  ASP B C   1 
ATOM   3094  O  O   . ASP B 1 55  ? 36.373  28.403  38.204  1.00 20.58  ? 55  ASP B O   1 
ATOM   3095  C  CB  . ASP B 1 55  ? 34.462  26.483  36.749  1.00 26.54  ? 55  ASP B CB  1 
ATOM   3096  C  CG  . ASP B 1 55  ? 34.491  27.196  35.379  1.00 27.89  ? 55  ASP B CG  1 
ATOM   3097  O  OD1 . ASP B 1 55  ? 35.506  27.870  35.071  1.00 29.44  ? 55  ASP B OD1 1 
ATOM   3098  O  OD2 . ASP B 1 55  ? 33.495  27.085  34.597  1.00 28.14  ? 55  ASP B OD2 1 
ATOM   3099  N  N   . PRO B 1 56  ? 37.815  27.593  36.714  1.00 24.04  ? 56  PRO B N   1 
ATOM   3100  C  CA  . PRO B 1 56  ? 38.699  28.736  36.894  1.00 22.48  ? 56  PRO B CA  1 
ATOM   3101  C  C   . PRO B 1 56  ? 38.066  30.075  36.491  1.00 22.81  ? 56  PRO B C   1 
ATOM   3102  O  O   . PRO B 1 56  ? 38.309  31.096  37.180  1.00 21.37  ? 56  PRO B O   1 
ATOM   3103  C  CB  . PRO B 1 56  ? 39.892  28.386  36.010  1.00 23.20  ? 56  PRO B CB  1 
ATOM   3104  C  CG  . PRO B 1 56  ? 39.867  26.886  35.963  1.00 25.44  ? 56  PRO B CG  1 
ATOM   3105  C  CD  . PRO B 1 56  ? 38.397  26.591  35.808  1.00 23.52  ? 56  PRO B CD  1 
ATOM   3106  N  N   . GLU B 1 57  ? 37.241  30.075  35.432  1.00 23.63  ? 57  GLU B N   1 
ATOM   3107  C  CA  . GLU B 1 57  ? 36.494  31.275  35.006  1.00 24.47  ? 57  GLU B CA  1 
ATOM   3108  C  C   . GLU B 1 57  ? 35.544  31.825  36.040  1.00 21.57  ? 57  GLU B C   1 
ATOM   3109  O  O   . GLU B 1 57  ? 35.470  33.034  36.246  1.00 20.13  ? 57  GLU B O   1 
ATOM   3110  C  CB  . GLU B 1 57  ? 35.696  31.016  33.739  1.00 29.33  ? 57  GLU B CB  1 
ATOM   3111  C  CG  . GLU B 1 57  ? 36.528  31.201  32.497  1.00 38.63  ? 57  GLU B CG  1 
ATOM   3112  C  CD  . GLU B 1 57  ? 36.502  29.962  31.630  1.00 45.71  ? 57  GLU B CD  1 
ATOM   3113  O  OE1 . GLU B 1 57  ? 36.459  28.811  32.182  1.00 46.44  ? 57  GLU B OE1 1 
ATOM   3114  O  OE2 . GLU B 1 57  ? 36.520  30.158  30.392  1.00 51.06  ? 57  GLU B OE2 1 
ATOM   3115  N  N   . VAL B 1 58  ? 34.789  30.954  36.683  1.00 20.94  ? 58  VAL B N   1 
ATOM   3116  C  CA  . VAL B 1 58  ? 34.023  31.418  37.828  1.00 21.21  ? 58  VAL B CA  1 
ATOM   3117  C  C   . VAL B 1 58  ? 34.887  32.059  38.919  1.00 19.83  ? 58  VAL B C   1 
ATOM   3118  O  O   . VAL B 1 58  ? 34.575  33.175  39.333  1.00 22.35  ? 58  VAL B O   1 
ATOM   3119  C  CB  . VAL B 1 58  ? 33.095  30.348  38.346  1.00 23.07  ? 58  VAL B CB  1 
ATOM   3120  C  CG1 . VAL B 1 58  ? 32.220  30.898  39.486  1.00 24.23  ? 58  VAL B CG1 1 
ATOM   3121  C  CG2 . VAL B 1 58  ? 32.268  29.839  37.172  1.00 21.94  ? 58  VAL B CG2 1 
ATOM   3122  N  N   . ARG B 1 59  ? 35.999  31.440  39.309  1.00 17.26  ? 59  ARG B N   1 
ATOM   3123  C  CA  . ARG B 1 59  ? 36.880  32.057  40.333  1.00 17.43  ? 59  ARG B CA  1 
ATOM   3124  C  C   . ARG B 1 59  ? 37.399  33.443  39.970  1.00 17.08  ? 59  ARG B C   1 
ATOM   3125  O  O   . ARG B 1 59  ? 37.370  34.324  40.809  1.00 15.86  ? 59  ARG B O   1 
ATOM   3126  C  CB  . ARG B 1 59  ? 38.096  31.173  40.693  1.00 16.14  ? 59  ARG B CB  1 
ATOM   3127  C  CG  . ARG B 1 59  ? 37.724  29.938  41.476  1.00 16.19  ? 59  ARG B CG  1 
ATOM   3128  C  CD  . ARG B 1 59  ? 38.885  28.992  41.556  1.00 15.65  ? 59  ARG B CD  1 
ATOM   3129  N  NE  . ARG B 1 59  ? 39.722  29.199  42.725  1.00 14.71  ? 59  ARG B NE  1 
ATOM   3130  C  CZ  . ARG B 1 59  ? 39.657  28.433  43.810  1.00 14.69  ? 59  ARG B CZ  1 
ATOM   3131  N  NH1 . ARG B 1 59  ? 38.745  27.463  43.881  1.00 14.31  ? 59  ARG B NH1 1 
ATOM   3132  N  NH2 . ARG B 1 59  ? 40.473  28.660  44.847  1.00 14.21  ? 59  ARG B NH2 1 
ATOM   3133  N  N   . ILE B 1 60  ? 37.935  33.587  38.747  1.00 17.78  ? 60  ILE B N   1 
ATOM   3134  C  CA  . ILE B 1 60  ? 38.354  34.862  38.184  1.00 18.33  ? 60  ILE B CA  1 
ATOM   3135  C  C   . ILE B 1 60  ? 37.262  35.905  38.356  1.00 18.69  ? 60  ILE B C   1 
ATOM   3136  O  O   . ILE B 1 60  ? 37.542  37.025  38.782  1.00 16.83  ? 60  ILE B O   1 
ATOM   3137  C  CB  . ILE B 1 60  ? 38.686  34.763  36.680  1.00 18.47  ? 60  ILE B CB  1 
ATOM   3138  C  CG1 . ILE B 1 60  ? 39.996  34.011  36.450  1.00 19.70  ? 60  ILE B CG1 1 
ATOM   3139  C  CG2 . ILE B 1 60  ? 38.835  36.139  36.066  1.00 17.55  ? 60  ILE B CG2 1 
ATOM   3140  C  CD1 . ILE B 1 60  ? 41.166  34.604  37.194  1.00 20.34  ? 60  ILE B CD1 1 
ATOM   3141  N  N   . ARG B 1 61  ? 36.023  35.517  38.065  1.00 20.59  ? 61  ARG B N   1 
ATOM   3142  C  CA  . ARG B 1 61  ? 34.903  36.450  38.151  1.00 23.20  ? 61  ARG B CA  1 
ATOM   3143  C  C   . ARG B 1 61  ? 34.648  36.813  39.601  1.00 22.55  ? 61  ARG B C   1 
ATOM   3144  O  O   . ARG B 1 61  ? 34.470  37.991  39.919  1.00 23.03  ? 61  ARG B O   1 
ATOM   3145  C  CB  . ARG B 1 61  ? 33.627  35.884  37.525  1.00 28.40  ? 61  ARG B CB  1 
ATOM   3146  C  CG  . ARG B 1 61  ? 32.484  36.894  37.399  1.00 34.22  ? 61  ARG B CG  1 
ATOM   3147  C  CD  . ARG B 1 61  ? 31.170  36.175  37.177  1.00 40.86  ? 61  ARG B CD  1 
ATOM   3148  N  NE  . ARG B 1 61  ? 30.061  37.082  36.893  1.00 47.19  ? 61  ARG B NE  1 
ATOM   3149  C  CZ  . ARG B 1 61  ? 29.159  37.478  37.789  1.00 53.20  ? 61  ARG B CZ  1 
ATOM   3150  N  NH1 . ARG B 1 61  ? 29.234  37.064  39.057  1.00 53.98  ? 61  ARG B NH1 1 
ATOM   3151  N  NH2 . ARG B 1 61  ? 28.185  38.308  37.419  1.00 49.29  ? 61  ARG B NH2 1 
ATOM   3152  N  N   . GLU B 1 62  ? 34.668  35.837  40.500  1.00 20.27  ? 62  GLU B N   1 
ATOM   3153  C  CA  . GLU B 1 62  ? 34.502  36.201  41.905  1.00 21.10  ? 62  GLU B CA  1 
ATOM   3154  C  C   . GLU B 1 62  ? 35.716  36.983  42.453  1.00 21.22  ? 62  GLU B C   1 
ATOM   3155  O  O   . GLU B 1 62  ? 35.534  37.870  43.276  1.00 20.32  ? 62  GLU B O   1 
ATOM   3156  C  CB  . GLU B 1 62  ? 34.059  35.013  42.774  1.00 21.59  ? 62  GLU B CB  1 
ATOM   3157  C  CG  . GLU B 1 62  ? 32.971  34.187  42.081  1.00 22.74  ? 62  GLU B CG  1 
ATOM   3158  C  CD  . GLU B 1 62  ? 32.337  33.078  42.939  1.00 26.27  ? 62  GLU B CD  1 
ATOM   3159  O  OE1 . GLU B 1 62  ? 32.890  32.694  44.014  1.00 27.11  ? 62  GLU B OE1 1 
ATOM   3160  O  OE2 . GLU B 1 62  ? 31.252  32.578  42.525  1.00 26.47  ? 62  GLU B OE2 1 
ATOM   3161  N  N   . MET B 1 63  ? 36.928  36.721  41.950  1.00 20.80  ? 63  MET B N   1 
ATOM   3162  C  CA  . MET B 1 63  ? 38.118  37.473  42.411  1.00 21.26  ? 63  MET B CA  1 
ATOM   3163  C  C   . MET B 1 63  ? 38.120  38.926  41.980  1.00 21.79  ? 63  MET B C   1 
ATOM   3164  O  O   . MET B 1 63  ? 38.614  39.811  42.702  1.00 21.87  ? 63  MET B O   1 
ATOM   3165  C  CB  . MET B 1 63  ? 39.427  36.848  41.950  1.00 20.67  ? 63  MET B CB  1 
ATOM   3166  C  CG  . MET B 1 63  ? 39.808  35.485  42.547  1.00 21.51  ? 63  MET B CG  1 
ATOM   3167  S  SD  . MET B 1 63  ? 41.146  34.752  41.529  1.00 23.91  ? 63  MET B SD  1 
ATOM   3168  C  CE  . MET B 1 63  ? 40.546  33.117  41.734  1.00 25.01  ? 63  MET B CE  1 
ATOM   3169  N  N   . ASP B 1 64  ? 37.623  39.167  40.773  1.00 23.75  ? 64  ASP B N   1 
ATOM   3170  C  CA  . ASP B 1 64  ? 37.436  40.525  40.262  1.00 23.81  ? 64  ASP B CA  1 
ATOM   3171  C  C   . ASP B 1 64  ? 36.446  41.337  41.103  1.00 22.99  ? 64  ASP B C   1 
ATOM   3172  O  O   . ASP B 1 64  ? 36.781  42.414  41.509  1.00 22.82  ? 64  ASP B O   1 
ATOM   3173  C  CB  . ASP B 1 64  ? 36.996  40.468  38.817  1.00 26.23  ? 64  ASP B CB  1 
ATOM   3174  C  CG  . ASP B 1 64  ? 38.097  40.008  37.892  1.00 29.13  ? 64  ASP B CG  1 
ATOM   3175  O  OD1 . ASP B 1 64  ? 39.263  39.786  38.334  1.00 29.67  ? 64  ASP B OD1 1 
ATOM   3176  O  OD2 . ASP B 1 64  ? 37.790  39.871  36.694  1.00 30.97  ? 64  ASP B OD2 1 
ATOM   3177  N  N   . GLN B 1 65  ? 35.259  40.818  41.406  1.00 25.70  ? 65  GLN B N   1 
ATOM   3178  C  CA  . GLN B 1 65  ? 34.305  41.521  42.324  1.00 29.56  ? 65  GLN B CA  1 
ATOM   3179  C  C   . GLN B 1 65  ? 34.794  41.791  43.784  1.00 29.29  ? 65  GLN B C   1 
ATOM   3180  O  O   . GLN B 1 65  ? 34.314  42.710  44.443  1.00 32.45  ? 65  GLN B O   1 
ATOM   3181  C  CB  . GLN B 1 65  ? 32.921  40.836  42.314  1.00 35.61  ? 65  GLN B CB  1 
ATOM   3182  C  CG  . GLN B 1 65  ? 32.149  40.961  40.973  1.00 45.28  ? 65  GLN B CG  1 
ATOM   3183  C  CD  . GLN B 1 65  ? 31.002  39.937  40.765  1.00 54.94  ? 65  GLN B CD  1 
ATOM   3184  O  OE1 . GLN B 1 65  ? 30.982  38.841  41.369  1.00 56.59  ? 65  GLN B OE1 1 
ATOM   3185  N  NE2 . GLN B 1 65  ? 30.053  40.286  39.878  1.00 53.75  ? 65  GLN B NE2 1 
ATOM   3186  N  N   . LYS B 1 66  ? 35.741  40.993  44.281  1.00 28.40  ? 66  LYS B N   1 
ATOM   3187  C  CA  . LYS B 1 66  ? 36.280  41.104  45.635  1.00 26.15  ? 66  LYS B CA  1 
ATOM   3188  C  C   . LYS B 1 66  ? 37.627  41.808  45.689  1.00 24.03  ? 66  LYS B C   1 
ATOM   3189  O  O   . LYS B 1 66  ? 38.157  42.024  46.773  1.00 24.02  ? 66  LYS B O   1 
ATOM   3190  C  CB  . LYS B 1 66  ? 36.476  39.710  46.250  1.00 28.21  ? 66  LYS B CB  1 
ATOM   3191  C  CG  . LYS B 1 66  ? 35.257  38.807  46.305  1.00 30.98  ? 66  LYS B CG  1 
ATOM   3192  C  CD  . LYS B 1 66  ? 34.412  39.039  47.537  1.00 35.91  ? 66  LYS B CD  1 
ATOM   3193  C  CE  . LYS B 1 66  ? 33.090  38.287  47.452  1.00 38.71  ? 66  LYS B CE  1 
ATOM   3194  N  NZ  . LYS B 1 66  ? 31.993  39.120  48.043  1.00 39.37  ? 66  LYS B NZ  1 
ATOM   3195  N  N   . GLY B 1 67  ? 38.208  42.112  44.528  1.00 23.92  ? 67  GLY B N   1 
ATOM   3196  C  CA  . GLY B 1 67  ? 39.534  42.727  44.445  1.00 22.07  ? 67  GLY B CA  1 
ATOM   3197  C  C   . GLY B 1 67  ? 40.704  41.770  44.695  1.00 24.66  ? 67  GLY B C   1 
ATOM   3198  O  O   . GLY B 1 67  ? 41.807  42.220  44.995  1.00 24.69  ? 67  GLY B O   1 
ATOM   3199  N  N   . VAL B 1 68  ? 40.521  40.448  44.554  1.00 23.30  ? 68  VAL B N   1 
ATOM   3200  C  CA  . VAL B 1 68  ? 41.695  39.592  44.674  1.00 21.18  ? 68  VAL B CA  1 
ATOM   3201  C  C   . VAL B 1 68  ? 42.479  39.533  43.367  1.00 20.08  ? 68  VAL B C   1 
ATOM   3202  O  O   . VAL B 1 68  ? 41.960  39.201  42.319  1.00 20.34  ? 68  VAL B O   1 
ATOM   3203  C  CB  . VAL B 1 68  ? 41.404  38.201  45.313  1.00 21.98  ? 68  VAL B CB  1 
ATOM   3204  C  CG1 . VAL B 1 68  ? 42.664  37.336  45.365  1.00 19.45  ? 68  VAL B CG1 1 
ATOM   3205  C  CG2 . VAL B 1 68  ? 40.863  38.360  46.730  1.00 20.28  ? 68  VAL B CG2 1 
ATOM   3206  N  N   . THR B 1 69  ? 43.741  39.902  43.468  1.00 18.81  ? 69  THR B N   1 
ATOM   3207  C  CA  . THR B 1 69  ? 44.663  39.920  42.367  1.00 17.66  ? 69  THR B CA  1 
ATOM   3208  C  C   . THR B 1 69  ? 45.158  38.491  42.089  1.00 17.72  ? 69  THR B C   1 
ATOM   3209  O  O   . THR B 1 69  ? 45.028  38.023  40.946  1.00 17.02  ? 69  THR B O   1 
ATOM   3210  C  CB  . THR B 1 69  ? 45.868  40.819  42.708  1.00 18.30  ? 69  THR B CB  1 
ATOM   3211  O  OG1 . THR B 1 69  ? 45.405  42.072  43.228  1.00 19.21  ? 69  THR B OG1 1 
ATOM   3212  C  CG2 . THR B 1 69  ? 46.806  41.027  41.482  1.00 17.68  ? 69  THR B CG2 1 
ATOM   3213  N  N   . VAL B 1 70  ? 45.742  37.825  43.102  1.00 15.73  ? 70  VAL B N   1 
ATOM   3214  C  CA  . VAL B 1 70  ? 46.158  36.444  42.981  1.00 15.95  ? 70  VAL B CA  1 
ATOM   3215  C  C   . VAL B 1 70  ? 45.627  35.477  44.084  1.00 16.79  ? 70  VAL B C   1 
ATOM   3216  O  O   . VAL B 1 70  ? 45.447  35.872  45.248  1.00 18.49  ? 70  VAL B O   1 
ATOM   3217  C  CB  . VAL B 1 70  ? 47.688  36.217  42.531  1.00 17.13  ? 70  VAL B CB  1 
ATOM   3218  C  CG1 . VAL B 1 70  ? 48.541  37.457  42.234  1.00 16.03  ? 70  VAL B CG1 1 
ATOM   3219  C  CG2 . VAL B 1 70  ? 48.435  35.186  43.347  1.00 16.98  ? 70  VAL B CG2 1 
ATOM   3220  N  N   . GLN B 1 71  ? 45.313  34.240  43.694  1.00 15.97  ? 71  GLN B N   1 
ATOM   3221  C  CA  . GLN B 1 71  ? 45.145  33.120  44.627  1.00 15.58  ? 71  GLN B CA  1 
ATOM   3222  C  C   . GLN B 1 71  ? 46.229  32.115  44.416  1.00 14.11  ? 71  GLN B C   1 
ATOM   3223  O  O   . GLN B 1 71  ? 46.532  31.773  43.295  1.00 15.03  ? 71  GLN B O   1 
ATOM   3224  C  CB  . GLN B 1 71  ? 43.821  32.409  44.426  1.00 15.56  ? 71  GLN B CB  1 
ATOM   3225  C  CG  . GLN B 1 71  ? 42.587  33.214  44.777  1.00 16.53  ? 71  GLN B CG  1 
ATOM   3226  C  CD  . GLN B 1 71  ? 41.291  32.463  44.459  1.00 17.10  ? 71  GLN B CD  1 
ATOM   3227  O  OE1 . GLN B 1 71  ? 41.283  31.464  43.725  1.00 17.89  ? 71  GLN B OE1 1 
ATOM   3228  N  NE2 . GLN B 1 71  ? 40.195  32.932  45.018  1.00 17.91  ? 71  GLN B NE2 1 
ATOM   3229  N  N   . ALA B 1 72  ? 46.825  31.683  45.510  1.00 13.57  ? 72  ALA B N   1 
ATOM   3230  C  CA  . ALA B 1 72  ? 47.636  30.478  45.620  1.00 13.58  ? 72  ALA B CA  1 
ATOM   3231  C  C   . ALA B 1 72  ? 46.726  29.251  45.716  1.00 13.63  ? 72  ALA B C   1 
ATOM   3232  O  O   . ALA B 1 72  ? 45.958  29.089  46.652  1.00 15.41  ? 72  ALA B O   1 
ATOM   3233  C  CB  . ALA B 1 72  ? 48.538  30.545  46.826  1.00 12.28  ? 72  ALA B CB  1 
ATOM   3234  N  N   . LEU B 1 73  ? 46.812  28.395  44.737  1.00 12.45  ? 73  LEU B N   1 
ATOM   3235  C  CA  . LEU B 1 73  ? 45.853  27.349  44.625  1.00 12.70  ? 73  LEU B CA  1 
ATOM   3236  C  C   . LEU B 1 73  ? 46.468  26.055  45.158  1.00 12.96  ? 73  LEU B C   1 
ATOM   3237  O  O   . LEU B 1 73  ? 47.596  25.674  44.794  1.00 13.66  ? 73  LEU B O   1 
ATOM   3238  C  CB  . LEU B 1 73  ? 45.416  27.195  43.170  1.00 11.43  ? 73  LEU B CB  1 
ATOM   3239  C  CG  . LEU B 1 73  ? 44.575  28.233  42.402  1.00 10.83  ? 73  LEU B CG  1 
ATOM   3240  C  CD1 . LEU B 1 73  ? 44.368  27.749  40.968  1.00 10.06  ? 73  LEU B CD1 1 
ATOM   3241  C  CD2 . LEU B 1 73  ? 43.225  28.394  43.053  1.00 10.06  ? 73  LEU B CD2 1 
ATOM   3242  N  N   . SER B 1 74  ? 45.755  25.412  46.066  1.00 12.55  ? 74  SER B N   1 
ATOM   3243  C  CA  . SER B 1 74  ? 46.152  24.086  46.491  1.00 13.14  ? 74  SER B CA  1 
ATOM   3244  C  C   . SER B 1 74  ? 44.918  23.171  46.436  1.00 12.69  ? 74  SER B C   1 
ATOM   3245  O  O   . SER B 1 74  ? 43.763  23.662  46.300  1.00 11.40  ? 74  SER B O   1 
ATOM   3246  C  CB  . SER B 1 74  ? 46.729  24.140  47.906  1.00 13.74  ? 74  SER B CB  1 
ATOM   3247  O  OG  . SER B 1 74  ? 45.722  24.456  48.854  1.00 15.36  ? 74  SER B OG  1 
ATOM   3248  N  N   . THR B 1 75  ? 45.167  21.863  46.520  1.00 11.60  ? 75  THR B N   1 
ATOM   3249  C  CA  . THR B 1 75  ? 44.087  20.923  46.638  1.00 11.49  ? 75  THR B CA  1 
ATOM   3250  C  C   . THR B 1 75  ? 43.334  20.970  47.957  1.00 11.66  ? 75  THR B C   1 
ATOM   3251  O  O   . THR B 1 75  ? 43.774  21.535  48.960  1.00 12.74  ? 75  THR B O   1 
ATOM   3252  C  CB  . THR B 1 75  ? 44.528  19.476  46.334  1.00 11.78  ? 75  THR B CB  1 
ATOM   3253  O  OG1 . THR B 1 75  ? 43.349  18.664  46.140  1.00 11.14  ? 75  THR B OG1 1 
ATOM   3254  C  CG2 . THR B 1 75  ? 45.410  18.883  47.471  1.00 11.96  ? 75  THR B CG2 1 
ATOM   3255  N  N   . VAL B 1 76  ? 42.178  20.353  47.969  1.00 11.77  ? 76  VAL B N   1 
ATOM   3256  C  CA  . VAL B 1 76  ? 41.454  20.184  49.195  1.00 11.99  ? 76  VAL B CA  1 
ATOM   3257  C  C   . VAL B 1 76  ? 42.192  19.140  50.092  1.00 12.58  ? 76  VAL B C   1 
ATOM   3258  O  O   . VAL B 1 76  ? 42.518  18.022  49.646  1.00 12.49  ? 76  VAL B O   1 
ATOM   3259  C  CB  . VAL B 1 76  ? 40.001  19.783  48.863  1.00 12.50  ? 76  VAL B CB  1 
ATOM   3260  C  CG1 . VAL B 1 76  ? 39.145  19.603  50.127  1.00 12.33  ? 76  VAL B CG1 1 
ATOM   3261  C  CG2 . VAL B 1 76  ? 39.396  20.799  47.922  1.00 11.62  ? 76  VAL B CG2 1 
ATOM   3262  N  N   . PRO B 1 77  ? 42.478  19.504  51.355  1.00 12.31  ? 77  PRO B N   1 
ATOM   3263  C  CA  . PRO B 1 77  ? 43.275  18.675  52.265  1.00 13.00  ? 77  PRO B CA  1 
ATOM   3264  C  C   . PRO B 1 77  ? 42.844  17.202  52.391  1.00 13.92  ? 77  PRO B C   1 
ATOM   3265  O  O   . PRO B 1 77  ? 43.705  16.310  52.546  1.00 14.12  ? 77  PRO B O   1 
ATOM   3266  C  CB  . PRO B 1 77  ? 43.110  19.375  53.614  1.00 12.53  ? 77  PRO B CB  1 
ATOM   3267  C  CG  . PRO B 1 77  ? 42.765  20.771  53.258  1.00 11.93  ? 77  PRO B CG  1 
ATOM   3268  C  CD  . PRO B 1 77  ? 41.928  20.678  52.035  1.00 11.95  ? 77  PRO B CD  1 
ATOM   3269  N  N   . VAL B 1 78  ? 41.535  16.940  52.337  1.00 14.70  ? 78  VAL B N   1 
ATOM   3270  C  CA  . VAL B 1 78  ? 41.037  15.574  52.285  1.00 14.31  ? 78  VAL B CA  1 
ATOM   3271  C  C   . VAL B 1 78  ? 41.656  14.755  51.129  1.00 14.36  ? 78  VAL B C   1 
ATOM   3272  O  O   . VAL B 1 78  ? 41.675  13.521  51.211  1.00 14.64  ? 78  VAL B O   1 
ATOM   3273  C  CB  . VAL B 1 78  ? 39.493  15.541  52.269  1.00 15.27  ? 78  VAL B CB  1 
ATOM   3274  C  CG1 . VAL B 1 78  ? 38.922  16.002  50.925  1.00 16.76  ? 78  VAL B CG1 1 
ATOM   3275  C  CG2 . VAL B 1 78  ? 38.976  14.146  52.605  1.00 14.76  ? 78  VAL B CG2 1 
ATOM   3276  N  N   . MET B 1 79  ? 42.198  15.421  50.084  1.00 13.62  ? 79  MET B N   1 
ATOM   3277  C  CA  . MET B 1 79  ? 42.884  14.716  48.996  1.00 12.59  ? 79  MET B CA  1 
ATOM   3278  C  C   . MET B 1 79  ? 44.309  14.269  49.363  1.00 12.47  ? 79  MET B C   1 
ATOM   3279  O  O   . MET B 1 79  ? 44.929  13.495  48.590  1.00 12.45  ? 79  MET B O   1 
ATOM   3280  C  CB  . MET B 1 79  ? 42.962  15.571  47.713  1.00 13.20  ? 79  MET B CB  1 
ATOM   3281  C  CG  . MET B 1 79  ? 41.635  16.059  47.126  1.00 13.76  ? 79  MET B CG  1 
ATOM   3282  S  SD  . MET B 1 79  ? 40.408  14.737  46.936  1.00 15.19  ? 79  MET B SD  1 
ATOM   3283  C  CE  . MET B 1 79  ? 41.054  14.015  45.408  1.00 14.12  ? 79  MET B CE  1 
ATOM   3284  N  N   . PHE B 1 80  ? 44.864  14.751  50.479  1.00 11.64  ? 80  PHE B N   1 
ATOM   3285  C  CA  . PHE B 1 80  ? 46.223  14.315  50.873  1.00 12.95  ? 80  PHE B CA  1 
ATOM   3286  C  C   . PHE B 1 80  ? 46.443  12.783  50.743  1.00 13.40  ? 80  PHE B C   1 
ATOM   3287  O  O   . PHE B 1 80  ? 47.511  12.364  50.295  1.00 13.17  ? 80  PHE B O   1 
ATOM   3288  C  CB  . PHE B 1 80  ? 46.598  14.690  52.319  1.00 12.66  ? 80  PHE B CB  1 
ATOM   3289  C  CG  . PHE B 1 80  ? 46.723  16.160  52.586  1.00 13.40  ? 80  PHE B CG  1 
ATOM   3290  C  CD1 . PHE B 1 80  ? 47.052  17.085  51.563  1.00 12.68  ? 80  PHE B CD1 1 
ATOM   3291  C  CD2 . PHE B 1 80  ? 46.509  16.641  53.897  1.00 13.05  ? 80  PHE B CD2 1 
ATOM   3292  C  CE1 . PHE B 1 80  ? 47.136  18.427  51.843  1.00 12.37  ? 80  PHE B CE1 1 
ATOM   3293  C  CE2 . PHE B 1 80  ? 46.629  18.015  54.176  1.00 12.75  ? 80  PHE B CE2 1 
ATOM   3294  C  CZ  . PHE B 1 80  ? 46.939  18.895  53.149  1.00 12.68  ? 80  PHE B CZ  1 
ATOM   3295  N  N   . SER B 1 81  ? 45.483  11.963  51.204  1.00 13.15  ? 81  SER B N   1 
ATOM   3296  C  CA  . SER B 1 81  ? 45.602  10.501  51.049  1.00 14.99  ? 81  SER B CA  1 
ATOM   3297  C  C   . SER B 1 81  ? 46.933  9.878   51.597  1.00 14.93  ? 81  SER B C   1 
ATOM   3298  O  O   . SER B 1 81  ? 47.462  8.873   51.052  1.00 14.96  ? 81  SER B O   1 
ATOM   3299  C  CB  . SER B 1 81  ? 45.415  10.099  49.557  1.00 14.87  ? 81  SER B CB  1 
ATOM   3300  O  OG  . SER B 1 81  ? 44.498  10.981  48.920  1.00 14.53  ? 81  SER B OG  1 
ATOM   3301  N  N   . TYR B 1 82  ? 47.427  10.418  52.707  1.00 14.32  ? 82  TYR B N   1 
ATOM   3302  C  CA  . TYR B 1 82  ? 48.624  9.873   53.389  1.00 13.91  ? 82  TYR B CA  1 
ATOM   3303  C  C   . TYR B 1 82  ? 48.450  8.428   53.885  1.00 13.90  ? 82  TYR B C   1 
ATOM   3304  O  O   . TYR B 1 82  ? 49.406  7.666   54.004  1.00 14.82  ? 82  TYR B O   1 
ATOM   3305  C  CB  . TYR B 1 82  ? 48.991  10.789  54.555  1.00 12.85  ? 82  TYR B CB  1 
ATOM   3306  C  CG  . TYR B 1 82  ? 49.380  12.219  54.181  1.00 12.48  ? 82  TYR B CG  1 
ATOM   3307  C  CD1 . TYR B 1 82  ? 49.806  12.564  52.882  1.00 11.70  ? 82  TYR B CD1 1 
ATOM   3308  C  CD2 . TYR B 1 82  ? 49.389  13.213  55.146  1.00 11.68  ? 82  TYR B CD2 1 
ATOM   3309  C  CE1 . TYR B 1 82  ? 50.228  13.849  52.579  1.00 10.91  ? 82  TYR B CE1 1 
ATOM   3310  C  CE2 . TYR B 1 82  ? 49.799  14.487  54.840  1.00 11.45  ? 82  TYR B CE2 1 
ATOM   3311  C  CZ  . TYR B 1 82  ? 50.210  14.799  53.555  1.00 10.83  ? 82  TYR B CZ  1 
ATOM   3312  O  OH  . TYR B 1 82  ? 50.594  16.097  53.317  1.00 10.84  ? 82  TYR B OH  1 
ATOM   3313  N  N   . TRP B 1 83  ? 47.219  8.066   54.184  1.00 14.21  ? 83  TRP B N   1 
ATOM   3314  C  CA  . TRP B 1 83  ? 46.887  6.728   54.632  1.00 14.53  ? 83  TRP B CA  1 
ATOM   3315  C  C   . TRP B 1 83  ? 47.062  5.693   53.493  1.00 15.36  ? 83  TRP B C   1 
ATOM   3316  O  O   . TRP B 1 83  ? 47.141  4.486   53.738  1.00 14.17  ? 83  TRP B O   1 
ATOM   3317  C  CB  . TRP B 1 83  ? 45.439  6.736   55.160  1.00 14.09  ? 83  TRP B CB  1 
ATOM   3318  C  CG  . TRP B 1 83  ? 44.504  7.142   54.065  1.00 14.85  ? 83  TRP B CG  1 
ATOM   3319  C  CD1 . TRP B 1 83  ? 44.096  8.416   53.738  1.00 15.22  ? 83  TRP B CD1 1 
ATOM   3320  C  CD2 . TRP B 1 83  ? 43.910  6.283   53.020  1.00 14.46  ? 83  TRP B CD2 1 
ATOM   3321  N  NE1 . TRP B 1 83  ? 43.286  8.394   52.621  1.00 15.45  ? 83  TRP B NE1 1 
ATOM   3322  C  CE2 . TRP B 1 83  ? 43.152  7.174   52.140  1.00 14.06  ? 83  TRP B CE2 1 
ATOM   3323  C  CE3 . TRP B 1 83  ? 43.906  4.920   52.762  1.00 13.72  ? 83  TRP B CE3 1 
ATOM   3324  C  CZ2 . TRP B 1 83  ? 42.425  6.706   51.056  1.00 14.48  ? 83  TRP B CZ2 1 
ATOM   3325  C  CZ3 . TRP B 1 83  ? 43.185  4.454   51.653  1.00 13.86  ? 83  TRP B CZ3 1 
ATOM   3326  C  CH2 . TRP B 1 83  ? 42.440  5.325   50.834  1.00 14.18  ? 83  TRP B CH2 1 
ATOM   3327  N  N   . ALA B 1 84  ? 47.104  6.114   52.234  1.00 14.74  ? 84  ALA B N   1 
ATOM   3328  C  CA  . ALA B 1 84  ? 47.079  5.071   51.200  1.00 15.38  ? 84  ALA B CA  1 
ATOM   3329  C  C   . ALA B 1 84  ? 48.470  4.447   50.939  1.00 16.46  ? 84  ALA B C   1 
ATOM   3330  O  O   . ALA B 1 84  ? 49.454  4.824   51.605  1.00 16.74  ? 84  ALA B O   1 
ATOM   3331  C  CB  . ALA B 1 84  ? 46.439  5.599   49.927  1.00 14.20  ? 84  ALA B CB  1 
ATOM   3332  N  N   . LYS B 1 85  ? 48.549  3.476   50.026  1.00 17.19  ? 85  LYS B N   1 
ATOM   3333  C  CA  . LYS B 1 85  ? 49.849  2.969   49.569  1.00 19.96  ? 85  LYS B CA  1 
ATOM   3334  C  C   . LYS B 1 85  ? 50.672  4.102   48.943  1.00 19.89  ? 85  LYS B C   1 
ATOM   3335  O  O   . LYS B 1 85  ? 50.152  4.894   48.195  1.00 18.22  ? 85  LYS B O   1 
ATOM   3336  C  CB  . LYS B 1 85  ? 49.678  1.847   48.542  1.00 22.20  ? 85  LYS B CB  1 
ATOM   3337  C  CG  . LYS B 1 85  ? 48.856  0.669   49.042  1.00 24.12  ? 85  LYS B CG  1 
ATOM   3338  C  CD  . LYS B 1 85  ? 48.912  -0.462  48.029  1.00 26.44  ? 85  LYS B CD  1 
ATOM   3339  C  CE  . LYS B 1 85  ? 48.381  -1.779  48.587  1.00 29.19  ? 85  LYS B CE  1 
ATOM   3340  N  NZ  . LYS B 1 85  ? 47.867  -2.591  47.430  1.00 30.76  ? 85  LYS B NZ  1 
ATOM   3341  N  N   . PRO B 1 86  ? 51.969  4.177   49.273  1.00 21.64  ? 86  PRO B N   1 
ATOM   3342  C  CA  . PRO B 1 86  ? 52.857  5.172   48.723  1.00 21.59  ? 86  PRO B CA  1 
ATOM   3343  C  C   . PRO B 1 86  ? 52.731  5.414   47.215  1.00 22.99  ? 86  PRO B C   1 
ATOM   3344  O  O   . PRO B 1 86  ? 52.601  6.570   46.808  1.00 25.56  ? 86  PRO B O   1 
ATOM   3345  C  CB  . PRO B 1 86  ? 54.243  4.614   49.094  1.00 23.31  ? 86  PRO B CB  1 
ATOM   3346  C  CG  . PRO B 1 86  ? 54.016  3.967   50.421  1.00 21.93  ? 86  PRO B CG  1 
ATOM   3347  C  CD  . PRO B 1 86  ? 52.665  3.318   50.269  1.00 21.81  ? 86  PRO B CD  1 
ATOM   3348  N  N   . GLU B 1 87  ? 52.762  4.369   46.387  1.00 23.71  ? 87  GLU B N   1 
ATOM   3349  C  CA  . GLU B 1 87  ? 52.728  4.579   44.930  1.00 24.97  ? 87  GLU B CA  1 
ATOM   3350  C  C   . GLU B 1 87  ? 51.367  5.068   44.433  1.00 21.59  ? 87  GLU B C   1 
ATOM   3351  O  O   . GLU B 1 87  ? 51.277  5.752   43.435  1.00 19.93  ? 87  GLU B O   1 
ATOM   3352  C  CB  . GLU B 1 87  ? 53.188  3.348   44.131  1.00 30.00  ? 87  GLU B CB  1 
ATOM   3353  C  CG  . GLU B 1 87  ? 54.653  2.920   44.335  1.00 35.69  ? 87  GLU B CG  1 
ATOM   3354  C  CD  . GLU B 1 87  ? 55.718  3.836   43.700  1.00 43.80  ? 87  GLU B CD  1 
ATOM   3355  O  OE1 . GLU B 1 87  ? 55.504  4.393   42.573  1.00 46.12  ? 87  GLU B OE1 1 
ATOM   3356  O  OE2 . GLU B 1 87  ? 56.814  3.967   44.323  1.00 45.54  ? 87  GLU B OE2 1 
ATOM   3357  N  N   . ASP B 1 88  ? 50.303  4.706   45.126  1.00 19.66  ? 88  ASP B N   1 
ATOM   3358  C  CA  . ASP B 1 88  ? 48.991  5.197   44.767  1.00 17.92  ? 88  ASP B CA  1 
ATOM   3359  C  C   . ASP B 1 88  ? 48.802  6.661   45.121  1.00 17.17  ? 88  ASP B C   1 
ATOM   3360  O  O   . ASP B 1 88  ? 48.142  7.401   44.388  1.00 16.43  ? 88  ASP B O   1 
ATOM   3361  C  CB  . ASP B 1 88  ? 47.940  4.340   45.446  1.00 19.93  ? 88  ASP B CB  1 
ATOM   3362  C  CG  . ASP B 1 88  ? 48.009  2.885   45.003  1.00 20.55  ? 88  ASP B CG  1 
ATOM   3363  O  OD1 . ASP B 1 88  ? 48.651  2.627   43.951  1.00 22.02  ? 88  ASP B OD1 1 
ATOM   3364  O  OD2 . ASP B 1 88  ? 47.428  2.024   45.699  1.00 19.47  ? 88  ASP B OD2 1 
ATOM   3365  N  N   . THR B 1 89  ? 49.416  7.092   46.227  1.00 15.77  ? 89  THR B N   1 
ATOM   3366  C  CA  . THR B 1 89  ? 49.269  8.469   46.673  1.00 15.07  ? 89  THR B CA  1 
ATOM   3367  C  C   . THR B 1 89  ? 50.074  9.311   45.706  1.00 15.45  ? 89  THR B C   1 
ATOM   3368  O  O   . THR B 1 89  ? 49.587  10.389  45.329  1.00 15.49  ? 89  THR B O   1 
ATOM   3369  C  CB  . THR B 1 89  ? 49.725  8.664   48.149  1.00 14.13  ? 89  THR B CB  1 
ATOM   3370  O  OG1 . THR B 1 89  ? 48.980  7.780   49.000  1.00 13.36  ? 89  THR B OG1 1 
ATOM   3371  C  CG2 . THR B 1 89  ? 49.541  10.097  48.628  1.00 12.87  ? 89  THR B CG2 1 
ATOM   3372  N  N   . LEU B 1 90  ? 51.261  8.816   45.288  1.00 14.36  ? 90  LEU B N   1 
ATOM   3373  C  CA  . LEU B 1 90  ? 52.080  9.484   44.247  1.00 15.39  ? 90  LEU B CA  1 
ATOM   3374  C  C   . LEU B 1 90  ? 51.303  9.577   42.941  1.00 16.90  ? 90  LEU B C   1 
ATOM   3375  O  O   . LEU B 1 90  ? 51.334  10.595  42.250  1.00 19.31  ? 90  LEU B O   1 
ATOM   3376  C  CB  . LEU B 1 90  ? 53.408  8.758   43.984  1.00 15.71  ? 90  LEU B CB  1 
ATOM   3377  C  CG  . LEU B 1 90  ? 54.305  9.260   42.845  1.00 15.53  ? 90  LEU B CG  1 
ATOM   3378  C  CD1 . LEU B 1 90  ? 54.560  10.751  43.076  1.00 16.11  ? 90  LEU B CD1 1 
ATOM   3379  C  CD2 . LEU B 1 90  ? 55.641  8.505   42.652  1.00 14.03  ? 90  LEU B CD2 1 
ATOM   3380  N  N   . ASN B 1 91  ? 50.553  8.540   42.625  1.00 16.77  ? 91  ASN B N   1 
ATOM   3381  C  CA  . ASN B 1 91  ? 49.777  8.568   41.450  1.00 16.78  ? 91  ASN B CA  1 
ATOM   3382  C  C   . ASN B 1 91  ? 48.732  9.666   41.516  1.00 17.20  ? 91  ASN B C   1 
ATOM   3383  O  O   . ASN B 1 91  ? 48.574  10.452  40.590  1.00 16.95  ? 91  ASN B O   1 
ATOM   3384  C  CB  . ASN B 1 91  ? 49.149  7.218   41.190  1.00 17.80  ? 91  ASN B CB  1 
ATOM   3385  C  CG  . ASN B 1 91  ? 48.311  7.226   39.929  1.00 19.69  ? 91  ASN B CG  1 
ATOM   3386  O  OD1 . ASN B 1 91  ? 47.092  7.488   39.962  1.00 21.61  ? 91  ASN B OD1 1 
ATOM   3387  N  ND2 . ASN B 1 91  ? 48.953  6.997   38.816  1.00 17.98  ? 91  ASN B ND2 1 
ATOM   3388  N  N   . LEU B 1 92  ? 48.017  9.761   42.623  1.00 18.21  ? 92  LEU B N   1 
ATOM   3389  C  CA  . LEU B 1 92  ? 47.009  10.817  42.704  1.00 16.28  ? 92  LEU B CA  1 
ATOM   3390  C  C   . LEU B 1 92  ? 47.643  12.236  42.743  1.00 15.22  ? 92  LEU B C   1 
ATOM   3391  O  O   . LEU B 1 92  ? 47.105  13.179  42.155  1.00 14.00  ? 92  LEU B O   1 
ATOM   3392  C  CB  . LEU B 1 92  ? 46.109  10.564  43.901  1.00 16.63  ? 92  LEU B CB  1 
ATOM   3393  C  CG  . LEU B 1 92  ? 44.940  11.520  44.160  1.00 15.93  ? 92  LEU B CG  1 
ATOM   3394  C  CD1 . LEU B 1 92  ? 43.949  11.368  43.007  1.00 15.65  ? 92  LEU B CD1 1 
ATOM   3395  C  CD2 . LEU B 1 92  ? 44.323  11.137  45.496  1.00 15.70  ? 92  LEU B CD2 1 
ATOM   3396  N  N   . CYS B 1 93  ? 48.775  12.372  43.420  1.00 15.13  ? 93  CYS B N   1 
ATOM   3397  C  CA  . CYS B 1 93  ? 49.491  13.663  43.493  1.00 15.88  ? 93  CYS B CA  1 
ATOM   3398  C  C   . CYS B 1 93  ? 49.910  14.121  42.127  1.00 15.08  ? 93  CYS B C   1 
ATOM   3399  O  O   . CYS B 1 93  ? 49.826  15.312  41.874  1.00 15.89  ? 93  CYS B O   1 
ATOM   3400  C  CB  . CYS B 1 93  ? 50.743  13.628  44.397  1.00 16.51  ? 93  CYS B CB  1 
ATOM   3401  S  SG  . CYS B 1 93  ? 50.423  13.252  46.142  1.00 22.90  ? 93  CYS B SG  1 
ATOM   3402  N  N   . GLN B 1 94  ? 50.341  13.205  41.257  1.00 14.86  ? 94  GLN B N   1 
ATOM   3403  C  CA  . GLN B 1 94  ? 50.745  13.576  39.886  1.00 16.18  ? 94  GLN B CA  1 
ATOM   3404  C  C   . GLN B 1 94  ? 49.564  14.135  39.138  1.00 15.67  ? 94  GLN B C   1 
ATOM   3405  O  O   . GLN B 1 94  ? 49.641  15.246  38.572  1.00 17.25  ? 94  GLN B O   1 
ATOM   3406  C  CB  . GLN B 1 94  ? 51.436  12.434  39.115  1.00 17.10  ? 94  GLN B CB  1 
ATOM   3407  C  CG  . GLN B 1 94  ? 52.900  12.182  39.595  1.00 18.17  ? 94  GLN B CG  1 
ATOM   3408  C  CD  . GLN B 1 94  ? 53.468  10.749  39.304  1.00 18.99  ? 94  GLN B CD  1 
ATOM   3409  O  OE1 . GLN B 1 94  ? 52.728  9.761   39.128  1.00 18.31  ? 94  GLN B OE1 1 
ATOM   3410  N  NE2 . GLN B 1 94  ? 54.798  10.641  39.311  1.00 18.70  ? 94  GLN B NE2 1 
ATOM   3411  N  N   . LEU B 1 95  ? 48.454  13.418  39.197  1.00 14.79  ? 95  LEU B N   1 
ATOM   3412  C  CA  . LEU B 1 95  ? 47.227  13.880  38.601  1.00 14.66  ? 95  LEU B CA  1 
ATOM   3413  C  C   . LEU B 1 95  ? 46.781  15.271  39.149  1.00 15.41  ? 95  LEU B C   1 
ATOM   3414  O  O   . LEU B 1 95  ? 46.544  16.200  38.356  1.00 16.19  ? 95  LEU B O   1 
ATOM   3415  C  CB  . LEU B 1 95  ? 46.171  12.816  38.781  1.00 15.46  ? 95  LEU B CB  1 
ATOM   3416  C  CG  . LEU B 1 95  ? 44.888  12.981  37.970  1.00 17.17  ? 95  LEU B CG  1 
ATOM   3417  C  CD1 . LEU B 1 95  ? 44.241  11.603  37.823  1.00 17.80  ? 95  LEU B CD1 1 
ATOM   3418  C  CD2 . LEU B 1 95  ? 43.935  14.011  38.564  1.00 17.03  ? 95  LEU B CD2 1 
ATOM   3419  N  N   . LEU B 1 96  ? 46.734  15.451  40.479  1.00 14.26  ? 96  LEU B N   1 
ATOM   3420  C  CA  . LEU B 1 96  ? 46.312  16.747  41.062  1.00 13.30  ? 96  LEU B CA  1 
ATOM   3421  C  C   . LEU B 1 96  ? 47.263  17.898  40.757  1.00 12.31  ? 96  LEU B C   1 
ATOM   3422  O  O   . LEU B 1 96  ? 46.836  18.960  40.385  1.00 11.57  ? 96  LEU B O   1 
ATOM   3423  C  CB  . LEU B 1 96  ? 46.087  16.636  42.576  1.00 13.46  ? 96  LEU B CB  1 
ATOM   3424  C  CG  . LEU B 1 96  ? 44.908  15.698  42.906  1.00 14.34  ? 96  LEU B CG  1 
ATOM   3425  C  CD1 . LEU B 1 96  ? 44.745  15.472  44.403  1.00 13.64  ? 96  LEU B CD1 1 
ATOM   3426  C  CD2 . LEU B 1 96  ? 43.597  16.155  42.310  1.00 13.09  ? 96  LEU B CD2 1 
ATOM   3427  N  N   . ASN B 1 97  ? 48.557  17.680  40.909  1.00 11.67  ? 97  ASN B N   1 
ATOM   3428  C  CA  . ASN B 1 97  ? 49.516  18.663  40.530  1.00 11.31  ? 97  ASN B CA  1 
ATOM   3429  C  C   . ASN B 1 97  ? 49.474  19.074  39.052  1.00 12.63  ? 97  ASN B C   1 
ATOM   3430  O  O   . ASN B 1 97  ? 49.455  20.291  38.735  1.00 12.38  ? 97  ASN B O   1 
ATOM   3431  C  CB  . ASN B 1 97  ? 50.872  18.159  40.915  1.00 10.95  ? 97  ASN B CB  1 
ATOM   3432  C  CG  . ASN B 1 97  ? 51.065  18.182  42.408  1.00 11.10  ? 97  ASN B CG  1 
ATOM   3433  O  OD1 . ASN B 1 97  ? 50.391  18.938  43.108  1.00 11.77  ? 97  ASN B OD1 1 
ATOM   3434  N  ND2 . ASN B 1 97  ? 51.977  17.401  42.909  1.00 10.83  ? 97  ASN B ND2 1 
ATOM   3435  N  N   . ASN B 1 98  ? 49.434  18.085  38.147  1.00 13.19  ? 98  ASN B N   1 
ATOM   3436  C  CA  . ASN B 1 98  ? 49.291  18.377  36.714  1.00 13.87  ? 98  ASN B CA  1 
ATOM   3437  C  C   . ASN B 1 98  ? 48.098  19.246  36.408  1.00 13.76  ? 98  ASN B C   1 
ATOM   3438  O  O   . ASN B 1 98  ? 48.240  20.177  35.699  1.00 14.95  ? 98  ASN B O   1 
ATOM   3439  C  CB  . ASN B 1 98  ? 49.303  17.096  35.877  1.00 14.58  ? 98  ASN B CB  1 
ATOM   3440  C  CG  . ASN B 1 98  ? 50.664  16.406  35.937  1.00 15.40  ? 98  ASN B CG  1 
ATOM   3441  O  OD1 . ASN B 1 98  ? 51.660  17.041  36.297  1.00 16.55  ? 98  ASN B OD1 1 
ATOM   3442  N  ND2 . ASN B 1 98  ? 50.717  15.134  35.579  1.00 14.74  ? 98  ASN B ND2 1 
ATOM   3443  N  N   . ASP B 1 99  ? 46.969  19.011  37.047  1.00 14.99  ? 99  ASP B N   1 
ATOM   3444  C  CA  . ASP B 1 99  ? 45.755  19.826  36.862  1.00 17.33  ? 99  ASP B CA  1 
ATOM   3445  C  C   . ASP B 1 99  ? 45.844  21.267  37.454  1.00 17.69  ? 99  ASP B C   1 
ATOM   3446  O  O   . ASP B 1 99  ? 45.296  22.245  36.888  1.00 17.65  ? 99  ASP B O   1 
ATOM   3447  C  CB  . ASP B 1 99  ? 44.552  19.057  37.409  1.00 19.64  ? 99  ASP B CB  1 
ATOM   3448  C  CG  . ASP B 1 99  ? 43.279  19.834  37.338  1.00 23.87  ? 99  ASP B CG  1 
ATOM   3449  O  OD1 . ASP B 1 99  ? 42.549  19.749  36.293  1.00 28.98  ? 99  ASP B OD1 1 
ATOM   3450  O  OD2 . ASP B 1 99  ? 43.015  20.563  38.330  1.00 28.75  ? 99  ASP B OD2 1 
ATOM   3451  N  N   . LEU B 1 100 ? 46.549  21.395  38.575  1.00 17.00  ? 100 LEU B N   1 
ATOM   3452  C  CA  . LEU B 1 100 ? 46.980  22.711  39.061  1.00 16.61  ? 100 LEU B CA  1 
ATOM   3453  C  C   . LEU B 1 100 ? 47.848  23.430  38.013  1.00 15.57  ? 100 LEU B C   1 
ATOM   3454  O  O   . LEU B 1 100 ? 47.617  24.606  37.734  1.00 14.86  ? 100 LEU B O   1 
ATOM   3455  C  CB  . LEU B 1 100 ? 47.791  22.604  40.378  1.00 16.28  ? 100 LEU B CB  1 
ATOM   3456  C  CG  . LEU B 1 100 ? 47.267  23.293  41.621  1.00 17.95  ? 100 LEU B CG  1 
ATOM   3457  C  CD1 . LEU B 1 100 ? 45.782  22.953  41.814  1.00 18.39  ? 100 LEU B CD1 1 
ATOM   3458  C  CD2 . LEU B 1 100 ? 48.050  22.833  42.840  1.00 17.58  ? 100 LEU B CD2 1 
ATOM   3459  N  N   . ALA B 1 101 ? 48.848  22.740  37.460  1.00 14.59  ? 101 ALA B N   1 
ATOM   3460  C  CA  . ALA B 1 101 ? 49.711  23.404  36.473  1.00 14.74  ? 101 ALA B CA  1 
ATOM   3461  C  C   . ALA B 1 101 ? 48.972  23.933  35.215  1.00 14.89  ? 101 ALA B C   1 
ATOM   3462  O  O   . ALA B 1 101 ? 49.264  25.054  34.822  1.00 14.34  ? 101 ALA B O   1 
ATOM   3463  C  CB  . ALA B 1 101 ? 50.959  22.616  36.128  1.00 13.87  ? 101 ALA B CB  1 
ATOM   3464  N  N   . SER B 1 102 ? 48.018  23.176  34.624  1.00 14.37  ? 102 SER B N   1 
ATOM   3465  C  CA  . SER B 1 102 ? 47.192  23.780  33.575  1.00 14.70  ? 102 SER B CA  1 
ATOM   3466  C  C   . SER B 1 102 ? 46.389  24.974  33.988  1.00 13.67  ? 102 SER B C   1 
ATOM   3467  O  O   . SER B 1 102 ? 46.260  25.892  33.178  1.00 15.15  ? 102 SER B O   1 
ATOM   3468  C  CB  . SER B 1 102 ? 46.261  22.803  32.843  1.00 15.64  ? 102 SER B CB  1 
ATOM   3469  O  OG  . SER B 1 102 ? 45.888  21.834  33.745  1.00 21.90  ? 102 SER B OG  1 
ATOM   3470  N  N   . THR B 1 103 ? 45.780  24.983  35.173  1.00 12.64  ? 103 THR B N   1 
ATOM   3471  C  CA  . THR B 1 103 ? 45.042  26.190  35.579  1.00 12.88  ? 103 THR B CA  1 
ATOM   3472  C  C   . THR B 1 103 ? 45.987  27.405  35.609  1.00 12.30  ? 103 THR B C   1 
ATOM   3473  O  O   . THR B 1 103 ? 45.695  28.447  35.088  1.00 12.28  ? 103 THR B O   1 
ATOM   3474  C  CB  . THR B 1 103 ? 44.342  26.011  36.948  1.00 13.66  ? 103 THR B CB  1 
ATOM   3475  O  OG1 . THR B 1 103 ? 43.401  24.940  36.857  1.00 13.94  ? 103 THR B OG1 1 
ATOM   3476  C  CG2 . THR B 1 103 ? 43.597  27.267  37.353  1.00 12.96  ? 103 THR B CG2 1 
ATOM   3477  N  N   . VAL B 1 104 ? 47.154  27.239  36.178  1.00 12.27  ? 104 VAL B N   1 
ATOM   3478  C  CA  . VAL B 1 104 ? 48.091  28.310  36.195  1.00 12.52  ? 104 VAL B CA  1 
ATOM   3479  C  C   . VAL B 1 104 ? 48.447  28.726  34.773  1.00 13.46  ? 104 VAL B C   1 
ATOM   3480  O  O   . VAL B 1 104 ? 48.460  29.912  34.474  1.00 15.35  ? 104 VAL B O   1 
ATOM   3481  C  CB  . VAL B 1 104 ? 49.339  27.896  36.972  1.00 12.07  ? 104 VAL B CB  1 
ATOM   3482  C  CG1 . VAL B 1 104 ? 50.464  28.917  36.802  1.00 11.43  ? 104 VAL B CG1 1 
ATOM   3483  C  CG2 . VAL B 1 104 ? 48.967  27.698  38.440  1.00 11.77  ? 104 VAL B CG2 1 
ATOM   3484  N  N   . VAL B 1 105 ? 48.715  27.770  33.886  1.00 13.17  ? 105 VAL B N   1 
ATOM   3485  C  CA  . VAL B 1 105 ? 49.104  28.084  32.519  1.00 13.28  ? 105 VAL B CA  1 
ATOM   3486  C  C   . VAL B 1 105 ? 48.044  28.960  31.882  1.00 13.99  ? 105 VAL B C   1 
ATOM   3487  O  O   . VAL B 1 105 ? 48.361  29.910  31.174  1.00 13.69  ? 105 VAL B O   1 
ATOM   3488  C  CB  . VAL B 1 105 ? 49.420  26.805  31.687  1.00 13.00  ? 105 VAL B CB  1 
ATOM   3489  C  CG1 . VAL B 1 105 ? 49.246  27.035  30.183  1.00 12.16  ? 105 VAL B CG1 1 
ATOM   3490  C  CG2 . VAL B 1 105 ? 50.823  26.296  32.014  1.00 11.57  ? 105 VAL B CG2 1 
ATOM   3491  N  N   . SER B 1 106 ? 46.777  28.689  32.178  1.00 15.98  ? 106 SER B N   1 
ATOM   3492  C  CA  . SER B 1 106 ? 45.701  29.515  31.595  1.00 17.47  ? 106 SER B CA  1 
ATOM   3493  C  C   . SER B 1 106 ? 45.626  30.934  32.158  1.00 18.71  ? 106 SER B C   1 
ATOM   3494  O  O   . SER B 1 106 ? 45.076  31.834  31.518  1.00 19.19  ? 106 SER B O   1 
ATOM   3495  C  CB  . SER B 1 106 ? 44.334  28.812  31.698  1.00 18.03  ? 106 SER B CB  1 
ATOM   3496  O  OG  . SER B 1 106 ? 44.355  27.618  30.910  1.00 20.32  ? 106 SER B OG  1 
ATOM   3497  N  N   . TYR B 1 107 ? 46.131  31.135  33.371  1.00 18.51  ? 107 TYR B N   1 
ATOM   3498  C  CA  . TYR B 1 107 ? 46.001  32.425  34.029  1.00 18.63  ? 107 TYR B CA  1 
ATOM   3499  C  C   . TYR B 1 107 ? 47.257  32.694  34.879  1.00 17.39  ? 107 TYR B C   1 
ATOM   3500  O  O   . TYR B 1 107 ? 47.169  32.884  36.083  1.00 15.62  ? 107 TYR B O   1 
ATOM   3501  C  CB  . TYR B 1 107 ? 44.753  32.434  34.925  1.00 20.68  ? 107 TYR B CB  1 
ATOM   3502  C  CG  . TYR B 1 107 ? 43.426  32.326  34.213  1.00 23.80  ? 107 TYR B CG  1 
ATOM   3503  C  CD1 . TYR B 1 107 ? 42.800  33.466  33.710  1.00 27.99  ? 107 TYR B CD1 1 
ATOM   3504  C  CD2 . TYR B 1 107 ? 42.774  31.090  34.065  1.00 24.09  ? 107 TYR B CD2 1 
ATOM   3505  C  CE1 . TYR B 1 107 ? 41.572  33.378  33.059  1.00 28.92  ? 107 TYR B CE1 1 
ATOM   3506  C  CE2 . TYR B 1 107 ? 41.551  30.988  33.424  1.00 24.47  ? 107 TYR B CE2 1 
ATOM   3507  C  CZ  . TYR B 1 107 ? 40.958  32.141  32.935  1.00 28.27  ? 107 TYR B CZ  1 
ATOM   3508  O  OH  . TYR B 1 107 ? 39.745  32.098  32.304  1.00 34.32  ? 107 TYR B OH  1 
ATOM   3509  N  N   . PRO B 1 108 ? 48.434  32.715  34.242  1.00 17.57  ? 108 PRO B N   1 
ATOM   3510  C  CA  . PRO B 1 108 ? 49.697  32.780  35.014  1.00 17.57  ? 108 PRO B CA  1 
ATOM   3511  C  C   . PRO B 1 108 ? 49.857  34.068  35.854  1.00 18.15  ? 108 PRO B C   1 
ATOM   3512  O  O   . PRO B 1 108 ? 50.785  34.188  36.680  1.00 17.63  ? 108 PRO B O   1 
ATOM   3513  C  CB  . PRO B 1 108 ? 50.775  32.743  33.937  1.00 16.36  ? 108 PRO B CB  1 
ATOM   3514  C  CG  . PRO B 1 108 ? 50.080  33.316  32.735  1.00 17.39  ? 108 PRO B CG  1 
ATOM   3515  C  CD  . PRO B 1 108 ? 48.643  32.901  32.794  1.00 16.05  ? 108 PRO B CD  1 
ATOM   3516  N  N   . ARG B 1 109 ? 49.000  35.041  35.647  1.00 17.94  ? 109 ARG B N   1 
ATOM   3517  C  CA  . ARG B 1 109 ? 49.125  36.184  36.508  1.00 20.38  ? 109 ARG B CA  1 
ATOM   3518  C  C   . ARG B 1 109 ? 47.937  36.334  37.435  1.00 18.12  ? 109 ARG B C   1 
ATOM   3519  O  O   . ARG B 1 109 ? 47.772  37.351  38.080  1.00 19.23  ? 109 ARG B O   1 
ATOM   3520  C  CB  . ARG B 1 109 ? 49.544  37.461  35.739  1.00 24.88  ? 109 ARG B CB  1 
ATOM   3521  C  CG  . ARG B 1 109 ? 48.727  37.835  34.530  1.00 29.33  ? 109 ARG B CG  1 
ATOM   3522  C  CD  . ARG B 1 109 ? 49.688  38.295  33.437  1.00 36.66  ? 109 ARG B CD  1 
ATOM   3523  N  NE  . ARG B 1 109 ? 49.453  39.684  32.972  1.00 49.06  ? 109 ARG B NE  1 
ATOM   3524  C  CZ  . ARG B 1 109 ? 48.413  40.125  32.234  1.00 53.74  ? 109 ARG B CZ  1 
ATOM   3525  N  NH1 . ARG B 1 109 ? 47.423  39.304  31.858  1.00 57.84  ? 109 ARG B NH1 1 
ATOM   3526  N  NH2 . ARG B 1 109 ? 48.351  41.415  31.871  1.00 51.07  ? 109 ARG B NH2 1 
ATOM   3527  N  N   . ARG B 1 110 ? 47.143  35.283  37.549  1.00 15.64  ? 110 ARG B N   1 
ATOM   3528  C  CA  . ARG B 1 110 ? 46.100  35.279  38.553  1.00 15.07  ? 110 ARG B CA  1 
ATOM   3529  C  C   . ARG B 1 110 ? 46.258  34.177  39.607  1.00 14.43  ? 110 ARG B C   1 
ATOM   3530  O  O   . ARG B 1 110 ? 45.664  34.246  40.660  1.00 13.20  ? 110 ARG B O   1 
ATOM   3531  C  CB  . ARG B 1 110 ? 44.692  35.292  37.920  1.00 14.12  ? 110 ARG B CB  1 
ATOM   3532  C  CG  . ARG B 1 110 ? 44.502  36.395  36.873  1.00 14.56  ? 110 ARG B CG  1 
ATOM   3533  C  CD  . ARG B 1 110 ? 44.612  37.844  37.390  1.00 14.44  ? 110 ARG B CD  1 
ATOM   3534  N  NE  . ARG B 1 110 ? 43.719  38.194  38.531  1.00 13.75  ? 110 ARG B NE  1 
ATOM   3535  C  CZ  . ARG B 1 110 ? 42.461  38.627  38.448  1.00 14.38  ? 110 ARG B CZ  1 
ATOM   3536  N  NH1 . ARG B 1 110 ? 41.833  38.756  37.263  1.00 15.50  ? 110 ARG B NH1 1 
ATOM   3537  N  NH2 . ARG B 1 110 ? 41.785  38.920  39.571  1.00 14.38  ? 110 ARG B NH2 1 
ATOM   3538  N  N   . PHE B 1 111 ? 47.070  33.162  39.319  1.00 13.41  ? 111 PHE B N   1 
ATOM   3539  C  CA  . PHE B 1 111 ? 47.140  32.040  40.187  1.00 12.53  ? 111 PHE B CA  1 
ATOM   3540  C  C   . PHE B 1 111 ? 48.580  31.661  40.314  1.00 12.89  ? 111 PHE B C   1 
ATOM   3541  O  O   . PHE B 1 111 ? 49.386  31.946  39.440  1.00 13.36  ? 111 PHE B O   1 
ATOM   3542  C  CB  . PHE B 1 111 ? 46.334  30.869  39.598  1.00 12.09  ? 111 PHE B CB  1 
ATOM   3543  C  CG  . PHE B 1 111 ? 44.865  31.131  39.435  1.00 12.22  ? 111 PHE B CG  1 
ATOM   3544  C  CD1 . PHE B 1 111 ? 44.047  31.367  40.528  1.00 12.52  ? 111 PHE B CD1 1 
ATOM   3545  C  CD2 . PHE B 1 111 ? 44.262  31.063  38.179  1.00 13.26  ? 111 PHE B CD2 1 
ATOM   3546  C  CE1 . PHE B 1 111 ? 42.677  31.570  40.382  1.00 12.00  ? 111 PHE B CE1 1 
ATOM   3547  C  CE2 . PHE B 1 111 ? 42.885  31.241  38.022  1.00 12.65  ? 111 PHE B CE2 1 
ATOM   3548  C  CZ  . PHE B 1 111 ? 42.095  31.512  39.125  1.00 12.58  ? 111 PHE B CZ  1 
ATOM   3549  N  N   . VAL B 1 112 ? 48.918  31.027  41.428  1.00 13.25  ? 112 VAL B N   1 
ATOM   3550  C  CA  . VAL B 1 112 ? 50.141  30.201  41.534  1.00 12.98  ? 112 VAL B CA  1 
ATOM   3551  C  C   . VAL B 1 112 ? 49.708  28.881  42.167  1.00 12.91  ? 112 VAL B C   1 
ATOM   3552  O  O   . VAL B 1 112 ? 48.731  28.834  42.897  1.00 12.40  ? 112 VAL B O   1 
ATOM   3553  C  CB  . VAL B 1 112 ? 51.270  30.867  42.386  1.00 12.75  ? 112 VAL B CB  1 
ATOM   3554  C  CG1 . VAL B 1 112 ? 51.849  32.097  41.689  1.00 12.26  ? 112 VAL B CG1 1 
ATOM   3555  C  CG2 . VAL B 1 112 ? 50.758  31.238  43.763  1.00 12.12  ? 112 VAL B CG2 1 
ATOM   3556  N  N   . GLY B 1 113 ? 50.422  27.799  41.896  1.00 13.15  ? 113 GLY B N   1 
ATOM   3557  C  CA  . GLY B 1 113 ? 50.078  26.543  42.556  1.00 12.47  ? 113 GLY B CA  1 
ATOM   3558  C  C   . GLY B 1 113 ? 50.950  26.172  43.757  1.00 12.36  ? 113 GLY B C   1 
ATOM   3559  O  O   . GLY B 1 113 ? 52.182  26.340  43.738  1.00 11.71  ? 113 GLY B O   1 
ATOM   3560  N  N   . LEU B 1 114 ? 50.317  25.612  44.782  1.00 12.13  ? 114 LEU B N   1 
ATOM   3561  C  CA  . LEU B 1 114 ? 51.082  24.878  45.787  1.00 12.19  ? 114 LEU B CA  1 
ATOM   3562  C  C   . LEU B 1 114 ? 50.762  23.388  45.605  1.00 12.30  ? 114 LEU B C   1 
ATOM   3563  O  O   . LEU B 1 114 ? 49.624  22.992  45.758  1.00 12.99  ? 114 LEU B O   1 
ATOM   3564  C  CB  . LEU B 1 114 ? 50.699  25.370  47.189  1.00 12.30  ? 114 LEU B CB  1 
ATOM   3565  C  CG  . LEU B 1 114 ? 50.772  26.895  47.399  1.00 11.88  ? 114 LEU B CG  1 
ATOM   3566  C  CD1 . LEU B 1 114 ? 50.056  27.338  48.673  1.00 11.46  ? 114 LEU B CD1 1 
ATOM   3567  C  CD2 . LEU B 1 114 ? 52.246  27.277  47.432  1.00 11.40  ? 114 LEU B CD2 1 
ATOM   3568  N  N   . GLY B 1 115 ? 51.748  22.572  45.261  1.00 12.00  ? 115 GLY B N   1 
ATOM   3569  C  CA  . GLY B 1 115 ? 51.501  21.163  44.975  1.00 12.53  ? 115 GLY B CA  1 
ATOM   3570  C  C   . GLY B 1 115 ? 51.258  20.323  46.228  1.00 12.96  ? 115 GLY B C   1 
ATOM   3571  O  O   . GLY B 1 115 ? 51.433  20.798  47.341  1.00 13.73  ? 115 GLY B O   1 
ATOM   3572  N  N   . THR B 1 116 ? 50.843  19.086  46.038  1.00 12.80  ? 116 THR B N   1 
ATOM   3573  C  CA  . THR B 1 116 ? 50.692  18.140  47.092  1.00 13.89  ? 116 THR B CA  1 
ATOM   3574  C  C   . THR B 1 116 ? 51.711  17.008  46.913  1.00 14.27  ? 116 THR B C   1 
ATOM   3575  O  O   . THR B 1 116 ? 52.065  16.640  45.757  1.00 15.21  ? 116 THR B O   1 
ATOM   3576  C  CB  . THR B 1 116 ? 49.251  17.621  47.047  1.00 15.98  ? 116 THR B CB  1 
ATOM   3577  O  OG1 . THR B 1 116 ? 48.830  17.116  48.339  1.00 17.55  ? 116 THR B OG1 1 
ATOM   3578  C  CG2 . THR B 1 116 ? 49.084  16.557  45.946  1.00 16.72  ? 116 THR B CG2 1 
ATOM   3579  N  N   . LEU B 1 117 ? 52.183  16.457  48.024  1.00 13.76  ? 117 LEU B N   1 
ATOM   3580  C  CA  . LEU B 1 117 ? 53.169  15.322  48.042  1.00 14.81  ? 117 LEU B CA  1 
ATOM   3581  C  C   . LEU B 1 117 ? 52.697  13.990  48.648  1.00 15.20  ? 117 LEU B C   1 
ATOM   3582  O  O   . LEU B 1 117 ? 51.808  13.966  49.477  1.00 16.38  ? 117 LEU B O   1 
ATOM   3583  C  CB  . LEU B 1 117 ? 54.439  15.743  48.795  1.00 14.24  ? 117 LEU B CB  1 
ATOM   3584  C  CG  . LEU B 1 117 ? 55.018  17.081  48.316  1.00 14.98  ? 117 LEU B CG  1 
ATOM   3585  C  CD1 . LEU B 1 117 ? 56.126  17.528  49.258  1.00 15.70  ? 117 LEU B CD1 1 
ATOM   3586  C  CD2 . LEU B 1 117 ? 55.462  17.076  46.844  1.00 13.35  ? 117 LEU B CD2 1 
ATOM   3587  N  N   . PRO B 1 118 ? 53.312  12.864  48.253  1.00 15.96  ? 118 PRO B N   1 
ATOM   3588  C  CA  . PRO B 1 118 ? 53.083  11.613  48.998  1.00 15.09  ? 118 PRO B CA  1 
ATOM   3589  C  C   . PRO B 1 118 ? 53.961  11.549  50.275  1.00 15.72  ? 118 PRO B C   1 
ATOM   3590  O  O   . PRO B 1 118 ? 55.007  10.886  50.301  1.00 15.80  ? 118 PRO B O   1 
ATOM   3591  C  CB  . PRO B 1 118 ? 53.492  10.547  47.976  1.00 14.20  ? 118 PRO B CB  1 
ATOM   3592  C  CG  . PRO B 1 118 ? 54.577  11.204  47.224  1.00 14.32  ? 118 PRO B CG  1 
ATOM   3593  C  CD  . PRO B 1 118 ? 54.107  12.619  47.029  1.00 15.25  ? 118 PRO B CD  1 
ATOM   3594  N  N   . MET B 1 119 ? 53.532  12.218  51.333  1.00 16.19  ? 119 MET B N   1 
ATOM   3595  C  CA  . MET B 1 119 ? 54.387  12.434  52.496  1.00 17.06  ? 119 MET B CA  1 
ATOM   3596  C  C   . MET B 1 119 ? 54.714  11.162  53.307  1.00 18.21  ? 119 MET B C   1 
ATOM   3597  O  O   . MET B 1 119 ? 55.738  11.119  54.010  1.00 18.42  ? 119 MET B O   1 
ATOM   3598  C  CB  . MET B 1 119 ? 53.811  13.522  53.416  1.00 17.35  ? 119 MET B CB  1 
ATOM   3599  C  CG  . MET B 1 119 ? 53.839  14.936  52.840  1.00 18.27  ? 119 MET B CG  1 
ATOM   3600  S  SD  . MET B 1 119 ? 55.532  15.599  52.798  1.00 21.66  ? 119 MET B SD  1 
ATOM   3601  C  CE  . MET B 1 119 ? 55.839  15.981  54.545  1.00 18.18  ? 119 MET B CE  1 
ATOM   3602  N  N   . GLN B 1 120 ? 53.885  10.128  53.211  1.00 17.23  ? 120 GLN B N   1 
ATOM   3603  C  CA  . GLN B 1 120 ? 54.200  8.886   53.901  1.00 18.79  ? 120 GLN B CA  1 
ATOM   3604  C  C   . GLN B 1 120 ? 55.393  8.118   53.266  1.00 20.49  ? 120 GLN B C   1 
ATOM   3605  O  O   . GLN B 1 120 ? 55.816  7.056   53.759  1.00 21.31  ? 120 GLN B O   1 
ATOM   3606  C  CB  . GLN B 1 120 ? 52.973  7.987   53.948  1.00 18.79  ? 120 GLN B CB  1 
ATOM   3607  C  CG  . GLN B 1 120 ? 52.682  7.269   52.630  1.00 19.11  ? 120 GLN B CG  1 
ATOM   3608  C  CD  . GLN B 1 120 ? 51.679  8.008   51.765  1.00 18.60  ? 120 GLN B CD  1 
ATOM   3609  O  OE1 . GLN B 1 120 ? 51.770  9.215   51.615  1.00 18.04  ? 120 GLN B OE1 1 
ATOM   3610  N  NE2 . GLN B 1 120 ? 50.702  7.273   51.199  1.00 17.79  ? 120 GLN B NE2 1 
ATOM   3611  N  N   . ALA B 1 121 ? 55.898  8.622   52.151  1.00 20.74  ? 121 ALA B N   1 
ATOM   3612  C  CA  . ALA B 1 121 ? 57.028  7.977   51.464  1.00 22.15  ? 121 ALA B CA  1 
ATOM   3613  C  C   . ALA B 1 121 ? 57.968  9.091   51.050  1.00 24.20  ? 121 ALA B C   1 
ATOM   3614  O  O   . ALA B 1 121 ? 57.864  9.650   49.925  1.00 24.81  ? 121 ALA B O   1 
ATOM   3615  C  CB  . ALA B 1 121 ? 56.583  7.174   50.275  1.00 20.99  ? 121 ALA B CB  1 
ATOM   3616  N  N   . PRO B 1 122 ? 58.859  9.443   51.986  1.00 23.21  ? 122 PRO B N   1 
ATOM   3617  C  CA  . PRO B 1 122 ? 59.844  10.495  51.918  1.00 25.06  ? 122 PRO B CA  1 
ATOM   3618  C  C   . PRO B 1 122 ? 60.595  10.619  50.581  1.00 25.07  ? 122 PRO B C   1 
ATOM   3619  O  O   . PRO B 1 122 ? 60.667  11.746  50.034  1.00 24.87  ? 122 PRO B O   1 
ATOM   3620  C  CB  . PRO B 1 122 ? 60.791  10.139  53.080  1.00 25.43  ? 122 PRO B CB  1 
ATOM   3621  C  CG  . PRO B 1 122 ? 59.857  9.559   54.099  1.00 24.34  ? 122 PRO B CG  1 
ATOM   3622  C  CD  . PRO B 1 122 ? 58.893  8.748   53.294  1.00 23.36  ? 122 PRO B CD  1 
ATOM   3623  N  N   . GLU B 1 123 ? 61.141  9.514   50.067  1.00 24.99  ? 123 GLU B N   1 
ATOM   3624  C  CA  . GLU B 1 123 ? 61.921  9.572   48.803  1.00 27.72  ? 123 GLU B CA  1 
ATOM   3625  C  C   . GLU B 1 123 ? 61.037  9.804   47.553  1.00 25.78  ? 123 GLU B C   1 
ATOM   3626  O  O   . GLU B 1 123 ? 61.446  10.504  46.620  1.00 26.67  ? 123 GLU B O   1 
ATOM   3627  C  CB  . GLU B 1 123 ? 62.911  8.409   48.629  1.00 30.05  ? 123 GLU B CB  1 
ATOM   3628  C  CG  . GLU B 1 123 ? 62.348  7.137   47.986  1.00 37.63  ? 123 GLU B CG  1 
ATOM   3629  C  CD  . GLU B 1 123 ? 63.226  6.602   46.833  1.00 44.81  ? 123 GLU B CD  1 
ATOM   3630  O  OE1 . GLU B 1 123 ? 64.475  6.472   46.996  1.00 45.94  ? 123 GLU B OE1 1 
ATOM   3631  O  OE2 . GLU B 1 123 ? 62.666  6.316   45.741  1.00 44.81  ? 123 GLU B OE2 1 
ATOM   3632  N  N   . LEU B 1 124 ? 59.826  9.253   47.555  1.00 23.64  ? 124 LEU B N   1 
ATOM   3633  C  CA  . LEU B 1 124 ? 58.848  9.630   46.534  1.00 22.77  ? 124 LEU B CA  1 
ATOM   3634  C  C   . LEU B 1 124 ? 58.398  11.059  46.728  1.00 21.65  ? 124 LEU B C   1 
ATOM   3635  O  O   . LEU B 1 124 ? 58.079  11.689  45.760  1.00 21.95  ? 124 LEU B O   1 
ATOM   3636  C  CB  . LEU B 1 124 ? 57.628  8.716   46.503  1.00 23.05  ? 124 LEU B CB  1 
ATOM   3637  C  CG  . LEU B 1 124 ? 57.895  7.210   46.410  1.00 26.43  ? 124 LEU B CG  1 
ATOM   3638  C  CD1 . LEU B 1 124 ? 56.582  6.458   46.410  1.00 24.65  ? 124 LEU B CD1 1 
ATOM   3639  C  CD2 . LEU B 1 124 ? 58.772  6.854   45.204  1.00 26.50  ? 124 LEU B CD2 1 
ATOM   3640  N  N   . ALA B 1 125 ? 58.392  11.573  47.963  1.00 20.36  ? 125 ALA B N   1 
ATOM   3641  C  CA  . ALA B 1 125 ? 57.981  12.969  48.180  1.00 19.72  ? 125 ALA B CA  1 
ATOM   3642  C  C   . ALA B 1 125 ? 58.990  13.943  47.621  1.00 19.51  ? 125 ALA B C   1 
ATOM   3643  O  O   . ALA B 1 125 ? 58.599  14.958  47.033  1.00 18.62  ? 125 ALA B O   1 
ATOM   3644  C  CB  . ALA B 1 125 ? 57.719  13.285  49.647  1.00 17.36  ? 125 ALA B CB  1 
ATOM   3645  N  N   . VAL B 1 126 ? 60.276  13.657  47.840  1.00 19.90  ? 126 VAL B N   1 
ATOM   3646  C  CA  . VAL B 1 126 ? 61.344  14.497  47.303  1.00 20.76  ? 126 VAL B CA  1 
ATOM   3647  C  C   . VAL B 1 126 ? 61.201  14.556  45.809  1.00 21.70  ? 126 VAL B C   1 
ATOM   3648  O  O   . VAL B 1 126 ? 61.177  15.651  45.251  1.00 23.09  ? 126 VAL B O   1 
ATOM   3649  C  CB  . VAL B 1 126 ? 62.729  13.955  47.669  1.00 22.42  ? 126 VAL B CB  1 
ATOM   3650  C  CG1 . VAL B 1 126 ? 63.821  14.619  46.847  1.00 19.98  ? 126 VAL B CG1 1 
ATOM   3651  C  CG2 . VAL B 1 126 ? 62.969  14.113  49.176  1.00 21.39  ? 126 VAL B CG2 1 
ATOM   3652  N  N   . LYS B 1 127 ? 61.047  13.388  45.179  1.00 22.73  ? 127 LYS B N   1 
ATOM   3653  C  CA  . LYS B 1 127 ? 60.986  13.299  43.732  1.00 25.12  ? 127 LYS B CA  1 
ATOM   3654  C  C   . LYS B 1 127 ? 59.805  14.099  43.197  1.00 24.02  ? 127 LYS B C   1 
ATOM   3655  O  O   . LYS B 1 127 ? 59.937  14.816  42.222  1.00 26.27  ? 127 LYS B O   1 
ATOM   3656  C  CB  . LYS B 1 127 ? 60.885  11.842  43.248  1.00 27.87  ? 127 LYS B CB  1 
ATOM   3657  C  CG  . LYS B 1 127 ? 62.147  11.281  42.614  1.00 33.27  ? 127 LYS B CG  1 
ATOM   3658  C  CD  . LYS B 1 127 ? 61.873  10.607  41.252  1.00 35.61  ? 127 LYS B CD  1 
ATOM   3659  C  CE  . LYS B 1 127 ? 63.166  10.499  40.427  1.00 37.06  ? 127 LYS B CE  1 
ATOM   3660  N  NZ  . LYS B 1 127 ? 62.994  10.024  39.022  1.00 37.63  ? 127 LYS B NZ  1 
ATOM   3661  N  N   . GLU B 1 128 ? 58.660  13.995  43.844  1.00 21.55  ? 128 GLU B N   1 
ATOM   3662  C  CA  . GLU B 1 128 ? 57.498  14.709  43.384  1.00 21.51  ? 128 GLU B CA  1 
ATOM   3663  C  C   . GLU B 1 128 ? 57.629  16.206  43.643  1.00 20.74  ? 128 GLU B C   1 
ATOM   3664  O  O   . GLU B 1 128 ? 56.976  17.029  42.988  1.00 20.76  ? 128 GLU B O   1 
ATOM   3665  C  CB  . GLU B 1 128 ? 56.190  14.123  43.963  1.00 21.08  ? 128 GLU B CB  1 
ATOM   3666  C  CG  . GLU B 1 128 ? 54.930  14.909  43.542  1.00 21.30  ? 128 GLU B CG  1 
ATOM   3667  C  CD  . GLU B 1 128 ? 54.596  14.829  42.026  1.00 23.46  ? 128 GLU B CD  1 
ATOM   3668  O  OE1 . GLU B 1 128 ? 55.327  14.123  41.261  1.00 25.29  ? 128 GLU B OE1 1 
ATOM   3669  O  OE2 . GLU B 1 128 ? 53.583  15.459  41.582  1.00 21.07  ? 128 GLU B OE2 1 
ATOM   3670  N  N   . MET B 1 129 ? 58.487  16.567  44.575  1.00 20.87  ? 129 MET B N   1 
ATOM   3671  C  CA  . MET B 1 129 ? 58.674  17.973  44.898  1.00 22.48  ? 129 MET B CA  1 
ATOM   3672  C  C   . MET B 1 129 ? 59.675  18.617  43.965  1.00 21.91  ? 129 MET B C   1 
ATOM   3673  O  O   . MET B 1 129 ? 59.526  19.780  43.596  1.00 20.13  ? 129 MET B O   1 
ATOM   3674  C  CB  . MET B 1 129 ? 59.157  18.136  46.331  1.00 23.70  ? 129 MET B CB  1 
ATOM   3675  C  CG  . MET B 1 129 ? 59.026  19.557  46.842  1.00 26.92  ? 129 MET B CG  1 
ATOM   3676  S  SD  . MET B 1 129 ? 60.227  19.896  48.133  1.00 31.00  ? 129 MET B SD  1 
ATOM   3677  C  CE  . MET B 1 129 ? 59.768  18.705  49.368  1.00 27.28  ? 129 MET B CE  1 
ATOM   3678  N  N   . GLU B 1 130 ? 60.716  17.872  43.610  1.00 24.60  ? 130 GLU B N   1 
ATOM   3679  C  CA  . GLU B 1 130 ? 61.674  18.345  42.606  1.00 27.16  ? 130 GLU B CA  1 
ATOM   3680  C  C   . GLU B 1 130 ? 60.881  18.581  41.339  1.00 24.75  ? 130 GLU B C   1 
ATOM   3681  O  O   . GLU B 1 130 ? 61.009  19.604  40.661  1.00 25.05  ? 130 GLU B O   1 
ATOM   3682  C  CB  . GLU B 1 130 ? 62.737  17.283  42.359  1.00 32.20  ? 130 GLU B CB  1 
ATOM   3683  C  CG  . GLU B 1 130 ? 63.906  17.342  43.338  1.00 41.44  ? 130 GLU B CG  1 
ATOM   3684  C  CD  . GLU B 1 130 ? 64.693  16.026  43.462  1.00 48.09  ? 130 GLU B CD  1 
ATOM   3685  O  OE1 . GLU B 1 130 ? 64.160  14.942  43.084  1.00 47.51  ? 130 GLU B OE1 1 
ATOM   3686  O  OE2 . GLU B 1 130 ? 65.847  16.078  43.971  1.00 48.11  ? 130 GLU B OE2 1 
ATOM   3687  N  N   . ARG B 1 131 ? 59.987  17.657  41.069  1.00 22.35  ? 131 ARG B N   1 
ATOM   3688  C  CA  . ARG B 1 131 ? 59.161  17.779  39.903  1.00 22.01  ? 131 ARG B CA  1 
ATOM   3689  C  C   . ARG B 1 131 ? 58.303  19.030  39.936  1.00 21.98  ? 131 ARG B C   1 
ATOM   3690  O  O   . ARG B 1 131 ? 58.299  19.788  38.949  1.00 22.20  ? 131 ARG B O   1 
ATOM   3691  C  CB  . ARG B 1 131 ? 58.308  16.552  39.764  1.00 20.51  ? 131 ARG B CB  1 
ATOM   3692  C  CG  . ARG B 1 131 ? 57.889  16.286  38.349  1.00 20.80  ? 131 ARG B CG  1 
ATOM   3693  C  CD  . ARG B 1 131 ? 56.616  15.465  38.431  1.00 21.56  ? 131 ARG B CD  1 
ATOM   3694  N  NE  . ARG B 1 131 ? 55.804  15.857  37.307  1.00 22.52  ? 131 ARG B NE  1 
ATOM   3695  C  CZ  . ARG B 1 131 ? 54.494  16.043  37.321  1.00 21.13  ? 131 ARG B CZ  1 
ATOM   3696  N  NH1 . ARG B 1 131 ? 53.756  15.882  38.424  1.00 19.23  ? 131 ARG B NH1 1 
ATOM   3697  N  NH2 . ARG B 1 131 ? 53.933  16.404  36.184  1.00 20.18  ? 131 ARG B NH2 1 
ATOM   3698  N  N   . CYS B 1 132 ? 57.547  19.226  41.029  1.00 21.44  ? 132 CYS B N   1 
ATOM   3699  C  CA  . CYS B 1 132 ? 56.701  20.434  41.218  1.00 22.09  ? 132 CYS B CA  1 
ATOM   3700  C  C   . CYS B 1 132 ? 57.398  21.787  41.028  1.00 21.29  ? 132 CYS B C   1 
ATOM   3701  O  O   . CYS B 1 132 ? 56.818  22.708  40.475  1.00 20.09  ? 132 CYS B O   1 
ATOM   3702  C  CB  . CYS B 1 132 ? 56.047  20.456  42.610  1.00 23.15  ? 132 CYS B CB  1 
ATOM   3703  S  SG  . CYS B 1 132 ? 54.635  19.356  42.804  1.00 23.19  ? 132 CYS B SG  1 
ATOM   3704  N  N   . VAL B 1 133 ? 58.627  21.898  41.519  1.00 22.06  ? 133 VAL B N   1 
ATOM   3705  C  CA  . VAL B 1 133 ? 59.421  23.131  41.440  1.00 22.73  ? 133 VAL B CA  1 
ATOM   3706  C  C   . VAL B 1 133 ? 60.175  23.330  40.120  1.00 23.26  ? 133 VAL B C   1 
ATOM   3707  O  O   . VAL B 1 133 ? 60.102  24.397  39.507  1.00 23.14  ? 133 VAL B O   1 
ATOM   3708  C  CB  . VAL B 1 133 ? 60.442  23.136  42.604  1.00 23.09  ? 133 VAL B CB  1 
ATOM   3709  C  CG1 . VAL B 1 133 ? 61.538  24.187  42.407  1.00 21.12  ? 133 VAL B CG1 1 
ATOM   3710  C  CG2 . VAL B 1 133 ? 59.716  23.265  43.943  1.00 21.59  ? 133 VAL B CG2 1 
ATOM   3711  N  N   . LYS B 1 134 ? 60.918  22.313  39.699  1.00 25.72  ? 134 LYS B N   1 
ATOM   3712  C  CA  . LYS B 1 134 ? 61.707  22.391  38.447  1.00 28.56  ? 134 LYS B CA  1 
ATOM   3713  C  C   . LYS B 1 134 ? 60.860  22.249  37.141  1.00 26.54  ? 134 LYS B C   1 
ATOM   3714  O  O   . LYS B 1 134 ? 61.093  22.947  36.134  1.00 27.73  ? 134 LYS B O   1 
ATOM   3715  C  CB  . LYS B 1 134 ? 62.864  21.345  38.443  1.00 30.75  ? 134 LYS B CB  1 
ATOM   3716  C  CG  . LYS B 1 134 ? 63.830  21.404  39.621  1.00 35.16  ? 134 LYS B CG  1 
ATOM   3717  C  CD  . LYS B 1 134 ? 64.639  22.703  39.682  1.00 38.07  ? 134 LYS B CD  1 
ATOM   3718  C  CE  . LYS B 1 134 ? 65.680  22.706  40.804  1.00 41.69  ? 134 LYS B CE  1 
ATOM   3719  N  NZ  . LYS B 1 134 ? 66.697  21.602  40.741  1.00 44.55  ? 134 LYS B NZ  1 
ATOM   3720  N  N   . GLU B 1 135 ? 59.907  21.325  37.142  1.00 24.34  ? 135 GLU B N   1 
ATOM   3721  C  CA  . GLU B 1 135 ? 59.101  21.074  35.938  1.00 21.79  ? 135 GLU B CA  1 
ATOM   3722  C  C   . GLU B 1 135 ? 57.797  21.897  35.928  1.00 19.33  ? 135 GLU B C   1 
ATOM   3723  O  O   . GLU B 1 135 ? 57.430  22.487  34.915  1.00 18.43  ? 135 GLU B O   1 
ATOM   3724  C  CB  . GLU B 1 135 ? 58.881  19.572  35.738  1.00 23.67  ? 135 GLU B CB  1 
ATOM   3725  C  CG  . GLU B 1 135 ? 60.207  18.823  35.529  1.00 26.47  ? 135 GLU B CG  1 
ATOM   3726  C  CD  . GLU B 1 135 ? 60.079  17.303  35.302  1.00 32.35  ? 135 GLU B CD  1 
ATOM   3727  O  OE1 . GLU B 1 135 ? 58.945  16.750  35.207  1.00 33.33  ? 135 GLU B OE1 1 
ATOM   3728  O  OE2 . GLU B 1 135 ? 61.143  16.621  35.190  1.00 38.34  ? 135 GLU B OE2 1 
ATOM   3729  N  N   . LEU B 1 136 ? 57.119  22.003  37.061  1.00 16.48  ? 136 LEU B N   1 
ATOM   3730  C  CA  . LEU B 1 136 ? 55.836  22.675  37.004  1.00 13.97  ? 136 LEU B CA  1 
ATOM   3731  C  C   . LEU B 1 136 ? 55.919  24.173  37.392  1.00 13.45  ? 136 LEU B C   1 
ATOM   3732  O  O   . LEU B 1 136 ? 55.001  24.957  37.106  1.00 12.94  ? 136 LEU B O   1 
ATOM   3733  C  CB  . LEU B 1 136 ? 54.790  21.902  37.764  1.00 13.09  ? 136 LEU B CB  1 
ATOM   3734  C  CG  . LEU B 1 136 ? 54.588  20.414  37.454  1.00 12.92  ? 136 LEU B CG  1 
ATOM   3735  C  CD1 . LEU B 1 136 ? 53.623  19.848  38.495  1.00 12.59  ? 136 LEU B CD1 1 
ATOM   3736  C  CD2 . LEU B 1 136 ? 54.099  20.077  36.056  1.00 12.42  ? 136 LEU B CD2 1 
ATOM   3737  N  N   . GLY B 1 137 ? 57.056  24.575  37.952  1.00 12.01  ? 137 GLY B N   1 
ATOM   3738  C  CA  . GLY B 1 137 ? 57.240  25.941  38.345  1.00 11.39  ? 137 GLY B CA  1 
ATOM   3739  C  C   . GLY B 1 137 ? 56.370  26.407  39.523  1.00 11.28  ? 137 GLY B C   1 
ATOM   3740  O  O   . GLY B 1 137 ? 56.035  27.590  39.603  1.00 11.11  ? 137 GLY B O   1 
ATOM   3741  N  N   . PHE B 1 138 ? 56.020  25.512  40.446  1.00 10.60  ? 138 PHE B N   1 
ATOM   3742  C  CA  . PHE B 1 138 ? 55.323  25.908  41.695  1.00 10.54  ? 138 PHE B CA  1 
ATOM   3743  C  C   . PHE B 1 138 ? 56.258  26.553  42.729  1.00 10.50  ? 138 PHE B C   1 
ATOM   3744  O  O   . PHE B 1 138 ? 57.327  26.037  42.978  1.00 11.27  ? 138 PHE B O   1 
ATOM   3745  C  CB  . PHE B 1 138 ? 54.738  24.685  42.404  1.00 10.41  ? 138 PHE B CB  1 
ATOM   3746  C  CG  . PHE B 1 138 ? 53.602  24.017  41.692  1.00 10.04  ? 138 PHE B CG  1 
ATOM   3747  C  CD1 . PHE B 1 138 ? 52.953  24.621  40.631  1.00 9.74   ? 138 PHE B CD1 1 
ATOM   3748  C  CD2 . PHE B 1 138 ? 53.146  22.768  42.142  1.00 10.07  ? 138 PHE B CD2 1 
ATOM   3749  C  CE1 . PHE B 1 138 ? 51.902  23.969  40.020  1.00 9.79   ? 138 PHE B CE1 1 
ATOM   3750  C  CE2 . PHE B 1 138 ? 52.085  22.118  41.536  1.00 9.86   ? 138 PHE B CE2 1 
ATOM   3751  C  CZ  . PHE B 1 138 ? 51.469  22.721  40.456  1.00 9.88   ? 138 PHE B CZ  1 
ATOM   3752  N  N   . PRO B 1 139 ? 55.860  27.653  43.363  1.00 10.46  ? 139 PRO B N   1 
ATOM   3753  C  CA  . PRO B 1 139 ? 56.749  28.214  44.390  1.00 10.73  ? 139 PRO B CA  1 
ATOM   3754  C  C   . PRO B 1 139 ? 56.766  27.398  45.730  1.00 11.20  ? 139 PRO B C   1 
ATOM   3755  O  O   . PRO B 1 139 ? 57.599  27.679  46.620  1.00 11.03  ? 139 PRO B O   1 
ATOM   3756  C  CB  . PRO B 1 139 ? 56.119  29.584  44.675  1.00 10.58  ? 139 PRO B CB  1 
ATOM   3757  C  CG  . PRO B 1 139 ? 54.643  29.399  44.338  1.00 10.41  ? 139 PRO B CG  1 
ATOM   3758  C  CD  . PRO B 1 139 ? 54.675  28.510  43.129  1.00 10.63  ? 139 PRO B CD  1 
ATOM   3759  N  N   . GLY B 1 140 ? 55.821  26.478  45.910  1.00 10.74  ? 140 GLY B N   1 
ATOM   3760  C  CA  . GLY B 1 140 ? 55.863  25.610  47.070  1.00 11.26  ? 140 GLY B CA  1 
ATOM   3761  C  C   . GLY B 1 140 ? 54.878  24.478  47.057  1.00 10.90  ? 140 GLY B C   1 
ATOM   3762  O  O   . GLY B 1 140 ? 54.339  24.156  46.001  1.00 11.23  ? 140 GLY B O   1 
ATOM   3763  N  N   . VAL B 1 141 ? 54.624  23.920  48.234  1.00 10.46  ? 141 VAL B N   1 
ATOM   3764  C  CA  . VAL B 1 141 ? 53.674  22.835  48.413  1.00 11.13  ? 141 VAL B CA  1 
ATOM   3765  C  C   . VAL B 1 141 ? 52.847  22.942  49.697  1.00 11.55  ? 141 VAL B C   1 
ATOM   3766  O  O   . VAL B 1 141 ? 53.271  23.572  50.683  1.00 11.82  ? 141 VAL B O   1 
ATOM   3767  C  CB  . VAL B 1 141 ? 54.369  21.448  48.382  1.00 11.46  ? 141 VAL B CB  1 
ATOM   3768  C  CG1 . VAL B 1 141 ? 55.037  21.196  47.000  1.00 11.25  ? 141 VAL B CG1 1 
ATOM   3769  C  CG2 . VAL B 1 141 ? 55.353  21.326  49.531  1.00 11.29  ? 141 VAL B CG2 1 
ATOM   3770  N  N   . GLN B 1 142 ? 51.650  22.365  49.650  1.00 11.56  ? 142 GLN B N   1 
ATOM   3771  C  CA  . GLN B 1 142 ? 50.727  22.273  50.773  1.00 11.57  ? 142 GLN B CA  1 
ATOM   3772  C  C   . GLN B 1 142 ? 50.891  20.872  51.386  1.00 11.60  ? 142 GLN B C   1 
ATOM   3773  O  O   . GLN B 1 142 ? 50.767  19.890  50.699  1.00 12.62  ? 142 GLN B O   1 
ATOM   3774  C  CB  . GLN B 1 142 ? 49.273  22.457  50.282  1.00 12.03  ? 142 GLN B CB  1 
ATOM   3775  C  CG  . GLN B 1 142 ? 48.262  22.364  51.422  1.00 13.43  ? 142 GLN B CG  1 
ATOM   3776  C  CD  . GLN B 1 142 ? 46.784  22.501  51.015  1.00 13.90  ? 142 GLN B CD  1 
ATOM   3777  O  OE1 . GLN B 1 142 ? 46.028  23.173  51.722  1.00 13.73  ? 142 GLN B OE1 1 
ATOM   3778  N  NE2 . GLN B 1 142 ? 46.366  21.865  49.892  1.00 13.36  ? 142 GLN B NE2 1 
ATOM   3779  N  N   . ILE B 1 143 ? 51.250  20.785  52.652  1.00 11.21  ? 143 ILE B N   1 
ATOM   3780  C  CA  . ILE B 1 143 ? 51.313  19.497  53.364  1.00 10.87  ? 143 ILE B CA  1 
ATOM   3781  C  C   . ILE B 1 143 ? 50.399  19.612  54.600  1.00 10.77  ? 143 ILE B C   1 
ATOM   3782  O  O   . ILE B 1 143 ? 49.921  20.726  54.924  1.00 10.24  ? 143 ILE B O   1 
ATOM   3783  C  CB  . ILE B 1 143 ? 52.773  19.089  53.755  1.00 10.49  ? 143 ILE B CB  1 
ATOM   3784  C  CG1 . ILE B 1 143 ? 53.334  20.040  54.788  1.00 9.85   ? 143 ILE B CG1 1 
ATOM   3785  C  CG2 . ILE B 1 143 ? 53.676  18.979  52.509  1.00 10.41  ? 143 ILE B CG2 1 
ATOM   3786  C  CD1 . ILE B 1 143 ? 54.589  19.565  55.482  1.00 10.16  ? 143 ILE B CD1 1 
ATOM   3787  N  N   . GLY B 1 144 ? 50.110  18.467  55.220  1.00 10.49  ? 144 GLY B N   1 
ATOM   3788  C  CA  . GLY B 1 144 ? 49.264  18.391  56.409  1.00 10.35  ? 144 GLY B CA  1 
ATOM   3789  C  C   . GLY B 1 144 ? 50.026  18.591  57.708  1.00 10.85  ? 144 GLY B C   1 
ATOM   3790  O  O   . GLY B 1 144 ? 51.270  18.717  57.723  1.00 10.38  ? 144 GLY B O   1 
ATOM   3791  N  N   . THR B 1 145 ? 49.297  18.543  58.819  1.00 10.73  ? 145 THR B N   1 
ATOM   3792  C  CA  . THR B 1 145 ? 49.918  18.831  60.099  1.00 11.37  ? 145 THR B CA  1 
ATOM   3793  C  C   . THR B 1 145 ? 50.616  17.615  60.665  1.00 12.41  ? 145 THR B C   1 
ATOM   3794  O  O   . THR B 1 145 ? 51.441  17.697  61.569  1.00 12.73  ? 145 THR B O   1 
ATOM   3795  C  CB  . THR B 1 145 ? 48.887  19.413  61.063  1.00 11.48  ? 145 THR B CB  1 
ATOM   3796  O  OG1 . THR B 1 145 ? 47.698  18.619  60.992  1.00 10.97  ? 145 THR B OG1 1 
ATOM   3797  C  CG2 . THR B 1 145 ? 48.582  20.939  60.679  1.00 10.45  ? 145 THR B CG2 1 
ATOM   3798  N  N   . HIS B 1 146 ? 50.325  16.465  60.086  1.00 13.20  ? 146 HIS B N   1 
ATOM   3799  C  CA  . HIS B 1 146 ? 50.978  15.259  60.520  1.00 13.99  ? 146 HIS B CA  1 
ATOM   3800  C  C   . HIS B 1 146 ? 50.774  14.222  59.444  1.00 13.56  ? 146 HIS B C   1 
ATOM   3801  O  O   . HIS B 1 146 ? 49.927  14.398  58.575  1.00 12.92  ? 146 HIS B O   1 
ATOM   3802  C  CB  . HIS B 1 146 ? 50.427  14.824  61.889  1.00 15.02  ? 146 HIS B CB  1 
ATOM   3803  C  CG  . HIS B 1 146 ? 49.075  14.163  61.829  1.00 15.72  ? 146 HIS B CG  1 
ATOM   3804  N  ND1 . HIS B 1 146 ? 47.946  14.856  61.767  1.00 17.24  ? 146 HIS B ND1 1 
ATOM   3805  C  CD2 . HIS B 1 146 ? 48.704  12.814  61.867  1.00 18.33  ? 146 HIS B CD2 1 
ATOM   3806  C  CE1 . HIS B 1 146 ? 46.879  14.024  61.733  1.00 18.19  ? 146 HIS B CE1 1 
ATOM   3807  N  NE2 . HIS B 1 146 ? 47.341  12.767  61.807  1.00 19.29  ? 146 HIS B NE2 1 
ATOM   3808  N  N   . VAL B 1 147 ? 51.551  13.147  59.507  1.00 12.86  ? 147 VAL B N   1 
ATOM   3809  C  CA  . VAL B 1 147 ? 51.532  12.115  58.487  1.00 12.94  ? 147 VAL B CA  1 
ATOM   3810  C  C   . VAL B 1 147 ? 51.374  10.759  59.122  1.00 13.50  ? 147 VAL B C   1 
ATOM   3811  O  O   . VAL B 1 147 ? 52.344  10.178  59.577  1.00 13.41  ? 147 VAL B O   1 
ATOM   3812  C  CB  . VAL B 1 147 ? 52.831  12.157  57.627  1.00 12.57  ? 147 VAL B CB  1 
ATOM   3813  C  CG1 . VAL B 1 147 ? 52.684  11.239  56.413  1.00 11.61  ? 147 VAL B CG1 1 
ATOM   3814  C  CG2 . VAL B 1 147 ? 53.161  13.602  57.227  1.00 11.82  ? 147 VAL B CG2 1 
ATOM   3815  N  N   . ASN B 1 148 ? 50.154  10.244  59.096  1.00 14.81  ? 148 ASN B N   1 
ATOM   3816  C  CA  . ASN B 1 148 ? 49.761  9.059   59.838  1.00 17.20  ? 148 ASN B CA  1 
ATOM   3817  C  C   . ASN B 1 148 ? 50.242  9.096   61.303  1.00 20.53  ? 148 ASN B C   1 
ATOM   3818  O  O   . ASN B 1 148 ? 49.761  9.887   62.083  1.00 23.23  ? 148 ASN B O   1 
ATOM   3819  C  CB  . ASN B 1 148 ? 50.212  7.806   59.106  1.00 16.34  ? 148 ASN B CB  1 
ATOM   3820  C  CG  . ASN B 1 148 ? 49.670  7.755   57.705  1.00 17.34  ? 148 ASN B CG  1 
ATOM   3821  O  OD1 . ASN B 1 148 ? 48.477  7.934   57.493  1.00 17.12  ? 148 ASN B OD1 1 
ATOM   3822  N  ND2 . ASN B 1 148 ? 50.547  7.546   56.734  1.00 17.87  ? 148 ASN B ND2 1 
ATOM   3823  N  N   . GLU B 1 149 ? 51.232  8.285   61.643  1.00 22.68  ? 149 GLU B N   1 
ATOM   3824  C  CA  . GLU B 1 149 ? 51.712  8.193   62.987  1.00 24.51  ? 149 GLU B CA  1 
ATOM   3825  C  C   . GLU B 1 149 ? 52.903  9.122   63.256  1.00 22.63  ? 149 GLU B C   1 
ATOM   3826  O  O   . GLU B 1 149 ? 53.396  9.148   64.384  1.00 23.81  ? 149 GLU B O   1 
ATOM   3827  C  CB  . GLU B 1 149 ? 52.053  6.708   63.278  1.00 28.90  ? 149 GLU B CB  1 
ATOM   3828  C  CG  . GLU B 1 149 ? 51.571  6.117   64.614  1.00 35.12  ? 149 GLU B CG  1 
ATOM   3829  C  CD  . GLU B 1 149 ? 50.336  6.800   65.258  1.00 40.18  ? 149 GLU B CD  1 
ATOM   3830  O  OE1 . GLU B 1 149 ? 50.400  7.093   66.485  1.00 45.73  ? 149 GLU B OE1 1 
ATOM   3831  O  OE2 . GLU B 1 149 ? 49.301  7.051   64.584  1.00 38.53  ? 149 GLU B OE2 1 
ATOM   3832  N  N   . TRP B 1 150 ? 53.365  9.866   62.238  1.00 20.53  ? 150 TRP B N   1 
ATOM   3833  C  CA  . TRP B 1 150 ? 54.428  10.870  62.400  1.00 19.90  ? 150 TRP B CA  1 
ATOM   3834  C  C   . TRP B 1 150 ? 53.904  12.245  62.540  1.00 20.91  ? 150 TRP B C   1 
ATOM   3835  O  O   . TRP B 1 150 ? 53.046  12.682  61.772  1.00 21.09  ? 150 TRP B O   1 
ATOM   3836  C  CB  . TRP B 1 150 ? 55.380  10.918  61.228  1.00 18.68  ? 150 TRP B CB  1 
ATOM   3837  C  CG  . TRP B 1 150 ? 56.000  9.612   60.813  1.00 19.45  ? 150 TRP B CG  1 
ATOM   3838  C  CD1 . TRP B 1 150 ? 56.347  8.523   61.625  1.00 19.91  ? 150 TRP B CD1 1 
ATOM   3839  C  CD2 . TRP B 1 150 ? 56.400  9.223   59.460  1.00 19.65  ? 150 TRP B CD2 1 
ATOM   3840  N  NE1 . TRP B 1 150 ? 56.892  7.521   60.884  1.00 21.10  ? 150 TRP B NE1 1 
ATOM   3841  C  CE2 . TRP B 1 150 ? 56.946  7.863   59.574  1.00 20.19  ? 150 TRP B CE2 1 
ATOM   3842  C  CE3 . TRP B 1 150 ? 56.350  9.837   58.200  1.00 19.65  ? 150 TRP B CE3 1 
ATOM   3843  C  CZ2 . TRP B 1 150 ? 57.448  7.181   58.481  1.00 20.85  ? 150 TRP B CZ2 1 
ATOM   3844  C  CZ3 . TRP B 1 150 ? 56.850  9.131   57.092  1.00 20.88  ? 150 TRP B CZ3 1 
ATOM   3845  C  CH2 . TRP B 1 150 ? 57.381  7.833   57.228  1.00 21.62  ? 150 TRP B CH2 1 
ATOM   3846  N  N   . ASP B 1 151 ? 54.425  12.961  63.528  1.00 22.51  ? 151 ASP B N   1 
ATOM   3847  C  CA  . ASP B 1 151 ? 54.302  14.392  63.554  1.00 23.45  ? 151 ASP B CA  1 
ATOM   3848  C  C   . ASP B 1 151 ? 55.446  14.933  62.697  1.00 22.82  ? 151 ASP B C   1 
ATOM   3849  O  O   . ASP B 1 151 ? 56.313  14.189  62.226  1.00 20.08  ? 151 ASP B O   1 
ATOM   3850  C  CB  . ASP B 1 151 ? 54.395  14.902  64.991  1.00 28.69  ? 151 ASP B CB  1 
ATOM   3851  C  CG  . ASP B 1 151 ? 53.013  15.184  65.630  1.00 35.23  ? 151 ASP B CG  1 
ATOM   3852  O  OD1 . ASP B 1 151 ? 52.076  15.620  64.911  1.00 39.39  ? 151 ASP B OD1 1 
ATOM   3853  O  OD2 . ASP B 1 151 ? 52.870  15.002  66.872  1.00 37.67  ? 151 ASP B OD2 1 
ATOM   3854  N  N   . LEU B 1 152 ? 55.447  16.239  62.513  1.00 22.07  ? 152 LEU B N   1 
ATOM   3855  C  CA  . LEU B 1 152 ? 56.350  16.890  61.598  1.00 21.59  ? 152 LEU B CA  1 
ATOM   3856  C  C   . LEU B 1 152 ? 57.811  16.887  62.087  1.00 23.51  ? 152 LEU B C   1 
ATOM   3857  O  O   . LEU B 1 152 ? 58.747  17.234  61.328  1.00 23.81  ? 152 LEU B O   1 
ATOM   3858  C  CB  . LEU B 1 152 ? 55.842  18.301  61.370  1.00 20.81  ? 152 LEU B CB  1 
ATOM   3859  C  CG  . LEU B 1 152 ? 54.996  18.567  60.112  1.00 21.47  ? 152 LEU B CG  1 
ATOM   3860  C  CD1 . LEU B 1 152 ? 54.312  17.360  59.471  1.00 20.26  ? 152 LEU B CD1 1 
ATOM   3861  C  CD2 . LEU B 1 152 ? 54.011  19.637  60.503  1.00 18.64  ? 152 LEU B CD2 1 
ATOM   3862  N  N   . ASN B 1 153 ? 58.005  16.500  63.350  1.00 22.04  ? 153 ASN B N   1 
ATOM   3863  C  CA  . ASN B 1 153 ? 59.345  16.314  63.882  1.00 22.75  ? 153 ASN B CA  1 
ATOM   3864  C  C   . ASN B 1 153 ? 60.041  15.009  63.395  1.00 22.37  ? 153 ASN B C   1 
ATOM   3865  O  O   . ASN B 1 153 ? 61.245  14.840  63.582  1.00 22.62  ? 153 ASN B O   1 
ATOM   3866  C  CB  . ASN B 1 153 ? 59.282  16.297  65.399  1.00 22.22  ? 153 ASN B CB  1 
ATOM   3867  C  CG  . ASN B 1 153 ? 58.536  15.083  65.917  1.00 25.65  ? 153 ASN B CG  1 
ATOM   3868  O  OD1 . ASN B 1 153 ? 57.400  14.809  65.521  1.00 27.54  ? 153 ASN B OD1 1 
ATOM   3869  N  ND2 . ASN B 1 153 ? 59.185  14.319  66.763  1.00 27.71  ? 153 ASN B ND2 1 
ATOM   3870  N  N   . ALA B 1 154 ? 59.292  14.072  62.825  1.00 21.50  ? 154 ALA B N   1 
ATOM   3871  C  CA  . ALA B 1 154 ? 59.849  12.764  62.504  1.00 22.10  ? 154 ALA B CA  1 
ATOM   3872  C  C   . ALA B 1 154 ? 61.118  12.851  61.644  1.00 23.65  ? 154 ALA B C   1 
ATOM   3873  O  O   . ALA B 1 154 ? 61.126  13.531  60.590  1.00 24.32  ? 154 ALA B O   1 
ATOM   3874  C  CB  . ALA B 1 154 ? 58.810  11.888  61.836  1.00 19.50  ? 154 ALA B CB  1 
ATOM   3875  N  N   . GLN B 1 155 ? 62.180  12.187  62.108  1.00 24.47  ? 155 GLN B N   1 
ATOM   3876  C  CA  . GLN B 1 155 ? 63.442  12.006  61.343  1.00 26.31  ? 155 GLN B CA  1 
ATOM   3877  C  C   . GLN B 1 155 ? 63.243  11.663  59.882  1.00 23.31  ? 155 GLN B C   1 
ATOM   3878  O  O   . GLN B 1 155 ? 63.997  12.123  59.028  1.00 23.76  ? 155 GLN B O   1 
ATOM   3879  C  CB  . GLN B 1 155 ? 64.292  10.851  61.932  1.00 29.46  ? 155 GLN B CB  1 
ATOM   3880  C  CG  . GLN B 1 155 ? 65.047  11.174  63.209  1.00 34.71  ? 155 GLN B CG  1 
ATOM   3881  C  CD  . GLN B 1 155 ? 65.854  12.448  63.109  1.00 38.03  ? 155 GLN B CD  1 
ATOM   3882  O  OE1 . GLN B 1 155 ? 66.880  12.498  62.424  1.00 41.62  ? 155 GLN B OE1 1 
ATOM   3883  N  NE2 . GLN B 1 155 ? 65.406  13.489  63.817  1.00 39.54  ? 155 GLN B NE2 1 
ATOM   3884  N  N   . GLU B 1 156 ? 62.254  10.814  59.615  1.00 23.89  ? 156 GLU B N   1 
ATOM   3885  C  CA  . GLU B 1 156 ? 62.034  10.228  58.292  1.00 25.01  ? 156 GLU B CA  1 
ATOM   3886  C  C   . GLU B 1 156 ? 61.666  11.303  57.251  1.00 24.60  ? 156 GLU B C   1 
ATOM   3887  O  O   . GLU B 1 156 ? 61.897  11.135  56.048  1.00 25.08  ? 156 GLU B O   1 
ATOM   3888  C  CB  . GLU B 1 156 ? 60.964  9.150   58.353  1.00 26.45  ? 156 GLU B CB  1 
ATOM   3889  C  CG  . GLU B 1 156 ? 61.395  7.879   59.051  1.00 30.06  ? 156 GLU B CG  1 
ATOM   3890  C  CD  . GLU B 1 156 ? 61.155  7.833   60.568  1.00 33.63  ? 156 GLU B CD  1 
ATOM   3891  O  OE1 . GLU B 1 156 ? 60.793  8.847   61.232  1.00 32.41  ? 156 GLU B OE1 1 
ATOM   3892  O  OE2 . GLU B 1 156 ? 61.332  6.720   61.120  1.00 38.33  ? 156 GLU B OE2 1 
ATOM   3893  N  N   . LEU B 1 157 ? 61.130  12.407  57.743  1.00 21.72  ? 157 LEU B N   1 
ATOM   3894  C  CA  . LEU B 1 157 ? 60.703  13.511  56.917  1.00 22.12  ? 157 LEU B CA  1 
ATOM   3895  C  C   . LEU B 1 157 ? 61.773  14.568  56.789  1.00 22.17  ? 157 LEU B C   1 
ATOM   3896  O  O   . LEU B 1 157 ? 61.570  15.575  56.125  1.00 21.46  ? 157 LEU B O   1 
ATOM   3897  C  CB  . LEU B 1 157 ? 59.468  14.167  57.539  1.00 20.01  ? 157 LEU B CB  1 
ATOM   3898  C  CG  . LEU B 1 157 ? 58.229  13.297  57.652  1.00 20.14  ? 157 LEU B CG  1 
ATOM   3899  C  CD1 . LEU B 1 157 ? 57.169  14.035  58.475  1.00 18.88  ? 157 LEU B CD1 1 
ATOM   3900  C  CD2 . LEU B 1 157 ? 57.713  12.873  56.275  1.00 18.28  ? 157 LEU B CD2 1 
ATOM   3901  N  N   . PHE B 1 158 ? 62.885  14.378  57.489  1.00 23.83  ? 158 PHE B N   1 
ATOM   3902  C  CA  . PHE B 1 158 ? 64.054  15.234  57.287  1.00 24.90  ? 158 PHE B CA  1 
ATOM   3903  C  C   . PHE B 1 158 ? 64.512  15.401  55.829  1.00 23.81  ? 158 PHE B C   1 
ATOM   3904  O  O   . PHE B 1 158 ? 64.789  16.528  55.402  1.00 24.39  ? 158 PHE B O   1 
ATOM   3905  C  CB  . PHE B 1 158 ? 65.190  14.807  58.209  1.00 25.93  ? 158 PHE B CB  1 
ATOM   3906  C  CG  . PHE B 1 158 ? 65.117  15.475  59.540  1.00 28.60  ? 158 PHE B CG  1 
ATOM   3907  C  CD1 . PHE B 1 158 ? 63.880  15.614  60.191  1.00 29.56  ? 158 PHE B CD1 1 
ATOM   3908  C  CD2 . PHE B 1 158 ? 66.245  15.988  60.145  1.00 30.72  ? 158 PHE B CD2 1 
ATOM   3909  C  CE1 . PHE B 1 158 ? 63.785  16.241  61.424  1.00 31.33  ? 158 PHE B CE1 1 
ATOM   3910  C  CE2 . PHE B 1 158 ? 66.158  16.637  61.384  1.00 32.27  ? 158 PHE B CE2 1 
ATOM   3911  C  CZ  . PHE B 1 158 ? 64.926  16.764  62.023  1.00 31.61  ? 158 PHE B CZ  1 
ATOM   3912  N  N   . PRO B 1 159 ? 64.548  14.302  55.053  1.00 22.91  ? 159 PRO B N   1 
ATOM   3913  C  CA  . PRO B 1 159 ? 64.894  14.422  53.610  1.00 23.90  ? 159 PRO B CA  1 
ATOM   3914  C  C   . PRO B 1 159 ? 64.005  15.394  52.785  1.00 22.18  ? 159 PRO B C   1 
ATOM   3915  O  O   . PRO B 1 159 ? 64.469  16.007  51.824  1.00 24.25  ? 159 PRO B O   1 
ATOM   3916  C  CB  . PRO B 1 159 ? 64.747  12.990  53.087  1.00 23.33  ? 159 PRO B CB  1 
ATOM   3917  C  CG  . PRO B 1 159 ? 64.941  12.106  54.296  1.00 24.13  ? 159 PRO B CG  1 
ATOM   3918  C  CD  . PRO B 1 159 ? 64.481  12.893  55.495  1.00 23.67  ? 159 PRO B CD  1 
ATOM   3919  N  N   . VAL B 1 160 ? 62.742  15.483  53.153  1.00 20.60  ? 160 VAL B N   1 
ATOM   3920  C  CA  . VAL B 1 160 ? 61.806  16.356  52.510  1.00 20.47  ? 160 VAL B CA  1 
ATOM   3921  C  C   . VAL B 1 160 ? 62.049  17.804  52.880  1.00 19.66  ? 160 VAL B C   1 
ATOM   3922  O  O   . VAL B 1 160 ? 61.884  18.687  52.026  1.00 20.34  ? 160 VAL B O   1 
ATOM   3923  C  CB  . VAL B 1 160 ? 60.348  16.009  52.842  1.00 20.22  ? 160 VAL B CB  1 
ATOM   3924  C  CG1 . VAL B 1 160 ? 59.443  17.023  52.173  1.00 20.11  ? 160 VAL B CG1 1 
ATOM   3925  C  CG2 . VAL B 1 160 ? 60.027  14.634  52.324  1.00 20.20  ? 160 VAL B CG2 1 
ATOM   3926  N  N   . TYR B 1 161 ? 62.444  18.061  54.126  1.00 17.44  ? 161 TYR B N   1 
ATOM   3927  C  CA  . TYR B 1 161 ? 62.849  19.412  54.475  1.00 17.00  ? 161 TYR B CA  1 
ATOM   3928  C  C   . TYR B 1 161 ? 64.142  19.779  53.832  1.00 17.23  ? 161 TYR B C   1 
ATOM   3929  O  O   . TYR B 1 161 ? 64.277  20.902  53.371  1.00 19.20  ? 161 TYR B O   1 
ATOM   3930  C  CB  . TYR B 1 161 ? 62.941  19.662  55.989  1.00 16.81  ? 161 TYR B CB  1 
ATOM   3931  C  CG  . TYR B 1 161 ? 61.710  19.243  56.725  1.00 16.79  ? 161 TYR B CG  1 
ATOM   3932  C  CD1 . TYR B 1 161 ? 60.453  19.616  56.273  1.00 17.05  ? 161 TYR B CD1 1 
ATOM   3933  C  CD2 . TYR B 1 161 ? 61.795  18.480  57.859  1.00 16.29  ? 161 TYR B CD2 1 
ATOM   3934  C  CE1 . TYR B 1 161 ? 59.312  19.232  56.947  1.00 17.23  ? 161 TYR B CE1 1 
ATOM   3935  C  CE2 . TYR B 1 161 ? 60.658  18.085  58.533  1.00 17.27  ? 161 TYR B CE2 1 
ATOM   3936  C  CZ  . TYR B 1 161 ? 59.424  18.471  58.063  1.00 17.08  ? 161 TYR B CZ  1 
ATOM   3937  O  OH  . TYR B 1 161 ? 58.304  18.070  58.703  1.00 16.64  ? 161 TYR B OH  1 
ATOM   3938  N  N   . ALA B 1 162 ? 65.113  18.874  53.816  1.00 17.98  ? 162 ALA B N   1 
ATOM   3939  C  CA  . ALA B 1 162 ? 66.416  19.202  53.197  1.00 18.12  ? 162 ALA B CA  1 
ATOM   3940  C  C   . ALA B 1 162 ? 66.222  19.574  51.718  1.00 17.66  ? 162 ALA B C   1 
ATOM   3941  O  O   . ALA B 1 162 ? 66.787  20.561  51.250  1.00 18.72  ? 162 ALA B O   1 
ATOM   3942  C  CB  . ALA B 1 162 ? 67.430  18.080  53.376  1.00 16.49  ? 162 ALA B CB  1 
ATOM   3943  N  N   . ALA B 1 163 ? 65.356  18.843  51.023  1.00 17.41  ? 163 ALA B N   1 
ATOM   3944  C  CA  . ALA B 1 163 ? 65.012  19.169  49.625  1.00 18.50  ? 163 ALA B CA  1 
ATOM   3945  C  C   . ALA B 1 163 ? 64.208  20.451  49.511  1.00 18.80  ? 163 ALA B C   1 
ATOM   3946  O  O   . ALA B 1 163 ? 64.506  21.296  48.671  1.00 21.14  ? 163 ALA B O   1 
ATOM   3947  C  CB  . ALA B 1 163 ? 64.269  18.015  48.953  1.00 19.20  ? 163 ALA B CB  1 
ATOM   3948  N  N   . ALA B 1 164 ? 63.209  20.629  50.365  1.00 19.03  ? 164 ALA B N   1 
ATOM   3949  C  CA  . ALA B 1 164 ? 62.452  21.879  50.371  1.00 20.14  ? 164 ALA B CA  1 
ATOM   3950  C  C   . ALA B 1 164 ? 63.344  23.114  50.533  1.00 19.99  ? 164 ALA B C   1 
ATOM   3951  O  O   . ALA B 1 164 ? 63.173  24.108  49.826  1.00 19.28  ? 164 ALA B O   1 
ATOM   3952  C  CB  . ALA B 1 164 ? 61.357  21.844  51.441  1.00 20.45  ? 164 ALA B CB  1 
ATOM   3953  N  N   . GLU B 1 165 ? 64.299  23.046  51.457  1.00 21.17  ? 165 GLU B N   1 
ATOM   3954  C  CA  . GLU B 1 165 ? 65.304  24.094  51.579  1.00 23.74  ? 165 GLU B CA  1 
ATOM   3955  C  C   . GLU B 1 165 ? 66.199  24.332  50.324  1.00 26.06  ? 165 GLU B C   1 
ATOM   3956  O  O   . GLU B 1 165 ? 66.402  25.488  49.957  1.00 31.52  ? 165 GLU B O   1 
ATOM   3957  C  CB  . GLU B 1 165 ? 66.170  23.864  52.800  1.00 23.32  ? 165 GLU B CB  1 
ATOM   3958  C  CG  . GLU B 1 165 ? 66.777  25.140  53.317  1.00 26.77  ? 165 GLU B CG  1 
ATOM   3959  C  CD  . GLU B 1 165 ? 67.765  24.920  54.473  1.00 31.61  ? 165 GLU B CD  1 
ATOM   3960  O  OE1 . GLU B 1 165 ? 68.626  23.996  54.378  1.00 31.34  ? 165 GLU B OE1 1 
ATOM   3961  O  OE2 . GLU B 1 165 ? 67.688  25.700  55.469  1.00 28.16  ? 165 GLU B OE2 1 
ATOM   3962  N  N   . ARG B 1 166 ? 66.708  23.297  49.656  1.00 25.70  ? 166 ARG B N   1 
ATOM   3963  C  CA  . ARG B 1 166 ? 67.478  23.519  48.385  1.00 29.87  ? 166 ARG B CA  1 
ATOM   3964  C  C   . ARG B 1 166 ? 66.671  24.016  47.199  1.00 27.56  ? 166 ARG B C   1 
ATOM   3965  O  O   . ARG B 1 166 ? 67.215  24.661  46.298  1.00 28.17  ? 166 ARG B O   1 
ATOM   3966  C  CB  . ARG B 1 166 ? 68.069  22.226  47.809  1.00 32.85  ? 166 ARG B CB  1 
ATOM   3967  C  CG  . ARG B 1 166 ? 69.031  21.403  48.619  1.00 38.52  ? 166 ARG B CG  1 
ATOM   3968  C  CD  . ARG B 1 166 ? 69.759  20.452  47.650  1.00 43.57  ? 166 ARG B CD  1 
ATOM   3969  N  NE  . ARG B 1 166 ? 68.872  19.855  46.633  1.00 44.73  ? 166 ARG B NE  1 
ATOM   3970  C  CZ  . ARG B 1 166 ? 68.152  18.747  46.822  1.00 47.36  ? 166 ARG B CZ  1 
ATOM   3971  N  NH1 . ARG B 1 166 ? 68.199  18.107  47.997  1.00 46.57  ? 166 ARG B NH1 1 
ATOM   3972  N  NH2 . ARG B 1 166 ? 67.382  18.278  45.844  1.00 46.59  ? 166 ARG B NH2 1 
ATOM   3973  N  N   . LEU B 1 167 ? 65.415  23.591  47.108  1.00 25.50  ? 167 LEU B N   1 
ATOM   3974  C  CA  . LEU B 1 167 ? 64.619  23.908  45.914  1.00 24.71  ? 167 LEU B CA  1 
ATOM   3975  C  C   . LEU B 1 167 ? 64.057  25.292  46.087  1.00 25.77  ? 167 LEU B C   1 
ATOM   3976  O  O   . LEU B 1 167 ? 63.465  25.874  45.154  1.00 26.57  ? 167 LEU B O   1 
ATOM   3977  C  CB  . LEU B 1 167 ? 63.503  22.886  45.682  1.00 23.19  ? 167 LEU B CB  1 
ATOM   3978  C  CG  . LEU B 1 167 ? 63.967  21.426  45.518  1.00 23.26  ? 167 LEU B CG  1 
ATOM   3979  C  CD1 . LEU B 1 167 ? 62.823  20.432  45.713  1.00 21.83  ? 167 LEU B CD1 1 
ATOM   3980  C  CD2 . LEU B 1 167 ? 64.668  21.201  44.172  1.00 23.64  ? 167 LEU B CD2 1 
ATOM   3981  N  N   . LYS B 1 168 ? 64.284  25.833  47.292  1.00 27.22  ? 168 LYS B N   1 
ATOM   3982  C  CA  . LYS B 1 168 ? 63.646  27.070  47.727  1.00 26.91  ? 168 LYS B CA  1 
ATOM   3983  C  C   . LYS B 1 168 ? 62.135  26.870  47.582  1.00 24.76  ? 168 LYS B C   1 
ATOM   3984  O  O   . LYS B 1 168 ? 61.422  27.673  46.996  1.00 23.60  ? 168 LYS B O   1 
ATOM   3985  C  CB  . LYS B 1 168 ? 64.166  28.254  46.912  1.00 30.54  ? 168 LYS B CB  1 
ATOM   3986  C  CG  . LYS B 1 168 ? 65.679  28.420  47.047  1.00 36.40  ? 168 LYS B CG  1 
ATOM   3987  C  CD  . LYS B 1 168 ? 66.191  29.805  46.632  1.00 38.86  ? 168 LYS B CD  1 
ATOM   3988  C  CE  . LYS B 1 168 ? 67.628  29.990  47.121  1.00 42.87  ? 168 LYS B CE  1 
ATOM   3989  N  NZ  . LYS B 1 168 ? 68.572  28.962  46.552  1.00 42.04  ? 168 LYS B NZ  1 
ATOM   3990  N  N   . CYS B 1 169 ? 61.671  25.746  48.108  1.00 21.93  ? 169 CYS B N   1 
ATOM   3991  C  CA  . CYS B 1 169 ? 60.273  25.397  48.067  1.00 21.06  ? 169 CYS B CA  1 
ATOM   3992  C  C   . CYS B 1 169 ? 59.544  25.806  49.398  1.00 20.30  ? 169 CYS B C   1 
ATOM   3993  O  O   . CYS B 1 169 ? 59.880  25.310  50.467  1.00 20.88  ? 169 CYS B O   1 
ATOM   3994  C  CB  . CYS B 1 169 ? 60.214  23.905  47.810  1.00 20.91  ? 169 CYS B CB  1 
ATOM   3995  S  SG  . CYS B 1 169 ? 58.557  23.219  47.806  1.00 24.83  ? 169 CYS B SG  1 
ATOM   3996  N  N   . SER B 1 170 ? 58.604  26.745  49.347  1.00 18.20  ? 170 SER B N   1 
ATOM   3997  C  CA  . SER B 1 170 ? 57.831  27.100  50.537  1.00 18.28  ? 170 SER B CA  1 
ATOM   3998  C  C   . SER B 1 170 ? 56.898  25.953  50.959  1.00 17.04  ? 170 SER B C   1 
ATOM   3999  O  O   . SER B 1 170 ? 56.623  25.075  50.163  1.00 19.69  ? 170 SER B O   1 
ATOM   4000  C  CB  . SER B 1 170 ? 57.061  28.386  50.304  1.00 19.21  ? 170 SER B CB  1 
ATOM   4001  O  OG  . SER B 1 170 ? 57.986  29.472  50.273  1.00 21.92  ? 170 SER B OG  1 
ATOM   4002  N  N   . LEU B 1 171 ? 56.486  25.922  52.209  1.00 13.88  ? 171 LEU B N   1 
ATOM   4003  C  CA  . LEU B 1 171 ? 55.679  24.854  52.731  1.00 13.24  ? 171 LEU B CA  1 
ATOM   4004  C  C   . LEU B 1 171 ? 54.478  25.452  53.406  1.00 12.18  ? 171 LEU B C   1 
ATOM   4005  O  O   . LEU B 1 171 ? 54.605  26.287  54.288  1.00 12.35  ? 171 LEU B O   1 
ATOM   4006  C  CB  . LEU B 1 171 ? 56.424  24.013  53.783  1.00 13.73  ? 171 LEU B CB  1 
ATOM   4007  C  CG  . LEU B 1 171 ? 57.671  23.169  53.509  1.00 13.87  ? 171 LEU B CG  1 
ATOM   4008  C  CD1 . LEU B 1 171 ? 57.826  22.233  54.702  1.00 13.88  ? 171 LEU B CD1 1 
ATOM   4009  C  CD2 . LEU B 1 171 ? 57.619  22.359  52.226  1.00 13.91  ? 171 LEU B CD2 1 
ATOM   4010  N  N   . PHE B 1 172 ? 53.300  25.044  52.982  1.00 11.06  ? 172 PHE B N   1 
ATOM   4011  C  CA  . PHE B 1 172 ? 52.100  25.543  53.605  1.00 10.34  ? 172 PHE B CA  1 
ATOM   4012  C  C   . PHE B 1 172 ? 51.497  24.341  54.365  1.00 9.97   ? 172 PHE B C   1 
ATOM   4013  O  O   . PHE B 1 172 ? 51.272  23.290  53.790  1.00 10.04  ? 172 PHE B O   1 
ATOM   4014  C  CB  . PHE B 1 172 ? 51.201  26.178  52.548  1.00 10.30  ? 172 PHE B CB  1 
ATOM   4015  C  CG  . PHE B 1 172 ? 49.940  26.750  53.087  1.00 11.50  ? 172 PHE B CG  1 
ATOM   4016  C  CD1 . PHE B 1 172 ? 49.933  27.988  53.742  1.00 12.12  ? 172 PHE B CD1 1 
ATOM   4017  C  CD2 . PHE B 1 172 ? 48.729  26.087  52.908  1.00 11.66  ? 172 PHE B CD2 1 
ATOM   4018  C  CE1 . PHE B 1 172 ? 48.757  28.522  54.253  1.00 12.19  ? 172 PHE B CE1 1 
ATOM   4019  C  CE2 . PHE B 1 172 ? 47.564  26.615  53.429  1.00 12.19  ? 172 PHE B CE2 1 
ATOM   4020  C  CZ  . PHE B 1 172 ? 47.585  27.826  54.116  1.00 12.10  ? 172 PHE B CZ  1 
ATOM   4021  N  N   . VAL B 1 173 ? 51.344  24.475  55.674  1.00 9.23   ? 173 VAL B N   1 
ATOM   4022  C  CA  . VAL B 1 173 ? 51.011  23.360  56.531  1.00 9.19   ? 173 VAL B CA  1 
ATOM   4023  C  C   . VAL B 1 173 ? 49.578  23.547  56.872  1.00 8.79   ? 173 VAL B C   1 
ATOM   4024  O  O   . VAL B 1 173 ? 49.222  24.559  57.421  1.00 8.80   ? 173 VAL B O   1 
ATOM   4025  C  CB  . VAL B 1 173 ? 51.863  23.389  57.828  1.00 9.44   ? 173 VAL B CB  1 
ATOM   4026  C  CG1 . VAL B 1 173 ? 51.402  22.308  58.785  1.00 9.61   ? 173 VAL B CG1 1 
ATOM   4027  C  CG2 . VAL B 1 173 ? 53.348  23.172  57.519  1.00 9.01   ? 173 VAL B CG2 1 
ATOM   4028  N  N   . HIS B 1 174 ? 48.741  22.605  56.498  1.00 8.87   ? 174 HIS B N   1 
ATOM   4029  C  CA  . HIS B 1 174 ? 47.313  22.731  56.675  1.00 9.45   ? 174 HIS B CA  1 
ATOM   4030  C  C   . HIS B 1 174 ? 46.830  21.609  57.579  1.00 10.12  ? 174 HIS B C   1 
ATOM   4031  O  O   . HIS B 1 174 ? 47.098  20.458  57.310  1.00 9.89   ? 174 HIS B O   1 
ATOM   4032  C  CB  . HIS B 1 174 ? 46.613  22.568  55.315  1.00 9.49   ? 174 HIS B CB  1 
ATOM   4033  C  CG  . HIS B 1 174 ? 45.189  23.058  55.302  1.00 9.60   ? 174 HIS B CG  1 
ATOM   4034  N  ND1 . HIS B 1 174 ? 44.232  22.513  56.066  1.00 9.60   ? 174 HIS B ND1 1 
ATOM   4035  C  CD2 . HIS B 1 174 ? 44.585  24.108  54.610  1.00 9.91   ? 174 HIS B CD2 1 
ATOM   4036  C  CE1 . HIS B 1 174 ? 43.057  23.156  55.880  1.00 9.42   ? 174 HIS B CE1 1 
ATOM   4037  N  NE2 . HIS B 1 174 ? 43.274  24.141  55.001  1.00 10.69  ? 174 HIS B NE2 1 
ATOM   4038  N  N   . PRO B 1 175 ? 46.040  21.905  58.611  1.00 10.71  ? 175 PRO B N   1 
ATOM   4039  C  CA  . PRO B 1 175 ? 45.564  20.783  59.444  1.00 11.89  ? 175 PRO B CA  1 
ATOM   4040  C  C   . PRO B 1 175 ? 44.630  19.848  58.697  1.00 13.38  ? 175 PRO B C   1 
ATOM   4041  O  O   . PRO B 1 175 ? 43.815  20.242  57.838  1.00 13.19  ? 175 PRO B O   1 
ATOM   4042  C  CB  . PRO B 1 175 ? 44.824  21.461  60.587  1.00 10.92  ? 175 PRO B CB  1 
ATOM   4043  C  CG  . PRO B 1 175 ? 44.408  22.773  60.042  1.00 11.23  ? 175 PRO B CG  1 
ATOM   4044  C  CD  . PRO B 1 175 ? 45.284  23.136  58.860  1.00 10.91  ? 175 PRO B CD  1 
ATOM   4045  N  N   . TRP B 1 176 ? 44.804  18.589  58.998  1.00 15.84  ? 176 TRP B N   1 
ATOM   4046  C  CA  . TRP B 1 176 ? 43.982  17.556  58.429  1.00 19.10  ? 176 TRP B CA  1 
ATOM   4047  C  C   . TRP B 1 176 ? 44.048  16.350  59.332  1.00 20.58  ? 176 TRP B C   1 
ATOM   4048  O  O   . TRP B 1 176 ? 44.972  16.215  60.137  1.00 20.44  ? 176 TRP B O   1 
ATOM   4049  C  CB  . TRP B 1 176 ? 44.351  17.213  56.972  1.00 20.95  ? 176 TRP B CB  1 
ATOM   4050  C  CG  . TRP B 1 176 ? 43.164  16.443  56.444  1.00 24.28  ? 176 TRP B CG  1 
ATOM   4051  C  CD1 . TRP B 1 176 ? 43.120  15.100  56.043  1.00 24.19  ? 176 TRP B CD1 1 
ATOM   4052  C  CD2 . TRP B 1 176 ? 41.728  16.889  56.442  1.00 24.87  ? 176 TRP B CD2 1 
ATOM   4053  N  NE1 . TRP B 1 176 ? 41.819  14.734  55.737  1.00 25.89  ? 176 TRP B NE1 1 
ATOM   4054  C  CE2 . TRP B 1 176 ? 40.945  15.746  55.953  1.00 24.48  ? 176 TRP B CE2 1 
ATOM   4055  C  CE3 . TRP B 1 176 ? 41.059  18.097  56.743  1.00 24.75  ? 176 TRP B CE3 1 
ATOM   4056  C  CZ2 . TRP B 1 176 ? 39.567  15.808  55.805  1.00 23.53  ? 176 TRP B CZ2 1 
ATOM   4057  C  CZ3 . TRP B 1 176 ? 39.679  18.162  56.553  1.00 24.96  ? 176 TRP B CZ3 1 
ATOM   4058  C  CH2 . TRP B 1 176 ? 38.950  17.044  56.091  1.00 25.62  ? 176 TRP B CH2 1 
ATOM   4059  N  N   . ASP B 1 177 ? 43.028  15.521  59.269  1.00 22.65  ? 177 ASP B N   1 
ATOM   4060  C  CA  . ASP B 1 177 ? 42.974  14.315  60.063  1.00 27.14  ? 177 ASP B CA  1 
ATOM   4061  C  C   . ASP B 1 177 ? 42.938  14.467  61.574  1.00 26.62  ? 177 ASP B C   1 
ATOM   4062  O  O   . ASP B 1 177 ? 43.637  13.745  62.323  1.00 27.08  ? 177 ASP B O   1 
ATOM   4063  C  CB  . ASP B 1 177 ? 44.086  13.390  59.635  1.00 31.53  ? 177 ASP B CB  1 
ATOM   4064  C  CG  . ASP B 1 177 ? 43.603  12.371  58.693  1.00 38.71  ? 177 ASP B CG  1 
ATOM   4065  O  OD1 . ASP B 1 177 ? 42.537  11.759  59.003  1.00 44.31  ? 177 ASP B OD1 1 
ATOM   4066  O  OD2 . ASP B 1 177 ? 44.267  12.196  57.647  1.00 45.34  ? 177 ASP B OD2 1 
ATOM   4067  N  N   . MET B 1 178 ? 42.136  15.426  62.020  1.00 27.32  ? 178 MET B N   1 
ATOM   4068  C  CA  . MET B 1 178 ? 41.770  15.546  63.429  1.00 27.89  ? 178 MET B CA  1 
ATOM   4069  C  C   . MET B 1 178 ? 40.849  14.351  63.701  1.00 27.18  ? 178 MET B C   1 
ATOM   4070  O  O   . MET B 1 178 ? 40.275  13.811  62.777  1.00 26.78  ? 178 MET B O   1 
ATOM   4071  C  CB  . MET B 1 178 ? 40.962  16.826  63.680  1.00 27.66  ? 178 MET B CB  1 
ATOM   4072  C  CG  . MET B 1 178 ? 41.334  18.024  62.852  1.00 27.82  ? 178 MET B CG  1 
ATOM   4073  S  SD  . MET B 1 178 ? 40.911  17.918  61.101  1.00 31.19  ? 178 MET B SD  1 
ATOM   4074  C  CE  . MET B 1 178 ? 39.113  17.871  61.007  1.00 27.19  ? 178 MET B CE  1 
ATOM   4075  N  N   . GLN B 1 179 ? 40.699  13.960  64.961  1.00 29.66  ? 179 GLN B N   1 
ATOM   4076  C  CA  . GLN B 1 179 ? 39.645  13.024  65.369  1.00 29.58  ? 179 GLN B CA  1 
ATOM   4077  C  C   . GLN B 1 179 ? 38.268  13.536  64.911  1.00 28.15  ? 179 GLN B C   1 
ATOM   4078  O  O   . GLN B 1 179 ? 37.908  14.673  65.167  1.00 26.07  ? 179 GLN B O   1 
ATOM   4079  C  CB  . GLN B 1 179 ? 39.677  12.847  66.882  1.00 27.79  ? 179 GLN B CB  1 
ATOM   4080  C  CG  . GLN B 1 179 ? 38.579  11.989  67.457  1.00 30.17  ? 179 GLN B CG  1 
ATOM   4081  C  CD  . GLN B 1 179 ? 38.616  11.987  68.981  1.00 29.35  ? 179 GLN B CD  1 
ATOM   4082  O  OE1 . GLN B 1 179 ? 39.652  12.232  69.557  1.00 31.60  ? 179 GLN B OE1 1 
ATOM   4083  N  NE2 . GLN B 1 179 ? 37.484  11.718  69.631  1.00 26.98  ? 179 GLN B NE2 1 
ATOM   4084  N  N   . MET B 1 180 ? 37.535  12.679  64.207  1.00 30.71  ? 180 MET B N   1 
ATOM   4085  C  CA  . MET B 1 180 ? 36.205  12.987  63.676  1.00 33.88  ? 180 MET B CA  1 
ATOM   4086  C  C   . MET B 1 180 ? 35.038  12.375  64.447  1.00 33.36  ? 180 MET B C   1 
ATOM   4087  O  O   . MET B 1 180 ? 33.897  12.763  64.235  1.00 35.00  ? 180 MET B O   1 
ATOM   4088  C  CB  . MET B 1 180 ? 36.130  12.528  62.224  1.00 35.47  ? 180 MET B CB  1 
ATOM   4089  C  CG  . MET B 1 180 ? 37.338  13.010  61.444  1.00 38.96  ? 180 MET B CG  1 
ATOM   4090  S  SD  . MET B 1 180 ? 37.135  14.701  60.873  1.00 41.24  ? 180 MET B SD  1 
ATOM   4091  C  CE  . MET B 1 180 ? 36.763  14.344  59.162  1.00 39.42  ? 180 MET B CE  1 
ATOM   4092  N  N   . ASP B 1 181 ? 35.324  11.422  65.324  1.00 33.02  ? 181 ASP B N   1 
ATOM   4093  C  CA  . ASP B 1 181 ? 34.272  10.638  65.992  1.00 35.96  ? 181 ASP B CA  1 
ATOM   4094  C  C   . ASP B 1 181 ? 34.331  10.750  67.520  1.00 33.30  ? 181 ASP B C   1 
ATOM   4095  O  O   . ASP B 1 181 ? 35.082  11.570  68.049  1.00 34.51  ? 181 ASP B O   1 
ATOM   4096  C  CB  . ASP B 1 181 ? 34.341  9.159   65.536  1.00 39.26  ? 181 ASP B CB  1 
ATOM   4097  C  CG  . ASP B 1 181 ? 35.546  8.396   66.114  1.00 43.95  ? 181 ASP B CG  1 
ATOM   4098  O  OD1 . ASP B 1 181 ? 36.456  9.000   66.748  1.00 47.13  ? 181 ASP B OD1 1 
ATOM   4099  O  OD2 . ASP B 1 181 ? 35.585  7.160   65.924  1.00 49.81  ? 181 ASP B OD2 1 
ATOM   4100  N  N   . GLY B 1 182 ? 33.551  9.919   68.214  1.00 31.49  ? 182 GLY B N   1 
ATOM   4101  C  CA  . GLY B 1 182 ? 33.577  9.864   69.673  1.00 30.06  ? 182 GLY B CA  1 
ATOM   4102  C  C   . GLY B 1 182 ? 33.054  11.178  70.210  1.00 30.25  ? 182 GLY B C   1 
ATOM   4103  O  O   . GLY B 1 182 ? 32.026  11.687  69.731  1.00 32.99  ? 182 GLY B O   1 
ATOM   4104  N  N   . ARG B 1 183 ? 33.786  11.759  71.153  1.00 26.92  ? 183 ARG B N   1 
ATOM   4105  C  CA  . ARG B 1 183 ? 33.386  13.018  71.775  1.00 25.35  ? 183 ARG B CA  1 
ATOM   4106  C  C   . ARG B 1 183 ? 33.418  14.158  70.750  1.00 25.84  ? 183 ARG B C   1 
ATOM   4107  O  O   . ARG B 1 183 ? 32.699  15.152  70.900  1.00 24.38  ? 183 ARG B O   1 
ATOM   4108  C  CB  . ARG B 1 183 ? 34.295  13.347  72.959  1.00 24.98  ? 183 ARG B CB  1 
ATOM   4109  C  CG  . ARG B 1 183 ? 34.172  12.393  74.133  1.00 27.68  ? 183 ARG B CG  1 
ATOM   4110  C  CD  . ARG B 1 183 ? 35.094  12.758  75.305  1.00 30.51  ? 183 ARG B CD  1 
ATOM   4111  N  NE  . ARG B 1 183 ? 35.218  14.210  75.505  1.00 33.29  ? 183 ARG B NE  1 
ATOM   4112  C  CZ  . ARG B 1 183 ? 36.376  14.887  75.572  1.00 34.41  ? 183 ARG B CZ  1 
ATOM   4113  N  NH1 . ARG B 1 183 ? 37.539  14.244  75.493  1.00 35.54  ? 183 ARG B NH1 1 
ATOM   4114  N  NH2 . ARG B 1 183 ? 36.373  16.208  75.717  1.00 32.78  ? 183 ARG B NH2 1 
ATOM   4115  N  N   . MET B 1 184 ? 34.221  14.008  69.694  1.00 23.92  ? 184 MET B N   1 
ATOM   4116  C  CA  . MET B 1 184 ? 34.390  15.107  68.735  1.00 26.23  ? 184 MET B CA  1 
ATOM   4117  C  C   . MET B 1 184 ? 33.330  15.181  67.642  1.00 27.30  ? 184 MET B C   1 
ATOM   4118  O  O   . MET B 1 184 ? 33.367  16.085  66.816  1.00 29.16  ? 184 MET B O   1 
ATOM   4119  C  CB  . MET B 1 184 ? 35.772  15.064  68.067  1.00 25.82  ? 184 MET B CB  1 
ATOM   4120  C  CG  . MET B 1 184 ? 36.961  15.234  69.006  1.00 25.57  ? 184 MET B CG  1 
ATOM   4121  S  SD  . MET B 1 184 ? 37.108  16.890  69.703  1.00 30.61  ? 184 MET B SD  1 
ATOM   4122  C  CE  . MET B 1 184 ? 37.875  17.890  68.385  1.00 25.59  ? 184 MET B CE  1 
ATOM   4123  N  N   . ALA B 1 185 ? 32.405  14.230  67.596  1.00 28.52  ? 185 ALA B N   1 
ATOM   4124  C  CA  . ALA B 1 185 ? 31.495  14.142  66.442  1.00 27.45  ? 185 ALA B CA  1 
ATOM   4125  C  C   . ALA B 1 185 ? 30.501  15.306  66.373  1.00 29.72  ? 185 ALA B C   1 
ATOM   4126  O  O   . ALA B 1 185 ? 29.882  15.538  65.317  1.00 35.09  ? 185 ALA B O   1 
ATOM   4127  C  CB  . ALA B 1 185 ? 30.777  12.795  66.405  1.00 23.17  ? 185 ALA B CB  1 
ATOM   4128  N  N   . LYS B 1 186 ? 30.370  16.061  67.466  1.00 25.37  ? 186 LYS B N   1 
ATOM   4129  C  CA  . LYS B 1 186 ? 29.307  17.043  67.550  1.00 24.35  ? 186 LYS B CA  1 
ATOM   4130  C  C   . LYS B 1 186 ? 29.756  18.493  67.349  1.00 23.37  ? 186 LYS B C   1 
ATOM   4131  O  O   . LYS B 1 186 ? 30.930  18.819  67.451  1.00 24.26  ? 186 LYS B O   1 
ATOM   4132  C  CB  . LYS B 1 186 ? 28.583  16.907  68.900  1.00 26.78  ? 186 LYS B CB  1 
ATOM   4133  C  CG  . LYS B 1 186 ? 29.517  16.705  70.080  1.00 26.35  ? 186 LYS B CG  1 
ATOM   4134  C  CD  . LYS B 1 186 ? 29.127  17.514  71.311  1.00 26.83  ? 186 LYS B CD  1 
ATOM   4135  C  CE  . LYS B 1 186 ? 30.190  17.422  72.402  1.00 25.68  ? 186 LYS B CE  1 
ATOM   4136  N  NZ  . LYS B 1 186 ? 30.433  15.995  72.769  1.00 23.12  ? 186 LYS B NZ  1 
ATOM   4137  N  N   . TYR B 1 187 ? 28.778  19.348  67.079  1.00 21.54  ? 187 TYR B N   1 
ATOM   4138  C  CA  . TYR B 1 187 ? 28.908  20.816  67.033  1.00 19.90  ? 187 TYR B CA  1 
ATOM   4139  C  C   . TYR B 1 187 ? 30.047  21.329  66.116  1.00 18.24  ? 187 TYR B C   1 
ATOM   4140  O  O   . TYR B 1 187 ? 30.529  22.436  66.293  1.00 17.90  ? 187 TYR B O   1 
ATOM   4141  C  CB  . TYR B 1 187 ? 29.072  21.394  68.437  1.00 20.59  ? 187 TYR B CB  1 
ATOM   4142  C  CG  . TYR B 1 187 ? 28.046  21.033  69.492  1.00 22.33  ? 187 TYR B CG  1 
ATOM   4143  C  CD1 . TYR B 1 187 ? 28.437  20.907  70.836  1.00 22.79  ? 187 TYR B CD1 1 
ATOM   4144  C  CD2 . TYR B 1 187 ? 26.686  20.868  69.185  1.00 21.81  ? 187 TYR B CD2 1 
ATOM   4145  C  CE1 . TYR B 1 187 ? 27.516  20.607  71.844  1.00 22.65  ? 187 TYR B CE1 1 
ATOM   4146  C  CE2 . TYR B 1 187 ? 25.764  20.556  70.173  1.00 23.03  ? 187 TYR B CE2 1 
ATOM   4147  C  CZ  . TYR B 1 187 ? 26.184  20.433  71.505  1.00 24.33  ? 187 TYR B CZ  1 
ATOM   4148  O  OH  . TYR B 1 187 ? 25.279  20.134  72.489  1.00 25.86  ? 187 TYR B OH  1 
ATOM   4149  N  N   . TRP B 1 188 ? 30.455  20.512  65.156  1.00 16.37  ? 188 TRP B N   1 
ATOM   4150  C  CA  . TRP B 1 188 ? 31.500  20.839  64.208  1.00 15.95  ? 188 TRP B CA  1 
ATOM   4151  C  C   . TRP B 1 188 ? 32.846  21.033  64.857  1.00 15.77  ? 188 TRP B C   1 
ATOM   4152  O  O   . TRP B 1 188 ? 33.715  21.719  64.302  1.00 16.16  ? 188 TRP B O   1 
ATOM   4153  C  CB  . TRP B 1 188 ? 31.123  22.048  63.409  1.00 16.07  ? 188 TRP B CB  1 
ATOM   4154  C  CG  . TRP B 1 188 ? 31.605  22.069  61.973  1.00 17.37  ? 188 TRP B CG  1 
ATOM   4155  C  CD1 . TRP B 1 188 ? 31.938  20.985  61.176  1.00 18.10  ? 188 TRP B CD1 1 
ATOM   4156  C  CD2 . TRP B 1 188 ? 31.779  23.254  61.103  1.00 16.57  ? 188 TRP B CD2 1 
ATOM   4157  N  NE1 . TRP B 1 188 ? 32.322  21.410  59.919  1.00 19.86  ? 188 TRP B NE1 1 
ATOM   4158  C  CE2 . TRP B 1 188 ? 32.240  22.756  59.814  1.00 18.10  ? 188 TRP B CE2 1 
ATOM   4159  C  CE3 . TRP B 1 188 ? 31.597  24.612  61.269  1.00 17.86  ? 188 TRP B CE3 1 
ATOM   4160  C  CZ2 . TRP B 1 188 ? 32.491  23.601  58.734  1.00 17.87  ? 188 TRP B CZ2 1 
ATOM   4161  C  CZ3 . TRP B 1 188 ? 31.860  25.474  60.185  1.00 18.59  ? 188 TRP B CZ3 1 
ATOM   4162  C  CH2 . TRP B 1 188 ? 32.296  24.971  58.941  1.00 18.95  ? 188 TRP B CH2 1 
ATOM   4163  N  N   . LEU B 1 189 ? 33.056  20.407  66.011  1.00 14.52  ? 189 LEU B N   1 
ATOM   4164  C  CA  . LEU B 1 189 ? 34.265  20.649  66.827  1.00 14.07  ? 189 LEU B CA  1 
ATOM   4165  C  C   . LEU B 1 189 ? 35.589  20.327  66.157  1.00 14.32  ? 189 LEU B C   1 
ATOM   4166  O  O   . LEU B 1 189 ? 36.593  21.039  66.413  1.00 14.40  ? 189 LEU B O   1 
ATOM   4167  C  CB  . LEU B 1 189 ? 34.205  19.857  68.131  1.00 13.83  ? 189 LEU B CB  1 
ATOM   4168  C  CG  . LEU B 1 189 ? 33.166  20.347  69.130  1.00 14.42  ? 189 LEU B CG  1 
ATOM   4169  C  CD1 . LEU B 1 189 ? 33.224  19.558  70.445  1.00 14.61  ? 189 LEU B CD1 1 
ATOM   4170  C  CD2 . LEU B 1 189 ? 33.388  21.823  69.384  1.00 14.79  ? 189 LEU B CD2 1 
ATOM   4171  N  N   . PRO B 1 190 ? 35.623  19.246  65.330  1.00 13.95  ? 190 PRO B N   1 
ATOM   4172  C  CA  . PRO B 1 190 ? 36.872  18.951  64.635  1.00 14.18  ? 190 PRO B CA  1 
ATOM   4173  C  C   . PRO B 1 190 ? 37.299  20.078  63.719  1.00 14.73  ? 190 PRO B C   1 
ATOM   4174  O  O   . PRO B 1 190 ? 38.483  20.229  63.501  1.00 16.53  ? 190 PRO B O   1 
ATOM   4175  C  CB  . PRO B 1 190 ? 36.594  17.653  63.842  1.00 14.33  ? 190 PRO B CB  1 
ATOM   4176  C  CG  . PRO B 1 190 ? 35.198  17.204  64.210  1.00 13.91  ? 190 PRO B CG  1 
ATOM   4177  C  CD  . PRO B 1 190 ? 34.519  18.363  64.889  1.00 14.39  ? 190 PRO B CD  1 
ATOM   4178  N  N   . TRP B 1 191 ? 36.364  20.878  63.210  1.00 14.75  ? 191 TRP B N   1 
ATOM   4179  C  CA  . TRP B 1 191 ? 36.716  22.042  62.430  1.00 15.12  ? 191 TRP B CA  1 
ATOM   4180  C  C   . TRP B 1 191 ? 36.906  23.274  63.270  1.00 14.59  ? 191 TRP B C   1 
ATOM   4181  O  O   . TRP B 1 191 ? 37.772  24.093  62.986  1.00 14.56  ? 191 TRP B O   1 
ATOM   4182  C  CB  . TRP B 1 191 ? 35.696  22.312  61.317  1.00 15.63  ? 191 TRP B CB  1 
ATOM   4183  C  CG  . TRP B 1 191 ? 35.978  21.504  60.069  1.00 16.93  ? 191 TRP B CG  1 
ATOM   4184  C  CD1 . TRP B 1 191 ? 36.715  21.905  58.959  1.00 17.81  ? 191 TRP B CD1 1 
ATOM   4185  C  CD2 . TRP B 1 191 ? 35.569  20.120  59.772  1.00 16.91  ? 191 TRP B CD2 1 
ATOM   4186  N  NE1 . TRP B 1 191 ? 36.781  20.909  58.030  1.00 17.84  ? 191 TRP B NE1 1 
ATOM   4187  C  CE2 . TRP B 1 191 ? 36.106  19.809  58.455  1.00 17.50  ? 191 TRP B CE2 1 
ATOM   4188  C  CE3 . TRP B 1 191 ? 34.829  19.151  60.439  1.00 18.13  ? 191 TRP B CE3 1 
ATOM   4189  C  CZ2 . TRP B 1 191 ? 35.890  18.576  57.837  1.00 17.72  ? 191 TRP B CZ2 1 
ATOM   4190  C  CZ3 . TRP B 1 191 ? 34.628  17.905  59.814  1.00 18.22  ? 191 TRP B CZ3 1 
ATOM   4191  C  CH2 . TRP B 1 191 ? 35.162  17.628  58.547  1.00 18.08  ? 191 TRP B CH2 1 
ATOM   4192  N  N   . LEU B 1 192 ? 36.084  23.457  64.293  1.00 13.97  ? 192 LEU B N   1 
ATOM   4193  C  CA  . LEU B 1 192 ? 36.165  24.705  65.049  1.00 13.51  ? 192 LEU B CA  1 
ATOM   4194  C  C   . LEU B 1 192 ? 37.314  24.655  66.060  1.00 12.80  ? 192 LEU B C   1 
ATOM   4195  O  O   . LEU B 1 192 ? 37.835  25.679  66.438  1.00 12.00  ? 192 LEU B O   1 
ATOM   4196  C  CB  . LEU B 1 192 ? 34.856  25.038  65.776  1.00 13.21  ? 192 LEU B CB  1 
ATOM   4197  C  CG  . LEU B 1 192 ? 33.576  25.045  64.965  1.00 14.41  ? 192 LEU B CG  1 
ATOM   4198  C  CD1 . LEU B 1 192 ? 32.394  25.373  65.880  1.00 14.92  ? 192 LEU B CD1 1 
ATOM   4199  C  CD2 . LEU B 1 192 ? 33.666  25.999  63.775  1.00 13.83  ? 192 LEU B CD2 1 
ATOM   4200  N  N   . VAL B 1 193 ? 37.679  23.459  66.500  1.00 13.04  ? 193 VAL B N   1 
ATOM   4201  C  CA  . VAL B 1 193 ? 38.610  23.314  67.622  1.00 13.88  ? 193 VAL B CA  1 
ATOM   4202  C  C   . VAL B 1 193 ? 39.696  22.350  67.292  1.00 15.09  ? 193 VAL B C   1 
ATOM   4203  O  O   . VAL B 1 193 ? 40.842  22.643  67.509  1.00 16.58  ? 193 VAL B O   1 
ATOM   4204  C  CB  . VAL B 1 193 ? 37.901  22.764  68.878  1.00 13.78  ? 193 VAL B CB  1 
ATOM   4205  C  CG1 . VAL B 1 193 ? 38.907  22.473  69.993  1.00 14.04  ? 193 VAL B CG1 1 
ATOM   4206  C  CG2 . VAL B 1 193 ? 36.763  23.702  69.322  1.00 13.31  ? 193 VAL B CG2 1 
ATOM   4207  N  N   . GLY B 1 194 ? 39.343  21.170  66.780  1.00 16.50  ? 194 GLY B N   1 
ATOM   4208  C  CA  . GLY B 1 194 ? 40.355  20.190  66.411  1.00 15.72  ? 194 GLY B CA  1 
ATOM   4209  C  C   . GLY B 1 194 ? 41.387  20.707  65.413  1.00 16.29  ? 194 GLY B C   1 
ATOM   4210  O  O   . GLY B 1 194 ? 42.579  20.398  65.553  1.00 17.08  ? 194 GLY B O   1 
ATOM   4211  N  N   . MET B 1 195 ? 40.960  21.461  64.403  1.00 15.66  ? 195 MET B N   1 
ATOM   4212  C  CA  . MET B 1 195 ? 41.911  21.986  63.407  1.00 17.00  ? 195 MET B CA  1 
ATOM   4213  C  C   . MET B 1 195 ? 42.905  22.976  64.019  1.00 16.17  ? 195 MET B C   1 
ATOM   4214  O  O   . MET B 1 195 ? 44.096  22.771  63.878  1.00 16.30  ? 195 MET B O   1 
ATOM   4215  C  CB  . MET B 1 195 ? 41.227  22.590  62.189  1.00 18.25  ? 195 MET B CB  1 
ATOM   4216  C  CG  . MET B 1 195 ? 40.978  21.549  61.124  1.00 20.97  ? 195 MET B CG  1 
ATOM   4217  S  SD  . MET B 1 195 ? 40.075  22.100  59.632  1.00 27.75  ? 195 MET B SD  1 
ATOM   4218  C  CE  . MET B 1 195 ? 40.781  23.631  59.131  1.00 21.27  ? 195 MET B CE  1 
ATOM   4219  N  N   . PRO B 1 196 ? 42.429  24.010  64.729  1.00 15.14  ? 196 PRO B N   1 
ATOM   4220  C  CA  . PRO B 1 196 ? 43.383  24.835  65.463  1.00 14.92  ? 196 PRO B CA  1 
ATOM   4221  C  C   . PRO B 1 196 ? 44.386  24.026  66.350  1.00 15.00  ? 196 PRO B C   1 
ATOM   4222  O  O   . PRO B 1 196 ? 45.613  24.288  66.314  1.00 14.55  ? 196 PRO B O   1 
ATOM   4223  C  CB  . PRO B 1 196 ? 42.491  25.753  66.291  1.00 15.49  ? 196 PRO B CB  1 
ATOM   4224  C  CG  . PRO B 1 196 ? 41.176  25.794  65.554  1.00 15.66  ? 196 PRO B CG  1 
ATOM   4225  C  CD  . PRO B 1 196 ? 41.027  24.417  64.975  1.00 15.88  ? 196 PRO B CD  1 
ATOM   4226  N  N   . ALA B 1 197 ? 43.901  22.993  67.036  1.00 14.71  ? 197 ALA B N   1 
ATOM   4227  C  CA  . ALA B 1 197 ? 44.771  22.141  67.886  1.00 15.55  ? 197 ALA B CA  1 
ATOM   4228  C  C   . ALA B 1 197 ? 45.817  21.329  67.101  1.00 15.27  ? 197 ALA B C   1 
ATOM   4229  O  O   . ALA B 1 197 ? 46.940  21.181  67.557  1.00 14.83  ? 197 ALA B O   1 
ATOM   4230  C  CB  . ALA B 1 197 ? 43.945  21.215  68.807  1.00 15.08  ? 197 ALA B CB  1 
ATOM   4231  N  N   . GLU B 1 198 ? 45.454  20.825  65.925  1.00 15.52  ? 198 GLU B N   1 
ATOM   4232  C  CA  . GLU B 1 198 ? 46.438  20.190  65.047  1.00 16.37  ? 198 GLU B CA  1 
ATOM   4233  C  C   . GLU B 1 198 ? 47.560  21.126  64.633  1.00 15.08  ? 198 GLU B C   1 
ATOM   4234  O  O   . GLU B 1 198 ? 48.705  20.712  64.609  1.00 14.83  ? 198 GLU B O   1 
ATOM   4235  C  CB  . GLU B 1 198 ? 45.801  19.616  63.803  1.00 18.05  ? 198 GLU B CB  1 
ATOM   4236  C  CG  . GLU B 1 198 ? 45.187  18.263  64.056  1.00 20.50  ? 198 GLU B CG  1 
ATOM   4237  C  CD  . GLU B 1 198 ? 46.207  17.127  64.115  1.00 24.47  ? 198 GLU B CD  1 
ATOM   4238  O  OE1 . GLU B 1 198 ? 47.102  17.053  63.183  1.00 24.18  ? 198 GLU B OE1 1 
ATOM   4239  O  OE2 . GLU B 1 198 ? 46.082  16.291  65.092  1.00 25.41  ? 198 GLU B OE2 1 
ATOM   4240  N  N   . THR B 1 199 ? 47.226  22.372  64.316  1.00 14.47  ? 199 THR B N   1 
ATOM   4241  C  CA  . THR B 1 199 ? 48.236  23.349  63.896  1.00 14.98  ? 199 THR B CA  1 
ATOM   4242  C  C   . THR B 1 199 ? 49.208  23.718  65.020  1.00 14.56  ? 199 THR B C   1 
ATOM   4243  O  O   . THR B 1 199 ? 50.401  23.956  64.784  1.00 15.77  ? 199 THR B O   1 
ATOM   4244  C  CB  . THR B 1 199 ? 47.579  24.644  63.353  1.00 15.01  ? 199 THR B CB  1 
ATOM   4245  O  OG1 . THR B 1 199 ? 46.733  24.318  62.253  1.00 15.31  ? 199 THR B OG1 1 
ATOM   4246  C  CG2 . THR B 1 199 ? 48.604  25.634  62.914  1.00 13.73  ? 199 THR B CG2 1 
ATOM   4247  N  N   . THR B 1 200 ? 48.681  23.802  66.226  1.00 13.60  ? 200 THR B N   1 
ATOM   4248  C  CA  . THR B 1 200 ? 49.486  24.039  67.382  1.00 14.00  ? 200 THR B CA  1 
ATOM   4249  C  C   . THR B 1 200 ? 50.450  22.856  67.583  1.00 13.80  ? 200 THR B C   1 
ATOM   4250  O  O   . THR B 1 200 ? 51.642  23.040  67.747  1.00 14.04  ? 200 THR B O   1 
ATOM   4251  C  CB  . THR B 1 200 ? 48.590  24.293  68.621  1.00 14.41  ? 200 THR B CB  1 
ATOM   4252  O  OG1 . THR B 1 200 ? 47.645  25.323  68.306  1.00 15.19  ? 200 THR B OG1 1 
ATOM   4253  C  CG2 . THR B 1 200 ? 49.392  24.781  69.764  1.00 13.84  ? 200 THR B CG2 1 
ATOM   4254  N  N   . ILE B 1 201 ? 49.960  21.636  67.510  1.00 14.21  ? 201 ILE B N   1 
ATOM   4255  C  CA  . ILE B 1 201 ? 50.852  20.490  67.646  1.00 14.35  ? 201 ILE B CA  1 
ATOM   4256  C  C   . ILE B 1 201 ? 51.930  20.531  66.540  1.00 13.73  ? 201 ILE B C   1 
ATOM   4257  O  O   . ILE B 1 201 ? 53.106  20.317  66.789  1.00 14.01  ? 201 ILE B O   1 
ATOM   4258  C  CB  . ILE B 1 201 ? 50.043  19.190  67.584  1.00 14.95  ? 201 ILE B CB  1 
ATOM   4259  C  CG1 . ILE B 1 201 ? 49.102  19.129  68.781  1.00 16.25  ? 201 ILE B CG1 1 
ATOM   4260  C  CG2 . ILE B 1 201 ? 50.980  17.972  67.508  1.00 15.18  ? 201 ILE B CG2 1 
ATOM   4261  C  CD1 . ILE B 1 201 ? 48.110  17.964  68.753  1.00 16.65  ? 201 ILE B CD1 1 
ATOM   4262  N  N   . ALA B 1 202 ? 51.536  20.865  65.329  1.00 12.66  ? 202 ALA B N   1 
ATOM   4263  C  CA  . ALA B 1 202 ? 52.506  20.878  64.234  1.00 13.36  ? 202 ALA B CA  1 
ATOM   4264  C  C   . ALA B 1 202 ? 53.574  21.925  64.429  1.00 13.03  ? 202 ALA B C   1 
ATOM   4265  O  O   . ALA B 1 202 ? 54.738  21.651  64.184  1.00 12.52  ? 202 ALA B O   1 
ATOM   4266  C  CB  . ALA B 1 202 ? 51.822  21.044  62.884  1.00 12.42  ? 202 ALA B CB  1 
ATOM   4267  N  N   . ILE B 1 203 ? 53.168  23.126  64.856  1.00 13.63  ? 203 ILE B N   1 
ATOM   4268  C  CA  . ILE B 1 203 ? 54.107  24.182  65.205  1.00 14.31  ? 203 ILE B CA  1 
ATOM   4269  C  C   . ILE B 1 203 ? 55.051  23.733  66.304  1.00 14.92  ? 203 ILE B C   1 
ATOM   4270  O  O   . ILE B 1 203 ? 56.263  23.849  66.131  1.00 15.10  ? 203 ILE B O   1 
ATOM   4271  C  CB  . ILE B 1 203 ? 53.418  25.541  65.567  1.00 14.58  ? 203 ILE B CB  1 
ATOM   4272  C  CG1 . ILE B 1 203 ? 52.759  26.106  64.315  1.00 13.05  ? 203 ILE B CG1 1 
ATOM   4273  C  CG2 . ILE B 1 203 ? 54.433  26.556  66.107  1.00 12.60  ? 203 ILE B CG2 1 
ATOM   4274  C  CD1 . ILE B 1 203 ? 51.936  27.336  64.579  1.00 13.21  ? 203 ILE B CD1 1 
ATOM   4275  N  N   . CYS B 1 204 ? 54.518  23.148  67.378  1.00 15.60  ? 204 CYS B N   1 
ATOM   4276  C  CA  . CYS B 1 204 ? 55.371  22.604  68.471  1.00 16.30  ? 204 CYS B CA  1 
ATOM   4277  C  C   . CYS B 1 204 ? 56.294  21.493  68.000  1.00 17.64  ? 204 CYS B C   1 
ATOM   4278  O  O   . CYS B 1 204 ? 57.462  21.392  68.436  1.00 17.06  ? 204 CYS B O   1 
ATOM   4279  C  CB  . CYS B 1 204 ? 54.547  22.070  69.660  1.00 16.18  ? 204 CYS B CB  1 
ATOM   4280  S  SG  . CYS B 1 204 ? 53.652  23.355  70.592  1.00 17.61  ? 204 CYS B SG  1 
ATOM   4281  N  N   . SER B 1 205 ? 55.777  20.635  67.131  1.00 17.97  ? 205 SER B N   1 
ATOM   4282  C  CA  . SER B 1 205 ? 56.583  19.543  66.650  1.00 19.63  ? 205 SER B CA  1 
ATOM   4283  C  C   . SER B 1 205 ? 57.756  20.024  65.800  1.00 20.74  ? 205 SER B C   1 
ATOM   4284  O  O   . SER B 1 205 ? 58.817  19.393  65.764  1.00 21.21  ? 205 SER B O   1 
ATOM   4285  C  CB  . SER B 1 205 ? 55.728  18.556  65.886  1.00 19.09  ? 205 SER B CB  1 
ATOM   4286  O  OG  . SER B 1 205 ? 54.912  17.878  66.810  1.00 19.61  ? 205 SER B OG  1 
ATOM   4287  N  N   . MET B 1 206 ? 57.587  21.137  65.116  1.00 21.90  ? 206 MET B N   1 
ATOM   4288  C  CA  . MET B 1 206 ? 58.674  21.547  64.228  1.00 23.28  ? 206 MET B CA  1 
ATOM   4289  C  C   . MET B 1 206 ? 59.744  22.243  65.059  1.00 23.10  ? 206 MET B C   1 
ATOM   4290  O  O   . MET B 1 206 ? 60.940  22.114  64.772  1.00 24.70  ? 206 MET B O   1 
ATOM   4291  C  CB  . MET B 1 206 ? 58.161  22.437  63.090  1.00 22.54  ? 206 MET B CB  1 
ATOM   4292  C  CG  . MET B 1 206 ? 57.322  21.636  62.119  1.00 23.29  ? 206 MET B CG  1 
ATOM   4293  S  SD  . MET B 1 206 ? 57.079  22.553  60.602  1.00 28.44  ? 206 MET B SD  1 
ATOM   4294  C  CE  . MET B 1 206 ? 58.438  22.063  59.563  1.00 24.65  ? 206 MET B CE  1 
ATOM   4295  N  N   . ILE B 1 207 ? 59.299  22.964  66.092  1.00 21.59  ? 207 ILE B N   1 
ATOM   4296  C  CA  . ILE B 1 207 ? 60.204  23.716  66.929  1.00 19.96  ? 207 ILE B CA  1 
ATOM   4297  C  C   . ILE B 1 207 ? 60.970  22.707  67.796  1.00 19.34  ? 207 ILE B C   1 
ATOM   4298  O  O   . ILE B 1 207 ? 62.185  22.532  67.630  1.00 17.44  ? 207 ILE B O   1 
ATOM   4299  C  CB  . ILE B 1 207 ? 59.507  24.806  67.760  1.00 19.00  ? 207 ILE B CB  1 
ATOM   4300  C  CG1 . ILE B 1 207 ? 58.963  25.933  66.901  1.00 18.32  ? 207 ILE B CG1 1 
ATOM   4301  C  CG2 . ILE B 1 207 ? 60.505  25.455  68.689  1.00 21.34  ? 207 ILE B CG2 1 
ATOM   4302  C  CD1 . ILE B 1 207 ? 57.992  26.823  67.663  1.00 17.40  ? 207 ILE B CD1 1 
ATOM   4303  N  N   . MET B 1 208 ? 60.249  22.007  68.662  1.00 18.83  ? 208 MET B N   1 
ATOM   4304  C  CA  . MET B 1 208 ? 60.885  21.071  69.557  1.00 19.12  ? 208 MET B CA  1 
ATOM   4305  C  C   . MET B 1 208 ? 61.596  19.923  68.891  1.00 19.37  ? 208 MET B C   1 
ATOM   4306  O  O   . MET B 1 208 ? 62.543  19.355  69.496  1.00 20.29  ? 208 MET B O   1 
ATOM   4307  C  CB  . MET B 1 208 ? 59.939  20.593  70.638  1.00 20.57  ? 208 MET B CB  1 
ATOM   4308  C  CG  . MET B 1 208 ? 59.764  21.677  71.660  1.00 24.66  ? 208 MET B CG  1 
ATOM   4309  S  SD  . MET B 1 208 ? 58.407  21.501  72.811  1.00 31.35  ? 208 MET B SD  1 
ATOM   4310  C  CE  . MET B 1 208 ? 57.040  21.246  71.684  1.00 26.01  ? 208 MET B CE  1 
ATOM   4311  N  N   . GLY B 1 209 ? 61.203  19.587  67.663  1.00 18.29  ? 209 GLY B N   1 
ATOM   4312  C  CA  . GLY B 1 209 ? 61.877  18.502  66.931  1.00 19.34  ? 209 GLY B CA  1 
ATOM   4313  C  C   . GLY B 1 209 ? 63.161  18.947  66.219  1.00 20.67  ? 209 GLY B C   1 
ATOM   4314  O  O   . GLY B 1 209 ? 63.860  18.144  65.613  1.00 20.29  ? 209 GLY B O   1 
ATOM   4315  N  N   . GLY B 1 210 ? 63.451  20.239  66.264  1.00 22.06  ? 210 GLY B N   1 
ATOM   4316  C  CA  . GLY B 1 210 ? 64.669  20.787  65.663  1.00 23.50  ? 210 GLY B CA  1 
ATOM   4317  C  C   . GLY B 1 210 ? 64.593  21.172  64.179  1.00 24.45  ? 210 GLY B C   1 
ATOM   4318  O  O   . GLY B 1 210 ? 65.618  21.539  63.585  1.00 23.17  ? 210 GLY B O   1 
ATOM   4319  N  N   . VAL B 1 211 ? 63.391  21.115  63.590  1.00 23.03  ? 211 VAL B N   1 
ATOM   4320  C  CA  . VAL B 1 211 ? 63.249  21.352  62.158  1.00 22.23  ? 211 VAL B CA  1 
ATOM   4321  C  C   . VAL B 1 211 ? 63.746  22.731  61.748  1.00 22.51  ? 211 VAL B C   1 
ATOM   4322  O  O   . VAL B 1 211 ? 64.592  22.837  60.863  1.00 22.56  ? 211 VAL B O   1 
ATOM   4323  C  CB  . VAL B 1 211 ? 61.813  21.089  61.675  1.00 21.99  ? 211 VAL B CB  1 
ATOM   4324  C  CG1 . VAL B 1 211 ? 61.644  21.473  60.209  1.00 20.40  ? 211 VAL B CG1 1 
ATOM   4325  C  CG2 . VAL B 1 211 ? 61.492  19.626  61.858  1.00 19.54  ? 211 VAL B CG2 1 
ATOM   4326  N  N   . PHE B 1 212 ? 63.247  23.778  62.398  1.00 22.05  ? 212 PHE B N   1 
ATOM   4327  C  CA  . PHE B 1 212 ? 63.746  25.102  62.143  1.00 23.51  ? 212 PHE B CA  1 
ATOM   4328  C  C   . PHE B 1 212 ? 65.246  25.243  62.394  1.00 27.18  ? 212 PHE B C   1 
ATOM   4329  O  O   . PHE B 1 212 ? 65.899  26.069  61.755  1.00 28.91  ? 212 PHE B O   1 
ATOM   4330  C  CB  . PHE B 1 212 ? 62.972  26.161  62.914  1.00 22.57  ? 212 PHE B CB  1 
ATOM   4331  C  CG  . PHE B 1 212 ? 61.517  26.226  62.563  1.00 25.04  ? 212 PHE B CG  1 
ATOM   4332  C  CD1 . PHE B 1 212 ? 61.102  26.660  61.315  1.00 25.42  ? 212 PHE B CD1 1 
ATOM   4333  C  CD2 . PHE B 1 212 ? 60.537  25.858  63.499  1.00 25.48  ? 212 PHE B CD2 1 
ATOM   4334  C  CE1 . PHE B 1 212 ? 59.743  26.709  60.991  1.00 26.32  ? 212 PHE B CE1 1 
ATOM   4335  C  CE2 . PHE B 1 212 ? 59.185  25.945  63.190  1.00 25.91  ? 212 PHE B CE2 1 
ATOM   4336  C  CZ  . PHE B 1 212 ? 58.789  26.367  61.931  1.00 25.53  ? 212 PHE B CZ  1 
ATOM   4337  N  N   . GLU B 1 213 ? 65.796  24.440  63.307  1.00 31.98  ? 213 GLU B N   1 
ATOM   4338  C  CA  . GLU B 1 213 ? 67.233  24.478  63.596  1.00 35.54  ? 213 GLU B CA  1 
ATOM   4339  C  C   . GLU B 1 213 ? 68.145  23.791  62.538  1.00 35.44  ? 213 GLU B C   1 
ATOM   4340  O  O   . GLU B 1 213 ? 69.183  24.356  62.200  1.00 37.89  ? 213 GLU B O   1 
ATOM   4341  C  CB  . GLU B 1 213 ? 67.522  23.969  65.022  1.00 39.88  ? 213 GLU B CB  1 
ATOM   4342  C  CG  . GLU B 1 213 ? 68.938  24.220  65.528  1.00 46.68  ? 213 GLU B CG  1 
ATOM   4343  C  CD  . GLU B 1 213 ? 69.309  25.710  65.557  1.00 60.16  ? 213 GLU B CD  1 
ATOM   4344  O  OE1 . GLU B 1 213 ? 68.590  26.523  66.219  1.00 62.44  ? 213 GLU B OE1 1 
ATOM   4345  O  OE2 . GLU B 1 213 ? 70.333  26.074  64.917  1.00 62.14  ? 213 GLU B OE2 1 
ATOM   4346  N  N   . LYS B 1 214 ? 67.799  22.601  62.033  1.00 31.64  ? 214 LYS B N   1 
ATOM   4347  C  CA  . LYS B 1 214 ? 68.567  22.021  60.908  1.00 32.76  ? 214 LYS B CA  1 
ATOM   4348  C  C   . LYS B 1 214 ? 68.384  22.811  59.611  1.00 29.56  ? 214 LYS B C   1 
ATOM   4349  O  O   . LYS B 1 214 ? 69.267  22.839  58.792  1.00 33.93  ? 214 LYS B O   1 
ATOM   4350  C  CB  . LYS B 1 214 ? 68.256  20.543  60.634  1.00 33.92  ? 214 LYS B CB  1 
ATOM   4351  C  CG  . LYS B 1 214 ? 68.866  19.573  61.617  1.00 41.09  ? 214 LYS B CG  1 
ATOM   4352  C  CD  . LYS B 1 214 ? 68.132  19.719  62.959  1.00 49.65  ? 214 LYS B CD  1 
ATOM   4353  C  CE  . LYS B 1 214 ? 68.490  18.699  64.037  1.00 50.27  ? 214 LYS B CE  1 
ATOM   4354  N  NZ  . LYS B 1 214 ? 67.405  18.748  65.064  1.00 48.27  ? 214 LYS B NZ  1 
ATOM   4355  N  N   . PHE B 1 215 ? 67.250  23.462  59.429  1.00 26.06  ? 215 PHE B N   1 
ATOM   4356  C  CA  . PHE B 1 215 ? 66.961  24.092  58.144  1.00 22.51  ? 215 PHE B CA  1 
ATOM   4357  C  C   . PHE B 1 215 ? 66.532  25.523  58.309  1.00 23.59  ? 215 PHE B C   1 
ATOM   4358  O  O   . PHE B 1 215 ? 65.409  25.854  57.980  1.00 24.12  ? 215 PHE B O   1 
ATOM   4359  C  CB  . PHE B 1 215 ? 65.886  23.308  57.408  1.00 19.68  ? 215 PHE B CB  1 
ATOM   4360  C  CG  . PHE B 1 215 ? 66.123  21.835  57.416  1.00 18.49  ? 215 PHE B CG  1 
ATOM   4361  C  CD1 . PHE B 1 215 ? 67.087  21.254  56.561  1.00 18.63  ? 215 PHE B CD1 1 
ATOM   4362  C  CD2 . PHE B 1 215 ? 65.434  21.019  58.295  1.00 17.15  ? 215 PHE B CD2 1 
ATOM   4363  C  CE1 . PHE B 1 215 ? 67.330  19.873  56.589  1.00 17.21  ? 215 PHE B CE1 1 
ATOM   4364  C  CE2 . PHE B 1 215 ? 65.658  19.644  58.315  1.00 16.41  ? 215 PHE B CE2 1 
ATOM   4365  C  CZ  . PHE B 1 215 ? 66.596  19.069  57.453  1.00 16.58  ? 215 PHE B CZ  1 
ATOM   4366  N  N   . PRO B 1 216 ? 67.436  26.389  58.808  1.00 24.81  ? 216 PRO B N   1 
ATOM   4367  C  CA  . PRO B 1 216 ? 67.040  27.765  59.041  1.00 24.33  ? 216 PRO B CA  1 
ATOM   4368  C  C   . PRO B 1 216 ? 66.582  28.541  57.809  1.00 24.28  ? 216 PRO B C   1 
ATOM   4369  O  O   . PRO B 1 216 ? 65.883  29.554  57.949  1.00 27.43  ? 216 PRO B O   1 
ATOM   4370  C  CB  . PRO B 1 216 ? 68.317  28.404  59.660  1.00 25.73  ? 216 PRO B CB  1 
ATOM   4371  C  CG  . PRO B 1 216 ? 69.442  27.444  59.388  1.00 23.95  ? 216 PRO B CG  1 
ATOM   4372  C  CD  . PRO B 1 216 ? 68.787  26.101  59.354  1.00 24.73  ? 216 PRO B CD  1 
ATOM   4373  N  N   . LYS B 1 217 ? 66.997  28.133  56.623  1.00 24.30  ? 217 LYS B N   1 
ATOM   4374  C  CA  . LYS B 1 217 ? 66.537  28.804  55.388  1.00 25.33  ? 217 LYS B CA  1 
ATOM   4375  C  C   . LYS B 1 217 ? 65.129  28.322  54.923  1.00 23.04  ? 217 LYS B C   1 
ATOM   4376  O  O   . LYS B 1 217 ? 64.614  28.804  53.931  1.00 21.59  ? 217 LYS B O   1 
ATOM   4377  C  CB  . LYS B 1 217 ? 67.537  28.560  54.247  1.00 27.75  ? 217 LYS B CB  1 
ATOM   4378  C  CG  . LYS B 1 217 ? 68.968  29.014  54.495  1.00 36.15  ? 217 LYS B CG  1 
ATOM   4379  C  CD  . LYS B 1 217 ? 70.044  27.954  54.152  1.00 41.48  ? 217 LYS B CD  1 
ATOM   4380  C  CE  . LYS B 1 217 ? 70.069  27.514  52.681  1.00 42.51  ? 217 LYS B CE  1 
ATOM   4381  N  NZ  . LYS B 1 217 ? 70.388  28.613  51.719  1.00 44.75  ? 217 LYS B NZ  1 
ATOM   4382  N  N   . LEU B 1 218 ? 64.535  27.364  55.630  1.00 21.06  ? 218 LEU B N   1 
ATOM   4383  C  CA  . LEU B 1 218 ? 63.252  26.766  55.252  1.00 21.37  ? 218 LEU B CA  1 
ATOM   4384  C  C   . LEU B 1 218 ? 62.047  27.660  55.533  1.00 20.18  ? 218 LEU B C   1 
ATOM   4385  O  O   . LEU B 1 218 ? 61.855  28.083  56.681  1.00 20.01  ? 218 LEU B O   1 
ATOM   4386  C  CB  . LEU B 1 218 ? 63.049  25.417  56.007  1.00 22.16  ? 218 LEU B CB  1 
ATOM   4387  C  CG  . LEU B 1 218 ? 61.652  24.772  55.899  1.00 22.57  ? 218 LEU B CG  1 
ATOM   4388  C  CD1 . LEU B 1 218 ? 61.482  23.881  54.660  1.00 21.44  ? 218 LEU B CD1 1 
ATOM   4389  C  CD2 . LEU B 1 218 ? 61.314  24.026  57.181  1.00 22.25  ? 218 LEU B CD2 1 
ATOM   4390  N  N   . LYS B 1 219 ? 61.208  27.894  54.519  1.00 18.72  ? 219 LYS B N   1 
ATOM   4391  C  CA  . LYS B 1 219 ? 60.049  28.780  54.687  1.00 18.20  ? 219 LYS B CA  1 
ATOM   4392  C  C   . LYS B 1 219 ? 58.734  28.023  54.967  1.00 16.13  ? 219 LYS B C   1 
ATOM   4393  O  O   . LYS B 1 219 ? 58.262  27.252  54.124  1.00 16.32  ? 219 LYS B O   1 
ATOM   4394  C  CB  . LYS B 1 219 ? 59.893  29.706  53.472  1.00 20.93  ? 219 LYS B CB  1 
ATOM   4395  C  CG  . LYS B 1 219 ? 60.888  30.879  53.370  1.00 23.55  ? 219 LYS B CG  1 
ATOM   4396  C  CD  . LYS B 1 219 ? 60.727  31.652  52.062  1.00 24.87  ? 219 LYS B CD  1 
ATOM   4397  C  CE  . LYS B 1 219 ? 61.996  32.395  51.630  1.00 28.11  ? 219 LYS B CE  1 
ATOM   4398  N  NZ  . LYS B 1 219 ? 62.048  33.831  52.087  1.00 29.73  ? 219 LYS B NZ  1 
ATOM   4399  N  N   . VAL B 1 220 ? 58.128  28.260  56.128  1.00 13.09  ? 220 VAL B N   1 
ATOM   4400  C  CA  . VAL B 1 220 ? 56.943  27.541  56.521  1.00 11.77  ? 220 VAL B CA  1 
ATOM   4401  C  C   . VAL B 1 220 ? 55.813  28.515  56.820  1.00 11.64  ? 220 VAL B C   1 
ATOM   4402  O  O   . VAL B 1 220 ? 56.041  29.503  57.463  1.00 12.67  ? 220 VAL B O   1 
ATOM   4403  C  CB  . VAL B 1 220 ? 57.239  26.601  57.703  1.00 10.92  ? 220 VAL B CB  1 
ATOM   4404  C  CG1 . VAL B 1 220 ? 56.029  25.774  58.066  1.00 10.62  ? 220 VAL B CG1 1 
ATOM   4405  C  CG2 . VAL B 1 220 ? 58.336  25.618  57.349  1.00 11.12  ? 220 VAL B CG2 1 
ATOM   4406  N  N   . CYS B 1 221 ? 54.616  28.268  56.316  1.00 11.34  ? 221 CYS B N   1 
ATOM   4407  C  CA  . CYS B 1 221 ? 53.432  29.021  56.703  1.00 12.24  ? 221 CYS B CA  1 
ATOM   4408  C  C   . CYS B 1 221 ? 52.361  28.095  57.327  1.00 12.02  ? 221 CYS B C   1 
ATOM   4409  O  O   . CYS B 1 221 ? 52.067  27.047  56.778  1.00 12.90  ? 221 CYS B O   1 
ATOM   4410  C  CB  . CYS B 1 221 ? 52.826  29.731  55.489  1.00 12.54  ? 221 CYS B CB  1 
ATOM   4411  S  SG  . CYS B 1 221 ? 51.509  30.878  55.956  1.00 16.24  ? 221 CYS B SG  1 
ATOM   4412  N  N   . PHE B 1 222 ? 51.760  28.478  58.436  1.00 11.34  ? 222 PHE B N   1 
ATOM   4413  C  CA  . PHE B 1 222 ? 50.726  27.640  59.052  1.00 11.84  ? 222 PHE B CA  1 
ATOM   4414  C  C   . PHE B 1 222 ? 49.346  28.246  58.913  1.00 12.41  ? 222 PHE B C   1 
ATOM   4415  O  O   . PHE B 1 222 ? 49.195  29.437  58.994  1.00 11.94  ? 222 PHE B O   1 
ATOM   4416  C  CB  . PHE B 1 222 ? 50.995  27.396  60.529  1.00 10.84  ? 222 PHE B CB  1 
ATOM   4417  C  CG  . PHE B 1 222 ? 52.292  26.754  60.784  1.00 10.31  ? 222 PHE B CG  1 
ATOM   4418  C  CD1 . PHE B 1 222 ? 52.391  25.348  60.835  1.00 10.27  ? 222 PHE B CD1 1 
ATOM   4419  C  CD2 . PHE B 1 222 ? 53.404  27.516  60.943  1.00 10.11  ? 222 PHE B CD2 1 
ATOM   4420  C  CE1 . PHE B 1 222 ? 53.586  24.736  61.046  1.00 9.88   ? 222 PHE B CE1 1 
ATOM   4421  C  CE2 . PHE B 1 222 ? 54.628  26.912  61.185  1.00 10.60  ? 222 PHE B CE2 1 
ATOM   4422  C  CZ  . PHE B 1 222 ? 54.724  25.526  61.221  1.00 10.50  ? 222 PHE B CZ  1 
ATOM   4423  N  N   . ALA B 1 223 ? 48.345  27.411  58.715  1.00 13.36  ? 223 ALA B N   1 
ATOM   4424  C  CA  . ALA B 1 223 ? 47.035  27.902  58.391  1.00 14.59  ? 223 ALA B CA  1 
ATOM   4425  C  C   . ALA B 1 223 ? 46.297  28.372  59.630  1.00 15.69  ? 223 ALA B C   1 
ATOM   4426  O  O   . ALA B 1 223 ? 46.634  27.971  60.738  1.00 15.51  ? 223 ALA B O   1 
ATOM   4427  C  CB  . ALA B 1 223 ? 46.280  26.816  57.668  1.00 14.57  ? 223 ALA B CB  1 
ATOM   4428  N  N   . HIS B 1 224 ? 45.306  29.241  59.421  1.00 17.81  ? 224 HIS B N   1 
ATOM   4429  C  CA  . HIS B 1 224 ? 44.430  29.822  60.472  1.00 19.25  ? 224 HIS B CA  1 
ATOM   4430  C  C   . HIS B 1 224 ? 45.146  30.518  61.605  1.00 20.26  ? 224 HIS B C   1 
ATOM   4431  O  O   . HIS B 1 224 ? 44.841  30.307  62.797  1.00 22.13  ? 224 HIS B O   1 
ATOM   4432  C  CB  . HIS B 1 224 ? 43.425  28.798  61.066  1.00 20.14  ? 224 HIS B CB  1 
ATOM   4433  C  CG  . HIS B 1 224 ? 42.877  27.808  60.082  1.00 21.24  ? 224 HIS B CG  1 
ATOM   4434  N  ND1 . HIS B 1 224 ? 42.015  28.161  59.058  1.00 22.69  ? 224 HIS B ND1 1 
ATOM   4435  C  CD2 . HIS B 1 224 ? 43.007  26.420  60.024  1.00 21.88  ? 224 HIS B CD2 1 
ATOM   4436  C  CE1 . HIS B 1 224 ? 41.671  27.043  58.364  1.00 22.94  ? 224 HIS B CE1 1 
ATOM   4437  N  NE2 . HIS B 1 224 ? 42.290  25.984  58.939  1.00 21.71  ? 224 HIS B NE2 1 
ATOM   4438  N  N   . GLY B 1 225 ? 46.089  31.382  61.280  1.00 21.11  ? 225 GLY B N   1 
ATOM   4439  C  CA  . GLY B 1 225 ? 46.721  32.157  62.321  1.00 18.94  ? 225 GLY B CA  1 
ATOM   4440  C  C   . GLY B 1 225 ? 47.527  31.291  63.269  1.00 19.94  ? 225 GLY B C   1 
ATOM   4441  O  O   . GLY B 1 225 ? 47.860  31.714  64.365  1.00 19.09  ? 225 GLY B O   1 
ATOM   4442  N  N   . GLY B 1 226 ? 47.881  30.080  62.858  1.00 19.86  ? 226 GLY B N   1 
ATOM   4443  C  CA  . GLY B 1 226 ? 48.757  29.283  63.712  1.00 17.86  ? 226 GLY B CA  1 
ATOM   4444  C  C   . GLY B 1 226 ? 47.999  28.501  64.770  1.00 17.75  ? 226 GLY B C   1 
ATOM   4445  O  O   . GLY B 1 226 ? 48.609  28.039  65.758  1.00 16.63  ? 226 GLY B O   1 
ATOM   4446  N  N   . GLY B 1 227 ? 46.703  28.281  64.529  1.00 15.24  ? 227 GLY B N   1 
ATOM   4447  C  CA  . GLY B 1 227 ? 45.856  27.643  65.498  1.00 16.34  ? 227 GLY B CA  1 
ATOM   4448  C  C   . GLY B 1 227 ? 45.712  28.382  66.850  1.00 16.82  ? 227 GLY B C   1 
ATOM   4449  O  O   . GLY B 1 227 ? 45.030  29.390  66.937  1.00 17.67  ? 227 GLY B O   1 
ATOM   4450  N  N   . ALA B 1 228 ? 46.343  27.872  67.903  1.00 16.34  ? 228 ALA B N   1 
ATOM   4451  C  CA  . ALA B 1 228 ? 46.150  28.411  69.250  1.00 16.94  ? 228 ALA B CA  1 
ATOM   4452  C  C   . ALA B 1 228 ? 47.479  28.970  69.685  1.00 16.93  ? 228 ALA B C   1 
ATOM   4453  O  O   . ALA B 1 228 ? 47.597  29.725  70.690  1.00 18.14  ? 228 ALA B O   1 
ATOM   4454  C  CB  . ALA B 1 228 ? 45.748  27.297  70.211  1.00 17.89  ? 228 ALA B CB  1 
ATOM   4455  N  N   . PHE B 1 229 ? 48.499  28.555  68.945  1.00 15.35  ? 229 PHE B N   1 
ATOM   4456  C  CA  . PHE B 1 229 ? 49.863  28.982  69.214  1.00 14.46  ? 229 PHE B CA  1 
ATOM   4457  C  C   . PHE B 1 229 ? 50.039  30.448  69.623  1.00 13.94  ? 229 PHE B C   1 
ATOM   4458  O  O   . PHE B 1 229 ? 50.527  30.707  70.703  1.00 13.92  ? 229 PHE B O   1 
ATOM   4459  C  CB  . PHE B 1 229 ? 50.827  28.608  68.094  1.00 13.44  ? 229 PHE B CB  1 
ATOM   4460  C  CG  . PHE B 1 229 ? 52.262  28.780  68.499  1.00 13.99  ? 229 PHE B CG  1 
ATOM   4461  C  CD1 . PHE B 1 229 ? 52.898  27.808  69.242  1.00 13.39  ? 229 PHE B CD1 1 
ATOM   4462  C  CD2 . PHE B 1 229 ? 52.960  29.943  68.185  1.00 14.17  ? 229 PHE B CD2 1 
ATOM   4463  C  CE1 . PHE B 1 229 ? 54.209  27.943  69.578  1.00 13.65  ? 229 PHE B CE1 1 
ATOM   4464  C  CE2 . PHE B 1 229 ? 54.274  30.101  68.589  1.00 13.80  ? 229 PHE B CE2 1 
ATOM   4465  C  CZ  . PHE B 1 229 ? 54.898  29.107  69.264  1.00 12.99  ? 229 PHE B CZ  1 
ATOM   4466  N  N   . PRO B 1 230 ? 49.627  31.407  68.778  1.00 13.98  ? 230 PRO B N   1 
ATOM   4467  C  CA  . PRO B 1 230 ? 49.865  32.811  69.170  1.00 13.04  ? 230 PRO B CA  1 
ATOM   4468  C  C   . PRO B 1 230 ? 49.412  33.097  70.590  1.00 12.69  ? 230 PRO B C   1 
ATOM   4469  O  O   . PRO B 1 230 ? 50.004  33.933  71.257  1.00 12.79  ? 230 PRO B O   1 
ATOM   4470  C  CB  . PRO B 1 230 ? 48.997  33.607  68.208  1.00 13.23  ? 230 PRO B CB  1 
ATOM   4471  C  CG  . PRO B 1 230 ? 48.775  32.699  67.035  1.00 13.47  ? 230 PRO B CG  1 
ATOM   4472  C  CD  . PRO B 1 230 ? 48.886  31.287  67.505  1.00 13.52  ? 230 PRO B CD  1 
ATOM   4473  N  N   . PHE B 1 231 ? 48.363  32.427  71.046  1.00 11.77  ? 231 PHE B N   1 
ATOM   4474  C  CA  . PHE B 1 231 ? 47.784  32.735  72.345  1.00 11.15  ? 231 PHE B CA  1 
ATOM   4475  C  C   . PHE B 1 231 ? 48.437  31.871  73.440  1.00 11.87  ? 231 PHE B C   1 
ATOM   4476  O  O   . PHE B 1 231 ? 48.570  32.307  74.573  1.00 13.03  ? 231 PHE B O   1 
ATOM   4477  C  CB  . PHE B 1 231 ? 46.280  32.460  72.362  1.00 10.51  ? 231 PHE B CB  1 
ATOM   4478  C  CG  . PHE B 1 231 ? 45.623  32.771  73.681  1.00 10.38  ? 231 PHE B CG  1 
ATOM   4479  C  CD1 . PHE B 1 231 ? 45.467  34.081  74.116  1.00 10.87  ? 231 PHE B CD1 1 
ATOM   4480  C  CD2 . PHE B 1 231 ? 45.219  31.764  74.517  1.00 10.68  ? 231 PHE B CD2 1 
ATOM   4481  C  CE1 . PHE B 1 231 ? 44.887  34.382  75.345  1.00 10.77  ? 231 PHE B CE1 1 
ATOM   4482  C  CE2 . PHE B 1 231 ? 44.646  32.047  75.762  1.00 10.95  ? 231 PHE B CE2 1 
ATOM   4483  C  CZ  . PHE B 1 231 ? 44.469  33.359  76.171  1.00 10.55  ? 231 PHE B CZ  1 
ATOM   4484  N  N   . THR B 1 232 ? 48.781  30.634  73.131  1.00 11.21  ? 232 THR B N   1 
ATOM   4485  C  CA  . THR B 1 232 ? 49.218  29.781  74.155  1.00 11.39  ? 232 THR B CA  1 
ATOM   4486  C  C   . THR B 1 232 ? 50.738  29.587  74.088  1.00 11.58  ? 232 THR B C   1 
ATOM   4487  O  O   . THR B 1 232 ? 51.282  28.680  74.751  1.00 12.32  ? 232 THR B O   1 
ATOM   4488  C  CB  . THR B 1 232 ? 48.510  28.416  74.067  1.00 11.52  ? 232 THR B CB  1 
ATOM   4489  O  OG1 . THR B 1 232 ? 48.849  27.854  72.824  1.00 11.96  ? 232 THR B OG1 1 
ATOM   4490  C  CG2 . THR B 1 232 ? 46.942  28.499  74.149  1.00 10.96  ? 232 THR B CG2 1 
ATOM   4491  N  N   . VAL B 1 233 ? 51.425  30.408  73.309  1.00 11.32  ? 233 VAL B N   1 
ATOM   4492  C  CA  . VAL B 1 233 ? 52.895  30.327  73.257  1.00 11.90  ? 233 VAL B CA  1 
ATOM   4493  C  C   . VAL B 1 233 ? 53.504  30.570  74.658  1.00 12.43  ? 233 VAL B C   1 
ATOM   4494  O  O   . VAL B 1 233 ? 54.509  29.937  75.008  1.00 12.35  ? 233 VAL B O   1 
ATOM   4495  C  CB  . VAL B 1 233 ? 53.509  31.279  72.213  1.00 11.86  ? 233 VAL B CB  1 
ATOM   4496  C  CG1 . VAL B 1 233 ? 53.034  32.710  72.452  1.00 12.00  ? 233 VAL B CG1 1 
ATOM   4497  C  CG2 . VAL B 1 233 ? 55.023  31.220  72.265  1.00 11.76  ? 233 VAL B CG2 1 
ATOM   4498  N  N   . GLY B 1 234 ? 52.888  31.426  75.484  1.00 12.54  ? 234 GLY B N   1 
ATOM   4499  C  CA  . GLY B 1 234 ? 53.416  31.609  76.857  1.00 12.60  ? 234 GLY B CA  1 
ATOM   4500  C  C   . GLY B 1 234 ? 53.427  30.329  77.676  1.00 13.29  ? 234 GLY B C   1 
ATOM   4501  O  O   . GLY B 1 234 ? 54.379  30.047  78.378  1.00 14.78  ? 234 GLY B O   1 
ATOM   4502  N  N   . ARG B 1 235 ? 52.395  29.515  77.561  1.00 13.19  ? 235 ARG B N   1 
ATOM   4503  C  CA  . ARG B 1 235 ? 52.325  28.271  78.301  1.00 13.24  ? 235 ARG B CA  1 
ATOM   4504  C  C   . ARG B 1 235 ? 53.320  27.252  77.780  1.00 13.32  ? 235 ARG B C   1 
ATOM   4505  O  O   . ARG B 1 235 ? 53.893  26.474  78.544  1.00 12.86  ? 235 ARG B O   1 
ATOM   4506  C  CB  . ARG B 1 235 ? 50.916  27.655  78.148  1.00 13.69  ? 235 ARG B CB  1 
ATOM   4507  C  CG  . ARG B 1 235 ? 50.727  26.291  78.823  1.00 13.95  ? 235 ARG B CG  1 
ATOM   4508  C  CD  . ARG B 1 235 ? 49.295  25.756  78.646  1.00 15.41  ? 235 ARG B CD  1 
ATOM   4509  N  NE  . ARG B 1 235 ? 49.150  24.456  79.290  1.00 15.21  ? 235 ARG B NE  1 
ATOM   4510  C  CZ  . ARG B 1 235 ? 48.784  24.288  80.565  1.00 15.43  ? 235 ARG B CZ  1 
ATOM   4511  N  NH1 . ARG B 1 235 ? 48.498  25.330  81.348  1.00 15.37  ? 235 ARG B NH1 1 
ATOM   4512  N  NH2 . ARG B 1 235 ? 48.744  23.076  81.073  1.00 14.40  ? 235 ARG B NH2 1 
ATOM   4513  N  N   . ILE B 1 236 ? 53.460  27.206  76.459  1.00 13.15  ? 236 ILE B N   1 
ATOM   4514  C  CA  . ILE B 1 236 ? 54.288  26.195  75.828  1.00 13.71  ? 236 ILE B CA  1 
ATOM   4515  C  C   . ILE B 1 236 ? 55.753  26.494  76.191  1.00 14.49  ? 236 ILE B C   1 
ATOM   4516  O  O   . ILE B 1 236 ? 56.557  25.585  76.458  1.00 13.86  ? 236 ILE B O   1 
ATOM   4517  C  CB  . ILE B 1 236 ? 54.048  26.185  74.295  1.00 13.42  ? 236 ILE B CB  1 
ATOM   4518  C  CG1 . ILE B 1 236 ? 52.635  25.661  73.990  1.00 12.62  ? 236 ILE B CG1 1 
ATOM   4519  C  CG2 . ILE B 1 236 ? 55.178  25.476  73.561  1.00 12.75  ? 236 ILE B CG2 1 
ATOM   4520  C  CD1 . ILE B 1 236 ? 52.148  25.960  72.590  1.00 12.30  ? 236 ILE B CD1 1 
ATOM   4521  N  N   . SER B 1 237 ? 56.080  27.777  76.239  1.00 14.55  ? 237 SER B N   1 
ATOM   4522  C  CA  . SER B 1 237 ? 57.447  28.166  76.458  1.00 15.60  ? 237 SER B CA  1 
ATOM   4523  C  C   . SER B 1 237 ? 57.775  28.160  77.949  1.00 16.39  ? 237 SER B C   1 
ATOM   4524  O  O   . SER B 1 237 ? 58.856  27.749  78.346  1.00 15.15  ? 237 SER B O   1 
ATOM   4525  C  CB  . SER B 1 237 ? 57.729  29.502  75.765  1.00 16.62  ? 237 SER B CB  1 
ATOM   4526  O  OG  . SER B 1 237 ? 57.618  30.593  76.628  1.00 19.09  ? 237 SER B OG  1 
ATOM   4527  N  N   . HIS B 1 238 ? 56.831  28.570  78.793  1.00 17.48  ? 238 HIS B N   1 
ATOM   4528  C  CA  . HIS B 1 238 ? 57.043  28.366  80.202  1.00 18.31  ? 238 HIS B CA  1 
ATOM   4529  C  C   . HIS B 1 238 ? 57.162  26.900  80.486  1.00 19.36  ? 238 HIS B C   1 
ATOM   4530  O  O   . HIS B 1 238 ? 58.043  26.469  81.241  1.00 22.03  ? 238 HIS B O   1 
ATOM   4531  C  CB  . HIS B 1 238 ? 55.971  29.015  81.056  1.00 19.93  ? 238 HIS B CB  1 
ATOM   4532  C  CG  . HIS B 1 238 ? 56.164  28.762  82.512  1.00 22.17  ? 238 HIS B CG  1 
ATOM   4533  N  ND1 . HIS B 1 238 ? 57.221  29.279  83.208  1.00 23.19  ? 238 HIS B ND1 1 
ATOM   4534  C  CD2 . HIS B 1 238 ? 55.460  27.969  83.396  1.00 22.24  ? 238 HIS B CD2 1 
ATOM   4535  C  CE1 . HIS B 1 238 ? 57.167  28.855  84.469  1.00 22.07  ? 238 HIS B CE1 1 
ATOM   4536  N  NE2 . HIS B 1 238 ? 56.088  28.051  84.595  1.00 22.73  ? 238 HIS B NE2 1 
ATOM   4537  N  N   . GLY B 1 239 ? 56.343  26.089  79.834  1.00 18.65  ? 239 GLY B N   1 
ATOM   4538  C  CA  . GLY B 1 239 ? 56.486  24.618  79.955  1.00 18.41  ? 239 GLY B CA  1 
ATOM   4539  C  C   . GLY B 1 239 ? 57.832  24.032  79.569  1.00 18.56  ? 239 GLY B C   1 
ATOM   4540  O  O   . GLY B 1 239 ? 58.345  23.131  80.243  1.00 19.61  ? 239 GLY B O   1 
ATOM   4541  N  N   . PHE B 1 240 ? 58.411  24.546  78.490  1.00 17.31  ? 240 PHE B N   1 
ATOM   4542  C  CA  . PHE B 1 240 ? 59.689  24.076  77.972  1.00 17.48  ? 240 PHE B CA  1 
ATOM   4543  C  C   . PHE B 1 240 ? 60.837  24.380  78.944  1.00 17.77  ? 240 PHE B C   1 
ATOM   4544  O  O   . PHE B 1 240 ? 61.821  23.651  79.041  1.00 16.72  ? 240 PHE B O   1 
ATOM   4545  C  CB  . PHE B 1 240 ? 59.929  24.752  76.602  1.00 17.13  ? 240 PHE B CB  1 
ATOM   4546  C  CG  . PHE B 1 240 ? 61.217  24.389  75.935  1.00 17.03  ? 240 PHE B CG  1 
ATOM   4547  C  CD1 . PHE B 1 240 ? 61.260  23.340  75.010  1.00 17.91  ? 240 PHE B CD1 1 
ATOM   4548  C  CD2 . PHE B 1 240 ? 62.365  25.122  76.173  1.00 16.98  ? 240 PHE B CD2 1 
ATOM   4549  C  CE1 . PHE B 1 240 ? 62.436  22.997  74.358  1.00 18.33  ? 240 PHE B CE1 1 
ATOM   4550  C  CE2 . PHE B 1 240 ? 63.539  24.795  75.532  1.00 18.56  ? 240 PHE B CE2 1 
ATOM   4551  C  CZ  . PHE B 1 240 ? 63.580  23.723  74.616  1.00 18.98  ? 240 PHE B CZ  1 
ATOM   4552  N  N   . SER B 1 241 ? 60.694  25.492  79.643  1.00 19.73  ? 241 SER B N   1 
ATOM   4553  C  CA  . SER B 1 241 ? 61.634  25.918  80.670  1.00 20.62  ? 241 SER B CA  1 
ATOM   4554  C  C   . SER B 1 241 ? 61.641  24.964  81.835  1.00 21.64  ? 241 SER B C   1 
ATOM   4555  O  O   . SER B 1 241 ? 62.694  24.534  82.265  1.00 20.49  ? 241 SER B O   1 
ATOM   4556  C  CB  . SER B 1 241 ? 61.263  27.299  81.168  1.00 19.93  ? 241 SER B CB  1 
ATOM   4557  O  OG  . SER B 1 241 ? 61.559  28.216  80.125  1.00 20.79  ? 241 SER B OG  1 
ATOM   4558  N  N   . MET B 1 242 ? 60.453  24.614  82.304  1.00 22.35  ? 242 MET B N   1 
ATOM   4559  C  CA  . MET B 1 242 ? 60.293  23.825  83.501  1.00 23.39  ? 242 MET B CA  1 
ATOM   4560  C  C   . MET B 1 242 ? 60.649  22.347  83.350  1.00 25.28  ? 242 MET B C   1 
ATOM   4561  O  O   . MET B 1 242 ? 61.185  21.738  84.282  1.00 28.26  ? 242 MET B O   1 
ATOM   4562  C  CB  . MET B 1 242 ? 58.843  23.962  84.001  1.00 24.83  ? 242 MET B CB  1 
ATOM   4563  C  CG  . MET B 1 242 ? 58.479  25.361  84.471  1.00 24.83  ? 242 MET B CG  1 
ATOM   4564  S  SD  . MET B 1 242 ? 59.645  26.027  85.671  1.00 27.67  ? 242 MET B SD  1 
ATOM   4565  C  CE  . MET B 1 242 ? 60.463  27.350  84.787  1.00 26.35  ? 242 MET B CE  1 
ATOM   4566  N  N   . ARG B 1 243 ? 60.350  21.756  82.198  1.00 25.03  ? 243 ARG B N   1 
ATOM   4567  C  CA  . ARG B 1 243 ? 60.628  20.338  81.987  1.00 24.41  ? 243 ARG B CA  1 
ATOM   4568  C  C   . ARG B 1 243 ? 61.508  20.053  80.769  1.00 25.18  ? 243 ARG B C   1 
ATOM   4569  O  O   . ARG B 1 243 ? 61.032  19.430  79.812  1.00 24.39  ? 243 ARG B O   1 
ATOM   4570  C  CB  . ARG B 1 243 ? 59.324  19.548  81.831  1.00 26.17  ? 243 ARG B CB  1 
ATOM   4571  C  CG  . ARG B 1 243 ? 58.378  19.517  83.027  1.00 27.17  ? 243 ARG B CG  1 
ATOM   4572  C  CD  . ARG B 1 243 ? 59.012  18.967  84.284  1.00 28.46  ? 243 ARG B CD  1 
ATOM   4573  N  NE  . ARG B 1 243 ? 59.608  17.648  84.115  1.00 30.40  ? 243 ARG B NE  1 
ATOM   4574  C  CZ  . ARG B 1 243 ? 58.950  16.486  84.197  1.00 34.03  ? 243 ARG B CZ  1 
ATOM   4575  N  NH1 . ARG B 1 243 ? 57.632  16.452  84.406  1.00 32.02  ? 243 ARG B NH1 1 
ATOM   4576  N  NH2 . ARG B 1 243 ? 59.617  15.336  84.069  1.00 33.33  ? 243 ARG B NH2 1 
ATOM   4577  N  N   . PRO B 1 244 ? 62.788  20.498  80.794  1.00 24.63  ? 244 PRO B N   1 
ATOM   4578  C  CA  . PRO B 1 244 ? 63.733  20.192  79.694  1.00 25.33  ? 244 PRO B CA  1 
ATOM   4579  C  C   . PRO B 1 244 ? 63.902  18.702  79.380  1.00 25.87  ? 244 PRO B C   1 
ATOM   4580  O  O   . PRO B 1 244 ? 64.262  18.366  78.236  1.00 25.42  ? 244 PRO B O   1 
ATOM   4581  C  CB  . PRO B 1 244 ? 65.070  20.774  80.182  1.00 24.25  ? 244 PRO B CB  1 
ATOM   4582  C  CG  . PRO B 1 244 ? 64.867  21.058  81.631  1.00 24.05  ? 244 PRO B CG  1 
ATOM   4583  C  CD  . PRO B 1 244 ? 63.404  21.363  81.805  1.00 23.03  ? 244 PRO B CD  1 
ATOM   4584  N  N   . ASP B 1 245 ? 63.677  17.834  80.373  1.00 24.64  ? 245 ASP B N   1 
ATOM   4585  C  CA  . ASP B 1 245 ? 63.704  16.366  80.172  1.00 28.18  ? 245 ASP B CA  1 
ATOM   4586  C  C   . ASP B 1 245 ? 62.605  15.831  79.237  1.00 27.95  ? 245 ASP B C   1 
ATOM   4587  O  O   . ASP B 1 245 ? 62.716  14.768  78.640  1.00 28.72  ? 245 ASP B O   1 
ATOM   4588  C  CB  . ASP B 1 245 ? 63.637  15.600  81.511  1.00 29.17  ? 245 ASP B CB  1 
ATOM   4589  C  CG  . ASP B 1 245 ? 62.427  15.990  82.379  1.00 33.08  ? 245 ASP B CG  1 
ATOM   4590  O  OD1 . ASP B 1 245 ? 61.985  17.176  82.412  1.00 35.05  ? 245 ASP B OD1 1 
ATOM   4591  O  OD2 . ASP B 1 245 ? 61.921  15.098  83.084  1.00 35.41  ? 245 ASP B OD2 1 
ATOM   4592  N  N   . LEU B 1 246 ? 61.523  16.562  79.130  1.00 29.01  ? 246 LEU B N   1 
ATOM   4593  C  CA  . LEU B 1 246 ? 60.416  16.076  78.340  1.00 30.06  ? 246 LEU B CA  1 
ATOM   4594  C  C   . LEU B 1 246 ? 60.355  16.786  77.001  1.00 28.80  ? 246 LEU B C   1 
ATOM   4595  O  O   . LEU B 1 246 ? 59.848  16.221  76.007  1.00 27.73  ? 246 LEU B O   1 
ATOM   4596  C  CB  . LEU B 1 246 ? 59.113  16.270  79.118  1.00 30.34  ? 246 LEU B CB  1 
ATOM   4597  C  CG  . LEU B 1 246 ? 59.023  15.338  80.320  1.00 31.04  ? 246 LEU B CG  1 
ATOM   4598  C  CD1 . LEU B 1 246 ? 57.825  15.739  81.157  1.00 31.69  ? 246 LEU B CD1 1 
ATOM   4599  C  CD2 . LEU B 1 246 ? 58.905  13.880  79.892  1.00 31.20  ? 246 LEU B CD2 1 
ATOM   4600  N  N   . CYS B 1 247 ? 60.924  17.996  76.989  1.00 26.28  ? 247 CYS B N   1 
ATOM   4601  C  CA  . CYS B 1 247 ? 60.743  18.984  75.923  1.00 26.65  ? 247 CYS B CA  1 
ATOM   4602  C  C   . CYS B 1 247 ? 61.951  19.316  75.056  1.00 25.71  ? 247 CYS B C   1 
ATOM   4603  O  O   . CYS B 1 247 ? 61.773  19.661  73.903  1.00 25.61  ? 247 CYS B O   1 
ATOM   4604  C  CB  . CYS B 1 247 ? 60.234  20.287  76.530  1.00 26.52  ? 247 CYS B CB  1 
ATOM   4605  S  SG  . CYS B 1 247 ? 58.608  20.123  77.303  1.00 25.45  ? 247 CYS B SG  1 
ATOM   4606  N  N   . ALA B 1 248 ? 63.157  19.222  75.616  1.00 26.26  ? 248 ALA B N   1 
ATOM   4607  C  CA  . ALA B 1 248 ? 64.369  19.698  74.973  1.00 26.13  ? 248 ALA B CA  1 
ATOM   4608  C  C   . ALA B 1 248 ? 65.375  18.629  74.567  1.00 27.60  ? 248 ALA B C   1 
ATOM   4609  O  O   . ALA B 1 248 ? 66.512  18.936  74.239  1.00 31.08  ? 248 ALA B O   1 
ATOM   4610  C  CB  . ALA B 1 248 ? 65.042  20.759  75.833  1.00 25.83  ? 248 ALA B CB  1 
ATOM   4611  N  N   . GLN B 1 249 ? 64.986  17.377  74.549  1.00 30.89  ? 249 GLN B N   1 
ATOM   4612  C  CA  . GLN B 1 249 ? 65.916  16.382  74.044  1.00 34.97  ? 249 GLN B CA  1 
ATOM   4613  C  C   . GLN B 1 249 ? 66.252  16.485  72.520  1.00 34.75  ? 249 GLN B C   1 
ATOM   4614  O  O   . GLN B 1 249 ? 67.268  15.935  72.078  1.00 37.51  ? 249 GLN B O   1 
ATOM   4615  C  CB  . GLN B 1 249 ? 65.468  14.973  74.434  1.00 40.15  ? 249 GLN B CB  1 
ATOM   4616  C  CG  . GLN B 1 249 ? 64.210  14.508  73.717  1.00 50.96  ? 249 GLN B CG  1 
ATOM   4617  C  CD  . GLN B 1 249 ? 64.128  12.988  73.573  1.00 56.56  ? 249 GLN B CD  1 
ATOM   4618  O  OE1 . GLN B 1 249 ? 65.036  12.237  74.000  1.00 57.71  ? 249 GLN B OE1 1 
ATOM   4619  N  NE2 . GLN B 1 249 ? 63.036  12.526  72.966  1.00 50.62  ? 249 GLN B NE2 1 
ATOM   4620  N  N   . ASP B 1 250 ? 65.441  17.171  71.716  1.00 29.17  ? 250 ASP B N   1 
ATOM   4621  C  CA  . ASP B 1 250 ? 65.792  17.270  70.293  1.00 29.10  ? 250 ASP B CA  1 
ATOM   4622  C  C   . ASP B 1 250 ? 66.270  18.638  69.870  1.00 25.46  ? 250 ASP B C   1 
ATOM   4623  O  O   . ASP B 1 250 ? 66.968  18.771  68.890  1.00 32.09  ? 250 ASP B O   1 
ATOM   4624  C  CB  . ASP B 1 250 ? 64.646  16.817  69.371  1.00 31.32  ? 250 ASP B CB  1 
ATOM   4625  C  CG  . ASP B 1 250 ? 64.265  15.349  69.568  1.00 35.97  ? 250 ASP B CG  1 
ATOM   4626  O  OD1 . ASP B 1 250 ? 65.144  14.466  69.534  1.00 37.14  ? 250 ASP B OD1 1 
ATOM   4627  O  OD2 . ASP B 1 250 ? 63.064  15.065  69.728  1.00 40.94  ? 250 ASP B OD2 1 
ATOM   4628  N  N   . ASN B 1 251 ? 65.860  19.660  70.579  1.00 23.46  ? 251 ASN B N   1 
ATOM   4629  C  CA  . ASN B 1 251 ? 66.170  21.047  70.232  1.00 22.76  ? 251 ASN B CA  1 
ATOM   4630  C  C   . ASN B 1 251 ? 66.115  21.849  71.519  1.00 22.10  ? 251 ASN B C   1 
ATOM   4631  O  O   . ASN B 1 251 ? 65.074  21.908  72.158  1.00 20.74  ? 251 ASN B O   1 
ATOM   4632  C  CB  . ASN B 1 251 ? 65.128  21.631  69.293  1.00 22.01  ? 251 ASN B CB  1 
ATOM   4633  C  CG  . ASN B 1 251 ? 65.449  23.060  68.903  1.00 21.95  ? 251 ASN B CG  1 
ATOM   4634  O  OD1 . ASN B 1 251 ? 66.465  23.324  68.249  1.00 23.66  ? 251 ASN B OD1 1 
ATOM   4635  N  ND2 . ASN B 1 251 ? 64.595  23.980  69.278  1.00 20.75  ? 251 ASN B ND2 1 
ATOM   4636  N  N   . PRO B 1 252 ? 67.242  22.439  71.913  1.00 23.55  ? 252 PRO B N   1 
ATOM   4637  C  CA  . PRO B 1 252 ? 67.338  23.092  73.216  1.00 22.00  ? 252 PRO B CA  1 
ATOM   4638  C  C   . PRO B 1 252 ? 66.975  24.562  73.229  1.00 22.59  ? 252 PRO B C   1 
ATOM   4639  O  O   . PRO B 1 252 ? 67.136  25.198  74.238  1.00 23.31  ? 252 PRO B O   1 
ATOM   4640  C  CB  . PRO B 1 252 ? 68.831  22.932  73.585  1.00 23.07  ? 252 PRO B CB  1 
ATOM   4641  C  CG  . PRO B 1 252 ? 69.537  22.375  72.352  1.00 23.56  ? 252 PRO B CG  1 
ATOM   4642  C  CD  . PRO B 1 252 ? 68.555  22.343  71.220  1.00 23.48  ? 252 PRO B CD  1 
ATOM   4643  N  N   . MET B 1 253 ? 66.519  25.136  72.131  1.00 24.30  ? 253 MET B N   1 
ATOM   4644  C  CA  . MET B 1 253 ? 66.259  26.553  72.161  1.00 25.46  ? 253 MET B CA  1 
ATOM   4645  C  C   . MET B 1 253 ? 64.785  26.746  72.493  1.00 23.80  ? 253 MET B C   1 
ATOM   4646  O  O   . MET B 1 253 ? 63.931  26.084  71.928  1.00 23.42  ? 253 MET B O   1 
ATOM   4647  C  CB  . MET B 1 253 ? 66.655  27.232  70.836  1.00 33.11  ? 253 MET B CB  1 
ATOM   4648  C  CG  . MET B 1 253 ? 68.142  27.119  70.456  1.00 40.00  ? 253 MET B CG  1 
ATOM   4649  S  SD  . MET B 1 253 ? 68.557  25.771  69.290  1.00 56.20  ? 253 MET B SD  1 
ATOM   4650  C  CE  . MET B 1 253 ? 70.330  25.526  69.557  1.00 51.93  ? 253 MET B CE  1 
ATOM   4651  N  N   . ASN B 1 254 ? 64.496  27.632  73.435  1.00 22.76  ? 254 ASN B N   1 
ATOM   4652  C  CA  . ASN B 1 254 ? 63.137  27.892  73.862  1.00 23.89  ? 254 ASN B CA  1 
ATOM   4653  C  C   . ASN B 1 254 ? 62.271  28.264  72.645  1.00 24.18  ? 254 ASN B C   1 
ATOM   4654  O  O   . ASN B 1 254 ? 62.705  29.023  71.779  1.00 25.34  ? 254 ASN B O   1 
ATOM   4655  C  CB  . ASN B 1 254 ? 63.127  28.997  74.927  1.00 23.21  ? 254 ASN B CB  1 
ATOM   4656  C  CG  . ASN B 1 254 ? 61.800  29.105  75.645  1.00 26.12  ? 254 ASN B CG  1 
ATOM   4657  O  OD1 . ASN B 1 254 ? 60.818  29.635  75.086  1.00 26.87  ? 254 ASN B OD1 1 
ATOM   4658  N  ND2 . ASN B 1 254 ? 61.745  28.593  76.902  1.00 23.89  ? 254 ASN B ND2 1 
ATOM   4659  N  N   . PRO B 1 255 ? 61.063  27.713  72.560  1.00 23.96  ? 255 PRO B N   1 
ATOM   4660  C  CA  . PRO B 1 255 ? 60.137  28.010  71.455  1.00 25.76  ? 255 PRO B CA  1 
ATOM   4661  C  C   . PRO B 1 255 ? 59.963  29.502  71.235  1.00 28.17  ? 255 PRO B C   1 
ATOM   4662  O  O   . PRO B 1 255 ? 59.976  29.989  70.099  1.00 29.41  ? 255 PRO B O   1 
ATOM   4663  C  CB  . PRO B 1 255 ? 58.821  27.411  71.945  1.00 25.38  ? 255 PRO B CB  1 
ATOM   4664  C  CG  . PRO B 1 255 ? 59.251  26.238  72.794  1.00 25.03  ? 255 PRO B CG  1 
ATOM   4665  C  CD  . PRO B 1 255 ? 60.553  26.660  73.448  1.00 23.61  ? 255 PRO B CD  1 
ATOM   4666  N  N   . LYS B 1 256 ? 59.863  30.238  72.332  1.00 29.85  ? 256 LYS B N   1 
ATOM   4667  C  CA  . LYS B 1 256 ? 59.751  31.679  72.266  1.00 29.99  ? 256 LYS B CA  1 
ATOM   4668  C  C   . LYS B 1 256 ? 60.692  32.319  71.248  1.00 28.46  ? 256 LYS B C   1 
ATOM   4669  O  O   . LYS B 1 256 ? 60.363  33.357  70.681  1.00 28.42  ? 256 LYS B O   1 
ATOM   4670  C  CB  . LYS B 1 256 ? 59.993  32.265  73.642  1.00 33.97  ? 256 LYS B CB  1 
ATOM   4671  C  CG  . LYS B 1 256 ? 59.064  33.408  73.963  1.00 39.38  ? 256 LYS B CG  1 
ATOM   4672  C  CD  . LYS B 1 256 ? 58.804  33.485  75.461  1.00 45.47  ? 256 LYS B CD  1 
ATOM   4673  C  CE  . LYS B 1 256 ? 57.313  33.711  75.749  1.00 47.68  ? 256 LYS B CE  1 
ATOM   4674  N  NZ  . LYS B 1 256 ? 57.052  33.939  77.207  1.00 47.17  ? 256 LYS B NZ  1 
ATOM   4675  N  N   . LYS B 1 257 ? 61.857  31.718  71.017  1.00 28.38  ? 257 LYS B N   1 
ATOM   4676  C  CA  . LYS B 1 257 ? 62.877  32.320  70.128  1.00 28.18  ? 257 LYS B CA  1 
ATOM   4677  C  C   . LYS B 1 257 ? 62.624  32.079  68.610  1.00 27.12  ? 257 LYS B C   1 
ATOM   4678  O  O   . LYS B 1 257 ? 63.381  32.545  67.768  1.00 25.62  ? 257 LYS B O   1 
ATOM   4679  C  CB  . LYS B 1 257 ? 64.295  31.854  70.516  1.00 32.47  ? 257 LYS B CB  1 
ATOM   4680  C  CG  . LYS B 1 257 ? 64.816  32.194  71.929  1.00 39.16  ? 257 LYS B CG  1 
ATOM   4681  C  CD  . LYS B 1 257 ? 66.193  31.516  72.131  1.00 48.56  ? 257 LYS B CD  1 
ATOM   4682  C  CE  . LYS B 1 257 ? 66.659  31.318  73.592  1.00 50.16  ? 257 LYS B CE  1 
ATOM   4683  N  NZ  . LYS B 1 257 ? 66.272  29.987  74.190  1.00 46.90  ? 257 LYS B NZ  1 
ATOM   4684  N  N   . TYR B 1 258 ? 61.576  31.320  68.273  1.00 27.47  ? 258 TYR B N   1 
ATOM   4685  C  CA  . TYR B 1 258 ? 61.214  31.080  66.882  1.00 26.19  ? 258 TYR B CA  1 
ATOM   4686  C  C   . TYR B 1 258 ? 60.083  31.996  66.437  1.00 26.03  ? 258 TYR B C   1 
ATOM   4687  O  O   . TYR B 1 258 ? 59.650  31.947  65.291  1.00 28.34  ? 258 TYR B O   1 
ATOM   4688  C  CB  . TYR B 1 258 ? 60.871  29.618  66.679  1.00 24.49  ? 258 TYR B CB  1 
ATOM   4689  C  CG  . TYR B 1 258 ? 62.073  28.748  66.859  1.00 25.03  ? 258 TYR B CG  1 
ATOM   4690  C  CD1 . TYR B 1 258 ? 63.009  28.602  65.839  1.00 23.84  ? 258 TYR B CD1 1 
ATOM   4691  C  CD2 . TYR B 1 258 ? 62.314  28.114  68.067  1.00 25.33  ? 258 TYR B CD2 1 
ATOM   4692  C  CE1 . TYR B 1 258 ? 64.133  27.834  66.000  1.00 23.44  ? 258 TYR B CE1 1 
ATOM   4693  C  CE2 . TYR B 1 258 ? 63.436  27.309  68.234  1.00 26.33  ? 258 TYR B CE2 1 
ATOM   4694  C  CZ  . TYR B 1 258 ? 64.350  27.176  67.194  1.00 26.42  ? 258 TYR B CZ  1 
ATOM   4695  O  OH  . TYR B 1 258 ? 65.470  26.355  67.359  1.00 27.14  ? 258 TYR B OH  1 
ATOM   4696  N  N   . LEU B 1 259 ? 59.598  32.836  67.343  1.00 24.82  ? 259 LEU B N   1 
ATOM   4697  C  CA  . LEU B 1 259 ? 58.662  33.869  66.945  1.00 24.17  ? 259 LEU B CA  1 
ATOM   4698  C  C   . LEU B 1 259 ? 59.409  34.733  65.937  1.00 24.05  ? 259 LEU B C   1 
ATOM   4699  O  O   . LEU B 1 259 ? 60.517  35.241  66.236  1.00 24.41  ? 259 LEU B O   1 
ATOM   4700  C  CB  . LEU B 1 259 ? 58.174  34.682  68.135  1.00 23.18  ? 259 LEU B CB  1 
ATOM   4701  C  CG  . LEU B 1 259 ? 57.370  33.899  69.168  1.00 24.37  ? 259 LEU B CG  1 
ATOM   4702  C  CD1 . LEU B 1 259 ? 56.835  34.819  70.272  1.00 24.96  ? 259 LEU B CD1 1 
ATOM   4703  C  CD2 . LEU B 1 259 ? 56.225  33.179  68.493  1.00 23.27  ? 259 LEU B CD2 1 
ATOM   4704  N  N   . GLY B 1 260 ? 58.834  34.839  64.737  1.00 22.50  ? 260 GLY B N   1 
ATOM   4705  C  CA  . GLY B 1 260 ? 59.433  35.611  63.641  1.00 22.32  ? 260 GLY B CA  1 
ATOM   4706  C  C   . GLY B 1 260 ? 60.193  34.736  62.665  1.00 22.08  ? 260 GLY B C   1 
ATOM   4707  O  O   . GLY B 1 260 ? 60.782  35.233  61.737  1.00 24.41  ? 260 GLY B O   1 
ATOM   4708  N  N   . SER B 1 261 ? 60.189  33.431  62.879  1.00 22.09  ? 261 SER B N   1 
ATOM   4709  C  CA  . SER B 1 261 ? 60.872  32.514  61.976  1.00 22.96  ? 261 SER B CA  1 
ATOM   4710  C  C   . SER B 1 261 ? 59.935  31.659  61.108  1.00 20.94  ? 261 SER B C   1 
ATOM   4711  O  O   . SER B 1 261 ? 60.370  30.698  60.455  1.00 19.97  ? 261 SER B O   1 
ATOM   4712  C  CB  . SER B 1 261 ? 61.795  31.611  62.789  1.00 24.48  ? 261 SER B CB  1 
ATOM   4713  O  OG  . SER B 1 261 ? 62.768  32.458  63.360  1.00 32.94  ? 261 SER B OG  1 
ATOM   4714  N  N   . PHE B 1 262 ? 58.653  31.986  61.144  1.00 17.73  ? 262 PHE B N   1 
ATOM   4715  C  CA  . PHE B 1 262 ? 57.703  31.304  60.309  1.00 16.89  ? 262 PHE B CA  1 
ATOM   4716  C  C   . PHE B 1 262 ? 56.520  32.222  60.121  1.00 16.19  ? 262 PHE B C   1 
ATOM   4717  O  O   . PHE B 1 262 ? 56.398  33.240  60.800  1.00 16.45  ? 262 PHE B O   1 
ATOM   4718  C  CB  . PHE B 1 262 ? 57.312  29.940  60.885  1.00 16.75  ? 262 PHE B CB  1 
ATOM   4719  C  CG  . PHE B 1 262 ? 56.656  29.998  62.245  1.00 15.98  ? 262 PHE B CG  1 
ATOM   4720  C  CD1 . PHE B 1 262 ? 55.290  30.283  62.371  1.00 16.28  ? 262 PHE B CD1 1 
ATOM   4721  C  CD2 . PHE B 1 262 ? 57.391  29.703  63.400  1.00 16.15  ? 262 PHE B CD2 1 
ATOM   4722  C  CE1 . PHE B 1 262 ? 54.677  30.324  63.647  1.00 16.48  ? 262 PHE B CE1 1 
ATOM   4723  C  CE2 . PHE B 1 262 ? 56.796  29.751  64.675  1.00 16.51  ? 262 PHE B CE2 1 
ATOM   4724  C  CZ  . PHE B 1 262 ? 55.442  30.062  64.804  1.00 15.75  ? 262 PHE B CZ  1 
ATOM   4725  N  N   . TYR B 1 263 ? 55.654  31.868  59.185  1.00 15.22  ? 263 TYR B N   1 
ATOM   4726  C  CA  . TYR B 1 263 ? 54.549  32.721  58.798  1.00 14.13  ? 263 TYR B CA  1 
ATOM   4727  C  C   . TYR B 1 263 ? 53.270  32.042  59.273  1.00 13.13  ? 263 TYR B C   1 
ATOM   4728  O  O   . TYR B 1 263 ? 53.270  30.863  59.521  1.00 12.31  ? 263 TYR B O   1 
ATOM   4729  C  CB  . TYR B 1 263 ? 54.542  32.780  57.279  1.00 14.56  ? 263 TYR B CB  1 
ATOM   4730  C  CG  . TYR B 1 263 ? 55.668  33.548  56.630  1.00 14.85  ? 263 TYR B CG  1 
ATOM   4731  C  CD1 . TYR B 1 263 ? 55.462  34.855  56.200  1.00 15.79  ? 263 TYR B CD1 1 
ATOM   4732  C  CD2 . TYR B 1 263 ? 56.908  32.966  56.391  1.00 15.43  ? 263 TYR B CD2 1 
ATOM   4733  C  CE1 . TYR B 1 263 ? 56.467  35.578  55.572  1.00 16.58  ? 263 TYR B CE1 1 
ATOM   4734  C  CE2 . TYR B 1 263 ? 57.926  33.675  55.753  1.00 16.04  ? 263 TYR B CE2 1 
ATOM   4735  C  CZ  . TYR B 1 263 ? 57.692  34.991  55.363  1.00 16.54  ? 263 TYR B CZ  1 
ATOM   4736  O  OH  . TYR B 1 263 ? 58.654  35.754  54.758  1.00 18.47  ? 263 TYR B OH  1 
ATOM   4737  N  N   . THR B 1 264 ? 52.185  32.769  59.385  1.00 12.60  ? 264 THR B N   1 
ATOM   4738  C  CA  . THR B 1 264 ? 50.892  32.135  59.509  1.00 13.51  ? 264 THR B CA  1 
ATOM   4739  C  C   . THR B 1 264 ? 49.988  32.872  58.541  1.00 13.47  ? 264 THR B C   1 
ATOM   4740  O  O   . THR B 1 264 ? 50.265  34.029  58.253  1.00 12.42  ? 264 THR B O   1 
ATOM   4741  C  CB  . THR B 1 264 ? 50.258  32.317  60.911  1.00 14.21  ? 264 THR B CB  1 
ATOM   4742  O  OG1 . THR B 1 264 ? 49.961  33.698  61.113  1.00 14.98  ? 264 THR B OG1 1 
ATOM   4743  C  CG2 . THR B 1 264 ? 51.161  31.826  62.044  1.00 13.78  ? 264 THR B CG2 1 
ATOM   4744  N  N   . ASP B 1 265 ? 48.923  32.226  58.061  1.00 14.03  ? 265 ASP B N   1 
ATOM   4745  C  CA  . ASP B 1 265 ? 47.852  32.936  57.391  1.00 16.38  ? 265 ASP B CA  1 
ATOM   4746  C  C   . ASP B 1 265 ? 47.052  33.767  58.452  1.00 16.23  ? 265 ASP B C   1 
ATOM   4747  O  O   . ASP B 1 265 ? 47.216  33.547  59.627  1.00 16.85  ? 265 ASP B O   1 
ATOM   4748  C  CB  . ASP B 1 265 ? 46.971  31.976  56.565  1.00 18.82  ? 265 ASP B CB  1 
ATOM   4749  C  CG  . ASP B 1 265 ? 45.792  31.378  57.378  1.00 24.43  ? 265 ASP B CG  1 
ATOM   4750  O  OD1 . ASP B 1 265 ? 45.567  31.846  58.554  1.00 25.00  ? 265 ASP B OD1 1 
ATOM   4751  O  OD2 . ASP B 1 265 ? 45.113  30.424  56.842  1.00 23.63  ? 265 ASP B OD2 1 
ATOM   4752  N  N   . ALA B 1 266 ? 46.214  34.706  58.032  1.00 15.27  ? 266 ALA B N   1 
ATOM   4753  C  CA  . ALA B 1 266 ? 45.534  35.680  58.945  1.00 14.50  ? 266 ALA B CA  1 
ATOM   4754  C  C   . ALA B 1 266 ? 44.030  35.368  59.162  1.00 14.66  ? 266 ALA B C   1 
ATOM   4755  O  O   . ALA B 1 266 ? 43.267  36.154  59.771  1.00 15.06  ? 266 ALA B O   1 
ATOM   4756  C  CB  . ALA B 1 266 ? 45.687  37.079  58.404  1.00 13.35  ? 266 ALA B CB  1 
ATOM   4757  N  N   . LEU B 1 267 ? 43.609  34.209  58.680  1.00 13.97  ? 267 LEU B N   1 
ATOM   4758  C  CA  . LEU B 1 267 ? 42.243  33.786  58.820  1.00 14.30  ? 267 LEU B CA  1 
ATOM   4759  C  C   . LEU B 1 267 ? 41.896  33.553  60.303  1.00 14.22  ? 267 LEU B C   1 
ATOM   4760  O  O   . LEU B 1 267 ? 41.925  32.450  60.784  1.00 13.54  ? 267 LEU B O   1 
ATOM   4761  C  CB  . LEU B 1 267 ? 42.026  32.535  57.989  1.00 14.21  ? 267 LEU B CB  1 
ATOM   4762  C  CG  . LEU B 1 267 ? 40.623  32.161  57.480  1.00 15.70  ? 267 LEU B CG  1 
ATOM   4763  C  CD1 . LEU B 1 267 ? 39.868  33.390  56.970  1.00 15.34  ? 267 LEU B CD1 1 
ATOM   4764  C  CD2 . LEU B 1 267 ? 40.725  31.052  56.397  1.00 14.72  ? 267 LEU B CD2 1 
ATOM   4765  N  N   . VAL B 1 268 ? 41.593  34.619  61.030  1.00 14.88  ? 268 VAL B N   1 
ATOM   4766  C  CA  . VAL B 1 268 ? 41.273  34.471  62.470  1.00 15.71  ? 268 VAL B CA  1 
ATOM   4767  C  C   . VAL B 1 268 ? 39.987  35.172  62.818  1.00 16.68  ? 268 VAL B C   1 
ATOM   4768  O  O   . VAL B 1 268 ? 39.679  35.303  63.993  1.00 17.85  ? 268 VAL B O   1 
ATOM   4769  C  CB  . VAL B 1 268 ? 42.384  35.034  63.421  1.00 14.69  ? 268 VAL B CB  1 
ATOM   4770  C  CG1 . VAL B 1 268 ? 43.658  34.176  63.380  1.00 14.06  ? 268 VAL B CG1 1 
ATOM   4771  C  CG2 . VAL B 1 268 ? 42.681  36.502  63.118  1.00 14.17  ? 268 VAL B CG2 1 
ATOM   4772  N  N   . HIS B 1 269 ? 39.292  35.701  61.813  1.00 17.86  ? 269 HIS B N   1 
ATOM   4773  C  CA  . HIS B 1 269 ? 37.968  36.333  61.987  1.00 20.81  ? 269 HIS B CA  1 
ATOM   4774  C  C   . HIS B 1 269 ? 37.799  37.523  62.926  1.00 22.64  ? 269 HIS B C   1 
ATOM   4775  O  O   . HIS B 1 269 ? 36.890  38.310  62.733  1.00 27.61  ? 269 HIS B O   1 
ATOM   4776  C  CB  . HIS B 1 269 ? 36.906  35.276  62.273  1.00 20.93  ? 269 HIS B CB  1 
ATOM   4777  C  CG  . HIS B 1 269 ? 37.027  34.055  61.381  1.00 24.48  ? 269 HIS B CG  1 
ATOM   4778  N  ND1 . HIS B 1 269 ? 37.715  32.924  61.759  1.00 24.42  ? 269 HIS B ND1 1 
ATOM   4779  C  CD2 . HIS B 1 269 ? 36.592  33.836  60.068  1.00 25.61  ? 269 HIS B CD2 1 
ATOM   4780  C  CE1 . HIS B 1 269 ? 37.668  32.025  60.757  1.00 26.37  ? 269 HIS B CE1 1 
ATOM   4781  N  NE2 . HIS B 1 269 ? 36.980  32.578  59.720  1.00 28.14  ? 269 HIS B NE2 1 
ATOM   4782  N  N   . ASP B 1 270 ? 38.622  37.703  63.943  1.00 21.55  ? 270 ASP B N   1 
ATOM   4783  C  CA  . ASP B 1 270 ? 38.366  38.840  64.817  1.00 20.73  ? 270 ASP B CA  1 
ATOM   4784  C  C   . ASP B 1 270 ? 39.526  39.767  64.919  1.00 17.31  ? 270 ASP B C   1 
ATOM   4785  O  O   . ASP B 1 270 ? 40.663  39.323  64.936  1.00 16.77  ? 270 ASP B O   1 
ATOM   4786  C  CB  . ASP B 1 270 ? 37.889  38.406  66.191  1.00 23.58  ? 270 ASP B CB  1 
ATOM   4787  C  CG  . ASP B 1 270 ? 36.468  37.870  66.154  1.00 30.46  ? 270 ASP B CG  1 
ATOM   4788  O  OD1 . ASP B 1 270 ? 35.886  37.800  65.023  1.00 28.11  ? 270 ASP B OD1 1 
ATOM   4789  O  OD2 . ASP B 1 270 ? 35.941  37.501  67.261  1.00 32.00  ? 270 ASP B OD2 1 
ATOM   4790  N  N   . PRO B 1 271 ? 39.226  41.062  64.953  1.00 16.50  ? 271 PRO B N   1 
ATOM   4791  C  CA  . PRO B 1 271 ? 40.186  42.165  65.124  1.00 16.45  ? 271 PRO B CA  1 
ATOM   4792  C  C   . PRO B 1 271 ? 41.101  41.868  66.306  1.00 15.15  ? 271 PRO B C   1 
ATOM   4793  O  O   . PRO B 1 271 ? 42.313  41.938  66.185  1.00 14.74  ? 271 PRO B O   1 
ATOM   4794  C  CB  . PRO B 1 271 ? 39.307  43.392  65.437  1.00 16.98  ? 271 PRO B CB  1 
ATOM   4795  C  CG  . PRO B 1 271 ? 37.887  42.920  65.424  1.00 18.32  ? 271 PRO B CG  1 
ATOM   4796  C  CD  . PRO B 1 271 ? 37.824  41.518  64.886  1.00 16.94  ? 271 PRO B CD  1 
ATOM   4797  N  N   . LEU B 1 272 ? 40.527  41.507  67.441  1.00 15.33  ? 272 LEU B N   1 
ATOM   4798  C  CA  . LEU B 1 272 ? 41.352  41.283  68.632  1.00 15.59  ? 272 LEU B CA  1 
ATOM   4799  C  C   . LEU B 1 272 ? 42.357  40.184  68.365  1.00 15.25  ? 272 LEU B C   1 
ATOM   4800  O  O   . LEU B 1 272 ? 43.499  40.312  68.725  1.00 15.25  ? 272 LEU B O   1 
ATOM   4801  C  CB  . LEU B 1 272 ? 40.495  40.923  69.847  1.00 16.53  ? 272 LEU B CB  1 
ATOM   4802  C  CG  . LEU B 1 272 ? 39.745  42.053  70.520  1.00 17.00  ? 272 LEU B CG  1 
ATOM   4803  C  CD1 . LEU B 1 272 ? 38.812  41.528  71.611  1.00 16.26  ? 272 LEU B CD1 1 
ATOM   4804  C  CD2 . LEU B 1 272 ? 40.741  43.054  71.075  1.00 17.16  ? 272 LEU B CD2 1 
ATOM   4805  N  N   . SER B 1 273 ? 41.957  39.111  67.692  1.00 15.73  ? 273 SER B N   1 
ATOM   4806  C  CA  . SER B 1 273 ? 42.913  38.041  67.377  1.00 15.37  ? 273 SER B CA  1 
ATOM   4807  C  C   . SER B 1 273 ? 43.893  38.433  66.310  1.00 14.39  ? 273 SER B C   1 
ATOM   4808  O  O   . SER B 1 273 ? 45.025  38.023  66.350  1.00 13.98  ? 273 SER B O   1 
ATOM   4809  C  CB  . SER B 1 273 ? 42.189  36.789  66.944  1.00 16.22  ? 273 SER B CB  1 
ATOM   4810  O  OG  . SER B 1 273 ? 41.404  36.360  68.030  1.00 18.03  ? 273 SER B OG  1 
ATOM   4811  N  N   . LEU B 1 274 ? 43.475  39.233  65.353  1.00 14.84  ? 274 LEU B N   1 
ATOM   4812  C  CA  . LEU B 1 274 ? 44.380  39.595  64.239  1.00 15.03  ? 274 LEU B CA  1 
ATOM   4813  C  C   . LEU B 1 274 ? 45.555  40.380  64.807  1.00 14.77  ? 274 LEU B C   1 
ATOM   4814  O  O   . LEU B 1 274 ? 46.714  40.199  64.394  1.00 13.53  ? 274 LEU B O   1 
ATOM   4815  C  CB  . LEU B 1 274 ? 43.636  40.423  63.166  1.00 14.71  ? 274 LEU B CB  1 
ATOM   4816  C  CG  . LEU B 1 274 ? 44.484  40.858  61.941  1.00 15.14  ? 274 LEU B CG  1 
ATOM   4817  C  CD1 . LEU B 1 274 ? 45.551  39.845  61.553  1.00 15.34  ? 274 LEU B CD1 1 
ATOM   4818  C  CD2 . LEU B 1 274 ? 43.564  41.056  60.770  1.00 14.86  ? 274 LEU B CD2 1 
ATOM   4819  N  N   . LYS B 1 275 ? 45.211  41.240  65.778  1.00 15.85  ? 275 LYS B N   1 
ATOM   4820  C  CA  . LYS B 1 275 ? 46.148  42.119  66.485  1.00 16.01  ? 275 LYS B CA  1 
ATOM   4821  C  C   . LYS B 1 275 ? 47.128  41.344  67.308  1.00 15.16  ? 275 LYS B C   1 
ATOM   4822  O  O   . LYS B 1 275 ? 48.324  41.576  67.226  1.00 17.12  ? 275 LYS B O   1 
ATOM   4823  C  CB  . LYS B 1 275 ? 45.378  43.118  67.352  1.00 17.22  ? 275 LYS B CB  1 
ATOM   4824  C  CG  . LYS B 1 275 ? 46.233  44.225  67.924  1.00 19.43  ? 275 LYS B CG  1 
ATOM   4825  C  CD  . LYS B 1 275 ? 47.053  44.938  66.839  1.00 23.69  ? 275 LYS B CD  1 
ATOM   4826  C  CE  . LYS B 1 275 ? 47.637  46.270  67.331  1.00 24.26  ? 275 LYS B CE  1 
ATOM   4827  N  NZ  . LYS B 1 275 ? 49.036  46.131  67.842  1.00 26.63  ? 275 LYS B NZ  1 
ATOM   4828  N  N   . LEU B 1 276 ? 46.638  40.380  68.070  1.00 14.53  ? 276 LEU B N   1 
ATOM   4829  C  CA  . LEU B 1 276 ? 47.540  39.532  68.826  1.00 15.07  ? 276 LEU B CA  1 
ATOM   4830  C  C   . LEU B 1 276 ? 48.522  38.796  67.885  1.00 15.27  ? 276 LEU B C   1 
ATOM   4831  O  O   . LEU B 1 276 ? 49.731  38.725  68.137  1.00 15.08  ? 276 LEU B O   1 
ATOM   4832  C  CB  . LEU B 1 276 ? 46.741  38.537  69.714  1.00 14.67  ? 276 LEU B CB  1 
ATOM   4833  C  CG  . LEU B 1 276 ? 47.527  37.454  70.488  1.00 15.15  ? 276 LEU B CG  1 
ATOM   4834  C  CD1 . LEU B 1 276 ? 48.322  38.047  71.647  1.00 15.45  ? 276 LEU B CD1 1 
ATOM   4835  C  CD2 . LEU B 1 276 ? 46.612  36.396  71.080  1.00 16.36  ? 276 LEU B CD2 1 
ATOM   4836  N  N   . LEU B 1 277 ? 47.972  38.249  66.806  1.00 14.73  ? 277 LEU B N   1 
ATOM   4837  C  CA  . LEU B 1 277 ? 48.741  37.527  65.793  1.00 15.38  ? 277 LEU B CA  1 
ATOM   4838  C  C   . LEU B 1 277 ? 49.923  38.370  65.281  1.00 16.50  ? 277 LEU B C   1 
ATOM   4839  O  O   . LEU B 1 277 ? 51.062  37.878  65.213  1.00 16.52  ? 277 LEU B O   1 
ATOM   4840  C  CB  . LEU B 1 277 ? 47.795  37.018  64.665  1.00 14.45  ? 277 LEU B CB  1 
ATOM   4841  C  CG  . LEU B 1 277 ? 48.323  36.149  63.519  1.00 16.30  ? 277 LEU B CG  1 
ATOM   4842  C  CD1 . LEU B 1 277 ? 48.883  34.825  63.970  1.00 15.62  ? 277 LEU B CD1 1 
ATOM   4843  C  CD2 . LEU B 1 277 ? 47.282  35.895  62.417  1.00 16.77  ? 277 LEU B CD2 1 
ATOM   4844  N  N   . THR B 1 278 ? 49.680  39.637  64.944  1.00 17.64  ? 278 THR B N   1 
ATOM   4845  C  CA  . THR B 1 278 ? 50.758  40.453  64.402  1.00 19.44  ? 278 THR B CA  1 
ATOM   4846  C  C   . THR B 1 278 ? 51.707  40.843  65.479  1.00 20.60  ? 278 THR B C   1 
ATOM   4847  O  O   . THR B 1 278 ? 52.907  40.906  65.242  1.00 22.31  ? 278 THR B O   1 
ATOM   4848  C  CB  . THR B 1 278 ? 50.301  41.752  63.725  1.00 19.27  ? 278 THR B CB  1 
ATOM   4849  O  OG1 . THR B 1 278 ? 49.431  42.450  64.617  1.00 22.00  ? 278 THR B OG1 1 
ATOM   4850  C  CG2 . THR B 1 278 ? 49.559  41.440  62.457  1.00 19.06  ? 278 THR B CG2 1 
ATOM   4851  N  N   . ASP B 1 279 ? 51.199  41.108  66.670  1.00 21.47  ? 279 ASP B N   1 
ATOM   4852  C  CA  . ASP B 1 279 ? 52.134  41.394  67.772  1.00 24.36  ? 279 ASP B CA  1 
ATOM   4853  C  C   . ASP B 1 279 ? 53.037  40.208  68.096  1.00 23.45  ? 279 ASP B C   1 
ATOM   4854  O  O   . ASP B 1 279 ? 54.187  40.407  68.414  1.00 23.47  ? 279 ASP B O   1 
ATOM   4855  C  CB  . ASP B 1 279 ? 51.401  41.821  69.047  1.00 28.62  ? 279 ASP B CB  1 
ATOM   4856  C  CG  . ASP B 1 279 ? 50.593  43.087  68.862  1.00 33.17  ? 279 ASP B CG  1 
ATOM   4857  O  OD1 . ASP B 1 279 ? 50.872  43.854  67.886  1.00 39.82  ? 279 ASP B OD1 1 
ATOM   4858  O  OD2 . ASP B 1 279 ? 49.671  43.311  69.690  1.00 34.63  ? 279 ASP B OD2 1 
ATOM   4859  N  N   . VAL B 1 280 ? 52.517  38.983  68.033  1.00 21.02  ? 280 VAL B N   1 
ATOM   4860  C  CA  . VAL B 1 280 ? 53.313  37.813  68.396  1.00 20.44  ? 280 VAL B CA  1 
ATOM   4861  C  C   . VAL B 1 280 ? 54.162  37.333  67.225  1.00 20.45  ? 280 VAL B C   1 
ATOM   4862  O  O   . VAL B 1 280 ? 55.368  37.156  67.358  1.00 20.67  ? 280 VAL B O   1 
ATOM   4863  C  CB  . VAL B 1 280 ? 52.418  36.676  68.972  1.00 20.29  ? 280 VAL B CB  1 
ATOM   4864  C  CG1 . VAL B 1 280 ? 53.200  35.396  69.145  1.00 20.13  ? 280 VAL B CG1 1 
ATOM   4865  C  CG2 . VAL B 1 280 ? 51.822  37.098  70.323  1.00 21.18  ? 280 VAL B CG2 1 
ATOM   4866  N  N   . ILE B 1 281 ? 53.534  37.129  66.073  1.00 20.38  ? 281 ILE B N   1 
ATOM   4867  C  CA  . ILE B 1 281 ? 54.203  36.531  64.903  1.00 21.34  ? 281 ILE B CA  1 
ATOM   4868  C  C   . ILE B 1 281 ? 54.988  37.607  64.142  1.00 22.17  ? 281 ILE B C   1 
ATOM   4869  O  O   . ILE B 1 281 ? 55.990  37.306  63.487  1.00 24.68  ? 281 ILE B O   1 
ATOM   4870  C  CB  . ILE B 1 281 ? 53.147  35.845  63.960  1.00 20.85  ? 281 ILE B CB  1 
ATOM   4871  C  CG1 . ILE B 1 281 ? 52.409  34.664  64.654  1.00 20.72  ? 281 ILE B CG1 1 
ATOM   4872  C  CG2 . ILE B 1 281 ? 53.723  35.446  62.624  1.00 19.04  ? 281 ILE B CG2 1 
ATOM   4873  C  CD1 . ILE B 1 281 ? 53.264  33.680  65.432  1.00 19.76  ? 281 ILE B CD1 1 
ATOM   4874  N  N   . GLY B 1 282 ? 54.529  38.864  64.226  1.00 21.50  ? 282 GLY B N   1 
ATOM   4875  C  CA  . GLY B 1 282 ? 55.188  39.963  63.516  1.00 19.67  ? 282 GLY B CA  1 
ATOM   4876  C  C   . GLY B 1 282 ? 54.431  40.456  62.289  1.00 18.42  ? 282 GLY B C   1 
ATOM   4877  O  O   . GLY B 1 282 ? 53.791  39.678  61.576  1.00 18.43  ? 282 GLY B O   1 
ATOM   4878  N  N   . LYS B 1 283 ? 54.545  41.743  62.023  1.00 17.30  ? 283 LYS B N   1 
ATOM   4879  C  CA  . LYS B 1 283 ? 53.931  42.351  60.847  1.00 19.51  ? 283 LYS B CA  1 
ATOM   4880  C  C   . LYS B 1 283 ? 54.455  41.838  59.484  1.00 19.89  ? 283 LYS B C   1 
ATOM   4881  O  O   . LYS B 1 283 ? 53.730  41.892  58.508  1.00 19.79  ? 283 LYS B O   1 
ATOM   4882  C  CB  . LYS B 1 283 ? 54.054  43.868  60.944  1.00 19.43  ? 283 LYS B CB  1 
ATOM   4883  C  CG  . LYS B 1 283 ? 53.181  44.434  62.066  1.00 22.07  ? 283 LYS B CG  1 
ATOM   4884  C  CD  . LYS B 1 283 ? 53.531  45.884  62.389  1.00 26.15  ? 283 LYS B CD  1 
ATOM   4885  C  CE  . LYS B 1 283 ? 53.139  46.226  63.813  1.00 27.05  ? 283 LYS B CE  1 
ATOM   4886  N  NZ  . LYS B 1 283 ? 53.641  45.113  64.682  1.00 30.82  ? 283 LYS B NZ  1 
ATOM   4887  N  N   . ASP B 1 284 ? 55.708  41.393  59.428  1.00 20.60  ? 284 ASP B N   1 
ATOM   4888  C  CA  . ASP B 1 284 ? 56.298  40.812  58.226  1.00 23.12  ? 284 ASP B CA  1 
ATOM   4889  C  C   . ASP B 1 284 ? 55.910  39.344  57.996  1.00 20.45  ? 284 ASP B C   1 
ATOM   4890  O  O   . ASP B 1 284 ? 56.306  38.773  56.983  1.00 18.94  ? 284 ASP B O   1 
ATOM   4891  C  CB  . ASP B 1 284 ? 57.836  40.797  58.332  1.00 28.35  ? 284 ASP B CB  1 
ATOM   4892  C  CG  . ASP B 1 284 ? 58.465  42.164  58.160  1.00 37.57  ? 284 ASP B CG  1 
ATOM   4893  O  OD1 . ASP B 1 284 ? 58.021  42.945  57.284  1.00 40.00  ? 284 ASP B OD1 1 
ATOM   4894  O  OD2 . ASP B 1 284 ? 59.445  42.450  58.904  1.00 47.77  ? 284 ASP B OD2 1 
ATOM   4895  N  N   . LYS B 1 285 ? 55.201  38.728  58.944  1.00 18.31  ? 285 LYS B N   1 
ATOM   4896  C  CA  . LYS B 1 285 ? 55.047  37.280  58.928  1.00 16.56  ? 285 LYS B CA  1 
ATOM   4897  C  C   . LYS B 1 285 ? 53.594  36.801  58.815  1.00 15.19  ? 285 LYS B C   1 
ATOM   4898  O  O   . LYS B 1 285 ? 53.350  35.603  58.890  1.00 14.89  ? 285 LYS B O   1 
ATOM   4899  C  CB  . LYS B 1 285 ? 55.785  36.639  60.102  1.00 16.19  ? 285 LYS B CB  1 
ATOM   4900  C  CG  . LYS B 1 285 ? 57.294  36.923  60.036  1.00 19.86  ? 285 LYS B CG  1 
ATOM   4901  C  CD  . LYS B 1 285 ? 58.088  35.769  59.442  1.00 20.14  ? 285 LYS B CD  1 
ATOM   4902  C  CE  . LYS B 1 285 ? 58.967  36.216  58.304  1.00 23.40  ? 285 LYS B CE  1 
ATOM   4903  N  NZ  . LYS B 1 285 ? 60.307  36.660  58.767  1.00 26.40  ? 285 LYS B NZ  1 
ATOM   4904  N  N   . VAL B 1 286 ? 52.660  37.722  58.572  1.00 13.72  ? 286 VAL B N   1 
ATOM   4905  C  CA  . VAL B 1 286 ? 51.234  37.390  58.559  1.00 12.73  ? 286 VAL B CA  1 
ATOM   4906  C  C   . VAL B 1 286 ? 50.694  37.650  57.180  1.00 12.41  ? 286 VAL B C   1 
ATOM   4907  O  O   . VAL B 1 286 ? 50.982  38.686  56.609  1.00 12.28  ? 286 VAL B O   1 
ATOM   4908  C  CB  . VAL B 1 286 ? 50.445  38.192  59.612  1.00 12.06  ? 286 VAL B CB  1 
ATOM   4909  C  CG1 . VAL B 1 286 ? 48.974  37.843  59.573  1.00 12.25  ? 286 VAL B CG1 1 
ATOM   4910  C  CG2 . VAL B 1 286 ? 50.936  37.832  60.992  1.00 13.01  ? 286 VAL B CG2 1 
ATOM   4911  N  N   . ILE B 1 287 ? 49.917  36.713  56.644  1.00 12.89  ? 287 ILE B N   1 
ATOM   4912  C  CA  . ILE B 1 287 ? 49.570  36.701  55.193  1.00 13.59  ? 287 ILE B CA  1 
ATOM   4913  C  C   . ILE B 1 287 ? 48.076  36.487  55.029  1.00 14.39  ? 287 ILE B C   1 
ATOM   4914  O  O   . ILE B 1 287 ? 47.480  35.621  55.665  1.00 14.86  ? 287 ILE B O   1 
ATOM   4915  C  CB  . ILE B 1 287 ? 50.288  35.545  54.430  1.00 13.73  ? 287 ILE B CB  1 
ATOM   4916  C  CG1 . ILE B 1 287 ? 51.809  35.610  54.498  1.00 13.23  ? 287 ILE B CG1 1 
ATOM   4917  C  CG2 . ILE B 1 287 ? 49.942  35.504  52.954  1.00 13.28  ? 287 ILE B CG2 1 
ATOM   4918  C  CD1 . ILE B 1 287 ? 52.459  34.353  53.890  1.00 13.24  ? 287 ILE B CD1 1 
ATOM   4919  N  N   . LEU B 1 288 ? 47.454  37.319  54.201  1.00 15.30  ? 288 LEU B N   1 
ATOM   4920  C  CA  . LEU B 1 288 ? 46.033  37.239  53.942  1.00 14.69  ? 288 LEU B CA  1 
ATOM   4921  C  C   . LEU B 1 288 ? 45.749  35.873  53.317  1.00 14.95  ? 288 LEU B C   1 
ATOM   4922  O  O   . LEU B 1 288 ? 46.448  35.419  52.422  1.00 15.91  ? 288 LEU B O   1 
ATOM   4923  C  CB  . LEU B 1 288 ? 45.605  38.444  53.059  1.00 15.16  ? 288 LEU B CB  1 
ATOM   4924  C  CG  . LEU B 1 288 ? 44.285  38.438  52.260  1.00 15.52  ? 288 LEU B CG  1 
ATOM   4925  C  CD1 . LEU B 1 288 ? 43.065  38.196  53.147  1.00 16.66  ? 288 LEU B CD1 1 
ATOM   4926  C  CD2 . LEU B 1 288 ? 44.095  39.695  51.470  1.00 14.62  ? 288 LEU B CD2 1 
ATOM   4927  N  N   . GLY B 1 289 ? 44.771  35.189  53.859  1.00 15.54  ? 289 GLY B N   1 
ATOM   4928  C  CA  . GLY B 1 289 ? 44.383  33.883  53.390  1.00 16.99  ? 289 GLY B CA  1 
ATOM   4929  C  C   . GLY B 1 289 ? 42.915  33.747  53.739  1.00 18.39  ? 289 GLY B C   1 
ATOM   4930  O  O   . GLY B 1 289 ? 42.445  34.344  54.716  1.00 21.46  ? 289 GLY B O   1 
ATOM   4931  N  N   . THR B 1 290 ? 42.200  32.947  52.973  1.00 17.66  ? 290 THR B N   1 
ATOM   4932  C  CA  . THR B 1 290 ? 40.763  33.070  52.896  1.00 19.49  ? 290 THR B CA  1 
ATOM   4933  C  C   . THR B 1 290 ? 39.970  31.768  53.056  1.00 18.81  ? 290 THR B C   1 
ATOM   4934  O  O   . THR B 1 290 ? 38.765  31.822  53.332  1.00 18.82  ? 290 THR B O   1 
ATOM   4935  C  CB  . THR B 1 290 ? 40.436  33.716  51.535  1.00 21.30  ? 290 THR B CB  1 
ATOM   4936  O  OG1 . THR B 1 290 ? 40.711  35.131  51.610  1.00 25.36  ? 290 THR B OG1 1 
ATOM   4937  C  CG2 . THR B 1 290 ? 39.036  33.496  51.142  1.00 22.81  ? 290 THR B CG2 1 
ATOM   4938  N  N   . ASP B 1 291 ? 40.625  30.622  52.833  1.00 17.76  ? 291 ASP B N   1 
ATOM   4939  C  CA  . ASP B 1 291 ? 39.959  29.317  52.716  1.00 18.25  ? 291 ASP B CA  1 
ATOM   4940  C  C   . ASP B 1 291 ? 38.824  29.355  51.681  1.00 16.30  ? 291 ASP B C   1 
ATOM   4941  O  O   . ASP B 1 291 ? 37.835  28.650  51.808  1.00 17.89  ? 291 ASP B O   1 
ATOM   4942  C  CB  . ASP B 1 291 ? 39.472  28.774  54.089  1.00 20.12  ? 291 ASP B CB  1 
ATOM   4943  C  CG  . ASP B 1 291 ? 39.228  27.235  54.096  1.00 23.93  ? 291 ASP B CG  1 
ATOM   4944  O  OD1 . ASP B 1 291 ? 40.108  26.432  53.647  1.00 25.06  ? 291 ASP B OD1 1 
ATOM   4945  O  OD2 . ASP B 1 291 ? 38.140  26.806  54.590  1.00 27.09  ? 291 ASP B OD2 1 
ATOM   4946  N  N   . TYR B 1 292 ? 38.958  30.205  50.694  1.00 14.98  ? 292 TYR B N   1 
ATOM   4947  C  CA  . TYR B 1 292 ? 38.081  30.221  49.539  1.00 15.52  ? 292 TYR B CA  1 
ATOM   4948  C  C   . TYR B 1 292 ? 38.112  28.849  48.847  1.00 15.16  ? 292 TYR B C   1 
ATOM   4949  O  O   . TYR B 1 292 ? 39.185  28.257  48.628  1.00 15.59  ? 292 TYR B O   1 
ATOM   4950  C  CB  . TYR B 1 292 ? 38.549  31.308  48.556  1.00 15.61  ? 292 TYR B CB  1 
ATOM   4951  C  CG  . TYR B 1 292 ? 37.679  31.434  47.326  1.00 16.91  ? 292 TYR B CG  1 
ATOM   4952  C  CD1 . TYR B 1 292 ? 36.491  32.229  47.334  1.00 17.66  ? 292 TYR B CD1 1 
ATOM   4953  C  CD2 . TYR B 1 292 ? 37.975  30.692  46.174  1.00 17.07  ? 292 TYR B CD2 1 
ATOM   4954  C  CE1 . TYR B 1 292 ? 35.677  32.329  46.197  1.00 17.47  ? 292 TYR B CE1 1 
ATOM   4955  C  CE2 . TYR B 1 292 ? 37.166  30.755  45.048  1.00 17.97  ? 292 TYR B CE2 1 
ATOM   4956  C  CZ  . TYR B 1 292 ? 36.039  31.586  45.051  1.00 18.65  ? 292 TYR B CZ  1 
ATOM   4957  O  OH  . TYR B 1 292 ? 35.308  31.632  43.901  1.00 19.82  ? 292 TYR B OH  1 
ATOM   4958  N  N   . PRO B 1 293 ? 36.953  28.340  48.458  1.00 14.48  ? 293 PRO B N   1 
ATOM   4959  C  CA  . PRO B 1 293 ? 35.651  28.963  48.429  1.00 15.23  ? 293 PRO B CA  1 
ATOM   4960  C  C   . PRO B 1 293 ? 34.800  28.450  49.585  1.00 16.01  ? 293 PRO B C   1 
ATOM   4961  O  O   . PRO B 1 293 ? 33.584  28.481  49.496  1.00 17.14  ? 293 PRO B O   1 
ATOM   4962  C  CB  . PRO B 1 293 ? 35.056  28.403  47.119  1.00 14.15  ? 293 PRO B CB  1 
ATOM   4963  C  CG  . PRO B 1 293 ? 35.635  27.010  47.020  1.00 13.34  ? 293 PRO B CG  1 
ATOM   4964  C  CD  . PRO B 1 293 ? 36.916  26.992  47.849  1.00 14.16  ? 293 PRO B CD  1 
ATOM   4965  N  N   . PHE B 1 294 ? 35.419  27.929  50.621  1.00 15.68  ? 294 PHE B N   1 
ATOM   4966  C  CA  . PHE B 1 294 ? 34.627  27.354  51.681  1.00 17.55  ? 294 PHE B CA  1 
ATOM   4967  C  C   . PHE B 1 294 ? 34.025  28.384  52.644  1.00 17.92  ? 294 PHE B C   1 
ATOM   4968  O  O   . PHE B 1 294 ? 34.616  29.460  52.862  1.00 17.46  ? 294 PHE B O   1 
ATOM   4969  C  CB  . PHE B 1 294 ? 35.416  26.275  52.436  1.00 17.68  ? 294 PHE B CB  1 
ATOM   4970  C  CG  . PHE B 1 294 ? 35.949  25.207  51.545  1.00 19.21  ? 294 PHE B CG  1 
ATOM   4971  C  CD1 . PHE B 1 294 ? 37.197  24.650  51.781  1.00 19.79  ? 294 PHE B CD1 1 
ATOM   4972  C  CD2 . PHE B 1 294 ? 35.220  24.792  50.425  1.00 19.50  ? 294 PHE B CD2 1 
ATOM   4973  C  CE1 . PHE B 1 294 ? 37.698  23.670  50.949  1.00 20.66  ? 294 PHE B CE1 1 
ATOM   4974  C  CE2 . PHE B 1 294 ? 35.701  23.801  49.604  1.00 18.90  ? 294 PHE B CE2 1 
ATOM   4975  C  CZ  . PHE B 1 294 ? 36.943  23.236  49.867  1.00 20.32  ? 294 PHE B CZ  1 
ATOM   4976  N  N   . PRO B 1 295 ? 32.871  28.027  53.247  1.00 19.08  ? 295 PRO B N   1 
ATOM   4977  C  CA  . PRO B 1 295 ? 32.060  28.906  54.107  1.00 21.34  ? 295 PRO B CA  1 
ATOM   4978  C  C   . PRO B 1 295 ? 32.704  29.305  55.442  1.00 21.02  ? 295 PRO B C   1 
ATOM   4979  O  O   . PRO B 1 295 ? 32.363  30.350  55.983  1.00 21.89  ? 295 PRO B O   1 
ATOM   4980  C  CB  . PRO B 1 295 ? 30.801  28.054  54.372  1.00 22.60  ? 295 PRO B CB  1 
ATOM   4981  C  CG  . PRO B 1 295 ? 31.280  26.631  54.214  1.00 20.82  ? 295 PRO B CG  1 
ATOM   4982  C  CD  . PRO B 1 295 ? 32.202  26.720  53.050  1.00 19.13  ? 295 PRO B CD  1 
ATOM   4983  N  N   . LEU B 1 296 ? 33.628  28.497  55.946  1.00 20.67  ? 296 LEU B N   1 
ATOM   4984  C  CA  . LEU B 1 296 ? 34.302  28.814  57.183  1.00 21.59  ? 296 LEU B CA  1 
ATOM   4985  C  C   . LEU B 1 296 ? 35.380  29.868  57.013  1.00 23.49  ? 296 LEU B C   1 
ATOM   4986  O  O   . LEU B 1 296 ? 36.031  30.246  57.988  1.00 24.38  ? 296 LEU B O   1 
ATOM   4987  C  CB  . LEU B 1 296 ? 34.974  27.574  57.754  1.00 20.33  ? 296 LEU B CB  1 
ATOM   4988  C  CG  . LEU B 1 296 ? 34.893  27.330  59.267  1.00 21.37  ? 296 LEU B CG  1 
ATOM   4989  C  CD1 . LEU B 1 296 ? 36.067  26.441  59.662  1.00 22.38  ? 296 LEU B CD1 1 
ATOM   4990  C  CD2 . LEU B 1 296 ? 34.715  28.514  60.240  1.00 17.84  ? 296 LEU B CD2 1 
ATOM   4991  N  N   . GLY B 1 297 ? 35.613  30.307  55.782  1.00 24.72  ? 297 GLY B N   1 
ATOM   4992  C  CA  . GLY B 1 297 ? 36.693  31.256  55.507  1.00 25.28  ? 297 GLY B CA  1 
ATOM   4993  C  C   . GLY B 1 297 ? 36.126  32.638  55.499  1.00 26.44  ? 297 GLY B C   1 
ATOM   4994  O  O   . GLY B 1 297 ? 35.057  32.862  56.049  1.00 31.31  ? 297 GLY B O   1 
ATOM   4995  N  N   . GLU B 1 298 ? 36.835  33.563  54.873  1.00 27.56  ? 298 GLU B N   1 
ATOM   4996  C  CA  . GLU B 1 298 ? 36.500  34.978  54.938  1.00 28.63  ? 298 GLU B CA  1 
ATOM   4997  C  C   . GLU B 1 298 ? 35.741  35.376  53.689  1.00 29.94  ? 298 GLU B C   1 
ATOM   4998  O  O   . GLU B 1 298 ? 36.301  35.469  52.604  1.00 29.95  ? 298 GLU B O   1 
ATOM   4999  C  CB  . GLU B 1 298 ? 37.758  35.850  55.107  1.00 28.03  ? 298 GLU B CB  1 
ATOM   5000  C  CG  . GLU B 1 298 ? 37.490  37.358  55.102  1.00 30.49  ? 298 GLU B CG  1 
ATOM   5001  C  CD  . GLU B 1 298 ? 38.754  38.267  55.125  1.00 34.14  ? 298 GLU B CD  1 
ATOM   5002  O  OE1 . GLU B 1 298 ? 39.791  37.948  54.454  1.00 31.55  ? 298 GLU B OE1 1 
ATOM   5003  O  OE2 . GLU B 1 298 ? 38.686  39.349  55.788  1.00 29.71  ? 298 GLU B OE2 1 
ATOM   5004  N  N   . LEU B 1 299 ? 34.467  35.681  53.884  1.00 34.83  ? 299 LEU B N   1 
ATOM   5005  C  CA  . LEU B 1 299 ? 33.566  36.049  52.814  1.00 34.76  ? 299 LEU B CA  1 
ATOM   5006  C  C   . LEU B 1 299 ? 34.032  37.254  51.984  1.00 31.79  ? 299 LEU B C   1 
ATOM   5007  O  O   . LEU B 1 299 ? 33.839  37.244  50.766  1.00 28.80  ? 299 LEU B O   1 
ATOM   5008  C  CB  . LEU B 1 299 ? 32.164  36.276  53.388  1.00 41.03  ? 299 LEU B CB  1 
ATOM   5009  C  CG  . LEU B 1 299 ? 31.717  35.372  54.564  1.00 50.35  ? 299 LEU B CG  1 
ATOM   5010  C  CD1 . LEU B 1 299 ? 30.252  35.657  54.916  1.00 53.30  ? 299 LEU B CD1 1 
ATOM   5011  C  CD2 . LEU B 1 299 ? 31.937  33.861  54.344  1.00 49.93  ? 299 LEU B CD2 1 
ATOM   5012  N  N   . GLU B 1 300 ? 34.604  38.280  52.644  1.00 29.87  ? 300 GLU B N   1 
ATOM   5013  C  CA  . GLU B 1 300 ? 35.125  39.511  51.991  1.00 28.81  ? 300 GLU B CA  1 
ATOM   5014  C  C   . GLU B 1 300 ? 36.618  39.618  52.198  1.00 26.82  ? 300 GLU B C   1 
ATOM   5015  O  O   . GLU B 1 300 ? 37.073  40.161  53.208  1.00 24.71  ? 300 GLU B O   1 
ATOM   5016  C  CB  . GLU B 1 300 ? 34.521  40.801  52.564  1.00 34.76  ? 300 GLU B CB  1 
ATOM   5017  C  CG  . GLU B 1 300 ? 32.999  40.891  52.639  1.00 39.59  ? 300 GLU B CG  1 
ATOM   5018  C  CD  . GLU B 1 300 ? 32.353  40.924  51.277  1.00 43.23  ? 300 GLU B CD  1 
ATOM   5019  O  OE1 . GLU B 1 300 ? 33.085  41.004  50.257  1.00 50.50  ? 300 GLU B OE1 1 
ATOM   5020  O  OE2 . GLU B 1 300 ? 31.111  40.885  51.227  1.00 45.51  ? 300 GLU B OE2 1 
ATOM   5021  N  N   . PRO B 1 301 ? 37.402  39.102  51.245  1.00 25.56  ? 301 PRO B N   1 
ATOM   5022  C  CA  . PRO B 1 301 ? 38.844  39.058  51.440  1.00 24.00  ? 301 PRO B CA  1 
ATOM   5023  C  C   . PRO B 1 301 ? 39.396  40.439  51.793  1.00 24.74  ? 301 PRO B C   1 
ATOM   5024  O  O   . PRO B 1 301 ? 39.069  41.434  51.113  1.00 24.44  ? 301 PRO B O   1 
ATOM   5025  C  CB  . PRO B 1 301 ? 39.342  38.613  50.070  1.00 23.00  ? 301 PRO B CB  1 
ATOM   5026  C  CG  . PRO B 1 301 ? 38.267  37.728  49.579  1.00 22.61  ? 301 PRO B CG  1 
ATOM   5027  C  CD  . PRO B 1 301 ? 36.993  38.392  50.021  1.00 23.71  ? 301 PRO B CD  1 
ATOM   5028  N  N   . GLY B 1 302 ? 40.187  40.497  52.873  1.00 24.48  ? 302 GLY B N   1 
ATOM   5029  C  CA  . GLY B 1 302 ? 40.873  41.712  53.304  1.00 23.46  ? 302 GLY B CA  1 
ATOM   5030  C  C   . GLY B 1 302 ? 40.068  42.742  54.086  1.00 23.23  ? 302 GLY B C   1 
ATOM   5031  O  O   . GLY B 1 302 ? 40.560  43.805  54.422  1.00 25.37  ? 302 GLY B O   1 
ATOM   5032  N  N   . LYS B 1 303 ? 38.817  42.463  54.355  1.00 24.32  ? 303 LYS B N   1 
ATOM   5033  C  CA  . LYS B 1 303 ? 37.977  43.454  54.997  1.00 24.86  ? 303 LYS B CA  1 
ATOM   5034  C  C   . LYS B 1 303 ? 38.354  43.609  56.468  1.00 25.84  ? 303 LYS B C   1 
ATOM   5035  O  O   . LYS B 1 303 ? 38.210  44.681  57.069  1.00 28.79  ? 303 LYS B O   1 
ATOM   5036  C  CB  . LYS B 1 303 ? 36.543  43.005  54.869  1.00 27.27  ? 303 LYS B CB  1 
ATOM   5037  C  CG  . LYS B 1 303 ? 35.505  44.072  55.101  1.00 31.18  ? 303 LYS B CG  1 
ATOM   5038  C  CD  . LYS B 1 303 ? 34.862  43.837  56.450  1.00 36.93  ? 303 LYS B CD  1 
ATOM   5039  C  CE  . LYS B 1 303 ? 33.357  43.971  56.346  1.00 38.23  ? 303 LYS B CE  1 
ATOM   5040  N  NZ  . LYS B 1 303 ? 32.759  42.700  56.841  1.00 41.54  ? 303 LYS B NZ  1 
ATOM   5041  N  N   . LEU B 1 304 ? 38.817  42.525  57.063  1.00 23.82  ? 304 LEU B N   1 
ATOM   5042  C  CA  . LEU B 1 304 ? 39.207  42.564  58.445  1.00 23.24  ? 304 LEU B CA  1 
ATOM   5043  C  C   . LEU B 1 304 ? 40.519  43.339  58.511  1.00 21.85  ? 304 LEU B C   1 
ATOM   5044  O  O   . LEU B 1 304 ? 40.660  44.209  59.328  1.00 24.11  ? 304 LEU B O   1 
ATOM   5045  C  CB  . LEU B 1 304 ? 39.319  41.134  59.043  1.00 22.82  ? 304 LEU B CB  1 
ATOM   5046  C  CG  . LEU B 1 304 ? 39.838  41.023  60.493  1.00 22.61  ? 304 LEU B CG  1 
ATOM   5047  C  CD1 . LEU B 1 304 ? 38.852  41.668  61.462  1.00 22.12  ? 304 LEU B CD1 1 
ATOM   5048  C  CD2 . LEU B 1 304 ? 40.179  39.581  60.907  1.00 21.57  ? 304 LEU B CD2 1 
ATOM   5049  N  N   . ILE B 1 305 ? 41.458  43.064  57.621  1.00 21.87  ? 305 ILE B N   1 
ATOM   5050  C  CA  . ILE B 1 305 ? 42.697  43.813  57.615  1.00 22.92  ? 305 ILE B CA  1 
ATOM   5051  C  C   . ILE B 1 305 ? 42.440  45.295  57.376  1.00 24.02  ? 305 ILE B C   1 
ATOM   5052  O  O   . ILE B 1 305 ? 43.003  46.135  58.061  1.00 22.60  ? 305 ILE B O   1 
ATOM   5053  C  CB  . ILE B 1 305 ? 43.689  43.271  56.589  1.00 23.19  ? 305 ILE B CB  1 
ATOM   5054  C  CG1 . ILE B 1 305 ? 44.090  41.841  56.959  1.00 23.35  ? 305 ILE B CG1 1 
ATOM   5055  C  CG2 . ILE B 1 305 ? 44.924  44.159  56.501  1.00 22.35  ? 305 ILE B CG2 1 
ATOM   5056  C  CD1 . ILE B 1 305 ? 44.725  41.076  55.806  1.00 21.52  ? 305 ILE B CD1 1 
ATOM   5057  N  N   . GLU B 1 306 ? 41.536  45.603  56.450  1.00 27.38  ? 306 GLU B N   1 
ATOM   5058  C  CA  . GLU B 1 306 ? 41.260  46.977  56.072  1.00 29.80  ? 306 GLU B CA  1 
ATOM   5059  C  C   . GLU B 1 306 ? 40.471  47.731  57.111  1.00 28.07  ? 306 GLU B C   1 
ATOM   5060  O  O   . GLU B 1 306 ? 40.525  48.952  57.161  1.00 27.48  ? 306 GLU B O   1 
ATOM   5061  C  CB  . GLU B 1 306 ? 40.499  47.010  54.756  1.00 37.92  ? 306 GLU B CB  1 
ATOM   5062  C  CG  . GLU B 1 306 ? 40.903  48.170  53.854  1.00 45.30  ? 306 GLU B CG  1 
ATOM   5063  C  CD  . GLU B 1 306 ? 40.938  47.743  52.389  1.00 50.42  ? 306 GLU B CD  1 
ATOM   5064  O  OE1 . GLU B 1 306 ? 39.939  47.140  51.908  1.00 49.57  ? 306 GLU B OE1 1 
ATOM   5065  O  OE2 . GLU B 1 306 ? 41.973  47.992  51.726  1.00 52.60  ? 306 GLU B OE2 1 
ATOM   5066  N  N   . SER B 1 307 ? 39.704  47.027  57.930  1.00 25.88  ? 307 SER B N   1 
ATOM   5067  C  CA  . SER B 1 307 ? 38.987  47.729  59.016  1.00 26.42  ? 307 SER B CA  1 
ATOM   5068  C  C   . SER B 1 307 ? 39.851  48.102  60.242  1.00 24.40  ? 307 SER B C   1 
ATOM   5069  O  O   . SER B 1 307 ? 39.300  48.603  61.222  1.00 23.13  ? 307 SER B O   1 
ATOM   5070  C  CB  . SER B 1 307 ? 37.780  46.887  59.497  1.00 25.26  ? 307 SER B CB  1 
ATOM   5071  O  OG  . SER B 1 307 ? 38.201  45.721  60.213  1.00 20.94  ? 307 SER B OG  1 
ATOM   5072  N  N   . MET B 1 308 ? 41.156  47.799  60.216  1.00 23.97  ? 308 MET B N   1 
ATOM   5073  C  CA  . MET B 1 308 ? 41.994  47.906  61.427  1.00 25.82  ? 308 MET B CA  1 
ATOM   5074  C  C   . MET B 1 308 ? 42.688  49.222  61.507  1.00 24.36  ? 308 MET B C   1 
ATOM   5075  O  O   . MET B 1 308 ? 43.737  49.433  60.890  1.00 24.26  ? 308 MET B O   1 
ATOM   5076  C  CB  . MET B 1 308 ? 43.121  46.855  61.500  1.00 26.70  ? 308 MET B CB  1 
ATOM   5077  C  CG  . MET B 1 308 ? 42.698  45.429  61.303  1.00 27.69  ? 308 MET B CG  1 
ATOM   5078  S  SD  . MET B 1 308 ? 41.966  44.752  62.780  1.00 30.66  ? 308 MET B SD  1 
ATOM   5079  C  CE  . MET B 1 308 ? 43.335  44.596  63.940  1.00 24.33  ? 308 MET B CE  1 
ATOM   5080  N  N   . GLU B 1 309 ? 42.128  50.105  62.295  1.00 26.07  ? 309 GLU B N   1 
ATOM   5081  C  CA  . GLU B 1 309 ? 42.791  51.386  62.529  1.00 30.07  ? 309 GLU B CA  1 
ATOM   5082  C  C   . GLU B 1 309 ? 44.168  51.247  63.237  1.00 30.47  ? 309 GLU B C   1 
ATOM   5083  O  O   . GLU B 1 309 ? 45.023  52.107  63.095  1.00 32.40  ? 309 GLU B O   1 
ATOM   5084  C  CB  . GLU B 1 309 ? 41.835  52.363  63.224  1.00 31.07  ? 309 GLU B CB  1 
ATOM   5085  C  CG  . GLU B 1 309 ? 41.030  51.802  64.376  1.00 32.72  ? 309 GLU B CG  1 
ATOM   5086  C  CD  . GLU B 1 309 ? 39.731  51.104  63.971  1.00 39.02  ? 309 GLU B CD  1 
ATOM   5087  O  OE1 . GLU B 1 309 ? 38.661  51.772  63.887  1.00 36.75  ? 309 GLU B OE1 1 
ATOM   5088  O  OE2 . GLU B 1 309 ? 39.772  49.854  63.800  1.00 40.81  ? 309 GLU B OE2 1 
ATOM   5089  N  N   . GLU B 1 310 ? 44.377  50.147  63.962  1.00 31.40  ? 310 GLU B N   1 
ATOM   5090  C  CA  . GLU B 1 310 ? 45.647  49.845  64.615  1.00 34.02  ? 310 GLU B CA  1 
ATOM   5091  C  C   . GLU B 1 310 ? 46.817  49.774  63.629  1.00 33.30  ? 310 GLU B C   1 
ATOM   5092  O  O   . GLU B 1 310 ? 47.983  49.792  64.054  1.00 36.00  ? 310 GLU B O   1 
ATOM   5093  C  CB  . GLU B 1 310 ? 45.613  48.472  65.293  1.00 35.51  ? 310 GLU B CB  1 
ATOM   5094  C  CG  . GLU B 1 310 ? 44.556  48.260  66.343  1.00 44.07  ? 310 GLU B CG  1 
ATOM   5095  C  CD  . GLU B 1 310 ? 43.235  47.755  65.779  1.00 47.44  ? 310 GLU B CD  1 
ATOM   5096  O  OE1 . GLU B 1 310 ? 42.827  48.173  64.672  1.00 40.40  ? 310 GLU B OE1 1 
ATOM   5097  O  OE2 . GLU B 1 310 ? 42.596  46.935  66.477  1.00 56.50  ? 310 GLU B OE2 1 
ATOM   5098  N  N   . PHE B 1 311 ? 46.511  49.617  62.344  1.00 28.54  ? 311 PHE B N   1 
ATOM   5099  C  CA  . PHE B 1 311 ? 47.545  49.319  61.335  1.00 28.92  ? 311 PHE B CA  1 
ATOM   5100  C  C   . PHE B 1 311 ? 47.764  50.508  60.425  1.00 27.82  ? 311 PHE B C   1 
ATOM   5101  O  O   . PHE B 1 311 ? 46.806  51.044  59.885  1.00 26.31  ? 311 PHE B O   1 
ATOM   5102  C  CB  . PHE B 1 311 ? 47.146  48.135  60.427  1.00 26.47  ? 311 PHE B CB  1 
ATOM   5103  C  CG  . PHE B 1 311 ? 47.118  46.799  61.109  1.00 25.85  ? 311 PHE B CG  1 
ATOM   5104  C  CD1 . PHE B 1 311 ? 47.969  46.505  62.179  1.00 25.69  ? 311 PHE B CD1 1 
ATOM   5105  C  CD2 . PHE B 1 311 ? 46.271  45.795  60.633  1.00 24.35  ? 311 PHE B CD2 1 
ATOM   5106  C  CE1 . PHE B 1 311 ? 47.938  45.245  62.782  1.00 26.06  ? 311 PHE B CE1 1 
ATOM   5107  C  CE2 . PHE B 1 311 ? 46.233  44.555  61.244  1.00 23.19  ? 311 PHE B CE2 1 
ATOM   5108  C  CZ  . PHE B 1 311 ? 47.064  44.274  62.308  1.00 24.21  ? 311 PHE B CZ  1 
ATOM   5109  N  N   . ASP B 1 312 ? 49.012  50.907  60.229  1.00 29.67  ? 312 ASP B N   1 
ATOM   5110  C  CA  . ASP B 1 312 ? 49.260  51.976  59.269  1.00 35.34  ? 312 ASP B CA  1 
ATOM   5111  C  C   . ASP B 1 312 ? 49.108  51.451  57.836  1.00 35.14  ? 312 ASP B C   1 
ATOM   5112  O  O   . ASP B 1 312 ? 48.939  50.248  57.620  1.00 33.84  ? 312 ASP B O   1 
ATOM   5113  C  CB  . ASP B 1 312 ? 50.600  52.698  59.518  1.00 39.61  ? 312 ASP B CB  1 
ATOM   5114  C  CG  . ASP B 1 312 ? 51.797  51.773  59.475  1.00 46.12  ? 312 ASP B CG  1 
ATOM   5115  O  OD1 . ASP B 1 312 ? 51.874  50.919  58.569  1.00 49.56  ? 312 ASP B OD1 1 
ATOM   5116  O  OD2 . ASP B 1 312 ? 52.687  51.917  60.349  1.00 55.22  ? 312 ASP B OD2 1 
ATOM   5117  N  N   . GLU B 1 313 ? 49.148  52.342  56.858  1.00 36.21  ? 313 GLU B N   1 
ATOM   5118  C  CA  . GLU B 1 313 ? 48.886  51.917  55.509  1.00 37.61  ? 313 GLU B CA  1 
ATOM   5119  C  C   . GLU B 1 313 ? 49.931  50.903  55.045  1.00 32.40  ? 313 GLU B C   1 
ATOM   5120  O  O   . GLU B 1 313 ? 49.585  49.919  54.423  1.00 29.34  ? 313 GLU B O   1 
ATOM   5121  C  CB  . GLU B 1 313 ? 48.775  53.117  54.572  1.00 45.32  ? 313 GLU B CB  1 
ATOM   5122  C  CG  . GLU B 1 313 ? 47.569  53.041  53.643  1.00 55.04  ? 313 GLU B CG  1 
ATOM   5123  C  CD  . GLU B 1 313 ? 46.230  53.045  54.389  1.00 62.43  ? 313 GLU B CD  1 
ATOM   5124  O  OE1 . GLU B 1 313 ? 45.522  52.005  54.350  1.00 64.59  ? 313 GLU B OE1 1 
ATOM   5125  O  OE2 . GLU B 1 313 ? 45.878  54.082  55.012  1.00 65.01  ? 313 GLU B OE2 1 
ATOM   5126  N  N   . GLU B 1 314 ? 51.199  51.116  55.379  1.00 32.35  ? 314 GLU B N   1 
ATOM   5127  C  CA  . GLU B 1 314 ? 52.256  50.175  54.952  1.00 34.54  ? 314 GLU B CA  1 
ATOM   5128  C  C   . GLU B 1 314 ? 52.096  48.761  55.601  1.00 33.03  ? 314 GLU B C   1 
ATOM   5129  O  O   . GLU B 1 314 ? 52.454  47.722  55.008  1.00 35.02  ? 314 GLU B O   1 
ATOM   5130  C  CB  . GLU B 1 314 ? 53.654  50.809  55.123  1.00 40.45  ? 314 GLU B CB  1 
ATOM   5131  C  CG  . GLU B 1 314 ? 54.741  49.948  55.769  1.00 48.22  ? 314 GLU B CG  1 
ATOM   5132  C  CD  . GLU B 1 314 ? 55.702  50.750  56.654  1.00 57.55  ? 314 GLU B CD  1 
ATOM   5133  O  OE1 . GLU B 1 314 ? 55.252  51.499  57.574  1.00 61.91  ? 314 GLU B OE1 1 
ATOM   5134  O  OE2 . GLU B 1 314 ? 56.928  50.620  56.435  1.00 60.63  ? 314 GLU B OE2 1 
ATOM   5135  N  N   . THR B 1 315 ? 51.518  48.731  56.797  1.00 26.02  ? 315 THR B N   1 
ATOM   5136  C  CA  . THR B 1 315 ? 51.208  47.495  57.448  1.00 23.70  ? 315 THR B CA  1 
ATOM   5137  C  C   . THR B 1 315 ? 50.027  46.784  56.773  1.00 22.26  ? 315 THR B C   1 
ATOM   5138  O  O   . THR B 1 315 ? 50.042  45.555  56.593  1.00 19.21  ? 315 THR B O   1 
ATOM   5139  C  CB  . THR B 1 315 ? 51.018  47.712  58.955  1.00 24.40  ? 315 THR B CB  1 
ATOM   5140  O  OG1 . THR B 1 315 ? 52.283  48.100  59.507  1.00 25.29  ? 315 THR B OG1 1 
ATOM   5141  C  CG2 . THR B 1 315 ? 50.514  46.445  59.660  1.00 24.61  ? 315 THR B CG2 1 
ATOM   5142  N  N   . LYS B 1 316 ? 49.032  47.548  56.358  1.00 20.73  ? 316 LYS B N   1 
ATOM   5143  C  CA  . LYS B 1 316 ? 47.958  46.959  55.596  1.00 20.64  ? 316 LYS B CA  1 
ATOM   5144  C  C   . LYS B 1 316 ? 48.442  46.298  54.307  1.00 21.74  ? 316 LYS B C   1 
ATOM   5145  O  O   . LYS B 1 316 ? 47.871  45.284  53.937  1.00 21.52  ? 316 LYS B O   1 
ATOM   5146  C  CB  . LYS B 1 316 ? 46.858  47.959  55.319  1.00 21.22  ? 316 LYS B CB  1 
ATOM   5147  C  CG  . LYS B 1 316 ? 45.983  48.144  56.540  1.00 21.43  ? 316 LYS B CG  1 
ATOM   5148  C  CD  . LYS B 1 316 ? 44.758  48.987  56.268  1.00 21.56  ? 316 LYS B CD  1 
ATOM   5149  C  CE  . LYS B 1 316 ? 44.437  49.783  57.520  1.00 22.43  ? 316 LYS B CE  1 
ATOM   5150  N  NZ  . LYS B 1 316 ? 43.010  49.744  57.915  1.00 23.00  ? 316 LYS B NZ  1 
ATOM   5151  N  N   . ASN B 1 317 ? 49.512  46.815  53.672  1.00 22.27  ? 317 ASN B N   1 
ATOM   5152  C  CA  . ASN B 1 317 ? 49.970  46.298  52.363  1.00 22.15  ? 317 ASN B CA  1 
ATOM   5153  C  C   . ASN B 1 317 ? 50.842  45.067  52.512  1.00 21.34  ? 317 ASN B C   1 
ATOM   5154  O  O   . ASN B 1 317 ? 50.798  44.151  51.683  1.00 23.29  ? 317 ASN B O   1 
ATOM   5155  C  CB  . ASN B 1 317 ? 50.732  47.348  51.550  1.00 22.99  ? 317 ASN B CB  1 
ATOM   5156  C  CG  . ASN B 1 317 ? 49.884  48.555  51.193  1.00 26.56  ? 317 ASN B CG  1 
ATOM   5157  O  OD1 . ASN B 1 317 ? 48.690  48.445  50.898  1.00 29.00  ? 317 ASN B OD1 1 
ATOM   5158  N  ND2 . ASN B 1 317 ? 50.510  49.723  51.195  1.00 27.68  ? 317 ASN B ND2 1 
ATOM   5159  N  N   . LYS B 1 318 ? 51.656  45.045  53.550  1.00 20.27  ? 318 LYS B N   1 
ATOM   5160  C  CA  . LYS B 1 318 ? 52.375  43.830  53.872  1.00 20.95  ? 318 LYS B CA  1 
ATOM   5161  C  C   . LYS B 1 318 ? 51.387  42.658  54.077  1.00 19.02  ? 318 LYS B C   1 
ATOM   5162  O  O   . LYS B 1 318 ? 51.586  41.557  53.539  1.00 18.53  ? 318 LYS B O   1 
ATOM   5163  C  CB  . LYS B 1 318 ? 53.238  44.009  55.109  1.00 22.66  ? 318 LYS B CB  1 
ATOM   5164  C  CG  . LYS B 1 318 ? 54.518  44.822  54.950  1.00 25.41  ? 318 LYS B CG  1 
ATOM   5165  C  CD  . LYS B 1 318 ? 54.923  45.301  56.355  1.00 30.76  ? 318 LYS B CD  1 
ATOM   5166  C  CE  . LYS B 1 318 ? 56.415  45.261  56.640  1.00 31.83  ? 318 LYS B CE  1 
ATOM   5167  N  NZ  . LYS B 1 318 ? 57.230  46.124  55.727  1.00 35.39  ? 318 LYS B NZ  1 
ATOM   5168  N  N   . LEU B 1 319 ? 50.326  42.893  54.832  1.00 16.68  ? 319 LEU B N   1 
ATOM   5169  C  CA  . LEU B 1 319 ? 49.453  41.797  55.134  1.00 16.74  ? 319 LEU B CA  1 
ATOM   5170  C  C   . LEU B 1 319 ? 48.630  41.393  53.915  1.00 16.90  ? 319 LEU B C   1 
ATOM   5171  O  O   . LEU B 1 319 ? 48.312  40.212  53.756  1.00 15.89  ? 319 LEU B O   1 
ATOM   5172  C  CB  . LEU B 1 319 ? 48.537  42.072  56.315  1.00 15.82  ? 319 LEU B CB  1 
ATOM   5173  C  CG  . LEU B 1 319 ? 49.127  42.306  57.714  1.00 17.64  ? 319 LEU B CG  1 
ATOM   5174  C  CD1 . LEU B 1 319 ? 48.394  41.479  58.755  1.00 18.93  ? 319 LEU B CD1 1 
ATOM   5175  C  CD2 . LEU B 1 319 ? 50.606  42.013  57.812  1.00 16.39  ? 319 LEU B CD2 1 
ATOM   5176  N  N   . LYS B 1 320 ? 48.277  42.369  53.090  1.00 16.81  ? 320 LYS B N   1 
ATOM   5177  C  CA  . LYS B 1 320 ? 47.410  42.114  51.948  1.00 18.60  ? 320 LYS B CA  1 
ATOM   5178  C  C   . LYS B 1 320 ? 48.116  41.465  50.752  1.00 17.33  ? 320 LYS B C   1 
ATOM   5179  O  O   . LYS B 1 320 ? 47.474  40.805  49.954  1.00 16.99  ? 320 LYS B O   1 
ATOM   5180  C  CB  . LYS B 1 320 ? 46.651  43.381  51.526  1.00 19.80  ? 320 LYS B CB  1 
ATOM   5181  C  CG  . LYS B 1 320 ? 45.490  43.661  52.470  1.00 22.19  ? 320 LYS B CG  1 
ATOM   5182  C  CD  . LYS B 1 320 ? 44.669  44.891  52.081  1.00 25.16  ? 320 LYS B CD  1 
ATOM   5183  C  CE  . LYS B 1 320 ? 45.414  45.866  51.194  1.00 26.40  ? 320 LYS B CE  1 
ATOM   5184  N  NZ  . LYS B 1 320 ? 44.450  46.870  50.663  1.00 31.06  ? 320 LYS B NZ  1 
ATOM   5185  N  N   . ALA B 1 321 ? 49.427  41.656  50.651  1.00 17.06  ? 321 ALA B N   1 
ATOM   5186  C  CA  . ALA B 1 321 ? 50.176  41.249  49.458  1.00 16.81  ? 321 ALA B CA  1 
ATOM   5187  C  C   . ALA B 1 321 ? 51.656  41.085  49.725  1.00 15.85  ? 321 ALA B C   1 
ATOM   5188  O  O   . ALA B 1 321 ? 52.251  40.085  49.319  1.00 15.88  ? 321 ALA B O   1 
ATOM   5189  C  CB  . ALA B 1 321 ? 49.953  42.238  48.289  1.00 16.55  ? 321 ALA B CB  1 
ATOM   5190  N  N   . GLY B 1 322 ? 52.248  42.044  50.421  1.00 15.07  ? 322 GLY B N   1 
ATOM   5191  C  CA  . GLY B 1 322 ? 53.706  42.041  50.575  1.00 15.71  ? 322 GLY B CA  1 
ATOM   5192  C  C   . GLY B 1 322 ? 54.352  40.850  51.255  1.00 15.16  ? 322 GLY B C   1 
ATOM   5193  O  O   . GLY B 1 322 ? 55.389  40.318  50.807  1.00 14.61  ? 322 GLY B O   1 
ATOM   5194  N  N   . ASN B 1 323 ? 53.781  40.442  52.374  1.00 15.90  ? 323 ASN B N   1 
ATOM   5195  C  CA  . ASN B 1 323 ? 54.308  39.249  53.028  1.00 15.55  ? 323 ASN B CA  1 
ATOM   5196  C  C   . ASN B 1 323 ? 54.071  37.985  52.206  1.00 15.22  ? 323 ASN B C   1 
ATOM   5197  O  O   . ASN B 1 323 ? 54.842  37.062  52.307  1.00 15.00  ? 323 ASN B O   1 
ATOM   5198  C  CB  . ASN B 1 323 ? 53.637  39.046  54.362  1.00 16.69  ? 323 ASN B CB  1 
ATOM   5199  C  CG  . ASN B 1 323 ? 53.969  40.128  55.371  1.00 17.16  ? 323 ASN B CG  1 
ATOM   5200  O  OD1 . ASN B 1 323 ? 54.941  40.875  55.223  1.00 16.48  ? 323 ASN B OD1 1 
ATOM   5201  N  ND2 . ASN B 1 323 ? 53.163  40.186  56.431  1.00 16.56  ? 323 ASN B ND2 1 
ATOM   5202  N  N   . ALA B 1 324 ? 52.983  37.930  51.429  1.00 15.30  ? 324 ALA B N   1 
ATOM   5203  C  CA  . ALA B 1 324 ? 52.730  36.760  50.568  1.00 15.54  ? 324 ALA B CA  1 
ATOM   5204  C  C   . ALA B 1 324 ? 53.824  36.621  49.497  1.00 16.81  ? 324 ALA B C   1 
ATOM   5205  O  O   . ALA B 1 324 ? 54.342  35.521  49.321  1.00 16.98  ? 324 ALA B O   1 
ATOM   5206  C  CB  . ALA B 1 324 ? 51.334  36.804  49.945  1.00 14.68  ? 324 ALA B CB  1 
ATOM   5207  N  N   . LEU B 1 325 ? 54.218  37.731  48.841  1.00 17.08  ? 325 LEU B N   1 
ATOM   5208  C  CA  . LEU B 1 325 ? 55.332  37.682  47.857  1.00 18.23  ? 325 LEU B CA  1 
ATOM   5209  C  C   . LEU B 1 325 ? 56.693  37.294  48.468  1.00 18.61  ? 325 LEU B C   1 
ATOM   5210  O  O   . LEU B 1 325 ? 57.480  36.606  47.805  1.00 19.64  ? 325 LEU B O   1 
ATOM   5211  C  CB  . LEU B 1 325 ? 55.455  38.962  47.038  1.00 18.05  ? 325 LEU B CB  1 
ATOM   5212  C  CG  . LEU B 1 325 ? 54.163  39.277  46.274  1.00 19.63  ? 325 LEU B CG  1 
ATOM   5213  C  CD1 . LEU B 1 325 ? 54.041  40.780  46.011  1.00 19.35  ? 325 LEU B CD1 1 
ATOM   5214  C  CD2 . LEU B 1 325 ? 54.020  38.488  44.975  1.00 18.54  ? 325 LEU B CD2 1 
ATOM   5215  N  N   . ALA B 1 326 ? 56.953  37.693  49.718  1.00 17.06  ? 326 ALA B N   1 
ATOM   5216  C  CA  . ALA B 1 326 ? 58.175  37.250  50.399  1.00 16.26  ? 326 ALA B CA  1 
ATOM   5217  C  C   . ALA B 1 326 ? 58.169  35.748  50.751  1.00 15.47  ? 326 ALA B C   1 
ATOM   5218  O  O   . ALA B 1 326 ? 59.153  35.059  50.557  1.00 15.47  ? 326 ALA B O   1 
ATOM   5219  C  CB  . ALA B 1 326 ? 58.435  38.096  51.643  1.00 16.51  ? 326 ALA B CB  1 
ATOM   5220  N  N   . PHE B 1 327 ? 57.056  35.238  51.252  1.00 14.96  ? 327 PHE B N   1 
ATOM   5221  C  CA  . PHE B 1 327 ? 56.912  33.801  51.501  1.00 15.56  ? 327 PHE B CA  1 
ATOM   5222  C  C   . PHE B 1 327 ? 57.110  32.920  50.257  1.00 16.58  ? 327 PHE B C   1 
ATOM   5223  O  O   . PHE B 1 327 ? 57.782  31.933  50.336  1.00 17.19  ? 327 PHE B O   1 
ATOM   5224  C  CB  . PHE B 1 327 ? 55.555  33.523  52.133  1.00 14.59  ? 327 PHE B CB  1 
ATOM   5225  C  CG  . PHE B 1 327 ? 55.195  32.059  52.237  1.00 13.88  ? 327 PHE B CG  1 
ATOM   5226  C  CD1 . PHE B 1 327 ? 55.886  31.207  53.115  1.00 14.08  ? 327 PHE B CD1 1 
ATOM   5227  C  CD2 . PHE B 1 327 ? 54.114  31.567  51.558  1.00 12.71  ? 327 PHE B CD2 1 
ATOM   5228  C  CE1 . PHE B 1 327 ? 55.545  29.866  53.230  1.00 13.21  ? 327 PHE B CE1 1 
ATOM   5229  C  CE2 . PHE B 1 327 ? 53.736  30.238  51.696  1.00 13.00  ? 327 PHE B CE2 1 
ATOM   5230  C  CZ  . PHE B 1 327 ? 54.463  29.384  52.514  1.00 13.36  ? 327 PHE B CZ  1 
ATOM   5231  N  N   . LEU B 1 328 ? 56.522  33.292  49.122  1.00 18.78  ? 328 LEU B N   1 
ATOM   5232  C  CA  . LEU B 1 328 ? 56.681  32.534  47.899  1.00 21.01  ? 328 LEU B CA  1 
ATOM   5233  C  C   . LEU B 1 328 ? 57.975  32.820  47.122  1.00 24.26  ? 328 LEU B C   1 
ATOM   5234  O  O   . LEU B 1 328 ? 58.370  32.024  46.243  1.00 27.05  ? 328 LEU B O   1 
ATOM   5235  C  CB  . LEU B 1 328 ? 55.491  32.770  46.997  1.00 20.18  ? 328 LEU B CB  1 
ATOM   5236  C  CG  . LEU B 1 328 ? 54.181  32.518  47.718  1.00 20.07  ? 328 LEU B CG  1 
ATOM   5237  C  CD1 . LEU B 1 328 ? 53.041  33.039  46.869  1.00 20.30  ? 328 LEU B CD1 1 
ATOM   5238  C  CD2 . LEU B 1 328 ? 54.016  31.038  48.028  1.00 19.33  ? 328 LEU B CD2 1 
ATOM   5239  N  N   . GLY B 1 329 ? 58.639  33.933  47.419  1.00 23.41  ? 329 GLY B N   1 
ATOM   5240  C  CA  . GLY B 1 329 ? 59.861  34.276  46.676  1.00 22.48  ? 329 GLY B CA  1 
ATOM   5241  C  C   . GLY B 1 329 ? 59.528  34.787  45.286  1.00 22.85  ? 329 GLY B C   1 
ATOM   5242  O  O   . GLY B 1 329 ? 60.276  34.549  44.329  1.00 22.69  ? 329 GLY B O   1 
ATOM   5243  N  N   . LEU B 1 330 ? 58.393  35.479  45.166  1.00 23.93  ? 330 LEU B N   1 
ATOM   5244  C  CA  . LEU B 1 330 ? 57.911  35.999  43.870  1.00 24.87  ? 330 LEU B CA  1 
ATOM   5245  C  C   . LEU B 1 330 ? 57.960  37.535  43.789  1.00 25.09  ? 330 LEU B C   1 
ATOM   5246  O  O   . LEU B 1 330 ? 58.073  38.185  44.833  1.00 22.82  ? 330 LEU B O   1 
ATOM   5247  C  CB  . LEU B 1 330 ? 56.477  35.547  43.659  1.00 24.63  ? 330 LEU B CB  1 
ATOM   5248  C  CG  . LEU B 1 330 ? 56.283  34.050  43.487  1.00 25.50  ? 330 LEU B CG  1 
ATOM   5249  C  CD1 . LEU B 1 330 ? 54.799  33.732  43.605  1.00 24.32  ? 330 LEU B CD1 1 
ATOM   5250  C  CD2 . LEU B 1 330 ? 56.821  33.536  42.152  1.00 25.52  ? 330 LEU B CD2 1 
ATOM   5251  N  N   . GLU B 1 331 ? 57.847  38.074  42.555  1.00 29.22  ? 331 GLU B N   1 
ATOM   5252  C  CA  . GLU B 1 331 ? 57.897  39.519  42.219  1.00 33.57  ? 331 GLU B CA  1 
ATOM   5253  C  C   . GLU B 1 331 ? 56.536  40.120  41.840  1.00 36.22  ? 331 GLU B C   1 
ATOM   5254  O  O   . GLU B 1 331 ? 55.747  39.495  41.126  1.00 35.80  ? 331 GLU B O   1 
ATOM   5255  C  CB  . GLU B 1 331 ? 58.834  39.763  41.025  1.00 40.08  ? 331 GLU B CB  1 
ATOM   5256  C  CG  . GLU B 1 331 ? 60.113  38.944  40.990  1.00 49.28  ? 331 GLU B CG  1 
ATOM   5257  C  CD  . GLU B 1 331 ? 61.241  39.565  41.799  1.00 55.01  ? 331 GLU B CD  1 
ATOM   5258  O  OE1 . GLU B 1 331 ? 62.348  39.749  41.225  1.00 60.09  ? 331 GLU B OE1 1 
ATOM   5259  O  OE2 . GLU B 1 331 ? 61.023  39.865  42.998  1.00 53.77  ? 331 GLU B OE2 1 
ATOM   5260  N  N   . ARG B 1 332 ? 56.276  41.362  42.251  1.00 38.42  ? 332 ARG B N   1 
ATOM   5261  C  CA  . ARG B 1 332 ? 54.956  41.997  42.019  1.00 42.14  ? 332 ARG B CA  1 
ATOM   5262  C  C   . ARG B 1 332 ? 54.518  42.108  40.538  1.00 39.34  ? 332 ARG B C   1 
ATOM   5263  O  O   . ARG B 1 332 ? 55.319  41.915  39.615  1.00 42.35  ? 332 ARG B O   1 
ATOM   5264  C  CB  . ARG B 1 332 ? 54.843  43.358  42.746  1.00 46.02  ? 332 ARG B CB  1 
ATOM   5265  C  CG  . ARG B 1 332 ? 55.603  43.454  44.072  1.00 56.74  ? 332 ARG B CG  1 
ATOM   5266  C  CD  . ARG B 1 332 ? 57.085  43.808  43.853  1.00 66.73  ? 332 ARG B CD  1 
ATOM   5267  N  NE  . ARG B 1 332 ? 58.046  43.023  44.649  1.00 62.69  ? 332 ARG B NE  1 
ATOM   5268  C  CZ  . ARG B 1 332 ? 59.306  42.780  44.277  1.00 64.08  ? 332 ARG B CZ  1 
ATOM   5269  N  NH1 . ARG B 1 332 ? 59.770  43.243  43.120  1.00 58.72  ? 332 ARG B NH1 1 
ATOM   5270  N  NH2 . ARG B 1 332 ? 60.103  42.063  45.062  1.00 66.89  ? 332 ARG B NH2 1 
ATOM   5271  N  N   . MET C 1 1   ? 49.917  39.331  94.591  1.00 44.25  ? 1   MET C N   1 
ATOM   5272  C  CA  . MET C 1 1   ? 49.295  39.451  95.942  1.00 50.19  ? 1   MET C CA  1 
ATOM   5273  C  C   . MET C 1 1   ? 48.180  38.391  96.196  1.00 46.90  ? 1   MET C C   1 
ATOM   5274  O  O   . MET C 1 1   ? 48.479  37.300  96.686  1.00 59.03  ? 1   MET C O   1 
ATOM   5275  C  CB  . MET C 1 1   ? 48.837  40.931  96.282  1.00 56.38  ? 1   MET C CB  1 
ATOM   5276  C  CG  . MET C 1 1   ? 48.941  41.409  97.766  1.00 54.16  ? 1   MET C CG  1 
ATOM   5277  S  SD  . MET C 1 1   ? 47.576  42.370  98.580  1.00 59.32  ? 1   MET C SD  1 
ATOM   5278  C  CE  . MET C 1 1   ? 47.992  44.125  98.397  1.00 54.89  ? 1   MET C CE  1 
ATOM   5279  N  N   . LYS C 1 2   ? 46.934  38.666  95.816  1.00 36.02  ? 2   LYS C N   1 
ATOM   5280  C  CA  . LYS C 1 2   ? 45.793  38.400  96.736  1.00 30.12  ? 2   LYS C CA  1 
ATOM   5281  C  C   . LYS C 1 2   ? 45.092  37.019  96.871  1.00 27.66  ? 2   LYS C C   1 
ATOM   5282  O  O   . LYS C 1 2   ? 45.431  36.257  97.777  1.00 27.15  ? 2   LYS C O   1 
ATOM   5283  C  CB  . LYS C 1 2   ? 44.754  39.493  96.546  1.00 27.72  ? 2   LYS C CB  1 
ATOM   5284  C  CG  . LYS C 1 2   ? 44.977  40.677  97.407  1.00 25.65  ? 2   LYS C CG  1 
ATOM   5285  C  CD  . LYS C 1 2   ? 44.159  40.601  98.699  1.00 25.17  ? 2   LYS C CD  1 
ATOM   5286  C  CE  . LYS C 1 2   ? 44.001  42.025  99.162  1.00 23.24  ? 2   LYS C CE  1 
ATOM   5287  N  NZ  . LYS C 1 2   ? 45.303  42.726  98.879  1.00 20.60  ? 2   LYS C NZ  1 
ATOM   5288  N  N   . ILE C 1 3   ? 44.087  36.722  96.027  1.00 23.51  ? 3   ILE C N   1 
ATOM   5289  C  CA  . ILE C 1 3   ? 43.381  35.432  96.090  1.00 21.20  ? 3   ILE C CA  1 
ATOM   5290  C  C   . ILE C 1 3   ? 43.852  34.509  94.957  1.00 20.06  ? 3   ILE C C   1 
ATOM   5291  O  O   . ILE C 1 3   ? 43.968  34.939  93.829  1.00 21.79  ? 3   ILE C O   1 
ATOM   5292  C  CB  . ILE C 1 3   ? 41.845  35.626  96.043  1.00 19.68  ? 3   ILE C CB  1 
ATOM   5293  C  CG1 . ILE C 1 3   ? 41.374  36.414  97.246  1.00 19.90  ? 3   ILE C CG1 1 
ATOM   5294  C  CG2 . ILE C 1 3   ? 41.111  34.317  96.118  1.00 19.65  ? 3   ILE C CG2 1 
ATOM   5295  C  CD1 . ILE C 1 3   ? 39.939  36.845  97.133  1.00 20.45  ? 3   ILE C CD1 1 
ATOM   5296  N  N   . ASP C 1 4   ? 44.135  33.251  95.247  1.00 18.84  ? 4   ASP C N   1 
ATOM   5297  C  CA  . ASP C 1 4   ? 44.503  32.305  94.189  1.00 19.08  ? 4   ASP C CA  1 
ATOM   5298  C  C   . ASP C 1 4   ? 43.457  31.209  94.056  1.00 19.19  ? 4   ASP C C   1 
ATOM   5299  O  O   . ASP C 1 4   ? 43.352  30.322  94.916  1.00 17.81  ? 4   ASP C O   1 
ATOM   5300  C  CB  . ASP C 1 4   ? 45.911  31.748  94.433  1.00 20.30  ? 4   ASP C CB  1 
ATOM   5301  C  CG  . ASP C 1 4   ? 46.377  30.707  93.382  1.00 22.79  ? 4   ASP C CG  1 
ATOM   5302  O  OD1 . ASP C 1 4   ? 45.755  30.467  92.278  1.00 20.24  ? 4   ASP C OD1 1 
ATOM   5303  O  OD2 . ASP C 1 4   ? 47.449  30.112  93.706  1.00 25.52  ? 4   ASP C OD2 1 
ATOM   5304  N  N   . ILE C 1 5   ? 42.697  31.283  92.964  1.00 18.41  ? 5   ILE C N   1 
ATOM   5305  C  CA  . ILE C 1 5   ? 41.565  30.385  92.740  1.00 18.08  ? 5   ILE C CA  1 
ATOM   5306  C  C   . ILE C 1 5   ? 41.944  28.969  92.310  1.00 17.24  ? 5   ILE C C   1 
ATOM   5307  O  O   . ILE C 1 5   ? 41.077  28.092  92.255  1.00 17.95  ? 5   ILE C O   1 
ATOM   5308  C  CB  . ILE C 1 5   ? 40.540  31.005  91.729  1.00 19.19  ? 5   ILE C CB  1 
ATOM   5309  C  CG1 . ILE C 1 5   ? 39.132  30.417  91.901  1.00 20.30  ? 5   ILE C CG1 1 
ATOM   5310  C  CG2 . ILE C 1 5   ? 41.011  30.870  90.284  1.00 18.24  ? 5   ILE C CG2 1 
ATOM   5311  C  CD1 . ILE C 1 5   ? 38.361  31.064  93.035  1.00 20.95  ? 5   ILE C CD1 1 
ATOM   5312  N  N   . HIS C 1 6   ? 43.207  28.729  91.979  1.00 15.97  ? 6   HIS C N   1 
ATOM   5313  C  CA  . HIS C 1 6   ? 43.556  27.496  91.270  1.00 15.30  ? 6   HIS C CA  1 
ATOM   5314  C  C   . HIS C 1 6   ? 44.715  26.952  91.976  1.00 15.39  ? 6   HIS C C   1 
ATOM   5315  O  O   . HIS C 1 6   ? 45.846  27.322  91.676  1.00 16.52  ? 6   HIS C O   1 
ATOM   5316  C  CB  . HIS C 1 6   ? 43.894  27.800  89.794  1.00 15.39  ? 6   HIS C CB  1 
ATOM   5317  C  CG  . HIS C 1 6   ? 44.301  26.586  88.938  1.00 15.53  ? 6   HIS C CG  1 
ATOM   5318  N  ND1 . HIS C 1 6   ? 44.382  26.648  87.591  1.00 15.87  ? 6   HIS C ND1 1 
ATOM   5319  C  CD2 . HIS C 1 6   ? 44.630  25.274  89.275  1.00 15.74  ? 6   HIS C CD2 1 
ATOM   5320  C  CE1 . HIS C 1 6   ? 44.748  25.456  87.106  1.00 15.19  ? 6   HIS C CE1 1 
ATOM   5321  N  NE2 . HIS C 1 6   ? 44.889  24.614  88.132  1.00 14.31  ? 6   HIS C NE2 1 
ATOM   5322  N  N   . SER C 1 7   ? 44.479  26.118  92.977  1.00 15.82  ? 7   SER C N   1 
ATOM   5323  C  CA  . SER C 1 7   ? 45.603  25.454  93.591  1.00 16.98  ? 7   SER C CA  1 
ATOM   5324  C  C   . SER C 1 7   ? 45.207  24.133  94.142  1.00 17.49  ? 7   SER C C   1 
ATOM   5325  O  O   . SER C 1 7   ? 44.056  23.925  94.515  1.00 20.11  ? 7   SER C O   1 
ATOM   5326  C  CB  . SER C 1 7   ? 46.280  26.305  94.647  1.00 17.71  ? 7   SER C CB  1 
ATOM   5327  O  OG  . SER C 1 7   ? 45.454  26.415  95.757  1.00 20.37  ? 7   SER C OG  1 
ATOM   5328  N  N   . HIS C 1 8   ? 46.170  23.229  94.192  1.00 16.99  ? 8   HIS C N   1 
ATOM   5329  C  CA  . HIS C 1 8   ? 45.854  21.839  94.451  1.00 16.13  ? 8   HIS C CA  1 
ATOM   5330  C  C   . HIS C 1 8   ? 46.525  21.384  95.683  1.00 15.68  ? 8   HIS C C   1 
ATOM   5331  O  O   . HIS C 1 8   ? 47.668  21.742  95.922  1.00 15.36  ? 8   HIS C O   1 
ATOM   5332  C  CB  . HIS C 1 8   ? 46.283  21.029  93.271  1.00 14.97  ? 8   HIS C CB  1 
ATOM   5333  C  CG  . HIS C 1 8   ? 45.570  21.423  91.993  1.00 15.85  ? 8   HIS C CG  1 
ATOM   5334  N  ND1 . HIS C 1 8   ? 44.248  21.162  91.780  1.00 16.04  ? 8   HIS C ND1 1 
ATOM   5335  C  CD2 . HIS C 1 8   ? 46.027  22.050  90.853  1.00 15.15  ? 8   HIS C CD2 1 
ATOM   5336  C  CE1 . HIS C 1 8   ? 43.906  21.595  90.558  1.00 15.13  ? 8   HIS C CE1 1 
ATOM   5337  N  NE2 . HIS C 1 8   ? 44.986  22.155  90.002  1.00 15.66  ? 8   HIS C NE2 1 
ATOM   5338  N  N   . ILE C 1 9   ? 45.808  20.611  96.493  1.00 15.69  ? 9   ILE C N   1 
ATOM   5339  C  CA  . ILE C 1 9   ? 46.390  19.989  97.675  1.00 15.61  ? 9   ILE C CA  1 
ATOM   5340  C  C   . ILE C 1 9   ? 45.993  18.511  97.717  1.00 17.29  ? 9   ILE C C   1 
ATOM   5341  O  O   . ILE C 1 9   ? 44.984  18.129  97.093  1.00 18.52  ? 9   ILE C O   1 
ATOM   5342  C  CB  . ILE C 1 9   ? 45.898  20.726  98.919  1.00 15.26  ? 9   ILE C CB  1 
ATOM   5343  C  CG1 . ILE C 1 9   ? 46.926  20.620  100.091 1.00 15.29  ? 9   ILE C CG1 1 
ATOM   5344  C  CG2 . ILE C 1 9   ? 44.453  20.338  99.248  1.00 15.26  ? 9   ILE C CG2 1 
ATOM   5345  C  CD1 . ILE C 1 9   ? 46.395  21.051  101.433 1.00 13.35  ? 9   ILE C CD1 1 
ATOM   5346  N  N   . LEU C 1 10  ? 46.788  17.682  98.392  1.00 18.36  ? 10  LEU C N   1 
ATOM   5347  C  CA  . LEU C 1 10  ? 46.444  16.273  98.691  1.00 19.83  ? 10  LEU C CA  1 
ATOM   5348  C  C   . LEU C 1 10  ? 46.419  15.990  100.195 1.00 20.49  ? 10  LEU C C   1 
ATOM   5349  O  O   . LEU C 1 10  ? 46.984  16.768  100.973 1.00 22.01  ? 10  LEU C O   1 
ATOM   5350  C  CB  . LEU C 1 10  ? 47.459  15.327  98.049  1.00 20.28  ? 10  LEU C CB  1 
ATOM   5351  C  CG  . LEU C 1 10  ? 47.492  15.178  96.519  1.00 21.54  ? 10  LEU C CG  1 
ATOM   5352  C  CD1 . LEU C 1 10  ? 48.840  14.637  96.046  1.00 20.91  ? 10  LEU C CD1 1 
ATOM   5353  C  CD2 . LEU C 1 10  ? 46.357  14.303  95.982  1.00 21.03  ? 10  LEU C CD2 1 
ATOM   5354  N  N   . PRO C 1 11  ? 45.790  14.866  100.626 1.00 20.68  ? 11  PRO C N   1 
ATOM   5355  C  CA  . PRO C 1 11  ? 45.957  14.516  102.045 1.00 20.95  ? 11  PRO C CA  1 
ATOM   5356  C  C   . PRO C 1 11  ? 47.346  13.976  102.218 1.00 22.65  ? 11  PRO C C   1 
ATOM   5357  O  O   . PRO C 1 11  ? 47.921  13.539  101.252 1.00 22.13  ? 11  PRO C O   1 
ATOM   5358  C  CB  . PRO C 1 11  ? 44.926  13.393  102.271 1.00 19.85  ? 11  PRO C CB  1 
ATOM   5359  C  CG  . PRO C 1 11  ? 44.001  13.449  101.101 1.00 18.71  ? 11  PRO C CG  1 
ATOM   5360  C  CD  . PRO C 1 11  ? 44.765  14.040  99.962  1.00 19.62  ? 11  PRO C CD  1 
ATOM   5361  N  N   . LYS C 1 12  ? 47.900  13.988  103.424 1.00 28.22  ? 12  LYS C N   1 
ATOM   5362  C  CA  . LYS C 1 12  ? 49.266  13.438  103.624 1.00 31.93  ? 12  LYS C CA  1 
ATOM   5363  C  C   . LYS C 1 12  ? 49.359  11.906  103.354 1.00 31.69  ? 12  LYS C C   1 
ATOM   5364  O  O   . LYS C 1 12  ? 50.354  11.406  102.803 1.00 32.51  ? 12  LYS C O   1 
ATOM   5365  C  CB  . LYS C 1 12  ? 49.836  13.846  104.992 1.00 35.23  ? 12  LYS C CB  1 
ATOM   5366  C  CG  . LYS C 1 12  ? 48.843  13.782  106.148 1.00 42.09  ? 12  LYS C CG  1 
ATOM   5367  C  CD  . LYS C 1 12  ? 47.695  14.796  106.052 1.00 43.77  ? 12  LYS C CD  1 
ATOM   5368  C  CE  . LYS C 1 12  ? 46.422  14.305  106.784 1.00 48.88  ? 12  LYS C CE  1 
ATOM   5369  N  NZ  . LYS C 1 12  ? 46.322  14.478  108.286 1.00 41.60  ? 12  LYS C NZ  1 
ATOM   5370  N  N   . GLU C 1 13  ? 48.293  11.185  103.682 1.00 30.22  ? 13  GLU C N   1 
ATOM   5371  C  CA  . GLU C 1 13  ? 48.226  9.745   103.487 1.00 31.16  ? 13  GLU C CA  1 
ATOM   5372  C  C   . GLU C 1 13  ? 46.763  9.399   103.317 1.00 28.61  ? 13  GLU C C   1 
ATOM   5373  O  O   . GLU C 1 13  ? 45.908  10.081  103.876 1.00 28.22  ? 13  GLU C O   1 
ATOM   5374  C  CB  . GLU C 1 13  ? 48.841  8.994   104.700 1.00 36.88  ? 13  GLU C CB  1 
ATOM   5375  C  CG  . GLU C 1 13  ? 50.349  8.645   104.559 1.00 42.93  ? 13  GLU C CG  1 
ATOM   5376  C  CD  . GLU C 1 13  ? 51.212  8.956   105.815 1.00 51.13  ? 13  GLU C CD  1 
ATOM   5377  O  OE1 . GLU C 1 13  ? 50.634  9.226   106.900 1.00 52.72  ? 13  GLU C OE1 1 
ATOM   5378  O  OE2 . GLU C 1 13  ? 52.480  8.938   105.729 1.00 47.74  ? 13  GLU C OE2 1 
ATOM   5379  N  N   . TRP C 1 14  ? 46.471  8.387   102.503 1.00 26.17  ? 14  TRP C N   1 
ATOM   5380  C  CA  . TRP C 1 14  ? 45.149  7.794   102.447 1.00 26.17  ? 14  TRP C CA  1 
ATOM   5381  C  C   . TRP C 1 14  ? 45.305  6.295   102.321 1.00 26.70  ? 14  TRP C C   1 
ATOM   5382  O  O   . TRP C 1 14  ? 46.404  5.815   102.072 1.00 28.28  ? 14  TRP C O   1 
ATOM   5383  C  CB  . TRP C 1 14  ? 44.271  8.425   101.336 1.00 26.31  ? 14  TRP C CB  1 
ATOM   5384  C  CG  . TRP C 1 14  ? 44.858  8.415   99.947  1.00 25.41  ? 14  TRP C CG  1 
ATOM   5385  C  CD1 . TRP C 1 14  ? 44.707  7.430   98.970  1.00 26.56  ? 14  TRP C CD1 1 
ATOM   5386  C  CD2 . TRP C 1 14  ? 45.719  9.440   99.320  1.00 25.25  ? 14  TRP C CD2 1 
ATOM   5387  N  NE1 . TRP C 1 14  ? 45.387  7.757   97.821  1.00 24.72  ? 14  TRP C NE1 1 
ATOM   5388  C  CE2 . TRP C 1 14  ? 46.031  8.945   97.969  1.00 26.02  ? 14  TRP C CE2 1 
ATOM   5389  C  CE3 . TRP C 1 14  ? 46.251  10.658  99.728  1.00 24.11  ? 14  TRP C CE3 1 
ATOM   5390  C  CZ2 . TRP C 1 14  ? 46.834  9.669   97.085  1.00 25.11  ? 14  TRP C CZ2 1 
ATOM   5391  C  CZ3 . TRP C 1 14  ? 47.067  11.366  98.838  1.00 23.31  ? 14  TRP C CZ3 1 
ATOM   5392  C  CH2 . TRP C 1 14  ? 47.342  10.885  97.547  1.00 24.58  ? 14  TRP C CH2 1 
ATOM   5393  N  N   . PRO C 1 15  ? 44.219  5.524   102.503 1.00 26.13  ? 15  PRO C N   1 
ATOM   5394  C  CA  . PRO C 1 15  ? 44.301  4.049   102.433 1.00 27.19  ? 15  PRO C CA  1 
ATOM   5395  C  C   . PRO C 1 15  ? 44.708  3.490   101.086 1.00 28.79  ? 15  PRO C C   1 
ATOM   5396  O  O   . PRO C 1 15  ? 44.751  4.224   100.089 1.00 30.41  ? 15  PRO C O   1 
ATOM   5397  C  CB  . PRO C 1 15  ? 42.871  3.617   102.767 1.00 27.50  ? 15  PRO C CB  1 
ATOM   5398  C  CG  . PRO C 1 15  ? 42.384  4.718   103.687 1.00 27.15  ? 15  PRO C CG  1 
ATOM   5399  C  CD  . PRO C 1 15  ? 42.908  5.965   103.012 1.00 26.30  ? 15  PRO C CD  1 
ATOM   5400  N  N   . ASP C 1 16  ? 45.032  2.202   101.056 1.00 31.09  ? 16  ASP C N   1 
ATOM   5401  C  CA  . ASP C 1 16  ? 45.331  1.512   99.795  1.00 34.05  ? 16  ASP C CA  1 
ATOM   5402  C  C   . ASP C 1 16  ? 44.041  1.229   99.028  1.00 33.40  ? 16  ASP C C   1 
ATOM   5403  O  O   . ASP C 1 16  ? 43.168  0.467   99.495  1.00 31.91  ? 16  ASP C O   1 
ATOM   5404  C  CB  . ASP C 1 16  ? 46.123  0.214   99.992  1.00 37.28  ? 16  ASP C CB  1 
ATOM   5405  C  CG  . ASP C 1 16  ? 46.635  -0.353  98.656  1.00 43.35  ? 16  ASP C CG  1 
ATOM   5406  O  OD1 . ASP C 1 16  ? 45.827  -0.951  97.895  1.00 44.25  ? 16  ASP C OD1 1 
ATOM   5407  O  OD2 . ASP C 1 16  ? 47.839  -0.170  98.349  1.00 43.66  ? 16  ASP C OD2 1 
ATOM   5408  N  N   . LEU C 1 17  ? 43.926  1.845   97.854  1.00 30.40  ? 17  LEU C N   1 
ATOM   5409  C  CA  . LEU C 1 17  ? 42.598  1.997   97.258  1.00 29.43  ? 17  LEU C CA  1 
ATOM   5410  C  C   . LEU C 1 17  ? 42.160  0.749   96.507  1.00 27.69  ? 17  LEU C C   1 
ATOM   5411  O  O   . LEU C 1 17  ? 40.989  0.376   96.556  1.00 27.62  ? 17  LEU C O   1 
ATOM   5412  C  CB  . LEU C 1 17  ? 42.493  3.284   96.433  1.00 25.62  ? 17  LEU C CB  1 
ATOM   5413  C  CG  . LEU C 1 17  ? 42.528  4.626   97.181  1.00 24.61  ? 17  LEU C CG  1 
ATOM   5414  C  CD1 . LEU C 1 17  ? 42.273  5.727   96.163  1.00 22.21  ? 17  LEU C CD1 1 
ATOM   5415  C  CD2 . LEU C 1 17  ? 41.541  4.764   98.367  1.00 24.28  ? 17  LEU C CD2 1 
ATOM   5416  N  N   . LYS C 1 18  ? 43.117  0.114   95.845  1.00 30.00  ? 18  LYS C N   1 
ATOM   5417  C  CA  . LYS C 1 18  ? 42.987  -1.243  95.302  1.00 34.12  ? 18  LYS C CA  1 
ATOM   5418  C  C   . LYS C 1 18  ? 42.345  -2.184  96.353  1.00 36.77  ? 18  LYS C C   1 
ATOM   5419  O  O   . LYS C 1 18  ? 41.222  -2.692  96.165  1.00 34.62  ? 18  LYS C O   1 
ATOM   5420  C  CB  . LYS C 1 18  ? 44.381  -1.740  94.886  1.00 35.96  ? 18  LYS C CB  1 
ATOM   5421  C  CG  . LYS C 1 18  ? 44.425  -2.928  93.943  1.00 37.86  ? 18  LYS C CG  1 
ATOM   5422  C  CD  . LYS C 1 18  ? 45.854  -3.137  93.475  1.00 40.62  ? 18  LYS C CD  1 
ATOM   5423  C  CE  . LYS C 1 18  ? 45.929  -3.624  92.035  1.00 45.21  ? 18  LYS C CE  1 
ATOM   5424  N  NZ  . LYS C 1 18  ? 45.564  -5.073  91.912  1.00 47.32  ? 18  LYS C NZ  1 
ATOM   5425  N  N   . LYS C 1 19  ? 43.040  -2.363  97.472  1.00 37.14  ? 19  LYS C N   1 
ATOM   5426  C  CA  . LYS C 1 19  ? 42.520  -3.145  98.592  1.00 40.62  ? 19  LYS C CA  1 
ATOM   5427  C  C   . LYS C 1 19  ? 41.141  -2.680  99.076  1.00 39.19  ? 19  LYS C C   1 
ATOM   5428  O  O   . LYS C 1 19  ? 40.240  -3.510  99.231  1.00 42.06  ? 19  LYS C O   1 
ATOM   5429  C  CB  . LYS C 1 19  ? 43.532  -3.200  99.756  1.00 43.41  ? 19  LYS C CB  1 
ATOM   5430  C  CG  . LYS C 1 19  ? 44.662  -4.193  99.510  1.00 49.51  ? 19  LYS C CG  1 
ATOM   5431  C  CD  . LYS C 1 19  ? 45.785  -4.082  100.530 1.00 51.37  ? 19  LYS C CD  1 
ATOM   5432  C  CE  . LYS C 1 19  ? 46.902  -5.049  100.190 1.00 53.12  ? 19  LYS C CE  1 
ATOM   5433  N  NZ  . LYS C 1 19  ? 48.054  -4.904  101.118 1.00 57.78  ? 19  LYS C NZ  1 
ATOM   5434  N  N   . ARG C 1 20  ? 40.969  -1.375  99.299  1.00 34.63  ? 20  ARG C N   1 
ATOM   5435  C  CA  . ARG C 1 20  ? 39.675  -0.861  99.782  1.00 35.95  ? 20  ARG C CA  1 
ATOM   5436  C  C   . ARG C 1 20  ? 38.504  -1.081  98.770  1.00 35.20  ? 20  ARG C C   1 
ATOM   5437  O  O   . ARG C 1 20  ? 37.338  -1.092  99.174  1.00 38.27  ? 20  ARG C O   1 
ATOM   5438  C  CB  . ARG C 1 20  ? 39.788  0.618   100.277 1.00 33.66  ? 20  ARG C CB  1 
ATOM   5439  C  CG  . ARG C 1 20  ? 38.460  1.331   100.621 1.00 34.06  ? 20  ARG C CG  1 
ATOM   5440  C  CD  . ARG C 1 20  ? 38.587  2.862   100.749 1.00 32.85  ? 20  ARG C CD  1 
ATOM   5441  N  NE  . ARG C 1 20  ? 38.954  3.243   102.121 1.00 35.70  ? 20  ARG C NE  1 
ATOM   5442  C  CZ  . ARG C 1 20  ? 38.316  4.119   102.903 1.00 34.92  ? 20  ARG C CZ  1 
ATOM   5443  N  NH1 . ARG C 1 20  ? 37.267  4.815   102.486 1.00 28.77  ? 20  ARG C NH1 1 
ATOM   5444  N  NH2 . ARG C 1 20  ? 38.767  4.321   104.133 1.00 40.80  ? 20  ARG C NH2 1 
ATOM   5445  N  N   . PHE C 1 21  ? 38.813  -1.270  97.488  1.00 31.92  ? 21  PHE C N   1 
ATOM   5446  C  CA  . PHE C 1 21  ? 37.766  -1.277  96.453  1.00 32.61  ? 21  PHE C CA  1 
ATOM   5447  C  C   . PHE C 1 21  ? 37.749  -2.525  95.551  1.00 35.99  ? 21  PHE C C   1 
ATOM   5448  O  O   . PHE C 1 21  ? 36.736  -2.816  94.921  1.00 37.25  ? 21  PHE C O   1 
ATOM   5449  C  CB  . PHE C 1 21  ? 37.813  0.015   95.583  1.00 29.02  ? 21  PHE C CB  1 
ATOM   5450  C  CG  . PHE C 1 21  ? 37.446  1.284   96.326  1.00 26.05  ? 21  PHE C CG  1 
ATOM   5451  C  CD1 . PHE C 1 21  ? 38.229  2.423   96.201  1.00 24.71  ? 21  PHE C CD1 1 
ATOM   5452  C  CD2 . PHE C 1 21  ? 36.355  1.324   97.186  1.00 26.30  ? 21  PHE C CD2 1 
ATOM   5453  C  CE1 . PHE C 1 21  ? 37.921  3.576   96.887  1.00 22.53  ? 21  PHE C CE1 1 
ATOM   5454  C  CE2 . PHE C 1 21  ? 36.043  2.482   97.885  1.00 25.51  ? 21  PHE C CE2 1 
ATOM   5455  C  CZ  . PHE C 1 21  ? 36.825  3.610   97.721  1.00 24.64  ? 21  PHE C CZ  1 
ATOM   5456  N  N   . GLY C 1 22  ? 38.873  -3.233  95.466  1.00 37.03  ? 22  GLY C N   1 
ATOM   5457  C  CA  . GLY C 1 22  ? 38.955  -4.465  94.709  1.00 34.50  ? 22  GLY C CA  1 
ATOM   5458  C  C   . GLY C 1 22  ? 39.537  -4.383  93.303  1.00 36.21  ? 22  GLY C C   1 
ATOM   5459  O  O   . GLY C 1 22  ? 39.620  -5.403  92.602  1.00 35.21  ? 22  GLY C O   1 
ATOM   5460  N  N   . TYR C 1 23  ? 39.926  -3.194  92.853  1.00 34.86  ? 23  TYR C N   1 
ATOM   5461  C  CA  . TYR C 1 23  ? 40.494  -3.083  91.495  1.00 31.08  ? 23  TYR C CA  1 
ATOM   5462  C  C   . TYR C 1 23  ? 41.538  -1.986  91.358  1.00 30.67  ? 23  TYR C C   1 
ATOM   5463  O  O   . TYR C 1 23  ? 41.633  -1.098  92.202  1.00 29.58  ? 23  TYR C O   1 
ATOM   5464  C  CB  . TYR C 1 23  ? 39.394  -2.953  90.453  1.00 28.60  ? 23  TYR C CB  1 
ATOM   5465  C  CG  . TYR C 1 23  ? 38.417  -1.876  90.770  1.00 27.20  ? 23  TYR C CG  1 
ATOM   5466  C  CD1 . TYR C 1 23  ? 38.559  -0.629  90.204  1.00 27.32  ? 23  TYR C CD1 1 
ATOM   5467  C  CD2 . TYR C 1 23  ? 37.363  -2.091  91.635  1.00 26.62  ? 23  TYR C CD2 1 
ATOM   5468  C  CE1 . TYR C 1 23  ? 37.685  0.386   90.476  1.00 25.46  ? 23  TYR C CE1 1 
ATOM   5469  C  CE2 . TYR C 1 23  ? 36.475  -1.076  91.918  1.00 27.31  ? 23  TYR C CE2 1 
ATOM   5470  C  CZ  . TYR C 1 23  ? 36.653  0.169   91.325  1.00 27.33  ? 23  TYR C CZ  1 
ATOM   5471  O  OH  . TYR C 1 23  ? 35.799  1.227   91.562  1.00 28.54  ? 23  TYR C OH  1 
ATOM   5472  N  N   . GLY C 1 24  ? 42.339  -2.064  90.299  1.00 30.73  ? 24  GLY C N   1 
ATOM   5473  C  CA  . GLY C 1 24  ? 43.544  -1.247  90.189  1.00 28.09  ? 24  GLY C CA  1 
ATOM   5474  C  C   . GLY C 1 24  ? 43.290  0.068   89.493  1.00 28.49  ? 24  GLY C C   1 
ATOM   5475  O  O   . GLY C 1 24  ? 42.141  0.411   89.172  1.00 25.21  ? 24  GLY C O   1 
ATOM   5476  N  N   . GLY C 1 25  ? 44.365  0.816   89.269  1.00 28.20  ? 25  GLY C N   1 
ATOM   5477  C  CA  . GLY C 1 25  ? 44.235  2.081   88.553  1.00 28.08  ? 25  GLY C CA  1 
ATOM   5478  C  C   . GLY C 1 25  ? 44.195  3.345   89.410  1.00 28.38  ? 25  GLY C C   1 
ATOM   5479  O  O   . GLY C 1 25  ? 44.135  4.436   88.849  1.00 28.99  ? 25  GLY C O   1 
ATOM   5480  N  N   . TRP C 1 26  ? 44.209  3.211   90.746  1.00 24.78  ? 26  TRP C N   1 
ATOM   5481  C  CA  . TRP C 1 26  ? 44.151  4.373   91.660  1.00 23.73  ? 26  TRP C CA  1 
ATOM   5482  C  C   . TRP C 1 26  ? 45.489  5.003   91.957  1.00 23.79  ? 26  TRP C C   1 
ATOM   5483  O  O   . TRP C 1 26  ? 46.516  4.377   91.755  1.00 24.37  ? 26  TRP C O   1 
ATOM   5484  C  CB  . TRP C 1 26  ? 43.557  3.983   92.991  1.00 21.33  ? 26  TRP C CB  1 
ATOM   5485  C  CG  . TRP C 1 26  ? 42.263  3.260   92.865  1.00 19.81  ? 26  TRP C CG  1 
ATOM   5486  C  CD1 . TRP C 1 26  ? 42.074  1.902   92.755  1.00 19.13  ? 26  TRP C CD1 1 
ATOM   5487  C  CD2 . TRP C 1 26  ? 40.932  3.833   92.862  1.00 19.40  ? 26  TRP C CD2 1 
ATOM   5488  N  NE1 . TRP C 1 26  ? 40.753  1.600   92.663  1.00 19.17  ? 26  TRP C NE1 1 
ATOM   5489  C  CE2 . TRP C 1 26  ? 40.010  2.708   92.716  1.00 19.11  ? 26  TRP C CE2 1 
ATOM   5490  C  CE3 . TRP C 1 26  ? 40.421  5.122   92.924  1.00 18.31  ? 26  TRP C CE3 1 
ATOM   5491  C  CZ2 . TRP C 1 26  ? 38.647  2.882   92.680  1.00 18.34  ? 26  TRP C CZ2 1 
ATOM   5492  C  CZ3 . TRP C 1 26  ? 39.045  5.277   92.872  1.00 17.80  ? 26  TRP C CZ3 1 
ATOM   5493  C  CH2 . TRP C 1 26  ? 38.185  4.187   92.772  1.00 18.04  ? 26  TRP C CH2 1 
ATOM   5494  N  N   . VAL C 1 27  ? 45.496  6.240   92.466  1.00 22.33  ? 27  VAL C N   1 
ATOM   5495  C  CA  . VAL C 1 27  ? 46.769  6.845   92.820  1.00 23.12  ? 27  VAL C CA  1 
ATOM   5496  C  C   . VAL C 1 27  ? 47.090  6.794   94.311  1.00 22.53  ? 27  VAL C C   1 
ATOM   5497  O  O   . VAL C 1 27  ? 46.194  6.872   95.136  1.00 22.28  ? 27  VAL C O   1 
ATOM   5498  C  CB  . VAL C 1 27  ? 46.983  8.253   92.204  1.00 24.83  ? 27  VAL C CB  1 
ATOM   5499  C  CG1 . VAL C 1 27  ? 45.768  8.736   91.425  1.00 23.08  ? 27  VAL C CG1 1 
ATOM   5500  C  CG2 . VAL C 1 27  ? 47.446  9.254   93.249  1.00 25.23  ? 27  VAL C CG2 1 
ATOM   5501  N  N   . GLN C 1 28  ? 48.370  6.608   94.627  1.00 21.65  ? 28  GLN C N   1 
ATOM   5502  C  CA  . GLN C 1 28  ? 48.827  6.602   96.010  1.00 20.60  ? 28  GLN C CA  1 
ATOM   5503  C  C   . GLN C 1 28  ? 49.950  7.598   96.187  1.00 20.53  ? 28  GLN C C   1 
ATOM   5504  O  O   . GLN C 1 28  ? 50.739  7.804   95.293  1.00 20.61  ? 28  GLN C O   1 
ATOM   5505  C  CB  . GLN C 1 28  ? 49.389  5.220   96.434  1.00 21.01  ? 28  GLN C CB  1 
ATOM   5506  C  CG  . GLN C 1 28  ? 48.573  3.974   96.160  1.00 19.34  ? 28  GLN C CG  1 
ATOM   5507  C  CD  . GLN C 1 28  ? 47.293  3.969   96.934  1.00 21.61  ? 28  GLN C CD  1 
ATOM   5508  O  OE1 . GLN C 1 28  ? 46.266  3.515   96.438  1.00 25.20  ? 28  GLN C OE1 1 
ATOM   5509  N  NE2 . GLN C 1 28  ? 47.320  4.517   98.147  1.00 21.10  ? 28  GLN C NE2 1 
ATOM   5510  N  N   . LEU C 1 29  ? 50.027  8.181   97.375  1.00 23.27  ? 29  LEU C N   1 
ATOM   5511  C  CA  . LEU C 1 29  ? 51.129  9.010   97.784  1.00 25.63  ? 29  LEU C CA  1 
ATOM   5512  C  C   . LEU C 1 29  ? 52.119  8.198   98.638  1.00 28.95  ? 29  LEU C C   1 
ATOM   5513  O  O   . LEU C 1 29  ? 51.734  7.610   99.636  1.00 28.75  ? 29  LEU C O   1 
ATOM   5514  C  CB  . LEU C 1 29  ? 50.589  10.203  98.594  1.00 24.96  ? 29  LEU C CB  1 
ATOM   5515  C  CG  . LEU C 1 29  ? 51.580  11.342  98.883  1.00 24.49  ? 29  LEU C CG  1 
ATOM   5516  C  CD1 . LEU C 1 29  ? 52.291  11.784  97.612  1.00 24.50  ? 29  LEU C CD1 1 
ATOM   5517  C  CD2 . LEU C 1 29  ? 50.888  12.515  99.555  1.00 22.90  ? 29  LEU C CD2 1 
ATOM   5518  N  N   . GLN C 1 30  ? 53.384  8.179   98.220  1.00 34.22  ? 30  GLN C N   1 
ATOM   5519  C  CA  . GLN C 1 30  ? 54.485  7.517   98.921  1.00 38.60  ? 30  GLN C CA  1 
ATOM   5520  C  C   . GLN C 1 30  ? 55.611  8.463   99.359  1.00 38.91  ? 30  GLN C C   1 
ATOM   5521  O  O   . GLN C 1 30  ? 56.403  8.888   98.533  1.00 36.77  ? 30  GLN C O   1 
ATOM   5522  C  CB  . GLN C 1 30  ? 55.112  6.506   97.977  1.00 40.78  ? 30  GLN C CB  1 
ATOM   5523  C  CG  . GLN C 1 30  ? 55.004  5.070   98.422  1.00 46.76  ? 30  GLN C CG  1 
ATOM   5524  C  CD  . GLN C 1 30  ? 56.256  4.305   98.089  1.00 47.72  ? 30  GLN C CD  1 
ATOM   5525  O  OE1 . GLN C 1 30  ? 56.527  3.981   96.927  1.00 46.58  ? 30  GLN C OE1 1 
ATOM   5526  N  NE2 . GLN C 1 30  ? 57.043  4.024   99.111  1.00 50.43  ? 30  GLN C NE2 1 
ATOM   5527  N  N   . HIS C 1 31  ? 55.720  8.762   100.647 1.00 43.07  ? 31  HIS C N   1 
ATOM   5528  C  CA  . HIS C 1 31  ? 56.819  9.610   101.141 1.00 45.54  ? 31  HIS C CA  1 
ATOM   5529  C  C   . HIS C 1 31  ? 58.133  8.886   101.086 1.00 50.08  ? 31  HIS C C   1 
ATOM   5530  O  O   . HIS C 1 31  ? 58.359  7.945   101.831 1.00 49.91  ? 31  HIS C O   1 
ATOM   5531  C  CB  . HIS C 1 31  ? 56.515  10.068  102.535 1.00 43.73  ? 31  HIS C CB  1 
ATOM   5532  C  CG  . HIS C 1 31  ? 55.194  10.781  102.653 1.00 46.03  ? 31  HIS C CG  1 
ATOM   5533  N  ND1 . HIS C 1 31  ? 54.963  11.970  102.073 1.00 46.20  ? 31  HIS C ND1 1 
ATOM   5534  C  CD2 . HIS C 1 31  ? 54.011  10.425  103.305 1.00 47.35  ? 31  HIS C CD2 1 
ATOM   5535  C  CE1 . HIS C 1 31  ? 53.707  12.371  102.354 1.00 47.98  ? 31  HIS C CE1 1 
ATOM   5536  N  NE2 . HIS C 1 31  ? 53.124  11.422  103.106 1.00 47.23  ? 31  HIS C NE2 1 
ATOM   5537  N  N   . HIS C 1 32  ? 59.008  9.316   100.186 1.00 60.09  ? 32  HIS C N   1 
ATOM   5538  C  CA  . HIS C 1 32  ? 60.186  8.526   99.839  1.00 74.70  ? 32  HIS C CA  1 
ATOM   5539  C  C   . HIS C 1 32  ? 61.464  9.176   100.288 1.00 81.41  ? 32  HIS C C   1 
ATOM   5540  O  O   . HIS C 1 32  ? 62.536  8.559   100.260 1.00 87.44  ? 32  HIS C O   1 
ATOM   5541  C  CB  . HIS C 1 32  ? 60.226  8.268   98.335  1.00 80.04  ? 32  HIS C CB  1 
ATOM   5542  C  CG  . HIS C 1 32  ? 60.843  9.394   97.546  1.00 92.39  ? 32  HIS C CG  1 
ATOM   5543  N  ND1 . HIS C 1 32  ? 62.153  9.423   97.231  1.00 96.75  ? 32  HIS C ND1 1 
ATOM   5544  C  CD2 . HIS C 1 32  ? 60.283  10.561  97.018  1.00 101.80 ? 32  HIS C CD2 1 
ATOM   5545  C  CE1 . HIS C 1 32  ? 62.421  10.545  96.529  1.00 103.24 ? 32  HIS C CE1 1 
ATOM   5546  N  NE2 . HIS C 1 32  ? 61.274  11.239  96.397  1.00 106.73 ? 32  HIS C NE2 1 
ATOM   5547  N  N   . SER C 1 33  ? 61.355  10.433  100.703 1.00 79.04  ? 33  SER C N   1 
ATOM   5548  C  CA  . SER C 1 33  ? 62.507  11.241  101.087 1.00 76.70  ? 33  SER C CA  1 
ATOM   5549  C  C   . SER C 1 33  ? 62.055  12.143  102.220 1.00 75.10  ? 33  SER C C   1 
ATOM   5550  O  O   . SER C 1 33  ? 60.936  11.993  102.731 1.00 68.73  ? 33  SER C O   1 
ATOM   5551  C  CB  . SER C 1 33  ? 63.022  12.053  99.871  1.00 76.04  ? 33  SER C CB  1 
ATOM   5552  O  OG  . SER C 1 33  ? 63.707  13.248  100.231 1.00 69.59  ? 33  SER C OG  1 
ATOM   5553  N  N   . LYS C 1 34  ? 62.937  13.062  102.607 1.00 75.28  ? 34  LYS C N   1 
ATOM   5554  C  CA  . LYS C 1 34  ? 62.646  14.083  103.605 1.00 72.67  ? 34  LYS C CA  1 
ATOM   5555  C  C   . LYS C 1 34  ? 61.993  15.317  102.957 1.00 70.39  ? 34  LYS C C   1 
ATOM   5556  O  O   . LYS C 1 34  ? 62.670  16.163  102.356 1.00 64.21  ? 34  LYS C O   1 
ATOM   5557  C  CB  . LYS C 1 34  ? 63.928  14.431  104.371 1.00 74.09  ? 34  LYS C CB  1 
ATOM   5558  C  CG  . LYS C 1 34  ? 64.316  13.385  105.416 1.00 72.15  ? 34  LYS C CG  1 
ATOM   5559  C  CD  . LYS C 1 34  ? 63.501  13.596  106.688 1.00 71.26  ? 34  LYS C CD  1 
ATOM   5560  C  CE  . LYS C 1 34  ? 63.500  12.376  107.587 1.00 68.80  ? 34  LYS C CE  1 
ATOM   5561  N  NZ  . LYS C 1 34  ? 62.810  12.701  108.864 1.00 67.40  ? 34  LYS C NZ  1 
ATOM   5562  N  N   . GLY C 1 35  ? 60.664  15.384  103.059 1.00 69.41  ? 35  GLY C N   1 
ATOM   5563  C  CA  . GLY C 1 35  ? 59.863  16.407  102.375 1.00 61.50  ? 35  GLY C CA  1 
ATOM   5564  C  C   . GLY C 1 35  ? 59.448  16.100  100.931 1.00 57.76  ? 35  GLY C C   1 
ATOM   5565  O  O   . GLY C 1 35  ? 58.712  16.871  100.316 1.00 58.73  ? 35  GLY C O   1 
ATOM   5566  N  N   . GLU C 1 36  ? 59.921  14.990  100.374 1.00 54.64  ? 36  GLU C N   1 
ATOM   5567  C  CA  . GLU C 1 36  ? 59.597  14.651  98.986  1.00 52.45  ? 36  GLU C CA  1 
ATOM   5568  C  C   . GLU C 1 36  ? 58.796  13.366  98.858  1.00 51.35  ? 36  GLU C C   1 
ATOM   5569  O  O   . GLU C 1 36  ? 58.961  12.420  99.645  1.00 55.45  ? 36  GLU C O   1 
ATOM   5570  C  CB  . GLU C 1 36  ? 60.851  14.563  98.138  1.00 52.96  ? 36  GLU C CB  1 
ATOM   5571  C  CG  . GLU C 1 36  ? 61.403  15.919  97.767  1.00 57.88  ? 36  GLU C CG  1 
ATOM   5572  C  CD  . GLU C 1 36  ? 62.270  15.863  96.531  1.00 60.14  ? 36  GLU C CD  1 
ATOM   5573  O  OE1 . GLU C 1 36  ? 62.889  16.902  96.203  1.00 63.15  ? 36  GLU C OE1 1 
ATOM   5574  O  OE2 . GLU C 1 36  ? 62.321  14.786  95.892  1.00 57.80  ? 36  GLU C OE2 1 
ATOM   5575  N  N   . ALA C 1 37  ? 57.926  13.319  97.863  1.00 42.40  ? 37  ALA C N   1 
ATOM   5576  C  CA  . ALA C 1 37  ? 57.061  12.180  97.753  1.00 37.35  ? 37  ALA C CA  1 
ATOM   5577  C  C   . ALA C 1 37  ? 56.735  11.906  96.308  1.00 35.74  ? 37  ALA C C   1 
ATOM   5578  O  O   . ALA C 1 37  ? 56.780  12.787  95.468  1.00 34.08  ? 37  ALA C O   1 
ATOM   5579  C  CB  . ALA C 1 37  ? 55.802  12.412  98.562  1.00 33.46  ? 37  ALA C CB  1 
ATOM   5580  N  N   . LYS C 1 38  ? 56.378  10.667  96.035  1.00 35.86  ? 38  LYS C N   1 
ATOM   5581  C  CA  . LYS C 1 38  ? 56.039  10.263  94.703  1.00 35.56  ? 38  LYS C CA  1 
ATOM   5582  C  C   . LYS C 1 38  ? 54.561  9.896   94.632  1.00 33.44  ? 38  LYS C C   1 
ATOM   5583  O  O   . LYS C 1 38  ? 54.028  9.302   95.574  1.00 31.11  ? 38  LYS C O   1 
ATOM   5584  C  CB  . LYS C 1 38  ? 56.946  9.117   94.297  1.00 38.97  ? 38  LYS C CB  1 
ATOM   5585  C  CG  . LYS C 1 38  ? 58.411  9.548   94.275  1.00 42.20  ? 38  LYS C CG  1 
ATOM   5586  C  CD  . LYS C 1 38  ? 59.248  8.667   93.361  1.00 46.03  ? 38  LYS C CD  1 
ATOM   5587  C  CE  . LYS C 1 38  ? 60.733  8.808   93.674  1.00 50.96  ? 38  LYS C CE  1 
ATOM   5588  N  NZ  . LYS C 1 38  ? 61.598  7.946   92.800  1.00 50.33  ? 38  LYS C NZ  1 
ATOM   5589  N  N   . LEU C 1 39  ? 53.895  10.334  93.556  1.00 30.12  ? 39  LEU C N   1 
ATOM   5590  C  CA  . LEU C 1 39  ? 52.550  9.878   93.235  1.00 29.01  ? 39  LEU C CA  1 
ATOM   5591  C  C   . LEU C 1 39  ? 52.664  8.704   92.316  1.00 28.89  ? 39  LEU C C   1 
ATOM   5592  O  O   . LEU C 1 39  ? 53.341  8.795   91.287  1.00 28.60  ? 39  LEU C O   1 
ATOM   5593  C  CB  . LEU C 1 39  ? 51.761  10.961  92.536  1.00 28.60  ? 39  LEU C CB  1 
ATOM   5594  C  CG  . LEU C 1 39  ? 51.345  12.068  93.483  1.00 28.58  ? 39  LEU C CG  1 
ATOM   5595  C  CD1 . LEU C 1 39  ? 50.631  13.175  92.715  1.00 28.69  ? 39  LEU C CD1 1 
ATOM   5596  C  CD2 . LEU C 1 39  ? 50.438  11.441  94.522  1.00 26.70  ? 39  LEU C CD2 1 
ATOM   5597  N  N   . LEU C 1 40  ? 52.039  7.597   92.710  1.00 29.49  ? 40  LEU C N   1 
ATOM   5598  C  CA  . LEU C 1 40  ? 52.066  6.352   91.934  1.00 32.80  ? 40  LEU C CA  1 
ATOM   5599  C  C   . LEU C 1 40  ? 50.643  5.990   91.577  1.00 35.85  ? 40  LEU C C   1 
ATOM   5600  O  O   . LEU C 1 40  ? 49.744  6.143   92.395  1.00 36.01  ? 40  LEU C O   1 
ATOM   5601  C  CB  . LEU C 1 40  ? 52.722  5.175   92.706  1.00 31.57  ? 40  LEU C CB  1 
ATOM   5602  C  CG  . LEU C 1 40  ? 53.974  5.439   93.553  1.00 32.42  ? 40  LEU C CG  1 
ATOM   5603  C  CD1 . LEU C 1 40  ? 54.397  4.227   94.368  1.00 34.17  ? 40  LEU C CD1 1 
ATOM   5604  C  CD2 . LEU C 1 40  ? 55.119  5.890   92.651  1.00 35.93  ? 40  LEU C CD2 1 
ATOM   5605  N  N   . LYS C 1 41  ? 50.464  5.539   90.337  1.00 44.97  ? 41  LYS C N   1 
ATOM   5606  C  CA  . LYS C 1 41  ? 49.192  5.076   89.821  1.00 52.00  ? 41  LYS C CA  1 
ATOM   5607  C  C   . LYS C 1 41  ? 49.298  3.588   89.498  1.00 63.08  ? 41  LYS C C   1 
ATOM   5608  O  O   . LYS C 1 41  ? 49.338  3.200   88.322  1.00 65.13  ? 41  LYS C O   1 
ATOM   5609  C  CB  . LYS C 1 41  ? 48.831  5.831   88.555  1.00 49.64  ? 41  LYS C CB  1 
ATOM   5610  C  CG  . LYS C 1 41  ? 47.411  5.558   88.070  1.00 47.36  ? 41  LYS C CG  1 
ATOM   5611  C  CD  . LYS C 1 41  ? 47.268  5.978   86.620  1.00 48.65  ? 41  LYS C CD  1 
ATOM   5612  C  CE  . LYS C 1 41  ? 47.522  7.473   86.441  1.00 48.24  ? 41  LYS C CE  1 
ATOM   5613  N  NZ  . LYS C 1 41  ? 46.278  8.244   86.695  1.00 49.97  ? 41  LYS C NZ  1 
ATOM   5614  N  N   . ASP C 1 42  ? 49.377  2.767   90.547  1.00 69.72  ? 42  ASP C N   1 
ATOM   5615  C  CA  . ASP C 1 42  ? 49.368  1.309   90.418  1.00 71.71  ? 42  ASP C CA  1 
ATOM   5616  C  C   . ASP C 1 42  ? 50.546  0.767   89.589  1.00 79.53  ? 42  ASP C C   1 
ATOM   5617  O  O   . ASP C 1 42  ? 50.702  -0.461  89.447  1.00 74.37  ? 42  ASP C O   1 
ATOM   5618  C  CB  . ASP C 1 42  ? 48.036  0.858   89.815  1.00 68.81  ? 42  ASP C CB  1 
ATOM   5619  C  CG  . ASP C 1 42  ? 47.592  -0.449  90.347  1.00 65.80  ? 42  ASP C CG  1 
ATOM   5620  O  OD1 . ASP C 1 42  ? 47.077  -0.473  91.491  1.00 62.55  ? 42  ASP C OD1 1 
ATOM   5621  O  OD2 . ASP C 1 42  ? 47.771  -1.443  89.621  1.00 60.55  ? 42  ASP C OD2 1 
ATOM   5622  N  N   . GLY C 1 43  ? 51.358  1.695   89.053  1.00 80.24  ? 43  GLY C N   1 
ATOM   5623  C  CA  . GLY C 1 43  ? 52.551  1.396   88.240  1.00 75.39  ? 43  GLY C CA  1 
ATOM   5624  C  C   . GLY C 1 43  ? 53.577  2.526   88.246  1.00 72.44  ? 43  GLY C C   1 
ATOM   5625  O  O   . GLY C 1 43  ? 54.241  2.766   89.256  1.00 72.74  ? 43  GLY C O   1 
ATOM   5626  N  N   . LYS C 1 44  ? 53.680  3.217   87.109  1.00 72.60  ? 44  LYS C N   1 
ATOM   5627  C  CA  . LYS C 1 44  ? 54.591  4.352   86.868  1.00 69.68  ? 44  LYS C CA  1 
ATOM   5628  C  C   . LYS C 1 44  ? 54.773  5.359   88.015  1.00 71.19  ? 44  LYS C C   1 
ATOM   5629  O  O   . LYS C 1 44  ? 54.004  5.384   88.981  1.00 72.38  ? 44  LYS C O   1 
ATOM   5630  C  CB  . LYS C 1 44  ? 54.139  5.125   85.614  1.00 71.64  ? 44  LYS C CB  1 
ATOM   5631  C  CG  . LYS C 1 44  ? 54.708  4.627   84.291  1.00 73.09  ? 44  LYS C CG  1 
ATOM   5632  C  CD  . LYS C 1 44  ? 53.891  3.493   83.687  1.00 71.83  ? 44  LYS C CD  1 
ATOM   5633  C  CE  . LYS C 1 44  ? 54.391  3.146   82.291  1.00 70.69  ? 44  LYS C CE  1 
ATOM   5634  N  NZ  . LYS C 1 44  ? 54.273  1.689   81.998  1.00 72.18  ? 44  LYS C NZ  1 
ATOM   5635  N  N   . VAL C 1 45  ? 55.803  6.192   87.889  1.00 64.25  ? 45  VAL C N   1 
ATOM   5636  C  CA  . VAL C 1 45  ? 56.014  7.292   88.805  1.00 59.87  ? 45  VAL C CA  1 
ATOM   5637  C  C   . VAL C 1 45  ? 55.231  8.430   88.209  1.00 57.32  ? 45  VAL C C   1 
ATOM   5638  O  O   . VAL C 1 45  ? 55.759  9.187   87.392  1.00 63.29  ? 45  VAL C O   1 
ATOM   5639  C  CB  . VAL C 1 45  ? 57.490  7.770   88.871  1.00 63.00  ? 45  VAL C CB  1 
ATOM   5640  C  CG1 . VAL C 1 45  ? 57.683  8.712   90.052  1.00 59.97  ? 45  VAL C CG1 1 
ATOM   5641  C  CG2 . VAL C 1 45  ? 58.477  6.608   88.941  1.00 64.42  ? 45  VAL C CG2 1 
ATOM   5642  N  N   . PHE C 1 46  ? 53.974  8.569   88.593  1.00 53.24  ? 46  PHE C N   1 
ATOM   5643  C  CA  . PHE C 1 46  ? 53.185  9.608   87.981  1.00 49.60  ? 46  PHE C CA  1 
ATOM   5644  C  C   . PHE C 1 46  ? 53.833  10.999  88.106  1.00 46.24  ? 46  PHE C C   1 
ATOM   5645  O  O   . PHE C 1 46  ? 53.909  11.755  87.126  1.00 43.03  ? 46  PHE C O   1 
ATOM   5646  C  CB  . PHE C 1 46  ? 51.721  9.613   88.459  1.00 51.60  ? 46  PHE C CB  1 
ATOM   5647  C  CG  . PHE C 1 46  ? 50.872  10.557  87.661  1.00 55.24  ? 46  PHE C CG  1 
ATOM   5648  C  CD1 . PHE C 1 46  ? 50.593  10.286  86.312  1.00 54.28  ? 46  PHE C CD1 1 
ATOM   5649  C  CD2 . PHE C 1 46  ? 50.439  11.762  88.207  1.00 56.73  ? 46  PHE C CD2 1 
ATOM   5650  C  CE1 . PHE C 1 46  ? 49.857  11.180  85.540  1.00 59.18  ? 46  PHE C CE1 1 
ATOM   5651  C  CE2 . PHE C 1 46  ? 49.695  12.662  87.438  1.00 61.13  ? 46  PHE C CE2 1 
ATOM   5652  C  CZ  . PHE C 1 46  ? 49.401  12.369  86.108  1.00 57.99  ? 46  PHE C CZ  1 
ATOM   5653  N  N   . ARG C 1 47  ? 54.320  11.326  89.300  1.00 41.03  ? 47  ARG C N   1 
ATOM   5654  C  CA  . ARG C 1 47  ? 54.761  12.687  89.573  1.00 39.20  ? 47  ARG C CA  1 
ATOM   5655  C  C   . ARG C 1 47  ? 55.529  12.813  90.867  1.00 33.75  ? 47  ARG C C   1 
ATOM   5656  O  O   . ARG C 1 47  ? 55.336  12.014  91.780  1.00 30.99  ? 47  ARG C O   1 
ATOM   5657  C  CB  . ARG C 1 47  ? 53.543  13.583  89.660  1.00 39.95  ? 47  ARG C CB  1 
ATOM   5658  C  CG  . ARG C 1 47  ? 53.796  14.990  89.211  1.00 39.56  ? 47  ARG C CG  1 
ATOM   5659  C  CD  . ARG C 1 47  ? 52.449  15.650  89.121  1.00 40.99  ? 47  ARG C CD  1 
ATOM   5660  N  NE  . ARG C 1 47  ? 52.447  16.802  88.239  1.00 41.40  ? 47  ARG C NE  1 
ATOM   5661  C  CZ  . ARG C 1 47  ? 51.347  17.492  87.963  1.00 40.78  ? 47  ARG C CZ  1 
ATOM   5662  N  NH1 . ARG C 1 47  ? 50.193  17.105  88.501  1.00 37.92  ? 47  ARG C NH1 1 
ATOM   5663  N  NH2 . ARG C 1 47  ? 51.396  18.547  87.145  1.00 38.84  ? 47  ARG C NH2 1 
ATOM   5664  N  N   . VAL C 1 48  ? 56.373  13.835  90.945  1.00 32.61  ? 48  VAL C N   1 
ATOM   5665  C  CA  . VAL C 1 48  ? 57.145  14.111  92.157  1.00 32.94  ? 48  VAL C CA  1 
ATOM   5666  C  C   . VAL C 1 48  ? 56.594  15.344  92.839  1.00 32.81  ? 48  VAL C C   1 
ATOM   5667  O  O   . VAL C 1 48  ? 56.573  16.405  92.234  1.00 35.27  ? 48  VAL C O   1 
ATOM   5668  C  CB  . VAL C 1 48  ? 58.615  14.396  91.833  1.00 33.29  ? 48  VAL C CB  1 
ATOM   5669  C  CG1 . VAL C 1 48  ? 59.426  14.499  93.120  1.00 33.41  ? 48  VAL C CG1 1 
ATOM   5670  C  CG2 . VAL C 1 48  ? 59.184  13.320  90.910  1.00 33.10  ? 48  VAL C CG2 1 
ATOM   5671  N  N   . VAL C 1 49  ? 56.166  15.220  94.084  1.00 29.12  ? 49  VAL C N   1 
ATOM   5672  C  CA  . VAL C 1 49  ? 55.644  16.369  94.816  1.00 31.27  ? 49  VAL C CA  1 
ATOM   5673  C  C   . VAL C 1 49  ? 56.539  16.663  96.001  1.00 32.90  ? 49  VAL C C   1 
ATOM   5674  O  O   . VAL C 1 49  ? 57.413  15.861  96.311  1.00 32.41  ? 49  VAL C O   1 
ATOM   5675  C  CB  . VAL C 1 49  ? 54.197  16.121  95.297  1.00 32.95  ? 49  VAL C CB  1 
ATOM   5676  C  CG1 . VAL C 1 49  ? 53.256  16.052  94.096  1.00 33.89  ? 49  VAL C CG1 1 
ATOM   5677  C  CG2 . VAL C 1 49  ? 54.107  14.821  96.090  1.00 32.60  ? 49  VAL C CG2 1 
ATOM   5678  N  N   . ARG C 1 50  ? 56.337  17.815  96.645  1.00 33.91  ? 50  ARG C N   1 
ATOM   5679  C  CA  . ARG C 1 50  ? 57.066  18.187  97.865  1.00 34.03  ? 50  ARG C CA  1 
ATOM   5680  C  C   . ARG C 1 50  ? 56.099  18.455  98.996  1.00 31.45  ? 50  ARG C C   1 
ATOM   5681  O  O   . ARG C 1 50  ? 54.908  18.243  98.852  1.00 32.98  ? 50  ARG C O   1 
ATOM   5682  C  CB  . ARG C 1 50  ? 57.970  19.392  97.638  1.00 35.74  ? 50  ARG C CB  1 
ATOM   5683  C  CG  . ARG C 1 50  ? 59.249  19.046  96.910  1.00 43.52  ? 50  ARG C CG  1 
ATOM   5684  C  CD  . ARG C 1 50  ? 59.628  20.158  95.951  1.00 48.96  ? 50  ARG C CD  1 
ATOM   5685  N  NE  . ARG C 1 50  ? 60.957  19.976  95.360  1.00 57.20  ? 50  ARG C NE  1 
ATOM   5686  C  CZ  . ARG C 1 50  ? 61.416  20.651  94.296  1.00 59.24  ? 50  ARG C CZ  1 
ATOM   5687  N  NH1 . ARG C 1 50  ? 60.650  21.560  93.680  1.00 55.12  ? 50  ARG C NH1 1 
ATOM   5688  N  NH2 . ARG C 1 50  ? 62.647  20.409  93.841  1.00 55.31  ? 50  ARG C NH2 1 
ATOM   5689  N  N   . GLU C 1 51  ? 56.618  18.934  100.120 1.00 32.60  ? 51  GLU C N   1 
ATOM   5690  C  CA  . GLU C 1 51  ? 55.826  19.166  101.352 1.00 31.20  ? 51  GLU C CA  1 
ATOM   5691  C  C   . GLU C 1 51  ? 54.636  20.082  101.120 1.00 25.14  ? 51  GLU C C   1 
ATOM   5692  O  O   . GLU C 1 51  ? 53.578  19.899  101.725 1.00 21.44  ? 51  GLU C O   1 
ATOM   5693  C  CB  . GLU C 1 51  ? 56.711  19.810  102.453 1.00 35.06  ? 51  GLU C CB  1 
ATOM   5694  C  CG  . GLU C 1 51  ? 57.552  18.846  103.276 1.00 47.68  ? 51  GLU C CG  1 
ATOM   5695  C  CD  . GLU C 1 51  ? 57.966  19.389  104.656 1.00 53.37  ? 51  GLU C CD  1 
ATOM   5696  O  OE1 . GLU C 1 51  ? 57.500  18.817  105.681 1.00 51.66  ? 51  GLU C OE1 1 
ATOM   5697  O  OE2 . GLU C 1 51  ? 58.746  20.383  104.717 1.00 53.99  ? 51  GLU C OE2 1 
ATOM   5698  N  N   . ASN C 1 52  ? 54.844  21.109  100.293 1.00 22.85  ? 52  ASN C N   1 
ATOM   5699  C  CA  . ASN C 1 52  ? 53.843  22.144  100.142 1.00 23.32  ? 52  ASN C CA  1 
ATOM   5700  C  C   . ASN C 1 52  ? 52.613  21.644  99.403  1.00 24.76  ? 52  ASN C C   1 
ATOM   5701  O  O   . ASN C 1 52  ? 51.555  22.281  99.444  1.00 22.14  ? 52  ASN C O   1 
ATOM   5702  C  CB  . ASN C 1 52  ? 54.405  23.384  99.486  1.00 22.47  ? 52  ASN C CB  1 
ATOM   5703  C  CG  . ASN C 1 52  ? 54.893  23.148  98.069  1.00 22.02  ? 52  ASN C CG  1 
ATOM   5704  O  OD1 . ASN C 1 52  ? 54.851  22.039  97.526  1.00 21.85  ? 52  ASN C OD1 1 
ATOM   5705  N  ND2 . ASN C 1 52  ? 55.406  24.215  97.469  1.00 22.14  ? 52  ASN C ND2 1 
ATOM   5706  N  N   . CYS C 1 53  ? 52.752  20.470  98.784  1.00 25.61  ? 53  CYS C N   1 
ATOM   5707  C  CA  . CYS C 1 53  ? 51.615  19.764  98.232  1.00 27.23  ? 53  CYS C CA  1 
ATOM   5708  C  C   . CYS C 1 53  ? 50.661  19.121  99.231  1.00 27.57  ? 53  CYS C C   1 
ATOM   5709  O  O   . CYS C 1 53  ? 49.541  18.788  98.855  1.00 25.95  ? 53  CYS C O   1 
ATOM   5710  C  CB  . CYS C 1 53  ? 52.092  18.697  97.284  1.00 31.24  ? 53  CYS C CB  1 
ATOM   5711  S  SG  . CYS C 1 53  ? 50.781  18.160  96.176  1.00 39.02  ? 53  CYS C SG  1 
ATOM   5712  N  N   . TRP C 1 54  ? 51.073  18.921  100.488 1.00 29.10  ? 54  TRP C N   1 
ATOM   5713  C  CA  . TRP C 1 54  ? 50.128  18.357  101.487 1.00 29.77  ? 54  TRP C CA  1 
ATOM   5714  C  C   . TRP C 1 54  ? 50.076  19.062  102.790 1.00 31.60  ? 54  TRP C C   1 
ATOM   5715  O  O   . TRP C 1 54  ? 49.103  18.914  103.520 1.00 39.27  ? 54  TRP C O   1 
ATOM   5716  C  CB  . TRP C 1 54  ? 50.294  16.843  101.694 1.00 28.20  ? 54  TRP C CB  1 
ATOM   5717  C  CG  . TRP C 1 54  ? 51.712  16.376  101.490 1.00 28.18  ? 54  TRP C CG  1 
ATOM   5718  C  CD1 . TRP C 1 54  ? 52.327  15.999  100.303 1.00 29.37  ? 54  TRP C CD1 1 
ATOM   5719  C  CD2 . TRP C 1 54  ? 52.741  16.275  102.491 1.00 25.81  ? 54  TRP C CD2 1 
ATOM   5720  N  NE1 . TRP C 1 54  ? 53.645  15.687  100.504 1.00 27.62  ? 54  TRP C NE1 1 
ATOM   5721  C  CE2 . TRP C 1 54  ? 53.953  15.816  101.793 1.00 27.68  ? 54  TRP C CE2 1 
ATOM   5722  C  CE3 . TRP C 1 54  ? 52.784  16.500  103.831 1.00 25.33  ? 54  TRP C CE3 1 
ATOM   5723  C  CZ2 . TRP C 1 54  ? 55.146  15.603  102.450 1.00 28.85  ? 54  TRP C CZ2 1 
ATOM   5724  C  CZ3 . TRP C 1 54  ? 53.991  16.277  104.499 1.00 29.65  ? 54  TRP C CZ3 1 
ATOM   5725  C  CH2 . TRP C 1 54  ? 55.142  15.843  103.825 1.00 30.34  ? 54  TRP C CH2 1 
ATOM   5726  N  N   . ASP C 1 55  ? 51.110  19.820  103.123 1.00 32.77  ? 55  ASP C N   1 
ATOM   5727  C  CA  . ASP C 1 55  ? 51.195  20.404  104.456 1.00 29.32  ? 55  ASP C CA  1 
ATOM   5728  C  C   . ASP C 1 55  ? 50.790  21.856  104.489 1.00 27.05  ? 55  ASP C C   1 
ATOM   5729  O  O   . ASP C 1 55  ? 51.511  22.676  103.969 1.00 25.89  ? 55  ASP C O   1 
ATOM   5730  C  CB  . ASP C 1 55  ? 52.607  20.301  104.974 1.00 32.46  ? 55  ASP C CB  1 
ATOM   5731  C  CG  . ASP C 1 55  ? 52.722  20.732  106.424 1.00 35.96  ? 55  ASP C CG  1 
ATOM   5732  O  OD1 . ASP C 1 55  ? 51.722  21.222  107.038 1.00 37.48  ? 55  ASP C OD1 1 
ATOM   5733  O  OD2 . ASP C 1 55  ? 53.831  20.557  106.961 1.00 39.09  ? 55  ASP C OD2 1 
ATOM   5734  N  N   . PRO C 1 56  ? 49.650  22.172  105.133 1.00 26.40  ? 56  PRO C N   1 
ATOM   5735  C  CA  . PRO C 1 56  ? 49.091  23.510  105.209 1.00 25.13  ? 56  PRO C CA  1 
ATOM   5736  C  C   . PRO C 1 56  ? 50.044  24.536  105.815 1.00 27.58  ? 56  PRO C C   1 
ATOM   5737  O  O   . PRO C 1 56  ? 50.029  25.712  105.377 1.00 26.98  ? 56  PRO C O   1 
ATOM   5738  C  CB  . PRO C 1 56  ? 47.884  23.349  106.130 1.00 25.53  ? 56  PRO C CB  1 
ATOM   5739  C  CG  . PRO C 1 56  ? 47.517  21.909  106.070 1.00 23.73  ? 56  PRO C CG  1 
ATOM   5740  C  CD  . PRO C 1 56  ? 48.790  21.166  105.789 1.00 24.69  ? 56  PRO C CD  1 
ATOM   5741  N  N   . GLU C 1 57  ? 50.868  24.123  106.785 1.00 26.36  ? 57  GLU C N   1 
ATOM   5742  C  CA  . GLU C 1 57  ? 51.760  25.080  107.457 1.00 27.78  ? 57  GLU C CA  1 
ATOM   5743  C  C   . GLU C 1 57  ? 52.808  25.595  106.471 1.00 28.15  ? 57  GLU C C   1 
ATOM   5744  O  O   . GLU C 1 57  ? 53.134  26.789  106.427 1.00 25.73  ? 57  GLU C O   1 
ATOM   5745  C  CB  . GLU C 1 57  ? 52.430  24.456  108.689 1.00 32.03  ? 57  GLU C CB  1 
ATOM   5746  C  CG  . GLU C 1 57  ? 51.533  24.406  109.919 1.00 35.25  ? 57  GLU C CG  1 
ATOM   5747  C  CD  . GLU C 1 57  ? 52.208  23.779  111.144 1.00 42.68  ? 57  GLU C CD  1 
ATOM   5748  O  OE1 . GLU C 1 57  ? 53.432  23.486  111.103 1.00 47.07  ? 57  GLU C OE1 1 
ATOM   5749  O  OE2 . GLU C 1 57  ? 51.508  23.567  112.163 1.00 42.34  ? 57  GLU C OE2 1 
ATOM   5750  N  N   . VAL C 1 58  ? 53.331  24.683  105.664 1.00 26.62  ? 58  VAL C N   1 
ATOM   5751  C  CA  . VAL C 1 58  ? 54.293  25.053  104.642 1.00 26.62  ? 58  VAL C CA  1 
ATOM   5752  C  C   . VAL C 1 58  ? 53.628  25.979  103.570 1.00 26.82  ? 58  VAL C C   1 
ATOM   5753  O  O   . VAL C 1 58  ? 54.153  27.054  103.254 1.00 27.38  ? 58  VAL C O   1 
ATOM   5754  C  CB  . VAL C 1 58  ? 54.973  23.780  104.093 1.00 26.43  ? 58  VAL C CB  1 
ATOM   5755  C  CG1 . VAL C 1 58  ? 55.852  24.072  102.889 1.00 24.81  ? 58  VAL C CG1 1 
ATOM   5756  C  CG2 . VAL C 1 58  ? 55.798  23.146  105.214 1.00 24.21  ? 58  VAL C CG2 1 
ATOM   5757  N  N   . ARG C 1 59  ? 52.457  25.601  103.064 1.00 23.77  ? 59  ARG C N   1 
ATOM   5758  C  CA  . ARG C 1 59  ? 51.763  26.439  102.097 1.00 23.58  ? 59  ARG C CA  1 
ATOM   5759  C  C   . ARG C 1 59  ? 51.660  27.869  102.588 1.00 23.20  ? 59  ARG C C   1 
ATOM   5760  O  O   . ARG C 1 59  ? 52.082  28.792  101.903 1.00 25.53  ? 59  ARG C O   1 
ATOM   5761  C  CB  . ARG C 1 59  ? 50.385  25.872  101.746 1.00 22.15  ? 59  ARG C CB  1 
ATOM   5762  C  CG  . ARG C 1 59  ? 50.487  24.576  100.990 1.00 21.75  ? 59  ARG C CG  1 
ATOM   5763  C  CD  . ARG C 1 59  ? 49.124  24.037  100.626 1.00 21.22  ? 59  ARG C CD  1 
ATOM   5764  N  NE  . ARG C 1 59  ? 48.447  24.711  99.531  1.00 19.23  ? 59  ARG C NE  1 
ATOM   5765  C  CZ  . ARG C 1 59  ? 48.200  24.133  98.363  1.00 18.85  ? 59  ARG C CZ  1 
ATOM   5766  N  NH1 . ARG C 1 59  ? 48.609  22.913  98.139  1.00 17.47  ? 59  ARG C NH1 1 
ATOM   5767  N  NH2 . ARG C 1 59  ? 47.499  24.762  97.437  1.00 19.58  ? 59  ARG C NH2 1 
ATOM   5768  N  N   . ILE C 1 60  ? 51.146  28.037  103.794 1.00 22.68  ? 60  ILE C N   1 
ATOM   5769  C  CA  . ILE C 1 60  ? 51.114  29.322  104.469 1.00 23.59  ? 60  ILE C CA  1 
ATOM   5770  C  C   . ILE C 1 60  ? 52.490  30.027  104.584 1.00 25.33  ? 60  ILE C C   1 
ATOM   5771  O  O   . ILE C 1 60  ? 52.560  31.255  104.425 1.00 25.77  ? 60  ILE C O   1 
ATOM   5772  C  CB  . ILE C 1 60  ? 50.351  29.184  105.807 1.00 22.59  ? 60  ILE C CB  1 
ATOM   5773  C  CG1 . ILE C 1 60  ? 48.882  28.939  105.447 1.00 22.35  ? 60  ILE C CG1 1 
ATOM   5774  C  CG2 . ILE C 1 60  ? 50.565  30.377  106.721 1.00 19.38  ? 60  ILE C CG2 1 
ATOM   5775  C  CD1 . ILE C 1 60  ? 47.880  29.373  106.487 1.00 24.69  ? 60  ILE C CD1 1 
ATOM   5776  N  N   . ARG C 1 61  ? 53.573  29.267  104.801 1.00 27.86  ? 61  ARG C N   1 
ATOM   5777  C  CA  . ARG C 1 61  ? 54.935  29.841  104.767 1.00 31.45  ? 61  ARG C CA  1 
ATOM   5778  C  C   . ARG C 1 61  ? 55.203  30.449  103.376 1.00 28.96  ? 61  ARG C C   1 
ATOM   5779  O  O   . ARG C 1 61  ? 55.669  31.570  103.290 1.00 28.17  ? 61  ARG C O   1 
ATOM   5780  C  CB  . ARG C 1 61  ? 56.022  28.807  105.142 1.00 36.76  ? 61  ARG C CB  1 
ATOM   5781  C  CG  . ARG C 1 61  ? 57.412  29.377  105.476 1.00 46.53  ? 61  ARG C CG  1 
ATOM   5782  C  CD  . ARG C 1 61  ? 58.405  28.290  105.939 1.00 53.23  ? 61  ARG C CD  1 
ATOM   5783  N  NE  . ARG C 1 61  ? 59.810  28.753  106.047 1.00 57.84  ? 61  ARG C NE  1 
ATOM   5784  C  CZ  . ARG C 1 61  ? 60.812  28.424  105.217 1.00 58.91  ? 61  ARG C CZ  1 
ATOM   5785  N  NH1 . ARG C 1 61  ? 60.607  27.623  104.172 1.00 61.44  ? 61  ARG C NH1 1 
ATOM   5786  N  NH2 . ARG C 1 61  ? 62.036  28.903  105.425 1.00 52.86  ? 61  ARG C NH2 1 
ATOM   5787  N  N   . GLU C 1 62  ? 54.861  29.735  102.305 1.00 26.76  ? 62  GLU C N   1 
ATOM   5788  C  CA  . GLU C 1 62  ? 55.099  30.254  100.963 1.00 27.61  ? 62  GLU C CA  1 
ATOM   5789  C  C   . GLU C 1 62  ? 54.131  31.337  100.520 1.00 25.85  ? 62  GLU C C   1 
ATOM   5790  O  O   . GLU C 1 62  ? 54.514  32.212  99.737  1.00 24.53  ? 62  GLU C O   1 
ATOM   5791  C  CB  . GLU C 1 62  ? 55.186  29.121  99.927  1.00 33.08  ? 62  GLU C CB  1 
ATOM   5792  C  CG  . GLU C 1 62  ? 56.327  28.123  100.189 1.00 38.71  ? 62  GLU C CG  1 
ATOM   5793  C  CD  . GLU C 1 62  ? 56.534  27.049  99.096  1.00 48.13  ? 62  GLU C CD  1 
ATOM   5794  O  OE1 . GLU C 1 62  ? 56.003  27.173  97.943  1.00 45.74  ? 62  GLU C OE1 1 
ATOM   5795  O  OE2 . GLU C 1 62  ? 57.267  26.065  99.404  1.00 47.37  ? 62  GLU C OE2 1 
ATOM   5796  N  N   . MET C 1 63  ? 52.892  31.314  101.025 1.00 24.42  ? 63  MET C N   1 
ATOM   5797  C  CA  . MET C 1 63  ? 51.936  32.392  100.709 1.00 24.67  ? 63  MET C CA  1 
ATOM   5798  C  C   . MET C 1 63  ? 52.296  33.717  101.382 1.00 26.49  ? 63  MET C C   1 
ATOM   5799  O  O   . MET C 1 63  ? 52.024  34.786  100.832 1.00 26.49  ? 63  MET C O   1 
ATOM   5800  C  CB  . MET C 1 63  ? 50.499  32.027  101.076 1.00 24.15  ? 63  MET C CB  1 
ATOM   5801  C  CG  . MET C 1 63  ? 49.954  30.711  100.531 1.00 22.54  ? 63  MET C CG  1 
ATOM   5802  S  SD  . MET C 1 63  ? 48.382  30.332  101.375 1.00 25.99  ? 63  MET C SD  1 
ATOM   5803  C  CE  . MET C 1 63  ? 48.506  28.583  101.244 1.00 26.42  ? 63  MET C CE  1 
ATOM   5804  N  N   . ASP C 1 64  ? 52.872  33.647  102.584 1.00 30.64  ? 64  ASP C N   1 
ATOM   5805  C  CA  . ASP C 1 64  ? 53.335  34.847  103.290 1.00 33.76  ? 64  ASP C CA  1 
ATOM   5806  C  C   . ASP C 1 64  ? 54.473  35.488  102.526 1.00 33.63  ? 64  ASP C C   1 
ATOM   5807  O  O   . ASP C 1 64  ? 54.485  36.697  102.383 1.00 38.26  ? 64  ASP C O   1 
ATOM   5808  C  CB  . ASP C 1 64  ? 53.784  34.567  104.733 1.00 36.24  ? 64  ASP C CB  1 
ATOM   5809  C  CG  . ASP C 1 64  ? 52.599  34.332  105.721 1.00 43.25  ? 64  ASP C CG  1 
ATOM   5810  O  OD1 . ASP C 1 64  ? 51.387  34.449  105.352 1.00 44.38  ? 64  ASP C OD1 1 
ATOM   5811  O  OD2 . ASP C 1 64  ? 52.908  33.994  106.894 1.00 42.58  ? 64  ASP C OD2 1 
ATOM   5812  N  N   . GLN C 1 65  ? 55.412  34.687  102.035 1.00 33.38  ? 65  GLN C N   1 
ATOM   5813  C  CA  . GLN C 1 65  ? 56.515  35.182  101.201 1.00 38.14  ? 65  GLN C CA  1 
ATOM   5814  C  C   . GLN C 1 65  ? 56.010  35.728  99.876  1.00 36.86  ? 65  GLN C C   1 
ATOM   5815  O  O   . GLN C 1 65  ? 56.500  36.745  99.400  1.00 39.55  ? 65  GLN C O   1 
ATOM   5816  C  CB  . GLN C 1 65  ? 57.565  34.089  100.925 1.00 42.07  ? 65  GLN C CB  1 
ATOM   5817  C  CG  . GLN C 1 65  ? 58.267  33.505  102.149 1.00 46.15  ? 65  GLN C CG  1 
ATOM   5818  C  CD  . GLN C 1 65  ? 58.972  32.179  101.853 1.00 51.99  ? 65  GLN C CD  1 
ATOM   5819  O  OE1 . GLN C 1 65  ? 58.615  31.452  100.912 1.00 56.45  ? 65  GLN C OE1 1 
ATOM   5820  N  NE2 . GLN C 1 65  ? 59.974  31.854  102.660 1.00 51.97  ? 65  GLN C NE2 1 
ATOM   5821  N  N   . LYS C 1 66  ? 55.019  35.063  99.292  1.00 36.17  ? 66  LYS C N   1 
ATOM   5822  C  CA  . LYS C 1 66  ? 54.535  35.433  97.949  1.00 33.75  ? 66  LYS C CA  1 
ATOM   5823  C  C   . LYS C 1 66  ? 53.457  36.485  97.962  1.00 30.96  ? 66  LYS C C   1 
ATOM   5824  O  O   . LYS C 1 66  ? 53.030  36.952  96.919  1.00 29.73  ? 66  LYS C O   1 
ATOM   5825  C  CB  . LYS C 1 66  ? 54.097  34.191  97.150  1.00 34.83  ? 66  LYS C CB  1 
ATOM   5826  C  CG  . LYS C 1 66  ? 55.271  33.307  96.745  1.00 37.61  ? 66  LYS C CG  1 
ATOM   5827  C  CD  . LYS C 1 66  ? 56.357  34.170  96.100  1.00 42.93  ? 66  LYS C CD  1 
ATOM   5828  C  CE  . LYS C 1 66  ? 57.779  33.644  96.330  1.00 47.74  ? 66  LYS C CE  1 
ATOM   5829  N  NZ  . LYS C 1 66  ? 58.385  32.969  95.139  1.00 47.24  ? 66  LYS C NZ  1 
ATOM   5830  N  N   . GLY C 1 67  ? 53.020  36.881  99.148  1.00 29.63  ? 67  GLY C N   1 
ATOM   5831  C  CA  . GLY C 1 67  ? 51.980  37.890  99.240  1.00 25.04  ? 67  GLY C CA  1 
ATOM   5832  C  C   . GLY C 1 67  ? 50.588  37.374  98.954  1.00 23.96  ? 67  GLY C C   1 
ATOM   5833  O  O   . GLY C 1 67  ? 49.672  38.166  98.789  1.00 23.15  ? 67  GLY C O   1 
ATOM   5834  N  N   . VAL C 1 68  ? 50.403  36.060  98.947  1.00 21.16  ? 68  VAL C N   1 
ATOM   5835  C  CA  . VAL C 1 68  ? 49.064  35.472  98.731  1.00 21.20  ? 68  VAL C CA  1 
ATOM   5836  C  C   . VAL C 1 68  ? 48.244  35.437  100.032 1.00 20.47  ? 68  VAL C C   1 
ATOM   5837  O  O   . VAL C 1 68  ? 48.733  34.978  101.028 1.00 22.52  ? 68  VAL C O   1 
ATOM   5838  C  CB  . VAL C 1 68  ? 49.197  34.023  98.186  1.00 20.19  ? 68  VAL C CB  1 
ATOM   5839  C  CG1 . VAL C 1 68  ? 47.853  33.474  97.743  1.00 19.14  ? 68  VAL C CG1 1 
ATOM   5840  C  CG2 . VAL C 1 68  ? 50.249  33.948  97.070  1.00 18.47  ? 68  VAL C CG2 1 
ATOM   5841  N  N   . THR C 1 69  ? 46.992  35.878  100.010 1.00 20.28  ? 69  THR C N   1 
ATOM   5842  C  CA  . THR C 1 69  ? 46.175  36.011  101.220 1.00 19.33  ? 69  THR C CA  1 
ATOM   5843  C  C   . THR C 1 69  ? 45.345  34.787  101.375 1.00 20.71  ? 69  THR C C   1 
ATOM   5844  O  O   . THR C 1 69  ? 45.270  34.232  102.475 1.00 22.60  ? 69  THR C O   1 
ATOM   5845  C  CB  . THR C 1 69  ? 45.163  37.152  101.092 1.00 19.10  ? 69  THR C CB  1 
ATOM   5846  O  OG1 . THR C 1 69  ? 45.797  38.283  100.519 1.00 19.39  ? 69  THR C OG1 1 
ATOM   5847  C  CG2 . THR C 1 69  ? 44.548  37.550  102.459 1.00 19.13  ? 69  THR C CG2 1 
ATOM   5848  N  N   . VAL C 1 70  ? 44.694  34.373  100.278 1.00 20.63  ? 70  VAL C N   1 
ATOM   5849  C  CA  . VAL C 1 70  ? 43.922  33.145  100.246 1.00 19.07  ? 70  VAL C CA  1 
ATOM   5850  C  C   . VAL C 1 70  ? 44.087  32.291  98.974  1.00 19.32  ? 70  VAL C C   1 
ATOM   5851  O  O   . VAL C 1 70  ? 44.050  32.798  97.859  1.00 18.85  ? 70  VAL C O   1 
ATOM   5852  C  CB  . VAL C 1 70  ? 42.429  33.324  100.719 1.00 20.23  ? 70  VAL C CB  1 
ATOM   5853  C  CG1 . VAL C 1 70  ? 42.056  34.755  101.103 1.00 18.40  ? 70  VAL C CG1 1 
ATOM   5854  C  CG2 . VAL C 1 70  ? 41.420  32.675  99.779  1.00 19.24  ? 70  VAL C CG2 1 
ATOM   5855  N  N   . GLN C 1 71  ? 44.287  30.987  99.184  1.00 18.73  ? 71  GLN C N   1 
ATOM   5856  C  CA  . GLN C 1 71  ? 44.204  29.972  98.154  1.00 19.21  ? 71  GLN C CA  1 
ATOM   5857  C  C   . GLN C 1 71  ? 42.880  29.234  98.234  1.00 18.19  ? 71  GLN C C   1 
ATOM   5858  O  O   . GLN C 1 71  ? 42.484  28.798  99.309  1.00 18.16  ? 71  GLN C O   1 
ATOM   5859  C  CB  . GLN C 1 71  ? 45.322  28.931  98.312  1.00 19.29  ? 71  GLN C CB  1 
ATOM   5860  C  CG  . GLN C 1 71  ? 46.726  29.488  98.132  1.00 20.97  ? 71  GLN C CG  1 
ATOM   5861  C  CD  . GLN C 1 71  ? 47.836  28.433  98.215  1.00 21.46  ? 71  GLN C CD  1 
ATOM   5862  O  OE1 . GLN C 1 71  ? 47.671  27.343  98.787  1.00 23.09  ? 71  GLN C OE1 1 
ATOM   5863  N  NE2 . GLN C 1 71  ? 48.974  28.756  97.627  1.00 21.47  ? 71  GLN C NE2 1 
ATOM   5864  N  N   . ALA C 1 72  ? 42.210  29.074  97.096  1.00 17.23  ? 72  ALA C N   1 
ATOM   5865  C  CA  . ALA C 1 72  ? 41.137  28.092  96.976  1.00 17.05  ? 72  ALA C CA  1 
ATOM   5866  C  C   . ALA C 1 72  ? 41.751  26.698  96.785  1.00 16.84  ? 72  ALA C C   1 
ATOM   5867  O  O   . ALA C 1 72  ? 42.490  26.460  95.841  1.00 16.60  ? 72  ALA C O   1 
ATOM   5868  C  CB  . ALA C 1 72  ? 40.197  28.430  95.831  1.00 16.12  ? 72  ALA C CB  1 
ATOM   5869  N  N   . LEU C 1 73  ? 41.474  25.780  97.703  1.00 16.30  ? 73  LEU C N   1 
ATOM   5870  C  CA  . LEU C 1 73  ? 42.091  24.480  97.615  1.00 15.94  ? 73  LEU C CA  1 
ATOM   5871  C  C   . LEU C 1 73  ? 41.222  23.469  96.880  1.00 16.12  ? 73  LEU C C   1 
ATOM   5872  O  O   . LEU C 1 73  ? 40.026  23.324  97.193  1.00 16.65  ? 73  LEU C O   1 
ATOM   5873  C  CB  . LEU C 1 73  ? 42.435  23.982  98.992  1.00 15.79  ? 73  LEU C CB  1 
ATOM   5874  C  CG  . LEU C 1 73  ? 43.410  24.869  99.790  1.00 16.03  ? 73  LEU C CG  1 
ATOM   5875  C  CD1 . LEU C 1 73  ? 43.203  24.422  101.237 1.00 15.83  ? 73  LEU C CD1 1 
ATOM   5876  C  CD2 . LEU C 1 73  ? 44.874  24.787  99.329  1.00 14.54  ? 73  LEU C CD2 1 
ATOM   5877  N  N   . SER C 1 74  ? 41.810  22.807  95.881  1.00 15.12  ? 74  SER C N   1 
ATOM   5878  C  CA  . SER C 1 74  ? 41.141  21.737  95.178  1.00 15.48  ? 74  SER C CA  1 
ATOM   5879  C  C   . SER C 1 74  ? 42.069  20.500  95.169  1.00 15.67  ? 74  SER C C   1 
ATOM   5880  O  O   . SER C 1 74  ? 43.272  20.611  95.424  1.00 15.77  ? 74  SER C O   1 
ATOM   5881  C  CB  . SER C 1 74  ? 40.697  22.188  93.761  1.00 16.48  ? 74  SER C CB  1 
ATOM   5882  O  OG  . SER C 1 74  ? 41.770  22.592  92.854  1.00 17.15  ? 74  SER C OG  1 
ATOM   5883  N  N   . THR C 1 75  ? 41.508  19.316  94.951  1.00 15.84  ? 75  THR C N   1 
ATOM   5884  C  CA  . THR C 1 75  ? 42.312  18.106  94.849  1.00 15.71  ? 75  THR C CA  1 
ATOM   5885  C  C   . THR C 1 75  ? 43.021  18.074  93.467  1.00 16.51  ? 75  THR C C   1 
ATOM   5886  O  O   . THR C 1 75  ? 42.645  18.801  92.544  1.00 17.87  ? 75  THR C O   1 
ATOM   5887  C  CB  . THR C 1 75  ? 41.427  16.864  95.091  1.00 16.49  ? 75  THR C CB  1 
ATOM   5888  O  OG1 . THR C 1 75  ? 42.245  15.697  95.298  1.00 17.85  ? 75  THR C OG1 1 
ATOM   5889  C  CG2 . THR C 1 75  ? 40.462  16.625  93.923  1.00 14.92  ? 75  THR C CG2 1 
ATOM   5890  N  N   . VAL C 1 76  ? 44.066  17.275  93.326  1.00 16.50  ? 76  VAL C N   1 
ATOM   5891  C  CA  . VAL C 1 76  ? 44.770  17.130  92.061  1.00 16.37  ? 76  VAL C CA  1 
ATOM   5892  C  C   . VAL C 1 76  ? 43.832  16.396  91.069  1.00 16.56  ? 76  VAL C C   1 
ATOM   5893  O  O   . VAL C 1 76  ? 43.217  15.406  91.419  1.00 15.65  ? 76  VAL C O   1 
ATOM   5894  C  CB  . VAL C 1 76  ? 46.057  16.318  92.270  1.00 16.15  ? 76  VAL C CB  1 
ATOM   5895  C  CG1 . VAL C 1 76  ? 46.847  16.160  90.996  1.00 15.24  ? 76  VAL C CG1 1 
ATOM   5896  C  CG2 . VAL C 1 76  ? 46.924  16.961  93.333  1.00 17.49  ? 76  VAL C CG2 1 
ATOM   5897  N  N   . PRO C 1 77  ? 43.742  16.873  89.822  1.00 16.88  ? 77  PRO C N   1 
ATOM   5898  C  CA  . PRO C 1 77  ? 42.733  16.323  88.903  1.00 17.42  ? 77  PRO C CA  1 
ATOM   5899  C  C   . PRO C 1 77  ? 42.865  14.828  88.648  1.00 17.69  ? 77  PRO C C   1 
ATOM   5900  O  O   . PRO C 1 77  ? 41.882  14.141  88.350  1.00 17.55  ? 77  PRO C O   1 
ATOM   5901  C  CB  . PRO C 1 77  ? 42.970  17.139  87.617  1.00 17.71  ? 77  PRO C CB  1 
ATOM   5902  C  CG  . PRO C 1 77  ? 43.493  18.453  88.132  1.00 16.06  ? 77  PRO C CG  1 
ATOM   5903  C  CD  . PRO C 1 77  ? 44.469  17.994  89.202  1.00 16.24  ? 77  PRO C CD  1 
ATOM   5904  N  N   . VAL C 1 78  ? 44.059  14.299  88.807  1.00 18.60  ? 78  VAL C N   1 
ATOM   5905  C  CA  . VAL C 1 78  ? 44.218  12.857  88.713  1.00 19.83  ? 78  VAL C CA  1 
ATOM   5906  C  C   . VAL C 1 78  ? 43.320  12.029  89.680  1.00 19.76  ? 78  VAL C C   1 
ATOM   5907  O  O   . VAL C 1 78  ? 43.094  10.863  89.422  1.00 20.77  ? 78  VAL C O   1 
ATOM   5908  C  CB  . VAL C 1 78  ? 45.708  12.490  88.874  1.00 21.25  ? 78  VAL C CB  1 
ATOM   5909  C  CG1 . VAL C 1 78  ? 46.122  12.602  90.332  1.00 20.74  ? 78  VAL C CG1 1 
ATOM   5910  C  CG2 . VAL C 1 78  ? 46.035  11.115  88.260  1.00 21.27  ? 78  VAL C CG2 1 
ATOM   5911  N  N   . MET C 1 79  ? 42.798  12.648  90.739  1.00 19.19  ? 79  MET C N   1 
ATOM   5912  C  CA  . MET C 1 79  ? 41.981  12.010  91.764  1.00 19.38  ? 79  MET C CA  1 
ATOM   5913  C  C   . MET C 1 79  ? 40.481  12.020  91.477  1.00 18.89  ? 79  MET C C   1 
ATOM   5914  O  O   . MET C 1 79  ? 39.677  11.548  92.293  1.00 18.47  ? 79  MET C O   1 
ATOM   5915  C  CB  . MET C 1 79  ? 42.203  12.729  93.104  1.00 21.51  ? 79  MET C CB  1 
ATOM   5916  C  CG  . MET C 1 79  ? 43.621  12.712  93.632  1.00 23.62  ? 79  MET C CG  1 
ATOM   5917  S  SD  . MET C 1 79  ? 44.239  11.032  93.891  1.00 29.66  ? 79  MET C SD  1 
ATOM   5918  C  CE  . MET C 1 79  ? 43.341  10.457  95.341  1.00 26.44  ? 79  MET C CE  1 
ATOM   5919  N  N   . PHE C 1 80  ? 40.079  12.587  90.347  1.00 19.65  ? 80  PHE C N   1 
ATOM   5920  C  CA  . PHE C 1 80  ? 38.643  12.723  90.040  1.00 18.81  ? 80  PHE C CA  1 
ATOM   5921  C  C   . PHE C 1 80  ? 38.006  11.348  90.007  1.00 18.55  ? 80  PHE C C   1 
ATOM   5922  O  O   . PHE C 1 80  ? 36.867  11.158  90.445  1.00 18.59  ? 80  PHE C O   1 
ATOM   5923  C  CB  . PHE C 1 80  ? 38.431  13.348  88.663  1.00 20.07  ? 80  PHE C CB  1 
ATOM   5924  C  CG  . PHE C 1 80  ? 38.644  14.850  88.601  1.00 20.03  ? 80  PHE C CG  1 
ATOM   5925  C  CD1 . PHE C 1 80  ? 38.507  15.657  89.727  1.00 19.63  ? 80  PHE C CD1 1 
ATOM   5926  C  CD2 . PHE C 1 80  ? 38.935  15.454  87.383  1.00 18.06  ? 80  PHE C CD2 1 
ATOM   5927  C  CE1 . PHE C 1 80  ? 38.716  17.031  89.641  1.00 19.47  ? 80  PHE C CE1 1 
ATOM   5928  C  CE2 . PHE C 1 80  ? 39.101  16.823  87.291  1.00 18.39  ? 80  PHE C CE2 1 
ATOM   5929  C  CZ  . PHE C 1 80  ? 38.977  17.617  88.406  1.00 18.36  ? 80  PHE C CZ  1 
ATOM   5930  N  N   . SER C 1 81  ? 38.773  10.414  89.451  1.00 17.47  ? 81  SER C N   1 
ATOM   5931  C  CA  . SER C 1 81  ? 38.411  9.021   89.277  1.00 18.08  ? 81  SER C CA  1 
ATOM   5932  C  C   . SER C 1 81  ? 37.011  8.787   88.693  1.00 16.96  ? 81  SER C C   1 
ATOM   5933  O  O   . SER C 1 81  ? 36.276  7.955   89.183  1.00 17.18  ? 81  SER C O   1 
ATOM   5934  C  CB  . SER C 1 81  ? 38.619  8.279   90.607  1.00 17.72  ? 81  SER C CB  1 
ATOM   5935  O  OG  . SER C 1 81  ? 39.745  8.833   91.275  1.00 18.57  ? 81  SER C OG  1 
ATOM   5936  N  N   . TYR C 1 82  ? 36.650  9.525   87.657  1.00 15.95  ? 82  TYR C N   1 
ATOM   5937  C  CA  . TYR C 1 82  ? 35.341  9.365   87.058  1.00 17.24  ? 82  TYR C CA  1 
ATOM   5938  C  C   . TYR C 1 82  ? 35.112  7.983   86.414  1.00 18.50  ? 82  TYR C C   1 
ATOM   5939  O  O   . TYR C 1 82  ? 33.982  7.617   86.163  1.00 19.69  ? 82  TYR C O   1 
ATOM   5940  C  CB  . TYR C 1 82  ? 35.083  10.455  86.020  1.00 16.49  ? 82  TYR C CB  1 
ATOM   5941  C  CG  . TYR C 1 82  ? 35.062  11.888  86.535  1.00 16.03  ? 82  TYR C CG  1 
ATOM   5942  C  CD1 . TYR C 1 82  ? 34.759  12.176  87.870  1.00 15.19  ? 82  TYR C CD1 1 
ATOM   5943  C  CD2 . TYR C 1 82  ? 35.307  12.978  85.659  1.00 15.78  ? 82  TYR C CD2 1 
ATOM   5944  C  CE1 . TYR C 1 82  ? 34.717  13.479  88.334  1.00 15.74  ? 82  TYR C CE1 1 
ATOM   5945  C  CE2 . TYR C 1 82  ? 35.270  14.305  86.130  1.00 15.71  ? 82  TYR C CE2 1 
ATOM   5946  C  CZ  . TYR C 1 82  ? 34.978  14.536  87.471  1.00 15.87  ? 82  TYR C CZ  1 
ATOM   5947  O  OH  . TYR C 1 82  ? 34.927  15.814  87.984  1.00 16.68  ? 82  TYR C OH  1 
ATOM   5948  N  N   . TRP C 1 83  ? 36.179  7.226   86.183  1.00 19.57  ? 83  TRP C N   1 
ATOM   5949  C  CA  . TRP C 1 83  ? 36.172  5.974   85.441  1.00 20.93  ? 83  TRP C CA  1 
ATOM   5950  C  C   . TRP C 1 83  ? 35.883  4.782   86.284  1.00 23.45  ? 83  TRP C C   1 
ATOM   5951  O  O   . TRP C 1 83  ? 35.869  3.645   85.789  1.00 25.07  ? 83  TRP C O   1 
ATOM   5952  C  CB  . TRP C 1 83  ? 37.541  5.784   84.845  1.00 21.65  ? 83  TRP C CB  1 
ATOM   5953  C  CG  . TRP C 1 83  ? 38.606  5.960   85.898  1.00 25.57  ? 83  TRP C CG  1 
ATOM   5954  C  CD1 . TRP C 1 83  ? 39.328  7.127   86.224  1.00 25.63  ? 83  TRP C CD1 1 
ATOM   5955  C  CD2 . TRP C 1 83  ? 39.090  4.941   86.844  1.00 25.73  ? 83  TRP C CD2 1 
ATOM   5956  N  NE1 . TRP C 1 83  ? 40.203  6.887   87.259  1.00 24.41  ? 83  TRP C NE1 1 
ATOM   5957  C  CE2 . TRP C 1 83  ? 40.104  5.615   87.691  1.00 24.51  ? 83  TRP C CE2 1 
ATOM   5958  C  CE3 . TRP C 1 83  ? 38.809  3.588   87.057  1.00 25.77  ? 83  TRP C CE3 1 
ATOM   5959  C  CZ2 . TRP C 1 83  ? 40.794  4.943   88.683  1.00 25.62  ? 83  TRP C CZ2 1 
ATOM   5960  C  CZ3 . TRP C 1 83  ? 39.515  2.918   88.067  1.00 26.66  ? 83  TRP C CZ3 1 
ATOM   5961  C  CH2 . TRP C 1 83  ? 40.483  3.586   88.861  1.00 27.36  ? 83  TRP C CH2 1 
ATOM   5962  N  N   . ALA C 1 84  ? 35.689  5.014   87.578  1.00 23.01  ? 84  ALA C N   1 
ATOM   5963  C  CA  . ALA C 1 84  ? 35.504  3.926   88.521  1.00 22.76  ? 84  ALA C CA  1 
ATOM   5964  C  C   . ALA C 1 84  ? 34.014  3.695   88.779  1.00 23.13  ? 84  ALA C C   1 
ATOM   5965  O  O   . ALA C 1 84  ? 33.175  4.421   88.255  1.00 20.83  ? 84  ALA C O   1 
ATOM   5966  C  CB  . ALA C 1 84  ? 36.254  4.241   89.814  1.00 22.17  ? 84  ALA C CB  1 
ATOM   5967  N  N   . LYS C 1 85  ? 33.685  2.668   89.559  1.00 25.67  ? 85  LYS C N   1 
ATOM   5968  C  CA  . LYS C 1 85  ? 32.291  2.426   89.962  1.00 29.51  ? 85  LYS C CA  1 
ATOM   5969  C  C   . LYS C 1 85  ? 31.788  3.622   90.772  1.00 28.48  ? 85  LYS C C   1 
ATOM   5970  O  O   . LYS C 1 85  ? 32.500  4.154   91.597  1.00 25.71  ? 85  LYS C O   1 
ATOM   5971  C  CB  . LYS C 1 85  ? 32.145  1.122   90.769  1.00 31.96  ? 85  LYS C CB  1 
ATOM   5972  C  CG  . LYS C 1 85  ? 32.528  -0.139  89.986  1.00 37.84  ? 85  LYS C CG  1 
ATOM   5973  C  CD  . LYS C 1 85  ? 32.496  -1.397  90.863  1.00 42.27  ? 85  LYS C CD  1 
ATOM   5974  C  CE  . LYS C 1 85  ? 33.098  -2.611  90.150  1.00 41.34  ? 85  LYS C CE  1 
ATOM   5975  N  NZ  . LYS C 1 85  ? 32.713  -3.872  90.853  1.00 42.09  ? 85  LYS C NZ  1 
ATOM   5976  N  N   . PRO C 1 86  ? 30.562  4.060   90.507  1.00 29.51  ? 86  PRO C N   1 
ATOM   5977  C  CA  . PRO C 1 86  ? 30.027  5.207   91.224  1.00 31.53  ? 86  PRO C CA  1 
ATOM   5978  C  C   . PRO C 1 86  ? 30.269  5.166   92.764  1.00 36.24  ? 86  PRO C C   1 
ATOM   5979  O  O   . PRO C 1 86  ? 30.933  6.080   93.278  1.00 41.46  ? 86  PRO C O   1 
ATOM   5980  C  CB  . PRO C 1 86  ? 28.533  5.174   90.874  1.00 31.98  ? 86  PRO C CB  1 
ATOM   5981  C  CG  . PRO C 1 86  ? 28.471  4.430   89.561  1.00 29.89  ? 86  PRO C CG  1 
ATOM   5982  C  CD  . PRO C 1 86  ? 29.566  3.410   89.636  1.00 28.90  ? 86  PRO C CD  1 
ATOM   5983  N  N   . GLU C 1 87  ? 29.790  4.138   93.488  1.00 36.50  ? 87  GLU C N   1 
ATOM   5984  C  CA  . GLU C 1 87  ? 29.866  4.118   94.983  1.00 33.93  ? 87  GLU C CA  1 
ATOM   5985  C  C   . GLU C 1 87  ? 31.282  4.365   95.521  1.00 30.50  ? 87  GLU C C   1 
ATOM   5986  O  O   . GLU C 1 87  ? 31.459  4.999   96.546  1.00 30.22  ? 87  GLU C O   1 
ATOM   5987  C  CB  . GLU C 1 87  ? 29.356  2.795   95.583  1.00 37.05  ? 87  GLU C CB  1 
ATOM   5988  C  CG  . GLU C 1 87  ? 27.878  2.440   95.439  1.00 42.71  ? 87  GLU C CG  1 
ATOM   5989  C  CD  . GLU C 1 87  ? 26.958  3.636   95.298  1.00 48.41  ? 87  GLU C CD  1 
ATOM   5990  O  OE1 . GLU C 1 87  ? 26.926  4.508   96.214  1.00 50.69  ? 87  GLU C OE1 1 
ATOM   5991  O  OE2 . GLU C 1 87  ? 26.250  3.690   94.262  1.00 49.92  ? 87  GLU C OE2 1 
ATOM   5992  N  N   . ASP C 1 88  ? 32.272  3.832   94.815  1.00 28.78  ? 88  ASP C N   1 
ATOM   5993  C  CA  . ASP C 1 88  ? 33.689  3.964   95.159  1.00 27.22  ? 88  ASP C CA  1 
ATOM   5994  C  C   . ASP C 1 88  ? 34.183  5.400   94.987  1.00 25.29  ? 88  ASP C C   1 
ATOM   5995  O  O   . ASP C 1 88  ? 34.812  5.962   95.880  1.00 25.91  ? 88  ASP C O   1 
ATOM   5996  C  CB  . ASP C 1 88  ? 34.540  2.964   94.345  1.00 25.82  ? 88  ASP C CB  1 
ATOM   5997  C  CG  . ASP C 1 88  ? 34.075  1.488   94.549  1.00 27.43  ? 88  ASP C CG  1 
ATOM   5998  O  OD1 . ASP C 1 88  ? 33.146  1.305   95.370  1.00 24.73  ? 88  ASP C OD1 1 
ATOM   5999  O  OD2 . ASP C 1 88  ? 34.619  0.534   93.895  1.00 25.96  ? 88  ASP C OD2 1 
ATOM   6000  N  N   . THR C 1 89  ? 33.903  5.994   93.841  1.00 23.30  ? 89  THR C N   1 
ATOM   6001  C  CA  . THR C 1 89  ? 34.222  7.388   93.644  1.00 22.31  ? 89  THR C CA  1 
ATOM   6002  C  C   . THR C 1 89  ? 33.589  8.268   94.730  1.00 22.63  ? 89  THR C C   1 
ATOM   6003  O  O   . THR C 1 89  ? 34.259  9.165   95.218  1.00 22.83  ? 89  THR C O   1 
ATOM   6004  C  CB  . THR C 1 89  ? 33.812  7.855   92.245  1.00 22.38  ? 89  THR C CB  1 
ATOM   6005  O  OG1 . THR C 1 89  ? 34.517  7.065   91.269  1.00 21.48  ? 89  THR C OG1 1 
ATOM   6006  C  CG2 . THR C 1 89  ? 34.159  9.332   92.058  1.00 21.98  ? 89  THR C CG2 1 
ATOM   6007  N  N   . LEU C 1 90  ? 32.340  7.988   95.133  1.00 22.70  ? 90  LEU C N   1 
ATOM   6008  C  CA  . LEU C 1 90  ? 31.705  8.727   96.235  1.00 23.37  ? 90  LEU C CA  1 
ATOM   6009  C  C   . LEU C 1 90  ? 32.499  8.561   97.513  1.00 24.12  ? 90  LEU C C   1 
ATOM   6010  O  O   . LEU C 1 90  ? 32.647  9.505   98.291  1.00 26.45  ? 90  LEU C O   1 
ATOM   6011  C  CB  . LEU C 1 90  ? 30.259  8.297   96.505  1.00 23.28  ? 90  LEU C CB  1 
ATOM   6012  C  CG  . LEU C 1 90  ? 29.613  9.170   97.626  1.00 23.38  ? 90  LEU C CG  1 
ATOM   6013  C  CD1 . LEU C 1 90  ? 29.315  10.611  97.185  1.00 20.69  ? 90  LEU C CD1 1 
ATOM   6014  C  CD2 . LEU C 1 90  ? 28.357  8.514   98.181  1.00 22.61  ? 90  LEU C CD2 1 
ATOM   6015  N  N   . ASN C 1 91  ? 33.024  7.362   97.712  1.00 23.32  ? 91  ASN C N   1 
ATOM   6016  C  CA  . ASN C 1 91  ? 33.746  7.057   98.912  1.00 23.36  ? 91  ASN C CA  1 
ATOM   6017  C  C   . ASN C 1 91  ? 34.995  7.927   98.970  1.00 23.21  ? 91  ASN C C   1 
ATOM   6018  O  O   . ASN C 1 91  ? 35.166  8.693   99.917  1.00 23.23  ? 91  ASN C O   1 
ATOM   6019  C  CB  . ASN C 1 91  ? 34.056  5.559   98.962  1.00 24.69  ? 91  ASN C CB  1 
ATOM   6020  C  CG  . ASN C 1 91  ? 34.582  5.105   100.317 1.00 27.12  ? 91  ASN C CG  1 
ATOM   6021  O  OD1 . ASN C 1 91  ? 35.729  5.393   100.681 1.00 30.08  ? 91  ASN C OD1 1 
ATOM   6022  N  ND2 . ASN C 1 91  ? 33.774  4.353   101.041 1.00 25.49  ? 91  ASN C ND2 1 
ATOM   6023  N  N   . LEU C 1 92  ? 35.823  7.867   97.923  1.00 23.16  ? 92  LEU C N   1 
ATOM   6024  C  CA  . LEU C 1 92  ? 37.069  8.640   97.867  1.00 21.94  ? 92  LEU C CA  1 
ATOM   6025  C  C   . LEU C 1 92  ? 36.780  10.121  97.971  1.00 23.86  ? 92  LEU C C   1 
ATOM   6026  O  O   . LEU C 1 92  ? 37.551  10.877  98.604  1.00 24.26  ? 92  LEU C O   1 
ATOM   6027  C  CB  . LEU C 1 92  ? 37.825  8.341   96.567  1.00 22.79  ? 92  LEU C CB  1 
ATOM   6028  C  CG  . LEU C 1 92  ? 39.068  9.164   96.224  1.00 20.11  ? 92  LEU C CG  1 
ATOM   6029  C  CD1 . LEU C 1 92  ? 40.112  9.000   97.313  1.00 20.71  ? 92  LEU C CD1 1 
ATOM   6030  C  CD2 . LEU C 1 92  ? 39.613  8.746   94.883  1.00 19.48  ? 92  LEU C CD2 1 
ATOM   6031  N  N   . CYS C 1 93  ? 35.648  10.532  97.382  1.00 24.12  ? 93  CYS C N   1 
ATOM   6032  C  CA  . CYS C 1 93  ? 35.223  11.905  97.471  1.00 24.74  ? 93  CYS C CA  1 
ATOM   6033  C  C   . CYS C 1 93  ? 35.078  12.337  98.888  1.00 25.20  ? 93  CYS C C   1 
ATOM   6034  O  O   . CYS C 1 93  ? 35.596  13.383  99.240  1.00 26.98  ? 93  CYS C O   1 
ATOM   6035  C  CB  . CYS C 1 93  ? 33.935  12.168  96.719  1.00 25.36  ? 93  CYS C CB  1 
ATOM   6036  S  SG  . CYS C 1 93  ? 34.323  12.311  94.977  1.00 34.28  ? 93  CYS C SG  1 
ATOM   6037  N  N   . GLN C 1 94  ? 34.362  11.554  99.689  1.00 25.78  ? 94  GLN C N   1 
ATOM   6038  C  CA  . GLN C 1 94  ? 34.105  11.917  101.092 1.00 26.86  ? 94  GLN C CA  1 
ATOM   6039  C  C   . GLN C 1 94  ? 35.440  12.050  101.787 1.00 24.73  ? 94  GLN C C   1 
ATOM   6040  O  O   . GLN C 1 94  ? 35.739  13.031  102.453 1.00 24.80  ? 94  GLN C O   1 
ATOM   6041  C  CB  . GLN C 1 94  ? 33.249  10.847  101.794 1.00 29.05  ? 94  GLN C CB  1 
ATOM   6042  C  CG  . GLN C 1 94  ? 31.803  11.266  101.927 1.00 33.51  ? 94  GLN C CG  1 
ATOM   6043  C  CD  . GLN C 1 94  ? 30.823  10.196  101.534 1.00 35.37  ? 94  GLN C CD  1 
ATOM   6044  O  OE1 . GLN C 1 94  ? 31.177  9.031   101.364 1.00 42.42  ? 94  GLN C OE1 1 
ATOM   6045  N  NE2 . GLN C 1 94  ? 29.570  10.585  101.387 1.00 38.19  ? 94  GLN C NE2 1 
ATOM   6046  N  N   . LEU C 1 95  ? 36.267  11.061  101.583 1.00 23.26  ? 95  LEU C N   1 
ATOM   6047  C  CA  . LEU C 1 95  ? 37.573  11.088  102.145 1.00 24.03  ? 95  LEU C CA  1 
ATOM   6048  C  C   . LEU C 1 95  ? 38.297  12.399  101.716 1.00 23.69  ? 95  LEU C C   1 
ATOM   6049  O  O   . LEU C 1 95  ? 38.809  13.115  102.567 1.00 24.99  ? 95  LEU C O   1 
ATOM   6050  C  CB  . LEU C 1 95  ? 38.279  9.799   101.722 1.00 24.41  ? 95  LEU C CB  1 
ATOM   6051  C  CG  . LEU C 1 95  ? 39.656  9.552   102.279 1.00 28.12  ? 95  LEU C CG  1 
ATOM   6052  C  CD1 . LEU C 1 95  ? 39.986  8.074   102.177 1.00 29.95  ? 95  LEU C CD1 1 
ATOM   6053  C  CD2 . LEU C 1 95  ? 40.630  10.385  101.469 1.00 27.93  ? 95  LEU C CD2 1 
ATOM   6054  N  N   . LEU C 1 96  ? 38.263  12.749  100.425 1.00 21.40  ? 96  LEU C N   1 
ATOM   6055  C  CA  . LEU C 1 96  ? 38.967  13.960  99.931  1.00 19.25  ? 96  LEU C CA  1 
ATOM   6056  C  C   . LEU C 1 96  ? 38.284  15.262  100.356 1.00 18.06  ? 96  LEU C C   1 
ATOM   6057  O  O   . LEU C 1 96  ? 38.928  16.230  100.743 1.00 18.48  ? 96  LEU C O   1 
ATOM   6058  C  CB  . LEU C 1 96  ? 39.126  13.930  98.407  1.00 18.00  ? 96  LEU C CB  1 
ATOM   6059  C  CG  . LEU C 1 96  ? 40.035  12.829  97.823  1.00 18.06  ? 96  LEU C CG  1 
ATOM   6060  C  CD1 . LEU C 1 96  ? 39.846  12.702  96.320  1.00 16.23  ? 96  LEU C CD1 1 
ATOM   6061  C  CD2 . LEU C 1 96  ? 41.506  13.058  98.173  1.00 16.49  ? 96  LEU C CD2 1 
ATOM   6062  N  N   . ASN C 1 97  ? 36.971  15.291  100.318 1.00 17.51  ? 97  ASN C N   1 
ATOM   6063  C  CA  . ASN C 1 97  ? 36.294  16.481  100.738 1.00 16.74  ? 97  ASN C CA  1 
ATOM   6064  C  C   . ASN C 1 97  ? 36.431  16.712  102.251 1.00 15.59  ? 97  ASN C C   1 
ATOM   6065  O  O   . ASN C 1 97  ? 36.615  17.838  102.663 1.00 14.16  ? 97  ASN C O   1 
ATOM   6066  C  CB  . ASN C 1 97  ? 34.839  16.481  100.243 1.00 16.56  ? 97  ASN C CB  1 
ATOM   6067  C  CG  . ASN C 1 97  ? 34.728  16.529  98.694  1.00 17.06  ? 97  ASN C CG  1 
ATOM   6068  O  OD1 . ASN C 1 97  ? 35.653  16.987  97.933  1.00 15.75  ? 97  ASN C OD1 1 
ATOM   6069  N  ND2 . ASN C 1 97  ? 33.611  16.012  98.213  1.00 15.38  ? 97  ASN C ND2 1 
ATOM   6070  N  N   . ASN C 1 98  ? 36.389  15.647  103.059 1.00 15.54  ? 98  ASN C N   1 
ATOM   6071  C  CA  . ASN C 1 98  ? 36.561  15.786  104.532 1.00 15.95  ? 98  ASN C CA  1 
ATOM   6072  C  C   . ASN C 1 98  ? 37.960  16.221  104.883 1.00 15.19  ? 98  ASN C C   1 
ATOM   6073  O  O   . ASN C 1 98  ? 38.161  16.975  105.810 1.00 13.69  ? 98  ASN C O   1 
ATOM   6074  C  CB  . ASN C 1 98  ? 36.250  14.503  105.283 1.00 16.61  ? 98  ASN C CB  1 
ATOM   6075  C  CG  . ASN C 1 98  ? 34.813  14.054  105.106 1.00 17.78  ? 98  ASN C CG  1 
ATOM   6076  O  OD1 . ASN C 1 98  ? 33.912  14.868  104.828 1.00 17.80  ? 98  ASN C OD1 1 
ATOM   6077  N  ND2 . ASN C 1 98  ? 34.587  12.754  105.260 1.00 16.47  ? 98  ASN C ND2 1 
ATOM   6078  N  N   . ASP C 1 99  ? 38.931  15.781  104.111 1.00 16.62  ? 99  ASP C N   1 
ATOM   6079  C  CA  . ASP C 1 99  ? 40.263  16.278  104.360 1.00 19.32  ? 99  ASP C CA  1 
ATOM   6080  C  C   . ASP C 1 99  ? 40.374  17.766  104.026 1.00 19.78  ? 99  ASP C C   1 
ATOM   6081  O  O   . ASP C 1 99  ? 40.899  18.535  104.843 1.00 21.70  ? 99  ASP C O   1 
ATOM   6082  C  CB  . ASP C 1 99  ? 41.296  15.456  103.627 1.00 22.56  ? 99  ASP C CB  1 
ATOM   6083  C  CG  . ASP C 1 99  ? 42.696  15.941  103.872 1.00 26.61  ? 99  ASP C CG  1 
ATOM   6084  O  OD1 . ASP C 1 99  ? 43.288  15.524  104.895 1.00 28.13  ? 99  ASP C OD1 1 
ATOM   6085  O  OD2 . ASP C 1 99  ? 43.212  16.725  103.011 1.00 33.17  ? 99  ASP C OD2 1 
ATOM   6086  N  N   . LEU C 1 100 ? 39.819  18.182  102.890 1.00 18.05  ? 100 LEU C N   1 
ATOM   6087  C  CA  . LEU C 1 100 ? 39.919  19.564  102.472 1.00 19.00  ? 100 LEU C CA  1 
ATOM   6088  C  C   . LEU C 1 100 ? 39.294  20.428  103.575 1.00 17.47  ? 100 LEU C C   1 
ATOM   6089  O  O   . LEU C 1 100 ? 39.830  21.483  103.945 1.00 16.58  ? 100 LEU C O   1 
ATOM   6090  C  CB  . LEU C 1 100 ? 39.175  19.835  101.145 1.00 20.10  ? 100 LEU C CB  1 
ATOM   6091  C  CG  . LEU C 1 100 ? 39.649  19.943  99.693  1.00 24.50  ? 100 LEU C CG  1 
ATOM   6092  C  CD1 . LEU C 1 100 ? 40.136  18.647  99.049  1.00 25.52  ? 100 LEU C CD1 1 
ATOM   6093  C  CD2 . LEU C 1 100 ? 38.487  20.472  98.830  1.00 24.19  ? 100 LEU C CD2 1 
ATOM   6094  N  N   . ALA C 1 101 ? 38.144  19.996  104.060 1.00 15.70  ? 101 ALA C N   1 
ATOM   6095  C  CA  . ALA C 1 101 ? 37.460  20.752  105.103 1.00 16.03  ? 101 ALA C CA  1 
ATOM   6096  C  C   . ALA C 1 101 ? 38.387  20.946  106.302 1.00 15.43  ? 101 ALA C C   1 
ATOM   6097  O  O   . ALA C 1 101 ? 38.444  22.036  106.835 1.00 16.36  ? 101 ALA C O   1 
ATOM   6098  C  CB  . ALA C 1 101 ? 36.160  20.086  105.509 1.00 14.94  ? 101 ALA C CB  1 
ATOM   6099  N  N   . SER C 1 102 ? 39.167  19.939  106.672 1.00 15.95  ? 102 SER C N   1 
ATOM   6100  C  CA  . SER C 1 102 ? 40.065  20.068  107.841 1.00 16.80  ? 102 SER C CA  1 
ATOM   6101  C  C   . SER C 1 102 ? 41.138  21.069  107.616 1.00 16.06  ? 102 SER C C   1 
ATOM   6102  O  O   . SER C 1 102 ? 41.520  21.720  108.544 1.00 16.50  ? 102 SER C O   1 
ATOM   6103  C  CB  . SER C 1 102 ? 40.785  18.775  108.190 1.00 17.54  ? 102 SER C CB  1 
ATOM   6104  O  OG  . SER C 1 102 ? 39.822  17.794  108.478 1.00 22.28  ? 102 SER C OG  1 
ATOM   6105  N  N   . THR C 1 103 ? 41.687  21.147  106.406 1.00 15.52  ? 103 THR C N   1 
ATOM   6106  C  CA  . THR C 1 103 ? 42.745  22.103  106.154 1.00 14.48  ? 103 THR C CA  1 
ATOM   6107  C  C   . THR C 1 103 ? 42.142  23.527  106.302 1.00 14.44  ? 103 THR C C   1 
ATOM   6108  O  O   . THR C 1 103 ? 42.771  24.424  106.873 1.00 15.35  ? 103 THR C O   1 
ATOM   6109  C  CB  . THR C 1 103 ? 43.389  21.785  104.800 1.00 14.83  ? 103 THR C CB  1 
ATOM   6110  O  OG1 . THR C 1 103 ? 43.946  20.465  104.841 1.00 13.36  ? 103 THR C OG1 1 
ATOM   6111  C  CG2 . THR C 1 103 ? 44.475  22.808  104.378 1.00 13.63  ? 103 THR C CG2 1 
ATOM   6112  N  N   . VAL C 1 104 ? 40.880  23.692  105.911 1.00 13.83  ? 104 VAL C N   1 
ATOM   6113  C  CA  . VAL C 1 104 ? 40.223  24.986  105.895 1.00 13.66  ? 104 VAL C CA  1 
ATOM   6114  C  C   . VAL C 1 104 ? 39.859  25.417  107.319 1.00 14.65  ? 104 VAL C C   1 
ATOM   6115  O  O   . VAL C 1 104 ? 40.080  26.573  107.695 1.00 14.85  ? 104 VAL C O   1 
ATOM   6116  C  CB  . VAL C 1 104 ? 38.945  24.960  105.019 1.00 13.45  ? 104 VAL C CB  1 
ATOM   6117  C  CG1 . VAL C 1 104 ? 38.127  26.223  105.227 1.00 12.95  ? 104 VAL C CG1 1 
ATOM   6118  C  CG2 . VAL C 1 104 ? 39.273  24.796  103.529 1.00 13.17  ? 104 VAL C CG2 1 
ATOM   6119  N  N   . VAL C 1 105 ? 39.245  24.512  108.091 1.00 14.42  ? 105 VAL C N   1 
ATOM   6120  C  CA  . VAL C 1 105 ? 38.952  24.749  109.496 1.00 15.08  ? 105 VAL C CA  1 
ATOM   6121  C  C   . VAL C 1 105 ? 40.226  25.250  110.191 1.00 15.93  ? 105 VAL C C   1 
ATOM   6122  O  O   . VAL C 1 105 ? 40.196  26.199  110.993 1.00 16.10  ? 105 VAL C O   1 
ATOM   6123  C  CB  . VAL C 1 105 ? 38.532  23.430  110.188 1.00 15.87  ? 105 VAL C CB  1 
ATOM   6124  C  CG1 . VAL C 1 105 ? 38.720  23.555  111.684 1.00 15.45  ? 105 VAL C CG1 1 
ATOM   6125  C  CG2 . VAL C 1 105 ? 37.091  23.043  109.822 1.00 14.76  ? 105 VAL C CG2 1 
ATOM   6126  N  N   . SER C 1 106 ? 41.356  24.653  109.831 1.00 17.06  ? 106 SER C N   1 
ATOM   6127  C  CA  . SER C 1 106 ? 42.652  25.065  110.364 1.00 18.71  ? 106 SER C CA  1 
ATOM   6128  C  C   . SER C 1 106 ? 43.057  26.524  110.102 1.00 21.07  ? 106 SER C C   1 
ATOM   6129  O  O   . SER C 1 106 ? 43.706  27.161  110.937 1.00 19.88  ? 106 SER C O   1 
ATOM   6130  C  CB  . SER C 1 106 ? 43.731  24.126  109.853 1.00 18.63  ? 106 SER C CB  1 
ATOM   6131  O  OG  . SER C 1 106 ? 43.853  23.018  110.748 1.00 21.94  ? 106 SER C OG  1 
ATOM   6132  N  N   . TYR C 1 107 ? 42.701  27.053  108.928 1.00 22.89  ? 107 TYR C N   1 
ATOM   6133  C  CA  . TYR C 1 107 ? 43.075  28.407  108.603 1.00 22.77  ? 107 TYR C CA  1 
ATOM   6134  C  C   . TYR C 1 107 ? 41.944  29.011  107.841 1.00 21.99  ? 107 TYR C C   1 
ATOM   6135  O  O   . TYR C 1 107 ? 42.089  29.264  106.680 1.00 21.00  ? 107 TYR C O   1 
ATOM   6136  C  CB  . TYR C 1 107 ? 44.352  28.420  107.766 1.00 24.89  ? 107 TYR C CB  1 
ATOM   6137  C  CG  . TYR C 1 107 ? 45.512  27.725  108.435 1.00 27.86  ? 107 TYR C CG  1 
ATOM   6138  C  CD1 . TYR C 1 107 ? 46.328  28.411  109.341 1.00 29.54  ? 107 TYR C CD1 1 
ATOM   6139  C  CD2 . TYR C 1 107 ? 45.795  26.380  108.175 1.00 28.92  ? 107 TYR C CD2 1 
ATOM   6140  C  CE1 . TYR C 1 107 ? 47.403  27.781  109.969 1.00 31.73  ? 107 TYR C CE1 1 
ATOM   6141  C  CE2 . TYR C 1 107 ? 46.861  25.731  108.796 1.00 31.26  ? 107 TYR C CE2 1 
ATOM   6142  C  CZ  . TYR C 1 107 ? 47.659  26.436  109.698 1.00 34.34  ? 107 TYR C CZ  1 
ATOM   6143  O  OH  . TYR C 1 107 ? 48.717  25.807  110.335 1.00 39.47  ? 107 TYR C OH  1 
ATOM   6144  N  N   . PRO C 1 108 ? 40.810  29.257  108.502 1.00 23.49  ? 108 PRO C N   1 
ATOM   6145  C  CA  . PRO C 1 108 ? 39.629  29.694  107.746 1.00 24.76  ? 108 PRO C CA  1 
ATOM   6146  C  C   . PRO C 1 108 ? 39.796  31.097  107.150 1.00 27.13  ? 108 PRO C C   1 
ATOM   6147  O  O   . PRO C 1 108 ? 38.940  31.553  106.396 1.00 29.17  ? 108 PRO C O   1 
ATOM   6148  C  CB  . PRO C 1 108 ? 38.495  29.665  108.799 1.00 23.82  ? 108 PRO C CB  1 
ATOM   6149  C  CG  . PRO C 1 108 ? 39.193  29.829  110.118 1.00 22.48  ? 108 PRO C CG  1 
ATOM   6150  C  CD  . PRO C 1 108 ? 40.624  29.389  109.967 1.00 23.01  ? 108 PRO C CD  1 
ATOM   6151  N  N   . ARG C 1 109 ? 40.882  31.780  107.481 1.00 28.24  ? 109 ARG C N   1 
ATOM   6152  C  CA  . ARG C 1 109 ? 41.143  33.072  106.874 1.00 29.68  ? 109 ARG C CA  1 
ATOM   6153  C  C   . ARG C 1 109 ? 42.214  32.962  105.786 1.00 26.95  ? 109 ARG C C   1 
ATOM   6154  O  O   . ARG C 1 109 ? 42.575  33.956  105.165 1.00 28.56  ? 109 ARG C O   1 
ATOM   6155  C  CB  . ARG C 1 109 ? 41.510  34.113  107.942 1.00 34.85  ? 109 ARG C CB  1 
ATOM   6156  C  CG  . ARG C 1 109 ? 40.367  34.416  108.925 1.00 39.65  ? 109 ARG C CG  1 
ATOM   6157  C  CD  . ARG C 1 109 ? 40.561  35.752  109.653 1.00 47.71  ? 109 ARG C CD  1 
ATOM   6158  N  NE  . ARG C 1 109 ? 41.877  35.884  110.300 1.00 54.33  ? 109 ARG C NE  1 
ATOM   6159  C  CZ  . ARG C 1 109 ? 42.108  35.891  111.623 1.00 67.29  ? 109 ARG C CZ  1 
ATOM   6160  N  NH1 . ARG C 1 109 ? 41.111  35.768  112.505 1.00 63.49  ? 109 ARG C NH1 1 
ATOM   6161  N  NH2 . ARG C 1 109 ? 43.358  36.025  112.076 1.00 69.70  ? 109 ARG C NH2 1 
ATOM   6162  N  N   . ARG C 1 110 ? 42.702  31.757  105.522 1.00 21.81  ? 110 ARG C N   1 
ATOM   6163  C  CA  . ARG C 1 110 ? 43.675  31.596  104.479 1.00 20.81  ? 110 ARG C CA  1 
ATOM   6164  C  C   . ARG C 1 110 ? 43.231  30.615  103.395 1.00 20.94  ? 110 ARG C C   1 
ATOM   6165  O  O   . ARG C 1 110 ? 43.837  30.554  102.302 1.00 20.39  ? 110 ARG C O   1 
ATOM   6166  C  CB  . ARG C 1 110 ? 45.057  31.226  105.047 1.00 20.36  ? 110 ARG C CB  1 
ATOM   6167  C  CG  . ARG C 1 110 ? 45.465  32.057  106.274 1.00 21.97  ? 110 ARG C CG  1 
ATOM   6168  C  CD  . ARG C 1 110 ? 45.756  33.532  106.008 1.00 20.33  ? 110 ARG C CD  1 
ATOM   6169  N  NE  . ARG C 1 110 ? 46.633  33.815  104.862 1.00 18.91  ? 110 ARG C NE  1 
ATOM   6170  C  CZ  . ARG C 1 110 ? 47.960  33.863  104.925 1.00 18.43  ? 110 ARG C CZ  1 
ATOM   6171  N  NH1 . ARG C 1 110 ? 48.601  33.606  106.050 1.00 17.51  ? 110 ARG C NH1 1 
ATOM   6172  N  NH2 . ARG C 1 110 ? 48.658  34.181  103.855 1.00 17.57  ? 110 ARG C NH2 1 
ATOM   6173  N  N   . PHE C 1 111 ? 42.182  29.842  103.658 1.00 18.93  ? 111 PHE C N   1 
ATOM   6174  C  CA  . PHE C 1 111 ? 41.776  28.896  102.656 1.00 18.41  ? 111 PHE C CA  1 
ATOM   6175  C  C   . PHE C 1 111 ? 40.277  28.888  102.446 1.00 18.47  ? 111 PHE C C   1 
ATOM   6176  O  O   . PHE C 1 111 ? 39.543  29.284  103.326 1.00 21.21  ? 111 PHE C O   1 
ATOM   6177  C  CB  . PHE C 1 111 ? 42.227  27.537  103.095 1.00 18.49  ? 111 PHE C CB  1 
ATOM   6178  C  CG  . PHE C 1 111 ? 43.703  27.381  103.169 1.00 18.58  ? 111 PHE C CG  1 
ATOM   6179  C  CD1 . PHE C 1 111 ? 44.504  27.644  102.063 1.00 18.82  ? 111 PHE C CD1 1 
ATOM   6180  C  CD2 . PHE C 1 111 ? 44.305  26.906  104.332 1.00 18.63  ? 111 PHE C CD2 1 
ATOM   6181  C  CE1 . PHE C 1 111 ? 45.882  27.459  102.118 1.00 17.94  ? 111 PHE C CE1 1 
ATOM   6182  C  CE2 . PHE C 1 111 ? 45.674  26.746  104.404 1.00 17.85  ? 111 PHE C CE2 1 
ATOM   6183  C  CZ  . PHE C 1 111 ? 46.469  27.023  103.291 1.00 18.16  ? 111 PHE C CZ  1 
ATOM   6184  N  N   . VAL C 1 112 ? 39.834  28.474  101.269 1.00 17.65  ? 112 VAL C N   1 
ATOM   6185  C  CA  . VAL C 1 112 ? 38.459  27.992  101.041 1.00 16.90  ? 112 VAL C CA  1 
ATOM   6186  C  C   . VAL C 1 112 ? 38.596  26.723  100.252 1.00 16.23  ? 112 VAL C C   1 
ATOM   6187  O  O   . VAL C 1 112 ? 39.594  26.526  99.585  1.00 17.42  ? 112 VAL C O   1 
ATOM   6188  C  CB  . VAL C 1 112 ? 37.605  28.978  100.224 1.00 17.38  ? 112 VAL C CB  1 
ATOM   6189  C  CG1 . VAL C 1 112 ? 37.101  30.098  101.118 1.00 16.44  ? 112 VAL C CG1 1 
ATOM   6190  C  CG2 . VAL C 1 112 ? 38.414  29.537  99.061  1.00 16.79  ? 112 VAL C CG2 1 
ATOM   6191  N  N   . GLY C 1 113 ? 37.620  25.846  100.319 1.00 16.34  ? 113 GLY C N   1 
ATOM   6192  C  CA  . GLY C 1 113 ? 37.737  24.562  99.663  1.00 17.16  ? 113 GLY C CA  1 
ATOM   6193  C  C   . GLY C 1 113 ? 36.790  24.494  98.490  1.00 18.41  ? 113 GLY C C   1 
ATOM   6194  O  O   . GLY C 1 113 ? 35.765  25.182  98.481  1.00 18.58  ? 113 GLY C O   1 
ATOM   6195  N  N   . LEU C 1 114 ? 37.163  23.701  97.485  1.00 18.88  ? 114 LEU C N   1 
ATOM   6196  C  CA  . LEU C 1 114 ? 36.282  23.376  96.359  1.00 19.05  ? 114 LEU C CA  1 
ATOM   6197  C  C   . LEU C 1 114 ? 36.329  21.871  96.215  1.00 20.23  ? 114 LEU C C   1 
ATOM   6198  O  O   . LEU C 1 114 ? 37.369  21.289  95.835  1.00 22.52  ? 114 LEU C O   1 
ATOM   6199  C  CB  . LEU C 1 114 ? 36.794  24.007  95.073  1.00 18.99  ? 114 LEU C CB  1 
ATOM   6200  C  CG  . LEU C 1 114 ? 37.131  25.494  95.097  1.00 18.30  ? 114 LEU C CG  1 
ATOM   6201  C  CD1 . LEU C 1 114 ? 37.987  25.851  93.882  1.00 17.88  ? 114 LEU C CD1 1 
ATOM   6202  C  CD2 . LEU C 1 114 ? 35.842  26.301  95.123  1.00 17.57  ? 114 LEU C CD2 1 
ATOM   6203  N  N   . GLY C 1 115 ? 35.224  21.224  96.541  1.00 19.78  ? 115 GLY C N   1 
ATOM   6204  C  CA  . GLY C 1 115 ? 35.224  19.780  96.659  1.00 19.83  ? 115 GLY C CA  1 
ATOM   6205  C  C   . GLY C 1 115 ? 35.216  19.116  95.297  1.00 20.31  ? 115 GLY C C   1 
ATOM   6206  O  O   . GLY C 1 115 ? 35.106  19.802  94.267  1.00 19.10  ? 115 GLY C O   1 
ATOM   6207  N  N   . THR C 1 116 ? 35.320  17.788  95.303  1.00 18.88  ? 116 THR C N   1 
ATOM   6208  C  CA  . THR C 1 116 ? 35.305  16.987  94.097  1.00 20.06  ? 116 THR C CA  1 
ATOM   6209  C  C   . THR C 1 116 ? 33.990  16.199  94.124  1.00 20.21  ? 116 THR C C   1 
ATOM   6210  O  O   . THR C 1 116 ? 33.467  15.940  95.208  1.00 20.60  ? 116 THR C O   1 
ATOM   6211  C  CB  . THR C 1 116 ? 36.608  16.108  93.989  1.00 21.62  ? 116 THR C CB  1 
ATOM   6212  O  OG1 . THR C 1 116 ? 36.675  15.375  92.740  1.00 25.31  ? 116 THR C OG1 1 
ATOM   6213  C  CG2 . THR C 1 116 ? 36.725  15.149  95.113  1.00 22.19  ? 116 THR C CG2 1 
ATOM   6214  N  N   . LEU C 1 117 ? 33.428  15.869  92.956  1.00 19.57  ? 117 LEU C N   1 
ATOM   6215  C  CA  . LEU C 1 117 ? 32.170  15.120  92.903  1.00 19.85  ? 117 LEU C CA  1 
ATOM   6216  C  C   . LEU C 1 117 ? 32.241  13.812  92.111  1.00 20.83  ? 117 LEU C C   1 
ATOM   6217  O  O   . LEU C 1 117 ? 33.107  13.655  91.240  1.00 22.22  ? 117 LEU C O   1 
ATOM   6218  C  CB  . LEU C 1 117 ? 31.042  15.992  92.370  1.00 19.65  ? 117 LEU C CB  1 
ATOM   6219  C  CG  . LEU C 1 117 ? 30.718  17.279  93.131  1.00 20.98  ? 117 LEU C CG  1 
ATOM   6220  C  CD1 . LEU C 1 117 ? 29.672  18.045  92.323  1.00 22.39  ? 117 LEU C CD1 1 
ATOM   6221  C  CD2 . LEU C 1 117 ? 30.220  17.037  94.549  1.00 20.16  ? 117 LEU C CD2 1 
ATOM   6222  N  N   . PRO C 1 118 ? 31.335  12.855  92.406  1.00 20.70  ? 118 PRO C N   1 
ATOM   6223  C  CA  . PRO C 1 118 ? 31.275  11.676  91.554  1.00 20.57  ? 118 PRO C CA  1 
ATOM   6224  C  C   . PRO C 1 118 ? 30.490  11.926  90.257  1.00 21.90  ? 118 PRO C C   1 
ATOM   6225  O  O   . PRO C 1 118 ? 29.326  11.488  90.120  1.00 22.81  ? 118 PRO C O   1 
ATOM   6226  C  CB  . PRO C 1 118 ? 30.600  10.624  92.445  1.00 20.52  ? 118 PRO C CB  1 
ATOM   6227  C  CG  . PRO C 1 118 ? 29.831  11.413  93.443  1.00 21.14  ? 118 PRO C CG  1 
ATOM   6228  C  CD  . PRO C 1 118 ? 30.578  12.685  93.660  1.00 20.97  ? 118 PRO C CD  1 
ATOM   6229  N  N   . MET C 1 119 ? 31.107  12.647  89.323  1.00 21.01  ? 119 MET C N   1 
ATOM   6230  C  CA  . MET C 1 119 ? 30.374  13.115  88.142  1.00 22.24  ? 119 MET C CA  1 
ATOM   6231  C  C   . MET C 1 119 ? 29.727  11.992  87.311  1.00 21.90  ? 119 MET C C   1 
ATOM   6232  O  O   . MET C 1 119 ? 28.618  12.140  86.857  1.00 22.46  ? 119 MET C O   1 
ATOM   6233  C  CB  . MET C 1 119 ? 31.254  14.043  87.285  1.00 23.20  ? 119 MET C CB  1 
ATOM   6234  C  CG  . MET C 1 119 ? 31.538  15.376  87.982  1.00 23.59  ? 119 MET C CG  1 
ATOM   6235  S  SD  . MET C 1 119 ? 29.996  16.248  88.377  1.00 27.28  ? 119 MET C SD  1 
ATOM   6236  C  CE  . MET C 1 119 ? 29.683  17.048  86.787  1.00 25.48  ? 119 MET C CE  1 
ATOM   6237  N  N   . GLN C 1 120 ? 30.390  10.852  87.158  1.00 22.68  ? 120 GLN C N   1 
ATOM   6238  C  CA  . GLN C 1 120 ? 29.772  9.703   86.458  1.00 23.33  ? 120 GLN C CA  1 
ATOM   6239  C  C   . GLN C 1 120 ? 28.443  9.165   87.058  1.00 25.88  ? 120 GLN C C   1 
ATOM   6240  O  O   . GLN C 1 120 ? 27.716  8.460   86.391  1.00 28.20  ? 120 GLN C O   1 
ATOM   6241  C  CB  . GLN C 1 120 ? 30.792  8.584   86.177  1.00 20.16  ? 120 GLN C CB  1 
ATOM   6242  C  CG  . GLN C 1 120 ? 31.011  7.576   87.281  1.00 19.83  ? 120 GLN C CG  1 
ATOM   6243  C  CD  . GLN C 1 120 ? 31.916  8.027   88.434  1.00 19.10  ? 120 GLN C CD  1 
ATOM   6244  O  OE1 . GLN C 1 120 ? 32.134  9.237   88.707  1.00 16.91  ? 120 GLN C OE1 1 
ATOM   6245  N  NE2 . GLN C 1 120 ? 32.433  7.026   89.151  1.00 17.61  ? 120 GLN C NE2 1 
ATOM   6246  N  N   . ALA C 1 121 ? 28.110  9.529   88.293  1.00 29.48  ? 121 ALA C N   1 
ATOM   6247  C  CA  . ALA C 1 121 ? 26.789  9.204   88.860  1.00 28.81  ? 121 ALA C CA  1 
ATOM   6248  C  C   . ALA C 1 121 ? 26.064  10.457  89.326  1.00 28.60  ? 121 ALA C C   1 
ATOM   6249  O  O   . ALA C 1 121 ? 26.159  10.800  90.482  1.00 33.59  ? 121 ALA C O   1 
ATOM   6250  C  CB  . ALA C 1 121 ? 26.955  8.231   90.014  1.00 31.13  ? 121 ALA C CB  1 
ATOM   6251  N  N   . PRO C 1 122 ? 25.349  11.153  88.421  1.00 29.97  ? 122 PRO C N   1 
ATOM   6252  C  CA  . PRO C 1 122 ? 24.695  12.426  88.675  1.00 29.40  ? 122 PRO C CA  1 
ATOM   6253  C  C   . PRO C 1 122 ? 23.866  12.500  89.965  1.00 31.25  ? 122 PRO C C   1 
ATOM   6254  O  O   . PRO C 1 122 ? 23.905  13.525  90.666  1.00 29.21  ? 122 PRO C O   1 
ATOM   6255  C  CB  . PRO C 1 122 ? 23.774  12.584  87.470  1.00 27.94  ? 122 PRO C CB  1 
ATOM   6256  C  CG  . PRO C 1 122 ? 24.524  11.923  86.385  1.00 29.17  ? 122 PRO C CG  1 
ATOM   6257  C  CD  . PRO C 1 122 ? 25.149  10.723  87.019  1.00 30.48  ? 122 PRO C CD  1 
ATOM   6258  N  N   . GLU C 1 123 ? 23.120  11.446  90.287  1.00 31.39  ? 123 GLU C N   1 
ATOM   6259  C  CA  . GLU C 1 123 ? 22.346  11.472  91.543  1.00 32.48  ? 123 GLU C CA  1 
ATOM   6260  C  C   . GLU C 1 123 ? 23.269  11.433  92.794  1.00 26.49  ? 123 GLU C C   1 
ATOM   6261  O  O   . GLU C 1 123 ? 23.055  12.178  93.714  1.00 25.19  ? 123 GLU C O   1 
ATOM   6262  C  CB  . GLU C 1 123 ? 21.195  10.432  91.555  1.00 36.53  ? 123 GLU C CB  1 
ATOM   6263  C  CG  . GLU C 1 123 ? 20.188  10.666  92.688  1.00 44.58  ? 123 GLU C CG  1 
ATOM   6264  C  CD  . GLU C 1 123 ? 18.721  10.429  92.291  1.00 52.56  ? 123 GLU C CD  1 
ATOM   6265  O  OE1 . GLU C 1 123 ? 18.475  9.923   91.167  1.00 53.76  ? 123 GLU C OE1 1 
ATOM   6266  O  OE2 . GLU C 1 123 ? 17.807  10.756  93.107  1.00 49.46  ? 123 GLU C OE2 1 
ATOM   6267  N  N   . LEU C 1 124 ? 24.295  10.588  92.794  1.00 24.79  ? 124 LEU C N   1 
ATOM   6268  C  CA  . LEU C 1 124 ? 25.312  10.613  93.853  1.00 25.62  ? 124 LEU C CA  1 
ATOM   6269  C  C   . LEU C 1 124 ? 26.044  11.940  93.903  1.00 28.47  ? 124 LEU C C   1 
ATOM   6270  O  O   . LEU C 1 124 ? 26.292  12.455  95.004  1.00 29.65  ? 124 LEU C O   1 
ATOM   6271  C  CB  . LEU C 1 124 ? 26.320  9.489   93.684  1.00 24.62  ? 124 LEU C CB  1 
ATOM   6272  C  CG  . LEU C 1 124 ? 25.763  8.092   93.974  1.00 26.08  ? 124 LEU C CG  1 
ATOM   6273  C  CD1 . LEU C 1 124 ? 26.898  7.068   93.994  1.00 24.44  ? 124 LEU C CD1 1 
ATOM   6274  C  CD2 . LEU C 1 124 ? 24.985  8.080   95.305  1.00 23.41  ? 124 LEU C CD2 1 
ATOM   6275  N  N   . ALA C 1 125 ? 26.379  12.506  92.727  1.00 28.44  ? 125 ALA C N   1 
ATOM   6276  C  CA  . ALA C 1 125 ? 27.077  13.796  92.680  1.00 27.35  ? 125 ALA C CA  1 
ATOM   6277  C  C   . ALA C 1 125 ? 26.331  14.922  93.385  1.00 27.39  ? 125 ALA C C   1 
ATOM   6278  O  O   . ALA C 1 125 ? 26.953  15.661  94.141  1.00 30.01  ? 125 ALA C O   1 
ATOM   6279  C  CB  . ALA C 1 125 ? 27.466  14.187  91.256  1.00 28.32  ? 125 ALA C CB  1 
ATOM   6280  N  N   . VAL C 1 126 ? 25.010  15.026  93.174  1.00 26.86  ? 126 VAL C N   1 
ATOM   6281  C  CA  . VAL C 1 126 ? 24.150  16.043  93.809  1.00 25.38  ? 126 VAL C CA  1 
ATOM   6282  C  C   . VAL C 1 126 ? 24.124  15.892  95.339  1.00 26.45  ? 126 VAL C C   1 
ATOM   6283  O  O   . VAL C 1 126 ? 24.240  16.867  96.088  1.00 24.82  ? 126 VAL C O   1 
ATOM   6284  C  CB  . VAL C 1 126 ? 22.723  16.018  93.204  1.00 26.27  ? 126 VAL C CB  1 
ATOM   6285  C  CG1 . VAL C 1 126 ? 21.800  17.021  93.881  1.00 25.07  ? 126 VAL C CG1 1 
ATOM   6286  C  CG2 . VAL C 1 126 ? 22.757  16.286  91.691  1.00 26.22  ? 126 VAL C CG2 1 
ATOM   6287  N  N   . LYS C 1 127 ? 24.036  14.656  95.812  1.00 28.83  ? 127 LYS C N   1 
ATOM   6288  C  CA  . LYS C 1 127 ? 24.075  14.410  97.247  1.00 30.83  ? 127 LYS C CA  1 
ATOM   6289  C  C   . LYS C 1 127 ? 25.419  14.849  97.855  1.00 29.98  ? 127 LYS C C   1 
ATOM   6290  O  O   . LYS C 1 127 ? 25.444  15.589  98.844  1.00 29.29  ? 127 LYS C O   1 
ATOM   6291  C  CB  . LYS C 1 127 ? 23.741  12.950  97.524  1.00 35.87  ? 127 LYS C CB  1 
ATOM   6292  C  CG  . LYS C 1 127 ? 22.334  12.598  97.043  1.00 36.58  ? 127 LYS C CG  1 
ATOM   6293  C  CD  . LYS C 1 127 ? 21.289  13.141  98.005  1.00 38.13  ? 127 LYS C CD  1 
ATOM   6294  C  CE  . LYS C 1 127 ? 19.884  12.696  97.618  1.00 41.73  ? 127 LYS C CE  1 
ATOM   6295  N  NZ  . LYS C 1 127 ? 18.951  12.703  98.789  1.00 40.76  ? 127 LYS C NZ  1 
ATOM   6296  N  N   . GLU C 1 128 ? 26.532  14.463  97.232  1.00 27.48  ? 128 GLU C N   1 
ATOM   6297  C  CA  . GLU C 1 128 ? 27.815  14.945  97.701  1.00 25.22  ? 128 GLU C CA  1 
ATOM   6298  C  C   . GLU C 1 128 ? 27.963  16.485  97.596  1.00 25.52  ? 128 GLU C C   1 
ATOM   6299  O  O   . GLU C 1 128 ? 28.544  17.131  98.486  1.00 25.50  ? 128 GLU C O   1 
ATOM   6300  C  CB  . GLU C 1 128 ? 28.960  14.185  97.047  1.00 25.45  ? 128 GLU C CB  1 
ATOM   6301  C  CG  . GLU C 1 128 ? 30.345  14.483  97.627  1.00 27.82  ? 128 GLU C CG  1 
ATOM   6302  C  CD  . GLU C 1 128 ? 30.504  14.172  99.130  1.00 30.20  ? 128 GLU C CD  1 
ATOM   6303  O  OE1 . GLU C 1 128 ? 29.548  13.666  99.788  1.00 31.84  ? 128 GLU C OE1 1 
ATOM   6304  O  OE2 . GLU C 1 128 ? 31.617  14.413  99.668  1.00 29.13  ? 128 GLU C OE2 1 
ATOM   6305  N  N   . MET C 1 129 ? 27.407  17.089  96.554  1.00 23.65  ? 129 MET C N   1 
ATOM   6306  C  CA  . MET C 1 129 ? 27.463  18.535  96.457  1.00 24.08  ? 129 MET C CA  1 
ATOM   6307  C  C   . MET C 1 129 ? 26.668  19.186  97.595  1.00 26.67  ? 129 MET C C   1 
ATOM   6308  O  O   . MET C 1 129 ? 27.084  20.223  98.139  1.00 24.99  ? 129 MET C O   1 
ATOM   6309  C  CB  . MET C 1 129 ? 26.918  18.994  95.117  1.00 24.74  ? 129 MET C CB  1 
ATOM   6310  C  CG  . MET C 1 129 ? 27.175  20.457  94.791  1.00 26.38  ? 129 MET C CG  1 
ATOM   6311  S  SD  . MET C 1 129 ? 26.271  21.066  93.334  1.00 31.54  ? 129 MET C SD  1 
ATOM   6312  C  CE  . MET C 1 129 ? 26.692  19.915  92.023  1.00 27.70  ? 129 MET C CE  1 
ATOM   6313  N  N   . GLU C 1 130 ? 25.515  18.596  97.947  1.00 28.61  ? 130 GLU C N   1 
ATOM   6314  C  CA  . GLU C 1 130 ? 24.701  19.158  99.022  1.00 31.00  ? 130 GLU C CA  1 
ATOM   6315  C  C   . GLU C 1 130 ? 25.496  19.138  100.304 1.00 29.45  ? 130 GLU C C   1 
ATOM   6316  O  O   . GLU C 1 130 ? 25.505  20.107  101.052 1.00 31.58  ? 130 GLU C O   1 
ATOM   6317  C  CB  . GLU C 1 130 ? 23.412  18.387  99.213  1.00 36.25  ? 130 GLU C CB  1 
ATOM   6318  C  CG  . GLU C 1 130 ? 22.177  19.153  98.796  1.00 41.67  ? 130 GLU C CG  1 
ATOM   6319  C  CD  . GLU C 1 130 ? 21.078  18.230  98.301  1.00 45.77  ? 130 GLU C CD  1 
ATOM   6320  O  OE1 . GLU C 1 130 ? 20.762  17.230  98.987  1.00 50.68  ? 130 GLU C OE1 1 
ATOM   6321  O  OE2 . GLU C 1 130 ? 20.526  18.503  97.215  1.00 47.97  ? 130 GLU C OE2 1 
ATOM   6322  N  N   . ARG C 1 131 ? 26.205  18.038  100.510 1.00 26.42  ? 131 ARG C N   1 
ATOM   6323  C  CA  . ARG C 1 131 ? 27.017  17.834  101.687 1.00 24.70  ? 131 ARG C CA  1 
ATOM   6324  C  C   . ARG C 1 131 ? 28.151  18.855  101.742 1.00 25.44  ? 131 ARG C C   1 
ATOM   6325  O  O   . ARG C 1 131 ? 28.277  19.576  102.740 1.00 26.37  ? 131 ARG C O   1 
ATOM   6326  C  CB  . ARG C 1 131 ? 27.551  16.411  101.657 1.00 24.49  ? 131 ARG C CB  1 
ATOM   6327  C  CG  . ARG C 1 131 ? 27.670  15.750  102.992 1.00 24.52  ? 131 ARG C CG  1 
ATOM   6328  C  CD  . ARG C 1 131 ? 28.629  14.575  102.910 1.00 26.00  ? 131 ARG C CD  1 
ATOM   6329  N  NE  . ARG C 1 131 ? 29.540  14.800  104.005 1.00 29.27  ? 131 ARG C NE  1 
ATOM   6330  C  CZ  . ARG C 1 131 ? 30.860  14.870  103.925 1.00 27.57  ? 131 ARG C CZ  1 
ATOM   6331  N  NH1 . ARG C 1 131 ? 31.509  14.615  102.793 1.00 27.95  ? 131 ARG C NH1 1 
ATOM   6332  N  NH2 . ARG C 1 131 ? 31.529  15.140  105.032 1.00 27.88  ? 131 ARG C NH2 1 
ATOM   6333  N  N   . CYS C 1 132 ? 28.951  18.945  100.673 1.00 25.26  ? 132 CYS C N   1 
ATOM   6334  C  CA  . CYS C 1 132 ? 30.026  19.974  100.550 1.00 25.71  ? 132 CYS C CA  1 
ATOM   6335  C  C   . CYS C 1 132 ? 29.578  21.414  100.830 1.00 24.41  ? 132 CYS C C   1 
ATOM   6336  O  O   . CYS C 1 132 ? 30.303  22.189  101.469 1.00 23.82  ? 132 CYS C O   1 
ATOM   6337  C  CB  . CYS C 1 132 ? 30.671  19.954  99.153  1.00 26.68  ? 132 CYS C CB  1 
ATOM   6338  S  SG  . CYS C 1 132 ? 31.608  18.470  98.747  1.00 30.74  ? 132 CYS C SG  1 
ATOM   6339  N  N   . VAL C 1 133 ? 28.409  21.782  100.324 1.00 24.70  ? 133 VAL C N   1 
ATOM   6340  C  CA  . VAL C 1 133 ? 27.904  23.130  100.551 1.00 27.00  ? 133 VAL C CA  1 
ATOM   6341  C  C   . VAL C 1 133 ? 27.230  23.281  101.910 1.00 30.01  ? 133 VAL C C   1 
ATOM   6342  O  O   . VAL C 1 133 ? 27.507  24.253  102.621 1.00 32.78  ? 133 VAL C O   1 
ATOM   6343  C  CB  . VAL C 1 133 ? 26.958  23.619  99.438  1.00 26.74  ? 133 VAL C CB  1 
ATOM   6344  C  CG1 . VAL C 1 133 ? 26.811  25.122  99.534  1.00 29.60  ? 133 VAL C CG1 1 
ATOM   6345  C  CG2 . VAL C 1 133 ? 27.521  23.272  98.060  1.00 29.07  ? 133 VAL C CG2 1 
ATOM   6346  N  N   . LYS C 1 134 ? 26.360  22.343  102.284 1.00 30.70  ? 134 LYS C N   1 
ATOM   6347  C  CA  . LYS C 1 134 ? 25.607  22.467  103.559 1.00 32.60  ? 134 LYS C CA  1 
ATOM   6348  C  C   . LYS C 1 134 ? 26.382  22.170  104.857 1.00 34.19  ? 134 LYS C C   1 
ATOM   6349  O  O   . LYS C 1 134 ? 26.234  22.885  105.824 1.00 35.00  ? 134 LYS C O   1 
ATOM   6350  C  CB  . LYS C 1 134 ? 24.312  21.651  103.540 1.00 32.02  ? 134 LYS C CB  1 
ATOM   6351  C  CG  . LYS C 1 134 ? 23.291  22.141  102.530 1.00 37.43  ? 134 LYS C CG  1 
ATOM   6352  C  CD  . LYS C 1 134 ? 23.208  23.667  102.514 1.00 38.33  ? 134 LYS C CD  1 
ATOM   6353  C  CE  . LYS C 1 134 ? 21.927  24.166  101.858 1.00 39.30  ? 134 LYS C CE  1 
ATOM   6354  N  NZ  . LYS C 1 134 ? 20.712  23.762  102.623 1.00 40.18  ? 134 LYS C NZ  1 
ATOM   6355  N  N   . GLU C 1 135 ? 27.168  21.095  104.882 1.00 34.53  ? 135 GLU C N   1 
ATOM   6356  C  CA  . GLU C 1 135 ? 27.891  20.683  106.089 1.00 33.57  ? 135 GLU C CA  1 
ATOM   6357  C  C   . GLU C 1 135 ? 29.330  21.203  106.128 1.00 31.25  ? 135 GLU C C   1 
ATOM   6358  O  O   . GLU C 1 135 ? 29.718  21.870  107.094 1.00 30.76  ? 135 GLU C O   1 
ATOM   6359  C  CB  . GLU C 1 135 ? 27.871  19.172  106.215 1.00 39.86  ? 135 GLU C CB  1 
ATOM   6360  C  CG  . GLU C 1 135 ? 26.454  18.615  106.142 1.00 48.73  ? 135 GLU C CG  1 
ATOM   6361  C  CD  . GLU C 1 135 ? 26.353  17.131  106.482 1.00 54.65  ? 135 GLU C CD  1 
ATOM   6362  O  OE1 . GLU C 1 135 ? 27.382  16.487  106.788 1.00 58.09  ? 135 GLU C OE1 1 
ATOM   6363  O  OE2 . GLU C 1 135 ? 25.219  16.599  106.441 1.00 60.34  ? 135 GLU C OE2 1 
ATOM   6364  N  N   . LEU C 1 136 ? 30.093  20.944  105.056 1.00 26.01  ? 136 LEU C N   1 
ATOM   6365  C  CA  . LEU C 1 136 ? 31.480  21.362  104.972 1.00 23.05  ? 136 LEU C CA  1 
ATOM   6366  C  C   . LEU C 1 136 ? 31.636  22.873  104.698 1.00 21.63  ? 136 LEU C C   1 
ATOM   6367  O  O   . LEU C 1 136 ? 32.688  23.409  104.936 1.00 22.48  ? 136 LEU C O   1 
ATOM   6368  C  CB  . LEU C 1 136 ? 32.278  20.517  103.958 1.00 21.82  ? 136 LEU C CB  1 
ATOM   6369  C  CG  . LEU C 1 136 ? 32.248  18.982  104.050 1.00 21.91  ? 136 LEU C CG  1 
ATOM   6370  C  CD1 . LEU C 1 136 ? 33.165  18.326  103.025 1.00 19.72  ? 136 LEU C CD1 1 
ATOM   6371  C  CD2 . LEU C 1 136 ? 32.605  18.506  105.460 1.00 21.37  ? 136 LEU C CD2 1 
ATOM   6372  N  N   . GLY C 1 137 ? 30.600  23.565  104.234 1.00 20.65  ? 137 GLY C N   1 
ATOM   6373  C  CA  . GLY C 1 137 ? 30.722  25.026  103.959 1.00 18.34  ? 137 GLY C CA  1 
ATOM   6374  C  C   . GLY C 1 137 ? 31.621  25.486  102.793 1.00 17.19  ? 137 GLY C C   1 
ATOM   6375  O  O   . GLY C 1 137 ? 32.137  26.582  102.821 1.00 16.73  ? 137 GLY C O   1 
ATOM   6376  N  N   . PHE C 1 138 ? 31.802  24.670  101.761 1.00 16.78  ? 138 PHE C N   1 
ATOM   6377  C  CA  . PHE C 1 138 ? 32.574  25.052  100.566 1.00 16.30  ? 138 PHE C CA  1 
ATOM   6378  C  C   . PHE C 1 138 ? 31.764  26.022  99.669  1.00 17.72  ? 138 PHE C C   1 
ATOM   6379  O  O   . PHE C 1 138 ? 30.603  25.747  99.349  1.00 20.33  ? 138 PHE C O   1 
ATOM   6380  C  CB  . PHE C 1 138 ? 32.819  23.790  99.695  1.00 15.85  ? 138 PHE C CB  1 
ATOM   6381  C  CG  . PHE C 1 138 ? 33.750  22.791  100.285 1.00 14.88  ? 138 PHE C CG  1 
ATOM   6382  C  CD1 . PHE C 1 138 ? 34.558  23.101  101.394 1.00 14.33  ? 138 PHE C CD1 1 
ATOM   6383  C  CD2 . PHE C 1 138 ? 33.867  21.541  99.709  1.00 14.26  ? 138 PHE C CD2 1 
ATOM   6384  C  CE1 . PHE C 1 138 ? 35.435  22.144  101.907 1.00 14.35  ? 138 PHE C CE1 1 
ATOM   6385  C  CE2 . PHE C 1 138 ? 34.716  20.580  100.236 1.00 13.57  ? 138 PHE C CE2 1 
ATOM   6386  C  CZ  . PHE C 1 138 ? 35.522  20.880  101.322 1.00 13.47  ? 138 PHE C CZ  1 
ATOM   6387  N  N   . PRO C 1 139 ? 32.363  27.113  99.182  1.00 17.90  ? 139 PRO C N   1 
ATOM   6388  C  CA  . PRO C 1 139 ? 31.667  27.929  98.132  1.00 16.79  ? 139 PRO C CA  1 
ATOM   6389  C  C   . PRO C 1 139 ? 31.495  27.271  96.737  1.00 18.12  ? 139 PRO C C   1 
ATOM   6390  O  O   . PRO C 1 139 ? 30.783  27.807  95.860  1.00 17.01  ? 139 PRO C O   1 
ATOM   6391  C  CB  . PRO C 1 139 ? 32.617  29.079  97.939  1.00 16.47  ? 139 PRO C CB  1 
ATOM   6392  C  CG  . PRO C 1 139 ? 33.970  28.512  98.297  1.00 18.20  ? 139 PRO C CG  1 
ATOM   6393  C  CD  . PRO C 1 139 ? 33.703  27.647  99.499  1.00 17.17  ? 139 PRO C CD  1 
ATOM   6394  N  N   . GLY C 1 140 ? 32.166  26.147  96.489  1.00 18.23  ? 140 GLY C N   1 
ATOM   6395  C  CA  . GLY C 1 140 ? 32.120  25.578  95.149  1.00 17.57  ? 140 GLY C CA  1 
ATOM   6396  C  C   . GLY C 1 140 ? 32.780  24.224  95.041  1.00 18.52  ? 140 GLY C C   1 
ATOM   6397  O  O   . GLY C 1 140 ? 33.278  23.686  96.035  1.00 18.85  ? 140 GLY C O   1 
ATOM   6398  N  N   . VAL C 1 141 ? 32.772  23.669  93.829  1.00 16.79  ? 141 VAL C N   1 
ATOM   6399  C  CA  . VAL C 1 141 ? 33.404  22.401  93.558  1.00 16.21  ? 141 VAL C CA  1 
ATOM   6400  C  C   . VAL C 1 141 ? 34.255  22.536  92.312  1.00 16.40  ? 141 VAL C C   1 
ATOM   6401  O  O   . VAL C 1 141 ? 34.079  23.484  91.532  1.00 16.68  ? 141 VAL C O   1 
ATOM   6402  C  CB  . VAL C 1 141 ? 32.384  21.243  93.361  1.00 16.58  ? 141 VAL C CB  1 
ATOM   6403  C  CG1 . VAL C 1 141 ? 31.749  20.812  94.686  1.00 16.42  ? 141 VAL C CG1 1 
ATOM   6404  C  CG2 . VAL C 1 141 ? 31.343  21.579  92.308  1.00 15.90  ? 141 VAL C CG2 1 
ATOM   6405  N  N   . GLN C 1 142 ? 35.162  21.571  92.132  1.00 16.18  ? 142 GLN C N   1 
ATOM   6406  C  CA  . GLN C 1 142 ? 36.042  21.506  90.999  1.00 15.80  ? 142 GLN C CA  1 
ATOM   6407  C  C   . GLN C 1 142 ? 35.644  20.258  90.213  1.00 14.89  ? 142 GLN C C   1 
ATOM   6408  O  O   . GLN C 1 142 ? 35.517  19.188  90.787  1.00 14.07  ? 142 GLN C O   1 
ATOM   6409  C  CB  . GLN C 1 142 ? 37.492  21.410  91.475  1.00 18.42  ? 142 GLN C CB  1 
ATOM   6410  C  CG  . GLN C 1 142 ? 38.459  21.299  90.305  1.00 22.56  ? 142 GLN C CG  1 
ATOM   6411  C  CD  . GLN C 1 142 ? 39.883  21.003  90.684  1.00 24.33  ? 142 GLN C CD  1 
ATOM   6412  O  OE1 . GLN C 1 142 ? 40.803  21.603  90.157  1.00 25.93  ? 142 GLN C OE1 1 
ATOM   6413  N  NE2 . GLN C 1 142 ? 40.074  20.057  91.590  1.00 29.41  ? 142 GLN C NE2 1 
ATOM   6414  N  N   . ILE C 1 143 ? 35.391  20.404  88.915  1.00 14.08  ? 143 ILE C N   1 
ATOM   6415  C  CA  . ILE C 1 143 ? 35.015  19.252  88.044  1.00 13.64  ? 143 ILE C CA  1 
ATOM   6416  C  C   . ILE C 1 143 ? 35.938  19.136  86.794  1.00 13.50  ? 143 ILE C C   1 
ATOM   6417  O  O   . ILE C 1 143 ? 36.664  20.103  86.441  1.00 12.63  ? 143 ILE C O   1 
ATOM   6418  C  CB  . ILE C 1 143 ? 33.510  19.246  87.687  1.00 13.25  ? 143 ILE C CB  1 
ATOM   6419  C  CG1 . ILE C 1 143 ? 33.142  20.424  86.802  1.00 14.02  ? 143 ILE C CG1 1 
ATOM   6420  C  CG2 . ILE C 1 143 ? 32.645  19.325  88.958  1.00 13.28  ? 143 ILE C CG2 1 
ATOM   6421  C  CD1 . ILE C 1 143 ? 31.784  20.311  86.148  1.00 14.15  ? 143 ILE C CD1 1 
ATOM   6422  N  N   . GLY C 1 144 ? 35.967  17.950  86.174  1.00 12.85  ? 144 GLY C N   1 
ATOM   6423  C  CA  . GLY C 1 144 ? 36.715  17.762  84.927  1.00 12.61  ? 144 GLY C CA  1 
ATOM   6424  C  C   . GLY C 1 144 ? 36.036  18.439  83.746  1.00 13.12  ? 144 GLY C C   1 
ATOM   6425  O  O   . GLY C 1 144 ? 34.871  18.861  83.843  1.00 13.38  ? 144 GLY C O   1 
ATOM   6426  N  N   . THR C 1 145 ? 36.763  18.580  82.636  1.00 13.56  ? 145 THR C N   1 
ATOM   6427  C  CA  . THR C 1 145 ? 36.227  19.101  81.373  1.00 13.42  ? 145 THR C CA  1 
ATOM   6428  C  C   . THR C 1 145 ? 35.382  18.011  80.647  1.00 14.68  ? 145 THR C C   1 
ATOM   6429  O  O   . THR C 1 145 ? 34.761  18.243  79.643  1.00 15.24  ? 145 THR C O   1 
ATOM   6430  C  CB  . THR C 1 145 ? 37.381  19.535  80.430  1.00 12.92  ? 145 THR C CB  1 
ATOM   6431  O  OG1 . THR C 1 145 ? 38.414  18.560  80.441  1.00 12.04  ? 145 THR C OG1 1 
ATOM   6432  C  CG2 . THR C 1 145 ? 37.953  20.842  80.850  1.00 12.17  ? 145 THR C CG2 1 
ATOM   6433  N  N   . HIS C 1 146 ? 35.361  16.797  81.142  1.00 16.23  ? 146 HIS C N   1 
ATOM   6434  C  CA  . HIS C 1 146 ? 34.429  15.861  80.563  1.00 17.94  ? 146 HIS C CA  1 
ATOM   6435  C  C   . HIS C 1 146 ? 34.324  14.663  81.445  1.00 17.43  ? 146 HIS C C   1 
ATOM   6436  O  O   . HIS C 1 146 ? 35.150  14.469  82.320  1.00 17.05  ? 146 HIS C O   1 
ATOM   6437  C  CB  . HIS C 1 146 ? 34.826  15.536  79.120  1.00 18.62  ? 146 HIS C CB  1 
ATOM   6438  C  CG  . HIS C 1 146 ? 36.079  14.700  79.017  1.00 20.14  ? 146 HIS C CG  1 
ATOM   6439  N  ND1 . HIS C 1 146 ? 37.288  15.232  78.749  1.00 20.45  ? 146 HIS C ND1 1 
ATOM   6440  C  CD2 . HIS C 1 146 ? 36.276  13.331  79.200  1.00 19.91  ? 146 HIS C CD2 1 
ATOM   6441  C  CE1 . HIS C 1 146 ? 38.209  14.258  78.739  1.00 21.72  ? 146 HIS C CE1 1 
ATOM   6442  N  NE2 . HIS C 1 146 ? 37.583  13.088  79.012  1.00 21.71  ? 146 HIS C NE2 1 
ATOM   6443  N  N   . VAL C 1 147 ? 33.291  13.854  81.250  1.00 18.94  ? 147 VAL C N   1 
ATOM   6444  C  CA  . VAL C 1 147 ? 33.059  12.721  82.145  1.00 19.58  ? 147 VAL C CA  1 
ATOM   6445  C  C   . VAL C 1 147 ? 32.973  11.394  81.377  1.00 21.27  ? 147 VAL C C   1 
ATOM   6446  O  O   . VAL C 1 147 ? 31.886  10.971  80.986  1.00 22.02  ? 147 VAL C O   1 
ATOM   6447  C  CB  . VAL C 1 147 ? 31.808  12.953  83.032  1.00 18.90  ? 147 VAL C CB  1 
ATOM   6448  C  CG1 . VAL C 1 147 ? 31.860  12.004  84.236  1.00 19.04  ? 147 VAL C CG1 1 
ATOM   6449  C  CG2 . VAL C 1 147 ? 31.726  14.394  83.493  1.00 16.97  ? 147 VAL C CG2 1 
ATOM   6450  N  N   . ASN C 1 148 ? 34.111  10.728  81.175  1.00 22.96  ? 148 ASN C N   1 
ATOM   6451  C  CA  . ASN C 1 148 ? 34.149  9.564   80.303  1.00 26.53  ? 148 ASN C CA  1 
ATOM   6452  C  C   . ASN C 1 148 ? 33.653  9.969   78.877  1.00 28.68  ? 148 ASN C C   1 
ATOM   6453  O  O   . ASN C 1 148 ? 34.284  10.803  78.222  1.00 27.73  ? 148 ASN C O   1 
ATOM   6454  C  CB  . ASN C 1 148 ? 33.355  8.403   80.926  1.00 26.26  ? 148 ASN C CB  1 
ATOM   6455  C  CG  . ASN C 1 148 ? 33.819  8.076   82.356  1.00 31.34  ? 148 ASN C CG  1 
ATOM   6456  O  OD1 . ASN C 1 148 ? 33.000  7.983   83.291  1.00 29.53  ? 148 ASN C OD1 1 
ATOM   6457  N  ND2 . ASN C 1 148 ? 35.143  7.915   82.538  1.00 31.00  ? 148 ASN C ND2 1 
ATOM   6458  N  N   . GLU C 1 149 ? 32.523  9.449   78.413  1.00 28.83  ? 149 GLU C N   1 
ATOM   6459  C  CA  . GLU C 1 149 ? 32.078  9.825   77.069  1.00 33.44  ? 149 GLU C CA  1 
ATOM   6460  C  C   . GLU C 1 149 ? 31.194  11.088  77.037  1.00 31.71  ? 149 GLU C C   1 
ATOM   6461  O  O   . GLU C 1 149 ? 30.924  11.607  75.983  1.00 29.95  ? 149 GLU C O   1 
ATOM   6462  C  CB  . GLU C 1 149 ? 31.486  8.616   76.309  1.00 39.33  ? 149 GLU C CB  1 
ATOM   6463  C  CG  . GLU C 1 149 ? 30.885  8.890   74.911  1.00 53.37  ? 149 GLU C CG  1 
ATOM   6464  C  CD  . GLU C 1 149 ? 31.882  9.234   73.767  1.00 57.01  ? 149 GLU C CD  1 
ATOM   6465  O  OE1 . GLU C 1 149 ? 31.584  10.193  72.997  1.00 55.31  ? 149 GLU C OE1 1 
ATOM   6466  O  OE2 . GLU C 1 149 ? 32.932  8.549   73.602  1.00 53.25  ? 149 GLU C OE2 1 
ATOM   6467  N  N   . TRP C 1 150 ? 30.814  11.626  78.191  1.00 30.51  ? 150 TRP C N   1 
ATOM   6468  C  CA  . TRP C 1 150 ? 30.052  12.861  78.207  1.00 29.31  ? 150 TRP C CA  1 
ATOM   6469  C  C   . TRP C 1 150 ? 30.892  14.093  78.276  1.00 27.39  ? 150 TRP C C   1 
ATOM   6470  O  O   . TRP C 1 150 ? 31.775  14.235  79.135  1.00 27.03  ? 150 TRP C O   1 
ATOM   6471  C  CB  . TRP C 1 150 ? 29.098  12.917  79.392  1.00 31.10  ? 150 TRP C CB  1 
ATOM   6472  C  CG  . TRP C 1 150 ? 28.202  11.728  79.578  1.00 34.72  ? 150 TRP C CG  1 
ATOM   6473  C  CD1 . TRP C 1 150 ? 27.684  10.873  78.600  1.00 32.68  ? 150 TRP C CD1 1 
ATOM   6474  C  CD2 . TRP C 1 150 ? 27.624  11.261  80.852  1.00 36.58  ? 150 TRP C CD2 1 
ATOM   6475  N  NE1 . TRP C 1 150 ? 26.878  9.919   79.174  1.00 35.60  ? 150 TRP C NE1 1 
ATOM   6476  C  CE2 . TRP C 1 150 ? 26.793  10.098  80.520  1.00 36.23  ? 150 TRP C CE2 1 
ATOM   6477  C  CE3 . TRP C 1 150 ? 27.722  11.675  82.197  1.00 35.76  ? 150 TRP C CE3 1 
ATOM   6478  C  CZ2 . TRP C 1 150 ? 26.105  9.381   81.505  1.00 37.32  ? 150 TRP C CZ2 1 
ATOM   6479  C  CZ3 . TRP C 1 150 ? 27.022  10.944  83.181  1.00 35.50  ? 150 TRP C CZ3 1 
ATOM   6480  C  CH2 . TRP C 1 150 ? 26.231  9.827   82.840  1.00 35.40  ? 150 TRP C CH2 1 
ATOM   6481  N  N   . ASP C 1 151 ? 30.595  15.019  77.386  1.00 25.05  ? 151 ASP C N   1 
ATOM   6482  C  CA  . ASP C 1 151 ? 31.026  16.386  77.552  1.00 25.71  ? 151 ASP C CA  1 
ATOM   6483  C  C   . ASP C 1 151 ? 29.994  17.118  78.402  1.00 23.66  ? 151 ASP C C   1 
ATOM   6484  O  O   . ASP C 1 151 ? 28.922  16.602  78.707  1.00 23.90  ? 151 ASP C O   1 
ATOM   6485  C  CB  . ASP C 1 151 ? 31.190  17.080  76.196  1.00 29.12  ? 151 ASP C CB  1 
ATOM   6486  C  CG  . ASP C 1 151 ? 32.561  16.787  75.520  1.00 35.27  ? 151 ASP C CG  1 
ATOM   6487  O  OD1 . ASP C 1 151 ? 33.635  17.257  76.023  1.00 34.22  ? 151 ASP C OD1 1 
ATOM   6488  O  OD2 . ASP C 1 151 ? 32.544  16.116  74.451  1.00 38.14  ? 151 ASP C OD2 1 
ATOM   6489  N  N   . LEU C 1 152 ? 30.323  18.337  78.764  1.00 22.50  ? 152 LEU C N   1 
ATOM   6490  C  CA  . LEU C 1 152 ? 29.543  19.110  79.713  1.00 22.41  ? 152 LEU C CA  1 
ATOM   6491  C  C   . LEU C 1 152 ? 28.154  19.547  79.169  1.00 23.84  ? 152 LEU C C   1 
ATOM   6492  O  O   . LEU C 1 152 ? 27.309  20.026  79.919  1.00 25.28  ? 152 LEU C O   1 
ATOM   6493  C  CB  . LEU C 1 152 ? 30.404  20.275  80.213  1.00 20.66  ? 152 LEU C CB  1 
ATOM   6494  C  CG  . LEU C 1 152 ? 31.284  20.064  81.480  1.00 20.46  ? 152 LEU C CG  1 
ATOM   6495  C  CD1 . LEU C 1 152 ? 31.625  18.613  81.847  1.00 20.90  ? 152 LEU C CD1 1 
ATOM   6496  C  CD2 . LEU C 1 152 ? 32.542  20.932  81.445  1.00 19.04  ? 152 LEU C CD2 1 
ATOM   6497  N  N   . ASN C 1 153 ? 27.917  19.337  77.875  1.00 23.31  ? 153 ASN C N   1 
ATOM   6498  C  CA  . ASN C 1 153 ? 26.589  19.506  77.256  1.00 22.83  ? 153 ASN C CA  1 
ATOM   6499  C  C   . ASN C 1 153 ? 25.626  18.379  77.608  1.00 22.11  ? 153 ASN C C   1 
ATOM   6500  O  O   . ASN C 1 153 ? 24.436  18.487  77.317  1.00 20.77  ? 153 ASN C O   1 
ATOM   6501  C  CB  . ASN C 1 153 ? 26.704  19.553  75.722  1.00 20.96  ? 153 ASN C CB  1 
ATOM   6502  C  CG  . ASN C 1 153 ? 27.007  18.197  75.126  1.00 20.08  ? 153 ASN C CG  1 
ATOM   6503  O  OD1 . ASN C 1 153 ? 27.871  17.457  75.614  1.00 20.44  ? 153 ASN C OD1 1 
ATOM   6504  N  ND2 . ASN C 1 153 ? 26.263  17.832  74.105  1.00 19.59  ? 153 ASN C ND2 1 
ATOM   6505  N  N   . ALA C 1 154 ? 26.148  17.304  78.196  1.00 21.80  ? 154 ALA C N   1 
ATOM   6506  C  CA  . ALA C 1 154 ? 25.368  16.077  78.386  1.00 26.15  ? 154 ALA C CA  1 
ATOM   6507  C  C   . ALA C 1 154 ? 24.118  16.299  79.249  1.00 28.91  ? 154 ALA C C   1 
ATOM   6508  O  O   . ALA C 1 154 ? 24.221  16.851  80.355  1.00 26.68  ? 154 ALA C O   1 
ATOM   6509  C  CB  . ALA C 1 154 ? 26.235  14.966  78.977  1.00 24.44  ? 154 ALA C CB  1 
ATOM   6510  N  N   . GLN C 1 155 ? 22.954  15.869  78.743  1.00 31.95  ? 155 GLN C N   1 
ATOM   6511  C  CA  . GLN C 1 155 ? 21.678  16.025  79.471  1.00 35.47  ? 155 GLN C CA  1 
ATOM   6512  C  C   . GLN C 1 155 ? 21.724  15.350  80.819  1.00 33.12  ? 155 GLN C C   1 
ATOM   6513  O  O   . GLN C 1 155 ? 21.153  15.871  81.779  1.00 33.64  ? 155 GLN C O   1 
ATOM   6514  C  CB  . GLN C 1 155 ? 20.475  15.507  78.677  1.00 41.58  ? 155 GLN C CB  1 
ATOM   6515  C  CG  . GLN C 1 155 ? 19.692  16.620  77.996  1.00 50.35  ? 155 GLN C CG  1 
ATOM   6516  C  CD  . GLN C 1 155 ? 18.519  16.091  77.195  1.00 59.24  ? 155 GLN C CD  1 
ATOM   6517  O  OE1 . GLN C 1 155 ? 17.640  15.411  77.734  1.00 66.56  ? 155 GLN C OE1 1 
ATOM   6518  N  NE2 . GLN C 1 155 ? 18.497  16.397  75.895  1.00 60.91  ? 155 GLN C NE2 1 
ATOM   6519  N  N   . GLU C 1 156 ? 22.445  14.226  80.874  1.00 29.99  ? 156 GLU C N   1 
ATOM   6520  C  CA  . GLU C 1 156 ? 22.656  13.455  82.097  1.00 29.67  ? 156 GLU C CA  1 
ATOM   6521  C  C   . GLU C 1 156 ? 23.156  14.259  83.294  1.00 28.05  ? 156 GLU C C   1 
ATOM   6522  O  O   . GLU C 1 156 ? 22.971  13.834  84.433  1.00 27.72  ? 156 GLU C O   1 
ATOM   6523  C  CB  . GLU C 1 156 ? 23.643  12.332  81.841  1.00 32.69  ? 156 GLU C CB  1 
ATOM   6524  C  CG  . GLU C 1 156 ? 23.054  11.131  81.118  1.00 37.42  ? 156 GLU C CG  1 
ATOM   6525  C  CD  . GLU C 1 156 ? 23.351  11.129  79.620  1.00 41.81  ? 156 GLU C CD  1 
ATOM   6526  O  OE1 . GLU C 1 156 ? 23.454  12.220  78.996  1.00 42.78  ? 156 GLU C OE1 1 
ATOM   6527  O  OE2 . GLU C 1 156 ? 23.489  10.013  79.062  1.00 42.84  ? 156 GLU C OE2 1 
ATOM   6528  N  N   . LEU C 1 157 ? 23.779  15.407  83.026  1.00 23.97  ? 157 LEU C N   1 
ATOM   6529  C  CA  . LEU C 1 157 ? 24.451  16.198  84.035  1.00 21.72  ? 157 LEU C CA  1 
ATOM   6530  C  C   . LEU C 1 157 ? 23.639  17.401  84.371  1.00 22.78  ? 157 LEU C C   1 
ATOM   6531  O  O   . LEU C 1 157 ? 24.003  18.139  85.270  1.00 25.49  ? 157 LEU C O   1 
ATOM   6532  C  CB  . LEU C 1 157 ? 25.862  16.644  83.578  1.00 19.69  ? 157 LEU C CB  1 
ATOM   6533  C  CG  . LEU C 1 157 ? 26.894  15.553  83.237  1.00 18.06  ? 157 LEU C CG  1 
ATOM   6534  C  CD1 . LEU C 1 157 ? 28.103  16.146  82.559  1.00 17.91  ? 157 LEU C CD1 1 
ATOM   6535  C  CD2 . LEU C 1 157 ? 27.359  14.776  84.451  1.00 17.46  ? 157 LEU C CD2 1 
ATOM   6536  N  N   . PHE C 1 158 ? 22.533  17.618  83.670  1.00 24.53  ? 158 PHE C N   1 
ATOM   6537  C  CA  . PHE C 1 158 ? 21.679  18.749  83.992  1.00 25.33  ? 158 PHE C CA  1 
ATOM   6538  C  C   . PHE C 1 158 ? 21.160  18.816  85.464  1.00 26.72  ? 158 PHE C C   1 
ATOM   6539  O  O   . PHE C 1 158 ? 21.022  19.927  86.037  1.00 27.20  ? 158 PHE C O   1 
ATOM   6540  C  CB  . PHE C 1 158 ? 20.565  18.876  82.948  1.00 27.83  ? 158 PHE C CB  1 
ATOM   6541  C  CG  . PHE C 1 158 ? 20.998  19.604  81.678  1.00 31.40  ? 158 PHE C CG  1 
ATOM   6542  C  CD1 . PHE C 1 158 ? 22.240  19.323  81.059  1.00 30.67  ? 158 PHE C CD1 1 
ATOM   6543  C  CD2 . PHE C 1 158 ? 20.178  20.571  81.091  1.00 30.70  ? 158 PHE C CD2 1 
ATOM   6544  C  CE1 . PHE C 1 158 ? 22.648  20.005  79.913  1.00 31.47  ? 158 PHE C CE1 1 
ATOM   6545  C  CE2 . PHE C 1 158 ? 20.591  21.246  79.931  1.00 31.67  ? 158 PHE C CE2 1 
ATOM   6546  C  CZ  . PHE C 1 158 ? 21.822  20.957  79.340  1.00 30.41  ? 158 PHE C CZ  1 
ATOM   6547  N  N   . PRO C 1 159 ? 20.885  17.653  86.093  1.00 26.20  ? 159 PRO C N   1 
ATOM   6548  C  CA  . PRO C 1 159 ? 20.462  17.713  87.499  1.00 26.68  ? 159 PRO C CA  1 
ATOM   6549  C  C   . PRO C 1 159 ? 21.542  18.272  88.388  1.00 26.96  ? 159 PRO C C   1 
ATOM   6550  O  O   . PRO C 1 159 ? 21.249  18.929  89.388  1.00 26.16  ? 159 PRO C O   1 
ATOM   6551  C  CB  . PRO C 1 159 ? 20.216  16.241  87.856  1.00 26.89  ? 159 PRO C CB  1 
ATOM   6552  C  CG  . PRO C 1 159 ? 19.811  15.631  86.556  1.00 27.50  ? 159 PRO C CG  1 
ATOM   6553  C  CD  . PRO C 1 159 ? 20.699  16.296  85.536  1.00 26.70  ? 159 PRO C CD  1 
ATOM   6554  N  N   . VAL C 1 160 ? 22.787  18.035  87.995  1.00 27.17  ? 160 VAL C N   1 
ATOM   6555  C  CA  . VAL C 1 160 ? 23.931  18.572  88.714  1.00 27.55  ? 160 VAL C CA  1 
ATOM   6556  C  C   . VAL C 1 160 ? 24.000  20.085  88.568  1.00 28.37  ? 160 VAL C C   1 
ATOM   6557  O  O   . VAL C 1 160 ? 24.253  20.779  89.576  1.00 28.95  ? 160 VAL C O   1 
ATOM   6558  C  CB  . VAL C 1 160 ? 25.249  17.925  88.257  1.00 28.80  ? 160 VAL C CB  1 
ATOM   6559  C  CG1 . VAL C 1 160 ? 26.419  18.528  89.000  1.00 30.82  ? 160 VAL C CG1 1 
ATOM   6560  C  CG2 . VAL C 1 160 ? 25.208  16.411  88.457  1.00 29.56  ? 160 VAL C CG2 1 
ATOM   6561  N  N   . TYR C 1 161 ? 23.750  20.602  87.347  1.00 25.19  ? 161 TYR C N   1 
ATOM   6562  C  CA  . TYR C 1 161 ? 23.816  22.048  87.120  1.00 24.64  ? 161 TYR C CA  1 
ATOM   6563  C  C   . TYR C 1 161 ? 22.652  22.721  87.825  1.00 24.04  ? 161 TYR C C   1 
ATOM   6564  O  O   . TYR C 1 161 ? 22.784  23.860  88.291  1.00 21.15  ? 161 TYR C O   1 
ATOM   6565  C  CB  . TYR C 1 161 ? 23.758  22.407  85.624  1.00 26.55  ? 161 TYR C CB  1 
ATOM   6566  C  CG  . TYR C 1 161 ? 24.896  21.873  84.790  1.00 25.67  ? 161 TYR C CG  1 
ATOM   6567  C  CD1 . TYR C 1 161 ? 26.209  22.074  85.179  1.00 25.57  ? 161 TYR C CD1 1 
ATOM   6568  C  CD2 . TYR C 1 161 ? 24.653  21.183  83.619  1.00 25.08  ? 161 TYR C CD2 1 
ATOM   6569  C  CE1 . TYR C 1 161 ? 27.253  21.598  84.431  1.00 26.93  ? 161 TYR C CE1 1 
ATOM   6570  C  CE2 . TYR C 1 161 ? 25.691  20.690  82.850  1.00 27.11  ? 161 TYR C CE2 1 
ATOM   6571  C  CZ  . TYR C 1 161 ? 27.002  20.904  83.267  1.00 28.83  ? 161 TYR C CZ  1 
ATOM   6572  O  OH  . TYR C 1 161 ? 28.082  20.440  82.524  1.00 28.45  ? 161 TYR C OH  1 
ATOM   6573  N  N   . ALA C 1 162 ? 21.510  22.014  87.877  1.00 23.68  ? 162 ALA C N   1 
ATOM   6574  C  CA  . ALA C 1 162 ? 20.301  22.509  88.580  1.00 23.47  ? 162 ALA C CA  1 
ATOM   6575  C  C   . ALA C 1 162 ? 20.610  22.707  90.067  1.00 21.41  ? 162 ALA C C   1 
ATOM   6576  O  O   . ALA C 1 162 ? 20.400  23.761  90.577  1.00 21.05  ? 162 ALA C O   1 
ATOM   6577  C  CB  . ALA C 1 162 ? 19.116  21.555  88.397  1.00 22.52  ? 162 ALA C CB  1 
ATOM   6578  N  N   . ALA C 1 163 ? 21.154  21.689  90.724  1.00 21.58  ? 163 ALA C N   1 
ATOM   6579  C  CA  . ALA C 1 163 ? 21.577  21.789  92.108  1.00 23.24  ? 163 ALA C CA  1 
ATOM   6580  C  C   . ALA C 1 163 ? 22.618  22.879  92.324  1.00 24.00  ? 163 ALA C C   1 
ATOM   6581  O  O   . ALA C 1 163 ? 22.543  23.650  93.269  1.00 22.65  ? 163 ALA C O   1 
ATOM   6582  C  CB  . ALA C 1 163 ? 22.107  20.451  92.589  1.00 22.97  ? 163 ALA C CB  1 
ATOM   6583  N  N   . ALA C 1 164 ? 23.592  22.968  91.430  1.00 25.49  ? 164 ALA C N   1 
ATOM   6584  C  CA  . ALA C 1 164 ? 24.642  23.923  91.652  1.00 25.38  ? 164 ALA C CA  1 
ATOM   6585  C  C   . ALA C 1 164 ? 24.106  25.368  91.570  1.00 27.40  ? 164 ALA C C   1 
ATOM   6586  O  O   . ALA C 1 164 ? 24.482  26.240  92.383  1.00 30.80  ? 164 ALA C O   1 
ATOM   6587  C  CB  . ALA C 1 164 ? 25.784  23.662  90.694  1.00 24.71  ? 164 ALA C CB  1 
ATOM   6588  N  N   . GLU C 1 165 ? 23.201  25.620  90.630  1.00 27.57  ? 165 GLU C N   1 
ATOM   6589  C  CA  . GLU C 1 165 ? 22.528  26.920  90.546  1.00 29.42  ? 165 GLU C CA  1 
ATOM   6590  C  C   . GLU C 1 165 ? 21.717  27.257  91.802  1.00 30.62  ? 165 GLU C C   1 
ATOM   6591  O  O   . GLU C 1 165 ? 21.731  28.405  92.270  1.00 32.97  ? 165 GLU C O   1 
ATOM   6592  C  CB  . GLU C 1 165 ? 21.635  26.989  89.300  1.00 29.68  ? 165 GLU C CB  1 
ATOM   6593  C  CG  . GLU C 1 165 ? 20.953  28.327  89.055  1.00 30.82  ? 165 GLU C CG  1 
ATOM   6594  C  CD  . GLU C 1 165 ? 20.182  28.371  87.723  1.00 34.38  ? 165 GLU C CD  1 
ATOM   6595  O  OE1 . GLU C 1 165 ? 19.291  27.499  87.528  1.00 34.56  ? 165 GLU C OE1 1 
ATOM   6596  O  OE2 . GLU C 1 165 ? 20.457  29.279  86.871  1.00 31.31  ? 165 GLU C OE2 1 
ATOM   6597  N  N   . ARG C 1 166 ? 21.018  26.264  92.343  1.00 31.26  ? 166 ARG C N   1 
ATOM   6598  C  CA  . ARG C 1 166 ? 20.150  26.471  93.503  1.00 35.10  ? 166 ARG C CA  1 
ATOM   6599  C  C   . ARG C 1 166 ? 20.894  26.594  94.847  1.00 34.94  ? 166 ARG C C   1 
ATOM   6600  O  O   . ARG C 1 166 ? 20.475  27.340  95.733  1.00 36.26  ? 166 ARG C O   1 
ATOM   6601  C  CB  . ARG C 1 166 ? 19.085  25.370  93.581  1.00 38.17  ? 166 ARG C CB  1 
ATOM   6602  C  CG  . ARG C 1 166 ? 17.975  25.698  94.570  1.00 43.68  ? 166 ARG C CG  1 
ATOM   6603  C  CD  . ARG C 1 166 ? 17.221  24.476  95.062  1.00 44.96  ? 166 ARG C CD  1 
ATOM   6604  N  NE  . ARG C 1 166 ? 18.071  23.534  95.781  1.00 46.94  ? 166 ARG C NE  1 
ATOM   6605  C  CZ  . ARG C 1 166 ? 18.367  22.313  95.343  1.00 49.52  ? 166 ARG C CZ  1 
ATOM   6606  N  NH1 . ARG C 1 166 ? 17.888  21.874  94.181  1.00 54.30  ? 166 ARG C NH1 1 
ATOM   6607  N  NH2 . ARG C 1 166 ? 19.149  21.523  96.061  1.00 46.87  ? 166 ARG C NH2 1 
ATOM   6608  N  N   . LEU C 1 167 ? 21.994  25.859  95.000  1.00 32.87  ? 167 LEU C N   1 
ATOM   6609  C  CA  . LEU C 1 167 ? 22.764  25.902  96.241  1.00 30.94  ? 167 LEU C CA  1 
ATOM   6610  C  C   . LEU C 1 167 ? 23.797  26.994  96.177  1.00 28.71  ? 167 LEU C C   1 
ATOM   6611  O  O   . LEU C 1 167 ? 24.649  27.082  97.028  1.00 28.43  ? 167 LEU C O   1 
ATOM   6612  C  CB  . LEU C 1 167 ? 23.500  24.592  96.454  1.00 31.36  ? 167 LEU C CB  1 
ATOM   6613  C  CG  . LEU C 1 167 ? 22.765  23.300  96.729  1.00 31.97  ? 167 LEU C CG  1 
ATOM   6614  C  CD1 . LEU C 1 167 ? 23.799  22.214  96.571  1.00 31.29  ? 167 LEU C CD1 1 
ATOM   6615  C  CD2 . LEU C 1 167 ? 22.181  23.260  98.133  1.00 32.83  ? 167 LEU C CD2 1 
ATOM   6616  N  N   . LYS C 1 168 ? 23.740  27.792  95.125  1.00 31.72  ? 168 LYS C N   1 
ATOM   6617  C  CA  . LYS C 1 168 ? 24.706  28.840  94.865  1.00 33.32  ? 168 LYS C CA  1 
ATOM   6618  C  C   . LYS C 1 168 ? 26.133  28.273  94.899  1.00 32.83  ? 168 LYS C C   1 
ATOM   6619  O  O   . LYS C 1 168 ? 27.007  28.780  95.585  1.00 33.42  ? 168 LYS C O   1 
ATOM   6620  C  CB  . LYS C 1 168 ? 24.488  30.014  95.831  1.00 34.47  ? 168 LYS C CB  1 
ATOM   6621  C  CG  . LYS C 1 168 ? 23.299  30.878  95.428  1.00 38.43  ? 168 LYS C CG  1 
ATOM   6622  C  CD  . LYS C 1 168 ? 22.877  31.820  96.547  1.00 45.84  ? 168 LYS C CD  1 
ATOM   6623  C  CE  . LYS C 1 168 ? 22.787  33.283  96.093  1.00 50.96  ? 168 LYS C CE  1 
ATOM   6624  N  NZ  . LYS C 1 168 ? 21.706  33.548  95.088  1.00 48.30  ? 168 LYS C NZ  1 
ATOM   6625  N  N   . CYS C 1 169 ? 26.352  27.202  94.147  1.00 30.50  ? 169 CYS C N   1 
ATOM   6626  C  CA  . CYS C 1 169 ? 27.630  26.508  94.192  1.00 27.80  ? 169 CYS C CA  1 
ATOM   6627  C  C   . CYS C 1 169 ? 28.410  26.763  92.895  1.00 26.22  ? 169 CYS C C   1 
ATOM   6628  O  O   . CYS C 1 169 ? 28.045  26.228  91.825  1.00 26.87  ? 169 CYS C O   1 
ATOM   6629  C  CB  . CYS C 1 169 ? 27.405  25.011  94.415  1.00 26.34  ? 169 CYS C CB  1 
ATOM   6630  S  SG  . CYS C 1 169 ? 28.929  24.035  94.416  1.00 34.04  ? 169 CYS C SG  1 
ATOM   6631  N  N   . SER C 1 170 ? 29.445  27.600  92.992  1.00 22.24  ? 170 SER C N   1 
ATOM   6632  C  CA  . SER C 1 170 ? 30.400  27.842  91.889  1.00 20.51  ? 170 SER C CA  1 
ATOM   6633  C  C   . SER C 1 170 ? 31.086  26.558  91.367  1.00 18.32  ? 170 SER C C   1 
ATOM   6634  O  O   . SER C 1 170 ? 31.360  25.656  92.142  1.00 17.66  ? 170 SER C O   1 
ATOM   6635  C  CB  . SER C 1 170 ? 31.475  28.836  92.334  1.00 20.33  ? 170 SER C CB  1 
ATOM   6636  O  OG  . SER C 1 170 ? 30.902  30.035  92.850  1.00 20.84  ? 170 SER C OG  1 
ATOM   6637  N  N   . LEU C 1 171 ? 31.312  26.466  90.052  1.00 16.27  ? 171 LEU C N   1 
ATOM   6638  C  CA  . LEU C 1 171 ? 31.979  25.289  89.446  1.00 15.53  ? 171 LEU C CA  1 
ATOM   6639  C  C   . LEU C 1 171 ? 33.308  25.666  88.854  1.00 14.79  ? 171 LEU C C   1 
ATOM   6640  O  O   . LEU C 1 171 ? 33.422  26.610  88.135  1.00 15.99  ? 171 LEU C O   1 
ATOM   6641  C  CB  . LEU C 1 171 ? 31.123  24.662  88.354  1.00 15.58  ? 171 LEU C CB  1 
ATOM   6642  C  CG  . LEU C 1 171 ? 29.764  23.999  88.650  1.00 16.30  ? 171 LEU C CG  1 
ATOM   6643  C  CD1 . LEU C 1 171 ? 29.144  23.417  87.353  1.00 17.88  ? 171 LEU C CD1 1 
ATOM   6644  C  CD2 . LEU C 1 171 ? 29.868  22.857  89.647  1.00 16.40  ? 171 LEU C CD2 1 
ATOM   6645  N  N   . PHE C 1 172 ? 34.359  24.972  89.200  1.00 15.32  ? 172 PHE C N   1 
ATOM   6646  C  CA  . PHE C 1 172 ? 35.652  25.300  88.625  1.00 14.10  ? 172 PHE C CA  1 
ATOM   6647  C  C   . PHE C 1 172 ? 35.999  24.125  87.727  1.00 13.51  ? 172 PHE C C   1 
ATOM   6648  O  O   . PHE C 1 172 ? 36.052  22.975  88.181  1.00 13.51  ? 172 PHE C O   1 
ATOM   6649  C  CB  . PHE C 1 172 ? 36.682  25.516  89.731  1.00 14.23  ? 172 PHE C CB  1 
ATOM   6650  C  CG  . PHE C 1 172 ? 38.029  25.896  89.227  1.00 15.00  ? 172 PHE C CG  1 
ATOM   6651  C  CD1 . PHE C 1 172 ? 38.273  27.160  88.746  1.00 15.71  ? 172 PHE C CD1 1 
ATOM   6652  C  CD2 . PHE C 1 172 ? 39.058  24.985  89.237  1.00 16.19  ? 172 PHE C CD2 1 
ATOM   6653  C  CE1 . PHE C 1 172 ? 39.526  27.506  88.249  1.00 16.33  ? 172 PHE C CE1 1 
ATOM   6654  C  CE2 . PHE C 1 172 ? 40.319  25.313  88.755  1.00 17.44  ? 172 PHE C CE2 1 
ATOM   6655  C  CZ  . PHE C 1 172 ? 40.545  26.577  88.249  1.00 17.29  ? 172 PHE C CZ  1 
ATOM   6656  N  N   . VAL C 1 173 ? 36.190  24.409  86.447  1.00 12.42  ? 173 VAL C N   1 
ATOM   6657  C  CA  . VAL C 1 173 ? 36.363  23.361  85.468  1.00 11.68  ? 173 VAL C CA  1 
ATOM   6658  C  C   . VAL C 1 173 ? 37.821  23.209  85.109  1.00 11.74  ? 173 VAL C C   1 
ATOM   6659  O  O   . VAL C 1 173 ? 38.454  24.126  84.606  1.00 11.70  ? 173 VAL C O   1 
ATOM   6660  C  CB  . VAL C 1 173 ? 35.462  23.569  84.227  1.00 11.83  ? 173 VAL C CB  1 
ATOM   6661  C  CG1 . VAL C 1 173 ? 35.843  22.587  83.127  1.00 11.10  ? 173 VAL C CG1 1 
ATOM   6662  C  CG2 . VAL C 1 173 ? 33.965  23.429  84.618  1.00 11.63  ? 173 VAL C CG2 1 
ATOM   6663  N  N   . HIS C 1 174 ? 38.360  22.032  85.403  1.00 12.12  ? 174 HIS C N   1 
ATOM   6664  C  CA  . HIS C 1 174 ? 39.744  21.768  85.216  1.00 12.69  ? 174 HIS C CA  1 
ATOM   6665  C  C   . HIS C 1 174 ? 39.897  20.693  84.145  1.00 13.92  ? 174 HIS C C   1 
ATOM   6666  O  O   . HIS C 1 174 ? 39.370  19.577  84.271  1.00 14.71  ? 174 HIS C O   1 
ATOM   6667  C  CB  . HIS C 1 174 ? 40.366  21.334  86.532  1.00 11.97  ? 174 HIS C CB  1 
ATOM   6668  C  CG  . HIS C 1 174 ? 41.861  21.520  86.599  1.00 11.89  ? 174 HIS C CG  1 
ATOM   6669  N  ND1 . HIS C 1 174 ? 42.710  20.865  85.796  1.00 11.88  ? 174 HIS C ND1 1 
ATOM   6670  C  CD2 . HIS C 1 174 ? 42.655  22.283  87.460  1.00 12.02  ? 174 HIS C CD2 1 
ATOM   6671  C  CE1 . HIS C 1 174 ? 43.985  21.194  86.106  1.00 11.12  ? 174 HIS C CE1 1 
ATOM   6672  N  NE2 . HIS C 1 174 ? 43.945  22.076  87.108  1.00 11.91  ? 174 HIS C NE2 1 
ATOM   6673  N  N   . PRO C 1 175 ? 40.648  20.999  83.087  1.00 13.66  ? 175 PRO C N   1 
ATOM   6674  C  CA  . PRO C 1 175 ? 40.977  19.977  82.110  1.00 14.05  ? 175 PRO C CA  1 
ATOM   6675  C  C   . PRO C 1 175 ? 41.676  18.802  82.742  1.00 15.48  ? 175 PRO C C   1 
ATOM   6676  O  O   . PRO C 1 175 ? 42.607  18.918  83.642  1.00 14.13  ? 175 PRO C O   1 
ATOM   6677  C  CB  . PRO C 1 175 ? 41.979  20.687  81.205  1.00 14.09  ? 175 PRO C CB  1 
ATOM   6678  C  CG  . PRO C 1 175 ? 42.602  21.742  82.073  1.00 13.71  ? 175 PRO C CG  1 
ATOM   6679  C  CD  . PRO C 1 175 ? 41.479  22.203  82.935  1.00 13.40  ? 175 PRO C CD  1 
ATOM   6680  N  N   . TRP C 1 176 ? 41.224  17.661  82.282  1.00 16.57  ? 176 TRP C N   1 
ATOM   6681  C  CA  . TRP C 1 176 ? 41.765  16.396  82.714  1.00 19.41  ? 176 TRP C CA  1 
ATOM   6682  C  C   . TRP C 1 176 ? 41.347  15.355  81.740  1.00 21.75  ? 176 TRP C C   1 
ATOM   6683  O  O   . TRP C 1 176 ? 40.371  15.511  80.963  1.00 21.57  ? 176 TRP C O   1 
ATOM   6684  C  CB  . TRP C 1 176 ? 41.350  15.992  84.155  1.00 20.45  ? 176 TRP C CB  1 
ATOM   6685  C  CG  . TRP C 1 176 ? 42.167  14.788  84.567  1.00 22.11  ? 176 TRP C CG  1 
ATOM   6686  C  CD1 . TRP C 1 176 ? 41.712  13.512  84.921  1.00 23.23  ? 176 TRP C CD1 1 
ATOM   6687  C  CD2 . TRP C 1 176 ? 43.648  14.682  84.579  1.00 21.59  ? 176 TRP C CD2 1 
ATOM   6688  N  NE1 . TRP C 1 176 ? 42.786  12.658  85.163  1.00 23.83  ? 176 TRP C NE1 1 
ATOM   6689  C  CE2 . TRP C 1 176 ? 43.960  13.297  84.980  1.00 22.15  ? 176 TRP C CE2 1 
ATOM   6690  C  CE3 . TRP C 1 176 ? 44.703  15.570  84.315  1.00 21.53  ? 176 TRP C CE3 1 
ATOM   6691  C  CZ2 . TRP C 1 176 ? 45.268  12.842  85.093  1.00 23.12  ? 176 TRP C CZ2 1 
ATOM   6692  C  CZ3 . TRP C 1 176 ? 46.030  15.092  84.434  1.00 22.78  ? 176 TRP C CZ3 1 
ATOM   6693  C  CH2 . TRP C 1 176 ? 46.299  13.759  84.807  1.00 22.52  ? 176 TRP C CH2 1 
ATOM   6694  N  N   . ASP C 1 177 ? 42.116  14.287  81.758  1.00 25.38  ? 177 ASP C N   1 
ATOM   6695  C  CA  . ASP C 1 177 ? 41.893  13.143  80.886  1.00 30.76  ? 177 ASP C CA  1 
ATOM   6696  C  C   . ASP C 1 177 ? 42.002  13.368  79.358  1.00 29.27  ? 177 ASP C C   1 
ATOM   6697  O  O   . ASP C 1 177 ? 41.200  12.806  78.611  1.00 28.28  ? 177 ASP C O   1 
ATOM   6698  C  CB  . ASP C 1 177 ? 40.586  12.432  81.254  1.00 34.42  ? 177 ASP C CB  1 
ATOM   6699  C  CG  . ASP C 1 177 ? 40.684  10.946  81.034  1.00 42.26  ? 177 ASP C CG  1 
ATOM   6700  O  OD1 . ASP C 1 177 ? 41.835  10.446  81.014  1.00 45.11  ? 177 ASP C OD1 1 
ATOM   6701  O  OD2 . ASP C 1 177 ? 39.637  10.283  80.847  1.00 46.53  ? 177 ASP C OD2 1 
ATOM   6702  N  N   . MET C 1 178 ? 42.967  14.195  78.918  1.00 29.03  ? 178 MET C N   1 
ATOM   6703  C  CA  . MET C 1 178 ? 43.370  14.304  77.487  1.00 31.14  ? 178 MET C CA  1 
ATOM   6704  C  C   . MET C 1 178 ? 43.980  12.985  76.994  1.00 30.17  ? 178 MET C C   1 
ATOM   6705  O  O   . MET C 1 178 ? 44.303  12.077  77.785  1.00 26.83  ? 178 MET C O   1 
ATOM   6706  C  CB  . MET C 1 178 ? 44.490  15.356  77.230  1.00 33.63  ? 178 MET C CB  1 
ATOM   6707  C  CG  . MET C 1 178 ? 44.689  16.494  78.198  1.00 34.65  ? 178 MET C CG  1 
ATOM   6708  S  SD  . MET C 1 178 ? 45.031  15.967  79.885  1.00 43.63  ? 178 MET C SD  1 
ATOM   6709  C  CE  . MET C 1 178 ? 46.815  15.847  79.974  1.00 36.66  ? 178 MET C CE  1 
ATOM   6710  N  N   . GLN C 1 179 ? 44.200  12.923  75.679  1.00 30.72  ? 179 GLN C N   1 
ATOM   6711  C  CA  . GLN C 1 179 ? 44.938  11.828  75.094  1.00 29.45  ? 179 GLN C CA  1 
ATOM   6712  C  C   . GLN C 1 179 ? 46.339  11.898  75.651  1.00 30.12  ? 179 GLN C C   1 
ATOM   6713  O  O   . GLN C 1 179 ? 46.977  12.944  75.628  1.00 29.03  ? 179 GLN C O   1 
ATOM   6714  C  CB  . GLN C 1 179 ? 44.959  11.901  73.569  1.00 30.22  ? 179 GLN C CB  1 
ATOM   6715  C  CG  . GLN C 1 179 ? 45.688  10.701  72.976  1.00 30.97  ? 179 GLN C CG  1 
ATOM   6716  C  CD  . GLN C 1 179 ? 45.955  10.803  71.487  1.00 32.10  ? 179 GLN C CD  1 
ATOM   6717  O  OE1 . GLN C 1 179 ? 45.544  11.743  70.806  1.00 33.59  ? 179 GLN C OE1 1 
ATOM   6718  N  NE2 . GLN C 1 179 ? 46.650  9.812   70.969  1.00 35.60  ? 179 GLN C NE2 1 
ATOM   6719  N  N   . MET C 1 180 ? 46.805  10.775  76.169  1.00 33.43  ? 180 MET C N   1 
ATOM   6720  C  CA  . MET C 1 180 ? 48.098  10.716  76.826  1.00 35.86  ? 180 MET C CA  1 
ATOM   6721  C  C   . MET C 1 180 ? 49.135  10.009  75.962  1.00 34.93  ? 180 MET C C   1 
ATOM   6722  O  O   . MET C 1 180 ? 50.342  10.223  76.132  1.00 32.07  ? 180 MET C O   1 
ATOM   6723  C  CB  . MET C 1 180 ? 47.957  10.004  78.166  1.00 38.09  ? 180 MET C CB  1 
ATOM   6724  C  CG  . MET C 1 180 ? 47.059  10.748  79.144  1.00 44.58  ? 180 MET C CG  1 
ATOM   6725  S  SD  . MET C 1 180 ? 47.867  12.123  80.011  1.00 48.70  ? 180 MET C SD  1 
ATOM   6726  C  CE  . MET C 1 180 ? 49.309  11.277  80.694  1.00 46.64  ? 180 MET C CE  1 
ATOM   6727  N  N   . ASP C 1 181 ? 48.675  9.169   75.032  1.00 34.23  ? 181 ASP C N   1 
ATOM   6728  C  CA  . ASP C 1 181 ? 49.615  8.356   74.273  1.00 35.25  ? 181 ASP C CA  1 
ATOM   6729  C  C   . ASP C 1 181 ? 49.582  8.633   72.770  1.00 32.82  ? 181 ASP C C   1 
ATOM   6730  O  O   . ASP C 1 181 ? 49.106  9.692   72.329  1.00 29.88  ? 181 ASP C O   1 
ATOM   6731  C  CB  . ASP C 1 181 ? 49.430  6.856   74.606  1.00 39.28  ? 181 ASP C CB  1 
ATOM   6732  C  CG  . ASP C 1 181 ? 48.040  6.338   74.248  1.00 44.10  ? 181 ASP C CG  1 
ATOM   6733  O  OD1 . ASP C 1 181 ? 47.248  7.094   73.623  1.00 48.62  ? 181 ASP C OD1 1 
ATOM   6734  O  OD2 . ASP C 1 181 ? 47.736  5.172   74.591  1.00 46.40  ? 181 ASP C OD2 1 
ATOM   6735  N  N   . GLY C 1 182 ? 50.112  7.683   71.989  1.00 32.07  ? 182 GLY C N   1 
ATOM   6736  C  CA  . GLY C 1 182 ? 50.265  7.865   70.541  1.00 26.86  ? 182 GLY C CA  1 
ATOM   6737  C  C   . GLY C 1 182 ? 51.048  9.128   70.259  1.00 23.98  ? 182 GLY C C   1 
ATOM   6738  O  O   . GLY C 1 182 ? 52.021  9.436   70.962  1.00 23.30  ? 182 GLY C O   1 
ATOM   6739  N  N   . ARG C 1 183 ? 50.602  9.880   69.262  1.00 23.03  ? 183 ARG C N   1 
ATOM   6740  C  CA  . ARG C 1 183 ? 51.280  11.118  68.841  1.00 22.93  ? 183 ARG C CA  1 
ATOM   6741  C  C   . ARG C 1 183 ? 51.427  12.090  70.002  1.00 23.19  ? 183 ARG C C   1 
ATOM   6742  O  O   . ARG C 1 183 ? 52.332  12.917  70.031  1.00 24.04  ? 183 ARG C O   1 
ATOM   6743  C  CB  . ARG C 1 183 ? 50.510  11.813  67.707  1.00 23.10  ? 183 ARG C CB  1 
ATOM   6744  C  CG  . ARG C 1 183 ? 50.523  11.123  66.326  1.00 26.77  ? 183 ARG C CG  1 
ATOM   6745  C  CD  . ARG C 1 183 ? 49.504  11.750  65.350  1.00 24.97  ? 183 ARG C CD  1 
ATOM   6746  N  NE  . ARG C 1 183 ? 49.688  13.203  65.317  1.00 27.85  ? 183 ARG C NE  1 
ATOM   6747  C  CZ  . ARG C 1 183 ? 48.719  14.119  65.269  1.00 27.10  ? 183 ARG C CZ  1 
ATOM   6748  N  NH1 . ARG C 1 183 ? 47.441  13.740  65.257  1.00 27.30  ? 183 ARG C NH1 1 
ATOM   6749  N  NH2 . ARG C 1 183 ? 49.037  15.420  65.239  1.00 24.96  ? 183 ARG C NH2 1 
ATOM   6750  N  N   . MET C 1 184 ? 50.525  12.000  70.963  1.00 24.00  ? 184 MET C N   1 
ATOM   6751  C  CA  . MET C 1 184 ? 50.553  12.919  72.061  1.00 25.48  ? 184 MET C CA  1 
ATOM   6752  C  C   . MET C 1 184 ? 51.663  12.579  73.044  1.00 26.34  ? 184 MET C C   1 
ATOM   6753  O  O   . MET C 1 184 ? 52.025  13.419  73.862  1.00 31.57  ? 184 MET C O   1 
ATOM   6754  C  CB  . MET C 1 184 ? 49.179  12.985  72.749  1.00 28.24  ? 184 MET C CB  1 
ATOM   6755  C  CG  . MET C 1 184 ? 48.050  13.594  71.894  1.00 27.66  ? 184 MET C CG  1 
ATOM   6756  S  SD  . MET C 1 184 ? 48.516  15.192  71.172  1.00 33.18  ? 184 MET C SD  1 
ATOM   6757  C  CE  . MET C 1 184 ? 47.947  16.359  72.422  1.00 26.88  ? 184 MET C CE  1 
ATOM   6758  N  N   . ALA C 1 185 ? 52.253  11.392  72.945  1.00 23.81  ? 185 ALA C N   1 
ATOM   6759  C  CA  . ALA C 1 185 ? 53.257  10.984  73.946  1.00 24.38  ? 185 ALA C CA  1 
ATOM   6760  C  C   . ALA C 1 185 ? 54.600  11.754  73.959  1.00 23.86  ? 185 ALA C C   1 
ATOM   6761  O  O   . ALA C 1 185 ? 55.520  11.339  74.645  1.00 27.09  ? 185 ALA C O   1 
ATOM   6762  C  CB  . ALA C 1 185 ? 53.517  9.472   73.902  1.00 22.40  ? 185 ALA C CB  1 
ATOM   6763  N  N   . LYS C 1 186 ? 54.736  12.855  73.242  1.00 20.53  ? 186 LYS C N   1 
ATOM   6764  C  CA  . LYS C 1 186 ? 56.042  13.507  73.222  1.00 20.02  ? 186 LYS C CA  1 
ATOM   6765  C  C   . LYS C 1 186 ? 55.929  14.959  73.636  1.00 17.59  ? 186 LYS C C   1 
ATOM   6766  O  O   . LYS C 1 186 ? 54.815  15.499  73.728  1.00 16.98  ? 186 LYS C O   1 
ATOM   6767  C  CB  . LYS C 1 186 ? 56.708  13.369  71.846  1.00 22.07  ? 186 LYS C CB  1 
ATOM   6768  C  CG  . LYS C 1 186 ? 55.801  13.822  70.728  1.00 24.06  ? 186 LYS C CG  1 
ATOM   6769  C  CD  . LYS C 1 186 ? 56.402  13.550  69.361  1.00 26.87  ? 186 LYS C CD  1 
ATOM   6770  C  CE  . LYS C 1 186 ? 55.356  13.838  68.296  1.00 27.73  ? 186 LYS C CE  1 
ATOM   6771  N  NZ  . LYS C 1 186 ? 54.470  12.641  68.121  1.00 28.71  ? 186 LYS C NZ  1 
ATOM   6772  N  N   . TYR C 1 187 ? 57.074  15.545  73.946  1.00 14.64  ? 187 TYR C N   1 
ATOM   6773  C  CA  . TYR C 1 187 ? 57.200  16.968  74.230  1.00 15.05  ? 187 TYR C CA  1 
ATOM   6774  C  C   . TYR C 1 187 ? 56.183  17.585  75.213  1.00 14.90  ? 187 TYR C C   1 
ATOM   6775  O  O   . TYR C 1 187 ? 55.909  18.795  75.144  1.00 13.37  ? 187 TYR C O   1 
ATOM   6776  C  CB  . TYR C 1 187 ? 57.228  17.787  72.947  1.00 14.66  ? 187 TYR C CB  1 
ATOM   6777  C  CG  . TYR C 1 187 ? 58.152  17.296  71.868  1.00 15.44  ? 187 TYR C CG  1 
ATOM   6778  C  CD1 . TYR C 1 187 ? 57.723  17.252  70.544  1.00 16.00  ? 187 TYR C CD1 1 
ATOM   6779  C  CD2 . TYR C 1 187 ? 59.481  16.948  72.143  1.00 16.03  ? 187 TYR C CD2 1 
ATOM   6780  C  CE1 . TYR C 1 187 ? 58.577  16.864  69.505  1.00 16.58  ? 187 TYR C CE1 1 
ATOM   6781  C  CE2 . TYR C 1 187 ? 60.355  16.543  71.133  1.00 16.23  ? 187 TYR C CE2 1 
ATOM   6782  C  CZ  . TYR C 1 187 ? 59.897  16.501  69.794  1.00 17.93  ? 187 TYR C CZ  1 
ATOM   6783  O  OH  . TYR C 1 187 ? 60.737  16.070  68.750  1.00 17.31  ? 187 TYR C OH  1 
ATOM   6784  N  N   . TRP C 1 188 ? 55.645  16.757  76.124  1.00 15.34  ? 188 TRP C N   1 
ATOM   6785  C  CA  . TRP C 1 188 ? 54.690  17.206  77.154  1.00 14.81  ? 188 TRP C CA  1 
ATOM   6786  C  C   . TRP C 1 188 ? 53.467  17.792  76.502  1.00 15.00  ? 188 TRP C C   1 
ATOM   6787  O  O   . TRP C 1 188 ? 52.799  18.674  77.075  1.00 17.45  ? 188 TRP C O   1 
ATOM   6788  C  CB  . TRP C 1 188 ? 55.354  18.231  78.100  1.00 15.33  ? 188 TRP C CB  1 
ATOM   6789  C  CG  . TRP C 1 188 ? 54.858  18.223  79.553  1.00 16.73  ? 188 TRP C CG  1 
ATOM   6790  C  CD1 . TRP C 1 188 ? 54.133  17.233  80.196  1.00 17.03  ? 188 TRP C CD1 1 
ATOM   6791  C  CD2 . TRP C 1 188 ? 55.075  19.252  80.598  1.00 16.74  ? 188 TRP C CD2 1 
ATOM   6792  N  NE1 . TRP C 1 188 ? 53.885  17.570  81.505  1.00 17.50  ? 188 TRP C NE1 1 
ATOM   6793  C  CE2 . TRP C 1 188 ? 54.421  18.755  81.809  1.00 17.02  ? 188 TRP C CE2 1 
ATOM   6794  C  CE3 . TRP C 1 188 ? 55.727  20.486  80.644  1.00 17.37  ? 188 TRP C CE3 1 
ATOM   6795  C  CZ2 . TRP C 1 188 ? 54.434  19.468  83.009  1.00 17.27  ? 188 TRP C CZ2 1 
ATOM   6796  C  CZ3 . TRP C 1 188 ? 55.707  21.213  81.850  1.00 17.47  ? 188 TRP C CZ3 1 
ATOM   6797  C  CH2 . TRP C 1 188 ? 55.077  20.705  83.010  1.00 17.21  ? 188 TRP C CH2 1 
ATOM   6798  N  N   . LEU C 1 189 ? 53.151  17.335  75.297  1.00 13.72  ? 189 LEU C N   1 
ATOM   6799  C  CA  . LEU C 1 189 ? 52.002  17.854  74.569  1.00 13.35  ? 189 LEU C CA  1 
ATOM   6800  C  C   . LEU C 1 189 ? 50.675  17.754  75.301  1.00 13.28  ? 189 LEU C C   1 
ATOM   6801  O  O   . LEU C 1 189 ? 49.892  18.655  75.210  1.00 12.72  ? 189 LEU C O   1 
ATOM   6802  C  CB  . LEU C 1 189 ? 51.857  17.159  73.225  1.00 13.15  ? 189 LEU C CB  1 
ATOM   6803  C  CG  . LEU C 1 189 ? 53.026  17.465  72.286  1.00 13.56  ? 189 LEU C CG  1 
ATOM   6804  C  CD1 . LEU C 1 189 ? 52.899  16.615  71.008  1.00 11.69  ? 189 LEU C CD1 1 
ATOM   6805  C  CD2 . LEU C 1 189 ? 53.066  18.988  72.079  1.00 12.90  ? 189 LEU C CD2 1 
ATOM   6806  N  N   . PRO C 1 190 ? 50.410  16.643  76.017  1.00 13.72  ? 190 PRO C N   1 
ATOM   6807  C  CA  . PRO C 1 190 ? 49.148  16.600  76.725  1.00 14.06  ? 190 PRO C CA  1 
ATOM   6808  C  C   . PRO C 1 190 ? 48.945  17.789  77.655  1.00 14.05  ? 190 PRO C C   1 
ATOM   6809  O  O   . PRO C 1 190 ? 47.827  18.254  77.786  1.00 14.49  ? 190 PRO C O   1 
ATOM   6810  C  CB  . PRO C 1 190 ? 49.264  15.311  77.540  1.00 14.17  ? 190 PRO C CB  1 
ATOM   6811  C  CG  . PRO C 1 190 ? 50.074  14.417  76.657  1.00 13.69  ? 190 PRO C CG  1 
ATOM   6812  C  CD  . PRO C 1 190 ? 51.128  15.364  76.154  1.00 13.92  ? 190 PRO C CD  1 
ATOM   6813  N  N   . TRP C 1 191 ? 49.999  18.263  78.288  1.00 13.66  ? 191 TRP C N   1 
ATOM   6814  C  CA  . TRP C 1 191 ? 49.862  19.368  79.213  1.00 15.52  ? 191 TRP C CA  1 
ATOM   6815  C  C   . TRP C 1 191 ? 49.951  20.705  78.542  1.00 15.29  ? 191 TRP C C   1 
ATOM   6816  O  O   . TRP C 1 191 ? 49.275  21.662  78.936  1.00 14.38  ? 191 TRP C O   1 
ATOM   6817  C  CB  . TRP C 1 191 ? 50.934  19.278  80.288  1.00 17.93  ? 191 TRP C CB  1 
ATOM   6818  C  CG  . TRP C 1 191 ? 50.510  18.515  81.526  1.00 21.02  ? 191 TRP C CG  1 
ATOM   6819  C  CD1 . TRP C 1 191 ? 49.971  19.045  82.697  1.00 22.68  ? 191 TRP C CD1 1 
ATOM   6820  C  CD2 . TRP C 1 191 ? 50.528  17.062  81.737  1.00 23.06  ? 191 TRP C CD2 1 
ATOM   6821  N  NE1 . TRP C 1 191 ? 49.682  18.060  83.593  1.00 25.36  ? 191 TRP C NE1 1 
ATOM   6822  C  CE2 . TRP C 1 191 ? 49.987  16.841  83.087  1.00 24.85  ? 191 TRP C CE2 1 
ATOM   6823  C  CE3 . TRP C 1 191 ? 50.932  15.968  80.988  1.00 23.27  ? 191 TRP C CE3 1 
ATOM   6824  C  CZ2 . TRP C 1 191 ? 49.895  15.570  83.651  1.00 24.91  ? 191 TRP C CZ2 1 
ATOM   6825  C  CZ3 . TRP C 1 191 ? 50.804  14.694  81.552  1.00 25.70  ? 191 TRP C CZ3 1 
ATOM   6826  C  CH2 . TRP C 1 191 ? 50.302  14.501  82.861  1.00 25.36  ? 191 TRP C CH2 1 
ATOM   6827  N  N   . LEU C 1 192 ? 50.796  20.800  77.522  1.00 15.25  ? 192 LEU C N   1 
ATOM   6828  C  CA  . LEU C 1 192 ? 51.013  22.095  76.901  1.00 15.99  ? 192 LEU C CA  1 
ATOM   6829  C  C   . LEU C 1 192 ? 49.941  22.405  75.857  1.00 15.35  ? 192 LEU C C   1 
ATOM   6830  O  O   . LEU C 1 192 ? 49.604  23.549  75.680  1.00 16.66  ? 192 LEU C O   1 
ATOM   6831  C  CB  . LEU C 1 192 ? 52.421  22.240  76.303  1.00 15.54  ? 192 LEU C CB  1 
ATOM   6832  C  CG  . LEU C 1 192 ? 53.637  21.775  77.093  1.00 17.67  ? 192 LEU C CG  1 
ATOM   6833  C  CD1 . LEU C 1 192 ? 54.853  21.837  76.212  1.00 17.12  ? 192 LEU C CD1 1 
ATOM   6834  C  CD2 . LEU C 1 192 ? 53.850  22.632  78.331  1.00 17.49  ? 192 LEU C CD2 1 
ATOM   6835  N  N   . VAL C 1 193 ? 49.440  21.405  75.154  1.00 14.87  ? 193 VAL C N   1 
ATOM   6836  C  CA  . VAL C 1 193 ? 48.456  21.657  74.120  1.00 15.63  ? 193 VAL C CA  1 
ATOM   6837  C  C   . VAL C 1 193 ? 47.180  20.935  74.424  1.00 15.64  ? 193 VAL C C   1 
ATOM   6838  O  O   . VAL C 1 193 ? 46.127  21.380  74.055  1.00 16.53  ? 193 VAL C O   1 
ATOM   6839  C  CB  . VAL C 1 193 ? 48.915  21.184  72.706  1.00 16.27  ? 193 VAL C CB  1 
ATOM   6840  C  CG1 . VAL C 1 193 ? 47.749  21.275  71.738  1.00 15.94  ? 193 VAL C CG1 1 
ATOM   6841  C  CG2 . VAL C 1 193 ? 50.094  22.026  72.163  1.00 16.65  ? 193 VAL C CG2 1 
ATOM   6842  N  N   . GLY C 1 194 ? 47.268  19.792  75.080  1.00 16.16  ? 194 GLY C N   1 
ATOM   6843  C  CA  . GLY C 1 194 ? 46.092  19.017  75.338  1.00 16.88  ? 194 GLY C CA  1 
ATOM   6844  C  C   . GLY C 1 194 ? 45.139  19.674  76.335  1.00 18.62  ? 194 GLY C C   1 
ATOM   6845  O  O   . GLY C 1 194 ? 43.930  19.706  76.076  1.00 21.51  ? 194 GLY C O   1 
ATOM   6846  N  N   . MET C 1 195 ? 45.643  20.226  77.438  1.00 18.26  ? 195 MET C N   1 
ATOM   6847  C  CA  . MET C 1 195 ? 44.733  20.778  78.453  1.00 19.08  ? 195 MET C CA  1 
ATOM   6848  C  C   . MET C 1 195 ? 43.979  21.953  77.871  1.00 18.14  ? 195 MET C C   1 
ATOM   6849  O  O   . MET C 1 195 ? 42.776  21.968  77.922  1.00 17.74  ? 195 MET C O   1 
ATOM   6850  C  CB  . MET C 1 195 ? 45.445  21.144  79.777  1.00 20.24  ? 195 MET C CB  1 
ATOM   6851  C  CG  . MET C 1 195 ? 45.775  19.924  80.612  1.00 22.87  ? 195 MET C CG  1 
ATOM   6852  S  SD  . MET C 1 195 ? 46.656  20.153  82.203  1.00 29.48  ? 195 MET C SD  1 
ATOM   6853  C  CE  . MET C 1 195 ? 45.651  21.391  83.004  1.00 29.18  ? 195 MET C CE  1 
ATOM   6854  N  N   . PRO C 1 196 ? 44.689  22.924  77.260  1.00 18.51  ? 196 PRO C N   1 
ATOM   6855  C  CA  . PRO C 1 196 ? 43.991  24.097  76.694  1.00 17.22  ? 196 PRO C CA  1 
ATOM   6856  C  C   . PRO C 1 196 ? 42.896  23.669  75.681  1.00 16.93  ? 196 PRO C C   1 
ATOM   6857  O  O   . PRO C 1 196 ? 41.772  24.192  75.722  1.00 15.91  ? 196 PRO C O   1 
ATOM   6858  C  CB  . PRO C 1 196 ? 45.095  24.872  75.968  1.00 17.51  ? 196 PRO C CB  1 
ATOM   6859  C  CG  . PRO C 1 196 ? 46.382  24.357  76.514  1.00 17.91  ? 196 PRO C CG  1 
ATOM   6860  C  CD  . PRO C 1 196 ? 46.152  22.968  77.046  1.00 18.10  ? 196 PRO C CD  1 
ATOM   6861  N  N   . ALA C 1 197 ? 43.213  22.709  74.820  1.00 15.99  ? 197 ALA C N   1 
ATOM   6862  C  CA  . ALA C 1 197 ? 42.201  22.155  73.904  1.00 16.91  ? 197 ALA C CA  1 
ATOM   6863  C  C   . ALA C 1 197 ? 41.017  21.491  74.674  1.00 17.26  ? 197 ALA C C   1 
ATOM   6864  O  O   . ALA C 1 197 ? 39.847  21.672  74.312  1.00 16.95  ? 197 ALA C O   1 
ATOM   6865  C  CB  . ALA C 1 197 ? 42.835  21.194  72.907  1.00 14.91  ? 197 ALA C CB  1 
ATOM   6866  N  N   . GLU C 1 198 ? 41.306  20.742  75.734  1.00 17.52  ? 198 GLU C N   1 
ATOM   6867  C  CA  . GLU C 1 198 ? 40.203  20.166  76.511  1.00 18.95  ? 198 GLU C CA  1 
ATOM   6868  C  C   . GLU C 1 198 ? 39.329  21.275  77.029  1.00 16.99  ? 198 GLU C C   1 
ATOM   6869  O  O   . GLU C 1 198 ? 38.121  21.206  76.984  1.00 16.97  ? 198 GLU C O   1 
ATOM   6870  C  CB  . GLU C 1 198 ? 40.708  19.316  77.662  1.00 21.60  ? 198 GLU C CB  1 
ATOM   6871  C  CG  . GLU C 1 198 ? 40.961  17.874  77.267  1.00 25.96  ? 198 GLU C CG  1 
ATOM   6872  C  CD  . GLU C 1 198 ? 39.684  17.079  76.936  1.00 33.25  ? 198 GLU C CD  1 
ATOM   6873  O  OE1 . GLU C 1 198 ? 38.614  17.311  77.582  1.00 35.37  ? 198 GLU C OE1 1 
ATOM   6874  O  OE2 . GLU C 1 198 ? 39.760  16.180  76.035  1.00 36.78  ? 198 GLU C OE2 1 
ATOM   6875  N  N   . THR C 1 199 ? 39.939  22.334  77.508  1.00 16.49  ? 199 THR C N   1 
ATOM   6876  C  CA  . THR C 1 199 ? 39.159  23.431  78.031  1.00 16.49  ? 199 THR C CA  1 
ATOM   6877  C  C   . THR C 1 199 ? 38.292  24.122  76.968  1.00 14.92  ? 199 THR C C   1 
ATOM   6878  O  O   . THR C 1 199 ? 37.150  24.492  77.258  1.00 14.79  ? 199 THR C O   1 
ATOM   6879  C  CB  . THR C 1 199 ? 40.092  24.429  78.700  1.00 17.27  ? 199 THR C CB  1 
ATOM   6880  O  OG1 . THR C 1 199 ? 40.800  23.717  79.716  1.00 20.00  ? 199 THR C OG1 1 
ATOM   6881  C  CG2 . THR C 1 199 ? 39.324  25.609  79.278  1.00 16.02  ? 199 THR C CG2 1 
ATOM   6882  N  N   . THR C 1 200 ? 38.825  24.296  75.761  1.00 13.47  ? 200 THR C N   1 
ATOM   6883  C  CA  . THR C 1 200 ? 38.049  24.917  74.707  1.00 13.95  ? 200 THR C CA  1 
ATOM   6884  C  C   . THR C 1 200 ? 36.801  24.073  74.332  1.00 14.06  ? 200 THR C C   1 
ATOM   6885  O  O   . THR C 1 200 ? 35.735  24.624  74.061  1.00 15.09  ? 200 THR C O   1 
ATOM   6886  C  CB  . THR C 1 200 ? 38.875  25.187  73.419  1.00 13.84  ? 200 THR C CB  1 
ATOM   6887  O  OG1 . THR C 1 200 ? 40.118  25.823  73.727  1.00 13.88  ? 200 THR C OG1 1 
ATOM   6888  C  CG2 . THR C 1 200 ? 38.109  26.139  72.513  1.00 13.67  ? 200 THR C CG2 1 
ATOM   6889  N  N   . ILE C 1 201 ? 36.934  22.751  74.306  1.00 13.55  ? 201 ILE C N   1 
ATOM   6890  C  CA  . ILE C 1 201 ? 35.806  21.882  74.002  1.00 13.95  ? 201 ILE C CA  1 
ATOM   6891  C  C   . ILE C 1 201 ? 34.742  22.019  75.073  1.00 13.54  ? 201 ILE C C   1 
ATOM   6892  O  O   . ILE C 1 201 ? 33.564  22.153  74.791  1.00 13.45  ? 201 ILE C O   1 
ATOM   6893  C  CB  . ILE C 1 201 ? 36.275  20.430  73.847  1.00 15.01  ? 201 ILE C CB  1 
ATOM   6894  C  CG1 . ILE C 1 201 ? 37.050  20.289  72.517  1.00 15.85  ? 201 ILE C CG1 1 
ATOM   6895  C  CG2 . ILE C 1 201 ? 35.100  19.451  73.898  1.00 14.47  ? 201 ILE C CG2 1 
ATOM   6896  C  CD1 . ILE C 1 201 ? 38.207  19.290  72.544  1.00 16.88  ? 201 ILE C CD1 1 
ATOM   6897  N  N   . ALA C 1 202 ? 35.191  22.073  76.312  1.00 13.83  ? 202 ALA C N   1 
ATOM   6898  C  CA  . ALA C 1 202 ? 34.316  22.202  77.466  1.00 13.43  ? 202 ALA C CA  1 
ATOM   6899  C  C   . ALA C 1 202 ? 33.543  23.480  77.389  1.00 13.21  ? 202 ALA C C   1 
ATOM   6900  O  O   . ALA C 1 202 ? 32.309  23.467  77.564  1.00 13.02  ? 202 ALA C O   1 
ATOM   6901  C  CB  . ALA C 1 202 ? 35.127  22.141  78.749  1.00 13.24  ? 202 ALA C CB  1 
ATOM   6902  N  N   . ILE C 1 203 ? 34.240  24.578  77.112  1.00 12.93  ? 203 ILE C N   1 
ATOM   6903  C  CA  . ILE C 1 203 ? 33.532  25.857  76.891  1.00 13.94  ? 203 ILE C CA  1 
ATOM   6904  C  C   . ILE C 1 203 ? 32.504  25.742  75.728  1.00 14.75  ? 203 ILE C C   1 
ATOM   6905  O  O   . ILE C 1 203 ? 31.330  26.045  75.891  1.00 13.80  ? 203 ILE C O   1 
ATOM   6906  C  CB  . ILE C 1 203 ? 34.522  27.006  76.653  1.00 13.75  ? 203 ILE C CB  1 
ATOM   6907  C  CG1 . ILE C 1 203 ? 35.396  27.220  77.921  1.00 13.37  ? 203 ILE C CG1 1 
ATOM   6908  C  CG2 . ILE C 1 203 ? 33.803  28.289  76.288  1.00 13.29  ? 203 ILE C CG2 1 
ATOM   6909  C  CD1 . ILE C 1 203 ? 36.582  28.133  77.669  1.00 14.07  ? 203 ILE C CD1 1 
ATOM   6910  N  N   . CYS C 1 204 ? 32.930  25.242  74.575  1.00 15.95  ? 204 CYS C N   1 
ATOM   6911  C  CA  . CYS C 1 204 ? 31.984  25.050  73.480  1.00 17.67  ? 204 CYS C CA  1 
ATOM   6912  C  C   . CYS C 1 204 ? 30.747  24.217  73.876  1.00 18.74  ? 204 CYS C C   1 
ATOM   6913  O  O   . CYS C 1 204 ? 29.606  24.513  73.451  1.00 17.92  ? 204 CYS C O   1 
ATOM   6914  C  CB  . CYS C 1 204 ? 32.696  24.383  72.319  1.00 18.19  ? 204 CYS C CB  1 
ATOM   6915  S  SG  . CYS C 1 204 ? 33.814  25.545  71.543  1.00 24.28  ? 204 CYS C SG  1 
ATOM   6916  N  N   . SER C 1 205 ? 30.994  23.160  74.654  1.00 18.78  ? 205 SER C N   1 
ATOM   6917  C  CA  . SER C 1 205 ? 29.955  22.218  74.996  1.00 21.23  ? 205 SER C CA  1 
ATOM   6918  C  C   . SER C 1 205 ? 28.935  22.899  75.846  1.00 20.64  ? 205 SER C C   1 
ATOM   6919  O  O   . SER C 1 205 ? 27.746  22.760  75.629  1.00 22.49  ? 205 SER C O   1 
ATOM   6920  C  CB  . SER C 1 205 ? 30.505  20.996  75.727  1.00 20.31  ? 205 SER C CB  1 
ATOM   6921  O  OG  . SER C 1 205 ? 31.130  20.163  74.769  1.00 23.94  ? 205 SER C OG  1 
ATOM   6922  N  N   . MET C 1 206 ? 29.399  23.673  76.796  1.00 21.91  ? 206 MET C N   1 
ATOM   6923  C  CA  . MET C 1 206 ? 28.461  24.345  77.669  1.00 22.44  ? 206 MET C CA  1 
ATOM   6924  C  C   . MET C 1 206 ? 27.622  25.365  76.925  1.00 21.40  ? 206 MET C C   1 
ATOM   6925  O  O   . MET C 1 206 ? 26.407  25.308  77.016  1.00 20.47  ? 206 MET C O   1 
ATOM   6926  C  CB  . MET C 1 206 ? 29.158  24.919  78.886  1.00 23.81  ? 206 MET C CB  1 
ATOM   6927  C  CG  . MET C 1 206 ? 29.750  23.816  79.706  1.00 26.49  ? 206 MET C CG  1 
ATOM   6928  S  SD  . MET C 1 206 ? 30.279  24.398  81.305  1.00 33.30  ? 206 MET C SD  1 
ATOM   6929  C  CE  . MET C 1 206 ? 28.839  25.277  81.896  1.00 28.90  ? 206 MET C CE  1 
ATOM   6930  N  N   . ILE C 1 207 ? 28.271  26.257  76.173  1.00 20.10  ? 207 ILE C N   1 
ATOM   6931  C  CA  . ILE C 1 207 ? 27.588  27.237  75.310  1.00 19.38  ? 207 ILE C CA  1 
ATOM   6932  C  C   . ILE C 1 207 ? 26.675  26.586  74.249  1.00 19.62  ? 207 ILE C C   1 
ATOM   6933  O  O   . ILE C 1 207 ? 25.489  26.900  74.157  1.00 19.59  ? 207 ILE C O   1 
ATOM   6934  C  CB  . ILE C 1 207 ? 28.594  28.147  74.563  1.00 19.01  ? 207 ILE C CB  1 
ATOM   6935  C  CG1 . ILE C 1 207 ? 29.469  28.924  75.542  1.00 19.32  ? 207 ILE C CG1 1 
ATOM   6936  C  CG2 . ILE C 1 207 ? 27.866  29.105  73.623  1.00 19.98  ? 207 ILE C CG2 1 
ATOM   6937  C  CD1 . ILE C 1 207 ? 30.550  29.783  74.892  1.00 19.75  ? 207 ILE C CD1 1 
ATOM   6938  N  N   . MET C 1 208 ? 27.192  25.678  73.443  1.00 21.07  ? 208 MET C N   1 
ATOM   6939  C  CA  . MET C 1 208 ? 26.329  25.152  72.344  1.00 20.80  ? 208 MET C CA  1 
ATOM   6940  C  C   . MET C 1 208 ? 25.357  24.155  72.864  1.00 20.91  ? 208 MET C C   1 
ATOM   6941  O  O   . MET C 1 208 ? 24.378  23.897  72.216  1.00 21.29  ? 208 MET C O   1 
ATOM   6942  C  CB  . MET C 1 208 ? 27.116  24.571  71.178  1.00 20.69  ? 208 MET C CB  1 
ATOM   6943  C  CG  . MET C 1 208 ? 27.775  25.664  70.353  1.00 22.40  ? 208 MET C CG  1 
ATOM   6944  S  SD  . MET C 1 208 ? 28.874  25.019  69.064  1.00 28.04  ? 208 MET C SD  1 
ATOM   6945  C  CE  . MET C 1 208 ? 30.439  25.051  69.921  1.00 24.60  ? 208 MET C CE  1 
ATOM   6946  N  N   . GLY C 1 209 ? 25.611  23.597  74.045  1.00 21.81  ? 209 GLY C N   1 
ATOM   6947  C  CA  . GLY C 1 209 ? 24.685  22.635  74.600  1.00 22.77  ? 209 GLY C CA  1 
ATOM   6948  C  C   . GLY C 1 209 ? 23.563  23.360  75.315  1.00 25.63  ? 209 GLY C C   1 
ATOM   6949  O  O   . GLY C 1 209 ? 22.651  22.712  75.806  1.00 28.03  ? 209 GLY C O   1 
ATOM   6950  N  N   . GLY C 1 210 ? 23.633  24.699  75.382  1.00 25.94  ? 210 GLY C N   1 
ATOM   6951  C  CA  . GLY C 1 210 ? 22.623  25.509  76.050  1.00 25.49  ? 210 GLY C CA  1 
ATOM   6952  C  C   . GLY C 1 210 ? 22.661  25.447  77.576  1.00 28.56  ? 210 GLY C C   1 
ATOM   6953  O  O   . GLY C 1 210 ? 21.625  25.550  78.245  1.00 31.67  ? 210 GLY C O   1 
ATOM   6954  N  N   . VAL C 1 211 ? 23.845  25.295  78.155  1.00 26.50  ? 211 VAL C N   1 
ATOM   6955  C  CA  . VAL C 1 211 ? 23.931  25.194  79.596  1.00 25.90  ? 211 VAL C CA  1 
ATOM   6956  C  C   . VAL C 1 211 ? 23.859  26.571  80.278  1.00 23.78  ? 211 VAL C C   1 
ATOM   6957  O  O   . VAL C 1 211 ? 23.154  26.750  81.262  1.00 22.40  ? 211 VAL C O   1 
ATOM   6958  C  CB  . VAL C 1 211 ? 25.131  24.329  80.041  1.00 26.50  ? 211 VAL C CB  1 
ATOM   6959  C  CG1 . VAL C 1 211 ? 25.010  23.964  81.510  1.00 25.98  ? 211 VAL C CG1 1 
ATOM   6960  C  CG2 . VAL C 1 211 ? 25.212  23.062  79.198  1.00 24.61  ? 211 VAL C CG2 1 
ATOM   6961  N  N   . PHE C 1 212 ? 24.547  27.549  79.727  1.00 23.47  ? 212 PHE C N   1 
ATOM   6962  C  CA  . PHE C 1 212 ? 24.477  28.911  80.237  1.00 24.30  ? 212 PHE C CA  1 
ATOM   6963  C  C   . PHE C 1 212 ? 23.127  29.517  79.979  1.00 26.33  ? 212 PHE C C   1 
ATOM   6964  O  O   . PHE C 1 212 ? 22.751  30.492  80.644  1.00 28.70  ? 212 PHE C O   1 
ATOM   6965  C  CB  . PHE C 1 212 ? 25.492  29.790  79.534  1.00 22.74  ? 212 PHE C CB  1 
ATOM   6966  C  CG  . PHE C 1 212 ? 26.889  29.453  79.868  1.00 22.48  ? 212 PHE C CG  1 
ATOM   6967  C  CD1 . PHE C 1 212 ? 27.283  29.367  81.195  1.00 20.82  ? 212 PHE C CD1 1 
ATOM   6968  C  CD2 . PHE C 1 212 ? 27.825  29.222  78.856  1.00 22.21  ? 212 PHE C CD2 1 
ATOM   6969  C  CE1 . PHE C 1 212 ? 28.589  29.038  81.507  1.00 20.88  ? 212 PHE C CE1 1 
ATOM   6970  C  CE2 . PHE C 1 212 ? 29.136  28.898  79.171  1.00 20.76  ? 212 PHE C CE2 1 
ATOM   6971  C  CZ  . PHE C 1 212 ? 29.515  28.819  80.495  1.00 20.56  ? 212 PHE C CZ  1 
ATOM   6972  N  N   . GLU C 1 213 ? 22.420  28.960  78.987  1.00 27.34  ? 213 GLU C N   1 
ATOM   6973  C  CA  . GLU C 1 213 ? 21.093  29.407  78.663  1.00 29.15  ? 213 GLU C CA  1 
ATOM   6974  C  C   . GLU C 1 213 ? 20.057  28.799  79.593  1.00 29.16  ? 213 GLU C C   1 
ATOM   6975  O  O   . GLU C 1 213 ? 19.204  29.508  80.079  1.00 30.12  ? 213 GLU C O   1 
ATOM   6976  C  CB  . GLU C 1 213 ? 20.740  29.080  77.213  1.00 34.30  ? 213 GLU C CB  1 
ATOM   6977  C  CG  . GLU C 1 213 ? 19.593  29.925  76.702  1.00 39.11  ? 213 GLU C CG  1 
ATOM   6978  C  CD  . GLU C 1 213 ? 19.901  31.425  76.809  1.00 47.25  ? 213 GLU C CD  1 
ATOM   6979  O  OE1 . GLU C 1 213 ? 20.531  31.984  75.882  1.00 52.36  ? 213 GLU C OE1 1 
ATOM   6980  O  OE2 . GLU C 1 213 ? 19.515  32.055  77.822  1.00 51.35  ? 213 GLU C OE2 1 
ATOM   6981  N  N   . LYS C 1 214 ? 20.112  27.489  79.833  1.00 28.71  ? 214 LYS C N   1 
ATOM   6982  C  CA  . LYS C 1 214 ? 19.150  26.876  80.721  1.00 29.47  ? 214 LYS C CA  1 
ATOM   6983  C  C   . LYS C 1 214 ? 19.397  27.237  82.203  1.00 28.63  ? 214 LYS C C   1 
ATOM   6984  O  O   . LYS C 1 214 ? 18.464  27.342  82.980  1.00 27.44  ? 214 LYS C O   1 
ATOM   6985  C  CB  . LYS C 1 214 ? 19.021  25.368  80.474  1.00 32.38  ? 214 LYS C CB  1 
ATOM   6986  C  CG  . LYS C 1 214 ? 18.038  24.990  79.332  1.00 40.42  ? 214 LYS C CG  1 
ATOM   6987  C  CD  . LYS C 1 214 ? 18.676  24.746  77.925  1.00 39.70  ? 214 LYS C CD  1 
ATOM   6988  C  CE  . LYS C 1 214 ? 18.587  25.979  77.011  1.00 41.00  ? 214 LYS C CE  1 
ATOM   6989  N  NZ  . LYS C 1 214 ? 19.091  25.822  75.602  1.00 43.14  ? 214 LYS C NZ  1 
ATOM   6990  N  N   . PHE C 1 215 ? 20.643  27.462  82.587  1.00 27.61  ? 215 PHE C N   1 
ATOM   6991  C  CA  . PHE C 1 215 ? 20.930  27.781  83.989  1.00 27.17  ? 215 PHE C CA  1 
ATOM   6992  C  C   . PHE C 1 215 ? 21.677  29.090  84.072  1.00 27.19  ? 215 PHE C C   1 
ATOM   6993  O  O   . PHE C 1 215 ? 22.876  29.091  84.270  1.00 25.92  ? 215 PHE C O   1 
ATOM   6994  C  CB  . PHE C 1 215 ? 21.760  26.676  84.635  1.00 24.30  ? 215 PHE C CB  1 
ATOM   6995  C  CG  . PHE C 1 215 ? 21.170  25.309  84.469  1.00 25.09  ? 215 PHE C CG  1 
ATOM   6996  C  CD1 . PHE C 1 215 ? 20.127  24.867  85.309  1.00 25.05  ? 215 PHE C CD1 1 
ATOM   6997  C  CD2 . PHE C 1 215 ? 21.640  24.453  83.483  1.00 23.67  ? 215 PHE C CD2 1 
ATOM   6998  C  CE1 . PHE C 1 215 ? 19.573  23.602  85.154  1.00 23.78  ? 215 PHE C CE1 1 
ATOM   6999  C  CE2 . PHE C 1 215 ? 21.083  23.190  83.327  1.00 25.21  ? 215 PHE C CE2 1 
ATOM   7000  C  CZ  . PHE C 1 215 ? 20.053  22.756  84.174  1.00 24.12  ? 215 PHE C CZ  1 
ATOM   7001  N  N   . PRO C 1 216 ? 20.967  30.213  83.937  1.00 28.39  ? 216 PRO C N   1 
ATOM   7002  C  CA  . PRO C 1 216 ? 21.647  31.509  83.752  1.00 29.80  ? 216 PRO C CA  1 
ATOM   7003  C  C   . PRO C 1 216 ? 22.314  32.128  85.001  1.00 29.03  ? 216 PRO C C   1 
ATOM   7004  O  O   . PRO C 1 216 ? 23.001  33.123  84.880  1.00 28.08  ? 216 PRO C O   1 
ATOM   7005  C  CB  . PRO C 1 216 ? 20.521  32.425  83.229  1.00 30.74  ? 216 PRO C CB  1 
ATOM   7006  C  CG  . PRO C 1 216 ? 19.254  31.814  83.722  1.00 29.82  ? 216 PRO C CG  1 
ATOM   7007  C  CD  . PRO C 1 216 ? 19.503  30.350  84.008  1.00 29.86  ? 216 PRO C CD  1 
ATOM   7008  N  N   . LYS C 1 217 ? 22.110  31.556  86.178  1.00 32.03  ? 217 LYS C N   1 
ATOM   7009  C  CA  . LYS C 1 217 ? 22.781  32.037  87.406  1.00 31.98  ? 217 LYS C CA  1 
ATOM   7010  C  C   . LYS C 1 217 ? 23.945  31.130  87.830  1.00 28.59  ? 217 LYS C C   1 
ATOM   7011  O  O   . LYS C 1 217 ? 24.642  31.417  88.800  1.00 26.24  ? 217 LYS C O   1 
ATOM   7012  C  CB  . LYS C 1 217 ? 21.772  32.187  88.560  1.00 33.57  ? 217 LYS C CB  1 
ATOM   7013  C  CG  . LYS C 1 217 ? 20.748  33.294  88.320  1.00 39.00  ? 217 LYS C CG  1 
ATOM   7014  C  CD  . LYS C 1 217 ? 19.950  33.649  89.579  1.00 46.17  ? 217 LYS C CD  1 
ATOM   7015  C  CE  . LYS C 1 217 ? 20.667  34.629  90.518  1.00 50.19  ? 217 LYS C CE  1 
ATOM   7016  N  NZ  . LYS C 1 217 ? 20.951  35.951  89.873  1.00 49.49  ? 217 LYS C NZ  1 
ATOM   7017  N  N   . LEU C 1 218 ? 24.127  30.019  87.117  1.00 26.87  ? 218 LEU C N   1 
ATOM   7018  C  CA  . LEU C 1 218 ? 25.298  29.149  87.328  1.00 26.28  ? 218 LEU C CA  1 
ATOM   7019  C  C   . LEU C 1 218 ? 26.602  29.955  87.189  1.00 24.58  ? 218 LEU C C   1 
ATOM   7020  O  O   . LEU C 1 218 ? 26.748  30.730  86.264  1.00 22.44  ? 218 LEU C O   1 
ATOM   7021  C  CB  . LEU C 1 218 ? 25.278  27.986  86.336  1.00 22.94  ? 218 LEU C CB  1 
ATOM   7022  C  CG  . LEU C 1 218 ? 26.052  26.716  86.652  1.00 22.76  ? 218 LEU C CG  1 
ATOM   7023  C  CD1 . LEU C 1 218 ? 25.717  26.166  88.032  1.00 21.08  ? 218 LEU C CD1 1 
ATOM   7024  C  CD2 . LEU C 1 218 ? 25.781  25.671  85.569  1.00 20.89  ? 218 LEU C CD2 1 
ATOM   7025  N  N   . LYS C 1 219 ? 27.511  29.820  88.153  1.00 25.26  ? 219 LYS C N   1 
ATOM   7026  C  CA  . LYS C 1 219 ? 28.762  30.564  88.100  1.00 24.39  ? 219 LYS C CA  1 
ATOM   7027  C  C   . LYS C 1 219 ? 29.818  29.584  87.665  1.00 21.05  ? 219 LYS C C   1 
ATOM   7028  O  O   . LYS C 1 219 ? 30.052  28.586  88.323  1.00 20.89  ? 219 LYS C O   1 
ATOM   7029  C  CB  . LYS C 1 219 ? 29.137  31.141  89.454  1.00 30.01  ? 219 LYS C CB  1 
ATOM   7030  C  CG  . LYS C 1 219 ? 27.989  31.699  90.266  1.00 32.11  ? 219 LYS C CG  1 
ATOM   7031  C  CD  . LYS C 1 219 ? 28.509  32.801  91.171  1.00 33.62  ? 219 LYS C CD  1 
ATOM   7032  C  CE  . LYS C 1 219 ? 28.566  34.118  90.433  1.00 34.80  ? 219 LYS C CE  1 
ATOM   7033  N  NZ  . LYS C 1 219 ? 27.236  34.788  90.401  1.00 38.63  ? 219 LYS C NZ  1 
ATOM   7034  N  N   . VAL C 1 220 ? 30.431  29.838  86.523  1.00 18.26  ? 220 VAL C N   1 
ATOM   7035  C  CA  . VAL C 1 220 ? 31.388  28.890  85.987  1.00 16.19  ? 220 VAL C CA  1 
ATOM   7036  C  C   . VAL C 1 220 ? 32.745  29.537  85.804  1.00 15.00  ? 220 VAL C C   1 
ATOM   7037  O  O   . VAL C 1 220 ? 32.837  30.693  85.371  1.00 15.30  ? 220 VAL C O   1 
ATOM   7038  C  CB  . VAL C 1 220 ? 30.876  28.280  84.684  1.00 15.47  ? 220 VAL C CB  1 
ATOM   7039  C  CG1 . VAL C 1 220 ? 31.845  27.227  84.195  1.00 15.05  ? 220 VAL C CG1 1 
ATOM   7040  C  CG2 . VAL C 1 220 ? 29.512  27.648  84.913  1.00 15.57  ? 220 VAL C CG2 1 
ATOM   7041  N  N   . CYS C 1 221 ? 33.796  28.815  86.152  1.00 13.84  ? 221 CYS C N   1 
ATOM   7042  C  CA  . CYS C 1 221 ? 35.131  29.276  85.808  1.00 14.33  ? 221 CYS C CA  1 
ATOM   7043  C  C   . CYS C 1 221 ? 35.999  28.171  85.206  1.00 13.95  ? 221 CYS C C   1 
ATOM   7044  O  O   . CYS C 1 221 ? 35.989  27.046  85.683  1.00 13.73  ? 221 CYS C O   1 
ATOM   7045  C  CB  . CYS C 1 221 ? 35.789  29.899  87.041  1.00 15.60  ? 221 CYS C CB  1 
ATOM   7046  S  SG  . CYS C 1 221 ? 37.532  30.341  86.873  1.00 18.55  ? 221 CYS C SG  1 
ATOM   7047  N  N   . PHE C 1 222 ? 36.753  28.509  84.163  1.00 13.34  ? 222 PHE C N   1 
ATOM   7048  C  CA  . PHE C 1 222 ? 37.584  27.561  83.468  1.00 13.39  ? 222 PHE C CA  1 
ATOM   7049  C  C   . PHE C 1 222 ? 39.078  27.789  83.697  1.00 14.46  ? 222 PHE C C   1 
ATOM   7050  O  O   . PHE C 1 222 ? 39.533  28.910  83.761  1.00 16.48  ? 222 PHE C O   1 
ATOM   7051  C  CB  . PHE C 1 222 ? 37.296  27.711  81.989  1.00 12.60  ? 222 PHE C CB  1 
ATOM   7052  C  CG  . PHE C 1 222 ? 35.893  27.356  81.618  1.00 12.22  ? 222 PHE C CG  1 
ATOM   7053  C  CD1 . PHE C 1 222 ? 35.518  26.006  81.431  1.00 11.61  ? 222 PHE C CD1 1 
ATOM   7054  C  CD2 . PHE C 1 222 ? 34.932  28.351  81.423  1.00 11.38  ? 222 PHE C CD2 1 
ATOM   7055  C  CE1 . PHE C 1 222 ? 34.206  25.670  81.079  1.00 10.63  ? 222 PHE C CE1 1 
ATOM   7056  C  CE2 . PHE C 1 222 ? 33.625  27.995  81.085  1.00 11.13  ? 222 PHE C CE2 1 
ATOM   7057  C  CZ  . PHE C 1 222 ? 33.273  26.661  80.924  1.00 10.46  ? 222 PHE C CZ  1 
ATOM   7058  N  N   . ALA C 1 223 ? 39.849  26.730  83.816  1.00 15.19  ? 223 ALA C N   1 
ATOM   7059  C  CA  . ALA C 1 223 ? 41.286  26.830  84.034  1.00 16.68  ? 223 ALA C CA  1 
ATOM   7060  C  C   . ALA C 1 223 ? 42.059  27.444  82.817  1.00 18.52  ? 223 ALA C C   1 
ATOM   7061  O  O   . ALA C 1 223 ? 41.501  27.566  81.701  1.00 19.39  ? 223 ALA C O   1 
ATOM   7062  C  CB  . ALA C 1 223 ? 41.813  25.425  84.323  1.00 16.57  ? 223 ALA C CB  1 
ATOM   7063  N  N   . HIS C 1 224 ? 43.338  27.772  83.025  1.00 18.13  ? 224 HIS C N   1 
ATOM   7064  C  CA  . HIS C 1 224 ? 44.249  28.272  81.971  1.00 19.63  ? 224 HIS C CA  1 
ATOM   7065  C  C   . HIS C 1 224 ? 43.645  29.193  80.925  1.00 21.52  ? 224 HIS C C   1 
ATOM   7066  O  O   . HIS C 1 224 ? 43.767  28.983  79.697  1.00 22.07  ? 224 HIS C O   1 
ATOM   7067  C  CB  . HIS C 1 224 ? 45.015  27.132  81.312  1.00 20.82  ? 224 HIS C CB  1 
ATOM   7068  C  CG  . HIS C 1 224 ? 45.273  25.967  82.218  1.00 22.17  ? 224 HIS C CG  1 
ATOM   7069  N  ND1 . HIS C 1 224 ? 46.233  25.977  83.164  1.00 23.98  ? 224 HIS C ND1 1 
ATOM   7070  C  CD2 . HIS C 1 224 ? 44.671  24.712  82.288  1.00 23.52  ? 224 HIS C CD2 1 
ATOM   7071  C  CE1 . HIS C 1 224 ? 46.251  24.780  83.810  1.00 23.38  ? 224 HIS C CE1 1 
ATOM   7072  N  NE2 . HIS C 1 224 ? 45.295  24.015  83.281  1.00 23.11  ? 224 HIS C NE2 1 
ATOM   7073  N  N   . GLY C 1 225 ? 42.993  30.248  81.415  1.00 23.27  ? 225 GLY C N   1 
ATOM   7074  C  CA  . GLY C 1 225 ? 42.518  31.345  80.594  1.00 21.56  ? 225 GLY C CA  1 
ATOM   7075  C  C   . GLY C 1 225 ? 41.585  30.902  79.479  1.00 22.15  ? 225 GLY C C   1 
ATOM   7076  O  O   . GLY C 1 225 ? 41.489  31.566  78.434  1.00 23.52  ? 225 GLY C O   1 
ATOM   7077  N  N   . GLY C 1 226 ? 40.877  29.799  79.675  1.00 20.45  ? 226 GLY C N   1 
ATOM   7078  C  CA  . GLY C 1 226 ? 39.877  29.418  78.680  1.00 18.91  ? 226 GLY C CA  1 
ATOM   7079  C  C   . GLY C 1 226 ? 40.538  28.589  77.590  1.00 18.18  ? 226 GLY C C   1 
ATOM   7080  O  O   . GLY C 1 226 ? 39.929  28.315  76.578  1.00 17.49  ? 226 GLY C O   1 
ATOM   7081  N  N   . GLY C 1 227 ? 41.765  28.131  77.823  1.00 16.95  ? 227 GLY C N   1 
ATOM   7082  C  CA  . GLY C 1 227 ? 42.438  27.297  76.838  1.00 17.70  ? 227 GLY C CA  1 
ATOM   7083  C  C   . GLY C 1 227 ? 42.838  28.117  75.620  1.00 17.82  ? 227 GLY C C   1 
ATOM   7084  O  O   . GLY C 1 227 ? 43.775  28.884  75.688  1.00 18.68  ? 227 GLY C O   1 
ATOM   7085  N  N   . ALA C 1 228 ? 42.083  27.994  74.535  1.00 17.90  ? 228 ALA C N   1 
ATOM   7086  C  CA  . ALA C 1 228 ? 42.404  28.638  73.258  1.00 17.47  ? 228 ALA C CA  1 
ATOM   7087  C  C   . ALA C 1 228 ? 41.215  29.478  72.857  1.00 16.58  ? 228 ALA C C   1 
ATOM   7088  O  O   . ALA C 1 228 ? 41.226  30.255  71.900  1.00 18.59  ? 228 ALA C O   1 
ATOM   7089  C  CB  . ALA C 1 228 ? 42.687  27.575  72.192  1.00 17.37  ? 228 ALA C CB  1 
ATOM   7090  N  N   . PHE C 1 229 ? 40.190  29.358  73.648  1.00 15.62  ? 229 PHE C N   1 
ATOM   7091  C  CA  . PHE C 1 229 ? 38.961  30.005  73.346  1.00 15.74  ? 229 PHE C CA  1 
ATOM   7092  C  C   . PHE C 1 229 ? 39.010  31.523  73.198  1.00 16.21  ? 229 PHE C C   1 
ATOM   7093  O  O   . PHE C 1 229 ? 38.277  32.048  72.394  1.00 16.65  ? 229 PHE C O   1 
ATOM   7094  C  CB  . PHE C 1 229 ? 37.908  29.597  74.376  1.00 15.41  ? 229 PHE C CB  1 
ATOM   7095  C  CG  . PHE C 1 229 ? 36.577  30.253  74.164  1.00 15.46  ? 229 PHE C CG  1 
ATOM   7096  C  CD1 . PHE C 1 229 ? 35.614  29.629  73.412  1.00 14.34  ? 229 PHE C CD1 1 
ATOM   7097  C  CD2 . PHE C 1 229 ? 36.303  31.494  74.733  1.00 14.77  ? 229 PHE C CD2 1 
ATOM   7098  C  CE1 . PHE C 1 229 ? 34.388  30.227  73.231  1.00 14.98  ? 229 PHE C CE1 1 
ATOM   7099  C  CE2 . PHE C 1 229 ? 35.064  32.100  74.557  1.00 14.58  ? 229 PHE C CE2 1 
ATOM   7100  C  CZ  . PHE C 1 229 ? 34.103  31.462  73.812  1.00 14.32  ? 229 PHE C CZ  1 
ATOM   7101  N  N   . PRO C 1 230 ? 39.844  32.256  73.973  1.00 15.16  ? 230 PRO C N   1 
ATOM   7102  C  CA  . PRO C 1 230 ? 39.748  33.678  73.656  1.00 14.83  ? 230 PRO C CA  1 
ATOM   7103  C  C   . PRO C 1 230 ? 40.323  34.052  72.286  1.00 14.49  ? 230 PRO C C   1 
ATOM   7104  O  O   . PRO C 1 230 ? 40.028  35.136  71.766  1.00 13.86  ? 230 PRO C O   1 
ATOM   7105  C  CB  . PRO C 1 230 ? 40.583  34.342  74.746  1.00 14.33  ? 230 PRO C CB  1 
ATOM   7106  C  CG  . PRO C 1 230 ? 40.580  33.370  75.862  1.00 14.83  ? 230 PRO C CG  1 
ATOM   7107  C  CD  . PRO C 1 230 ? 40.662  32.041  75.160  1.00 15.41  ? 230 PRO C CD  1 
ATOM   7108  N  N   . PHE C 1 231 ? 41.170  33.198  71.738  1.00 14.46  ? 231 PHE C N   1 
ATOM   7109  C  CA  . PHE C 1 231 ? 41.843  33.522  70.484  1.00 14.60  ? 231 PHE C CA  1 
ATOM   7110  C  C   . PHE C 1 231 ? 40.991  33.013  69.319  1.00 14.51  ? 231 PHE C C   1 
ATOM   7111  O  O   . PHE C 1 231 ? 40.844  33.669  68.332  1.00 15.53  ? 231 PHE C O   1 
ATOM   7112  C  CB  . PHE C 1 231 ? 43.222  32.878  70.448  1.00 14.21  ? 231 PHE C CB  1 
ATOM   7113  C  CG  . PHE C 1 231 ? 44.010  33.227  69.243  1.00 14.70  ? 231 PHE C CG  1 
ATOM   7114  C  CD1 . PHE C 1 231 ? 44.441  34.533  69.038  1.00 15.92  ? 231 PHE C CD1 1 
ATOM   7115  C  CD2 . PHE C 1 231 ? 44.332  32.256  68.288  1.00 15.28  ? 231 PHE C CD2 1 
ATOM   7116  C  CE1 . PHE C 1 231 ? 45.181  34.882  67.907  1.00 15.31  ? 231 PHE C CE1 1 
ATOM   7117  C  CE2 . PHE C 1 231 ? 45.064  32.599  67.144  1.00 15.66  ? 231 PHE C CE2 1 
ATOM   7118  C  CZ  . PHE C 1 231 ? 45.489  33.912  66.959  1.00 15.29  ? 231 PHE C CZ  1 
ATOM   7119  N  N   . THR C 1 232 ? 40.406  31.845  69.475  1.00 13.67  ? 232 THR C N   1 
ATOM   7120  C  CA  . THR C 1 232 ? 39.635  31.226  68.442  1.00 13.28  ? 232 THR C CA  1 
ATOM   7121  C  C   . THR C 1 232 ? 38.110  31.492  68.572  1.00 13.70  ? 232 THR C C   1 
ATOM   7122  O  O   . THR C 1 232 ? 37.307  30.948  67.799  1.00 15.07  ? 232 THR C O   1 
ATOM   7123  C  CB  . THR C 1 232 ? 39.863  29.720  68.507  1.00 12.87  ? 232 THR C CB  1 
ATOM   7124  O  OG1 . THR C 1 232 ? 39.541  29.299  69.831  1.00 13.56  ? 232 THR C OG1 1 
ATOM   7125  C  CG2 . THR C 1 232 ? 41.317  29.328  68.206  1.00 12.03  ? 232 THR C CG2 1 
ATOM   7126  N  N   . VAL C 1 233 ? 37.683  32.332  69.498  1.00 13.58  ? 233 VAL C N   1 
ATOM   7127  C  CA  . VAL C 1 233 ? 36.263  32.554  69.620  1.00 13.84  ? 233 VAL C CA  1 
ATOM   7128  C  C   . VAL C 1 233 ? 35.735  33.101  68.258  1.00 14.05  ? 233 VAL C C   1 
ATOM   7129  O  O   . VAL C 1 233 ? 34.604  32.863  67.893  1.00 13.51  ? 233 VAL C O   1 
ATOM   7130  C  CB  . VAL C 1 233 ? 35.895  33.495  70.790  1.00 14.01  ? 233 VAL C CB  1 
ATOM   7131  C  CG1 . VAL C 1 233 ? 36.488  34.880  70.576  1.00 13.85  ? 233 VAL C CG1 1 
ATOM   7132  C  CG2 . VAL C 1 233 ? 34.379  33.621  70.888  1.00 14.76  ? 233 VAL C CG2 1 
ATOM   7133  N  N   . GLY C 1 234 ? 36.579  33.788  67.505  1.00 13.79  ? 234 GLY C N   1 
ATOM   7134  C  CA  . GLY C 1 234 ? 36.138  34.387  66.252  1.00 14.72  ? 234 GLY C CA  1 
ATOM   7135  C  C   . GLY C 1 234 ? 35.762  33.290  65.288  1.00 14.46  ? 234 GLY C C   1 
ATOM   7136  O  O   . GLY C 1 234 ? 34.720  33.332  64.671  1.00 15.09  ? 234 GLY C O   1 
ATOM   7137  N  N   . ARG C 1 235 ? 36.608  32.280  65.212  1.00 15.01  ? 235 ARG C N   1 
ATOM   7138  C  CA  . ARG C 1 235 ? 36.364  31.089  64.367  1.00 14.34  ? 235 ARG C CA  1 
ATOM   7139  C  C   . ARG C 1 235 ? 35.138  30.299  64.822  1.00 13.69  ? 235 ARG C C   1 
ATOM   7140  O  O   . ARG C 1 235 ? 34.284  29.944  64.010  1.00 13.02  ? 235 ARG C O   1 
ATOM   7141  C  CB  . ARG C 1 235 ? 37.601  30.206  64.377  1.00 13.73  ? 235 ARG C CB  1 
ATOM   7142  C  CG  . ARG C 1 235 ? 37.545  29.002  63.478  1.00 14.96  ? 235 ARG C CG  1 
ATOM   7143  C  CD  . ARG C 1 235 ? 38.794  28.150  63.682  1.00 17.29  ? 235 ARG C CD  1 
ATOM   7144  N  NE  . ARG C 1 235 ? 38.741  26.933  62.877  1.00 17.60  ? 235 ARG C NE  1 
ATOM   7145  C  CZ  . ARG C 1 235 ? 38.961  26.914  61.571  1.00 19.35  ? 235 ARG C CZ  1 
ATOM   7146  N  NH1 . ARG C 1 235 ? 39.225  28.054  60.907  1.00 21.46  ? 235 ARG C NH1 1 
ATOM   7147  N  NH2 . ARG C 1 235 ? 38.863  25.772  60.908  1.00 20.06  ? 235 ARG C NH2 1 
ATOM   7148  N  N   . ILE C 1 236 ? 35.081  29.970  66.109  1.00 14.14  ? 236 ILE C N   1 
ATOM   7149  C  CA  . ILE C 1 236 ? 33.957  29.199  66.648  1.00 13.45  ? 236 ILE C CA  1 
ATOM   7150  C  C   . ILE C 1 236 ? 32.659  29.899  66.300  1.00 13.75  ? 236 ILE C C   1 
ATOM   7151  O  O   . ILE C 1 236 ? 31.716  29.273  65.794  1.00 13.75  ? 236 ILE C O   1 
ATOM   7152  C  CB  . ILE C 1 236 ? 34.124  29.001  68.165  1.00 13.56  ? 236 ILE C CB  1 
ATOM   7153  C  CG1 . ILE C 1 236 ? 35.292  28.050  68.428  1.00 13.31  ? 236 ILE C CG1 1 
ATOM   7154  C  CG2 . ILE C 1 236 ? 32.823  28.492  68.799  1.00 13.46  ? 236 ILE C CG2 1 
ATOM   7155  C  CD1 . ILE C 1 236 ? 36.017  28.291  69.752  1.00 12.54  ? 236 ILE C CD1 1 
ATOM   7156  N  N   . SER C 1 237 ? 32.642  31.217  66.499  1.00 14.46  ? 237 SER C N   1 
ATOM   7157  C  CA  . SER C 1 237 ? 31.477  32.074  66.252  1.00 14.70  ? 237 SER C CA  1 
ATOM   7158  C  C   . SER C 1 237 ? 31.029  32.156  64.788  1.00 15.46  ? 237 SER C C   1 
ATOM   7159  O  O   . SER C 1 237 ? 29.860  31.948  64.463  1.00 14.90  ? 237 SER C O   1 
ATOM   7160  C  CB  . SER C 1 237 ? 31.803  33.479  66.730  1.00 15.34  ? 237 SER C CB  1 
ATOM   7161  O  OG  . SER C 1 237 ? 30.739  34.352  66.407  1.00 17.51  ? 237 SER C OG  1 
ATOM   7162  N  N   . HIS C 1 238 ? 31.959  32.510  63.916  1.00 15.71  ? 238 HIS C N   1 
ATOM   7163  C  CA  . HIS C 1 238 ? 31.750  32.447  62.478  1.00 17.25  ? 238 HIS C CA  1 
ATOM   7164  C  C   . HIS C 1 238 ? 31.274  31.084  62.031  1.00 17.49  ? 238 HIS C C   1 
ATOM   7165  O  O   . HIS C 1 238 ? 30.309  30.968  61.243  1.00 16.40  ? 238 HIS C O   1 
ATOM   7166  C  CB  . HIS C 1 238 ? 33.051  32.775  61.759  1.00 19.75  ? 238 HIS C CB  1 
ATOM   7167  C  CG  . HIS C 1 238 ? 32.890  32.997  60.276  1.00 21.50  ? 238 HIS C CG  1 
ATOM   7168  N  ND1 . HIS C 1 238 ? 32.169  34.040  59.765  1.00 21.95  ? 238 HIS C ND1 1 
ATOM   7169  C  CD2 . HIS C 1 238 ? 33.387  32.280  59.185  1.00 21.49  ? 238 HIS C CD2 1 
ATOM   7170  C  CE1 . HIS C 1 238 ? 32.180  33.966  58.423  1.00 21.87  ? 238 HIS C CE1 1 
ATOM   7171  N  NE2 . HIS C 1 238 ? 32.941  32.890  58.063  1.00 21.33  ? 238 HIS C NE2 1 
ATOM   7172  N  N   . GLY C 1 239 ? 31.924  30.023  62.534  1.00 16.80  ? 239 GLY C N   1 
ATOM   7173  C  CA  . GLY C 1 239 ? 31.515  28.669  62.167  1.00 15.71  ? 239 GLY C CA  1 
ATOM   7174  C  C   . GLY C 1 239 ? 30.070  28.452  62.568  1.00 18.15  ? 239 GLY C C   1 
ATOM   7175  O  O   . GLY C 1 239 ? 29.264  27.984  61.775  1.00 18.78  ? 239 GLY C O   1 
ATOM   7176  N  N   . PHE C 1 240 ? 29.725  28.817  63.811  1.00 18.96  ? 240 PHE C N   1 
ATOM   7177  C  CA  . PHE C 1 240 ? 28.363  28.668  64.292  1.00 17.97  ? 240 PHE C CA  1 
ATOM   7178  C  C   . PHE C 1 240 ? 27.382  29.317  63.322  1.00 17.34  ? 240 PHE C C   1 
ATOM   7179  O  O   . PHE C 1 240 ? 26.380  28.684  63.020  1.00 16.23  ? 240 PHE C O   1 
ATOM   7180  C  CB  . PHE C 1 240 ? 28.206  29.180  65.736  1.00 16.87  ? 240 PHE C CB  1 
ATOM   7181  C  CG  . PHE C 1 240 ? 26.820  28.984  66.337  1.00 17.41  ? 240 PHE C CG  1 
ATOM   7182  C  CD1 . PHE C 1 240 ? 26.592  27.980  67.280  1.00 17.87  ? 240 PHE C CD1 1 
ATOM   7183  C  CD2 . PHE C 1 240 ? 25.750  29.839  66.005  1.00 16.76  ? 240 PHE C CD2 1 
ATOM   7184  C  CE1 . PHE C 1 240 ? 25.344  27.819  67.871  1.00 17.61  ? 240 PHE C CE1 1 
ATOM   7185  C  CE2 . PHE C 1 240 ? 24.509  29.680  66.590  1.00 17.50  ? 240 PHE C CE2 1 
ATOM   7186  C  CZ  . PHE C 1 240 ? 24.287  28.661  67.517  1.00 17.68  ? 240 PHE C CZ  1 
ATOM   7187  N  N   . SER C 1 241 ? 27.642  30.551  62.867  1.00 18.12  ? 241 SER C N   1 
ATOM   7188  C  CA  . SER C 1 241 ? 26.720  31.228  61.919  1.00 19.84  ? 241 SER C CA  1 
ATOM   7189  C  C   . SER C 1 241 ? 26.632  30.522  60.562  1.00 21.27  ? 241 SER C C   1 
ATOM   7190  O  O   . SER C 1 241 ? 25.616  30.609  59.890  1.00 21.75  ? 241 SER C O   1 
ATOM   7191  C  CB  . SER C 1 241 ? 27.125  32.671  61.606  1.00 19.01  ? 241 SER C CB  1 
ATOM   7192  O  OG  . SER C 1 241 ? 27.373  33.440  62.752  1.00 21.57  ? 241 SER C OG  1 
ATOM   7193  N  N   . MET C 1 242 ? 27.725  29.895  60.143  1.00 23.55  ? 242 MET C N   1 
ATOM   7194  C  CA  . MET C 1 242 ? 27.836  29.329  58.782  1.00 26.72  ? 242 MET C CA  1 
ATOM   7195  C  C   . MET C 1 242 ? 27.150  27.987  58.648  1.00 25.41  ? 242 MET C C   1 
ATOM   7196  O  O   . MET C 1 242 ? 26.371  27.773  57.722  1.00 27.44  ? 242 MET C O   1 
ATOM   7197  C  CB  . MET C 1 242 ? 29.289  29.255  58.323  1.00 25.82  ? 242 MET C CB  1 
ATOM   7198  C  CG  . MET C 1 242 ? 29.878  30.632  58.096  1.00 30.05  ? 242 MET C CG  1 
ATOM   7199  S  SD  . MET C 1 242 ? 28.924  31.700  56.978  1.00 36.15  ? 242 MET C SD  1 
ATOM   7200  C  CE  . MET C 1 242 ? 28.191  32.922  58.071  1.00 32.90  ? 242 MET C CE  1 
ATOM   7201  N  N   . ARG C 1 243 ? 27.422  27.096  59.587  1.00 24.25  ? 243 ARG C N   1 
ATOM   7202  C  CA  . ARG C 1 243 ? 26.772  25.792  59.620  1.00 23.12  ? 243 ARG C CA  1 
ATOM   7203  C  C   . ARG C 1 243 ? 25.866  25.704  60.839  1.00 23.55  ? 243 ARG C C   1 
ATOM   7204  O  O   . ARG C 1 243 ? 26.205  25.033  61.820  1.00 23.86  ? 243 ARG C O   1 
ATOM   7205  C  CB  . ARG C 1 243 ? 27.813  24.664  59.614  1.00 23.47  ? 243 ARG C CB  1 
ATOM   7206  C  CG  . ARG C 1 243 ? 28.693  24.650  58.355  1.00 23.50  ? 243 ARG C CG  1 
ATOM   7207  C  CD  . ARG C 1 243 ? 27.868  24.361  57.099  1.00 22.87  ? 243 ARG C CD  1 
ATOM   7208  N  NE  . ARG C 1 243 ? 27.159  23.091  57.304  1.00 23.47  ? 243 ARG C NE  1 
ATOM   7209  C  CZ  . ARG C 1 243 ? 27.651  21.892  56.963  1.00 24.37  ? 243 ARG C CZ  1 
ATOM   7210  N  NH1 . ARG C 1 243 ? 28.858  21.784  56.377  1.00 21.72  ? 243 ARG C NH1 1 
ATOM   7211  N  NH2 . ARG C 1 243 ? 26.944  20.792  57.224  1.00 21.96  ? 243 ARG C NH2 1 
ATOM   7212  N  N   . PRO C 1 244 ? 24.693  26.368  60.789  1.00 23.08  ? 244 PRO C N   1 
ATOM   7213  C  CA  . PRO C 1 244 ? 23.897  26.264  62.015  1.00 23.12  ? 244 PRO C CA  1 
ATOM   7214  C  C   . PRO C 1 244 ? 23.273  24.892  62.177  1.00 22.31  ? 244 PRO C C   1 
ATOM   7215  O  O   . PRO C 1 244 ? 22.879  24.530  63.279  1.00 22.71  ? 244 PRO C O   1 
ATOM   7216  C  CB  . PRO C 1 244 ? 22.854  27.385  61.880  1.00 22.55  ? 244 PRO C CB  1 
ATOM   7217  C  CG  . PRO C 1 244 ? 22.816  27.731  60.434  1.00 23.31  ? 244 PRO C CG  1 
ATOM   7218  C  CD  . PRO C 1 244 ? 24.114  27.310  59.810  1.00 23.46  ? 244 PRO C CD  1 
ATOM   7219  N  N   . ASP C 1 245 ? 23.260  24.106  61.109  1.00 23.56  ? 245 ASP C N   1 
ATOM   7220  C  CA  . ASP C 1 245 ? 22.705  22.718  61.124  1.00 24.81  ? 245 ASP C CA  1 
ATOM   7221  C  C   . ASP C 1 245 ? 23.550  21.682  61.892  1.00 25.83  ? 245 ASP C C   1 
ATOM   7222  O  O   . ASP C 1 245 ? 23.047  20.592  62.235  1.00 25.82  ? 245 ASP C O   1 
ATOM   7223  C  CB  . ASP C 1 245 ? 22.543  22.218  59.697  1.00 24.91  ? 245 ASP C CB  1 
ATOM   7224  C  CG  . ASP C 1 245 ? 23.867  22.275  58.923  1.00 27.52  ? 245 ASP C CG  1 
ATOM   7225  O  OD1 . ASP C 1 245 ? 24.469  23.381  58.801  1.00 28.48  ? 245 ASP C OD1 1 
ATOM   7226  O  OD2 . ASP C 1 245 ? 24.318  21.217  58.468  1.00 27.58  ? 245 ASP C OD2 1 
ATOM   7227  N  N   . LEU C 1 246 ? 24.831  21.986  62.132  1.00 27.68  ? 246 LEU C N   1 
ATOM   7228  C  CA  . LEU C 1 246 ? 25.686  21.119  62.978  1.00 27.84  ? 246 LEU C CA  1 
ATOM   7229  C  C   . LEU C 1 246 ? 25.842  21.700  64.384  1.00 28.68  ? 246 LEU C C   1 
ATOM   7230  O  O   . LEU C 1 246 ? 26.099  20.959  65.350  1.00 31.38  ? 246 LEU C O   1 
ATOM   7231  C  CB  . LEU C 1 246 ? 27.081  20.948  62.371  1.00 27.92  ? 246 LEU C CB  1 
ATOM   7232  C  CG  . LEU C 1 246 ? 27.277  20.526  60.919  1.00 28.38  ? 246 LEU C CG  1 
ATOM   7233  C  CD1 . LEU C 1 246 ? 28.744  20.749  60.626  1.00 27.30  ? 246 LEU C CD1 1 
ATOM   7234  C  CD2 . LEU C 1 246 ? 26.909  19.060  60.688  1.00 28.98  ? 246 LEU C CD2 1 
ATOM   7235  N  N   . CYS C 1 247 ? 25.652  23.020  64.477  1.00 27.11  ? 247 CYS C N   1 
ATOM   7236  C  CA  . CYS C 1 247 ? 26.045  23.839  65.608  1.00 25.85  ? 247 CYS C CA  1 
ATOM   7237  C  C   . CYS C 1 247 ? 24.920  24.346  66.460  1.00 26.31  ? 247 CYS C C   1 
ATOM   7238  O  O   . CYS C 1 247 ? 25.133  24.660  67.643  1.00 28.20  ? 247 CYS C O   1 
ATOM   7239  C  CB  . CYS C 1 247 ? 26.821  25.047  65.100  1.00 26.42  ? 247 CYS C CB  1 
ATOM   7240  S  SG  . CYS C 1 247 ? 28.449  24.578  64.496  1.00 26.30  ? 247 CYS C SG  1 
ATOM   7241  N  N   . ALA C 1 248 ? 23.723  24.413  65.883  1.00 25.67  ? 248 ALA C N   1 
ATOM   7242  C  CA  . ALA C 1 248 ? 22.610  25.128  66.508  1.00 23.88  ? 248 ALA C CA  1 
ATOM   7243  C  C   . ALA C 1 248 ? 21.455  24.256  66.916  1.00 24.18  ? 248 ALA C C   1 
ATOM   7244  O  O   . ALA C 1 248 ? 20.422  24.765  67.310  1.00 25.38  ? 248 ALA C O   1 
ATOM   7245  C  CB  . ALA C 1 248 ? 22.119  26.230  65.578  1.00 23.27  ? 248 ALA C CB  1 
ATOM   7246  N  N   . GLN C 1 249 ? 21.596  22.947  66.835  1.00 26.99  ? 249 GLN C N   1 
ATOM   7247  C  CA  . GLN C 1 249 ? 20.420  22.107  67.056  1.00 31.68  ? 249 GLN C CA  1 
ATOM   7248  C  C   . GLN C 1 249 ? 19.974  21.980  68.523  1.00 31.42  ? 249 GLN C C   1 
ATOM   7249  O  O   . GLN C 1 249 ? 18.877  21.511  68.758  1.00 32.99  ? 249 GLN C O   1 
ATOM   7250  C  CB  . GLN C 1 249 ? 20.457  20.758  66.281  1.00 37.52  ? 249 GLN C CB  1 
ATOM   7251  C  CG  . GLN C 1 249 ? 21.822  20.117  66.037  1.00 43.77  ? 249 GLN C CG  1 
ATOM   7252  C  CD  . GLN C 1 249 ? 22.172  19.008  67.040  1.00 52.65  ? 249 GLN C CD  1 
ATOM   7253  O  OE1 . GLN C 1 249 ? 22.579  19.276  68.187  1.00 54.55  ? 249 GLN C OE1 1 
ATOM   7254  N  NE2 . GLN C 1 249 ? 22.021  17.744  66.606  1.00 52.58  ? 249 GLN C NE2 1 
ATOM   7255  N  N   . ASP C 1 250 ? 20.798  22.433  69.481  1.00 30.51  ? 250 ASP C N   1 
ATOM   7256  C  CA  . ASP C 1 250 ? 20.460  22.432  70.928  1.00 28.30  ? 250 ASP C CA  1 
ATOM   7257  C  C   . ASP C 1 250 ? 20.331  23.817  71.543  1.00 28.17  ? 250 ASP C C   1 
ATOM   7258  O  O   . ASP C 1 250 ? 19.724  23.948  72.594  1.00 31.27  ? 250 ASP C O   1 
ATOM   7259  C  CB  . ASP C 1 250 ? 21.524  21.700  71.764  1.00 28.41  ? 250 ASP C CB  1 
ATOM   7260  C  CG  . ASP C 1 250 ? 21.525  20.204  71.556  1.00 29.98  ? 250 ASP C CG  1 
ATOM   7261  O  OD1 . ASP C 1 250 ? 20.431  19.612  71.576  1.00 32.08  ? 250 ASP C OD1 1 
ATOM   7262  O  OD2 . ASP C 1 250 ? 22.616  19.616  71.397  1.00 28.71  ? 250 ASP C OD2 1 
ATOM   7263  N  N   . ASN C 1 251 ? 20.963  24.821  70.928  1.00 27.94  ? 251 ASN C N   1 
ATOM   7264  C  CA  . ASN C 1 251 ? 20.890  26.235  71.329  1.00 27.10  ? 251 ASN C CA  1 
ATOM   7265  C  C   . ASN C 1 251 ? 21.117  27.136  70.112  1.00 28.30  ? 251 ASN C C   1 
ATOM   7266  O  O   . ASN C 1 251 ? 22.214  27.161  69.579  1.00 27.59  ? 251 ASN C O   1 
ATOM   7267  C  CB  . ASN C 1 251 ? 21.917  26.578  72.439  1.00 26.71  ? 251 ASN C CB  1 
ATOM   7268  C  CG  . ASN C 1 251 ? 21.919  28.070  72.815  1.00 28.49  ? 251 ASN C CG  1 
ATOM   7269  O  OD1 . ASN C 1 251 ? 20.940  28.793  72.566  1.00 34.14  ? 251 ASN C OD1 1 
ATOM   7270  N  ND2 . ASN C 1 251 ? 23.016  28.542  73.389  1.00 25.17  ? 251 ASN C ND2 1 
ATOM   7271  N  N   . PRO C 1 252 ? 20.082  27.881  69.671  1.00 32.80  ? 252 PRO C N   1 
ATOM   7272  C  CA  . PRO C 1 252 ? 20.163  28.763  68.465  1.00 31.42  ? 252 PRO C CA  1 
ATOM   7273  C  C   . PRO C 1 252 ? 21.064  30.004  68.576  1.00 31.50  ? 252 PRO C C   1 
ATOM   7274  O  O   . PRO C 1 252 ? 21.449  30.592  67.550  1.00 34.59  ? 252 PRO C O   1 
ATOM   7275  C  CB  . PRO C 1 252 ? 18.718  29.223  68.264  1.00 30.08  ? 252 PRO C CB  1 
ATOM   7276  C  CG  . PRO C 1 252 ? 18.042  28.984  69.576  1.00 30.43  ? 252 PRO C CG  1 
ATOM   7277  C  CD  . PRO C 1 252 ? 18.710  27.805  70.204  1.00 30.21  ? 252 PRO C CD  1 
ATOM   7278  N  N   . MET C 1 253 ? 21.396  30.410  69.791  1.00 30.98  ? 253 MET C N   1 
ATOM   7279  C  CA  . MET C 1 253 ? 22.057  31.699  70.023  1.00 29.64  ? 253 MET C CA  1 
ATOM   7280  C  C   . MET C 1 253 ? 23.567  31.648  69.746  1.00 26.96  ? 253 MET C C   1 
ATOM   7281  O  O   . MET C 1 253 ? 24.255  30.701  70.139  1.00 24.41  ? 253 MET C O   1 
ATOM   7282  C  CB  . MET C 1 253 ? 21.826  32.114  71.478  1.00 35.79  ? 253 MET C CB  1 
ATOM   7283  C  CG  . MET C 1 253 ? 21.413  33.556  71.666  1.00 43.73  ? 253 MET C CG  1 
ATOM   7284  S  SD  . MET C 1 253 ? 19.781  33.848  70.939  1.00 56.64  ? 253 MET C SD  1 
ATOM   7285  C  CE  . MET C 1 253 ? 18.647  33.341  72.240  1.00 52.36  ? 253 MET C CE  1 
ATOM   7286  N  N   . ASN C 1 254 ? 24.094  32.680  69.102  1.00 25.31  ? 254 ASN C N   1 
ATOM   7287  C  CA  . ASN C 1 254 ? 25.535  32.715  68.819  1.00 25.73  ? 254 ASN C CA  1 
ATOM   7288  C  C   . ASN C 1 254 ? 26.393  32.766  70.108  1.00 25.24  ? 254 ASN C C   1 
ATOM   7289  O  O   . ASN C 1 254 ? 26.105  33.573  70.990  1.00 25.19  ? 254 ASN C O   1 
ATOM   7290  C  CB  . ASN C 1 254 ? 25.889  33.866  67.874  1.00 23.47  ? 254 ASN C CB  1 
ATOM   7291  C  CG  . ASN C 1 254 ? 27.302  33.756  67.303  1.00 24.55  ? 254 ASN C CG  1 
ATOM   7292  O  OD1 . ASN C 1 254 ? 28.315  33.962  67.998  1.00 23.57  ? 254 ASN C OD1 1 
ATOM   7293  N  ND2 . ASN C 1 254 ? 27.376  33.443  66.021  1.00 22.80  ? 254 ASN C ND2 1 
ATOM   7294  N  N   . PRO C 1 255 ? 27.419  31.879  70.212  1.00 25.05  ? 255 PRO C N   1 
ATOM   7295  C  CA  . PRO C 1 255 ? 28.459  31.762  71.248  1.00 25.90  ? 255 PRO C CA  1 
ATOM   7296  C  C   . PRO C 1 255 ? 28.968  33.098  71.766  1.00 26.13  ? 255 PRO C C   1 
ATOM   7297  O  O   . PRO C 1 255 ? 29.218  33.244  72.959  1.00 24.19  ? 255 PRO C O   1 
ATOM   7298  C  CB  . PRO C 1 255 ? 29.584  31.035  70.520  1.00 23.94  ? 255 PRO C CB  1 
ATOM   7299  C  CG  . PRO C 1 255 ? 28.850  30.099  69.626  1.00 25.41  ? 255 PRO C CG  1 
ATOM   7300  C  CD  . PRO C 1 255 ? 27.522  30.745  69.267  1.00 26.84  ? 255 PRO C CD  1 
ATOM   7301  N  N   . LYS C 1 256 ? 29.077  34.057  70.856  1.00 26.36  ? 256 LYS C N   1 
ATOM   7302  C  CA  . LYS C 1 256 ? 29.488  35.417  71.168  1.00 29.15  ? 256 LYS C CA  1 
ATOM   7303  C  C   . LYS C 1 256 ? 28.589  36.124  72.201  1.00 29.18  ? 256 LYS C C   1 
ATOM   7304  O  O   . LYS C 1 256 ? 29.074  36.902  73.016  1.00 31.67  ? 256 LYS C O   1 
ATOM   7305  C  CB  . LYS C 1 256 ? 29.549  36.227  69.879  1.00 29.83  ? 256 LYS C CB  1 
ATOM   7306  C  CG  . LYS C 1 256 ? 30.761  37.100  69.837  1.00 33.31  ? 256 LYS C CG  1 
ATOM   7307  C  CD  . LYS C 1 256 ? 31.492  37.001  68.517  1.00 36.98  ? 256 LYS C CD  1 
ATOM   7308  C  CE  . LYS C 1 256 ? 32.926  37.481  68.728  1.00 36.80  ? 256 LYS C CE  1 
ATOM   7309  N  NZ  . LYS C 1 256 ? 33.791  36.998  67.626  1.00 31.51  ? 256 LYS C NZ  1 
ATOM   7310  N  N   . LYS C 1 257 ? 27.291  35.865  72.179  1.00 28.65  ? 257 LYS C N   1 
ATOM   7311  C  CA  . LYS C 1 257 ? 26.423  36.399  73.222  1.00 30.85  ? 257 LYS C CA  1 
ATOM   7312  C  C   . LYS C 1 257 ? 26.742  35.904  74.666  1.00 28.07  ? 257 LYS C C   1 
ATOM   7313  O  O   . LYS C 1 257 ? 26.247  36.456  75.621  1.00 28.30  ? 257 LYS C O   1 
ATOM   7314  C  CB  . LYS C 1 257 ? 24.944  36.225  72.844  1.00 35.45  ? 257 LYS C CB  1 
ATOM   7315  C  CG  . LYS C 1 257 ? 24.492  37.298  71.826  1.00 46.31  ? 257 LYS C CG  1 
ATOM   7316  C  CD  . LYS C 1 257 ? 23.511  36.811  70.755  1.00 49.56  ? 257 LYS C CD  1 
ATOM   7317  C  CE  . LYS C 1 257 ? 23.794  37.474  69.403  1.00 57.04  ? 257 LYS C CE  1 
ATOM   7318  N  NZ  . LYS C 1 257 ? 22.960  36.945  68.270  1.00 57.76  ? 257 LYS C NZ  1 
ATOM   7319  N  N   . TYR C 1 258 ? 27.593  34.898  74.810  1.00 24.22  ? 258 TYR C N   1 
ATOM   7320  C  CA  . TYR C 1 258 ? 27.878  34.336  76.120  1.00 24.44  ? 258 TYR C CA  1 
ATOM   7321  C  C   . TYR C 1 258 ? 29.194  34.849  76.724  1.00 25.26  ? 258 TYR C C   1 
ATOM   7322  O  O   . TYR C 1 258 ? 29.624  34.381  77.769  1.00 26.07  ? 258 TYR C O   1 
ATOM   7323  C  CB  . TYR C 1 258 ? 27.827  32.809  76.087  1.00 21.87  ? 258 TYR C CB  1 
ATOM   7324  C  CG  . TYR C 1 258 ? 26.421  32.289  75.818  1.00 22.03  ? 258 TYR C CG  1 
ATOM   7325  C  CD1 . TYR C 1 258 ? 25.507  32.106  76.852  1.00 22.12  ? 258 TYR C CD1 1 
ATOM   7326  C  CD2 . TYR C 1 258 ? 25.993  32.024  74.531  1.00 21.97  ? 258 TYR C CD2 1 
ATOM   7327  C  CE1 . TYR C 1 258 ? 24.230  31.649  76.620  1.00 21.50  ? 258 TYR C CE1 1 
ATOM   7328  C  CE2 . TYR C 1 258 ? 24.711  31.569  74.287  1.00 21.40  ? 258 TYR C CE2 1 
ATOM   7329  C  CZ  . TYR C 1 258 ? 23.837  31.373  75.326  1.00 21.84  ? 258 TYR C CZ  1 
ATOM   7330  O  OH  . TYR C 1 258 ? 22.567  30.872  75.066  1.00 21.48  ? 258 TYR C OH  1 
ATOM   7331  N  N   . LEU C 1 259 ? 29.831  35.809  76.070  1.00 25.14  ? 259 LEU C N   1 
ATOM   7332  C  CA  . LEU C 1 259 ? 31.007  36.415  76.648  1.00 26.71  ? 259 LEU C CA  1 
ATOM   7333  C  C   . LEU C 1 259 ? 30.512  37.240  77.833  1.00 25.95  ? 259 LEU C C   1 
ATOM   7334  O  O   . LEU C 1 259 ? 29.446  37.876  77.746  1.00 28.29  ? 259 LEU C O   1 
ATOM   7335  C  CB  . LEU C 1 259 ? 31.738  37.283  75.624  1.00 24.58  ? 259 LEU C CB  1 
ATOM   7336  C  CG  . LEU C 1 259 ? 32.231  36.520  74.418  1.00 25.80  ? 259 LEU C CG  1 
ATOM   7337  C  CD1 . LEU C 1 259 ? 32.830  37.484  73.403  1.00 27.31  ? 259 LEU C CD1 1 
ATOM   7338  C  CD2 . LEU C 1 259 ? 33.253  35.472  74.825  1.00 27.61  ? 259 LEU C CD2 1 
ATOM   7339  N  N   . GLY C 1 260 ? 31.252  37.200  78.933  1.00 22.66  ? 260 GLY C N   1 
ATOM   7340  C  CA  . GLY C 1 260 ? 30.815  37.849  80.177  1.00 23.02  ? 260 GLY C CA  1 
ATOM   7341  C  C   . GLY C 1 260 ? 29.848  36.983  80.988  1.00 22.29  ? 260 GLY C C   1 
ATOM   7342  O  O   . GLY C 1 260 ? 29.350  37.439  82.013  1.00 21.97  ? 260 GLY C O   1 
ATOM   7343  N  N   . SER C 1 261 ? 29.568  35.754  80.504  1.00 21.24  ? 261 SER C N   1 
ATOM   7344  C  CA  . SER C 1 261 ? 28.705  34.777  81.185  1.00 20.70  ? 261 SER C CA  1 
ATOM   7345  C  C   . SER C 1 261 ? 29.488  33.803  82.082  1.00 19.74  ? 261 SER C C   1 
ATOM   7346  O  O   . SER C 1 261 ? 28.879  33.064  82.868  1.00 19.65  ? 261 SER C O   1 
ATOM   7347  C  CB  . SER C 1 261 ? 27.879  33.929  80.178  1.00 21.13  ? 261 SER C CB  1 
ATOM   7348  O  OG  . SER C 1 261 ? 26.850  34.673  79.529  1.00 21.17  ? 261 SER C OG  1 
ATOM   7349  N  N   . PHE C 1 262 ? 30.816  33.766  81.943  1.00 17.01  ? 262 PHE C N   1 
ATOM   7350  C  CA  . PHE C 1 262 ? 31.624  32.818  82.692  1.00 15.09  ? 262 PHE C CA  1 
ATOM   7351  C  C   . PHE C 1 262 ? 32.947  33.453  82.998  1.00 13.97  ? 262 PHE C C   1 
ATOM   7352  O  O   . PHE C 1 262 ? 33.274  34.445  82.392  1.00 14.49  ? 262 PHE C O   1 
ATOM   7353  C  CB  . PHE C 1 262 ? 31.805  31.496  81.926  1.00 15.36  ? 262 PHE C CB  1 
ATOM   7354  C  CG  . PHE C 1 262 ? 32.327  31.665  80.514  1.00 15.44  ? 262 PHE C CG  1 
ATOM   7355  C  CD1 . PHE C 1 262 ? 33.696  31.655  80.252  1.00 14.60  ? 262 PHE C CD1 1 
ATOM   7356  C  CD2 . PHE C 1 262 ? 31.445  31.863  79.446  1.00 15.50  ? 262 PHE C CD2 1 
ATOM   7357  C  CE1 . PHE C 1 262 ? 34.183  31.818  78.966  1.00 14.04  ? 262 PHE C CE1 1 
ATOM   7358  C  CE2 . PHE C 1 262 ? 31.928  32.028  78.155  1.00 14.58  ? 262 PHE C CE2 1 
ATOM   7359  C  CZ  . PHE C 1 262 ? 33.300  31.999  77.915  1.00 14.36  ? 262 PHE C CZ  1 
ATOM   7360  N  N   . TYR C 1 263 ? 33.675  32.891  83.963  1.00 12.56  ? 263 TYR C N   1 
ATOM   7361  C  CA  . TYR C 1 263 ? 34.935  33.397  84.410  1.00 11.84  ? 263 TYR C CA  1 
ATOM   7362  C  C   . TYR C 1 263 ? 36.049  32.571  83.803  1.00 11.64  ? 263 TYR C C   1 
ATOM   7363  O  O   . TYR C 1 263 ? 35.842  31.416  83.431  1.00 11.11  ? 263 TYR C O   1 
ATOM   7364  C  CB  . TYR C 1 263 ? 34.999  33.208  85.938  1.00 12.83  ? 263 TYR C CB  1 
ATOM   7365  C  CG  . TYR C 1 263 ? 34.085  34.144  86.724  1.00 13.49  ? 263 TYR C CG  1 
ATOM   7366  C  CD1 . TYR C 1 263 ? 34.589  35.338  87.231  1.00 13.69  ? 263 TYR C CD1 1 
ATOM   7367  C  CD2 . TYR C 1 263 ? 32.727  33.841  86.943  1.00 13.65  ? 263 TYR C CD2 1 
ATOM   7368  C  CE1 . TYR C 1 263 ? 33.787  36.216  87.941  1.00 14.57  ? 263 TYR C CE1 1 
ATOM   7369  C  CE2 . TYR C 1 263 ? 31.902  34.727  87.624  1.00 14.78  ? 263 TYR C CE2 1 
ATOM   7370  C  CZ  . TYR C 1 263 ? 32.455  35.925  88.126  1.00 15.06  ? 263 TYR C CZ  1 
ATOM   7371  O  OH  . TYR C 1 263 ? 31.717  36.847  88.846  1.00 16.78  ? 263 TYR C OH  1 
ATOM   7372  N  N   . THR C 1 264 ? 37.257  33.092  83.796  1.00 11.35  ? 264 THR C N   1 
ATOM   7373  C  CA  . THR C 1 264 ? 38.414  32.212  83.651  1.00 12.40  ? 264 THR C CA  1 
ATOM   7374  C  C   . THR C 1 264 ? 39.517  32.619  84.626  1.00 13.46  ? 264 THR C C   1 
ATOM   7375  O  O   . THR C 1 264 ? 39.599  33.809  85.017  1.00 12.85  ? 264 THR C O   1 
ATOM   7376  C  CB  . THR C 1 264 ? 39.050  32.292  82.234  1.00 12.62  ? 264 THR C CB  1 
ATOM   7377  O  OG1 . THR C 1 264 ? 39.697  33.542  82.112  1.00 12.60  ? 264 THR C OG1 1 
ATOM   7378  C  CG2 . THR C 1 264 ? 37.998  32.201  81.073  1.00 12.04  ? 264 THR C CG2 1 
ATOM   7379  N  N   . ASP C 1 265 ? 40.397  31.664  84.974  1.00 14.93  ? 265 ASP C N   1 
ATOM   7380  C  CA  . ASP C 1 265 ? 41.647  31.985  85.662  1.00 16.48  ? 265 ASP C CA  1 
ATOM   7381  C  C   . ASP C 1 265 ? 42.637  32.799  84.767  1.00 16.44  ? 265 ASP C C   1 
ATOM   7382  O  O   . ASP C 1 265 ? 42.432  32.932  83.580  1.00 16.66  ? 265 ASP C O   1 
ATOM   7383  C  CB  . ASP C 1 265 ? 42.284  30.748  86.331  1.00 18.70  ? 265 ASP C CB  1 
ATOM   7384  C  CG  . ASP C 1 265 ? 43.101  29.881  85.355  1.00 22.54  ? 265 ASP C CG  1 
ATOM   7385  O  OD1 . ASP C 1 265 ? 43.508  30.385  84.262  1.00 21.43  ? 265 ASP C OD1 1 
ATOM   7386  O  OD2 . ASP C 1 265 ? 43.355  28.683  85.705  1.00 24.74  ? 265 ASP C OD2 1 
ATOM   7387  N  N   . ALA C 1 266 ? 43.681  33.381  85.358  1.00 16.89  ? 266 ALA C N   1 
ATOM   7388  C  CA  . ALA C 1 266 ? 44.523  34.344  84.642  1.00 16.26  ? 266 ALA C CA  1 
ATOM   7389  C  C   . ALA C 1 266 ? 45.795  33.685  84.115  1.00 16.15  ? 266 ALA C C   1 
ATOM   7390  O  O   . ALA C 1 266 ? 46.688  34.347  83.575  1.00 16.79  ? 266 ALA C O   1 
ATOM   7391  C  CB  . ALA C 1 266 ? 44.874  35.504  85.570  1.00 15.88  ? 266 ALA C CB  1 
ATOM   7392  N  N   . LEU C 1 267 ? 45.867  32.379  84.249  1.00 16.40  ? 267 LEU C N   1 
ATOM   7393  C  CA  . LEU C 1 267 ? 47.103  31.643  84.056  1.00 18.06  ? 267 LEU C CA  1 
ATOM   7394  C  C   . LEU C 1 267 ? 47.495  31.515  82.561  1.00 17.84  ? 267 LEU C C   1 
ATOM   7395  O  O   . LEU C 1 267 ? 47.330  30.463  81.971  1.00 17.86  ? 267 LEU C O   1 
ATOM   7396  C  CB  . LEU C 1 267 ? 46.962  30.265  84.725  1.00 19.69  ? 267 LEU C CB  1 
ATOM   7397  C  CG  . LEU C 1 267 ? 48.223  29.466  85.093  1.00 23.15  ? 267 LEU C CG  1 
ATOM   7398  C  CD1 . LEU C 1 267 ? 49.195  30.332  85.882  1.00 25.42  ? 267 LEU C CD1 1 
ATOM   7399  C  CD2 . LEU C 1 267 ? 47.910  28.163  85.848  1.00 22.22  ? 267 LEU C CD2 1 
ATOM   7400  N  N   . VAL C 1 268 ? 48.031  32.579  81.969  1.00 17.54  ? 268 VAL C N   1 
ATOM   7401  C  CA  . VAL C 1 268 ? 48.435  32.531  80.563  1.00 18.79  ? 268 VAL C CA  1 
ATOM   7402  C  C   . VAL C 1 268 ? 49.873  32.878  80.305  1.00 19.32  ? 268 VAL C C   1 
ATOM   7403  O  O   . VAL C 1 268 ? 50.319  32.845  79.177  1.00 18.34  ? 268 VAL C O   1 
ATOM   7404  C  CB  . VAL C 1 268 ? 47.515  33.380  79.675  1.00 19.15  ? 268 VAL C CB  1 
ATOM   7405  C  CG1 . VAL C 1 268 ? 46.210  32.618  79.454  1.00 17.92  ? 268 VAL C CG1 1 
ATOM   7406  C  CG2 . VAL C 1 268 ? 47.280  34.788  80.275  1.00 16.88  ? 268 VAL C CG2 1 
ATOM   7407  N  N   . HIS C 1 269 ? 50.594  33.220  81.371  1.00 21.64  ? 269 HIS C N   1 
ATOM   7408  C  CA  . HIS C 1 269 ? 52.041  33.407  81.340  1.00 21.32  ? 269 HIS C CA  1 
ATOM   7409  C  C   . HIS C 1 269 ? 52.573  34.611  80.615  1.00 22.79  ? 269 HIS C C   1 
ATOM   7410  O  O   . HIS C 1 269 ? 53.696  35.047  80.954  1.00 26.39  ? 269 HIS C O   1 
ATOM   7411  C  CB  . HIS C 1 269 ? 52.741  32.177  80.802  1.00 21.51  ? 269 HIS C CB  1 
ATOM   7412  C  CG  . HIS C 1 269 ? 52.393  30.912  81.526  1.00 21.48  ? 269 HIS C CG  1 
ATOM   7413  N  ND1 . HIS C 1 269 ? 51.472  30.044  81.056  1.00 22.74  ? 269 HIS C ND1 1 
ATOM   7414  C  CD2 . HIS C 1 269 ? 52.882  30.366  82.707  1.00 20.91  ? 269 HIS C CD2 1 
ATOM   7415  C  CE1 . HIS C 1 269 ? 51.391  28.985  81.884  1.00 22.13  ? 269 HIS C CE1 1 
ATOM   7416  N  NE2 . HIS C 1 269 ? 52.242  29.195  82.907  1.00 21.17  ? 269 HIS C NE2 1 
ATOM   7417  N  N   . ASP C 1 270 ? 51.835  35.168  79.639  1.00 22.50  ? 270 ASP C N   1 
ATOM   7418  C  CA  . ASP C 1 270 ? 52.340  36.308  78.825  1.00 22.18  ? 270 ASP C CA  1 
ATOM   7419  C  C   . ASP C 1 270 ? 51.394  37.493  78.792  1.00 20.01  ? 270 ASP C C   1 
ATOM   7420  O  O   . ASP C 1 270 ? 50.188  37.290  78.725  1.00 21.27  ? 270 ASP C O   1 
ATOM   7421  C  CB  . ASP C 1 270 ? 52.604  35.862  77.391  1.00 27.46  ? 270 ASP C CB  1 
ATOM   7422  C  CG  . ASP C 1 270 ? 53.876  35.012  77.249  1.00 34.20  ? 270 ASP C CG  1 
ATOM   7423  O  OD1 . ASP C 1 270 ? 54.528  34.679  78.288  1.00 33.24  ? 270 ASP C OD1 1 
ATOM   7424  O  OD2 . ASP C 1 270 ? 54.214  34.664  76.075  1.00 36.61  ? 270 ASP C OD2 1 
ATOM   7425  N  N   . PRO C 1 271 ? 51.928  38.734  78.806  1.00 18.06  ? 271 PRO C N   1 
ATOM   7426  C  CA  . PRO C 1 271 ? 51.085  39.950  78.852  1.00 16.62  ? 271 PRO C CA  1 
ATOM   7427  C  C   . PRO C 1 271 ? 50.162  40.142  77.621  1.00 16.60  ? 271 PRO C C   1 
ATOM   7428  O  O   . PRO C 1 271 ? 48.996  40.579  77.750  1.00 15.72  ? 271 PRO C O   1 
ATOM   7429  C  CB  . PRO C 1 271 ? 52.104  41.104  78.957  1.00 17.26  ? 271 PRO C CB  1 
ATOM   7430  C  CG  . PRO C 1 271 ? 53.461  40.495  79.160  1.00 17.27  ? 271 PRO C CG  1 
ATOM   7431  C  CD  . PRO C 1 271 ? 53.382  39.045  78.755  1.00 18.11  ? 271 PRO C CD  1 
ATOM   7432  N  N   . LEU C 1 272 ? 50.645  39.773  76.441  1.00 15.87  ? 272 LEU C N   1 
ATOM   7433  C  CA  . LEU C 1 272 ? 49.792  39.887  75.227  1.00 15.30  ? 272 LEU C CA  1 
ATOM   7434  C  C   . LEU C 1 272 ? 48.552  39.016  75.391  1.00 14.28  ? 272 LEU C C   1 
ATOM   7435  O  O   . LEU C 1 272 ? 47.447  39.464  75.162  1.00 13.68  ? 272 LEU C O   1 
ATOM   7436  C  CB  . LEU C 1 272 ? 50.602  39.607  73.915  1.00 14.50  ? 272 LEU C CB  1 
ATOM   7437  C  CG  . LEU C 1 272 ? 51.664  40.704  73.672  1.00 14.85  ? 272 LEU C CG  1 
ATOM   7438  C  CD1 . LEU C 1 272 ? 52.765  40.394  72.659  1.00 14.55  ? 272 LEU C CD1 1 
ATOM   7439  C  CD2 . LEU C 1 272 ? 51.001  42.049  73.349  1.00 14.69  ? 272 LEU C CD2 1 
ATOM   7440  N  N   . SER C 1 273 ? 48.760  37.795  75.868  1.00 14.31  ? 273 SER C N   1 
ATOM   7441  C  CA  . SER C 1 273 ? 47.686  36.861  76.121  1.00 14.41  ? 273 SER C CA  1 
ATOM   7442  C  C   . SER C 1 273 ? 46.818  37.316  77.253  1.00 13.69  ? 273 SER C C   1 
ATOM   7443  O  O   . SER C 1 273 ? 45.592  37.243  77.139  1.00 13.29  ? 273 SER C O   1 
ATOM   7444  C  CB  . SER C 1 273 ? 48.247  35.434  76.413  1.00 15.40  ? 273 SER C CB  1 
ATOM   7445  O  OG  . SER C 1 273 ? 48.945  34.942  75.273  1.00 14.47  ? 273 SER C OG  1 
ATOM   7446  N  N   . LEU C 1 274 ? 47.421  37.799  78.349  1.00 14.09  ? 274 LEU C N   1 
ATOM   7447  C  CA  . LEU C 1 274 ? 46.591  38.350  79.479  1.00 14.44  ? 274 LEU C CA  1 
ATOM   7448  C  C   . LEU C 1 274 ? 45.682  39.503  79.067  1.00 14.87  ? 274 LEU C C   1 
ATOM   7449  O  O   . LEU C 1 274 ? 44.498  39.557  79.476  1.00 15.73  ? 274 LEU C O   1 
ATOM   7450  C  CB  . LEU C 1 274 ? 47.415  38.742  80.712  1.00 14.67  ? 274 LEU C CB  1 
ATOM   7451  C  CG  . LEU C 1 274 ? 46.582  39.138  81.963  1.00 15.34  ? 274 LEU C CG  1 
ATOM   7452  C  CD1 . LEU C 1 274 ? 45.425  38.217  82.361  1.00 15.11  ? 274 LEU C CD1 1 
ATOM   7453  C  CD2 . LEU C 1 274 ? 47.545  39.263  83.129  1.00 17.35  ? 274 LEU C CD2 1 
ATOM   7454  N  N   . LYS C 1 275 ? 46.218  40.406  78.254  1.00 14.30  ? 275 LYS C N   1 
ATOM   7455  C  CA  . LYS C 1 275 ? 45.420  41.473  77.689  1.00 15.76  ? 275 LYS C CA  1 
ATOM   7456  C  C   . LYS C 1 275 ? 44.272  40.965  76.802  1.00 15.21  ? 275 LYS C C   1 
ATOM   7457  O  O   . LYS C 1 275 ? 43.121  41.434  76.901  1.00 15.97  ? 275 LYS C O   1 
ATOM   7458  C  CB  . LYS C 1 275 ? 46.329  42.502  76.931  1.00 17.14  ? 275 LYS C CB  1 
ATOM   7459  C  CG  . LYS C 1 275 ? 45.608  43.752  76.498  1.00 18.34  ? 275 LYS C CG  1 
ATOM   7460  C  CD  . LYS C 1 275 ? 44.802  44.280  77.698  1.00 22.40  ? 275 LYS C CD  1 
ATOM   7461  C  CE  . LYS C 1 275 ? 44.438  45.764  77.585  1.00 23.78  ? 275 LYS C CE  1 
ATOM   7462  N  NZ  . LYS C 1 275 ? 43.154  45.948  76.883  1.00 26.10  ? 275 LYS C NZ  1 
ATOM   7463  N  N   . LEU C 1 276 ? 44.549  39.996  75.941  1.00 14.77  ? 276 LEU C N   1 
ATOM   7464  C  CA  . LEU C 1 276 ? 43.506  39.551  75.047  1.00 13.81  ? 276 LEU C CA  1 
ATOM   7465  C  C   . LEU C 1 276 ? 42.371  38.924  75.868  1.00 13.49  ? 276 LEU C C   1 
ATOM   7466  O  O   . LEU C 1 276 ? 41.164  39.157  75.636  1.00 12.18  ? 276 LEU C O   1 
ATOM   7467  C  CB  . LEU C 1 276 ? 44.046  38.546  74.009  1.00 14.39  ? 276 LEU C CB  1 
ATOM   7468  C  CG  . LEU C 1 276 ? 42.851  37.977  73.157  1.00 14.87  ? 276 LEU C CG  1 
ATOM   7469  C  CD1 . LEU C 1 276 ? 42.280  39.077  72.276  1.00 15.31  ? 276 LEU C CD1 1 
ATOM   7470  C  CD2 . LEU C 1 276 ? 43.252  36.848  72.252  1.00 15.10  ? 276 LEU C CD2 1 
ATOM   7471  N  N   . LEU C 1 277 ? 42.783  38.084  76.812  1.00 14.17  ? 277 LEU C N   1 
ATOM   7472  C  CA  . LEU C 1 277 ? 41.865  37.417  77.746  1.00 14.78  ? 277 LEU C CA  1 
ATOM   7473  C  C   . LEU C 1 277 ? 40.929  38.446  78.329  1.00 14.81  ? 277 LEU C C   1 
ATOM   7474  O  O   . LEU C 1 277 ? 39.704  38.264  78.297  1.00 14.50  ? 277 LEU C O   1 
ATOM   7475  C  CB  . LEU C 1 277 ? 42.672  36.692  78.855  1.00 15.49  ? 277 LEU C CB  1 
ATOM   7476  C  CG  . LEU C 1 277 ? 41.981  35.870  79.940  1.00 15.83  ? 277 LEU C CG  1 
ATOM   7477  C  CD1 . LEU C 1 277 ? 41.095  34.793  79.314  1.00 15.61  ? 277 LEU C CD1 1 
ATOM   7478  C  CD2 . LEU C 1 277 ? 43.018  35.260  80.868  1.00 15.72  ? 277 LEU C CD2 1 
ATOM   7479  N  N   . THR C 1 278 ? 41.473  39.558  78.812  1.00 16.03  ? 278 THR C N   1 
ATOM   7480  C  CA  . THR C 1 278 ? 40.575  40.540  79.468  1.00 19.43  ? 278 THR C CA  1 
ATOM   7481  C  C   . THR C 1 278 ? 39.709  41.311  78.493  1.00 20.57  ? 278 THR C C   1 
ATOM   7482  O  O   . THR C 1 278 ? 38.598  41.667  78.834  1.00 21.98  ? 278 THR C O   1 
ATOM   7483  C  CB  . THR C 1 278 ? 41.275  41.505  80.442  1.00 19.38  ? 278 THR C CB  1 
ATOM   7484  O  OG1 . THR C 1 278 ? 42.369  42.140  79.787  1.00 19.73  ? 278 THR C OG1 1 
ATOM   7485  C  CG2 . THR C 1 278 ? 41.817  40.709  81.630  1.00 19.50  ? 278 THR C CG2 1 
ATOM   7486  N  N   . ASP C 1 279 ? 40.190  41.536  77.276  1.00 22.03  ? 279 ASP C N   1 
ATOM   7487  C  CA  . ASP C 1 279 ? 39.363  42.220  76.302  1.00 23.72  ? 279 ASP C CA  1 
ATOM   7488  C  C   . ASP C 1 279 ? 38.196  41.367  75.800  1.00 23.31  ? 279 ASP C C   1 
ATOM   7489  O  O   . ASP C 1 279 ? 37.183  41.925  75.391  1.00 24.55  ? 279 ASP C O   1 
ATOM   7490  C  CB  . ASP C 1 279 ? 40.217  42.696  75.145  1.00 29.31  ? 279 ASP C CB  1 
ATOM   7491  C  CG  . ASP C 1 279 ? 41.071  43.912  75.505  1.00 38.37  ? 279 ASP C CG  1 
ATOM   7492  O  OD1 . ASP C 1 279 ? 40.766  44.604  76.526  1.00 43.33  ? 279 ASP C OD1 1 
ATOM   7493  O  OD2 . ASP C 1 279 ? 42.045  44.185  74.751  1.00 41.27  ? 279 ASP C OD2 1 
ATOM   7494  N  N   . VAL C 1 280 ? 38.350  40.032  75.847  1.00 19.66  ? 280 VAL C N   1 
ATOM   7495  C  CA  . VAL C 1 280 ? 37.378  39.072  75.353  1.00 18.06  ? 280 VAL C CA  1 
ATOM   7496  C  C   . VAL C 1 280 ? 36.450  38.596  76.501  1.00 18.51  ? 280 VAL C C   1 
ATOM   7497  O  O   . VAL C 1 280 ? 35.223  38.670  76.397  1.00 17.49  ? 280 VAL C O   1 
ATOM   7498  C  CB  . VAL C 1 280 ? 38.096  37.829  74.707  1.00 17.50  ? 280 VAL C CB  1 
ATOM   7499  C  CG1 . VAL C 1 280 ? 37.123  36.688  74.441  1.00 17.81  ? 280 VAL C CG1 1 
ATOM   7500  C  CG2 . VAL C 1 280 ? 38.810  38.166  73.427  1.00 15.20  ? 280 VAL C CG2 1 
ATOM   7501  N  N   . ILE C 1 281 ? 37.049  38.082  77.582  1.00 19.38  ? 281 ILE C N   1 
ATOM   7502  C  CA  . ILE C 1 281 ? 36.289  37.558  78.743  1.00 20.55  ? 281 ILE C CA  1 
ATOM   7503  C  C   . ILE C 1 281 ? 35.712  38.707  79.609  1.00 21.77  ? 281 ILE C C   1 
ATOM   7504  O  O   . ILE C 1 281 ? 34.619  38.575  80.206  1.00 23.08  ? 281 ILE C O   1 
ATOM   7505  C  CB  . ILE C 1 281 ? 37.134  36.504  79.538  1.00 20.20  ? 281 ILE C CB  1 
ATOM   7506  C  CG1 . ILE C 1 281 ? 37.492  35.274  78.636  1.00 19.91  ? 281 ILE C CG1 1 
ATOM   7507  C  CG2 . ILE C 1 281 ? 36.498  36.053  80.862  1.00 18.85  ? 281 ILE C CG2 1 
ATOM   7508  C  CD1 . ILE C 1 281 ? 36.335  34.607  77.927  1.00 20.17  ? 281 ILE C CD1 1 
ATOM   7509  N  N   . GLY C 1 282 ? 36.409  39.841  79.641  1.00 19.80  ? 282 GLY C N   1 
ATOM   7510  C  CA  . GLY C 1 282 ? 35.937  40.949  80.433  1.00 20.57  ? 282 GLY C CA  1 
ATOM   7511  C  C   . GLY C 1 282 ? 36.785  41.172  81.663  1.00 20.65  ? 282 GLY C C   1 
ATOM   7512  O  O   . GLY C 1 282 ? 37.270  40.238  82.293  1.00 19.38  ? 282 GLY C O   1 
ATOM   7513  N  N   . LYS C 1 283 ? 36.946  42.429  82.022  1.00 22.53  ? 283 LYS C N   1 
ATOM   7514  C  CA  . LYS C 1 283 ? 37.830  42.746  83.118  1.00 24.28  ? 283 LYS C CA  1 
ATOM   7515  C  C   . LYS C 1 283 ? 37.317  42.223  84.489  1.00 23.12  ? 283 LYS C C   1 
ATOM   7516  O  O   . LYS C 1 283 ? 38.123  42.027  85.400  1.00 19.30  ? 283 LYS C O   1 
ATOM   7517  C  CB  . LYS C 1 283 ? 38.205  44.233  83.081  1.00 25.74  ? 283 LYS C CB  1 
ATOM   7518  C  CG  . LYS C 1 283 ? 39.489  44.474  82.243  1.00 27.69  ? 283 LYS C CG  1 
ATOM   7519  C  CD  . LYS C 1 283 ? 39.554  45.810  81.481  1.00 29.60  ? 283 LYS C CD  1 
ATOM   7520  C  CE  . LYS C 1 283 ? 40.818  45.941  80.579  1.00 32.21  ? 283 LYS C CE  1 
ATOM   7521  N  NZ  . LYS C 1 283 ? 41.152  44.912  79.505  1.00 28.94  ? 283 LYS C NZ  1 
ATOM   7522  N  N   . ASP C 1 284 ? 35.997  41.987  84.582  1.00 24.04  ? 284 ASP C N   1 
ATOM   7523  C  CA  . ASP C 1 284 ? 35.315  41.517  85.796  1.00 26.40  ? 284 ASP C CA  1 
ATOM   7524  C  C   . ASP C 1 284 ? 35.213  39.994  85.891  1.00 24.16  ? 284 ASP C C   1 
ATOM   7525  O  O   . ASP C 1 284 ? 34.609  39.451  86.841  1.00 25.36  ? 284 ASP C O   1 
ATOM   7526  C  CB  . ASP C 1 284 ? 33.863  42.029  85.867  1.00 34.01  ? 284 ASP C CB  1 
ATOM   7527  C  CG  . ASP C 1 284 ? 33.744  43.548  85.753  1.00 43.78  ? 284 ASP C CG  1 
ATOM   7528  O  OD1 . ASP C 1 284 ? 34.556  44.276  86.383  1.00 46.44  ? 284 ASP C OD1 1 
ATOM   7529  O  OD2 . ASP C 1 284 ? 32.809  44.009  85.031  1.00 51.23  ? 284 ASP C OD2 1 
ATOM   7530  N  N   . LYS C 1 285 ? 35.757  39.297  84.906  1.00 20.76  ? 285 LYS C N   1 
ATOM   7531  C  CA  . LYS C 1 285 ? 35.522  37.868  84.790  1.00 18.27  ? 285 LYS C CA  1 
ATOM   7532  C  C   . LYS C 1 285 ? 36.825  37.112  84.722  1.00 16.63  ? 285 LYS C C   1 
ATOM   7533  O  O   . LYS C 1 285 ? 36.846  35.925  84.451  1.00 16.60  ? 285 LYS C O   1 
ATOM   7534  C  CB  . LYS C 1 285 ? 34.618  37.593  83.596  1.00 20.21  ? 285 LYS C CB  1 
ATOM   7535  C  CG  . LYS C 1 285 ? 33.215  38.167  83.785  1.00 21.11  ? 285 LYS C CG  1 
ATOM   7536  C  CD  . LYS C 1 285 ? 32.372  37.182  84.582  1.00 23.47  ? 285 LYS C CD  1 
ATOM   7537  C  CE  . LYS C 1 285 ? 30.962  37.695  84.847  1.00 26.91  ? 285 LYS C CE  1 
ATOM   7538  N  NZ  . LYS C 1 285 ? 30.574  38.715  83.831  1.00 30.11  ? 285 LYS C NZ  1 
ATOM   7539  N  N   . VAL C 1 286 ? 37.919  37.780  85.068  1.00 15.27  ? 286 VAL C N   1 
ATOM   7540  C  CA  . VAL C 1 286 ? 39.210  37.137  85.008  1.00 14.72  ? 286 VAL C CA  1 
ATOM   7541  C  C   . VAL C 1 286 ? 39.785  37.116  86.386  1.00 14.72  ? 286 VAL C C   1 
ATOM   7542  O  O   . VAL C 1 286 ? 39.786  38.120  87.054  1.00 14.70  ? 286 VAL C O   1 
ATOM   7543  C  CB  . VAL C 1 286 ? 40.175  37.807  83.995  1.00 13.41  ? 286 VAL C CB  1 
ATOM   7544  C  CG1 . VAL C 1 286 ? 41.529  37.125  84.037  1.00 12.53  ? 286 VAL C CG1 1 
ATOM   7545  C  CG2 . VAL C 1 286 ? 39.582  37.685  82.609  1.00 13.58  ? 286 VAL C CG2 1 
ATOM   7546  N  N   . ILE C 1 287 ? 40.237  35.936  86.809  1.00 15.71  ? 287 ILE C N   1 
ATOM   7547  C  CA  . ILE C 1 287 ? 40.696  35.730  88.157  1.00 16.07  ? 287 ILE C CA  1 
ATOM   7548  C  C   . ILE C 1 287 ? 42.098  35.126  88.200  1.00 17.79  ? 287 ILE C C   1 
ATOM   7549  O  O   . ILE C 1 287 ? 42.450  34.220  87.440  1.00 16.63  ? 287 ILE C O   1 
ATOM   7550  C  CB  . ILE C 1 287 ? 39.773  34.777  88.885  1.00 16.88  ? 287 ILE C CB  1 
ATOM   7551  C  CG1 . ILE C 1 287 ? 38.324  35.180  88.668  1.00 17.38  ? 287 ILE C CG1 1 
ATOM   7552  C  CG2 . ILE C 1 287 ? 40.145  34.722  90.353  1.00 15.77  ? 287 ILE C CG2 1 
ATOM   7553  C  CD1 . ILE C 1 287 ? 37.381  34.041  88.941  1.00 18.52  ? 287 ILE C CD1 1 
ATOM   7554  N  N   . LEU C 1 288 ? 42.902  35.641  89.110  1.00 18.58  ? 288 LEU C N   1 
ATOM   7555  C  CA  . LEU C 1 288 ? 44.212  35.088  89.349  1.00 18.48  ? 288 LEU C CA  1 
ATOM   7556  C  C   . LEU C 1 288 ? 44.151  33.638  89.788  1.00 19.75  ? 288 LEU C C   1 
ATOM   7557  O  O   . LEU C 1 288 ? 43.404  33.301  90.711  1.00 21.39  ? 288 LEU C O   1 
ATOM   7558  C  CB  . LEU C 1 288 ? 44.891  35.932  90.398  1.00 18.23  ? 288 LEU C CB  1 
ATOM   7559  C  CG  . LEU C 1 288 ? 46.192  35.356  90.877  1.00 20.78  ? 288 LEU C CG  1 
ATOM   7560  C  CD1 . LEU C 1 288 ? 47.217  35.285  89.717  1.00 20.53  ? 288 LEU C CD1 1 
ATOM   7561  C  CD2 . LEU C 1 288 ? 46.635  36.206  92.054  1.00 20.13  ? 288 LEU C CD2 1 
ATOM   7562  N  N   . GLY C 1 289 ? 44.952  32.794  89.131  1.00 20.65  ? 289 GLY C N   1 
ATOM   7563  C  CA  . GLY C 1 289 ? 45.124  31.378  89.443  1.00 20.65  ? 289 GLY C CA  1 
ATOM   7564  C  C   . GLY C 1 289 ? 46.613  31.053  89.278  1.00 24.36  ? 289 GLY C C   1 
ATOM   7565  O  O   . GLY C 1 289 ? 47.308  31.709  88.508  1.00 26.72  ? 289 GLY C O   1 
ATOM   7566  N  N   . THR C 1 290 ? 47.113  30.026  89.961  1.00 22.74  ? 290 THR C N   1 
ATOM   7567  C  CA  . THR C 1 290 ? 48.552  29.758  89.999  1.00 23.02  ? 290 THR C CA  1 
ATOM   7568  C  C   . THR C 1 290 ? 48.905  28.328  89.624  1.00 21.24  ? 290 THR C C   1 
ATOM   7569  O  O   . THR C 1 290 ? 50.046  28.055  89.272  1.00 19.08  ? 290 THR C O   1 
ATOM   7570  C  CB  . THR C 1 290 ? 49.103  29.988  91.427  1.00 23.53  ? 290 THR C CB  1 
ATOM   7571  O  OG1 . THR C 1 290 ? 49.110  31.397  91.692  1.00 30.06  ? 290 THR C OG1 1 
ATOM   7572  C  CG2 . THR C 1 290 ? 50.504  29.481  91.559  1.00 27.65  ? 290 THR C CG2 1 
ATOM   7573  N  N   . ASP C 1 291 ? 47.955  27.409  89.770  1.00 20.06  ? 291 ASP C N   1 
ATOM   7574  C  CA  . ASP C 1 291 ? 48.277  25.986  89.638  1.00 22.74  ? 291 ASP C CA  1 
ATOM   7575  C  C   . ASP C 1 291 ? 49.359  25.559  90.662  1.00 21.57  ? 291 ASP C C   1 
ATOM   7576  O  O   . ASP C 1 291 ? 50.035  24.545  90.496  1.00 20.73  ? 291 ASP C O   1 
ATOM   7577  C  CB  . ASP C 1 291 ? 48.684  25.611  88.187  1.00 21.81  ? 291 ASP C CB  1 
ATOM   7578  C  CG  . ASP C 1 291 ? 48.553  24.104  87.900  1.00 25.82  ? 291 ASP C CG  1 
ATOM   7579  O  OD1 . ASP C 1 291 ? 47.737  23.425  88.570  1.00 28.11  ? 291 ASP C OD1 1 
ATOM   7580  O  OD2 . ASP C 1 291 ? 49.273  23.569  87.012  1.00 27.36  ? 291 ASP C OD2 1 
ATOM   7581  N  N   . TYR C 1 292 ? 49.537  26.366  91.698  1.00 22.15  ? 292 TYR C N   1 
ATOM   7582  C  CA  . TYR C 1 292 ? 50.319  25.984  92.865  1.00 22.02  ? 292 TYR C CA  1 
ATOM   7583  C  C   . TYR C 1 292 ? 49.947  24.558  93.316  1.00 22.02  ? 292 TYR C C   1 
ATOM   7584  O  O   . TYR C 1 292 ? 48.758  24.171  93.307  1.00 22.10  ? 292 TYR C O   1 
ATOM   7585  C  CB  . TYR C 1 292 ? 50.057  26.984  93.968  1.00 22.24  ? 292 TYR C CB  1 
ATOM   7586  C  CG  . TYR C 1 292 ? 50.947  26.811  95.163  1.00 24.07  ? 292 TYR C CG  1 
ATOM   7587  C  CD1 . TYR C 1 292 ? 52.255  27.348  95.198  1.00 24.35  ? 292 TYR C CD1 1 
ATOM   7588  C  CD2 . TYR C 1 292 ? 50.488  26.099  96.258  1.00 24.23  ? 292 TYR C CD2 1 
ATOM   7589  C  CE1 . TYR C 1 292 ? 53.059  27.180  96.319  1.00 25.45  ? 292 TYR C CE1 1 
ATOM   7590  C  CE2 . TYR C 1 292 ? 51.277  25.909  97.371  1.00 26.24  ? 292 TYR C CE2 1 
ATOM   7591  C  CZ  . TYR C 1 292 ? 52.549  26.449  97.403  1.00 27.17  ? 292 TYR C CZ  1 
ATOM   7592  O  OH  . TYR C 1 292 ? 53.249  26.215  98.546  1.00 27.46  ? 292 TYR C OH  1 
ATOM   7593  N  N   . PRO C 1 293 ? 50.949  23.756  93.679  1.00 21.39  ? 293 PRO C N   1 
ATOM   7594  C  CA  . PRO C 1 293 ? 52.390  24.025  93.774  1.00 22.26  ? 293 PRO C CA  1 
ATOM   7595  C  C   . PRO C 1 293 ? 53.180  23.431  92.618  1.00 20.95  ? 293 PRO C C   1 
ATOM   7596  O  O   . PRO C 1 293 ? 54.361  23.087  92.781  1.00 20.11  ? 293 PRO C O   1 
ATOM   7597  C  CB  . PRO C 1 293 ? 52.796  23.296  95.060  1.00 21.91  ? 293 PRO C CB  1 
ATOM   7598  C  CG  . PRO C 1 293 ? 51.692  22.297  95.311  1.00 22.74  ? 293 PRO C CG  1 
ATOM   7599  C  CD  . PRO C 1 293 ? 50.633  22.443  94.249  1.00 21.85  ? 293 PRO C CD  1 
ATOM   7600  N  N   . PHE C 1 294 ? 52.526  23.332  91.475  1.00 19.25  ? 294 PHE C N   1 
ATOM   7601  C  CA  . PHE C 1 294 ? 53.113  22.678  90.312  1.00 21.27  ? 294 PHE C CA  1 
ATOM   7602  C  C   . PHE C 1 294 ? 53.953  23.618  89.413  1.00 21.20  ? 294 PHE C C   1 
ATOM   7603  O  O   . PHE C 1 294 ? 53.679  24.836  89.331  1.00 19.16  ? 294 PHE C O   1 
ATOM   7604  C  CB  . PHE C 1 294 ? 52.019  21.952  89.523  1.00 20.47  ? 294 PHE C CB  1 
ATOM   7605  C  CG  . PHE C 1 294 ? 51.304  20.906  90.329  1.00 22.77  ? 294 PHE C CG  1 
ATOM   7606  C  CD1 . PHE C 1 294 ? 49.923  20.749  90.236  1.00 24.79  ? 294 PHE C CD1 1 
ATOM   7607  C  CD2 . PHE C 1 294 ? 52.008  20.069  91.192  1.00 21.79  ? 294 PHE C CD2 1 
ATOM   7608  C  CE1 . PHE C 1 294 ? 49.275  19.754  90.967  1.00 25.86  ? 294 PHE C CE1 1 
ATOM   7609  C  CE2 . PHE C 1 294 ? 51.362  19.096  91.927  1.00 22.21  ? 294 PHE C CE2 1 
ATOM   7610  C  CZ  . PHE C 1 294 ? 49.997  18.935  91.819  1.00 23.07  ? 294 PHE C CZ  1 
ATOM   7611  N  N   . PRO C 1 295 ? 54.977  23.055  88.745  1.00 21.94  ? 295 PRO C N   1 
ATOM   7612  C  CA  . PRO C 1 295 ? 55.960  23.857  87.975  1.00 22.29  ? 295 PRO C CA  1 
ATOM   7613  C  C   . PRO C 1 295 ? 55.348  24.599  86.782  1.00 22.91  ? 295 PRO C C   1 
ATOM   7614  O  O   . PRO C 1 295 ? 55.758  25.727  86.486  1.00 25.14  ? 295 PRO C O   1 
ATOM   7615  C  CB  . PRO C 1 295 ? 56.969  22.806  87.499  1.00 24.02  ? 295 PRO C CB  1 
ATOM   7616  C  CG  . PRO C 1 295 ? 56.584  21.501  88.163  1.00 21.89  ? 295 PRO C CG  1 
ATOM   7617  C  CD  . PRO C 1 295 ? 55.128  21.613  88.479  1.00 21.29  ? 295 PRO C CD  1 
ATOM   7618  N  N   . LEU C 1 296 ? 54.352  24.007  86.130  1.00 23.43  ? 296 LEU C N   1 
ATOM   7619  C  CA  . LEU C 1 296 ? 53.649  24.687  85.026  1.00 25.06  ? 296 LEU C CA  1 
ATOM   7620  C  C   . LEU C 1 296 ? 52.831  25.941  85.394  1.00 24.44  ? 296 LEU C C   1 
ATOM   7621  O  O   . LEU C 1 296 ? 52.484  26.753  84.525  1.00 22.41  ? 296 LEU C O   1 
ATOM   7622  C  CB  . LEU C 1 296 ? 52.725  23.720  84.333  1.00 25.46  ? 296 LEU C CB  1 
ATOM   7623  C  CG  . LEU C 1 296 ? 52.867  23.576  82.820  1.00 28.27  ? 296 LEU C CG  1 
ATOM   7624  C  CD1 . LEU C 1 296 ? 51.821  22.574  82.282  1.00 28.14  ? 296 LEU C CD1 1 
ATOM   7625  C  CD2 . LEU C 1 296 ? 52.876  24.876  82.020  1.00 27.33  ? 296 LEU C CD2 1 
ATOM   7626  N  N   . GLY C 1 297 ? 52.522  26.091  86.672  1.00 25.10  ? 297 GLY C N   1 
ATOM   7627  C  CA  . GLY C 1 297 ? 51.830  27.272  87.163  1.00 26.58  ? 297 GLY C CA  1 
ATOM   7628  C  C   . GLY C 1 297 ? 52.754  28.450  87.386  1.00 29.29  ? 297 GLY C C   1 
ATOM   7629  O  O   . GLY C 1 297 ? 53.923  28.397  87.041  1.00 30.35  ? 297 GLY C O   1 
ATOM   7630  N  N   . GLU C 1 298 ? 52.220  29.514  87.973  1.00 33.30  ? 298 GLU C N   1 
ATOM   7631  C  CA  . GLU C 1 298 ? 52.929  30.787  88.080  1.00 36.99  ? 298 GLU C CA  1 
ATOM   7632  C  C   . GLU C 1 298 ? 53.791  30.813  89.332  1.00 37.80  ? 298 GLU C C   1 
ATOM   7633  O  O   . GLU C 1 298 ? 53.294  30.592  90.425  1.00 39.71  ? 298 GLU C O   1 
ATOM   7634  C  CB  . GLU C 1 298 ? 51.928  31.965  88.066  1.00 38.96  ? 298 GLU C CB  1 
ATOM   7635  C  CG  . GLU C 1 298 ? 52.554  33.338  87.843  1.00 37.67  ? 298 GLU C CG  1 
ATOM   7636  C  CD  . GLU C 1 298 ? 51.620  34.517  88.142  1.00 39.64  ? 298 GLU C CD  1 
ATOM   7637  O  OE1 . GLU C 1 298 ? 50.763  34.425  89.069  1.00 37.57  ? 298 GLU C OE1 1 
ATOM   7638  O  OE2 . GLU C 1 298 ? 51.772  35.572  87.468  1.00 39.68  ? 298 GLU C OE2 1 
ATOM   7639  N  N   . LEU C 1 299 ? 55.081  31.092  89.162  1.00 41.23  ? 299 LEU C N   1 
ATOM   7640  C  CA  . LEU C 1 299 ? 56.031  31.114  90.270  1.00 43.01  ? 299 LEU C CA  1 
ATOM   7641  C  C   . LEU C 1 299 ? 55.861  32.312  91.204  1.00 36.68  ? 299 LEU C C   1 
ATOM   7642  O  O   . LEU C 1 299 ? 55.946  32.171  92.397  1.00 31.80  ? 299 LEU C O   1 
ATOM   7643  C  CB  . LEU C 1 299 ? 57.484  31.062  89.764  1.00 53.27  ? 299 LEU C CB  1 
ATOM   7644  C  CG  . LEU C 1 299 ? 58.145  29.809  89.139  1.00 62.94  ? 299 LEU C CG  1 
ATOM   7645  C  CD1 . LEU C 1 299 ? 59.614  29.728  89.582  1.00 60.52  ? 299 LEU C CD1 1 
ATOM   7646  C  CD2 . LEU C 1 299 ? 57.409  28.489  89.421  1.00 64.54  ? 299 LEU C CD2 1 
ATOM   7647  N  N   . GLU C 1 300 ? 55.675  33.496  90.650  1.00 37.49  ? 300 GLU C N   1 
ATOM   7648  C  CA  . GLU C 1 300 ? 55.390  34.672  91.472  1.00 36.84  ? 300 GLU C CA  1 
ATOM   7649  C  C   . GLU C 1 300 ? 53.966  35.069  91.201  1.00 31.11  ? 300 GLU C C   1 
ATOM   7650  O  O   . GLU C 1 300 ? 53.696  35.747  90.255  1.00 29.20  ? 300 GLU C O   1 
ATOM   7651  C  CB  . GLU C 1 300 ? 56.333  35.863  91.204  1.00 40.91  ? 300 GLU C CB  1 
ATOM   7652  C  CG  . GLU C 1 300 ? 57.810  35.525  91.025  1.00 49.58  ? 300 GLU C CG  1 
ATOM   7653  C  CD  . GLU C 1 300 ? 58.349  34.569  92.082  1.00 57.99  ? 300 GLU C CD  1 
ATOM   7654  O  OE1 . GLU C 1 300 ? 58.226  34.875  93.300  1.00 58.02  ? 300 GLU C OE1 1 
ATOM   7655  O  OE2 . GLU C 1 300 ? 58.903  33.508  91.688  1.00 64.21  ? 300 GLU C OE2 1 
ATOM   7656  N  N   . PRO C 1 301 ? 53.047  34.616  92.050  1.00 31.91  ? 301 PRO C N   1 
ATOM   7657  C  CA  . PRO C 1 301 ? 51.639  34.948  91.988  1.00 28.86  ? 301 PRO C CA  1 
ATOM   7658  C  C   . PRO C 1 301 ? 51.477  36.453  91.818  1.00 27.43  ? 301 PRO C C   1 
ATOM   7659  O  O   . PRO C 1 301 ? 52.111  37.210  92.549  1.00 25.23  ? 301 PRO C O   1 
ATOM   7660  C  CB  . PRO C 1 301 ? 51.137  34.560  93.367  1.00 29.41  ? 301 PRO C CB  1 
ATOM   7661  C  CG  . PRO C 1 301 ? 52.096  33.507  93.842  1.00 31.69  ? 301 PRO C CG  1 
ATOM   7662  C  CD  . PRO C 1 301 ? 53.408  33.944  93.314  1.00 32.19  ? 301 PRO C CD  1 
ATOM   7663  N  N   . GLY C 1 302 ? 50.645  36.874  90.858  1.00 24.93  ? 302 GLY C N   1 
ATOM   7664  C  CA  . GLY C 1 302 ? 50.305  38.276  90.704  1.00 21.91  ? 302 GLY C CA  1 
ATOM   7665  C  C   . GLY C 1 302 ? 51.299  39.023  89.853  1.00 21.95  ? 302 GLY C C   1 
ATOM   7666  O  O   . GLY C 1 302 ? 50.998  40.106  89.356  1.00 21.40  ? 302 GLY C O   1 
ATOM   7667  N  N   . LYS C 1 303 ? 52.484  38.451  89.647  1.00 23.54  ? 303 LYS C N   1 
ATOM   7668  C  CA  . LYS C 1 303 ? 53.580  39.211  89.024  1.00 25.55  ? 303 LYS C CA  1 
ATOM   7669  C  C   . LYS C 1 303 ? 53.193  39.698  87.638  1.00 27.44  ? 303 LYS C C   1 
ATOM   7670  O  O   . LYS C 1 303 ? 53.378  40.895  87.311  1.00 31.84  ? 303 LYS C O   1 
ATOM   7671  C  CB  . LYS C 1 303 ? 54.873  38.402  88.953  1.00 24.87  ? 303 LYS C CB  1 
ATOM   7672  C  CG  . LYS C 1 303 ? 56.052  39.183  88.444  1.00 25.25  ? 303 LYS C CG  1 
ATOM   7673  C  CD  . LYS C 1 303 ? 57.216  38.248  88.163  1.00 28.54  ? 303 LYS C CD  1 
ATOM   7674  C  CE  . LYS C 1 303 ? 58.537  38.877  88.618  1.00 31.93  ? 303 LYS C CE  1 
ATOM   7675  N  NZ  . LYS C 1 303 ? 59.554  37.872  89.068  1.00 31.81  ? 303 LYS C NZ  1 
ATOM   7676  N  N   . LEU C 1 304 ? 52.645  38.780  86.836  1.00 24.55  ? 304 LEU C N   1 
ATOM   7677  C  CA  . LEU C 1 304 ? 52.187  39.138  85.497  1.00 23.02  ? 304 LEU C CA  1 
ATOM   7678  C  C   . LEU C 1 304 ? 51.191  40.278  85.604  1.00 22.28  ? 304 LEU C C   1 
ATOM   7679  O  O   . LEU C 1 304 ? 51.322  41.309  84.959  1.00 22.19  ? 304 LEU C O   1 
ATOM   7680  C  CB  . LEU C 1 304 ? 51.621  37.922  84.733  1.00 20.03  ? 304 LEU C CB  1 
ATOM   7681  C  CG  . LEU C 1 304 ? 51.223  38.238  83.291  1.00 21.26  ? 304 LEU C CG  1 
ATOM   7682  C  CD1 . LEU C 1 304 ? 52.411  38.709  82.448  1.00 19.79  ? 304 LEU C CD1 1 
ATOM   7683  C  CD2 . LEU C 1 304 ? 50.461  37.081  82.609  1.00 21.74  ? 304 LEU C CD2 1 
ATOM   7684  N  N   . ILE C 1 305 ? 50.183  40.094  86.428  1.00 23.94  ? 305 ILE C N   1 
ATOM   7685  C  CA  . ILE C 1 305 ? 49.155  41.119  86.575  1.00 24.86  ? 305 ILE C CA  1 
ATOM   7686  C  C   . ILE C 1 305 ? 49.757  42.475  86.974  1.00 28.04  ? 305 ILE C C   1 
ATOM   7687  O  O   . ILE C 1 305 ? 49.411  43.524  86.386  1.00 27.45  ? 305 ILE C O   1 
ATOM   7688  C  CB  . ILE C 1 305 ? 48.071  40.651  87.561  1.00 24.26  ? 305 ILE C CB  1 
ATOM   7689  C  CG1 . ILE C 1 305 ? 47.195  39.619  86.844  1.00 23.94  ? 305 ILE C CG1 1 
ATOM   7690  C  CG2 . ILE C 1 305 ? 47.256  41.835  88.088  1.00 23.96  ? 305 ILE C CG2 1 
ATOM   7691  C  CD1 . ILE C 1 305 ? 46.318  38.755  87.733  1.00 24.23  ? 305 ILE C CD1 1 
ATOM   7692  N  N   . GLU C 1 306 ? 50.662  42.450  87.959  1.00 29.80  ? 306 GLU C N   1 
ATOM   7693  C  CA  . GLU C 1 306 ? 51.191  43.684  88.499  1.00 32.63  ? 306 GLU C CA  1 
ATOM   7694  C  C   . GLU C 1 306 ? 52.046  44.414  87.496  1.00 31.51  ? 306 GLU C C   1 
ATOM   7695  O  O   . GLU C 1 306 ? 52.006  45.633  87.440  1.00 31.44  ? 306 GLU C O   1 
ATOM   7696  C  CB  . GLU C 1 306 ? 51.899  43.468  89.844  1.00 38.63  ? 306 GLU C CB  1 
ATOM   7697  C  CG  . GLU C 1 306 ? 51.010  43.942  90.990  1.00 45.63  ? 306 GLU C CG  1 
ATOM   7698  C  CD  . GLU C 1 306 ? 51.324  43.306  92.336  1.00 55.97  ? 306 GLU C CD  1 
ATOM   7699  O  OE1 . GLU C 1 306 ? 52.494  43.371  92.794  1.00 68.06  ? 306 GLU C OE1 1 
ATOM   7700  O  OE2 . GLU C 1 306 ? 50.389  42.751  92.957  1.00 56.64  ? 306 GLU C OE2 1 
ATOM   7701  N  N   . SER C 1 307 ? 52.775  43.695  86.649  1.00 31.22  ? 307 SER C N   1 
ATOM   7702  C  CA  . SER C 1 307 ? 53.632  44.423  85.728  1.00 31.07  ? 307 SER C CA  1 
ATOM   7703  C  C   . SER C 1 307 ? 52.892  45.054  84.550  1.00 30.05  ? 307 SER C C   1 
ATOM   7704  O  O   . SER C 1 307 ? 53.501  45.815  83.825  1.00 33.27  ? 307 SER C O   1 
ATOM   7705  C  CB  . SER C 1 307 ? 54.826  43.594  85.260  1.00 30.70  ? 307 SER C CB  1 
ATOM   7706  O  OG  . SER C 1 307 ? 54.374  42.415  84.651  1.00 34.13  ? 307 SER C OG  1 
ATOM   7707  N  N   . MET C 1 308 ? 51.598  44.774  84.388  1.00 28.97  ? 308 MET C N   1 
ATOM   7708  C  CA  . MET C 1 308 ? 50.802  45.271  83.230  1.00 32.44  ? 308 MET C CA  1 
ATOM   7709  C  C   . MET C 1 308 ? 50.479  46.739  83.288  1.00 35.30  ? 308 MET C C   1 
ATOM   7710  O  O   . MET C 1 308 ? 49.424  47.141  83.835  1.00 34.90  ? 308 MET C O   1 
ATOM   7711  C  CB  . MET C 1 308 ? 49.449  44.596  83.135  1.00 29.88  ? 308 MET C CB  1 
ATOM   7712  C  CG  . MET C 1 308 ? 49.483  43.094  83.178  1.00 33.26  ? 308 MET C CG  1 
ATOM   7713  S  SD  . MET C 1 308 ? 49.891  42.434  81.582  1.00 34.26  ? 308 MET C SD  1 
ATOM   7714  C  CE  . MET C 1 308 ? 48.360  42.706  80.677  1.00 30.85  ? 308 MET C CE  1 
ATOM   7715  N  N   . GLU C 1 309 ? 51.345  47.541  82.695  1.00 37.52  ? 309 GLU C N   1 
ATOM   7716  C  CA  . GLU C 1 309 ? 51.123  48.987  82.737  1.00 45.27  ? 309 GLU C CA  1 
ATOM   7717  C  C   . GLU C 1 309 ? 49.829  49.439  82.022  1.00 39.95  ? 309 GLU C C   1 
ATOM   7718  O  O   . GLU C 1 309 ? 49.253  50.445  82.419  1.00 37.20  ? 309 GLU C O   1 
ATOM   7719  C  CB  . GLU C 1 309 ? 52.366  49.778  82.293  1.00 51.22  ? 309 GLU C CB  1 
ATOM   7720  C  CG  . GLU C 1 309 ? 52.613  49.782  80.790  1.00 58.33  ? 309 GLU C CG  1 
ATOM   7721  C  CD  . GLU C 1 309 ? 52.829  48.391  80.227  1.00 63.82  ? 309 GLU C CD  1 
ATOM   7722  O  OE1 . GLU C 1 309 ? 53.381  47.530  80.960  1.00 65.41  ? 309 GLU C OE1 1 
ATOM   7723  O  OE2 . GLU C 1 309 ? 52.440  48.168  79.056  1.00 66.83  ? 309 GLU C OE2 1 
ATOM   7724  N  N   . GLU C 1 310 ? 49.357  48.677  81.031  1.00 37.16  ? 310 GLU C N   1 
ATOM   7725  C  CA  . GLU C 1 310 ? 48.078  48.995  80.356  1.00 41.07  ? 310 GLU C CA  1 
ATOM   7726  C  C   . GLU C 1 310 ? 46.820  48.936  81.283  1.00 38.13  ? 310 GLU C C   1 
ATOM   7727  O  O   . GLU C 1 310 ? 45.797  49.469  80.931  1.00 37.67  ? 310 GLU C O   1 
ATOM   7728  C  CB  . GLU C 1 310 ? 47.889  48.156  79.057  1.00 48.42  ? 310 GLU C CB  1 
ATOM   7729  C  CG  . GLU C 1 310 ? 49.170  47.972  78.200  1.00 55.19  ? 310 GLU C CG  1 
ATOM   7730  C  CD  . GLU C 1 310 ? 48.988  47.797  76.662  1.00 57.88  ? 310 GLU C CD  1 
ATOM   7731  O  OE1 . GLU C 1 310 ? 50.012  47.508  75.983  1.00 56.31  ? 310 GLU C OE1 1 
ATOM   7732  O  OE2 . GLU C 1 310 ? 47.869  47.957  76.105  1.00 55.25  ? 310 GLU C OE2 1 
ATOM   7733  N  N   . PHE C 1 311 ? 46.914  48.315  82.466  1.00 38.22  ? 311 PHE C N   1 
ATOM   7734  C  CA  . PHE C 1 311 ? 45.799  48.265  83.448  1.00 35.27  ? 311 PHE C CA  1 
ATOM   7735  C  C   . PHE C 1 311 ? 45.855  49.357  84.534  1.00 35.14  ? 311 PHE C C   1 
ATOM   7736  O  O   . PHE C 1 311 ? 46.918  49.605  85.102  1.00 31.74  ? 311 PHE C O   1 
ATOM   7737  C  CB  . PHE C 1 311 ? 45.813  46.944  84.225  1.00 34.94  ? 311 PHE C CB  1 
ATOM   7738  C  CG  . PHE C 1 311 ? 45.459  45.722  83.421  1.00 36.71  ? 311 PHE C CG  1 
ATOM   7739  C  CD1 . PHE C 1 311 ? 44.516  45.770  82.377  1.00 36.85  ? 311 PHE C CD1 1 
ATOM   7740  C  CD2 . PHE C 1 311 ? 46.021  44.500  83.748  1.00 33.19  ? 311 PHE C CD2 1 
ATOM   7741  C  CE1 . PHE C 1 311 ? 44.183  44.634  81.675  1.00 32.70  ? 311 PHE C CE1 1 
ATOM   7742  C  CE2 . PHE C 1 311 ? 45.687  43.363  83.034  1.00 33.98  ? 311 PHE C CE2 1 
ATOM   7743  C  CZ  . PHE C 1 311 ? 44.769  43.430  82.008  1.00 33.16  ? 311 PHE C CZ  1 
ATOM   7744  N  N   . ASP C 1 312 ? 44.706  49.970  84.854  1.00 37.10  ? 312 ASP C N   1 
ATOM   7745  C  CA  . ASP C 1 312 ? 44.589  50.804  86.052  1.00 38.01  ? 312 ASP C CA  1 
ATOM   7746  C  C   . ASP C 1 312 ? 44.505  49.967  87.325  1.00 37.48  ? 312 ASP C C   1 
ATOM   7747  O  O   . ASP C 1 312 ? 44.244  48.770  87.284  1.00 36.17  ? 312 ASP C O   1 
ATOM   7748  C  CB  . ASP C 1 312 ? 43.418  51.798  85.980  1.00 41.96  ? 312 ASP C CB  1 
ATOM   7749  C  CG  . ASP C 1 312 ? 42.105  51.178  85.477  1.00 47.95  ? 312 ASP C CG  1 
ATOM   7750  O  OD1 . ASP C 1 312 ? 41.612  50.214  86.116  1.00 52.38  ? 312 ASP C OD1 1 
ATOM   7751  O  OD2 . ASP C 1 312 ? 41.539  51.690  84.460  1.00 48.23  ? 312 ASP C OD2 1 
ATOM   7752  N  N   . GLU C 1 313 ? 44.728  50.620  88.450  1.00 39.07  ? 313 GLU C N   1 
ATOM   7753  C  CA  . GLU C 1 313 ? 44.675  49.991  89.758  1.00 41.16  ? 313 GLU C CA  1 
ATOM   7754  C  C   . GLU C 1 313 ? 43.379  49.250  90.017  1.00 40.52  ? 313 GLU C C   1 
ATOM   7755  O  O   . GLU C 1 313 ? 43.408  48.142  90.557  1.00 44.18  ? 313 GLU C O   1 
ATOM   7756  C  CB  . GLU C 1 313 ? 44.860  51.042  90.852  1.00 50.21  ? 313 GLU C CB  1 
ATOM   7757  C  CG  . GLU C 1 313 ? 45.834  50.638  91.949  1.00 59.85  ? 313 GLU C CG  1 
ATOM   7758  C  CD  . GLU C 1 313 ? 47.287  50.742  91.507  1.00 64.66  ? 313 GLU C CD  1 
ATOM   7759  O  OE1 . GLU C 1 313 ? 48.045  51.505  92.154  1.00 67.18  ? 313 GLU C OE1 1 
ATOM   7760  O  OE2 . GLU C 1 313 ? 47.666  50.069  90.515  1.00 65.21  ? 313 GLU C OE2 1 
ATOM   7761  N  N   . GLU C 1 314 ? 42.247  49.849  89.660  1.00 38.59  ? 314 GLU C N   1 
ATOM   7762  C  CA  . GLU C 1 314 ? 40.948  49.211  89.893  1.00 37.11  ? 314 GLU C CA  1 
ATOM   7763  C  C   . GLU C 1 314 ? 40.927  47.808  89.270  1.00 33.12  ? 314 GLU C C   1 
ATOM   7764  O  O   . GLU C 1 314 ? 40.539  46.816  89.894  1.00 35.13  ? 314 GLU C O   1 
ATOM   7765  C  CB  . GLU C 1 314 ? 39.818  50.086  89.343  1.00 40.46  ? 314 GLU C CB  1 
ATOM   7766  C  CG  . GLU C 1 314 ? 38.439  49.435  89.352  1.00 48.33  ? 314 GLU C CG  1 
ATOM   7767  C  CD  . GLU C 1 314 ? 37.513  49.965  88.255  1.00 59.88  ? 314 GLU C CD  1 
ATOM   7768  O  OE1 . GLU C 1 314 ? 37.955  50.093  87.081  1.00 59.94  ? 314 GLU C OE1 1 
ATOM   7769  O  OE2 . GLU C 1 314 ? 36.325  50.255  88.569  1.00 65.81  ? 314 GLU C OE2 1 
ATOM   7770  N  N   . THR C 1 315 ? 41.386  47.733  88.044  1.00 27.64  ? 315 THR C N   1 
ATOM   7771  C  CA  . THR C 1 315 ? 41.376  46.503  87.312  1.00 25.66  ? 315 THR C CA  1 
ATOM   7772  C  C   . THR C 1 315 ? 42.328  45.487  87.898  1.00 25.82  ? 315 THR C C   1 
ATOM   7773  O  O   . THR C 1 315 ? 41.965  44.308  87.996  1.00 24.66  ? 315 THR C O   1 
ATOM   7774  C  CB  . THR C 1 315 ? 41.764  46.802  85.883  1.00 25.19  ? 315 THR C CB  1 
ATOM   7775  O  OG1 . THR C 1 315 ? 40.739  47.643  85.340  1.00 24.86  ? 315 THR C OG1 1 
ATOM   7776  C  CG2 . THR C 1 315 ? 41.957  45.513  85.055  1.00 23.61  ? 315 THR C CG2 1 
ATOM   7777  N  N   . LYS C 1 316 ? 43.532  45.922  88.285  1.00 25.13  ? 316 LYS C N   1 
ATOM   7778  C  CA  . LYS C 1 316 ? 44.497  44.999  88.894  1.00 25.85  ? 316 LYS C CA  1 
ATOM   7779  C  C   . LYS C 1 316 ? 43.902  44.323  90.129  1.00 26.41  ? 316 LYS C C   1 
ATOM   7780  O  O   . LYS C 1 316 ? 44.074  43.118  90.309  1.00 31.35  ? 316 LYS C O   1 
ATOM   7781  C  CB  . LYS C 1 316 ? 45.822  45.681  89.233  1.00 28.06  ? 316 LYS C CB  1 
ATOM   7782  C  CG  . LYS C 1 316 ? 46.751  45.961  88.056  1.00 28.41  ? 316 LYS C CG  1 
ATOM   7783  C  CD  . LYS C 1 316 ? 48.066  46.538  88.556  1.00 29.36  ? 316 LYS C CD  1 
ATOM   7784  C  CE  . LYS C 1 316 ? 49.160  46.590  87.477  1.00 31.82  ? 316 LYS C CE  1 
ATOM   7785  N  NZ  . LYS C 1 316 ? 49.072  47.756  86.548  1.00 32.06  ? 316 LYS C NZ  1 
ATOM   7786  N  N   . ASN C 1 317 ? 43.146  45.074  90.930  1.00 25.15  ? 317 ASN C N   1 
ATOM   7787  C  CA  . ASN C 1 317 ? 42.497  44.568  92.142  1.00 24.51  ? 317 ASN C CA  1 
ATOM   7788  C  C   . ASN C 1 317 ? 41.340  43.659  91.883  1.00 24.40  ? 317 ASN C C   1 
ATOM   7789  O  O   . ASN C 1 317 ? 41.067  42.738  92.662  1.00 25.43  ? 317 ASN C O   1 
ATOM   7790  C  CB  . ASN C 1 317 ? 42.046  45.725  93.028  1.00 25.31  ? 317 ASN C CB  1 
ATOM   7791  C  CG  . ASN C 1 317 ? 43.236  46.553  93.525  1.00 27.96  ? 317 ASN C CG  1 
ATOM   7792  O  OD1 . ASN C 1 317 ? 44.391  46.111  93.428  1.00 26.29  ? 317 ASN C OD1 1 
ATOM   7793  N  ND2 . ASN C 1 317 ? 42.964  47.752  94.046  1.00 27.15  ? 317 ASN C ND2 1 
ATOM   7794  N  N   . LYS C 1 318 ? 40.631  43.924  90.798  1.00 24.22  ? 318 LYS C N   1 
ATOM   7795  C  CA  . LYS C 1 318 ? 39.594  43.010  90.400  1.00 24.14  ? 318 LYS C CA  1 
ATOM   7796  C  C   . LYS C 1 318 ? 40.194  41.634  90.007  1.00 22.10  ? 318 LYS C C   1 
ATOM   7797  O  O   . LYS C 1 318 ? 39.659  40.606  90.393  1.00 20.75  ? 318 LYS C O   1 
ATOM   7798  C  CB  . LYS C 1 318 ? 38.699  43.639  89.331  1.00 26.68  ? 318 LYS C CB  1 
ATOM   7799  C  CG  . LYS C 1 318 ? 37.631  44.535  89.944  1.00 29.09  ? 318 LYS C CG  1 
ATOM   7800  C  CD  . LYS C 1 318 ? 36.595  44.915  88.921  1.00 33.11  ? 318 LYS C CD  1 
ATOM   7801  C  CE  . LYS C 1 318 ? 36.972  46.227  88.264  1.00 36.01  ? 318 LYS C CE  1 
ATOM   7802  N  NZ  . LYS C 1 318 ? 36.466  46.207  86.868  1.00 39.95  ? 318 LYS C NZ  1 
ATOM   7803  N  N   . LEU C 1 319 ? 41.329  41.632  89.305  1.00 21.12  ? 319 LEU C N   1 
ATOM   7804  C  CA  . LEU C 1 319 ? 41.967  40.379  88.886  1.00 21.08  ? 319 LEU C CA  1 
ATOM   7805  C  C   . LEU C 1 319 ? 42.724  39.669  89.995  1.00 20.75  ? 319 LEU C C   1 
ATOM   7806  O  O   . LEU C 1 319 ? 42.882  38.455  89.919  1.00 19.12  ? 319 LEU C O   1 
ATOM   7807  C  CB  . LEU C 1 319 ? 42.932  40.570  87.718  1.00 20.11  ? 319 LEU C CB  1 
ATOM   7808  C  CG  . LEU C 1 319 ? 42.543  41.055  86.312  1.00 23.27  ? 319 LEU C CG  1 
ATOM   7809  C  CD1 . LEU C 1 319 ? 43.287  40.189  85.296  1.00 24.85  ? 319 LEU C CD1 1 
ATOM   7810  C  CD2 . LEU C 1 319 ? 41.070  41.038  85.974  1.00 21.23  ? 319 LEU C CD2 1 
ATOM   7811  N  N   . LYS C 1 320 ? 43.232  40.417  90.984  1.00 20.39  ? 320 LYS C N   1 
ATOM   7812  C  CA  . LYS C 1 320 ? 43.970  39.802  92.074  1.00 20.37  ? 320 LYS C CA  1 
ATOM   7813  C  C   . LYS C 1 320 ? 43.020  39.240  93.115  1.00 20.18  ? 320 LYS C C   1 
ATOM   7814  O  O   . LYS C 1 320 ? 43.348  38.251  93.767  1.00 21.22  ? 320 LYS C O   1 
ATOM   7815  C  CB  . LYS C 1 320 ? 44.922  40.796  92.760  1.00 22.41  ? 320 LYS C CB  1 
ATOM   7816  C  CG  . LYS C 1 320 ? 46.001  41.366  91.871  1.00 25.24  ? 320 LYS C CG  1 
ATOM   7817  C  CD  . LYS C 1 320 ? 47.240  41.774  92.643  1.00 27.53  ? 320 LYS C CD  1 
ATOM   7818  C  CE  . LYS C 1 320 ? 47.044  43.056  93.423  1.00 30.29  ? 320 LYS C CE  1 
ATOM   7819  N  NZ  . LYS C 1 320 ? 48.229  43.961  93.345  1.00 31.33  ? 320 LYS C NZ  1 
ATOM   7820  N  N   . ALA C 1 321 ? 41.866  39.867  93.322  1.00 18.82  ? 321 ALA C N   1 
ATOM   7821  C  CA  . ALA C 1 321 ? 41.036  39.463  94.460  1.00 20.20  ? 321 ALA C CA  1 
ATOM   7822  C  C   . ALA C 1 321 ? 39.577  39.700  94.199  1.00 20.26  ? 321 ALA C C   1 
ATOM   7823  O  O   . ALA C 1 321 ? 38.753  38.805  94.384  1.00 22.70  ? 321 ALA C O   1 
ATOM   7824  C  CB  . ALA C 1 321 ? 41.446  40.215  95.724  1.00 19.11  ? 321 ALA C CB  1 
ATOM   7825  N  N   . GLY C 1 322 ? 39.252  40.897  93.758  1.00 18.08  ? 322 GLY C N   1 
ATOM   7826  C  CA  . GLY C 1 322 ? 37.860  41.221  93.505  1.00 18.59  ? 322 GLY C CA  1 
ATOM   7827  C  C   . GLY C 1 322 ? 37.013  40.233  92.739  1.00 17.71  ? 322 GLY C C   1 
ATOM   7828  O  O   . GLY C 1 322 ? 35.875  39.984  93.135  1.00 18.19  ? 322 GLY C O   1 
ATOM   7829  N  N   . ASN C 1 323 ? 37.523  39.701  91.620  1.00 16.96  ? 323 ASN C N   1 
ATOM   7830  C  CA  . ASN C 1 323 ? 36.679  38.847  90.763  1.00 16.68  ? 323 ASN C CA  1 
ATOM   7831  C  C   . ASN C 1 323 ? 36.468  37.469  91.363  1.00 16.25  ? 323 ASN C C   1 
ATOM   7832  O  O   . ASN C 1 323 ? 35.465  36.825  91.126  1.00 16.83  ? 323 ASN C O   1 
ATOM   7833  C  CB  . ASN C 1 323 ? 37.262  38.708  89.351  1.00 17.07  ? 323 ASN C CB  1 
ATOM   7834  C  CG  . ASN C 1 323 ? 37.246  40.007  88.559  1.00 16.10  ? 323 ASN C CG  1 
ATOM   7835  O  OD1 . ASN C 1 323 ? 36.486  40.914  88.831  1.00 15.40  ? 323 ASN C OD1 1 
ATOM   7836  N  ND2 . ASN C 1 323 ? 38.099  40.079  87.564  1.00 15.94  ? 323 ASN C ND2 1 
ATOM   7837  N  N   . ALA C 1 324 ? 37.447  37.020  92.130  1.00 16.95  ? 324 ALA C N   1 
ATOM   7838  C  CA  . ALA C 1 324 ? 37.383  35.755  92.828  1.00 17.01  ? 324 ALA C CA  1 
ATOM   7839  C  C   . ALA C 1 324 ? 36.262  35.770  93.892  1.00 18.83  ? 324 ALA C C   1 
ATOM   7840  O  O   . ALA C 1 324 ? 35.535  34.776  94.070  1.00 18.26  ? 324 ALA C O   1 
ATOM   7841  C  CB  . ALA C 1 324 ? 38.722  35.473  93.472  1.00 15.18  ? 324 ALA C CB  1 
ATOM   7842  N  N   . LEU C 1 325 ? 36.129  36.891  94.605  1.00 20.02  ? 325 LEU C N   1 
ATOM   7843  C  CA  . LEU C 1 325 ? 35.139  36.954  95.693  1.00 22.29  ? 325 LEU C CA  1 
ATOM   7844  C  C   . LEU C 1 325 ? 33.762  36.936  95.101  1.00 23.12  ? 325 LEU C C   1 
ATOM   7845  O  O   . LEU C 1 325 ? 32.876  36.281  95.636  1.00 23.66  ? 325 LEU C O   1 
ATOM   7846  C  CB  . LEU C 1 325 ? 35.306  38.203  96.535  1.00 20.92  ? 325 LEU C CB  1 
ATOM   7847  C  CG  . LEU C 1 325 ? 36.621  38.161  97.261  1.00 21.34  ? 325 LEU C CG  1 
ATOM   7848  C  CD1 . LEU C 1 325 ? 36.879  39.532  97.883  1.00 19.33  ? 325 LEU C CD1 1 
ATOM   7849  C  CD2 . LEU C 1 325 ? 36.655  36.984  98.249  1.00 20.59  ? 325 LEU C CD2 1 
ATOM   7850  N  N   . ALA C 1 326 ? 33.609  37.660  93.988  1.00 23.82  ? 326 ALA C N   1 
ATOM   7851  C  CA  . ALA C 1 326 ? 32.361  37.678  93.234  1.00 23.95  ? 326 ALA C CA  1 
ATOM   7852  C  C   . ALA C 1 326 ? 32.059  36.283  92.690  1.00 22.39  ? 326 ALA C C   1 
ATOM   7853  O  O   . ALA C 1 326 ? 30.924  35.799  92.773  1.00 26.82  ? 326 ALA C O   1 
ATOM   7854  C  CB  . ALA C 1 326 ? 32.459  38.688  92.106  1.00 24.21  ? 326 ALA C CB  1 
ATOM   7855  N  N   . PHE C 1 327 ? 33.061  35.621  92.138  1.00 19.85  ? 327 PHE C N   1 
ATOM   7856  C  CA  . PHE C 1 327 ? 32.858  34.254  91.634  1.00 18.64  ? 327 PHE C CA  1 
ATOM   7857  C  C   . PHE C 1 327 ? 32.479  33.230  92.743  1.00 19.83  ? 327 PHE C C   1 
ATOM   7858  O  O   . PHE C 1 327 ? 31.608  32.380  92.560  1.00 19.01  ? 327 PHE C O   1 
ATOM   7859  C  CB  . PHE C 1 327 ? 34.089  33.792  90.844  1.00 16.46  ? 327 PHE C CB  1 
ATOM   7860  C  CG  . PHE C 1 327 ? 34.106  32.315  90.552  1.00 15.16  ? 327 PHE C CG  1 
ATOM   7861  C  CD1 . PHE C 1 327 ? 33.180  31.756  89.698  1.00 14.65  ? 327 PHE C CD1 1 
ATOM   7862  C  CD2 . PHE C 1 327 ? 35.048  31.486  91.150  1.00 14.91  ? 327 PHE C CD2 1 
ATOM   7863  C  CE1 . PHE C 1 327 ? 33.160  30.390  89.450  1.00 14.52  ? 327 PHE C CE1 1 
ATOM   7864  C  CE2 . PHE C 1 327 ? 35.054  30.122  90.903  1.00 15.53  ? 327 PHE C CE2 1 
ATOM   7865  C  CZ  . PHE C 1 327 ? 34.108  29.577  90.034  1.00 15.44  ? 327 PHE C CZ  1 
ATOM   7866  N  N   . LEU C 1 328 ? 33.137  33.315  93.895  1.00 21.12  ? 328 LEU C N   1 
ATOM   7867  C  CA  . LEU C 1 328 ? 32.897  32.359  94.952  1.00 22.61  ? 328 LEU C CA  1 
ATOM   7868  C  C   . LEU C 1 328 ? 31.695  32.714  95.799  1.00 23.07  ? 328 LEU C C   1 
ATOM   7869  O  O   . LEU C 1 328 ? 31.266  31.918  96.626  1.00 24.84  ? 328 LEU C O   1 
ATOM   7870  C  CB  . LEU C 1 328 ? 34.148  32.223  95.836  1.00 22.41  ? 328 LEU C CB  1 
ATOM   7871  C  CG  . LEU C 1 328 ? 35.429  31.677  95.208  1.00 21.21  ? 328 LEU C CG  1 
ATOM   7872  C  CD1 . LEU C 1 328 ? 36.558  31.861  96.199  1.00 22.19  ? 328 LEU C CD1 1 
ATOM   7873  C  CD2 . LEU C 1 328 ? 35.301  30.207  94.843  1.00 21.32  ? 328 LEU C CD2 1 
ATOM   7874  N  N   . GLY C 1 329 ? 31.169  33.920  95.614  1.00 24.68  ? 329 GLY C N   1 
ATOM   7875  C  CA  . GLY C 1 329 ? 30.046  34.428  96.404  1.00 25.54  ? 329 GLY C CA  1 
ATOM   7876  C  C   . GLY C 1 329 ? 30.421  34.808  97.835  1.00 29.54  ? 329 GLY C C   1 
ATOM   7877  O  O   . GLY C 1 329 ? 29.657  34.541  98.766  1.00 31.58  ? 329 GLY C O   1 
ATOM   7878  N  N   . LEU C 1 330 ? 31.586  35.430  98.022  1.00 30.59  ? 330 LEU C N   1 
ATOM   7879  C  CA  . LEU C 1 330 ? 32.138  35.657  99.364  1.00 31.66  ? 330 LEU C CA  1 
ATOM   7880  C  C   . LEU C 1 330 ? 32.516  37.104  99.650  1.00 36.64  ? 330 LEU C C   1 
ATOM   7881  O  O   . LEU C 1 330 ? 32.683  37.909  98.718  1.00 36.26  ? 330 LEU C O   1 
ATOM   7882  C  CB  . LEU C 1 330 ? 33.354  34.797  99.576  1.00 29.42  ? 330 LEU C CB  1 
ATOM   7883  C  CG  . LEU C 1 330 ? 33.188  33.284  99.444  1.00 33.65  ? 330 LEU C CG  1 
ATOM   7884  C  CD1 . LEU C 1 330 ? 34.517  32.661  99.862  1.00 29.93  ? 330 LEU C CD1 1 
ATOM   7885  C  CD2 . LEU C 1 330 ? 32.014  32.716  100.269 1.00 31.33  ? 330 LEU C CD2 1 
ATOM   7886  N  N   . GLU C 1 331 ? 32.659  37.409  100.947 1.00 40.68  ? 331 GLU C N   1 
ATOM   7887  C  CA  . GLU C 1 331 ? 32.910  38.754  101.472 1.00 43.90  ? 331 GLU C CA  1 
ATOM   7888  C  C   . GLU C 1 331 ? 34.271  38.880  102.201 1.00 47.13  ? 331 GLU C C   1 
ATOM   7889  O  O   . GLU C 1 331 ? 34.601  38.037  103.043 1.00 50.75  ? 331 GLU C O   1 
ATOM   7890  C  CB  . GLU C 1 331 ? 31.790  39.100  102.461 1.00 50.00  ? 331 GLU C CB  1 
ATOM   7891  C  CG  . GLU C 1 331 ? 30.390  39.222  101.865 1.00 53.52  ? 331 GLU C CG  1 
ATOM   7892  C  CD  . GLU C 1 331 ? 29.955  40.669  101.643 1.00 58.33  ? 331 GLU C CD  1 
ATOM   7893  O  OE1 . GLU C 1 331 ? 29.027  40.903  100.825 1.00 59.82  ? 331 GLU C OE1 1 
ATOM   7894  O  OE2 . GLU C 1 331 ? 30.529  41.580  102.295 1.00 59.34  ? 331 GLU C OE2 1 
ATOM   7895  N  N   . ARG C 1 332 ? 35.049  39.928  101.904 1.00 45.76  ? 332 ARG C N   1 
ATOM   7896  C  CA  . ARG C 1 332 ? 36.237  40.263  102.717 1.00 43.56  ? 332 ARG C CA  1 
ATOM   7897  C  C   . ARG C 1 332 ? 35.833  40.905  104.041 1.00 41.77  ? 332 ARG C C   1 
ATOM   7898  O  O   . ARG C 1 332 ? 36.109  40.354  105.106 1.00 45.65  ? 332 ARG C O   1 
ATOM   7899  C  CB  . ARG C 1 332 ? 37.204  41.197  101.956 1.00 40.64  ? 332 ARG C CB  1 
ATOM   7900  C  CG  . ARG C 1 332 ? 36.601  41.948  100.780 1.00 37.67  ? 332 ARG C CG  1 
ATOM   7901  C  CD  . ARG C 1 332 ? 37.296  43.304  100.540 1.00 38.38  ? 332 ARG C CD  1 
ATOM   7902  N  NE  . ARG C 1 332 ? 38.677  43.208  100.004 1.00 38.52  ? 332 ARG C NE  1 
ATOM   7903  C  CZ  . ARG C 1 332 ? 39.018  43.386  98.706  1.00 37.47  ? 332 ARG C CZ  1 
ATOM   7904  N  NH1 . ARG C 1 332 ? 38.086  43.655  97.781  1.00 35.86  ? 332 ARG C NH1 1 
ATOM   7905  N  NH2 . ARG C 1 332 ? 40.299  43.286  98.321  1.00 33.24  ? 332 ARG C NH2 1 
ATOM   7906  N  N   . MET D 1 1   ? 17.905  -0.206  10.771  1.00 54.73  ? 1   MET D N   1 
ATOM   7907  C  CA  . MET D 1 1   ? 17.768  0.465   9.463   1.00 52.15  ? 1   MET D CA  1 
ATOM   7908  C  C   . MET D 1 1   ? 18.510  -0.345  8.383   1.00 48.24  ? 1   MET D C   1 
ATOM   7909  O  O   . MET D 1 1   ? 18.628  0.125   7.257   1.00 58.20  ? 1   MET D O   1 
ATOM   7910  C  CB  . MET D 1 1   ? 18.277  1.923   9.553   1.00 57.27  ? 1   MET D CB  1 
ATOM   7911  C  CG  . MET D 1 1   ? 17.490  2.986   8.786   1.00 63.51  ? 1   MET D CG  1 
ATOM   7912  S  SD  . MET D 1 1   ? 18.475  4.485   8.422   1.00 84.02  ? 1   MET D SD  1 
ATOM   7913  C  CE  . MET D 1 1   ? 17.273  5.720   7.891   1.00 67.42  ? 1   MET D CE  1 
ATOM   7914  N  N   . LYS D 1 2   ? 19.008  -1.546  8.688   1.00 36.86  ? 2   LYS D N   1 
ATOM   7915  C  CA  . LYS D 1 2   ? 19.473  -2.445  7.602   1.00 30.01  ? 2   LYS D CA  1 
ATOM   7916  C  C   . LYS D 1 2   ? 18.494  -3.622  7.463   1.00 26.09  ? 2   LYS D C   1 
ATOM   7917  O  O   . LYS D 1 2   ? 17.682  -3.608  6.533   1.00 22.37  ? 2   LYS D O   1 
ATOM   7918  C  CB  . LYS D 1 2   ? 20.913  -2.950  7.787   1.00 30.94  ? 2   LYS D CB  1 
ATOM   7919  C  CG  . LYS D 1 2   ? 22.047  -1.988  7.519   1.00 30.72  ? 2   LYS D CG  1 
ATOM   7920  C  CD  . LYS D 1 2   ? 22.635  -2.176  6.112   1.00 33.05  ? 2   LYS D CD  1 
ATOM   7921  C  CE  . LYS D 1 2   ? 22.754  -0.824  5.393   1.00 31.97  ? 2   LYS D CE  1 
ATOM   7922  N  NZ  . LYS D 1 2   ? 23.499  0.218   6.164   1.00 28.72  ? 2   LYS D NZ  1 
ATOM   7923  N  N   . ILE D 1 3   ? 18.549  -4.614  8.374   1.00 21.32  ? 3   ILE D N   1 
ATOM   7924  C  CA  . ILE D 1 3   ? 17.657  -5.785  8.285   1.00 20.02  ? 3   ILE D CA  1 
ATOM   7925  C  C   . ILE D 1 3   ? 16.547  -5.795  9.374   1.00 20.88  ? 3   ILE D C   1 
ATOM   7926  O  O   . ILE D 1 3   ? 16.771  -5.394  10.514  1.00 20.81  ? 3   ILE D O   1 
ATOM   7927  C  CB  . ILE D 1 3   ? 18.450  -7.101  8.278   1.00 18.95  ? 3   ILE D CB  1 
ATOM   7928  C  CG1 . ILE D 1 3   ? 19.308  -7.186  7.014   1.00 20.10  ? 3   ILE D CG1 1 
ATOM   7929  C  CG2 . ILE D 1 3   ? 17.535  -8.318  8.277   1.00 17.90  ? 3   ILE D CG2 1 
ATOM   7930  C  CD1 . ILE D 1 3   ? 20.314  -8.331  7.020   1.00 19.74  ? 3   ILE D CD1 1 
ATOM   7931  N  N   . ASP D 1 4   ? 15.350  -6.224  8.995   1.00 20.48  ? 4   ASP D N   1 
ATOM   7932  C  CA  . ASP D 1 4   ? 14.206  -6.324  9.887   1.00 19.67  ? 4   ASP D CA  1 
ATOM   7933  C  C   . ASP D 1 4   ? 13.712  -7.794  9.920   1.00 18.97  ? 4   ASP D C   1 
ATOM   7934  O  O   . ASP D 1 4   ? 13.247  -8.342  8.909   1.00 17.19  ? 4   ASP D O   1 
ATOM   7935  C  CB  . ASP D 1 4   ? 13.123  -5.379  9.388   1.00 22.45  ? 4   ASP D CB  1 
ATOM   7936  C  CG  . ASP D 1 4   ? 11.886  -5.347  10.289  1.00 27.92  ? 4   ASP D CG  1 
ATOM   7937  O  OD1 . ASP D 1 4   ? 11.875  -5.930  11.414  1.00 28.94  ? 4   ASP D OD1 1 
ATOM   7938  O  OD2 . ASP D 1 4   ? 10.896  -4.711  9.854   1.00 34.24  ? 4   ASP D OD2 1 
ATOM   7939  N  N   . ILE D 1 5   ? 13.829  -8.428  11.077  1.00 17.11  ? 5   ILE D N   1 
ATOM   7940  C  CA  . ILE D 1 5   ? 13.537  -9.838  11.172  1.00 17.30  ? 5   ILE D CA  1 
ATOM   7941  C  C   . ILE D 1 5   ? 12.087  -10.130 11.457  1.00 17.32  ? 5   ILE D C   1 
ATOM   7942  O  O   . ILE D 1 5   ? 11.634  -11.225 11.212  1.00 20.42  ? 5   ILE D O   1 
ATOM   7943  C  CB  . ILE D 1 5   ? 14.438  -10.542 12.244  1.00 18.68  ? 5   ILE D CB  1 
ATOM   7944  C  CG1 . ILE D 1 5   ? 14.640  -12.017 11.911  1.00 17.17  ? 5   ILE D CG1 1 
ATOM   7945  C  CG2 . ILE D 1 5   ? 13.961  -10.320 13.683  1.00 17.24  ? 5   ILE D CG2 1 
ATOM   7946  C  CD1 . ILE D 1 5   ? 15.817  -12.170 10.994  1.00 16.86  ? 5   ILE D CD1 1 
ATOM   7947  N  N   . HIS D 1 6   ? 11.352  -9.151  11.953  1.00 16.24  ? 6   HIS D N   1 
ATOM   7948  C  CA  . HIS D 1 6   ? 10.014  -9.380  12.445  1.00 15.22  ? 6   HIS D CA  1 
ATOM   7949  C  C   . HIS D 1 6   ? 9.112   -8.562  11.589  1.00 14.38  ? 6   HIS D C   1 
ATOM   7950  O  O   . HIS D 1 6   ? 8.914   -7.390  11.827  1.00 13.74  ? 6   HIS D O   1 
ATOM   7951  C  CB  . HIS D 1 6   ? 9.977   -8.918  13.920  1.00 14.78  ? 6   HIS D CB  1 
ATOM   7952  C  CG  . HIS D 1 6   ? 8.657   -9.124  14.625  1.00 14.37  ? 6   HIS D CG  1 
ATOM   7953  N  ND1 . HIS D 1 6   ? 8.544   -9.061  15.979  1.00 14.97  ? 6   HIS D ND1 1 
ATOM   7954  C  CD2 . HIS D 1 6   ? 7.370   -9.363  14.137  1.00 13.89  ? 6   HIS D CD2 1 
ATOM   7955  C  CE1 . HIS D 1 6   ? 7.261   -9.273  16.320  1.00 13.78  ? 6   HIS D CE1 1 
ATOM   7956  N  NE2 . HIS D 1 6   ? 6.549   -9.454  15.197  1.00 12.98  ? 6   HIS D NE2 1 
ATOM   7957  N  N   . SER D 1 7   ? 8.549   -9.149  10.549  1.00 15.28  ? 7   SER D N   1 
ATOM   7958  C  CA  . SER D 1 7   ? 7.575   -8.384  9.735   1.00 14.90  ? 7   SER D CA  1 
ATOM   7959  C  C   . SER D 1 7   ? 6.556   -9.329  9.162   1.00 13.69  ? 7   SER D C   1 
ATOM   7960  O  O   . SER D 1 7   ? 6.850   -10.516 9.024   1.00 14.02  ? 7   SER D O   1 
ATOM   7961  C  CB  . SER D 1 7   ? 8.226   -7.515  8.653   1.00 15.46  ? 7   SER D CB  1 
ATOM   7962  O  OG  . SER D 1 7   ? 8.655   -8.296  7.552   1.00 18.50  ? 7   SER D OG  1 
ATOM   7963  N  N   . HIS D 1 8   ? 5.361   -8.820  8.888   1.00 12.64  ? 8   HIS D N   1 
ATOM   7964  C  CA  . HIS D 1 8   ? 4.246   -9.678  8.508   1.00 12.91  ? 8   HIS D CA  1 
ATOM   7965  C  C   . HIS D 1 8   ? 3.621   -9.288  7.224   1.00 12.70  ? 8   HIS D C   1 
ATOM   7966  O  O   . HIS D 1 8   ? 3.610   -8.124  6.869   1.00 12.33  ? 8   HIS D O   1 
ATOM   7967  C  CB  . HIS D 1 8   ? 3.195   -9.641  9.566   1.00 13.03  ? 8   HIS D CB  1 
ATOM   7968  C  CG  . HIS D 1 8   ? 3.675   -10.142 10.884  1.00 13.51  ? 8   HIS D CG  1 
ATOM   7969  N  ND1 . HIS D 1 8   ? 3.799   -9.343  11.956  1.00 13.07  ? 8   HIS D ND1 1 
ATOM   7970  C  CD2 . HIS D 1 8   ? 4.080   -11.392 11.284  1.00 12.99  ? 8   HIS D CD2 1 
ATOM   7971  C  CE1 . HIS D 1 8   ? 4.253   -10.055 12.988  1.00 12.96  ? 8   HIS D CE1 1 
ATOM   7972  N  NE2 . HIS D 1 8   ? 4.429   -11.294 12.587  1.00 13.47  ? 8   HIS D NE2 1 
ATOM   7973  N  N   . ILE D 1 9   ? 3.093   -10.266 6.512   1.00 12.76  ? 9   ILE D N   1 
ATOM   7974  C  CA  . ILE D 1 9   ? 2.538   -10.021 5.200   1.00 13.35  ? 9   ILE D CA  1 
ATOM   7975  C  C   . ILE D 1 9   ? 1.445   -11.030 4.973   1.00 13.85  ? 9   ILE D C   1 
ATOM   7976  O  O   . ILE D 1 9   ? 1.457   -12.115 5.548   1.00 15.10  ? 9   ILE D O   1 
ATOM   7977  C  CB  . ILE D 1 9   ? 3.621   -10.159 4.089   1.00 13.43  ? 9   ILE D CB  1 
ATOM   7978  C  CG1 . ILE D 1 9   ? 3.157   -9.506  2.778   1.00 13.17  ? 9   ILE D CG1 1 
ATOM   7979  C  CG2 . ILE D 1 9   ? 3.998   -11.625 3.848   1.00 14.04  ? 9   ILE D CG2 1 
ATOM   7980  C  CD1 . ILE D 1 9   ? 4.267   -9.383  1.754   1.00 12.32  ? 9   ILE D CD1 1 
ATOM   7981  N  N   . LEU D 1 10  ? 0.503   -10.674 4.130   1.00 14.24  ? 10  LEU D N   1 
ATOM   7982  C  CA  . LEU D 1 10  ? -0.582  -11.542 3.798   1.00 15.18  ? 10  LEU D CA  1 
ATOM   7983  C  C   . LEU D 1 10  ? -0.654  -11.649 2.279   1.00 16.77  ? 10  LEU D C   1 
ATOM   7984  O  O   . LEU D 1 10  ? -0.297  -10.697 1.567   1.00 15.44  ? 10  LEU D O   1 
ATOM   7985  C  CB  . LEU D 1 10  ? -1.899  -10.976 4.355   1.00 14.27  ? 10  LEU D CB  1 
ATOM   7986  C  CG  . LEU D 1 10  ? -2.050  -11.270 5.852   1.00 14.30  ? 10  LEU D CG  1 
ATOM   7987  C  CD1 . LEU D 1 10  ? -3.406  -10.850 6.394   1.00 14.59  ? 10  LEU D CD1 1 
ATOM   7988  C  CD2 . LEU D 1 10  ? -1.859  -12.747 6.193   1.00 14.11  ? 10  LEU D CD2 1 
ATOM   7989  N  N   . PRO D 1 11  ? -1.109  -12.804 1.772   1.00 17.15  ? 11  PRO D N   1 
ATOM   7990  C  CA  . PRO D 1 11  ? -1.614  -12.707 0.380   1.00 19.80  ? 11  PRO D CA  1 
ATOM   7991  C  C   . PRO D 1 11  ? -2.794  -11.696 0.248   1.00 22.44  ? 11  PRO D C   1 
ATOM   7992  O  O   . PRO D 1 11  ? -3.591  -11.527 1.186   1.00 22.08  ? 11  PRO D O   1 
ATOM   7993  C  CB  . PRO D 1 11  ? -2.075  -14.115 0.057   1.00 17.27  ? 11  PRO D CB  1 
ATOM   7994  C  CG  . PRO D 1 11  ? -1.558  -14.969 1.153   1.00 17.32  ? 11  PRO D CG  1 
ATOM   7995  C  CD  . PRO D 1 11  ? -1.384  -14.104 2.374   1.00 16.53  ? 11  PRO D CD  1 
ATOM   7996  N  N   . LYS D 1 12  ? -2.902  -11.021 -0.893  1.00 26.22  ? 12  LYS D N   1 
ATOM   7997  C  CA  . LYS D 1 12  ? -3.967  -10.019 -1.043  1.00 29.54  ? 12  LYS D CA  1 
ATOM   7998  C  C   . LYS D 1 12  ? -5.360  -10.681 -0.997  1.00 28.33  ? 12  LYS D C   1 
ATOM   7999  O  O   . LYS D 1 12  ? -6.322  -10.094 -0.479  1.00 26.17  ? 12  LYS D O   1 
ATOM   8000  C  CB  . LYS D 1 12  ? -3.745  -9.092  -2.264  1.00 31.82  ? 12  LYS D CB  1 
ATOM   8001  C  CG  . LYS D 1 12  ? -3.799  -9.759  -3.633  1.00 39.99  ? 12  LYS D CG  1 
ATOM   8002  C  CD  . LYS D 1 12  ? -2.659  -10.762 -3.862  1.00 45.93  ? 12  LYS D CD  1 
ATOM   8003  C  CE  . LYS D 1 12  ? -2.845  -11.559 -5.151  1.00 48.65  ? 12  LYS D CE  1 
ATOM   8004  N  NZ  . LYS D 1 12  ? -2.463  -12.989 -4.956  1.00 48.81  ? 12  LYS D NZ  1 
ATOM   8005  N  N   . GLU D 1 13  ? -5.437  -11.916 -1.495  1.00 28.46  ? 13  GLU D N   1 
ATOM   8006  C  CA  . GLU D 1 13  ? -6.678  -12.706 -1.488  1.00 30.37  ? 13  GLU D CA  1 
ATOM   8007  C  C   . GLU D 1 13  ? -6.384  -14.187 -1.203  1.00 27.60  ? 13  GLU D C   1 
ATOM   8008  O  O   . GLU D 1 13  ? -5.332  -14.700 -1.560  1.00 25.43  ? 13  GLU D O   1 
ATOM   8009  C  CB  . GLU D 1 13  ? -7.437  -12.613 -2.850  1.00 34.94  ? 13  GLU D CB  1 
ATOM   8010  C  CG  . GLU D 1 13  ? -7.204  -11.365 -3.721  1.00 41.08  ? 13  GLU D CG  1 
ATOM   8011  C  CD  . GLU D 1 13  ? -7.783  -11.460 -5.156  1.00 47.39  ? 13  GLU D CD  1 
ATOM   8012  O  OE1 . GLU D 1 13  ? -7.909  -12.580 -5.722  1.00 49.52  ? 13  GLU D OE1 1 
ATOM   8013  O  OE2 . GLU D 1 13  ? -8.111  -10.394 -5.741  1.00 48.12  ? 13  GLU D OE2 1 
ATOM   8014  N  N   . TRP D 1 14  ? -7.327  -14.876 -0.572  1.00 26.53  ? 14  TRP D N   1 
ATOM   8015  C  CA  . TRP D 1 14  ? -7.293  -16.342 -0.531  1.00 25.92  ? 14  TRP D CA  1 
ATOM   8016  C  C   . TRP D 1 14  ? -8.696  -16.917 -0.443  1.00 24.03  ? 14  TRP D C   1 
ATOM   8017  O  O   . TRP D 1 14  ? -9.625  -16.178 -0.194  1.00 24.65  ? 14  TRP D O   1 
ATOM   8018  C  CB  . TRP D 1 14  ? -6.340  -16.857 0.558   1.00 22.86  ? 14  TRP D CB  1 
ATOM   8019  C  CG  . TRP D 1 14  ? -6.774  -16.560 1.966   1.00 21.30  ? 14  TRP D CG  1 
ATOM   8020  C  CD1 . TRP D 1 14  ? -7.565  -17.346 2.788   1.00 21.06  ? 14  TRP D CD1 1 
ATOM   8021  C  CD2 . TRP D 1 14  ? -6.424  -15.400 2.777   1.00 19.93  ? 14  TRP D CD2 1 
ATOM   8022  N  NE1 . TRP D 1 14  ? -7.726  -16.764 4.031   1.00 20.92  ? 14  TRP D NE1 1 
ATOM   8023  C  CE2 . TRP D 1 14  ? -7.071  -15.603 4.091   1.00 20.09  ? 14  TRP D CE2 1 
ATOM   8024  C  CE3 . TRP D 1 14  ? -5.659  -14.279 2.579   1.00 18.68  ? 14  TRP D CE3 1 
ATOM   8025  C  CZ2 . TRP D 1 14  ? -6.951  -14.690 5.114   1.00 18.17  ? 14  TRP D CZ2 1 
ATOM   8026  C  CZ3 . TRP D 1 14  ? -5.517  -13.381 3.637   1.00 17.63  ? 14  TRP D CZ3 1 
ATOM   8027  C  CH2 . TRP D 1 14  ? -6.149  -13.587 4.867   1.00 18.15  ? 14  TRP D CH2 1 
ATOM   8028  N  N   . PRO D 1 15  ? -8.878  -18.229 -0.698  1.00 25.02  ? 15  PRO D N   1 
ATOM   8029  C  CA  . PRO D 1 15  ? -10.261 -18.729 -0.772  1.00 26.26  ? 15  PRO D CA  1 
ATOM   8030  C  C   . PRO D 1 15  ? -11.008 -18.703 0.572   1.00 27.59  ? 15  PRO D C   1 
ATOM   8031  O  O   . PRO D 1 15  ? -10.389 -18.545 1.651   1.00 23.54  ? 15  PRO D O   1 
ATOM   8032  C  CB  . PRO D 1 15  ? -10.089 -20.194 -1.224  1.00 26.76  ? 15  PRO D CB  1 
ATOM   8033  C  CG  . PRO D 1 15  ? -8.681  -20.321 -1.706  1.00 27.60  ? 15  PRO D CG  1 
ATOM   8034  C  CD  . PRO D 1 15  ? -7.912  -19.328 -0.863  1.00 25.93  ? 15  PRO D CD  1 
ATOM   8035  N  N   . ASP D 1 16  ? -12.332 -18.836 0.483   1.00 27.49  ? 16  ASP D N   1 
ATOM   8036  C  CA  . ASP D 1 16  ? -13.163 -18.957 1.643   1.00 28.40  ? 16  ASP D CA  1 
ATOM   8037  C  C   . ASP D 1 16  ? -12.804 -20.273 2.301   1.00 25.63  ? 16  ASP D C   1 
ATOM   8038  O  O   . ASP D 1 16  ? -12.903 -21.333 1.679   1.00 25.41  ? 16  ASP D O   1 
ATOM   8039  C  CB  . ASP D 1 16  ? -14.646 -18.938 1.269   1.00 35.16  ? 16  ASP D CB  1 
ATOM   8040  C  CG  . ASP D 1 16  ? -15.557 -19.214 2.468   1.00 42.52  ? 16  ASP D CG  1 
ATOM   8041  O  OD1 . ASP D 1 16  ? -15.207 -18.867 3.624   1.00 48.70  ? 16  ASP D OD1 1 
ATOM   8042  O  OD2 . ASP D 1 16  ? -16.637 -19.799 2.253   1.00 53.80  ? 16  ASP D OD2 1 
ATOM   8043  N  N   . LEU D 1 17  ? -12.386 -20.202 3.559   1.00 22.82  ? 17  LEU D N   1 
ATOM   8044  C  CA  . LEU D 1 17  ? -11.762 -21.354 4.171   1.00 23.33  ? 17  LEU D CA  1 
ATOM   8045  C  C   . LEU D 1 17  ? -12.783 -22.307 4.768   1.00 23.90  ? 17  LEU D C   1 
ATOM   8046  O  O   . LEU D 1 17  ? -12.572 -23.504 4.769   1.00 24.18  ? 17  LEU D O   1 
ATOM   8047  C  CB  . LEU D 1 17  ? -10.704 -20.928 5.180   1.00 21.37  ? 17  LEU D CB  1 
ATOM   8048  C  CG  . LEU D 1 17  ? -9.473  -20.265 4.586   1.00 20.65  ? 17  LEU D CG  1 
ATOM   8049  C  CD1 . LEU D 1 17  ? -8.428  -20.084 5.668   1.00 19.67  ? 17  LEU D CD1 1 
ATOM   8050  C  CD2 . LEU D 1 17  ? -8.898  -21.095 3.434   1.00 21.76  ? 17  LEU D CD2 1 
ATOM   8051  N  N   . LYS D 1 18  ? -13.886 -21.747 5.243   1.00 25.78  ? 18  LYS D N   1 
ATOM   8052  C  CA  . LYS D 1 18  ? -15.054 -22.496 5.696   1.00 30.50  ? 18  LYS D CA  1 
ATOM   8053  C  C   . LYS D 1 18  ? -15.683 -23.342 4.580   1.00 31.10  ? 18  LYS D C   1 
ATOM   8054  O  O   . LYS D 1 18  ? -15.984 -24.491 4.815   1.00 32.74  ? 18  LYS D O   1 
ATOM   8055  C  CB  . LYS D 1 18  ? -16.060 -21.516 6.299   1.00 32.83  ? 18  LYS D CB  1 
ATOM   8056  C  CG  . LYS D 1 18  ? -17.341 -22.080 6.871   1.00 34.99  ? 18  LYS D CG  1 
ATOM   8057  C  CD  . LYS D 1 18  ? -18.390 -20.969 6.775   1.00 40.32  ? 18  LYS D CD  1 
ATOM   8058  C  CE  . LYS D 1 18  ? -18.981 -20.601 8.131   1.00 45.09  ? 18  LYS D CE  1 
ATOM   8059  N  NZ  . LYS D 1 18  ? -19.772 -21.733 8.706   1.00 45.80  ? 18  LYS D NZ  1 
ATOM   8060  N  N   . LYS D 1 19  ? -15.850 -22.797 3.373   1.00 34.90  ? 19  LYS D N   1 
ATOM   8061  C  CA  . LYS D 1 19  ? -16.337 -23.592 2.220   1.00 34.45  ? 19  LYS D CA  1 
ATOM   8062  C  C   . LYS D 1 19  ? -15.381 -24.733 1.977   1.00 32.09  ? 19  LYS D C   1 
ATOM   8063  O  O   . LYS D 1 19  ? -15.795 -25.874 1.796   1.00 31.22  ? 19  LYS D O   1 
ATOM   8064  C  CB  . LYS D 1 19  ? -16.414 -22.760 0.925   1.00 40.54  ? 19  LYS D CB  1 
ATOM   8065  C  CG  . LYS D 1 19  ? -17.723 -22.015 0.654   1.00 48.83  ? 19  LYS D CG  1 
ATOM   8066  C  CD  . LYS D 1 19  ? -17.975 -21.843 -0.858  1.00 49.09  ? 19  LYS D CD  1 
ATOM   8067  C  CE  . LYS D 1 19  ? -19.446 -22.052 -1.246  1.00 51.61  ? 19  LYS D CE  1 
ATOM   8068  N  NZ  . LYS D 1 19  ? -20.359 -20.883 -1.009  1.00 49.79  ? 19  LYS D NZ  1 
ATOM   8069  N  N   . ARG D 1 20  ? -14.091 -24.408 1.981   1.00 32.21  ? 20  ARG D N   1 
ATOM   8070  C  CA  . ARG D 1 20  ? -13.021 -25.335 1.609   1.00 29.14  ? 20  ARG D CA  1 
ATOM   8071  C  C   . ARG D 1 20  ? -12.851 -26.475 2.637   1.00 28.05  ? 20  ARG D C   1 
ATOM   8072  O  O   . ARG D 1 20  ? -12.744 -27.649 2.282   1.00 27.39  ? 20  ARG D O   1 
ATOM   8073  C  CB  . ARG D 1 20  ? -11.684 -24.570 1.425   1.00 29.99  ? 20  ARG D CB  1 
ATOM   8074  C  CG  . ARG D 1 20  ? -10.598 -25.415 0.774   1.00 30.95  ? 20  ARG D CG  1 
ATOM   8075  C  CD  . ARG D 1 20  ? -9.183  -24.954 1.033   1.00 31.05  ? 20  ARG D CD  1 
ATOM   8076  N  NE  . ARG D 1 20  ? -8.722  -24.147 -0.082  1.00 38.02  ? 20  ARG D NE  1 
ATOM   8077  C  CZ  . ARG D 1 20  ? -7.654  -24.377 -0.838  1.00 35.86  ? 20  ARG D CZ  1 
ATOM   8078  N  NH1 . ARG D 1 20  ? -6.849  -25.390 -0.609  1.00 36.55  ? 20  ARG D NH1 1 
ATOM   8079  N  NH2 . ARG D 1 20  ? -7.396  -23.553 -1.833  1.00 40.06  ? 20  ARG D NH2 1 
ATOM   8080  N  N   . PHE D 1 21  ? -12.866 -26.146 3.916   1.00 25.25  ? 21  PHE D N   1 
ATOM   8081  C  CA  . PHE D 1 21  ? -12.377 -27.121 4.883   1.00 26.06  ? 21  PHE D CA  1 
ATOM   8082  C  C   . PHE D 1 21  ? -13.490 -27.862 5.597   1.00 26.37  ? 21  PHE D C   1 
ATOM   8083  O  O   . PHE D 1 21  ? -13.256 -28.927 6.193   1.00 25.36  ? 21  PHE D O   1 
ATOM   8084  C  CB  . PHE D 1 21  ? -11.412 -26.442 5.871   1.00 23.69  ? 21  PHE D CB  1 
ATOM   8085  C  CG  . PHE D 1 21  ? -10.073 -26.066 5.256   1.00 22.65  ? 21  PHE D CG  1 
ATOM   8086  C  CD1 . PHE D 1 21  ? -9.452  -24.874 5.582   1.00 21.32  ? 21  PHE D CD1 1 
ATOM   8087  C  CD2 . PHE D 1 21  ? -9.432  -26.917 4.347   1.00 22.26  ? 21  PHE D CD2 1 
ATOM   8088  C  CE1 . PHE D 1 21  ? -8.220  -24.539 5.000   1.00 21.91  ? 21  PHE D CE1 1 
ATOM   8089  C  CE2 . PHE D 1 21  ? -8.187  -26.602 3.792   1.00 20.95  ? 21  PHE D CE2 1 
ATOM   8090  C  CZ  . PHE D 1 21  ? -7.572  -25.409 4.122   1.00 20.00  ? 21  PHE D CZ  1 
ATOM   8091  N  N   . GLY D 1 22  ? -14.694 -27.292 5.544   1.00 26.46  ? 22  GLY D N   1 
ATOM   8092  C  CA  . GLY D 1 22  ? -15.857 -27.921 6.173   1.00 28.69  ? 22  GLY D CA  1 
ATOM   8093  C  C   . GLY D 1 22  ? -16.419 -27.336 7.461   1.00 29.07  ? 22  GLY D C   1 
ATOM   8094  O  O   . GLY D 1 22  ? -17.523 -27.672 7.860   1.00 30.32  ? 22  GLY D O   1 
ATOM   8095  N  N   . TYR D 1 23  ? -15.675 -26.450 8.112   1.00 32.21  ? 23  TYR D N   1 
ATOM   8096  C  CA  . TYR D 1 23  ? -16.052 -25.919 9.435   1.00 29.82  ? 23  TYR D CA  1 
ATOM   8097  C  C   . TYR D 1 23  ? -15.457 -24.511 9.562   1.00 27.82  ? 23  TYR D C   1 
ATOM   8098  O  O   . TYR D 1 23  ? -14.606 -24.118 8.761   1.00 32.66  ? 23  TYR D O   1 
ATOM   8099  C  CB  . TYR D 1 23  ? -15.582 -26.886 10.536  1.00 29.84  ? 23  TYR D CB  1 
ATOM   8100  C  CG  . TYR D 1 23  ? -14.126 -27.264 10.385  1.00 31.06  ? 23  TYR D CG  1 
ATOM   8101  C  CD1 . TYR D 1 23  ? -13.128 -26.528 11.047  1.00 30.51  ? 23  TYR D CD1 1 
ATOM   8102  C  CD2 . TYR D 1 23  ? -13.735 -28.326 9.555   1.00 28.76  ? 23  TYR D CD2 1 
ATOM   8103  C  CE1 . TYR D 1 23  ? -11.792 -26.842 10.901  1.00 28.46  ? 23  TYR D CE1 1 
ATOM   8104  C  CE2 . TYR D 1 23  ? -12.400 -28.647 9.401   1.00 28.72  ? 23  TYR D CE2 1 
ATOM   8105  C  CZ  . TYR D 1 23  ? -11.437 -27.897 10.086  1.00 30.01  ? 23  TYR D CZ  1 
ATOM   8106  O  OH  . TYR D 1 23  ? -10.108 -28.174 9.949   1.00 30.42  ? 23  TYR D OH  1 
ATOM   8107  N  N   . GLY D 1 24  ? -15.931 -23.739 10.518  1.00 25.03  ? 24  GLY D N   1 
ATOM   8108  C  CA  . GLY D 1 24  ? -15.650 -22.311 10.574  1.00 25.63  ? 24  GLY D CA  1 
ATOM   8109  C  C   . GLY D 1 24  ? -14.486 -21.929 11.475  1.00 25.27  ? 24  GLY D C   1 
ATOM   8110  O  O   . GLY D 1 24  ? -13.685 -22.775 11.840  1.00 24.85  ? 24  GLY D O   1 
ATOM   8111  N  N   . GLY D 1 25  ? -14.392 -20.651 11.833  1.00 24.69  ? 25  GLY D N   1 
ATOM   8112  C  CA  . GLY D 1 25  ? -13.300 -20.173 12.693  1.00 24.39  ? 25  GLY D CA  1 
ATOM   8113  C  C   . GLY D 1 25  ? -12.086 -19.540 12.007  1.00 24.69  ? 25  GLY D C   1 
ATOM   8114  O  O   . GLY D 1 25  ? -11.164 -19.074 12.681  1.00 29.29  ? 25  GLY D O   1 
ATOM   8115  N  N   . TRP D 1 26  ? -12.061 -19.505 10.682  1.00 22.53  ? 26  TRP D N   1 
ATOM   8116  C  CA  . TRP D 1 26  ? -10.883 -19.046 9.985   1.00 21.69  ? 26  TRP D CA  1 
ATOM   8117  C  C   . TRP D 1 26  ? -10.925 -17.557 9.764   1.00 22.33  ? 26  TRP D C   1 
ATOM   8118  O  O   . TRP D 1 26  ? -11.959 -16.925 9.909   1.00 25.62  ? 26  TRP D O   1 
ATOM   8119  C  CB  . TRP D 1 26  ? -10.729 -19.777 8.648   1.00 21.17  ? 26  TRP D CB  1 
ATOM   8120  C  CG  . TRP D 1 26  ? -10.672 -21.290 8.758   1.00 19.61  ? 26  TRP D CG  1 
ATOM   8121  C  CD1 . TRP D 1 26  ? -11.741 -22.181 8.771   1.00 20.40  ? 26  TRP D CD1 1 
ATOM   8122  C  CD2 . TRP D 1 26  ? -9.488  -22.137 8.831   1.00 18.47  ? 26  TRP D CD2 1 
ATOM   8123  N  NE1 . TRP D 1 26  ? -11.311 -23.491 8.861   1.00 18.41  ? 26  TRP D NE1 1 
ATOM   8124  C  CE2 . TRP D 1 26  ? -9.981  -23.533 8.933   1.00 18.36  ? 26  TRP D CE2 1 
ATOM   8125  C  CE3 . TRP D 1 26  ? -8.118  -21.903 8.868   1.00 18.26  ? 26  TRP D CE3 1 
ATOM   8126  C  CZ2 . TRP D 1 26  ? -9.118  -24.605 9.033   1.00 17.62  ? 26  TRP D CZ2 1 
ATOM   8127  C  CZ3 . TRP D 1 26  ? -7.256  -23.003 8.976   1.00 16.72  ? 26  TRP D CZ3 1 
ATOM   8128  C  CH2 . TRP D 1 26  ? -7.740  -24.309 9.057   1.00 17.49  ? 26  TRP D CH2 1 
ATOM   8129  N  N   . VAL D 1 27  ? -9.803  -16.985 9.353   1.00 21.72  ? 27  VAL D N   1 
ATOM   8130  C  CA  . VAL D 1 27  ? -9.766  -15.586 8.989   1.00 21.31  ? 27  VAL D CA  1 
ATOM   8131  C  C   . VAL D 1 27  ? -9.844  -15.327 7.490   1.00 21.42  ? 27  VAL D C   1 
ATOM   8132  O  O   . VAL D 1 27  ? -9.428  -16.144 6.685   1.00 24.88  ? 27  VAL D O   1 
ATOM   8133  C  CB  . VAL D 1 27  ? -8.577  -14.861 9.690   1.00 22.34  ? 27  VAL D CB  1 
ATOM   8134  C  CG1 . VAL D 1 27  ? -7.858  -15.782 10.685  1.00 18.74  ? 27  VAL D CG1 1 
ATOM   8135  C  CG2 . VAL D 1 27  ? -7.651  -14.230 8.686   1.00 21.16  ? 27  VAL D CG2 1 
ATOM   8136  N  N   . GLN D 1 28  ? -10.417 -14.202 7.108   1.00 21.57  ? 28  GLN D N   1 
ATOM   8137  C  CA  . GLN D 1 28  ? -10.524 -13.870 5.717   1.00 22.27  ? 28  GLN D CA  1 
ATOM   8138  C  C   . GLN D 1 28  ? -10.210 -12.421 5.561   1.00 24.03  ? 28  GLN D C   1 
ATOM   8139  O  O   . GLN D 1 28  ? -10.531 -11.630 6.441   1.00 23.66  ? 28  GLN D O   1 
ATOM   8140  C  CB  . GLN D 1 28  ? -11.946 -14.114 5.193   1.00 21.39  ? 28  GLN D CB  1 
ATOM   8141  C  CG  . GLN D 1 28  ? -12.447 -15.524 5.408   1.00 20.51  ? 28  GLN D CG  1 
ATOM   8142  C  CD  . GLN D 1 28  ? -11.916 -16.570 4.425   1.00 19.01  ? 28  GLN D CD  1 
ATOM   8143  O  OE1 . GLN D 1 28  ? -12.287 -17.740 4.527   1.00 19.08  ? 28  GLN D OE1 1 
ATOM   8144  N  NE2 . GLN D 1 28  ? -11.064 -16.166 3.481   1.00 18.79  ? 28  GLN D NE2 1 
ATOM   8145  N  N   . LEU D 1 29  ? -9.607  -12.079 4.422   1.00 26.08  ? 29  LEU D N   1 
ATOM   8146  C  CA  . LEU D 1 29  ? -9.315  -10.704 4.075   1.00 26.26  ? 29  LEU D CA  1 
ATOM   8147  C  C   . LEU D 1 29  ? -10.413 -10.120 3.185   1.00 27.77  ? 29  LEU D C   1 
ATOM   8148  O  O   . LEU D 1 29  ? -10.819 -10.731 2.197   1.00 27.83  ? 29  LEU D O   1 
ATOM   8149  C  CB  . LEU D 1 29  ? -7.958  -10.615 3.383   1.00 24.18  ? 29  LEU D CB  1 
ATOM   8150  C  CG  . LEU D 1 29  ? -7.318  -9.217  3.386   1.00 24.30  ? 29  LEU D CG  1 
ATOM   8151  C  CD1 . LEU D 1 29  ? -7.149  -8.663  4.788   1.00 22.63  ? 29  LEU D CD1 1 
ATOM   8152  C  CD2 . LEU D 1 29  ? -5.966  -9.193  2.703   1.00 24.94  ? 29  LEU D CD2 1 
ATOM   8153  N  N   . GLN D 1 30  ? -10.874 -8.922  3.545   1.00 31.06  ? 30  GLN D N   1 
ATOM   8154  C  CA  . GLN D 1 30  ? -11.886 -8.171  2.784   1.00 32.54  ? 30  GLN D CA  1 
ATOM   8155  C  C   . GLN D 1 30  ? -11.354 -6.829  2.364   1.00 31.07  ? 30  GLN D C   1 
ATOM   8156  O  O   . GLN D 1 30  ? -10.886 -6.058  3.200   1.00 31.22  ? 30  GLN D O   1 
ATOM   8157  C  CB  . GLN D 1 30  ? -13.120 -7.932  3.635   1.00 35.44  ? 30  GLN D CB  1 
ATOM   8158  C  CG  . GLN D 1 30  ? -14.100 -9.083  3.635   1.00 41.74  ? 30  GLN D CG  1 
ATOM   8159  C  CD  . GLN D 1 30  ? -15.408 -8.696  2.969   1.00 50.61  ? 30  GLN D CD  1 
ATOM   8160  O  OE1 . GLN D 1 30  ? -16.179 -7.885  3.518   1.00 48.68  ? 30  GLN D OE1 1 
ATOM   8161  N  NE2 . GLN D 1 30  ? -15.664 -9.258  1.767   1.00 53.00  ? 30  GLN D NE2 1 
ATOM   8162  N  N   . HIS D 1 31  ? -11.452 -6.551  1.072   1.00 30.80  ? 31  HIS D N   1 
ATOM   8163  C  CA  . HIS D 1 31  ? -11.115 -5.238  0.506   1.00 30.81  ? 31  HIS D CA  1 
ATOM   8164  C  C   . HIS D 1 31  ? -12.367 -4.483  0.359   1.00 31.59  ? 31  HIS D C   1 
ATOM   8165  O  O   . HIS D 1 31  ? -13.206 -4.833  -0.437  1.00 36.26  ? 31  HIS D O   1 
ATOM   8166  C  CB  . HIS D 1 31  ? -10.423 -5.409  -0.833  1.00 27.51  ? 31  HIS D CB  1 
ATOM   8167  C  CG  . HIS D 1 31  ? -9.129  -6.156  -0.715  1.00 27.34  ? 31  HIS D CG  1 
ATOM   8168  N  ND1 . HIS D 1 31  ? -7.950  -5.534  -0.453  1.00 24.53  ? 31  HIS D ND1 1 
ATOM   8169  C  CD2 . HIS D 1 31  ? -8.867  -7.521  -0.725  1.00 26.08  ? 31  HIS D CD2 1 
ATOM   8170  C  CE1 . HIS D 1 31  ? -6.988  -6.450  -0.356  1.00 26.16  ? 31  HIS D CE1 1 
ATOM   8171  N  NE2 . HIS D 1 31  ? -7.546  -7.671  -0.526  1.00 28.50  ? 31  HIS D NE2 1 
ATOM   8172  N  N   . HIS D 1 32  ? -12.524 -3.459  1.160   1.00 34.59  ? 32  HIS D N   1 
ATOM   8173  C  CA  . HIS D 1 32  ? -13.791 -2.740  1.214   1.00 40.67  ? 32  HIS D CA  1 
ATOM   8174  C  C   . HIS D 1 32  ? -13.613 -1.348  0.652   1.00 42.42  ? 32  HIS D C   1 
ATOM   8175  O  O   . HIS D 1 32  ? -14.585 -0.722  0.223   1.00 40.79  ? 32  HIS D O   1 
ATOM   8176  C  CB  . HIS D 1 32  ? -14.264 -2.657  2.659   1.00 36.80  ? 32  HIS D CB  1 
ATOM   8177  C  CG  . HIS D 1 32  ? -13.265 -1.978  3.571   1.00 34.53  ? 32  HIS D CG  1 
ATOM   8178  N  ND1 . HIS D 1 32  ? -12.133 -2.582  3.977   1.00 32.44  ? 32  HIS D ND1 1 
ATOM   8179  C  CD2 . HIS D 1 32  ? -13.243 -0.692  4.126   1.00 33.56  ? 32  HIS D CD2 1 
ATOM   8180  C  CE1 . HIS D 1 32  ? -11.433 -1.746  4.773   1.00 30.22  ? 32  HIS D CE1 1 
ATOM   8181  N  NE2 . HIS D 1 32  ? -12.112 -0.593  4.867   1.00 30.91  ? 32  HIS D NE2 1 
ATOM   8182  N  N   . SER D 1 33  ? -12.359 -0.880  0.647   1.00 41.52  ? 33  SER D N   1 
ATOM   8183  C  CA  . SER D 1 33  ? -12.004 0.484   0.270   1.00 42.83  ? 33  SER D CA  1 
ATOM   8184  C  C   . SER D 1 33  ? -10.646 0.459   -0.424  1.00 42.41  ? 33  SER D C   1 
ATOM   8185  O  O   . SER D 1 33  ? -9.982  -0.572  -0.432  1.00 40.27  ? 33  SER D O   1 
ATOM   8186  C  CB  . SER D 1 33  ? -11.930 1.357   1.524   1.00 47.19  ? 33  SER D CB  1 
ATOM   8187  O  OG  . SER D 1 33  ? -12.536 2.624   1.303   1.00 52.30  ? 33  SER D OG  1 
ATOM   8188  N  N   . LYS D 1 34  ? -10.225 1.582   -1.001  1.00 45.39  ? 34  LYS D N   1 
ATOM   8189  C  CA  . LYS D 1 34  ? -8.957  1.621   -1.750  1.00 45.74  ? 34  LYS D CA  1 
ATOM   8190  C  C   . LYS D 1 34  ? -7.709  1.688   -0.876  1.00 42.93  ? 34  LYS D C   1 
ATOM   8191  O  O   . LYS D 1 34  ? -7.487  2.650   -0.130  1.00 39.86  ? 34  LYS D O   1 
ATOM   8192  C  CB  . LYS D 1 34  ? -8.942  2.711   -2.838  1.00 50.42  ? 34  LYS D CB  1 
ATOM   8193  C  CG  . LYS D 1 34  ? -9.594  2.274   -4.155  1.00 56.78  ? 34  LYS D CG  1 
ATOM   8194  C  CD  . LYS D 1 34  ? -8.942  1.022   -4.746  1.00 60.73  ? 34  LYS D CD  1 
ATOM   8195  C  CE  . LYS D 1 34  ? -9.933  0.164   -5.545  1.00 60.80  ? 34  LYS D CE  1 
ATOM   8196  N  NZ  . LYS D 1 34  ? -9.356  -1.119  -6.064  1.00 52.03  ? 34  LYS D NZ  1 
ATOM   8197  N  N   . GLY D 1 35  ? -6.899  0.640   -1.003  1.00 43.31  ? 35  GLY D N   1 
ATOM   8198  C  CA  . GLY D 1 35  ? -5.676  0.457   -0.222  1.00 44.68  ? 35  GLY D CA  1 
ATOM   8199  C  C   . GLY D 1 35  ? -5.923  0.044   1.216   1.00 41.59  ? 35  GLY D C   1 
ATOM   8200  O  O   . GLY D 1 35  ? -5.022  0.108   2.042   1.00 44.04  ? 35  GLY D O   1 
ATOM   8201  N  N   . GLU D 1 36  ? -7.144  -0.381  1.505   1.00 36.77  ? 36  GLU D N   1 
ATOM   8202  C  CA  . GLU D 1 36  ? -7.567  -0.675  2.862   1.00 36.54  ? 36  GLU D CA  1 
ATOM   8203  C  C   . GLU D 1 36  ? -8.292  -2.022  2.868   1.00 32.00  ? 36  GLU D C   1 
ATOM   8204  O  O   . GLU D 1 36  ? -8.983  -2.378  1.893   1.00 28.07  ? 36  GLU D O   1 
ATOM   8205  C  CB  . GLU D 1 36  ? -8.473  0.442   3.408   1.00 40.54  ? 36  GLU D CB  1 
ATOM   8206  C  CG  . GLU D 1 36  ? -7.755  1.771   3.690   1.00 46.16  ? 36  GLU D CG  1 
ATOM   8207  C  CD  . GLU D 1 36  ? -8.604  2.789   4.475   1.00 55.00  ? 36  GLU D CD  1 
ATOM   8208  O  OE1 . GLU D 1 36  ? -8.929  3.862   3.899   1.00 58.04  ? 36  GLU D OE1 1 
ATOM   8209  O  OE2 . GLU D 1 36  ? -8.952  2.534   5.665   1.00 54.09  ? 36  GLU D OE2 1 
ATOM   8210  N  N   . ALA D 1 37  ? -8.090  -2.791  3.936   1.00 27.05  ? 37  ALA D N   1 
ATOM   8211  C  CA  . ALA D 1 37  ? -8.789  -4.070  4.071   1.00 26.69  ? 37  ALA D CA  1 
ATOM   8212  C  C   . ALA D 1 37  ? -9.135  -4.384  5.519   1.00 25.26  ? 37  ALA D C   1 
ATOM   8213  O  O   . ALA D 1 37  ? -8.694  -3.694  6.422   1.00 24.81  ? 37  ALA D O   1 
ATOM   8214  C  CB  . ALA D 1 37  ? -7.985  -5.214  3.430   1.00 26.14  ? 37  ALA D CB  1 
ATOM   8215  N  N   . LYS D 1 38  ? -9.916  -5.440  5.716   1.00 24.93  ? 38  LYS D N   1 
ATOM   8216  C  CA  . LYS D 1 38  ? -10.373 -5.862  7.015   1.00 23.86  ? 38  LYS D CA  1 
ATOM   8217  C  C   . LYS D 1 38  ? -10.140 -7.339  7.129   1.00 23.49  ? 38  LYS D C   1 
ATOM   8218  O  O   . LYS D 1 38  ? -10.570 -8.063  6.252   1.00 24.43  ? 38  LYS D O   1 
ATOM   8219  C  CB  . LYS D 1 38  ? -11.888 -5.668  7.124   1.00 26.18  ? 38  LYS D CB  1 
ATOM   8220  C  CG  . LYS D 1 38  ? -12.366 -4.259  7.395   1.00 29.73  ? 38  LYS D CG  1 
ATOM   8221  C  CD  . LYS D 1 38  ? -13.885 -4.223  7.459   1.00 34.34  ? 38  LYS D CD  1 
ATOM   8222  C  CE  . LYS D 1 38  ? -14.355 -2.790  7.712   1.00 38.71  ? 38  LYS D CE  1 
ATOM   8223  N  NZ  . LYS D 1 38  ? -15.842 -2.677  7.795   1.00 39.48  ? 38  LYS D NZ  1 
ATOM   8224  N  N   . LEU D 1 39  ? -9.534  -7.790  8.226   1.00 23.23  ? 39  LEU D N   1 
ATOM   8225  C  CA  . LEU D 1 39  ? -9.457  -9.214  8.565   1.00 24.21  ? 39  LEU D CA  1 
ATOM   8226  C  C   . LEU D 1 39  ? -10.642 -9.639  9.403   1.00 24.53  ? 39  LEU D C   1 
ATOM   8227  O  O   . LEU D 1 39  ? -10.898 -9.053  10.429  1.00 25.05  ? 39  LEU D O   1 
ATOM   8228  C  CB  . LEU D 1 39  ? -8.208  -9.459  9.404   1.00 24.79  ? 39  LEU D CB  1 
ATOM   8229  C  CG  . LEU D 1 39  ? -6.877  -9.445  8.693   1.00 25.61  ? 39  LEU D CG  1 
ATOM   8230  C  CD1 . LEU D 1 39  ? -5.748  -9.653  9.690   1.00 26.39  ? 39  LEU D CD1 1 
ATOM   8231  C  CD2 . LEU D 1 39  ? -6.932  -10.587 7.692   1.00 25.44  ? 39  LEU D CD2 1 
ATOM   8232  N  N   . LEU D 1 40  ? -11.335 -10.688 8.999   1.00 27.81  ? 40  LEU D N   1 
ATOM   8233  C  CA  . LEU D 1 40  ? -12.550 -11.133 9.690   1.00 31.87  ? 40  LEU D CA  1 
ATOM   8234  C  C   . LEU D 1 40  ? -12.386 -12.516 10.283  1.00 32.13  ? 40  LEU D C   1 
ATOM   8235  O  O   . LEU D 1 40  ? -12.025 -13.422 9.567   1.00 32.11  ? 40  LEU D O   1 
ATOM   8236  C  CB  . LEU D 1 40  ? -13.747 -11.177 8.707   1.00 31.58  ? 40  LEU D CB  1 
ATOM   8237  C  CG  . LEU D 1 40  ? -14.014 -9.972  7.804   1.00 31.74  ? 40  LEU D CG  1 
ATOM   8238  C  CD1 . LEU D 1 40  ? -15.238 -10.211 6.918   1.00 34.62  ? 40  LEU D CD1 1 
ATOM   8239  C  CD2 . LEU D 1 40  ? -14.180 -8.708  8.628   1.00 31.56  ? 40  LEU D CD2 1 
ATOM   8240  N  N   . LYS D 1 41  ? -12.671 -12.718 11.564  1.00 37.36  ? 41  LYS D N   1 
ATOM   8241  C  CA  . LYS D 1 41  ? -12.747 -14.123 12.019  1.00 44.66  ? 41  LYS D CA  1 
ATOM   8242  C  C   . LYS D 1 41  ? -14.114 -14.557 12.509  1.00 47.53  ? 41  LYS D C   1 
ATOM   8243  O  O   . LYS D 1 41  ? -14.483 -14.262 13.647  1.00 49.67  ? 41  LYS D O   1 
ATOM   8244  C  CB  . LYS D 1 41  ? -11.616 -14.543 12.960  1.00 45.76  ? 41  LYS D CB  1 
ATOM   8245  C  CG  . LYS D 1 41  ? -11.404 -13.730 14.218  1.00 51.99  ? 41  LYS D CG  1 
ATOM   8246  C  CD  . LYS D 1 41  ? -10.111 -14.159 14.927  1.00 51.84  ? 41  LYS D CD  1 
ATOM   8247  C  CE  . LYS D 1 41  ? -10.044 -15.665 15.159  1.00 47.10  ? 41  LYS D CE  1 
ATOM   8248  N  NZ  . LYS D 1 41  ? -8.757  -16.040 15.783  1.00 45.28  ? 41  LYS D NZ  1 
ATOM   8249  N  N   . ASP D 1 42  ? -14.827 -15.270 11.620  1.00 49.42  ? 42  ASP D N   1 
ATOM   8250  C  CA  . ASP D 1 42  ? -16.292 -15.469 11.652  1.00 52.51  ? 42  ASP D CA  1 
ATOM   8251  C  C   . ASP D 1 42  ? -17.029 -14.253 12.235  1.00 61.33  ? 42  ASP D C   1 
ATOM   8252  O  O   . ASP D 1 42  ? -16.959 -13.940 13.454  1.00 58.91  ? 42  ASP D O   1 
ATOM   8253  C  CB  . ASP D 1 42  ? -16.731 -16.791 12.347  1.00 45.73  ? 42  ASP D CB  1 
ATOM   8254  C  CG  . ASP D 1 42  ? -16.874 -17.974 11.374  1.00 38.28  ? 42  ASP D CG  1 
ATOM   8255  O  OD1 . ASP D 1 42  ? -16.354 -19.060 11.655  1.00 36.94  ? 42  ASP D OD1 1 
ATOM   8256  O  OD2 . ASP D 1 42  ? -17.488 -17.828 10.321  1.00 36.37  ? 42  ASP D OD2 1 
ATOM   8257  N  N   . GLY D 1 43  ? -17.723 -13.560 11.341  1.00 63.44  ? 43  GLY D N   1 
ATOM   8258  C  CA  . GLY D 1 43  ? -18.515 -12.411 11.728  1.00 62.08  ? 43  GLY D CA  1 
ATOM   8259  C  C   . GLY D 1 43  ? -17.683 -11.155 11.856  1.00 60.98  ? 43  GLY D C   1 
ATOM   8260  O  O   . GLY D 1 43  ? -17.622 -10.345 10.912  1.00 63.81  ? 43  GLY D O   1 
ATOM   8261  N  N   . LYS D 1 44  ? -17.019 -11.017 13.004  1.00 52.58  ? 44  LYS D N   1 
ATOM   8262  C  CA  . LYS D 1 44  ? -16.463 -9.724  13.436  1.00 51.63  ? 44  LYS D CA  1 
ATOM   8263  C  C   . LYS D 1 44  ? -15.094 -9.304  12.871  1.00 45.45  ? 44  LYS D C   1 
ATOM   8264  O  O   . LYS D 1 44  ? -14.355 -10.115 12.325  1.00 42.93  ? 44  LYS D O   1 
ATOM   8265  C  CB  . LYS D 1 44  ? -16.504 -9.630  14.961  1.00 51.49  ? 44  LYS D CB  1 
ATOM   8266  C  CG  . LYS D 1 44  ? -17.931 -9.474  15.458  1.00 55.98  ? 44  LYS D CG  1 
ATOM   8267  C  CD  . LYS D 1 44  ? -18.307 -10.581 16.425  1.00 58.71  ? 44  LYS D CD  1 
ATOM   8268  C  CE  . LYS D 1 44  ? -19.782 -10.960 16.299  1.00 60.74  ? 44  LYS D CE  1 
ATOM   8269  N  NZ  . LYS D 1 44  ? -20.101 -12.194 17.082  1.00 56.53  ? 44  LYS D NZ  1 
ATOM   8270  N  N   . VAL D 1 45  ? -14.789 -8.019  13.008  1.00 41.24  ? 45  VAL D N   1 
ATOM   8271  C  CA  . VAL D 1 45  ? -13.589 -7.442  12.463  1.00 39.13  ? 45  VAL D CA  1 
ATOM   8272  C  C   . VAL D 1 45  ? -12.462 -7.583  13.460  1.00 37.80  ? 45  VAL D C   1 
ATOM   8273  O  O   . VAL D 1 45  ? -12.453 -6.928  14.477  1.00 40.74  ? 45  VAL D O   1 
ATOM   8274  C  CB  . VAL D 1 45  ? -13.764 -5.940  12.090  1.00 38.36  ? 45  VAL D CB  1 
ATOM   8275  C  CG1 . VAL D 1 45  ? -12.429 -5.346  11.638  1.00 33.57  ? 45  VAL D CG1 1 
ATOM   8276  C  CG2 . VAL D 1 45  ? -14.840 -5.758  11.016  1.00 36.09  ? 45  VAL D CG2 1 
ATOM   8277  N  N   . PHE D 1 46  ? -11.501 -8.434  13.137  1.00 39.80  ? 46  PHE D N   1 
ATOM   8278  C  CA  . PHE D 1 46  ? -10.311 -8.630  13.951  1.00 40.61  ? 46  PHE D CA  1 
ATOM   8279  C  C   . PHE D 1 46  ? -9.328  -7.470  13.790  1.00 37.00  ? 46  PHE D C   1 
ATOM   8280  O  O   . PHE D 1 46  ? -8.761  -6.989  14.763  1.00 34.75  ? 46  PHE D O   1 
ATOM   8281  C  CB  . PHE D 1 46  ? -9.644  -9.978  13.592  1.00 44.00  ? 46  PHE D CB  1 
ATOM   8282  C  CG  . PHE D 1 46  ? -8.345  -10.225 14.300  1.00 45.67  ? 46  PHE D CG  1 
ATOM   8283  C  CD1 . PHE D 1 46  ? -8.311  -10.434 15.686  1.00 52.21  ? 46  PHE D CD1 1 
ATOM   8284  C  CD2 . PHE D 1 46  ? -7.146  -10.257 13.594  1.00 48.21  ? 46  PHE D CD2 1 
ATOM   8285  C  CE1 . PHE D 1 46  ? -7.098  -10.662 16.349  1.00 52.40  ? 46  PHE D CE1 1 
ATOM   8286  C  CE2 . PHE D 1 46  ? -5.927  -10.470 14.252  1.00 50.94  ? 46  PHE D CE2 1 
ATOM   8287  C  CZ  . PHE D 1 46  ? -5.905  -10.681 15.630  1.00 51.35  ? 46  PHE D CZ  1 
ATOM   8288  N  N   . ARG D 1 47  ? -9.108  -7.016  12.563  1.00 34.57  ? 47  ARG D N   1 
ATOM   8289  C  CA  . ARG D 1 47  ? -8.094  -5.985  12.361  1.00 30.94  ? 47  ARG D CA  1 
ATOM   8290  C  C   . ARG D 1 47  ? -8.270  -5.244  11.041  1.00 26.83  ? 47  ARG D C   1 
ATOM   8291  O  O   . ARG D 1 47  ? -8.711  -5.834  10.059  1.00 24.45  ? 47  ARG D O   1 
ATOM   8292  C  CB  . ARG D 1 47  ? -6.694  -6.597  12.480  1.00 32.56  ? 47  ARG D CB  1 
ATOM   8293  C  CG  . ARG D 1 47  ? -5.583  -5.565  12.614  1.00 39.30  ? 47  ARG D CG  1 
ATOM   8294  C  CD  . ARG D 1 47  ? -4.175  -6.172  12.564  1.00 44.58  ? 47  ARG D CD  1 
ATOM   8295  N  NE  . ARG D 1 47  ? -3.408  -5.965  13.796  1.00 46.37  ? 47  ARG D NE  1 
ATOM   8296  C  CZ  . ARG D 1 47  ? -2.756  -6.920  14.454  1.00 50.43  ? 47  ARG D CZ  1 
ATOM   8297  N  NH1 . ARG D 1 47  ? -2.749  -8.178  14.004  1.00 53.08  ? 47  ARG D NH1 1 
ATOM   8298  N  NH2 . ARG D 1 47  ? -2.096  -6.611  15.568  1.00 54.17  ? 47  ARG D NH2 1 
ATOM   8299  N  N   . VAL D 1 48  ? -7.957  -3.946  11.039  1.00 26.46  ? 48  VAL D N   1 
ATOM   8300  C  CA  . VAL D 1 48  ? -7.983  -3.133  9.815   1.00 26.08  ? 48  VAL D CA  1 
ATOM   8301  C  C   . VAL D 1 48  ? -6.543  -2.874  9.361   1.00 26.43  ? 48  VAL D C   1 
ATOM   8302  O  O   . VAL D 1 48  ? -5.750  -2.327  10.105  1.00 27.57  ? 48  VAL D O   1 
ATOM   8303  C  CB  . VAL D 1 48  ? -8.776  -1.809  9.980   1.00 26.35  ? 48  VAL D CB  1 
ATOM   8304  C  CG1 . VAL D 1 48  ? -8.774  -0.990  8.681   1.00 26.46  ? 48  VAL D CG1 1 
ATOM   8305  C  CG2 . VAL D 1 48  ? -10.223 -2.078  10.407  1.00 25.19  ? 48  VAL D CG2 1 
ATOM   8306  N  N   . VAL D 1 49  ? -6.204  -3.304  8.151   1.00 25.62  ? 49  VAL D N   1 
ATOM   8307  C  CA  . VAL D 1 49  ? -4.848  -3.137  7.622   1.00 26.52  ? 49  VAL D CA  1 
ATOM   8308  C  C   . VAL D 1 49  ? -4.879  -2.317  6.331   1.00 28.30  ? 49  VAL D C   1 
ATOM   8309  O  O   . VAL D 1 49  ? -5.930  -2.110  5.742   1.00 26.55  ? 49  VAL D O   1 
ATOM   8310  C  CB  . VAL D 1 49  ? -4.104  -4.488  7.387   1.00 25.29  ? 49  VAL D CB  1 
ATOM   8311  C  CG1 . VAL D 1 49  ? -4.056  -5.300  8.667   1.00 24.13  ? 49  VAL D CG1 1 
ATOM   8312  C  CG2 . VAL D 1 49  ? -4.731  -5.316  6.257   1.00 25.35  ? 49  VAL D CG2 1 
ATOM   8313  N  N   . ARG D 1 50  ? -3.710  -1.818  5.938   1.00 31.92  ? 50  ARG D N   1 
ATOM   8314  C  CA  . ARG D 1 50  ? -3.541  -1.079  4.697   1.00 31.21  ? 50  ARG D CA  1 
ATOM   8315  C  C   . ARG D 1 50  ? -2.770  -1.937  3.682   1.00 29.68  ? 50  ARG D C   1 
ATOM   8316  O  O   . ARG D 1 50  ? -2.341  -3.059  3.994   1.00 28.60  ? 50  ARG D O   1 
ATOM   8317  C  CB  . ARG D 1 50  ? -2.848  0.243   4.983   1.00 33.17  ? 50  ARG D CB  1 
ATOM   8318  C  CG  . ARG D 1 50  ? -3.398  0.911   6.231   1.00 41.08  ? 50  ARG D CG  1 
ATOM   8319  C  CD  . ARG D 1 50  ? -3.138  2.408   6.255   1.00 49.49  ? 50  ARG D CD  1 
ATOM   8320  N  NE  . ARG D 1 50  ? -4.067  3.146   5.391   1.00 58.05  ? 50  ARG D NE  1 
ATOM   8321  C  CZ  . ARG D 1 50  ? -4.029  4.463   5.169   1.00 58.61  ? 50  ARG D CZ  1 
ATOM   8322  N  NH1 . ARG D 1 50  ? -3.099  5.228   5.743   1.00 54.75  ? 50  ARG D NH1 1 
ATOM   8323  N  NH2 . ARG D 1 50  ? -4.934  5.019   4.367   1.00 57.35  ? 50  ARG D NH2 1 
ATOM   8324  N  N   . GLU D 1 51  ? -2.615  -1.424  2.468   1.00 29.31  ? 51  GLU D N   1 
ATOM   8325  C  CA  . GLU D 1 51  ? -2.019  -2.186  1.365   1.00 27.43  ? 51  GLU D CA  1 
ATOM   8326  C  C   . GLU D 1 51  ? -0.577  -2.646  1.604   1.00 25.54  ? 51  GLU D C   1 
ATOM   8327  O  O   . GLU D 1 51  ? -0.124  -3.617  0.975   1.00 23.72  ? 51  GLU D O   1 
ATOM   8328  C  CB  . GLU D 1 51  ? -2.097  -1.389  0.068   1.00 29.96  ? 51  GLU D CB  1 
ATOM   8329  C  CG  . GLU D 1 51  ? -1.857  0.100   0.214   1.00 34.36  ? 51  GLU D CG  1 
ATOM   8330  C  CD  . GLU D 1 51  ? -1.833  0.844   -1.132  1.00 42.01  ? 51  GLU D CD  1 
ATOM   8331  O  OE1 . GLU D 1 51  ? -2.185  0.228   -2.189  1.00 39.16  ? 51  GLU D OE1 1 
ATOM   8332  O  OE2 . GLU D 1 51  ? -1.457  2.059   -1.131  1.00 43.17  ? 51  GLU D OE2 1 
ATOM   8333  N  N   . ASN D 1 52  ? 0.151   -1.951  2.490   1.00 23.83  ? 52  ASN D N   1 
ATOM   8334  C  CA  . ASN D 1 52  ? 1.493   -2.414  2.861   1.00 22.42  ? 52  ASN D CA  1 
ATOM   8335  C  C   . ASN D 1 52  ? 1.467   -3.802  3.532   1.00 21.64  ? 52  ASN D C   1 
ATOM   8336  O  O   . ASN D 1 52  ? 2.499   -4.465  3.649   1.00 20.46  ? 52  ASN D O   1 
ATOM   8337  C  CB  . ASN D 1 52  ? 2.257   -1.386  3.691   1.00 20.43  ? 52  ASN D CB  1 
ATOM   8338  C  CG  . ASN D 1 52  ? 1.605   -1.107  5.029   1.00 21.53  ? 52  ASN D CG  1 
ATOM   8339  O  OD1 . ASN D 1 52  ? 0.565   -1.679  5.366   1.00 20.82  ? 52  ASN D OD1 1 
ATOM   8340  N  ND2 . ASN D 1 52  ? 2.219   -0.212  5.811   1.00 20.91  ? 52  ASN D ND2 1 
ATOM   8341  N  N   . CYS D 1 53  ? 0.288   -4.248  3.956   1.00 21.63  ? 53  CYS D N   1 
ATOM   8342  C  CA  . CYS D 1 53  ? 0.184   -5.571  4.505   1.00 23.16  ? 53  CYS D CA  1 
ATOM   8343  C  C   . CYS D 1 53  ? 0.267   -6.652  3.428   1.00 23.83  ? 53  CYS D C   1 
ATOM   8344  O  O   . CYS D 1 53  ? 0.671   -7.758  3.737   1.00 25.14  ? 53  CYS D O   1 
ATOM   8345  C  CB  . CYS D 1 53  ? -1.071  -5.733  5.352   1.00 26.98  ? 53  CYS D CB  1 
ATOM   8346  S  SG  . CYS D 1 53  ? -1.025  -7.153  6.484   1.00 33.17  ? 53  CYS D SG  1 
ATOM   8347  N  N   . TRP D 1 54  ? -0.064  -6.351  2.171   1.00 23.38  ? 54  TRP D N   1 
ATOM   8348  C  CA  . TRP D 1 54  ? 0.046   -7.359  1.112   1.00 23.80  ? 54  TRP D CA  1 
ATOM   8349  C  C   . TRP D 1 54  ? 0.816   -7.056  -0.138  1.00 25.11  ? 54  TRP D C   1 
ATOM   8350  O  O   . TRP D 1 54  ? 1.143   -7.974  -0.861  1.00 24.97  ? 54  TRP D O   1 
ATOM   8351  C  CB  . TRP D 1 54  ? -1.324  -7.814  0.670   1.00 25.47  ? 54  TRP D CB  1 
ATOM   8352  C  CG  . TRP D 1 54  ? -2.394  -6.757  0.777   1.00 28.47  ? 54  TRP D CG  1 
ATOM   8353  C  CD1 . TRP D 1 54  ? -3.179  -6.441  1.902   1.00 27.94  ? 54  TRP D CD1 1 
ATOM   8354  C  CD2 . TRP D 1 54  ? -2.855  -5.870  -0.273  1.00 28.04  ? 54  TRP D CD2 1 
ATOM   8355  N  NE1 . TRP D 1 54  ? -4.054  -5.432  1.618   1.00 28.89  ? 54  TRP D NE1 1 
ATOM   8356  C  CE2 . TRP D 1 54  ? -3.927  -5.054  0.320   1.00 30.33  ? 54  TRP D CE2 1 
ATOM   8357  C  CE3 . TRP D 1 54  ? -2.517  -5.684  -1.594  1.00 32.35  ? 54  TRP D CE3 1 
ATOM   8358  C  CZ2 . TRP D 1 54  ? -4.594  -4.084  -0.401  1.00 30.87  ? 54  TRP D CZ2 1 
ATOM   8359  C  CZ3 . TRP D 1 54  ? -3.208  -4.712  -2.330  1.00 37.79  ? 54  TRP D CZ3 1 
ATOM   8360  C  CH2 . TRP D 1 54  ? -4.219  -3.925  -1.737  1.00 37.48  ? 54  TRP D CH2 1 
ATOM   8361  N  N   . ASP D 1 55  ? 1.051   -5.793  -0.474  1.00 27.06  ? 55  ASP D N   1 
ATOM   8362  C  CA  . ASP D 1 55  ? 1.592   -5.495  -1.811  1.00 28.67  ? 55  ASP D CA  1 
ATOM   8363  C  C   . ASP D 1 55  ? 3.074   -5.161  -1.725  1.00 26.98  ? 55  ASP D C   1 
ATOM   8364  O  O   . ASP D 1 55  ? 3.438   -4.127  -1.149  1.00 27.84  ? 55  ASP D O   1 
ATOM   8365  C  CB  . ASP D 1 55  ? 0.807   -4.376  -2.537  1.00 31.49  ? 55  ASP D CB  1 
ATOM   8366  C  CG  . ASP D 1 55  ? 1.523   -3.874  -3.807  1.00 34.08  ? 55  ASP D CG  1 
ATOM   8367  O  OD1 . ASP D 1 55  ? 2.475   -4.526  -4.303  1.00 37.10  ? 55  ASP D OD1 1 
ATOM   8368  O  OD2 . ASP D 1 55  ? 1.156   -2.800  -4.316  1.00 35.64  ? 55  ASP D OD2 1 
ATOM   8369  N  N   . PRO D 1 56  ? 3.923   -6.016  -2.317  1.00 26.10  ? 56  PRO D N   1 
ATOM   8370  C  CA  . PRO D 1 56  ? 5.361   -5.915  -2.081  1.00 25.98  ? 56  PRO D CA  1 
ATOM   8371  C  C   . PRO D 1 56  ? 5.915   -4.559  -2.533  1.00 27.84  ? 56  PRO D C   1 
ATOM   8372  O  O   . PRO D 1 56  ? 6.776   -4.003  -1.857  1.00 29.42  ? 56  PRO D O   1 
ATOM   8373  C  CB  . PRO D 1 56  ? 5.951   -7.075  -2.901  1.00 24.85  ? 56  PRO D CB  1 
ATOM   8374  C  CG  . PRO D 1 56  ? 4.808   -7.986  -3.167  1.00 26.53  ? 56  PRO D CG  1 
ATOM   8375  C  CD  . PRO D 1 56  ? 3.589   -7.110  -3.252  1.00 26.47  ? 56  PRO D CD  1 
ATOM   8376  N  N   . GLU D 1 57  ? 5.380   -4.006  -3.618  1.00 27.20  ? 57  GLU D N   1 
ATOM   8377  C  CA  . GLU D 1 57  ? 5.849   -2.721  -4.152  1.00 29.82  ? 57  GLU D CA  1 
ATOM   8378  C  C   . GLU D 1 57  ? 5.735   -1.554  -3.199  1.00 26.52  ? 57  GLU D C   1 
ATOM   8379  O  O   . GLU D 1 57  ? 6.672   -0.751  -3.084  1.00 24.77  ? 57  GLU D O   1 
ATOM   8380  C  CB  . GLU D 1 57  ? 5.092   -2.351  -5.436  1.00 33.08  ? 57  GLU D CB  1 
ATOM   8381  C  CG  . GLU D 1 57  ? 5.799   -2.822  -6.689  1.00 43.27  ? 57  GLU D CG  1 
ATOM   8382  C  CD  . GLU D 1 57  ? 5.572   -4.298  -6.990  1.00 54.17  ? 57  GLU D CD  1 
ATOM   8383  O  OE1 . GLU D 1 57  ? 5.474   -4.610  -8.206  1.00 63.22  ? 57  GLU D OE1 1 
ATOM   8384  O  OE2 . GLU D 1 57  ? 5.504   -5.148  -6.047  1.00 54.42  ? 57  GLU D OE2 1 
ATOM   8385  N  N   . VAL D 1 58  ? 4.559   -1.447  -2.576  1.00 24.35  ? 58  VAL D N   1 
ATOM   8386  C  CA  . VAL D 1 58  ? 4.283   -0.483  -1.525  1.00 22.20  ? 58  VAL D CA  1 
ATOM   8387  C  C   . VAL D 1 58  ? 5.245   -0.742  -0.358  1.00 20.77  ? 58  VAL D C   1 
ATOM   8388  O  O   . VAL D 1 58  ? 5.763   0.199   0.212   1.00 21.48  ? 58  VAL D O   1 
ATOM   8389  C  CB  . VAL D 1 58  ? 2.791   -0.533  -1.108  1.00 22.66  ? 58  VAL D CB  1 
ATOM   8390  C  CG1 . VAL D 1 58  ? 2.469   0.483   -0.030  1.00 22.83  ? 58  VAL D CG1 1 
ATOM   8391  C  CG2 . VAL D 1 58  ? 1.899   -0.267  -2.312  1.00 21.38  ? 58  VAL D CG2 1 
ATOM   8392  N  N   . ARG D 1 59  ? 5.564   -2.000  -0.045  1.00 19.09  ? 59  ARG D N   1 
ATOM   8393  C  CA  . ARG D 1 59  ? 6.502   -2.217  1.066   1.00 19.33  ? 59  ARG D CA  1 
ATOM   8394  C  C   . ARG D 1 59  ? 7.925   -1.693  0.719   1.00 19.28  ? 59  ARG D C   1 
ATOM   8395  O  O   . ARG D 1 59  ? 8.554   -0.977  1.519   1.00 16.79  ? 59  ARG D O   1 
ATOM   8396  C  CB  . ARG D 1 59  ? 6.550   -3.688  1.531   1.00 17.30  ? 59  ARG D CB  1 
ATOM   8397  C  CG  . ARG D 1 59  ? 5.231   -4.239  1.966   1.00 16.66  ? 59  ARG D CG  1 
ATOM   8398  C  CD  . ARG D 1 59  ? 5.304   -5.692  2.346   1.00 15.52  ? 59  ARG D CD  1 
ATOM   8399  N  NE  . ARG D 1 59  ? 5.958   -5.989  3.639   1.00 15.59  ? 59  ARG D NE  1 
ATOM   8400  C  CZ  . ARG D 1 59  ? 5.306   -6.401  4.725   1.00 15.00  ? 59  ARG D CZ  1 
ATOM   8401  N  NH1 . ARG D 1 59  ? 3.982   -6.494  4.727   1.00 14.50  ? 59  ARG D NH1 1 
ATOM   8402  N  NH2 . ARG D 1 59  ? 5.975   -6.712  5.815   1.00 14.83  ? 59  ARG D NH2 1 
ATOM   8403  N  N   . ILE D 1 60  ? 8.422   -2.090  -0.454  1.00 19.87  ? 60  ILE D N   1 
ATOM   8404  C  CA  . ILE D 1 60  ? 9.703   -1.594  -0.971  1.00 22.92  ? 60  ILE D CA  1 
ATOM   8405  C  C   . ILE D 1 60  ? 9.744   -0.067  -0.980  1.00 24.43  ? 60  ILE D C   1 
ATOM   8406  O  O   . ILE D 1 60  ? 10.751  0.527   -0.580  1.00 24.41  ? 60  ILE D O   1 
ATOM   8407  C  CB  . ILE D 1 60  ? 10.038  -2.194  -2.370  1.00 24.10  ? 60  ILE D CB  1 
ATOM   8408  C  CG1 . ILE D 1 60  ? 10.530  -3.638  -2.205  1.00 22.98  ? 60  ILE D CG1 1 
ATOM   8409  C  CG2 . ILE D 1 60  ? 11.105  -1.380  -3.114  1.00 21.39  ? 60  ILE D CG2 1 
ATOM   8410  C  CD1 . ILE D 1 60  ? 9.800   -4.564  -3.127  1.00 24.61  ? 60  ILE D CD1 1 
ATOM   8411  N  N   . ARG D 1 61  ? 8.644   0.566   -1.388  1.00 25.79  ? 61  ARG D N   1 
ATOM   8412  C  CA  . ARG D 1 61  ? 8.579   2.034   -1.380  1.00 29.69  ? 61  ARG D CA  1 
ATOM   8413  C  C   . ARG D 1 61  ? 8.763   2.563   0.064   1.00 28.61  ? 61  ARG D C   1 
ATOM   8414  O  O   . ARG D 1 61  ? 9.577   3.453   0.338   1.00 29.20  ? 61  ARG D O   1 
ATOM   8415  C  CB  . ARG D 1 61  ? 7.272   2.512   -2.026  1.00 30.94  ? 61  ARG D CB  1 
ATOM   8416  C  CG  . ARG D 1 61  ? 7.249   3.972   -2.426  1.00 34.24  ? 61  ARG D CG  1 
ATOM   8417  C  CD  . ARG D 1 61  ? 6.263   4.257   -3.562  1.00 39.08  ? 61  ARG D CD  1 
ATOM   8418  N  NE  . ARG D 1 61  ? 4.851   4.208   -3.149  1.00 43.01  ? 61  ARG D NE  1 
ATOM   8419  C  CZ  . ARG D 1 61  ? 3.910   3.443   -3.706  1.00 44.12  ? 61  ARG D CZ  1 
ATOM   8420  N  NH1 . ARG D 1 61  ? 4.212   2.618   -4.711  1.00 42.07  ? 61  ARG D NH1 1 
ATOM   8421  N  NH2 . ARG D 1 61  ? 2.662   3.491   -3.246  1.00 41.64  ? 61  ARG D NH2 1 
ATOM   8422  N  N   . GLU D 1 62  ? 8.047   1.969   0.999   1.00 29.26  ? 62  GLU D N   1 
ATOM   8423  C  CA  . GLU D 1 62  ? 8.160   2.360   2.400   1.00 27.98  ? 62  GLU D CA  1 
ATOM   8424  C  C   . GLU D 1 62  ? 9.528   2.012   2.993   1.00 27.18  ? 62  GLU D C   1 
ATOM   8425  O  O   . GLU D 1 62  ? 10.069  2.764   3.803   1.00 31.58  ? 62  GLU D O   1 
ATOM   8426  C  CB  . GLU D 1 62  ? 7.005   1.748   3.183   1.00 29.78  ? 62  GLU D CB  1 
ATOM   8427  C  CG  . GLU D 1 62  ? 5.639   2.082   2.580   1.00 32.08  ? 62  GLU D CG  1 
ATOM   8428  C  CD  . GLU D 1 62  ? 4.465   1.946   3.567   1.00 39.18  ? 62  GLU D CD  1 
ATOM   8429  O  OE1 . GLU D 1 62  ? 4.682   1.450   4.725   1.00 35.70  ? 62  GLU D OE1 1 
ATOM   8430  O  OE2 . GLU D 1 62  ? 3.314   2.332   3.168   1.00 38.48  ? 62  GLU D OE2 1 
ATOM   8431  N  N   . MET D 1 63  ? 10.105  0.898   2.559   1.00 25.33  ? 63  MET D N   1 
ATOM   8432  C  CA  . MET D 1 63  ? 11.429  0.465   3.023   1.00 25.15  ? 63  MET D CA  1 
ATOM   8433  C  C   . MET D 1 63  ? 12.586  1.378   2.616   1.00 25.00  ? 63  MET D C   1 
ATOM   8434  O  O   . MET D 1 63  ? 13.496  1.563   3.412   1.00 23.49  ? 63  MET D O   1 
ATOM   8435  C  CB  . MET D 1 63  ? 11.756  -0.970  2.537   1.00 24.19  ? 63  MET D CB  1 
ATOM   8436  C  CG  . MET D 1 63  ? 10.945  -2.102  3.160   1.00 22.58  ? 63  MET D CG  1 
ATOM   8437  S  SD  . MET D 1 63  ? 11.305  -3.686  2.375   1.00 23.60  ? 63  MET D SD  1 
ATOM   8438  C  CE  . MET D 1 63  ? 9.651   -4.191  2.062   1.00 24.80  ? 63  MET D CE  1 
ATOM   8439  N  N   . ASP D 1 64  ? 12.594  1.870   1.369   1.00 27.20  ? 64  ASP D N   1 
ATOM   8440  C  CA  . ASP D 1 64  ? 13.690  2.704   0.838   1.00 31.73  ? 64  ASP D CA  1 
ATOM   8441  C  C   . ASP D 1 64  ? 13.733  3.990   1.650   1.00 31.13  ? 64  ASP D C   1 
ATOM   8442  O  O   . ASP D 1 64  ? 14.811  4.430   2.093   1.00 31.97  ? 64  ASP D O   1 
ATOM   8443  C  CB  . ASP D 1 64  ? 13.489  3.100   -0.646  1.00 37.20  ? 64  ASP D CB  1 
ATOM   8444  C  CG  . ASP D 1 64  ? 13.624  1.937   -1.624  1.00 42.06  ? 64  ASP D CG  1 
ATOM   8445  O  OD1 . ASP D 1 64  ? 14.261  0.914   -1.293  1.00 43.10  ? 64  ASP D OD1 1 
ATOM   8446  O  OD2 . ASP D 1 64  ? 13.083  2.060   -2.756  1.00 46.59  ? 64  ASP D OD2 1 
ATOM   8447  N  N   . GLN D 1 65  ? 12.543  4.553   1.870   1.00 31.98  ? 65  GLN D N   1 
ATOM   8448  C  CA  . GLN D 1 65  ? 12.369  5.797   2.608   1.00 34.31  ? 65  GLN D CA  1 
ATOM   8449  C  C   . GLN D 1 65  ? 12.844  5.680   4.026   1.00 31.63  ? 65  GLN D C   1 
ATOM   8450  O  O   . GLN D 1 65  ? 13.367  6.636   4.580   1.00 31.41  ? 65  GLN D O   1 
ATOM   8451  C  CB  . GLN D 1 65  ? 10.922  6.288   2.541   1.00 40.19  ? 65  GLN D CB  1 
ATOM   8452  C  CG  . GLN D 1 65  ? 10.715  7.176   1.305   1.00 51.24  ? 65  GLN D CG  1 
ATOM   8453  C  CD  . GLN D 1 65  ? 9.298   7.113   0.734   1.00 56.58  ? 65  GLN D CD  1 
ATOM   8454  O  OE1 . GLN D 1 65  ? 8.318   7.350   1.460   1.00 61.32  ? 65  GLN D OE1 1 
ATOM   8455  N  NE2 . GLN D 1 65  ? 9.181   6.802   -0.576  1.00 47.68  ? 65  GLN D NE2 1 
ATOM   8456  N  N   . LYS D 1 66  ? 12.709  4.486   4.592   1.00 30.61  ? 66  LYS D N   1 
ATOM   8457  C  CA  . LYS D 1 66  ? 13.114  4.238   5.982   1.00 29.10  ? 66  LYS D CA  1 
ATOM   8458  C  C   . LYS D 1 66  ? 14.516  3.685   6.042   1.00 27.75  ? 66  LYS D C   1 
ATOM   8459  O  O   . LYS D 1 66  ? 15.064  3.514   7.124   1.00 26.30  ? 66  LYS D O   1 
ATOM   8460  C  CB  . LYS D 1 66  ? 12.110  3.295   6.675   1.00 30.16  ? 66  LYS D CB  1 
ATOM   8461  C  CG  . LYS D 1 66  ? 10.762  3.963   6.971   1.00 32.12  ? 66  LYS D CG  1 
ATOM   8462  C  CD  . LYS D 1 66  ? 10.963  5.081   7.996   1.00 34.77  ? 66  LYS D CD  1 
ATOM   8463  C  CE  . LYS D 1 66  ? 9.889   6.158   7.958   1.00 36.05  ? 66  LYS D CE  1 
ATOM   8464  N  NZ  . LYS D 1 66  ? 8.979   5.956   9.116   1.00 35.85  ? 66  LYS D NZ  1 
ATOM   8465  N  N   . GLY D 1 67  ? 15.109  3.418   4.870   1.00 26.94  ? 67  GLY D N   1 
ATOM   8466  C  CA  . GLY D 1 67  ? 16.458  2.829   4.816   1.00 24.50  ? 67  GLY D CA  1 
ATOM   8467  C  C   . GLY D 1 67  ? 16.538  1.365   5.215   1.00 24.10  ? 67  GLY D C   1 
ATOM   8468  O  O   . GLY D 1 67  ? 17.618  0.885   5.527   1.00 24.16  ? 67  GLY D O   1 
ATOM   8469  N  N   . VAL D 1 68  ? 15.416  0.641   5.208   1.00 22.56  ? 68  VAL D N   1 
ATOM   8470  C  CA  . VAL D 1 68  ? 15.442  -0.794  5.495   1.00 21.64  ? 68  VAL D CA  1 
ATOM   8471  C  C   . VAL D 1 68  ? 15.886  -1.529  4.255   1.00 21.25  ? 68  VAL D C   1 
ATOM   8472  O  O   . VAL D 1 68  ? 15.305  -1.344  3.188   1.00 21.61  ? 68  VAL D O   1 
ATOM   8473  C  CB  . VAL D 1 68  ? 14.057  -1.325  5.902   1.00 22.40  ? 68  VAL D CB  1 
ATOM   8474  C  CG1 . VAL D 1 68  ? 14.125  -2.771  6.350   1.00 20.72  ? 68  VAL D CG1 1 
ATOM   8475  C  CG2 . VAL D 1 68  ? 13.453  -0.467  7.008   1.00 23.96  ? 68  VAL D CG2 1 
ATOM   8476  N  N   . THR D 1 69  ? 16.895  -2.385  4.388   1.00 20.88  ? 69  THR D N   1 
ATOM   8477  C  CA  . THR D 1 69  ? 17.403  -3.159  3.233   1.00 21.29  ? 69  THR D CA  1 
ATOM   8478  C  C   . THR D 1 69  ? 16.615  -4.449  2.896   1.00 20.30  ? 69  THR D C   1 
ATOM   8479  O  O   . THR D 1 69  ? 16.218  -4.650  1.748   1.00 20.69  ? 69  THR D O   1 
ATOM   8480  C  CB  . THR D 1 69  ? 18.895  -3.537  3.406   1.00 22.18  ? 69  THR D CB  1 
ATOM   8481  O  OG1 . THR D 1 69  ? 19.604  -2.438  3.981   1.00 22.30  ? 69  THR D OG1 1 
ATOM   8482  C  CG2 . THR D 1 69  ? 19.530  -3.921  2.055   1.00 22.78  ? 69  THR D CG2 1 
ATOM   8483  N  N   . VAL D 1 70  ? 16.455  -5.332  3.880   1.00 18.71  ? 70  VAL D N   1 
ATOM   8484  C  CA  . VAL D 1 70  ? 15.696  -6.530  3.709   1.00 18.22  ? 70  VAL D CA  1 
ATOM   8485  C  C   . VAL D 1 70  ? 14.685  -6.704  4.823   1.00 18.58  ? 70  VAL D C   1 
ATOM   8486  O  O   . VAL D 1 70  ? 14.964  -6.371  5.965   1.00 20.45  ? 70  VAL D O   1 
ATOM   8487  C  CB  . VAL D 1 70  ? 16.571  -7.818  3.430   1.00 18.55  ? 70  VAL D CB  1 
ATOM   8488  C  CG1 . VAL D 1 70  ? 18.062  -7.566  3.387   1.00 18.03  ? 70  VAL D CG1 1 
ATOM   8489  C  CG2 . VAL D 1 70  ? 16.196  -9.029  4.268   1.00 18.04  ? 70  VAL D CG2 1 
ATOM   8490  N  N   . GLN D 1 71  ? 13.508  -7.212  4.490   1.00 17.44  ? 71  GLN D N   1 
ATOM   8491  C  CA  . GLN D 1 71  ? 12.606  -7.693  5.510   1.00 17.58  ? 71  GLN D CA  1 
ATOM   8492  C  C   . GLN D 1 71  ? 12.528  -9.202  5.492   1.00 16.74  ? 71  GLN D C   1 
ATOM   8493  O  O   . GLN D 1 71  ? 12.427  -9.805  4.420   1.00 17.94  ? 71  GLN D O   1 
ATOM   8494  C  CB  . GLN D 1 71  ? 11.197  -7.126  5.297   1.00 18.40  ? 71  GLN D CB  1 
ATOM   8495  C  CG  . GLN D 1 71  ? 11.049  -5.639  5.575   1.00 17.44  ? 71  GLN D CG  1 
ATOM   8496  C  CD  . GLN D 1 71  ? 9.625   -5.122  5.377   1.00 18.00  ? 71  GLN D CD  1 
ATOM   8497  O  OE1 . GLN D 1 71  ? 8.785   -5.696  4.636   1.00 19.61  ? 71  GLN D OE1 1 
ATOM   8498  N  NE2 . GLN D 1 71  ? 9.348   -4.004  6.008   1.00 17.58  ? 71  GLN D NE2 1 
ATOM   8499  N  N   . ALA D 1 72  ? 12.552  -9.834  6.656   1.00 15.69  ? 72  ALA D N   1 
ATOM   8500  C  CA  . ALA D 1 72  ? 12.199  -11.263 6.707   1.00 15.90  ? 72  ALA D CA  1 
ATOM   8501  C  C   . ALA D 1 72  ? 10.706  -11.291 6.816   1.00 16.29  ? 72  ALA D C   1 
ATOM   8502  O  O   . ALA D 1 72  ? 10.129  -10.755 7.761   1.00 17.17  ? 72  ALA D O   1 
ATOM   8503  C  CB  . ALA D 1 72  ? 12.803  -11.978 7.896   1.00 14.89  ? 72  ALA D CB  1 
ATOM   8504  N  N   . LEU D 1 73  ? 10.088  -11.907 5.833   1.00 16.69  ? 73  LEU D N   1 
ATOM   8505  C  CA  . LEU D 1 73  ? 8.641   -11.935 5.714   1.00 16.58  ? 73  LEU D CA  1 
ATOM   8506  C  C   . LEU D 1 73  ? 8.104   -13.184 6.397   1.00 17.06  ? 73  LEU D C   1 
ATOM   8507  O  O   . LEU D 1 73  ? 8.517   -14.318 6.033   1.00 18.16  ? 73  LEU D O   1 
ATOM   8508  C  CB  . LEU D 1 73  ? 8.257   -11.957 4.226   1.00 14.52  ? 73  LEU D CB  1 
ATOM   8509  C  CG  . LEU D 1 73  ? 8.501   -10.695 3.430   1.00 14.06  ? 73  LEU D CG  1 
ATOM   8510  C  CD1 . LEU D 1 73  ? 7.889   -10.829 2.056   1.00 14.19  ? 73  LEU D CD1 1 
ATOM   8511  C  CD2 . LEU D 1 73  ? 7.967   -9.444  4.105   1.00 13.61  ? 73  LEU D CD2 1 
ATOM   8512  N  N   . SER D 1 74  ? 7.184   -12.980 7.350   1.00 16.52  ? 74  SER D N   1 
ATOM   8513  C  CA  . SER D 1 74  ? 6.365   -14.065 7.911   1.00 17.33  ? 74  SER D CA  1 
ATOM   8514  C  C   . SER D 1 74  ? 4.871   -13.811 7.754   1.00 15.38  ? 74  SER D C   1 
ATOM   8515  O  O   . SER D 1 74  ? 4.456   -12.748 7.351   1.00 16.04  ? 74  SER D O   1 
ATOM   8516  C  CB  . SER D 1 74  ? 6.724   -14.337 9.389   1.00 19.79  ? 74  SER D CB  1 
ATOM   8517  O  OG  . SER D 1 74  ? 6.849   -13.128 10.143  1.00 27.47  ? 74  SER D OG  1 
ATOM   8518  N  N   . THR D 1 75  ? 4.044   -14.787 8.028   1.00 14.61  ? 75  THR D N   1 
ATOM   8519  C  CA  . THR D 1 75  ? 2.638   -14.505 7.975   1.00 14.43  ? 75  THR D CA  1 
ATOM   8520  C  C   . THR D 1 75  ? 2.143   -13.917 9.300   1.00 14.42  ? 75  THR D C   1 
ATOM   8521  O  O   . THR D 1 75  ? 2.874   -13.937 10.299  1.00 13.95  ? 75  THR D O   1 
ATOM   8522  C  CB  . THR D 1 75  ? 1.784   -15.730 7.624   1.00 14.47  ? 75  THR D CB  1 
ATOM   8523  O  OG1 . THR D 1 75  ? 0.412   -15.291 7.474   1.00 14.48  ? 75  THR D OG1 1 
ATOM   8524  C  CG2 . THR D 1 75  ? 1.876   -16.773 8.747   1.00 14.38  ? 75  THR D CG2 1 
ATOM   8525  N  N   . VAL D 1 76  ? 0.900   -13.427 9.305   1.00 14.15  ? 76  VAL D N   1 
ATOM   8526  C  CA  . VAL D 1 76  ? 0.286   -12.903 10.510  1.00 14.02  ? 76  VAL D CA  1 
ATOM   8527  C  C   . VAL D 1 76  ? -0.032  -14.105 11.410  1.00 14.48  ? 76  VAL D C   1 
ATOM   8528  O  O   . VAL D 1 76  ? -0.631  -15.066 10.940  1.00 14.93  ? 76  VAL D O   1 
ATOM   8529  C  CB  . VAL D 1 76  ? -0.955  -12.052 10.184  1.00 14.54  ? 76  VAL D CB  1 
ATOM   8530  C  CG1 . VAL D 1 76  ? -1.399  -11.257 11.399  1.00 14.41  ? 76  VAL D CG1 1 
ATOM   8531  C  CG2 . VAL D 1 76  ? -0.644  -11.048 9.062   1.00 14.93  ? 76  VAL D CG2 1 
ATOM   8532  N  N   . PRO D 1 77  ? 0.397   -14.066 12.696  1.00 14.17  ? 77  PRO D N   1 
ATOM   8533  C  CA  . PRO D 1 77  ? 0.204   -15.190 13.625  1.00 15.30  ? 77  PRO D CA  1 
ATOM   8534  C  C   . PRO D 1 77  ? -1.223  -15.724 13.785  1.00 15.35  ? 77  PRO D C   1 
ATOM   8535  O  O   . PRO D 1 77  ? -1.391  -16.904 14.085  1.00 16.63  ? 77  PRO D O   1 
ATOM   8536  C  CB  . PRO D 1 77  ? 0.727   -14.649 14.978  1.00 14.87  ? 77  PRO D CB  1 
ATOM   8537  C  CG  . PRO D 1 77  ? 1.692   -13.571 14.612  1.00 13.92  ? 77  PRO D CG  1 
ATOM   8538  C  CD  . PRO D 1 77  ? 1.153   -12.968 13.325  1.00 14.00  ? 77  PRO D CD  1 
ATOM   8539  N  N   . VAL D 1 78  ? -2.238  -14.894 13.619  1.00 15.19  ? 78  VAL D N   1 
ATOM   8540  C  CA  . VAL D 1 78  ? -3.584  -15.391 13.611  1.00 15.18  ? 78  VAL D CA  1 
ATOM   8541  C  C   . VAL D 1 78  ? -3.757  -16.399 12.466  1.00 16.79  ? 78  VAL D C   1 
ATOM   8542  O  O   . VAL D 1 78  ? -4.737  -17.065 12.412  1.00 18.16  ? 78  VAL D O   1 
ATOM   8543  C  CB  . VAL D 1 78  ? -4.576  -14.217 13.472  1.00 16.55  ? 78  VAL D CB  1 
ATOM   8544  C  CG1 . VAL D 1 78  ? -4.431  -13.549 12.106  1.00 15.75  ? 78  VAL D CG1 1 
ATOM   8545  C  CG2 . VAL D 1 78  ? -6.037  -14.614 13.806  1.00 15.74  ? 78  VAL D CG2 1 
ATOM   8546  N  N   . MET D 1 79  ? -2.797  -16.545 11.564  1.00 17.57  ? 79  MET D N   1 
ATOM   8547  C  CA  . MET D 1 79  ? -2.917  -17.552 10.520  1.00 18.26  ? 79  MET D CA  1 
ATOM   8548  C  C   . MET D 1 79  ? -2.367  -18.902 10.928  1.00 17.48  ? 79  MET D C   1 
ATOM   8549  O  O   . MET D 1 79  ? -2.590  -19.890 10.227  1.00 17.28  ? 79  MET D O   1 
ATOM   8550  C  CB  . MET D 1 79  ? -2.204  -17.103 9.231   1.00 19.30  ? 79  MET D CB  1 
ATOM   8551  C  CG  . MET D 1 79  ? -2.739  -15.803 8.636   1.00 20.96  ? 79  MET D CG  1 
ATOM   8552  S  SD  . MET D 1 79  ? -4.529  -15.796 8.317   1.00 24.48  ? 79  MET D SD  1 
ATOM   8553  C  CE  . MET D 1 79  ? -4.583  -16.700 6.751   1.00 22.21  ? 79  MET D CE  1 
ATOM   8554  N  N   . PHE D 1 80  ? -1.618  -18.958 12.034  1.00 16.92  ? 80  PHE D N   1 
ATOM   8555  C  CA  . PHE D 1 80  ? -0.989  -20.218 12.448  1.00 15.49  ? 80  PHE D CA  1 
ATOM   8556  C  C   . PHE D 1 80  ? -1.996  -21.371 12.349  1.00 15.33  ? 80  PHE D C   1 
ATOM   8557  O  O   . PHE D 1 80  ? -1.626  -22.463 11.885  1.00 15.41  ? 80  PHE D O   1 
ATOM   8558  C  CB  . PHE D 1 80  ? -0.488  -20.167 13.874  1.00 15.89  ? 80  PHE D CB  1 
ATOM   8559  C  CG  . PHE D 1 80  ? 0.755   -19.346 14.084  1.00 16.98  ? 80  PHE D CG  1 
ATOM   8560  C  CD1 . PHE D 1 80  ? 1.749   -19.264 13.119  1.00 18.36  ? 80  PHE D CD1 1 
ATOM   8561  C  CD2 . PHE D 1 80  ? 0.953   -18.698 15.290  1.00 17.08  ? 80  PHE D CD2 1 
ATOM   8562  C  CE1 . PHE D 1 80  ? 2.900   -18.521 13.342  1.00 19.00  ? 80  PHE D CE1 1 
ATOM   8563  C  CE2 . PHE D 1 80  ? 2.088   -17.929 15.515  1.00 18.55  ? 80  PHE D CE2 1 
ATOM   8564  C  CZ  . PHE D 1 80  ? 3.068   -17.847 14.538  1.00 19.01  ? 80  PHE D CZ  1 
ATOM   8565  N  N   . SER D 1 81  ? -3.240  -21.143 12.801  1.00 14.04  ? 81  SER D N   1 
ATOM   8566  C  CA  . SER D 1 81  ? -4.328  -22.167 12.745  1.00 14.95  ? 81  SER D CA  1 
ATOM   8567  C  C   . SER D 1 81  ? -4.040  -23.522 13.442  1.00 14.54  ? 81  SER D C   1 
ATOM   8568  O  O   . SER D 1 81  ? -4.405  -24.598 12.906  1.00 13.19  ? 81  SER D O   1 
ATOM   8569  C  CB  . SER D 1 81  ? -4.664  -22.459 11.269  1.00 14.49  ? 81  SER D CB  1 
ATOM   8570  O  OG  . SER D 1 81  ? -4.872  -21.247 10.583  1.00 15.16  ? 81  SER D OG  1 
ATOM   8571  N  N   . TYR D 1 82  ? -3.338  -23.497 14.575  1.00 14.66  ? 82  TYR D N   1 
ATOM   8572  C  CA  . TYR D 1 82  ? -2.946  -24.760 15.243  1.00 15.38  ? 82  TYR D CA  1 
ATOM   8573  C  C   . TYR D 1 82  ? -4.122  -25.544 15.770  1.00 15.73  ? 82  TYR D C   1 
ATOM   8574  O  O   . TYR D 1 82  ? -4.022  -26.763 15.922  1.00 15.66  ? 82  TYR D O   1 
ATOM   8575  C  CB  . TYR D 1 82  ? -1.979  -24.510 16.388  1.00 15.91  ? 82  TYR D CB  1 
ATOM   8576  C  CG  . TYR D 1 82  ? -0.629  -23.964 15.961  1.00 16.20  ? 82  TYR D CG  1 
ATOM   8577  C  CD1 . TYR D 1 82  ? -0.151  -24.126 14.638  1.00 14.91  ? 82  TYR D CD1 1 
ATOM   8578  C  CD2 . TYR D 1 82  ? 0.180   -23.284 16.898  1.00 15.87  ? 82  TYR D CD2 1 
ATOM   8579  C  CE1 . TYR D 1 82  ? 1.075   -23.624 14.269  1.00 14.91  ? 82  TYR D CE1 1 
ATOM   8580  C  CE2 . TYR D 1 82  ? 1.402   -22.780 16.544  1.00 15.65  ? 82  TYR D CE2 1 
ATOM   8581  C  CZ  . TYR D 1 82  ? 1.850   -22.961 15.233  1.00 16.40  ? 82  TYR D CZ  1 
ATOM   8582  O  OH  . TYR D 1 82  ? 3.082   -22.445 14.938  1.00 17.26  ? 82  TYR D OH  1 
ATOM   8583  N  N   . TRP D 1 83  ? -5.226  -24.835 16.037  1.00 16.99  ? 83  TRP D N   1 
ATOM   8584  C  CA  . TRP D 1 83  ? -6.520  -25.410 16.444  1.00 18.33  ? 83  TRP D CA  1 
ATOM   8585  C  C   . TRP D 1 83  ? -7.195  -26.319 15.394  1.00 18.98  ? 83  TRP D C   1 
ATOM   8586  O  O   . TRP D 1 83  ? -8.044  -27.123 15.733  1.00 19.04  ? 83  TRP D O   1 
ATOM   8587  C  CB  . TRP D 1 83  ? -7.478  -24.283 16.870  1.00 18.18  ? 83  TRP D CB  1 
ATOM   8588  C  CG  . TRP D 1 83  ? -7.713  -23.285 15.752  1.00 20.03  ? 83  TRP D CG  1 
ATOM   8589  C  CD1 . TRP D 1 83  ? -6.987  -22.115 15.475  1.00 19.77  ? 83  TRP D CD1 1 
ATOM   8590  C  CD2 . TRP D 1 83  ? -8.728  -23.356 14.671  1.00 20.14  ? 83  TRP D CD2 1 
ATOM   8591  N  NE1 . TRP D 1 83  ? -7.485  -21.481 14.351  1.00 19.44  ? 83  TRP D NE1 1 
ATOM   8592  C  CE2 . TRP D 1 83  ? -8.518  -22.173 13.824  1.00 19.38  ? 83  TRP D CE2 1 
ATOM   8593  C  CE3 . TRP D 1 83  ? -9.760  -24.246 14.347  1.00 21.93  ? 83  TRP D CE3 1 
ATOM   8594  C  CZ2 . TRP D 1 83  ? -9.305  -21.915 12.708  1.00 20.56  ? 83  TRP D CZ2 1 
ATOM   8595  C  CZ3 . TRP D 1 83  ? -10.564 -23.969 13.220  1.00 21.93  ? 83  TRP D CZ3 1 
ATOM   8596  C  CH2 . TRP D 1 83  ? -10.328 -22.835 12.408  1.00 21.54  ? 83  TRP D CH2 1 
ATOM   8597  N  N   . ALA D 1 84  ? -6.823  -26.238 14.127  1.00 18.76  ? 84  ALA D N   1 
ATOM   8598  C  CA  . ALA D 1 84  ? -7.665  -26.846 13.085  1.00 20.68  ? 84  ALA D CA  1 
ATOM   8599  C  C   . ALA D 1 84  ? -7.330  -28.316 12.844  1.00 22.35  ? 84  ALA D C   1 
ATOM   8600  O  O   . ALA D 1 84  ? -6.411  -28.832 13.477  1.00 24.10  ? 84  ALA D O   1 
ATOM   8601  C  CB  . ALA D 1 84  ? -7.554  -26.038 11.813  1.00 19.39  ? 84  ALA D CB  1 
ATOM   8602  N  N   . LYS D 1 85  ? -8.069  -29.016 11.977  1.00 23.63  ? 85  LYS D N   1 
ATOM   8603  C  CA  . LYS D 1 85  ? -7.617  -30.356 11.555  1.00 25.56  ? 85  LYS D CA  1 
ATOM   8604  C  C   . LYS D 1 85  ? -6.197  -30.272 10.996  1.00 24.98  ? 85  LYS D C   1 
ATOM   8605  O  O   . LYS D 1 85  ? -5.870  -29.321 10.284  1.00 24.74  ? 85  LYS D O   1 
ATOM   8606  C  CB  . LYS D 1 85  ? -8.505  -30.963 10.461  1.00 30.63  ? 85  LYS D CB  1 
ATOM   8607  C  CG  . LYS D 1 85  ? -9.895  -31.392 10.878  1.00 34.15  ? 85  LYS D CG  1 
ATOM   8608  C  CD  . LYS D 1 85  ? -10.505 -32.236 9.773   1.00 40.31  ? 85  LYS D CD  1 
ATOM   8609  C  CE  . LYS D 1 85  ? -11.964 -32.605 10.057  1.00 47.20  ? 85  LYS D CE  1 
ATOM   8610  N  NZ  . LYS D 1 85  ? -12.544 -33.450 8.963   1.00 48.02  ? 85  LYS D NZ  1 
ATOM   8611  N  N   . PRO D 1 86  ? -5.349  -31.273 11.287  1.00 24.50  ? 86  PRO D N   1 
ATOM   8612  C  CA  . PRO D 1 86  ? -3.980  -31.243 10.727  1.00 23.88  ? 86  PRO D CA  1 
ATOM   8613  C  C   . PRO D 1 86  ? -3.841  -31.045 9.190   1.00 23.32  ? 86  PRO D C   1 
ATOM   8614  O  O   . PRO D 1 86  ? -2.973  -30.290 8.746   1.00 23.28  ? 86  PRO D O   1 
ATOM   8615  C  CB  . PRO D 1 86  ? -3.394  -32.592 11.161  1.00 23.76  ? 86  PRO D CB  1 
ATOM   8616  C  CG  . PRO D 1 86  ? -4.177  -32.959 12.394  1.00 24.47  ? 86  PRO D CG  1 
ATOM   8617  C  CD  . PRO D 1 86  ? -5.562  -32.416 12.196  1.00 22.45  ? 86  PRO D CD  1 
ATOM   8618  N  N   . GLU D 1 87  ? -4.656  -31.710 8.378   1.00 24.40  ? 87  GLU D N   1 
ATOM   8619  C  CA  . GLU D 1 87  ? -4.452  -31.673 6.913   1.00 25.46  ? 87  GLU D CA  1 
ATOM   8620  C  C   . GLU D 1 87  ? -4.923  -30.347 6.326   1.00 23.75  ? 87  GLU D C   1 
ATOM   8621  O  O   . GLU D 1 87  ? -4.435  -29.907 5.268   1.00 22.22  ? 87  GLU D O   1 
ATOM   8622  C  CB  . GLU D 1 87  ? -5.140  -32.855 6.208   1.00 29.16  ? 87  GLU D CB  1 
ATOM   8623  C  CG  . GLU D 1 87  ? -4.540  -34.235 6.528   1.00 34.40  ? 87  GLU D CG  1 
ATOM   8624  C  CD  . GLU D 1 87  ? -3.137  -34.522 5.932   1.00 40.23  ? 87  GLU D CD  1 
ATOM   8625  O  OE1 . GLU D 1 87  ? -2.651  -33.825 4.979   1.00 38.87  ? 87  GLU D OE1 1 
ATOM   8626  O  OE2 . GLU D 1 87  ? -2.513  -35.507 6.419   1.00 42.51  ? 87  GLU D OE2 1 
ATOM   8627  N  N   . ASP D 1 88  ? -5.847  -29.703 7.036   1.00 21.89  ? 88  ASP D N   1 
ATOM   8628  C  CA  . ASP D 1 88  ? -6.378  -28.433 6.596   1.00 22.92  ? 88  ASP D CA  1 
ATOM   8629  C  C   . ASP D 1 88  ? -5.388  -27.324 6.888   1.00 23.22  ? 88  ASP D C   1 
ATOM   8630  O  O   . ASP D 1 88  ? -5.172  -26.446 6.033   1.00 22.67  ? 88  ASP D O   1 
ATOM   8631  C  CB  . ASP D 1 88  ? -7.724  -28.124 7.258   1.00 23.33  ? 88  ASP D CB  1 
ATOM   8632  C  CG  . ASP D 1 88  ? -8.763  -29.231 7.051   1.00 24.04  ? 88  ASP D CG  1 
ATOM   8633  O  OD1 . ASP D 1 88  ? -8.518  -30.169 6.268   1.00 23.99  ? 88  ASP D OD1 1 
ATOM   8634  O  OD2 . ASP D 1 88  ? -9.841  -29.162 7.680   1.00 24.87  ? 88  ASP D OD2 1 
ATOM   8635  N  N   . THR D 1 89  ? -4.814  -27.347 8.100   1.00 22.00  ? 89  THR D N   1 
ATOM   8636  C  CA  . THR D 1 89  ? -3.739  -26.397 8.481   1.00 20.74  ? 89  THR D CA  1 
ATOM   8637  C  C   . THR D 1 89  ? -2.566  -26.571 7.516   1.00 19.75  ? 89  THR D C   1 
ATOM   8638  O  O   . THR D 1 89  ? -1.982  -25.565 7.055   1.00 18.38  ? 89  THR D O   1 
ATOM   8639  C  CB  . THR D 1 89  ? -3.225  -26.602 9.926   1.00 20.70  ? 89  THR D CB  1 
ATOM   8640  O  OG1 . THR D 1 89  ? -4.316  -26.501 10.872  1.00 22.47  ? 89  THR D OG1 1 
ATOM   8641  C  CG2 . THR D 1 89  ? -2.144  -25.596 10.284  1.00 20.48  ? 89  THR D CG2 1 
ATOM   8642  N  N   . LEU D 1 90  ? -2.233  -27.828 7.194   1.00 17.97  ? 90  LEU D N   1 
ATOM   8643  C  CA  . LEU D 1 90  ? -1.136  -28.049 6.258   1.00 18.07  ? 90  LEU D CA  1 
ATOM   8644  C  C   . LEU D 1 90  ? -1.436  -27.407 4.897   1.00 18.73  ? 90  LEU D C   1 
ATOM   8645  O  O   . LEU D 1 90  ? -0.598  -26.709 4.349   1.00 19.57  ? 90  LEU D O   1 
ATOM   8646  C  CB  . LEU D 1 90  ? -0.808  -29.513 6.084   1.00 18.05  ? 90  LEU D CB  1 
ATOM   8647  C  CG  . LEU D 1 90  ? 0.197   -29.739 4.947   1.00 18.40  ? 90  LEU D CG  1 
ATOM   8648  C  CD1 . LEU D 1 90  ? 1.595   -29.147 5.185   1.00 16.60  ? 90  LEU D CD1 1 
ATOM   8649  C  CD2 . LEU D 1 90  ? 0.263   -31.232 4.689   1.00 17.46  ? 90  LEU D CD2 1 
ATOM   8650  N  N   . ASN D 1 91  ? -2.648  -27.627 4.391   1.00 18.81  ? 91  ASN D N   1 
ATOM   8651  C  CA  . ASN D 1 91  ? -3.118  -27.067 3.140   1.00 18.32  ? 91  ASN D CA  1 
ATOM   8652  C  C   . ASN D 1 91  ? -3.016  -25.548 3.126   1.00 17.80  ? 91  ASN D C   1 
ATOM   8653  O  O   . ASN D 1 91  ? -2.431  -24.957 2.200   1.00 18.89  ? 91  ASN D O   1 
ATOM   8654  C  CB  . ASN D 1 91  ? -4.539  -27.590 2.905   1.00 20.04  ? 91  ASN D CB  1 
ATOM   8655  C  CG  . ASN D 1 91  ? -5.109  -27.197 1.568   1.00 22.05  ? 91  ASN D CG  1 
ATOM   8656  O  OD1 . ASN D 1 91  ? -5.680  -26.127 1.456   1.00 23.30  ? 91  ASN D OD1 1 
ATOM   8657  N  ND2 . ASN D 1 91  ? -4.968  -28.060 0.545   1.00 22.36  ? 91  ASN D ND2 1 
ATOM   8658  N  N   . LEU D 1 92  ? -3.522  -24.906 4.171   1.00 16.85  ? 92  LEU D N   1 
ATOM   8659  C  CA  . LEU D 1 92  ? -3.323  -23.460 4.380   1.00 16.26  ? 92  LEU D CA  1 
ATOM   8660  C  C   . LEU D 1 92  ? -1.887  -23.011 4.470   1.00 17.11  ? 92  LEU D C   1 
ATOM   8661  O  O   . LEU D 1 92  ? -1.534  -21.980 3.885   1.00 18.63  ? 92  LEU D O   1 
ATOM   8662  C  CB  . LEU D 1 92  ? -4.075  -22.979 5.616   1.00 16.13  ? 92  LEU D CB  1 
ATOM   8663  C  CG  . LEU D 1 92  ? -4.003  -21.486 5.977   1.00 15.96  ? 92  LEU D CG  1 
ATOM   8664  C  CD1 . LEU D 1 92  ? -4.525  -20.616 4.825   1.00 15.53  ? 92  LEU D CD1 1 
ATOM   8665  C  CD2 . LEU D 1 92  ? -4.766  -21.229 7.275   1.00 14.95  ? 92  LEU D CD2 1 
ATOM   8666  N  N   . CYS D 1 93  ? -1.046  -23.740 5.199   1.00 18.53  ? 93  CYS D N   1 
ATOM   8667  C  CA  . CYS D 1 93  ? 0.402   -23.395 5.259   1.00 20.27  ? 93  CYS D CA  1 
ATOM   8668  C  C   . CYS D 1 93  ? 1.033   -23.326 3.879   1.00 19.14  ? 93  CYS D C   1 
ATOM   8669  O  O   . CYS D 1 93  ? 1.867   -22.430 3.600   1.00 18.51  ? 93  CYS D O   1 
ATOM   8670  C  CB  . CYS D 1 93  ? 1.204   -24.399 6.095   1.00 22.58  ? 93  CYS D CB  1 
ATOM   8671  S  SG  . CYS D 1 93  ? 0.807   -24.322 7.852   1.00 31.88  ? 93  CYS D SG  1 
ATOM   8672  N  N   . GLN D 1 94  ? 0.656   -24.293 3.038   1.00 18.32  ? 94  GLN D N   1 
ATOM   8673  C  CA  . GLN D 1 94  ? 1.257   -24.465 1.718   1.00 19.34  ? 94  GLN D CA  1 
ATOM   8674  C  C   . GLN D 1 94  ? 0.905   -23.305 0.834   1.00 17.21  ? 94  GLN D C   1 
ATOM   8675  O  O   . GLN D 1 94  ? 1.736   -22.787 0.120   1.00 16.46  ? 94  GLN D O   1 
ATOM   8676  C  CB  . GLN D 1 94  ? 0.843   -25.797 1.052   1.00 22.02  ? 94  GLN D CB  1 
ATOM   8677  C  CG  . GLN D 1 94  ? 1.651   -26.991 1.539   1.00 23.34  ? 94  GLN D CG  1 
ATOM   8678  C  CD  . GLN D 1 94  ? 1.064   -28.318 1.107   1.00 26.36  ? 94  GLN D CD  1 
ATOM   8679  O  OE1 . GLN D 1 94  ? -0.117  -28.418 0.767   1.00 28.47  ? 94  GLN D OE1 1 
ATOM   8680  N  NE2 . GLN D 1 94  ? 1.889   -29.363 1.139   1.00 28.77  ? 94  GLN D NE2 1 
ATOM   8681  N  N   . LEU D 1 95  ? -0.339  -22.896 0.925   1.00 16.96  ? 95  LEU D N   1 
ATOM   8682  C  CA  . LEU D 1 95  ? -0.841  -21.731 0.238   1.00 16.90  ? 95  LEU D CA  1 
ATOM   8683  C  C   . LEU D 1 95  ? -0.108  -20.453 0.697   1.00 16.59  ? 95  LEU D C   1 
ATOM   8684  O  O   . LEU D 1 95  ? 0.273   -19.610 -0.132  1.00 15.94  ? 95  LEU D O   1 
ATOM   8685  C  CB  . LEU D 1 95  ? -2.326  -21.665 0.549   1.00 18.67  ? 95  LEU D CB  1 
ATOM   8686  C  CG  . LEU D 1 95  ? -3.321  -20.787 -0.178  1.00 21.57  ? 95  LEU D CG  1 
ATOM   8687  C  CD1 . LEU D 1 95  ? -4.720  -21.346 0.046   1.00 22.29  ? 95  LEU D CD1 1 
ATOM   8688  C  CD2 . LEU D 1 95  ? -3.205  -19.390 0.407   1.00 22.62  ? 95  LEU D CD2 1 
ATOM   8689  N  N   . LEU D 1 96  ? 0.107   -20.310 2.014   1.00 15.98  ? 96  LEU D N   1 
ATOM   8690  C  CA  . LEU D 1 96  ? 0.800   -19.126 2.531   1.00 14.66  ? 96  LEU D CA  1 
ATOM   8691  C  C   . LEU D 1 96  ? 2.298   -19.223 2.236   1.00 13.96  ? 96  LEU D C   1 
ATOM   8692  O  O   . LEU D 1 96  ? 2.904   -18.218 1.833   1.00 13.05  ? 96  LEU D O   1 
ATOM   8693  C  CB  . LEU D 1 96  ? 0.562   -18.907 4.030   1.00 14.03  ? 96  LEU D CB  1 
ATOM   8694  C  CG  . LEU D 1 96  ? -0.912  -18.751 4.463   1.00 14.59  ? 96  LEU D CG  1 
ATOM   8695  C  CD1 . LEU D 1 96  ? -1.071  -18.845 5.990   1.00 13.18  ? 96  LEU D CD1 1 
ATOM   8696  C  CD2 . LEU D 1 96  ? -1.535  -17.489 3.880   1.00 13.81  ? 96  LEU D CD2 1 
ATOM   8697  N  N   . ASN D 1 97  ? 2.881   -20.410 2.386   1.00 12.68  ? 97  ASN D N   1 
ATOM   8698  C  CA  . ASN D 1 97  ? 4.311   -20.531 2.107   1.00 13.42  ? 97  ASN D CA  1 
ATOM   8699  C  C   . ASN D 1 97  ? 4.633   -20.313 0.626   1.00 13.59  ? 97  ASN D C   1 
ATOM   8700  O  O   . ASN D 1 97  ? 5.587   -19.633 0.302   1.00 14.00  ? 97  ASN D O   1 
ATOM   8701  C  CB  . ASN D 1 97  ? 4.879   -21.855 2.636   1.00 13.18  ? 97  ASN D CB  1 
ATOM   8702  C  CG  . ASN D 1 97  ? 4.803   -21.970 4.162   1.00 13.23  ? 97  ASN D CG  1 
ATOM   8703  O  OD1 . ASN D 1 97  ? 4.681   -20.976 4.899   1.00 12.94  ? 97  ASN D OD1 1 
ATOM   8704  N  ND2 . ASN D 1 97  ? 4.889   -23.185 4.640   1.00 13.02  ? 97  ASN D ND2 1 
ATOM   8705  N  N   . ASN D 1 98  ? 3.804   -20.857 -0.258  1.00 14.35  ? 98  ASN D N   1 
ATOM   8706  C  CA  . ASN D 1 98  ? 3.895   -20.635 -1.717  1.00 15.98  ? 98  ASN D CA  1 
ATOM   8707  C  C   . ASN D 1 98  ? 3.786   -19.178 -2.078  1.00 16.48  ? 98  ASN D C   1 
ATOM   8708  O  O   . ASN D 1 98  ? 4.582   -18.675 -2.849  1.00 17.74  ? 98  ASN D O   1 
ATOM   8709  C  CB  . ASN D 1 98  ? 2.832   -21.466 -2.471  1.00 15.78  ? 98  ASN D CB  1 
ATOM   8710  C  CG  . ASN D 1 98  ? 3.128   -22.959 -2.397  1.00 17.11  ? 98  ASN D CG  1 
ATOM   8711  O  OD1 . ASN D 1 98  ? 4.264   -23.351 -2.122  1.00 16.19  ? 98  ASN D OD1 1 
ATOM   8712  N  ND2 . ASN D 1 98  ? 2.115   -23.793 -2.604  1.00 17.37  ? 98  ASN D ND2 1 
ATOM   8713  N  N   . ASP D 1 99  ? 2.847   -18.466 -1.488  1.00 17.53  ? 99  ASP D N   1 
ATOM   8714  C  CA  . ASP D 1 99  ? 2.738   -17.054 -1.789  1.00 20.05  ? 99  ASP D CA  1 
ATOM   8715  C  C   . ASP D 1 99  ? 3.958   -16.232 -1.326  1.00 20.47  ? 99  ASP D C   1 
ATOM   8716  O  O   . ASP D 1 99  ? 4.435   -15.356 -2.044  1.00 22.69  ? 99  ASP D O   1 
ATOM   8717  C  CB  . ASP D 1 99  ? 1.452   -16.488 -1.210  1.00 23.09  ? 99  ASP D CB  1 
ATOM   8718  C  CG  . ASP D 1 99  ? 1.420   -14.981 -1.259  1.00 26.98  ? 99  ASP D CG  1 
ATOM   8719  O  OD1 . ASP D 1 99  ? 1.225   -14.390 -2.369  1.00 33.95  ? 99  ASP D OD1 1 
ATOM   8720  O  OD2 . ASP D 1 99  ? 1.591   -14.380 -0.182  1.00 29.56  ? 99  ASP D OD2 1 
ATOM   8721  N  N   . LEU D 1 100 ? 4.439   -16.503 -0.120  1.00 19.76  ? 100 LEU D N   1 
ATOM   8722  C  CA  . LEU D 1 100 ? 5.640   -15.886 0.405   1.00 19.08  ? 100 LEU D CA  1 
ATOM   8723  C  C   . LEU D 1 100 ? 6.807   -16.115 -0.554  1.00 16.54  ? 100 LEU D C   1 
ATOM   8724  O  O   . LEU D 1 100 ? 7.529   -15.177 -0.916  1.00 15.62  ? 100 LEU D O   1 
ATOM   8725  C  CB  . LEU D 1 100 ? 5.974   -16.551 1.734   1.00 22.13  ? 100 LEU D CB  1 
ATOM   8726  C  CG  . LEU D 1 100 ? 6.350   -15.736 2.933   1.00 26.38  ? 100 LEU D CG  1 
ATOM   8727  C  CD1 . LEU D 1 100 ? 5.099   -14.942 3.292   1.00 28.18  ? 100 LEU D CD1 1 
ATOM   8728  C  CD2 . LEU D 1 100 ? 6.714   -16.719 4.041   1.00 26.40  ? 100 LEU D CD2 1 
ATOM   8729  N  N   . ALA D 1 101 ? 6.979   -17.368 -0.965  1.00 14.89  ? 101 ALA D N   1 
ATOM   8730  C  CA  . ALA D 1 101 ? 8.060   -17.768 -1.894  1.00 14.53  ? 101 ALA D CA  1 
ATOM   8731  C  C   . ALA D 1 101 ? 8.003   -16.977 -3.165  1.00 14.28  ? 101 ALA D C   1 
ATOM   8732  O  O   . ALA D 1 101 ? 9.041   -16.590 -3.658  1.00 16.22  ? 101 ALA D O   1 
ATOM   8733  C  CB  . ALA D 1 101 ? 8.019   -19.269 -2.200  1.00 13.76  ? 101 ALA D CB  1 
ATOM   8734  N  N   . SER D 1 102 ? 6.807   -16.652 -3.665  1.00 14.65  ? 102 SER D N   1 
ATOM   8735  C  CA  . SER D 1 102 ? 6.753   -15.963 -4.928  1.00 14.87  ? 102 SER D CA  1 
ATOM   8736  C  C   . SER D 1 102 ? 6.964   -14.488 -4.771  1.00 15.21  ? 102 SER D C   1 
ATOM   8737  O  O   . SER D 1 102 ? 7.521   -13.847 -5.656  1.00 15.29  ? 102 SER D O   1 
ATOM   8738  C  CB  . SER D 1 102 ? 5.524   -16.335 -5.747  1.00 15.93  ? 102 SER D CB  1 
ATOM   8739  O  OG  . SER D 1 102 ? 4.423   -15.550 -5.476  1.00 17.42  ? 102 SER D OG  1 
ATOM   8740  N  N   . THR D 1 103 ? 6.605   -13.948 -3.619  1.00 14.61  ? 103 THR D N   1 
ATOM   8741  C  CA  . THR D 1 103 ? 7.114   -12.628 -3.286  1.00 15.60  ? 103 THR D CA  1 
ATOM   8742  C  C   . THR D 1 103 ? 8.663   -12.577 -3.251  1.00 15.18  ? 103 THR D C   1 
ATOM   8743  O  O   . THR D 1 103 ? 9.251   -11.628 -3.751  1.00 15.28  ? 103 THR D O   1 
ATOM   8744  C  CB  . THR D 1 103 ? 6.552   -12.157 -1.945  1.00 15.80  ? 103 THR D CB  1 
ATOM   8745  O  OG1 . THR D 1 103 ? 5.123   -12.244 -1.998  1.00 17.30  ? 103 THR D OG1 1 
ATOM   8746  C  CG2 . THR D 1 103 ? 6.952   -10.766 -1.699  1.00 15.21  ? 103 THR D CG2 1 
ATOM   8747  N  N   . VAL D 1 104 ? 9.320   -13.587 -2.683  1.00 14.11  ? 104 VAL D N   1 
ATOM   8748  C  CA  . VAL D 1 104 ? 10.754  -13.510 -2.574  1.00 14.51  ? 104 VAL D CA  1 
ATOM   8749  C  C   . VAL D 1 104 ? 11.407  -13.663 -3.961  1.00 16.05  ? 104 VAL D C   1 
ATOM   8750  O  O   . VAL D 1 104 ? 12.412  -13.041 -4.263  1.00 17.23  ? 104 VAL D O   1 
ATOM   8751  C  CB  . VAL D 1 104 ? 11.306  -14.523 -1.538  1.00 14.29  ? 104 VAL D CB  1 
ATOM   8752  C  CG1 . VAL D 1 104 ? 12.827  -14.508 -1.484  1.00 13.16  ? 104 VAL D CG1 1 
ATOM   8753  C  CG2 . VAL D 1 104 ? 10.693  -14.261 -0.145  1.00 13.43  ? 104 VAL D CG2 1 
ATOM   8754  N  N   . VAL D 1 105 ? 10.824  -14.477 -4.817  1.00 16.46  ? 105 VAL D N   1 
ATOM   8755  C  CA  . VAL D 1 105 ? 11.336  -14.581 -6.181  1.00 17.50  ? 105 VAL D CA  1 
ATOM   8756  C  C   . VAL D 1 105 ? 11.336  -13.235 -6.904  1.00 18.08  ? 105 VAL D C   1 
ATOM   8757  O  O   . VAL D 1 105 ? 12.337  -12.890 -7.545  1.00 18.88  ? 105 VAL D O   1 
ATOM   8758  C  CB  . VAL D 1 105 ? 10.566  -15.644 -7.014  1.00 17.07  ? 105 VAL D CB  1 
ATOM   8759  C  CG1 . VAL D 1 105 ? 11.043  -15.638 -8.469  1.00 17.19  ? 105 VAL D CG1 1 
ATOM   8760  C  CG2 . VAL D 1 105 ? 10.768  -17.034 -6.401  1.00 15.28  ? 105 VAL D CG2 1 
ATOM   8761  N  N   . SER D 1 106 ? 10.260  -12.458 -6.779  1.00 18.53  ? 106 SER D N   1 
ATOM   8762  C  CA  . SER D 1 106 ? 10.224  -11.123 -7.424  1.00 20.45  ? 106 SER D CA  1 
ATOM   8763  C  C   . SER D 1 106 ? 11.249  -10.117 -6.938  1.00 21.10  ? 106 SER D C   1 
ATOM   8764  O  O   . SER D 1 106 ? 11.643  -9.249  -7.697  1.00 23.13  ? 106 SER D O   1 
ATOM   8765  C  CB  . SER D 1 106 ? 8.846   -10.490 -7.318  1.00 20.53  ? 106 SER D CB  1 
ATOM   8766  O  OG  . SER D 1 106 ? 7.877   -11.444 -7.685  1.00 25.10  ? 106 SER D OG  1 
ATOM   8767  N  N   . TYR D 1 107 ? 11.649  -10.206 -5.673  1.00 21.75  ? 107 TYR D N   1 
ATOM   8768  C  CA  . TYR D 1 107 ? 12.527  -9.235  -5.039  1.00 21.12  ? 107 TYR D CA  1 
ATOM   8769  C  C   . TYR D 1 107 ? 13.542  -9.955  -4.130  1.00 22.36  ? 107 TYR D C   1 
ATOM   8770  O  O   . TYR D 1 107 ? 13.602  -9.726  -2.897  1.00 21.64  ? 107 TYR D O   1 
ATOM   8771  C  CB  . TYR D 1 107 ? 11.685  -8.237  -4.238  1.00 23.11  ? 107 TYR D CB  1 
ATOM   8772  C  CG  . TYR D 1 107 ? 10.640  -7.540  -5.080  1.00 24.10  ? 107 TYR D CG  1 
ATOM   8773  C  CD1 . TYR D 1 107 ? 10.964  -6.402  -5.813  1.00 24.09  ? 107 TYR D CD1 1 
ATOM   8774  C  CD2 . TYR D 1 107 ? 9.326   -8.030  -5.153  1.00 25.85  ? 107 TYR D CD2 1 
ATOM   8775  C  CE1 . TYR D 1 107 ? 10.020  -5.768  -6.604  1.00 24.69  ? 107 TYR D CE1 1 
ATOM   8776  C  CE2 . TYR D 1 107 ? 8.361   -7.406  -5.949  1.00 24.56  ? 107 TYR D CE2 1 
ATOM   8777  C  CZ  . TYR D 1 107 ? 8.728   -6.276  -6.667  1.00 25.90  ? 107 TYR D CZ  1 
ATOM   8778  O  OH  . TYR D 1 107 ? 7.818   -5.643  -7.466  1.00 28.69  ? 107 TYR D OH  1 
ATOM   8779  N  N   . PRO D 1 108 ? 14.379  -10.813 -4.727  1.00 21.50  ? 108 PRO D N   1 
ATOM   8780  C  CA  . PRO D 1 108 ? 15.227  -11.657 -3.883  1.00 20.93  ? 108 PRO D CA  1 
ATOM   8781  C  C   . PRO D 1 108 ? 16.295  -10.908 -3.081  1.00 20.39  ? 108 PRO D C   1 
ATOM   8782  O  O   . PRO D 1 108 ? 16.950  -11.488 -2.237  1.00 18.57  ? 108 PRO D O   1 
ATOM   8783  C  CB  . PRO D 1 108 ? 15.889  -12.592 -4.895  1.00 20.91  ? 108 PRO D CB  1 
ATOM   8784  C  CG  . PRO D 1 108 ? 15.990  -11.728 -6.125  1.00 21.25  ? 108 PRO D CG  1 
ATOM   8785  C  CD  . PRO D 1 108 ? 14.720  -10.931 -6.154  1.00 20.26  ? 108 PRO D CD  1 
ATOM   8786  N  N   . ARG D 1 109 ? 16.491  -9.632  -3.325  1.00 22.51  ? 109 ARG D N   1 
ATOM   8787  C  CA  . ARG D 1 109 ? 17.535  -8.952  -2.555  1.00 24.19  ? 109 ARG D CA  1 
ATOM   8788  C  C   . ARG D 1 109 ? 16.931  -8.010  -1.483  1.00 22.86  ? 109 ARG D C   1 
ATOM   8789  O  O   . ARG D 1 109 ? 17.656  -7.382  -0.712  1.00 23.26  ? 109 ARG D O   1 
ATOM   8790  C  CB  . ARG D 1 109 ? 18.489  -8.210  -3.515  1.00 28.46  ? 109 ARG D CB  1 
ATOM   8791  C  CG  . ARG D 1 109 ? 17.803  -7.137  -4.331  1.00 35.61  ? 109 ARG D CG  1 
ATOM   8792  C  CD  . ARG D 1 109 ? 18.599  -6.696  -5.555  1.00 47.00  ? 109 ARG D CD  1 
ATOM   8793  N  NE  . ARG D 1 109 ? 17.767  -5.946  -6.516  1.00 48.67  ? 109 ARG D NE  1 
ATOM   8794  C  CZ  . ARG D 1 109 ? 18.036  -5.842  -7.824  1.00 52.37  ? 109 ARG D CZ  1 
ATOM   8795  N  NH1 . ARG D 1 109 ? 19.112  -6.434  -8.348  1.00 53.53  ? 109 ARG D NH1 1 
ATOM   8796  N  NH2 . ARG D 1 109 ? 17.227  -5.149  -8.619  1.00 53.13  ? 109 ARG D NH2 1 
ATOM   8797  N  N   . ARG D 1 110 ? 15.604  -7.940  -1.441  1.00 21.02  ? 110 ARG D N   1 
ATOM   8798  C  CA  . ARG D 1 110 ? 14.895  -7.143  -0.459  1.00 20.55  ? 110 ARG D CA  1 
ATOM   8799  C  C   . ARG D 1 110 ? 14.119  -7.973  0.544   1.00 18.32  ? 110 ARG D C   1 
ATOM   8800  O  O   . ARG D 1 110 ? 13.787  -7.479  1.616   1.00 16.69  ? 110 ARG D O   1 
ATOM   8801  C  CB  . ARG D 1 110 ? 13.933  -6.151  -1.154  1.00 20.87  ? 110 ARG D CB  1 
ATOM   8802  C  CG  . ARG D 1 110 ? 14.579  -5.257  -2.230  1.00 22.30  ? 110 ARG D CG  1 
ATOM   8803  C  CD  . ARG D 1 110 ? 15.724  -4.366  -1.698  1.00 22.77  ? 110 ARG D CD  1 
ATOM   8804  N  NE  . ARG D 1 110 ? 15.335  -3.475  -0.596  1.00 20.72  ? 110 ARG D NE  1 
ATOM   8805  C  CZ  . ARG D 1 110 ? 14.966  -2.198  -0.731  1.00 20.03  ? 110 ARG D CZ  1 
ATOM   8806  N  NH1 . ARG D 1 110 ? 14.925  -1.633  -1.914  1.00 19.22  ? 110 ARG D NH1 1 
ATOM   8807  N  NH2 . ARG D 1 110 ? 14.642  -1.469  0.334   1.00 19.22  ? 110 ARG D NH2 1 
ATOM   8808  N  N   . PHE D 1 111 ? 13.802  -9.218  0.194   1.00 16.99  ? 111 PHE D N   1 
ATOM   8809  C  CA  . PHE D 1 111 ? 13.037  -10.088 1.099   1.00 15.37  ? 111 PHE D CA  1 
ATOM   8810  C  C   . PHE D 1 111 ? 13.677  -11.455 1.268   1.00 15.71  ? 111 PHE D C   1 
ATOM   8811  O  O   . PHE D 1 111 ? 14.281  -11.992 0.326   1.00 16.37  ? 111 PHE D O   1 
ATOM   8812  C  CB  . PHE D 1 111 ? 11.631  -10.332 0.574   1.00 15.39  ? 111 PHE D CB  1 
ATOM   8813  C  CG  . PHE D 1 111 ? 10.838  -9.108  0.377   1.00 15.30  ? 111 PHE D CG  1 
ATOM   8814  C  CD1 . PHE D 1 111 ? 10.632  -8.213  1.432   1.00 15.94  ? 111 PHE D CD1 1 
ATOM   8815  C  CD2 . PHE D 1 111 ? 10.239  -8.861  -0.830  1.00 15.25  ? 111 PHE D CD2 1 
ATOM   8816  C  CE1 . PHE D 1 111 ? 9.890   -7.054  1.253   1.00 15.45  ? 111 PHE D CE1 1 
ATOM   8817  C  CE2 . PHE D 1 111 ? 9.493   -7.692  -1.021  1.00 15.74  ? 111 PHE D CE2 1 
ATOM   8818  C  CZ  . PHE D 1 111 ? 9.322   -6.790  0.025   1.00 15.77  ? 111 PHE D CZ  1 
ATOM   8819  N  N   . VAL D 1 112 ? 13.534  -12.020 2.464   1.00 14.86  ? 112 VAL D N   1 
ATOM   8820  C  CA  . VAL D 1 112 ? 13.590  -13.466 2.632   1.00 14.22  ? 112 VAL D CA  1 
ATOM   8821  C  C   . VAL D 1 112 ? 12.332  -13.970 3.329   1.00 13.80  ? 112 VAL D C   1 
ATOM   8822  O  O   . VAL D 1 112 ? 11.584  -13.186 3.934   1.00 13.73  ? 112 VAL D O   1 
ATOM   8823  C  CB  . VAL D 1 112 ? 14.810  -13.949 3.422   1.00 14.23  ? 112 VAL D CB  1 
ATOM   8824  C  CG1 . VAL D 1 112 ? 16.110  -13.455 2.793   1.00 13.55  ? 112 VAL D CG1 1 
ATOM   8825  C  CG2 . VAL D 1 112 ? 14.673  -13.615 4.903   1.00 13.97  ? 112 VAL D CG2 1 
ATOM   8826  N  N   . GLY D 1 113 ? 12.103  -15.275 3.257   1.00 12.85  ? 113 GLY D N   1 
ATOM   8827  C  CA  . GLY D 1 113 ? 10.870  -15.801 3.750   1.00 13.25  ? 113 GLY D CA  1 
ATOM   8828  C  C   . GLY D 1 113 ? 11.011  -16.642 4.998   1.00 13.60  ? 113 GLY D C   1 
ATOM   8829  O  O   . GLY D 1 113 ? 11.932  -17.444 5.103   1.00 12.78  ? 113 GLY D O   1 
ATOM   8830  N  N   . LEU D 1 114 ? 10.082  -16.464 5.936   1.00 14.57  ? 114 LEU D N   1 
ATOM   8831  C  CA  . LEU D 1 114 ? 9.995   -17.335 7.105   1.00 15.76  ? 114 LEU D CA  1 
ATOM   8832  C  C   . LEU D 1 114 ? 8.677   -18.029 6.997   1.00 16.65  ? 114 LEU D C   1 
ATOM   8833  O  O   . LEU D 1 114 ? 7.665   -17.373 7.156   1.00 19.88  ? 114 LEU D O   1 
ATOM   8834  C  CB  . LEU D 1 114 ? 10.032  -16.538 8.411   1.00 16.92  ? 114 LEU D CB  1 
ATOM   8835  C  CG  . LEU D 1 114 ? 11.310  -15.732 8.737   1.00 17.50  ? 114 LEU D CG  1 
ATOM   8836  C  CD1 . LEU D 1 114 ? 11.269  -15.138 10.136  1.00 18.30  ? 114 LEU D CD1 1 
ATOM   8837  C  CD2 . LEU D 1 114 ? 12.533  -16.623 8.610   1.00 17.87  ? 114 LEU D CD2 1 
ATOM   8838  N  N   . GLY D 1 115 ? 8.671   -19.331 6.726   1.00 15.32  ? 115 GLY D N   1 
ATOM   8839  C  CA  . GLY D 1 115 ? 7.412   -20.001 6.519   1.00 16.85  ? 115 GLY D CA  1 
ATOM   8840  C  C   . GLY D 1 115 ? 6.628   -20.410 7.770   1.00 16.66  ? 115 GLY D C   1 
ATOM   8841  O  O   . GLY D 1 115 ? 7.028   -20.175 8.889   1.00 15.30  ? 115 GLY D O   1 
ATOM   8842  N  N   . THR D 1 116 ? 5.492   -21.041 7.560   1.00 18.74  ? 116 THR D N   1 
ATOM   8843  C  CA  . THR D 1 116 ? 4.652   -21.474 8.672   1.00 20.82  ? 116 THR D CA  1 
ATOM   8844  C  C   . THR D 1 116 ? 4.315   -22.956 8.576   1.00 19.32  ? 116 THR D C   1 
ATOM   8845  O  O   . THR D 1 116 ? 4.306   -23.495 7.464   1.00 17.51  ? 116 THR D O   1 
ATOM   8846  C  CB  . THR D 1 116 ? 3.398   -20.600 8.752   1.00 24.03  ? 116 THR D CB  1 
ATOM   8847  O  OG1 . THR D 1 116 ? 2.825   -20.745 10.053  1.00 30.62  ? 116 THR D OG1 1 
ATOM   8848  C  CG2 . THR D 1 116 ? 2.377   -20.963 7.654   1.00 24.50  ? 116 THR D CG2 1 
ATOM   8849  N  N   . LEU D 1 117 ? 4.067   -23.610 9.727   1.00 17.83  ? 117 LEU D N   1 
ATOM   8850  C  CA  . LEU D 1 117 ? 3.981   -25.094 9.829   1.00 16.29  ? 117 LEU D CA  1 
ATOM   8851  C  C   . LEU D 1 117 ? 2.738   -25.555 10.566  1.00 16.80  ? 117 LEU D C   1 
ATOM   8852  O  O   . LEU D 1 117 ? 2.296   -24.864 11.484  1.00 14.93  ? 117 LEU D O   1 
ATOM   8853  C  CB  . LEU D 1 117 ? 5.181   -25.653 10.612  1.00 16.13  ? 117 LEU D CB  1 
ATOM   8854  C  CG  . LEU D 1 117 ? 6.638   -25.330 10.237  1.00 16.01  ? 117 LEU D CG  1 
ATOM   8855  C  CD1 . LEU D 1 117 ? 7.574   -25.863 11.296  1.00 16.36  ? 117 LEU D CD1 1 
ATOM   8856  C  CD2 . LEU D 1 117 ? 6.962   -25.955 8.906   1.00 14.57  ? 117 LEU D CD2 1 
ATOM   8857  N  N   . PRO D 1 118 ? 2.187   -26.748 10.196  1.00 17.09  ? 118 PRO D N   1 
ATOM   8858  C  CA  . PRO D 1 118 ? 1.115   -27.346 10.979  1.00 18.03  ? 118 PRO D CA  1 
ATOM   8859  C  C   . PRO D 1 118 ? 1.746   -28.022 12.192  1.00 18.80  ? 118 PRO D C   1 
ATOM   8860  O  O   . PRO D 1 118 ? 2.003   -29.249 12.211  1.00 19.03  ? 118 PRO D O   1 
ATOM   8861  C  CB  . PRO D 1 118 ? 0.507   -28.384 10.014  1.00 18.76  ? 118 PRO D CB  1 
ATOM   8862  C  CG  . PRO D 1 118 ? 1.677   -28.838 9.205   1.00 17.95  ? 118 PRO D CG  1 
ATOM   8863  C  CD  . PRO D 1 118 ? 2.540   -27.591 9.030   1.00 17.43  ? 118 PRO D CD  1 
ATOM   8864  N  N   . MET D 1 119 ? 2.056   -27.206 13.186  1.00 18.50  ? 119 MET D N   1 
ATOM   8865  C  CA  . MET D 1 119 ? 2.773   -27.696 14.344  1.00 18.52  ? 119 MET D CA  1 
ATOM   8866  C  C   . MET D 1 119 ? 1.991   -28.752 15.161  1.00 18.45  ? 119 MET D C   1 
ATOM   8867  O  O   . MET D 1 119 ? 2.599   -29.522 15.912  1.00 18.59  ? 119 MET D O   1 
ATOM   8868  C  CB  . MET D 1 119 ? 3.142   -26.517 15.219  1.00 18.83  ? 119 MET D CB  1 
ATOM   8869  C  CG  . MET D 1 119 ? 4.243   -25.665 14.622  1.00 21.25  ? 119 MET D CG  1 
ATOM   8870  S  SD  . MET D 1 119 ? 5.820   -26.575 14.530  1.00 23.13  ? 119 MET D SD  1 
ATOM   8871  C  CE  . MET D 1 119 ? 6.078   -26.770 16.302  1.00 22.21  ? 119 MET D CE  1 
ATOM   8872  N  N   . GLN D 1 120 ? 0.664   -28.788 15.044  1.00 17.82  ? 120 GLN D N   1 
ATOM   8873  C  CA  . GLN D 1 120 ? -0.133  -29.727 15.849  1.00 19.41  ? 120 GLN D CA  1 
ATOM   8874  C  C   . GLN D 1 120 ? -0.022  -31.182 15.356  1.00 19.99  ? 120 GLN D C   1 
ATOM   8875  O  O   . GLN D 1 120 ? -0.439  -32.144 16.040  1.00 20.25  ? 120 GLN D O   1 
ATOM   8876  C  CB  . GLN D 1 120 ? -1.597  -29.328 15.886  1.00 19.56  ? 120 GLN D CB  1 
ATOM   8877  C  CG  . GLN D 1 120 ? -2.333  -29.610 14.560  1.00 19.66  ? 120 GLN D CG  1 
ATOM   8878  C  CD  . GLN D 1 120 ? -2.375  -28.409 13.668  1.00 19.75  ? 120 GLN D CD  1 
ATOM   8879  O  OE1 . GLN D 1 120 ? -1.362  -27.758 13.440  1.00 20.89  ? 120 GLN D OE1 1 
ATOM   8880  N  NE2 . GLN D 1 120 ? -3.549  -28.106 13.145  1.00 21.31  ? 120 GLN D NE2 1 
ATOM   8881  N  N   . ALA D 1 121 ? 0.514   -31.315 14.154  1.00 21.59  ? 121 ALA D N   1 
ATOM   8882  C  CA  . ALA D 1 121 ? 0.816   -32.599 13.565  1.00 24.01  ? 121 ALA D CA  1 
ATOM   8883  C  C   . ALA D 1 121 ? 2.307   -32.655 13.227  1.00 24.11  ? 121 ALA D C   1 
ATOM   8884  O  O   . ALA D 1 121 ? 2.708   -32.279 12.147  1.00 23.79  ? 121 ALA D O   1 
ATOM   8885  C  CB  . ALA D 1 121 ? -0.033  -32.820 12.333  1.00 23.23  ? 121 ALA D CB  1 
ATOM   8886  N  N   . PRO D 1 122 ? 3.122   -33.134 14.171  1.00 25.56  ? 122 PRO D N   1 
ATOM   8887  C  CA  . PRO D 1 122 ? 4.573   -33.260 13.974  1.00 26.03  ? 122 PRO D CA  1 
ATOM   8888  C  C   . PRO D 1 122 ? 5.029   -33.928 12.683  1.00 27.88  ? 122 PRO D C   1 
ATOM   8889  O  O   . PRO D 1 122 ? 5.799   -33.308 11.961  1.00 28.43  ? 122 PRO D O   1 
ATOM   8890  C  CB  . PRO D 1 122 ? 5.030   -34.009 15.211  1.00 24.84  ? 122 PRO D CB  1 
ATOM   8891  C  CG  . PRO D 1 122 ? 4.077   -33.453 16.260  1.00 27.94  ? 122 PRO D CG  1 
ATOM   8892  C  CD  . PRO D 1 122 ? 2.733   -33.464 15.553  1.00 25.60  ? 122 PRO D CD  1 
ATOM   8893  N  N   . GLU D 1 123 ? 4.566   -35.135 12.357  1.00 30.78  ? 123 GLU D N   1 
ATOM   8894  C  CA  . GLU D 1 123 ? 5.047   -35.766 11.123  1.00 32.77  ? 123 GLU D CA  1 
ATOM   8895  C  C   . GLU D 1 123 ? 4.806   -34.823 9.919   1.00 31.85  ? 123 GLU D C   1 
ATOM   8896  O  O   . GLU D 1 123 ? 5.685   -34.652 9.075   1.00 29.96  ? 123 GLU D O   1 
ATOM   8897  C  CB  . GLU D 1 123 ? 4.436   -37.152 10.869  1.00 39.02  ? 123 GLU D CB  1 
ATOM   8898  C  CG  . GLU D 1 123 ? 5.381   -38.120 10.126  1.00 45.26  ? 123 GLU D CG  1 
ATOM   8899  C  CD  . GLU D 1 123 ? 4.820   -38.745 8.829   1.00 53.69  ? 123 GLU D CD  1 
ATOM   8900  O  OE1 . GLU D 1 123 ? 4.371   -37.999 7.905   1.00 57.67  ? 123 GLU D OE1 1 
ATOM   8901  O  OE2 . GLU D 1 123 ? 4.864   -40.000 8.701   1.00 56.44  ? 123 GLU D OE2 1 
ATOM   8902  N  N   . LEU D 1 124 ? 3.640   -34.189 9.853   1.00 29.71  ? 124 LEU D N   1 
ATOM   8903  C  CA  . LEU D 1 124 ? 3.371   -33.260 8.742   1.00 28.28  ? 124 LEU D CA  1 
ATOM   8904  C  C   . LEU D 1 124 ? 4.217   -31.971 8.804   1.00 25.88  ? 124 LEU D C   1 
ATOM   8905  O  O   . LEU D 1 124 ? 4.599   -31.433 7.775   1.00 25.13  ? 124 LEU D O   1 
ATOM   8906  C  CB  . LEU D 1 124 ? 1.891   -32.927 8.653   1.00 26.59  ? 124 LEU D CB  1 
ATOM   8907  C  CG  . LEU D 1 124 ? 0.882   -34.061 8.483   1.00 29.12  ? 124 LEU D CG  1 
ATOM   8908  C  CD1 . LEU D 1 124 ? -0.529  -33.475 8.651   1.00 28.33  ? 124 LEU D CD1 1 
ATOM   8909  C  CD2 . LEU D 1 124 ? 1.064   -34.795 7.151   1.00 25.41  ? 124 LEU D CD2 1 
ATOM   8910  N  N   . ALA D 1 125 ? 4.536   -31.499 10.001  1.00 23.34  ? 125 ALA D N   1 
ATOM   8911  C  CA  . ALA D 1 125 ? 5.348   -30.289 10.117  1.00 22.60  ? 125 ALA D CA  1 
ATOM   8912  C  C   . ALA D 1 125 ? 6.776   -30.535 9.621   1.00 20.97  ? 125 ALA D C   1 
ATOM   8913  O  O   . ALA D 1 125 ? 7.354   -29.682 8.977   1.00 19.05  ? 125 ALA D O   1 
ATOM   8914  C  CB  . ALA D 1 125 ? 5.350   -29.750 11.549  1.00 21.56  ? 125 ALA D CB  1 
ATOM   8915  N  N   . VAL D 1 126 ? 7.338   -31.700 9.916   1.00 22.17  ? 126 VAL D N   1 
ATOM   8916  C  CA  . VAL D 1 126 ? 8.668   -32.071 9.387   1.00 24.44  ? 126 VAL D CA  1 
ATOM   8917  C  C   . VAL D 1 126 ? 8.649   -32.053 7.859   1.00 25.39  ? 126 VAL D C   1 
ATOM   8918  O  O   . VAL D 1 126 ? 9.491   -31.423 7.239   1.00 25.74  ? 126 VAL D O   1 
ATOM   8919  C  CB  . VAL D 1 126 ? 9.188   -33.440 9.948   1.00 23.98  ? 126 VAL D CB  1 
ATOM   8920  C  CG1 . VAL D 1 126 ? 10.338  -33.987 9.110   1.00 23.51  ? 126 VAL D CG1 1 
ATOM   8921  C  CG2 . VAL D 1 126 ? 9.649   -33.279 11.390  1.00 21.16  ? 126 VAL D CG2 1 
ATOM   8922  N  N   . LYS D 1 127 ? 7.658   -32.703 7.261   1.00 28.68  ? 127 LYS D N   1 
ATOM   8923  C  CA  . LYS D 1 127 ? 7.496   -32.682 5.812   1.00 31.97  ? 127 LYS D CA  1 
ATOM   8924  C  C   . LYS D 1 127 ? 7.468   -31.271 5.217   1.00 29.89  ? 127 LYS D C   1 
ATOM   8925  O  O   . LYS D 1 127 ? 8.195   -30.984 4.253   1.00 31.64  ? 127 LYS D O   1 
ATOM   8926  C  CB  . LYS D 1 127 ? 6.232   -33.443 5.408   1.00 38.33  ? 127 LYS D CB  1 
ATOM   8927  C  CG  . LYS D 1 127 ? 6.484   -34.832 4.846   1.00 45.61  ? 127 LYS D CG  1 
ATOM   8928  C  CD  . LYS D 1 127 ? 7.142   -34.752 3.465   1.00 50.46  ? 127 LYS D CD  1 
ATOM   8929  C  CE  . LYS D 1 127 ? 6.912   -36.017 2.644   1.00 49.80  ? 127 LYS D CE  1 
ATOM   8930  N  NZ  . LYS D 1 127 ? 6.407   -35.620 1.294   1.00 49.62  ? 127 LYS D NZ  1 
ATOM   8931  N  N   . GLU D 1 128 ? 6.647   -30.389 5.783   1.00 26.61  ? 128 GLU D N   1 
ATOM   8932  C  CA  . GLU D 1 128 ? 6.487   -29.043 5.208   1.00 26.88  ? 128 GLU D CA  1 
ATOM   8933  C  C   . GLU D 1 128 ? 7.743   -28.204 5.441   1.00 28.31  ? 128 GLU D C   1 
ATOM   8934  O  O   . GLU D 1 128 ? 8.068   -27.299 4.637   1.00 25.95  ? 128 GLU D O   1 
ATOM   8935  C  CB  . GLU D 1 128 ? 5.244   -28.318 5.746   1.00 25.47  ? 128 GLU D CB  1 
ATOM   8936  C  CG  . GLU D 1 128 ? 5.023   -26.898 5.228   1.00 25.20  ? 128 GLU D CG  1 
ATOM   8937  C  CD  . GLU D 1 128 ? 4.820   -26.822 3.702   1.00 27.27  ? 128 GLU D CD  1 
ATOM   8938  O  OE1 . GLU D 1 128 ? 4.837   -27.883 3.014   1.00 27.78  ? 128 GLU D OE1 1 
ATOM   8939  O  OE2 . GLU D 1 128 ? 4.647   -25.697 3.180   1.00 24.42  ? 128 GLU D OE2 1 
ATOM   8940  N  N   . MET D 1 129 ? 8.463   -28.508 6.518   1.00 26.34  ? 129 MET D N   1 
ATOM   8941  C  CA  . MET D 1 129 ? 9.734   -27.802 6.742   1.00 28.68  ? 129 MET D CA  1 
ATOM   8942  C  C   . MET D 1 129 ? 10.790  -28.153 5.668   1.00 26.78  ? 129 MET D C   1 
ATOM   8943  O  O   . MET D 1 129 ? 11.452  -27.266 5.145   1.00 26.72  ? 129 MET D O   1 
ATOM   8944  C  CB  . MET D 1 129 ? 10.246  -27.996 8.157   1.00 26.95  ? 129 MET D CB  1 
ATOM   8945  C  CG  . MET D 1 129 ? 11.497  -27.227 8.469   1.00 29.87  ? 129 MET D CG  1 
ATOM   8946  S  SD  . MET D 1 129 ? 12.219  -27.887 9.995   1.00 32.74  ? 129 MET D SD  1 
ATOM   8947  C  CE  . MET D 1 129 ? 11.324  -26.903 11.179  1.00 29.88  ? 129 MET D CE  1 
ATOM   8948  N  N   . GLU D 1 130 ? 10.893  -29.419 5.296   1.00 27.52  ? 130 GLU D N   1 
ATOM   8949  C  CA  . GLU D 1 130 ? 11.829  -29.839 4.231   1.00 28.38  ? 130 GLU D CA  1 
ATOM   8950  C  C   . GLU D 1 130 ? 11.473  -29.126 2.930   1.00 27.19  ? 130 GLU D C   1 
ATOM   8951  O  O   . GLU D 1 130 ? 12.327  -28.510 2.260   1.00 24.37  ? 130 GLU D O   1 
ATOM   8952  C  CB  . GLU D 1 130 ? 11.766  -31.349 4.004   1.00 31.84  ? 130 GLU D CB  1 
ATOM   8953  C  CG  . GLU D 1 130 ? 12.103  -32.188 5.230   1.00 38.65  ? 130 GLU D CG  1 
ATOM   8954  C  CD  . GLU D 1 130 ? 11.701  -33.650 5.080   1.00 46.92  ? 130 GLU D CD  1 
ATOM   8955  O  OE1 . GLU D 1 130 ? 11.370  -34.058 3.935   1.00 57.87  ? 130 GLU D OE1 1 
ATOM   8956  O  OE2 . GLU D 1 130 ? 11.708  -34.393 6.098   1.00 46.12  ? 130 GLU D OE2 1 
ATOM   8957  N  N   . ARG D 1 131 ? 10.188  -29.180 2.607   1.00 24.65  ? 131 ARG D N   1 
ATOM   8958  C  CA  . ARG D 1 131 ? 9.663   -28.504 1.440   1.00 24.59  ? 131 ARG D CA  1 
ATOM   8959  C  C   . ARG D 1 131 ? 10.067  -27.019 1.465   1.00 24.96  ? 131 ARG D C   1 
ATOM   8960  O  O   . ARG D 1 131 ? 10.616  -26.522 0.487   1.00 25.33  ? 131 ARG D O   1 
ATOM   8961  C  CB  . ARG D 1 131 ? 8.155   -28.688 1.410   1.00 25.51  ? 131 ARG D CB  1 
ATOM   8962  C  CG  . ARG D 1 131 ? 7.514   -28.819 0.044   1.00 27.57  ? 131 ARG D CG  1 
ATOM   8963  C  CD  . ARG D 1 131 ? 6.109   -28.227 0.090   1.00 28.28  ? 131 ARG D CD  1 
ATOM   8964  N  NE  . ARG D 1 131 ? 6.083   -27.153 -0.897  1.00 30.30  ? 131 ARG D NE  1 
ATOM   8965  C  CZ  . ARG D 1 131 ? 5.369   -26.039 -0.847  1.00 26.26  ? 131 ARG D CZ  1 
ATOM   8966  N  NH1 . ARG D 1 131 ? 4.536   -25.741 0.150   1.00 24.50  ? 131 ARG D NH1 1 
ATOM   8967  N  NH2 . ARG D 1 131 ? 5.500   -25.219 -1.850  1.00 26.34  ? 131 ARG D NH2 1 
ATOM   8968  N  N   . CYS D 1 132 ? 9.828   -26.332 2.590   1.00 25.40  ? 132 CYS D N   1 
ATOM   8969  C  CA  . CYS D 1 132 ? 10.225  -24.914 2.776   1.00 24.48  ? 132 CYS D CA  1 
ATOM   8970  C  C   . CYS D 1 132 ? 11.704  -24.624 2.589   1.00 23.34  ? 132 CYS D C   1 
ATOM   8971  O  O   . CYS D 1 132 ? 12.062  -23.600 2.040   1.00 22.85  ? 132 CYS D O   1 
ATOM   8972  C  CB  . CYS D 1 132 ? 9.836   -24.418 4.171   1.00 24.70  ? 132 CYS D CB  1 
ATOM   8973  S  SG  . CYS D 1 132 ? 8.118   -23.901 4.290   1.00 26.65  ? 132 CYS D SG  1 
ATOM   8974  N  N   . VAL D 1 133 ? 12.554  -25.508 3.085   1.00 22.85  ? 133 VAL D N   1 
ATOM   8975  C  CA  . VAL D 1 133 ? 13.982  -25.283 3.041   1.00 23.87  ? 133 VAL D CA  1 
ATOM   8976  C  C   . VAL D 1 133 ? 14.535  -25.651 1.665   1.00 23.96  ? 133 VAL D C   1 
ATOM   8977  O  O   . VAL D 1 133 ? 15.238  -24.862 1.054   1.00 25.55  ? 133 VAL D O   1 
ATOM   8978  C  CB  . VAL D 1 133 ? 14.729  -26.060 4.170   1.00 23.72  ? 133 VAL D CB  1 
ATOM   8979  C  CG1 . VAL D 1 133 ? 16.225  -25.860 4.036   1.00 22.77  ? 133 VAL D CG1 1 
ATOM   8980  C  CG2 . VAL D 1 133 ? 14.275  -25.612 5.563   1.00 22.33  ? 133 VAL D CG2 1 
ATOM   8981  N  N   . LYS D 1 134 ? 14.214  -26.845 1.187   1.00 25.97  ? 134 LYS D N   1 
ATOM   8982  C  CA  . LYS D 1 134 ? 14.766  -27.381 -0.065  1.00 27.99  ? 134 LYS D CA  1 
ATOM   8983  C  C   . LYS D 1 134 ? 14.127  -26.801 -1.298  1.00 28.05  ? 134 LYS D C   1 
ATOM   8984  O  O   . LYS D 1 134 ? 14.830  -26.359 -2.199  1.00 30.99  ? 134 LYS D O   1 
ATOM   8985  C  CB  . LYS D 1 134 ? 14.675  -28.916 -0.116  1.00 32.43  ? 134 LYS D CB  1 
ATOM   8986  C  CG  . LYS D 1 134 ? 15.408  -29.630 1.023   1.00 36.67  ? 134 LYS D CG  1 
ATOM   8987  C  CD  . LYS D 1 134 ? 16.928  -29.447 0.921   1.00 37.46  ? 134 LYS D CD  1 
ATOM   8988  C  CE  . LYS D 1 134 ? 17.671  -30.139 2.070   1.00 40.79  ? 134 LYS D CE  1 
ATOM   8989  N  NZ  . LYS D 1 134 ? 17.221  -31.535 2.383   1.00 36.26  ? 134 LYS D NZ  1 
ATOM   8990  N  N   . GLU D 1 135 ? 12.804  -26.808 -1.365  1.00 27.35  ? 135 GLU D N   1 
ATOM   8991  C  CA  . GLU D 1 135 ? 12.138  -26.272 -2.552  1.00 28.25  ? 135 GLU D CA  1 
ATOM   8992  C  C   . GLU D 1 135 ? 12.004  -24.746 -2.569  1.00 26.34  ? 135 GLU D C   1 
ATOM   8993  O  O   . GLU D 1 135 ? 12.373  -24.116 -3.551  1.00 24.52  ? 135 GLU D O   1 
ATOM   8994  C  CB  . GLU D 1 135 ? 10.793  -26.960 -2.759  1.00 31.94  ? 135 GLU D CB  1 
ATOM   8995  C  CG  . GLU D 1 135 ? 10.976  -28.413 -3.170  1.00 39.09  ? 135 GLU D CG  1 
ATOM   8996  C  CD  . GLU D 1 135 ? 9.723   -29.256 -2.988  1.00 48.88  ? 135 GLU D CD  1 
ATOM   8997  O  OE1 . GLU D 1 135 ? 8.639   -28.928 -3.567  1.00 53.00  ? 135 GLU D OE1 1 
ATOM   8998  O  OE2 . GLU D 1 135 ? 9.835   -30.276 -2.269  1.00 51.47  ? 135 GLU D OE2 1 
ATOM   8999  N  N   . LEU D 1 136 ? 11.471  -24.145 -1.501  1.00 22.62  ? 136 LEU D N   1 
ATOM   9000  C  CA  . LEU D 1 136 ? 11.176  -22.711 -1.539  1.00 19.59  ? 136 LEU D CA  1 
ATOM   9001  C  C   . LEU D 1 136 ? 12.369  -21.891 -1.145  1.00 19.52  ? 136 LEU D C   1 
ATOM   9002  O  O   . LEU D 1 136 ? 12.404  -20.730 -1.408  1.00 21.89  ? 136 LEU D O   1 
ATOM   9003  C  CB  . LEU D 1 136 ? 9.991   -22.360 -0.641  1.00 19.44  ? 136 LEU D CB  1 
ATOM   9004  C  CG  . LEU D 1 136 ? 8.678   -23.144 -0.884  1.00 18.62  ? 136 LEU D CG  1 
ATOM   9005  C  CD1 . LEU D 1 136 ? 7.606   -22.784 0.139   1.00 16.86  ? 136 LEU D CD1 1 
ATOM   9006  C  CD2 . LEU D 1 136 ? 8.172   -23.002 -2.329  1.00 16.67  ? 136 LEU D CD2 1 
ATOM   9007  N  N   . GLY D 1 137 ? 13.366  -22.481 -0.511  1.00 20.34  ? 137 GLY D N   1 
ATOM   9008  C  CA  . GLY D 1 137 ? 14.570  -21.731 -0.163  1.00 18.74  ? 137 GLY D CA  1 
ATOM   9009  C  C   . GLY D 1 137 ? 14.545  -20.919 1.131   1.00 18.70  ? 137 GLY D C   1 
ATOM   9010  O  O   . GLY D 1 137 ? 15.462  -20.106 1.342   1.00 18.13  ? 137 GLY D O   1 
ATOM   9011  N  N   . PHE D 1 138 ? 13.508  -21.098 1.979   1.00 16.16  ? 138 PHE D N   1 
ATOM   9012  C  CA  . PHE D 1 138 ? 13.419  -20.331 3.244   1.00 14.84  ? 138 PHE D CA  1 
ATOM   9013  C  C   . PHE D 1 138 ? 14.586  -20.679 4.183   1.00 14.03  ? 138 PHE D C   1 
ATOM   9014  O  O   . PHE D 1 138 ? 14.876  -21.828 4.393   1.00 15.36  ? 138 PHE D O   1 
ATOM   9015  C  CB  . PHE D 1 138 ? 12.090  -20.529 3.994   1.00 13.19  ? 138 PHE D CB  1 
ATOM   9016  C  CG  . PHE D 1 138 ? 10.891  -20.098 3.222   1.00 13.76  ? 138 PHE D CG  1 
ATOM   9017  C  CD1 . PHE D 1 138 ? 11.014  -19.309 2.072   1.00 13.31  ? 138 PHE D CD1 1 
ATOM   9018  C  CD2 . PHE D 1 138 ? 9.632   -20.504 3.611   1.00 13.47  ? 138 PHE D CD2 1 
ATOM   9019  C  CE1 . PHE D 1 138 ? 9.899   -18.953 1.350   1.00 13.29  ? 138 PHE D CE1 1 
ATOM   9020  C  CE2 . PHE D 1 138 ? 8.517   -20.134 2.890   1.00 13.12  ? 138 PHE D CE2 1 
ATOM   9021  C  CZ  . PHE D 1 138 ? 8.646   -19.359 1.756   1.00 12.81  ? 138 PHE D CZ  1 
ATOM   9022  N  N   . PRO D 1 139 ? 15.256  -19.681 4.735   1.00 13.50  ? 139 PRO D N   1 
ATOM   9023  C  CA  . PRO D 1 139 ? 16.235  -19.947 5.805   1.00 13.22  ? 139 PRO D CA  1 
ATOM   9024  C  C   . PRO D 1 139 ? 15.626  -20.261 7.180   1.00 13.54  ? 139 PRO D C   1 
ATOM   9025  O  O   . PRO D 1 139 ? 16.370  -20.596 8.082   1.00 13.93  ? 139 PRO D O   1 
ATOM   9026  C  CB  . PRO D 1 139 ? 16.960  -18.624 5.915   1.00 12.90  ? 139 PRO D CB  1 
ATOM   9027  C  CG  . PRO D 1 139 ? 15.871  -17.613 5.588   1.00 13.45  ? 139 PRO D CG  1 
ATOM   9028  C  CD  . PRO D 1 139 ? 15.151  -18.238 4.416   1.00 13.18  ? 139 PRO D CD  1 
ATOM   9029  N  N   . GLY D 1 140 ? 14.310  -20.127 7.361   1.00 13.40  ? 140 GLY D N   1 
ATOM   9030  C  CA  . GLY D 1 140 ? 13.692  -20.436 8.648   1.00 13.27  ? 140 GLY D CA  1 
ATOM   9031  C  C   . GLY D 1 140 ? 12.173  -20.501 8.618   1.00 13.71  ? 140 GLY D C   1 
ATOM   9032  O  O   . GLY D 1 140 ? 11.535  -20.391 7.549   1.00 14.14  ? 140 GLY D O   1 
ATOM   9033  N  N   . VAL D 1 141 ? 11.572  -20.692 9.783   1.00 13.20  ? 141 VAL D N   1 
ATOM   9034  C  CA  . VAL D 1 141 ? 10.129  -20.690 9.870   1.00 13.32  ? 141 VAL D CA  1 
ATOM   9035  C  C   . VAL D 1 141 ? 9.736   -19.889 11.115  1.00 13.81  ? 141 VAL D C   1 
ATOM   9036  O  O   . VAL D 1 141 ? 10.558  -19.686 12.046  1.00 13.73  ? 141 VAL D O   1 
ATOM   9037  C  CB  . VAL D 1 141 ? 9.569   -22.121 10.026  1.00 14.24  ? 141 VAL D CB  1 
ATOM   9038  C  CG1 . VAL D 1 141 ? 9.868   -23.015 8.804   1.00 13.40  ? 141 VAL D CG1 1 
ATOM   9039  C  CG2 . VAL D 1 141 ? 10.112  -22.745 11.311  1.00 14.39  ? 141 VAL D CG2 1 
ATOM   9040  N  N   . GLN D 1 142 ? 8.491   -19.445 11.142  1.00 13.50  ? 142 GLN D N   1 
ATOM   9041  C  CA  . GLN D 1 142 ? 7.955   -18.706 12.288  1.00 13.53  ? 142 GLN D CA  1 
ATOM   9042  C  C   . GLN D 1 142 ? 6.999   -19.676 12.949  1.00 13.37  ? 142 GLN D C   1 
ATOM   9043  O  O   . GLN D 1 142 ? 6.231   -20.320 12.256  1.00 14.07  ? 142 GLN D O   1 
ATOM   9044  C  CB  . GLN D 1 142 ? 7.219   -17.444 11.817  1.00 13.47  ? 142 GLN D CB  1 
ATOM   9045  C  CG  . GLN D 1 142 ? 6.369   -16.713 12.865  1.00 14.38  ? 142 GLN D CG  1 
ATOM   9046  C  CD  . GLN D 1 142 ? 5.577   -15.541 12.275  1.00 15.49  ? 142 GLN D CD  1 
ATOM   9047  O  OE1 . GLN D 1 142 ? 4.783   -15.704 11.296  1.00 16.92  ? 142 GLN D OE1 1 
ATOM   9048  N  NE2 . GLN D 1 142 ? 5.785   -14.360 12.828  1.00 13.89  ? 142 GLN D NE2 1 
ATOM   9049  N  N   . ILE D 1 143 ? 7.077   -19.835 14.261  1.00 12.55  ? 143 ILE D N   1 
ATOM   9050  C  CA  . ILE D 1 143 ? 6.127   -20.691 14.956  1.00 13.08  ? 143 ILE D CA  1 
ATOM   9051  C  C   . ILE D 1 143 ? 5.596   -19.903 16.139  1.00 13.24  ? 143 ILE D C   1 
ATOM   9052  O  O   . ILE D 1 143 ? 6.150   -18.860 16.477  1.00 13.75  ? 143 ILE D O   1 
ATOM   9053  C  CB  . ILE D 1 143 ? 6.774   -22.010 15.417  1.00 12.91  ? 143 ILE D CB  1 
ATOM   9054  C  CG1 . ILE D 1 143 ? 7.939   -21.683 16.358  1.00 12.84  ? 143 ILE D CG1 1 
ATOM   9055  C  CG2 . ILE D 1 143 ? 7.297   -22.826 14.212  1.00 11.87  ? 143 ILE D CG2 1 
ATOM   9056  C  CD1 . ILE D 1 143 ? 8.774   -22.866 16.751  1.00 12.89  ? 143 ILE D CD1 1 
ATOM   9057  N  N   . GLY D 1 144 ? 4.512   -20.387 16.730  1.00 13.39  ? 144 GLY D N   1 
ATOM   9058  C  CA  . GLY D 1 144 ? 3.939   -19.819 17.927  1.00 13.07  ? 144 GLY D CA  1 
ATOM   9059  C  C   . GLY D 1 144 ? 4.629   -20.250 19.220  1.00 13.87  ? 144 GLY D C   1 
ATOM   9060  O  O   . GLY D 1 144 ? 5.462   -21.175 19.251  1.00 14.20  ? 144 GLY D O   1 
ATOM   9061  N  N   . THR D 1 145 ? 4.266   -19.576 20.300  1.00 13.12  ? 145 THR D N   1 
ATOM   9062  C  CA  . THR D 1 145 ? 4.876   -19.814 21.596  1.00 14.16  ? 145 THR D CA  1 
ATOM   9063  C  C   . THR D 1 145 ? 4.351   -21.082 22.242  1.00 14.93  ? 145 THR D C   1 
ATOM   9064  O  O   . THR D 1 145 ? 4.949   -21.614 23.151  1.00 14.26  ? 145 THR D O   1 
ATOM   9065  C  CB  . THR D 1 145 ? 4.642   -18.608 22.506  1.00 13.54  ? 145 THR D CB  1 
ATOM   9066  O  OG1 . THR D 1 145 ? 3.278   -18.156 22.346  1.00 13.50  ? 145 THR D OG1 1 
ATOM   9067  C  CG2 . THR D 1 145 ? 5.591   -17.480 22.119  1.00 11.85  ? 145 THR D CG2 1 
ATOM   9068  N  N   . HIS D 1 146 ? 3.198   -21.552 21.777  1.00 16.29  ? 146 HIS D N   1 
ATOM   9069  C  CA  . HIS D 1 146 ? 2.751   -22.896 22.150  1.00 16.83  ? 146 HIS D CA  1 
ATOM   9070  C  C   . HIS D 1 146 ? 1.813   -23.404 21.084  1.00 16.17  ? 146 HIS D C   1 
ATOM   9071  O  O   . HIS D 1 146 ? 1.344   -22.643 20.245  1.00 15.69  ? 146 HIS D O   1 
ATOM   9072  C  CB  . HIS D 1 146 ? 2.055   -22.859 23.502  1.00 16.72  ? 146 HIS D CB  1 
ATOM   9073  C  CG  . HIS D 1 146 ? 0.787   -22.077 23.474  1.00 18.33  ? 146 HIS D CG  1 
ATOM   9074  N  ND1 . HIS D 1 146 ? 0.757   -20.751 23.671  1.00 18.64  ? 146 HIS D ND1 1 
ATOM   9075  C  CD2 . HIS D 1 146 ? -0.521  -22.466 23.191  1.00 18.20  ? 146 HIS D CD2 1 
ATOM   9076  C  CE1 . HIS D 1 146 ? -0.510  -20.315 23.574  1.00 18.71  ? 146 HIS D CE1 1 
ATOM   9077  N  NE2 . HIS D 1 146 ? -1.289  -21.371 23.279  1.00 19.26  ? 146 HIS D NE2 1 
ATOM   9078  N  N   . VAL D 1 147 ? 1.518   -24.694 21.149  1.00 16.68  ? 147 VAL D N   1 
ATOM   9079  C  CA  . VAL D 1 147 ? 0.666   -25.421 20.190  1.00 15.69  ? 147 VAL D CA  1 
ATOM   9080  C  C   . VAL D 1 147 ? -0.500  -26.087 20.887  1.00 16.45  ? 147 VAL D C   1 
ATOM   9081  O  O   . VAL D 1 147 ? -0.334  -27.179 21.401  1.00 17.39  ? 147 VAL D O   1 
ATOM   9082  C  CB  . VAL D 1 147 ? 1.488   -26.512 19.491  1.00 14.70  ? 147 VAL D CB  1 
ATOM   9083  C  CG1 . VAL D 1 147 ? 0.720   -26.991 18.296  1.00 15.30  ? 147 VAL D CG1 1 
ATOM   9084  C  CG2 . VAL D 1 147 ? 2.811   -25.943 18.990  1.00 14.71  ? 147 VAL D CG2 1 
ATOM   9085  N  N   . ASN D 1 148 ? -1.662  -25.437 20.938  1.00 18.06  ? 148 ASN D N   1 
ATOM   9086  C  CA  . ASN D 1 148 ? -2.804  -25.938 21.697  1.00 21.11  ? 148 ASN D CA  1 
ATOM   9087  C  C   . ASN D 1 148 ? -2.449  -26.187 23.172  1.00 24.76  ? 148 ASN D C   1 
ATOM   9088  O  O   . ASN D 1 148 ? -2.207  -25.249 23.939  1.00 29.69  ? 148 ASN D O   1 
ATOM   9089  C  CB  . ASN D 1 148 ? -3.326  -27.244 21.104  1.00 21.07  ? 148 ASN D CB  1 
ATOM   9090  C  CG  . ASN D 1 148 ? -3.684  -27.129 19.643  1.00 20.74  ? 148 ASN D CG  1 
ATOM   9091  O  OD1 . ASN D 1 148 ? -4.358  -26.197 19.233  1.00 21.25  ? 148 ASN D OD1 1 
ATOM   9092  N  ND2 . ASN D 1 148 ? -3.258  -28.100 18.854  1.00 22.07  ? 148 ASN D ND2 1 
ATOM   9093  N  N   . GLU D 1 149 ? -2.379  -27.453 23.549  1.00 25.35  ? 149 GLU D N   1 
ATOM   9094  C  CA  . GLU D 1 149 ? -2.032  -27.848 24.907  1.00 28.03  ? 149 GLU D CA  1 
ATOM   9095  C  C   . GLU D 1 149 ? -0.543  -28.129 25.107  1.00 26.15  ? 149 GLU D C   1 
ATOM   9096  O  O   . GLU D 1 149 ? -0.089  -28.287 26.228  1.00 27.80  ? 149 GLU D O   1 
ATOM   9097  C  CB  . GLU D 1 149 ? -2.881  -29.073 25.313  1.00 32.51  ? 149 GLU D CB  1 
ATOM   9098  C  CG  . GLU D 1 149 ? -3.376  -29.099 26.759  1.00 38.28  ? 149 GLU D CG  1 
ATOM   9099  C  CD  . GLU D 1 149 ? -3.867  -27.739 27.304  1.00 44.14  ? 149 GLU D CD  1 
ATOM   9100  O  OE1 . GLU D 1 149 ? -3.778  -27.543 28.557  1.00 43.37  ? 149 GLU D OE1 1 
ATOM   9101  O  OE2 . GLU D 1 149 ? -4.331  -26.871 26.500  1.00 41.85  ? 149 GLU D OE2 1 
ATOM   9102  N  N   . TRP D 1 150 ? 0.224   -28.180 24.033  1.00 24.01  ? 150 TRP D N   1 
ATOM   9103  C  CA  . TRP D 1 150 ? 1.629   -28.373 24.183  1.00 23.30  ? 150 TRP D CA  1 
ATOM   9104  C  C   . TRP D 1 150 ? 2.329   -27.076 24.345  1.00 23.00  ? 150 TRP D C   1 
ATOM   9105  O  O   . TRP D 1 150 ? 2.153   -26.177 23.533  1.00 21.61  ? 150 TRP D O   1 
ATOM   9106  C  CB  . TRP D 1 150 ? 2.237   -29.055 22.962  1.00 23.14  ? 150 TRP D CB  1 
ATOM   9107  C  CG  . TRP D 1 150 ? 1.758   -30.446 22.713  1.00 23.55  ? 150 TRP D CG  1 
ATOM   9108  C  CD1 . TRP D 1 150 ? 1.317   -31.379 23.658  1.00 24.90  ? 150 TRP D CD1 1 
ATOM   9109  C  CD2 . TRP D 1 150 ? 1.674   -31.129 21.428  1.00 24.37  ? 150 TRP D CD2 1 
ATOM   9110  N  NE1 . TRP D 1 150 ? 0.950   -32.553 23.057  1.00 25.32  ? 150 TRP D NE1 1 
ATOM   9111  C  CE2 . TRP D 1 150 ? 1.154   -32.485 21.718  1.00 25.34  ? 150 TRP D CE2 1 
ATOM   9112  C  CE3 . TRP D 1 150 ? 1.957   -30.775 20.104  1.00 24.14  ? 150 TRP D CE3 1 
ATOM   9113  C  CZ2 . TRP D 1 150 ? 0.925   -33.416 20.715  1.00 24.58  ? 150 TRP D CZ2 1 
ATOM   9114  C  CZ3 . TRP D 1 150 ? 1.722   -31.731 19.094  1.00 25.40  ? 150 TRP D CZ3 1 
ATOM   9115  C  CH2 . TRP D 1 150 ? 1.210   -33.017 19.397  1.00 25.20  ? 150 TRP D CH2 1 
ATOM   9116  N  N   . ASP D 1 151 ? 3.176   -26.991 25.363  1.00 22.70  ? 151 ASP D N   1 
ATOM   9117  C  CA  . ASP D 1 151 ? 4.218   -25.993 25.368  1.00 25.22  ? 151 ASP D CA  1 
ATOM   9118  C  C   . ASP D 1 151 ? 5.405   -26.489 24.546  1.00 24.48  ? 151 ASP D C   1 
ATOM   9119  O  O   . ASP D 1 151 ? 5.457   -27.629 24.094  1.00 23.22  ? 151 ASP D O   1 
ATOM   9120  C  CB  . ASP D 1 151 ? 4.673   -25.606 26.791  1.00 28.10  ? 151 ASP D CB  1 
ATOM   9121  C  CG  . ASP D 1 151 ? 4.146   -24.212 27.246  1.00 35.45  ? 151 ASP D CG  1 
ATOM   9122  O  OD1 . ASP D 1 151 ? 4.193   -23.194 26.481  1.00 37.27  ? 151 ASP D OD1 1 
ATOM   9123  O  OD2 . ASP D 1 151 ? 3.696   -24.134 28.414  1.00 43.09  ? 151 ASP D OD2 1 
ATOM   9124  N  N   . LEU D 1 152 ? 6.354   -25.592 24.373  1.00 24.25  ? 152 LEU D N   1 
ATOM   9125  C  CA  . LEU D 1 152 ? 7.491   -25.802 23.509  1.00 24.32  ? 152 LEU D CA  1 
ATOM   9126  C  C   . LEU D 1 152 ? 8.483   -26.836 24.055  1.00 23.46  ? 152 LEU D C   1 
ATOM   9127  O  O   . LEU D 1 152 ? 9.353   -27.280 23.323  1.00 22.94  ? 152 LEU D O   1 
ATOM   9128  C  CB  . LEU D 1 152 ? 8.154   -24.447 23.238  1.00 21.67  ? 152 LEU D CB  1 
ATOM   9129  C  CG  . LEU D 1 152 ? 7.917   -23.872 21.850  1.00 20.43  ? 152 LEU D CG  1 
ATOM   9130  C  CD1 . LEU D 1 152 ? 6.536   -24.131 21.285  1.00 20.08  ? 152 LEU D CD1 1 
ATOM   9131  C  CD2 . LEU D 1 152 ? 8.264   -22.410 21.838  1.00 19.93  ? 152 LEU D CD2 1 
ATOM   9132  N  N   . ASN D 1 153 ? 8.318   -27.252 25.309  1.00 21.10  ? 153 ASN D N   1 
ATOM   9133  C  CA  . ASN D 1 153 ? 9.093   -28.407 25.814  1.00 22.08  ? 153 ASN D CA  1 
ATOM   9134  C  C   . ASN D 1 153 ? 8.595   -29.786 25.342  1.00 20.69  ? 153 ASN D C   1 
ATOM   9135  O  O   . ASN D 1 153 ? 9.271   -30.753 25.572  1.00 20.66  ? 153 ASN D O   1 
ATOM   9136  C  CB  . ASN D 1 153 ? 9.099   -28.454 27.337  1.00 19.58  ? 153 ASN D CB  1 
ATOM   9137  C  CG  . ASN D 1 153 ? 7.709   -28.595 27.883  1.00 20.53  ? 153 ASN D CG  1 
ATOM   9138  O  OD1 . ASN D 1 153 ? 6.834   -27.794 27.544  1.00 22.14  ? 153 ASN D OD1 1 
ATOM   9139  N  ND2 . ASN D 1 153 ? 7.473   -29.619 28.684  1.00 19.56  ? 153 ASN D ND2 1 
ATOM   9140  N  N   . ALA D 1 154 ? 7.432   -29.853 24.696  1.00 21.48  ? 154 ALA D N   1 
ATOM   9141  C  CA  . ALA D 1 154 ? 6.710   -31.118 24.436  1.00 22.24  ? 154 ALA D CA  1 
ATOM   9142  C  C   . ALA D 1 154 ? 7.479   -32.102 23.587  1.00 23.25  ? 154 ALA D C   1 
ATOM   9143  O  O   . ALA D 1 154 ? 8.041   -31.701 22.528  1.00 22.70  ? 154 ALA D O   1 
ATOM   9144  C  CB  . ALA D 1 154 ? 5.368   -30.836 23.804  1.00 20.32  ? 154 ALA D CB  1 
ATOM   9145  N  N   . GLN D 1 155 ? 7.528   -33.366 24.049  1.00 24.82  ? 155 GLN D N   1 
ATOM   9146  C  CA  . GLN D 1 155 ? 8.371   -34.399 23.397  1.00 27.37  ? 155 GLN D CA  1 
ATOM   9147  C  C   . GLN D 1 155 ? 7.897   -34.745 22.003  1.00 27.29  ? 155 GLN D C   1 
ATOM   9148  O  O   . GLN D 1 155 ? 8.701   -35.122 21.154  1.00 28.04  ? 155 GLN D O   1 
ATOM   9149  C  CB  . GLN D 1 155 ? 8.587   -35.663 24.247  1.00 30.09  ? 155 GLN D CB  1 
ATOM   9150  C  CG  . GLN D 1 155 ? 9.930   -35.655 24.989  1.00 36.62  ? 155 GLN D CG  1 
ATOM   9151  C  CD  . GLN D 1 155 ? 10.715  -36.947 24.849  1.00 45.74  ? 155 GLN D CD  1 
ATOM   9152  O  OE1 . GLN D 1 155 ? 11.303  -37.214 23.796  1.00 50.25  ? 155 GLN D OE1 1 
ATOM   9153  N  NE2 . GLN D 1 155 ? 10.748  -37.755 25.921  1.00 51.35  ? 155 GLN D NE2 1 
ATOM   9154  N  N   . GLU D 1 156 ? 6.597   -34.598 21.767  1.00 27.53  ? 156 GLU D N   1 
ATOM   9155  C  CA  . GLU D 1 156 ? 6.041   -34.735 20.418  1.00 28.66  ? 156 GLU D CA  1 
ATOM   9156  C  C   . GLU D 1 156 ? 6.672   -33.782 19.394  1.00 25.81  ? 156 GLU D C   1 
ATOM   9157  O  O   . GLU D 1 156 ? 6.708   -34.075 18.217  1.00 26.76  ? 156 GLU D O   1 
ATOM   9158  C  CB  . GLU D 1 156 ? 4.520   -34.538 20.439  1.00 33.24  ? 156 GLU D CB  1 
ATOM   9159  C  CG  . GLU D 1 156 ? 3.742   -35.577 21.262  1.00 37.42  ? 156 GLU D CG  1 
ATOM   9160  C  CD  . GLU D 1 156 ? 3.608   -35.237 22.757  1.00 39.22  ? 156 GLU D CD  1 
ATOM   9161  O  OE1 . GLU D 1 156 ? 3.979   -34.126 23.196  1.00 41.89  ? 156 GLU D OE1 1 
ATOM   9162  O  OE2 . GLU D 1 156 ? 3.126   -36.099 23.523  1.00 40.81  ? 156 GLU D OE2 1 
ATOM   9163  N  N   . LEU D 1 157 ? 7.182   -32.650 19.853  1.00 23.82  ? 157 LEU D N   1 
ATOM   9164  C  CA  . LEU D 1 157 ? 7.725   -31.634 18.982  1.00 21.56  ? 157 LEU D CA  1 
ATOM   9165  C  C   . LEU D 1 157 ? 9.205   -31.822 18.696  1.00 21.12  ? 157 LEU D C   1 
ATOM   9166  O  O   . LEU D 1 157 ? 9.764   -31.130 17.837  1.00 19.62  ? 157 LEU D O   1 
ATOM   9167  C  CB  . LEU D 1 157 ? 7.462   -30.261 19.586  1.00 22.23  ? 157 LEU D CB  1 
ATOM   9168  C  CG  . LEU D 1 157 ? 5.993   -29.874 19.432  1.00 23.23  ? 157 LEU D CG  1 
ATOM   9169  C  CD1 . LEU D 1 157 ? 5.576   -28.671 20.270  1.00 23.32  ? 157 LEU D CD1 1 
ATOM   9170  C  CD2 . LEU D 1 157 ? 5.714   -29.641 17.959  1.00 23.46  ? 157 LEU D CD2 1 
ATOM   9171  N  N   . PHE D 1 158 ? 9.836   -32.778 19.380  1.00 21.39  ? 158 PHE D N   1 
ATOM   9172  C  CA  . PHE D 1 158 ? 11.258  -33.040 19.168  1.00 22.07  ? 158 PHE D CA  1 
ATOM   9173  C  C   . PHE D 1 158 ? 11.639  -33.375 17.724  1.00 22.46  ? 158 PHE D C   1 
ATOM   9174  O  O   . PHE D 1 158 ? 12.686  -32.923 17.259  1.00 26.40  ? 158 PHE D O   1 
ATOM   9175  C  CB  . PHE D 1 158 ? 11.808  -34.063 20.176  1.00 23.69  ? 158 PHE D CB  1 
ATOM   9176  C  CG  . PHE D 1 158 ? 12.211  -33.451 21.493  1.00 24.24  ? 158 PHE D CG  1 
ATOM   9177  C  CD1 . PHE D 1 158 ? 11.442  -32.477 22.085  1.00 23.38  ? 158 PHE D CD1 1 
ATOM   9178  C  CD2 . PHE D 1 158 ? 13.375  -33.844 22.122  1.00 26.31  ? 158 PHE D CD2 1 
ATOM   9179  C  CE1 . PHE D 1 158 ? 11.823  -31.908 23.292  1.00 26.63  ? 158 PHE D CE1 1 
ATOM   9180  C  CE2 . PHE D 1 158 ? 13.773  -33.273 23.333  1.00 27.44  ? 158 PHE D CE2 1 
ATOM   9181  C  CZ  . PHE D 1 158 ? 12.995  -32.296 23.921  1.00 25.24  ? 158 PHE D CZ  1 
ATOM   9182  N  N   . PRO D 1 159 ? 10.820  -34.170 17.008  1.00 20.70  ? 159 PRO D N   1 
ATOM   9183  C  CA  . PRO D 1 159 ? 11.155  -34.410 15.595  1.00 19.91  ? 159 PRO D CA  1 
ATOM   9184  C  C   . PRO D 1 159 ? 11.247  -33.132 14.746  1.00 19.13  ? 159 PRO D C   1 
ATOM   9185  O  O   . PRO D 1 159 ? 11.992  -33.080 13.764  1.00 17.10  ? 159 PRO D O   1 
ATOM   9186  C  CB  . PRO D 1 159 ? 9.993   -35.279 15.122  1.00 19.68  ? 159 PRO D CB  1 
ATOM   9187  C  CG  . PRO D 1 159 ? 9.719   -36.146 16.333  1.00 20.73  ? 159 PRO D CG  1 
ATOM   9188  C  CD  . PRO D 1 159 ? 9.899   -35.204 17.523  1.00 20.96  ? 159 PRO D CD  1 
ATOM   9189  N  N   . VAL D 1 160 ? 10.498  -32.105 15.145  1.00 19.11  ? 160 VAL D N   1 
ATOM   9190  C  CA  . VAL D 1 160 ? 10.461  -30.832 14.425  1.00 18.06  ? 160 VAL D CA  1 
ATOM   9191  C  C   . VAL D 1 160 ? 11.762  -30.084 14.695  1.00 18.28  ? 160 VAL D C   1 
ATOM   9192  O  O   . VAL D 1 160 ? 12.292  -29.447 13.798  1.00 18.22  ? 160 VAL D O   1 
ATOM   9193  C  CB  . VAL D 1 160 ? 9.225   -30.023 14.845  1.00 18.33  ? 160 VAL D CB  1 
ATOM   9194  C  CG1 . VAL D 1 160 ? 9.131   -28.722 14.091  1.00 19.10  ? 160 VAL D CG1 1 
ATOM   9195  C  CG2 . VAL D 1 160 ? 7.968   -30.830 14.573  1.00 18.05  ? 160 VAL D CG2 1 
ATOM   9196  N  N   . TYR D 1 161 ? 12.324  -30.245 15.900  1.00 18.19  ? 161 TYR D N   1 
ATOM   9197  C  CA  . TYR D 1 161 ? 13.575  -29.587 16.257  1.00 19.34  ? 161 TYR D CA  1 
ATOM   9198  C  C   . TYR D 1 161 ? 14.728  -30.314 15.673  1.00 18.71  ? 161 TYR D C   1 
ATOM   9199  O  O   . TYR D 1 161 ? 15.701  -29.697 15.216  1.00 18.50  ? 161 TYR D O   1 
ATOM   9200  C  CB  . TYR D 1 161 ? 13.802  -29.516 17.765  1.00 19.93  ? 161 TYR D CB  1 
ATOM   9201  C  CG  . TYR D 1 161 ? 12.728  -28.780 18.526  1.00 21.58  ? 161 TYR D CG  1 
ATOM   9202  C  CD1 . TYR D 1 161 ? 12.154  -27.625 18.013  1.00 21.66  ? 161 TYR D CD1 1 
ATOM   9203  C  CD2 . TYR D 1 161 ? 12.294  -29.247 19.762  1.00 22.07  ? 161 TYR D CD2 1 
ATOM   9204  C  CE1 . TYR D 1 161 ? 11.182  -26.956 18.716  1.00 23.06  ? 161 TYR D CE1 1 
ATOM   9205  C  CE2 . TYR D 1 161 ? 11.307  -28.589 20.475  1.00 23.07  ? 161 TYR D CE2 1 
ATOM   9206  C  CZ  . TYR D 1 161 ? 10.769  -27.441 19.949  1.00 24.50  ? 161 TYR D CZ  1 
ATOM   9207  O  OH  . TYR D 1 161 ? 9.803   -26.771 20.671  1.00 27.94  ? 161 TYR D OH  1 
ATOM   9208  N  N   . ALA D 1 162 ? 14.625  -31.634 15.716  1.00 19.02  ? 162 ALA D N   1 
ATOM   9209  C  CA  . ALA D 1 162 ? 15.647  -32.482 15.123  1.00 19.05  ? 162 ALA D CA  1 
ATOM   9210  C  C   . ALA D 1 162 ? 15.749  -32.128 13.663  1.00 18.92  ? 162 ALA D C   1 
ATOM   9211  O  O   . ALA D 1 162 ? 16.843  -31.914 13.185  1.00 21.89  ? 162 ALA D O   1 
ATOM   9212  C  CB  . ALA D 1 162 ? 15.350  -33.951 15.329  1.00 17.50  ? 162 ALA D CB  1 
ATOM   9213  N  N   . ALA D 1 163 ? 14.617  -32.012 12.972  1.00 18.80  ? 163 ALA D N   1 
ATOM   9214  C  CA  . ALA D 1 163 ? 14.599  -31.633 11.561  1.00 18.26  ? 163 ALA D CA  1 
ATOM   9215  C  C   . ALA D 1 163 ? 15.114  -30.220 11.355  1.00 18.82  ? 163 ALA D C   1 
ATOM   9216  O  O   . ALA D 1 163 ? 15.955  -29.995 10.505  1.00 20.74  ? 163 ALA D O   1 
ATOM   9217  C  CB  . ALA D 1 163 ? 13.198  -31.777 10.985  1.00 17.98  ? 163 ALA D CB  1 
ATOM   9218  N  N   . ALA D 1 164 ? 14.616  -29.251 12.121  1.00 19.79  ? 164 ALA D N   1 
ATOM   9219  C  CA  . ALA D 1 164 ? 15.109  -27.875 11.974  1.00 19.94  ? 164 ALA D CA  1 
ATOM   9220  C  C   . ALA D 1 164 ? 16.613  -27.807 12.142  1.00 20.66  ? 164 ALA D C   1 
ATOM   9221  O  O   . ALA D 1 164 ? 17.277  -27.074 11.401  1.00 20.06  ? 164 ALA D O   1 
ATOM   9222  C  CB  . ALA D 1 164 ? 14.415  -26.921 12.931  1.00 18.43  ? 164 ALA D CB  1 
ATOM   9223  N  N   . GLU D 1 165 ? 17.146  -28.564 13.111  1.00 21.92  ? 165 GLU D N   1 
ATOM   9224  C  CA  . GLU D 1 165 ? 18.594  -28.548 13.369  1.00 22.93  ? 165 GLU D CA  1 
ATOM   9225  C  C   . GLU D 1 165 ? 19.349  -29.209 12.252  1.00 23.64  ? 165 GLU D C   1 
ATOM   9226  O  O   . GLU D 1 165 ? 20.348  -28.684 11.836  1.00 24.13  ? 165 GLU D O   1 
ATOM   9227  C  CB  . GLU D 1 165 ? 18.973  -29.214 14.700  1.00 24.28  ? 165 GLU D CB  1 
ATOM   9228  C  CG  . GLU D 1 165 ? 20.465  -29.090 15.065  1.00 24.37  ? 165 GLU D CG  1 
ATOM   9229  C  CD  . GLU D 1 165 ? 20.891  -29.950 16.263  1.00 26.77  ? 165 GLU D CD  1 
ATOM   9230  O  OE1 . GLU D 1 165 ? 20.657  -31.182 16.217  1.00 26.72  ? 165 GLU D OE1 1 
ATOM   9231  O  OE2 . GLU D 1 165 ? 21.472  -29.400 17.251  1.00 26.54  ? 165 GLU D OE2 1 
ATOM   9232  N  N   . ARG D 1 166 ? 18.889  -30.377 11.791  1.00 26.00  ? 166 ARG D N   1 
ATOM   9233  C  CA  . ARG D 1 166 ? 19.471  -31.062 10.617  1.00 27.38  ? 166 ARG D CA  1 
ATOM   9234  C  C   . ARG D 1 166 ? 19.472  -30.170 9.361   1.00 29.71  ? 166 ARG D C   1 
ATOM   9235  O  O   . ARG D 1 166 ? 20.433  -30.130 8.612   1.00 28.64  ? 166 ARG D O   1 
ATOM   9236  C  CB  . ARG D 1 166 ? 18.672  -32.329 10.308  1.00 27.51  ? 166 ARG D CB  1 
ATOM   9237  C  CG  . ARG D 1 166 ? 19.161  -33.111 9.090   1.00 29.36  ? 166 ARG D CG  1 
ATOM   9238  C  CD  . ARG D 1 166 ? 18.400  -34.418 8.911   1.00 31.28  ? 166 ARG D CD  1 
ATOM   9239  N  NE  . ARG D 1 166 ? 17.163  -34.251 8.130   1.00 35.97  ? 166 ARG D NE  1 
ATOM   9240  C  CZ  . ARG D 1 166 ? 15.932  -34.392 8.629   1.00 40.71  ? 166 ARG D CZ  1 
ATOM   9241  N  NH1 . ARG D 1 166 ? 15.743  -34.700 9.926   1.00 42.21  ? 166 ARG D NH1 1 
ATOM   9242  N  NH2 . ARG D 1 166 ? 14.873  -34.230 7.830   1.00 40.34  ? 166 ARG D NH2 1 
ATOM   9243  N  N   . LEU D 1 167 ? 18.364  -29.467 9.141   1.00 30.50  ? 167 LEU D N   1 
ATOM   9244  C  CA  . LEU D 1 167 ? 18.184  -28.668 7.940   1.00 30.44  ? 167 LEU D CA  1 
ATOM   9245  C  C   . LEU D 1 167 ? 18.765  -27.239 8.002   1.00 28.88  ? 167 LEU D C   1 
ATOM   9246  O  O   . LEU D 1 167 ? 18.714  -26.524 7.028   1.00 28.86  ? 167 LEU D O   1 
ATOM   9247  C  CB  . LEU D 1 167 ? 16.690  -28.676 7.546   1.00 29.07  ? 167 LEU D CB  1 
ATOM   9248  C  CG  . LEU D 1 167 ? 16.137  -30.093 7.270   1.00 29.95  ? 167 LEU D CG  1 
ATOM   9249  C  CD1 . LEU D 1 167 ? 14.634  -30.132 7.011   1.00 27.65  ? 167 LEU D CD1 1 
ATOM   9250  C  CD2 . LEU D 1 167 ? 16.909  -30.775 6.144   1.00 30.71  ? 167 LEU D CD2 1 
ATOM   9251  N  N   . LYS D 1 168 ? 19.364  -26.840 9.120   1.00 30.88  ? 168 LYS D N   1 
ATOM   9252  C  CA  . LYS D 1 168 ? 19.819  -25.439 9.290   1.00 33.93  ? 168 LYS D CA  1 
ATOM   9253  C  C   . LYS D 1 168 ? 18.632  -24.482 9.114   1.00 32.48  ? 168 LYS D C   1 
ATOM   9254  O  O   . LYS D 1 168 ? 18.686  -23.509 8.358   1.00 28.18  ? 168 LYS D O   1 
ATOM   9255  C  CB  . LYS D 1 168 ? 20.950  -25.058 8.307   1.00 38.99  ? 168 LYS D CB  1 
ATOM   9256  C  CG  . LYS D 1 168 ? 22.316  -25.712 8.576   1.00 47.85  ? 168 LYS D CG  1 
ATOM   9257  C  CD  . LYS D 1 168 ? 22.566  -26.922 7.667   1.00 52.17  ? 168 LYS D CD  1 
ATOM   9258  C  CE  . LYS D 1 168 ? 24.044  -27.318 7.609   1.00 54.87  ? 168 LYS D CE  1 
ATOM   9259  N  NZ  . LYS D 1 168 ? 24.492  -28.069 8.821   1.00 50.21  ? 168 LYS D NZ  1 
ATOM   9260  N  N   . CYS D 1 169 ? 17.534  -24.803 9.779   1.00 29.09  ? 169 CYS D N   1 
ATOM   9261  C  CA  . CYS D 1 169 ? 16.347  -23.981 9.669   1.00 26.63  ? 169 CYS D CA  1 
ATOM   9262  C  C   . CYS D 1 169 ? 16.174  -23.203 10.996  1.00 23.30  ? 169 CYS D C   1 
ATOM   9263  O  O   . CYS D 1 169 ? 15.940  -23.790 12.044  1.00 23.22  ? 169 CYS D O   1 
ATOM   9264  C  CB  . CYS D 1 169 ? 15.141  -24.869 9.328   1.00 26.83  ? 169 CYS D CB  1 
ATOM   9265  S  SG  . CYS D 1 169 ? 13.559  -24.000 9.265   1.00 31.83  ? 169 CYS D SG  1 
ATOM   9266  N  N   . SER D 1 170 ? 16.345  -21.896 10.945  1.00 20.24  ? 170 SER D N   1 
ATOM   9267  C  CA  . SER D 1 170 ? 16.132  -21.041 12.104  1.00 20.47  ? 170 SER D CA  1 
ATOM   9268  C  C   . SER D 1 170 ? 14.666  -21.031 12.524  1.00 19.53  ? 170 SER D C   1 
ATOM   9269  O  O   . SER D 1 170 ? 13.771  -21.107 11.662  1.00 21.19  ? 170 SER D O   1 
ATOM   9270  C  CB  . SER D 1 170 ? 16.541  -19.623 11.734  1.00 21.55  ? 170 SER D CB  1 
ATOM   9271  O  OG  . SER D 1 170 ? 17.856  -19.610 11.189  1.00 22.54  ? 170 SER D OG  1 
ATOM   9272  N  N   . LEU D 1 171 ? 14.409  -20.968 13.829  1.00 16.87  ? 171 LEU D N   1 
ATOM   9273  C  CA  . LEU D 1 171 ? 13.042  -20.770 14.331  1.00 16.16  ? 171 LEU D CA  1 
ATOM   9274  C  C   . LEU D 1 171 ? 12.785  -19.356 14.841  1.00 15.74  ? 171 LEU D C   1 
ATOM   9275  O  O   . LEU D 1 171 ? 13.512  -18.839 15.689  1.00 15.50  ? 171 LEU D O   1 
ATOM   9276  C  CB  . LEU D 1 171 ? 12.688  -21.763 15.442  1.00 15.84  ? 171 LEU D CB  1 
ATOM   9277  C  CG  . LEU D 1 171 ? 12.921  -23.266 15.189  1.00 16.94  ? 171 LEU D CG  1 
ATOM   9278  C  CD1 . LEU D 1 171 ? 12.517  -24.103 16.421  1.00 15.02  ? 171 LEU D CD1 1 
ATOM   9279  C  CD2 . LEU D 1 171 ? 12.297  -23.750 13.873  1.00 14.96  ? 171 LEU D CD2 1 
ATOM   9280  N  N   . PHE D 1 172 ? 11.739  -18.729 14.349  1.00 15.91  ? 172 PHE D N   1 
ATOM   9281  C  CA  . PHE D 1 172 ? 11.357  -17.463 14.927  1.00 16.88  ? 172 PHE D CA  1 
ATOM   9282  C  C   . PHE D 1 172 ? 10.039  -17.721 15.660  1.00 16.01  ? 172 PHE D C   1 
ATOM   9283  O  O   . PHE D 1 172 ? 9.015   -18.091 15.041  1.00 15.35  ? 172 PHE D O   1 
ATOM   9284  C  CB  . PHE D 1 172 ? 11.237  -16.390 13.847  1.00 18.46  ? 172 PHE D CB  1 
ATOM   9285  C  CG  . PHE D 1 172 ? 10.986  -15.022 14.393  1.00 20.27  ? 172 PHE D CG  1 
ATOM   9286  C  CD1 . PHE D 1 172 ? 12.025  -14.270 14.936  1.00 21.23  ? 172 PHE D CD1 1 
ATOM   9287  C  CD2 . PHE D 1 172 ? 9.708   -14.475 14.365  1.00 22.49  ? 172 PHE D CD2 1 
ATOM   9288  C  CE1 . PHE D 1 172 ? 11.781  -13.011 15.469  1.00 22.80  ? 172 PHE D CE1 1 
ATOM   9289  C  CE2 . PHE D 1 172 ? 9.467   -13.212 14.890  1.00 24.36  ? 172 PHE D CE2 1 
ATOM   9290  C  CZ  . PHE D 1 172 ? 10.506  -12.475 15.441  1.00 22.09  ? 172 PHE D CZ  1 
ATOM   9291  N  N   . VAL D 1 173 ? 10.086  -17.549 16.975  1.00 14.02  ? 173 VAL D N   1 
ATOM   9292  C  CA  . VAL D 1 173 ? 8.993   -17.924 17.853  1.00 13.26  ? 173 VAL D CA  1 
ATOM   9293  C  C   . VAL D 1 173 ? 8.252   -16.647 18.157  1.00 12.90  ? 173 VAL D C   1 
ATOM   9294  O  O   . VAL D 1 173 ? 8.860   -15.713 18.731  1.00 13.39  ? 173 VAL D O   1 
ATOM   9295  C  CB  . VAL D 1 173 ? 9.531   -18.576 19.170  1.00 13.57  ? 173 VAL D CB  1 
ATOM   9296  C  CG1 . VAL D 1 173 ? 8.420   -18.873 20.189  1.00 12.93  ? 173 VAL D CG1 1 
ATOM   9297  C  CG2 . VAL D 1 173 ? 10.291  -19.858 18.854  1.00 13.96  ? 173 VAL D CG2 1 
ATOM   9298  N  N   . HIS D 1 174 ? 6.954   -16.626 17.813  1.00 12.03  ? 174 HIS D N   1 
ATOM   9299  C  CA  . HIS D 1 174 ? 6.095   -15.458 17.953  1.00 12.25  ? 174 HIS D CA  1 
ATOM   9300  C  C   . HIS D 1 174 ? 4.993   -15.750 18.954  1.00 13.03  ? 174 HIS D C   1 
ATOM   9301  O  O   . HIS D 1 174 ? 4.317   -16.762 18.839  1.00 11.91  ? 174 HIS D O   1 
ATOM   9302  C  CB  . HIS D 1 174 ? 5.467   -15.061 16.593  1.00 11.35  ? 174 HIS D CB  1 
ATOM   9303  C  CG  . HIS D 1 174 ? 4.891   -13.665 16.574  1.00 11.12  ? 174 HIS D CG  1 
ATOM   9304  N  ND1 . HIS D 1 174 ? 3.905   -13.259 17.431  1.00 11.13  ? 174 HIS D ND1 1 
ATOM   9305  C  CD2 . HIS D 1 174 ? 5.196   -12.558 15.789  1.00 11.16  ? 174 HIS D CD2 1 
ATOM   9306  C  CE1 . HIS D 1 174 ? 3.623   -11.960 17.222  1.00 10.31  ? 174 HIS D CE1 1 
ATOM   9307  N  NE2 . HIS D 1 174 ? 4.410   -11.522 16.234  1.00 11.20  ? 174 HIS D NE2 1 
ATOM   9308  N  N   . PRO D 1 175 ? 4.782   -14.851 19.937  1.00 13.83  ? 175 PRO D N   1 
ATOM   9309  C  CA  . PRO D 1 175 ? 3.710   -15.104 20.872  1.00 15.19  ? 175 PRO D CA  1 
ATOM   9310  C  C   . PRO D 1 175 ? 2.364   -15.100 20.162  1.00 17.20  ? 175 PRO D C   1 
ATOM   9311  O  O   . PRO D 1 175 ? 2.040   -14.200 19.299  1.00 17.40  ? 175 PRO D O   1 
ATOM   9312  C  CB  . PRO D 1 175 ? 3.806   -13.931 21.858  1.00 14.00  ? 175 PRO D CB  1 
ATOM   9313  C  CG  . PRO D 1 175 ? 4.334   -12.815 21.040  1.00 14.36  ? 175 PRO D CG  1 
ATOM   9314  C  CD  . PRO D 1 175 ? 5.340   -13.498 20.132  1.00 14.48  ? 175 PRO D CD  1 
ATOM   9315  N  N   . TRP D 1 176 ? 1.591   -16.108 20.507  1.00 18.12  ? 176 TRP D N   1 
ATOM   9316  C  CA  . TRP D 1 176 ? 0.228   -16.137 20.036  1.00 23.23  ? 176 TRP D CA  1 
ATOM   9317  C  C   . TRP D 1 176 ? -0.695  -16.927 20.944  1.00 23.69  ? 176 TRP D C   1 
ATOM   9318  O  O   . TRP D 1 176 ? -0.240  -17.530 21.935  1.00 21.25  ? 176 TRP D O   1 
ATOM   9319  C  CB  . TRP D 1 176 ? 0.191   -16.585 18.567  1.00 24.80  ? 176 TRP D CB  1 
ATOM   9320  C  CG  . TRP D 1 176 ? -1.186  -16.510 18.018  1.00 26.55  ? 176 TRP D CG  1 
ATOM   9321  C  CD1 . TRP D 1 176 ? -1.994  -17.579 17.648  1.00 28.33  ? 176 TRP D CD1 1 
ATOM   9322  C  CD2 . TRP D 1 176 ? -2.022  -15.291 17.805  1.00 27.46  ? 176 TRP D CD2 1 
ATOM   9323  N  NE1 . TRP D 1 176 ? -3.243  -17.130 17.243  1.00 28.56  ? 176 TRP D NE1 1 
ATOM   9324  C  CE2 . TRP D 1 176 ? -3.320  -15.774 17.318  1.00 27.06  ? 176 TRP D CE2 1 
ATOM   9325  C  CE3 . TRP D 1 176 ? -1.838  -13.908 18.000  1.00 29.26  ? 176 TRP D CE3 1 
ATOM   9326  C  CZ2 . TRP D 1 176 ? -4.356  -14.911 17.008  1.00 28.32  ? 176 TRP D CZ2 1 
ATOM   9327  C  CZ3 . TRP D 1 176 ? -2.908  -13.041 17.674  1.00 31.63  ? 176 TRP D CZ3 1 
ATOM   9328  C  CH2 . TRP D 1 176 ? -4.140  -13.540 17.194  1.00 27.96  ? 176 TRP D CH2 1 
ATOM   9329  N  N   . ASP D 1 177 ? -1.989  -16.852 20.656  1.00 25.10  ? 177 ASP D N   1 
ATOM   9330  C  CA  . ASP D 1 177 ? -3.036  -17.541 21.424  1.00 31.89  ? 177 ASP D CA  1 
ATOM   9331  C  C   . ASP D 1 177 ? -3.003  -17.261 22.948  1.00 30.54  ? 177 ASP D C   1 
ATOM   9332  O  O   . ASP D 1 177 ? -3.180  -18.164 23.761  1.00 28.56  ? 177 ASP D O   1 
ATOM   9333  C  CB  . ASP D 1 177 ? -3.036  -19.060 21.117  1.00 40.02  ? 177 ASP D CB  1 
ATOM   9334  C  CG  . ASP D 1 177 ? -4.284  -19.793 21.698  1.00 56.56  ? 177 ASP D CG  1 
ATOM   9335  O  OD1 . ASP D 1 177 ? -5.337  -19.112 21.860  1.00 67.39  ? 177 ASP D OD1 1 
ATOM   9336  O  OD2 . ASP D 1 177 ? -4.216  -21.025 22.014  1.00 54.79  ? 177 ASP D OD2 1 
ATOM   9337  N  N   . MET D 1 178 ? -2.719  -16.014 23.319  1.00 31.08  ? 178 MET D N   1 
ATOM   9338  C  CA  . MET D 1 178 ? -2.906  -15.491 24.695  1.00 31.78  ? 178 MET D CA  1 
ATOM   9339  C  C   . MET D 1 178 ? -4.376  -15.602 25.104  1.00 29.82  ? 178 MET D C   1 
ATOM   9340  O  O   . MET D 1 178 ? -5.247  -15.786 24.256  1.00 32.25  ? 178 MET D O   1 
ATOM   9341  C  CB  . MET D 1 178 ? -2.572  -13.995 24.763  1.00 32.09  ? 178 MET D CB  1 
ATOM   9342  C  CG  . MET D 1 178 ? -1.381  -13.533 23.967  1.00 32.89  ? 178 MET D CG  1 
ATOM   9343  S  SD  . MET D 1 178 ? -1.652  -13.539 22.194  1.00 35.43  ? 178 MET D SD  1 
ATOM   9344  C  CE  . MET D 1 178 ? -2.412  -11.944 21.874  1.00 30.19  ? 178 MET D CE  1 
ATOM   9345  N  N   . GLN D 1 179 ? -4.650  -15.434 26.389  1.00 29.30  ? 179 GLN D N   1 
ATOM   9346  C  CA  . GLN D 1 179 ? -6.010  -15.301 26.861  1.00 29.98  ? 179 GLN D CA  1 
ATOM   9347  C  C   . GLN D 1 179 ? -6.618  -14.010 26.311  1.00 28.67  ? 179 GLN D C   1 
ATOM   9348  O  O   . GLN D 1 179 ? -6.044  -12.937 26.433  1.00 27.42  ? 179 GLN D O   1 
ATOM   9349  C  CB  . GLN D 1 179 ? -6.055  -15.340 28.389  1.00 31.01  ? 179 GLN D CB  1 
ATOM   9350  C  CG  . GLN D 1 179 ? -7.476  -15.301 28.966  1.00 36.40  ? 179 GLN D CG  1 
ATOM   9351  C  CD  . GLN D 1 179 ? -7.523  -15.451 30.494  1.00 40.37  ? 179 GLN D CD  1 
ATOM   9352  O  OE1 . GLN D 1 179 ? -6.779  -16.247 31.071  1.00 39.85  ? 179 GLN D OE1 1 
ATOM   9353  N  NE2 . GLN D 1 179 ? -8.408  -14.685 31.153  1.00 40.29  ? 179 GLN D NE2 1 
ATOM   9354  N  N   . MET D 1 180 ? -7.784  -14.128 25.692  1.00 32.33  ? 180 MET D N   1 
ATOM   9355  C  CA  . MET D 1 180 ? -8.529  -12.960 25.147  1.00 36.15  ? 180 MET D CA  1 
ATOM   9356  C  C   . MET D 1 180 ? -9.749  -12.583 26.008  1.00 40.15  ? 180 MET D C   1 
ATOM   9357  O  O   . MET D 1 180 ? -10.239 -11.459 25.933  1.00 44.44  ? 180 MET D O   1 
ATOM   9358  C  CB  . MET D 1 180 ? -9.007  -13.204 23.702  1.00 35.23  ? 180 MET D CB  1 
ATOM   9359  C  CG  . MET D 1 180 ? -8.014  -13.896 22.773  1.00 36.51  ? 180 MET D CG  1 
ATOM   9360  S  SD  . MET D 1 180 ? -6.564  -12.875 22.402  1.00 44.59  ? 180 MET D SD  1 
ATOM   9361  C  CE  . MET D 1 180 ? -5.862  -13.846 21.044  1.00 40.84  ? 180 MET D CE  1 
ATOM   9362  N  N   . ASP D 1 181 ? -10.256 -13.515 26.812  1.00 40.18  ? 181 ASP D N   1 
ATOM   9363  C  CA  . ASP D 1 181 ? -11.494 -13.257 27.548  1.00 38.43  ? 181 ASP D CA  1 
ATOM   9364  C  C   . ASP D 1 181 ? -11.245 -13.024 29.052  1.00 36.29  ? 181 ASP D C   1 
ATOM   9365  O  O   . ASP D 1 181 ? -10.087 -12.884 29.504  1.00 34.54  ? 181 ASP D O   1 
ATOM   9366  C  CB  . ASP D 1 181 ? -12.521 -14.385 27.302  1.00 42.54  ? 181 ASP D CB  1 
ATOM   9367  C  CG  . ASP D 1 181 ? -12.237 -15.661 28.136  1.00 48.01  ? 181 ASP D CG  1 
ATOM   9368  O  OD1 . ASP D 1 181 ? -11.058 -16.105 28.173  1.00 50.39  ? 181 ASP D OD1 1 
ATOM   9369  O  OD2 . ASP D 1 181 ? -13.202 -16.221 28.746  1.00 46.54  ? 181 ASP D OD2 1 
ATOM   9370  N  N   . GLY D 1 182 ? -12.337 -12.970 29.813  1.00 32.73  ? 182 GLY D N   1 
ATOM   9371  C  CA  . GLY D 1 182 ? -12.279 -12.794 31.247  1.00 29.48  ? 182 GLY D CA  1 
ATOM   9372  C  C   . GLY D 1 182 ? -11.644 -11.469 31.551  1.00 28.11  ? 182 GLY D C   1 
ATOM   9373  O  O   . GLY D 1 182 ? -11.914 -10.470 30.886  1.00 25.78  ? 182 GLY D O   1 
ATOM   9374  N  N   . ARG D 1 183 ? -10.759 -11.491 32.534  1.00 29.44  ? 183 ARG D N   1 
ATOM   9375  C  CA  . ARG D 1 183 ? -10.007 -10.319 32.956  1.00 31.08  ? 183 ARG D CA  1 
ATOM   9376  C  C   . ARG D 1 183 ? -9.090  -9.724  31.878  1.00 30.00  ? 183 ARG D C   1 
ATOM   9377  O  O   . ARG D 1 183 ? -8.790  -8.533  31.908  1.00 28.68  ? 183 ARG D O   1 
ATOM   9378  C  CB  . ARG D 1 183 ? -9.183  -10.692 34.186  1.00 34.47  ? 183 ARG D CB  1 
ATOM   9379  C  CG  . ARG D 1 183 ? -10.007 -11.126 35.396  1.00 36.55  ? 183 ARG D CG  1 
ATOM   9380  C  CD  . ARG D 1 183 ? -9.090  -11.789 36.424  1.00 41.25  ? 183 ARG D CD  1 
ATOM   9381  N  NE  . ARG D 1 183 ? -7.809  -11.080 36.517  1.00 43.56  ? 183 ARG D NE  1 
ATOM   9382  C  CZ  . ARG D 1 183 ? -6.646  -11.623 36.891  1.00 42.95  ? 183 ARG D CZ  1 
ATOM   9383  N  NH1 . ARG D 1 183 ? -6.560  -12.914 37.223  1.00 37.19  ? 183 ARG D NH1 1 
ATOM   9384  N  NH2 . ARG D 1 183 ? -5.556  -10.856 36.933  1.00 44.89  ? 183 ARG D NH2 1 
ATOM   9385  N  N   . MET D 1 184 ? -8.669  -10.544 30.918  1.00 30.55  ? 184 MET D N   1 
ATOM   9386  C  CA  . MET D 1 184 ? -7.803  -10.086 29.821  1.00 32.01  ? 184 MET D CA  1 
ATOM   9387  C  C   . MET D 1 184 ? -8.514  -9.309  28.689  1.00 33.29  ? 184 MET D C   1 
ATOM   9388  O  O   . MET D 1 184 ? -7.865  -8.902  27.697  1.00 29.48  ? 184 MET D O   1 
ATOM   9389  C  CB  . MET D 1 184 ? -7.050  -11.286 29.206  1.00 33.63  ? 184 MET D CB  1 
ATOM   9390  C  CG  . MET D 1 184 ? -6.143  -12.038 30.156  1.00 32.92  ? 184 MET D CG  1 
ATOM   9391  S  SD  . MET D 1 184 ? -4.997  -10.912 30.979  1.00 38.80  ? 184 MET D SD  1 
ATOM   9392  C  CE  . MET D 1 184 ? -3.651  -10.773 29.782  1.00 31.69  ? 184 MET D CE  1 
ATOM   9393  N  N   . ALA D 1 185 ? -9.829  -9.110  28.806  1.00 31.93  ? 185 ALA D N   1 
ATOM   9394  C  CA  . ALA D 1 185 ? -10.561 -8.431  27.721  1.00 35.88  ? 185 ALA D CA  1 
ATOM   9395  C  C   . ALA D 1 185 ? -10.352 -6.905  27.644  1.00 36.27  ? 185 ALA D C   1 
ATOM   9396  O  O   . ALA D 1 185 ? -10.549 -6.298  26.593  1.00 43.15  ? 185 ALA D O   1 
ATOM   9397  C  CB  . ALA D 1 185 ? -12.049 -8.785  27.742  1.00 37.00  ? 185 ALA D CB  1 
ATOM   9398  N  N   . LYS D 1 186 ? -9.932  -6.284  28.731  1.00 31.39  ? 186 LYS D N   1 
ATOM   9399  C  CA  . LYS D 1 186 ? -9.843  -4.835  28.750  1.00 28.31  ? 186 LYS D CA  1 
ATOM   9400  C  C   . LYS D 1 186 ? -8.441  -4.352  28.496  1.00 25.90  ? 186 LYS D C   1 
ATOM   9401  O  O   . LYS D 1 186 ? -7.496  -5.122  28.558  1.00 26.26  ? 186 LYS D O   1 
ATOM   9402  C  CB  . LYS D 1 186 ? -10.287 -4.317  30.112  1.00 27.34  ? 186 LYS D CB  1 
ATOM   9403  C  CG  . LYS D 1 186 ? -9.562  -5.026  31.225  1.00 26.87  ? 186 LYS D CG  1 
ATOM   9404  C  CD  . LYS D 1 186 ? -10.037 -4.565  32.590  1.00 29.46  ? 186 LYS D CD  1 
ATOM   9405  C  CE  . LYS D 1 186 ? -9.298  -5.302  33.691  1.00 29.18  ? 186 LYS D CE  1 
ATOM   9406  N  NZ  . LYS D 1 186 ? -9.717  -6.736  33.698  1.00 29.18  ? 186 LYS D NZ  1 
ATOM   9407  N  N   . TYR D 1 187 ? -8.346  -3.050  28.232  1.00 24.94  ? 187 TYR D N   1 
ATOM   9408  C  CA  . TYR D 1 187 ? -7.120  -2.289  28.108  1.00 23.84  ? 187 TYR D CA  1 
ATOM   9409  C  C   . TYR D 1 187 ? -6.084  -2.874  27.172  1.00 23.00  ? 187 TYR D C   1 
ATOM   9410  O  O   . TYR D 1 187 ? -4.899  -2.553  27.291  1.00 21.83  ? 187 TYR D O   1 
ATOM   9411  C  CB  . TYR D 1 187 ? -6.477  -2.062  29.491  1.00 25.14  ? 187 TYR D CB  1 
ATOM   9412  C  CG  . TYR D 1 187 ? -7.384  -1.416  30.514  1.00 25.68  ? 187 TYR D CG  1 
ATOM   9413  C  CD1 . TYR D 1 187 ? -7.288  -1.744  31.857  1.00 24.46  ? 187 TYR D CD1 1 
ATOM   9414  C  CD2 . TYR D 1 187 ? -8.355  -0.479  30.130  1.00 25.44  ? 187 TYR D CD2 1 
ATOM   9415  C  CE1 . TYR D 1 187 ? -8.117  -1.141  32.801  1.00 25.11  ? 187 TYR D CE1 1 
ATOM   9416  C  CE2 . TYR D 1 187 ? -9.177  0.117   31.058  1.00 25.28  ? 187 TYR D CE2 1 
ATOM   9417  C  CZ  . TYR D 1 187 ? -9.066  -0.223  32.386  1.00 26.13  ? 187 TYR D CZ  1 
ATOM   9418  O  OH  . TYR D 1 187 ? -9.911  0.371   33.304  1.00 29.28  ? 187 TYR D OH  1 
ATOM   9419  N  N   . TRP D 1 188 ? -6.511  -3.751  26.284  1.00 22.04  ? 188 TRP D N   1 
ATOM   9420  C  CA  . TRP D 1 188 ? -5.618  -4.350  25.302  1.00 24.48  ? 188 TRP D CA  1 
ATOM   9421  C  C   . TRP D 1 188 ? -4.545  -5.203  25.952  1.00 25.11  ? 188 TRP D C   1 
ATOM   9422  O  O   . TRP D 1 188 ? -3.458  -5.457  25.366  1.00 24.93  ? 188 TRP D O   1 
ATOM   9423  C  CB  . TRP D 1 188 ? -5.017  -3.243  24.407  1.00 25.95  ? 188 TRP D CB  1 
ATOM   9424  C  CG  . TRP D 1 188 ? -4.642  -3.684  23.019  1.00 28.68  ? 188 TRP D CG  1 
ATOM   9425  C  CD1 . TRP D 1 188 ? -5.155  -4.768  22.283  1.00 30.29  ? 188 TRP D CD1 1 
ATOM   9426  C  CD2 . TRP D 1 188 ? -3.689  -3.035  22.123  1.00 29.15  ? 188 TRP D CD2 1 
ATOM   9427  N  NE1 . TRP D 1 188 ? -4.573  -4.842  21.042  1.00 30.10  ? 188 TRP D NE1 1 
ATOM   9428  C  CE2 . TRP D 1 188 ? -3.689  -3.826  20.878  1.00 30.35  ? 188 TRP D CE2 1 
ATOM   9429  C  CE3 . TRP D 1 188 ? -2.854  -1.933  22.227  1.00 28.91  ? 188 TRP D CE3 1 
ATOM   9430  C  CZ2 . TRP D 1 188 ? -2.875  -3.508  19.817  1.00 30.93  ? 188 TRP D CZ2 1 
ATOM   9431  C  CZ3 . TRP D 1 188 ? -2.038  -1.616  21.152  1.00 30.02  ? 188 TRP D CZ3 1 
ATOM   9432  C  CH2 . TRP D 1 188 ? -2.053  -2.381  19.968  1.00 33.30  ? 188 TRP D CH2 1 
ATOM   9433  N  N   . LEU D 1 189 ? -4.823  -5.664  27.171  1.00 22.04  ? 189 LEU D N   1 
ATOM   9434  C  CA  . LEU D 1 189 ? -3.814  -6.405  27.917  1.00 21.67  ? 189 LEU D CA  1 
ATOM   9435  C  C   . LEU D 1 189 ? -3.233  -7.609  27.188  1.00 20.88  ? 189 LEU D C   1 
ATOM   9436  O  O   . LEU D 1 189 ? -2.065  -7.951  27.415  1.00 21.13  ? 189 LEU D O   1 
ATOM   9437  C  CB  . LEU D 1 189 ? -4.371  -6.878  29.270  1.00 22.32  ? 189 LEU D CB  1 
ATOM   9438  C  CG  . LEU D 1 189 ? -4.845  -5.734  30.159  1.00 23.59  ? 189 LEU D CG  1 
ATOM   9439  C  CD1 . LEU D 1 189 ? -5.460  -6.253  31.468  1.00 23.30  ? 189 LEU D CD1 1 
ATOM   9440  C  CD2 . LEU D 1 189 ? -3.703  -4.743  30.391  1.00 23.06  ? 189 LEU D CD2 1 
ATOM   9441  N  N   . PRO D 1 190 ? -4.049  -8.298  26.355  1.00 19.45  ? 190 PRO D N   1 
ATOM   9442  C  CA  . PRO D 1 190 ? -3.477  -9.475  25.704  1.00 18.82  ? 190 PRO D CA  1 
ATOM   9443  C  C   . PRO D 1 190 ? -2.283  -9.150  24.807  1.00 19.36  ? 190 PRO D C   1 
ATOM   9444  O  O   . PRO D 1 190 ? -1.358  -9.978  24.692  1.00 20.63  ? 190 PRO D O   1 
ATOM   9445  C  CB  . PRO D 1 190 ? -4.627  -10.037 24.871  1.00 19.29  ? 190 PRO D CB  1 
ATOM   9446  C  CG  . PRO D 1 190 ? -5.870  -9.342  25.329  1.00 18.67  ? 190 PRO D CG  1 
ATOM   9447  C  CD  . PRO D 1 190 ? -5.468  -8.087  26.024  1.00 18.37  ? 190 PRO D CD  1 
ATOM   9448  N  N   . TRP D 1 191 ? -2.280  -7.971  24.195  1.00 18.76  ? 191 TRP D N   1 
ATOM   9449  C  CA  . TRP D 1 191 ? -1.148  -7.566  23.407  1.00 19.42  ? 191 TRP D CA  1 
ATOM   9450  C  C   . TRP D 1 191 ? -0.049  -6.923  24.247  1.00 20.17  ? 191 TRP D C   1 
ATOM   9451  O  O   . TRP D 1 191 ? 1.149   -7.095  23.977  1.00 18.07  ? 191 TRP D O   1 
ATOM   9452  C  CB  . TRP D 1 191 ? -1.601  -6.652  22.292  1.00 21.98  ? 191 TRP D CB  1 
ATOM   9453  C  CG  . TRP D 1 191 ? -2.120  -7.422  21.114  1.00 27.37  ? 191 TRP D CG  1 
ATOM   9454  C  CD1 . TRP D 1 191 ? -1.449  -7.717  19.923  1.00 30.23  ? 191 TRP D CD1 1 
ATOM   9455  C  CD2 . TRP D 1 191 ? -3.463  -8.051  20.963  1.00 30.41  ? 191 TRP D CD2 1 
ATOM   9456  N  NE1 . TRP D 1 191 ? -2.257  -8.459  19.070  1.00 33.32  ? 191 TRP D NE1 1 
ATOM   9457  C  CE2 . TRP D 1 191 ? -3.478  -8.685  19.639  1.00 31.95  ? 191 TRP D CE2 1 
ATOM   9458  C  CE3 . TRP D 1 191 ? -4.615  -8.117  21.755  1.00 32.91  ? 191 TRP D CE3 1 
ATOM   9459  C  CZ2 . TRP D 1 191 ? -4.600  -9.365  19.162  1.00 33.41  ? 191 TRP D CZ2 1 
ATOM   9460  C  CZ3 . TRP D 1 191 ? -5.741  -8.800  21.260  1.00 32.52  ? 191 TRP D CZ3 1 
ATOM   9461  C  CH2 . TRP D 1 191 ? -5.726  -9.417  19.997  1.00 32.89  ? 191 TRP D CH2 1 
ATOM   9462  N  N   . LEU D 1 192 ? -0.426  -6.155  25.264  1.00 19.32  ? 192 LEU D N   1 
ATOM   9463  C  CA  . LEU D 1 192 ? 0.577   -5.487  26.060  1.00 19.40  ? 192 LEU D CA  1 
ATOM   9464  C  C   . LEU D 1 192 ? 1.244   -6.356  27.104  1.00 18.50  ? 192 LEU D C   1 
ATOM   9465  O  O   . LEU D 1 192 ? 2.402   -6.171  27.402  1.00 18.44  ? 192 LEU D O   1 
ATOM   9466  C  CB  . LEU D 1 192 ? -0.008  -4.260  26.734  1.00 20.10  ? 192 LEU D CB  1 
ATOM   9467  C  CG  . LEU D 1 192 ? -0.789  -3.432  25.752  1.00 21.70  ? 192 LEU D CG  1 
ATOM   9468  C  CD1 . LEU D 1 192 ? -1.412  -2.292  26.537  1.00 21.17  ? 192 LEU D CD1 1 
ATOM   9469  C  CD2 . LEU D 1 192 ? 0.087   -2.959  24.574  1.00 20.25  ? 192 LEU D CD2 1 
ATOM   9470  N  N   . VAL D 1 193 ? 0.518   -7.288  27.692  1.00 18.24  ? 193 VAL D N   1 
ATOM   9471  C  CA  . VAL D 1 193 ? 1.087   -8.077  28.778  1.00 16.79  ? 193 VAL D CA  1 
ATOM   9472  C  C   . VAL D 1 193 ? 1.084   -9.546  28.448  1.00 17.95  ? 193 VAL D C   1 
ATOM   9473  O  O   . VAL D 1 193 ? 2.063   -10.248 28.704  1.00 18.00  ? 193 VAL D O   1 
ATOM   9474  C  CB  . VAL D 1 193 ? 0.255   -7.908  30.033  1.00 17.26  ? 193 VAL D CB  1 
ATOM   9475  C  CG1 . VAL D 1 193 ? 0.611   -8.976  31.088  1.00 17.17  ? 193 VAL D CG1 1 
ATOM   9476  C  CG2 . VAL D 1 193 ? 0.377   -6.469  30.557  1.00 16.74  ? 193 VAL D CG2 1 
ATOM   9477  N  N   . GLY D 1 194 ? -0.024  -9.991  27.844  1.00 19.53  ? 194 GLY D N   1 
ATOM   9478  C  CA  . GLY D 1 194 ? -0.264  -11.381 27.571  1.00 18.78  ? 194 GLY D CA  1 
ATOM   9479  C  C   . GLY D 1 194 ? 0.820   -11.905 26.650  1.00 19.42  ? 194 GLY D C   1 
ATOM   9480  O  O   . GLY D 1 194 ? 1.311   -13.016 26.848  1.00 20.66  ? 194 GLY D O   1 
ATOM   9481  N  N   . MET D 1 195 ? 1.212   -11.098 25.669  1.00 18.22  ? 195 MET D N   1 
ATOM   9482  C  CA  . MET D 1 195 ? 2.181   -11.528 24.647  1.00 17.16  ? 195 MET D CA  1 
ATOM   9483  C  C   . MET D 1 195 ? 3.563   -11.638 25.192  1.00 14.63  ? 195 MET D C   1 
ATOM   9484  O  O   . MET D 1 195 ? 4.242   -12.593 24.894  1.00 14.84  ? 195 MET D O   1 
ATOM   9485  C  CB  . MET D 1 195 ? 2.187   -10.598 23.403  1.00 17.85  ? 195 MET D CB  1 
ATOM   9486  C  CG  . MET D 1 195 ? 1.093   -10.946 22.446  1.00 20.31  ? 195 MET D CG  1 
ATOM   9487  S  SD  . MET D 1 195 ? 1.313   -10.262 20.790  1.00 26.91  ? 195 MET D SD  1 
ATOM   9488  C  CE  . MET D 1 195 ? 2.157   -8.744  21.136  1.00 25.00  ? 195 MET D CE  1 
ATOM   9489  N  N   . PRO D 1 196 ? 4.003   -10.653 25.965  1.00 13.87  ? 196 PRO D N   1 
ATOM   9490  C  CA  . PRO D 1 196 ? 5.270   -10.865 26.637  1.00 14.00  ? 196 PRO D CA  1 
ATOM   9491  C  C   . PRO D 1 196 ? 5.293   -12.047 27.604  1.00 13.98  ? 196 PRO D C   1 
ATOM   9492  O  O   . PRO D 1 196 ? 6.346   -12.655 27.762  1.00 14.67  ? 196 PRO D O   1 
ATOM   9493  C  CB  . PRO D 1 196 ? 5.496   -9.557  27.400  1.00 13.56  ? 196 PRO D CB  1 
ATOM   9494  C  CG  . PRO D 1 196 ? 4.762   -8.542  26.615  1.00 13.57  ? 196 PRO D CG  1 
ATOM   9495  C  CD  . PRO D 1 196 ? 3.561   -9.252  26.061  1.00 14.01  ? 196 PRO D CD  1 
ATOM   9496  N  N   . ALA D 1 197 ? 4.159   -12.373 28.235  1.00 14.19  ? 197 ALA D N   1 
ATOM   9497  C  CA  . ALA D 1 197 ? 4.100   -13.450 29.226  1.00 14.19  ? 197 ALA D CA  1 
ATOM   9498  C  C   . ALA D 1 197 ? 4.263   -14.775 28.520  1.00 14.48  ? 197 ALA D C   1 
ATOM   9499  O  O   . ALA D 1 197 ? 4.991   -15.609 28.979  1.00 14.89  ? 197 ALA D O   1 
ATOM   9500  C  CB  . ALA D 1 197 ? 2.758   -13.423 29.961  1.00 14.26  ? 197 ALA D CB  1 
ATOM   9501  N  N   . GLU D 1 198 ? 3.547   -14.964 27.406  1.00 15.22  ? 198 GLU D N   1 
ATOM   9502  C  CA  . GLU D 1 198 ? 3.671   -16.154 26.557  1.00 15.86  ? 198 GLU D CA  1 
ATOM   9503  C  C   . GLU D 1 198 ? 5.107   -16.410 26.095  1.00 14.48  ? 198 GLU D C   1 
ATOM   9504  O  O   . GLU D 1 198 ? 5.511   -17.537 26.058  1.00 14.37  ? 198 GLU D O   1 
ATOM   9505  C  CB  . GLU D 1 198 ? 2.825   -15.992 25.291  1.00 19.03  ? 198 GLU D CB  1 
ATOM   9506  C  CG  . GLU D 1 198 ? 1.392   -16.462 25.388  1.00 21.32  ? 198 GLU D CG  1 
ATOM   9507  C  CD  . GLU D 1 198 ? 1.312   -17.968 25.598  1.00 25.44  ? 198 GLU D CD  1 
ATOM   9508  O  OE1 . GLU D 1 198 ? 2.018   -18.729 24.870  1.00 24.82  ? 198 GLU D OE1 1 
ATOM   9509  O  OE2 . GLU D 1 198 ? 0.576   -18.376 26.548  1.00 30.17  ? 198 GLU D OE2 1 
ATOM   9510  N  N   . THR D 1 199 ? 5.839   -15.371 25.695  1.00 14.09  ? 199 THR D N   1 
ATOM   9511  C  CA  . THR D 1 199 ? 7.194   -15.506 25.164  1.00 13.85  ? 199 THR D CA  1 
ATOM   9512  C  C   . THR D 1 199 ? 8.103   -15.910 26.306  1.00 13.81  ? 199 THR D C   1 
ATOM   9513  O  O   . THR D 1 199 ? 8.988   -16.722 26.111  1.00 13.67  ? 199 THR D O   1 
ATOM   9514  C  CB  . THR D 1 199 ? 7.744   -14.167 24.592  1.00 14.10  ? 199 THR D CB  1 
ATOM   9515  O  OG1 . THR D 1 199 ? 6.948   -13.736 23.503  1.00 14.34  ? 199 THR D OG1 1 
ATOM   9516  C  CG2 . THR D 1 199 ? 9.212   -14.274 24.145  1.00 13.38  ? 199 THR D CG2 1 
ATOM   9517  N  N   . THR D 1 200 ? 7.887   -15.355 27.495  1.00 13.98  ? 200 THR D N   1 
ATOM   9518  C  CA  . THR D 1 200 ? 8.662   -15.794 28.674  1.00 15.40  ? 200 THR D CA  1 
ATOM   9519  C  C   . THR D 1 200 ? 8.445   -17.304 28.960  1.00 15.82  ? 200 THR D C   1 
ATOM   9520  O  O   . THR D 1 200 ? 9.382   -18.020 29.304  1.00 17.65  ? 200 THR D O   1 
ATOM   9521  C  CB  . THR D 1 200 ? 8.269   -14.968 29.932  1.00 15.72  ? 200 THR D CB  1 
ATOM   9522  O  OG1 . THR D 1 200 ? 8.316   -13.560 29.651  1.00 15.10  ? 200 THR D OG1 1 
ATOM   9523  C  CG2 . THR D 1 200 ? 9.160   -15.301 31.126  1.00 16.27  ? 200 THR D CG2 1 
ATOM   9524  N  N   . ILE D 1 201 ? 7.211   -17.786 28.813  1.00 15.64  ? 201 ILE D N   1 
ATOM   9525  C  CA  . ILE D 1 201 ? 6.892   -19.212 29.063  1.00 16.00  ? 201 ILE D CA  1 
ATOM   9526  C  C   . ILE D 1 201 ? 7.592   -20.128 28.038  1.00 15.24  ? 201 ILE D C   1 
ATOM   9527  O  O   . ILE D 1 201 ? 8.006   -21.245 28.344  1.00 15.70  ? 201 ILE D O   1 
ATOM   9528  C  CB  . ILE D 1 201 ? 5.348   -19.450 29.053  1.00 16.58  ? 201 ILE D CB  1 
ATOM   9529  C  CG1 . ILE D 1 201 ? 4.676   -18.819 30.260  1.00 17.16  ? 201 ILE D CG1 1 
ATOM   9530  C  CG2 . ILE D 1 201 ? 5.018   -20.940 28.964  1.00 17.11  ? 201 ILE D CG2 1 
ATOM   9531  C  CD1 . ILE D 1 201 ? 3.171   -18.580 30.122  1.00 16.78  ? 201 ILE D CD1 1 
ATOM   9532  N  N   . ALA D 1 202 ? 7.742   -19.644 26.818  1.00 15.08  ? 202 ALA D N   1 
ATOM   9533  C  CA  . ALA D 1 202 ? 8.326   -20.467 25.749  1.00 15.11  ? 202 ALA D CA  1 
ATOM   9534  C  C   . ALA D 1 202 ? 9.814   -20.649 25.942  1.00 14.98  ? 202 ALA D C   1 
ATOM   9535  O  O   . ALA D 1 202 ? 10.331  -21.761 25.852  1.00 16.10  ? 202 ALA D O   1 
ATOM   9536  C  CB  . ALA D 1 202 ? 8.021   -19.884 24.384  1.00 13.65  ? 202 ALA D CB  1 
ATOM   9537  N  N   . ILE D 1 203 ? 10.501  -19.551 26.205  1.00 14.91  ? 203 ILE D N   1 
ATOM   9538  C  CA  . ILE D 1 203 ? 11.898  -19.611 26.615  1.00 15.77  ? 203 ILE D CA  1 
ATOM   9539  C  C   . ILE D 1 203 ? 12.075  -20.575 27.818  1.00 16.74  ? 203 ILE D C   1 
ATOM   9540  O  O   . ILE D 1 203 ? 12.949  -21.479 27.766  1.00 16.98  ? 203 ILE D O   1 
ATOM   9541  C  CB  . ILE D 1 203 ? 12.463  -18.209 26.971  1.00 14.91  ? 203 ILE D CB  1 
ATOM   9542  C  CG1 . ILE D 1 203 ? 12.295  -17.261 25.801  1.00 13.67  ? 203 ILE D CG1 1 
ATOM   9543  C  CG2 . ILE D 1 203 ? 13.915  -18.323 27.437  1.00 15.31  ? 203 ILE D CG2 1 
ATOM   9544  C  CD1 . ILE D 1 203 ? 12.754  -15.861 26.086  1.00 13.65  ? 203 ILE D CD1 1 
ATOM   9545  N  N   . CYS D 1 204 ? 11.269  -20.403 28.873  1.00 16.59  ? 204 CYS D N   1 
ATOM   9546  C  CA  . CYS D 1 204 ? 11.410  -21.307 30.054  1.00 18.69  ? 204 CYS D CA  1 
ATOM   9547  C  C   . CYS D 1 204 ? 11.176  -22.737 29.662  1.00 19.55  ? 204 CYS D C   1 
ATOM   9548  O  O   . CYS D 1 204 ? 11.956  -23.619 30.039  1.00 19.31  ? 204 CYS D O   1 
ATOM   9549  C  CB  . CYS D 1 204 ? 10.461  -20.966 31.211  1.00 18.18  ? 204 CYS D CB  1 
ATOM   9550  S  SG  . CYS D 1 204 ? 10.870  -19.416 32.051  1.00 21.71  ? 204 CYS D SG  1 
ATOM   9551  N  N   . SER D 1 205 ? 10.108  -22.979 28.896  1.00 19.17  ? 205 SER D N   1 
ATOM   9552  C  CA  . SER D 1 205 ? 9.814   -24.362 28.482  1.00 19.87  ? 205 SER D CA  1 
ATOM   9553  C  C   . SER D 1 205 ? 10.905  -24.931 27.619  1.00 19.58  ? 205 SER D C   1 
ATOM   9554  O  O   . SER D 1 205 ? 11.220  -26.087 27.737  1.00 21.33  ? 205 SER D O   1 
ATOM   9555  C  CB  . SER D 1 205 ? 8.462   -24.467 27.749  1.00 18.93  ? 205 SER D CB  1 
ATOM   9556  O  OG  . SER D 1 205 ? 7.469   -23.937 28.581  1.00 18.78  ? 205 SER D OG  1 
ATOM   9557  N  N   . MET D 1 206 ? 11.488  -24.140 26.737  1.00 20.04  ? 206 MET D N   1 
ATOM   9558  C  CA  . MET D 1 206 ? 12.589  -24.686 25.932  1.00 21.71  ? 206 MET D CA  1 
ATOM   9559  C  C   . MET D 1 206 ? 13.904  -24.902 26.682  1.00 21.09  ? 206 MET D C   1 
ATOM   9560  O  O   . MET D 1 206 ? 14.666  -25.783 26.313  1.00 22.90  ? 206 MET D O   1 
ATOM   9561  C  CB  . MET D 1 206 ? 12.851  -23.824 24.709  1.00 23.53  ? 206 MET D CB  1 
ATOM   9562  C  CG  . MET D 1 206 ? 11.836  -24.076 23.623  1.00 24.08  ? 206 MET D CG  1 
ATOM   9563  S  SD  . MET D 1 206 ? 12.198  -22.905 22.350  1.00 29.59  ? 206 MET D SD  1 
ATOM   9564  C  CE  . MET D 1 206 ? 13.168  -23.870 21.222  1.00 24.38  ? 206 MET D CE  1 
ATOM   9565  N  N   . ILE D 1 207 ? 14.182  -24.093 27.702  1.00 18.56  ? 207 ILE D N   1 
ATOM   9566  C  CA  . ILE D 1 207 ? 15.342  -24.302 28.524  1.00 17.77  ? 207 ILE D CA  1 
ATOM   9567  C  C   . ILE D 1 207 ? 15.057  -25.501 29.423  1.00 18.77  ? 207 ILE D C   1 
ATOM   9568  O  O   . ILE D 1 207 ? 15.735  -26.522 29.353  1.00 18.54  ? 207 ILE D O   1 
ATOM   9569  C  CB  . ILE D 1 207 ? 15.612  -23.079 29.419  1.00 18.79  ? 207 ILE D CB  1 
ATOM   9570  C  CG1 . ILE D 1 207 ? 15.878  -21.811 28.602  1.00 17.81  ? 207 ILE D CG1 1 
ATOM   9571  C  CG2 . ILE D 1 207 ? 16.745  -23.380 30.405  1.00 20.39  ? 207 ILE D CG2 1 
ATOM   9572  C  CD1 . ILE D 1 207 ? 16.359  -20.632 29.422  1.00 18.01  ? 207 ILE D CD1 1 
ATOM   9573  N  N   . MET D 1 208 ? 14.014  -25.403 30.243  1.00 19.85  ? 208 MET D N   1 
ATOM   9574  C  CA  . MET D 1 208 ? 13.772  -26.405 31.271  1.00 21.23  ? 208 MET D CA  1 
ATOM   9575  C  C   . MET D 1 208 ? 13.382  -27.746 30.718  1.00 22.15  ? 208 MET D C   1 
ATOM   9576  O  O   . MET D 1 208 ? 13.616  -28.787 31.360  1.00 21.85  ? 208 MET D O   1 
ATOM   9577  C  CB  . MET D 1 208 ? 12.751  -25.916 32.289  1.00 23.33  ? 208 MET D CB  1 
ATOM   9578  C  CG  . MET D 1 208 ? 13.400  -24.891 33.186  1.00 24.68  ? 208 MET D CG  1 
ATOM   9579  S  SD  . MET D 1 208 ? 12.493  -24.398 34.647  1.00 29.74  ? 208 MET D SD  1 
ATOM   9580  C  CE  . MET D 1 208 ? 12.074  -22.710 34.185  1.00 27.11  ? 208 MET D CE  1 
ATOM   9581  N  N   . GLY D 1 209 ? 12.795  -27.729 29.523  1.00 21.58  ? 209 GLY D N   1 
ATOM   9582  C  CA  . GLY D 1 209 ? 12.399  -28.950 28.872  1.00 19.97  ? 209 GLY D CA  1 
ATOM   9583  C  C   . GLY D 1 209 ? 13.534  -29.525 28.078  1.00 20.79  ? 209 GLY D C   1 
ATOM   9584  O  O   . GLY D 1 209 ? 13.311  -30.428 27.305  1.00 20.57  ? 209 GLY D O   1 
ATOM   9585  N  N   . GLY D 1 210 ? 14.740  -28.975 28.252  1.00 20.73  ? 210 GLY D N   1 
ATOM   9586  C  CA  . GLY D 1 210 ? 15.938  -29.445 27.567  1.00 21.30  ? 210 GLY D CA  1 
ATOM   9587  C  C   . GLY D 1 210 ? 16.028  -29.303 26.049  1.00 22.78  ? 210 GLY D C   1 
ATOM   9588  O  O   . GLY D 1 210 ? 16.868  -29.977 25.430  1.00 23.37  ? 210 GLY D O   1 
ATOM   9589  N  N   . VAL D 1 211 ? 15.219  -28.433 25.431  1.00 20.85  ? 211 VAL D N   1 
ATOM   9590  C  CA  . VAL D 1 211 ? 15.372  -28.253 23.973  1.00 20.75  ? 211 VAL D CA  1 
ATOM   9591  C  C   . VAL D 1 211 ? 16.777  -27.827 23.549  1.00 22.02  ? 211 VAL D C   1 
ATOM   9592  O  O   . VAL D 1 211 ? 17.371  -28.457 22.668  1.00 23.19  ? 211 VAL D O   1 
ATOM   9593  C  CB  . VAL D 1 211 ? 14.274  -27.411 23.299  1.00 19.48  ? 211 VAL D CB  1 
ATOM   9594  C  CG1 . VAL D 1 211 ? 14.560  -27.249 21.812  1.00 19.34  ? 211 VAL D CG1 1 
ATOM   9595  C  CG2 . VAL D 1 211 ? 12.928  -28.090 23.475  1.00 19.35  ? 211 VAL D CG2 1 
ATOM   9596  N  N   . PHE D 1 212 ? 17.318  -26.778 24.173  1.00 22.78  ? 212 PHE D N   1 
ATOM   9597  C  CA  . PHE D 1 212 ? 18.670  -26.309 23.836  1.00 23.37  ? 212 PHE D CA  1 
ATOM   9598  C  C   . PHE D 1 212 ? 19.819  -27.288 24.174  1.00 25.38  ? 212 PHE D C   1 
ATOM   9599  O  O   . PHE D 1 212 ? 20.903  -27.186 23.582  1.00 26.63  ? 212 PHE D O   1 
ATOM   9600  C  CB  . PHE D 1 212 ? 18.957  -24.948 24.447  1.00 21.73  ? 212 PHE D CB  1 
ATOM   9601  C  CG  . PHE D 1 212 ? 17.999  -23.866 24.022  1.00 21.92  ? 212 PHE D CG  1 
ATOM   9602  C  CD1 . PHE D 1 212 ? 18.088  -23.282 22.751  1.00 21.31  ? 212 PHE D CD1 1 
ATOM   9603  C  CD2 . PHE D 1 212 ? 17.044  -23.370 24.919  1.00 21.68  ? 212 PHE D CD2 1 
ATOM   9604  C  CE1 . PHE D 1 212 ? 17.226  -22.262 22.389  1.00 20.28  ? 212 PHE D CE1 1 
ATOM   9605  C  CE2 . PHE D 1 212 ? 16.150  -22.352 24.538  1.00 21.29  ? 212 PHE D CE2 1 
ATOM   9606  C  CZ  . PHE D 1 212 ? 16.254  -21.800 23.280  1.00 20.12  ? 212 PHE D CZ  1 
ATOM   9607  N  N   . GLU D 1 213 ? 19.598  -28.217 25.101  1.00 26.57  ? 213 GLU D N   1 
ATOM   9608  C  CA  . GLU D 1 213 ? 20.605  -29.216 25.418  1.00 30.01  ? 213 GLU D CA  1 
ATOM   9609  C  C   . GLU D 1 213 ? 20.634  -30.289 24.335  1.00 29.52  ? 213 GLU D C   1 
ATOM   9610  O  O   . GLU D 1 213 ? 21.682  -30.603 23.817  1.00 28.03  ? 213 GLU D O   1 
ATOM   9611  C  CB  . GLU D 1 213 ? 20.391  -29.835 26.819  1.00 34.88  ? 213 GLU D CB  1 
ATOM   9612  C  CG  . GLU D 1 213 ? 21.620  -30.549 27.408  1.00 39.42  ? 213 GLU D CG  1 
ATOM   9613  C  CD  . GLU D 1 213 ? 22.896  -29.672 27.525  1.00 45.54  ? 213 GLU D CD  1 
ATOM   9614  O  OE1 . GLU D 1 213 ? 22.811  -28.399 27.586  1.00 47.52  ? 213 GLU D OE1 1 
ATOM   9615  O  OE2 . GLU D 1 213 ? 24.011  -30.264 27.560  1.00 41.44  ? 213 GLU D OE2 1 
ATOM   9616  N  N   . LYS D 1 214 ? 19.476  -30.829 23.976  1.00 30.64  ? 214 LYS D N   1 
ATOM   9617  C  CA  . LYS D 1 214 ? 19.405  -31.836 22.915  1.00 30.24  ? 214 LYS D CA  1 
ATOM   9618  C  C   . LYS D 1 214 ? 19.816  -31.327 21.527  1.00 28.51  ? 214 LYS D C   1 
ATOM   9619  O  O   . LYS D 1 214 ? 20.338  -32.098 20.718  1.00 29.59  ? 214 LYS D O   1 
ATOM   9620  C  CB  . LYS D 1 214 ? 18.003  -32.419 22.806  1.00 33.88  ? 214 LYS D CB  1 
ATOM   9621  C  CG  . LYS D 1 214 ? 17.678  -33.562 23.750  1.00 38.24  ? 214 LYS D CG  1 
ATOM   9622  C  CD  . LYS D 1 214 ? 16.989  -33.050 25.016  1.00 43.94  ? 214 LYS D CD  1 
ATOM   9623  C  CE  . LYS D 1 214 ? 17.047  -34.055 26.168  1.00 43.75  ? 214 LYS D CE  1 
ATOM   9624  N  NZ  . LYS D 1 214 ? 16.934  -33.356 27.477  1.00 48.29  ? 214 LYS D NZ  1 
ATOM   9625  N  N   . PHE D 1 215 ? 19.570  -30.049 21.234  1.00 24.80  ? 215 PHE D N   1 
ATOM   9626  C  CA  . PHE D 1 215 ? 19.758  -29.529 19.883  1.00 21.13  ? 215 PHE D CA  1 
ATOM   9627  C  C   . PHE D 1 215 ? 20.546  -28.247 19.995  1.00 22.76  ? 215 PHE D C   1 
ATOM   9628  O  O   . PHE D 1 215 ? 19.992  -27.154 19.807  1.00 21.46  ? 215 PHE D O   1 
ATOM   9629  C  CB  . PHE D 1 215 ? 18.417  -29.278 19.184  1.00 20.28  ? 215 PHE D CB  1 
ATOM   9630  C  CG  . PHE D 1 215 ? 17.445  -30.437 19.279  1.00 19.49  ? 215 PHE D CG  1 
ATOM   9631  C  CD1 . PHE D 1 215 ? 17.645  -31.587 18.520  1.00 19.51  ? 215 PHE D CD1 1 
ATOM   9632  C  CD2 . PHE D 1 215 ? 16.371  -30.395 20.178  1.00 19.13  ? 215 PHE D CD2 1 
ATOM   9633  C  CE1 . PHE D 1 215 ? 16.794  -32.682 18.644  1.00 20.36  ? 215 PHE D CE1 1 
ATOM   9634  C  CE2 . PHE D 1 215 ? 15.512  -31.476 20.316  1.00 19.94  ? 215 PHE D CE2 1 
ATOM   9635  C  CZ  . PHE D 1 215 ? 15.727  -32.628 19.541  1.00 21.46  ? 215 PHE D CZ  1 
ATOM   9636  N  N   . PRO D 1 216 ? 21.865  -28.364 20.294  1.00 22.10  ? 216 PRO D N   1 
ATOM   9637  C  CA  . PRO D 1 216 ? 22.646  -27.163 20.527  1.00 21.74  ? 216 PRO D CA  1 
ATOM   9638  C  C   . PRO D 1 216 ? 22.939  -26.389 19.256  1.00 21.75  ? 216 PRO D C   1 
ATOM   9639  O  O   . PRO D 1 216 ? 23.398  -25.253 19.321  1.00 21.63  ? 216 PRO D O   1 
ATOM   9640  C  CB  . PRO D 1 216 ? 23.928  -27.698 21.162  1.00 22.00  ? 216 PRO D CB  1 
ATOM   9641  C  CG  . PRO D 1 216 ? 24.073  -29.080 20.615  1.00 21.68  ? 216 PRO D CG  1 
ATOM   9642  C  CD  . PRO D 1 216 ? 22.686  -29.586 20.360  1.00 22.21  ? 216 PRO D CD  1 
ATOM   9643  N  N   . LYS D 1 217 ? 22.653  -26.950 18.095  1.00 21.43  ? 217 LYS D N   1 
ATOM   9644  C  CA  . LYS D 1 217 ? 22.900  -26.146 16.895  1.00 23.44  ? 217 LYS D CA  1 
ATOM   9645  C  C   . LYS D 1 217 ? 21.643  -25.472 16.389  1.00 21.44  ? 217 LYS D C   1 
ATOM   9646  O  O   . LYS D 1 217 ? 21.678  -24.722 15.434  1.00 21.73  ? 217 LYS D O   1 
ATOM   9647  C  CB  . LYS D 1 217 ? 23.640  -26.954 15.784  1.00 25.22  ? 217 LYS D CB  1 
ATOM   9648  C  CG  . LYS D 1 217 ? 24.985  -27.496 16.257  1.00 27.40  ? 217 LYS D CG  1 
ATOM   9649  C  CD  . LYS D 1 217 ? 26.136  -27.210 15.296  1.00 31.30  ? 217 LYS D CD  1 
ATOM   9650  C  CE  . LYS D 1 217 ? 26.846  -25.901 15.641  1.00 34.42  ? 217 LYS D CE  1 
ATOM   9651  N  NZ  . LYS D 1 217 ? 27.594  -25.958 16.941  1.00 34.24  ? 217 LYS D NZ  1 
ATOM   9652  N  N   . LEU D 1 218 ? 20.527  -25.751 17.045  1.00 22.20  ? 218 LEU D N   1 
ATOM   9653  C  CA  . LEU D 1 218 ? 19.257  -25.164 16.694  1.00 21.13  ? 218 LEU D CA  1 
ATOM   9654  C  C   . LEU D 1 218 ? 19.309  -23.651 17.002  1.00 21.54  ? 218 LEU D C   1 
ATOM   9655  O  O   . LEU D 1 218 ? 19.668  -23.263 18.105  1.00 23.61  ? 218 LEU D O   1 
ATOM   9656  C  CB  . LEU D 1 218 ? 18.160  -25.867 17.491  1.00 22.07  ? 218 LEU D CB  1 
ATOM   9657  C  CG  . LEU D 1 218 ? 16.725  -25.316 17.421  1.00 22.19  ? 218 LEU D CG  1 
ATOM   9658  C  CD1 . LEU D 1 218 ? 16.128  -25.560 16.046  1.00 21.43  ? 218 LEU D CD1 1 
ATOM   9659  C  CD2 . LEU D 1 218 ? 15.875  -26.009 18.454  1.00 21.67  ? 218 LEU D CD2 1 
ATOM   9660  N  N   . LYS D 1 219 ? 18.997  -22.812 16.020  1.00 19.52  ? 219 LYS D N   1 
ATOM   9661  C  CA  . LYS D 1 219 ? 18.956  -21.361 16.197  1.00 18.30  ? 219 LYS D CA  1 
ATOM   9662  C  C   . LYS D 1 219 ? 17.533  -20.890 16.424  1.00 17.54  ? 219 LYS D C   1 
ATOM   9663  O  O   . LYS D 1 219 ? 16.614  -21.241 15.656  1.00 18.12  ? 219 LYS D O   1 
ATOM   9664  C  CB  . LYS D 1 219 ? 19.481  -20.660 14.962  1.00 19.02  ? 219 LYS D CB  1 
ATOM   9665  C  CG  . LYS D 1 219 ? 20.948  -20.290 14.967  1.00 20.12  ? 219 LYS D CG  1 
ATOM   9666  C  CD  . LYS D 1 219 ? 21.458  -20.587 13.576  1.00 22.52  ? 219 LYS D CD  1 
ATOM   9667  C  CE  . LYS D 1 219 ? 22.791  -19.939 13.266  1.00 26.92  ? 219 LYS D CE  1 
ATOM   9668  N  NZ  . LYS D 1 219 ? 23.782  -20.235 14.337  1.00 29.70  ? 219 LYS D NZ  1 
ATOM   9669  N  N   . VAL D 1 220 ? 17.348  -20.079 17.456  1.00 14.99  ? 220 VAL D N   1 
ATOM   9670  C  CA  . VAL D 1 220 ? 16.027  -19.654 17.835  1.00 14.33  ? 220 VAL D CA  1 
ATOM   9671  C  C   . VAL D 1 220 ? 16.045  -18.193 18.226  1.00 13.52  ? 220 VAL D C   1 
ATOM   9672  O  O   . VAL D 1 220 ? 16.896  -17.741 18.973  1.00 12.97  ? 220 VAL D O   1 
ATOM   9673  C  CB  . VAL D 1 220 ? 15.505  -20.467 19.015  1.00 14.71  ? 220 VAL D CB  1 
ATOM   9674  C  CG1 . VAL D 1 220 ? 14.018  -20.274 19.166  1.00 14.45  ? 220 VAL D CG1 1 
ATOM   9675  C  CG2 . VAL D 1 220 ? 15.841  -21.931 18.832  1.00 15.64  ? 220 VAL D CG2 1 
ATOM   9676  N  N   . CYS D 1 221 ? 15.093  -17.454 17.691  1.00 13.87  ? 221 CYS D N   1 
ATOM   9677  C  CA  . CYS D 1 221 ? 14.903  -16.065 18.032  1.00 14.22  ? 221 CYS D CA  1 
ATOM   9678  C  C   . CYS D 1 221 ? 13.518  -15.945 18.680  1.00 14.04  ? 221 CYS D C   1 
ATOM   9679  O  O   . CYS D 1 221 ? 12.550  -16.482 18.156  1.00 13.15  ? 221 CYS D O   1 
ATOM   9680  C  CB  . CYS D 1 221 ? 15.009  -15.196 16.784  1.00 14.68  ? 221 CYS D CB  1 
ATOM   9681  S  SG  . CYS D 1 221 ? 14.867  -13.409 17.071  1.00 18.32  ? 221 CYS D SG  1 
ATOM   9682  N  N   . PHE D 1 222 ? 13.427  -15.234 19.806  1.00 13.97  ? 222 PHE D N   1 
ATOM   9683  C  CA  . PHE D 1 222 ? 12.118  -14.919 20.398  1.00 14.70  ? 222 PHE D CA  1 
ATOM   9684  C  C   . PHE D 1 222 ? 11.695  -13.491 20.176  1.00 15.60  ? 222 PHE D C   1 
ATOM   9685  O  O   . PHE D 1 222 ? 12.518  -12.602 20.244  1.00 16.98  ? 222 PHE D O   1 
ATOM   9686  C  CB  . PHE D 1 222 ? 12.118  -15.211 21.882  1.00 13.57  ? 222 PHE D CB  1 
ATOM   9687  C  CG  . PHE D 1 222 ? 12.415  -16.648 22.184  1.00 14.07  ? 222 PHE D CG  1 
ATOM   9688  C  CD1 . PHE D 1 222 ? 11.397  -17.601 22.156  1.00 13.68  ? 222 PHE D CD1 1 
ATOM   9689  C  CD2 . PHE D 1 222 ? 13.711  -17.054 22.488  1.00 12.89  ? 222 PHE D CD2 1 
ATOM   9690  C  CE1 . PHE D 1 222 ? 11.663  -18.922 22.447  1.00 13.40  ? 222 PHE D CE1 1 
ATOM   9691  C  CE2 . PHE D 1 222 ? 13.975  -18.373 22.750  1.00 13.28  ? 222 PHE D CE2 1 
ATOM   9692  C  CZ  . PHE D 1 222 ? 12.952  -19.313 22.734  1.00 13.52  ? 222 PHE D CZ  1 
ATOM   9693  N  N   . ALA D 1 223 ? 10.409  -13.274 19.936  1.00 16.31  ? 223 ALA D N   1 
ATOM   9694  C  CA  . ALA D 1 223 ? 9.889   -11.904 19.648  1.00 17.62  ? 223 ALA D CA  1 
ATOM   9695  C  C   . ALA D 1 223 ? 9.869   -10.932 20.873  1.00 18.15  ? 223 ALA D C   1 
ATOM   9696  O  O   . ALA D 1 223 ? 10.034  -11.364 22.017  1.00 16.72  ? 223 ALA D O   1 
ATOM   9697  C  CB  . ALA D 1 223 ? 8.515   -11.989 18.984  1.00 15.32  ? 223 ALA D CB  1 
ATOM   9698  N  N   . HIS D 1 224 ? 9.692   -9.634  20.584  1.00 19.74  ? 224 HIS D N   1 
ATOM   9699  C  CA  . HIS D 1 224 ? 9.691   -8.511  21.560  1.00 20.40  ? 224 HIS D CA  1 
ATOM   9700  C  C   . HIS D 1 224 ? 10.678  -8.636  22.662  1.00 21.53  ? 224 HIS D C   1 
ATOM   9701  O  O   . HIS D 1 224 ? 10.289  -8.613  23.834  1.00 25.35  ? 224 HIS D O   1 
ATOM   9702  C  CB  . HIS D 1 224 ? 8.312   -8.361  22.190  1.00 20.74  ? 224 HIS D CB  1 
ATOM   9703  C  CG  . HIS D 1 224 ? 7.174   -8.671  21.241  1.00 20.07  ? 224 HIS D CG  1 
ATOM   9704  N  ND1 . HIS D 1 224 ? 6.937   -7.937  20.118  1.00 21.09  ? 224 HIS D ND1 1 
ATOM   9705  C  CD2 . HIS D 1 224 ? 6.222   -9.659  21.272  1.00 18.54  ? 224 HIS D CD2 1 
ATOM   9706  C  CE1 . HIS D 1 224 ? 5.865   -8.445  19.473  1.00 21.32  ? 224 HIS D CE1 1 
ATOM   9707  N  NE2 . HIS D 1 224 ? 5.437   -9.503  20.170  1.00 21.56  ? 224 HIS D NE2 1 
ATOM   9708  N  N   . GLY D 1 225 ? 11.954  -8.796  22.334  1.00 19.47  ? 225 GLY D N   1 
ATOM   9709  C  CA  . GLY D 1 225 ? 12.974  -8.940  23.387  1.00 19.21  ? 225 GLY D CA  1 
ATOM   9710  C  C   . GLY D 1 225 ? 12.822  -10.030 24.448  1.00 17.48  ? 225 GLY D C   1 
ATOM   9711  O  O   . GLY D 1 225 ? 13.251  -9.835  25.584  1.00 17.88  ? 225 GLY D O   1 
ATOM   9712  N  N   . GLY D 1 226 ? 12.259  -11.183 24.093  1.00 15.95  ? 226 GLY D N   1 
ATOM   9713  C  CA  . GLY D 1 226 ? 12.088  -12.242 25.049  1.00 16.81  ? 226 GLY D CA  1 
ATOM   9714  C  C   . GLY D 1 226 ? 10.931  -12.014 26.026  1.00 18.73  ? 226 GLY D C   1 
ATOM   9715  O  O   . GLY D 1 226 ? 10.785  -12.743 27.036  1.00 19.86  ? 226 GLY D O   1 
ATOM   9716  N  N   . GLY D 1 227 ? 10.088  -11.023 25.747  1.00 18.47  ? 227 GLY D N   1 
ATOM   9717  C  CA  . GLY D 1 227 ? 8.973   -10.736 26.651  1.00 19.54  ? 227 GLY D CA  1 
ATOM   9718  C  C   . GLY D 1 227 ? 9.546   -10.144 27.944  1.00 20.86  ? 227 GLY D C   1 
ATOM   9719  O  O   . GLY D 1 227 ? 10.196  -9.095  27.917  1.00 22.43  ? 227 GLY D O   1 
ATOM   9720  N  N   . ALA D 1 228 ? 9.368   -10.856 29.049  1.00 18.97  ? 228 ALA D N   1 
ATOM   9721  C  CA  . ALA D 1 228 ? 9.821   -10.393 30.367  1.00 19.46  ? 228 ALA D CA  1 
ATOM   9722  C  C   . ALA D 1 228 ? 11.121  -11.043 30.733  1.00 17.58  ? 228 ALA D C   1 
ATOM   9723  O  O   . ALA D 1 228 ? 11.776  -10.604 31.632  1.00 18.88  ? 228 ALA D O   1 
ATOM   9724  C  CB  . ALA D 1 228 ? 8.774   -10.753 31.454  1.00 19.23  ? 228 ALA D CB  1 
ATOM   9725  N  N   . PHE D 1 229 ? 11.455  -12.131 30.063  1.00 17.89  ? 229 PHE D N   1 
ATOM   9726  C  CA  . PHE D 1 229 ? 12.572  -12.970 30.449  1.00 16.90  ? 229 PHE D CA  1 
ATOM   9727  C  C   . PHE D 1 229 ? 13.867  -12.219 30.885  1.00 17.02  ? 229 PHE D C   1 
ATOM   9728  O  O   . PHE D 1 229 ? 14.449  -12.559 31.896  1.00 17.69  ? 229 PHE D O   1 
ATOM   9729  C  CB  . PHE D 1 229 ? 12.834  -14.042 29.378  1.00 15.43  ? 229 PHE D CB  1 
ATOM   9730  C  CG  . PHE D 1 229 ? 13.895  -15.027 29.770  1.00 14.67  ? 229 PHE D CG  1 
ATOM   9731  C  CD1 . PHE D 1 229 ? 13.590  -16.116 30.610  1.00 14.35  ? 229 PHE D CD1 1 
ATOM   9732  C  CD2 . PHE D 1 229 ? 15.219  -14.863 29.335  1.00 14.36  ? 229 PHE D CD2 1 
ATOM   9733  C  CE1 . PHE D 1 229 ? 14.575  -17.044 30.994  1.00 14.23  ? 229 PHE D CE1 1 
ATOM   9734  C  CE2 . PHE D 1 229 ? 16.222  -15.773 29.745  1.00 14.76  ? 229 PHE D CE2 1 
ATOM   9735  C  CZ  . PHE D 1 229 ? 15.896  -16.882 30.563  1.00 13.99  ? 229 PHE D CZ  1 
ATOM   9736  N  N   . PRO D 1 230 ? 14.314  -11.182 30.149  1.00 17.85  ? 230 PRO D N   1 
ATOM   9737  C  CA  . PRO D 1 230 ? 15.604  -10.539 30.568  1.00 17.48  ? 230 PRO D CA  1 
ATOM   9738  C  C   . PRO D 1 230 ? 15.498  -9.812  31.893  1.00 16.21  ? 230 PRO D C   1 
ATOM   9739  O  O   . PRO D 1 230 ? 16.477  -9.409  32.487  1.00 17.44  ? 230 PRO D O   1 
ATOM   9740  C  CB  . PRO D 1 230 ? 15.839  -9.493  29.465  1.00 17.24  ? 230 PRO D CB  1 
ATOM   9741  C  CG  . PRO D 1 230 ? 14.942  -9.906  28.344  1.00 16.70  ? 230 PRO D CG  1 
ATOM   9742  C  CD  . PRO D 1 230 ? 13.728  -10.448 29.021  1.00 17.23  ? 230 PRO D CD  1 
ATOM   9743  N  N   . PHE D 1 231 ? 14.301  -9.608  32.350  1.00 15.63  ? 231 PHE D N   1 
ATOM   9744  C  CA  . PHE D 1 231 ? 14.184  -8.864  33.552  1.00 16.06  ? 231 PHE D CA  1 
ATOM   9745  C  C   . PHE D 1 231 ? 13.935  -9.819  34.715  1.00 15.72  ? 231 PHE D C   1 
ATOM   9746  O  O   . PHE D 1 231 ? 14.444  -9.627  35.810  1.00 15.67  ? 231 PHE D O   1 
ATOM   9747  C  CB  . PHE D 1 231 ? 13.131  -7.775  33.428  1.00 15.33  ? 231 PHE D CB  1 
ATOM   9748  C  CG  . PHE D 1 231 ? 12.944  -7.001  34.701  1.00 16.88  ? 231 PHE D CG  1 
ATOM   9749  C  CD1 . PHE D 1 231 ? 13.934  -6.114  35.151  1.00 17.20  ? 231 PHE D CD1 1 
ATOM   9750  C  CD2 . PHE D 1 231 ? 11.802  -7.190  35.489  1.00 16.65  ? 231 PHE D CD2 1 
ATOM   9751  C  CE1 . PHE D 1 231 ? 13.769  -5.394  36.347  1.00 17.92  ? 231 PHE D CE1 1 
ATOM   9752  C  CE2 . PHE D 1 231 ? 11.648  -6.488  36.667  1.00 17.33  ? 231 PHE D CE2 1 
ATOM   9753  C  CZ  . PHE D 1 231 ? 12.630  -5.598  37.101  1.00 17.67  ? 231 PHE D CZ  1 
ATOM   9754  N  N   . THR D 1 232 ? 13.237  -10.910 34.421  1.00 16.06  ? 232 THR D N   1 
ATOM   9755  C  CA  . THR D 1 232 ? 12.868  -11.908 35.435  1.00 15.50  ? 232 THR D CA  1 
ATOM   9756  C  C   . THR D 1 232 ? 13.773  -13.139 35.446  1.00 15.08  ? 232 THR D C   1 
ATOM   9757  O  O   . THR D 1 232 ? 13.583  -14.076 36.259  1.00 13.88  ? 232 THR D O   1 
ATOM   9758  C  CB  . THR D 1 232 ? 11.392  -12.331 35.255  1.00 15.50  ? 232 THR D CB  1 
ATOM   9759  O  OG1 . THR D 1 232 ? 11.145  -12.514 33.863  1.00 16.57  ? 232 THR D OG1 1 
ATOM   9760  C  CG2 . THR D 1 232 ? 10.462  -11.242 35.753  1.00 14.53  ? 232 THR D CG2 1 
ATOM   9761  N  N   . VAL D 1 233 ? 14.770  -13.140 34.570  1.00 14.81  ? 233 VAL D N   1 
ATOM   9762  C  CA  . VAL D 1 233 ? 15.702  -14.253 34.538  1.00 15.71  ? 233 VAL D CA  1 
ATOM   9763  C  C   . VAL D 1 233 ? 16.320  -14.536 35.895  1.00 15.89  ? 233 VAL D C   1 
ATOM   9764  O  O   . VAL D 1 233 ? 16.531  -15.689 36.244  1.00 17.16  ? 233 VAL D O   1 
ATOM   9765  C  CB  . VAL D 1 233 ? 16.803  -14.083 33.481  1.00 16.16  ? 233 VAL D CB  1 
ATOM   9766  C  CG1 . VAL D 1 233 ? 17.687  -12.853 33.760  1.00 15.45  ? 233 VAL D CG1 1 
ATOM   9767  C  CG2 . VAL D 1 233 ? 17.607  -15.369 33.383  1.00 16.04  ? 233 VAL D CG2 1 
ATOM   9768  N  N   . GLY D 1 234 ? 16.578  -13.502 36.684  1.00 16.18  ? 234 GLY D N   1 
ATOM   9769  C  CA  . GLY D 1 234 ? 17.149  -13.731 38.011  1.00 16.41  ? 234 GLY D CA  1 
ATOM   9770  C  C   . GLY D 1 234 ? 16.269  -14.601 38.881  1.00 16.43  ? 234 GLY D C   1 
ATOM   9771  O  O   . GLY D 1 234 ? 16.730  -15.576 39.480  1.00 17.11  ? 234 GLY D O   1 
ATOM   9772  N  N   . ARG D 1 235 ? 14.993  -14.235 38.948  1.00 17.88  ? 235 ARG D N   1 
ATOM   9773  C  CA  . ARG D 1 235 ? 13.970  -15.021 39.658  1.00 18.01  ? 235 ARG D CA  1 
ATOM   9774  C  C   . ARG D 1 235 ? 13.809  -16.429 39.082  1.00 16.70  ? 235 ARG D C   1 
ATOM   9775  O  O   . ARG D 1 235 ? 13.760  -17.420 39.827  1.00 16.12  ? 235 ARG D O   1 
ATOM   9776  C  CB  . ARG D 1 235 ? 12.624  -14.287 39.630  1.00 19.21  ? 235 ARG D CB  1 
ATOM   9777  C  CG  . ARG D 1 235 ? 11.453  -15.038 40.271  1.00 20.82  ? 235 ARG D CG  1 
ATOM   9778  C  CD  . ARG D 1 235 ? 10.129  -14.385 39.882  1.00 22.77  ? 235 ARG D CD  1 
ATOM   9779  N  NE  . ARG D 1 235 ? 9.006   -14.949 40.610  1.00 25.16  ? 235 ARG D NE  1 
ATOM   9780  C  CZ  . ARG D 1 235 ? 8.709   -14.666 41.881  1.00 26.36  ? 235 ARG D CZ  1 
ATOM   9781  N  NH1 . ARG D 1 235 ? 9.465   -13.817 42.583  1.00 27.60  ? 235 ARG D NH1 1 
ATOM   9782  N  NH2 . ARG D 1 235 ? 7.667   -15.254 42.460  1.00 24.23  ? 235 ARG D NH2 1 
ATOM   9783  N  N   . ILE D 1 236 ? 13.765  -16.537 37.760  1.00 17.52  ? 236 ILE D N   1 
ATOM   9784  C  CA  . ILE D 1 236 ? 13.656  -17.890 37.137  1.00 17.43  ? 236 ILE D CA  1 
ATOM   9785  C  C   . ILE D 1 236 ? 14.867  -18.760 37.533  1.00 17.53  ? 236 ILE D C   1 
ATOM   9786  O  O   . ILE D 1 236 ? 14.709  -19.852 38.022  1.00 18.31  ? 236 ILE D O   1 
ATOM   9787  C  CB  . ILE D 1 236 ? 13.406  -17.820 35.615  1.00 16.86  ? 236 ILE D CB  1 
ATOM   9788  C  CG1 . ILE D 1 236 ? 12.035  -17.126 35.338  1.00 16.13  ? 236 ILE D CG1 1 
ATOM   9789  C  CG2 . ILE D 1 236 ? 13.520  -19.214 34.979  1.00 16.62  ? 236 ILE D CG2 1 
ATOM   9790  C  CD1 . ILE D 1 236 ? 11.917  -16.445 33.967  1.00 14.91  ? 236 ILE D CD1 1 
ATOM   9791  N  N   . SER D 1 237 ? 16.064  -18.208 37.431  1.00 18.24  ? 237 SER D N   1 
ATOM   9792  C  CA  . SER D 1 237 ? 17.275  -18.939 37.756  1.00 19.22  ? 237 SER D CA  1 
ATOM   9793  C  C   . SER D 1 237 ? 17.368  -19.168 39.247  1.00 19.27  ? 237 SER D C   1 
ATOM   9794  O  O   . SER D 1 237 ? 17.842  -20.197 39.670  1.00 18.27  ? 237 SER D O   1 
ATOM   9795  C  CB  . SER D 1 237 ? 18.522  -18.177 37.269  1.00 20.39  ? 237 SER D CB  1 
ATOM   9796  O  OG  . SER D 1 237 ? 19.677  -18.868 37.704  1.00 22.20  ? 237 SER D OG  1 
ATOM   9797  N  N   . HIS D 1 238 ? 16.909  -18.225 40.062  1.00 20.57  ? 238 HIS D N   1 
ATOM   9798  C  CA  . HIS D 1 238 ? 16.922  -18.494 41.511  1.00 21.60  ? 238 HIS D CA  1 
ATOM   9799  C  C   . HIS D 1 238 ? 15.942  -19.571 41.858  1.00 19.83  ? 238 HIS D C   1 
ATOM   9800  O  O   . HIS D 1 238 ? 16.267  -20.462 42.619  1.00 20.16  ? 238 HIS D O   1 
ATOM   9801  C  CB  . HIS D 1 238 ? 16.648  -17.230 42.300  1.00 23.80  ? 238 HIS D CB  1 
ATOM   9802  C  CG  . HIS D 1 238 ? 16.714  -17.418 43.784  1.00 27.21  ? 238 HIS D CG  1 
ATOM   9803  N  ND1 . HIS D 1 238 ? 15.678  -17.130 44.593  1.00 27.87  ? 238 HIS D ND1 1 
ATOM   9804  C  CD2 . HIS D 1 238 ? 17.753  -17.866 44.614  1.00 28.89  ? 238 HIS D CD2 1 
ATOM   9805  C  CE1 . HIS D 1 238 ? 16.025  -17.384 45.874  1.00 28.63  ? 238 HIS D CE1 1 
ATOM   9806  N  NE2 . HIS D 1 238 ? 17.288  -17.841 45.885  1.00 28.57  ? 238 HIS D NE2 1 
ATOM   9807  N  N   . GLY D 1 239 ? 14.750  -19.527 41.260  1.00 18.94  ? 239 GLY D N   1 
ATOM   9808  C  CA  . GLY D 1 239 ? 13.741  -20.575 41.479  1.00 17.99  ? 239 GLY D CA  1 
ATOM   9809  C  C   . GLY D 1 239 ? 14.223  -21.965 41.056  1.00 18.58  ? 239 GLY D C   1 
ATOM   9810  O  O   . GLY D 1 239 ? 14.038  -22.958 41.765  1.00 16.14  ? 239 GLY D O   1 
ATOM   9811  N  N   . PHE D 1 240 ? 14.839  -22.035 39.883  1.00 18.36  ? 240 PHE D N   1 
ATOM   9812  C  CA  . PHE D 1 240 ? 15.382  -23.299 39.420  1.00 21.74  ? 240 PHE D CA  1 
ATOM   9813  C  C   . PHE D 1 240 ? 16.266  -23.936 40.493  1.00 22.79  ? 240 PHE D C   1 
ATOM   9814  O  O   . PHE D 1 240 ? 16.276  -25.158 40.681  1.00 21.01  ? 240 PHE D O   1 
ATOM   9815  C  CB  . PHE D 1 240 ? 16.195  -23.096 38.124  1.00 21.83  ? 240 PHE D CB  1 
ATOM   9816  C  CG  . PHE D 1 240 ? 16.820  -24.340 37.606  1.00 20.85  ? 240 PHE D CG  1 
ATOM   9817  C  CD1 . PHE D 1 240 ? 16.168  -25.109 36.655  1.00 22.61  ? 240 PHE D CD1 1 
ATOM   9818  C  CD2 . PHE D 1 240 ? 18.062  -24.740 38.054  1.00 22.60  ? 240 PHE D CD2 1 
ATOM   9819  C  CE1 . PHE D 1 240 ? 16.744  -26.268 36.139  1.00 22.97  ? 240 PHE D CE1 1 
ATOM   9820  C  CE2 . PHE D 1 240 ? 18.649  -25.909 37.565  1.00 24.01  ? 240 PHE D CE2 1 
ATOM   9821  C  CZ  . PHE D 1 240 ? 17.987  -26.671 36.605  1.00 23.49  ? 240 PHE D CZ  1 
ATOM   9822  N  N   . SER D 1 241 ? 17.030  -23.089 41.173  1.00 26.71  ? 241 SER D N   1 
ATOM   9823  C  CA  . SER D 1 241 ? 18.002  -23.549 42.159  1.00 28.41  ? 241 SER D CA  1 
ATOM   9824  C  C   . SER D 1 241 ? 17.255  -24.006 43.386  1.00 30.24  ? 241 SER D C   1 
ATOM   9825  O  O   . SER D 1 241 ? 17.673  -24.939 44.052  1.00 33.88  ? 241 SER D O   1 
ATOM   9826  C  CB  . SER D 1 241 ? 18.923  -22.414 42.571  1.00 27.63  ? 241 SER D CB  1 
ATOM   9827  O  OG  . SER D 1 241 ? 19.687  -21.984 41.478  1.00 30.00  ? 241 SER D OG  1 
ATOM   9828  N  N   . MET D 1 242 ? 16.153  -23.341 43.705  1.00 29.67  ? 242 MET D N   1 
ATOM   9829  C  CA  . MET D 1 242 ? 15.493  -23.658 44.960  1.00 29.20  ? 242 MET D CA  1 
ATOM   9830  C  C   . MET D 1 242 ? 14.617  -24.914 44.879  1.00 29.28  ? 242 MET D C   1 
ATOM   9831  O  O   . MET D 1 242 ? 14.573  -25.656 45.829  1.00 31.43  ? 242 MET D O   1 
ATOM   9832  C  CB  . MET D 1 242 ? 14.777  -22.415 45.539  1.00 28.40  ? 242 MET D CB  1 
ATOM   9833  C  CG  . MET D 1 242 ? 15.756  -21.297 45.925  1.00 28.93  ? 242 MET D CG  1 
ATOM   9834  S  SD  . MET D 1 242 ? 17.047  -21.802 47.113  1.00 28.27  ? 242 MET D SD  1 
ATOM   9835  C  CE  . MET D 1 242 ? 18.504  -21.383 46.180  1.00 29.26  ? 242 MET D CE  1 
ATOM   9836  N  N   . ARG D 1 243 ? 13.974  -25.177 43.737  1.00 29.35  ? 243 ARG D N   1 
ATOM   9837  C  CA  . ARG D 1 243 ? 13.068  -26.321 43.581  1.00 28.88  ? 243 ARG D CA  1 
ATOM   9838  C  C   . ARG D 1 243 ? 13.425  -27.216 42.388  1.00 29.83  ? 243 ARG D C   1 
ATOM   9839  O  O   . ARG D 1 243 ? 12.684  -27.249 41.387  1.00 28.37  ? 243 ARG D O   1 
ATOM   9840  C  CB  . ARG D 1 243 ? 11.594  -25.867 43.482  1.00 30.54  ? 243 ARG D CB  1 
ATOM   9841  C  CG  . ARG D 1 243 ? 11.059  -25.061 44.664  1.00 30.61  ? 243 ARG D CG  1 
ATOM   9842  C  CD  . ARG D 1 243 ? 10.992  -25.821 45.989  1.00 31.27  ? 243 ARG D CD  1 
ATOM   9843  N  NE  . ARG D 1 243 ? 10.245  -27.076 45.855  1.00 32.90  ? 243 ARG D NE  1 
ATOM   9844  C  CZ  . ARG D 1 243 ? 8.985   -27.290 46.251  1.00 31.60  ? 243 ARG D CZ  1 
ATOM   9845  N  NH1 . ARG D 1 243 ? 8.272   -26.328 46.806  1.00 30.08  ? 243 ARG D NH1 1 
ATOM   9846  N  NH2 . ARG D 1 243 ? 8.430   -28.487 46.060  1.00 32.39  ? 243 ARG D NH2 1 
ATOM   9847  N  N   . PRO D 1 244 ? 14.557  -27.957 42.498  1.00 29.78  ? 244 PRO D N   1 
ATOM   9848  C  CA  . PRO D 1 244 ? 15.045  -28.880 41.482  1.00 29.57  ? 244 PRO D CA  1 
ATOM   9849  C  C   . PRO D 1 244 ? 14.086  -30.024 41.255  1.00 30.40  ? 244 PRO D C   1 
ATOM   9850  O  O   . PRO D 1 244 ? 14.114  -30.643 40.174  1.00 30.78  ? 244 PRO D O   1 
ATOM   9851  C  CB  . PRO D 1 244 ? 16.326  -29.435 42.109  1.00 30.51  ? 244 PRO D CB  1 
ATOM   9852  C  CG  . PRO D 1 244 ? 16.062  -29.333 43.575  1.00 30.80  ? 244 PRO D CG  1 
ATOM   9853  C  CD  . PRO D 1 244 ? 15.436  -27.980 43.685  1.00 29.61  ? 244 PRO D CD  1 
ATOM   9854  N  N   . ASP D 1 245 ? 13.272  -30.311 42.274  1.00 28.67  ? 245 ASP D N   1 
ATOM   9855  C  CA  . ASP D 1 245 ? 12.226  -31.325 42.191  1.00 31.57  ? 245 ASP D CA  1 
ATOM   9856  C  C   . ASP D 1 245 ? 11.100  -30.929 41.215  1.00 32.28  ? 245 ASP D C   1 
ATOM   9857  O  O   . ASP D 1 245 ? 10.460  -31.812 40.615  1.00 31.05  ? 245 ASP D O   1 
ATOM   9858  C  CB  . ASP D 1 245 ? 11.624  -31.616 43.576  1.00 32.67  ? 245 ASP D CB  1 
ATOM   9859  C  CG  . ASP D 1 245 ? 10.971  -30.400 44.195  1.00 34.41  ? 245 ASP D CG  1 
ATOM   9860  O  OD1 . ASP D 1 245 ? 11.566  -29.298 44.142  1.00 36.15  ? 245 ASP D OD1 1 
ATOM   9861  O  OD2 . ASP D 1 245 ? 9.852   -30.533 44.727  1.00 36.58  ? 245 ASP D OD2 1 
ATOM   9862  N  N   . LEU D 1 246 ? 10.870  -29.614 41.070  1.00 29.79  ? 246 LEU D N   1 
ATOM   9863  C  CA  . LEU D 1 246 ? 9.866   -29.081 40.151  1.00 28.00  ? 246 LEU D CA  1 
ATOM   9864  C  C   . LEU D 1 246 ? 10.445  -28.693 38.818  1.00 28.12  ? 246 LEU D C   1 
ATOM   9865  O  O   . LEU D 1 246 ? 9.848   -28.979 37.787  1.00 29.87  ? 246 LEU D O   1 
ATOM   9866  C  CB  . LEU D 1 246 ? 9.156   -27.879 40.760  1.00 26.56  ? 246 LEU D CB  1 
ATOM   9867  C  CG  . LEU D 1 246 ? 8.331   -28.076 42.041  1.00 27.72  ? 246 LEU D CG  1 
ATOM   9868  C  CD1 . LEU D 1 246 ? 7.806   -26.706 42.479  1.00 26.36  ? 246 LEU D CD1 1 
ATOM   9869  C  CD2 . LEU D 1 246 ? 7.198   -29.120 41.879  1.00 25.54  ? 246 LEU D CD2 1 
ATOM   9870  N  N   . CYS D 1 247 ? 11.621  -28.069 38.847  1.00 28.87  ? 247 CYS D N   1 
ATOM   9871  C  CA  . CYS D 1 247 ? 12.193  -27.402 37.677  1.00 29.38  ? 247 CYS D CA  1 
ATOM   9872  C  C   . CYS D 1 247 ? 13.259  -28.168 36.896  1.00 29.31  ? 247 CYS D C   1 
ATOM   9873  O  O   . CYS D 1 247 ? 13.598  -27.767 35.781  1.00 30.78  ? 247 CYS D O   1 
ATOM   9874  C  CB  . CYS D 1 247 ? 12.817  -26.077 38.091  1.00 29.50  ? 247 CYS D CB  1 
ATOM   9875  S  SG  . CYS D 1 247 ? 11.631  -24.853 38.674  1.00 34.98  ? 247 CYS D SG  1 
ATOM   9876  N  N   . ALA D 1 248 ? 13.805  -29.233 37.463  1.00 26.45  ? 248 ALA D N   1 
ATOM   9877  C  CA  . ALA D 1 248 ? 15.047  -29.767 36.931  1.00 27.92  ? 248 ALA D CA  1 
ATOM   9878  C  C   . ALA D 1 248 ? 14.957  -31.229 36.546  1.00 29.34  ? 248 ALA D C   1 
ATOM   9879  O  O   . ALA D 1 248 ? 15.973  -31.887 36.328  1.00 30.89  ? 248 ALA D O   1 
ATOM   9880  C  CB  . ALA D 1 248 ? 16.185  -29.544 37.928  1.00 28.12  ? 248 ALA D CB  1 
ATOM   9881  N  N   . GLN D 1 249 ? 13.739  -31.739 36.473  1.00 30.34  ? 249 GLN D N   1 
ATOM   9882  C  CA  . GLN D 1 249 ? 13.533  -33.134 36.207  1.00 33.88  ? 249 GLN D CA  1 
ATOM   9883  C  C   . GLN D 1 249 ? 13.823  -33.451 34.726  1.00 34.63  ? 249 GLN D C   1 
ATOM   9884  O  O   . GLN D 1 249 ? 14.274  -34.577 34.385  1.00 33.53  ? 249 GLN D O   1 
ATOM   9885  C  CB  . GLN D 1 249 ? 12.122  -33.545 36.669  1.00 38.13  ? 249 GLN D CB  1 
ATOM   9886  C  CG  . GLN D 1 249 ? 11.717  -34.979 36.302  1.00 46.28  ? 249 GLN D CG  1 
ATOM   9887  C  CD  . GLN D 1 249 ? 11.691  -35.945 37.491  1.00 49.14  ? 249 GLN D CD  1 
ATOM   9888  O  OE1 . GLN D 1 249 ? 11.800  -35.533 38.651  1.00 51.69  ? 249 GLN D OE1 1 
ATOM   9889  N  NE2 . GLN D 1 249 ? 11.544  -37.237 37.199  1.00 46.65  ? 249 GLN D NE2 1 
ATOM   9890  N  N   . ASP D 1 250 ? 13.600  -32.458 33.853  1.00 31.47  ? 250 ASP D N   1 
ATOM   9891  C  CA  . ASP D 1 250 ? 13.753  -32.678 32.395  1.00 32.02  ? 250 ASP D CA  1 
ATOM   9892  C  C   . ASP D 1 250 ? 15.092  -32.194 31.865  1.00 29.87  ? 250 ASP D C   1 
ATOM   9893  O  O   . ASP D 1 250 ? 15.513  -32.619 30.802  1.00 30.42  ? 250 ASP D O   1 
ATOM   9894  C  CB  . ASP D 1 250 ? 12.615  -32.031 31.588  1.00 34.97  ? 250 ASP D CB  1 
ATOM   9895  C  CG  . ASP D 1 250 ? 11.247  -32.673 31.855  1.00 40.58  ? 250 ASP D CG  1 
ATOM   9896  O  OD1 . ASP D 1 250 ? 11.192  -33.750 32.498  1.00 46.88  ? 250 ASP D OD1 1 
ATOM   9897  O  OD2 . ASP D 1 250 ? 10.221  -32.106 31.404  1.00 41.10  ? 250 ASP D OD2 1 
ATOM   9898  N  N   . ASN D 1 251 ? 15.734  -31.301 32.618  1.00 26.29  ? 251 ASN D N   1 
ATOM   9899  C  CA  . ASN D 1 251 ? 17.001  -30.753 32.264  1.00 25.13  ? 251 ASN D CA  1 
ATOM   9900  C  C   . ASN D 1 251 ? 17.673  -30.134 33.498  1.00 27.25  ? 251 ASN D C   1 
ATOM   9901  O  O   . ASN D 1 251 ? 17.127  -29.195 34.083  1.00 27.83  ? 251 ASN D O   1 
ATOM   9902  C  CB  . ASN D 1 251 ? 16.772  -29.675 31.234  1.00 23.68  ? 251 ASN D CB  1 
ATOM   9903  C  CG  . ASN D 1 251 ? 18.022  -29.300 30.509  1.00 22.15  ? 251 ASN D CG  1 
ATOM   9904  O  OD1 . ASN D 1 251 ? 18.628  -30.141 29.869  1.00 22.84  ? 251 ASN D OD1 1 
ATOM   9905  N  ND2 . ASN D 1 251 ? 18.403  -28.022 30.575  1.00 22.25  ? 251 ASN D ND2 1 
ATOM   9906  N  N   . PRO D 1 252 ? 18.871  -30.636 33.887  1.00 28.31  ? 252 PRO D N   1 
ATOM   9907  C  CA  . PRO D 1 252 ? 19.489  -30.190 35.160  1.00 26.77  ? 252 PRO D CA  1 
ATOM   9908  C  C   . PRO D 1 252 ? 20.321  -28.892 35.113  1.00 27.02  ? 252 PRO D C   1 
ATOM   9909  O  O   . PRO D 1 252 ? 20.820  -28.447 36.142  1.00 29.87  ? 252 PRO D O   1 
ATOM   9910  C  CB  . PRO D 1 252 ? 20.368  -31.370 35.519  1.00 27.03  ? 252 PRO D CB  1 
ATOM   9911  C  CG  . PRO D 1 252 ? 20.800  -31.926 34.176  1.00 26.40  ? 252 PRO D CG  1 
ATOM   9912  C  CD  . PRO D 1 252 ? 19.613  -31.770 33.281  1.00 27.15  ? 252 PRO D CD  1 
ATOM   9913  N  N   . MET D 1 253 ? 20.446  -28.282 33.942  1.00 26.97  ? 253 MET D N   1 
ATOM   9914  C  CA  . MET D 1 253 ? 21.194  -27.027 33.730  1.00 26.76  ? 253 MET D CA  1 
ATOM   9915  C  C   . MET D 1 253 ? 20.418  -25.772 34.156  1.00 24.43  ? 253 MET D C   1 
ATOM   9916  O  O   . MET D 1 253 ? 19.272  -25.569 33.747  1.00 22.55  ? 253 MET D O   1 
ATOM   9917  C  CB  . MET D 1 253 ? 21.532  -26.910 32.231  1.00 31.38  ? 253 MET D CB  1 
ATOM   9918  C  CG  . MET D 1 253 ? 22.843  -26.246 31.874  1.00 40.39  ? 253 MET D CG  1 
ATOM   9919  S  SD  . MET D 1 253 ? 24.346  -27.283 31.755  1.00 51.58  ? 253 MET D SD  1 
ATOM   9920  C  CE  . MET D 1 253 ? 23.720  -28.934 31.453  1.00 45.76  ? 253 MET D CE  1 
ATOM   9921  N  N   . ASN D 1 254 ? 21.045  -24.908 34.946  1.00 22.62  ? 254 ASN D N   1 
ATOM   9922  C  CA  . ASN D 1 254 ? 20.482  -23.610 35.246  1.00 22.30  ? 254 ASN D CA  1 
ATOM   9923  C  C   . ASN D 1 254 ? 20.195  -22.732 34.020  1.00 22.43  ? 254 ASN D C   1 
ATOM   9924  O  O   . ASN D 1 254 ? 21.058  -22.547 33.172  1.00 23.71  ? 254 ASN D O   1 
ATOM   9925  C  CB  . ASN D 1 254 ? 21.357  -22.811 36.221  1.00 22.49  ? 254 ASN D CB  1 
ATOM   9926  C  CG  . ASN D 1 254 ? 20.589  -21.658 36.856  1.00 23.51  ? 254 ASN D CG  1 
ATOM   9927  O  OD1 . ASN D 1 254 ? 20.382  -20.602 36.237  1.00 24.52  ? 254 ASN D OD1 1 
ATOM   9928  N  ND2 . ASN D 1 254 ? 20.120  -21.872 38.065  1.00 22.05  ? 254 ASN D ND2 1 
ATOM   9929  N  N   . PRO D 1 255 ? 18.985  -22.156 33.949  1.00 22.19  ? 255 PRO D N   1 
ATOM   9930  C  CA  . PRO D 1 255 ? 18.572  -21.216 32.903  1.00 22.12  ? 255 PRO D CA  1 
ATOM   9931  C  C   . PRO D 1 255 ? 19.623  -20.185 32.544  1.00 22.79  ? 255 PRO D C   1 
ATOM   9932  O  O   . PRO D 1 255 ? 19.731  -19.792 31.358  1.00 22.24  ? 255 PRO D O   1 
ATOM   9933  C  CB  . PRO D 1 255 ? 17.347  -20.567 33.521  1.00 20.64  ? 255 PRO D CB  1 
ATOM   9934  C  CG  . PRO D 1 255 ? 16.703  -21.757 34.154  1.00 20.53  ? 255 PRO D CG  1 
ATOM   9935  C  CD  . PRO D 1 255 ? 17.853  -22.469 34.836  1.00 20.54  ? 255 PRO D CD  1 
ATOM   9936  N  N   . LYS D 1 256 ? 20.418  -19.791 33.528  1.00 21.98  ? 256 LYS D N   1 
ATOM   9937  C  CA  . LYS D 1 256 ? 21.494  -18.871 33.253  1.00 25.25  ? 256 LYS D CA  1 
ATOM   9938  C  C   . LYS D 1 256 ? 22.553  -19.366 32.278  1.00 24.43  ? 256 LYS D C   1 
ATOM   9939  O  O   . LYS D 1 256 ? 23.187  -18.559 31.622  1.00 24.67  ? 256 LYS D O   1 
ATOM   9940  C  CB  . LYS D 1 256 ? 22.164  -18.396 34.552  1.00 30.42  ? 256 LYS D CB  1 
ATOM   9941  C  CG  . LYS D 1 256 ? 21.392  -17.234 35.149  1.00 31.49  ? 256 LYS D CG  1 
ATOM   9942  C  CD  . LYS D 1 256 ? 22.233  -16.302 35.995  1.00 33.37  ? 256 LYS D CD  1 
ATOM   9943  C  CE  . LYS D 1 256 ? 21.493  -14.976 36.132  1.00 34.18  ? 256 LYS D CE  1 
ATOM   9944  N  NZ  . LYS D 1 256 ? 21.573  -14.492 37.531  1.00 34.52  ? 256 LYS D NZ  1 
ATOM   9945  N  N   . LYS D 1 257 ? 22.765  -20.669 32.178  1.00 24.11  ? 257 LYS D N   1 
ATOM   9946  C  CA  . LYS D 1 257 ? 23.763  -21.158 31.249  1.00 27.05  ? 257 LYS D CA  1 
ATOM   9947  C  C   . LYS D 1 257 ? 23.349  -20.957 29.798  1.00 24.81  ? 257 LYS D C   1 
ATOM   9948  O  O   . LYS D 1 257 ? 24.171  -21.121 28.907  1.00 21.92  ? 257 LYS D O   1 
ATOM   9949  C  CB  . LYS D 1 257 ? 24.120  -22.621 31.541  1.00 33.26  ? 257 LYS D CB  1 
ATOM   9950  C  CG  . LYS D 1 257 ? 24.927  -22.718 32.850  1.00 44.28  ? 257 LYS D CG  1 
ATOM   9951  C  CD  . LYS D 1 257 ? 24.925  -24.110 33.487  1.00 45.10  ? 257 LYS D CD  1 
ATOM   9952  C  CE  . LYS D 1 257 ? 24.148  -24.190 34.807  1.00 42.22  ? 257 LYS D CE  1 
ATOM   9953  N  NZ  . LYS D 1 257 ? 23.865  -25.590 35.291  1.00 34.01  ? 257 LYS D NZ  1 
ATOM   9954  N  N   . TYR D 1 258 ? 22.079  -20.606 29.565  1.00 22.73  ? 258 TYR D N   1 
ATOM   9955  C  CA  . TYR D 1 258 ? 21.608  -20.444 28.189  1.00 23.06  ? 258 TYR D CA  1 
ATOM   9956  C  C   . TYR D 1 258 ? 21.647  -19.036 27.709  1.00 23.28  ? 258 TYR D C   1 
ATOM   9957  O  O   . TYR D 1 258 ? 21.425  -18.794 26.524  1.00 26.46  ? 258 TYR D O   1 
ATOM   9958  C  CB  . TYR D 1 258 ? 20.253  -21.087 27.951  1.00 20.70  ? 258 TYR D CB  1 
ATOM   9959  C  CG  . TYR D 1 258 ? 20.353  -22.550 28.170  1.00 19.53  ? 258 TYR D CG  1 
ATOM   9960  C  CD1 . TYR D 1 258 ? 20.926  -23.365 27.203  1.00 19.41  ? 258 TYR D CD1 1 
ATOM   9961  C  CD2 . TYR D 1 258 ? 19.968  -23.120 29.388  1.00 20.58  ? 258 TYR D CD2 1 
ATOM   9962  C  CE1 . TYR D 1 258 ? 21.093  -24.716 27.410  1.00 19.34  ? 258 TYR D CE1 1 
ATOM   9963  C  CE2 . TYR D 1 258 ? 20.111  -24.487 29.611  1.00 20.20  ? 258 TYR D CE2 1 
ATOM   9964  C  CZ  . TYR D 1 258 ? 20.677  -25.272 28.610  1.00 19.22  ? 258 TYR D CZ  1 
ATOM   9965  O  OH  . TYR D 1 258 ? 20.793  -26.608 28.780  1.00 19.05  ? 258 TYR D OH  1 
ATOM   9966  N  N   . LEU D 1 259 ? 21.955  -18.100 28.600  1.00 21.90  ? 259 LEU D N   1 
ATOM   9967  C  CA  . LEU D 1 259 ? 22.213  -16.740 28.144  1.00 22.28  ? 259 LEU D CA  1 
ATOM   9968  C  C   . LEU D 1 259 ? 23.386  -16.807 27.184  1.00 23.38  ? 259 LEU D C   1 
ATOM   9969  O  O   . LEU D 1 259 ? 24.478  -17.291 27.555  1.00 24.64  ? 259 LEU D O   1 
ATOM   9970  C  CB  . LEU D 1 259 ? 22.564  -15.846 29.316  1.00 21.31  ? 259 LEU D CB  1 
ATOM   9971  C  CG  . LEU D 1 259 ? 21.396  -15.687 30.283  1.00 21.84  ? 259 LEU D CG  1 
ATOM   9972  C  CD1 . LEU D 1 259 ? 21.629  -14.575 31.283  1.00 19.76  ? 259 LEU D CD1 1 
ATOM   9973  C  CD2 . LEU D 1 259 ? 20.102  -15.439 29.498  1.00 22.45  ? 259 LEU D CD2 1 
ATOM   9974  N  N   . GLY D 1 260 ? 23.153  -16.356 25.954  1.00 21.85  ? 260 GLY D N   1 
ATOM   9975  C  CA  . GLY D 1 260 ? 24.131  -16.466 24.869  1.00 20.61  ? 260 GLY D CA  1 
ATOM   9976  C  C   . GLY D 1 260 ? 23.823  -17.566 23.865  1.00 22.13  ? 260 GLY D C   1 
ATOM   9977  O  O   . GLY D 1 260 ? 24.627  -17.808 22.959  1.00 21.85  ? 260 GLY D O   1 
ATOM   9978  N  N   . SER D 1 261 ? 22.681  -18.246 24.018  1.00 22.76  ? 261 SER D N   1 
ATOM   9979  C  CA  . SER D 1 261 ? 22.370  -19.442 23.210  1.00 25.50  ? 261 SER D CA  1 
ATOM   9980  C  C   . SER D 1 261 ? 21.192  -19.268 22.233  1.00 23.60  ? 261 SER D C   1 
ATOM   9981  O  O   . SER D 1 261 ? 20.895  -20.162 21.429  1.00 23.04  ? 261 SER D O   1 
ATOM   9982  C  CB  . SER D 1 261 ? 22.059  -20.649 24.111  1.00 27.72  ? 261 SER D CB  1 
ATOM   9983  O  OG  . SER D 1 261 ? 23.250  -21.313 24.461  1.00 35.02  ? 261 SER D OG  1 
ATOM   9984  N  N   . PHE D 1 262 ? 20.495  -18.151 22.364  1.00 20.74  ? 262 PHE D N   1 
ATOM   9985  C  CA  . PHE D 1 262 ? 19.365  -17.863 21.511  1.00 19.14  ? 262 PHE D CA  1 
ATOM   9986  C  C   . PHE D 1 262 ? 19.254  -16.376 21.277  1.00 18.26  ? 262 PHE D C   1 
ATOM   9987  O  O   . PHE D 1 262 ? 19.865  -15.604 21.979  1.00 18.15  ? 262 PHE D O   1 
ATOM   9988  C  CB  . PHE D 1 262 ? 18.093  -18.379 22.135  1.00 18.65  ? 262 PHE D CB  1 
ATOM   9989  C  CG  . PHE D 1 262 ? 17.807  -17.818 23.491  1.00 17.38  ? 262 PHE D CG  1 
ATOM   9990  C  CD1 . PHE D 1 262 ? 17.186  -16.596 23.624  1.00 16.12  ? 262 PHE D CD1 1 
ATOM   9991  C  CD2 . PHE D 1 262 ? 18.149  -18.541 24.633  1.00 17.79  ? 262 PHE D CD2 1 
ATOM   9992  C  CE1 . PHE D 1 262 ? 16.912  -16.070 24.862  1.00 17.27  ? 262 PHE D CE1 1 
ATOM   9993  C  CE2 . PHE D 1 262 ? 17.860  -18.035 25.901  1.00 18.62  ? 262 PHE D CE2 1 
ATOM   9994  C  CZ  . PHE D 1 262 ? 17.243  -16.789 26.020  1.00 18.40  ? 262 PHE D CZ  1 
ATOM   9995  N  N   . TYR D 1 263 ? 18.488  -15.978 20.268  1.00 17.47  ? 263 TYR D N   1 
ATOM   9996  C  CA  . TYR D 1 263 ? 18.360  -14.586 19.959  1.00 15.38  ? 263 TYR D CA  1 
ATOM   9997  C  C   . TYR D 1 263 ? 17.052  -14.059 20.470  1.00 14.53  ? 263 TYR D C   1 
ATOM   9998  O  O   . TYR D 1 263 ? 16.208  -14.836 20.856  1.00 13.80  ? 263 TYR D O   1 
ATOM   9999  C  CB  . TYR D 1 263 ? 18.414  -14.443 18.474  1.00 15.38  ? 263 TYR D CB  1 
ATOM   10000 C  CG  . TYR D 1 263 ? 19.689  -14.942 17.873  1.00 15.65  ? 263 TYR D CG  1 
ATOM   10001 C  CD1 . TYR D 1 263 ? 20.592  -14.046 17.333  1.00 16.13  ? 263 TYR D CD1 1 
ATOM   10002 C  CD2 . TYR D 1 263 ? 19.989  -16.318 17.804  1.00 16.00  ? 263 TYR D CD2 1 
ATOM   10003 C  CE1 . TYR D 1 263 ? 21.776  -14.480 16.735  1.00 16.21  ? 263 TYR D CE1 1 
ATOM   10004 C  CE2 . TYR D 1 263 ? 21.163  -16.760 17.194  1.00 15.53  ? 263 TYR D CE2 1 
ATOM   10005 C  CZ  . TYR D 1 263 ? 22.055  -15.807 16.675  1.00 15.99  ? 263 TYR D CZ  1 
ATOM   10006 O  OH  . TYR D 1 263 ? 23.251  -16.126 16.085  1.00 17.11  ? 263 TYR D OH  1 
ATOM   10007 N  N   . THR D 1 264 ? 16.896  -12.734 20.471  1.00 14.52  ? 264 THR D N   1 
ATOM   10008 C  CA  . THR D 1 264 ? 15.591  -12.093 20.629  1.00 15.16  ? 264 THR D CA  1 
ATOM   10009 C  C   . THR D 1 264 ? 15.561  -10.881 19.717  1.00 15.08  ? 264 THR D C   1 
ATOM   10010 O  O   . THR D 1 264 ? 16.569  -10.228 19.558  1.00 14.59  ? 264 THR D O   1 
ATOM   10011 C  CB  . THR D 1 264 ? 15.337  -11.537 22.074  1.00 15.31  ? 264 THR D CB  1 
ATOM   10012 O  OG1 . THR D 1 264 ? 16.068  -10.322 22.236  1.00 16.09  ? 264 THR D OG1 1 
ATOM   10013 C  CG2 . THR D 1 264 ? 15.756  -12.484 23.195  1.00 14.28  ? 264 THR D CG2 1 
ATOM   10014 N  N   . ASP D 1 265 ? 14.398  -10.519 19.199  1.00 16.87  ? 265 ASP D N   1 
ATOM   10015 C  CA  . ASP D 1 265 ? 14.269  -9.240  18.492  1.00 18.94  ? 265 ASP D CA  1 
ATOM   10016 C  C   . ASP D 1 265 ? 14.458  -8.022  19.415  1.00 19.72  ? 265 ASP D C   1 
ATOM   10017 O  O   . ASP D 1 265 ? 14.334  -8.121  20.623  1.00 22.06  ? 265 ASP D O   1 
ATOM   10018 C  CB  . ASP D 1 265 ? 13.001  -9.166  17.599  1.00 21.25  ? 265 ASP D CB  1 
ATOM   10019 C  CG  . ASP D 1 265 ? 11.687  -8.793  18.372  1.00 25.37  ? 265 ASP D CG  1 
ATOM   10020 O  OD1 . ASP D 1 265 ? 11.763  -8.153  19.459  1.00 26.21  ? 265 ASP D OD1 1 
ATOM   10021 O  OD2 . ASP D 1 265 ? 10.541  -9.105  17.860  1.00 26.19  ? 265 ASP D OD2 1 
ATOM   10022 N  N   . ALA D 1 266 ? 14.759  -6.860  18.861  1.00 20.05  ? 266 ALA D N   1 
ATOM   10023 C  CA  . ALA D 1 266 ? 15.097  -5.714  19.709  1.00 19.90  ? 266 ALA D CA  1 
ATOM   10024 C  C   . ALA D 1 266 ? 13.891  -4.774  19.968  1.00 19.75  ? 266 ALA D C   1 
ATOM   10025 O  O   . ALA D 1 266 ? 14.055  -3.632  20.429  1.00 21.50  ? 266 ALA D O   1 
ATOM   10026 C  CB  . ALA D 1 266 ? 16.299  -4.969  19.119  1.00 19.10  ? 266 ALA D CB  1 
ATOM   10027 N  N   . LEU D 1 267 ? 12.687  -5.275  19.701  1.00 19.08  ? 267 LEU D N   1 
ATOM   10028 C  CA  . LEU D 1 267 ? 11.469  -4.507  19.829  1.00 20.43  ? 267 LEU D CA  1 
ATOM   10029 C  C   . LEU D 1 267 ? 11.050  -4.375  21.297  1.00 21.28  ? 267 LEU D C   1 
ATOM   10030 O  O   . LEU D 1 267 ? 10.222  -5.101  21.771  1.00 21.38  ? 267 LEU D O   1 
ATOM   10031 C  CB  . LEU D 1 267 ? 10.342  -5.123  18.987  1.00 21.67  ? 267 LEU D CB  1 
ATOM   10032 C  CG  . LEU D 1 267 ? 9.123   -4.243  18.679  1.00 22.66  ? 267 LEU D CG  1 
ATOM   10033 C  CD1 . LEU D 1 267 ? 9.544   -2.934  18.003  1.00 23.68  ? 267 LEU D CD1 1 
ATOM   10034 C  CD2 . LEU D 1 267 ? 8.113   -4.965  17.792  1.00 21.33  ? 267 LEU D CD2 1 
ATOM   10035 N  N   . VAL D 1 268 ? 11.658  -3.428  21.998  1.00 22.40  ? 268 VAL D N   1 
ATOM   10036 C  CA  . VAL D 1 268 ? 11.375  -3.184  23.396  1.00 23.93  ? 268 VAL D CA  1 
ATOM   10037 C  C   . VAL D 1 268 ? 11.042  -1.708  23.651  1.00 25.27  ? 268 VAL D C   1 
ATOM   10038 O  O   . VAL D 1 268 ? 10.797  -1.342  24.796  1.00 27.61  ? 268 VAL D O   1 
ATOM   10039 C  CB  . VAL D 1 268 ? 12.544  -3.622  24.316  1.00 22.49  ? 268 VAL D CB  1 
ATOM   10040 C  CG1 . VAL D 1 268 ? 12.658  -5.133  24.332  1.00 22.98  ? 268 VAL D CG1 1 
ATOM   10041 C  CG2 . VAL D 1 268 ? 13.869  -2.970  23.914  1.00 20.57  ? 268 VAL D CG2 1 
ATOM   10042 N  N   . HIS D 1 269 ? 11.076  -0.883  22.597  1.00 24.29  ? 269 HIS D N   1 
ATOM   10043 C  CA  . HIS D 1 269 ? 10.654  0.550   22.644  1.00 25.94  ? 269 HIS D CA  1 
ATOM   10044 C  C   . HIS D 1 269 ? 11.462  1.564   23.446  1.00 27.38  ? 269 HIS D C   1 
ATOM   10045 O  O   . HIS D 1 269 ? 11.530  2.745   23.069  1.00 30.29  ? 269 HIS D O   1 
ATOM   10046 C  CB  . HIS D 1 269 ? 9.173   0.658   22.993  1.00 24.60  ? 269 HIS D CB  1 
ATOM   10047 C  CG  . HIS D 1 269 ? 8.277   -0.115  22.044  1.00 22.90  ? 269 HIS D CG  1 
ATOM   10048 N  ND1 . HIS D 1 269 ? 7.926   -1.410  22.258  1.00 24.66  ? 269 HIS D ND1 1 
ATOM   10049 C  CD2 . HIS D 1 269 ? 7.699   0.252   20.857  1.00 21.11  ? 269 HIS D CD2 1 
ATOM   10050 C  CE1 . HIS D 1 269 ? 7.142   -1.825  21.259  1.00 21.96  ? 269 HIS D CE1 1 
ATOM   10051 N  NE2 . HIS D 1 269 ? 7.001   -0.803  20.404  1.00 21.55  ? 269 HIS D NE2 1 
ATOM   10052 N  N   . ASP D 1 270 ? 12.101  1.133   24.527  1.00 26.98  ? 270 ASP D N   1 
ATOM   10053 C  CA  . ASP D 1 270 ? 12.808  2.053   25.418  1.00 27.22  ? 270 ASP D CA  1 
ATOM   10054 C  C   . ASP D 1 270 ? 14.304  1.788   25.584  1.00 24.31  ? 270 ASP D C   1 
ATOM   10055 O  O   . ASP D 1 270 ? 14.741  0.631   25.636  1.00 24.55  ? 270 ASP D O   1 
ATOM   10056 C  CB  . ASP D 1 270 ? 12.100  2.090   26.784  1.00 32.45  ? 270 ASP D CB  1 
ATOM   10057 C  CG  . ASP D 1 270 ? 10.875  3.015   26.778  1.00 38.29  ? 270 ASP D CG  1 
ATOM   10058 O  OD1 . ASP D 1 270 ? 10.444  3.421   25.658  1.00 42.44  ? 270 ASP D OD1 1 
ATOM   10059 O  OD2 . ASP D 1 270 ? 10.358  3.359   27.876  1.00 38.78  ? 270 ASP D OD2 1 
ATOM   10060 N  N   . PRO D 1 271 ? 15.103  2.862   25.660  1.00 22.74  ? 271 PRO D N   1 
ATOM   10061 C  CA  . PRO D 1 271 ? 16.566  2.751   25.776  1.00 21.38  ? 271 PRO D CA  1 
ATOM   10062 C  C   . PRO D 1 271 ? 17.012  1.821   26.880  1.00 20.56  ? 271 PRO D C   1 
ATOM   10063 O  O   . PRO D 1 271 ? 17.885  0.968   26.662  1.00 20.16  ? 271 PRO D O   1 
ATOM   10064 C  CB  . PRO D 1 271 ? 17.014  4.186   26.121  1.00 20.32  ? 271 PRO D CB  1 
ATOM   10065 C  CG  . PRO D 1 271 ? 15.845  5.063   25.854  1.00 21.38  ? 271 PRO D CG  1 
ATOM   10066 C  CD  . PRO D 1 271 ? 14.694  4.239   25.326  1.00 22.30  ? 271 PRO D CD  1 
ATOM   10067 N  N   . LEU D 1 272 ? 16.407  1.984   28.055  1.00 19.46  ? 272 LEU D N   1 
ATOM   10068 C  CA  . LEU D 1 272 ? 16.828  1.243   29.246  1.00 18.90  ? 272 LEU D CA  1 
ATOM   10069 C  C   . LEU D 1 272 ? 16.429  -0.209  29.134  1.00 17.94  ? 272 LEU D C   1 
ATOM   10070 O  O   . LEU D 1 272 ? 17.094  -1.067  29.647  1.00 16.97  ? 272 LEU D O   1 
ATOM   10071 C  CB  . LEU D 1 272 ? 16.234  1.867   30.528  1.00 20.33  ? 272 LEU D CB  1 
ATOM   10072 C  CG  . LEU D 1 272 ? 16.327  3.383   30.710  1.00 21.14  ? 272 LEU D CG  1 
ATOM   10073 C  CD1 . LEU D 1 272 ? 15.458  3.841   31.894  1.00 21.74  ? 272 LEU D CD1 1 
ATOM   10074 C  CD2 . LEU D 1 272 ? 17.798  3.732   30.896  1.00 21.37  ? 272 LEU D CD2 1 
ATOM   10075 N  N   . SER D 1 273 ? 15.328  -0.487  28.455  1.00 18.28  ? 273 SER D N   1 
ATOM   10076 C  CA  . SER D 1 273 ? 15.042  -1.873  28.094  1.00 19.45  ? 273 SER D CA  1 
ATOM   10077 C  C   . SER D 1 273 ? 16.033  -2.394  27.050  1.00 17.32  ? 273 SER D C   1 
ATOM   10078 O  O   . SER D 1 273 ? 16.540  -3.516  27.154  1.00 16.63  ? 273 SER D O   1 
ATOM   10079 C  CB  . SER D 1 273 ? 13.584  -2.017  27.611  1.00 20.72  ? 273 SER D CB  1 
ATOM   10080 O  OG  . SER D 1 273 ? 12.743  -1.732  28.697  1.00 23.63  ? 273 SER D OG  1 
ATOM   10081 N  N   . LEU D 1 274 ? 16.330  -1.581  26.051  1.00 16.95  ? 274 LEU D N   1 
ATOM   10082 C  CA  . LEU D 1 274 ? 17.262  -2.044  25.023  1.00 17.42  ? 274 LEU D CA  1 
ATOM   10083 C  C   . LEU D 1 274 ? 18.601  -2.366  25.650  1.00 18.15  ? 274 LEU D C   1 
ATOM   10084 O  O   . LEU D 1 274 ? 19.109  -3.489  25.511  1.00 17.90  ? 274 LEU D O   1 
ATOM   10085 C  CB  . LEU D 1 274 ? 17.374  -1.048  23.851  1.00 17.41  ? 274 LEU D CB  1 
ATOM   10086 C  CG  . LEU D 1 274 ? 18.226  -1.513  22.654  1.00 17.27  ? 274 LEU D CG  1 
ATOM   10087 C  CD1 . LEU D 1 274 ? 17.886  -2.934  22.229  1.00 19.00  ? 274 LEU D CD1 1 
ATOM   10088 C  CD2 . LEU D 1 274 ? 18.068  -0.613  21.449  1.00 16.19  ? 274 LEU D CD2 1 
ATOM   10089 N  N   . LYS D 1 275 ? 19.141  -1.405  26.409  1.00 19.19  ? 275 LYS D N   1 
ATOM   10090 C  CA  . LYS D 1 275 ? 20.364  -1.644  27.175  1.00 18.53  ? 275 LYS D CA  1 
ATOM   10091 C  C   . LYS D 1 275 ? 20.336  -2.915  27.986  1.00 17.64  ? 275 LYS D C   1 
ATOM   10092 O  O   . LYS D 1 275 ? 21.280  -3.714  27.928  1.00 18.19  ? 275 LYS D O   1 
ATOM   10093 C  CB  . LYS D 1 275 ? 20.734  -0.441  28.080  1.00 19.89  ? 275 LYS D CB  1 
ATOM   10094 C  CG  . LYS D 1 275 ? 22.148  -0.535  28.672  1.00 20.81  ? 275 LYS D CG  1 
ATOM   10095 C  CD  . LYS D 1 275 ? 23.222  -0.501  27.573  1.00 24.16  ? 275 LYS D CD  1 
ATOM   10096 C  CE  . LYS D 1 275 ? 24.635  -0.151  28.089  1.00 28.18  ? 275 LYS D CE  1 
ATOM   10097 N  NZ  . LYS D 1 275 ? 25.148  -1.242  28.983  1.00 27.93  ? 275 LYS D NZ  1 
ATOM   10098 N  N   . LEU D 1 276 ? 19.274  -3.125  28.757  1.00 17.44  ? 276 LEU D N   1 
ATOM   10099 C  CA  . LEU D 1 276 ? 19.215  -4.339  29.586  1.00 17.44  ? 276 LEU D CA  1 
ATOM   10100 C  C   . LEU D 1 276 ? 19.240  -5.598  28.761  1.00 16.58  ? 276 LEU D C   1 
ATOM   10101 O  O   . LEU D 1 276 ? 19.941  -6.556  29.110  1.00 16.77  ? 276 LEU D O   1 
ATOM   10102 C  CB  . LEU D 1 276 ? 17.985  -4.370  30.507  1.00 18.82  ? 276 LEU D CB  1 
ATOM   10103 C  CG  . LEU D 1 276 ? 18.028  -5.547  31.480  1.00 19.60  ? 276 LEU D CG  1 
ATOM   10104 C  CD1 . LEU D 1 276 ? 19.012  -5.237  32.582  1.00 20.57  ? 276 LEU D CD1 1 
ATOM   10105 C  CD2 . LEU D 1 276 ? 16.683  -5.734  32.129  1.00 22.95  ? 276 LEU D CD2 1 
ATOM   10106 N  N   . LEU D 1 277 ? 18.449  -5.594  27.691  1.00 15.65  ? 277 LEU D N   1 
ATOM   10107 C  CA  . LEU D 1 277 ? 18.399  -6.695  26.747  1.00 15.92  ? 277 LEU D CA  1 
ATOM   10108 C  C   . LEU D 1 277 ? 19.776  -7.032  26.223  1.00 16.47  ? 277 LEU D C   1 
ATOM   10109 O  O   . LEU D 1 277 ? 20.152  -8.203  26.222  1.00 17.00  ? 277 LEU D O   1 
ATOM   10110 C  CB  . LEU D 1 277 ? 17.433  -6.356  25.600  1.00 15.43  ? 277 LEU D CB  1 
ATOM   10111 C  CG  . LEU D 1 277 ? 17.095  -7.337  24.483  1.00 15.23  ? 277 LEU D CG  1 
ATOM   10112 C  CD1 . LEU D 1 277 ? 16.580  -8.644  25.058  1.00 14.98  ? 277 LEU D CD1 1 
ATOM   10113 C  CD2 . LEU D 1 277 ? 16.097  -6.759  23.490  1.00 14.83  ? 277 LEU D CD2 1 
ATOM   10114 N  N   . THR D 1 278 ? 20.558  -6.031  25.822  1.00 18.19  ? 278 THR D N   1 
ATOM   10115 C  CA  . THR D 1 278 ? 21.912  -6.318  25.277  1.00 21.36  ? 278 THR D CA  1 
ATOM   10116 C  C   . THR D 1 278 ? 22.867  -6.825  26.362  1.00 24.04  ? 278 THR D C   1 
ATOM   10117 O  O   . THR D 1 278 ? 23.703  -7.719  26.116  1.00 24.75  ? 278 THR D O   1 
ATOM   10118 C  CB  . THR D 1 278 ? 22.547  -5.133  24.534  1.00 21.56  ? 278 THR D CB  1 
ATOM   10119 O  OG1 . THR D 1 278 ? 22.661  -4.008  25.417  1.00 24.78  ? 278 THR D OG1 1 
ATOM   10120 C  CG2 . THR D 1 278 ? 21.711  -4.745  23.337  1.00 20.84  ? 278 THR D CG2 1 
ATOM   10121 N  N   . ASP D 1 279 ? 22.705  -6.291  27.568  1.00 25.11  ? 279 ASP D N   1 
ATOM   10122 C  CA  . ASP D 1 279 ? 23.483  -6.743  28.729  1.00 26.23  ? 279 ASP D CA  1 
ATOM   10123 C  C   . ASP D 1 279 ? 23.183  -8.160  29.180  1.00 25.89  ? 279 ASP D C   1 
ATOM   10124 O  O   . ASP D 1 279 ? 24.059  -8.810  29.747  1.00 25.06  ? 279 ASP D O   1 
ATOM   10125 C  CB  . ASP D 1 279 ? 23.288  -5.798  29.910  1.00 29.97  ? 279 ASP D CB  1 
ATOM   10126 C  CG  . ASP D 1 279 ? 23.867  -4.416  29.651  1.00 35.69  ? 279 ASP D CG  1 
ATOM   10127 O  OD1 . ASP D 1 279 ? 24.735  -4.291  28.743  1.00 38.86  ? 279 ASP D OD1 1 
ATOM   10128 O  OD2 . ASP D 1 279 ? 23.458  -3.453  30.364  1.00 37.74  ? 279 ASP D OD2 1 
ATOM   10129 N  N   . VAL D 1 280 ? 21.958  -8.638  28.950  1.00 24.32  ? 280 VAL D N   1 
ATOM   10130 C  CA  . VAL D 1 280 ? 21.584  -10.003 29.375  1.00 23.42  ? 280 VAL D CA  1 
ATOM   10131 C  C   . VAL D 1 280 ? 21.723  -11.050 28.241  1.00 22.84  ? 280 VAL D C   1 
ATOM   10132 O  O   . VAL D 1 280 ? 22.467  -12.005 28.388  1.00 23.33  ? 280 VAL D O   1 
ATOM   10133 C  CB  . VAL D 1 280 ? 20.157  -10.045 30.013  1.00 23.68  ? 280 VAL D CB  1 
ATOM   10134 C  CG1 . VAL D 1 280 ? 19.888  -11.406 30.613  1.00 23.95  ? 280 VAL D CG1 1 
ATOM   10135 C  CG2 . VAL D 1 280 ? 20.023  -9.013  31.114  1.00 22.64  ? 280 VAL D CG2 1 
ATOM   10136 N  N   . ILE D 1 281 ? 21.011  -10.854 27.123  1.00 20.54  ? 281 ILE D N   1 
ATOM   10137 C  CA  . ILE D 1 281 ? 21.080  -11.709 25.924  1.00 19.54  ? 281 ILE D CA  1 
ATOM   10138 C  C   . ILE D 1 281 ? 22.452  -11.613 25.218  1.00 20.19  ? 281 ILE D C   1 
ATOM   10139 O  O   . ILE D 1 281 ? 22.976  -12.609 24.680  1.00 20.71  ? 281 ILE D O   1 
ATOM   10140 C  CB  . ILE D 1 281 ? 19.918  -11.334 24.932  1.00 18.82  ? 281 ILE D CB  1 
ATOM   10141 C  CG1 . ILE D 1 281 ? 18.575  -11.286 25.669  1.00 20.05  ? 281 ILE D CG1 1 
ATOM   10142 C  CG2 . ILE D 1 281 ? 19.744  -12.315 23.794  1.00 17.59  ? 281 ILE D CG2 1 
ATOM   10143 C  CD1 . ILE D 1 281 ? 18.194  -12.594 26.339  1.00 20.25  ? 281 ILE D CD1 1 
ATOM   10144 N  N   . GLY D 1 282 ? 23.055  -10.430 25.210  1.00 20.68  ? 282 GLY D N   1 
ATOM   10145 C  CA  . GLY D 1 282 ? 24.364  -10.292 24.565  1.00 22.18  ? 282 GLY D CA  1 
ATOM   10146 C  C   . GLY D 1 282 ? 24.279  -9.372  23.363  1.00 23.53  ? 282 GLY D C   1 
ATOM   10147 O  O   . GLY D 1 282 ? 23.231  -9.276  22.718  1.00 23.59  ? 282 GLY D O   1 
ATOM   10148 N  N   . LYS D 1 283 ? 25.368  -8.685  23.049  1.00 23.90  ? 283 LYS D N   1 
ATOM   10149 C  CA  . LYS D 1 283 ? 25.347  -7.838  21.866  1.00 24.71  ? 283 LYS D CA  1 
ATOM   10150 C  C   . LYS D 1 283 ? 25.382  -8.648  20.550  1.00 22.90  ? 283 LYS D C   1 
ATOM   10151 O  O   . LYS D 1 283 ? 25.065  -8.116  19.526  1.00 22.04  ? 283 LYS D O   1 
ATOM   10152 C  CB  . LYS D 1 283 ? 26.493  -6.821  21.891  1.00 28.18  ? 283 LYS D CB  1 
ATOM   10153 C  CG  . LYS D 1 283 ? 26.512  -5.856  23.077  1.00 32.93  ? 283 LYS D CG  1 
ATOM   10154 C  CD  . LYS D 1 283 ? 27.500  -4.718  22.812  1.00 36.50  ? 283 LYS D CD  1 
ATOM   10155 C  CE  . LYS D 1 283 ? 27.782  -3.852  24.037  1.00 38.51  ? 283 LYS D CE  1 
ATOM   10156 N  NZ  . LYS D 1 283 ? 29.075  -4.270  24.649  1.00 43.89  ? 283 LYS D NZ  1 
ATOM   10157 N  N   . ASP D 1 284 ? 25.779  -9.916  20.561  1.00 22.88  ? 284 ASP D N   1 
ATOM   10158 C  CA  . ASP D 1 284 ? 25.782  -10.687 19.313  1.00 23.86  ? 284 ASP D CA  1 
ATOM   10159 C  C   . ASP D 1 284 ? 24.416  -11.317 19.000  1.00 21.21  ? 284 ASP D C   1 
ATOM   10160 O  O   . ASP D 1 284 ? 24.256  -11.969 17.962  1.00 19.12  ? 284 ASP D O   1 
ATOM   10161 C  CB  . ASP D 1 284 ? 26.826  -11.811 19.359  1.00 29.35  ? 284 ASP D CB  1 
ATOM   10162 C  CG  . ASP D 1 284 ? 28.242  -11.298 19.630  1.00 37.96  ? 284 ASP D CG  1 
ATOM   10163 O  OD1 . ASP D 1 284 ? 28.739  -10.451 18.857  1.00 37.21  ? 284 ASP D OD1 1 
ATOM   10164 O  OD2 . ASP D 1 284 ? 28.871  -11.755 20.624  1.00 45.32  ? 284 ASP D OD2 1 
ATOM   10165 N  N   . LYS D 1 285 ? 23.449  -11.124 19.903  1.00 18.73  ? 285 LYS D N   1 
ATOM   10166 C  CA  . LYS D 1 285 ? 22.265  -11.987 19.984  1.00 17.42  ? 285 LYS D CA  1 
ATOM   10167 C  C   . LYS D 1 285 ? 20.912  -11.291 19.915  1.00 16.61  ? 285 LYS D C   1 
ATOM   10168 O  O   . LYS D 1 285 ? 19.884  -11.902 20.152  1.00 16.43  ? 285 LYS D O   1 
ATOM   10169 C  CB  . LYS D 1 285 ? 22.371  -12.833 21.257  1.00 17.68  ? 285 LYS D CB  1 
ATOM   10170 C  CG  . LYS D 1 285 ? 23.310  -14.019 21.097  1.00 17.93  ? 285 LYS D CG  1 
ATOM   10171 C  CD  . LYS D 1 285 ? 22.510  -15.209 20.544  1.00 17.82  ? 285 LYS D CD  1 
ATOM   10172 C  CE  . LYS D 1 285 ? 23.353  -16.155 19.697  1.00 17.18  ? 285 LYS D CE  1 
ATOM   10173 N  NZ  . LYS D 1 285 ? 24.787  -16.104 20.055  1.00 17.01  ? 285 LYS D NZ  1 
ATOM   10174 N  N   . VAL D 1 286 ? 20.932  -10.002 19.603  1.00 16.68  ? 286 VAL D N   1 
ATOM   10175 C  CA  . VAL D 1 286 ? 19.758  -9.144  19.608  1.00 16.60  ? 286 VAL D CA  1 
ATOM   10176 C  C   . VAL D 1 286 ? 19.593  -8.653  18.180  1.00 16.57  ? 286 VAL D C   1 
ATOM   10177 O  O   . VAL D 1 286 ? 20.503  -8.066  17.607  1.00 17.12  ? 286 VAL D O   1 
ATOM   10178 C  CB  . VAL D 1 286 ? 19.939  -7.952  20.598  1.00 15.60  ? 286 VAL D CB  1 
ATOM   10179 C  CG1 . VAL D 1 286 ? 18.867  -6.893  20.443  1.00 13.72  ? 286 VAL D CG1 1 
ATOM   10180 C  CG2 . VAL D 1 286 ? 19.963  -8.440  22.033  1.00 15.34  ? 286 VAL D CG2 1 
ATOM   10181 N  N   . ILE D 1 287 ? 18.430  -8.880  17.602  1.00 16.69  ? 287 ILE D N   1 
ATOM   10182 C  CA  . ILE D 1 287 ? 18.251  -8.595  16.192  1.00 16.78  ? 287 ILE D CA  1 
ATOM   10183 C  C   . ILE D 1 287 ? 17.162  -7.564  16.076  1.00 17.48  ? 287 ILE D C   1 
ATOM   10184 O  O   . ILE D 1 287 ? 16.141  -7.663  16.738  1.00 18.80  ? 287 ILE D O   1 
ATOM   10185 C  CB  . ILE D 1 287 ? 17.815  -9.867  15.440  1.00 17.23  ? 287 ILE D CB  1 
ATOM   10186 C  CG1 . ILE D 1 287 ? 18.723  -11.068 15.756  1.00 16.75  ? 287 ILE D CG1 1 
ATOM   10187 C  CG2 . ILE D 1 287 ? 17.790  -9.620  13.960  1.00 15.81  ? 287 ILE D CG2 1 
ATOM   10188 C  CD1 . ILE D 1 287 ? 18.256  -12.337 15.085  1.00 17.15  ? 287 ILE D CD1 1 
ATOM   10189 N  N   . LEU D 1 288 ? 17.388  -6.548  15.259  1.00 16.80  ? 288 LEU D N   1 
ATOM   10190 C  CA  . LEU D 1 288 ? 16.394  -5.538  14.977  1.00 16.60  ? 288 LEU D CA  1 
ATOM   10191 C  C   . LEU D 1 288 ? 15.120  -6.090  14.290  1.00 17.56  ? 288 LEU D C   1 
ATOM   10192 O  O   . LEU D 1 288 ? 15.178  -6.665  13.209  1.00 16.83  ? 288 LEU D O   1 
ATOM   10193 C  CB  . LEU D 1 288 ? 17.031  -4.466  14.087  1.00 15.93  ? 288 LEU D CB  1 
ATOM   10194 C  CG  . LEU D 1 288 ? 16.104  -3.434  13.446  1.00 15.65  ? 288 LEU D CG  1 
ATOM   10195 C  CD1 . LEU D 1 288 ? 15.510  -2.528  14.493  1.00 14.70  ? 288 LEU D CD1 1 
ATOM   10196 C  CD2 . LEU D 1 288 ? 16.867  -2.615  12.432  1.00 15.56  ? 288 LEU D CD2 1 
ATOM   10197 N  N   . GLY D 1 289 ? 13.973  -5.872  14.926  1.00 18.54  ? 289 GLY D N   1 
ATOM   10198 C  CA  . GLY D 1 289 ? 12.682  -6.204  14.354  1.00 18.75  ? 289 GLY D CA  1 
ATOM   10199 C  C   . GLY D 1 289 ? 11.649  -5.157  14.709  1.00 19.41  ? 289 GLY D C   1 
ATOM   10200 O  O   . GLY D 1 289 ? 11.651  -4.615  15.784  1.00 19.63  ? 289 GLY D O   1 
ATOM   10201 N  N   . THR D 1 290 ? 10.701  -4.985  13.812  1.00 21.99  ? 290 THR D N   1 
ATOM   10202 C  CA  . THR D 1 290 ? 9.857   -3.807  13.699  1.00 23.97  ? 290 THR D CA  1 
ATOM   10203 C  C   . THR D 1 290 ? 8.383   -4.139  13.876  1.00 22.10  ? 290 THR D C   1 
ATOM   10204 O  O   . THR D 1 290 ? 7.586   -3.259  14.209  1.00 20.15  ? 290 THR D O   1 
ATOM   10205 C  CB  . THR D 1 290 ? 10.039  -3.231  12.264  1.00 26.16  ? 290 THR D CB  1 
ATOM   10206 O  OG1 . THR D 1 290 ? 11.252  -2.446  12.214  1.00 31.01  ? 290 THR D OG1 1 
ATOM   10207 C  CG2 . THR D 1 290 ? 8.868   -2.380  11.840  1.00 25.61  ? 290 THR D CG2 1 
ATOM   10208 N  N   . ASP D 1 291 ? 8.017   -5.393  13.626  1.00 19.61  ? 291 ASP D N   1 
ATOM   10209 C  CA  . ASP D 1 291 ? 6.611   -5.768  13.596  1.00 20.70  ? 291 ASP D CA  1 
ATOM   10210 C  C   . ASP D 1 291 ? 5.855   -4.992  12.513  1.00 19.06  ? 291 ASP D C   1 
ATOM   10211 O  O   . ASP D 1 291 ? 4.634   -4.819  12.608  1.00 18.87  ? 291 ASP D O   1 
ATOM   10212 C  CB  . ASP D 1 291 ? 5.913   -5.633  14.986  1.00 22.40  ? 291 ASP D CB  1 
ATOM   10213 C  CG  . ASP D 1 291 ? 4.544   -6.372  15.063  1.00 26.25  ? 291 ASP D CG  1 
ATOM   10214 O  OD1 . ASP D 1 291 ? 4.405   -7.486  14.537  1.00 26.80  ? 291 ASP D OD1 1 
ATOM   10215 O  OD2 . ASP D 1 291 ? 3.578   -5.843  15.663  1.00 32.11  ? 291 ASP D OD2 1 
ATOM   10216 N  N   . TYR D 1 292 ? 6.558   -4.577  11.463  1.00 17.57  ? 292 TYR D N   1 
ATOM   10217 C  CA  . TYR D 1 292 ? 5.900   -3.963  10.297  1.00 18.54  ? 292 TYR D CA  1 
ATOM   10218 C  C   . TYR D 1 292 ? 4.810   -4.917  9.782   1.00 18.87  ? 292 TYR D C   1 
ATOM   10219 O  O   . TYR D 1 292 ? 5.025   -6.118  9.793   1.00 18.45  ? 292 TYR D O   1 
ATOM   10220 C  CB  . TYR D 1 292 ? 6.940   -3.684  9.235   1.00 18.96  ? 292 TYR D CB  1 
ATOM   10221 C  CG  . TYR D 1 292 ? 6.491   -2.947  8.005   1.00 19.72  ? 292 TYR D CG  1 
ATOM   10222 C  CD1 . TYR D 1 292 ? 6.529   -1.545  7.949   1.00 20.06  ? 292 TYR D CD1 1 
ATOM   10223 C  CD2 . TYR D 1 292 ? 6.083   -3.645  6.873   1.00 19.19  ? 292 TYR D CD2 1 
ATOM   10224 C  CE1 . TYR D 1 292 ? 6.143   -0.862  6.805   1.00 20.08  ? 292 TYR D CE1 1 
ATOM   10225 C  CE2 . TYR D 1 292 ? 5.710   -2.979  5.724   1.00 21.17  ? 292 TYR D CE2 1 
ATOM   10226 C  CZ  . TYR D 1 292 ? 5.749   -1.597  5.703   1.00 22.03  ? 292 TYR D CZ  1 
ATOM   10227 O  OH  . TYR D 1 292 ? 5.381   -0.973  4.561   1.00 25.69  ? 292 TYR D OH  1 
ATOM   10228 N  N   . PRO D 1 293 ? 3.645   -4.386  9.344   1.00 19.18  ? 293 PRO D N   1 
ATOM   10229 C  CA  . PRO D 1 293 ? 3.297   -2.944  9.264   1.00 19.68  ? 293 PRO D CA  1 
ATOM   10230 C  C   . PRO D 1 293 ? 2.420   -2.465  10.427  1.00 20.54  ? 293 PRO D C   1 
ATOM   10231 O  O   . PRO D 1 293 ? 1.788   -1.410  10.301  1.00 20.16  ? 293 PRO D O   1 
ATOM   10232 C  CB  . PRO D 1 293 ? 2.471   -2.862  7.973   1.00 18.11  ? 293 PRO D CB  1 
ATOM   10233 C  CG  . PRO D 1 293 ? 1.765   -4.183  7.935   1.00 18.09  ? 293 PRO D CG  1 
ATOM   10234 C  CD  . PRO D 1 293 ? 2.604   -5.209  8.690   1.00 17.81  ? 293 PRO D CD  1 
ATOM   10235 N  N   . PHE D 1 294 ? 2.405   -3.208  11.539  1.00 20.79  ? 294 PHE D N   1 
ATOM   10236 C  CA  . PHE D 1 294 ? 1.400   -2.964  12.611  1.00 22.11  ? 294 PHE D CA  1 
ATOM   10237 C  C   . PHE D 1 294 ? 1.695   -1.808  13.559  1.00 22.89  ? 294 PHE D C   1 
ATOM   10238 O  O   . PHE D 1 294 ? 2.831   -1.466  13.779  1.00 23.79  ? 294 PHE D O   1 
ATOM   10239 C  CB  . PHE D 1 294 ? 1.084   -4.262  13.371  1.00 20.38  ? 294 PHE D CB  1 
ATOM   10240 C  CG  . PHE D 1 294 ? 0.545   -5.358  12.478  1.00 20.84  ? 294 PHE D CG  1 
ATOM   10241 C  CD1 . PHE D 1 294 ? 0.941   -6.669  12.638  1.00 20.80  ? 294 PHE D CD1 1 
ATOM   10242 C  CD2 . PHE D 1 294 ? -0.364  -5.059  11.452  1.00 21.33  ? 294 PHE D CD2 1 
ATOM   10243 C  CE1 . PHE D 1 294 ? 0.439   -7.669  11.804  1.00 22.28  ? 294 PHE D CE1 1 
ATOM   10244 C  CE2 . PHE D 1 294 ? -0.878  -6.052  10.619  1.00 20.84  ? 294 PHE D CE2 1 
ATOM   10245 C  CZ  . PHE D 1 294 ? -0.470  -7.362  10.786  1.00 20.43  ? 294 PHE D CZ  1 
ATOM   10246 N  N   . PRO D 1 295 ? 0.657   -1.190  14.132  1.00 25.82  ? 295 PRO D N   1 
ATOM   10247 C  CA  . PRO D 1 295 ? 0.976   0.024   14.868  1.00 25.88  ? 295 PRO D CA  1 
ATOM   10248 C  C   . PRO D 1 295 ? 1.660   -0.235  16.220  1.00 26.55  ? 295 PRO D C   1 
ATOM   10249 O  O   . PRO D 1 295 ? 2.344   0.666   16.741  1.00 25.45  ? 295 PRO D O   1 
ATOM   10250 C  CB  . PRO D 1 295 ? -0.391  0.667   15.063  1.00 27.44  ? 295 PRO D CB  1 
ATOM   10251 C  CG  . PRO D 1 295 ? -1.314  -0.497  15.197  1.00 27.40  ? 295 PRO D CG  1 
ATOM   10252 C  CD  . PRO D 1 295 ? -0.785  -1.514  14.206  1.00 26.54  ? 295 PRO D CD  1 
ATOM   10253 N  N   . LEU D 1 296 ? 1.527   -1.433  16.790  1.00 25.58  ? 296 LEU D N   1 
ATOM   10254 C  CA  . LEU D 1 296 ? 2.278   -1.670  18.028  1.00 26.28  ? 296 LEU D CA  1 
ATOM   10255 C  C   . LEU D 1 296 ? 3.798   -1.791  17.806  1.00 25.49  ? 296 LEU D C   1 
ATOM   10256 O  O   . LEU D 1 296 ? 4.562   -1.887  18.779  1.00 27.63  ? 296 LEU D O   1 
ATOM   10257 C  CB  . LEU D 1 296 ? 1.755   -2.865  18.830  1.00 28.57  ? 296 LEU D CB  1 
ATOM   10258 C  CG  . LEU D 1 296 ? 1.593   -2.913  20.377  1.00 30.17  ? 296 LEU D CG  1 
ATOM   10259 C  CD1 . LEU D 1 296 ? 1.796   -4.353  20.802  1.00 31.85  ? 296 LEU D CD1 1 
ATOM   10260 C  CD2 . LEU D 1 296 ? 2.455   -2.047  21.270  1.00 27.96  ? 296 LEU D CD2 1 
ATOM   10261 N  N   . GLY D 1 297 ? 4.242   -1.740  16.557  1.00 23.62  ? 297 GLY D N   1 
ATOM   10262 C  CA  . GLY D 1 297 ? 5.665   -1.907  16.261  1.00 24.12  ? 297 GLY D CA  1 
ATOM   10263 C  C   . GLY D 1 297 ? 6.422   -0.597  16.170  1.00 25.04  ? 297 GLY D C   1 
ATOM   10264 O  O   . GLY D 1 297 ? 5.899   0.448   16.520  1.00 26.19  ? 297 GLY D O   1 
ATOM   10265 N  N   . GLU D 1 298 ? 7.661   -0.654  15.708  1.00 24.57  ? 298 GLU D N   1 
ATOM   10266 C  CA  . GLU D 1 298 ? 8.481   0.511   15.620  1.00 27.97  ? 298 GLU D CA  1 
ATOM   10267 C  C   . GLU D 1 298 ? 8.216   1.276   14.312  1.00 29.58  ? 298 GLU D C   1 
ATOM   10268 O  O   . GLU D 1 298 ? 8.311   0.725   13.216  1.00 32.78  ? 298 GLU D O   1 
ATOM   10269 C  CB  . GLU D 1 298 ? 9.954   0.118   15.757  1.00 32.96  ? 298 GLU D CB  1 
ATOM   10270 C  CG  . GLU D 1 298 ? 10.926  1.303   15.745  1.00 36.65  ? 298 GLU D CG  1 
ATOM   10271 C  CD  . GLU D 1 298 ? 12.407  0.907   15.818  1.00 40.24  ? 298 GLU D CD  1 
ATOM   10272 O  OE1 . GLU D 1 298 ? 12.842  -0.001  15.048  1.00 38.79  ? 298 GLU D OE1 1 
ATOM   10273 O  OE2 . GLU D 1 298 ? 13.144  1.528   16.644  1.00 40.11  ? 298 GLU D OE2 1 
ATOM   10274 N  N   . LEU D 1 299 ? 7.897   2.553   14.460  1.00 30.11  ? 299 LEU D N   1 
ATOM   10275 C  CA  . LEU D 1 299 ? 7.581   3.454   13.380  1.00 30.04  ? 299 LEU D CA  1 
ATOM   10276 C  C   . LEU D 1 299 ? 8.846   3.767   12.561  1.00 31.53  ? 299 LEU D C   1 
ATOM   10277 O  O   . LEU D 1 299 ? 8.889   3.542   11.356  1.00 29.79  ? 299 LEU D O   1 
ATOM   10278 C  CB  . LEU D 1 299 ? 6.981   4.746   13.969  1.00 31.32  ? 299 LEU D CB  1 
ATOM   10279 C  CG  . LEU D 1 299 ? 5.789   5.518   13.334  1.00 33.82  ? 299 LEU D CG  1 
ATOM   10280 C  CD1 . LEU D 1 299 ? 5.677   6.922   13.931  1.00 33.92  ? 299 LEU D CD1 1 
ATOM   10281 C  CD2 . LEU D 1 299 ? 5.845   5.625   11.822  1.00 31.72  ? 299 LEU D CD2 1 
ATOM   10282 N  N   . GLU D 1 300 ? 9.874   4.283   13.225  1.00 32.22  ? 300 GLU D N   1 
ATOM   10283 C  CA  . GLU D 1 300 ? 11.145  4.572   12.572  1.00 32.05  ? 300 GLU D CA  1 
ATOM   10284 C  C   . GLU D 1 300 ? 12.146  3.437   12.808  1.00 28.95  ? 300 GLU D C   1 
ATOM   10285 O  O   . GLU D 1 300 ? 12.789  3.400   13.851  1.00 28.46  ? 300 GLU D O   1 
ATOM   10286 C  CB  . GLU D 1 300 ? 11.696  5.914   13.089  1.00 35.64  ? 300 GLU D CB  1 
ATOM   10287 C  CG  . GLU D 1 300 ? 10.655  7.018   13.153  1.00 39.72  ? 300 GLU D CG  1 
ATOM   10288 C  CD  . GLU D 1 300 ? 10.013  7.313   11.793  1.00 48.76  ? 300 GLU D CD  1 
ATOM   10289 O  OE1 . GLU D 1 300 ? 10.706  7.121   10.757  1.00 50.26  ? 300 GLU D OE1 1 
ATOM   10290 O  OE2 . GLU D 1 300 ? 8.823   7.735   11.749  1.00 54.21  ? 300 GLU D OE2 1 
ATOM   10291 N  N   . PRO D 1 301 ? 12.271  2.500   11.845  1.00 27.75  ? 301 PRO D N   1 
ATOM   10292 C  CA  . PRO D 1 301 ? 13.048  1.298   12.156  1.00 26.69  ? 301 PRO D CA  1 
ATOM   10293 C  C   . PRO D 1 301 ? 14.503  1.588   12.469  1.00 26.05  ? 301 PRO D C   1 
ATOM   10294 O  O   . PRO D 1 301 ? 15.189  2.288   11.729  1.00 23.89  ? 301 PRO D O   1 
ATOM   10295 C  CB  . PRO D 1 301 ? 12.906  0.434   10.884  1.00 27.57  ? 301 PRO D CB  1 
ATOM   10296 C  CG  . PRO D 1 301 ? 11.650  0.915   10.231  1.00 26.24  ? 301 PRO D CG  1 
ATOM   10297 C  CD  . PRO D 1 301 ? 11.601  2.390   10.526  1.00 27.72  ? 301 PRO D CD  1 
ATOM   10298 N  N   . GLY D 1 302 ? 14.956  1.050   13.589  1.00 27.07  ? 302 GLY D N   1 
ATOM   10299 C  CA  . GLY D 1 302 ? 16.335  1.253   14.026  1.00 28.16  ? 302 GLY D CA  1 
ATOM   10300 C  C   . GLY D 1 302 ? 16.644  2.528   14.774  1.00 26.72  ? 302 GLY D C   1 
ATOM   10301 O  O   . GLY D 1 302 ? 17.793  2.749   15.147  1.00 27.31  ? 302 GLY D O   1 
ATOM   10302 N  N   . LYS D 1 303 ? 15.640  3.367   15.004  1.00 27.16  ? 303 LYS D N   1 
ATOM   10303 C  CA  . LYS D 1 303 ? 15.908  4.687   15.570  1.00 30.00  ? 303 LYS D CA  1 
ATOM   10304 C  C   . LYS D 1 303 ? 16.484  4.500   16.962  1.00 30.19  ? 303 LYS D C   1 
ATOM   10305 O  O   . LYS D 1 303 ? 17.569  4.986   17.266  1.00 36.09  ? 303 LYS D O   1 
ATOM   10306 C  CB  . LYS D 1 303 ? 14.638  5.540   15.606  1.00 30.93  ? 303 LYS D CB  1 
ATOM   10307 C  CG  . LYS D 1 303 ? 14.799  6.901   16.249  1.00 32.56  ? 303 LYS D CG  1 
ATOM   10308 C  CD  . LYS D 1 303 ? 13.886  7.877   15.509  1.00 39.09  ? 303 LYS D CD  1 
ATOM   10309 C  CE  . LYS D 1 303 ? 14.189  9.338   15.818  1.00 42.40  ? 303 LYS D CE  1 
ATOM   10310 N  NZ  . LYS D 1 303 ? 12.916  10.115  15.728  1.00 46.14  ? 303 LYS D NZ  1 
ATOM   10311 N  N   . LEU D 1 304 ? 15.765  3.742   17.778  1.00 28.98  ? 304 LEU D N   1 
ATOM   10312 C  CA  . LEU D 1 304 ? 16.181  3.435   19.118  1.00 27.69  ? 304 LEU D CA  1 
ATOM   10313 C  C   . LEU D 1 304 ? 17.649  3.000   19.159  1.00 27.63  ? 304 LEU D C   1 
ATOM   10314 O  O   . LEU D 1 304 ? 18.421  3.519   19.967  1.00 28.52  ? 304 LEU D O   1 
ATOM   10315 C  CB  . LEU D 1 304 ? 15.262  2.370   19.725  1.00 25.42  ? 304 LEU D CB  1 
ATOM   10316 C  CG  . LEU D 1 304 ? 15.286  2.282   21.258  1.00 28.51  ? 304 LEU D CG  1 
ATOM   10317 C  CD1 . LEU D 1 304 ? 14.420  3.402   21.837  1.00 27.45  ? 304 LEU D CD1 1 
ATOM   10318 C  CD2 . LEU D 1 304 ? 14.815  0.901   21.774  1.00 26.34  ? 304 LEU D CD2 1 
ATOM   10319 N  N   . ILE D 1 305 ? 18.026  2.048   18.308  1.00 26.75  ? 305 ILE D N   1 
ATOM   10320 C  CA  . ILE D 1 305 ? 19.412  1.579   18.234  1.00 28.66  ? 305 ILE D CA  1 
ATOM   10321 C  C   . ILE D 1 305 ? 20.367  2.725   17.906  1.00 31.09  ? 305 ILE D C   1 
ATOM   10322 O  O   . ILE D 1 305 ? 21.365  2.900   18.607  1.00 29.57  ? 305 ILE D O   1 
ATOM   10323 C  CB  . ILE D 1 305 ? 19.612  0.461   17.184  1.00 26.21  ? 305 ILE D CB  1 
ATOM   10324 C  CG1 . ILE D 1 305 ? 19.049  -0.859  17.694  1.00 27.62  ? 305 ILE D CG1 1 
ATOM   10325 C  CG2 . ILE D 1 305 ? 21.079  0.255   16.914  1.00 23.95  ? 305 ILE D CG2 1 
ATOM   10326 C  CD1 . ILE D 1 305 ? 18.864  -1.911  16.611  1.00 30.71  ? 305 ILE D CD1 1 
ATOM   10327 N  N   . GLU D 1 306 ? 20.052  3.494   16.853  1.00 34.14  ? 306 GLU D N   1 
ATOM   10328 C  CA  . GLU D 1 306 ? 20.909  4.608   16.409  1.00 39.49  ? 306 GLU D CA  1 
ATOM   10329 C  C   . GLU D 1 306 ? 21.086  5.646   17.500  1.00 39.60  ? 306 GLU D C   1 
ATOM   10330 O  O   . GLU D 1 306 ? 22.084  6.371   17.527  1.00 39.31  ? 306 GLU D O   1 
ATOM   10331 C  CB  . GLU D 1 306 ? 20.300  5.355   15.220  1.00 45.74  ? 306 GLU D CB  1 
ATOM   10332 C  CG  . GLU D 1 306 ? 20.046  4.547   13.959  1.00 55.09  ? 306 GLU D CG  1 
ATOM   10333 C  CD  . GLU D 1 306 ? 19.161  5.288   12.947  1.00 62.57  ? 306 GLU D CD  1 
ATOM   10334 O  OE1 . GLU D 1 306 ? 18.788  6.475   13.195  1.00 62.14  ? 306 GLU D OE1 1 
ATOM   10335 O  OE2 . GLU D 1 306 ? 18.845  4.674   11.894  1.00 62.65  ? 306 GLU D OE2 1 
ATOM   10336 N  N   . SER D 1 307 ? 20.089  5.750   18.370  1.00 36.35  ? 307 SER D N   1 
ATOM   10337 C  CA  . SER D 1 307 ? 20.049  6.823   19.345  1.00 35.74  ? 307 SER D CA  1 
ATOM   10338 C  C   . SER D 1 307 ? 20.770  6.441   20.644  1.00 35.59  ? 307 SER D C   1 
ATOM   10339 O  O   . SER D 1 307 ? 20.820  7.241   21.570  1.00 37.62  ? 307 SER D O   1 
ATOM   10340 C  CB  . SER D 1 307 ? 18.591  7.191   19.631  1.00 34.42  ? 307 SER D CB  1 
ATOM   10341 O  OG  . SER D 1 307 ? 18.044  6.321   20.603  1.00 35.38  ? 307 SER D OG  1 
ATOM   10342 N  N   . MET D 1 308 ? 21.286  5.211   20.721  1.00 34.05  ? 308 MET D N   1 
ATOM   10343 C  CA  . MET D 1 308 ? 21.967  4.731   21.924  1.00 33.40  ? 308 MET D CA  1 
ATOM   10344 C  C   . MET D 1 308 ? 23.423  5.167   21.948  1.00 37.04  ? 308 MET D C   1 
ATOM   10345 O  O   . MET D 1 308 ? 24.312  4.507   21.373  1.00 37.32  ? 308 MET D O   1 
ATOM   10346 C  CB  . MET D 1 308 ? 21.914  3.215   22.042  1.00 31.23  ? 308 MET D CB  1 
ATOM   10347 C  CG  . MET D 1 308 ? 20.507  2.635   22.009  1.00 33.37  ? 308 MET D CG  1 
ATOM   10348 S  SD  . MET D 1 308 ? 19.619  2.714   23.580  1.00 29.52  ? 308 MET D SD  1 
ATOM   10349 C  CE  . MET D 1 308 ? 20.483  1.518   24.605  1.00 27.30  ? 308 MET D CE  1 
ATOM   10350 N  N   . GLU D 1 309 ? 23.648  6.283   22.631  1.00 39.61  ? 309 GLU D N   1 
ATOM   10351 C  CA  . GLU D 1 309 ? 24.978  6.793   22.905  1.00 42.52  ? 309 GLU D CA  1 
ATOM   10352 C  C   . GLU D 1 309 ? 25.941  5.742   23.487  1.00 40.19  ? 309 GLU D C   1 
ATOM   10353 O  O   . GLU D 1 309 ? 27.123  5.828   23.263  1.00 41.76  ? 309 GLU D O   1 
ATOM   10354 C  CB  . GLU D 1 309 ? 24.927  8.107   23.719  1.00 47.39  ? 309 GLU D CB  1 
ATOM   10355 C  CG  . GLU D 1 309 ? 24.150  8.063   25.036  1.00 54.11  ? 309 GLU D CG  1 
ATOM   10356 C  CD  . GLU D 1 309 ? 22.630  8.208   24.894  1.00 63.66  ? 309 GLU D CD  1 
ATOM   10357 O  OE1 . GLU D 1 309 ? 22.146  8.940   23.991  1.00 68.63  ? 309 GLU D OE1 1 
ATOM   10358 O  OE2 . GLU D 1 309 ? 21.905  7.591   25.711  1.00 68.02  ? 309 GLU D OE2 1 
ATOM   10359 N  N   . GLU D 1 310 ? 25.463  4.705   24.157  1.00 40.42  ? 310 GLU D N   1 
ATOM   10360 C  CA  . GLU D 1 310 ? 26.420  3.724   24.663  1.00 39.65  ? 310 GLU D CA  1 
ATOM   10361 C  C   . GLU D 1 310 ? 26.984  2.723   23.651  1.00 37.52  ? 310 GLU D C   1 
ATOM   10362 O  O   . GLU D 1 310 ? 27.963  2.016   23.953  1.00 35.92  ? 310 GLU D O   1 
ATOM   10363 C  CB  . GLU D 1 310 ? 25.891  3.031   25.897  1.00 42.39  ? 310 GLU D CB  1 
ATOM   10364 C  CG  . GLU D 1 310 ? 26.127  3.895   27.122  1.00 54.96  ? 310 GLU D CG  1 
ATOM   10365 C  CD  . GLU D 1 310 ? 24.864  4.175   27.928  1.00 65.22  ? 310 GLU D CD  1 
ATOM   10366 O  OE1 . GLU D 1 310 ? 23.921  3.342   27.890  1.00 70.77  ? 310 GLU D OE1 1 
ATOM   10367 O  OE2 . GLU D 1 310 ? 24.822  5.230   28.615  1.00 68.07  ? 310 GLU D OE2 1 
ATOM   10368 N  N   . PHE D 1 311 ? 26.406  2.650   22.458  1.00 32.06  ? 311 PHE D N   1 
ATOM   10369 C  CA  . PHE D 1 311 ? 26.895  1.647   21.528  1.00 32.97  ? 311 PHE D CA  1 
ATOM   10370 C  C   . PHE D 1 311 ? 27.898  2.246   20.569  1.00 34.06  ? 311 PHE D C   1 
ATOM   10371 O  O   . PHE D 1 311 ? 27.660  3.316   20.018  1.00 37.61  ? 311 PHE D O   1 
ATOM   10372 C  CB  . PHE D 1 311 ? 25.755  0.981   20.728  1.00 30.72  ? 311 PHE D CB  1 
ATOM   10373 C  CG  . PHE D 1 311 ? 24.746  0.235   21.570  1.00 28.27  ? 311 PHE D CG  1 
ATOM   10374 C  CD1 . PHE D 1 311 ? 25.132  -0.463  22.702  1.00 26.40  ? 311 PHE D CD1 1 
ATOM   10375 C  CD2 . PHE D 1 311 ? 23.418  0.182   21.177  1.00 26.89  ? 311 PHE D CD2 1 
ATOM   10376 C  CE1 . PHE D 1 311 ? 24.208  -1.156  23.447  1.00 27.05  ? 311 PHE D CE1 1 
ATOM   10377 C  CE2 . PHE D 1 311 ? 22.484  -0.529  21.918  1.00 28.22  ? 311 PHE D CE2 1 
ATOM   10378 C  CZ  . PHE D 1 311 ? 22.877  -1.184  23.064  1.00 27.23  ? 311 PHE D CZ  1 
ATOM   10379 N  N   . ASP D 1 312 ? 29.009  1.556   20.341  1.00 36.79  ? 312 ASP D N   1 
ATOM   10380 C  CA  . ASP D 1 312 ? 29.877  1.934   19.215  1.00 41.26  ? 312 ASP D CA  1 
ATOM   10381 C  C   . ASP D 1 312 ? 29.204  1.551   17.882  1.00 40.13  ? 312 ASP D C   1 
ATOM   10382 O  O   . ASP D 1 312 ? 28.092  0.978   17.870  1.00 38.54  ? 312 ASP D O   1 
ATOM   10383 C  CB  . ASP D 1 312 ? 31.269  1.295   19.345  1.00 43.65  ? 312 ASP D CB  1 
ATOM   10384 C  CG  . ASP D 1 312 ? 31.227  -0.229  19.291  1.00 49.97  ? 312 ASP D CG  1 
ATOM   10385 O  OD1 . ASP D 1 312 ? 30.632  -0.785  18.336  1.00 53.87  ? 312 ASP D OD1 1 
ATOM   10386 O  OD2 . ASP D 1 312 ? 31.798  -0.883  20.194  1.00 56.44  ? 312 ASP D OD2 1 
ATOM   10387 N  N   . GLU D 1 313 ? 29.887  1.842   16.776  1.00 38.63  ? 313 GLU D N   1 
ATOM   10388 C  CA  . GLU D 1 313 ? 29.354  1.609   15.430  1.00 38.10  ? 313 GLU D CA  1 
ATOM   10389 C  C   . GLU D 1 313 ? 29.390  0.120   15.031  1.00 37.29  ? 313 GLU D C   1 
ATOM   10390 O  O   . GLU D 1 313 ? 28.528  -0.339  14.277  1.00 36.02  ? 313 GLU D O   1 
ATOM   10391 C  CB  . GLU D 1 313 ? 30.104  2.487   14.414  1.00 40.62  ? 313 GLU D CB  1 
ATOM   10392 C  CG  . GLU D 1 313 ? 29.456  2.622   13.036  1.00 47.43  ? 313 GLU D CG  1 
ATOM   10393 C  CD  . GLU D 1 313 ? 28.458  3.777   12.937  1.00 54.24  ? 313 GLU D CD  1 
ATOM   10394 O  OE1 . GLU D 1 313 ? 28.304  4.331   11.825  1.00 59.36  ? 313 GLU D OE1 1 
ATOM   10395 O  OE2 . GLU D 1 313 ? 27.819  4.145   13.954  1.00 57.94  ? 313 GLU D OE2 1 
ATOM   10396 N  N   . GLU D 1 314 ? 30.372  -0.630  15.532  1.00 35.59  ? 314 GLU D N   1 
ATOM   10397 C  CA  . GLU D 1 314 ? 30.439  -2.081  15.295  1.00 38.52  ? 314 GLU D CA  1 
ATOM   10398 C  C   . GLU D 1 314 ? 29.193  -2.768  15.898  1.00 34.82  ? 314 GLU D C   1 
ATOM   10399 O  O   . GLU D 1 314 ? 28.511  -3.569  15.259  1.00 33.53  ? 314 GLU D O   1 
ATOM   10400 C  CB  . GLU D 1 314 ? 31.733  -2.654  15.889  1.00 44.19  ? 314 GLU D CB  1 
ATOM   10401 C  CG  . GLU D 1 314 ? 31.754  -4.153  16.161  1.00 53.74  ? 314 GLU D CG  1 
ATOM   10402 C  CD  . GLU D 1 314 ? 32.252  -4.522  17.575  1.00 59.92  ? 314 GLU D CD  1 
ATOM   10403 O  OE1 . GLU D 1 314 ? 32.184  -3.661  18.499  1.00 60.90  ? 314 GLU D OE1 1 
ATOM   10404 O  OE2 . GLU D 1 314 ? 32.692  -5.692  17.773  1.00 55.19  ? 314 GLU D OE2 1 
ATOM   10405 N  N   . THR D 1 315 ? 28.899  -2.409  17.134  1.00 30.45  ? 315 THR D N   1 
ATOM   10406 C  CA  . THR D 1 315 ? 27.740  -2.883  17.834  1.00 24.59  ? 315 THR D CA  1 
ATOM   10407 C  C   . THR D 1 315 ? 26.476  -2.489  17.095  1.00 23.27  ? 315 THR D C   1 
ATOM   10408 O  O   . THR D 1 315 ? 25.616  -3.328  16.888  1.00 22.26  ? 315 THR D O   1 
ATOM   10409 C  CB  . THR D 1 315 ? 27.761  -2.300  19.236  1.00 24.03  ? 315 THR D CB  1 
ATOM   10410 O  OG1 . THR D 1 315 ? 28.919  -2.793  19.921  1.00 23.36  ? 315 THR D OG1 1 
ATOM   10411 C  CG2 . THR D 1 315 ? 26.505  -2.634  20.021  1.00 24.90  ? 315 THR D CG2 1 
ATOM   10412 N  N   . LYS D 1 316 ? 26.361  -1.234  16.673  1.00 21.88  ? 316 LYS D N   1 
ATOM   10413 C  CA  . LYS D 1 316 ? 25.116  -0.787  16.064  1.00 22.16  ? 316 LYS D CA  1 
ATOM   10414 C  C   . LYS D 1 316 ? 24.882  -1.498  14.765  1.00 23.51  ? 316 LYS D C   1 
ATOM   10415 O  O   . LYS D 1 316 ? 23.745  -1.764  14.400  1.00 24.71  ? 316 LYS D O   1 
ATOM   10416 C  CB  . LYS D 1 316 ? 25.068  0.719   15.844  1.00 21.97  ? 316 LYS D CB  1 
ATOM   10417 C  CG  . LYS D 1 316 ? 24.784  1.511   17.107  1.00 22.19  ? 316 LYS D CG  1 
ATOM   10418 C  CD  . LYS D 1 316 ? 24.658  3.005   16.858  1.00 21.01  ? 316 LYS D CD  1 
ATOM   10419 C  CE  . LYS D 1 316 ? 24.949  3.744   18.148  1.00 22.55  ? 316 LYS D CE  1 
ATOM   10420 N  NZ  . LYS D 1 316 ? 24.697  5.201   18.101  1.00 23.60  ? 316 LYS D NZ  1 
ATOM   10421 N  N   . ASN D 1 317 ? 25.967  -1.797  14.065  1.00 24.45  ? 317 ASN D N   1 
ATOM   10422 C  CA  . ASN D 1 317 ? 25.922  -2.624  12.857  1.00 24.48  ? 317 ASN D CA  1 
ATOM   10423 C  C   . ASN D 1 317 ? 25.494  -4.040  13.169  1.00 21.90  ? 317 ASN D C   1 
ATOM   10424 O  O   . ASN D 1 317 ? 24.736  -4.644  12.436  1.00 22.69  ? 317 ASN D O   1 
ATOM   10425 C  CB  . ASN D 1 317 ? 27.290  -2.621  12.143  1.00 27.33  ? 317 ASN D CB  1 
ATOM   10426 C  CG  . ASN D 1 317 ? 27.612  -1.283  11.499  1.00 30.00  ? 317 ASN D CG  1 
ATOM   10427 O  OD1 . ASN D 1 317 ? 26.710  -0.518  11.159  1.00 33.18  ? 317 ASN D OD1 1 
ATOM   10428 N  ND2 . ASN D 1 317 ? 28.899  -0.997  11.317  1.00 32.35  ? 317 ASN D ND2 1 
ATOM   10429 N  N   . LYS D 1 318 ? 25.987  -4.583  14.258  1.00 20.66  ? 318 LYS D N   1 
ATOM   10430 C  CA  . LYS D 1 318 ? 25.552  -5.891  14.629  1.00 21.46  ? 318 LYS D CA  1 
ATOM   10431 C  C   . LYS D 1 318 ? 24.060  -5.942  14.942  1.00 22.29  ? 318 LYS D C   1 
ATOM   10432 O  O   . LYS D 1 318 ? 23.378  -6.918  14.529  1.00 22.57  ? 318 LYS D O   1 
ATOM   10433 C  CB  . LYS D 1 318 ? 26.350  -6.399  15.794  1.00 21.98  ? 318 LYS D CB  1 
ATOM   10434 C  CG  . LYS D 1 318 ? 27.645  -7.025  15.308  1.00 23.50  ? 318 LYS D CG  1 
ATOM   10435 C  CD  . LYS D 1 318 ? 28.738  -6.981  16.357  1.00 26.41  ? 318 LYS D CD  1 
ATOM   10436 C  CE  . LYS D 1 318 ? 28.565  -8.095  17.376  1.00 28.20  ? 318 LYS D CE  1 
ATOM   10437 N  NZ  . LYS D 1 318 ? 29.252  -7.790  18.679  1.00 31.22  ? 318 LYS D NZ  1 
ATOM   10438 N  N   . LEU D 1 319 ? 23.548  -4.923  15.648  1.00 19.68  ? 319 LEU D N   1 
ATOM   10439 C  CA  . LEU D 1 319 ? 22.127  -4.915  16.021  1.00 19.59  ? 319 LEU D CA  1 
ATOM   10440 C  C   . LEU D 1 319 ? 21.244  -4.670  14.818  1.00 19.54  ? 319 LEU D C   1 
ATOM   10441 O  O   . LEU D 1 319 ? 20.119  -5.138  14.790  1.00 19.10  ? 319 LEU D O   1 
ATOM   10442 C  CB  . LEU D 1 319 ? 21.785  -3.944  17.178  1.00 17.82  ? 319 LEU D CB  1 
ATOM   10443 C  CG  . LEU D 1 319 ? 22.455  -4.195  18.566  1.00 17.60  ? 319 LEU D CG  1 
ATOM   10444 C  CD1 . LEU D 1 319 ? 22.198  -3.080  19.588  1.00 18.80  ? 319 LEU D CD1 1 
ATOM   10445 C  CD2 . LEU D 1 319 ? 22.132  -5.500  19.235  1.00 16.56  ? 319 LEU D CD2 1 
ATOM   10446 N  N   . LYS D 1 320 ? 21.750  -3.963  13.813  1.00 20.00  ? 320 LYS D N   1 
ATOM   10447 C  CA  . LYS D 1 320 ? 20.932  -3.658  12.626  1.00 20.65  ? 320 LYS D CA  1 
ATOM   10448 C  C   . LYS D 1 320 ? 20.945  -4.699  11.487  1.00 18.30  ? 320 LYS D C   1 
ATOM   10449 O  O   . LYS D 1 320 ? 20.053  -4.709  10.687  1.00 18.03  ? 320 LYS D O   1 
ATOM   10450 C  CB  . LYS D 1 320 ? 21.304  -2.299  12.048  1.00 24.40  ? 320 LYS D CB  1 
ATOM   10451 C  CG  . LYS D 1 320 ? 20.916  -1.128  12.914  1.00 27.82  ? 320 LYS D CG  1 
ATOM   10452 C  CD  . LYS D 1 320 ? 21.123  0.160   12.148  1.00 32.02  ? 320 LYS D CD  1 
ATOM   10453 C  CE  . LYS D 1 320 ? 22.595  0.463   11.906  1.00 38.13  ? 320 LYS D CE  1 
ATOM   10454 N  NZ  . LYS D 1 320 ? 22.786  1.664   11.008  1.00 39.90  ? 320 LYS D NZ  1 
ATOM   10455 N  N   . ALA D 1 321 ? 21.948  -5.556  11.402  1.00 18.30  ? 321 ALA D N   1 
ATOM   10456 C  CA  . ALA D 1 321 ? 22.035  -6.451  10.261  1.00 18.94  ? 321 ALA D CA  1 
ATOM   10457 C  C   . ALA D 1 321 ? 22.849  -7.695  10.526  1.00 18.70  ? 321 ALA D C   1 
ATOM   10458 O  O   . ALA D 1 321 ? 22.464  -8.797  10.113  1.00 19.53  ? 321 ALA D O   1 
ATOM   10459 C  CB  . ALA D 1 321 ? 22.604  -5.716  9.049   1.00 18.07  ? 321 ALA D CB  1 
ATOM   10460 N  N   . GLY D 1 322 ? 24.006  -7.515  11.150  1.00 18.27  ? 322 GLY D N   1 
ATOM   10461 C  CA  . GLY D 1 322 ? 24.958  -8.622  11.352  1.00 17.80  ? 322 GLY D CA  1 
ATOM   10462 C  C   . GLY D 1 322 ? 24.451  -9.755  12.238  1.00 18.58  ? 322 GLY D C   1 
ATOM   10463 O  O   . GLY D 1 322 ? 24.797  -10.902 12.005  1.00 20.72  ? 322 GLY D O   1 
ATOM   10464 N  N   . ASN D 1 323 ? 23.632  -9.466  13.252  1.00 18.28  ? 323 ASN D N   1 
ATOM   10465 C  CA  . ASN D 1 323 ? 23.001  -10.550 14.016  1.00 17.87  ? 323 ASN D CA  1 
ATOM   10466 C  C   . ASN D 1 323 ? 21.864  -11.254 13.278  1.00 18.33  ? 323 ASN D C   1 
ATOM   10467 O  O   . ASN D 1 323 ? 21.701  -12.455 13.447  1.00 18.15  ? 323 ASN D O   1 
ATOM   10468 C  CB  . ASN D 1 323 ? 22.521  -10.048 15.366  1.00 18.73  ? 323 ASN D CB  1 
ATOM   10469 C  CG  . ASN D 1 323 ? 23.658  -9.463  16.210  1.00 19.36  ? 323 ASN D CG  1 
ATOM   10470 O  OD1 . ASN D 1 323 ? 24.849  -9.773  16.005  1.00 16.93  ? 323 ASN D OD1 1 
ATOM   10471 N  ND2 . ASN D 1 323 ? 23.286  -8.614  17.162  1.00 18.59  ? 323 ASN D ND2 1 
ATOM   10472 N  N   . ALA D 1 324 ? 21.085  -10.542 12.447  1.00 17.35  ? 324 ALA D N   1 
ATOM   10473 C  CA  . ALA D 1 324 ? 20.101  -11.236 11.582  1.00 17.35  ? 324 ALA D CA  1 
ATOM   10474 C  C   . ALA D 1 324 ? 20.772  -12.158 10.558  1.00 17.51  ? 324 ALA D C   1 
ATOM   10475 O  O   . ALA D 1 324 ? 20.394  -13.322 10.433  1.00 17.20  ? 324 ALA D O   1 
ATOM   10476 C  CB  . ALA D 1 324 ? 19.141  -10.258 10.892  1.00 16.83  ? 324 ALA D CB  1 
ATOM   10477 N  N   . LEU D 1 325 ? 21.810  -11.688 9.874   1.00 17.62  ? 325 LEU D N   1 
ATOM   10478 C  CA  . LEU D 1 325 ? 22.488  -12.586 8.881   1.00 18.26  ? 325 LEU D CA  1 
ATOM   10479 C  C   . LEU D 1 325 ? 23.027  -13.857 9.540   1.00 19.54  ? 325 LEU D C   1 
ATOM   10480 O  O   . LEU D 1 325 ? 22.829  -14.997 9.068   1.00 20.93  ? 325 LEU D O   1 
ATOM   10481 C  CB  . LEU D 1 325 ? 23.617  -11.849 8.168   1.00 18.16  ? 325 LEU D CB  1 
ATOM   10482 C  CG  . LEU D 1 325 ? 23.137  -10.652 7.336   1.00 17.21  ? 325 LEU D CG  1 
ATOM   10483 C  CD1 . LEU D 1 325 ? 24.314  -9.757  6.964   1.00 17.04  ? 325 LEU D CD1 1 
ATOM   10484 C  CD2 . LEU D 1 325 ? 22.353  -11.115 6.116   1.00 16.65  ? 325 LEU D CD2 1 
ATOM   10485 N  N   . ALA D 1 326 ? 23.698  -13.656 10.660  1.00 19.24  ? 326 ALA D N   1 
ATOM   10486 C  CA  . ALA D 1 326 ? 24.130  -14.764 11.453  1.00 19.12  ? 326 ALA D CA  1 
ATOM   10487 C  C   . ALA D 1 326 ? 22.935  -15.638 11.870  1.00 19.36  ? 326 ALA D C   1 
ATOM   10488 O  O   . ALA D 1 326 ? 22.968  -16.862 11.676  1.00 19.86  ? 326 ALA D O   1 
ATOM   10489 C  CB  . ALA D 1 326 ? 24.926  -14.286 12.648  1.00 18.70  ? 326 ALA D CB  1 
ATOM   10490 N  N   . PHE D 1 327 ? 21.883  -15.056 12.436  1.00 17.58  ? 327 PHE D N   1 
ATOM   10491 C  CA  . PHE D 1 327 ? 20.721  -15.911 12.759  1.00 16.95  ? 327 PHE D CA  1 
ATOM   10492 C  C   . PHE D 1 327 ? 20.158  -16.621 11.498  1.00 17.36  ? 327 PHE D C   1 
ATOM   10493 O  O   . PHE D 1 327 ? 19.799  -17.773 11.565  1.00 17.64  ? 327 PHE D O   1 
ATOM   10494 C  CB  . PHE D 1 327 ? 19.645  -15.124 13.511  1.00 14.98  ? 327 PHE D CB  1 
ATOM   10495 C  CG  . PHE D 1 327 ? 18.312  -15.816 13.641  1.00 14.46  ? 327 PHE D CG  1 
ATOM   10496 C  CD1 . PHE D 1 327 ? 18.126  -16.912 14.497  1.00 14.35  ? 327 PHE D CD1 1 
ATOM   10497 C  CD2 . PHE D 1 327 ? 17.204  -15.326 12.966  1.00 14.16  ? 327 PHE D CD2 1 
ATOM   10498 C  CE1 . PHE D 1 327 ? 16.850  -17.509 14.630  1.00 14.03  ? 327 PHE D CE1 1 
ATOM   10499 C  CE2 . PHE D 1 327 ? 15.945  -15.903 13.114  1.00 14.02  ? 327 PHE D CE2 1 
ATOM   10500 C  CZ  . PHE D 1 327 ? 15.764  -16.991 13.952  1.00 13.58  ? 327 PHE D CZ  1 
ATOM   10501 N  N   . LEU D 1 328 ? 20.086  -15.947 10.357  1.00 18.66  ? 328 LEU D N   1 
ATOM   10502 C  CA  . LEU D 1 328 ? 19.520  -16.593 9.171   1.00 20.42  ? 328 LEU D CA  1 
ATOM   10503 C  C   . LEU D 1 328 ? 20.440  -17.617 8.459   1.00 21.12  ? 328 LEU D C   1 
ATOM   10504 O  O   . LEU D 1 328 ? 19.948  -18.448 7.696   1.00 21.21  ? 328 LEU D O   1 
ATOM   10505 C  CB  . LEU D 1 328 ? 18.961  -15.554 8.204   1.00 19.37  ? 328 LEU D CB  1 
ATOM   10506 C  CG  . LEU D 1 328 ? 17.800  -14.840 8.902   1.00 21.06  ? 328 LEU D CG  1 
ATOM   10507 C  CD1 . LEU D 1 328 ? 17.220  -13.767 8.008   1.00 21.77  ? 328 LEU D CD1 1 
ATOM   10508 C  CD2 . LEU D 1 328 ? 16.707  -15.810 9.358   1.00 21.71  ? 328 LEU D CD2 1 
ATOM   10509 N  N   . GLY D 1 329 ? 21.744  -17.567 8.750   1.00 21.78  ? 329 GLY D N   1 
ATOM   10510 C  CA  . GLY D 1 329 ? 22.769  -18.324 8.024   1.00 23.22  ? 329 GLY D CA  1 
ATOM   10511 C  C   . GLY D 1 329 ? 23.081  -17.737 6.642   1.00 25.80  ? 329 GLY D C   1 
ATOM   10512 O  O   . GLY D 1 329 ? 23.486  -18.465 5.744   1.00 26.66  ? 329 GLY D O   1 
ATOM   10513 N  N   . LEU D 1 330 ? 22.903  -16.425 6.459   1.00 26.91  ? 330 LEU D N   1 
ATOM   10514 C  CA  . LEU D 1 330 ? 23.063  -15.808 5.132   1.00 27.50  ? 330 LEU D CA  1 
ATOM   10515 C  C   . LEU D 1 330 ? 24.261  -14.897 5.060   1.00 28.80  ? 330 LEU D C   1 
ATOM   10516 O  O   . LEU D 1 330 ? 24.774  -14.475 6.096   1.00 30.08  ? 330 LEU D O   1 
ATOM   10517 C  CB  . LEU D 1 330 ? 21.827  -15.009 4.767   1.00 26.31  ? 330 LEU D CB  1 
ATOM   10518 C  CG  . LEU D 1 330 ? 20.478  -15.731 4.645   1.00 27.25  ? 330 LEU D CG  1 
ATOM   10519 C  CD1 . LEU D 1 330 ? 19.392  -14.691 4.406   1.00 26.45  ? 330 LEU D CD1 1 
ATOM   10520 C  CD2 . LEU D 1 330 ? 20.424  -16.834 3.586   1.00 25.12  ? 330 LEU D CD2 1 
ATOM   10521 N  N   . GLU D 1 331 ? 24.687  -14.571 3.845   1.00 31.62  ? 331 GLU D N   1 
ATOM   10522 C  CA  . GLU D 1 331 ? 25.877  -13.718 3.627   1.00 36.36  ? 331 GLU D CA  1 
ATOM   10523 C  C   . GLU D 1 331 ? 25.501  -12.366 3.005   1.00 36.12  ? 331 GLU D C   1 
ATOM   10524 O  O   . GLU D 1 331 ? 24.814  -12.324 1.990   1.00 35.33  ? 331 GLU D O   1 
ATOM   10525 C  CB  . GLU D 1 331 ? 26.885  -14.423 2.689   1.00 41.79  ? 331 GLU D CB  1 
ATOM   10526 C  CG  . GLU D 1 331 ? 27.574  -15.682 3.230   1.00 45.93  ? 331 GLU D CG  1 
ATOM   10527 C  CD  . GLU D 1 331 ? 27.955  -16.677 2.120   1.00 55.50  ? 331 GLU D CD  1 
ATOM   10528 O  OE1 . GLU D 1 331 ? 27.320  -16.655 1.029   1.00 56.86  ? 331 GLU D OE1 1 
ATOM   10529 O  OE2 . GLU D 1 331 ? 28.886  -17.502 2.335   1.00 57.01  ? 331 GLU D OE2 1 
ATOM   10530 N  N   . ARG D 1 332 ? 25.969  -11.271 3.606   1.00 36.71  ? 332 ARG D N   1 
ATOM   10531 C  CA  . ARG D 1 332 ? 25.765  -9.929  3.065   1.00 38.51  ? 332 ARG D CA  1 
ATOM   10532 C  C   . ARG D 1 332 ? 26.176  -9.865  1.610   1.00 35.46  ? 332 ARG D C   1 
ATOM   10533 O  O   . ARG D 1 332 ? 25.477  -9.271  0.818   1.00 36.65  ? 332 ARG D O   1 
ATOM   10534 C  CB  . ARG D 1 332 ? 26.534  -8.870  3.872   1.00 42.89  ? 332 ARG D CB  1 
ATOM   10535 C  CG  . ARG D 1 332 ? 27.945  -9.274  4.314   1.00 51.83  ? 332 ARG D CG  1 
ATOM   10536 C  CD  . ARG D 1 332 ? 28.824  -9.970  3.245   1.00 55.18  ? 332 ARG D CD  1 
ATOM   10537 N  NE  . ARG D 1 332 ? 29.701  -10.982 3.853   1.00 57.14  ? 332 ARG D NE  1 
ATOM   10538 C  CZ  . ARG D 1 332 ? 30.821  -10.698 4.525   1.00 61.27  ? 332 ARG D CZ  1 
ATOM   10539 N  NH1 . ARG D 1 332 ? 31.225  -9.440  4.662   1.00 63.48  ? 332 ARG D NH1 1 
ATOM   10540 N  NH2 . ARG D 1 332 ? 31.545  -11.666 5.066   1.00 59.03  ? 332 ARG D NH2 1 
ATOM   10541 N  N   . MET E 1 1   ? 18.623  -5.187  55.029  1.00 63.04  ? 1   MET E N   1 
ATOM   10542 C  CA  . MET E 1 1   ? 19.596  -4.950  56.124  1.00 61.75  ? 1   MET E CA  1 
ATOM   10543 C  C   . MET E 1 1   ? 19.037  -3.912  57.099  1.00 56.50  ? 1   MET E C   1 
ATOM   10544 O  O   . MET E 1 1   ? 19.693  -3.577  58.088  1.00 66.39  ? 1   MET E O   1 
ATOM   10545 C  CB  . MET E 1 1   ? 20.969  -4.516  55.565  1.00 71.42  ? 1   MET E CB  1 
ATOM   10546 C  CG  . MET E 1 1   ? 22.150  -4.638  56.536  1.00 78.63  ? 1   MET E CG  1 
ATOM   10547 S  SD  . MET E 1 1   ? 23.123  -3.116  56.742  1.00 89.99  ? 1   MET E SD  1 
ATOM   10548 C  CE  . MET E 1 1   ? 24.454  -3.650  57.830  1.00 84.54  ? 1   MET E CE  1 
ATOM   10549 N  N   . LYS E 1 2   ? 17.843  -3.385  56.832  1.00 45.79  ? 2   LYS E N   1 
ATOM   10550 C  CA  . LYS E 1 2   ? 17.152  -2.592  57.853  1.00 37.71  ? 2   LYS E CA  1 
ATOM   10551 C  C   . LYS E 1 2   ? 15.694  -2.986  57.870  1.00 33.32  ? 2   LYS E C   1 
ATOM   10552 O  O   . LYS E 1 2   ? 15.269  -3.663  58.793  1.00 36.36  ? 2   LYS E O   1 
ATOM   10553 C  CB  . LYS E 1 2   ? 17.338  -1.067  57.691  1.00 38.18  ? 2   LYS E CB  1 
ATOM   10554 C  CG  . LYS E 1 2   ? 18.670  -0.469  58.137  1.00 36.35  ? 2   LYS E CG  1 
ATOM   10555 C  CD  . LYS E 1 2   ? 18.601  0.186   59.528  1.00 38.78  ? 2   LYS E CD  1 
ATOM   10556 C  CE  . LYS E 1 2   ? 19.926  -0.001  60.278  1.00 34.84  ? 2   LYS E CE  1 
ATOM   10557 N  NZ  . LYS E 1 2   ? 21.068  0.617   59.560  1.00 33.37  ? 2   LYS E NZ  1 
ATOM   10558 N  N   . ILE E 1 3   ? 14.919  -2.600  56.861  1.00 30.27  ? 3   ILE E N   1 
ATOM   10559 C  CA  . ILE E 1 3   ? 13.509  -2.948  56.845  1.00 27.62  ? 3   ILE E CA  1 
ATOM   10560 C  C   . ILE E 1 3   ? 13.166  -3.924  55.713  1.00 30.06  ? 3   ILE E C   1 
ATOM   10561 O  O   . ILE E 1 3   ? 13.560  -3.728  54.554  1.00 30.44  ? 3   ILE E O   1 
ATOM   10562 C  CB  . ILE E 1 3   ? 12.624  -1.692  56.813  1.00 27.99  ? 3   ILE E CB  1 
ATOM   10563 C  CG1 . ILE E 1 3   ? 12.633  -1.018  58.189  1.00 28.99  ? 3   ILE E CG1 1 
ATOM   10564 C  CG2 . ILE E 1 3   ? 11.183  -1.999  56.393  1.00 27.95  ? 3   ILE E CG2 1 
ATOM   10565 C  CD1 . ILE E 1 3   ? 12.165  0.414   58.138  1.00 27.76  ? 3   ILE E CD1 1 
ATOM   10566 N  N   . ASP E 1 4   ? 12.451  -4.982  56.086  1.00 28.68  ? 4   ASP E N   1 
ATOM   10567 C  CA  . ASP E 1 4   ? 11.834  -5.924  55.166  1.00 29.15  ? 4   ASP E CA  1 
ATOM   10568 C  C   . ASP E 1 4   ? 10.318  -5.723  55.123  1.00 27.88  ? 4   ASP E C   1 
ATOM   10569 O  O   . ASP E 1 4   ? 9.599   -6.068  56.094  1.00 25.72  ? 4   ASP E O   1 
ATOM   10570 C  CB  . ASP E 1 4   ? 12.114  -7.347  55.633  1.00 33.49  ? 4   ASP E CB  1 
ATOM   10571 C  CG  . ASP E 1 4   ? 11.806  -8.390  54.569  1.00 39.53  ? 4   ASP E CG  1 
ATOM   10572 O  OD1 . ASP E 1 4   ? 11.345  -8.054  53.442  1.00 41.93  ? 4   ASP E OD1 1 
ATOM   10573 O  OD2 . ASP E 1 4   ? 12.039  -9.579  54.873  1.00 46.18  ? 4   ASP E OD2 1 
ATOM   10574 N  N   . ILE E 1 5   ? 9.843   -5.191  53.994  1.00 24.27  ? 5   ILE E N   1 
ATOM   10575 C  CA  . ILE E 1 5   ? 8.423   -4.912  53.758  1.00 23.28  ? 5   ILE E CA  1 
ATOM   10576 C  C   . ILE E 1 5   ? 7.621   -6.162  53.359  1.00 23.08  ? 5   ILE E C   1 
ATOM   10577 O  O   . ILE E 1 5   ? 6.384   -6.157  53.354  1.00 23.97  ? 5   ILE E O   1 
ATOM   10578 C  CB  . ILE E 1 5   ? 8.288   -3.822  52.658  1.00 24.51  ? 5   ILE E CB  1 
ATOM   10579 C  CG1 . ILE E 1 5   ? 6.998   -3.032  52.832  1.00 25.53  ? 5   ILE E CG1 1 
ATOM   10580 C  CG2 . ILE E 1 5   ? 8.406   -4.399  51.239  1.00 22.07  ? 5   ILE E CG2 1 
ATOM   10581 C  CD1 . ILE E 1 5   ? 6.915   -2.246  54.134  1.00 25.04  ? 5   ILE E CD1 1 
ATOM   10582 N  N   . HIS E 1 6   ? 8.328   -7.242  53.036  1.00 21.26  ? 6   HIS E N   1 
ATOM   10583 C  CA  . HIS E 1 6   ? 7.720   -8.375  52.397  1.00 20.16  ? 6   HIS E CA  1 
ATOM   10584 C  C   . HIS E 1 6   ? 8.130   -9.632  53.107  1.00 19.54  ? 6   HIS E C   1 
ATOM   10585 O  O   . HIS E 1 6   ? 9.193   -10.198 52.877  1.00 19.30  ? 6   HIS E O   1 
ATOM   10586 C  CB  . HIS E 1 6   ? 8.091   -8.347  50.906  1.00 19.38  ? 6   HIS E CB  1 
ATOM   10587 C  CG  . HIS E 1 6   ? 7.495   -9.461  50.081  1.00 19.28  ? 6   HIS E CG  1 
ATOM   10588 N  ND1 . HIS E 1 6   ? 7.589   -9.482  48.738  1.00 18.94  ? 6   HIS E ND1 1 
ATOM   10589 C  CD2 . HIS E 1 6   ? 6.821   -10.635 50.452  1.00 19.77  ? 6   HIS E CD2 1 
ATOM   10590 C  CE1 . HIS E 1 6   ? 7.006   -10.614 48.262  1.00 21.12  ? 6   HIS E CE1 1 
ATOM   10591 N  NE2 . HIS E 1 6   ? 6.529   -11.318 49.315  1.00 19.82  ? 6   HIS E NE2 1 
ATOM   10592 N  N   . SER E 1 7   ? 7.271   -10.074 54.003  1.00 19.07  ? 7   SER E N   1 
ATOM   10593 C  CA  . SER E 1 7   ? 7.523   -11.280 54.788  1.00 20.13  ? 7   SER E CA  1 
ATOM   10594 C  C   . SER E 1 7   ? 6.200   -11.756 55.318  1.00 18.88  ? 7   SER E C   1 
ATOM   10595 O  O   . SER E 1 7   ? 5.296   -10.968 55.513  1.00 18.55  ? 7   SER E O   1 
ATOM   10596 C  CB  . SER E 1 7   ? 8.496   -11.046 55.957  1.00 21.53  ? 7   SER E CB  1 
ATOM   10597 O  OG  . SER E 1 7   ? 8.203   -9.841  56.624  1.00 24.08  ? 7   SER E OG  1 
ATOM   10598 N  N   . HIS E 1 8   ? 6.101   -13.055 55.532  1.00 18.00  ? 8   HIS E N   1 
ATOM   10599 C  CA  . HIS E 1 8   ? 4.836   -13.675 55.808  1.00 18.63  ? 8   HIS E CA  1 
ATOM   10600 C  C   . HIS E 1 8   ? 4.933   -14.430 57.082  1.00 18.12  ? 8   HIS E C   1 
ATOM   10601 O  O   . HIS E 1 8   ? 5.974   -15.030 57.405  1.00 17.22  ? 8   HIS E O   1 
ATOM   10602 C  CB  . HIS E 1 8   ? 4.468   -14.626 54.668  1.00 18.19  ? 8   HIS E CB  1 
ATOM   10603 C  CG  . HIS E 1 8   ? 4.293   -13.939 53.354  1.00 18.69  ? 8   HIS E CG  1 
ATOM   10604 N  ND1 . HIS E 1 8   ? 3.302   -13.068 53.132  1.00 20.75  ? 8   HIS E ND1 1 
ATOM   10605 C  CD2 . HIS E 1 8   ? 5.018   -13.998 52.192  1.00 18.63  ? 8   HIS E CD2 1 
ATOM   10606 C  CE1 . HIS E 1 8   ? 3.397   -12.580 51.889  1.00 19.19  ? 8   HIS E CE1 1 
ATOM   10607 N  NE2 . HIS E 1 8   ? 4.419   -13.166 51.303  1.00 18.46  ? 8   HIS E NE2 1 
ATOM   10608 N  N   . ILE E 1 9   ? 3.819   -14.459 57.792  1.00 17.51  ? 9   ILE E N   1 
ATOM   10609 C  CA  . ILE E 1 9   ? 3.729   -15.191 59.053  1.00 17.19  ? 9   ILE E CA  1 
ATOM   10610 C  C   . ILE E 1 9   ? 2.341   -15.825 59.108  1.00 17.96  ? 9   ILE E C   1 
ATOM   10611 O  O   . ILE E 1 9   ? 1.372   -15.240 58.619  1.00 17.79  ? 9   ILE E O   1 
ATOM   10612 C  CB  . ILE E 1 9   ? 3.937   -14.214 60.216  1.00 17.18  ? 9   ILE E CB  1 
ATOM   10613 C  CG1 . ILE E 1 9   ? 4.101   -14.917 61.578  1.00 17.98  ? 9   ILE E CG1 1 
ATOM   10614 C  CG2 . ILE E 1 9   ? 2.829   -13.183 60.264  1.00 16.80  ? 9   ILE E CG2 1 
ATOM   10615 C  CD1 . ILE E 1 9   ? 4.781   -13.973 62.573  1.00 17.03  ? 9   ILE E CD1 1 
ATOM   10616 N  N   . LEU E 1 10  ? 2.265   -17.026 59.659  1.00 18.20  ? 10  LEU E N   1 
ATOM   10617 C  CA  . LEU E 1 10  ? 1.022   -17.675 59.996  1.00 19.09  ? 10  LEU E CA  1 
ATOM   10618 C  C   . LEU E 1 10  ? 0.832   -17.752 61.512  1.00 22.14  ? 10  LEU E C   1 
ATOM   10619 O  O   . LEU E 1 10  ? 1.821   -17.746 62.289  1.00 23.20  ? 10  LEU E O   1 
ATOM   10620 C  CB  . LEU E 1 10  ? 1.052   -19.111 59.493  1.00 17.72  ? 10  LEU E CB  1 
ATOM   10621 C  CG  . LEU E 1 10  ? 0.942   -19.303 58.000  1.00 17.32  ? 10  LEU E CG  1 
ATOM   10622 C  CD1 . LEU E 1 10  ? 1.344   -20.732 57.688  1.00 17.87  ? 10  LEU E CD1 1 
ATOM   10623 C  CD2 . LEU E 1 10  ? -0.479  -19.034 57.525  1.00 16.53  ? 10  LEU E CD2 1 
ATOM   10624 N  N   . PRO E 1 11  ? -0.435  -17.891 61.954  1.00 23.02  ? 11  PRO E N   1 
ATOM   10625 C  CA  . PRO E 1 11  ? -0.643  -18.316 63.363  1.00 22.52  ? 11  PRO E CA  1 
ATOM   10626 C  C   . PRO E 1 11  ? -0.222  -19.762 63.510  1.00 23.35  ? 11  PRO E C   1 
ATOM   10627 O  O   . PRO E 1 11  ? -0.456  -20.529 62.602  1.00 21.17  ? 11  PRO E O   1 
ATOM   10628 C  CB  . PRO E 1 11  ? -2.166  -18.238 63.552  1.00 22.29  ? 11  PRO E CB  1 
ATOM   10629 C  CG  . PRO E 1 11  ? -2.712  -17.655 62.271  1.00 22.32  ? 11  PRO E CG  1 
ATOM   10630 C  CD  . PRO E 1 11  ? -1.691  -17.822 61.187  1.00 20.73  ? 11  PRO E CD  1 
ATOM   10631 N  N   . LYS E 1 12  ? 0.379   -20.143 64.643  1.00 27.95  ? 12  LYS E N   1 
ATOM   10632 C  CA  . LYS E 1 12  ? 0.758   -21.550 64.875  1.00 30.88  ? 12  LYS E CA  1 
ATOM   10633 C  C   . LYS E 1 12  ? -0.418  -22.529 64.889  1.00 29.54  ? 12  LYS E C   1 
ATOM   10634 O  O   . LYS E 1 12  ? -0.254  -23.706 64.593  1.00 29.88  ? 12  LYS E O   1 
ATOM   10635 C  CB  . LYS E 1 12  ? 1.626   -21.727 66.144  1.00 36.50  ? 12  LYS E CB  1 
ATOM   10636 C  CG  . LYS E 1 12  ? 0.945   -21.486 67.490  1.00 44.36  ? 12  LYS E CG  1 
ATOM   10637 C  CD  . LYS E 1 12  ? 0.619   -20.005 67.738  1.00 52.20  ? 12  LYS E CD  1 
ATOM   10638 C  CE  . LYS E 1 12  ? -0.851  -19.661 67.452  1.00 54.13  ? 12  LYS E CE  1 
ATOM   10639 N  NZ  . LYS E 1 12  ? -1.072  -18.193 67.274  1.00 54.08  ? 12  LYS E NZ  1 
ATOM   10640 N  N   . GLU E 1 13  ? -1.601  -22.062 65.243  1.00 29.04  ? 13  GLU E N   1 
ATOM   10641 C  CA  . GLU E 1 13  ? -2.744  -22.953 65.267  1.00 31.04  ? 13  GLU E CA  1 
ATOM   10642 C  C   . GLU E 1 13  ? -3.976  -22.159 64.921  1.00 29.04  ? 13  GLU E C   1 
ATOM   10643 O  O   . GLU E 1 13  ? -4.062  -20.974 65.262  1.00 26.46  ? 13  GLU E O   1 
ATOM   10644 C  CB  . GLU E 1 13  ? -2.884  -23.609 66.646  1.00 33.87  ? 13  GLU E CB  1 
ATOM   10645 C  CG  . GLU E 1 13  ? -3.366  -25.048 66.541  1.00 43.86  ? 13  GLU E CG  1 
ATOM   10646 C  CD  . GLU E 1 13  ? -2.460  -26.072 67.246  1.00 51.69  ? 13  GLU E CD  1 
ATOM   10647 O  OE1 . GLU E 1 13  ? -2.993  -27.115 67.722  1.00 52.97  ? 13  GLU E OE1 1 
ATOM   10648 O  OE2 . GLU E 1 13  ? -1.217  -25.853 67.315  1.00 55.24  ? 13  GLU E OE2 1 
ATOM   10649 N  N   . TRP E 1 14  ? -4.909  -22.777 64.206  1.00 26.42  ? 14  TRP E N   1 
ATOM   10650 C  CA  . TRP E 1 14  ? -6.198  -22.125 64.035  1.00 27.78  ? 14  TRP E CA  1 
ATOM   10651 C  C   . TRP E 1 14  ? -7.266  -23.149 63.956  1.00 27.28  ? 14  TRP E C   1 
ATOM   10652 O  O   . TRP E 1 14  ? -6.982  -24.312 63.764  1.00 28.97  ? 14  TRP E O   1 
ATOM   10653 C  CB  . TRP E 1 14  ? -6.211  -21.069 62.916  1.00 28.11  ? 14  TRP E CB  1 
ATOM   10654 C  CG  . TRP E 1 14  ? -5.968  -21.576 61.501  1.00 31.64  ? 14  TRP E CG  1 
ATOM   10655 C  CD1 . TRP E 1 14  ? -6.917  -22.032 60.580  1.00 29.78  ? 14  TRP E CD1 1 
ATOM   10656 C  CD2 . TRP E 1 14  ? -4.673  -21.656 60.772  1.00 29.79  ? 14  TRP E CD2 1 
ATOM   10657 N  NE1 . TRP E 1 14  ? -6.309  -22.386 59.385  1.00 29.19  ? 14  TRP E NE1 1 
ATOM   10658 C  CE2 . TRP E 1 14  ? -4.985  -22.180 59.429  1.00 27.57  ? 14  TRP E CE2 1 
ATOM   10659 C  CE3 . TRP E 1 14  ? -3.359  -21.338 61.080  1.00 28.11  ? 14  TRP E CE3 1 
ATOM   10660 C  CZ2 . TRP E 1 14  ? -4.008  -22.385 58.476  1.00 27.13  ? 14  TRP E CZ2 1 
ATOM   10661 C  CZ3 . TRP E 1 14  ? -2.379  -21.537 60.087  1.00 27.83  ? 14  TRP E CZ3 1 
ATOM   10662 C  CH2 . TRP E 1 14  ? -2.699  -22.052 58.829  1.00 28.09  ? 14  TRP E CH2 1 
ATOM   10663 N  N   . PRO E 1 15  ? -8.516  -22.760 64.191  1.00 27.97  ? 15  PRO E N   1 
ATOM   10664 C  CA  . PRO E 1 15  ? -9.514  -23.839 64.324  1.00 31.07  ? 15  PRO E CA  1 
ATOM   10665 C  C   . PRO E 1 15  ? -9.858  -24.496 62.968  1.00 32.03  ? 15  PRO E C   1 
ATOM   10666 O  O   . PRO E 1 15  ? -9.553  -23.919 61.919  1.00 35.58  ? 15  PRO E O   1 
ATOM   10667 C  CB  . PRO E 1 15  ? -10.744 -23.113 64.896  1.00 29.52  ? 15  PRO E CB  1 
ATOM   10668 C  CG  . PRO E 1 15  ? -10.288 -21.711 65.203  1.00 28.32  ? 15  PRO E CG  1 
ATOM   10669 C  CD  . PRO E 1 15  ? -9.137  -21.436 64.278  1.00 27.24  ? 15  PRO E CD  1 
ATOM   10670 N  N   . ASP E 1 16  ? -10.434 -25.699 62.985  1.00 31.10  ? 16  ASP E N   1 
ATOM   10671 C  CA  . ASP E 1 16  ? -10.906 -26.345 61.744  1.00 30.11  ? 16  ASP E CA  1 
ATOM   10672 C  C   . ASP E 1 16  ? -11.892 -25.427 60.980  1.00 25.63  ? 16  ASP E C   1 
ATOM   10673 O  O   . ASP E 1 16  ? -12.938 -25.033 61.497  1.00 26.08  ? 16  ASP E O   1 
ATOM   10674 C  CB  . ASP E 1 16  ? -11.535 -27.724 62.013  1.00 31.32  ? 16  ASP E CB  1 
ATOM   10675 C  CG  . ASP E 1 16  ? -11.990 -28.438 60.702  1.00 37.07  ? 16  ASP E CG  1 
ATOM   10676 O  OD1 . ASP E 1 16  ? -11.999 -27.791 59.621  1.00 42.57  ? 16  ASP E OD1 1 
ATOM   10677 O  OD2 . ASP E 1 16  ? -12.333 -29.645 60.738  1.00 35.06  ? 16  ASP E OD2 1 
ATOM   10678 N  N   . LEU E 1 17  ? -11.531 -25.083 59.758  1.00 23.15  ? 17  LEU E N   1 
ATOM   10679 C  CA  . LEU E 1 17  ? -12.283 -24.109 58.974  1.00 22.20  ? 17  LEU E CA  1 
ATOM   10680 C  C   . LEU E 1 17  ? -13.404 -24.783 58.214  1.00 21.42  ? 17  LEU E C   1 
ATOM   10681 O  O   . LEU E 1 17  ? -14.482 -24.215 58.095  1.00 21.60  ? 17  LEU E O   1 
ATOM   10682 C  CB  . LEU E 1 17  ? -11.368 -23.277 58.053  1.00 21.99  ? 17  LEU E CB  1 
ATOM   10683 C  CG  . LEU E 1 17  ? -10.315 -22.431 58.807  1.00 21.09  ? 17  LEU E CG  1 
ATOM   10684 C  CD1 . LEU E 1 17  ? -9.510  -21.541 57.864  1.00 20.34  ? 17  LEU E CD1 1 
ATOM   10685 C  CD2 . LEU E 1 17  ? -10.982 -21.581 59.879  1.00 20.91  ? 17  LEU E CD2 1 
ATOM   10686 N  N   . LYS E 1 18  ? -13.199 -26.019 57.766  1.00 21.83  ? 18  LYS E N   1 
ATOM   10687 C  CA  . LYS E 1 18  ? -14.341 -26.737 57.208  1.00 24.01  ? 18  LYS E CA  1 
ATOM   10688 C  C   . LYS E 1 18  ? -15.493 -26.895 58.235  1.00 24.17  ? 18  LYS E C   1 
ATOM   10689 O  O   . LYS E 1 18  ? -16.656 -26.811 57.861  1.00 22.88  ? 18  LYS E O   1 
ATOM   10690 C  CB  . LYS E 1 18  ? -13.957 -28.065 56.584  1.00 24.81  ? 18  LYS E CB  1 
ATOM   10691 C  CG  . LYS E 1 18  ? -15.101 -28.737 55.786  1.00 24.60  ? 18  LYS E CG  1 
ATOM   10692 C  CD  . LYS E 1 18  ? -14.534 -29.944 55.027  1.00 25.36  ? 18  LYS E CD  1 
ATOM   10693 C  CE  . LYS E 1 18  ? -15.500 -30.509 53.976  1.00 27.44  ? 18  LYS E CE  1 
ATOM   10694 N  NZ  . LYS E 1 18  ? -16.890 -30.743 54.475  1.00 22.48  ? 18  LYS E NZ  1 
ATOM   10695 N  N   . LYS E 1 19  ? -15.160 -27.080 59.505  1.00 24.83  ? 19  LYS E N   1 
ATOM   10696 C  CA  . LYS E 1 19  ? -16.175 -27.193 60.550  1.00 29.14  ? 19  LYS E CA  1 
ATOM   10697 C  C   . LYS E 1 19  ? -16.739 -25.829 60.915  1.00 26.84  ? 19  LYS E C   1 
ATOM   10698 O  O   . LYS E 1 19  ? -17.947 -25.667 60.937  1.00 26.39  ? 19  LYS E O   1 
ATOM   10699 C  CB  . LYS E 1 19  ? -15.681 -27.957 61.806  1.00 32.39  ? 19  LYS E CB  1 
ATOM   10700 C  CG  . LYS E 1 19  ? -16.825 -28.425 62.728  1.00 41.24  ? 19  LYS E CG  1 
ATOM   10701 C  CD  . LYS E 1 19  ? -16.336 -29.232 63.927  1.00 44.74  ? 19  LYS E CD  1 
ATOM   10702 C  CE  . LYS E 1 19  ? -17.336 -30.312 64.319  1.00 49.89  ? 19  LYS E CE  1 
ATOM   10703 N  NZ  . LYS E 1 19  ? -16.695 -31.440 65.082  1.00 55.80  ? 19  LYS E NZ  1 
ATOM   10704 N  N   . ARG E 1 20  ? -15.872 -24.849 61.149  1.00 26.05  ? 20  ARG E N   1 
ATOM   10705 C  CA  . ARG E 1 20  ? -16.318 -23.486 61.432  1.00 25.72  ? 20  ARG E CA  1 
ATOM   10706 C  C   . ARG E 1 20  ? -17.251 -22.862 60.358  1.00 24.93  ? 20  ARG E C   1 
ATOM   10707 O  O   . ARG E 1 20  ? -18.182 -22.124 60.686  1.00 25.13  ? 20  ARG E O   1 
ATOM   10708 C  CB  . ARG E 1 20  ? -15.127 -22.568 61.666  1.00 25.76  ? 20  ARG E CB  1 
ATOM   10709 C  CG  . ARG E 1 20  ? -15.532 -21.168 62.107  1.00 27.31  ? 20  ARG E CG  1 
ATOM   10710 C  CD  . ARG E 1 20  ? -14.334 -20.263 62.330  1.00 29.43  ? 20  ARG E CD  1 
ATOM   10711 N  NE  . ARG E 1 20  ? -13.843 -20.395 63.694  1.00 37.21  ? 20  ARG E NE  1 
ATOM   10712 C  CZ  . ARG E 1 20  ? -13.652 -19.396 64.552  1.00 30.80  ? 20  ARG E CZ  1 
ATOM   10713 N  NH1 . ARG E 1 20  ? -13.845 -18.141 64.204  1.00 27.12  ? 20  ARG E NH1 1 
ATOM   10714 N  NH2 . ARG E 1 20  ? -13.217 -19.685 65.758  1.00 32.71  ? 20  ARG E NH2 1 
ATOM   10715 N  N   . PHE E 1 21  ? -17.021 -23.132 59.078  1.00 23.91  ? 21  PHE E N   1 
ATOM   10716 C  CA  . PHE E 1 21  ? -17.824 -22.402 58.097  1.00 21.90  ? 21  PHE E CA  1 
ATOM   10717 C  C   . PHE E 1 21  ? -18.829 -23.277 57.372  1.00 20.76  ? 21  PHE E C   1 
ATOM   10718 O  O   . PHE E 1 21  ? -19.773 -22.761 56.755  1.00 19.62  ? 21  PHE E O   1 
ATOM   10719 C  CB  . PHE E 1 21  ? -16.961 -21.650 57.092  1.00 20.69  ? 21  PHE E CB  1 
ATOM   10720 C  CG  . PHE E 1 21  ? -16.036 -20.655 57.704  1.00 20.16  ? 21  PHE E CG  1 
ATOM   10721 C  CD1 . PHE E 1 21  ? -14.674 -20.707 57.420  1.00 19.25  ? 21  PHE E CD1 1 
ATOM   10722 C  CD2 . PHE E 1 21  ? -16.513 -19.672 58.568  1.00 19.99  ? 21  PHE E CD2 1 
ATOM   10723 C  CE1 . PHE E 1 21  ? -13.803 -19.771 57.963  1.00 21.44  ? 21  PHE E CE1 1 
ATOM   10724 C  CE2 . PHE E 1 21  ? -15.647 -18.750 59.138  1.00 20.53  ? 21  PHE E CE2 1 
ATOM   10725 C  CZ  . PHE E 1 21  ? -14.280 -18.793 58.830  1.00 21.02  ? 21  PHE E CZ  1 
ATOM   10726 N  N   . GLY E 1 22  ? -18.638 -24.587 57.427  1.00 19.90  ? 22  GLY E N   1 
ATOM   10727 C  CA  . GLY E 1 22  ? -19.543 -25.466 56.673  1.00 20.92  ? 22  GLY E CA  1 
ATOM   10728 C  C   . GLY E 1 22  ? -19.075 -25.988 55.339  1.00 20.54  ? 22  GLY E C   1 
ATOM   10729 O  O   . GLY E 1 22  ? -19.369 -27.106 54.984  1.00 24.21  ? 22  GLY E O   1 
ATOM   10730 N  N   . TYR E 1 23  ? -18.301 -25.228 54.591  1.00 21.64  ? 23  TYR E N   1 
ATOM   10731 C  CA  . TYR E 1 23  ? -17.773 -25.760 53.331  1.00 20.52  ? 23  TYR E CA  1 
ATOM   10732 C  C   . TYR E 1 23  ? -16.247 -25.775 53.331  1.00 21.17  ? 23  TYR E C   1 
ATOM   10733 O  O   . TYR E 1 23  ? -15.636 -25.156 54.207  1.00 21.52  ? 23  TYR E O   1 
ATOM   10734 C  CB  . TYR E 1 23  ? -18.299 -24.907 52.197  1.00 19.39  ? 23  TYR E CB  1 
ATOM   10735 C  CG  . TYR E 1 23  ? -18.074 -23.431 52.451  1.00 19.13  ? 23  TYR E CG  1 
ATOM   10736 C  CD1 . TYR E 1 23  ? -16.975 -22.756 51.898  1.00 18.41  ? 23  TYR E CD1 1 
ATOM   10737 C  CD2 . TYR E 1 23  ? -18.935 -22.713 53.281  1.00 18.54  ? 23  TYR E CD2 1 
ATOM   10738 C  CE1 . TYR E 1 23  ? -16.759 -21.414 52.151  1.00 17.28  ? 23  TYR E CE1 1 
ATOM   10739 C  CE2 . TYR E 1 23  ? -18.723 -21.377 53.528  1.00 18.41  ? 23  TYR E CE2 1 
ATOM   10740 C  CZ  . TYR E 1 23  ? -17.637 -20.732 52.955  1.00 18.24  ? 23  TYR E CZ  1 
ATOM   10741 O  OH  . TYR E 1 23  ? -17.468 -19.369 53.191  1.00 19.47  ? 23  TYR E OH  1 
ATOM   10742 N  N   . GLY E 1 24  ? -15.657 -26.476 52.343  1.00 20.66  ? 24  GLY E N   1 
ATOM   10743 C  CA  . GLY E 1 24  ? -14.234 -26.736 52.238  1.00 19.49  ? 24  GLY E CA  1 
ATOM   10744 C  C   . GLY E 1 24  ? -13.449 -25.743 51.380  1.00 22.24  ? 24  GLY E C   1 
ATOM   10745 O  O   . GLY E 1 24  ? -13.941 -24.661 51.012  1.00 20.83  ? 24  GLY E O   1 
ATOM   10746 N  N   . GLY E 1 25  ? -12.208 -26.113 51.049  1.00 23.37  ? 25  GLY E N   1 
ATOM   10747 C  CA  . GLY E 1 25  ? -11.358 -25.284 50.193  1.00 21.66  ? 25  GLY E CA  1 
ATOM   10748 C  C   . GLY E 1 25  ? -10.387 -24.441 51.013  1.00 22.35  ? 25  GLY E C   1 
ATOM   10749 O  O   . GLY E 1 25  ? -9.562  -23.753 50.449  1.00 22.38  ? 25  GLY E O   1 
ATOM   10750 N  N   . TRP E 1 26  ? -10.499 -24.472 52.338  1.00 21.01  ? 26  TRP E N   1 
ATOM   10751 C  CA  . TRP E 1 26  ? -9.643  -23.650 53.223  1.00 20.64  ? 26  TRP E CA  1 
ATOM   10752 C  C   . TRP E 1 26  ? -8.299  -24.279 53.512  1.00 21.76  ? 26  TRP E C   1 
ATOM   10753 O  O   . TRP E 1 26  ? -8.115  -25.478 53.311  1.00 25.30  ? 26  TRP E O   1 
ATOM   10754 C  CB  . TRP E 1 26  ? -10.348 -23.457 54.558  1.00 20.17  ? 26  TRP E CB  1 
ATOM   10755 C  CG  . TRP E 1 26  ? -11.712 -22.781 54.485  1.00 17.56  ? 26  TRP E CG  1 
ATOM   10756 C  CD1 . TRP E 1 26  ? -12.942 -23.382 54.465  1.00 16.47  ? 26  TRP E CD1 1 
ATOM   10757 C  CD2 . TRP E 1 26  ? -11.994 -21.342 54.395  1.00 16.12  ? 26  TRP E CD2 1 
ATOM   10758 N  NE1 . TRP E 1 26  ? -13.918 -22.439 54.399  1.00 16.39  ? 26  TRP E NE1 1 
ATOM   10759 C  CE2 . TRP E 1 26  ? -13.424 -21.216 54.334  1.00 15.06  ? 26  TRP E CE2 1 
ATOM   10760 C  CE3 . TRP E 1 26  ? -11.214 -20.197 54.356  1.00 16.30  ? 26  TRP E CE3 1 
ATOM   10761 C  CZ2 . TRP E 1 26  ? -14.059 -19.997 54.268  1.00 15.71  ? 26  TRP E CZ2 1 
ATOM   10762 C  CZ3 . TRP E 1 26  ? -11.859 -18.961 54.285  1.00 15.93  ? 26  TRP E CZ3 1 
ATOM   10763 C  CH2 . TRP E 1 26  ? -13.256 -18.867 54.261  1.00 15.91  ? 26  TRP E CH2 1 
ATOM   10764 N  N   . VAL E 1 27  ? -7.340  -23.517 54.017  1.00 22.18  ? 27  VAL E N   1 
ATOM   10765 C  CA  . VAL E 1 27  ? -6.067  -24.147 54.455  1.00 22.56  ? 27  VAL E CA  1 
ATOM   10766 C  C   . VAL E 1 27  ? -5.914  -24.300 55.982  1.00 23.05  ? 27  VAL E C   1 
ATOM   10767 O  O   . VAL E 1 27  ? -6.377  -23.458 56.770  1.00 21.62  ? 27  VAL E O   1 
ATOM   10768 C  CB  . VAL E 1 27  ? -4.815  -23.612 53.690  1.00 22.51  ? 27  VAL E CB  1 
ATOM   10769 C  CG1 . VAL E 1 27  ? -5.153  -22.381 52.854  1.00 21.58  ? 27  VAL E CG1 1 
ATOM   10770 C  CG2 . VAL E 1 27  ? -3.596  -23.405 54.578  1.00 21.56  ? 27  VAL E CG2 1 
ATOM   10771 N  N   . GLN E 1 28  ? -5.336  -25.441 56.356  1.00 24.04  ? 28  GLN E N   1 
ATOM   10772 C  CA  . GLN E 1 28  ? -5.012  -25.812 57.729  1.00 25.42  ? 28  GLN E CA  1 
ATOM   10773 C  C   . GLN E 1 28  ? -3.501  -26.025 57.877  1.00 25.75  ? 28  GLN E C   1 
ATOM   10774 O  O   . GLN E 1 28  ? -2.836  -26.465 56.938  1.00 25.59  ? 28  GLN E O   1 
ATOM   10775 C  CB  . GLN E 1 28  ? -5.725  -27.122 58.106  1.00 26.41  ? 28  GLN E CB  1 
ATOM   10776 C  CG  . GLN E 1 28  ? -7.246  -27.126 58.002  1.00 26.80  ? 28  GLN E CG  1 
ATOM   10777 C  CD  . GLN E 1 28  ? -7.918  -25.984 58.761  1.00 28.53  ? 28  GLN E CD  1 
ATOM   10778 O  OE1 . GLN E 1 28  ? -8.955  -25.475 58.330  1.00 30.37  ? 28  GLN E OE1 1 
ATOM   10779 N  NE2 . GLN E 1 28  ? -7.325  -25.563 59.870  1.00 26.87  ? 28  GLN E NE2 1 
ATOM   10780 N  N   . LEU E 1 29  ? -2.964  -25.754 59.058  1.00 27.10  ? 29  LEU E N   1 
ATOM   10781 C  CA  . LEU E 1 29  ? -1.538  -26.012 59.333  1.00 30.09  ? 29  LEU E CA  1 
ATOM   10782 C  C   . LEU E 1 29  ? -1.418  -27.228 60.214  1.00 31.33  ? 29  LEU E C   1 
ATOM   10783 O  O   . LEU E 1 29  ? -2.000  -27.239 61.276  1.00 32.41  ? 29  LEU E O   1 
ATOM   10784 C  CB  . LEU E 1 29  ? -0.926  -24.816 60.048  1.00 29.45  ? 29  LEU E CB  1 
ATOM   10785 C  CG  . LEU E 1 29  ? 0.567   -24.696 60.353  1.00 31.82  ? 29  LEU E CG  1 
ATOM   10786 C  CD1 . LEU E 1 29  ? 1.426   -24.654 59.107  1.00 32.28  ? 29  LEU E CD1 1 
ATOM   10787 C  CD2 . LEU E 1 29  ? 0.819   -23.430 61.156  1.00 31.71  ? 29  LEU E CD2 1 
ATOM   10788 N  N   . GLN E 1 30  ? -0.668  -28.244 59.788  1.00 32.57  ? 30  GLN E N   1 
ATOM   10789 C  CA  . GLN E 1 30  ? -0.526  -29.460 60.577  1.00 36.76  ? 30  GLN E CA  1 
ATOM   10790 C  C   . GLN E 1 30  ? 0.917   -29.744 60.991  1.00 36.69  ? 30  GLN E C   1 
ATOM   10791 O  O   . GLN E 1 30  ? 1.787   -29.880 60.122  1.00 32.37  ? 30  GLN E O   1 
ATOM   10792 C  CB  . GLN E 1 30  ? -1.094  -30.649 59.816  1.00 42.08  ? 30  GLN E CB  1 
ATOM   10793 C  CG  . GLN E 1 30  ? -2.558  -30.482 59.422  1.00 50.49  ? 30  GLN E CG  1 
ATOM   10794 C  CD  . GLN E 1 30  ? -3.558  -30.907 60.488  1.00 60.50  ? 30  GLN E CD  1 
ATOM   10795 O  OE1 . GLN E 1 30  ? -3.193  -31.536 61.498  1.00 68.99  ? 30  GLN E OE1 1 
ATOM   10796 N  NE2 . GLN E 1 30  ? -4.841  -30.576 60.259  1.00 55.14  ? 30  GLN E NE2 1 
ATOM   10797 N  N   . HIS E 1 31  ? 1.163   -29.833 62.304  1.00 34.66  ? 31  HIS E N   1 
ATOM   10798 C  CA  . HIS E 1 31  ? 2.519   -30.107 62.839  1.00 40.65  ? 31  HIS E CA  1 
ATOM   10799 C  C   . HIS E 1 31  ? 2.811   -31.585 62.836  1.00 43.84  ? 31  HIS E C   1 
ATOM   10800 O  O   . HIS E 1 31  ? 1.948   -32.395 63.146  1.00 45.87  ? 31  HIS E O   1 
ATOM   10801 C  CB  . HIS E 1 31  ? 2.699   -29.524 64.254  1.00 40.41  ? 31  HIS E CB  1 
ATOM   10802 C  CG  . HIS E 1 31  ? 2.337   -28.054 64.363  1.00 41.06  ? 31  HIS E CG  1 
ATOM   10803 N  ND1 . HIS E 1 31  ? 3.237   -27.067 64.180  1.00 41.73  ? 31  HIS E ND1 1 
ATOM   10804 C  CD2 . HIS E 1 31  ? 1.121   -27.426 64.633  1.00 44.08  ? 31  HIS E CD2 1 
ATOM   10805 C  CE1 . HIS E 1 31  ? 2.638   -25.869 64.329  1.00 42.21  ? 31  HIS E CE1 1 
ATOM   10806 N  NE2 . HIS E 1 31  ? 1.341   -26.088 64.609  1.00 45.01  ? 31  HIS E NE2 1 
ATOM   10807 N  N   . HIS E 1 32  ? 4.016   -31.979 62.463  1.00 51.85  ? 32  HIS E N   1 
ATOM   10808 C  CA  . HIS E 1 32  ? 4.311   -33.408 62.469  1.00 61.76  ? 32  HIS E CA  1 
ATOM   10809 C  C   . HIS E 1 32  ? 5.664   -33.767 63.015  1.00 65.54  ? 32  HIS E C   1 
ATOM   10810 O  O   . HIS E 1 32  ? 5.839   -34.845 63.599  1.00 68.01  ? 32  HIS E O   1 
ATOM   10811 C  CB  . HIS E 1 32  ? 3.993   -34.076 61.114  1.00 71.15  ? 32  HIS E CB  1 
ATOM   10812 C  CG  . HIS E 1 32  ? 4.817   -33.572 59.942  1.00 79.51  ? 32  HIS E CG  1 
ATOM   10813 N  ND1 . HIS E 1 32  ? 4.751   -32.303 59.493  1.00 85.96  ? 32  HIS E ND1 1 
ATOM   10814 C  CD2 . HIS E 1 32  ? 5.705   -34.244 59.087  1.00 88.69  ? 32  HIS E CD2 1 
ATOM   10815 C  CE1 . HIS E 1 32  ? 5.578   -32.156 58.427  1.00 88.25  ? 32  HIS E CE1 1 
ATOM   10816 N  NE2 . HIS E 1 32  ? 6.156   -33.346 58.179  1.00 86.70  ? 32  HIS E NE2 1 
ATOM   10817 N  N   . SER E 1 33  ? 6.622   -32.859 62.852  1.00 66.20  ? 33  SER E N   1 
ATOM   10818 C  CA  . SER E 1 33  ? 7.984   -33.085 63.308  1.00 62.88  ? 33  SER E CA  1 
ATOM   10819 C  C   . SER E 1 33  ? 8.354   -31.974 64.248  1.00 62.65  ? 33  SER E C   1 
ATOM   10820 O  O   . SER E 1 33  ? 7.472   -31.275 64.761  1.00 62.09  ? 33  SER E O   1 
ATOM   10821 C  CB  . SER E 1 33  ? 8.954   -33.119 62.129  1.00 62.85  ? 33  SER E CB  1 
ATOM   10822 O  OG  . SER E 1 33  ? 10.290  -33.012 62.589  1.00 60.93  ? 33  SER E OG  1 
ATOM   10823 N  N   . LYS E 1 34  ? 9.654   -31.824 64.494  1.00 62.77  ? 34  LYS E N   1 
ATOM   10824 C  CA  . LYS E 1 34  ? 10.149  -30.682 65.254  1.00 65.22  ? 34  LYS E CA  1 
ATOM   10825 C  C   . LYS E 1 34  ? 10.477  -29.546 64.286  1.00 59.21  ? 34  LYS E C   1 
ATOM   10826 O  O   . LYS E 1 34  ? 11.233  -29.732 63.315  1.00 53.57  ? 34  LYS E O   1 
ATOM   10827 C  CB  . LYS E 1 34  ? 11.347  -31.058 66.140  1.00 70.05  ? 34  LYS E CB  1 
ATOM   10828 C  CG  . LYS E 1 34  ? 11.001  -31.995 67.298  1.00 79.85  ? 34  LYS E CG  1 
ATOM   10829 C  CD  . LYS E 1 34  ? 10.173  -31.323 68.397  1.00 80.07  ? 34  LYS E CD  1 
ATOM   10830 C  CE  . LYS E 1 34  ? 9.880   -32.293 69.533  1.00 77.96  ? 34  LYS E CE  1 
ATOM   10831 N  NZ  . LYS E 1 34  ? 9.293   -31.619 70.725  1.00 72.86  ? 34  LYS E NZ  1 
ATOM   10832 N  N   . GLY E 1 35  ? 9.865   -28.386 64.547  1.00 53.78  ? 35  GLY E N   1 
ATOM   10833 C  CA  . GLY E 1 35  ? 10.031  -27.188 63.716  1.00 54.35  ? 35  GLY E CA  1 
ATOM   10834 C  C   . GLY E 1 35  ? 9.780   -27.331 62.215  1.00 49.02  ? 35  GLY E C   1 
ATOM   10835 O  O   . GLY E 1 35  ? 10.409  -26.643 61.413  1.00 47.34  ? 35  GLY E O   1 
ATOM   10836 N  N   . GLU E 1 36  ? 8.881   -28.248 61.857  1.00 47.23  ? 36  GLU E N   1 
ATOM   10837 C  CA  . GLU E 1 36  ? 8.426   -28.463 60.496  1.00 48.74  ? 36  GLU E CA  1 
ATOM   10838 C  C   . GLU E 1 36  ? 6.902   -28.703 60.503  1.00 50.72  ? 36  GLU E C   1 
ATOM   10839 O  O   . GLU E 1 36  ? 6.335   -29.370 61.394  1.00 50.20  ? 36  GLU E O   1 
ATOM   10840 C  CB  . GLU E 1 36  ? 9.203   -29.600 59.794  1.00 53.43  ? 36  GLU E CB  1 
ATOM   10841 C  CG  . GLU E 1 36  ? 10.124  -29.151 58.631  1.00 59.83  ? 36  GLU E CG  1 
ATOM   10842 C  CD  . GLU E 1 36  ? 11.610  -28.948 58.994  1.00 61.89  ? 36  GLU E CD  1 
ATOM   10843 O  OE1 . GLU E 1 36  ? 12.062  -27.791 59.232  1.00 59.44  ? 36  GLU E OE1 1 
ATOM   10844 O  OE2 . GLU E 1 36  ? 12.349  -29.954 59.018  1.00 59.13  ? 36  GLU E OE2 1 
ATOM   10845 N  N   . ALA E 1 37  ? 6.241   -28.106 59.524  1.00 44.63  ? 37  ALA E N   1 
ATOM   10846 C  CA  . ALA E 1 37  ? 4.802   -28.156 59.430  1.00 40.24  ? 37  ALA E CA  1 
ATOM   10847 C  C   . ALA E 1 37  ? 4.351   -28.161 57.964  1.00 36.44  ? 37  ALA E C   1 
ATOM   10848 O  O   . ALA E 1 37  ? 5.075   -27.692 57.088  1.00 35.38  ? 37  ALA E O   1 
ATOM   10849 C  CB  . ALA E 1 37  ? 4.202   -26.977 60.173  1.00 40.17  ? 37  ALA E CB  1 
ATOM   10850 N  N   . LYS E 1 38  ? 3.156   -28.698 57.730  1.00 33.44  ? 38  LYS E N   1 
ATOM   10851 C  CA  . LYS E 1 38  ? 2.569   -28.829 56.410  1.00 33.23  ? 38  LYS E CA  1 
ATOM   10852 C  C   . LYS E 1 38  ? 1.282   -28.019 56.290  1.00 32.67  ? 38  LYS E C   1 
ATOM   10853 O  O   . LYS E 1 38  ? 0.404   -28.141 57.119  1.00 35.00  ? 38  LYS E O   1 
ATOM   10854 C  CB  . LYS E 1 38  ? 2.271   -30.293 56.128  1.00 33.54  ? 38  LYS E CB  1 
ATOM   10855 C  CG  . LYS E 1 38  ? 3.504   -31.147 55.876  1.00 34.16  ? 38  LYS E CG  1 
ATOM   10856 C  CD  . LYS E 1 38  ? 3.087   -32.580 55.610  1.00 37.28  ? 38  LYS E CD  1 
ATOM   10857 C  CE  . LYS E 1 38  ? 4.219   -33.399 55.008  1.00 42.47  ? 38  LYS E CE  1 
ATOM   10858 N  NZ  . LYS E 1 38  ? 3.808   -34.830 54.866  1.00 41.21  ? 38  LYS E NZ  1 
ATOM   10859 N  N   . LEU E 1 39  ? 1.205   -27.154 55.281  1.00 31.53  ? 39  LEU E N   1 
ATOM   10860 C  CA  . LEU E 1 39  ? -0.051  -26.564 54.840  1.00 30.28  ? 39  LEU E CA  1 
ATOM   10861 C  C   . LEU E 1 39  ? -0.852  -27.560 53.980  1.00 32.61  ? 39  LEU E C   1 
ATOM   10862 O  O   . LEU E 1 39  ? -0.303  -28.199 53.057  1.00 32.96  ? 39  LEU E O   1 
ATOM   10863 C  CB  . LEU E 1 39  ? 0.225   -25.318 54.021  1.00 28.95  ? 39  LEU E CB  1 
ATOM   10864 C  CG  . LEU E 1 39  ? 0.802   -24.096 54.715  1.00 27.90  ? 39  LEU E CG  1 
ATOM   10865 C  CD1 . LEU E 1 39  ? 0.722   -22.951 53.723  1.00 25.67  ? 39  LEU E CD1 1 
ATOM   10866 C  CD2 . LEU E 1 39  ? 0.028   -23.770 55.983  1.00 25.80  ? 39  LEU E CD2 1 
ATOM   10867 N  N   . LEU E 1 40  ? -2.143  -27.689 54.276  1.00 32.47  ? 40  LEU E N   1 
ATOM   10868 C  CA  . LEU E 1 40  ? -3.003  -28.610 53.549  1.00 36.14  ? 40  LEU E CA  1 
ATOM   10869 C  C   . LEU E 1 40  ? -4.221  -27.931 52.974  1.00 38.17  ? 40  LEU E C   1 
ATOM   10870 O  O   . LEU E 1 40  ? -4.749  -26.985 53.565  1.00 37.13  ? 40  LEU E O   1 
ATOM   10871 C  CB  . LEU E 1 40  ? -3.474  -29.760 54.443  1.00 39.17  ? 40  LEU E CB  1 
ATOM   10872 C  CG  . LEU E 1 40  ? -2.485  -30.432 55.399  1.00 42.26  ? 40  LEU E CG  1 
ATOM   10873 C  CD1 . LEU E 1 40  ? -2.371  -29.579 56.649  1.00 39.49  ? 40  LEU E CD1 1 
ATOM   10874 C  CD2 . LEU E 1 40  ? -2.935  -31.838 55.765  1.00 40.20  ? 40  LEU E CD2 1 
ATOM   10875 N  N   . LYS E 1 41  ? -4.664  -28.451 51.825  1.00 45.47  ? 41  LYS E N   1 
ATOM   10876 C  CA  . LYS E 1 41  ? -5.970  -28.142 51.206  1.00 46.44  ? 41  LYS E CA  1 
ATOM   10877 C  C   . LYS E 1 41  ? -6.918  -29.364 51.250  1.00 48.73  ? 41  LYS E C   1 
ATOM   10878 O  O   . LYS E 1 41  ? -6.937  -30.188 50.310  1.00 49.72  ? 41  LYS E O   1 
ATOM   10879 C  CB  . LYS E 1 41  ? -5.790  -27.661 49.767  1.00 43.18  ? 41  LYS E CB  1 
ATOM   10880 C  CG  . LYS E 1 41  ? -7.084  -27.179 49.117  1.00 47.77  ? 41  LYS E CG  1 
ATOM   10881 C  CD  . LYS E 1 41  ? -6.915  -27.011 47.610  1.00 47.28  ? 41  LYS E CD  1 
ATOM   10882 C  CE  . LYS E 1 41  ? -8.196  -26.566 46.927  1.00 46.68  ? 41  LYS E CE  1 
ATOM   10883 N  NZ  . LYS E 1 41  ? -7.893  -26.273 45.498  1.00 45.21  ? 41  LYS E NZ  1 
ATOM   10884 N  N   . ASP E 1 42  ? -7.701  -29.463 52.337  1.00 48.41  ? 42  ASP E N   1 
ATOM   10885 C  CA  . ASP E 1 42  ? -8.700  -30.525 52.505  1.00 52.20  ? 42  ASP E CA  1 
ATOM   10886 C  C   . ASP E 1 42  ? -7.993  -31.880 52.565  1.00 61.79  ? 42  ASP E C   1 
ATOM   10887 O  O   . ASP E 1 42  ? -8.416  -32.855 51.905  1.00 63.06  ? 42  ASP E O   1 
ATOM   10888 C  CB  . ASP E 1 42  ? -9.722  -30.540 51.343  1.00 48.89  ? 42  ASP E CB  1 
ATOM   10889 C  CG  . ASP E 1 42  ? -10.998 -29.776 51.646  1.00 45.53  ? 42  ASP E CG  1 
ATOM   10890 O  OD1 . ASP E 1 42  ? -11.669 -30.057 52.657  1.00 45.62  ? 42  ASP E OD1 1 
ATOM   10891 O  OD2 . ASP E 1 42  ? -11.355 -28.907 50.837  1.00 46.76  ? 42  ASP E OD2 1 
ATOM   10892 N  N   . GLY E 1 43  ? -6.905  -31.932 53.336  1.00 61.96  ? 43  GLY E N   1 
ATOM   10893 C  CA  . GLY E 1 43  ? -6.090  -33.140 53.438  1.00 58.66  ? 43  GLY E CA  1 
ATOM   10894 C  C   . GLY E 1 43  ? -5.054  -33.314 52.337  1.00 58.65  ? 43  GLY E C   1 
ATOM   10895 O  O   . GLY E 1 43  ? -4.216  -34.207 52.425  1.00 65.39  ? 43  GLY E O   1 
ATOM   10896 N  N   . LYS E 1 44  ? -5.094  -32.490 51.293  1.00 54.68  ? 44  LYS E N   1 
ATOM   10897 C  CA  . LYS E 1 44  ? -4.017  -32.520 50.297  1.00 52.78  ? 44  LYS E CA  1 
ATOM   10898 C  C   . LYS E 1 44  ? -2.849  -31.569 50.653  1.00 49.20  ? 44  LYS E C   1 
ATOM   10899 O  O   . LYS E 1 44  ? -3.027  -30.367 50.780  1.00 43.19  ? 44  LYS E O   1 
ATOM   10900 C  CB  . LYS E 1 44  ? -4.561  -32.201 48.906  1.00 57.05  ? 44  LYS E CB  1 
ATOM   10901 C  CG  . LYS E 1 44  ? -3.651  -32.628 47.764  1.00 62.81  ? 44  LYS E CG  1 
ATOM   10902 C  CD  . LYS E 1 44  ? -3.580  -34.148 47.658  1.00 66.11  ? 44  LYS E CD  1 
ATOM   10903 C  CE  . LYS E 1 44  ? -3.278  -34.599 46.237  1.00 62.56  ? 44  LYS E CE  1 
ATOM   10904 N  NZ  . LYS E 1 44  ? -3.689  -36.019 46.070  1.00 62.55  ? 44  LYS E NZ  1 
ATOM   10905 N  N   . VAL E 1 45  ? -1.656  -32.131 50.809  1.00 49.49  ? 45  VAL E N   1 
ATOM   10906 C  CA  . VAL E 1 45  ? -0.427  -31.367 51.092  1.00 46.67  ? 45  VAL E CA  1 
ATOM   10907 C  C   . VAL E 1 45  ? -0.149  -30.326 50.021  1.00 42.24  ? 45  VAL E C   1 
ATOM   10908 O  O   . VAL E 1 45  ? -0.398  -30.580 48.858  1.00 45.76  ? 45  VAL E O   1 
ATOM   10909 C  CB  . VAL E 1 45  ? 0.778   -32.312 51.226  1.00 45.97  ? 45  VAL E CB  1 
ATOM   10910 C  CG1 . VAL E 1 45  ? 1.987   -31.567 51.752  1.00 45.07  ? 45  VAL E CG1 1 
ATOM   10911 C  CG2 . VAL E 1 45  ? 0.421   -33.454 52.164  1.00 47.37  ? 45  VAL E CG2 1 
ATOM   10912 N  N   . PHE E 1 46  ? 0.362   -29.166 50.424  1.00 39.95  ? 46  PHE E N   1 
ATOM   10913 C  CA  . PHE E 1 46  ? 0.419   -27.987 49.567  1.00 40.93  ? 46  PHE E CA  1 
ATOM   10914 C  C   . PHE E 1 46  ? 1.770   -27.274 49.677  1.00 39.84  ? 46  PHE E C   1 
ATOM   10915 O  O   . PHE E 1 46  ? 2.318   -26.790 48.672  1.00 38.86  ? 46  PHE E O   1 
ATOM   10916 C  CB  . PHE E 1 46  ? -0.795  -27.049 49.872  1.00 44.08  ? 46  PHE E CB  1 
ATOM   10917 C  CG  . PHE E 1 46  ? -0.589  -25.600 49.488  1.00 45.64  ? 46  PHE E CG  1 
ATOM   10918 C  CD1 . PHE E 1 46  ? -0.569  -25.200 48.145  1.00 51.57  ? 46  PHE E CD1 1 
ATOM   10919 C  CD2 . PHE E 1 46  ? -0.431  -24.626 50.468  1.00 47.13  ? 46  PHE E CD2 1 
ATOM   10920 C  CE1 . PHE E 1 46  ? -0.374  -23.856 47.787  1.00 53.95  ? 46  PHE E CE1 1 
ATOM   10921 C  CE2 . PHE E 1 46  ? -0.222  -23.289 50.123  1.00 51.77  ? 46  PHE E CE2 1 
ATOM   10922 C  CZ  . PHE E 1 46  ? -0.201  -22.895 48.780  1.00 52.53  ? 46  PHE E CZ  1 
ATOM   10923 N  N   . ARG E 1 47  ? 2.311   -27.233 50.890  1.00 36.83  ? 47  ARG E N   1 
ATOM   10924 C  CA  . ARG E 1 47  ? 3.520   -26.457 51.198  1.00 35.77  ? 47  ARG E CA  1 
ATOM   10925 C  C   . ARG E 1 47  ? 4.076   -26.889 52.573  1.00 36.66  ? 47  ARG E C   1 
ATOM   10926 O  O   . ARG E 1 47  ? 3.319   -27.225 53.502  1.00 35.70  ? 47  ARG E O   1 
ATOM   10927 C  CB  . ARG E 1 47  ? 3.225   -24.944 51.101  1.00 35.97  ? 47  ARG E CB  1 
ATOM   10928 C  CG  . ARG E 1 47  ? 4.221   -23.999 51.746  1.00 37.70  ? 47  ARG E CG  1 
ATOM   10929 C  CD  . ARG E 1 47  ? 4.403   -22.730 50.930  1.00 41.37  ? 47  ARG E CD  1 
ATOM   10930 N  NE  . ARG E 1 47  ? 5.616   -22.851 50.126  1.00 50.54  ? 47  ARG E NE  1 
ATOM   10931 C  CZ  . ARG E 1 47  ? 6.120   -21.917 49.323  1.00 49.92  ? 47  ARG E CZ  1 
ATOM   10932 N  NH1 . ARG E 1 47  ? 5.495   -20.743 49.178  1.00 44.32  ? 47  ARG E NH1 1 
ATOM   10933 N  NH2 . ARG E 1 47  ?