data_4IHB
# 
_entry.id   4IHB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IHB         
RCSB  RCSB076751   
WWPDB D_1000076751 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2DMH 'C2A domain of myoferlin'         unspecified 
PDB 3L9B 'C2A domain of otoferlin'         unspecified 
PDB 4IQH 'Dysferlin C2A variant 1 (C2Av1)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IHB 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sutton, R.B.' 1 
'Fuson, K.L.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                104 
_citation.page_last                 115 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24239457 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.10.001 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fuson, K.'       1  
primary 'Rice, A.'        2  
primary 'Mahling, R.'     3  
primary 'Snow, A.'        4  
primary 'Nayak, K.'       5  
primary 'Shanbhogue, P.'  6  
primary 'Meyer, A.G.'     7  
primary 'Redpath, G.M.'   8  
primary 'Hinderliter, A.' 9  
primary 'Cooper, S.T.'    10 
primary 'Sutton, R.B.'    11 
# 
_cell.entry_id           4IHB 
_cell.length_a           102.413 
_cell.length_b           70.670 
_cell.length_c           118.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         113.39 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IHB 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Dysferlin     14563.558 6   ? ? 'C2A DOMAIN, UNP residues 1-124' ? 
2 non-polymer syn 'FORMIC ACID' 46.025    39  ? ? ?                                ? 
3 non-polymer syn 'CALCIUM ION' 40.078    1   ? ? ?                                ? 
4 water       nat water         18.015    287 ? ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dystrophy-associated fer-1-like protein, Fer-1-like protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETM
GRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAAAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETM
GRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAAAS
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   GLU n 
1 5   PHE n 
1 6   MET n 
1 7   LEU n 
1 8   ARG n 
1 9   VAL n 
1 10  PHE n 
1 11  ILE n 
1 12  LEU n 
1 13  TYR n 
1 14  ALA n 
1 15  GLU n 
1 16  ASN n 
1 17  VAL n 
1 18  HIS n 
1 19  THR n 
1 20  PRO n 
1 21  ASP n 
1 22  THR n 
1 23  ASP n 
1 24  ILE n 
1 25  SER n 
1 26  ASP n 
1 27  ALA n 
1 28  TYR n 
1 29  CYS n 
1 30  SER n 
1 31  ALA n 
1 32  VAL n 
1 33  PHE n 
1 34  ALA n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  ARG n 
1 40  THR n 
1 41  LYS n 
1 42  VAL n 
1 43  ILE n 
1 44  LYS n 
1 45  ASN n 
1 46  SER n 
1 47  VAL n 
1 48  ASN n 
1 49  PRO n 
1 50  VAL n 
1 51  TRP n 
1 52  ASN n 
1 53  GLU n 
1 54  GLY n 
1 55  PHE n 
1 56  GLU n 
1 57  TRP n 
1 58  ASP n 
1 59  LEU n 
1 60  LYS n 
1 61  GLY n 
1 62  ILE n 
1 63  PRO n 
1 64  LEU n 
1 65  ASP n 
1 66  GLN n 
1 67  GLY n 
1 68  SER n 
1 69  GLU n 
1 70  LEU n 
1 71  HIS n 
1 72  VAL n 
1 73  VAL n 
1 74  VAL n 
1 75  LYS n 
1 76  ASP n 
1 77  HIS n 
1 78  GLU n 
1 79  THR n 
1 80  MET n 
1 81  GLY n 
1 82  ARG n 
1 83  ASN n 
1 84  ARG n 
1 85  PHE n 
1 86  LEU n 
1 87  GLY n 
1 88  GLU n 
1 89  ALA n 
1 90  LYS n 
1 91  VAL n 
1 92  PRO n 
1 93  LEU n 
1 94  ARG n 
1 95  GLU n 
1 96  VAL n 
1 97  LEU n 
1 98  ALA n 
1 99  THR n 
1 100 PRO n 
1 101 SER n 
1 102 LEU n 
1 103 SER n 
1 104 ALA n 
1 105 SER n 
1 106 PHE n 
1 107 ASN n 
1 108 ALA n 
1 109 PRO n 
1 110 LEU n 
1 111 LEU n 
1 112 ASP n 
1 113 THR n 
1 114 LYS n 
1 115 LYS n 
1 116 GLN n 
1 117 PRO n 
1 118 THR n 
1 119 GLY n 
1 120 ALA n 
1 121 SER n 
1 122 LEU n 
1 123 VAL n 
1 124 LEU n 
1 125 GLN n 
1 126 VAL n 
1 127 SER n 
1 128 TYR n 
1 129 THR n 
1 130 ALA n 
1 131 ALA n 
1 132 ALA n 
1 133 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DYSF, FER1L1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX4T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DYSF_HUMAN 
_struct_ref.pdbx_db_accession          O75923 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRF
LGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYT
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IHB A 6 ? 129 ? O75923 1 ? 124 ? 1 124 
2 1 4IHB B 6 ? 129 ? O75923 1 ? 124 ? 1 124 
3 1 4IHB C 6 ? 129 ? O75923 1 ? 124 ? 1 124 
4 1 4IHB D 6 ? 129 ? O75923 1 ? 124 ? 1 124 
5 1 4IHB E 6 ? 129 ? O75923 1 ? 124 ? 1 124 
6 1 4IHB F 6 ? 129 ? O75923 1 ? 124 ? 1 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IHB GLY A 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  1  
1 4IHB SER A 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  2  
1 4IHB PRO A 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  3  
1 4IHB GLU A 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  4  
1 4IHB PHE A 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   5  
1 4IHB ALA A 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 6  
1 4IHB ALA A 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 7  
1 4IHB ALA A 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 8  
1 4IHB SER A 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 9  
2 4IHB GLY B 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  10 
2 4IHB SER B 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  11 
2 4IHB PRO B 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  12 
2 4IHB GLU B 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  13 
2 4IHB PHE B 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   14 
2 4IHB ALA B 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 15 
2 4IHB ALA B 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 16 
2 4IHB ALA B 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 17 
2 4IHB SER B 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 18 
3 4IHB GLY C 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  19 
3 4IHB SER C 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  20 
3 4IHB PRO C 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  21 
3 4IHB GLU C 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  22 
3 4IHB PHE C 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   23 
3 4IHB ALA C 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 24 
3 4IHB ALA C 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 25 
3 4IHB ALA C 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 26 
3 4IHB SER C 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 27 
4 4IHB GLY D 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  28 
4 4IHB SER D 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  29 
4 4IHB PRO D 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  30 
4 4IHB GLU D 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  31 
4 4IHB PHE D 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   32 
4 4IHB ALA D 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 33 
4 4IHB ALA D 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 34 
4 4IHB ALA D 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 35 
4 4IHB SER D 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 36 
5 4IHB GLY E 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  37 
5 4IHB SER E 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  38 
5 4IHB PRO E 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  39 
5 4IHB GLU E 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  40 
5 4IHB PHE E 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   41 
5 4IHB ALA E 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 42 
5 4IHB ALA E 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 43 
5 4IHB ALA E 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 44 
5 4IHB SER E 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 45 
6 4IHB GLY F 1   ? UNP O75923 ? ? 'EXPRESSION TAG' -4  46 
6 4IHB SER F 2   ? UNP O75923 ? ? 'EXPRESSION TAG' -3  47 
6 4IHB PRO F 3   ? UNP O75923 ? ? 'EXPRESSION TAG' -2  48 
6 4IHB GLU F 4   ? UNP O75923 ? ? 'EXPRESSION TAG' -1  49 
6 4IHB PHE F 5   ? UNP O75923 ? ? 'EXPRESSION TAG' 0   50 
6 4IHB ALA F 130 ? UNP O75923 ? ? 'EXPRESSION TAG' 125 51 
6 4IHB ALA F 131 ? UNP O75923 ? ? 'EXPRESSION TAG' 126 52 
6 4IHB ALA F 132 ? UNP O75923 ? ? 'EXPRESSION TAG' 127 53 
6 4IHB SER F 133 ? UNP O75923 ? ? 'EXPRESSION TAG' 128 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4IHB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.25 
_exptl_crystal.density_percent_sol   45.30 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            284 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pdbx_details    '2M Sodium Formate, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 284K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 90 ? 1 
2 90 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'Mercury 3'        ?          'Integrated MaxFlux confocal optic' 
2 CCD 'ADSC QUANTUM 315' 2010-06-04 ?                                   
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.5418  1.0 
2 0.97946 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' RIGAKU                ?    ?     ? 1.5418  
2 SYNCHROTRON      'SSRL BEAMLINE BL7-1' SSRL BL7-1 ? 0.97946 
# 
_reflns.entry_id                     4IHB 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             56.000 
_reflns.d_resolution_high            2.040 
_reflns.number_obs                   49251 
_reflns.number_all                   49251 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.07300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.04 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.415 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.415 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 4IHB 
_refine.ls_number_reflns_obs                     48842 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.902 
_refine.ls_d_res_high                            2.044 
_refine.ls_percent_reflns_obs                    99.19 
_refine.ls_R_factor_obs                          0.2041 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2000 
_refine.ls_R_factor_R_free                       0.2401 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.07 
_refine.ls_number_reflns_R_free                  4918 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2DMH 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.27 
_refine.pdbx_overall_phase_error                 23.80 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5917 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         118 
_refine_hist.number_atoms_solvent             287 
_refine_hist.number_atoms_total               6322 
_refine_hist.d_res_high                       2.044 
_refine_hist.d_res_low                        33.902 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 6175 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.347  ? ? 8337 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 16.307 ? ? 2223 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.089  ? ? 959  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 1062 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.0440 2.0673  1438 0.2591 99.00  0.3178 . . 193 . . . . 'X-RAY DIFFRACTION' 
. 2.0673 2.0916  1430 0.2494 100.00 0.3207 . . 180 . . . . 'X-RAY DIFFRACTION' 
. 2.0916 2.1171  1465 0.2380 100.00 0.2650 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 2.1171 2.1439  1519 0.2379 100.00 0.2520 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 2.1439 2.1721  1420 0.2253 99.00  0.2914 . . 163 . . . . 'X-RAY DIFFRACTION' 
. 2.1721 2.2018  1478 0.2295 100.00 0.2650 . . 174 . . . . 'X-RAY DIFFRACTION' 
. 2.2018 2.2333  1440 0.2276 100.00 0.2653 . . 171 . . . . 'X-RAY DIFFRACTION' 
. 2.2333 2.2666  1495 0.2253 100.00 0.2970 . . 162 . . . . 'X-RAY DIFFRACTION' 
. 2.2666 2.3020  1438 0.2256 99.00  0.2870 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 2.3020 2.3398  1469 0.2216 99.00  0.3099 . . 163 . . . . 'X-RAY DIFFRACTION' 
. 2.3398 2.3801  1455 0.2355 100.00 0.2912 . . 155 . . . . 'X-RAY DIFFRACTION' 
. 2.3801 2.4234  1512 0.2198 100.00 0.2702 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.4234 2.4700  1447 0.2348 99.00  0.2849 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.4700 2.5204  1488 0.2218 100.00 0.2972 . . 163 . . . . 'X-RAY DIFFRACTION' 
. 2.5204 2.5752  1423 0.2252 100.00 0.2728 . . 169 . . . . 'X-RAY DIFFRACTION' 
. 2.5752 2.6350  1472 0.2241 99.00  0.2684 . . 170 . . . . 'X-RAY DIFFRACTION' 
. 2.6350 2.7009  1463 0.2085 99.00  0.2723 . . 176 . . . . 'X-RAY DIFFRACTION' 
. 2.7009 2.7739  1449 0.2088 99.00  0.2566 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 2.7739 2.8555  1431 0.2057 99.00  0.2395 . . 183 . . . . 'X-RAY DIFFRACTION' 
. 2.8555 2.9476  1481 0.2085 99.00  0.2854 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 2.9476 3.0529  1479 0.1984 100.00 0.2501 . . 167 . . . . 'X-RAY DIFFRACTION' 
. 3.0529 3.1750  1434 0.2011 99.00  0.2585 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 3.1750 3.3194  1471 0.1833 100.00 0.2161 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 3.3194 3.4943  1487 0.1644 99.00  0.2181 . . 157 . . . . 'X-RAY DIFFRACTION' 
. 3.4943 3.7129  1472 0.1768 99.00  0.1849 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 3.7129 3.9992  1447 0.1787 100.00 0.2197 . . 178 . . . . 'X-RAY DIFFRACTION' 
. 3.9992 4.4009  1501 0.1591 99.00  0.1907 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 4.4009 5.0359  1487 0.1538 98.00  0.1886 . . 128 . . . . 'X-RAY DIFFRACTION' 
. 5.0359 6.3379  1412 0.2060 95.00  0.2301 . . 167 . . . . 'X-RAY DIFFRACTION' 
. 6.3379 33.9063 1521 0.2483 99.00  0.2267 . . 175 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IHB 
_struct.title                     'X-RAY STRUCTURE OF THE canonical C2A DOMAIN FROM HUMAN DYSFERLIN' 
_struct.pdbx_descriptor           Dysferlin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IHB 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
'BETA SANDWICH, TYPE II C2 DOMAIN, MUSCULAR DYSTROPHY, MEMBRANE PROTEIN, MEMBRANE REPAIR, PLASMA MEMBRANE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 3 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
ZA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 94 ? THR A 99 ? ARG A 89 THR A 94 5 ? 6 
HELX_P HELX_P2 2 ARG B 94 ? ALA B 98 ? ARG B 89 ALA B 93 5 ? 5 
HELX_P HELX_P3 3 ARG C 94 ? VAL C 96 ? ARG C 89 VAL C 91 5 ? 3 
HELX_P HELX_P4 4 GLU D 95 ? THR D 99 ? GLU D 90 THR D 94 5 ? 5 
HELX_P HELX_P5 5 ARG E 94 ? VAL E 96 ? ARG E 89 VAL E 91 5 ? 3 
HELX_P HELX_P6 6 ARG F 94 ? ALA F 98 ? ARG F 89 ALA F 93 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E  ASN 45 OD1 ? ? ? 1_555 RA CA  . CA ? ? E ASN 40  E CA  207 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc2 metalc ? ? RA CA  .  CA  ? ? ? 1_555 YA HOH . O  ? ? E CA  207 E HOH 340 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc3 metalc ? ? E  ILE 24 O   ? ? ? 1_555 RA CA  . CA ? ? E ILE 19  E CA  207 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc4 metalc ? ? E  ASP 26 OD1 ? ? ? 1_555 RA CA  . CA ? ? E ASP 21  E CA  207 1_555 ? ? ? ? ? ? ? 2.517 ? 
metalc5 metalc ? ? E  ASP 26 OD2 ? ? ? 1_555 RA CA  . CA ? ? E ASP 21  E CA  207 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc6 metalc ? ? E  ASP 23 OD2 ? ? ? 1_555 RA CA  . CA ? ? E ASP 18  E CA  207 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc7 metalc ? ? E  ASP 23 OD1 ? ? ? 1_555 RA CA  . CA ? ? E ASP 18  E CA  207 1_555 ? ? ? ? ? ? ? 2.893 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 78 B . ? GLU 73 B THR 79 B ? THR 74 B 1 8.20   
2 THR 79 B . ? THR 74 B MET 80 B ? MET 75 B 1 10.03  
3 ASP 65 C . ? ASP 60 C GLN 66 C ? GLN 61 C 1 2.27   
4 GLN 66 C . ? GLN 61 C GLY 67 C ? GLY 62 C 1 19.16  
5 PRO 20 D . ? PRO 15 D ASP 21 D ? ASP 16 D 1 -8.52  
6 PRO 63 E . ? PRO 58 E LEU 64 E ? LEU 59 E 1 -3.66  
7 GLN 66 E . ? GLN 61 E GLY 67 E ? GLY 62 E 1 2.72   
8 GLU 78 E . ? GLU 73 E THR 79 E ? THR 74 E 1 -25.69 
9 THR 79 E . ? THR 74 E MET 80 E ? MET 75 E 1 20.80  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 3 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 50  ? ASP A 58  ? VAL A 45  ASP A 53  
A 2 MET A 6   ? GLU A 15  ? MET A 1   GLU A 10  
A 3 PRO A 117 ? THR A 129 ? PRO A 112 THR A 124 
A 4 SER A 103 ? LEU A 111 ? SER A 98  LEU A 106 
B 1 VAL A 36  ? ARG A 39  ? VAL A 31  ARG A 34  
B 2 ALA A 27  ? PHE A 33  ? ALA A 22  PHE A 28  
B 3 GLU A 69  ? ASP A 76  ? GLU A 64  ASP A 71  
B 4 PHE A 85  ? PRO A 92  ? PHE A 80  PRO A 87  
C 1 VAL B 50  ? ASP B 58  ? VAL B 45  ASP B 53  
C 2 MET B 6   ? GLU B 15  ? MET B 1   GLU B 10  
C 3 PRO B 117 ? THR B 129 ? PRO B 112 THR B 124 
C 4 SER B 103 ? LEU B 111 ? SER B 98  LEU B 106 
D 1 VAL B 36  ? ARG B 39  ? VAL B 31  ARG B 34  
D 2 SER B 25  ? PHE B 33  ? SER B 20  PHE B 28  
D 3 ILE B 43  ? SER B 46  ? ILE B 38  SER B 41  
E 1 VAL B 36  ? ARG B 39  ? VAL B 31  ARG B 34  
E 2 SER B 25  ? PHE B 33  ? SER B 20  PHE B 28  
E 3 GLU B 69  ? HIS B 77  ? GLU B 64  HIS B 72  
E 4 ASN B 83  ? PRO B 92  ? ASN B 78  PRO B 87  
F 1 VAL C 50  ? ASP C 58  ? VAL C 45  ASP C 53  
F 2 MET C 6   ? GLU C 15  ? MET C 1   GLU C 10  
F 3 PRO C 117 ? THR C 129 ? PRO C 112 THR C 124 
F 4 SER C 103 ? LEU C 111 ? SER C 98  LEU C 106 
G 1 VAL C 36  ? ARG C 39  ? VAL C 31  ARG C 34  
G 2 ALA C 27  ? PHE C 33  ? ALA C 22  PHE C 28  
G 3 GLU C 69  ? ASP C 76  ? GLU C 64  ASP C 71  
G 4 PHE C 85  ? PRO C 92  ? PHE C 80  PRO C 87  
H 1 VAL D 50  ? ASP D 58  ? VAL D 45  ASP D 53  
H 2 PHE D 5   ? ALA D 14  ? PHE D 0   ALA D 9   
H 3 PRO D 117 ? ALA D 130 ? PRO D 112 ALA D 125 
H 4 SER D 103 ? LEU D 111 ? SER D 98  LEU D 106 
I 1 VAL D 36  ? ARG D 39  ? VAL D 31  ARG D 34  
I 2 ASP D 26  ? PHE D 33  ? ASP D 21  PHE D 28  
I 3 ILE D 43  ? LYS D 44  ? ILE D 38  LYS D 39  
J 1 VAL D 36  ? ARG D 39  ? VAL D 31  ARG D 34  
J 2 ASP D 26  ? PHE D 33  ? ASP D 21  PHE D 28  
J 3 GLU D 69  ? ASP D 76  ? GLU D 64  ASP D 71  
J 4 PHE D 85  ? PRO D 92  ? PHE D 80  PRO D 87  
K 1 VAL E 50  ? ASP E 58  ? VAL E 45  ASP E 53  
K 2 MET E 6   ? GLU E 15  ? MET E 1   GLU E 10  
K 3 PRO E 117 ? THR E 129 ? PRO E 112 THR E 124 
K 4 SER E 103 ? LEU E 111 ? SER E 98  LEU E 106 
L 1 VAL E 36  ? ARG E 39  ? VAL E 31  ARG E 34  
L 2 ALA E 27  ? PHE E 33  ? ALA E 22  PHE E 28  
L 3 GLU E 69  ? ASP E 76  ? GLU E 64  ASP E 71  
L 4 ARG E 84  ? PRO E 92  ? ARG E 79  PRO E 87  
M 1 VAL F 50  ? ASP F 58  ? VAL F 45  ASP F 53  
M 2 MET F 6   ? GLU F 15  ? MET F 1   GLU F 10  
M 3 PRO F 117 ? THR F 129 ? PRO F 112 THR F 124 
M 4 SER F 103 ? LEU F 111 ? SER F 98  LEU F 106 
N 1 VAL F 36  ? ARG F 39  ? VAL F 31  ARG F 34  
N 2 ALA F 27  ? PHE F 33  ? ALA F 22  PHE F 28  
N 3 GLU F 69  ? ASP F 76  ? GLU F 64  ASP F 71  
N 4 PHE F 85  ? PRO F 92  ? PHE F 80  PRO F 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TRP A 57  ? O TRP A 52  N LEU A 7   ? N LEU A 2   
A 2 3 N ARG A 8   ? N ARG A 3   O SER A 127 ? O SER A 122 
A 3 4 O LEU A 122 ? O LEU A 117 N ALA A 108 ? N ALA A 103 
B 1 2 O LYS A 38  ? O LYS A 33  N ALA A 31  ? N ALA A 26  
B 2 3 N SER A 30  ? N SER A 25  O VAL A 73  ? O VAL A 68  
B 3 4 N VAL A 74  ? N VAL A 69  O GLY A 87  ? O GLY A 82  
C 1 2 O PHE B 55  ? O PHE B 50  N VAL B 9   ? N VAL B 4   
C 2 3 N ARG B 8   ? N ARG B 3   O SER B 127 ? O SER B 122 
C 3 4 O ALA B 120 ? O ALA B 115 N LEU B 110 ? N LEU B 105 
D 1 2 O LYS B 38  ? O LYS B 33  N ALA B 31  ? N ALA B 26  
D 2 3 N SER B 25  ? N SER B 20  O SER B 46  ? O SER B 41  
E 1 2 O LYS B 38  ? O LYS B 33  N ALA B 31  ? N ALA B 26  
E 2 3 N SER B 30  ? N SER B 25  O VAL B 73  ? O VAL B 68  
E 3 4 N ASP B 76  ? N ASP B 71  O ARG B 84  ? O ARG B 79  
F 1 2 O PHE C 55  ? O PHE C 50  N VAL C 9   ? N VAL C 4   
F 2 3 N TYR C 13  ? N TYR C 8   O VAL C 123 ? O VAL C 118 
F 3 4 O LEU C 124 ? O LEU C 119 N PHE C 106 ? N PHE C 101 
G 1 2 O LYS C 38  ? O LYS C 33  N ALA C 31  ? N ALA C 26  
G 2 3 N SER C 30  ? N SER C 25  O VAL C 73  ? O VAL C 68  
G 3 4 N LEU C 70  ? N LEU C 65  O VAL C 91  ? O VAL C 86  
H 1 2 O PHE D 55  ? O PHE D 50  N VAL D 9   ? N VAL D 4   
H 2 3 N TYR D 13  ? N TYR D 8   O VAL D 123 ? O VAL D 118 
H 3 4 O LEU D 124 ? O LEU D 119 N PHE D 106 ? N PHE D 101 
I 1 2 O LYS D 38  ? O LYS D 33  N ALA D 31  ? N ALA D 26  
I 2 3 N ALA D 27  ? N ALA D 22  O ILE D 43  ? O ILE D 38  
J 1 2 O LYS D 38  ? O LYS D 33  N ALA D 31  ? N ALA D 26  
J 2 3 N SER D 30  ? N SER D 25  O VAL D 73  ? O VAL D 68  
J 3 4 N VAL D 74  ? N VAL D 69  O GLY D 87  ? O GLY D 82  
K 1 2 O PHE E 55  ? O PHE E 50  N VAL E 9   ? N VAL E 4   
K 2 3 N TYR E 13  ? N TYR E 8   O VAL E 123 ? O VAL E 118 
K 3 4 O LEU E 124 ? O LEU E 119 N PHE E 106 ? N PHE E 101 
L 1 2 O LYS E 38  ? O LYS E 33  N ALA E 31  ? N ALA E 26  
L 2 3 N SER E 30  ? N SER E 25  O VAL E 73  ? O VAL E 68  
L 3 4 N VAL E 74  ? N VAL E 69  O GLY E 87  ? O GLY E 82  
M 1 2 O PHE F 55  ? O PHE F 50  N VAL F 9   ? N VAL F 4   
M 2 3 N MET F 6   ? N MET F 1   O THR F 129 ? O THR F 124 
M 3 4 O VAL F 126 ? O VAL F 121 N ALA F 104 ? N ALA F 99  
N 1 2 O LYS F 38  ? O LYS F 33  N ALA F 31  ? N ALA F 26  
N 2 3 N SER F 30  ? N SER F 25  O VAL F 73  ? O VAL F 68  
N 3 4 N VAL F 74  ? N VAL F 69  O GLY F 87  ? O GLY F 82  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FMT A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 202' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE FMT A 203' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 204' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FMT A 205' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FMT A 206' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 207' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT A 208' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT B 201' 
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FMT B 202' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT B 203' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT B 204' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FMT B 205' 
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT B 206' 
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT B 207' 
BC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FMT C 201' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FMT C 202' 
BC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT C 203' 
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE FMT C 204' 
CC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FMT D 201' 
CC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT D 202' 
CC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FMT D 203' 
CC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT D 204' 
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE FMT D 205' 
CC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT D 206' 
CC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT D 207' 
CC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE FMT D 208' 
DC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT D 209' 
DC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT D 210' 
DC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FMT D 211' 
DC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT D 212' 
DC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT E 201' 
DC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT E 202' 
DC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT E 203' 
DC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FMT E 204' 
DC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT E 205' 
EC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT E 206' 
EC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA E 207'  
EC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT F 201' 
EC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT F 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7 PHE A  33  ? PHE A 28  . ? 1_555 ? 
2   AC1 7 ALA A  34  ? ALA A 29  . ? 1_555 ? 
3   AC1 7 GLU A  69  ? GLU A 64  . ? 1_555 ? 
4   AC1 7 HOH UA .   ? HOH A 308 . ? 1_555 ? 
5   AC1 7 HOH UA .   ? HOH A 309 . ? 1_555 ? 
6   AC1 7 HOH UA .   ? HOH A 310 . ? 1_555 ? 
7   AC1 7 GLY F  61  ? GLY F 56  . ? 1_555 ? 
8   AC2 4 SER A  103 ? SER A 98  . ? 1_555 ? 
9   AC2 4 ALA A  104 ? ALA A 99  . ? 1_555 ? 
10  AC2 4 GLN A  125 ? GLN A 120 . ? 1_555 ? 
11  AC2 4 HOH UA .   ? HOH A 327 . ? 1_555 ? 
12  AC3 2 ARG A  39  ? ARG A 34  . ? 1_555 ? 
13  AC3 2 PHE A  55  ? PHE A 50  . ? 1_555 ? 
14  AC4 4 LYS A  41  ? LYS A 36  . ? 1_555 ? 
15  AC4 4 TRP A  51  ? TRP A 46  . ? 1_555 ? 
16  AC4 4 ASN A  52  ? ASN A 47  . ? 1_555 ? 
17  AC4 4 HOH UA .   ? HOH A 319 . ? 1_555 ? 
18  AC5 7 TYR A  13  ? TYR A 8   . ? 1_555 ? 
19  AC5 7 GLU A  15  ? GLU A 10  . ? 1_555 ? 
20  AC5 7 ASN A  107 ? ASN A 102 . ? 1_555 ? 
21  AC5 7 VAL A  123 ? VAL A 118 . ? 1_555 ? 
22  AC5 7 HOH UA .   ? HOH A 314 . ? 1_555 ? 
23  AC5 7 SER B  101 ? SER B 96  . ? 2_554 ? 
24  AC5 7 SER B  103 ? SER B 98  . ? 2_554 ? 
25  AC6 7 HIS A  18  ? HIS A 13  . ? 1_555 ? 
26  AC6 7 THR A  19  ? THR A 14  . ? 1_555 ? 
27  AC6 7 THR A  22  ? THR A 17  . ? 1_555 ? 
28  AC6 7 ASP A  23  ? ASP A 18  . ? 1_555 ? 
29  AC6 7 ILE A  24  ? ILE A 19  . ? 1_555 ? 
30  AC6 7 SER A  25  ? SER A 20  . ? 1_555 ? 
31  AC6 7 HOH UA .   ? HOH A 321 . ? 1_555 ? 
32  AC7 4 GLY A  35  ? GLY A 30  . ? 1_555 ? 
33  AC7 4 VAL A  36  ? VAL A 31  . ? 1_555 ? 
34  AC7 4 LYS A  37  ? LYS A 32  . ? 1_555 ? 
35  AC7 4 HOH ZA .   ? HOH F 307 . ? 1_555 ? 
36  AC8 5 GLN A  66  ? GLN A 61  . ? 1_555 ? 
37  AC8 5 LEU A  97  ? LEU A 92  . ? 1_555 ? 
38  AC8 5 ALA B  89  ? ALA B 84  . ? 1_555 ? 
39  AC8 5 LYS B  90  ? LYS B 85  . ? 1_555 ? 
40  AC8 5 PRO B  109 ? PRO B 104 . ? 1_555 ? 
41  AC9 5 VAL B  36  ? VAL B 31  . ? 1_555 ? 
42  AC9 5 LYS B  38  ? LYS B 33  . ? 1_555 ? 
43  AC9 5 GLU B  56  ? GLU B 51  . ? 1_555 ? 
44  AC9 5 TRP B  57  ? TRP B 52  . ? 1_555 ? 
45  AC9 5 ASP B  58  ? ASP B 53  . ? 1_555 ? 
46  BC1 7 PHE B  33  ? PHE B 28  . ? 1_555 ? 
47  BC1 7 ALA B  34  ? ALA B 29  . ? 1_555 ? 
48  BC1 7 GLU B  69  ? GLU B 64  . ? 1_555 ? 
49  BC1 7 HOH VA .   ? HOH B 312 . ? 1_555 ? 
50  BC1 7 GLY D  35  ? GLY D 30  . ? 3_545 ? 
51  BC1 7 FMT Z  .   ? FMT D 201 . ? 3_545 ? 
52  BC1 7 HOH XA .   ? HOH D 308 . ? 3_545 ? 
53  BC2 5 LYS B  38  ? LYS B 33  . ? 1_555 ? 
54  BC2 5 GLY B  54  ? GLY B 49  . ? 1_555 ? 
55  BC2 5 PHE B  55  ? PHE B 50  . ? 1_555 ? 
56  BC2 5 GLU B  56  ? GLU B 51  . ? 1_555 ? 
57  BC2 5 HOH VA .   ? HOH B 344 . ? 1_555 ? 
58  BC3 3 LYS B  38  ? LYS B 33  . ? 1_555 ? 
59  BC3 3 ARG B  39  ? ARG B 34  . ? 1_555 ? 
60  BC3 3 HOH VA .   ? HOH B 344 . ? 1_555 ? 
61  BC4 6 PRO A  100 ? PRO A 95  . ? 1_555 ? 
62  BC4 6 LEU A  102 ? LEU A 97  . ? 1_555 ? 
63  BC4 6 PRO B  109 ? PRO B 104 . ? 1_555 ? 
64  BC4 6 LEU B  110 ? LEU B 105 . ? 1_555 ? 
65  BC4 6 GLY B  119 ? GLY B 114 . ? 1_555 ? 
66  BC4 6 ALA B  120 ? ALA B 115 . ? 1_555 ? 
67  BC5 3 ASN B  16  ? ASN B 11  . ? 1_555 ? 
68  BC5 3 GLY B  119 ? GLY B 114 . ? 1_555 ? 
69  BC5 3 SER B  121 ? SER B 116 . ? 1_555 ? 
70  BC6 5 SER A  101 ? SER A 96  . ? 2_554 ? 
71  BC6 5 LEU A  102 ? LEU A 97  . ? 2_554 ? 
72  BC6 5 SER A  127 ? SER A 122 . ? 2_554 ? 
73  BC6 5 TYR A  128 ? TYR A 123 . ? 2_554 ? 
74  BC6 5 GLU B  15  ? GLU B 10  . ? 1_555 ? 
75  BC7 8 ILE C  43  ? ILE C 38  . ? 1_555 ? 
76  BC7 8 SER C  46  ? SER C 41  . ? 1_555 ? 
77  BC7 8 ASN C  48  ? ASN C 43  . ? 1_555 ? 
78  BC7 8 PRO C  49  ? PRO C 44  . ? 1_555 ? 
79  BC7 8 VAL C  50  ? VAL C 45  . ? 1_555 ? 
80  BC7 8 HOH WA .   ? HOH C 309 . ? 1_555 ? 
81  BC7 8 HOH WA .   ? HOH C 332 . ? 1_555 ? 
82  BC7 8 HOH WA .   ? HOH C 343 . ? 1_555 ? 
83  BC8 6 GLY C  35  ? GLY C 30  . ? 1_555 ? 
84  BC8 6 LYS C  37  ? LYS C 32  . ? 1_555 ? 
85  BC8 6 HOH WA .   ? HOH C 329 . ? 1_555 ? 
86  BC8 6 GLY E  35  ? GLY E 30  . ? 1_545 ? 
87  BC8 6 LYS E  37  ? LYS E 32  . ? 1_545 ? 
88  BC8 6 FMT NA .   ? FMT E 203 . ? 1_545 ? 
89  BC9 3 GLU C  95  ? GLU C 90  . ? 1_555 ? 
90  BC9 3 SER C  105 ? SER C 100 . ? 1_555 ? 
91  BC9 3 HOH WA .   ? HOH C 341 . ? 1_555 ? 
92  CC1 1 HOH WA .   ? HOH C 333 . ? 1_555 ? 
93  CC2 7 FMT P  .   ? FMT B 202 . ? 3_454 ? 
94  CC2 7 HOH VA .   ? HOH B 333 . ? 3_454 ? 
95  CC2 7 GLY D  35  ? GLY D 30  . ? 1_555 ? 
96  CC2 7 VAL D  36  ? VAL D 31  . ? 1_555 ? 
97  CC2 7 LYS D  37  ? LYS D 32  . ? 1_555 ? 
98  CC2 7 HOH XA .   ? HOH D 308 . ? 1_555 ? 
99  CC2 7 HOH XA .   ? HOH D 317 . ? 1_555 ? 
100 CC3 4 LYS D  38  ? LYS D 33  . ? 1_555 ? 
101 CC3 4 GLU D  56  ? GLU D 51  . ? 1_555 ? 
102 CC3 4 ASP D  58  ? ASP D 53  . ? 1_555 ? 
103 CC3 4 HOH XA .   ? HOH D 309 . ? 1_555 ? 
104 CC4 6 LYS D  38  ? LYS D 33  . ? 1_555 ? 
105 CC4 6 PHE D  55  ? PHE D 50  . ? 1_555 ? 
106 CC4 6 GLU D  56  ? GLU D 51  . ? 1_555 ? 
107 CC4 6 FMT FA .   ? FMT D 207 . ? 1_555 ? 
108 CC4 6 HOH XA .   ? HOH D 307 . ? 1_555 ? 
109 CC4 6 HOH XA .   ? HOH D 336 . ? 1_555 ? 
110 CC5 4 LYS D  41  ? LYS D 36  . ? 1_555 ? 
111 CC5 4 TRP D  51  ? TRP D 46  . ? 1_555 ? 
112 CC5 4 ASN D  52  ? ASN D 47  . ? 1_555 ? 
113 CC5 4 GLU D  53  ? GLU D 48  . ? 1_555 ? 
114 CC6 2 TRP E  51  ? TRP E 46  . ? 2_454 ? 
115 CC6 2 ASN E  52  ? ASN E 47  . ? 2_454 ? 
116 CC7 4 VAL D  36  ? VAL D 31  . ? 1_555 ? 
117 CC7 4 LYS D  37  ? LYS D 32  . ? 1_555 ? 
118 CC7 4 LYS D  38  ? LYS D 33  . ? 1_555 ? 
119 CC7 4 FMT GA .   ? FMT D 208 . ? 1_555 ? 
120 CC8 5 LYS D  38  ? LYS D 33  . ? 1_555 ? 
121 CC8 5 ARG D  39  ? ARG D 34  . ? 1_555 ? 
122 CC8 5 PHE D  55  ? PHE D 50  . ? 1_555 ? 
123 CC8 5 FMT BA .   ? FMT D 203 . ? 1_555 ? 
124 CC8 5 HOH XA .   ? HOH D 331 . ? 1_555 ? 
125 CC9 2 LYS D  37  ? LYS D 32  . ? 1_555 ? 
126 CC9 2 FMT EA .   ? FMT D 206 . ? 1_555 ? 
127 DC1 4 VAL B  36  ? VAL B 31  . ? 3_454 ? 
128 DC1 4 VAL D  32  ? VAL D 27  . ? 1_555 ? 
129 DC1 4 HIS D  71  ? HIS D 66  . ? 1_555 ? 
130 DC1 4 FMT JA .   ? FMT D 211 . ? 1_555 ? 
131 DC2 5 GLY B  61  ? GLY B 56  . ? 3_454 ? 
132 DC2 5 ALA D  34  ? ALA D 29  . ? 1_555 ? 
133 DC2 5 GLU D  69  ? GLU D 64  . ? 1_555 ? 
134 DC2 5 FMT JA .   ? FMT D 211 . ? 1_555 ? 
135 DC2 5 HOH XA .   ? HOH D 322 . ? 1_555 ? 
136 DC3 6 VAL D  32  ? VAL D 27  . ? 1_555 ? 
137 DC3 6 PHE D  33  ? PHE D 28  . ? 1_555 ? 
138 DC3 6 ALA D  34  ? ALA D 29  . ? 1_555 ? 
139 DC3 6 GLY D  35  ? GLY D 30  . ? 1_555 ? 
140 DC3 6 FMT HA .   ? FMT D 209 . ? 1_555 ? 
141 DC3 6 FMT IA .   ? FMT D 210 . ? 1_555 ? 
142 DC4 3 ASN D  107 ? ASN D 102 . ? 1_555 ? 
143 DC4 3 SER E  103 ? SER E 98  . ? 2_454 ? 
144 DC4 3 GLN E  125 ? GLN E 120 . ? 2_454 ? 
145 DC5 5 TYR D  13  ? TYR D 8   . ? 2_454 ? 
146 DC5 5 GLU D  15  ? GLU D 10  . ? 2_454 ? 
147 DC5 5 SER E  101 ? SER E 96  . ? 1_555 ? 
148 DC5 5 SER E  103 ? SER E 98  . ? 1_555 ? 
149 DC5 5 SER E  127 ? SER E 122 . ? 1_555 ? 
150 DC6 5 LYS E  38  ? LYS E 33  . ? 1_555 ? 
151 DC6 5 ARG E  39  ? ARG E 34  . ? 1_555 ? 
152 DC6 5 PHE E  55  ? PHE E 50  . ? 1_555 ? 
153 DC6 5 FMT NA .   ? FMT E 203 . ? 1_555 ? 
154 DC6 5 FMT OA .   ? FMT E 204 . ? 1_555 ? 
155 DC7 3 FMT W  .   ? FMT C 202 . ? 1_565 ? 
156 DC7 3 LYS E  37  ? LYS E 32  . ? 1_555 ? 
157 DC7 3 FMT MA .   ? FMT E 202 . ? 1_555 ? 
158 DC8 3 ARG E  39  ? ARG E 34  . ? 1_555 ? 
159 DC8 3 GLU E  53  ? GLU E 48  . ? 1_555 ? 
160 DC8 3 FMT MA .   ? FMT E 202 . ? 1_555 ? 
161 DC9 5 ASN E  16  ? ASN E 11  . ? 1_555 ? 
162 DC9 5 HIS E  18  ? HIS E 13  . ? 1_555 ? 
163 DC9 5 THR E  118 ? THR E 113 . ? 1_555 ? 
164 DC9 5 HOH YA .   ? HOH E 305 . ? 1_555 ? 
165 DC9 5 HOH YA .   ? HOH E 339 . ? 1_555 ? 
166 EC1 5 ALA E  89  ? ALA E 84  . ? 1_555 ? 
167 EC1 5 LYS E  90  ? LYS E 85  . ? 1_555 ? 
168 EC1 5 PRO E  109 ? PRO E 104 . ? 1_555 ? 
169 EC1 5 ASP F  65  ? ASP F 60  . ? 1_555 ? 
170 EC1 5 HOH ZA .   ? HOH F 350 . ? 1_555 ? 
171 EC2 6 LYS D  44  ? LYS D 39  . ? 3_545 ? 
172 EC2 6 ASP E  23  ? ASP E 18  . ? 1_555 ? 
173 EC2 6 ILE E  24  ? ILE E 19  . ? 1_555 ? 
174 EC2 6 ASP E  26  ? ASP E 21  . ? 1_555 ? 
175 EC2 6 ASN E  45  ? ASN E 40  . ? 1_555 ? 
176 EC2 6 HOH YA .   ? HOH E 340 . ? 1_555 ? 
177 EC3 5 SER F  103 ? SER F 98  . ? 2_454 ? 
178 EC3 5 ALA F  104 ? ALA F 99  . ? 2_454 ? 
179 EC3 5 SER F  105 ? SER F 100 . ? 1_555 ? 
180 EC3 5 GLN F  125 ? GLN F 120 . ? 2_454 ? 
181 EC3 5 FMT TA .   ? FMT F 202 . ? 2_454 ? 
182 EC4 5 GLU F  95  ? GLU F 90  . ? 1_555 ? 
183 EC4 5 ALA F  104 ? ALA F 99  . ? 1_555 ? 
184 EC4 5 SER F  105 ? SER F 100 . ? 2_454 ? 
185 EC4 5 SER F  105 ? SER F 100 . ? 1_555 ? 
186 EC4 5 FMT SA .   ? FMT F 201 . ? 2_454 ? 
# 
_database_PDB_matrix.entry_id          4IHB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IHB 
_atom_sites.fract_transf_matrix[1][1]   0.009764 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004224 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014150 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009209 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A  1 5   ? 8.626   21.611  -56.266 1.00 49.63  ? 0   PHE A N   1 
ATOM   2    C  CA  . PHE A  1 5   ? 7.626   22.293  -57.069 1.00 52.42  ? 0   PHE A CA  1 
ATOM   3    C  C   . PHE A  1 5   ? 7.106   21.493  -58.243 1.00 43.94  ? 0   PHE A C   1 
ATOM   4    O  O   . PHE A  1 5   ? 5.940   21.541  -58.504 1.00 51.15  ? 0   PHE A O   1 
ATOM   5    C  CB  . PHE A  1 5   ? 8.126   23.636  -57.574 1.00 58.84  ? 0   PHE A CB  1 
ATOM   6    C  CG  . PHE A  1 5   ? 8.214   24.687  -56.531 1.00 71.05  ? 0   PHE A CG  1 
ATOM   7    C  CD1 . PHE A  1 5   ? 8.154   24.375  -55.194 1.00 79.24  ? 0   PHE A CD1 1 
ATOM   8    C  CD2 . PHE A  1 5   ? 8.365   25.994  -56.891 1.00 75.23  ? 0   PHE A CD2 1 
ATOM   9    C  CE1 . PHE A  1 5   ? 8.230   25.368  -54.227 1.00 85.34  ? 0   PHE A CE1 1 
ATOM   10   C  CE2 . PHE A  1 5   ? 8.458   26.975  -55.943 1.00 82.05  ? 0   PHE A CE2 1 
ATOM   11   C  CZ  . PHE A  1 5   ? 8.390   26.660  -54.605 1.00 85.43  ? 0   PHE A CZ  1 
ATOM   12   N  N   . MET A  1 6   ? 7.966   20.797  -58.964 1.00 37.92  ? 1   MET A N   1 
ATOM   13   C  CA  . MET A  1 6   ? 7.539   19.872  -60.009 1.00 34.54  ? 1   MET A CA  1 
ATOM   14   C  C   . MET A  1 6   ? 8.170   18.491  -59.915 1.00 34.41  ? 1   MET A C   1 
ATOM   15   O  O   . MET A  1 6   ? 9.268   18.336  -59.524 1.00 26.52  ? 1   MET A O   1 
ATOM   16   C  CB  . MET A  1 6   ? 7.978   20.341  -61.348 1.00 41.15  ? 1   MET A CB  1 
ATOM   17   C  CG  . MET A  1 6   ? 7.405   21.584  -61.941 1.00 49.44  ? 1   MET A CG  1 
ATOM   18   S  SD  . MET A  1 6   ? 8.567   21.723  -63.324 1.00 122.31 ? 1   MET A SD  1 
ATOM   19   C  CE  . MET A  1 6   ? 7.716   20.854  -64.640 1.00 97.47  ? 1   MET A CE  1 
ATOM   20   N  N   . LEU A  1 7   ? 7.444   17.508  -60.375 1.00 30.95  ? 2   LEU A N   1 
ATOM   21   C  CA  . LEU A  1 7   ? 7.956   16.194  -60.614 1.00 28.89  ? 2   LEU A CA  1 
ATOM   22   C  C   . LEU A  1 7   ? 8.250   16.098  -62.073 1.00 31.06  ? 2   LEU A C   1 
ATOM   23   O  O   . LEU A  1 7   ? 7.397   16.319  -62.873 1.00 32.51  ? 2   LEU A O   1 
ATOM   24   C  CB  . LEU A  1 7   ? 6.933   15.140  -60.270 1.00 29.98  ? 2   LEU A CB  1 
ATOM   25   C  CG  . LEU A  1 7   ? 7.480   13.740  -60.296 1.00 27.13  ? 2   LEU A CG  1 
ATOM   26   C  CD1 . LEU A  1 7   ? 8.444   13.557  -59.163 1.00 29.94  ? 2   LEU A CD1 1 
ATOM   27   C  CD2 . LEU A  1 7   ? 6.376   12.731  -60.216 1.00 27.17  ? 2   LEU A CD2 1 
ATOM   28   N  N   . ARG A  1 8   ? 9.466   15.770  -62.420 1.00 28.21  ? 3   ARG A N   1 
ATOM   29   C  CA  . ARG A  1 8   ? 9.843   15.623  -63.790 1.00 23.02  ? 3   ARG A CA  1 
ATOM   30   C  C   . ARG A  1 8   ? 10.153  14.164  -64.030 1.00 29.81  ? 3   ARG A C   1 
ATOM   31   O  O   . ARG A  1 8   ? 10.870  13.580  -63.277 1.00 23.53  ? 3   ARG A O   1 
ATOM   32   C  CB  . ARG A  1 8   ? 11.045  16.491  -64.059 1.00 31.45  ? 3   ARG A CB  1 
ATOM   33   C  CG  . ARG A  1 8   ? 11.629  16.419  -65.451 1.00 39.96  ? 3   ARG A CG  1 
ATOM   34   C  CD  . ARG A  1 8   ? 12.786  17.381  -65.641 1.00 43.49  ? 3   ARG A CD  1 
ATOM   35   N  NE  . ARG A  1 8   ? 13.840  17.192  -64.660 1.00 46.00  ? 3   ARG A NE  1 
ATOM   36   C  CZ  . ARG A  1 8   ? 14.620  18.164  -64.206 1.00 47.39  ? 3   ARG A CZ  1 
ATOM   37   N  NH1 . ARG A  1 8   ? 14.484  19.401  -64.668 1.00 49.52  ? 3   ARG A NH1 1 
ATOM   38   N  NH2 . ARG A  1 8   ? 15.543  17.893  -63.325 1.00 37.37  ? 3   ARG A NH2 1 
ATOM   39   N  N   . VAL A  1 9   ? 9.584   13.592  -65.074 1.00 19.21  ? 4   VAL A N   1 
ATOM   40   C  CA  . VAL A  1 9   ? 9.738   12.179  -65.388 1.00 18.55  ? 4   VAL A CA  1 
ATOM   41   C  C   . VAL A  1 9   ? 10.141  11.983  -66.840 1.00 25.12  ? 4   VAL A C   1 
ATOM   42   O  O   . VAL A  1 9   ? 9.510   12.528  -67.748 1.00 28.55  ? 4   VAL A O   1 
ATOM   43   C  CB  . VAL A  1 9   ? 8.430   11.398  -65.136 1.00 28.02  ? 4   VAL A CB  1 
ATOM   44   C  CG1 . VAL A  1 9   ? 8.542   9.984   -65.680 1.00 24.02  ? 4   VAL A CG1 1 
ATOM   45   C  CG2 . VAL A  1 9   ? 8.092   11.377  -63.653 1.00 20.65  ? 4   VAL A CG2 1 
ATOM   46   N  N   . PHE A  1 10  ? 11.200  11.211  -67.053 1.00 17.67  ? 5   PHE A N   1 
ATOM   47   C  CA  . PHE A  1 10  ? 11.618  10.845  -68.394 1.00 17.93  ? 5   PHE A CA  1 
ATOM   48   C  C   . PHE A  1 10  ? 11.325  9.373   -68.618 1.00 22.33  ? 5   PHE A C   1 
ATOM   49   O  O   . PHE A  1 10  ? 11.940  8.506   -67.997 1.00 18.06  ? 5   PHE A O   1 
ATOM   50   C  CB  . PHE A  1 10  ? 13.107  11.133  -68.601 1.00 18.29  ? 5   PHE A CB  1 
ATOM   51   C  CG  . PHE A  1 10  ? 13.464  12.580  -68.445 1.00 18.49  ? 5   PHE A CG  1 
ATOM   52   C  CD1 . PHE A  1 10  ? 13.276  13.469  -69.488 1.00 19.52  ? 5   PHE A CD1 1 
ATOM   53   C  CD2 . PHE A  1 10  ? 13.981  13.052  -67.252 1.00 18.14  ? 5   PHE A CD2 1 
ATOM   54   C  CE1 . PHE A  1 10  ? 13.597  14.806  -69.344 1.00 24.04  ? 5   PHE A CE1 1 
ATOM   55   C  CE2 . PHE A  1 10  ? 14.303  14.385  -67.102 1.00 23.71  ? 5   PHE A CE2 1 
ATOM   56   C  CZ  . PHE A  1 10  ? 14.111  15.263  -68.149 1.00 23.54  ? 5   PHE A CZ  1 
ATOM   57   N  N   . ILE A  1 11  ? 10.363  9.096   -69.488 1.00 23.24  ? 6   ILE A N   1 
ATOM   58   C  CA  . ILE A  1 11  ? 10.095  7.727   -69.899 1.00 21.86  ? 6   ILE A CA  1 
ATOM   59   C  C   . ILE A  1 11  ? 10.968  7.428   -71.110 1.00 20.26  ? 6   ILE A C   1 
ATOM   60   O  O   . ILE A  1 11  ? 10.719  7.929   -72.208 1.00 20.44  ? 6   ILE A O   1 
ATOM   61   C  CB  . ILE A  1 11  ? 8.607   7.518   -70.227 1.00 25.06  ? 6   ILE A CB  1 
ATOM   62   C  CG1 . ILE A  1 11  ? 7.748   8.040   -69.071 1.00 25.50  ? 6   ILE A CG1 1 
ATOM   63   C  CG2 . ILE A  1 11  ? 8.327   6.049   -70.552 1.00 27.81  ? 6   ILE A CG2 1 
ATOM   64   C  CD1 . ILE A  1 11  ? 6.592   7.148   -68.682 1.00 36.13  ? 6   ILE A CD1 1 
ATOM   65   N  N   . LEU A  1 12  ? 12.007  6.628   -70.898 1.00 20.22  ? 7   LEU A N   1 
ATOM   66   C  CA  . LEU A  1 12  ? 13.013  6.403   -71.927 1.00 21.54  ? 7   LEU A CA  1 
ATOM   67   C  C   . LEU A  1 12  ? 12.604  5.297   -72.895 1.00 27.04  ? 7   LEU A C   1 
ATOM   68   O  O   . LEU A  1 12  ? 12.452  5.539   -74.092 1.00 24.21  ? 7   LEU A O   1 
ATOM   69   C  CB  . LEU A  1 12  ? 14.372  6.094   -71.291 1.00 28.54  ? 7   LEU A CB  1 
ATOM   70   C  CG  . LEU A  1 12  ? 14.894  7.172   -70.335 1.00 21.58  ? 7   LEU A CG  1 
ATOM   71   C  CD1 . LEU A  1 12  ? 16.352  6.923   -69.989 1.00 23.28  ? 7   LEU A CD1 1 
ATOM   72   C  CD2 . LEU A  1 12  ? 14.718  8.555   -70.941 1.00 24.07  ? 7   LEU A CD2 1 
ATOM   73   N  N   . TYR A  1 13  ? 12.421  4.088   -72.376 1.00 22.67  ? 8   TYR A N   1 
ATOM   74   C  CA  . TYR A  1 13  ? 12.070  2.959   -73.226 1.00 23.93  ? 8   TYR A CA  1 
ATOM   75   C  C   . TYR A  1 13  ? 11.579  1.758   -72.432 1.00 27.69  ? 8   TYR A C   1 
ATOM   76   O  O   . TYR A  1 13  ? 11.686  1.714   -71.206 1.00 23.22  ? 8   TYR A O   1 
ATOM   77   C  CB  . TYR A  1 13  ? 13.269  2.544   -74.083 1.00 26.48  ? 8   TYR A CB  1 
ATOM   78   C  CG  . TYR A  1 13  ? 14.474  2.092   -73.290 1.00 27.63  ? 8   TYR A CG  1 
ATOM   79   C  CD1 . TYR A  1 13  ? 15.444  3.001   -72.885 1.00 27.78  ? 8   TYR A CD1 1 
ATOM   80   C  CD2 . TYR A  1 13  ? 14.647  0.755   -72.950 1.00 29.08  ? 8   TYR A CD2 1 
ATOM   81   C  CE1 . TYR A  1 13  ? 16.554  2.592   -72.163 1.00 29.44  ? 8   TYR A CE1 1 
ATOM   82   C  CE2 . TYR A  1 13  ? 15.749  0.336   -72.227 1.00 30.98  ? 8   TYR A CE2 1 
ATOM   83   C  CZ  . TYR A  1 13  ? 16.699  1.259   -71.836 1.00 31.19  ? 8   TYR A CZ  1 
ATOM   84   O  OH  . TYR A  1 13  ? 17.797  0.843   -71.121 1.00 33.64  ? 8   TYR A OH  1 
ATOM   85   N  N   . ALA A  1 14  ? 11.042  0.784   -73.155 1.00 24.78  ? 9   ALA A N   1 
ATOM   86   C  CA  . ALA A  1 14  ? 10.700  -0.507  -72.584 1.00 28.70  ? 9   ALA A CA  1 
ATOM   87   C  C   . ALA A  1 14  ? 11.395  -1.580  -73.404 1.00 27.97  ? 9   ALA A C   1 
ATOM   88   O  O   . ALA A  1 14  ? 11.679  -1.378  -74.583 1.00 29.06  ? 9   ALA A O   1 
ATOM   89   C  CB  . ALA A  1 14  ? 9.198   -0.718  -72.596 1.00 24.63  ? 9   ALA A CB  1 
ATOM   90   N  N   . GLU A  1 15  ? 11.678  -2.716  -72.781 1.00 29.54  ? 10  GLU A N   1 
ATOM   91   C  CA  . GLU A  1 15  ? 12.334  -3.810  -73.481 1.00 40.55  ? 10  GLU A CA  1 
ATOM   92   C  C   . GLU A  1 15  ? 11.514  -5.081  -73.380 1.00 33.54  ? 10  GLU A C   1 
ATOM   93   O  O   . GLU A  1 15  ? 10.780  -5.279  -72.408 1.00 35.22  ? 10  GLU A O   1 
ATOM   94   C  CB  . GLU A  1 15  ? 13.730  -4.052  -72.916 1.00 44.32  ? 10  GLU A CB  1 
ATOM   95   C  CG  . GLU A  1 15  ? 14.706  -2.927  -73.177 1.00 56.21  ? 10  GLU A CG  1 
ATOM   96   C  CD  . GLU A  1 15  ? 16.118  -3.302  -72.793 1.00 65.25  ? 10  GLU A CD  1 
ATOM   97   O  OE1 . GLU A  1 15  ? 16.289  -3.947  -71.738 1.00 67.20  ? 10  GLU A OE1 1 
ATOM   98   O  OE2 . GLU A  1 15  ? 17.054  -2.972  -73.552 1.00 68.10  ? 10  GLU A OE2 1 
ATOM   99   N  N   . ASN A  1 16  ? 11.653  -5.940  -74.387 1.00 35.88  ? 11  ASN A N   1 
ATOM   100  C  CA  . ASN A  1 16  ? 10.923  -7.203  -74.445 1.00 46.81  ? 11  ASN A CA  1 
ATOM   101  C  C   . ASN A  1 16  ? 9.414   -7.027  -74.339 1.00 44.03  ? 11  ASN A C   1 
ATOM   102  O  O   . ASN A  1 16  ? 8.752   -7.736  -73.585 1.00 35.21  ? 11  ASN A O   1 
ATOM   103  C  CB  . ASN A  1 16  ? 11.425  -8.169  -73.367 1.00 59.15  ? 11  ASN A CB  1 
ATOM   104  C  CG  . ASN A  1 16  ? 12.696  -8.885  -73.775 1.00 70.38  ? 11  ASN A CG  1 
ATOM   105  O  OD1 . ASN A  1 16  ? 12.695  -10.096 -73.997 1.00 78.56  ? 11  ASN A OD1 1 
ATOM   106  N  ND2 . ASN A  1 16  ? 13.786  -8.136  -73.893 1.00 70.99  ? 11  ASN A ND2 1 
ATOM   107  N  N   . VAL A  1 17  ? 8.869   -6.077  -75.088 1.00 33.04  ? 12  VAL A N   1 
ATOM   108  C  CA  . VAL A  1 17  ? 7.433   -5.853  -75.067 1.00 36.33  ? 12  VAL A CA  1 
ATOM   109  C  C   . VAL A  1 17  ? 6.763   -6.798  -76.046 1.00 39.61  ? 12  VAL A C   1 
ATOM   110  O  O   . VAL A  1 17  ? 7.075   -6.800  -77.236 1.00 38.64  ? 12  VAL A O   1 
ATOM   111  C  CB  . VAL A  1 17  ? 7.069   -4.411  -75.429 1.00 40.64  ? 12  VAL A CB  1 
ATOM   112  C  CG1 . VAL A  1 17  ? 5.577   -4.186  -75.222 1.00 38.98  ? 12  VAL A CG1 1 
ATOM   113  C  CG2 . VAL A  1 17  ? 7.883   -3.447  -74.591 1.00 37.12  ? 12  VAL A CG2 1 
ATOM   114  N  N   . HIS A  1 18  ? 5.852   -7.615  -75.535 1.00 39.16  ? 13  HIS A N   1 
ATOM   115  C  CA  . HIS A  1 18  ? 5.140   -8.562  -76.377 1.00 47.98  ? 13  HIS A CA  1 
ATOM   116  C  C   . HIS A  1 18  ? 3.641   -8.480  -76.144 1.00 51.27  ? 13  HIS A C   1 
ATOM   117  O  O   . HIS A  1 18  ? 3.163   -8.597  -75.016 1.00 53.96  ? 13  HIS A O   1 
ATOM   118  C  CB  . HIS A  1 18  ? 5.659   -9.984  -76.151 1.00 44.68  ? 13  HIS A CB  1 
ATOM   119  C  CG  . HIS A  1 18  ? 7.086   -10.173 -76.561 1.00 49.16  ? 13  HIS A CG  1 
ATOM   120  N  ND1 . HIS A  1 18  ? 7.487   -10.171 -77.880 1.00 51.16  ? 13  HIS A ND1 1 
ATOM   121  C  CD2 . HIS A  1 18  ? 8.210   -10.363 -75.828 1.00 51.49  ? 13  HIS A CD2 1 
ATOM   122  C  CE1 . HIS A  1 18  ? 8.794   -10.353 -77.943 1.00 56.12  ? 13  HIS A CE1 1 
ATOM   123  N  NE2 . HIS A  1 18  ? 9.256   -10.474 -76.711 1.00 56.54  ? 13  HIS A NE2 1 
ATOM   124  N  N   . THR A  1 19  ? 2.907   -8.253  -77.223 1.00 47.86  ? 14  THR A N   1 
ATOM   125  C  CA  . THR A  1 19  ? 1.462   -8.163  -77.155 1.00 46.89  ? 14  THR A CA  1 
ATOM   126  C  C   . THR A  1 19  ? 0.867   -9.531  -77.474 1.00 49.91  ? 14  THR A C   1 
ATOM   127  O  O   . THR A  1 19  ? 1.213   -10.134 -78.492 1.00 54.74  ? 14  THR A O   1 
ATOM   128  C  CB  . THR A  1 19  ? 0.939   -7.120  -78.156 1.00 47.20  ? 14  THR A CB  1 
ATOM   129  O  OG1 . THR A  1 19  ? 1.636   -5.878  -77.980 1.00 45.62  ? 14  THR A OG1 1 
ATOM   130  C  CG2 . THR A  1 19  ? -0.556  -6.905  -77.992 1.00 52.40  ? 14  THR A CG2 1 
ATOM   131  N  N   . PRO A  1 20  ? -0.021  -10.031 -76.597 1.00 53.84  ? 15  PRO A N   1 
ATOM   132  C  CA  . PRO A  1 20  ? -0.711  -11.311 -76.804 1.00 60.74  ? 15  PRO A CA  1 
ATOM   133  C  C   . PRO A  1 20  ? -1.442  -11.376 -78.153 1.00 62.71  ? 15  PRO A C   1 
ATOM   134  O  O   . PRO A  1 20  ? -2.144  -10.438 -78.530 1.00 66.54  ? 15  PRO A O   1 
ATOM   135  C  CB  . PRO A  1 20  ? -1.726  -11.356 -75.654 1.00 58.76  ? 15  PRO A CB  1 
ATOM   136  C  CG  . PRO A  1 20  ? -1.176  -10.446 -74.610 1.00 59.69  ? 15  PRO A CG  1 
ATOM   137  C  CD  . PRO A  1 20  ? -0.429  -9.373  -75.342 1.00 54.74  ? 15  PRO A CD  1 
ATOM   138  N  N   . ASP A  1 21  ? -1.260  -12.485 -78.864 1.00 57.03  ? 16  ASP A N   1 
ATOM   139  C  CA  . ASP A  1 21  ? -1.932  -12.757 -80.140 1.00 61.57  ? 16  ASP A CA  1 
ATOM   140  C  C   . ASP A  1 21  ? -1.717  -11.711 -81.231 1.00 44.98  ? 16  ASP A C   1 
ATOM   141  O  O   . ASP A  1 21  ? -2.601  -11.440 -82.051 1.00 47.83  ? 16  ASP A O   1 
ATOM   142  C  CB  . ASP A  1 21  ? -3.416  -13.058 -79.932 1.00 71.70  ? 16  ASP A CB  1 
ATOM   143  C  CG  . ASP A  1 21  ? -3.635  -14.310 -79.119 1.00 82.80  ? 16  ASP A CG  1 
ATOM   144  O  OD1 . ASP A  1 21  ? -3.272  -15.401 -79.609 1.00 89.33  ? 16  ASP A OD1 1 
ATOM   145  O  OD2 . ASP A  1 21  ? -4.163  -14.202 -77.990 1.00 82.96  ? 16  ASP A OD2 1 
ATOM   146  N  N   . THR A  1 22  ? -0.518  -11.146 -81.232 1.00 43.73  ? 17  THR A N   1 
ATOM   147  C  CA  . THR A  1 22  ? -0.083  -10.261 -82.290 1.00 56.55  ? 17  THR A CA  1 
ATOM   148  C  C   . THR A  1 22  ? 1.379   -10.597 -82.570 1.00 44.95  ? 17  THR A C   1 
ATOM   149  O  O   . THR A  1 22  ? 2.080   -11.123 -81.698 1.00 56.56  ? 17  THR A O   1 
ATOM   150  C  CB  . THR A  1 22  ? -0.236  -8.789  -81.873 1.00 53.98  ? 17  THR A CB  1 
ATOM   151  O  OG1 . THR A  1 22  ? -0.658  -8.006  -82.996 1.00 59.21  ? 17  THR A OG1 1 
ATOM   152  C  CG2 . THR A  1 22  ? 1.069   -8.253  -81.346 1.00 40.40  ? 17  THR A CG2 1 
ATOM   153  N  N   . ASP A  1 23  ? 1.835   -10.323 -83.786 1.00 49.85  ? 18  ASP A N   1 
ATOM   154  C  CA  . ASP A  1 23  ? 3.211   -10.631 -84.143 1.00 53.89  ? 18  ASP A CA  1 
ATOM   155  C  C   . ASP A  1 23  ? 4.167   -9.530  -83.689 1.00 56.56  ? 18  ASP A C   1 
ATOM   156  O  O   . ASP A  1 23  ? 5.264   -9.814  -83.204 1.00 62.37  ? 18  ASP A O   1 
ATOM   157  C  CB  . ASP A  1 23  ? 3.344   -10.915 -85.646 1.00 52.80  ? 18  ASP A CB  1 
ATOM   158  C  CG  . ASP A  1 23  ? 3.168   -9.675  -86.508 1.00 62.23  ? 18  ASP A CG  1 
ATOM   159  O  OD1 . ASP A  1 23  ? 2.317   -8.817  -86.185 1.00 51.88  ? 18  ASP A OD1 1 
ATOM   160  O  OD2 . ASP A  1 23  ? 3.886   -9.568  -87.524 1.00 63.91  ? 18  ASP A OD2 1 
ATOM   161  N  N   . ILE A  1 24  ? 3.740   -8.277  -83.835 1.00 54.44  ? 19  ILE A N   1 
ATOM   162  C  CA  . ILE A  1 24  ? 4.576   -7.133  -83.474 1.00 53.59  ? 19  ILE A CA  1 
ATOM   163  C  C   . ILE A  1 24  ? 3.862   -6.193  -82.518 1.00 52.85  ? 19  ILE A C   1 
ATOM   164  O  O   . ILE A  1 24  ? 2.643   -6.037  -82.585 1.00 55.58  ? 19  ILE A O   1 
ATOM   165  C  CB  . ILE A  1 24  ? 5.010   -6.344  -84.711 1.00 58.63  ? 19  ILE A CB  1 
ATOM   166  C  CG1 . ILE A  1 24  ? 3.787   -5.997  -85.555 1.00 63.50  ? 19  ILE A CG1 1 
ATOM   167  C  CG2 . ILE A  1 24  ? 5.971   -7.174  -85.521 1.00 65.50  ? 19  ILE A CG2 1 
ATOM   168  C  CD1 . ILE A  1 24  ? 3.749   -4.601  -86.065 1.00 67.69  ? 19  ILE A CD1 1 
ATOM   169  N  N   . SER A  1 25  ? 4.626   -5.559  -81.634 1.00 53.17  ? 20  SER A N   1 
ATOM   170  C  CA  . SER A  1 25  ? 4.036   -4.731  -80.591 1.00 51.16  ? 20  SER A CA  1 
ATOM   171  C  C   . SER A  1 25  ? 3.877   -3.257  -80.974 1.00 43.42  ? 20  SER A C   1 
ATOM   172  O  O   . SER A  1 25  ? 4.774   -2.648  -81.564 1.00 38.59  ? 20  SER A O   1 
ATOM   173  C  CB  . SER A  1 25  ? 4.849   -4.858  -79.303 1.00 57.04  ? 20  SER A CB  1 
ATOM   174  O  OG  . SER A  1 25  ? 5.803   -5.904  -79.411 1.00 64.63  ? 20  SER A OG  1 
ATOM   175  N  N   . ASP A  1 26  ? 2.725   -2.696  -80.622 1.00 44.60  ? 21  ASP A N   1 
ATOM   176  C  CA  . ASP A  1 26  ? 2.429   -1.297  -80.884 1.00 51.63  ? 21  ASP A CA  1 
ATOM   177  C  C   . ASP A  1 26  ? 2.139   -0.581  -79.567 1.00 51.80  ? 21  ASP A C   1 
ATOM   178  O  O   . ASP A  1 26  ? 0.979   -0.406  -79.193 1.00 64.46  ? 21  ASP A O   1 
ATOM   179  C  CB  . ASP A  1 26  ? 1.217   -1.197  -81.804 1.00 64.35  ? 21  ASP A CB  1 
ATOM   180  C  CG  . ASP A  1 26  ? 0.993   0.197   -82.298 1.00 76.45  ? 21  ASP A CG  1 
ATOM   181  O  OD1 . ASP A  1 26  ? 2.003   0.882   -82.518 1.00 81.82  ? 21  ASP A OD1 1 
ATOM   182  O  OD2 . ASP A  1 26  ? -0.174  0.611   -82.452 1.00 81.06  ? 21  ASP A OD2 1 
ATOM   183  N  N   . ALA A  1 27  ? 3.196   -0.140  -78.890 1.00 37.10  ? 22  ALA A N   1 
ATOM   184  C  CA  . ALA A  1 27  ? 3.101   0.222   -77.479 1.00 36.43  ? 22  ALA A CA  1 
ATOM   185  C  C   . ALA A  1 27  ? 3.222   1.715   -77.168 1.00 30.58  ? 22  ALA A C   1 
ATOM   186  O  O   . ALA A  1 27  ? 3.968   2.454   -77.819 1.00 26.46  ? 22  ALA A O   1 
ATOM   187  C  CB  . ALA A  1 27  ? 4.134   -0.564  -76.668 1.00 27.84  ? 22  ALA A CB  1 
ATOM   188  N  N   . TYR A  1 28  ? 2.482   2.140   -76.150 1.00 28.53  ? 23  TYR A N   1 
ATOM   189  C  CA  . TYR A  1 28  ? 2.633   3.473   -75.584 1.00 26.34  ? 23  TYR A CA  1 
ATOM   190  C  C   . TYR A  1 28  ? 2.600   3.391   -74.058 1.00 30.83  ? 23  TYR A C   1 
ATOM   191  O  O   . TYR A  1 28  ? 2.165   2.388   -73.489 1.00 25.93  ? 23  TYR A O   1 
ATOM   192  C  CB  . TYR A  1 28  ? 1.545   4.417   -76.104 1.00 31.23  ? 23  TYR A CB  1 
ATOM   193  C  CG  . TYR A  1 28  ? 0.168   4.184   -75.516 1.00 28.93  ? 23  TYR A CG  1 
ATOM   194  C  CD1 . TYR A  1 28  ? -0.733  3.312   -76.115 1.00 30.24  ? 23  TYR A CD1 1 
ATOM   195  C  CD2 . TYR A  1 28  ? -0.235  4.851   -74.368 1.00 28.50  ? 23  TYR A CD2 1 
ATOM   196  C  CE1 . TYR A  1 28  ? -1.994  3.105   -75.574 1.00 39.39  ? 23  TYR A CE1 1 
ATOM   197  C  CE2 . TYR A  1 28  ? -1.481  4.651   -73.826 1.00 33.69  ? 23  TYR A CE2 1 
ATOM   198  C  CZ  . TYR A  1 28  ? -2.363  3.780   -74.428 1.00 41.77  ? 23  TYR A CZ  1 
ATOM   199  O  OH  . TYR A  1 28  ? -3.611  3.588   -73.880 1.00 42.86  ? 23  TYR A OH  1 
ATOM   200  N  N   . CYS A  1 29  ? 2.904   4.277   -73.330 1.00 28.00  ? 24  CYS A N   1 
ATOM   201  C  CA  . CYS A  1 29  ? 3.005   4.256   -71.874 1.00 23.82  ? 24  CYS A CA  1 
ATOM   202  C  C   . CYS A  1 29  ? 2.071   5.260   -71.211 1.00 27.64  ? 24  CYS A C   1 
ATOM   203  O  O   . CYS A  1 29  ? 2.029   6.429   -71.592 1.00 33.98  ? 24  CYS A O   1 
ATOM   204  C  CB  . CYS A  1 29  ? 4.445   4.528   -71.436 1.00 24.03  ? 24  CYS A CB  1 
ATOM   205  S  SG  . CYS A  1 29  ? 4.724   4.447   -69.660 1.00 43.40  ? 24  CYS A SG  1 
ATOM   206  N  N   . SER A  1 30  ? 1.413   4.962   -70.322 1.00 25.05  ? 25  SER A N   1 
ATOM   207  C  CA  . SER A  1 30  ? 0.496   5.810   -69.571 1.00 30.53  ? 25  SER A CA  1 
ATOM   208  C  C   . SER A  1 30  ? 1.043   6.037   -68.170 1.00 40.40  ? 25  SER A C   1 
ATOM   209  O  O   . SER A  1 30  ? 1.355   5.085   -67.457 1.00 44.26  ? 25  SER A O   1 
ATOM   210  C  CB  . SER A  1 30  ? -0.892  5.177   -69.493 1.00 39.08  ? 25  SER A CB  1 
ATOM   211  O  OG  . SER A  1 30  ? -1.793  6.026   -68.805 1.00 48.32  ? 25  SER A OG  1 
ATOM   212  N  N   . ALA A  1 31  ? 1.170   7.301   -67.784 1.00 39.43  ? 26  ALA A N   1 
ATOM   213  C  CA  . ALA A  1 31  ? 1.682   7.647   -66.464 1.00 21.50  ? 26  ALA A CA  1 
ATOM   214  C  C   . ALA A  1 31  ? 0.703   8.548   -65.726 1.00 33.59  ? 26  ALA A C   1 
ATOM   215  O  O   . ALA A  1 31  ? 0.207   9.529   -66.282 1.00 36.76  ? 26  ALA A O   1 
ATOM   216  C  CB  . ALA A  1 31  ? 3.044   8.315   -66.579 1.00 20.13  ? 26  ALA A CB  1 
ATOM   217  N  N   . VAL A  1 32  ? 0.421   8.201   -64.475 1.00 30.56  ? 27  VAL A N   1 
ATOM   218  C  CA  . VAL A  1 32  ? -0.500  8.978   -63.658 1.00 29.41  ? 27  VAL A CA  1 
ATOM   219  C  C   . VAL A  1 32  ? 0.143   9.440   -62.359 1.00 32.31  ? 27  VAL A C   1 
ATOM   220  O  O   . VAL A  1 32  ? 0.597   8.629   -61.551 1.00 33.35  ? 27  VAL A O   1 
ATOM   221  C  CB  . VAL A  1 32  ? -1.771  8.178   -63.311 1.00 29.69  ? 27  VAL A CB  1 
ATOM   222  C  CG1 . VAL A  1 32  ? -2.624  8.947   -62.313 1.00 34.01  ? 27  VAL A CG1 1 
ATOM   223  C  CG2 . VAL A  1 32  ? -2.566  7.868   -64.571 1.00 29.85  ? 27  VAL A CG2 1 
ATOM   224  N  N   . PHE A  1 33  ? 0.186   10.753  -62.166 1.00 33.73  ? 28  PHE A N   1 
ATOM   225  C  CA  . PHE A  1 33  ? 0.576   11.307  -60.879 1.00 39.26  ? 28  PHE A CA  1 
ATOM   226  C  C   . PHE A  1 33  ? -0.213  12.569  -60.554 1.00 36.81  ? 28  PHE A C   1 
ATOM   227  O  O   . PHE A  1 33  ? -0.620  13.304  -61.454 1.00 31.84  ? 28  PHE A O   1 
ATOM   228  C  CB  . PHE A  1 33  ? 2.074   11.595  -60.818 1.00 35.45  ? 28  PHE A CB  1 
ATOM   229  C  CG  . PHE A  1 33  ? 2.567   11.874  -59.430 1.00 37.46  ? 28  PHE A CG  1 
ATOM   230  C  CD1 . PHE A  1 33  ? 2.806   10.835  -58.548 1.00 29.26  ? 28  PHE A CD1 1 
ATOM   231  C  CD2 . PHE A  1 33  ? 2.767   13.171  -58.995 1.00 34.60  ? 28  PHE A CD2 1 
ATOM   232  C  CE1 . PHE A  1 33  ? 3.248   11.085  -57.263 1.00 31.86  ? 28  PHE A CE1 1 
ATOM   233  C  CE2 . PHE A  1 33  ? 3.211   13.420  -57.713 1.00 38.10  ? 28  PHE A CE2 1 
ATOM   234  C  CZ  . PHE A  1 33  ? 3.453   12.380  -56.849 1.00 35.52  ? 28  PHE A CZ  1 
ATOM   235  N  N   . ALA A  1 34  ? -0.415  12.800  -59.258 1.00 33.66  ? 29  ALA A N   1 
ATOM   236  C  CA  . ALA A  1 34  ? -1.164  13.951  -58.758 1.00 45.52  ? 29  ALA A CA  1 
ATOM   237  C  C   . ALA A  1 34  ? -2.527  14.062  -59.427 1.00 45.85  ? 29  ALA A C   1 
ATOM   238  O  O   . ALA A  1 34  ? -3.010  15.160  -59.701 1.00 47.80  ? 29  ALA A O   1 
ATOM   239  C  CB  . ALA A  1 34  ? -0.365  15.236  -58.938 1.00 49.21  ? 29  ALA A CB  1 
ATOM   240  N  N   . GLY A  1 35  ? -3.134  12.911  -59.698 1.00 44.96  ? 30  GLY A N   1 
ATOM   241  C  CA  . GLY A  1 35  ? -4.415  12.859  -60.373 1.00 39.91  ? 30  GLY A CA  1 
ATOM   242  C  C   . GLY A  1 35  ? -4.355  13.310  -61.820 1.00 44.19  ? 30  GLY A C   1 
ATOM   243  O  O   . GLY A  1 35  ? -5.389  13.583  -62.426 1.00 46.86  ? 30  GLY A O   1 
ATOM   244  N  N   . VAL A  1 36  ? -3.151  13.400  -62.380 1.00 40.51  ? 31  VAL A N   1 
ATOM   245  C  CA  . VAL A  1 36  ? -3.001  13.803  -63.777 1.00 42.16  ? 31  VAL A CA  1 
ATOM   246  C  C   . VAL A  1 36  ? -2.355  12.710  -64.629 1.00 36.44  ? 31  VAL A C   1 
ATOM   247  O  O   . VAL A  1 36  ? -1.220  12.301  -64.384 1.00 35.01  ? 31  VAL A O   1 
ATOM   248  C  CB  . VAL A  1 36  ? -2.205  15.118  -63.928 1.00 35.03  ? 31  VAL A CB  1 
ATOM   249  C  CG1 . VAL A  1 36  ? -2.154  15.533  -65.394 1.00 36.30  ? 31  VAL A CG1 1 
ATOM   250  C  CG2 . VAL A  1 36  ? -2.829  16.221  -63.081 1.00 38.95  ? 31  VAL A CG2 1 
ATOM   251  N  N   . LYS A  1 37  ? -3.095  12.240  -65.629 1.00 33.92  ? 32  LYS A N   1 
ATOM   252  C  CA  . LYS A  1 37  ? -2.609  11.217  -66.547 1.00 30.19  ? 32  LYS A CA  1 
ATOM   253  C  C   . LYS A  1 37  ? -1.941  11.842  -67.768 1.00 31.46  ? 32  LYS A C   1 
ATOM   254  O  O   . LYS A  1 37  ? -2.514  12.706  -68.433 1.00 31.34  ? 32  LYS A O   1 
ATOM   255  C  CB  . LYS A  1 37  ? -3.754  10.298  -66.990 1.00 36.39  ? 32  LYS A CB  1 
ATOM   256  C  CG  . LYS A  1 37  ? -3.386  9.367   -68.143 1.00 43.49  ? 32  LYS A CG  1 
ATOM   257  C  CD  . LYS A  1 37  ? -4.520  8.417   -68.512 1.00 45.73  ? 32  LYS A CD  1 
ATOM   258  C  CE  . LYS A  1 37  ? -4.585  7.232   -67.561 1.00 47.01  ? 32  LYS A CE  1 
ATOM   259  N  NZ  . LYS A  1 37  ? -5.568  6.208   -68.012 1.00 59.47  ? 32  LYS A NZ  1 
ATOM   260  N  N   . LYS A  1 38  ? -0.719  11.408  -68.051 1.00 26.64  ? 33  LYS A N   1 
ATOM   261  C  CA  . LYS A  1 38  ? -0.015  11.832  -69.251 1.00 32.86  ? 33  LYS A CA  1 
ATOM   262  C  C   . LYS A  1 38  ? 0.328   10.588  -70.058 1.00 31.46  ? 33  LYS A C   1 
ATOM   263  O  O   . LYS A  1 38  ? 0.496   9.509   -69.491 1.00 26.26  ? 33  LYS A O   1 
ATOM   264  C  CB  . LYS A  1 38  ? 1.256   12.606  -68.888 1.00 31.89  ? 33  LYS A CB  1 
ATOM   265  C  CG  . LYS A  1 38  ? 1.008   13.857  -68.050 1.00 32.36  ? 33  LYS A CG  1 
ATOM   266  C  CD  . LYS A  1 38  ? 2.314   14.533  -67.656 1.00 35.00  ? 33  LYS A CD  1 
ATOM   267  C  CE  . LYS A  1 38  ? 2.082   15.679  -66.681 1.00 29.46  ? 33  LYS A CE  1 
ATOM   268  N  NZ  . LYS A  1 38  ? 1.444   16.859  -67.318 1.00 31.14  ? 33  LYS A NZ  1 
ATOM   269  N  N   . ARG A  1 39  ? 0.421   10.731  -71.376 1.00 32.82  ? 34  ARG A N   1 
ATOM   270  C  CA  . ARG A  1 39  ? 0.728   9.592   -72.234 1.00 34.73  ? 34  ARG A CA  1 
ATOM   271  C  C   . ARG A  1 39  ? 1.853   9.902   -73.205 1.00 26.64  ? 34  ARG A C   1 
ATOM   272  O  O   . ARG A  1 39  ? 1.951   11.016  -73.722 1.00 30.27  ? 34  ARG A O   1 
ATOM   273  C  CB  . ARG A  1 39  ? -0.507  9.159   -73.032 1.00 41.47  ? 34  ARG A CB  1 
ATOM   274  C  CG  . ARG A  1 39  ? -1.679  8.670   -72.194 1.00 51.93  ? 34  ARG A CG  1 
ATOM   275  C  CD  . ARG A  1 39  ? -2.718  7.971   -73.068 1.00 57.66  ? 34  ARG A CD  1 
ATOM   276  N  NE  . ARG A  1 39  ? -3.988  7.741   -72.376 1.00 61.15  ? 34  ARG A NE  1 
ATOM   277  C  CZ  . ARG A  1 39  ? -4.347  6.602   -71.786 1.00 60.60  ? 34  ARG A CZ  1 
ATOM   278  N  NH1 . ARG A  1 39  ? -3.539  5.553   -71.783 1.00 62.85  ? 34  ARG A NH1 1 
ATOM   279  N  NH2 . ARG A  1 39  ? -5.528  6.513   -71.192 1.00 61.04  ? 34  ARG A NH2 1 
ATOM   280  N  N   . THR A  1 40  ? 2.698   8.909   -73.456 1.00 26.64  ? 35  THR A N   1 
ATOM   281  C  CA  . THR A  1 40  ? 3.690   9.020   -74.511 1.00 30.39  ? 35  THR A CA  1 
ATOM   282  C  C   . THR A  1 40  ? 2.997   8.757   -75.839 1.00 32.27  ? 35  THR A C   1 
ATOM   283  O  O   . THR A  1 40  ? 1.839   8.341   -75.876 1.00 31.27  ? 35  THR A O   1 
ATOM   284  C  CB  . THR A  1 40  ? 4.817   7.981   -74.360 1.00 32.62  ? 35  THR A CB  1 
ATOM   285  O  OG1 . THR A  1 40  ? 4.296   6.670   -74.619 1.00 27.22  ? 35  THR A OG1 1 
ATOM   286  C  CG2 . THR A  1 40  ? 5.440   8.029   -72.959 1.00 19.23  ? 35  THR A CG2 1 
ATOM   287  N  N   . LYS A  1 41  ? 3.709   8.996   -76.932 1.00 33.30  ? 36  LYS A N   1 
ATOM   288  C  CA  . LYS A  1 41  ? 3.188   8.651   -78.241 1.00 37.08  ? 36  LYS A CA  1 
ATOM   289  C  C   . LYS A  1 41  ? 3.275   7.142   -78.417 1.00 32.69  ? 36  LYS A C   1 
ATOM   290  O  O   . LYS A  1 41  ? 3.938   6.454   -77.641 1.00 33.10  ? 36  LYS A O   1 
ATOM   291  C  CB  . LYS A  1 41  ? 3.975   9.367   -79.338 1.00 42.78  ? 36  LYS A CB  1 
ATOM   292  C  CG  . LYS A  1 41  ? 5.454   9.018   -79.380 1.00 43.97  ? 36  LYS A CG  1 
ATOM   293  C  CD  . LYS A  1 41  ? 6.200   9.933   -80.342 1.00 53.78  ? 36  LYS A CD  1 
ATOM   294  C  CE  . LYS A  1 41  ? 7.688   9.614   -80.391 1.00 56.75  ? 36  LYS A CE  1 
ATOM   295  N  NZ  . LYS A  1 41  ? 8.328   9.678   -79.047 1.00 55.12  ? 36  LYS A NZ  1 
ATOM   296  N  N   . VAL A  1 42  ? 2.591   6.625   -79.427 1.00 31.84  ? 37  VAL A N   1 
ATOM   297  C  CA  . VAL A  1 42  ? 2.690   5.210   -79.737 1.00 34.45  ? 37  VAL A CA  1 
ATOM   298  C  C   . VAL A  1 42  ? 3.909   4.967   -80.618 1.00 33.93  ? 37  VAL A C   1 
ATOM   299  O  O   . VAL A  1 42  ? 4.192   5.743   -81.532 1.00 34.43  ? 37  VAL A O   1 
ATOM   300  C  CB  . VAL A  1 42  ? 1.426   4.694   -80.449 1.00 38.26  ? 37  VAL A CB  1 
ATOM   301  C  CG1 . VAL A  1 42  ? 1.542   3.222   -80.721 1.00 37.37  ? 37  VAL A CG1 1 
ATOM   302  C  CG2 . VAL A  1 42  ? 0.205   4.948   -79.600 1.00 41.08  ? 37  VAL A CG2 1 
ATOM   303  N  N   . ILE A  1 43  ? 4.644   3.902   -80.321 1.00 31.07  ? 38  ILE A N   1 
ATOM   304  C  CA  . ILE A  1 43  ? 5.724   3.461   -81.186 1.00 32.24  ? 38  ILE A CA  1 
ATOM   305  C  C   . ILE A  1 43  ? 5.245   2.252   -81.975 1.00 37.95  ? 38  ILE A C   1 
ATOM   306  O  O   . ILE A  1 43  ? 5.097   1.161   -81.422 1.00 39.93  ? 38  ILE A O   1 
ATOM   307  C  CB  . ILE A  1 43  ? 6.979   3.071   -80.387 1.00 30.92  ? 38  ILE A CB  1 
ATOM   308  C  CG1 . ILE A  1 43  ? 7.488   4.257   -79.562 1.00 29.35  ? 38  ILE A CG1 1 
ATOM   309  C  CG2 . ILE A  1 43  ? 8.065   2.587   -81.327 1.00 30.84  ? 38  ILE A CG2 1 
ATOM   310  C  CD1 . ILE A  1 43  ? 8.016   5.405   -80.396 1.00 28.06  ? 38  ILE A CD1 1 
ATOM   311  N  N   . LYS A  1 44  ? 4.994   2.446   -83.266 1.00 35.87  ? 39  LYS A N   1 
ATOM   312  C  CA  . LYS A  1 44  ? 4.487   1.367   -84.102 1.00 38.64  ? 39  LYS A CA  1 
ATOM   313  C  C   . LYS A  1 44  ? 5.545   0.294   -84.307 1.00 46.29  ? 39  LYS A C   1 
ATOM   314  O  O   . LYS A  1 44  ? 6.714   0.606   -84.535 1.00 43.57  ? 39  LYS A O   1 
ATOM   315  C  CB  . LYS A  1 44  ? 4.008   1.891   -85.463 1.00 42.10  ? 39  LYS A CB  1 
ATOM   316  C  CG  . LYS A  1 44  ? 3.223   3.198   -85.422 1.00 48.15  ? 39  LYS A CG  1 
ATOM   317  C  CD  . LYS A  1 44  ? 1.932   3.090   -84.624 1.00 50.28  ? 39  LYS A CD  1 
ATOM   318  C  CE  . LYS A  1 44  ? 0.951   2.114   -85.249 1.00 58.36  ? 39  LYS A CE  1 
ATOM   319  N  NZ  . LYS A  1 44  ? -0.361  2.123   -84.542 1.00 61.92  ? 39  LYS A NZ  1 
ATOM   320  N  N   . ASN A  1 45  ? 5.126   -0.966  -84.208 1.00 44.08  ? 40  ASN A N   1 
ATOM   321  C  CA  . ASN A  1 45  ? 5.950   -2.096  -84.625 1.00 46.39  ? 40  ASN A CA  1 
ATOM   322  C  C   . ASN A  1 45  ? 7.319   -2.162  -83.950 1.00 48.43  ? 40  ASN A C   1 
ATOM   323  O  O   . ASN A  1 45  ? 8.341   -1.925  -84.596 1.00 51.23  ? 40  ASN A O   1 
ATOM   324  C  CB  . ASN A  1 45  ? 6.128   -2.059  -86.148 1.00 57.68  ? 40  ASN A CB  1 
ATOM   325  C  CG  . ASN A  1 45  ? 4.893   -1.530  -86.867 1.00 64.53  ? 40  ASN A CG  1 
ATOM   326  O  OD1 . ASN A  1 45  ? 3.824   -1.391  -86.271 1.00 69.55  ? 40  ASN A OD1 1 
ATOM   327  N  ND2 . ASN A  1 45  ? 5.035   -1.241  -88.154 1.00 62.16  ? 40  ASN A ND2 1 
ATOM   328  N  N   . SER A  1 46  ? 7.343   -2.483  -82.657 1.00 43.29  ? 41  SER A N   1 
ATOM   329  C  CA  . SER A  1 46  ? 8.605   -2.540  -81.922 1.00 39.52  ? 41  SER A CA  1 
ATOM   330  C  C   . SER A  1 46  ? 8.535   -3.353  -80.627 1.00 38.97  ? 41  SER A C   1 
ATOM   331  O  O   . SER A  1 46  ? 7.591   -3.231  -79.847 1.00 36.68  ? 41  SER A O   1 
ATOM   332  C  CB  . SER A  1 46  ? 9.112   -1.125  -81.628 1.00 43.40  ? 41  SER A CB  1 
ATOM   333  O  OG  . SER A  1 46  ? 10.416  -1.153  -81.073 1.00 50.36  ? 41  SER A OG  1 
ATOM   334  N  N   . VAL A  1 47  ? 9.552   -4.179  -80.409 1.00 36.81  ? 42  VAL A N   1 
ATOM   335  C  CA  . VAL A  1 47  ? 9.659   -4.982  -79.200 1.00 36.58  ? 42  VAL A CA  1 
ATOM   336  C  C   . VAL A  1 47  ? 10.395  -4.169  -78.136 1.00 37.88  ? 42  VAL A C   1 
ATOM   337  O  O   . VAL A  1 47  ? 10.307  -4.444  -76.937 1.00 34.70  ? 42  VAL A O   1 
ATOM   338  C  CB  . VAL A  1 47  ? 10.408  -6.299  -79.492 1.00 43.28  ? 42  VAL A CB  1 
ATOM   339  C  CG1 . VAL A  1 47  ? 10.498  -7.173  -78.249 1.00 43.27  ? 42  VAL A CG1 1 
ATOM   340  C  CG2 . VAL A  1 47  ? 9.719   -7.052  -80.627 1.00 44.40  ? 42  VAL A CG2 1 
ATOM   341  N  N   A ASN A  1 48  ? 11.109  -3.145  -78.590 0.43 38.45  ? 43  ASN A N   1 
ATOM   342  N  N   B ASN A  1 48  ? 11.047  -3.079  -78.532 0.57 37.79  ? 43  ASN A N   1 
ATOM   343  C  CA  A ASN A  1 48  ? 11.881  -2.291  -77.698 0.43 42.41  ? 43  ASN A CA  1 
ATOM   344  C  CA  B ASN A  1 48  ? 11.888  -2.236  -77.673 0.57 30.37  ? 43  ASN A CA  1 
ATOM   345  C  C   A ASN A  1 48  ? 11.631  -0.815  -77.993 0.43 28.54  ? 43  ASN A C   1 
ATOM   346  C  C   B ASN A  1 48  ? 11.636  -0.749  -77.891 0.57 28.33  ? 43  ASN A C   1 
ATOM   347  O  O   A ASN A  1 48  ? 12.514  -0.109  -78.475 0.43 31.75  ? 43  ASN A O   1 
ATOM   348  O  O   B ASN A  1 48  ? 12.401  -0.083  -78.474 0.57 28.73  ? 43  ASN A O   1 
ATOM   349  C  CB  A ASN A  1 48  ? 13.368  -2.635  -77.804 0.43 32.30  ? 43  ASN A CB  1 
ATOM   350  C  CB  B ASN A  1 48  ? 13.383  -2.586  -77.800 0.57 43.84  ? 43  ASN A CB  1 
ATOM   351  C  CG  A ASN A  1 48  ? 13.617  -4.135  -77.768 0.43 37.67  ? 43  ASN A CG  1 
ATOM   352  C  CG  B ASN A  1 48  ? 14.318  -1.525  -77.178 0.57 46.46  ? 43  ASN A CG  1 
ATOM   353  O  OD1 A ASN A  1 48  ? 13.821  -4.720  -76.704 0.43 37.74  ? 43  ASN A OD1 1 
ATOM   354  O  OD1 B ASN A  1 48  ? 14.249  -1.202  -76.001 0.57 29.11  ? 43  ASN A OD1 1 
ATOM   355  N  ND2 A ASN A  1 48  ? 13.586  -4.767  -78.938 0.43 41.07  ? 43  ASN A ND2 1 
ATOM   356  N  ND2 B ASN A  1 48  ? 15.206  -0.998  -77.980 0.57 44.27  ? 43  ASN A ND2 1 
ATOM   357  N  N   . PRO A  1 49  ? 10.411  -0.346  -77.695 1.00 27.03  ? 44  PRO A N   1 
ATOM   358  C  CA  . PRO A  1 49  ? 9.993   1.010   -78.049 1.00 25.86  ? 44  PRO A CA  1 
ATOM   359  C  C   . PRO A  1 49  ? 10.777  2.054   -77.273 1.00 33.60  ? 44  PRO A C   1 
ATOM   360  O  O   . PRO A  1 49  ? 10.878  1.969   -76.051 1.00 29.23  ? 44  PRO A O   1 
ATOM   361  C  CB  . PRO A  1 49  ? 8.522   1.039   -77.630 1.00 25.15  ? 44  PRO A CB  1 
ATOM   362  C  CG  . PRO A  1 49  ? 8.429   0.040   -76.533 1.00 24.94  ? 44  PRO A CG  1 
ATOM   363  C  CD  . PRO A  1 49  ? 9.384   -1.051  -76.908 1.00 26.79  ? 44  PRO A CD  1 
ATOM   364  N  N   . VAL A  1 50  ? 11.338  3.021   -77.987 1.00 31.04  ? 45  VAL A N   1 
ATOM   365  C  CA  . VAL A  1 50  ? 12.046  4.122   -77.358 1.00 23.75  ? 45  VAL A CA  1 
ATOM   366  C  C   . VAL A  1 50  ? 11.195  5.376   -77.481 1.00 26.03  ? 45  VAL A C   1 
ATOM   367  O  O   . VAL A  1 50  ? 11.139  5.994   -78.542 1.00 29.28  ? 45  VAL A O   1 
ATOM   368  C  CB  . VAL A  1 50  ? 13.412  4.363   -78.027 1.00 25.55  ? 45  VAL A CB  1 
ATOM   369  C  CG1 . VAL A  1 50  ? 14.142  5.518   -77.355 1.00 27.55  ? 45  VAL A CG1 1 
ATOM   370  C  CG2 . VAL A  1 50  ? 14.251  3.094   -77.991 1.00 27.13  ? 45  VAL A CG2 1 
ATOM   371  N  N   . TRP A  1 51  ? 10.518  5.742   -76.400 1.00 23.53  ? 46  TRP A N   1 
ATOM   372  C  CA  . TRP A  1 51  ? 9.688   6.938   -76.405 1.00 21.24  ? 46  TRP A CA  1 
ATOM   373  C  C   . TRP A  1 51  ? 10.534  8.185   -76.175 1.00 28.85  ? 46  TRP A C   1 
ATOM   374  O  O   . TRP A  1 51  ? 10.351  9.197   -76.855 1.00 26.37  ? 46  TRP A O   1 
ATOM   375  C  CB  . TRP A  1 51  ? 8.589   6.838   -75.349 1.00 20.02  ? 46  TRP A CB  1 
ATOM   376  C  CG  . TRP A  1 51  ? 7.665   5.676   -75.559 1.00 21.56  ? 46  TRP A CG  1 
ATOM   377  C  CD1 . TRP A  1 51  ? 6.669   5.583   -76.488 1.00 28.24  ? 46  TRP A CD1 1 
ATOM   378  C  CD2 . TRP A  1 51  ? 7.646   4.443   -74.826 1.00 25.24  ? 46  TRP A CD2 1 
ATOM   379  N  NE1 . TRP A  1 51  ? 6.034   4.369   -76.382 1.00 28.05  ? 46  TRP A NE1 1 
ATOM   380  C  CE2 . TRP A  1 51  ? 6.612   3.651   -75.369 1.00 22.54  ? 46  TRP A CE2 1 
ATOM   381  C  CE3 . TRP A  1 51  ? 8.401   3.932   -73.765 1.00 30.80  ? 46  TRP A CE3 1 
ATOM   382  C  CZ2 . TRP A  1 51  ? 6.311   2.380   -74.885 1.00 21.57  ? 46  TRP A CZ2 1 
ATOM   383  C  CZ3 . TRP A  1 51  ? 8.102   2.664   -73.288 1.00 26.40  ? 46  TRP A CZ3 1 
ATOM   384  C  CH2 . TRP A  1 51  ? 7.065   1.904   -73.848 1.00 24.74  ? 46  TRP A CH2 1 
ATOM   385  N  N   . ASN A  1 52  ? 11.459  8.097   -75.220 1.00 23.33  ? 47  ASN A N   1 
ATOM   386  C  CA  . ASN A  1 52  ? 12.340  9.211   -74.872 1.00 26.22  ? 47  ASN A CA  1 
ATOM   387  C  C   . ASN A  1 52  ? 11.552  10.500  -74.647 1.00 22.65  ? 47  ASN A C   1 
ATOM   388  O  O   . ASN A  1 52  ? 11.837  11.536  -75.251 1.00 23.45  ? 47  ASN A O   1 
ATOM   389  C  CB  . ASN A  1 52  ? 13.401  9.409   -75.958 1.00 30.69  ? 47  ASN A CB  1 
ATOM   390  C  CG  . ASN A  1 52  ? 14.484  10.384  -75.548 1.00 35.40  ? 47  ASN A CG  1 
ATOM   391  O  OD1 . ASN A  1 52  ? 14.693  10.635  -74.363 1.00 45.70  ? 47  ASN A OD1 1 
ATOM   392  N  ND2 . ASN A  1 52  ? 15.177  10.943  -76.530 1.00 32.84  ? 47  ASN A ND2 1 
ATOM   393  N  N   . GLU A  1 53  ? 10.538  10.425  -73.794 1.00 22.22  ? 48  GLU A N   1 
ATOM   394  C  CA  . GLU A  1 53  ? 9.663   11.567  -73.572 1.00 25.66  ? 48  GLU A CA  1 
ATOM   395  C  C   . GLU A  1 53  ? 9.766   12.140  -72.167 1.00 22.24  ? 48  GLU A C   1 
ATOM   396  O  O   . GLU A  1 53  ? 9.866   11.403  -71.188 1.00 24.77  ? 48  GLU A O   1 
ATOM   397  C  CB  . GLU A  1 53  ? 8.213   11.210  -73.897 1.00 30.00  ? 48  GLU A CB  1 
ATOM   398  C  CG  . GLU A  1 53  ? 7.845   11.455  -75.350 1.00 36.99  ? 48  GLU A CG  1 
ATOM   399  C  CD  . GLU A  1 53  ? 6.385   11.199  -75.631 1.00 29.18  ? 48  GLU A CD  1 
ATOM   400  O  OE1 . GLU A  1 53  ? 5.532   11.894  -75.038 1.00 36.68  ? 48  GLU A OE1 1 
ATOM   401  O  OE2 . GLU A  1 53  ? 6.090   10.294  -76.440 1.00 35.22  ? 48  GLU A OE2 1 
ATOM   402  N  N   . GLY A  1 54  ? 9.746   13.466  -72.089 1.00 26.19  ? 49  GLY A N   1 
ATOM   403  C  CA  . GLY A  1 54  ? 9.786   14.166  -70.821 1.00 23.41  ? 49  GLY A CA  1 
ATOM   404  C  C   . GLY A  1 54  ? 8.402   14.621  -70.407 1.00 26.41  ? 49  GLY A C   1 
ATOM   405  O  O   . GLY A  1 54  ? 7.628   15.119  -71.223 1.00 31.93  ? 49  GLY A O   1 
ATOM   406  N  N   . PHE A  1 55  ? 8.086   14.432  -69.132 1.00 26.60  ? 50  PHE A N   1 
ATOM   407  C  CA  . PHE A  1 55  ? 6.817   14.879  -68.583 1.00 27.12  ? 50  PHE A CA  1 
ATOM   408  C  C   . PHE A  1 55  ? 7.079   15.716  -67.343 1.00 31.72  ? 50  PHE A C   1 
ATOM   409  O  O   . PHE A  1 55  ? 8.005   15.437  -66.581 1.00 28.97  ? 50  PHE A O   1 
ATOM   410  C  CB  . PHE A  1 55  ? 5.930   13.688  -68.219 1.00 26.97  ? 50  PHE A CB  1 
ATOM   411  C  CG  . PHE A  1 55  ? 5.520   12.850  -69.394 1.00 35.09  ? 50  PHE A CG  1 
ATOM   412  C  CD1 . PHE A  1 55  ? 4.725   13.379  -70.396 1.00 37.14  ? 50  PHE A CD1 1 
ATOM   413  C  CD2 . PHE A  1 55  ? 5.914   11.527  -69.486 1.00 39.82  ? 50  PHE A CD2 1 
ATOM   414  C  CE1 . PHE A  1 55  ? 4.342   12.606  -71.477 1.00 39.08  ? 50  PHE A CE1 1 
ATOM   415  C  CE2 . PHE A  1 55  ? 5.535   10.749  -70.561 1.00 44.97  ? 50  PHE A CE2 1 
ATOM   416  C  CZ  . PHE A  1 55  ? 4.748   11.289  -71.558 1.00 37.75  ? 50  PHE A CZ  1 
ATOM   417  N  N   . GLU A  1 56  ? 6.263   16.745  -67.146 1.00 26.94  ? 51  GLU A N   1 
ATOM   418  C  CA  . GLU A  1 56  ? 6.373   17.586  -65.962 1.00 30.64  ? 51  GLU A CA  1 
ATOM   419  C  C   . GLU A  1 56  ? 5.022   17.718  -65.277 1.00 35.38  ? 51  GLU A C   1 
ATOM   420  O  O   . GLU A  1 56  ? 4.056   18.188  -65.878 1.00 33.56  ? 51  GLU A O   1 
ATOM   421  C  CB  . GLU A  1 56  ? 6.911   18.972  -66.322 1.00 43.96  ? 51  GLU A CB  1 
ATOM   422  C  CG  . GLU A  1 56  ? 8.342   18.972  -66.826 1.00 49.43  ? 51  GLU A CG  1 
ATOM   423  C  CD  . GLU A  1 56  ? 8.989   20.341  -66.742 1.00 59.61  ? 51  GLU A CD  1 
ATOM   424  O  OE1 . GLU A  1 56  ? 8.260   21.353  -66.802 1.00 62.31  ? 51  GLU A OE1 1 
ATOM   425  O  OE2 . GLU A  1 56  ? 10.230  20.404  -66.604 1.00 65.13  ? 51  GLU A OE2 1 
ATOM   426  N  N   . TRP A  1 57  ? 4.955   17.290  -64.022 1.00 29.91  ? 52  TRP A N   1 
ATOM   427  C  CA  . TRP A  1 57  ? 3.761   17.490  -63.215 1.00 31.65  ? 52  TRP A CA  1 
ATOM   428  C  C   . TRP A  1 57  ? 3.945   18.695  -62.313 1.00 44.56  ? 52  TRP A C   1 
ATOM   429  O  O   . TRP A  1 57  ? 4.822   18.698  -61.448 1.00 45.00  ? 52  TRP A O   1 
ATOM   430  C  CB  . TRP A  1 57  ? 3.478   16.268  -62.338 1.00 31.83  ? 52  TRP A CB  1 
ATOM   431  C  CG  . TRP A  1 57  ? 2.791   15.134  -63.029 1.00 28.52  ? 52  TRP A CG  1 
ATOM   432  C  CD1 . TRP A  1 57  ? 1.447   14.891  -63.070 1.00 30.02  ? 52  TRP A CD1 1 
ATOM   433  C  CD2 . TRP A  1 57  ? 3.413   14.073  -63.762 1.00 25.90  ? 52  TRP A CD2 1 
ATOM   434  N  NE1 . TRP A  1 57  ? 1.194   13.749  -63.790 1.00 29.99  ? 52  TRP A NE1 1 
ATOM   435  C  CE2 . TRP A  1 57  ? 2.385   13.228  -64.226 1.00 28.69  ? 52  TRP A CE2 1 
ATOM   436  C  CE3 . TRP A  1 57  ? 4.738   13.759  -64.076 1.00 25.86  ? 52  TRP A CE3 1 
ATOM   437  C  CZ2 . TRP A  1 57  ? 2.642   12.088  -64.986 1.00 28.56  ? 52  TRP A CZ2 1 
ATOM   438  C  CZ3 . TRP A  1 57  ? 4.991   12.629  -64.831 1.00 24.40  ? 52  TRP A CZ3 1 
ATOM   439  C  CH2 . TRP A  1 57  ? 3.948   11.807  -65.278 1.00 22.00  ? 52  TRP A CH2 1 
ATOM   440  N  N   . ASP A  1 58  ? 3.132   19.726  -62.517 1.00 43.22  ? 53  ASP A N   1 
ATOM   441  C  CA  . ASP A  1 58  ? 2.984   20.732  -61.485 1.00 49.52  ? 53  ASP A CA  1 
ATOM   442  C  C   . ASP A  1 58  ? 2.322   20.002  -60.338 1.00 48.97  ? 53  ASP A C   1 
ATOM   443  O  O   . ASP A  1 58  ? 1.287   19.356  -60.512 1.00 56.30  ? 53  ASP A O   1 
ATOM   444  C  CB  . ASP A  1 58  ? 2.114   21.900  -61.941 1.00 57.80  ? 53  ASP A CB  1 
ATOM   445  C  CG  . ASP A  1 58  ? 1.791   22.863  -60.808 1.00 67.09  ? 53  ASP A CG  1 
ATOM   446  O  OD1 . ASP A  1 58  ? 2.559   22.911  -59.822 1.00 70.64  ? 53  ASP A OD1 1 
ATOM   447  O  OD2 . ASP A  1 58  ? 0.770   23.575  -60.903 1.00 74.43  ? 53  ASP A OD2 1 
ATOM   448  N  N   . LEU A  1 59  ? 2.934   20.092  -59.167 1.00 43.48  ? 54  LEU A N   1 
ATOM   449  C  CA  . LEU A  1 59  ? 2.466   19.353  -58.010 1.00 45.58  ? 54  LEU A CA  1 
ATOM   450  C  C   . LEU A  1 59  ? 1.324   20.074  -57.306 1.00 51.59  ? 54  LEU A C   1 
ATOM   451  O  O   . LEU A  1 59  ? 0.828   19.610  -56.278 1.00 55.42  ? 54  LEU A O   1 
ATOM   452  C  CB  . LEU A  1 59  ? 3.628   19.101  -57.059 1.00 44.78  ? 54  LEU A CB  1 
ATOM   453  C  CG  . LEU A  1 59  ? 4.509   17.946  -57.523 1.00 50.35  ? 54  LEU A CG  1 
ATOM   454  C  CD1 . LEU A  1 59  ? 5.592   17.625  -56.510 1.00 48.31  ? 54  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A  1 59  ? 3.630   16.736  -57.785 1.00 55.41  ? 54  LEU A CD2 1 
ATOM   456  N  N   . LYS A  1 60  ? 0.913   21.197  -57.895 1.00 56.58  ? 55  LYS A N   1 
ATOM   457  C  CA  . LYS A  1 60  ? -0.129  22.072  -57.361 1.00 59.66  ? 55  LYS A CA  1 
ATOM   458  C  C   . LYS A  1 60  ? -0.061  22.220  -55.847 1.00 59.66  ? 55  LYS A C   1 
ATOM   459  O  O   . LYS A  1 60  ? -1.061  22.048  -55.152 1.00 60.42  ? 55  LYS A O   1 
ATOM   460  C  CB  . LYS A  1 60  ? -1.520  21.581  -57.766 1.00 60.79  ? 55  LYS A CB  1 
ATOM   461  C  CG  . LYS A  1 60  ? -1.637  21.153  -59.213 1.00 65.01  ? 55  LYS A CG  1 
ATOM   462  C  CD  . LYS A  1 60  ? -2.015  22.303  -60.123 1.00 72.97  ? 55  LYS A CD  1 
ATOM   463  C  CE  . LYS A  1 60  ? -2.218  21.804  -61.541 1.00 75.27  ? 55  LYS A CE  1 
ATOM   464  N  NZ  . LYS A  1 60  ? -2.391  22.913  -62.513 1.00 79.89  ? 55  LYS A NZ  1 
ATOM   465  N  N   . GLY A  1 61  ? 1.128   22.515  -55.340 1.00 60.24  ? 56  GLY A N   1 
ATOM   466  C  CA  . GLY A  1 61  ? 1.301   22.727  -53.920 1.00 65.19  ? 56  GLY A CA  1 
ATOM   467  C  C   . GLY A  1 61  ? 1.509   21.464  -53.108 1.00 65.62  ? 56  GLY A C   1 
ATOM   468  O  O   . GLY A  1 61  ? 2.023   21.536  -51.996 1.00 68.85  ? 56  GLY A O   1 
ATOM   469  N  N   . ILE A  1 62  ? 1.109   20.309  -53.635 1.00 64.49  ? 57  ILE A N   1 
ATOM   470  C  CA  . ILE A  1 62  ? 1.352   19.056  -52.922 1.00 66.49  ? 57  ILE A CA  1 
ATOM   471  C  C   . ILE A  1 62  ? 2.808   18.612  -53.055 1.00 62.46  ? 57  ILE A C   1 
ATOM   472  O  O   . ILE A  1 62  ? 3.323   18.460  -54.160 1.00 53.81  ? 57  ILE A O   1 
ATOM   473  C  CB  . ILE A  1 62  ? 0.395   17.910  -53.361 1.00 89.77  ? 57  ILE A CB  1 
ATOM   474  C  CG1 . ILE A  1 62  ? -0.787  17.805  -52.396 1.00 94.90  ? 57  ILE A CG1 1 
ATOM   475  C  CG2 . ILE A  1 62  ? 1.108   16.570  -53.382 1.00 85.71  ? 57  ILE A CG2 1 
ATOM   476  C  CD1 . ILE A  1 62  ? -1.509  16.451  -52.407 1.00 94.77  ? 57  ILE A CD1 1 
ATOM   477  N  N   . PRO A  1 63  ? 3.493   18.439  -51.915 1.00 63.42  ? 58  PRO A N   1 
ATOM   478  C  CA  . PRO A  1 63  ? 4.847   17.883  -51.940 1.00 57.93  ? 58  PRO A CA  1 
ATOM   479  C  C   . PRO A  1 63  ? 4.786   16.364  -51.889 1.00 50.08  ? 58  PRO A C   1 
ATOM   480  O  O   . PRO A  1 63  ? 3.768   15.805  -51.473 1.00 49.98  ? 58  PRO A O   1 
ATOM   481  C  CB  . PRO A  1 63  ? 5.462   18.422  -50.653 1.00 62.43  ? 58  PRO A CB  1 
ATOM   482  C  CG  . PRO A  1 63  ? 4.307   18.565  -49.721 1.00 68.32  ? 58  PRO A CG  1 
ATOM   483  C  CD  . PRO A  1 63  ? 3.094   18.878  -50.565 1.00 66.69  ? 58  PRO A CD  1 
ATOM   484  N  N   . LEU A  1 64  ? 5.856   15.710  -52.326 1.00 47.83  ? 59  LEU A N   1 
ATOM   485  C  CA  . LEU A  1 64  ? 5.949   14.265  -52.237 1.00 49.91  ? 59  LEU A CA  1 
ATOM   486  C  C   . LEU A  1 64  ? 6.127   13.877  -50.780 1.00 53.16  ? 59  LEU A C   1 
ATOM   487  O  O   . LEU A  1 64  ? 6.733   14.620  -50.007 1.00 58.71  ? 59  LEU A O   1 
ATOM   488  C  CB  . LEU A  1 64  ? 7.160   13.760  -53.022 1.00 48.89  ? 59  LEU A CB  1 
ATOM   489  C  CG  . LEU A  1 64  ? 7.439   14.205  -54.461 1.00 45.79  ? 59  LEU A CG  1 
ATOM   490  C  CD1 . LEU A  1 64  ? 8.647   13.447  -54.996 1.00 36.84  ? 59  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A  1 64  ? 6.229   14.005  -55.365 1.00 43.16  ? 59  LEU A CD2 1 
ATOM   492  N  N   . ASP A  1 65  ? 5.591   12.726  -50.395 1.00 57.29  ? 60  ASP A N   1 
ATOM   493  C  CA  . ASP A  1 65  ? 6.033   12.088  -49.161 1.00 61.34  ? 60  ASP A CA  1 
ATOM   494  C  C   . ASP A  1 65  ? 6.475   10.664  -49.474 1.00 56.74  ? 60  ASP A C   1 
ATOM   495  O  O   . ASP A  1 65  ? 6.606   10.296  -50.642 1.00 48.42  ? 60  ASP A O   1 
ATOM   496  C  CB  . ASP A  1 65  ? 4.990   12.156  -48.032 1.00 65.64  ? 60  ASP A CB  1 
ATOM   497  C  CG  . ASP A  1 65  ? 3.704   11.407  -48.349 1.00 64.46  ? 60  ASP A CG  1 
ATOM   498  O  OD1 . ASP A  1 65  ? 3.757   10.255  -48.828 1.00 58.47  ? 60  ASP A OD1 1 
ATOM   499  O  OD2 . ASP A  1 65  ? 2.623   11.974  -48.088 1.00 67.75  ? 60  ASP A OD2 1 
ATOM   500  N  N   . GLN A  1 66  ? 6.689   9.860   -48.441 1.00 64.27  ? 61  GLN A N   1 
ATOM   501  C  CA  . GLN A  1 66  ? 7.276   8.538   -48.640 1.00 71.50  ? 61  GLN A CA  1 
ATOM   502  C  C   . GLN A  1 66  ? 6.275   7.469   -49.098 1.00 69.82  ? 61  GLN A C   1 
ATOM   503  O  O   . GLN A  1 66  ? 6.649   6.312   -49.315 1.00 71.98  ? 61  GLN A O   1 
ATOM   504  C  CB  . GLN A  1 66  ? 8.034   8.094   -47.385 1.00 78.65  ? 61  GLN A CB  1 
ATOM   505  C  CG  . GLN A  1 66  ? 9.054   9.123   -46.906 1.00 87.89  ? 61  GLN A CG  1 
ATOM   506  C  CD  . GLN A  1 66  ? 10.150  8.520   -46.044 1.00 98.94  ? 61  GLN A CD  1 
ATOM   507  O  OE1 . GLN A  1 66  ? 9.936   7.529   -45.346 1.00 103.32 ? 61  GLN A OE1 1 
ATOM   508  N  NE2 . GLN A  1 66  ? 11.335  9.118   -46.095 1.00 101.46 ? 61  GLN A NE2 1 
ATOM   509  N  N   . GLY A  1 67  ? 5.012   7.857   -49.258 1.00 58.37  ? 62  GLY A N   1 
ATOM   510  C  CA  . GLY A  1 67  ? 3.996   6.939   -49.740 1.00 50.97  ? 62  GLY A CA  1 
ATOM   511  C  C   . GLY A  1 67  ? 3.670   7.205   -51.194 1.00 48.99  ? 62  GLY A C   1 
ATOM   512  O  O   . GLY A  1 67  ? 2.992   6.413   -51.849 1.00 47.14  ? 62  GLY A O   1 
ATOM   513  N  N   . SER A  1 68  ? 4.169   8.332   -51.693 1.00 46.51  ? 63  SER A N   1 
ATOM   514  C  CA  . SER A  1 68  ? 3.950   8.750   -53.071 1.00 38.94  ? 63  SER A CA  1 
ATOM   515  C  C   . SER A  1 68  ? 4.424   7.697   -54.057 1.00 37.14  ? 63  SER A C   1 
ATOM   516  O  O   . SER A  1 68  ? 5.493   7.110   -53.889 1.00 36.36  ? 63  SER A O   1 
ATOM   517  C  CB  . SER A  1 68  ? 4.674   10.072  -53.346 1.00 41.40  ? 63  SER A CB  1 
ATOM   518  O  OG  . SER A  1 68  ? 4.032   11.152  -52.693 1.00 57.53  ? 63  SER A OG  1 
ATOM   519  N  N   . GLU A  1 69  ? 3.617   7.453   -55.084 1.00 34.14  ? 64  GLU A N   1 
ATOM   520  C  CA  . GLU A  1 69  ? 3.987   6.504   -56.127 1.00 38.72  ? 64  GLU A CA  1 
ATOM   521  C  C   . GLU A  1 69  ? 3.564   7.003   -57.501 1.00 35.85  ? 64  GLU A C   1 
ATOM   522  O  O   . GLU A  1 69  ? 2.500   7.599   -57.659 1.00 35.12  ? 64  GLU A O   1 
ATOM   523  C  CB  . GLU A  1 69  ? 3.390   5.116   -55.851 1.00 43.77  ? 64  GLU A CB  1 
ATOM   524  C  CG  . GLU A  1 69  ? 3.980   4.408   -54.628 1.00 52.91  ? 64  GLU A CG  1 
ATOM   525  C  CD  . GLU A  1 69  ? 3.591   2.942   -54.539 1.00 64.19  ? 64  GLU A CD  1 
ATOM   526  O  OE1 . GLU A  1 69  ? 2.378   2.641   -54.511 1.00 68.34  ? 64  GLU A OE1 1 
ATOM   527  O  OE2 . GLU A  1 69  ? 4.505   2.090   -54.497 1.00 70.53  ? 64  GLU A OE2 1 
ATOM   528  N  N   . LEU A  1 70  ? 4.424   6.772   -58.486 1.00 33.28  ? 65  LEU A N   1 
ATOM   529  C  CA  . LEU A  1 70  ? 4.107   7.066   -59.873 1.00 30.25  ? 65  LEU A CA  1 
ATOM   530  C  C   . LEU A  1 70  ? 3.631   5.774   -60.518 1.00 32.08  ? 65  LEU A C   1 
ATOM   531  O  O   . LEU A  1 70  ? 4.337   4.767   -60.492 1.00 30.82  ? 65  LEU A O   1 
ATOM   532  C  CB  . LEU A  1 70  ? 5.348   7.597   -60.593 1.00 32.05  ? 65  LEU A CB  1 
ATOM   533  C  CG  . LEU A  1 70  ? 5.285   7.832   -62.103 1.00 30.20  ? 65  LEU A CG  1 
ATOM   534  C  CD1 . LEU A  1 70  ? 4.417   9.035   -62.433 1.00 31.14  ? 65  LEU A CD1 1 
ATOM   535  C  CD2 . LEU A  1 70  ? 6.685   8.011   -62.660 1.00 29.36  ? 65  LEU A CD2 1 
ATOM   536  N  N   . HIS A  1 71  ? 2.425   5.795   -61.077 1.00 26.11  ? 66  HIS A N   1 
ATOM   537  C  CA  . HIS A  1 71  ? 1.855   4.599   -61.685 1.00 33.12  ? 66  HIS A CA  1 
ATOM   538  C  C   . HIS A  1 71  ? 2.045   4.630   -63.194 1.00 30.27  ? 66  HIS A C   1 
ATOM   539  O  O   . HIS A  1 71  ? 1.603   5.558   -63.869 1.00 26.32  ? 66  HIS A O   1 
ATOM   540  C  CB  . HIS A  1 71  ? 0.370   4.462   -61.342 1.00 37.58  ? 66  HIS A CB  1 
ATOM   541  C  CG  . HIS A  1 71  ? -0.235  3.166   -61.787 1.00 46.55  ? 66  HIS A CG  1 
ATOM   542  N  ND1 . HIS A  1 71  ? -1.532  3.066   -62.244 1.00 54.40  ? 66  HIS A ND1 1 
ATOM   543  C  CD2 . HIS A  1 71  ? 0.280   1.914   -61.842 1.00 49.16  ? 66  HIS A CD2 1 
ATOM   544  C  CE1 . HIS A  1 71  ? -1.788  1.810   -62.564 1.00 56.65  ? 66  HIS A CE1 1 
ATOM   545  N  NE2 . HIS A  1 71  ? -0.705  1.091   -62.329 1.00 51.55  ? 66  HIS A NE2 1 
ATOM   546  N  N   . VAL A  1 72  ? 2.715   3.614   -63.721 1.00 29.31  ? 67  VAL A N   1 
ATOM   547  C  CA  . VAL A  1 72  ? 2.970   3.553   -65.149 1.00 22.54  ? 67  VAL A CA  1 
ATOM   548  C  C   . VAL A  1 72  ? 2.366   2.288   -65.744 1.00 25.82  ? 67  VAL A C   1 
ATOM   549  O  O   . VAL A  1 72  ? 2.499   1.198   -65.188 1.00 25.41  ? 67  VAL A O   1 
ATOM   550  C  CB  . VAL A  1 72  ? 4.481   3.653   -65.463 1.00 28.41  ? 67  VAL A CB  1 
ATOM   551  C  CG1 . VAL A  1 72  ? 5.017   5.013   -65.031 1.00 29.38  ? 67  VAL A CG1 1 
ATOM   552  C  CG2 . VAL A  1 72  ? 5.251   2.536   -64.771 1.00 32.41  ? 67  VAL A CG2 1 
ATOM   553  N  N   . VAL A  1 73  ? 1.670   2.453   -66.864 1.00 24.70  ? 68  VAL A N   1 
ATOM   554  C  CA  . VAL A  1 73  ? 1.041   1.337   -67.556 1.00 24.79  ? 68  VAL A CA  1 
ATOM   555  C  C   . VAL A  1 73  ? 1.458   1.347   -69.017 1.00 28.28  ? 68  VAL A C   1 
ATOM   556  O  O   . VAL A  1 73  ? 1.355   2.370   -69.694 1.00 31.05  ? 68  VAL A O   1 
ATOM   557  C  CB  . VAL A  1 73  ? -0.504  1.409   -67.484 1.00 27.05  ? 68  VAL A CB  1 
ATOM   558  C  CG1 . VAL A  1 73  ? -1.133  0.241   -68.239 1.00 29.32  ? 68  VAL A CG1 1 
ATOM   559  C  CG2 . VAL A  1 73  ? -0.977  1.427   -66.038 1.00 32.28  ? 68  VAL A CG2 1 
ATOM   560  N  N   . VAL A  1 74  ? 1.941   0.209   -69.498 1.00 31.93  ? 69  VAL A N   1 
ATOM   561  C  CA  . VAL A  1 74  ? 2.246   0.062   -70.910 1.00 31.03  ? 69  VAL A CA  1 
ATOM   562  C  C   . VAL A  1 74  ? 1.094   -0.675  -71.582 1.00 31.38  ? 69  VAL A C   1 
ATOM   563  O  O   . VAL A  1 74  ? 0.600   -1.676  -71.064 1.00 31.49  ? 69  VAL A O   1 
ATOM   564  C  CB  . VAL A  1 74  ? 3.575   -0.677  -71.131 1.00 24.47  ? 69  VAL A CB  1 
ATOM   565  C  CG1 . VAL A  1 74  ? 3.911   -0.729  -72.606 1.00 24.83  ? 69  VAL A CG1 1 
ATOM   566  C  CG2 . VAL A  1 74  ? 4.687   0.020   -70.370 1.00 25.78  ? 69  VAL A CG2 1 
ATOM   567  N  N   . LYS A  1 75  ? 0.654   -0.153  -72.721 1.00 28.79  ? 70  LYS A N   1 
ATOM   568  C  CA  . LYS A  1 75  ? -0.497  -0.700  -73.426 1.00 35.11  ? 70  LYS A CA  1 
ATOM   569  C  C   . LYS A  1 75  ? -0.210  -0.784  -74.915 1.00 38.31  ? 70  LYS A C   1 
ATOM   570  O  O   . LYS A  1 75  ? 0.617   -0.038  -75.437 1.00 33.48  ? 70  LYS A O   1 
ATOM   571  C  CB  . LYS A  1 75  ? -1.719  0.188   -73.204 1.00 38.22  ? 70  LYS A CB  1 
ATOM   572  C  CG  . LYS A  1 75  ? -2.250  0.192   -71.789 1.00 44.58  ? 70  LYS A CG  1 
ATOM   573  C  CD  . LYS A  1 75  ? -3.213  1.347   -71.601 1.00 53.01  ? 70  LYS A CD  1 
ATOM   574  C  CE  . LYS A  1 75  ? -4.300  1.014   -70.599 1.00 64.15  ? 70  LYS A CE  1 
ATOM   575  N  NZ  . LYS A  1 75  ? -5.353  2.067   -70.588 1.00 67.61  ? 70  LYS A NZ  1 
ATOM   576  N  N   . ASP A  1 76  ? -0.892  -1.690  -75.603 1.00 41.17  ? 71  ASP A N   1 
ATOM   577  C  CA  . ASP A  1 76  ? -0.739  -1.771  -77.045 1.00 48.49  ? 71  ASP A CA  1 
ATOM   578  C  C   . ASP A  1 76  ? -1.866  -1.018  -77.722 1.00 51.59  ? 71  ASP A C   1 
ATOM   579  O  O   . ASP A  1 76  ? -3.010  -1.058  -77.269 1.00 55.48  ? 71  ASP A O   1 
ATOM   580  C  CB  . ASP A  1 76  ? -0.701  -3.223  -77.528 1.00 57.01  ? 71  ASP A CB  1 
ATOM   581  C  CG  . ASP A  1 76  ? -0.230  -3.346  -78.968 1.00 63.78  ? 71  ASP A CG  1 
ATOM   582  O  OD1 . ASP A  1 76  ? -0.801  -2.672  -79.849 1.00 72.09  ? 71  ASP A OD1 1 
ATOM   583  O  OD2 . ASP A  1 76  ? 0.725   -4.108  -79.220 1.00 65.91  ? 71  ASP A OD2 1 
ATOM   584  N  N   . HIS A  1 77  ? -1.546  -0.320  -78.803 1.00 87.51  ? 72  HIS A N   1 
ATOM   585  C  CA  . HIS A  1 77  ? -2.600  0.289   -79.593 1.00 93.64  ? 72  HIS A CA  1 
ATOM   586  C  C   . HIS A  1 77  ? -2.936  -0.552  -80.806 1.00 100.69 ? 72  HIS A C   1 
ATOM   587  O  O   . HIS A  1 77  ? -3.261  -0.043  -81.878 1.00 104.26 ? 72  HIS A O   1 
ATOM   588  C  CB  . HIS A  1 77  ? -2.301  1.732   -79.967 1.00 91.54  ? 72  HIS A CB  1 
ATOM   589  C  CG  . HIS A  1 77  ? -3.303  2.702   -79.426 1.00 94.55  ? 72  HIS A CG  1 
ATOM   590  N  ND1 . HIS A  1 77  ? -3.659  2.740   -78.096 1.00 93.42  ? 72  HIS A ND1 1 
ATOM   591  C  CD2 . HIS A  1 77  ? -4.040  3.657   -80.038 1.00 84.51  ? 72  HIS A CD2 1 
ATOM   592  C  CE1 . HIS A  1 77  ? -4.556  3.691   -77.908 1.00 82.07  ? 72  HIS A CE1 1 
ATOM   593  N  NE2 . HIS A  1 77  ? -4.803  4.264   -79.071 1.00 96.70  ? 72  HIS A NE2 1 
ATOM   594  N  N   . GLU A  1 78  ? -2.834  -1.858  -80.615 1.00 106.53 ? 73  GLU A N   1 
ATOM   595  C  CA  . GLU A  1 78  ? -3.713  -2.757  -81.310 1.00 119.49 ? 73  GLU A CA  1 
ATOM   596  C  C   . GLU A  1 78  ? -5.067  -2.156  -80.949 1.00 128.97 ? 73  GLU A C   1 
ATOM   597  O  O   . GLU A  1 78  ? -5.880  -1.877  -81.827 1.00 133.71 ? 73  GLU A O   1 
ATOM   598  C  CB  . GLU A  1 78  ? -3.590  -4.155  -80.711 1.00 119.86 ? 73  GLU A CB  1 
ATOM   599  C  CG  . GLU A  1 78  ? -4.161  -5.285  -81.543 1.00 126.28 ? 73  GLU A CG  1 
ATOM   600  C  CD  . GLU A  1 78  ? -3.534  -5.403  -82.922 1.00 127.52 ? 73  GLU A CD  1 
ATOM   601  O  OE1 . GLU A  1 78  ? -2.650  -6.267  -83.105 1.00 127.34 ? 73  GLU A OE1 1 
ATOM   602  O  OE2 . GLU A  1 78  ? -3.950  -4.650  -83.828 1.00 128.55 ? 73  GLU A OE2 1 
ATOM   603  N  N   . THR A  1 79  ? -5.247  -1.903  -79.644 1.00 131.77 ? 74  THR A N   1 
ATOM   604  C  CA  . THR A  1 79  ? -6.499  -1.439  -79.026 1.00 141.56 ? 74  THR A CA  1 
ATOM   605  C  C   . THR A  1 79  ? -6.441  -0.001  -78.492 1.00 140.94 ? 74  THR A C   1 
ATOM   606  O  O   . THR A  1 79  ? -5.472  0.399   -77.842 1.00 132.79 ? 74  THR A O   1 
ATOM   607  C  CB  . THR A  1 79  ? -6.888  -2.332  -77.829 1.00 145.03 ? 74  THR A CB  1 
ATOM   608  O  OG1 . THR A  1 79  ? -6.812  -3.715  -78.199 1.00 149.23 ? 74  THR A OG1 1 
ATOM   609  C  CG2 . THR A  1 79  ? -8.274  -1.978  -77.282 1.00 150.89 ? 74  THR A CG2 1 
ATOM   610  N  N   . MET A  1 80  ? -7.512  0.755   -78.722 1.00 149.40 ? 75  MET A N   1 
ATOM   611  C  CA  . MET A  1 80  ? -7.506  2.190   -78.441 1.00 149.23 ? 75  MET A CA  1 
ATOM   612  C  C   . MET A  1 80  ? -8.250  2.681   -77.203 1.00 152.78 ? 75  MET A C   1 
ATOM   613  O  O   . MET A  1 80  ? -7.650  2.913   -76.155 1.00 149.24 ? 75  MET A O   1 
ATOM   614  C  CB  . MET A  1 80  ? -8.068  2.942   -79.626 1.00 154.29 ? 75  MET A CB  1 
ATOM   615  C  CG  . MET A  1 80  ? -7.344  2.682   -80.897 1.00 153.67 ? 75  MET A CG  1 
ATOM   616  S  SD  . MET A  1 80  ? -7.864  4.021   -81.929 1.00 186.39 ? 75  MET A SD  1 
ATOM   617  C  CE  . MET A  1 80  ? -6.720  5.292   -81.434 1.00 188.11 ? 75  MET A CE  1 
ATOM   618  N  N   . GLY A  1 81  ? -9.551  2.907   -77.368 1.00 160.48 ? 76  GLY A N   1 
ATOM   619  C  CA  . GLY A  1 81  ? -10.400 3.404   -76.303 1.00 163.31 ? 76  GLY A CA  1 
ATOM   620  C  C   . GLY A  1 81  ? -10.507 2.378   -75.198 1.00 163.50 ? 76  GLY A C   1 
ATOM   621  O  O   . GLY A  1 81  ? -10.559 2.725   -74.018 1.00 162.79 ? 76  GLY A O   1 
ATOM   622  N  N   . ARG A  1 82  ? -10.546 1.105   -75.582 1.00 162.81 ? 77  ARG A N   1 
ATOM   623  C  CA  . ARG A  1 82  ? -10.449 0.026   -74.614 1.00 158.66 ? 77  ARG A CA  1 
ATOM   624  C  C   . ARG A  1 82  ? -8.962  -0.080  -74.318 1.00 140.58 ? 77  ARG A C   1 
ATOM   625  O  O   . ARG A  1 82  ? -8.157  0.561   -74.983 1.00 134.82 ? 77  ARG A O   1 
ATOM   626  C  CB  . ARG A  1 82  ? -11.002 -1.285  -75.187 1.00 169.12 ? 77  ARG A CB  1 
ATOM   627  C  CG  . ARG A  1 82  ? -12.455 -1.216  -75.675 1.00 184.63 ? 77  ARG A CG  1 
ATOM   628  C  CD  . ARG A  1 82  ? -12.867 -2.478  -76.428 1.00 196.64 ? 77  ARG A CD  1 
ATOM   629  N  NE  . ARG A  1 82  ? -13.477 -3.478  -75.556 1.00 206.15 ? 77  ARG A NE  1 
ATOM   630  C  CZ  . ARG A  1 82  ? -13.860 -4.685  -75.961 1.00 215.84 ? 77  ARG A CZ  1 
ATOM   631  N  NH1 . ARG A  1 82  ? -13.695 -5.042  -77.226 1.00 219.35 ? 77  ARG A NH1 1 
ATOM   632  N  NH2 . ARG A  1 82  ? -14.407 -5.539  -75.107 1.00 221.20 ? 77  ARG A NH2 1 
ATOM   633  N  N   . ASN A  1 83  ? -8.570  -0.873  -73.335 1.00 132.06 ? 78  ASN A N   1 
ATOM   634  C  CA  . ASN A  1 83  ? -7.180  -0.785  -72.911 1.00 117.29 ? 78  ASN A CA  1 
ATOM   635  C  C   . ASN A  1 83  ? -6.135  -1.456  -73.814 1.00 110.40 ? 78  ASN A C   1 
ATOM   636  O  O   . ASN A  1 83  ? -5.378  -0.754  -74.490 1.00 105.91 ? 78  ASN A O   1 
ATOM   637  C  CB  . ASN A  1 83  ? -7.013  -1.149  -71.428 1.00 111.82 ? 78  ASN A CB  1 
ATOM   638  C  CG  . ASN A  1 83  ? -7.504  -2.542  -71.097 1.00 113.48 ? 78  ASN A CG  1 
ATOM   639  O  OD1 . ASN A  1 83  ? -7.234  -3.504  -71.819 1.00 115.85 ? 78  ASN A OD1 1 
ATOM   640  N  ND2 . ASN A  1 83  ? -8.224  -2.660  -69.991 1.00 114.12 ? 78  ASN A ND2 1 
ATOM   641  N  N   . ARG A  1 84  ? -6.141  -2.790  -73.856 1.00 109.84 ? 79  ARG A N   1 
ATOM   642  C  CA  . ARG A  1 84  ? -5.001  -3.598  -74.325 1.00 104.43 ? 79  ARG A CA  1 
ATOM   643  C  C   . ARG A  1 84  ? -3.833  -3.409  -73.379 1.00 95.63  ? 79  ARG A C   1 
ATOM   644  O  O   . ARG A  1 84  ? -2.714  -3.107  -73.799 1.00 76.72  ? 79  ARG A O   1 
ATOM   645  C  CB  . ARG A  1 84  ? -4.560  -3.251  -75.745 1.00 87.63  ? 79  ARG A CB  1 
ATOM   646  C  CG  . ARG A  1 84  ? -3.845  -4.348  -76.509 1.00 99.22  ? 79  ARG A CG  1 
ATOM   647  C  CD  . ARG A  1 84  ? -4.100  -5.720  -75.912 1.00 103.93 ? 79  ARG A CD  1 
ATOM   648  N  NE  . ARG A  1 84  ? -3.632  -6.814  -76.757 1.00 108.59 ? 79  ARG A NE  1 
ATOM   649  C  CZ  . ARG A  1 84  ? -3.692  -8.093  -76.403 1.00 112.54 ? 79  ARG A CZ  1 
ATOM   650  N  NH1 . ARG A  1 84  ? -4.191  -8.436  -75.223 1.00 112.41 ? 79  ARG A NH1 1 
ATOM   651  N  NH2 . ARG A  1 84  ? -3.251  -9.028  -77.224 1.00 116.01 ? 79  ARG A NH2 1 
ATOM   652  N  N   . PHE A  1 85  ? -4.130  -3.560  -72.096 1.00 48.44  ? 80  PHE A N   1 
ATOM   653  C  CA  . PHE A  1 85  ? -3.147  -3.529  -71.028 1.00 47.83  ? 80  PHE A CA  1 
ATOM   654  C  C   . PHE A  1 85  ? -2.061  -4.573  -71.288 1.00 42.79  ? 80  PHE A C   1 
ATOM   655  O  O   . PHE A  1 85  ? -2.354  -5.754  -71.465 1.00 47.92  ? 80  PHE A O   1 
ATOM   656  C  CB  . PHE A  1 85  ? -3.892  -3.793  -69.713 1.00 49.20  ? 80  PHE A CB  1 
ATOM   657  C  CG  . PHE A  1 85  ? -3.010  -3.970  -68.503 1.00 52.00  ? 80  PHE A CG  1 
ATOM   658  C  CD1 . PHE A  1 85  ? -2.472  -5.208  -68.193 1.00 53.05  ? 80  PHE A CD1 1 
ATOM   659  C  CD2 . PHE A  1 85  ? -2.780  -2.917  -67.638 1.00 51.27  ? 80  PHE A CD2 1 
ATOM   660  C  CE1 . PHE A  1 85  ? -1.692  -5.383  -67.073 1.00 49.93  ? 80  PHE A CE1 1 
ATOM   661  C  CE2 . PHE A  1 85  ? -1.996  -3.087  -66.509 1.00 49.20  ? 80  PHE A CE2 1 
ATOM   662  C  CZ  . PHE A  1 85  ? -1.454  -4.324  -66.228 1.00 46.70  ? 80  PHE A CZ  1 
ATOM   663  N  N   . LEU A  1 86  ? -0.809  -4.127  -71.336 1.00 38.52  ? 81  LEU A N   1 
ATOM   664  C  CA  . LEU A  1 86  ? 0.320   -5.033  -71.532 1.00 36.03  ? 81  LEU A CA  1 
ATOM   665  C  C   . LEU A  1 86  ? 1.025   -5.342  -70.215 1.00 37.93  ? 81  LEU A C   1 
ATOM   666  O  O   . LEU A  1 86  ? 1.377   -6.488  -69.939 1.00 38.92  ? 81  LEU A O   1 
ATOM   667  C  CB  . LEU A  1 86  ? 1.309   -4.451  -72.545 1.00 32.90  ? 81  LEU A CB  1 
ATOM   668  C  CG  . LEU A  1 86  ? 1.212   -5.002  -73.970 1.00 37.20  ? 81  LEU A CG  1 
ATOM   669  C  CD1 . LEU A  1 86  ? -0.193  -5.503  -74.278 1.00 39.96  ? 81  LEU A CD1 1 
ATOM   670  C  CD2 . LEU A  1 86  ? 1.629   -3.936  -74.963 1.00 30.90  ? 81  LEU A CD2 1 
ATOM   671  N  N   . GLY A  1 87  ? 1.227   -4.313  -69.403 1.00 33.45  ? 82  GLY A N   1 
ATOM   672  C  CA  . GLY A  1 87  ? 1.870   -4.486  -68.114 1.00 33.23  ? 82  GLY A CA  1 
ATOM   673  C  C   . GLY A  1 87  ? 1.930   -3.172  -67.369 1.00 30.87  ? 82  GLY A C   1 
ATOM   674  O  O   . GLY A  1 87  ? 1.751   -2.110  -67.964 1.00 28.20  ? 82  GLY A O   1 
ATOM   675  N  N   . GLU A  1 88  ? 2.183   -3.234  -66.067 1.00 27.79  ? 83  GLU A N   1 
ATOM   676  C  CA  . GLU A  1 88  ? 2.202   -2.023  -65.257 1.00 27.57  ? 83  GLU A CA  1 
ATOM   677  C  C   . GLU A  1 88  ? 3.210   -2.094  -64.117 1.00 34.18  ? 83  GLU A C   1 
ATOM   678  O  O   . GLU A  1 88  ? 3.579   -3.175  -63.655 1.00 28.78  ? 83  GLU A O   1 
ATOM   679  C  CB  . GLU A  1 88  ? 0.811   -1.739  -64.690 1.00 29.88  ? 83  GLU A CB  1 
ATOM   680  C  CG  . GLU A  1 88  ? 0.342   -2.773  -63.684 1.00 49.34  ? 83  GLU A CG  1 
ATOM   681  C  CD  . GLU A  1 88  ? -1.008  -2.433  -63.089 1.00 55.46  ? 83  GLU A CD  1 
ATOM   682  O  OE1 . GLU A  1 88  ? -1.448  -1.275  -63.239 1.00 58.62  ? 83  GLU A OE1 1 
ATOM   683  O  OE2 . GLU A  1 88  ? -1.628  -3.325  -62.473 1.00 59.35  ? 83  GLU A OE2 1 
ATOM   684  N  N   . ALA A  1 89  ? 3.642   -0.925  -63.662 1.00 30.03  ? 84  ALA A N   1 
ATOM   685  C  CA  . ALA A  1 89  ? 4.520   -0.834  -62.509 1.00 32.07  ? 84  ALA A CA  1 
ATOM   686  C  C   . ALA A  1 89  ? 4.136   0.354   -61.639 1.00 37.17  ? 84  ALA A C   1 
ATOM   687  O  O   . ALA A  1 89  ? 3.627   1.364   -62.127 1.00 33.90  ? 84  ALA A O   1 
ATOM   688  C  CB  . ALA A  1 89  ? 5.968   -0.722  -62.950 1.00 33.09  ? 84  ALA A CB  1 
ATOM   689  N  N   . LYS A  1 90  ? 4.366   0.213   -60.341 1.00 33.73  ? 85  LYS A N   1 
ATOM   690  C  CA  . LYS A  1 90  ? 4.248   1.328   -59.421 1.00 39.07  ? 85  LYS A CA  1 
ATOM   691  C  C   . LYS A  1 90  ? 5.652   1.657   -58.962 1.00 39.31  ? 85  LYS A C   1 
ATOM   692  O  O   . LYS A  1 90  ? 6.312   0.832   -58.335 1.00 43.79  ? 85  LYS A O   1 
ATOM   693  C  CB  . LYS A  1 90  ? 3.373   0.955   -58.224 1.00 45.17  ? 85  LYS A CB  1 
ATOM   694  C  CG  . LYS A  1 90  ? 1.953   0.561   -58.597 1.00 56.35  ? 85  LYS A CG  1 
ATOM   695  C  CD  . LYS A  1 90  ? 0.928   1.454   -57.914 1.00 62.31  ? 85  LYS A CD  1 
ATOM   696  C  CE  . LYS A  1 90  ? -0.457  1.257   -58.509 1.00 63.53  ? 85  LYS A CE  1 
ATOM   697  N  NZ  . LYS A  1 90  ? -0.870  -0.174  -58.498 1.00 68.30  ? 85  LYS A NZ  1 
ATOM   698  N  N   . VAL A  1 91  ? 6.131   2.848   -59.292 1.00 34.64  ? 86  VAL A N   1 
ATOM   699  C  CA  . VAL A  1 91  ? 7.477   3.213   -58.879 1.00 36.81  ? 86  VAL A CA  1 
ATOM   700  C  C   . VAL A  1 91  ? 7.440   4.064   -57.605 1.00 37.13  ? 86  VAL A C   1 
ATOM   701  O  O   . VAL A  1 91  ? 6.687   5.036   -57.513 1.00 31.70  ? 86  VAL A O   1 
ATOM   702  C  CB  . VAL A  1 91  ? 8.312   3.835   -60.041 1.00 40.05  ? 86  VAL A CB  1 
ATOM   703  C  CG1 . VAL A  1 91  ? 7.981   3.136   -61.356 1.00 43.78  ? 86  VAL A CG1 1 
ATOM   704  C  CG2 . VAL A  1 91  ? 8.089   5.329   -60.167 1.00 39.74  ? 86  VAL A CG2 1 
ATOM   705  N  N   . PRO A  1 92  ? 8.221   3.658   -56.592 1.00 39.05  ? 87  PRO A N   1 
ATOM   706  C  CA  . PRO A  1 92  ? 8.203   4.329   -55.289 1.00 39.74  ? 87  PRO A CA  1 
ATOM   707  C  C   . PRO A  1 92  ? 9.010   5.620   -55.303 1.00 40.84  ? 87  PRO A C   1 
ATOM   708  O  O   . PRO A  1 92  ? 10.229  5.594   -55.474 1.00 43.03  ? 87  PRO A O   1 
ATOM   709  C  CB  . PRO A  1 92  ? 8.851   3.299   -54.360 1.00 45.06  ? 87  PRO A CB  1 
ATOM   710  C  CG  . PRO A  1 92  ? 9.766   2.524   -55.246 1.00 49.41  ? 87  PRO A CG  1 
ATOM   711  C  CD  . PRO A  1 92  ? 9.125   2.494   -56.610 1.00 42.98  ? 87  PRO A CD  1 
ATOM   712  N  N   . LEU A  1 93  ? 8.332   6.746   -55.117 1.00 39.72  ? 88  LEU A N   1 
ATOM   713  C  CA  . LEU A  1 93  ? 9.000   8.038   -55.193 1.00 39.05  ? 88  LEU A CA  1 
ATOM   714  C  C   . LEU A  1 93  ? 9.763   8.364   -53.914 1.00 43.18  ? 88  LEU A C   1 
ATOM   715  O  O   . LEU A  1 93  ? 10.448  9.385   -53.836 1.00 36.05  ? 88  LEU A O   1 
ATOM   716  C  CB  . LEU A  1 93  ? 8.004   9.146   -55.539 1.00 39.31  ? 88  LEU A CB  1 
ATOM   717  C  CG  . LEU A  1 93  ? 7.387   9.018   -56.934 1.00 31.57  ? 88  LEU A CG  1 
ATOM   718  C  CD1 . LEU A  1 93  ? 6.563   10.242  -57.268 1.00 38.72  ? 88  LEU A CD1 1 
ATOM   719  C  CD2 . LEU A  1 93  ? 8.471   8.804   -57.972 1.00 33.61  ? 88  LEU A CD2 1 
ATOM   720  N  N   . ARG A  1 94  ? 9.654   7.488   -52.919 1.00 44.16  ? 89  ARG A N   1 
ATOM   721  C  CA  . ARG A  1 94  ? 10.424  7.643   -51.691 1.00 50.99  ? 89  ARG A CA  1 
ATOM   722  C  C   . ARG A  1 94  ? 11.916  7.599   -52.012 1.00 45.39  ? 89  ARG A C   1 
ATOM   723  O  O   . ARG A  1 94  ? 12.723  8.254   -51.354 1.00 37.08  ? 89  ARG A O   1 
ATOM   724  C  CB  . ARG A  1 94  ? 10.059  6.566   -50.662 1.00 58.35  ? 89  ARG A CB  1 
ATOM   725  C  CG  . ARG A  1 94  ? 10.536  5.159   -51.004 1.00 65.42  ? 89  ARG A CG  1 
ATOM   726  C  CD  . ARG A  1 94  ? 10.259  4.183   -49.870 1.00 77.04  ? 89  ARG A CD  1 
ATOM   727  N  NE  . ARG A  1 94  ? 8.828   3.980   -49.664 1.00 87.39  ? 89  ARG A NE  1 
ATOM   728  C  CZ  . ARG A  1 94  ? 8.125   2.998   -50.220 1.00 93.20  ? 89  ARG A CZ  1 
ATOM   729  N  NH1 . ARG A  1 94  ? 8.722   2.120   -51.016 1.00 92.37  ? 89  ARG A NH1 1 
ATOM   730  N  NH2 . ARG A  1 94  ? 6.826   2.891   -49.979 1.00 97.40  ? 89  ARG A NH2 1 
ATOM   731  N  N   . GLU A  1 95  ? 12.265  6.837   -53.047 1.00 46.10  ? 90  GLU A N   1 
ATOM   732  C  CA  . GLU A  1 95  ? 13.646  6.715   -53.494 1.00 45.00  ? 90  GLU A CA  1 
ATOM   733  C  C   . GLU A  1 95  ? 14.189  8.051   -53.994 1.00 41.93  ? 90  GLU A C   1 
ATOM   734  O  O   . GLU A  1 95  ? 15.395  8.290   -53.959 1.00 47.60  ? 90  GLU A O   1 
ATOM   735  C  CB  . GLU A  1 95  ? 13.766  5.658   -54.594 1.00 46.58  ? 90  GLU A CB  1 
ATOM   736  C  CG  . GLU A  1 95  ? 13.409  4.246   -54.154 1.00 59.81  ? 90  GLU A CG  1 
ATOM   737  C  CD  . GLU A  1 95  ? 13.960  3.191   -55.096 1.00 67.40  ? 90  GLU A CD  1 
ATOM   738  O  OE1 . GLU A  1 95  ? 15.199  3.104   -55.232 1.00 74.80  ? 90  GLU A OE1 1 
ATOM   739  O  OE2 . GLU A  1 95  ? 13.157  2.452   -55.703 1.00 65.38  ? 90  GLU A OE2 1 
ATOM   740  N  N   . VAL A  1 96  ? 13.294  8.917   -54.459 1.00 32.98  ? 91  VAL A N   1 
ATOM   741  C  CA  . VAL A  1 96  ? 13.678  10.255  -54.896 1.00 35.63  ? 91  VAL A CA  1 
ATOM   742  C  C   . VAL A  1 96  ? 14.043  11.128  -53.692 1.00 36.99  ? 91  VAL A C   1 
ATOM   743  O  O   . VAL A  1 96  ? 14.964  11.943  -53.759 1.00 42.59  ? 91  VAL A O   1 
ATOM   744  C  CB  . VAL A  1 96  ? 12.555  10.920  -55.732 1.00 40.17  ? 91  VAL A CB  1 
ATOM   745  C  CG1 . VAL A  1 96  ? 12.900  12.362  -56.062 1.00 42.82  ? 91  VAL A CG1 1 
ATOM   746  C  CG2 . VAL A  1 96  ? 12.306  10.128  -57.006 1.00 31.77  ? 91  VAL A CG2 1 
ATOM   747  N  N   . LEU A  1 97  ? 13.328  10.936  -52.586 1.00 36.99  ? 92  LEU A N   1 
ATOM   748  C  CA  . LEU A  1 97  ? 13.577  11.692  -51.360 1.00 41.21  ? 92  LEU A CA  1 
ATOM   749  C  C   . LEU A  1 97  ? 14.695  11.080  -50.520 1.00 42.59  ? 92  LEU A C   1 
ATOM   750  O  O   . LEU A  1 97  ? 14.879  11.453  -49.363 1.00 47.34  ? 92  LEU A O   1 
ATOM   751  C  CB  . LEU A  1 97  ? 12.306  11.763  -50.509 1.00 46.01  ? 92  LEU A CB  1 
ATOM   752  C  CG  . LEU A  1 97  ? 11.135  12.614  -51.001 1.00 48.69  ? 92  LEU A CG  1 
ATOM   753  C  CD1 . LEU A  1 97  ? 10.001  12.579  -49.989 1.00 48.34  ? 92  LEU A CD1 1 
ATOM   754  C  CD2 . LEU A  1 97  ? 11.580  14.045  -51.260 1.00 47.60  ? 92  LEU A CD2 1 
ATOM   755  N  N   . ALA A  1 98  ? 15.440  10.145  -51.100 1.00 41.41  ? 93  ALA A N   1 
ATOM   756  C  CA  . ALA A  1 98  ? 16.396  9.353   -50.330 1.00 44.52  ? 93  ALA A CA  1 
ATOM   757  C  C   . ALA A  1 98  ? 17.832  9.886   -50.349 1.00 33.10  ? 93  ALA A C   1 
ATOM   758  O  O   . ALA A  1 98  ? 18.626  9.552   -49.470 1.00 35.63  ? 93  ALA A O   1 
ATOM   759  C  CB  . ALA A  1 98  ? 16.357  7.895   -50.777 1.00 51.20  ? 93  ALA A CB  1 
ATOM   760  N  N   . THR A  1 99  ? 18.169  10.689  -51.357 1.00 32.59  ? 94  THR A N   1 
ATOM   761  C  CA  . THR A  1 99  ? 19.496  11.306  -51.456 1.00 34.17  ? 94  THR A CA  1 
ATOM   762  C  C   . THR A  1 99  ? 19.342  12.789  -51.832 1.00 28.41  ? 94  THR A C   1 
ATOM   763  O  O   . THR A  1 99  ? 18.301  13.178  -52.366 1.00 27.07  ? 94  THR A O   1 
ATOM   764  C  CB  . THR A  1 99  ? 20.403  10.578  -52.493 1.00 49.23  ? 94  THR A CB  1 
ATOM   765  O  OG1 . THR A  1 99  ? 20.244  11.172  -53.787 1.00 36.19  ? 94  THR A OG1 1 
ATOM   766  C  CG2 . THR A  1 99  ? 20.084  9.086   -52.566 1.00 53.84  ? 94  THR A CG2 1 
ATOM   767  N  N   . PRO A  1 100 ? 20.367  13.624  -51.556 1.00 31.84  ? 95  PRO A N   1 
ATOM   768  C  CA  . PRO A  1 100 ? 20.242  15.067  -51.817 1.00 30.81  ? 95  PRO A CA  1 
ATOM   769  C  C   . PRO A  1 100 ? 19.979  15.417  -53.277 1.00 28.53  ? 95  PRO A C   1 
ATOM   770  O  O   . PRO A  1 100 ? 19.470  16.500  -53.560 1.00 31.43  ? 95  PRO A O   1 
ATOM   771  C  CB  . PRO A  1 100 ? 21.614  15.620  -51.410 1.00 30.86  ? 95  PRO A CB  1 
ATOM   772  C  CG  . PRO A  1 100 ? 22.141  14.648  -50.442 1.00 37.91  ? 95  PRO A CG  1 
ATOM   773  C  CD  . PRO A  1 100 ? 21.648  13.306  -50.899 1.00 36.54  ? 95  PRO A CD  1 
ATOM   774  N  N   . SER A  1 101 ? 20.322  14.512  -54.187 1.00 26.52  ? 96  SER A N   1 
ATOM   775  C  CA  . SER A  1 101 ? 20.156  14.761  -55.612 1.00 27.96  ? 96  SER A CA  1 
ATOM   776  C  C   . SER A  1 101 ? 18.687  14.884  -56.010 1.00 31.76  ? 96  SER A C   1 
ATOM   777  O  O   . SER A  1 101 ? 18.387  15.327  -57.112 1.00 30.56  ? 96  SER A O   1 
ATOM   778  C  CB  . SER A  1 101 ? 20.814  13.648  -56.429 1.00 30.39  ? 96  SER A CB  1 
ATOM   779  O  OG  . SER A  1 101 ? 20.004  12.485  -56.433 1.00 37.07  ? 96  SER A OG  1 
ATOM   780  N  N   . LEU A  1 102 ? 17.788  14.477  -55.115 1.00 26.18  ? 97  LEU A N   1 
ATOM   781  C  CA  . LEU A  1 102 ? 16.342  14.535  -55.349 1.00 27.96  ? 97  LEU A CA  1 
ATOM   782  C  C   . LEU A  1 102 ? 15.954  13.970  -56.710 1.00 30.80  ? 97  LEU A C   1 
ATOM   783  O  O   . LEU A  1 102 ? 15.130  14.540  -57.424 1.00 34.36  ? 97  LEU A O   1 
ATOM   784  C  CB  . LEU A  1 102 ? 15.818  15.964  -55.190 1.00 33.84  ? 97  LEU A CB  1 
ATOM   785  C  CG  . LEU A  1 102 ? 15.922  16.547  -53.778 1.00 35.17  ? 97  LEU A CG  1 
ATOM   786  C  CD1 . LEU A  1 102 ? 15.413  17.977  -53.759 1.00 31.96  ? 97  LEU A CD1 1 
ATOM   787  C  CD2 . LEU A  1 102 ? 15.161  15.688  -52.776 1.00 26.52  ? 97  LEU A CD2 1 
ATOM   788  N  N   . SER A  1 103 ? 16.571  12.850  -57.061 1.00 26.03  ? 98  SER A N   1 
ATOM   789  C  CA  . SER A  1 103 ? 16.333  12.202  -58.338 1.00 26.74  ? 98  SER A CA  1 
ATOM   790  C  C   . SER A  1 103 ? 16.641  10.724  -58.189 1.00 25.74  ? 98  SER A C   1 
ATOM   791  O  O   . SER A  1 103 ? 17.400  10.328  -57.305 1.00 29.50  ? 98  SER A O   1 
ATOM   792  C  CB  . SER A  1 103 ? 17.234  12.800  -59.416 1.00 25.92  ? 98  SER A CB  1 
ATOM   793  O  OG  . SER A  1 103 ? 18.562  12.327  -59.276 1.00 33.38  ? 98  SER A OG  1 
ATOM   794  N  N   . ALA A  1 104 ? 16.056  9.909   -59.057 1.00 23.25  ? 99  ALA A N   1 
ATOM   795  C  CA  . ALA A  1 104 ? 16.300  8.476   -59.026 1.00 21.53  ? 99  ALA A CA  1 
ATOM   796  C  C   . ALA A  1 104 ? 15.962  7.871   -60.375 1.00 27.72  ? 99  ALA A C   1 
ATOM   797  O  O   . ALA A  1 104 ? 15.110  8.383   -61.099 1.00 24.78  ? 99  ALA A O   1 
ATOM   798  C  CB  . ALA A  1 104 ? 15.474  7.818   -57.930 1.00 21.45  ? 99  ALA A CB  1 
ATOM   799  N  N   . SER A  1 105 ? 16.638  6.782   -60.717 1.00 24.07  ? 100 SER A N   1 
ATOM   800  C  CA  . SER A  1 105 ? 16.324  6.069   -61.943 1.00 25.28  ? 100 SER A CA  1 
ATOM   801  C  C   . SER A  1 105 ? 15.705  4.730   -61.598 1.00 28.50  ? 100 SER A C   1 
ATOM   802  O  O   . SER A  1 105 ? 15.978  4.160   -60.543 1.00 24.44  ? 100 SER A O   1 
ATOM   803  C  CB  . SER A  1 105 ? 17.576  5.853   -62.782 1.00 25.87  ? 100 SER A CB  1 
ATOM   804  O  OG  . SER A  1 105 ? 18.414  4.873   -62.194 1.00 33.68  ? 100 SER A OG  1 
ATOM   805  N  N   . PHE A  1 106 ? 14.869  4.230   -62.496 1.00 22.01  ? 101 PHE A N   1 
ATOM   806  C  CA  . PHE A  1 106 ? 14.218  2.954   -62.284 1.00 21.80  ? 101 PHE A CA  1 
ATOM   807  C  C   . PHE A  1 106 ? 14.296  2.109   -63.544 1.00 27.14  ? 101 PHE A C   1 
ATOM   808  O  O   . PHE A  1 106 ? 14.092  2.600   -64.656 1.00 19.68  ? 101 PHE A O   1 
ATOM   809  C  CB  . PHE A  1 106 ? 12.756  3.156   -61.878 1.00 26.70  ? 101 PHE A CB  1 
ATOM   810  C  CG  . PHE A  1 106 ? 12.579  4.036   -60.676 1.00 25.41  ? 101 PHE A CG  1 
ATOM   811  C  CD1 . PHE A  1 106 ? 12.440  5.406   -60.819 1.00 23.29  ? 101 PHE A CD1 1 
ATOM   812  C  CD2 . PHE A  1 106 ? 12.551  3.494   -59.403 1.00 29.13  ? 101 PHE A CD2 1 
ATOM   813  C  CE1 . PHE A  1 106 ? 12.282  6.219   -59.715 1.00 26.62  ? 101 PHE A CE1 1 
ATOM   814  C  CE2 . PHE A  1 106 ? 12.391  4.302   -58.295 1.00 31.67  ? 101 PHE A CE2 1 
ATOM   815  C  CZ  . PHE A  1 106 ? 12.254  5.666   -58.452 1.00 29.51  ? 101 PHE A CZ  1 
ATOM   816  N  N   . ASN A  1 107 ? 14.623  0.839   -63.356 1.00 24.68  ? 102 ASN A N   1 
ATOM   817  C  CA  . ASN A  1 107 ? 14.499  -0.151  -64.406 1.00 27.55  ? 102 ASN A CA  1 
ATOM   818  C  C   . ASN A  1 107 ? 13.518  -1.183  -63.884 1.00 30.94  ? 102 ASN A C   1 
ATOM   819  O  O   . ASN A  1 107 ? 13.908  -2.148  -63.229 1.00 37.09  ? 102 ASN A O   1 
ATOM   820  C  CB  . ASN A  1 107 ? 15.847  -0.795  -64.699 1.00 33.20  ? 102 ASN A CB  1 
ATOM   821  C  CG  . ASN A  1 107 ? 15.899  -1.430  -66.067 1.00 34.74  ? 102 ASN A CG  1 
ATOM   822  O  OD1 . ASN A  1 107 ? 14.883  -1.876  -66.601 1.00 35.01  ? 102 ASN A OD1 1 
ATOM   823  N  ND2 . ASN A  1 107 ? 17.087  -1.468  -66.649 1.00 39.54  ? 102 ASN A ND2 1 
ATOM   824  N  N   . ALA A  1 108 ? 12.239  -0.962  -64.161 1.00 31.12  ? 103 ALA A N   1 
ATOM   825  C  CA  . ALA A  1 108 ? 11.181  -1.683  -63.468 1.00 32.76  ? 103 ALA A CA  1 
ATOM   826  C  C   . ALA A  1 108 ? 10.483  -2.720  -64.334 1.00 28.65  ? 103 ALA A C   1 
ATOM   827  O  O   . ALA A  1 108 ? 9.976   -2.395  -65.407 1.00 29.57  ? 103 ALA A O   1 
ATOM   828  C  CB  . ALA A  1 108 ? 10.166  -0.699  -62.908 1.00 34.54  ? 103 ALA A CB  1 
ATOM   829  N  N   . PRO A  1 109 ? 10.458  -3.978  -63.864 1.00 27.25  ? 104 PRO A N   1 
ATOM   830  C  CA  . PRO A  1 109 ? 9.695   -5.039  -64.522 1.00 29.90  ? 104 PRO A CA  1 
ATOM   831  C  C   . PRO A  1 109 ? 8.224   -4.669  -64.561 1.00 33.38  ? 104 PRO A C   1 
ATOM   832  O  O   . PRO A  1 109 ? 7.699   -4.113  -63.595 1.00 35.55  ? 104 PRO A O   1 
ATOM   833  C  CB  . PRO A  1 109 ? 9.893   -6.242  -63.595 1.00 31.41  ? 104 PRO A CB  1 
ATOM   834  C  CG  . PRO A  1 109 ? 11.147  -5.960  -62.872 1.00 32.41  ? 104 PRO A CG  1 
ATOM   835  C  CD  . PRO A  1 109 ? 11.199  -4.477  -62.694 1.00 28.55  ? 104 PRO A CD  1 
ATOM   836  N  N   . LEU A  1 110 ? 7.570   -4.962  -65.675 1.00 33.98  ? 105 LEU A N   1 
ATOM   837  C  CA  . LEU A  1 110 ? 6.147   -4.702  -65.796 1.00 34.94  ? 105 LEU A CA  1 
ATOM   838  C  C   . LEU A  1 110 ? 5.369   -5.933  -65.359 1.00 32.53  ? 105 LEU A C   1 
ATOM   839  O  O   . LEU A  1 110 ? 5.688   -7.056  -65.750 1.00 31.33  ? 105 LEU A O   1 
ATOM   840  C  CB  . LEU A  1 110 ? 5.798   -4.309  -67.229 1.00 24.94  ? 105 LEU A CB  1 
ATOM   841  C  CG  . LEU A  1 110 ? 6.432   -2.992  -67.677 1.00 24.26  ? 105 LEU A CG  1 
ATOM   842  C  CD1 . LEU A  1 110 ? 6.414   -2.878  -69.185 1.00 27.15  ? 105 LEU A CD1 1 
ATOM   843  C  CD2 . LEU A  1 110 ? 5.716   -1.815  -67.037 1.00 30.18  ? 105 LEU A CD2 1 
ATOM   844  N  N   . LEU A  1 111 ? 4.355   -5.715  -64.532 1.00 35.66  ? 106 LEU A N   1 
ATOM   845  C  CA  . LEU A  1 111 ? 3.574   -6.810  -63.979 1.00 35.26  ? 106 LEU A CA  1 
ATOM   846  C  C   . LEU A  1 111 ? 2.200   -6.880  -64.638 1.00 38.28  ? 106 LEU A C   1 
ATOM   847  O  O   . LEU A  1 111 ? 1.675   -5.865  -65.097 1.00 32.08  ? 106 LEU A O   1 
ATOM   848  C  CB  . LEU A  1 111 ? 3.415   -6.632  -62.469 1.00 35.11  ? 106 LEU A CB  1 
ATOM   849  C  CG  . LEU A  1 111 ? 4.658   -6.248  -61.662 1.00 41.34  ? 106 LEU A CG  1 
ATOM   850  C  CD1 . LEU A  1 111 ? 4.343   -6.245  -60.172 1.00 43.37  ? 106 LEU A CD1 1 
ATOM   851  C  CD2 . LEU A  1 111 ? 5.827   -7.173  -61.967 1.00 40.22  ? 106 LEU A CD2 1 
ATOM   852  N  N   . ASP A  1 112 ? 1.624   -8.078  -64.685 1.00 41.70  ? 107 ASP A N   1 
ATOM   853  C  CA  . ASP A  1 112 ? 0.261   -8.247  -65.182 1.00 41.57  ? 107 ASP A CA  1 
ATOM   854  C  C   . ASP A  1 112 ? -0.750  -7.900  -64.090 1.00 41.86  ? 107 ASP A C   1 
ATOM   855  O  O   . ASP A  1 112 ? -0.374  -7.377  -63.041 1.00 40.88  ? 107 ASP A O   1 
ATOM   856  C  CB  . ASP A  1 112 ? 0.033   -9.666  -65.727 1.00 43.92  ? 107 ASP A CB  1 
ATOM   857  C  CG  . ASP A  1 112 ? 0.311   -10.758 -64.696 1.00 52.04  ? 107 ASP A CG  1 
ATOM   858  O  OD1 . ASP A  1 112 ? 0.362   -10.463 -63.483 1.00 51.54  ? 107 ASP A OD1 1 
ATOM   859  O  OD2 . ASP A  1 112 ? 0.473   -11.928 -65.107 1.00 51.60  ? 107 ASP A OD2 1 
ATOM   860  N  N   . THR A  1 113 ? -2.026  -8.190  -64.326 1.00 43.04  ? 108 THR A N   1 
ATOM   861  C  CA  . THR A  1 113 ? -3.051  -7.880  -63.329 1.00 53.95  ? 108 THR A CA  1 
ATOM   862  C  C   . THR A  1 113 ? -2.921  -8.742  -62.076 1.00 60.84  ? 108 THR A C   1 
ATOM   863  O  O   . THR A  1 113 ? -3.323  -8.329  -60.989 1.00 59.35  ? 108 THR A O   1 
ATOM   864  C  CB  . THR A  1 113 ? -4.481  -7.968  -63.894 1.00 56.88  ? 108 THR A CB  1 
ATOM   865  O  OG1 . THR A  1 113 ? -4.572  -9.067  -64.807 1.00 59.24  ? 108 THR A OG1 1 
ATOM   866  C  CG2 . THR A  1 113 ? -4.840  -6.680  -64.620 1.00 54.71  ? 108 THR A CG2 1 
ATOM   867  N  N   . LYS A  1 114 ? -2.336  -9.927  -62.226 1.00 64.29  ? 109 LYS A N   1 
ATOM   868  C  CA  . LYS A  1 114 ? -2.074  -10.801 -61.087 1.00 67.74  ? 109 LYS A CA  1 
ATOM   869  C  C   . LYS A  1 114 ? -0.824  -10.340 -60.339 1.00 66.78  ? 109 LYS A C   1 
ATOM   870  O  O   . LYS A  1 114 ? -0.332  -11.034 -59.449 1.00 69.32  ? 109 LYS A O   1 
ATOM   871  C  CB  . LYS A  1 114 ? -1.902  -12.248 -61.551 1.00 69.14  ? 109 LYS A CB  1 
ATOM   872  C  CG  . LYS A  1 114 ? -3.018  -12.750 -62.455 1.00 70.08  ? 109 LYS A CG  1 
ATOM   873  C  CD  . LYS A  1 114 ? -2.848  -14.227 -62.795 1.00 72.33  ? 109 LYS A CD  1 
ATOM   874  C  CE  . LYS A  1 114 ? -1.943  -14.443 -64.006 1.00 70.64  ? 109 LYS A CE  1 
ATOM   875  N  NZ  . LYS A  1 114 ? -0.513  -14.101 -63.764 1.00 65.11  ? 109 LYS A NZ  1 
ATOM   876  N  N   . LYS A  1 115 ? -0.326  -9.162  -60.715 1.00 60.32  ? 110 LYS A N   1 
ATOM   877  C  CA  . LYS A  1 115 ? 0.897   -8.588  -60.161 1.00 61.51  ? 110 LYS A CA  1 
ATOM   878  C  C   . LYS A  1 115 ? 2.071   -9.548  -60.284 1.00 59.45  ? 110 LYS A C   1 
ATOM   879  O  O   . LYS A  1 115 ? 2.881   -9.680  -59.370 1.00 64.81  ? 110 LYS A O   1 
ATOM   880  C  CB  . LYS A  1 115 ? 0.696   -8.152  -58.708 1.00 72.31  ? 110 LYS A CB  1 
ATOM   881  C  CG  . LYS A  1 115 ? -0.315  -7.029  -58.537 1.00 76.73  ? 110 LYS A CG  1 
ATOM   882  C  CD  . LYS A  1 115 ? 0.188   -5.723  -59.135 1.00 74.75  ? 110 LYS A CD  1 
ATOM   883  C  CE  . LYS A  1 115 ? -0.823  -4.600  -58.942 1.00 78.38  ? 110 LYS A CE  1 
ATOM   884  N  NZ  . LYS A  1 115 ? -0.305  -3.299  -59.450 1.00 76.20  ? 110 LYS A NZ  1 
ATOM   885  N  N   . GLN A  1 116 ? 2.142   -10.218 -61.428 1.00 52.27  ? 111 GLN A N   1 
ATOM   886  C  CA  . GLN A  1 116 ? 3.225   -11.142 -61.731 1.00 54.29  ? 111 GLN A CA  1 
ATOM   887  C  C   . GLN A  1 116 ? 3.894   -10.698 -63.031 1.00 50.77  ? 111 GLN A C   1 
ATOM   888  O  O   . GLN A  1 116 ? 3.230   -10.155 -63.913 1.00 44.38  ? 111 GLN A O   1 
ATOM   889  C  CB  . GLN A  1 116 ? 2.681   -12.569 -61.829 1.00 59.93  ? 111 GLN A CB  1 
ATOM   890  C  CG  . GLN A  1 116 ? 2.247   -13.130 -60.482 1.00 71.92  ? 111 GLN A CG  1 
ATOM   891  C  CD  . GLN A  1 116 ? 1.372   -14.361 -60.601 1.00 81.63  ? 111 GLN A CD  1 
ATOM   892  O  OE1 . GLN A  1 116 ? 0.615   -14.685 -59.686 1.00 86.42  ? 111 GLN A OE1 1 
ATOM   893  N  NE2 . GLN A  1 116 ? 1.473   -15.057 -61.727 1.00 83.81  ? 111 GLN A NE2 1 
ATOM   894  N  N   . PRO A  1 117 ? 5.215   -10.916 -63.147 1.00 50.80  ? 112 PRO A N   1 
ATOM   895  C  CA  . PRO A  1 117 ? 6.014   -10.335 -64.235 1.00 44.86  ? 112 PRO A CA  1 
ATOM   896  C  C   . PRO A  1 117 ? 5.541   -10.729 -65.634 1.00 44.60  ? 112 PRO A C   1 
ATOM   897  O  O   . PRO A  1 117 ? 5.042   -11.834 -65.830 1.00 42.67  ? 112 PRO A O   1 
ATOM   898  C  CB  . PRO A  1 117 ? 7.413   -10.902 -63.982 1.00 50.22  ? 112 PRO A CB  1 
ATOM   899  C  CG  . PRO A  1 117 ? 7.423   -11.286 -62.546 1.00 53.50  ? 112 PRO A CG  1 
ATOM   900  C  CD  . PRO A  1 117 ? 6.035   -11.747 -62.249 1.00 49.29  ? 112 PRO A CD  1 
ATOM   901  N  N   . THR A  1 118 ? 5.703   -9.822  -66.592 1.00 39.91  ? 113 THR A N   1 
ATOM   902  C  CA  . THR A  1 118 ? 5.325   -10.088 -67.975 1.00 40.45  ? 113 THR A CA  1 
ATOM   903  C  C   . THR A  1 118 ? 6.550   -10.465 -68.796 1.00 42.91  ? 113 THR A C   1 
ATOM   904  O  O   . THR A  1 118 ? 6.435   -10.975 -69.909 1.00 44.13  ? 113 THR A O   1 
ATOM   905  C  CB  . THR A  1 118 ? 4.676   -8.854  -68.625 1.00 35.25  ? 113 THR A CB  1 
ATOM   906  O  OG1 . THR A  1 118 ? 5.627   -7.781  -68.666 1.00 38.83  ? 113 THR A OG1 1 
ATOM   907  C  CG2 . THR A  1 118 ? 3.453   -8.415  -67.837 1.00 33.31  ? 113 THR A CG2 1 
ATOM   908  N  N   . GLY A  1 119 ? 7.727   -10.207 -68.238 1.00 44.94  ? 114 GLY A N   1 
ATOM   909  C  CA  . GLY A  1 119 ? 8.970   -10.418 -68.953 1.00 41.74  ? 114 GLY A CA  1 
ATOM   910  C  C   . GLY A  1 119 ? 9.486   -9.108  -69.511 1.00 37.39  ? 114 GLY A C   1 
ATOM   911  O  O   . GLY A  1 119 ? 10.670  -8.974  -69.819 1.00 37.53  ? 114 GLY A O   1 
ATOM   912  N  N   . ALA A  1 120 ? 8.586   -8.138  -69.641 1.00 32.40  ? 115 ALA A N   1 
ATOM   913  C  CA  . ALA A  1 120 ? 8.945   -6.816  -70.133 1.00 28.13  ? 115 ALA A CA  1 
ATOM   914  C  C   . ALA A  1 120 ? 9.408   -5.923  -68.984 1.00 28.62  ? 115 ALA A C   1 
ATOM   915  O  O   . ALA A  1 120 ? 9.067   -6.160  -67.826 1.00 26.76  ? 115 ALA A O   1 
ATOM   916  C  CB  . ALA A  1 120 ? 7.766   -6.182  -70.859 1.00 27.11  ? 115 ALA A CB  1 
ATOM   917  N  N   . SER A  1 121 ? 10.190  -4.900  -69.313 1.00 26.82  ? 116 SER A N   1 
ATOM   918  C  CA  . SER A  1 121 ? 10.681  -3.955  -68.316 1.00 25.16  ? 116 SER A CA  1 
ATOM   919  C  C   . SER A  1 121 ? 10.590  -2.530  -68.846 1.00 26.85  ? 116 SER A C   1 
ATOM   920  O  O   . SER A  1 121 ? 10.613  -2.315  -70.053 1.00 25.20  ? 116 SER A O   1 
ATOM   921  C  CB  . SER A  1 121 ? 12.126  -4.282  -67.939 1.00 32.08  ? 116 SER A CB  1 
ATOM   922  O  OG  . SER A  1 121 ? 12.958  -4.297  -69.087 1.00 38.48  ? 116 SER A OG  1 
ATOM   923  N  N   . LEU A  1 122 ? 10.489  -1.562  -67.942 1.00 26.96  ? 117 LEU A N   1 
ATOM   924  C  CA  . LEU A  1 122 ? 10.372  -0.161  -68.332 1.00 20.12  ? 117 LEU A CA  1 
ATOM   925  C  C   . LEU A  1 122 ? 11.458  0.681   -67.677 1.00 24.32  ? 117 LEU A C   1 
ATOM   926  O  O   . LEU A  1 122 ? 11.648  0.625   -66.464 1.00 21.85  ? 117 LEU A O   1 
ATOM   927  C  CB  . LEU A  1 122 ? 8.997   0.386   -67.948 1.00 19.81  ? 117 LEU A CB  1 
ATOM   928  C  CG  . LEU A  1 122 ? 8.759   1.875   -68.210 1.00 19.94  ? 117 LEU A CG  1 
ATOM   929  C  CD1 . LEU A  1 122 ? 8.775   2.187   -69.704 1.00 23.70  ? 117 LEU A CD1 1 
ATOM   930  C  CD2 . LEU A  1 122 ? 7.449   2.320   -67.578 1.00 26.26  ? 117 LEU A CD2 1 
ATOM   931  N  N   . VAL A  1 123 ? 12.169  1.462   -68.484 1.00 23.12  ? 118 VAL A N   1 
ATOM   932  C  CA  . VAL A  1 123 ? 13.242  2.304   -67.973 1.00 24.22  ? 118 VAL A CA  1 
ATOM   933  C  C   . VAL A  1 123 ? 12.831  3.771   -67.941 1.00 23.15  ? 118 VAL A C   1 
ATOM   934  O  O   . VAL A  1 123 ? 12.456  4.349   -68.963 1.00 20.74  ? 118 VAL A O   1 
ATOM   935  C  CB  . VAL A  1 123 ? 14.529  2.147   -68.800 1.00 26.13  ? 118 VAL A CB  1 
ATOM   936  C  CG1 . VAL A  1 123 ? 15.554  3.193   -68.390 1.00 26.21  ? 118 VAL A CG1 1 
ATOM   937  C  CG2 . VAL A  1 123 ? 15.091  0.744   -68.633 1.00 21.78  ? 118 VAL A CG2 1 
ATOM   938  N  N   . LEU A  1 124 ? 12.903  4.367   -66.757 1.00 18.09  ? 119 LEU A N   1 
ATOM   939  C  CA  . LEU A  1 124 ? 12.502  5.753   -66.586 1.00 17.62  ? 119 LEU A CA  1 
ATOM   940  C  C   . LEU A  1 124 ? 13.392  6.477   -65.583 1.00 21.54  ? 119 LEU A C   1 
ATOM   941  O  O   . LEU A  1 124 ? 14.120  5.849   -64.812 1.00 19.62  ? 119 LEU A O   1 
ATOM   942  C  CB  . LEU A  1 124 ? 11.029  5.854   -66.168 1.00 21.90  ? 119 LEU A CB  1 
ATOM   943  C  CG  . LEU A  1 124 ? 10.540  5.164   -64.889 1.00 21.86  ? 119 LEU A CG  1 
ATOM   944  C  CD1 . LEU A  1 124 ? 9.292   5.860   -64.374 1.00 25.42  ? 119 LEU A CD1 1 
ATOM   945  C  CD2 . LEU A  1 124 ? 10.248  3.685   -65.117 1.00 28.12  ? 119 LEU A CD2 1 
ATOM   946  N  N   . GLN A  1 125 ? 13.329  7.803   -65.615 1.00 20.83  ? 120 GLN A N   1 
ATOM   947  C  CA  . GLN A  1 125 ? 14.090  8.648   -64.707 1.00 20.73  ? 120 GLN A CA  1 
ATOM   948  C  C   . GLN A  1 125 ? 13.160  9.687   -64.101 1.00 22.88  ? 120 GLN A C   1 
ATOM   949  O  O   . GLN A  1 125 ? 12.350  10.293  -64.807 1.00 20.56  ? 120 GLN A O   1 
ATOM   950  C  CB  . GLN A  1 125 ? 15.229  9.343   -65.453 1.00 19.70  ? 120 GLN A CB  1 
ATOM   951  C  CG  . GLN A  1 125 ? 15.700  10.642  -64.810 1.00 31.72  ? 120 GLN A CG  1 
ATOM   952  C  CD  . GLN A  1 125 ? 16.665  10.412  -63.672 1.00 38.25  ? 120 GLN A CD  1 
ATOM   953  O  OE1 . GLN A  1 125 ? 17.271  9.346   -63.565 1.00 43.79  ? 120 GLN A OE1 1 
ATOM   954  N  NE2 . GLN A  1 125 ? 16.817  11.413  -62.812 1.00 33.73  ? 120 GLN A NE2 1 
ATOM   955  N  N   . VAL A  1 126 ? 13.279  9.890   -62.793 1.00 17.54  ? 121 VAL A N   1 
ATOM   956  C  CA  . VAL A  1 126 ? 12.393  10.796  -62.076 1.00 18.04  ? 121 VAL A CA  1 
ATOM   957  C  C   . VAL A  1 126 ? 13.180  11.838  -61.277 1.00 24.91  ? 121 VAL A C   1 
ATOM   958  O  O   . VAL A  1 126 ? 14.185  11.521  -60.641 1.00 20.84  ? 121 VAL A O   1 
ATOM   959  C  CB  . VAL A  1 126 ? 11.445  10.022  -61.133 1.00 22.09  ? 121 VAL A CB  1 
ATOM   960  C  CG1 . VAL A  1 126 ? 10.404  10.950  -60.561 1.00 21.48  ? 121 VAL A CG1 1 
ATOM   961  C  CG2 . VAL A  1 126 ? 10.767  8.882   -61.878 1.00 28.34  ? 121 VAL A CG2 1 
ATOM   962  N  N   . SER A  1 127 ? 12.711  13.082  -61.317 1.00 23.84  ? 122 SER A N   1 
ATOM   963  C  CA  . SER A  1 127 ? 13.398  14.191  -60.664 1.00 30.02  ? 122 SER A CA  1 
ATOM   964  C  C   . SER A  1 127 ? 12.423  15.162  -59.994 1.00 31.96  ? 122 SER A C   1 
ATOM   965  O  O   . SER A  1 127 ? 11.399  15.536  -60.567 1.00 25.25  ? 122 SER A O   1 
ATOM   966  C  CB  . SER A  1 127 ? 14.283  14.937  -61.668 1.00 32.64  ? 122 SER A CB  1 
ATOM   967  O  OG  . SER A  1 127 ? 14.817  16.120  -61.101 1.00 44.23  ? 122 SER A OG  1 
ATOM   968  N  N   . TYR A  1 128 ? 12.775  15.572  -58.780 1.00 30.06  ? 123 TYR A N   1 
ATOM   969  C  CA  . TYR A  1 128 ? 11.963  16.457  -57.952 1.00 34.39  ? 123 TYR A CA  1 
ATOM   970  C  C   . TYR A  1 128 ? 12.644  17.822  -57.942 1.00 36.74  ? 123 TYR A C   1 
ATOM   971  O  O   . TYR A  1 128 ? 13.649  18.006  -57.257 1.00 41.65  ? 123 TYR A O   1 
ATOM   972  C  CB  . TYR A  1 128 ? 11.930  15.882  -56.535 1.00 36.14  ? 123 TYR A CB  1 
ATOM   973  C  CG  . TYR A  1 128 ? 10.876  16.431  -55.598 1.00 38.98  ? 123 TYR A CG  1 
ATOM   974  C  CD1 . TYR A  1 128 ? 9.794   17.165  -56.064 1.00 43.07  ? 123 TYR A CD1 1 
ATOM   975  C  CD2 . TYR A  1 128 ? 10.971  16.202  -54.231 1.00 37.37  ? 123 TYR A CD2 1 
ATOM   976  C  CE1 . TYR A  1 128 ? 8.836   17.657  -55.187 1.00 44.15  ? 123 TYR A CE1 1 
ATOM   977  C  CE2 . TYR A  1 128 ? 10.024  16.687  -53.355 1.00 42.71  ? 123 TYR A CE2 1 
ATOM   978  C  CZ  . TYR A  1 128 ? 8.958   17.413  -53.834 1.00 41.74  ? 123 TYR A CZ  1 
ATOM   979  O  OH  . TYR A  1 128 ? 8.019   17.892  -52.948 1.00 48.62  ? 123 TYR A OH  1 
ATOM   980  N  N   . THR A  1 129 ? 12.114  18.778  -58.699 1.00 38.12  ? 124 THR A N   1 
ATOM   981  C  CA  . THR A  1 129 ? 12.834  20.032  -58.909 1.00 45.30  ? 124 THR A CA  1 
ATOM   982  C  C   . THR A  1 129 ? 11.971  21.292  -58.831 1.00 46.34  ? 124 THR A C   1 
ATOM   983  O  O   . THR A  1 129 ? 10.752  21.243  -58.996 1.00 41.84  ? 124 THR A O   1 
ATOM   984  C  CB  . THR A  1 129 ? 13.582  20.022  -60.262 1.00 46.64  ? 124 THR A CB  1 
ATOM   985  O  OG1 . THR A  1 129 ? 14.552  21.077  -60.288 1.00 48.64  ? 124 THR A OG1 1 
ATOM   986  C  CG2 . THR A  1 129 ? 12.606  20.197  -61.420 1.00 45.34  ? 124 THR A CG2 1 
ATOM   987  N  N   . ALA A  1 130 ? 12.628  22.421  -58.580 1.00 55.11  ? 125 ALA A N   1 
ATOM   988  C  CA  . ALA A  1 130 ? 11.964  23.718  -58.546 1.00 56.69  ? 125 ALA A CA  1 
ATOM   989  C  C   . ALA A  1 130 ? 12.205  24.477  -59.846 1.00 59.26  ? 125 ALA A C   1 
ATOM   990  O  O   . ALA A  1 130 ? 11.347  24.507  -60.727 1.00 65.48  ? 125 ALA A O   1 
ATOM   991  C  CB  . ALA A  1 130 ? 12.453  24.532  -57.357 1.00 58.12  ? 125 ALA A CB  1 
ATOM   992  N  N   . PHE B  1 5   ? 21.537  -4.625  -26.357 1.00 59.23  ? 0   PHE B N   1 
ATOM   993  C  CA  . PHE B  1 5   ? 21.897  -4.049  -27.648 1.00 56.80  ? 0   PHE B CA  1 
ATOM   994  C  C   . PHE B  1 5   ? 21.472  -2.591  -27.696 1.00 48.30  ? 0   PHE B C   1 
ATOM   995  O  O   . PHE B  1 5   ? 20.544  -2.184  -26.998 1.00 47.14  ? 0   PHE B O   1 
ATOM   996  C  CB  . PHE B  1 5   ? 21.230  -4.809  -28.798 1.00 66.28  ? 0   PHE B CB  1 
ATOM   997  C  CG  . PHE B  1 5   ? 21.789  -6.187  -29.035 1.00 79.98  ? 0   PHE B CG  1 
ATOM   998  C  CD1 . PHE B  1 5   ? 22.715  -6.748  -28.169 1.00 85.50  ? 0   PHE B CD1 1 
ATOM   999  C  CD2 . PHE B  1 5   ? 21.391  -6.916  -30.141 1.00 84.81  ? 0   PHE B CD2 1 
ATOM   1000 C  CE1 . PHE B  1 5   ? 23.223  -8.012  -28.397 1.00 93.24  ? 0   PHE B CE1 1 
ATOM   1001 C  CE2 . PHE B  1 5   ? 21.897  -8.179  -30.375 1.00 92.00  ? 0   PHE B CE2 1 
ATOM   1002 C  CZ  . PHE B  1 5   ? 22.813  -8.729  -29.502 1.00 96.13  ? 0   PHE B CZ  1 
ATOM   1003 N  N   . MET B  1 6   ? 22.147  -1.803  -28.524 1.00 41.06  ? 1   MET B N   1 
ATOM   1004 C  CA  . MET B  1 6   ? 21.832  -0.387  -28.626 1.00 40.20  ? 1   MET B CA  1 
ATOM   1005 C  C   . MET B  1 6   ? 21.889  0.132   -30.055 1.00 35.17  ? 1   MET B C   1 
ATOM   1006 O  O   . MET B  1 6   ? 22.634  -0.385  -30.886 1.00 31.64  ? 1   MET B O   1 
ATOM   1007 C  CB  . MET B  1 6   ? 22.772  0.429   -27.740 1.00 45.06  ? 1   MET B CB  1 
ATOM   1008 C  CG  . MET B  1 6   ? 22.419  0.390   -26.263 1.00 55.64  ? 1   MET B CG  1 
ATOM   1009 S  SD  . MET B  1 6   ? 23.825  0.767   -25.200 1.00 79.51  ? 1   MET B SD  1 
ATOM   1010 C  CE  . MET B  1 6   ? 25.080  1.172   -26.408 1.00 42.35  ? 1   MET B CE  1 
ATOM   1011 N  N   . LEU B  1 7   ? 21.089  1.155   -30.331 1.00 35.42  ? 2   LEU B N   1 
ATOM   1012 C  CA  . LEU B  1 7   ? 21.159  1.850   -31.604 1.00 28.69  ? 2   LEU B CA  1 
ATOM   1013 C  C   . LEU B  1 7   ? 22.177  2.975   -31.482 1.00 24.31  ? 2   LEU B C   1 
ATOM   1014 O  O   . LEU B  1 7   ? 21.960  3.937   -30.749 1.00 28.71  ? 2   LEU B O   1 
ATOM   1015 C  CB  . LEU B  1 7   ? 19.795  2.427   -31.987 1.00 25.59  ? 2   LEU B CB  1 
ATOM   1016 C  CG  . LEU B  1 7   ? 19.751  3.113   -33.355 1.00 23.64  ? 2   LEU B CG  1 
ATOM   1017 C  CD1 . LEU B  1 7   ? 19.790  2.071   -34.451 1.00 24.73  ? 2   LEU B CD1 1 
ATOM   1018 C  CD2 . LEU B  1 7   ? 18.523  3.996   -33.502 1.00 27.86  ? 2   LEU B CD2 1 
ATOM   1019 N  N   . ARG B  1 8   ? 23.295  2.845   -32.188 1.00 23.83  ? 3   ARG B N   1 
ATOM   1020 C  CA  . ARG B  1 8   ? 24.334  3.865   -32.154 1.00 24.46  ? 3   ARG B CA  1 
ATOM   1021 C  C   . ARG B  1 8   ? 24.252  4.742   -33.395 1.00 25.05  ? 3   ARG B C   1 
ATOM   1022 O  O   . ARG B  1 8   ? 24.274  4.244   -34.521 1.00 25.35  ? 3   ARG B O   1 
ATOM   1023 C  CB  . ARG B  1 8   ? 25.718  3.225   -32.048 1.00 23.95  ? 3   ARG B CB  1 
ATOM   1024 C  CG  . ARG B  1 8   ? 26.861  4.225   -31.959 1.00 28.45  ? 3   ARG B CG  1 
ATOM   1025 C  CD  . ARG B  1 8   ? 28.189  3.507   -31.792 1.00 27.23  ? 3   ARG B CD  1 
ATOM   1026 N  NE  . ARG B  1 8   ? 28.382  2.499   -32.829 1.00 27.89  ? 3   ARG B NE  1 
ATOM   1027 C  CZ  . ARG B  1 8   ? 29.081  1.382   -32.664 1.00 31.61  ? 3   ARG B CZ  1 
ATOM   1028 N  NH1 . ARG B  1 8   ? 29.657  1.125   -31.498 1.00 41.91  ? 3   ARG B NH1 1 
ATOM   1029 N  NH2 . ARG B  1 8   ? 29.199  0.520   -33.666 1.00 30.58  ? 3   ARG B NH2 1 
ATOM   1030 N  N   . VAL B  1 9   ? 24.154  6.050   -33.180 1.00 20.62  ? 4   VAL B N   1 
ATOM   1031 C  CA  . VAL B  1 9   ? 24.017  7.001   -34.276 1.00 20.39  ? 4   VAL B CA  1 
ATOM   1032 C  C   . VAL B  1 9   ? 25.060  8.104   -34.186 1.00 16.88  ? 4   VAL B C   1 
ATOM   1033 O  O   . VAL B  1 9   ? 25.215  8.742   -33.144 1.00 21.05  ? 4   VAL B O   1 
ATOM   1034 C  CB  . VAL B  1 9   ? 22.619  7.661   -34.271 1.00 21.62  ? 4   VAL B CB  1 
ATOM   1035 C  CG1 . VAL B  1 9   ? 22.502  8.684   -35.395 1.00 21.04  ? 4   VAL B CG1 1 
ATOM   1036 C  CG2 . VAL B  1 9   ? 21.525  6.607   -34.375 1.00 21.56  ? 4   VAL B CG2 1 
ATOM   1037 N  N   . PHE B  1 10  ? 25.778  8.326   -35.281 1.00 16.86  ? 5   PHE B N   1 
ATOM   1038 C  CA  . PHE B  1 10  ? 26.650  9.485   -35.385 1.00 18.14  ? 5   PHE B CA  1 
ATOM   1039 C  C   . PHE B  1 10  ? 26.020  10.510  -36.315 1.00 19.44  ? 5   PHE B C   1 
ATOM   1040 O  O   . PHE B  1 10  ? 25.836  10.247  -37.499 1.00 17.01  ? 5   PHE B O   1 
ATOM   1041 C  CB  . PHE B  1 10  ? 28.028  9.091   -35.915 1.00 18.69  ? 5   PHE B CB  1 
ATOM   1042 C  CG  . PHE B  1 10  ? 28.731  8.067   -35.077 1.00 22.86  ? 5   PHE B CG  1 
ATOM   1043 C  CD1 . PHE B  1 10  ? 29.502  8.451   -33.994 1.00 26.65  ? 5   PHE B CD1 1 
ATOM   1044 C  CD2 . PHE B  1 10  ? 28.627  6.719   -35.377 1.00 24.82  ? 5   PHE B CD2 1 
ATOM   1045 C  CE1 . PHE B  1 10  ? 30.154  7.506   -33.221 1.00 29.76  ? 5   PHE B CE1 1 
ATOM   1046 C  CE2 . PHE B  1 10  ? 29.275  5.771   -34.608 1.00 27.78  ? 5   PHE B CE2 1 
ATOM   1047 C  CZ  . PHE B  1 10  ? 30.041  6.166   -33.531 1.00 30.16  ? 5   PHE B CZ  1 
ATOM   1048 N  N   A ILE B  1 11  ? 25.671  11.670  -35.774 0.20 21.32  ? 6   ILE B N   1 
ATOM   1049 N  N   B ILE B  1 11  ? 25.664  11.664  -35.781 0.80 22.63  ? 6   ILE B N   1 
ATOM   1050 C  CA  A ILE B  1 11  ? 25.242  12.781  -36.608 0.20 20.11  ? 6   ILE B CA  1 
ATOM   1051 C  CA  B ILE B  1 11  ? 25.274  12.808  -36.574 0.80 20.40  ? 6   ILE B CA  1 
ATOM   1052 C  C   A ILE B  1 11  ? 26.502  13.519  -37.038 0.20 19.45  ? 6   ILE B C   1 
ATOM   1053 C  C   B ILE B  1 11  ? 26.500  13.558  -37.055 0.80 17.38  ? 6   ILE B C   1 
ATOM   1054 O  O   A ILE B  1 11  ? 27.152  14.173  -36.225 0.20 20.85  ? 6   ILE B O   1 
ATOM   1055 O  O   B ILE B  1 11  ? 27.221  14.027  -36.257 0.80 21.93  ? 6   ILE B O   1 
ATOM   1056 C  CB  A ILE B  1 11  ? 24.305  13.732  -35.847 0.20 22.69  ? 6   ILE B CB  1 
ATOM   1057 C  CB  B ILE B  1 11  ? 24.423  13.806  -35.770 0.80 25.29  ? 6   ILE B CB  1 
ATOM   1058 C  CG1 A ILE B  1 11  ? 23.068  12.976  -35.359 0.20 21.76  ? 6   ILE B CG1 1 
ATOM   1059 C  CG1 B ILE B  1 11  ? 23.227  13.161  -35.123 0.80 23.16  ? 6   ILE B CG1 1 
ATOM   1060 C  CG2 A ILE B  1 11  ? 23.898  14.906  -36.729 0.20 22.24  ? 6   ILE B CG2 1 
ATOM   1061 C  CG2 B ILE B  1 11  ? 23.981  14.948  -36.642 0.80 23.06  ? 6   ILE B CG2 1 
ATOM   1062 C  CD1 A ILE B  1 11  ? 22.041  13.861  -34.691 0.20 22.63  ? 6   ILE B CD1 1 
ATOM   1063 C  CD1 B ILE B  1 11  ? 22.421  12.378  -36.083 0.80 15.82  ? 6   ILE B CD1 1 
ATOM   1064 N  N   . LEU B  1 12  ? 26.857  13.402  -38.310 1.00 21.22  ? 7   LEU B N   1 
ATOM   1065 C  CA  . LEU B  1 12  ? 28.141  13.910  -38.775 1.00 21.79  ? 7   LEU B CA  1 
ATOM   1066 C  C   . LEU B  1 12  ? 28.123  15.400  -39.091 1.00 26.44  ? 7   LEU B C   1 
ATOM   1067 O  O   . LEU B  1 12  ? 28.743  16.201  -38.392 1.00 21.26  ? 7   LEU B O   1 
ATOM   1068 C  CB  . LEU B  1 12  ? 28.616  13.102  -39.979 1.00 17.52  ? 7   LEU B CB  1 
ATOM   1069 C  CG  . LEU B  1 12  ? 28.970  11.674  -39.568 1.00 20.95  ? 7   LEU B CG  1 
ATOM   1070 C  CD1 . LEU B  1 12  ? 29.518  10.903  -40.740 1.00 19.50  ? 7   LEU B CD1 1 
ATOM   1071 C  CD2 . LEU B  1 12  ? 29.973  11.705  -38.424 1.00 21.96  ? 7   LEU B CD2 1 
ATOM   1072 N  N   . TYR B  1 13  ? 27.408  15.766  -40.146 1.00 17.29  ? 8   TYR B N   1 
ATOM   1073 C  CA  . TYR B  1 13  ? 27.322  17.157  -40.544 1.00 18.25  ? 8   TYR B CA  1 
ATOM   1074 C  C   . TYR B  1 13  ? 26.082  17.396  -41.383 1.00 27.00  ? 8   TYR B C   1 
ATOM   1075 O  O   . TYR B  1 13  ? 25.388  16.457  -41.779 1.00 19.21  ? 8   TYR B O   1 
ATOM   1076 C  CB  . TYR B  1 13  ? 28.568  17.566  -41.334 1.00 19.92  ? 8   TYR B CB  1 
ATOM   1077 C  CG  . TYR B  1 13  ? 28.792  16.754  -42.594 1.00 21.90  ? 8   TYR B CG  1 
ATOM   1078 C  CD1 . TYR B  1 13  ? 29.525  15.573  -42.561 1.00 21.04  ? 8   TYR B CD1 1 
ATOM   1079 C  CD2 . TYR B  1 13  ? 28.271  17.168  -43.815 1.00 22.38  ? 8   TYR B CD2 1 
ATOM   1080 C  CE1 . TYR B  1 13  ? 29.737  14.830  -43.705 1.00 22.59  ? 8   TYR B CE1 1 
ATOM   1081 C  CE2 . TYR B  1 13  ? 28.475  16.431  -44.966 1.00 23.94  ? 8   TYR B CE2 1 
ATOM   1082 C  CZ  . TYR B  1 13  ? 29.210  15.263  -44.905 1.00 29.57  ? 8   TYR B CZ  1 
ATOM   1083 O  OH  . TYR B  1 13  ? 29.416  14.523  -46.045 1.00 26.19  ? 8   TYR B OH  1 
ATOM   1084 N  N   . ALA B  1 14  ? 25.810  18.667  -41.644 1.00 27.05  ? 9   ALA B N   1 
ATOM   1085 C  CA  . ALA B  1 14  ? 24.760  19.048  -42.565 1.00 23.92  ? 9   ALA B CA  1 
ATOM   1086 C  C   . ALA B  1 14  ? 25.338  20.031  -43.567 1.00 23.31  ? 9   ALA B C   1 
ATOM   1087 O  O   . ALA B  1 14  ? 26.309  20.729  -43.271 1.00 24.99  ? 9   ALA B O   1 
ATOM   1088 C  CB  . ALA B  1 14  ? 23.592  19.663  -41.817 1.00 26.51  ? 9   ALA B CB  1 
ATOM   1089 N  N   . GLU B  1 15  ? 24.750  20.080  -44.756 1.00 25.06  ? 10  GLU B N   1 
ATOM   1090 C  CA  . GLU B  1 15  ? 25.227  20.984  -45.791 1.00 34.47  ? 10  GLU B CA  1 
ATOM   1091 C  C   . GLU B  1 15  ? 24.137  21.934  -46.252 1.00 35.28  ? 10  GLU B C   1 
ATOM   1092 O  O   . GLU B  1 15  ? 22.955  21.591  -46.229 1.00 31.05  ? 10  GLU B O   1 
ATOM   1093 C  CB  . GLU B  1 15  ? 25.774  20.201  -46.980 1.00 36.48  ? 10  GLU B CB  1 
ATOM   1094 C  CG  . GLU B  1 15  ? 26.889  19.253  -46.613 1.00 46.50  ? 10  GLU B CG  1 
ATOM   1095 C  CD  . GLU B  1 15  ? 27.669  18.787  -47.819 1.00 60.28  ? 10  GLU B CD  1 
ATOM   1096 O  OE1 . GLU B  1 15  ? 27.059  18.595  -48.894 1.00 65.42  ? 10  GLU B OE1 1 
ATOM   1097 O  OE2 . GLU B  1 15  ? 28.898  18.626  -47.686 1.00 65.65  ? 10  GLU B OE2 1 
ATOM   1098 N  N   . ASN B  1 16  ? 24.554  23.126  -46.670 1.00 39.39  ? 11  ASN B N   1 
ATOM   1099 C  CA  . ASN B  1 16  ? 23.645  24.157  -47.156 1.00 43.46  ? 11  ASN B CA  1 
ATOM   1100 C  C   . ASN B  1 16  ? 22.522  24.453  -46.165 1.00 41.22  ? 11  ASN B C   1 
ATOM   1101 O  O   . ASN B  1 16  ? 21.349  24.481  -46.530 1.00 41.30  ? 11  ASN B O   1 
ATOM   1102 C  CB  . ASN B  1 16  ? 23.069  23.771  -48.523 1.00 49.69  ? 11  ASN B CB  1 
ATOM   1103 C  CG  . ASN B  1 16  ? 24.017  22.903  -49.333 1.00 55.43  ? 11  ASN B CG  1 
ATOM   1104 O  OD1 . ASN B  1 16  ? 23.701  21.756  -49.650 1.00 64.04  ? 11  ASN B OD1 1 
ATOM   1105 N  ND2 . ASN B  1 16  ? 25.185  23.442  -49.664 1.00 57.41  ? 11  ASN B ND2 1 
ATOM   1106 N  N   . VAL B  1 17  ? 22.893  24.660  -44.905 1.00 38.99  ? 12  VAL B N   1 
ATOM   1107 C  CA  . VAL B  1 17  ? 21.926  25.012  -43.874 1.00 42.88  ? 12  VAL B CA  1 
ATOM   1108 C  C   . VAL B  1 17  ? 21.766  26.524  -43.771 1.00 48.42  ? 12  VAL B C   1 
ATOM   1109 O  O   . VAL B  1 17  ? 22.612  27.215  -43.201 1.00 55.61  ? 12  VAL B O   1 
ATOM   1110 C  CB  . VAL B  1 17  ? 22.321  24.449  -42.498 1.00 39.30  ? 12  VAL B CB  1 
ATOM   1111 C  CG1 . VAL B  1 17  ? 21.195  24.667  -41.504 1.00 43.67  ? 12  VAL B CG1 1 
ATOM   1112 C  CG2 . VAL B  1 17  ? 22.647  22.976  -42.609 1.00 39.45  ? 12  VAL B CG2 1 
ATOM   1113 N  N   . HIS B  1 18  ? 20.671  27.023  -44.336 1.00 52.39  ? 13  HIS B N   1 
ATOM   1114 C  CA  . HIS B  1 18  ? 20.359  28.445  -44.307 1.00 56.62  ? 13  HIS B CA  1 
ATOM   1115 C  C   . HIS B  1 18  ? 19.108  28.713  -43.482 1.00 60.81  ? 13  HIS B C   1 
ATOM   1116 O  O   . HIS B  1 18  ? 18.091  28.039  -43.636 1.00 60.06  ? 13  HIS B O   1 
ATOM   1117 C  CB  . HIS B  1 18  ? 20.150  28.986  -45.725 1.00 61.46  ? 13  HIS B CB  1 
ATOM   1118 C  CG  . HIS B  1 18  ? 21.345  28.846  -46.613 1.00 64.07  ? 13  HIS B CG  1 
ATOM   1119 N  ND1 . HIS B  1 18  ? 21.378  27.981  -47.685 1.00 64.07  ? 13  HIS B ND1 1 
ATOM   1120 C  CD2 . HIS B  1 18  ? 22.550  29.464  -46.591 1.00 67.85  ? 13  HIS B CD2 1 
ATOM   1121 C  CE1 . HIS B  1 18  ? 22.552  28.069  -48.284 1.00 64.45  ? 13  HIS B CE1 1 
ATOM   1122 N  NE2 . HIS B  1 18  ? 23.281  28.963  -47.641 1.00 65.37  ? 13  HIS B NE2 1 
ATOM   1123 N  N   . THR B  1 19  ? 19.198  29.700  -42.601 1.00 61.91  ? 14  THR B N   1 
ATOM   1124 C  CA  . THR B  1 19  ? 18.039  30.215  -41.890 1.00 67.36  ? 14  THR B CA  1 
ATOM   1125 C  C   . THR B  1 19  ? 17.316  31.120  -42.887 1.00 68.53  ? 14  THR B C   1 
ATOM   1126 O  O   . THR B  1 19  ? 17.973  31.781  -43.693 1.00 70.37  ? 14  THR B O   1 
ATOM   1127 C  CB  . THR B  1 19  ? 18.504  31.017  -40.656 1.00 76.31  ? 14  THR B CB  1 
ATOM   1128 O  OG1 . THR B  1 19  ? 19.356  30.196  -39.846 1.00 76.61  ? 14  THR B OG1 1 
ATOM   1129 C  CG2 . THR B  1 19  ? 17.335  31.485  -39.817 1.00 78.84  ? 14  THR B CG2 1 
ATOM   1130 N  N   . PRO B  1 20  ? 15.971  31.140  -42.871 1.00 67.49  ? 15  PRO B N   1 
ATOM   1131 C  CA  . PRO B  1 20  ? 15.313  31.951  -43.902 1.00 69.80  ? 15  PRO B CA  1 
ATOM   1132 C  C   . PRO B  1 20  ? 15.564  33.461  -43.817 1.00 70.35  ? 15  PRO B C   1 
ATOM   1133 O  O   . PRO B  1 20  ? 15.391  34.147  -44.824 1.00 69.69  ? 15  PRO B O   1 
ATOM   1134 C  CB  . PRO B  1 20  ? 13.825  31.641  -43.708 1.00 74.80  ? 15  PRO B CB  1 
ATOM   1135 C  CG  . PRO B  1 20  ? 13.723  31.111  -42.316 1.00 73.94  ? 15  PRO B CG  1 
ATOM   1136 C  CD  . PRO B  1 20  ? 14.997  30.361  -42.092 1.00 66.13  ? 15  PRO B CD  1 
ATOM   1137 N  N   . ASP B  1 21  ? 15.968  33.981  -42.663 1.00 68.11  ? 16  ASP B N   1 
ATOM   1138 C  CA  . ASP B  1 21  ? 16.179  35.425  -42.570 1.00 74.08  ? 16  ASP B CA  1 
ATOM   1139 C  C   . ASP B  1 21  ? 17.611  35.906  -42.285 1.00 74.24  ? 16  ASP B C   1 
ATOM   1140 O  O   . ASP B  1 21  ? 17.849  37.110  -42.227 1.00 71.91  ? 16  ASP B O   1 
ATOM   1141 C  CB  . ASP B  1 21  ? 15.163  36.093  -41.624 1.00 80.03  ? 16  ASP B CB  1 
ATOM   1142 C  CG  . ASP B  1 21  ? 15.288  35.627  -40.181 1.00 81.13  ? 16  ASP B CG  1 
ATOM   1143 O  OD1 . ASP B  1 21  ? 16.231  34.874  -39.862 1.00 76.59  ? 16  ASP B OD1 1 
ATOM   1144 O  OD2 . ASP B  1 21  ? 14.436  36.029  -39.359 1.00 86.43  ? 16  ASP B OD2 1 
ATOM   1145 N  N   . THR B  1 22  ? 18.569  34.994  -42.130 1.00 69.71  ? 17  THR B N   1 
ATOM   1146 C  CA  . THR B  1 22  ? 19.930  35.422  -41.782 1.00 76.02  ? 17  THR B CA  1 
ATOM   1147 C  C   . THR B  1 22  ? 21.060  34.938  -42.688 1.00 84.51  ? 17  THR B C   1 
ATOM   1148 O  O   . THR B  1 22  ? 20.915  33.981  -43.451 1.00 85.48  ? 17  THR B O   1 
ATOM   1149 C  CB  . THR B  1 22  ? 20.313  35.043  -40.340 1.00 70.56  ? 17  THR B CB  1 
ATOM   1150 O  OG1 . THR B  1 22  ? 20.455  33.622  -40.237 1.00 59.79  ? 17  THR B OG1 1 
ATOM   1151 C  CG2 . THR B  1 22  ? 19.263  35.526  -39.359 1.00 77.39  ? 17  THR B CG2 1 
ATOM   1152 N  N   . ASP B  1 23  ? 22.203  35.605  -42.548 1.00 89.08  ? 18  ASP B N   1 
ATOM   1153 C  CA  . ASP B  1 23  ? 23.381  35.364  -43.375 1.00 89.64  ? 18  ASP B CA  1 
ATOM   1154 C  C   . ASP B  1 23  ? 24.205  34.166  -42.897 1.00 86.49  ? 18  ASP B C   1 
ATOM   1155 O  O   . ASP B  1 23  ? 25.207  33.810  -43.515 1.00 89.66  ? 18  ASP B O   1 
ATOM   1156 C  CB  . ASP B  1 23  ? 24.256  36.617  -43.403 1.00 90.66  ? 18  ASP B CB  1 
ATOM   1157 C  CG  . ASP B  1 23  ? 24.677  37.057  -42.017 1.00 86.91  ? 18  ASP B CG  1 
ATOM   1158 O  OD1 . ASP B  1 23  ? 23.959  36.727  -41.051 1.00 89.42  ? 18  ASP B OD1 1 
ATOM   1159 O  OD2 . ASP B  1 23  ? 25.724  37.724  -41.891 1.00 82.27  ? 18  ASP B OD2 1 
ATOM   1160 N  N   . ILE B  1 24  ? 23.801  33.580  -41.771 1.00 80.38  ? 19  ILE B N   1 
ATOM   1161 C  CA  . ILE B  1 24  ? 24.355  32.308  -41.290 1.00 71.91  ? 19  ILE B CA  1 
ATOM   1162 C  C   . ILE B  1 24  ? 23.395  31.615  -40.329 1.00 65.25  ? 19  ILE B C   1 
ATOM   1163 O  O   . ILE B  1 24  ? 22.427  32.218  -39.865 1.00 71.02  ? 19  ILE B O   1 
ATOM   1164 C  CB  . ILE B  1 24  ? 25.726  32.457  -40.575 1.00 74.69  ? 19  ILE B CB  1 
ATOM   1165 C  CG1 . ILE B  1 24  ? 26.065  33.928  -40.319 1.00 74.71  ? 19  ILE B CG1 1 
ATOM   1166 C  CG2 . ILE B  1 24  ? 26.825  31.750  -41.369 1.00 73.94  ? 19  ILE B CG2 1 
ATOM   1167 C  CD1 . ILE B  1 24  ? 26.537  34.208  -38.925 1.00 75.11  ? 19  ILE B CD1 1 
ATOM   1168 N  N   . SER B  1 25  ? 23.671  30.348  -40.031 1.00 51.65  ? 20  SER B N   1 
ATOM   1169 C  CA  . SER B  1 25  ? 22.863  29.587  -39.082 1.00 49.74  ? 20  SER B CA  1 
ATOM   1170 C  C   . SER B  1 25  ? 23.682  29.160  -37.867 1.00 45.54  ? 20  SER B C   1 
ATOM   1171 O  O   . SER B  1 25  ? 24.890  28.944  -37.960 1.00 36.25  ? 20  SER B O   1 
ATOM   1172 C  CB  . SER B  1 25  ? 22.274  28.340  -39.749 1.00 58.99  ? 20  SER B CB  1 
ATOM   1173 O  OG  . SER B  1 25  ? 22.053  28.542  -41.132 1.00 64.90  ? 20  SER B OG  1 
ATOM   1174 N  N   . ASP B  1 26  ? 23.012  29.047  -36.725 1.00 41.82  ? 21  ASP B N   1 
ATOM   1175 C  CA  . ASP B  1 26  ? 23.589  28.423  -35.542 1.00 40.21  ? 21  ASP B CA  1 
ATOM   1176 C  C   . ASP B  1 26  ? 22.863  27.096  -35.352 1.00 40.79  ? 21  ASP B C   1 
ATOM   1177 O  O   . ASP B  1 26  ? 21.998  26.970  -34.488 1.00 41.46  ? 21  ASP B O   1 
ATOM   1178 C  CB  . ASP B  1 26  ? 23.382  29.306  -34.313 1.00 43.10  ? 21  ASP B CB  1 
ATOM   1179 C  CG  . ASP B  1 26  ? 23.853  30.730  -34.529 1.00 47.47  ? 21  ASP B CG  1 
ATOM   1180 O  OD1 . ASP B  1 26  ? 24.914  30.923  -35.163 1.00 51.17  ? 21  ASP B OD1 1 
ATOM   1181 O  OD2 . ASP B  1 26  ? 23.161  31.659  -34.061 1.00 57.37  ? 21  ASP B OD2 1 
ATOM   1182 N  N   . ALA B  1 27  ? 23.210  26.110  -36.171 1.00 33.01  ? 22  ALA B N   1 
ATOM   1183 C  CA  . ALA B  1 27  ? 22.415  24.892  -36.262 1.00 37.17  ? 22  ALA B CA  1 
ATOM   1184 C  C   . ALA B  1 27  ? 22.765  23.843  -35.216 1.00 32.59  ? 22  ALA B C   1 
ATOM   1185 O  O   . ALA B  1 27  ? 23.928  23.668  -34.853 1.00 25.28  ? 22  ALA B O   1 
ATOM   1186 C  CB  . ALA B  1 27  ? 22.526  24.292  -37.661 1.00 39.25  ? 22  ALA B CB  1 
ATOM   1187 N  N   . TYR B  1 28  ? 21.736  23.194  -34.716 1.00 25.48  ? 23  TYR B N   1 
ATOM   1188 C  CA  . TYR B  1 28  ? 21.835  21.969  -33.969 1.00 23.77  ? 23  TYR B CA  1 
ATOM   1189 C  C   . TYR B  1 28  ? 20.898  20.885  -34.521 1.00 28.71  ? 23  TYR B C   1 
ATOM   1190 O  O   . TYR B  1 28  ? 19.987  21.169  -35.226 1.00 26.90  ? 23  TYR B O   1 
ATOM   1191 C  CB  . TYR B  1 28  ? 21.611  22.184  -32.483 1.00 34.86  ? 23  TYR B CB  1 
ATOM   1192 C  CG  . TYR B  1 28  ? 20.194  22.392  -32.029 1.00 35.68  ? 23  TYR B CG  1 
ATOM   1193 C  CD1 . TYR B  1 28  ? 19.633  23.615  -32.045 1.00 38.62  ? 23  TYR B CD1 1 
ATOM   1194 C  CD2 . TYR B  1 28  ? 19.437  21.365  -31.578 1.00 34.99  ? 23  TYR B CD2 1 
ATOM   1195 C  CE1 . TYR B  1 28  ? 18.355  23.815  -31.621 1.00 44.02  ? 23  TYR B CE1 1 
ATOM   1196 C  CE2 . TYR B  1 28  ? 18.150  21.555  -31.168 1.00 36.20  ? 23  TYR B CE2 1 
ATOM   1197 C  CZ  . TYR B  1 28  ? 17.621  22.788  -31.203 1.00 41.96  ? 23  TYR B CZ  1 
ATOM   1198 O  OH  . TYR B  1 28  ? 16.371  23.010  -30.800 1.00 46.07  ? 23  TYR B OH  1 
ATOM   1199 N  N   . CYS B  1 29  ? 21.179  19.649  -34.206 1.00 25.72  ? 24  CYS B N   1 
ATOM   1200 C  CA  . CYS B  1 29  ? 20.391  18.560  -34.668 1.00 22.45  ? 24  CYS B CA  1 
ATOM   1201 C  C   . CYS B  1 29  ? 19.735  17.848  -33.529 1.00 31.10  ? 24  CYS B C   1 
ATOM   1202 O  O   . CYS B  1 29  ? 20.354  17.515  -32.549 1.00 26.80  ? 24  CYS B O   1 
ATOM   1203 C  CB  . CYS B  1 29  ? 21.207  17.640  -35.556 1.00 22.55  ? 24  CYS B CB  1 
ATOM   1204 S  SG  . CYS B  1 29  ? 20.229  16.356  -36.328 1.00 46.56  ? 24  CYS B SG  1 
ATOM   1205 N  N   . SER B  1 30  ? 18.443  17.661  -33.691 1.00 32.46  ? 25  SER B N   1 
ATOM   1206 C  CA  . SER B  1 30  ? 17.632  16.906  -32.780 1.00 38.30  ? 25  SER B CA  1 
ATOM   1207 C  C   . SER B  1 30  ? 17.277  15.579  -33.381 1.00 40.30  ? 25  SER B C   1 
ATOM   1208 O  O   . SER B  1 30  ? 16.900  15.520  -34.526 1.00 43.36  ? 25  SER B O   1 
ATOM   1209 C  CB  . SER B  1 30  ? 16.364  17.654  -32.490 1.00 47.22  ? 25  SER B CB  1 
ATOM   1210 O  OG  . SER B  1 30  ? 15.553  16.851  -31.714 1.00 54.25  ? 25  SER B OG  1 
ATOM   1211 N  N   . ALA B  1 31  ? 17.397  14.521  -32.608 1.00 32.73  ? 26  ALA B N   1 
ATOM   1212 C  CA  . ALA B  1 31  ? 17.147  13.184  -33.090 1.00 29.07  ? 26  ALA B CA  1 
ATOM   1213 C  C   . ALA B  1 31  ? 16.256  12.408  -32.151 1.00 31.49  ? 26  ALA B C   1 
ATOM   1214 O  O   . ALA B  1 31  ? 16.494  12.375  -30.970 1.00 33.84  ? 26  ALA B O   1 
ATOM   1215 C  CB  . ALA B  1 31  ? 18.434  12.442  -33.288 1.00 25.82  ? 26  ALA B CB  1 
ATOM   1216 N  N   . VAL B  1 32  ? 15.266  11.748  -32.707 1.00 23.11  ? 27  VAL B N   1 
ATOM   1217 C  CA  . VAL B  1 32  ? 14.292  11.042  -31.884 1.00 32.68  ? 27  VAL B CA  1 
ATOM   1218 C  C   . VAL B  1 32  ? 14.137  9.592   -32.314 1.00 31.77  ? 27  VAL B C   1 
ATOM   1219 O  O   . VAL B  1 32  ? 13.799  9.302   -33.463 1.00 31.30  ? 27  VAL B O   1 
ATOM   1220 C  CB  . VAL B  1 32  ? 12.911  11.730  -31.911 1.00 37.59  ? 27  VAL B CB  1 
ATOM   1221 C  CG1 . VAL B  1 32  ? 11.861  10.848  -31.248 1.00 34.86  ? 27  VAL B CG1 1 
ATOM   1222 C  CG2 . VAL B  1 32  ? 12.979  13.088  -31.226 1.00 41.45  ? 27  VAL B CG2 1 
ATOM   1223 N  N   . PHE B  1 33  ? 14.401  8.685   -31.382 1.00 32.93  ? 28  PHE B N   1 
ATOM   1224 C  CA  . PHE B  1 33  ? 14.141  7.271   -31.599 1.00 30.18  ? 28  PHE B CA  1 
ATOM   1225 C  C   . PHE B  1 33  ? 13.544  6.647   -30.345 1.00 32.40  ? 28  PHE B C   1 
ATOM   1226 O  O   . PHE B  1 33  ? 13.959  6.965   -29.228 1.00 34.15  ? 28  PHE B O   1 
ATOM   1227 C  CB  . PHE B  1 33  ? 15.417  6.528   -31.995 1.00 34.93  ? 28  PHE B CB  1 
ATOM   1228 C  CG  . PHE B  1 33  ? 15.219  5.050   -32.171 1.00 34.98  ? 28  PHE B CG  1 
ATOM   1229 C  CD1 . PHE B  1 33  ? 14.562  4.556   -33.285 1.00 32.71  ? 28  PHE B CD1 1 
ATOM   1230 C  CD2 . PHE B  1 33  ? 15.678  4.154   -31.219 1.00 32.38  ? 28  PHE B CD2 1 
ATOM   1231 C  CE1 . PHE B  1 33  ? 14.366  3.196   -33.445 1.00 30.62  ? 28  PHE B CE1 1 
ATOM   1232 C  CE2 . PHE B  1 33  ? 15.491  2.793   -31.380 1.00 29.76  ? 28  PHE B CE2 1 
ATOM   1233 C  CZ  . PHE B  1 33  ? 14.835  2.314   -32.494 1.00 30.41  ? 28  PHE B CZ  1 
ATOM   1234 N  N   . ALA B  1 34  ? 12.566  5.766   -30.542 1.00 32.22  ? 29  ALA B N   1 
ATOM   1235 C  CA  . ALA B  1 34  ? 11.916  5.051   -29.447 1.00 35.56  ? 29  ALA B CA  1 
ATOM   1236 C  C   . ALA B  1 34  ? 11.370  5.986   -28.372 1.00 37.60  ? 29  ALA B C   1 
ATOM   1237 O  O   . ALA B  1 34  ? 11.440  5.683   -27.182 1.00 39.78  ? 29  ALA B O   1 
ATOM   1238 C  CB  . ALA B  1 34  ? 12.869  4.032   -28.831 1.00 46.21  ? 29  ALA B CB  1 
ATOM   1239 N  N   . GLY B  1 35  ? 10.842  7.128   -28.797 1.00 37.36  ? 30  GLY B N   1 
ATOM   1240 C  CA  . GLY B  1 35  ? 10.264  8.086   -27.874 1.00 42.54  ? 30  GLY B CA  1 
ATOM   1241 C  C   . GLY B  1 35  ? 11.296  8.830   -27.048 1.00 41.55  ? 30  GLY B C   1 
ATOM   1242 O  O   . GLY B  1 35  ? 10.944  9.586   -26.145 1.00 42.50  ? 30  GLY B O   1 
ATOM   1243 N  N   . VAL B  1 36  ? 12.573  8.622   -27.354 1.00 41.54  ? 31  VAL B N   1 
ATOM   1244 C  CA  . VAL B  1 36  ? 13.643  9.310   -26.638 1.00 37.03  ? 31  VAL B CA  1 
ATOM   1245 C  C   . VAL B  1 36  ? 14.368  10.300  -27.542 1.00 34.85  ? 31  VAL B C   1 
ATOM   1246 O  O   . VAL B  1 36  ? 14.852  9.941   -28.616 1.00 29.84  ? 31  VAL B O   1 
ATOM   1247 C  CB  . VAL B  1 36  ? 14.666  8.327   -26.036 1.00 38.56  ? 31  VAL B CB  1 
ATOM   1248 C  CG1 . VAL B  1 36  ? 15.715  9.086   -25.235 1.00 39.85  ? 31  VAL B CG1 1 
ATOM   1249 C  CG2 . VAL B  1 36  ? 13.968  7.306   -25.160 1.00 43.05  ? 31  VAL B CG2 1 
ATOM   1250 N  N   . LYS B  1 37  ? 14.438  11.550  -27.094 1.00 38.64  ? 32  LYS B N   1 
ATOM   1251 C  CA  . LYS B  1 37  ? 15.054  12.619  -27.870 1.00 35.98  ? 32  LYS B CA  1 
ATOM   1252 C  C   . LYS B  1 37  ? 16.462  12.952  -27.390 1.00 38.14  ? 32  LYS B C   1 
ATOM   1253 O  O   . LYS B  1 37  ? 16.713  13.069  -26.190 1.00 42.82  ? 32  LYS B O   1 
ATOM   1254 C  CB  . LYS B  1 37  ? 14.182  13.879  -27.831 1.00 40.83  ? 32  LYS B CB  1 
ATOM   1255 C  CG  . LYS B  1 37  ? 14.822  15.095  -28.485 1.00 40.08  ? 32  LYS B CG  1 
ATOM   1256 C  CD  . LYS B  1 37  ? 13.772  16.045  -29.040 1.00 43.59  ? 32  LYS B CD  1 
ATOM   1257 C  CE  . LYS B  1 37  ? 13.346  17.088  -28.025 1.00 52.61  ? 32  LYS B CE  1 
ATOM   1258 N  NZ  . LYS B  1 37  ? 14.426  18.077  -27.752 1.00 61.15  ? 32  LYS B NZ  1 
ATOM   1259 N  N   . LYS B  1 38  ? 17.374  13.101  -28.343 1.00 37.35  ? 33  LYS B N   1 
ATOM   1260 C  CA  . LYS B  1 38  ? 18.728  13.551  -28.060 1.00 37.20  ? 33  LYS B CA  1 
ATOM   1261 C  C   . LYS B  1 38  ? 19.069  14.683  -29.022 1.00 39.01  ? 33  LYS B C   1 
ATOM   1262 O  O   . LYS B  1 38  ? 18.490  14.782  -30.106 1.00 34.91  ? 33  LYS B O   1 
ATOM   1263 C  CB  . LYS B  1 38  ? 19.718  12.398  -28.224 1.00 34.95  ? 33  LYS B CB  1 
ATOM   1264 C  CG  . LYS B  1 38  ? 19.399  11.182  -27.369 1.00 37.43  ? 33  LYS B CG  1 
ATOM   1265 C  CD  . LYS B  1 38  ? 20.261  9.991   -27.753 1.00 38.90  ? 33  LYS B CD  1 
ATOM   1266 C  CE  . LYS B  1 38  ? 19.857  8.741   -26.985 1.00 41.15  ? 33  LYS B CE  1 
ATOM   1267 N  NZ  . LYS B  1 38  ? 20.255  8.797   -25.553 1.00 43.21  ? 33  LYS B NZ  1 
ATOM   1268 N  N   . ARG B  1 39  ? 20.004  15.540  -28.631 1.00 37.58  ? 34  ARG B N   1 
ATOM   1269 C  CA  . ARG B  1 39  ? 20.374  16.664  -29.483 1.00 35.98  ? 34  ARG B CA  1 
ATOM   1270 C  C   . ARG B  1 39  ? 21.875  16.946  -29.481 1.00 32.75  ? 34  ARG B C   1 
ATOM   1271 O  O   . ARG B  1 39  ? 22.571  16.682  -28.501 1.00 34.08  ? 34  ARG B O   1 
ATOM   1272 C  CB  . ARG B  1 39  ? 19.575  17.915  -29.098 1.00 39.80  ? 34  ARG B CB  1 
ATOM   1273 C  CG  . ARG B  1 39  ? 19.749  18.335  -27.653 1.00 54.29  ? 34  ARG B CG  1 
ATOM   1274 C  CD  . ARG B  1 39  ? 18.585  19.184  -27.147 1.00 68.80  ? 34  ARG B CD  1 
ATOM   1275 N  NE  . ARG B  1 39  ? 17.402  18.390  -26.812 1.00 76.56  ? 34  ARG B NE  1 
ATOM   1276 C  CZ  . ARG B  1 39  ? 17.301  17.611  -25.738 1.00 78.81  ? 34  ARG B CZ  1 
ATOM   1277 N  NH1 . ARG B  1 39  ? 18.319  17.500  -24.895 1.00 76.01  ? 34  ARG B NH1 1 
ATOM   1278 N  NH2 . ARG B  1 39  ? 16.184  16.931  -25.510 1.00 83.21  ? 34  ARG B NH2 1 
ATOM   1279 N  N   . THR B  1 40  ? 22.369  17.468  -30.598 1.00 28.00  ? 35  THR B N   1 
ATOM   1280 C  CA  . THR B  1 40  ? 23.771  17.836  -30.715 1.00 29.88  ? 35  THR B CA  1 
ATOM   1281 C  C   . THR B  1 40  ? 23.974  19.227  -30.144 1.00 32.67  ? 35  THR B C   1 
ATOM   1282 O  O   . THR B  1 40  ? 23.010  19.926  -29.828 1.00 24.72  ? 35  THR B O   1 
ATOM   1283 C  CB  . THR B  1 40  ? 24.219  17.874  -32.181 1.00 30.98  ? 35  THR B CB  1 
ATOM   1284 O  OG1 . THR B  1 40  ? 23.595  18.986  -32.837 1.00 28.97  ? 35  THR B OG1 1 
ATOM   1285 C  CG2 . THR B  1 40  ? 23.841  16.579  -32.898 1.00 26.26  ? 35  THR B CG2 1 
ATOM   1286 N  N   . LYS B  1 41  ? 25.229  19.638  -30.026 1.00 23.68  ? 36  LYS B N   1 
ATOM   1287 C  CA  . LYS B  1 41  ? 25.525  21.002  -29.628 1.00 34.61  ? 36  LYS B CA  1 
ATOM   1288 C  C   . LYS B  1 41  ? 25.257  21.928  -30.804 1.00 33.91  ? 36  LYS B C   1 
ATOM   1289 O  O   . LYS B  1 41  ? 25.073  21.476  -31.938 1.00 23.77  ? 36  LYS B O   1 
ATOM   1290 C  CB  . LYS B  1 41  ? 26.975  21.131  -29.157 1.00 40.29  ? 36  LYS B CB  1 
ATOM   1291 C  CG  . LYS B  1 41  ? 28.009  20.842  -30.230 1.00 43.78  ? 36  LYS B CG  1 
ATOM   1292 C  CD  . LYS B  1 41  ? 29.411  20.765  -29.635 1.00 47.28  ? 36  LYS B CD  1 
ATOM   1293 C  CE  . LYS B  1 41  ? 30.443  20.393  -30.690 1.00 54.86  ? 36  LYS B CE  1 
ATOM   1294 N  NZ  . LYS B  1 41  ? 30.159  19.062  -31.298 1.00 57.83  ? 36  LYS B NZ  1 
ATOM   1295 N  N   . VAL B  1 42  ? 25.215  23.223  -30.523 1.00 28.43  ? 37  VAL B N   1 
ATOM   1296 C  CA  . VAL B  1 42  ? 25.033  24.228  -31.554 1.00 31.51  ? 37  VAL B CA  1 
ATOM   1297 C  C   . VAL B  1 42  ? 26.373  24.525  -32.212 1.00 32.67  ? 37  VAL B C   1 
ATOM   1298 O  O   . VAL B  1 42  ? 27.380  24.702  -31.526 1.00 35.75  ? 37  VAL B O   1 
ATOM   1299 C  CB  . VAL B  1 42  ? 24.470  25.533  -30.952 1.00 35.44  ? 37  VAL B CB  1 
ATOM   1300 C  CG1 . VAL B  1 42  ? 24.380  26.621  -32.009 1.00 33.77  ? 37  VAL B CG1 1 
ATOM   1301 C  CG2 . VAL B  1 42  ? 23.111  25.283  -30.315 1.00 37.31  ? 37  VAL B CG2 1 
ATOM   1302 N  N   . ILE B  1 43  ? 26.394  24.555  -33.539 1.00 27.70  ? 38  ILE B N   1 
ATOM   1303 C  CA  . ILE B  1 43  ? 27.565  25.039  -34.256 1.00 28.45  ? 38  ILE B CA  1 
ATOM   1304 C  C   . ILE B  1 43  ? 27.315  26.473  -34.683 1.00 34.26  ? 38  ILE B C   1 
ATOM   1305 O  O   . ILE B  1 43  ? 26.511  26.741  -35.574 1.00 31.17  ? 38  ILE B O   1 
ATOM   1306 C  CB  . ILE B  1 43  ? 27.880  24.210  -35.501 1.00 29.62  ? 38  ILE B CB  1 
ATOM   1307 C  CG1 . ILE B  1 43  ? 28.079  22.742  -35.125 1.00 32.76  ? 38  ILE B CG1 1 
ATOM   1308 C  CG2 . ILE B  1 43  ? 29.119  24.763  -36.190 1.00 31.52  ? 38  ILE B CG2 1 
ATOM   1309 C  CD1 . ILE B  1 43  ? 29.136  22.524  -34.064 1.00 24.88  ? 38  ILE B CD1 1 
ATOM   1310 N  N   . LYS B  1 44  ? 28.011  27.397  -34.041 1.00 35.47  ? 39  LYS B N   1 
ATOM   1311 C  CA  . LYS B  1 44  ? 27.774  28.808  -34.278 1.00 43.16  ? 39  LYS B CA  1 
ATOM   1312 C  C   . LYS B  1 44  ? 28.234  29.254  -35.657 1.00 43.71  ? 39  LYS B C   1 
ATOM   1313 O  O   . LYS B  1 44  ? 29.326  28.899  -36.108 1.00 42.44  ? 39  LYS B O   1 
ATOM   1314 C  CB  . LYS B  1 44  ? 28.464  29.629  -33.199 1.00 44.29  ? 39  LYS B CB  1 
ATOM   1315 C  CG  . LYS B  1 44  ? 28.087  29.185  -31.805 1.00 50.24  ? 39  LYS B CG  1 
ATOM   1316 C  CD  . LYS B  1 44  ? 26.796  29.829  -31.370 1.00 58.65  ? 39  LYS B CD  1 
ATOM   1317 C  CE  . LYS B  1 44  ? 27.087  30.996  -30.455 1.00 70.50  ? 39  LYS B CE  1 
ATOM   1318 N  NZ  . LYS B  1 44  ? 27.743  30.519  -29.208 1.00 77.25  ? 39  LYS B NZ  1 
ATOM   1319 N  N   . ASN B  1 45  ? 27.369  30.016  -36.322 1.00 41.27  ? 40  ASN B N   1 
ATOM   1320 C  CA  . ASN B  1 45  ? 27.706  30.716  -37.556 1.00 47.70  ? 40  ASN B CA  1 
ATOM   1321 C  C   . ASN B  1 45  ? 28.332  29.837  -38.640 1.00 43.40  ? 40  ASN B C   1 
ATOM   1322 O  O   . ASN B  1 45  ? 29.507  29.991  -38.971 1.00 50.89  ? 40  ASN B O   1 
ATOM   1323 C  CB  . ASN B  1 45  ? 28.623  31.900  -37.238 1.00 56.49  ? 40  ASN B CB  1 
ATOM   1324 C  CG  . ASN B  1 45  ? 28.234  32.608  -35.948 1.00 67.47  ? 40  ASN B CG  1 
ATOM   1325 O  OD1 . ASN B  1 45  ? 29.053  32.762  -35.041 1.00 68.81  ? 40  ASN B OD1 1 
ATOM   1326 N  ND2 . ASN B  1 45  ? 26.978  33.035  -35.859 1.00 71.54  ? 40  ASN B ND2 1 
ATOM   1327 N  N   . SER B  1 46  ? 27.544  28.917  -39.189 1.00 36.54  ? 41  SER B N   1 
ATOM   1328 C  CA  . SER B  1 46  ? 28.025  28.056  -40.265 1.00 40.04  ? 41  SER B CA  1 
ATOM   1329 C  C   . SER B  1 46  ? 26.903  27.597  -41.191 1.00 39.68  ? 41  SER B C   1 
ATOM   1330 O  O   . SER B  1 46  ? 25.773  27.369  -40.757 1.00 37.81  ? 41  SER B O   1 
ATOM   1331 C  CB  . SER B  1 46  ? 28.769  26.841  -39.702 1.00 41.86  ? 41  SER B CB  1 
ATOM   1332 O  OG  . SER B  1 46  ? 29.171  25.963  -40.741 1.00 39.05  ? 41  SER B OG  1 
ATOM   1333 N  N   . VAL B  1 47  ? 27.231  27.467  -42.471 1.00 41.56  ? 42  VAL B N   1 
ATOM   1334 C  CA  . VAL B  1 47  ? 26.298  26.964  -43.467 1.00 36.35  ? 42  VAL B CA  1 
ATOM   1335 C  C   . VAL B  1 47  ? 26.491  25.452  -43.564 1.00 36.92  ? 42  VAL B C   1 
ATOM   1336 O  O   . VAL B  1 47  ? 25.598  24.717  -43.990 1.00 36.64  ? 42  VAL B O   1 
ATOM   1337 C  CB  . VAL B  1 47  ? 26.541  27.649  -44.835 1.00 38.29  ? 42  VAL B CB  1 
ATOM   1338 C  CG1 . VAL B  1 47  ? 25.647  27.065  -45.918 1.00 50.26  ? 42  VAL B CG1 1 
ATOM   1339 C  CG2 . VAL B  1 47  ? 26.320  29.151  -44.717 1.00 41.77  ? 42  VAL B CG2 1 
ATOM   1340 N  N   . ASN B  1 48  ? 27.662  24.998  -43.123 1.00 36.58  ? 43  ASN B N   1 
ATOM   1341 C  CA  . ASN B  1 48  ? 28.036  23.587  -43.176 1.00 28.49  ? 43  ASN B CA  1 
ATOM   1342 C  C   . ASN B  1 48  ? 28.432  23.049  -41.795 1.00 26.36  ? 43  ASN B C   1 
ATOM   1343 O  O   . ASN B  1 48  ? 29.589  22.703  -41.564 1.00 26.41  ? 43  ASN B O   1 
ATOM   1344 C  CB  . ASN B  1 48  ? 29.190  23.414  -44.167 1.00 32.80  ? 43  ASN B CB  1 
ATOM   1345 C  CG  . ASN B  1 48  ? 29.620  21.969  -44.333 1.00 41.21  ? 43  ASN B CG  1 
ATOM   1346 O  OD1 . ASN B  1 48  ? 28.822  21.043  -44.191 1.00 33.31  ? 43  ASN B OD1 1 
ATOM   1347 N  ND2 . ASN B  1 48  ? 30.897  21.772  -44.631 1.00 40.11  ? 43  ASN B ND2 1 
ATOM   1348 N  N   . PRO B  1 49  ? 27.465  22.975  -40.868 1.00 25.00  ? 44  PRO B N   1 
ATOM   1349 C  CA  . PRO B  1 49  ? 27.789  22.608  -39.486 1.00 23.74  ? 44  PRO B CA  1 
ATOM   1350 C  C   . PRO B  1 49  ? 28.293  21.176  -39.373 1.00 23.70  ? 44  PRO B C   1 
ATOM   1351 O  O   . PRO B  1 49  ? 27.679  20.262  -39.920 1.00 23.75  ? 44  PRO B O   1 
ATOM   1352 C  CB  . PRO B  1 49  ? 26.446  22.756  -38.762 1.00 23.23  ? 44  PRO B CB  1 
ATOM   1353 C  CG  . PRO B  1 49  ? 25.423  22.550  -39.826 1.00 23.22  ? 44  PRO B CG  1 
ATOM   1354 C  CD  . PRO B  1 49  ? 26.016  23.156  -41.065 1.00 25.05  ? 44  PRO B CD  1 
ATOM   1355 N  N   . VAL B  1 50  ? 29.410  20.992  -38.680 1.00 22.78  ? 45  VAL B N   1 
ATOM   1356 C  CA  . VAL B  1 50  ? 29.918  19.654  -38.404 1.00 22.37  ? 45  VAL B CA  1 
ATOM   1357 C  C   . VAL B  1 50  ? 29.784  19.364  -36.919 1.00 20.38  ? 45  VAL B C   1 
ATOM   1358 O  O   . VAL B  1 50  ? 30.448  19.989  -36.096 1.00 21.73  ? 45  VAL B O   1 
ATOM   1359 C  CB  . VAL B  1 50  ? 31.386  19.501  -38.836 1.00 26.61  ? 45  VAL B CB  1 
ATOM   1360 C  CG1 . VAL B  1 50  ? 31.924  18.130  -38.438 1.00 25.40  ? 45  VAL B CG1 1 
ATOM   1361 C  CG2 . VAL B  1 50  ? 31.520  19.727  -40.337 1.00 23.68  ? 45  VAL B CG2 1 
ATOM   1362 N  N   . TRP B  1 51  ? 28.906  18.429  -36.576 1.00 25.10  ? 46  TRP B N   1 
ATOM   1363 C  CA  . TRP B  1 51  ? 28.702  18.065  -35.181 1.00 18.67  ? 46  TRP B CA  1 
ATOM   1364 C  C   . TRP B  1 51  ? 29.590  16.898  -34.773 1.00 27.58  ? 46  TRP B C   1 
ATOM   1365 O  O   . TRP B  1 51  ? 30.216  16.934  -33.711 1.00 24.64  ? 46  TRP B O   1 
ATOM   1366 C  CB  . TRP B  1 51  ? 27.240  17.719  -34.922 1.00 24.14  ? 46  TRP B CB  1 
ATOM   1367 C  CG  . TRP B  1 51  ? 26.305  18.854  -35.171 1.00 22.38  ? 46  TRP B CG  1 
ATOM   1368 C  CD1 . TRP B  1 51  ? 26.062  19.908  -34.343 1.00 23.51  ? 46  TRP B CD1 1 
ATOM   1369 C  CD2 . TRP B  1 51  ? 25.478  19.048  -36.322 1.00 19.57  ? 46  TRP B CD2 1 
ATOM   1370 N  NE1 . TRP B  1 51  ? 25.136  20.751  -34.909 1.00 25.31  ? 46  TRP B NE1 1 
ATOM   1371 C  CE2 . TRP B  1 51  ? 24.759  20.243  -36.125 1.00 20.48  ? 46  TRP B CE2 1 
ATOM   1372 C  CE3 . TRP B  1 51  ? 25.272  18.325  -37.503 1.00 21.39  ? 46  TRP B CE3 1 
ATOM   1373 C  CZ2 . TRP B  1 51  ? 23.852  20.735  -37.060 1.00 20.02  ? 46  TRP B CZ2 1 
ATOM   1374 C  CZ3 . TRP B  1 51  ? 24.370  18.812  -38.430 1.00 22.81  ? 46  TRP B CZ3 1 
ATOM   1375 C  CH2 . TRP B  1 51  ? 23.670  20.006  -38.202 1.00 27.90  ? 46  TRP B CH2 1 
ATOM   1376 N  N   . ASN B  1 52  ? 29.625  15.867  -35.616 1.00 24.09  ? 47  ASN B N   1 
ATOM   1377 C  CA  . ASN B  1 52  ? 30.451  14.689  -35.379 1.00 18.38  ? 47  ASN B CA  1 
ATOM   1378 C  C   . ASN B  1 52  ? 30.174  14.094  -33.999 1.00 23.35  ? 47  ASN B C   1 
ATOM   1379 O  O   . ASN B  1 52  ? 31.092  13.770  -33.243 1.00 21.83  ? 47  ASN B O   1 
ATOM   1380 C  CB  . ASN B  1 52  ? 31.931  15.053  -35.532 1.00 31.70  ? 47  ASN B CB  1 
ATOM   1381 C  CG  . ASN B  1 52  ? 32.834  13.840  -35.566 1.00 32.19  ? 47  ASN B CG  1 
ATOM   1382 O  OD1 . ASN B  1 52  ? 32.439  12.768  -36.021 1.00 36.47  ? 47  ASN B OD1 1 
ATOM   1383 N  ND2 . ASN B  1 52  ? 34.055  14.003  -35.075 1.00 29.06  ? 47  ASN B ND2 1 
ATOM   1384 N  N   . GLU B  1 53  ? 28.895  13.971  -33.665 1.00 17.52  ? 48  GLU B N   1 
ATOM   1385 C  CA  . GLU B  1 53  ? 28.507  13.514  -32.336 1.00 23.38  ? 48  GLU B CA  1 
ATOM   1386 C  C   . GLU B  1 53  ? 27.862  12.139  -32.354 1.00 26.33  ? 48  GLU B C   1 
ATOM   1387 O  O   . GLU B  1 53  ? 27.026  11.841  -33.209 1.00 21.62  ? 48  GLU B O   1 
ATOM   1388 C  CB  . GLU B  1 53  ? 27.570  14.520  -31.667 1.00 27.88  ? 48  GLU B CB  1 
ATOM   1389 C  CG  . GLU B  1 53  ? 28.271  15.755  -31.145 1.00 35.89  ? 48  GLU B CG  1 
ATOM   1390 C  CD  . GLU B  1 53  ? 27.354  16.639  -30.327 1.00 38.19  ? 48  GLU B CD  1 
ATOM   1391 O  OE1 . GLU B  1 53  ? 27.235  17.835  -30.662 1.00 30.60  ? 48  GLU B OE1 1 
ATOM   1392 O  OE2 . GLU B  1 53  ? 26.755  16.140  -29.349 1.00 36.71  ? 48  GLU B OE2 1 
ATOM   1393 N  N   . GLY B  1 54  ? 28.258  11.309  -31.396 1.00 32.22  ? 49  GLY B N   1 
ATOM   1394 C  CA  . GLY B  1 54  ? 27.704  9.978   -31.255 1.00 20.33  ? 49  GLY B CA  1 
ATOM   1395 C  C   . GLY B  1 54  ? 26.574  9.950   -30.245 1.00 26.72  ? 49  GLY B C   1 
ATOM   1396 O  O   . GLY B  1 54  ? 26.590  10.686  -29.259 1.00 30.02  ? 49  GLY B O   1 
ATOM   1397 N  N   . PHE B  1 55  ? 25.581  9.108   -30.505 1.00 25.74  ? 50  PHE B N   1 
ATOM   1398 C  CA  . PHE B  1 55  ? 24.481  8.893   -29.575 1.00 22.62  ? 50  PHE B CA  1 
ATOM   1399 C  C   . PHE B  1 55  ? 24.154  7.410   -29.528 1.00 28.30  ? 50  PHE B C   1 
ATOM   1400 O  O   . PHE B  1 55  ? 24.402  6.681   -30.490 1.00 29.24  ? 50  PHE B O   1 
ATOM   1401 C  CB  . PHE B  1 55  ? 23.236  9.671   -30.006 1.00 20.16  ? 50  PHE B CB  1 
ATOM   1402 C  CG  . PHE B  1 55  ? 23.441  11.154  -30.090 1.00 31.22  ? 50  PHE B CG  1 
ATOM   1403 C  CD1 . PHE B  1 55  ? 23.356  11.945  -28.957 1.00 33.53  ? 50  PHE B CD1 1 
ATOM   1404 C  CD2 . PHE B  1 55  ? 23.704  11.760  -31.306 1.00 29.90  ? 50  PHE B CD2 1 
ATOM   1405 C  CE1 . PHE B  1 55  ? 23.538  13.314  -29.034 1.00 34.55  ? 50  PHE B CE1 1 
ATOM   1406 C  CE2 . PHE B  1 55  ? 23.888  13.127  -31.391 1.00 34.20  ? 50  PHE B CE2 1 
ATOM   1407 C  CZ  . PHE B  1 55  ? 23.804  13.905  -30.253 1.00 34.28  ? 50  PHE B CZ  1 
ATOM   1408 N  N   . GLU B  1 56  ? 23.597  6.963   -28.407 1.00 37.43  ? 51  GLU B N   1 
ATOM   1409 C  CA  . GLU B  1 56  ? 23.206  5.568   -28.255 1.00 37.70  ? 51  GLU B CA  1 
ATOM   1410 C  C   . GLU B  1 56  ? 21.857  5.439   -27.546 1.00 37.49  ? 51  GLU B C   1 
ATOM   1411 O  O   . GLU B  1 56  ? 21.654  5.999   -26.470 1.00 34.47  ? 51  GLU B O   1 
ATOM   1412 C  CB  . GLU B  1 56  ? 24.289  4.781   -27.506 1.00 42.44  ? 51  GLU B CB  1 
ATOM   1413 C  CG  . GLU B  1 56  ? 25.604  4.658   -28.267 1.00 47.51  ? 51  GLU B CG  1 
ATOM   1414 C  CD  . GLU B  1 56  ? 26.676  3.916   -27.490 1.00 57.72  ? 51  GLU B CD  1 
ATOM   1415 O  OE1 . GLU B  1 56  ? 26.813  4.163   -26.272 1.00 61.13  ? 51  GLU B OE1 1 
ATOM   1416 O  OE2 . GLU B  1 56  ? 27.380  3.080   -28.097 1.00 59.00  ? 51  GLU B OE2 1 
ATOM   1417 N  N   . TRP B  1 57  ? 20.935  4.713   -28.175 1.00 37.24  ? 52  TRP B N   1 
ATOM   1418 C  CA  . TRP B  1 57  ? 19.636  4.400   -27.583 1.00 37.23  ? 52  TRP B CA  1 
ATOM   1419 C  C   . TRP B  1 57  ? 19.626  2.947   -27.131 1.00 38.01  ? 52  TRP B C   1 
ATOM   1420 O  O   . TRP B  1 57  ? 20.026  2.064   -27.885 1.00 38.21  ? 52  TRP B O   1 
ATOM   1421 C  CB  . TRP B  1 57  ? 18.517  4.576   -28.610 1.00 27.70  ? 52  TRP B CB  1 
ATOM   1422 C  CG  . TRP B  1 57  ? 18.074  5.984   -28.867 1.00 34.13  ? 52  TRP B CG  1 
ATOM   1423 C  CD1 . TRP B  1 57  ? 16.996  6.616   -28.318 1.00 31.22  ? 52  TRP B CD1 1 
ATOM   1424 C  CD2 . TRP B  1 57  ? 18.675  6.925   -29.766 1.00 31.69  ? 52  TRP B CD2 1 
ATOM   1425 N  NE1 . TRP B  1 57  ? 16.897  7.896   -28.810 1.00 26.36  ? 52  TRP B NE1 1 
ATOM   1426 C  CE2 . TRP B  1 57  ? 17.914  8.109   -29.700 1.00 26.95  ? 52  TRP B CE2 1 
ATOM   1427 C  CE3 . TRP B  1 57  ? 19.785  6.881   -30.614 1.00 28.27  ? 52  TRP B CE3 1 
ATOM   1428 C  CZ2 . TRP B  1 57  ? 18.230  9.240   -30.452 1.00 30.90  ? 52  TRP B CZ2 1 
ATOM   1429 C  CZ3 . TRP B  1 57  ? 20.097  8.005   -31.357 1.00 31.10  ? 52  TRP B CZ3 1 
ATOM   1430 C  CH2 . TRP B  1 57  ? 19.322  9.168   -31.272 1.00 33.95  ? 52  TRP B CH2 1 
ATOM   1431 N  N   . ASP B  1 58  ? 19.153  2.694   -25.915 1.00 39.09  ? 53  ASP B N   1 
ATOM   1432 C  CA  . ASP B  1 58  ? 19.019  1.326   -25.425 1.00 44.63  ? 53  ASP B CA  1 
ATOM   1433 C  C   . ASP B  1 58  ? 17.875  0.635   -26.164 1.00 47.65  ? 53  ASP B C   1 
ATOM   1434 O  O   . ASP B  1 58  ? 16.793  1.201   -26.309 1.00 48.37  ? 53  ASP B O   1 
ATOM   1435 C  CB  . ASP B  1 58  ? 18.764  1.319   -23.916 1.00 52.47  ? 53  ASP B CB  1 
ATOM   1436 C  CG  . ASP B  1 58  ? 19.030  -0.035  -23.282 1.00 64.62  ? 53  ASP B CG  1 
ATOM   1437 O  OD1 . ASP B  1 58  ? 19.008  -1.053  -24.005 1.00 67.19  ? 53  ASP B OD1 1 
ATOM   1438 O  OD2 . ASP B  1 58  ? 19.258  -0.081  -22.054 1.00 68.26  ? 53  ASP B OD2 1 
ATOM   1439 N  N   . LEU B  1 59  ? 18.113  -0.585  -26.634 1.00 49.09  ? 54  LEU B N   1 
ATOM   1440 C  CA  . LEU B  1 59  ? 17.124  -1.281  -27.453 1.00 48.87  ? 54  LEU B CA  1 
ATOM   1441 C  C   . LEU B  1 59  ? 16.295  -2.302  -26.690 1.00 48.95  ? 54  LEU B C   1 
ATOM   1442 O  O   . LEU B  1 59  ? 15.465  -2.987  -27.287 1.00 45.93  ? 54  LEU B O   1 
ATOM   1443 C  CB  . LEU B  1 59  ? 17.793  -1.979  -28.636 1.00 49.76  ? 54  LEU B CB  1 
ATOM   1444 C  CG  . LEU B  1 59  ? 18.258  -1.106  -29.795 1.00 47.46  ? 54  LEU B CG  1 
ATOM   1445 C  CD1 . LEU B  1 59  ? 18.809  -1.988  -30.896 1.00 49.68  ? 54  LEU B CD1 1 
ATOM   1446 C  CD2 . LEU B  1 59  ? 17.113  -0.243  -30.306 1.00 45.89  ? 54  LEU B CD2 1 
ATOM   1447 N  N   . LYS B  1 60  ? 16.526  -2.415  -25.387 1.00 49.70  ? 55  LYS B N   1 
ATOM   1448 C  CA  . LYS B  1 60  ? 15.799  -3.382  -24.573 1.00 58.99  ? 55  LYS B CA  1 
ATOM   1449 C  C   . LYS B  1 60  ? 14.291  -3.191  -24.692 1.00 57.48  ? 55  LYS B C   1 
ATOM   1450 O  O   . LYS B  1 60  ? 13.769  -2.109  -24.430 1.00 52.26  ? 55  LYS B O   1 
ATOM   1451 C  CB  . LYS B  1 60  ? 16.232  -3.292  -23.107 1.00 67.56  ? 55  LYS B CB  1 
ATOM   1452 C  CG  . LYS B  1 60  ? 17.648  -3.774  -22.853 1.00 76.93  ? 55  LYS B CG  1 
ATOM   1453 C  CD  . LYS B  1 60  ? 17.884  -5.106  -23.546 1.00 83.84  ? 55  LYS B CD  1 
ATOM   1454 C  CE  . LYS B  1 60  ? 19.189  -5.747  -23.108 1.00 88.35  ? 55  LYS B CE  1 
ATOM   1455 N  NZ  . LYS B  1 60  ? 19.190  -6.078  -21.656 1.00 93.44  ? 55  LYS B NZ  1 
ATOM   1456 N  N   . GLY B  1 61  ? 13.600  -4.244  -25.114 1.00 57.26  ? 56  GLY B N   1 
ATOM   1457 C  CA  . GLY B  1 61  ? 12.153  -4.218  -25.213 1.00 59.19  ? 56  GLY B CA  1 
ATOM   1458 C  C   . GLY B  1 61  ? 11.631  -3.514  -26.451 1.00 54.76  ? 56  GLY B C   1 
ATOM   1459 O  O   . GLY B  1 61  ? 10.455  -3.164  -26.518 1.00 87.93  ? 56  GLY B O   1 
ATOM   1460 N  N   . ILE B  1 62  ? 12.500  -3.314  -27.436 1.00 50.91  ? 57  ILE B N   1 
ATOM   1461 C  CA  . ILE B  1 62  ? 12.111  -2.653  -28.679 1.00 53.30  ? 57  ILE B CA  1 
ATOM   1462 C  C   . ILE B  1 62  ? 12.334  -3.551  -29.896 1.00 57.81  ? 57  ILE B C   1 
ATOM   1463 O  O   . ILE B  1 62  ? 13.460  -3.962  -30.171 1.00 56.41  ? 57  ILE B O   1 
ATOM   1464 C  CB  . ILE B  1 62  ? 12.879  -1.329  -28.872 1.00 49.35  ? 57  ILE B CB  1 
ATOM   1465 C  CG1 . ILE B  1 62  ? 12.628  -0.387  -27.689 1.00 53.53  ? 57  ILE B CG1 1 
ATOM   1466 C  CG2 . ILE B  1 62  ? 12.487  -0.667  -30.185 1.00 43.21  ? 57  ILE B CG2 1 
ATOM   1467 C  CD1 . ILE B  1 62  ? 13.732  0.633   -27.470 1.00 51.52  ? 57  ILE B CD1 1 
ATOM   1468 N  N   . PRO B  1 63  ? 11.253  -3.846  -30.637 1.00 63.89  ? 58  PRO B N   1 
ATOM   1469 C  CA  . PRO B  1 63  ? 11.297  -4.687  -31.835 1.00 69.01  ? 58  PRO B CA  1 
ATOM   1470 C  C   . PRO B  1 63  ? 11.665  -3.886  -33.080 1.00 70.13  ? 58  PRO B C   1 
ATOM   1471 O  O   . PRO B  1 63  ? 11.000  -2.905  -33.418 1.00 69.80  ? 58  PRO B O   1 
ATOM   1472 C  CB  . PRO B  1 63  ? 9.862   -5.205  -31.943 1.00 71.63  ? 58  PRO B CB  1 
ATOM   1473 C  CG  . PRO B  1 63  ? 9.014   -4.138  -31.278 1.00 71.69  ? 58  PRO B CG  1 
ATOM   1474 C  CD  . PRO B  1 63  ? 9.909   -3.292  -30.402 1.00 66.34  ? 58  PRO B CD  1 
ATOM   1475 N  N   . LEU B  1 64  ? 12.717  -4.314  -33.766 1.00 71.58  ? 59  LEU B N   1 
ATOM   1476 C  CA  . LEU B  1 64  ? 13.135  -3.668  -35.003 1.00 74.43  ? 59  LEU B CA  1 
ATOM   1477 C  C   . LEU B  1 64  ? 12.327  -4.207  -36.185 1.00 81.89  ? 59  LEU B C   1 
ATOM   1478 O  O   . LEU B  1 64  ? 12.860  -4.398  -37.278 1.00 82.23  ? 59  LEU B O   1 
ATOM   1479 C  CB  . LEU B  1 64  ? 14.635  -3.881  -35.219 1.00 73.70  ? 59  LEU B CB  1 
ATOM   1480 C  CG  . LEU B  1 64  ? 15.442  -3.439  -33.997 1.00 70.05  ? 59  LEU B CG  1 
ATOM   1481 C  CD1 . LEU B  1 64  ? 16.873  -3.949  -34.039 1.00 69.63  ? 59  LEU B CD1 1 
ATOM   1482 C  CD2 . LEU B  1 64  ? 15.410  -1.931  -33.878 1.00 63.46  ? 59  LEU B CD2 1 
ATOM   1483 N  N   . ASP B  1 65  ? 11.031  -4.428  -35.967 1.00 88.91  ? 60  ASP B N   1 
ATOM   1484 C  CA  . ASP B  1 65  ? 10.186  -5.068  -36.975 1.00 95.72  ? 60  ASP B CA  1 
ATOM   1485 C  C   . ASP B  1 65  ? 9.554   -4.088  -37.981 1.00 90.80  ? 60  ASP B C   1 
ATOM   1486 O  O   . ASP B  1 65  ? 9.760   -4.235  -39.189 1.00 90.64  ? 60  ASP B O   1 
ATOM   1487 C  CB  . ASP B  1 65  ? 9.143   -5.989  -36.314 1.00 104.37 ? 60  ASP B CB  1 
ATOM   1488 C  CG  . ASP B  1 65  ? 7.729   -5.431  -36.372 1.00 108.37 ? 60  ASP B CG  1 
ATOM   1489 O  OD1 . ASP B  1 65  ? 7.504   -4.307  -35.872 1.00 108.81 ? 60  ASP B OD1 1 
ATOM   1490 O  OD2 . ASP B  1 65  ? 6.846   -6.115  -36.933 1.00 110.91 ? 60  ASP B OD2 1 
ATOM   1491 N  N   . GLN B  1 66  ? 8.864   -3.075  -37.493 1.00 88.75  ? 61  GLN B N   1 
ATOM   1492 C  CA  . GLN B  1 66  ? 8.105   -2.167  -38.346 1.00 87.31  ? 61  GLN B CA  1 
ATOM   1493 C  C   . GLN B  1 66  ? 9.065   -1.349  -39.176 1.00 81.15  ? 61  GLN B C   1 
ATOM   1494 O  O   . GLN B  1 66  ? 10.271  -1.438  -39.008 1.00 83.97  ? 61  GLN B O   1 
ATOM   1495 C  CB  . GLN B  1 66  ? 7.172   -1.252  -37.521 1.00 86.18  ? 61  GLN B CB  1 
ATOM   1496 C  CG  . GLN B  1 66  ? 7.680   0.150   -37.188 1.00 80.09  ? 61  GLN B CG  1 
ATOM   1497 C  CD  . GLN B  1 66  ? 6.907   0.826   -36.069 1.00 78.95  ? 61  GLN B CD  1 
ATOM   1498 O  OE1 . GLN B  1 66  ? 5.978   0.259   -35.519 1.00 84.27  ? 61  GLN B OE1 1 
ATOM   1499 N  NE2 . GLN B  1 66  ? 7.287   2.046   -35.739 1.00 70.09  ? 61  GLN B NE2 1 
ATOM   1500 N  N   . GLY B  1 67  ? 8.527   -0.597  -40.111 1.00 72.72  ? 62  GLY B N   1 
ATOM   1501 C  CA  . GLY B  1 67  ? 9.356   0.304   -40.850 1.00 65.18  ? 62  GLY B CA  1 
ATOM   1502 C  C   . GLY B  1 67  ? 9.508   1.397   -39.824 1.00 58.45  ? 62  GLY B C   1 
ATOM   1503 O  O   . GLY B  1 67  ? 8.948   2.458   -39.943 1.00 64.09  ? 62  GLY B O   1 
ATOM   1504 N  N   . SER B  1 68  ? 10.257  1.074   -38.781 1.00 48.33  ? 63  SER B N   1 
ATOM   1505 C  CA  . SER B  1 68  ? 10.645  2.017   -37.754 1.00 49.52  ? 63  SER B CA  1 
ATOM   1506 C  C   . SER B  1 68  ? 11.668  3.008   -38.273 1.00 41.31  ? 63  SER B C   1 
ATOM   1507 O  O   . SER B  1 68  ? 12.490  2.667   -39.084 1.00 34.88  ? 63  SER B O   1 
ATOM   1508 C  CB  . SER B  1 68  ? 11.212  1.286   -36.557 1.00 55.99  ? 63  SER B CB  1 
ATOM   1509 O  OG  . SER B  1 68  ? 12.303  0.497   -36.922 1.00 56.62  ? 63  SER B OG  1 
ATOM   1510 N  N   . GLU B  1 69  ? 11.603  4.229   -37.779 1.00 32.42  ? 64  GLU B N   1 
ATOM   1511 C  CA  . GLU B  1 69  ? 12.394  5.306   -38.347 1.00 34.45  ? 64  GLU B CA  1 
ATOM   1512 C  C   . GLU B  1 69  ? 13.030  6.198   -37.296 1.00 34.53  ? 64  GLU B C   1 
ATOM   1513 O  O   . GLU B  1 69  ? 12.457  6.452   -36.236 1.00 37.65  ? 64  GLU B O   1 
ATOM   1514 C  CB  . GLU B  1 69  ? 11.537  6.138   -39.303 1.00 37.24  ? 64  GLU B CB  1 
ATOM   1515 C  CG  . GLU B  1 69  ? 11.136  5.408   -40.576 1.00 48.21  ? 64  GLU B CG  1 
ATOM   1516 C  CD  . GLU B  1 69  ? 10.086  6.158   -41.370 1.00 60.05  ? 64  GLU B CD  1 
ATOM   1517 O  OE1 . GLU B  1 69  ? 9.370   6.986   -40.768 1.00 63.06  ? 64  GLU B OE1 1 
ATOM   1518 O  OE2 . GLU B  1 69  ? 9.978   5.922   -42.593 1.00 63.40  ? 64  GLU B OE2 1 
ATOM   1519 N  N   . LEU B  1 70  ? 14.236  6.657   -37.599 1.00 25.15  ? 65  LEU B N   1 
ATOM   1520 C  CA  . LEU B  1 70  ? 14.874  7.690   -36.807 1.00 33.40  ? 65  LEU B CA  1 
ATOM   1521 C  C   . LEU B  1 70  ? 14.463  9.038   -37.383 1.00 29.59  ? 65  LEU B C   1 
ATOM   1522 O  O   . LEU B  1 70  ? 14.597  9.279   -38.583 1.00 33.50  ? 65  LEU B O   1 
ATOM   1523 C  CB  . LEU B  1 70  ? 16.391  7.531   -36.848 1.00 33.23  ? 65  LEU B CB  1 
ATOM   1524 C  CG  . LEU B  1 70  ? 17.213  8.636   -36.188 1.00 26.96  ? 65  LEU B CG  1 
ATOM   1525 C  CD1 . LEU B  1 70  ? 17.131  8.527   -34.678 1.00 25.87  ? 65  LEU B CD1 1 
ATOM   1526 C  CD2 . LEU B  1 70  ? 18.655  8.581   -36.653 1.00 28.13  ? 65  LEU B CD2 1 
ATOM   1527 N  N   . HIS B  1 71  ? 13.940  9.908   -36.528 1.00 23.83  ? 66  HIS B N   1 
ATOM   1528 C  CA  . HIS B  1 71  ? 13.522  11.231  -36.966 1.00 39.08  ? 66  HIS B CA  1 
ATOM   1529 C  C   . HIS B  1 71  ? 14.563  12.268  -36.574 1.00 32.99  ? 66  HIS B C   1 
ATOM   1530 O  O   . HIS B  1 71  ? 14.910  12.401  -35.401 1.00 34.13  ? 66  HIS B O   1 
ATOM   1531 C  CB  . HIS B  1 71  ? 12.163  11.601  -36.371 1.00 38.39  ? 66  HIS B CB  1 
ATOM   1532 C  CG  . HIS B  1 71  ? 11.590  12.869  -36.922 1.00 45.85  ? 66  HIS B CG  1 
ATOM   1533 N  ND1 . HIS B  1 71  ? 10.945  13.799  -36.136 1.00 51.31  ? 66  HIS B ND1 1 
ATOM   1534 C  CD2 . HIS B  1 71  ? 11.561  13.359  -38.184 1.00 51.72  ? 66  HIS B CD2 1 
ATOM   1535 C  CE1 . HIS B  1 71  ? 10.546  14.809  -36.889 1.00 50.99  ? 66  HIS B CE1 1 
ATOM   1536 N  NE2 . HIS B  1 71  ? 10.906  14.566  -38.135 1.00 48.18  ? 66  HIS B NE2 1 
ATOM   1537 N  N   . VAL B  1 72  ? 15.061  13.000  -37.563 1.00 27.96  ? 67  VAL B N   1 
ATOM   1538 C  CA  . VAL B  1 72  ? 16.060  14.028  -37.307 1.00 26.49  ? 67  VAL B CA  1 
ATOM   1539 C  C   . VAL B  1 72  ? 15.548  15.411  -37.698 1.00 27.18  ? 67  VAL B C   1 
ATOM   1540 O  O   . VAL B  1 72  ? 15.021  15.606  -38.791 1.00 31.58  ? 67  VAL B O   1 
ATOM   1541 C  CB  . VAL B  1 72  ? 17.384  13.723  -38.033 1.00 32.36  ? 67  VAL B CB  1 
ATOM   1542 C  CG1 . VAL B  1 72  ? 18.091  12.554  -37.364 1.00 31.59  ? 67  VAL B CG1 1 
ATOM   1543 C  CG2 . VAL B  1 72  ? 17.132  13.430  -39.507 1.00 34.72  ? 67  VAL B CG2 1 
ATOM   1544 N  N   . VAL B  1 73  ? 15.686  16.365  -36.784 1.00 24.90  ? 68  VAL B N   1 
ATOM   1545 C  CA  . VAL B  1 73  ? 15.303  17.741  -37.061 1.00 29.16  ? 68  VAL B CA  1 
ATOM   1546 C  C   . VAL B  1 73  ? 16.514  18.650  -36.890 1.00 31.17  ? 68  VAL B C   1 
ATOM   1547 O  O   . VAL B  1 73  ? 17.210  18.590  -35.873 1.00 29.08  ? 68  VAL B O   1 
ATOM   1548 C  CB  . VAL B  1 73  ? 14.169  18.219  -36.130 1.00 28.77  ? 68  VAL B CB  1 
ATOM   1549 C  CG1 . VAL B  1 73  ? 13.673  19.595  -36.557 1.00 35.18  ? 68  VAL B CG1 1 
ATOM   1550 C  CG2 . VAL B  1 73  ? 13.022  17.221  -36.125 1.00 32.01  ? 68  VAL B CG2 1 
ATOM   1551 N  N   . VAL B  1 74  ? 16.776  19.476  -37.895 1.00 26.59  ? 69  VAL B N   1 
ATOM   1552 C  CA  . VAL B  1 74  ? 17.816  20.488  -37.783 1.00 30.58  ? 69  VAL B CA  1 
ATOM   1553 C  C   . VAL B  1 74  ? 17.170  21.819  -37.428 1.00 30.04  ? 69  VAL B C   1 
ATOM   1554 O  O   . VAL B  1 74  ? 16.291  22.295  -38.139 1.00 29.54  ? 69  VAL B O   1 
ATOM   1555 C  CB  . VAL B  1 74  ? 18.614  20.639  -39.087 1.00 32.29  ? 69  VAL B CB  1 
ATOM   1556 C  CG1 . VAL B  1 74  ? 19.654  21.740  -38.943 1.00 27.94  ? 69  VAL B CG1 1 
ATOM   1557 C  CG2 . VAL B  1 74  ? 19.271  19.319  -39.461 1.00 29.17  ? 69  VAL B CG2 1 
ATOM   1558 N  N   . LYS B  1 75  ? 17.601  22.408  -36.319 1.00 33.40  ? 70  LYS B N   1 
ATOM   1559 C  CA  . LYS B  1 75  ? 17.016  23.657  -35.850 1.00 40.09  ? 70  LYS B CA  1 
ATOM   1560 C  C   . LYS B  1 75  ? 18.052  24.765  -35.718 1.00 36.91  ? 70  LYS B C   1 
ATOM   1561 O  O   . LYS B  1 75  ? 19.239  24.500  -35.517 1.00 32.19  ? 70  LYS B O   1 
ATOM   1562 C  CB  . LYS B  1 75  ? 16.329  23.457  -34.500 1.00 40.35  ? 70  LYS B CB  1 
ATOM   1563 C  CG  . LYS B  1 75  ? 15.011  22.713  -34.546 1.00 39.09  ? 70  LYS B CG  1 
ATOM   1564 C  CD  . LYS B  1 75  ? 14.154  23.114  -33.357 1.00 49.32  ? 70  LYS B CD  1 
ATOM   1565 C  CE  . LYS B  1 75  ? 12.932  22.229  -33.217 1.00 56.16  ? 70  LYS B CE  1 
ATOM   1566 N  NZ  . LYS B  1 75  ? 13.311  20.823  -32.911 1.00 54.29  ? 70  LYS B NZ  1 
ATOM   1567 N  N   . ASP B  1 76  ? 17.591  26.007  -35.829 1.00 36.60  ? 71  ASP B N   1 
ATOM   1568 C  CA  . ASP B  1 76  ? 18.441  27.162  -35.578 1.00 42.44  ? 71  ASP B CA  1 
ATOM   1569 C  C   . ASP B  1 76  ? 18.240  27.663  -34.150 1.00 49.37  ? 71  ASP B C   1 
ATOM   1570 O  O   . ASP B  1 76  ? 17.114  27.772  -33.666 1.00 46.89  ? 71  ASP B O   1 
ATOM   1571 C  CB  . ASP B  1 76  ? 18.159  28.283  -36.581 1.00 43.75  ? 71  ASP B CB  1 
ATOM   1572 C  CG  . ASP B  1 76  ? 19.067  29.482  -36.379 1.00 49.64  ? 71  ASP B CG  1 
ATOM   1573 O  OD1 . ASP B  1 76  ? 20.206  29.291  -35.904 1.00 44.39  ? 71  ASP B OD1 1 
ATOM   1574 O  OD2 . ASP B  1 76  ? 18.642  30.614  -36.691 1.00 59.52  ? 71  ASP B OD2 1 
ATOM   1575 N  N   . HIS B  1 77  ? 19.350  27.965  -33.489 1.00 53.04  ? 72  HIS B N   1 
ATOM   1576 C  CA  . HIS B  1 77  ? 19.362  28.384  -32.097 1.00 58.25  ? 72  HIS B CA  1 
ATOM   1577 C  C   . HIS B  1 77  ? 19.312  29.910  -32.048 1.00 57.45  ? 72  HIS B C   1 
ATOM   1578 O  O   . HIS B  1 77  ? 20.045  30.564  -32.788 1.00 52.11  ? 72  HIS B O   1 
ATOM   1579 C  CB  . HIS B  1 77  ? 20.658  27.875  -31.475 1.00 62.14  ? 72  HIS B CB  1 
ATOM   1580 C  CG  . HIS B  1 77  ? 20.682  27.929  -29.985 1.00 67.52  ? 72  HIS B CG  1 
ATOM   1581 N  ND1 . HIS B  1 77  ? 20.052  26.991  -29.195 1.00 69.90  ? 72  HIS B ND1 1 
ATOM   1582 C  CD2 . HIS B  1 77  ? 21.271  28.801  -29.139 1.00 69.77  ? 72  HIS B CD2 1 
ATOM   1583 C  CE1 . HIS B  1 77  ? 20.249  27.289  -27.924 1.00 73.58  ? 72  HIS B CE1 1 
ATOM   1584 N  NE2 . HIS B  1 77  ? 20.988  28.380  -27.862 1.00 71.92  ? 72  HIS B NE2 1 
ATOM   1585 N  N   . GLU B  1 78  ? 18.469  30.498  -31.198 1.00 67.29  ? 73  GLU B N   1 
ATOM   1586 C  CA  . GLU B  1 78  ? 18.237  31.947  -31.341 1.00 77.92  ? 73  GLU B CA  1 
ATOM   1587 C  C   . GLU B  1 78  ? 18.778  33.029  -30.369 1.00 102.24 ? 73  GLU B C   1 
ATOM   1588 O  O   . GLU B  1 78  ? 19.478  33.919  -30.844 1.00 102.20 ? 73  GLU B O   1 
ATOM   1589 C  CB  . GLU B  1 78  ? 16.811  32.267  -31.820 1.00 84.71  ? 73  GLU B CB  1 
ATOM   1590 C  CG  . GLU B  1 78  ? 16.559  31.919  -33.297 1.00 85.74  ? 73  GLU B CG  1 
ATOM   1591 C  CD  . GLU B  1 78  ? 17.266  32.844  -34.297 1.00 88.95  ? 73  GLU B CD  1 
ATOM   1592 O  OE1 . GLU B  1 78  ? 18.332  33.417  -33.981 1.00 89.03  ? 73  GLU B OE1 1 
ATOM   1593 O  OE2 . GLU B  1 78  ? 16.742  32.991  -35.421 1.00 90.15  ? 73  GLU B OE2 1 
ATOM   1594 N  N   . THR B  1 79  ? 18.513  33.027  -29.063 1.00 107.15 ? 74  THR B N   1 
ATOM   1595 C  CA  . THR B  1 79  ? 17.859  32.023  -28.249 1.00 111.33 ? 74  THR B CA  1 
ATOM   1596 C  C   . THR B  1 79  ? 17.713  32.924  -27.011 1.00 120.73 ? 74  THR B C   1 
ATOM   1597 O  O   . THR B  1 79  ? 18.191  34.054  -27.075 1.00 123.60 ? 74  THR B O   1 
ATOM   1598 C  CB  . THR B  1 79  ? 18.810  30.832  -28.027 1.00 109.79 ? 74  THR B CB  1 
ATOM   1599 O  OG1 . THR B  1 79  ? 18.049  29.641  -27.802 1.00 107.96 ? 74  THR B OG1 1 
ATOM   1600 C  CG2 . THR B  1 79  ? 19.761  31.076  -26.858 1.00 114.36 ? 74  THR B CG2 1 
ATOM   1601 N  N   . MET B  1 80  ? 17.092  32.525  -25.893 1.00 125.40 ? 75  MET B N   1 
ATOM   1602 C  CA  . MET B  1 80  ? 16.635  31.177  -25.541 1.00 124.65 ? 75  MET B CA  1 
ATOM   1603 C  C   . MET B  1 80  ? 15.123  31.037  -25.691 1.00 127.91 ? 75  MET B C   1 
ATOM   1604 O  O   . MET B  1 80  ? 14.572  29.970  -25.432 1.00 127.94 ? 75  MET B O   1 
ATOM   1605 C  CB  . MET B  1 80  ? 17.038  30.845  -24.090 1.00 125.70 ? 75  MET B CB  1 
ATOM   1606 C  CG  . MET B  1 80  ? 18.184  29.882  -23.821 1.00 120.53 ? 75  MET B CG  1 
ATOM   1607 S  SD  . MET B  1 80  ? 18.652  29.969  -22.052 1.00 272.69 ? 75  MET B SD  1 
ATOM   1608 C  CE  . MET B  1 80  ? 18.397  28.368  -21.409 1.00 107.72 ? 75  MET B CE  1 
ATOM   1609 N  N   . GLY B  1 81  ? 14.454  32.116  -26.096 1.00 131.52 ? 76  GLY B N   1 
ATOM   1610 C  CA  . GLY B  1 81  ? 13.009  32.107  -26.299 1.00 134.39 ? 76  GLY B CA  1 
ATOM   1611 C  C   . GLY B  1 81  ? 12.575  31.508  -27.626 1.00 130.76 ? 76  GLY B C   1 
ATOM   1612 O  O   . GLY B  1 81  ? 11.387  31.262  -27.850 1.00 134.44 ? 76  GLY B O   1 
ATOM   1613 N  N   . ARG B  1 82  ? 13.542  31.267  -28.507 1.00 122.70 ? 77  ARG B N   1 
ATOM   1614 C  CA  . ARG B  1 82  ? 13.254  30.670  -29.809 1.00 117.17 ? 77  ARG B CA  1 
ATOM   1615 C  C   . ARG B  1 82  ? 14.266  29.615  -30.202 1.00 106.89 ? 77  ARG B C   1 
ATOM   1616 O  O   . ARG B  1 82  ? 15.476  29.839  -30.148 1.00 105.64 ? 77  ARG B O   1 
ATOM   1617 C  CB  . ARG B  1 82  ? 13.226  31.732  -30.906 1.00 121.30 ? 77  ARG B CB  1 
ATOM   1618 C  CG  . ARG B  1 82  ? 12.152  32.742  -30.724 1.00 129.99 ? 77  ARG B CG  1 
ATOM   1619 C  CD  . ARG B  1 82  ? 12.113  33.731  -31.845 1.00 133.52 ? 77  ARG B CD  1 
ATOM   1620 N  NE  . ARG B  1 82  ? 11.022  34.670  -31.612 1.00 141.68 ? 77  ARG B NE  1 
ATOM   1621 C  CZ  . ARG B  1 82  ? 9.803   34.544  -32.120 1.00 145.84 ? 77  ARG B CZ  1 
ATOM   1622 N  NH1 . ARG B  1 82  ? 9.522   33.531  -32.925 1.00 142.45 ? 77  ARG B NH1 1 
ATOM   1623 N  NH2 . ARG B  1 82  ? 8.874   35.443  -31.833 1.00 153.57 ? 77  ARG B NH2 1 
ATOM   1624 N  N   . ASN B  1 83  ? 13.753  28.460  -30.599 1.00 102.40 ? 78  ASN B N   1 
ATOM   1625 C  CA  . ASN B  1 83  ? 14.541  27.480  -31.323 1.00 93.43  ? 78  ASN B CA  1 
ATOM   1626 C  C   . ASN B  1 83  ? 13.760  27.124  -32.575 1.00 86.39  ? 78  ASN B C   1 
ATOM   1627 O  O   . ASN B  1 83  ? 12.776  26.379  -32.524 1.00 85.72  ? 78  ASN B O   1 
ATOM   1628 C  CB  . ASN B  1 83  ? 14.829  26.249  -30.463 1.00 91.65  ? 78  ASN B CB  1 
ATOM   1629 C  CG  . ASN B  1 83  ? 16.090  26.403  -29.625 1.00 92.72  ? 78  ASN B CG  1 
ATOM   1630 O  OD1 . ASN B  1 83  ? 16.391  27.483  -29.116 1.00 99.43  ? 78  ASN B OD1 1 
ATOM   1631 N  ND2 . ASN B  1 83  ? 16.840  25.320  -29.489 1.00 90.17  ? 78  ASN B ND2 1 
ATOM   1632 N  N   . ARG B  1 84  ? 14.189  27.685  -33.699 1.00 78.81  ? 79  ARG B N   1 
ATOM   1633 C  CA  . ARG B  1 84  ? 13.392  27.641  -34.918 1.00 69.06  ? 79  ARG B CA  1 
ATOM   1634 C  C   . ARG B  1 84  ? 13.732  26.472  -35.843 1.00 57.56  ? 79  ARG B C   1 
ATOM   1635 O  O   . ARG B  1 84  ? 14.894  26.257  -36.196 1.00 52.10  ? 79  ARG B O   1 
ATOM   1636 C  CB  . ARG B  1 84  ? 13.492  28.981  -35.652 1.00 71.14  ? 79  ARG B CB  1 
ATOM   1637 C  CG  . ARG B  1 84  ? 13.093  28.945  -37.109 1.00 71.50  ? 79  ARG B CG  1 
ATOM   1638 C  CD  . ARG B  1 84  ? 12.270  30.170  -37.472 1.00 77.93  ? 79  ARG B CD  1 
ATOM   1639 N  NE  . ARG B  1 84  ? 12.678  31.352  -36.716 1.00 83.47  ? 79  ARG B NE  1 
ATOM   1640 C  CZ  . ARG B  1 84  ? 12.078  32.536  -36.800 1.00 84.54  ? 79  ARG B CZ  1 
ATOM   1641 N  NH1 . ARG B  1 84  ? 11.042  32.701  -37.612 1.00 85.81  ? 79  ARG B NH1 1 
ATOM   1642 N  NH2 . ARG B  1 84  ? 12.512  33.558  -36.075 1.00 84.37  ? 79  ARG B NH2 1 
ATOM   1643 N  N   . PHE B  1 85  ? 12.695  25.716  -36.202 1.00 52.87  ? 80  PHE B N   1 
ATOM   1644 C  CA  . PHE B  1 85  ? 12.775  24.605  -37.148 1.00 48.74  ? 80  PHE B CA  1 
ATOM   1645 C  C   . PHE B  1 85  ? 13.401  25.060  -38.458 1.00 45.61  ? 80  PHE B C   1 
ATOM   1646 O  O   . PHE B  1 85  ? 13.051  26.108  -38.991 1.00 44.09  ? 80  PHE B O   1 
ATOM   1647 C  CB  . PHE B  1 85  ? 11.360  24.058  -37.407 1.00 51.69  ? 80  PHE B CB  1 
ATOM   1648 C  CG  . PHE B  1 85  ? 11.288  22.917  -38.410 1.00 46.50  ? 80  PHE B CG  1 
ATOM   1649 C  CD1 . PHE B  1 85  ? 11.347  23.156  -39.778 1.00 47.40  ? 80  PHE B CD1 1 
ATOM   1650 C  CD2 . PHE B  1 85  ? 11.099  21.615  -37.982 1.00 46.34  ? 80  PHE B CD2 1 
ATOM   1651 C  CE1 . PHE B  1 85  ? 11.258  22.119  -40.689 1.00 47.10  ? 80  PHE B CE1 1 
ATOM   1652 C  CE2 . PHE B  1 85  ? 11.008  20.574  -38.892 1.00 41.93  ? 80  PHE B CE2 1 
ATOM   1653 C  CZ  . PHE B  1 85  ? 11.086  20.830  -40.246 1.00 44.43  ? 80  PHE B CZ  1 
ATOM   1654 N  N   . LEU B  1 86  ? 14.319  24.257  -38.984 1.00 38.08  ? 81  LEU B N   1 
ATOM   1655 C  CA  . LEU B  1 86  ? 14.911  24.534  -40.288 1.00 36.57  ? 81  LEU B CA  1 
ATOM   1656 C  C   . LEU B  1 86  ? 14.543  23.454  -41.304 1.00 36.76  ? 81  LEU B C   1 
ATOM   1657 O  O   . LEU B  1 86  ? 14.034  23.754  -42.383 1.00 41.91  ? 81  LEU B O   1 
ATOM   1658 C  CB  . LEU B  1 86  ? 16.431  24.660  -40.181 1.00 34.99  ? 81  LEU B CB  1 
ATOM   1659 C  CG  . LEU B  1 86  ? 16.986  25.843  -39.387 1.00 36.73  ? 81  LEU B CG  1 
ATOM   1660 C  CD1 . LEU B  1 86  ? 18.507  25.811  -39.395 1.00 40.52  ? 81  LEU B CD1 1 
ATOM   1661 C  CD2 . LEU B  1 86  ? 16.472  27.159  -39.951 1.00 38.60  ? 81  LEU B CD2 1 
ATOM   1662 N  N   . GLY B  1 87  ? 14.801  22.199  -40.952 1.00 31.95  ? 82  GLY B N   1 
ATOM   1663 C  CA  . GLY B  1 87  ? 14.501  21.084  -41.832 1.00 33.50  ? 82  GLY B CA  1 
ATOM   1664 C  C   . GLY B  1 87  ? 14.414  19.770  -41.081 1.00 32.13  ? 82  GLY B C   1 
ATOM   1665 O  O   . GLY B  1 87  ? 14.895  19.661  -39.954 1.00 31.74  ? 82  GLY B O   1 
ATOM   1666 N  N   . GLU B  1 88  ? 13.798  18.768  -41.703 1.00 26.13  ? 83  GLU B N   1 
ATOM   1667 C  CA  . GLU B  1 88  ? 13.663  17.459  -41.071 1.00 27.46  ? 83  GLU B CA  1 
ATOM   1668 C  C   . GLU B  1 88  ? 13.747  16.309  -42.069 1.00 28.64  ? 83  GLU B C   1 
ATOM   1669 O  O   . GLU B  1 88  ? 13.621  16.507  -43.276 1.00 31.15  ? 83  GLU B O   1 
ATOM   1670 C  CB  . GLU B  1 88  ? 12.359  17.371  -40.273 1.00 24.02  ? 83  GLU B CB  1 
ATOM   1671 C  CG  . GLU B  1 88  ? 11.097  17.517  -41.107 1.00 30.28  ? 83  GLU B CG  1 
ATOM   1672 C  CD  . GLU B  1 88  ? 9.846   17.614  -40.253 1.00 46.95  ? 83  GLU B CD  1 
ATOM   1673 O  OE1 . GLU B  1 88  ? 9.847   17.065  -39.131 1.00 49.59  ? 83  GLU B OE1 1 
ATOM   1674 O  OE2 . GLU B  1 88  ? 8.866   18.246  -40.697 1.00 59.63  ? 83  GLU B OE2 1 
ATOM   1675 N  N   . ALA B  1 89  ? 13.962  15.106  -41.548 1.00 28.38  ? 84  ALA B N   1 
ATOM   1676 C  CA  . ALA B  1 89  ? 14.038  13.909  -42.371 1.00 30.39  ? 84  ALA B CA  1 
ATOM   1677 C  C   . ALA B  1 89  ? 13.799  12.668  -41.523 1.00 33.05  ? 84  ALA B C   1 
ATOM   1678 O  O   . ALA B  1 89  ? 14.108  12.646  -40.331 1.00 32.52  ? 84  ALA B O   1 
ATOM   1679 C  CB  . ALA B  1 89  ? 15.392  13.822  -43.061 1.00 28.45  ? 84  ALA B CB  1 
ATOM   1680 N  N   . LYS B  1 90  ? 13.238  11.637  -42.142 1.00 30.19  ? 85  LYS B N   1 
ATOM   1681 C  CA  . LYS B  1 90  ? 13.070  10.352  -41.481 1.00 34.97  ? 85  LYS B CA  1 
ATOM   1682 C  C   . LYS B  1 90  ? 13.929  9.326   -42.201 1.00 29.29  ? 85  LYS B C   1 
ATOM   1683 O  O   . LYS B  1 90  ? 13.853  9.194   -43.421 1.00 34.31  ? 85  LYS B O   1 
ATOM   1684 C  CB  . LYS B  1 90  ? 11.603  9.924   -41.509 1.00 40.84  ? 85  LYS B CB  1 
ATOM   1685 C  CG  . LYS B  1 90  ? 10.666  10.880  -40.792 1.00 45.67  ? 85  LYS B CG  1 
ATOM   1686 C  CD  . LYS B  1 90  ? 9.292   10.883  -41.442 1.00 52.17  ? 85  LYS B CD  1 
ATOM   1687 C  CE  . LYS B  1 90  ? 8.327   11.799  -40.707 1.00 53.98  ? 85  LYS B CE  1 
ATOM   1688 N  NZ  . LYS B  1 90  ? 7.934   11.244  -39.381 1.00 56.64  ? 85  LYS B NZ  1 
ATOM   1689 N  N   . VAL B  1 91  ? 14.759  8.608   -41.456 1.00 25.83  ? 86  VAL B N   1 
ATOM   1690 C  CA  . VAL B  1 91  ? 15.603  7.593   -42.074 1.00 27.16  ? 86  VAL B CA  1 
ATOM   1691 C  C   . VAL B  1 91  ? 15.119  6.184   -41.729 1.00 29.82  ? 86  VAL B C   1 
ATOM   1692 O  O   . VAL B  1 91  ? 14.898  5.860   -40.561 1.00 28.95  ? 86  VAL B O   1 
ATOM   1693 C  CB  . VAL B  1 91  ? 17.108  7.797   -41.746 1.00 43.91  ? 86  VAL B CB  1 
ATOM   1694 C  CG1 . VAL B  1 91  ? 17.558  9.174   -42.202 1.00 51.77  ? 86  VAL B CG1 1 
ATOM   1695 C  CG2 . VAL B  1 91  ? 17.382  7.627   -40.266 1.00 42.08  ? 86  VAL B CG2 1 
ATOM   1696 N  N   . PRO B  1 92  ? 14.921  5.350   -42.762 1.00 31.64  ? 87  PRO B N   1 
ATOM   1697 C  CA  . PRO B  1 92  ? 14.386  3.996   -42.584 1.00 31.37  ? 87  PRO B CA  1 
ATOM   1698 C  C   . PRO B  1 92  ? 15.439  3.023   -42.064 1.00 32.84  ? 87  PRO B C   1 
ATOM   1699 O  O   . PRO B  1 92  ? 16.374  2.662   -42.779 1.00 34.44  ? 87  PRO B O   1 
ATOM   1700 C  CB  . PRO B  1 92  ? 13.942  3.608   -43.997 1.00 31.98  ? 87  PRO B CB  1 
ATOM   1701 C  CG  . PRO B  1 92  ? 14.838  4.390   -44.895 1.00 35.13  ? 87  PRO B CG  1 
ATOM   1702 C  CD  . PRO B  1 92  ? 15.137  5.683   -44.182 1.00 32.20  ? 87  PRO B CD  1 
ATOM   1703 N  N   . LEU B  1 93  ? 15.270  2.589   -40.821 1.00 24.37  ? 88  LEU B N   1 
ATOM   1704 C  CA  . LEU B  1 93  ? 16.232  1.702   -40.184 1.00 27.44  ? 88  LEU B CA  1 
ATOM   1705 C  C   . LEU B  1 93  ? 16.178  0.294   -40.764 1.00 30.31  ? 88  LEU B C   1 
ATOM   1706 O  O   . LEU B  1 93  ? 16.941  -0.581  -40.354 1.00 31.55  ? 88  LEU B O   1 
ATOM   1707 C  CB  . LEU B  1 93  ? 15.995  1.671   -38.677 1.00 30.71  ? 88  LEU B CB  1 
ATOM   1708 C  CG  . LEU B  1 93  ? 15.955  3.073   -38.072 1.00 31.60  ? 88  LEU B CG  1 
ATOM   1709 C  CD1 . LEU B  1 93  ? 15.441  3.025   -36.652 1.00 29.14  ? 88  LEU B CD1 1 
ATOM   1710 C  CD2 . LEU B  1 93  ? 17.336  3.706   -38.129 1.00 32.22  ? 88  LEU B CD2 1 
ATOM   1711 N  N   . ARG B  1 94  ? 15.276  0.084   -41.720 1.00 33.76  ? 89  ARG B N   1 
ATOM   1712 C  CA  . ARG B  1 94  ? 15.219  -1.169  -42.464 1.00 42.85  ? 89  ARG B CA  1 
ATOM   1713 C  C   . ARG B  1 94  ? 16.564  -1.419  -43.144 1.00 41.13  ? 89  ARG B C   1 
ATOM   1714 O  O   . ARG B  1 94  ? 17.012  -2.561  -43.250 1.00 38.59  ? 89  ARG B O   1 
ATOM   1715 C  CB  . ARG B  1 94  ? 14.077  -1.149  -43.495 1.00 48.83  ? 89  ARG B CB  1 
ATOM   1716 C  CG  . ARG B  1 94  ? 14.490  -0.819  -44.931 1.00 55.32  ? 89  ARG B CG  1 
ATOM   1717 C  CD  . ARG B  1 94  ? 13.326  -0.950  -45.905 1.00 61.20  ? 89  ARG B CD  1 
ATOM   1718 N  NE  . ARG B  1 94  ? 12.421  0.195   -45.855 1.00 64.27  ? 89  ARG B NE  1 
ATOM   1719 C  CZ  . ARG B  1 94  ? 12.387  1.162   -46.766 1.00 66.92  ? 89  ARG B CZ  1 
ATOM   1720 N  NH1 . ARG B  1 94  ? 13.204  1.125   -47.810 1.00 68.44  ? 89  ARG B NH1 1 
ATOM   1721 N  NH2 . ARG B  1 94  ? 11.529  2.165   -46.638 1.00 66.92  ? 89  ARG B NH2 1 
ATOM   1722 N  N   . GLU B  1 95  ? 17.210  -0.336  -43.576 1.00 38.48  ? 90  GLU B N   1 
ATOM   1723 C  CA  . GLU B  1 95  ? 18.509  -0.404  -44.232 1.00 41.68  ? 90  GLU B CA  1 
ATOM   1724 C  C   . GLU B  1 95  ? 19.541  -1.032  -43.315 1.00 35.43  ? 90  GLU B C   1 
ATOM   1725 O  O   . GLU B  1 95  ? 20.394  -1.799  -43.758 1.00 37.53  ? 90  GLU B O   1 
ATOM   1726 C  CB  . GLU B  1 95  ? 18.985  0.995   -44.621 1.00 45.51  ? 90  GLU B CB  1 
ATOM   1727 C  CG  . GLU B  1 95  ? 18.932  1.290   -46.106 1.00 58.50  ? 90  GLU B CG  1 
ATOM   1728 C  CD  . GLU B  1 95  ? 17.591  1.839   -46.540 1.00 68.30  ? 90  GLU B CD  1 
ATOM   1729 O  OE1 . GLU B  1 95  ? 16.653  1.037   -46.732 1.00 74.99  ? 90  GLU B OE1 1 
ATOM   1730 O  OE2 . GLU B  1 95  ? 17.476  3.074   -46.686 1.00 67.97  ? 90  GLU B OE2 1 
ATOM   1731 N  N   . VAL B  1 96  ? 19.461  -0.695  -42.033 1.00 29.02  ? 91  VAL B N   1 
ATOM   1732 C  CA  . VAL B  1 96  ? 20.417  -1.195  -41.059 1.00 33.00  ? 91  VAL B CA  1 
ATOM   1733 C  C   . VAL B  1 96  ? 20.328  -2.715  -40.967 1.00 31.61  ? 91  VAL B C   1 
ATOM   1734 O  O   . VAL B  1 96  ? 21.328  -3.384  -40.723 1.00 35.95  ? 91  VAL B O   1 
ATOM   1735 C  CB  . VAL B  1 96  ? 20.196  -0.559  -39.672 1.00 33.61  ? 91  VAL B CB  1 
ATOM   1736 C  CG1 . VAL B  1 96  ? 21.391  -0.834  -38.766 1.00 35.70  ? 91  VAL B CG1 1 
ATOM   1737 C  CG2 . VAL B  1 96  ? 19.969  0.941   -39.814 1.00 30.17  ? 91  VAL B CG2 1 
ATOM   1738 N  N   . LEU B  1 97  ? 19.134  -3.256  -41.194 1.00 30.58  ? 92  LEU B N   1 
ATOM   1739 C  CA  . LEU B  1 97  ? 18.926  -4.702  -41.143 1.00 34.29  ? 92  LEU B CA  1 
ATOM   1740 C  C   . LEU B  1 97  ? 19.018  -5.370  -42.515 1.00 33.98  ? 92  LEU B C   1 
ATOM   1741 O  O   . LEU B  1 97  ? 18.540  -6.489  -42.700 1.00 34.21  ? 92  LEU B O   1 
ATOM   1742 C  CB  . LEU B  1 97  ? 17.580  -5.027  -40.493 1.00 38.81  ? 92  LEU B CB  1 
ATOM   1743 C  CG  . LEU B  1 97  ? 17.477  -4.663  -39.013 1.00 39.69  ? 92  LEU B CG  1 
ATOM   1744 C  CD1 . LEU B  1 97  ? 16.115  -5.035  -38.460 1.00 47.71  ? 92  LEU B CD1 1 
ATOM   1745 C  CD2 . LEU B  1 97  ? 18.579  -5.354  -38.233 1.00 30.17  ? 92  LEU B CD2 1 
ATOM   1746 N  N   . ALA B  1 98  ? 19.638  -4.687  -43.470 1.00 36.28  ? 93  ALA B N   1 
ATOM   1747 C  CA  . ALA B  1 98  ? 19.784  -5.237  -44.813 1.00 40.22  ? 93  ALA B CA  1 
ATOM   1748 C  C   . ALA B  1 98  ? 20.943  -6.231  -44.909 1.00 41.01  ? 93  ALA B C   1 
ATOM   1749 O  O   . ALA B  1 98  ? 20.860  -7.213  -45.646 1.00 49.17  ? 93  ALA B O   1 
ATOM   1750 C  CB  . ALA B  1 98  ? 19.953  -4.120  -45.835 1.00 34.30  ? 93  ALA B CB  1 
ATOM   1751 N  N   . THR B  1 99  ? 22.020  -5.972  -44.169 1.00 31.32  ? 94  THR B N   1 
ATOM   1752 C  CA  . THR B  1 99  ? 23.235  -6.789  -44.243 1.00 34.43  ? 94  THR B CA  1 
ATOM   1753 C  C   . THR B  1 99  ? 23.706  -7.192  -42.836 1.00 32.07  ? 94  THR B C   1 
ATOM   1754 O  O   . THR B  1 99  ? 23.295  -6.573  -41.852 1.00 30.14  ? 94  THR B O   1 
ATOM   1755 C  CB  . THR B  1 99  ? 24.372  -6.036  -44.988 1.00 51.41  ? 94  THR B CB  1 
ATOM   1756 O  OG1 . THR B  1 99  ? 24.902  -5.000  -44.152 1.00 41.88  ? 94  THR B OG1 1 
ATOM   1757 C  CG2 . THR B  1 99  ? 23.865  -5.433  -46.294 1.00 56.97  ? 94  THR B CG2 1 
ATOM   1758 N  N   . PRO B  1 100 ? 24.565  -8.230  -42.732 1.00 34.10  ? 95  PRO B N   1 
ATOM   1759 C  CA  . PRO B  1 100 ? 25.072  -8.661  -41.419 1.00 33.95  ? 95  PRO B CA  1 
ATOM   1760 C  C   . PRO B  1 100 ? 25.926  -7.618  -40.706 1.00 31.10  ? 95  PRO B C   1 
ATOM   1761 O  O   . PRO B  1 100 ? 26.206  -7.777  -39.517 1.00 41.31  ? 95  PRO B O   1 
ATOM   1762 C  CB  . PRO B  1 100 ? 25.940  -9.881  -41.754 1.00 36.99  ? 95  PRO B CB  1 
ATOM   1763 C  CG  . PRO B  1 100 ? 25.411  -10.381 -43.026 1.00 39.47  ? 95  PRO B CG  1 
ATOM   1764 C  CD  . PRO B  1 100 ? 24.956  -9.174  -43.794 1.00 37.34  ? 95  PRO B CD  1 
ATOM   1765 N  N   . SER B  1 101 ? 26.343  -6.577  -41.416 1.00 29.62  ? 96  SER B N   1 
ATOM   1766 C  CA  . SER B  1 101 ? 27.104  -5.508  -40.785 1.00 28.49  ? 96  SER B CA  1 
ATOM   1767 C  C   . SER B  1 101 ? 26.227  -4.811  -39.751 1.00 28.99  ? 96  SER B C   1 
ATOM   1768 O  O   . SER B  1 101 ? 26.726  -4.281  -38.763 1.00 25.05  ? 96  SER B O   1 
ATOM   1769 C  CB  . SER B  1 101 ? 27.616  -4.504  -41.822 1.00 28.86  ? 96  SER B CB  1 
ATOM   1770 O  OG  . SER B  1 101 ? 26.561  -3.708  -42.331 1.00 35.21  ? 96  SER B OG  1 
ATOM   1771 N  N   . LEU B  1 102 ? 24.916  -4.848  -39.979 1.00 25.49  ? 97  LEU B N   1 
ATOM   1772 C  CA  . LEU B  1 102 ? 23.945  -4.189  -39.107 1.00 27.91  ? 97  LEU B CA  1 
ATOM   1773 C  C   . LEU B  1 102 ? 24.272  -2.710  -38.978 1.00 33.61  ? 97  LEU B C   1 
ATOM   1774 O  O   . LEU B  1 102 ? 24.291  -2.158  -37.879 1.00 32.57  ? 97  LEU B O   1 
ATOM   1775 C  CB  . LEU B  1 102 ? 23.890  -4.856  -37.728 1.00 26.83  ? 97  LEU B CB  1 
ATOM   1776 C  CG  . LEU B  1 102 ? 23.464  -6.326  -37.717 1.00 29.56  ? 97  LEU B CG  1 
ATOM   1777 C  CD1 . LEU B  1 102 ? 23.458  -6.868  -36.298 1.00 31.74  ? 97  LEU B CD1 1 
ATOM   1778 C  CD2 . LEU B  1 102 ? 22.098  -6.490  -38.364 1.00 32.32  ? 97  LEU B CD2 1 
ATOM   1779 N  N   . SER B  1 103 ? 24.537  -2.081  -40.116 1.00 32.29  ? 98  SER B N   1 
ATOM   1780 C  CA  . SER B  1 103 ? 24.887  -0.672  -40.149 1.00 29.11  ? 98  SER B CA  1 
ATOM   1781 C  C   . SER B  1 103 ? 24.588  -0.087  -41.516 1.00 29.99  ? 98  SER B C   1 
ATOM   1782 O  O   . SER B  1 103 ? 24.585  -0.797  -42.521 1.00 26.13  ? 98  SER B O   1 
ATOM   1783 C  CB  . SER B  1 103 ? 26.368  -0.485  -39.841 1.00 22.95  ? 98  SER B CB  1 
ATOM   1784 O  OG  . SER B  1 103 ? 27.163  -1.015  -40.887 1.00 23.69  ? 98  SER B OG  1 
ATOM   1785 N  N   . ALA B  1 104 ? 24.343  1.217   -41.545 1.00 27.60  ? 99  ALA B N   1 
ATOM   1786 C  CA  . ALA B  1 104 ? 24.108  1.924   -42.792 1.00 23.77  ? 99  ALA B CA  1 
ATOM   1787 C  C   . ALA B  1 104 ? 24.399  3.401   -42.594 1.00 20.42  ? 99  ALA B C   1 
ATOM   1788 O  O   . ALA B  1 104 ? 24.336  3.911   -41.478 1.00 23.32  ? 99  ALA B O   1 
ATOM   1789 C  CB  . ALA B  1 104 ? 22.675  1.730   -43.245 1.00 24.17  ? 99  ALA B CB  1 
ATOM   1790 N  N   . SER B  1 105 ? 24.712  4.086   -43.683 1.00 20.21  ? 100 SER B N   1 
ATOM   1791 C  CA  . SER B  1 105 ? 24.900  5.524   -43.639 1.00 26.85  ? 100 SER B CA  1 
ATOM   1792 C  C   . SER B  1 105 ? 23.816  6.178   -44.469 1.00 23.23  ? 100 SER B C   1 
ATOM   1793 O  O   . SER B  1 105 ? 23.308  5.583   -45.418 1.00 18.63  ? 100 SER B O   1 
ATOM   1794 C  CB  . SER B  1 105 ? 26.263  5.898   -44.202 1.00 26.13  ? 100 SER B CB  1 
ATOM   1795 O  OG  . SER B  1 105 ? 26.344  5.517   -45.562 1.00 34.85  ? 100 SER B OG  1 
ATOM   1796 N  N   . PHE B  1 106 ? 23.462  7.405   -44.111 1.00 18.72  ? 101 PHE B N   1 
ATOM   1797 C  CA  . PHE B  1 106 ? 22.437  8.136   -44.838 1.00 19.21  ? 101 PHE B CA  1 
ATOM   1798 C  C   . PHE B  1 106 ? 22.910  9.545   -45.157 1.00 20.74  ? 101 PHE B C   1 
ATOM   1799 O  O   . PHE B  1 106 ? 23.477  10.229  -44.306 1.00 19.91  ? 101 PHE B O   1 
ATOM   1800 C  CB  . PHE B  1 106 ? 21.143  8.199   -44.022 1.00 20.26  ? 101 PHE B CB  1 
ATOM   1801 C  CG  . PHE B  1 106 ? 20.598  6.851   -43.643 1.00 26.19  ? 101 PHE B CG  1 
ATOM   1802 C  CD1 . PHE B  1 106 ? 21.004  6.227   -42.474 1.00 26.49  ? 101 PHE B CD1 1 
ATOM   1803 C  CD2 . PHE B  1 106 ? 19.678  6.207   -44.455 1.00 25.50  ? 101 PHE B CD2 1 
ATOM   1804 C  CE1 . PHE B  1 106 ? 20.504  4.985   -42.122 1.00 25.39  ? 101 PHE B CE1 1 
ATOM   1805 C  CE2 . PHE B  1 106 ? 19.174  4.965   -44.108 1.00 26.96  ? 101 PHE B CE2 1 
ATOM   1806 C  CZ  . PHE B  1 106 ? 19.588  4.354   -42.940 1.00 25.93  ? 101 PHE B CZ  1 
ATOM   1807 N  N   . ASN B  1 107 ? 22.694  9.957   -46.399 1.00 16.87  ? 102 ASN B N   1 
ATOM   1808 C  CA  . ASN B  1 107 ? 22.824  11.351  -46.783 1.00 20.23  ? 102 ASN B CA  1 
ATOM   1809 C  C   . ASN B  1 107 ? 21.428  11.830  -47.160 1.00 23.68  ? 102 ASN B C   1 
ATOM   1810 O  O   . ASN B  1 107 ? 20.990  11.671  -48.298 1.00 26.13  ? 102 ASN B O   1 
ATOM   1811 C  CB  . ASN B  1 107 ? 23.791  11.507  -47.956 1.00 22.43  ? 102 ASN B CB  1 
ATOM   1812 C  CG  . ASN B  1 107 ? 24.273  12.934  -48.128 1.00 24.63  ? 102 ASN B CG  1 
ATOM   1813 O  OD1 . ASN B  1 107 ? 23.655  13.873  -47.628 1.00 25.71  ? 102 ASN B OD1 1 
ATOM   1814 N  ND2 . ASN B  1 107 ? 25.384  13.103  -48.834 1.00 26.59  ? 102 ASN B ND2 1 
ATOM   1815 N  N   . ALA B  1 108 ? 20.722  12.394  -46.188 1.00 22.91  ? 103 ALA B N   1 
ATOM   1816 C  CA  . ALA B  1 108 ? 19.297  12.644  -46.341 1.00 30.14  ? 103 ALA B CA  1 
ATOM   1817 C  C   . ALA B  1 108 ? 18.978  14.101  -46.645 1.00 27.38  ? 103 ALA B C   1 
ATOM   1818 O  O   . ALA B  1 108 ? 19.435  15.001  -45.940 1.00 21.66  ? 103 ALA B O   1 
ATOM   1819 C  CB  . ALA B  1 108 ? 18.546  12.182  -45.091 1.00 23.77  ? 103 ALA B CB  1 
ATOM   1820 N  N   . PRO B  1 109 ? 18.186  14.337  -47.701 1.00 21.86  ? 104 PRO B N   1 
ATOM   1821 C  CA  . PRO B  1 109 ? 17.705  15.691  -47.986 1.00 23.79  ? 104 PRO B CA  1 
ATOM   1822 C  C   . PRO B  1 109 ? 16.739  16.141  -46.899 1.00 26.13  ? 104 PRO B C   1 
ATOM   1823 O  O   . PRO B  1 109 ? 15.882  15.366  -46.471 1.00 23.94  ? 104 PRO B O   1 
ATOM   1824 C  CB  . PRO B  1 109 ? 16.962  15.525  -49.313 1.00 20.80  ? 104 PRO B CB  1 
ATOM   1825 C  CG  . PRO B  1 109 ? 16.561  14.102  -49.346 1.00 21.94  ? 104 PRO B CG  1 
ATOM   1826 C  CD  . PRO B  1 109 ? 17.655  13.350  -48.656 1.00 22.19  ? 104 PRO B CD  1 
ATOM   1827 N  N   . LEU B  1 110 ? 16.882  17.381  -46.450 1.00 25.91  ? 105 LEU B N   1 
ATOM   1828 C  CA  . LEU B  1 110 ? 16.013  17.898  -45.403 1.00 25.35  ? 105 LEU B CA  1 
ATOM   1829 C  C   . LEU B  1 110 ? 14.773  18.563  -45.995 1.00 27.24  ? 105 LEU B C   1 
ATOM   1830 O  O   . LEU B  1 110 ? 14.856  19.299  -46.976 1.00 27.41  ? 105 LEU B O   1 
ATOM   1831 C  CB  . LEU B  1 110 ? 16.782  18.867  -44.503 1.00 24.81  ? 105 LEU B CB  1 
ATOM   1832 C  CG  . LEU B  1 110 ? 17.945  18.235  -43.733 1.00 23.51  ? 105 LEU B CG  1 
ATOM   1833 C  CD1 . LEU B  1 110 ? 18.774  19.292  -43.018 1.00 19.49  ? 105 LEU B CD1 1 
ATOM   1834 C  CD2 . LEU B  1 110 ? 17.427  17.190  -42.749 1.00 17.34  ? 105 LEU B CD2 1 
ATOM   1835 N  N   . LEU B  1 111 ? 13.621  18.287  -45.394 1.00 31.09  ? 106 LEU B N   1 
ATOM   1836 C  CA  . LEU B  1 111 ? 12.359  18.848  -45.856 1.00 31.17  ? 106 LEU B CA  1 
ATOM   1837 C  C   . LEU B  1 111 ? 11.853  19.875  -44.849 1.00 36.48  ? 106 LEU B C   1 
ATOM   1838 O  O   . LEU B  1 111 ? 12.034  19.705  -43.643 1.00 37.42  ? 106 LEU B O   1 
ATOM   1839 C  CB  . LEU B  1 111 ? 11.326  17.735  -46.033 1.00 31.24  ? 106 LEU B CB  1 
ATOM   1840 C  CG  . LEU B  1 111 ? 11.755  16.543  -46.894 1.00 36.39  ? 106 LEU B CG  1 
ATOM   1841 C  CD1 . LEU B  1 111 ? 10.673  15.473  -46.913 1.00 36.45  ? 106 LEU B CD1 1 
ATOM   1842 C  CD2 . LEU B  1 111 ? 12.095  16.985  -48.310 1.00 36.55  ? 106 LEU B CD2 1 
ATOM   1843 N  N   . ASP B  1 112 ? 11.222  20.941  -45.335 1.00 33.05  ? 107 ASP B N   1 
ATOM   1844 C  CA  . ASP B  1 112 ? 10.691  21.960  -44.431 1.00 33.32  ? 107 ASP B CA  1 
ATOM   1845 C  C   . ASP B  1 112 ? 9.387   21.525  -43.763 1.00 36.17  ? 107 ASP B C   1 
ATOM   1846 O  O   . ASP B  1 112 ? 8.952   20.381  -43.910 1.00 33.56  ? 107 ASP B O   1 
ATOM   1847 C  CB  . ASP B  1 112 ? 10.536  23.328  -45.125 1.00 43.25  ? 107 ASP B CB  1 
ATOM   1848 C  CG  . ASP B  1 112 ? 9.507   23.323  -46.257 1.00 44.95  ? 107 ASP B CG  1 
ATOM   1849 O  OD1 . ASP B  1 112 ? 8.625   22.441  -46.297 1.00 43.11  ? 107 ASP B OD1 1 
ATOM   1850 O  OD2 . ASP B  1 112 ? 9.578   24.230  -47.114 1.00 40.47  ? 107 ASP B OD2 1 
ATOM   1851 N  N   . THR B  1 113 ? 8.769   22.451  -43.036 1.00 34.90  ? 108 THR B N   1 
ATOM   1852 C  CA  . THR B  1 113 ? 7.515   22.186  -42.341 1.00 48.27  ? 108 THR B CA  1 
ATOM   1853 C  C   . THR B  1 113 ? 6.420   21.750  -43.312 1.00 53.56  ? 108 THR B C   1 
ATOM   1854 O  O   . THR B  1 113 ? 5.575   20.921  -42.977 1.00 58.90  ? 108 THR B O   1 
ATOM   1855 C  CB  . THR B  1 113 ? 7.026   23.430  -41.580 1.00 46.63  ? 108 THR B CB  1 
ATOM   1856 O  OG1 . THR B  1 113 ? 6.633   24.439  -42.518 1.00 51.47  ? 108 THR B OG1 1 
ATOM   1857 C  CG2 . THR B  1 113 ? 8.126   23.976  -40.687 1.00 46.30  ? 108 THR B CG2 1 
ATOM   1858 N  N   . LYS B  1 114 ? 6.447   22.313  -44.517 1.00 48.14  ? 109 LYS B N   1 
ATOM   1859 C  CA  . LYS B  1 114 ? 5.466   21.992  -45.548 1.00 50.38  ? 109 LYS B CA  1 
ATOM   1860 C  C   . LYS B  1 114 ? 5.914   20.772  -46.345 1.00 45.25  ? 109 LYS B C   1 
ATOM   1861 O  O   . LYS B  1 114 ? 5.298   20.418  -47.349 1.00 48.22  ? 109 LYS B O   1 
ATOM   1862 C  CB  . LYS B  1 114 ? 5.290   23.180  -46.494 1.00 52.80  ? 109 LYS B CB  1 
ATOM   1863 C  CG  . LYS B  1 114 ? 5.516   24.537  -45.842 1.00 58.57  ? 109 LYS B CG  1 
ATOM   1864 C  CD  . LYS B  1 114 ? 4.221   25.147  -45.340 1.00 62.15  ? 109 LYS B CD  1 
ATOM   1865 C  CE  . LYS B  1 114 ? 4.466   26.497  -44.690 1.00 66.36  ? 109 LYS B CE  1 
ATOM   1866 N  NZ  . LYS B  1 114 ? 3.206   27.277  -44.550 1.00 71.54  ? 109 LYS B NZ  1 
ATOM   1867 N  N   . LYS B  1 115 ? 6.999   20.148  -45.892 1.00 41.69  ? 110 LYS B N   1 
ATOM   1868 C  CA  . LYS B  1 115 ? 7.589   18.972  -46.536 1.00 48.59  ? 110 LYS B CA  1 
ATOM   1869 C  C   . LYS B  1 115 ? 8.130   19.240  -47.940 1.00 43.87  ? 110 LYS B C   1 
ATOM   1870 O  O   . LYS B  1 115 ? 8.210   18.334  -48.768 1.00 40.57  ? 110 LYS B O   1 
ATOM   1871 C  CB  . LYS B  1 115 ? 6.620   17.785  -46.531 1.00 58.09  ? 110 LYS B CB  1 
ATOM   1872 C  CG  . LYS B  1 115 ? 6.082   17.474  -45.151 1.00 61.30  ? 110 LYS B CG  1 
ATOM   1873 C  CD  . LYS B  1 115 ? 5.731   16.012  -44.987 1.00 66.00  ? 110 LYS B CD  1 
ATOM   1874 C  CE  . LYS B  1 115 ? 6.181   15.528  -43.621 1.00 68.09  ? 110 LYS B CE  1 
ATOM   1875 N  NZ  . LYS B  1 115 ? 5.992   16.591  -42.593 1.00 69.50  ? 110 LYS B NZ  1 
ATOM   1876 N  N   . GLN B  1 116 ? 8.503   20.489  -48.195 1.00 37.66  ? 111 GLN B N   1 
ATOM   1877 C  CA  . GLN B  1 116 ? 9.194   20.843  -49.426 1.00 44.66  ? 111 GLN B CA  1 
ATOM   1878 C  C   . GLN B  1 116 ? 10.692  20.778  -49.162 1.00 43.73  ? 111 GLN B C   1 
ATOM   1879 O  O   . GLN B  1 116 ? 11.142  21.141  -48.076 1.00 45.44  ? 111 GLN B O   1 
ATOM   1880 C  CB  . GLN B  1 116 ? 8.822   22.259  -49.862 1.00 51.32  ? 111 GLN B CB  1 
ATOM   1881 C  CG  . GLN B  1 116 ? 7.372   22.638  -49.630 1.00 64.04  ? 111 GLN B CG  1 
ATOM   1882 C  CD  . GLN B  1 116 ? 7.113   24.100  -49.926 1.00 73.40  ? 111 GLN B CD  1 
ATOM   1883 O  OE1 . GLN B  1 116 ? 6.366   24.770  -49.212 1.00 79.31  ? 111 GLN B OE1 1 
ATOM   1884 N  NE2 . GLN B  1 116 ? 7.734   24.606  -50.985 1.00 72.83  ? 111 GLN B NE2 1 
ATOM   1885 N  N   . PRO B  1 117 ? 11.469  20.309  -50.150 1.00 41.81  ? 112 PRO B N   1 
ATOM   1886 C  CA  . PRO B  1 117 ? 12.931  20.250  -50.036 1.00 38.80  ? 112 PRO B CA  1 
ATOM   1887 C  C   . PRO B  1 117 ? 13.529  21.618  -49.729 1.00 34.68  ? 112 PRO B C   1 
ATOM   1888 O  O   . PRO B  1 117 ? 13.125  22.613  -50.330 1.00 35.63  ? 112 PRO B O   1 
ATOM   1889 C  CB  . PRO B  1 117 ? 13.367  19.793  -51.428 1.00 45.09  ? 112 PRO B CB  1 
ATOM   1890 C  CG  . PRO B  1 117 ? 12.212  19.020  -51.941 1.00 49.57  ? 112 PRO B CG  1 
ATOM   1891 C  CD  . PRO B  1 117 ? 10.992  19.716  -51.411 1.00 48.15  ? 112 PRO B CD  1 
ATOM   1892 N  N   . THR B  1 118 ? 14.480  21.660  -48.801 1.00 32.40  ? 113 THR B N   1 
ATOM   1893 C  CA  . THR B  1 118 ? 15.092  22.917  -48.385 1.00 37.39  ? 113 THR B CA  1 
ATOM   1894 C  C   . THR B  1 118 ? 16.410  23.176  -49.109 1.00 34.46  ? 113 THR B C   1 
ATOM   1895 O  O   . THR B  1 118 ? 16.914  24.298  -49.111 1.00 37.44  ? 113 THR B O   1 
ATOM   1896 C  CB  . THR B  1 118 ? 15.367  22.929  -46.872 1.00 37.58  ? 113 THR B CB  1 
ATOM   1897 O  OG1 . THR B  1 118 ? 16.254  21.852  -46.545 1.00 35.12  ? 113 THR B OG1 1 
ATOM   1898 C  CG2 . THR B  1 118 ? 14.073  22.772  -46.088 1.00 35.40  ? 113 THR B CG2 1 
ATOM   1899 N  N   . GLY B  1 119 ? 16.967  22.136  -49.719 1.00 30.90  ? 114 GLY B N   1 
ATOM   1900 C  CA  . GLY B  1 119 ? 18.267  22.239  -50.359 1.00 28.89  ? 114 GLY B CA  1 
ATOM   1901 C  C   . GLY B  1 119 ? 19.369  21.799  -49.411 1.00 27.46  ? 114 GLY B C   1 
ATOM   1902 O  O   . GLY B  1 119 ? 20.505  21.554  -49.821 1.00 30.42  ? 114 GLY B O   1 
ATOM   1903 N  N   . ALA B  1 120 ? 19.024  21.696  -48.133 1.00 21.93  ? 115 ALA B N   1 
ATOM   1904 C  CA  . ALA B  1 120 ? 19.963  21.247  -47.114 1.00 24.53  ? 115 ALA B CA  1 
ATOM   1905 C  C   . ALA B  1 120 ? 19.926  19.730  -46.972 1.00 22.60  ? 115 ALA B C   1 
ATOM   1906 O  O   . ALA B  1 120 ? 18.873  19.108  -47.122 1.00 26.63  ? 115 ALA B O   1 
ATOM   1907 C  CB  . ALA B  1 120 ? 19.653  21.915  -45.775 1.00 29.38  ? 115 ALA B CB  1 
ATOM   1908 N  N   . SER B  1 121 ? 21.077  19.135  -46.677 1.00 20.55  ? 116 SER B N   1 
ATOM   1909 C  CA  . SER B  1 121 ? 21.159  17.691  -46.478 1.00 24.69  ? 116 SER B CA  1 
ATOM   1910 C  C   . SER B  1 121 ? 21.857  17.351  -45.167 1.00 21.96  ? 116 SER B C   1 
ATOM   1911 O  O   . SER B  1 121 ? 22.649  18.141  -44.659 1.00 21.67  ? 116 SER B O   1 
ATOM   1912 C  CB  . SER B  1 121 ? 21.879  17.019  -47.650 1.00 30.48  ? 116 SER B CB  1 
ATOM   1913 O  OG  . SER B  1 121 ? 23.147  17.609  -47.875 1.00 34.61  ? 116 SER B OG  1 
ATOM   1914 N  N   . LEU B  1 122 ? 21.556  16.174  -44.624 1.00 21.34  ? 117 LEU B N   1 
ATOM   1915 C  CA  . LEU B  1 122 ? 22.156  15.731  -43.366 1.00 24.19  ? 117 LEU B CA  1 
ATOM   1916 C  C   . LEU B  1 122 ? 22.836  14.373  -43.512 1.00 18.77  ? 117 LEU B C   1 
ATOM   1917 O  O   . LEU B  1 122 ? 22.259  13.430  -44.055 1.00 19.50  ? 117 LEU B O   1 
ATOM   1918 C  CB  . LEU B  1 122 ? 21.105  15.666  -42.256 1.00 25.96  ? 117 LEU B CB  1 
ATOM   1919 C  CG  . LEU B  1 122 ? 21.609  15.118  -40.918 1.00 30.17  ? 117 LEU B CG  1 
ATOM   1920 C  CD1 . LEU B  1 122 ? 22.456  16.154  -40.185 1.00 30.00  ? 117 LEU B CD1 1 
ATOM   1921 C  CD2 . LEU B  1 122 ? 20.463  14.640  -40.049 1.00 35.46  ? 117 LEU B CD2 1 
ATOM   1922 N  N   . VAL B  1 123 ? 24.066  14.277  -43.025 1.00 18.18  ? 118 VAL B N   1 
ATOM   1923 C  CA  . VAL B  1 123 ? 24.812  13.030  -43.112 1.00 16.64  ? 118 VAL B CA  1 
ATOM   1924 C  C   . VAL B  1 123 ? 24.934  12.369  -41.749 1.00 18.84  ? 118 VAL B C   1 
ATOM   1925 O  O   . VAL B  1 123 ? 25.351  12.999  -40.774 1.00 18.19  ? 118 VAL B O   1 
ATOM   1926 C  CB  . VAL B  1 123 ? 26.214  13.251  -43.708 1.00 20.70  ? 118 VAL B CB  1 
ATOM   1927 C  CG1 . VAL B  1 123 ? 26.990  11.941  -43.730 1.00 20.25  ? 118 VAL B CG1 1 
ATOM   1928 C  CG2 . VAL B  1 123 ? 26.101  13.836  -45.109 1.00 21.54  ? 118 VAL B CG2 1 
ATOM   1929 N  N   . LEU B  1 124 ? 24.560  11.096  -41.684 1.00 12.84  ? 119 LEU B N   1 
ATOM   1930 C  CA  . LEU B  1 124 ? 24.652  10.342  -40.443 1.00 17.26  ? 119 LEU B CA  1 
ATOM   1931 C  C   . LEU B  1 124 ? 24.946  8.868   -40.698 1.00 15.57  ? 119 LEU B C   1 
ATOM   1932 O  O   . LEU B  1 124 ? 24.755  8.368   -41.803 1.00 17.65  ? 119 LEU B O   1 
ATOM   1933 C  CB  . LEU B  1 124 ? 23.371  10.487  -39.620 1.00 23.77  ? 119 LEU B CB  1 
ATOM   1934 C  CG  . LEU B  1 124 ? 22.078  9.923   -40.206 1.00 26.64  ? 119 LEU B CG  1 
ATOM   1935 C  CD1 . LEU B  1 124 ? 21.168  9.474   -39.084 1.00 29.18  ? 119 LEU B CD1 1 
ATOM   1936 C  CD2 . LEU B  1 124 ? 21.382  10.963  -41.067 1.00 28.13  ? 119 LEU B CD2 1 
ATOM   1937 N  N   . GLN B  1 125 ? 25.420  8.184   -39.664 1.00 18.16  ? 120 GLN B N   1 
ATOM   1938 C  CA  . GLN B  1 125 ? 25.717  6.761   -39.748 1.00 18.50  ? 120 GLN B CA  1 
ATOM   1939 C  C   . GLN B  1 125 ? 25.055  6.067   -38.564 1.00 19.31  ? 120 GLN B C   1 
ATOM   1940 O  O   . GLN B  1 125 ? 25.042  6.597   -37.456 1.00 22.14  ? 120 GLN B O   1 
ATOM   1941 C  CB  . GLN B  1 125 ? 27.231  6.524   -39.756 1.00 13.95  ? 120 GLN B CB  1 
ATOM   1942 C  CG  . GLN B  1 125 ? 27.647  5.117   -40.164 1.00 20.94  ? 120 GLN B CG  1 
ATOM   1943 C  CD  . GLN B  1 125 ? 27.750  4.169   -38.985 1.00 18.92  ? 120 GLN B CD  1 
ATOM   1944 O  OE1 . GLN B  1 125 ? 27.614  4.577   -37.832 1.00 21.87  ? 120 GLN B OE1 1 
ATOM   1945 N  NE2 . GLN B  1 125 ? 27.999  2.897   -39.268 1.00 24.55  ? 120 GLN B NE2 1 
ATOM   1946 N  N   . VAL B  1 126 ? 24.499  4.885   -38.805 1.00 19.32  ? 121 VAL B N   1 
ATOM   1947 C  CA  . VAL B  1 126 ? 23.660  4.209   -37.821 1.00 23.01  ? 121 VAL B CA  1 
ATOM   1948 C  C   . VAL B  1 126 ? 24.014  2.726   -37.746 1.00 16.95  ? 121 VAL B C   1 
ATOM   1949 O  O   . VAL B  1 126 ? 24.235  2.092   -38.776 1.00 16.81  ? 121 VAL B O   1 
ATOM   1950 C  CB  . VAL B  1 126 ? 22.170  4.329   -38.213 1.00 23.63  ? 121 VAL B CB  1 
ATOM   1951 C  CG1 . VAL B  1 126 ? 21.281  3.605   -37.214 1.00 21.18  ? 121 VAL B CG1 1 
ATOM   1952 C  CG2 . VAL B  1 126 ? 21.761  5.791   -38.343 1.00 24.05  ? 121 VAL B CG2 1 
ATOM   1953 N  N   . SER B  1 127 ? 24.064  2.173   -36.537 1.00 21.51  ? 122 SER B N   1 
ATOM   1954 C  CA  . SER B  1 127 ? 24.368  0.750   -36.370 1.00 19.63  ? 122 SER B CA  1 
ATOM   1955 C  C   . SER B  1 127 ? 23.768  0.136   -35.107 1.00 25.05  ? 122 SER B C   1 
ATOM   1956 O  O   . SER B  1 127 ? 23.517  0.827   -34.120 1.00 28.43  ? 122 SER B O   1 
ATOM   1957 C  CB  . SER B  1 127 ? 25.882  0.521   -36.369 1.00 22.38  ? 122 SER B CB  1 
ATOM   1958 O  OG  . SER B  1 127 ? 26.490  1.137   -35.247 1.00 24.04  ? 122 SER B OG  1 
ATOM   1959 N  N   . TYR B  1 128 ? 23.539  -1.172  -35.152 1.00 24.82  ? 123 TYR B N   1 
ATOM   1960 C  CA  . TYR B  1 128 ? 23.193  -1.922  -33.955 1.00 31.38  ? 123 TYR B CA  1 
ATOM   1961 C  C   . TYR B  1 128 ? 24.473  -2.517  -33.399 1.00 36.84  ? 123 TYR B C   1 
ATOM   1962 O  O   . TYR B  1 128 ? 25.219  -3.180  -34.119 1.00 42.23  ? 123 TYR B O   1 
ATOM   1963 C  CB  . TYR B  1 128 ? 22.187  -3.028  -34.269 1.00 42.24  ? 123 TYR B CB  1 
ATOM   1964 C  CG  . TYR B  1 128 ? 20.879  -2.511  -34.814 1.00 51.78  ? 123 TYR B CG  1 
ATOM   1965 C  CD1 . TYR B  1 128 ? 20.092  -1.647  -34.068 1.00 59.89  ? 123 TYR B CD1 1 
ATOM   1966 C  CD2 . TYR B  1 128 ? 20.428  -2.886  -36.071 1.00 55.29  ? 123 TYR B CD2 1 
ATOM   1967 C  CE1 . TYR B  1 128 ? 18.895  -1.170  -34.556 1.00 63.13  ? 123 TYR B CE1 1 
ATOM   1968 C  CE2 . TYR B  1 128 ? 19.228  -2.408  -36.571 1.00 60.37  ? 123 TYR B CE2 1 
ATOM   1969 C  CZ  . TYR B  1 128 ? 18.467  -1.549  -35.809 1.00 63.41  ? 123 TYR B CZ  1 
ATOM   1970 O  OH  . TYR B  1 128 ? 17.273  -1.068  -36.294 1.00 63.17  ? 123 TYR B OH  1 
ATOM   1971 N  N   . THR B  1 129 ? 24.734  -2.271  -32.122 1.00 36.49  ? 124 THR B N   1 
ATOM   1972 C  CA  . THR B  1 129 ? 25.985  -2.710  -31.524 1.00 43.23  ? 124 THR B CA  1 
ATOM   1973 C  C   . THR B  1 129 ? 25.784  -3.304  -30.135 1.00 45.78  ? 124 THR B C   1 
ATOM   1974 O  O   . THR B  1 129 ? 24.832  -2.964  -29.428 1.00 43.33  ? 124 THR B O   1 
ATOM   1975 C  CB  . THR B  1 129 ? 27.012  -1.557  -31.461 1.00 42.79  ? 124 THR B CB  1 
ATOM   1976 O  OG1 . THR B  1 129 ? 28.308  -2.081  -31.151 1.00 43.98  ? 124 THR B OG1 1 
ATOM   1977 C  CG2 . THR B  1 129 ? 26.613  -0.525  -30.410 1.00 41.16  ? 124 THR B CG2 1 
ATOM   1978 N  N   . ALA B  1 130 ? 26.683  -4.206  -29.759 1.00 51.24  ? 125 ALA B N   1 
ATOM   1979 C  CA  . ALA B  1 130 ? 26.659  -4.801  -28.432 1.00 51.80  ? 125 ALA B CA  1 
ATOM   1980 C  C   . ALA B  1 130 ? 27.260  -3.835  -27.421 1.00 49.12  ? 125 ALA B C   1 
ATOM   1981 O  O   . ALA B  1 130 ? 26.623  -3.488  -26.428 1.00 54.40  ? 125 ALA B O   1 
ATOM   1982 C  CB  . ALA B  1 130 ? 27.418  -6.118  -28.427 1.00 49.10  ? 125 ALA B CB  1 
ATOM   1983 N  N   . PHE C  1 5   ? 4.791   -18.908 -63.910 1.00 57.87  ? 0   PHE C N   1 
ATOM   1984 C  CA  . PHE C  1 5   ? 6.115   -18.788 -63.313 1.00 54.54  ? 0   PHE C CA  1 
ATOM   1985 C  C   . PHE C  1 5   ? 6.277   -19.683 -62.103 1.00 45.99  ? 0   PHE C C   1 
ATOM   1986 O  O   . PHE C  1 5   ? 5.317   -20.281 -61.617 1.00 43.88  ? 0   PHE C O   1 
ATOM   1987 C  CB  . PHE C  1 5   ? 6.385   -17.350 -62.877 1.00 58.01  ? 0   PHE C CB  1 
ATOM   1988 C  CG  . PHE C  1 5   ? 6.622   -16.411 -64.012 1.00 64.00  ? 0   PHE C CG  1 
ATOM   1989 C  CD1 . PHE C  1 5   ? 7.868   -16.326 -64.605 1.00 64.05  ? 0   PHE C CD1 1 
ATOM   1990 C  CD2 . PHE C  1 5   ? 5.600   -15.611 -64.485 1.00 67.63  ? 0   PHE C CD2 1 
ATOM   1991 C  CE1 . PHE C  1 5   ? 8.091   -15.460 -65.653 1.00 64.80  ? 0   PHE C CE1 1 
ATOM   1992 C  CE2 . PHE C  1 5   ? 5.816   -14.745 -65.532 1.00 67.71  ? 0   PHE C CE2 1 
ATOM   1993 C  CZ  . PHE C  1 5   ? 7.063   -14.667 -66.117 1.00 66.53  ? 0   PHE C CZ  1 
ATOM   1994 N  N   . MET C  1 6   ? 7.509   -19.765 -61.620 1.00 44.13  ? 1   MET C N   1 
ATOM   1995 C  CA  . MET C  1 6   ? 7.789   -20.417 -60.354 1.00 38.71  ? 1   MET C CA  1 
ATOM   1996 C  C   . MET C  1 6   ? 8.791   -19.593 -59.561 1.00 34.68  ? 1   MET C C   1 
ATOM   1997 O  O   . MET C  1 6   ? 9.733   -19.039 -60.127 1.00 33.31  ? 1   MET C O   1 
ATOM   1998 C  CB  . MET C  1 6   ? 8.304   -21.844 -60.568 1.00 40.17  ? 1   MET C CB  1 
ATOM   1999 C  CG  . MET C  1 6   ? 7.293   -22.762 -61.251 1.00 45.73  ? 1   MET C CG  1 
ATOM   2000 S  SD  . MET C  1 6   ? 7.645   -24.516 -61.036 1.00 102.06 ? 1   MET C SD  1 
ATOM   2001 C  CE  . MET C  1 6   ? 9.240   -24.647 -61.834 1.00 65.07  ? 1   MET C CE  1 
ATOM   2002 N  N   . LEU C  1 7   ? 8.566   -19.500 -58.253 1.00 28.79  ? 2   LEU C N   1 
ATOM   2003 C  CA  . LEU C  1 7   ? 9.506   -18.836 -57.363 1.00 25.52  ? 2   LEU C CA  1 
ATOM   2004 C  C   . LEU C  1 7   ? 10.599  -19.824 -56.997 1.00 32.44  ? 2   LEU C C   1 
ATOM   2005 O  O   . LEU C  1 7   ? 10.348  -20.836 -56.345 1.00 29.71  ? 2   LEU C O   1 
ATOM   2006 C  CB  . LEU C  1 7   ? 8.808   -18.340 -56.097 1.00 30.78  ? 2   LEU C CB  1 
ATOM   2007 C  CG  . LEU C  1 7   ? 9.665   -17.482 -55.163 1.00 33.27  ? 2   LEU C CG  1 
ATOM   2008 C  CD1 . LEU C  1 7   ? 9.876   -16.098 -55.756 1.00 27.32  ? 2   LEU C CD1 1 
ATOM   2009 C  CD2 . LEU C  1 7   ? 9.045   -17.392 -53.778 1.00 33.38  ? 2   LEU C CD2 1 
ATOM   2010 N  N   . ARG C  1 8   ? 11.816  -19.529 -57.429 1.00 27.12  ? 3   ARG C N   1 
ATOM   2011 C  CA  . ARG C  1 8   ? 12.926  -20.435 -57.210 1.00 24.28  ? 3   ARG C CA  1 
ATOM   2012 C  C   . ARG C  1 8   ? 13.869  -19.853 -56.160 1.00 26.17  ? 3   ARG C C   1 
ATOM   2013 O  O   . ARG C  1 8   ? 14.326  -18.718 -56.286 1.00 25.75  ? 3   ARG C O   1 
ATOM   2014 C  CB  . ARG C  1 8   ? 13.652  -20.683 -58.530 1.00 26.37  ? 3   ARG C CB  1 
ATOM   2015 C  CG  . ARG C  1 8   ? 14.771  -21.690 -58.454 1.00 30.00  ? 3   ARG C CG  1 
ATOM   2016 C  CD  . ARG C  1 8   ? 15.922  -21.252 -59.332 1.00 30.16  ? 3   ARG C CD  1 
ATOM   2017 N  NE  . ARG C  1 8   ? 15.804  -21.694 -60.712 1.00 35.20  ? 3   ARG C NE  1 
ATOM   2018 C  CZ  . ARG C  1 8   ? 16.026  -20.913 -61.763 1.00 38.87  ? 3   ARG C CZ  1 
ATOM   2019 N  NH1 . ARG C  1 8   ? 16.372  -19.644 -61.587 1.00 39.27  ? 3   ARG C NH1 1 
ATOM   2020 N  NH2 . ARG C  1 8   ? 15.901  -21.400 -62.988 1.00 35.60  ? 3   ARG C NH2 1 
ATOM   2021 N  N   . VAL C  1 9   ? 14.137  -20.631 -55.115 1.00 23.33  ? 4   VAL C N   1 
ATOM   2022 C  CA  . VAL C  1 9   ? 14.956  -20.168 -53.999 1.00 20.09  ? 4   VAL C CA  1 
ATOM   2023 C  C   . VAL C  1 9   ? 16.109  -21.126 -53.718 1.00 22.96  ? 4   VAL C C   1 
ATOM   2024 O  O   . VAL C  1 9   ? 15.908  -22.333 -53.599 1.00 23.31  ? 4   VAL C O   1 
ATOM   2025 C  CB  . VAL C  1 9   ? 14.109  -20.027 -52.714 1.00 21.03  ? 4   VAL C CB  1 
ATOM   2026 C  CG1 . VAL C  1 9   ? 14.988  -19.707 -51.514 1.00 18.36  ? 4   VAL C CG1 1 
ATOM   2027 C  CG2 . VAL C  1 9   ? 13.028  -18.972 -52.898 1.00 22.30  ? 4   VAL C CG2 1 
ATOM   2028 N  N   . PHE C  1 10  ? 17.320  -20.586 -53.617 1.00 22.68  ? 5   PHE C N   1 
ATOM   2029 C  CA  . PHE C  1 10  ? 18.459  -21.371 -53.164 1.00 18.15  ? 5   PHE C CA  1 
ATOM   2030 C  C   . PHE C  1 10  ? 18.874  -20.917 -51.776 1.00 21.32  ? 5   PHE C C   1 
ATOM   2031 O  O   . PHE C  1 10  ? 19.258  -19.766 -51.581 1.00 22.98  ? 5   PHE C O   1 
ATOM   2032 C  CB  . PHE C  1 10  ? 19.650  -21.225 -54.109 1.00 16.80  ? 5   PHE C CB  1 
ATOM   2033 C  CG  . PHE C  1 10  ? 19.393  -21.732 -55.493 1.00 17.93  ? 5   PHE C CG  1 
ATOM   2034 C  CD1 . PHE C  1 10  ? 18.992  -20.870 -56.492 1.00 19.83  ? 5   PHE C CD1 1 
ATOM   2035 C  CD2 . PHE C  1 10  ? 19.563  -23.071 -55.796 1.00 22.62  ? 5   PHE C CD2 1 
ATOM   2036 C  CE1 . PHE C  1 10  ? 18.764  -21.331 -57.766 1.00 23.62  ? 5   PHE C CE1 1 
ATOM   2037 C  CE2 . PHE C  1 10  ? 19.330  -23.543 -57.074 1.00 23.64  ? 5   PHE C CE2 1 
ATOM   2038 C  CZ  . PHE C  1 10  ? 18.929  -22.671 -58.061 1.00 27.52  ? 5   PHE C CZ  1 
ATOM   2039 N  N   . ILE C  1 11  ? 18.793  -21.823 -50.812 1.00 22.71  ? 6   ILE C N   1 
ATOM   2040 C  CA  . ILE C  1 11  ? 19.317  -21.552 -49.485 1.00 17.06  ? 6   ILE C CA  1 
ATOM   2041 C  C   . ILE C  1 11  ? 20.745  -22.083 -49.420 1.00 18.90  ? 6   ILE C C   1 
ATOM   2042 O  O   . ILE C  1 11  ? 20.973  -23.292 -49.417 1.00 19.36  ? 6   ILE C O   1 
ATOM   2043 C  CB  . ILE C  1 11  ? 18.451  -22.190 -48.395 1.00 25.67  ? 6   ILE C CB  1 
ATOM   2044 C  CG1 . ILE C  1 11  ? 17.017  -21.664 -48.496 1.00 25.26  ? 6   ILE C CG1 1 
ATOM   2045 C  CG2 . ILE C  1 11  ? 19.032  -21.900 -47.023 1.00 22.49  ? 6   ILE C CG2 1 
ATOM   2046 C  CD1 . ILE C  1 11  ? 16.105  -22.179 -47.411 1.00 26.53  ? 6   ILE C CD1 1 
ATOM   2047 N  N   . LEU C  1 12  ? 21.707  -21.168 -49.396 1.00 16.43  ? 7   LEU C N   1 
ATOM   2048 C  CA  . LEU C  1 12  ? 23.106  -21.552 -49.500 1.00 19.86  ? 7   LEU C CA  1 
ATOM   2049 C  C   . LEU C  1 12  ? 23.692  -21.928 -48.152 1.00 16.26  ? 7   LEU C C   1 
ATOM   2050 O  O   . LEU C  1 12  ? 24.027  -23.085 -47.927 1.00 16.81  ? 7   LEU C O   1 
ATOM   2051 C  CB  . LEU C  1 12  ? 23.917  -20.435 -50.151 1.00 21.94  ? 7   LEU C CB  1 
ATOM   2052 C  CG  . LEU C  1 12  ? 23.389  -20.088 -51.543 1.00 24.18  ? 7   LEU C CG  1 
ATOM   2053 C  CD1 . LEU C  1 12  ? 24.237  -19.014 -52.177 1.00 21.59  ? 7   LEU C CD1 1 
ATOM   2054 C  CD2 . LEU C  1 12  ? 23.336  -21.329 -52.415 1.00 23.28  ? 7   LEU C CD2 1 
ATOM   2055 N  N   . TYR C  1 13  ? 23.805  -20.953 -47.258 1.00 17.98  ? 8   TYR C N   1 
ATOM   2056 C  CA  . TYR C  1 13  ? 24.385  -21.215 -45.948 1.00 21.53  ? 8   TYR C CA  1 
ATOM   2057 C  C   . TYR C  1 13  ? 23.999  -20.172 -44.907 1.00 21.52  ? 8   TYR C C   1 
ATOM   2058 O  O   . TYR C  1 13  ? 23.487  -19.102 -45.239 1.00 24.85  ? 8   TYR C O   1 
ATOM   2059 C  CB  . TYR C  1 13  ? 25.912  -21.314 -46.048 1.00 19.12  ? 8   TYR C CB  1 
ATOM   2060 C  CG  . TYR C  1 13  ? 26.600  -20.040 -46.500 1.00 19.11  ? 8   TYR C CG  1 
ATOM   2061 C  CD1 . TYR C  1 13  ? 26.985  -19.071 -45.581 1.00 20.98  ? 8   TYR C CD1 1 
ATOM   2062 C  CD2 . TYR C  1 13  ? 26.879  -19.816 -47.842 1.00 24.85  ? 8   TYR C CD2 1 
ATOM   2063 C  CE1 . TYR C  1 13  ? 27.621  -17.909 -45.987 1.00 24.90  ? 8   TYR C CE1 1 
ATOM   2064 C  CE2 . TYR C  1 13  ? 27.513  -18.658 -48.260 1.00 22.68  ? 8   TYR C CE2 1 
ATOM   2065 C  CZ  . TYR C  1 13  ? 27.880  -17.708 -47.330 1.00 26.70  ? 8   TYR C CZ  1 
ATOM   2066 O  OH  . TYR C  1 13  ? 28.515  -16.560 -47.747 1.00 23.68  ? 8   TYR C OH  1 
ATOM   2067 N  N   . ALA C  1 14  ? 24.253  -20.500 -43.644 1.00 22.67  ? 9   ALA C N   1 
ATOM   2068 C  CA  . ALA C  1 14  ? 24.106  -19.546 -42.554 1.00 24.43  ? 9   ALA C CA  1 
ATOM   2069 C  C   . ALA C  1 14  ? 25.441  -19.415 -41.832 1.00 22.56  ? 9   ALA C C   1 
ATOM   2070 O  O   . ALA C  1 14  ? 26.260  -20.336 -41.862 1.00 23.88  ? 9   ALA C O   1 
ATOM   2071 C  CB  . ALA C  1 14  ? 23.015  -19.990 -41.589 1.00 19.88  ? 9   ALA C CB  1 
ATOM   2072 N  N   . GLU C  1 15  ? 25.662  -18.266 -41.200 1.00 21.77  ? 10  GLU C N   1 
ATOM   2073 C  CA  . GLU C  1 15  ? 26.891  -18.024 -40.456 1.00 32.65  ? 10  GLU C CA  1 
ATOM   2074 C  C   . GLU C  1 15  ? 26.615  -17.656 -39.008 1.00 25.37  ? 10  GLU C C   1 
ATOM   2075 O  O   . GLU C  1 15  ? 25.649  -16.953 -38.710 1.00 25.64  ? 10  GLU C O   1 
ATOM   2076 C  CB  . GLU C  1 15  ? 27.713  -16.917 -41.112 1.00 34.08  ? 10  GLU C CB  1 
ATOM   2077 C  CG  . GLU C  1 15  ? 28.396  -17.338 -42.389 1.00 44.64  ? 10  GLU C CG  1 
ATOM   2078 C  CD  . GLU C  1 15  ? 29.345  -16.280 -42.910 1.00 51.03  ? 10  GLU C CD  1 
ATOM   2079 O  OE1 . GLU C  1 15  ? 29.017  -15.081 -42.806 1.00 56.38  ? 10  GLU C OE1 1 
ATOM   2080 O  OE2 . GLU C  1 15  ? 30.426  -16.648 -43.416 1.00 50.22  ? 10  GLU C OE2 1 
ATOM   2081 N  N   . ASN C  1 16  ? 27.481  -18.135 -38.119 1.00 26.99  ? 11  ASN C N   1 
ATOM   2082 C  CA  . ASN C  1 16  ? 27.405  -17.823 -36.696 1.00 29.35  ? 11  ASN C CA  1 
ATOM   2083 C  C   . ASN C  1 16  ? 26.088  -18.260 -36.069 1.00 32.33  ? 11  ASN C C   1 
ATOM   2084 O  O   . ASN C  1 16  ? 25.442  -17.494 -35.356 1.00 30.76  ? 11  ASN C O   1 
ATOM   2085 C  CB  . ASN C  1 16  ? 27.650  -16.331 -36.459 1.00 60.89  ? 11  ASN C CB  1 
ATOM   2086 C  CG  . ASN C  1 16  ? 28.799  -15.793 -37.290 1.00 67.21  ? 11  ASN C CG  1 
ATOM   2087 O  OD1 . ASN C  1 16  ? 28.610  -14.927 -38.144 1.00 69.67  ? 11  ASN C OD1 1 
ATOM   2088 N  ND2 . ASN C  1 16  ? 29.999  -16.311 -37.050 1.00 70.59  ? 11  ASN C ND2 1 
ATOM   2089 N  N   . VAL C  1 17  ? 25.693  -19.496 -36.350 1.00 30.81  ? 12  VAL C N   1 
ATOM   2090 C  CA  . VAL C  1 17  ? 24.480  -20.071 -35.780 1.00 35.35  ? 12  VAL C CA  1 
ATOM   2091 C  C   . VAL C  1 17  ? 24.790  -20.673 -34.411 1.00 37.49  ? 12  VAL C C   1 
ATOM   2092 O  O   . VAL C  1 17  ? 25.625  -21.571 -34.292 1.00 40.11  ? 12  VAL C O   1 
ATOM   2093 C  CB  . VAL C  1 17  ? 23.882  -21.147 -36.708 1.00 31.49  ? 12  VAL C CB  1 
ATOM   2094 C  CG1 . VAL C  1 17  ? 22.722  -21.845 -36.026 1.00 32.55  ? 12  VAL C CG1 1 
ATOM   2095 C  CG2 . VAL C  1 17  ? 23.443  -20.524 -38.024 1.00 29.37  ? 12  VAL C CG2 1 
ATOM   2096 N  N   . HIS C  1 18  ? 24.125  -20.167 -33.378 1.00 36.92  ? 13  HIS C N   1 
ATOM   2097 C  CA  . HIS C  1 18  ? 24.418  -20.582 -32.009 1.00 36.03  ? 13  HIS C CA  1 
ATOM   2098 C  C   . HIS C  1 18  ? 23.156  -20.915 -31.209 1.00 55.38  ? 13  HIS C C   1 
ATOM   2099 O  O   . HIS C  1 18  ? 22.227  -20.113 -31.126 1.00 56.60  ? 13  HIS C O   1 
ATOM   2100 C  CB  . HIS C  1 18  ? 25.232  -19.501 -31.286 1.00 44.65  ? 13  HIS C CB  1 
ATOM   2101 C  CG  . HIS C  1 18  ? 26.648  -19.379 -31.763 1.00 49.15  ? 13  HIS C CG  1 
ATOM   2102 N  ND1 . HIS C  1 18  ? 27.107  -18.285 -32.468 1.00 52.51  ? 13  HIS C ND1 1 
ATOM   2103 C  CD2 . HIS C  1 18  ? 27.707  -20.212 -31.635 1.00 49.40  ? 13  HIS C CD2 1 
ATOM   2104 C  CE1 . HIS C  1 18  ? 28.385  -18.451 -32.751 1.00 52.76  ? 13  HIS C CE1 1 
ATOM   2105 N  NE2 . HIS C  1 18  ? 28.775  -19.613 -32.259 1.00 52.17  ? 13  HIS C NE2 1 
ATOM   2106 N  N   . THR C  1 19  ? 23.132  -22.109 -30.627 1.00 53.16  ? 14  THR C N   1 
ATOM   2107 C  CA  . THR C  1 19  ? 22.037  -22.542 -29.763 1.00 59.22  ? 14  THR C CA  1 
ATOM   2108 C  C   . THR C  1 19  ? 22.435  -22.244 -28.318 1.00 69.57  ? 14  THR C C   1 
ATOM   2109 O  O   . THR C  1 19  ? 23.630  -22.155 -28.039 1.00 69.43  ? 14  THR C O   1 
ATOM   2110 C  CB  . THR C  1 19  ? 21.767  -24.046 -29.951 1.00 63.05  ? 14  THR C CB  1 
ATOM   2111 O  OG1 . THR C  1 19  ? 22.989  -24.778 -29.794 1.00 69.08  ? 14  THR C OG1 1 
ATOM   2112 C  CG2 . THR C  1 19  ? 21.221  -24.303 -31.337 1.00 59.65  ? 14  THR C CG2 1 
ATOM   2113 N  N   . PRO C  1 20  ? 21.450  -22.061 -27.407 1.00 77.32  ? 15  PRO C N   1 
ATOM   2114 C  CA  . PRO C  1 20  ? 21.760  -21.763 -25.999 1.00 81.25  ? 15  PRO C CA  1 
ATOM   2115 C  C   . PRO C  1 20  ? 22.775  -22.761 -25.474 1.00 82.01  ? 15  PRO C C   1 
ATOM   2116 O  O   . PRO C  1 20  ? 22.442  -23.923 -25.251 1.00 77.61  ? 15  PRO C O   1 
ATOM   2117 C  CB  . PRO C  1 20  ? 20.416  -21.954 -25.305 1.00 83.68  ? 15  PRO C CB  1 
ATOM   2118 C  CG  . PRO C  1 20  ? 19.438  -21.580 -26.339 1.00 80.65  ? 15  PRO C CG  1 
ATOM   2119 C  CD  . PRO C  1 20  ? 19.995  -22.144 -27.621 1.00 78.17  ? 15  PRO C CD  1 
ATOM   2120 N  N   . ASP C  1 21  ? 23.991  -22.275 -25.250 1.00 88.09  ? 16  ASP C N   1 
ATOM   2121 C  CA  . ASP C  1 21  ? 25.202  -23.069 -25.454 1.00 93.81  ? 16  ASP C CA  1 
ATOM   2122 C  C   . ASP C  1 21  ? 25.616  -24.173 -24.486 1.00 98.40  ? 16  ASP C C   1 
ATOM   2123 O  O   . ASP C  1 21  ? 26.276  -23.932 -23.474 1.00 104.86 ? 16  ASP C O   1 
ATOM   2124 C  CB  . ASP C  1 21  ? 26.390  -22.144 -25.723 1.00 95.17  ? 16  ASP C CB  1 
ATOM   2125 C  CG  . ASP C  1 21  ? 26.627  -21.932 -27.200 1.00 90.44  ? 16  ASP C CG  1 
ATOM   2126 O  OD1 . ASP C  1 21  ? 26.313  -22.854 -27.982 1.00 87.46  ? 16  ASP C OD1 1 
ATOM   2127 O  OD2 . ASP C  1 21  ? 27.120  -20.852 -27.582 1.00 88.64  ? 16  ASP C OD2 1 
ATOM   2128 N  N   . THR C  1 22  ? 25.244  -25.395 -24.843 1.00 95.15  ? 17  THR C N   1 
ATOM   2129 C  CA  . THR C  1 22  ? 25.954  -26.573 -24.378 1.00 93.59  ? 17  THR C CA  1 
ATOM   2130 C  C   . THR C  1 22  ? 26.331  -27.365 -25.624 1.00 85.09  ? 17  THR C C   1 
ATOM   2131 O  O   . THR C  1 22  ? 27.497  -27.382 -26.025 1.00 82.26  ? 17  THR C O   1 
ATOM   2132 C  CB  . THR C  1 22  ? 25.125  -27.410 -23.390 1.00 94.61  ? 17  THR C CB  1 
ATOM   2133 O  OG1 . THR C  1 22  ? 24.924  -26.657 -22.187 1.00 97.81  ? 17  THR C OG1 1 
ATOM   2134 C  CG2 . THR C  1 22  ? 25.854  -28.689 -23.036 1.00 91.99  ? 17  THR C CG2 1 
ATOM   2135 N  N   . ASP C  1 23  ? 25.337  -27.980 -26.259 1.00 78.90  ? 18  ASP C N   1 
ATOM   2136 C  CA  . ASP C  1 23  ? 25.562  -28.661 -27.527 1.00 74.62  ? 18  ASP C CA  1 
ATOM   2137 C  C   . ASP C  1 23  ? 25.812  -27.658 -28.636 1.00 72.40  ? 18  ASP C C   1 
ATOM   2138 O  O   . ASP C  1 23  ? 25.686  -26.450 -28.450 1.00 71.23  ? 18  ASP C O   1 
ATOM   2139 C  CB  . ASP C  1 23  ? 24.359  -29.516 -27.904 1.00 79.19  ? 18  ASP C CB  1 
ATOM   2140 C  CG  . ASP C  1 23  ? 24.702  -30.598 -28.909 1.00 86.05  ? 18  ASP C CG  1 
ATOM   2141 O  OD1 . ASP C  1 23  ? 25.900  -30.747 -29.229 1.00 89.59  ? 18  ASP C OD1 1 
ATOM   2142 O  OD2 . ASP C  1 23  ? 23.779  -31.300 -29.374 1.00 87.43  ? 18  ASP C OD2 1 
ATOM   2143 N  N   . ILE C  1 24  ? 26.143  -28.179 -29.806 1.00 68.79  ? 19  ILE C N   1 
ATOM   2144 C  CA  . ILE C  1 24  ? 26.431  -27.348 -30.955 1.00 64.64  ? 19  ILE C CA  1 
ATOM   2145 C  C   . ILE C  1 24  ? 25.334  -27.532 -32.013 1.00 62.12  ? 19  ILE C C   1 
ATOM   2146 O  O   . ILE C  1 24  ? 24.773  -28.622 -32.157 1.00 38.80  ? 19  ILE C O   1 
ATOM   2147 C  CB  . ILE C  1 24  ? 27.851  -27.650 -31.474 1.00 66.82  ? 19  ILE C CB  1 
ATOM   2148 C  CG1 . ILE C  1 24  ? 27.893  -27.710 -32.994 1.00 61.32  ? 19  ILE C CG1 1 
ATOM   2149 C  CG2 . ILE C  1 24  ? 28.355  -28.956 -30.887 1.00 70.11  ? 19  ILE C CG2 1 
ATOM   2150 C  CD1 . ILE C  1 24  ? 28.121  -26.384 -33.656 1.00 58.06  ? 19  ILE C CD1 1 
ATOM   2151 N  N   . SER C  1 25  ? 25.028  -26.445 -32.719 1.00 35.92  ? 20  SER C N   1 
ATOM   2152 C  CA  . SER C  1 25  ? 23.871  -26.351 -33.606 1.00 44.54  ? 20  SER C CA  1 
ATOM   2153 C  C   . SER C  1 25  ? 23.747  -27.452 -34.655 1.00 37.52  ? 20  SER C C   1 
ATOM   2154 O  O   . SER C  1 25  ? 24.704  -27.777 -35.355 1.00 36.42  ? 20  SER C O   1 
ATOM   2155 C  CB  . SER C  1 25  ? 23.868  -24.995 -34.316 1.00 42.21  ? 20  SER C CB  1 
ATOM   2156 O  OG  . SER C  1 25  ? 24.213  -23.955 -33.416 1.00 49.30  ? 20  SER C OG  1 
ATOM   2157 N  N   . ASP C  1 26  ? 22.546  -28.008 -34.759 1.00 36.65  ? 21  ASP C N   1 
ATOM   2158 C  CA  . ASP C  1 26  ? 22.191  -28.894 -35.859 1.00 33.46  ? 21  ASP C CA  1 
ATOM   2159 C  C   . ASP C  1 26  ? 21.086  -28.213 -36.654 1.00 35.31  ? 21  ASP C C   1 
ATOM   2160 O  O   . ASP C  1 26  ? 19.913  -28.574 -36.561 1.00 34.35  ? 21  ASP C O   1 
ATOM   2161 C  CB  . ASP C  1 26  ? 21.723  -30.245 -35.322 1.00 34.53  ? 21  ASP C CB  1 
ATOM   2162 C  CG  . ASP C  1 26  ? 22.746  -30.887 -34.411 1.00 42.86  ? 21  ASP C CG  1 
ATOM   2163 O  OD1 . ASP C  1 26  ? 23.937  -30.936 -34.788 1.00 44.16  ? 21  ASP C OD1 1 
ATOM   2164 O  OD2 . ASP C  1 26  ? 22.370  -31.333 -33.309 1.00 39.60  ? 21  ASP C OD2 1 
ATOM   2165 N  N   . ALA C  1 27  ? 21.476  -27.216 -37.437 1.00 27.86  ? 22  ALA C N   1 
ATOM   2166 C  CA  . ALA C  1 27  ? 20.516  -26.292 -38.022 1.00 27.70  ? 22  ALA C CA  1 
ATOM   2167 C  C   . ALA C  1 27  ? 19.935  -26.757 -39.348 1.00 27.72  ? 22  ALA C C   1 
ATOM   2168 O  O   . ALA C  1 27  ? 20.627  -27.346 -40.176 1.00 24.53  ? 22  ALA C O   1 
ATOM   2169 C  CB  . ALA C  1 27  ? 21.144  -24.917 -38.183 1.00 25.13  ? 22  ALA C CB  1 
ATOM   2170 N  N   . TYR C  1 28  ? 18.655  -26.537 -39.527 1.00 31.13  ? 23  TYR C N   1 
ATOM   2171 C  CA  . TYR C  1 28  ? 18.002  -26.537 -40.826 1.00 25.25  ? 23  TYR C CA  1 
ATOM   2172 C  C   . TYR C  1 28  ? 17.197  -25.238 -41.029 1.00 23.35  ? 23  TYR C C   1 
ATOM   2173 O  O   . TYR C  1 28  ? 16.945  -24.527 -40.112 1.00 25.30  ? 23  TYR C O   1 
ATOM   2174 C  CB  . TYR C  1 28  ? 17.094  -27.737 -40.970 1.00 25.56  ? 23  TYR C CB  1 
ATOM   2175 C  CG  . TYR C  1 28  ? 15.893  -27.721 -40.079 1.00 27.43  ? 23  TYR C CG  1 
ATOM   2176 C  CD1 . TYR C  1 28  ? 16.000  -27.968 -38.735 1.00 29.34  ? 23  TYR C CD1 1 
ATOM   2177 C  CD2 . TYR C  1 28  ? 14.658  -27.469 -40.581 1.00 31.35  ? 23  TYR C CD2 1 
ATOM   2178 C  CE1 . TYR C  1 28  ? 14.897  -27.964 -37.923 1.00 33.95  ? 23  TYR C CE1 1 
ATOM   2179 C  CE2 . TYR C  1 28  ? 13.539  -27.461 -39.776 1.00 33.68  ? 23  TYR C CE2 1 
ATOM   2180 C  CZ  . TYR C  1 28  ? 13.674  -27.708 -38.444 1.00 39.26  ? 23  TYR C CZ  1 
ATOM   2181 O  OH  . TYR C  1 28  ? 12.600  -27.694 -37.630 1.00 48.27  ? 23  TYR C OH  1 
ATOM   2182 N  N   A CYS C  1 29  ? 16.808  -24.975 -42.250 0.58 25.33  ? 24  CYS C N   1 
ATOM   2183 N  N   B CYS C  1 29  ? 16.908  -24.975 -42.250 0.42 25.64  ? 24  CYS C N   1 
ATOM   2184 C  CA  A CYS C  1 29  ? 15.933  -23.877 -42.551 0.58 28.37  ? 24  CYS C CA  1 
ATOM   2185 C  CA  B CYS C  1 29  ? 16.033  -23.877 -42.551 0.42 27.71  ? 24  CYS C CA  1 
ATOM   2186 C  C   A CYS C  1 29  ? 14.566  -24.324 -42.898 0.58 34.25  ? 24  CYS C C   1 
ATOM   2187 C  C   B CYS C  1 29  ? 14.666  -24.324 -42.898 0.42 33.28  ? 24  CYS C C   1 
ATOM   2188 O  O   A CYS C  1 29  ? 14.386  -25.216 -43.661 0.58 35.94  ? 24  CYS C O   1 
ATOM   2189 O  O   B CYS C  1 29  ? 14.486  -25.216 -43.661 0.42 35.65  ? 24  CYS C O   1 
ATOM   2190 C  CB  A CYS C  1 29  ? 16.428  -23.073 -43.716 0.58 28.58  ? 24  CYS C CB  1 
ATOM   2191 C  CB  B CYS C  1 29  ? 16.528  -23.073 -43.716 0.42 28.21  ? 24  CYS C CB  1 
ATOM   2192 S  SG  A CYS C  1 29  ? 17.936  -22.255 -43.417 0.58 27.74  ? 24  CYS C SG  1 
ATOM   2193 S  SG  B CYS C  1 29  ? 15.863  -21.466 -43.796 0.42 32.90  ? 24  CYS C SG  1 
ATOM   2194 N  N   . SER C  1 30  ? 13.604  -23.650 -42.347 1.00 33.85  ? 25  SER C N   1 
ATOM   2195 C  CA  . SER C  1 30  ? 12.256  -23.791 -42.798 1.00 35.80  ? 25  SER C CA  1 
ATOM   2196 C  C   . SER C  1 30  ? 11.869  -22.551 -43.628 1.00 38.38  ? 25  SER C C   1 
ATOM   2197 O  O   . SER C  1 30  ? 11.962  -21.443 -43.157 1.00 37.88  ? 25  SER C O   1 
ATOM   2198 C  CB  . SER C  1 30  ? 11.332  -23.987 -41.617 1.00 36.84  ? 25  SER C CB  1 
ATOM   2199 O  OG  . SER C  1 30  ? 10.030  -24.222 -42.043 1.00 46.41  ? 25  SER C OG  1 
ATOM   2200 N  N   . ALA C  1 31  ? 11.465  -22.762 -44.860 1.00 24.71  ? 26  ALA C N   1 
ATOM   2201 C  CA  . ALA C  1 31  ? 11.047  -21.680 -45.718 1.00 24.50  ? 26  ALA C CA  1 
ATOM   2202 C  C   . ALA C  1 31  ? 9.599   -21.796 -46.146 1.00 29.53  ? 26  ALA C C   1 
ATOM   2203 O  O   . ALA C  1 31  ? 9.197   -22.795 -46.620 1.00 30.46  ? 26  ALA C O   1 
ATOM   2204 C  CB  . ALA C  1 31  ? 11.920  -21.632 -46.915 1.00 27.44  ? 26  ALA C CB  1 
ATOM   2205 N  N   . VAL C  1 32  ? 8.838   -20.746 -45.960 1.00 29.71  ? 27  VAL C N   1 
ATOM   2206 C  CA  . VAL C  1 32  ? 7.405   -20.776 -46.225 1.00 34.61  ? 27  VAL C CA  1 
ATOM   2207 C  C   . VAL C  1 32  ? 7.001   -19.702 -47.225 1.00 37.43  ? 27  VAL C C   1 
ATOM   2208 O  O   . VAL C  1 32  ? 7.314   -18.524 -47.048 1.00 27.24  ? 27  VAL C O   1 
ATOM   2209 C  CB  . VAL C  1 32  ? 6.588   -20.590 -44.929 1.00 36.66  ? 27  VAL C CB  1 
ATOM   2210 C  CG1 . VAL C  1 32  ? 5.095   -20.558 -45.235 1.00 35.46  ? 27  VAL C CG1 1 
ATOM   2211 C  CG2 . VAL C  1 32  ? 6.911   -21.696 -43.934 1.00 34.93  ? 27  VAL C CG2 1 
ATOM   2212 N  N   . PHE C  1 33  ? 6.312   -20.119 -48.281 1.00 28.57  ? 28  PHE C N   1 
ATOM   2213 C  CA  . PHE C  1 33  ? 5.755   -19.184 -49.248 1.00 29.13  ? 28  PHE C CA  1 
ATOM   2214 C  C   . PHE C  1 33  ? 4.330   -19.568 -49.619 1.00 31.87  ? 28  PHE C C   1 
ATOM   2215 O  O   . PHE C  1 33  ? 4.070   -20.706 -50.015 1.00 35.14  ? 28  PHE C O   1 
ATOM   2216 C  CB  . PHE C  1 33  ? 6.616   -19.112 -50.508 1.00 27.36  ? 28  PHE C CB  1 
ATOM   2217 C  CG  . PHE C  1 33  ? 6.089   -18.157 -51.535 1.00 35.06  ? 28  PHE C CG  1 
ATOM   2218 C  CD1 . PHE C  1 33  ? 6.268   -16.792 -51.385 1.00 35.60  ? 28  PHE C CD1 1 
ATOM   2219 C  CD2 . PHE C  1 33  ? 5.399   -18.619 -52.642 1.00 38.64  ? 28  PHE C CD2 1 
ATOM   2220 C  CE1 . PHE C  1 33  ? 5.778   -15.906 -52.323 1.00 35.24  ? 28  PHE C CE1 1 
ATOM   2221 C  CE2 . PHE C  1 33  ? 4.905   -17.737 -53.582 1.00 44.27  ? 28  PHE C CE2 1 
ATOM   2222 C  CZ  . PHE C  1 33  ? 5.096   -16.379 -53.424 1.00 36.30  ? 28  PHE C CZ  1 
ATOM   2223 N  N   . ALA C  1 34  ? 3.421   -18.603 -49.499 1.00 33.68  ? 29  ALA C N   1 
ATOM   2224 C  CA  . ALA C  1 34  ? 2.003   -18.810 -49.779 1.00 36.79  ? 29  ALA C CA  1 
ATOM   2225 C  C   . ALA C  1 34  ? 1.458   -20.019 -49.032 1.00 38.53  ? 29  ALA C C   1 
ATOM   2226 O  O   . ALA C  1 34  ? 0.632   -20.764 -49.558 1.00 40.67  ? 29  ALA C O   1 
ATOM   2227 C  CB  . ALA C  1 34  ? 1.761   -18.952 -51.274 1.00 41.98  ? 29  ALA C CB  1 
ATOM   2228 N  N   . GLY C  1 35  ? 1.942   -20.219 -47.811 1.00 45.36  ? 30  GLY C N   1 
ATOM   2229 C  CA  . GLY C  1 35  ? 1.492   -21.323 -46.985 1.00 47.82  ? 30  GLY C CA  1 
ATOM   2230 C  C   . GLY C  1 35  ? 2.109   -22.664 -47.343 1.00 46.18  ? 30  GLY C C   1 
ATOM   2231 O  O   . GLY C  1 35  ? 1.790   -23.673 -46.721 1.00 40.70  ? 30  GLY C O   1 
ATOM   2232 N  N   . VAL C  1 36  ? 2.977   -22.688 -48.351 1.00 36.46  ? 31  VAL C N   1 
ATOM   2233 C  CA  . VAL C  1 36  ? 3.698   -23.909 -48.697 1.00 35.64  ? 31  VAL C CA  1 
ATOM   2234 C  C   . VAL C  1 36  ? 5.081   -23.887 -48.056 1.00 36.69  ? 31  VAL C C   1 
ATOM   2235 O  O   . VAL C  1 36  ? 5.891   -23.000 -48.323 1.00 33.75  ? 31  VAL C O   1 
ATOM   2236 C  CB  . VAL C  1 36  ? 3.832   -24.108 -50.220 1.00 37.09  ? 31  VAL C CB  1 
ATOM   2237 C  CG1 . VAL C  1 36  ? 4.530   -25.430 -50.521 1.00 36.04  ? 31  VAL C CG1 1 
ATOM   2238 C  CG2 . VAL C  1 36  ? 2.464   -24.063 -50.886 1.00 44.72  ? 31  VAL C CG2 1 
ATOM   2239 N  N   . LYS C  1 37  ? 5.334   -24.873 -47.204 1.00 38.22  ? 32  LYS C N   1 
ATOM   2240 C  CA  . LYS C  1 37  ? 6.561   -24.932 -46.426 1.00 37.15  ? 32  LYS C CA  1 
ATOM   2241 C  C   . LYS C  1 37  ? 7.552   -25.937 -46.994 1.00 34.66  ? 32  LYS C C   1 
ATOM   2242 O  O   . LYS C  1 37  ? 7.192   -27.063 -47.338 1.00 35.77  ? 32  LYS C O   1 
ATOM   2243 C  CB  . LYS C  1 37  ? 6.249   -25.275 -44.967 1.00 40.35  ? 32  LYS C CB  1 
ATOM   2244 C  CG  . LYS C  1 37  ? 7.474   -25.645 -44.147 1.00 45.98  ? 32  LYS C CG  1 
ATOM   2245 C  CD  . LYS C  1 37  ? 7.111   -25.987 -42.711 1.00 51.38  ? 32  LYS C CD  1 
ATOM   2246 C  CE  . LYS C  1 37  ? 6.633   -24.764 -41.945 1.00 52.89  ? 32  LYS C CE  1 
ATOM   2247 N  NZ  . LYS C  1 37  ? 6.324   -25.087 -40.523 1.00 62.67  ? 32  LYS C NZ  1 
ATOM   2248 N  N   . LYS C  1 38  ? 8.807   -25.516 -47.091 1.00 29.58  ? 33  LYS C N   1 
ATOM   2249 C  CA  . LYS C  1 38  ? 9.874   -26.396 -47.536 1.00 33.95  ? 33  LYS C CA  1 
ATOM   2250 C  C   . LYS C  1 38  ? 11.023  -26.352 -46.535 1.00 35.33  ? 33  LYS C C   1 
ATOM   2251 O  O   . LYS C  1 38  ? 11.206  -25.359 -45.832 1.00 25.01  ? 33  LYS C O   1 
ATOM   2252 C  CB  . LYS C  1 38  ? 10.332  -25.995 -48.937 1.00 37.19  ? 33  LYS C CB  1 
ATOM   2253 C  CG  . LYS C  1 38  ? 9.198   -26.029 -49.955 1.00 40.92  ? 33  LYS C CG  1 
ATOM   2254 C  CD  . LYS C  1 38  ? 9.670   -25.682 -51.348 1.00 36.60  ? 33  LYS C CD  1 
ATOM   2255 C  CE  . LYS C  1 38  ? 8.505   -25.647 -52.323 1.00 32.53  ? 33  LYS C CE  1 
ATOM   2256 N  NZ  . LYS C  1 38  ? 7.940   -26.997 -52.576 1.00 33.46  ? 33  LYS C NZ  1 
ATOM   2257 N  N   . ARG C  1 39  ? 11.783  -27.438 -46.458 1.00 26.15  ? 34  ARG C N   1 
ATOM   2258 C  CA  . ARG C  1 39  ? 12.838  -27.554 -45.461 1.00 32.37  ? 34  ARG C CA  1 
ATOM   2259 C  C   . ARG C  1 39  ? 14.139  -28.064 -46.057 1.00 32.21  ? 34  ARG C C   1 
ATOM   2260 O  O   . ARG C  1 39  ? 14.137  -28.934 -46.927 1.00 37.17  ? 34  ARG C O   1 
ATOM   2261 C  CB  . ARG C  1 39  ? 12.415  -28.497 -44.334 1.00 41.54  ? 34  ARG C CB  1 
ATOM   2262 C  CG  . ARG C  1 39  ? 11.222  -28.038 -43.522 1.00 50.78  ? 34  ARG C CG  1 
ATOM   2263 C  CD  . ARG C  1 39  ? 10.936  -29.035 -42.413 1.00 59.07  ? 34  ARG C CD  1 
ATOM   2264 N  NE  . ARG C  1 39  ? 9.680   -28.759 -41.724 1.00 68.36  ? 34  ARG C NE  1 
ATOM   2265 C  CZ  . ARG C  1 39  ? 8.500   -29.240 -42.102 1.00 73.23  ? 34  ARG C CZ  1 
ATOM   2266 N  NH1 . ARG C  1 39  ? 8.410   -30.019 -43.171 1.00 72.59  ? 34  ARG C NH1 1 
ATOM   2267 N  NH2 . ARG C  1 39  ? 7.409   -28.941 -41.410 1.00 77.66  ? 34  ARG C NH2 1 
ATOM   2268 N  N   . THR C  1 40  ? 15.251  -27.523 -45.574 1.00 23.86  ? 35  THR C N   1 
ATOM   2269 C  CA  . THR C  1 40  ? 16.556  -28.059 -45.918 1.00 24.50  ? 35  THR C CA  1 
ATOM   2270 C  C   . THR C  1 40  ? 16.820  -29.295 -45.071 1.00 25.73  ? 35  THR C C   1 
ATOM   2271 O  O   . THR C  1 40  ? 16.043  -29.626 -44.173 1.00 25.95  ? 35  THR C O   1 
ATOM   2272 C  CB  . THR C  1 40  ? 17.677  -27.047 -45.634 1.00 25.87  ? 35  THR C CB  1 
ATOM   2273 O  OG1 . THR C  1 40  ? 17.758  -26.810 -44.222 1.00 26.37  ? 35  THR C OG1 1 
ATOM   2274 C  CG2 . THR C  1 40  ? 17.424  -25.728 -46.366 1.00 19.45  ? 35  THR C CG2 1 
ATOM   2275 N  N   . LYS C  1 41  ? 17.926  -29.970 -45.358 1.00 25.65  ? 36  LYS C N   1 
ATOM   2276 C  CA  . LYS C  1 41  ? 18.402  -31.042 -44.504 1.00 30.92  ? 36  LYS C CA  1 
ATOM   2277 C  C   . LYS C  1 41  ? 18.972  -30.421 -43.236 1.00 26.01  ? 36  LYS C C   1 
ATOM   2278 O  O   . LYS C  1 41  ? 19.207  -29.214 -43.171 1.00 26.67  ? 36  LYS C O   1 
ATOM   2279 C  CB  . LYS C  1 41  ? 19.502  -31.827 -45.214 1.00 33.00  ? 36  LYS C CB  1 
ATOM   2280 C  CG  . LYS C  1 41  ? 20.763  -31.007 -45.442 1.00 38.33  ? 36  LYS C CG  1 
ATOM   2281 C  CD  . LYS C  1 41  ? 21.853  -31.816 -46.122 1.00 46.58  ? 36  LYS C CD  1 
ATOM   2282 C  CE  . LYS C  1 41  ? 21.714  -31.763 -47.633 1.00 49.49  ? 36  LYS C CE  1 
ATOM   2283 N  NZ  . LYS C  1 41  ? 21.789  -30.361 -48.128 1.00 40.10  ? 36  LYS C NZ  1 
ATOM   2284 N  N   . VAL C  1 42  ? 19.195  -31.251 -42.229 1.00 27.97  ? 37  VAL C N   1 
ATOM   2285 C  CA  . VAL C  1 42  ? 19.872  -30.806 -41.025 1.00 32.25  ? 37  VAL C CA  1 
ATOM   2286 C  C   . VAL C  1 42  ? 21.369  -30.974 -41.202 1.00 29.63  ? 37  VAL C C   1 
ATOM   2287 O  O   . VAL C  1 42  ? 21.836  -32.033 -41.614 1.00 31.75  ? 37  VAL C O   1 
ATOM   2288 C  CB  . VAL C  1 42  ? 19.425  -31.623 -39.812 1.00 33.95  ? 37  VAL C CB  1 
ATOM   2289 C  CG1 . VAL C  1 42  ? 20.310  -31.331 -38.601 1.00 33.81  ? 37  VAL C CG1 1 
ATOM   2290 C  CG2 . VAL C  1 42  ? 17.970  -31.346 -39.517 1.00 31.47  ? 37  VAL C CG2 1 
ATOM   2291 N  N   . ILE C  1 43  ? 22.120  -29.920 -40.912 1.00 26.53  ? 38  ILE C N   1 
ATOM   2292 C  CA  . ILE C  1 43  ? 23.565  -30.038 -40.868 1.00 27.48  ? 38  ILE C CA  1 
ATOM   2293 C  C   . ILE C  1 43  ? 23.981  -30.252 -39.423 1.00 29.92  ? 38  ILE C C   1 
ATOM   2294 O  O   . ILE C  1 43  ? 23.900  -29.338 -38.600 1.00 31.59  ? 38  ILE C O   1 
ATOM   2295 C  CB  . ILE C  1 43  ? 24.260  -28.793 -41.422 1.00 26.35  ? 38  ILE C CB  1 
ATOM   2296 C  CG1 . ILE C  1 43  ? 23.755  -28.489 -42.833 1.00 25.37  ? 38  ILE C CG1 1 
ATOM   2297 C  CG2 . ILE C  1 43  ? 25.766  -29.000 -41.431 1.00 29.89  ? 38  ILE C CG2 1 
ATOM   2298 C  CD1 . ILE C  1 43  ? 24.060  -29.578 -43.840 1.00 26.66  ? 38  ILE C CD1 1 
ATOM   2299 N  N   . LYS C  1 44  ? 24.407  -31.472 -39.119 1.00 30.84  ? 39  LYS C N   1 
ATOM   2300 C  CA  . LYS C  1 44  ? 24.799  -31.833 -37.765 1.00 36.99  ? 39  LYS C CA  1 
ATOM   2301 C  C   . LYS C  1 44  ? 26.037  -31.075 -37.317 1.00 37.96  ? 39  LYS C C   1 
ATOM   2302 O  O   . LYS C  1 44  ? 27.017  -30.970 -38.057 1.00 36.83  ? 39  LYS C O   1 
ATOM   2303 C  CB  . LYS C  1 44  ? 25.064  -33.335 -37.668 1.00 43.58  ? 39  LYS C CB  1 
ATOM   2304 C  CG  . LYS C  1 44  ? 23.838  -34.200 -37.872 1.00 53.60  ? 39  LYS C CG  1 
ATOM   2305 C  CD  . LYS C  1 44  ? 22.894  -34.103 -36.691 1.00 64.05  ? 39  LYS C CD  1 
ATOM   2306 C  CE  . LYS C  1 44  ? 21.683  -34.990 -36.892 1.00 72.81  ? 39  LYS C CE  1 
ATOM   2307 N  NZ  . LYS C  1 44  ? 22.066  -36.378 -37.274 1.00 79.29  ? 39  LYS C NZ  1 
ATOM   2308 N  N   . ASN C  1 45  ? 25.974  -30.543 -36.102 1.00 39.50  ? 40  ASN C N   1 
ATOM   2309 C  CA  . ASN C  1 45  ? 27.134  -29.962 -35.434 1.00 37.69  ? 40  ASN C CA  1 
ATOM   2310 C  C   . ASN C  1 45  ? 27.920  -28.926 -36.239 1.00 38.26  ? 40  ASN C C   1 
ATOM   2311 O  O   . ASN C  1 45  ? 29.093  -29.131 -36.548 1.00 42.24  ? 40  ASN C O   1 
ATOM   2312 C  CB  . ASN C  1 45  ? 28.068  -31.068 -34.934 1.00 37.69  ? 40  ASN C CB  1 
ATOM   2313 C  CG  . ASN C  1 45  ? 27.418  -31.942 -33.880 1.00 49.66  ? 40  ASN C CG  1 
ATOM   2314 O  OD1 . ASN C  1 45  ? 26.775  -31.444 -32.954 1.00 48.61  ? 40  ASN C OD1 1 
ATOM   2315 N  ND2 . ASN C  1 45  ? 27.571  -33.254 -34.021 1.00 59.93  ? 40  ASN C ND2 1 
ATOM   2316 N  N   . SER C  1 46  ? 27.270  -27.815 -36.574 1.00 30.98  ? 41  SER C N   1 
ATOM   2317 C  CA  . SER C  1 46  ? 27.945  -26.726 -37.273 1.00 37.67  ? 41  SER C CA  1 
ATOM   2318 C  C   . SER C  1 46  ? 27.390  -25.352 -36.904 1.00 40.61  ? 41  SER C C   1 
ATOM   2319 O  O   . SER C  1 46  ? 26.181  -25.167 -36.766 1.00 39.82  ? 41  SER C O   1 
ATOM   2320 C  CB  . SER C  1 46  ? 27.890  -26.925 -38.787 1.00 34.10  ? 41  SER C CB  1 
ATOM   2321 O  OG  . SER C  1 46  ? 28.421  -25.795 -39.458 1.00 38.60  ? 41  SER C OG  1 
ATOM   2322 N  N   . VAL C  1 47  ? 28.296  -24.394 -36.746 1.00 39.47  ? 42  VAL C N   1 
ATOM   2323 C  CA  . VAL C  1 47  ? 27.936  -23.017 -36.446 1.00 32.89  ? 42  VAL C CA  1 
ATOM   2324 C  C   . VAL C  1 47  ? 27.778  -22.265 -37.766 1.00 30.25  ? 42  VAL C C   1 
ATOM   2325 O  O   . VAL C  1 47  ? 27.088  -21.244 -37.844 1.00 31.90  ? 42  VAL C O   1 
ATOM   2326 C  CB  . VAL C  1 47  ? 29.007  -22.366 -35.532 1.00 37.69  ? 42  VAL C CB  1 
ATOM   2327 C  CG1 . VAL C  1 47  ? 28.828  -20.863 -35.431 1.00 40.30  ? 42  VAL C CG1 1 
ATOM   2328 C  CG2 . VAL C  1 47  ? 28.970  -22.996 -34.143 1.00 44.68  ? 42  VAL C CG2 1 
ATOM   2329 N  N   . ASN C  1 48  ? 28.405  -22.797 -38.812 1.00 28.18  ? 43  ASN C N   1 
ATOM   2330 C  CA  . ASN C  1 48  ? 28.294  -22.229 -40.154 1.00 24.13  ? 43  ASN C CA  1 
ATOM   2331 C  C   . ASN C  1 48  ? 27.787  -23.249 -41.176 1.00 29.16  ? 43  ASN C C   1 
ATOM   2332 O  O   . ASN C  1 48  ? 28.519  -23.636 -42.087 1.00 32.43  ? 43  ASN C O   1 
ATOM   2333 C  CB  . ASN C  1 48  ? 29.640  -21.656 -40.601 1.00 28.37  ? 43  ASN C CB  1 
ATOM   2334 C  CG  . ASN C  1 48  ? 30.263  -20.750 -39.555 1.00 39.43  ? 43  ASN C CG  1 
ATOM   2335 O  OD1 . ASN C  1 48  ? 29.828  -19.615 -39.357 1.00 41.14  ? 43  ASN C OD1 1 
ATOM   2336 N  ND2 . ASN C  1 48  ? 31.289  -21.251 -38.877 1.00 41.61  ? 43  ASN C ND2 1 
ATOM   2337 N  N   . PRO C  1 49  ? 26.523  -23.679 -41.031 1.00 26.83  ? 44  PRO C N   1 
ATOM   2338 C  CA  . PRO C  1 49  ? 26.001  -24.772 -41.859 1.00 26.22  ? 44  PRO C CA  1 
ATOM   2339 C  C   . PRO C  1 49  ? 25.841  -24.381 -43.324 1.00 26.40  ? 44  PRO C C   1 
ATOM   2340 O  O   . PRO C  1 49  ? 25.356  -23.293 -43.623 1.00 21.74  ? 44  PRO C O   1 
ATOM   2341 C  CB  . PRO C  1 49  ? 24.635  -25.061 -41.229 1.00 26.85  ? 44  PRO C CB  1 
ATOM   2342 C  CG  . PRO C  1 49  ? 24.226  -23.767 -40.617 1.00 24.40  ? 44  PRO C CG  1 
ATOM   2343 C  CD  . PRO C  1 49  ? 25.494  -23.128 -40.131 1.00 22.55  ? 44  PRO C CD  1 
ATOM   2344 N  N   . VAL C  1 50  ? 26.256  -25.269 -44.222 1.00 22.36  ? 45  VAL C N   1 
ATOM   2345 C  CA  . VAL C  1 50  ? 26.074  -25.069 -45.654 1.00 27.09  ? 45  VAL C CA  1 
ATOM   2346 C  C   . VAL C  1 50  ? 25.100  -26.104 -46.212 1.00 29.85  ? 45  VAL C C   1 
ATOM   2347 O  O   . VAL C  1 50  ? 25.414  -27.292 -46.278 1.00 27.06  ? 45  VAL C O   1 
ATOM   2348 C  CB  . VAL C  1 50  ? 27.411  -25.174 -46.410 1.00 25.06  ? 45  VAL C CB  1 
ATOM   2349 C  CG1 . VAL C  1 50  ? 27.191  -25.009 -47.916 1.00 23.99  ? 45  VAL C CG1 1 
ATOM   2350 C  CG2 . VAL C  1 50  ? 28.401  -24.145 -45.880 1.00 22.79  ? 45  VAL C CG2 1 
ATOM   2351 N  N   . TRP C  1 51  ? 23.915  -25.650 -46.608 1.00 20.68  ? 46  TRP C N   1 
ATOM   2352 C  CA  . TRP C  1 51  ? 22.888  -26.549 -47.125 1.00 19.01  ? 46  TRP C CA  1 
ATOM   2353 C  C   . TRP C  1 51  ? 22.987  -26.682 -48.638 1.00 27.08  ? 46  TRP C C   1 
ATOM   2354 O  O   . TRP C  1 51  ? 22.895  -27.786 -49.181 1.00 31.52  ? 46  TRP C O   1 
ATOM   2355 C  CB  . TRP C  1 51  ? 21.493  -26.049 -46.749 1.00 19.95  ? 46  TRP C CB  1 
ATOM   2356 C  CG  . TRP C  1 51  ? 21.259  -25.934 -45.277 1.00 22.93  ? 46  TRP C CG  1 
ATOM   2357 C  CD1 . TRP C  1 51  ? 20.968  -26.948 -44.410 1.00 25.35  ? 46  TRP C CD1 1 
ATOM   2358 C  CD2 . TRP C  1 51  ? 21.282  -24.734 -44.496 1.00 22.56  ? 46  TRP C CD2 1 
ATOM   2359 N  NE1 . TRP C  1 51  ? 20.811  -26.454 -43.138 1.00 23.66  ? 46  TRP C NE1 1 
ATOM   2360 C  CE2 . TRP C  1 51  ? 20.999  -25.096 -43.165 1.00 23.54  ? 46  TRP C CE2 1 
ATOM   2361 C  CE3 . TRP C  1 51  ? 21.511  -23.386 -44.794 1.00 26.31  ? 46  TRP C CE3 1 
ATOM   2362 C  CZ2 . TRP C  1 51  ? 20.945  -24.163 -42.133 1.00 24.54  ? 46  TRP C CZ2 1 
ATOM   2363 C  CZ3 . TRP C  1 51  ? 21.457  -22.462 -43.769 1.00 28.75  ? 46  TRP C CZ3 1 
ATOM   2364 C  CH2 . TRP C  1 51  ? 21.176  -22.855 -42.455 1.00 25.69  ? 46  TRP C CH2 1 
ATOM   2365 N  N   . ASN C  1 52  ? 23.166  -25.546 -49.307 1.00 26.27  ? 47  ASN C N   1 
ATOM   2366 C  CA  . ASN C  1 52  ? 23.256  -25.489 -50.763 1.00 26.85  ? 47  ASN C CA  1 
ATOM   2367 C  C   . ASN C  1 52  ? 22.122  -26.232 -51.475 1.00 23.27  ? 47  ASN C C   1 
ATOM   2368 O  O   . ASN C  1 52  ? 22.365  -27.059 -52.353 1.00 20.11  ? 47  ASN C O   1 
ATOM   2369 C  CB  . ASN C  1 52  ? 24.618  -26.009 -51.245 1.00 31.35  ? 47  ASN C CB  1 
ATOM   2370 C  CG  . ASN C  1 52  ? 24.863  -25.720 -52.716 1.00 34.06  ? 47  ASN C CG  1 
ATOM   2371 O  OD1 . ASN C  1 52  ? 24.400  -24.711 -53.245 1.00 39.18  ? 47  ASN C OD1 1 
ATOM   2372 N  ND2 . ASN C  1 52  ? 25.573  -26.618 -53.389 1.00 27.75  ? 47  ASN C ND2 1 
ATOM   2373 N  N   . GLU C  1 53  ? 20.879  -25.961 -51.095 1.00 21.60  ? 48  GLU C N   1 
ATOM   2374 C  CA  . GLU C  1 53  ? 19.776  -26.595 -51.811 1.00 30.02  ? 48  GLU C CA  1 
ATOM   2375 C  C   . GLU C  1 53  ? 18.755  -25.643 -52.428 1.00 31.47  ? 48  GLU C C   1 
ATOM   2376 O  O   . GLU C  1 53  ? 18.528  -24.532 -51.941 1.00 27.92  ? 48  GLU C O   1 
ATOM   2377 C  CB  . GLU C  1 53  ? 19.098  -27.705 -50.994 1.00 42.53  ? 48  GLU C CB  1 
ATOM   2378 C  CG  . GLU C  1 53  ? 18.965  -27.466 -49.508 1.00 44.51  ? 48  GLU C CG  1 
ATOM   2379 C  CD  . GLU C  1 53  ? 18.565  -28.738 -48.776 1.00 41.19  ? 48  GLU C CD  1 
ATOM   2380 O  OE1 . GLU C  1 53  ? 17.415  -29.194 -48.953 1.00 37.11  ? 48  GLU C OE1 1 
ATOM   2381 O  OE2 . GLU C  1 53  ? 19.407  -29.293 -48.041 1.00 42.82  ? 48  GLU C OE2 1 
ATOM   2382 N  N   . GLY C  1 54  ? 18.159  -26.101 -53.522 1.00 30.06  ? 49  GLY C N   1 
ATOM   2383 C  CA  . GLY C  1 54  ? 17.191  -25.316 -54.257 1.00 22.40  ? 49  GLY C CA  1 
ATOM   2384 C  C   . GLY C  1 54  ? 15.775  -25.754 -53.971 1.00 24.35  ? 49  GLY C C   1 
ATOM   2385 O  O   . GLY C  1 54  ? 15.507  -26.938 -53.764 1.00 22.79  ? 49  GLY C O   1 
ATOM   2386 N  N   . PHE C  1 55  ? 14.867  -24.785 -53.955 1.00 24.69  ? 50  PHE C N   1 
ATOM   2387 C  CA  . PHE C  1 55  ? 13.450  -25.048 -53.762 1.00 22.91  ? 50  PHE C CA  1 
ATOM   2388 C  C   . PHE C  1 55  ? 12.657  -24.311 -54.832 1.00 25.65  ? 50  PHE C C   1 
ATOM   2389 O  O   . PHE C  1 55  ? 13.080  -23.260 -55.310 1.00 21.91  ? 50  PHE C O   1 
ATOM   2390 C  CB  . PHE C  1 55  ? 12.998  -24.577 -52.380 1.00 27.73  ? 50  PHE C CB  1 
ATOM   2391 C  CG  . PHE C  1 55  ? 13.731  -25.228 -51.241 1.00 34.38  ? 50  PHE C CG  1 
ATOM   2392 C  CD1 . PHE C  1 55  ? 13.366  -26.486 -50.793 1.00 35.09  ? 50  PHE C CD1 1 
ATOM   2393 C  CD2 . PHE C  1 55  ? 14.775  -24.573 -50.609 1.00 38.12  ? 50  PHE C CD2 1 
ATOM   2394 C  CE1 . PHE C  1 55  ? 14.034  -27.083 -49.742 1.00 34.67  ? 50  PHE C CE1 1 
ATOM   2395 C  CE2 . PHE C  1 55  ? 15.448  -25.164 -49.556 1.00 31.42  ? 50  PHE C CE2 1 
ATOM   2396 C  CZ  . PHE C  1 55  ? 15.077  -26.420 -49.122 1.00 31.94  ? 50  PHE C CZ  1 
ATOM   2397 N  N   . GLU C  1 56  ? 11.505  -24.858 -55.206 1.00 27.44  ? 51  GLU C N   1 
ATOM   2398 C  CA  . GLU C  1 56  ? 10.652  -24.208 -56.196 1.00 29.07  ? 51  GLU C CA  1 
ATOM   2399 C  C   . GLU C  1 56  ? 9.178   -24.253 -55.811 1.00 29.88  ? 51  GLU C C   1 
ATOM   2400 O  O   . GLU C  1 56  ? 8.648   -25.310 -55.472 1.00 34.55  ? 51  GLU C O   1 
ATOM   2401 C  CB  . GLU C  1 56  ? 10.857  -24.830 -57.580 1.00 37.92  ? 51  GLU C CB  1 
ATOM   2402 C  CG  . GLU C  1 56  ? 12.176  -24.460 -58.239 1.00 46.05  ? 51  GLU C CG  1 
ATOM   2403 C  CD  . GLU C  1 56  ? 12.342  -25.092 -59.606 1.00 58.87  ? 51  GLU C CD  1 
ATOM   2404 O  OE1 . GLU C  1 56  ? 11.528  -25.972 -59.957 1.00 64.86  ? 51  GLU C OE1 1 
ATOM   2405 O  OE2 . GLU C  1 56  ? 13.284  -24.706 -60.331 1.00 63.25  ? 51  GLU C OE2 1 
ATOM   2406 N  N   . TRP C  1 57  ? 8.531   -23.092 -55.856 1.00 27.63  ? 52  TRP C N   1 
ATOM   2407 C  CA  . TRP C  1 57  ? 7.093   -22.981 -55.646 1.00 33.84  ? 52  TRP C CA  1 
ATOM   2408 C  C   . TRP C  1 57  ? 6.406   -22.636 -56.968 1.00 38.85  ? 52  TRP C C   1 
ATOM   2409 O  O   . TRP C  1 57  ? 6.843   -21.726 -57.667 1.00 37.89  ? 52  TRP C O   1 
ATOM   2410 C  CB  . TRP C  1 57  ? 6.789   -21.865 -54.643 1.00 30.80  ? 52  TRP C CB  1 
ATOM   2411 C  CG  . TRP C  1 57  ? 7.089   -22.170 -53.202 1.00 32.27  ? 52  TRP C CG  1 
ATOM   2412 C  CD1 . TRP C  1 57  ? 6.195   -22.563 -52.250 1.00 29.50  ? 52  TRP C CD1 1 
ATOM   2413 C  CD2 . TRP C  1 57  ? 8.360   -22.075 -52.542 1.00 28.76  ? 52  TRP C CD2 1 
ATOM   2414 N  NE1 . TRP C  1 57  ? 6.829   -22.730 -51.043 1.00 30.38  ? 52  TRP C NE1 1 
ATOM   2415 C  CE2 . TRP C  1 57  ? 8.159   -22.436 -51.194 1.00 29.73  ? 52  TRP C CE2 1 
ATOM   2416 C  CE3 . TRP C  1 57  ? 9.648   -21.726 -52.960 1.00 28.20  ? 52  TRP C CE3 1 
ATOM   2417 C  CZ2 . TRP C  1 57  ? 9.196   -22.457 -50.260 1.00 30.11  ? 52  TRP C CZ2 1 
ATOM   2418 C  CZ3 . TRP C  1 57  ? 10.678  -21.749 -52.030 1.00 28.53  ? 52  TRP C CZ3 1 
ATOM   2419 C  CH2 . TRP C  1 57  ? 10.445  -22.113 -50.698 1.00 28.42  ? 52  TRP C CH2 1 
ATOM   2420 N  N   . ASP C  1 58  ? 5.335   -23.351 -57.307 1.00 43.27  ? 53  ASP C N   1 
ATOM   2421 C  CA  . ASP C  1 58  ? 4.500   -22.997 -58.458 1.00 46.38  ? 53  ASP C CA  1 
ATOM   2422 C  C   . ASP C  1 58  ? 3.667   -21.770 -58.075 1.00 43.57  ? 53  ASP C C   1 
ATOM   2423 O  O   . ASP C  1 58  ? 3.140   -21.705 -56.966 1.00 50.30  ? 53  ASP C O   1 
ATOM   2424 C  CB  . ASP C  1 58  ? 3.610   -24.180 -58.856 1.00 54.63  ? 53  ASP C CB  1 
ATOM   2425 C  CG  . ASP C  1 58  ? 2.842   -23.940 -60.152 1.00 65.92  ? 53  ASP C CG  1 
ATOM   2426 O  OD1 . ASP C  1 58  ? 2.354   -22.813 -60.372 1.00 65.38  ? 53  ASP C OD1 1 
ATOM   2427 O  OD2 . ASP C  1 58  ? 2.717   -24.890 -60.954 1.00 72.57  ? 53  ASP C OD2 1 
ATOM   2428 N  N   . LEU C  1 59  ? 3.576   -20.803 -58.972 1.00 55.69  ? 54  LEU C N   1 
ATOM   2429 C  CA  . LEU C  1 59  ? 3.103   -19.449 -58.670 1.00 66.14  ? 54  LEU C CA  1 
ATOM   2430 C  C   . LEU C  1 59  ? 1.697   -18.949 -59.064 1.00 84.64  ? 54  LEU C C   1 
ATOM   2431 O  O   . LEU C  1 59  ? 1.475   -17.745 -59.020 1.00 94.92  ? 54  LEU C O   1 
ATOM   2432 C  CB  . LEU C  1 59  ? 4.086   -18.418 -59.227 1.00 63.64  ? 54  LEU C CB  1 
ATOM   2433 C  CG  . LEU C  1 59  ? 5.238   -17.903 -58.380 1.00 59.29  ? 54  LEU C CG  1 
ATOM   2434 C  CD1 . LEU C  1 59  ? 5.826   -16.684 -59.054 1.00 61.56  ? 54  LEU C CD1 1 
ATOM   2435 C  CD2 . LEU C  1 59  ? 4.788   -17.592 -56.970 1.00 59.32  ? 54  LEU C CD2 1 
ATOM   2436 N  N   . LYS C  1 60  ? 0.760   -19.804 -59.433 1.00 89.90  ? 55  LYS C N   1 
ATOM   2437 C  CA  . LYS C  1 60  ? -0.482  -19.304 -60.029 1.00 102.85 ? 55  LYS C CA  1 
ATOM   2438 C  C   . LYS C  1 60  ? -1.179  -18.235 -59.154 1.00 108.46 ? 55  LYS C C   1 
ATOM   2439 O  O   . LYS C  1 60  ? -1.267  -18.349 -57.932 1.00 110.97 ? 55  LYS C O   1 
ATOM   2440 C  CB  . LYS C  1 60  ? -1.420  -20.463 -60.295 1.00 106.67 ? 55  LYS C CB  1 
ATOM   2441 C  CG  . LYS C  1 60  ? -0.709  -21.753 -60.655 1.00 104.61 ? 55  LYS C CG  1 
ATOM   2442 C  CD  . LYS C  1 60  ? -0.953  -22.160 -62.097 1.00 110.01 ? 55  LYS C CD  1 
ATOM   2443 C  CE  . LYS C  1 60  ? -0.794  -23.659 -62.295 1.00 109.53 ? 55  LYS C CE  1 
ATOM   2444 N  NZ  . LYS C  1 60  ? -1.728  -24.454 -61.455 1.00 111.78 ? 55  LYS C NZ  1 
ATOM   2445 N  N   . GLY C  1 61  ? -1.618  -17.165 -59.803 1.00 112.38 ? 56  GLY C N   1 
ATOM   2446 C  CA  . GLY C  1 61  ? -2.461  -16.157 -59.181 1.00 118.86 ? 56  GLY C CA  1 
ATOM   2447 C  C   . GLY C  1 61  ? -2.163  -15.423 -57.877 1.00 119.52 ? 56  GLY C C   1 
ATOM   2448 O  O   . GLY C  1 61  ? -3.017  -15.450 -56.991 1.00 122.73 ? 56  GLY C O   1 
ATOM   2449 N  N   . ILE C  1 62  ? -1.002  -14.797 -57.696 1.00 116.31 ? 57  ILE C N   1 
ATOM   2450 C  CA  . ILE C  1 62  ? -0.809  -14.145 -56.397 1.00 117.33 ? 57  ILE C CA  1 
ATOM   2451 C  C   . ILE C  1 62  ? -0.341  -12.681 -56.443 1.00 118.83 ? 57  ILE C C   1 
ATOM   2452 O  O   . ILE C  1 62  ? 0.611   -12.337 -57.144 1.00 115.57 ? 57  ILE C O   1 
ATOM   2453 C  CB  . ILE C  1 62  ? 0.127   -14.971 -55.469 1.00 104.06 ? 57  ILE C CB  1 
ATOM   2454 C  CG1 . ILE C  1 62  ? -0.636  -16.146 -54.849 1.00 102.12 ? 57  ILE C CG1 1 
ATOM   2455 C  CG2 . ILE C  1 62  ? 0.726   -14.103 -54.378 1.00 105.55 ? 57  ILE C CG2 1 
ATOM   2456 C  CD1 . ILE C  1 62  ? -0.441  -17.463 -55.582 1.00 95.72  ? 57  ILE C CD1 1 
ATOM   2457 N  N   . PRO C  1 63  ? -1.043  -11.816 -55.698 1.00 125.28 ? 58  PRO C N   1 
ATOM   2458 C  CA  . PRO C  1 63  ? -0.597  -10.466 -55.346 1.00 130.01 ? 58  PRO C CA  1 
ATOM   2459 C  C   . PRO C  1 63  ? 0.740   -10.531 -54.619 1.00 122.27 ? 58  PRO C C   1 
ATOM   2460 O  O   . PRO C  1 63  ? 0.863   -11.197 -53.590 1.00 117.75 ? 58  PRO C O   1 
ATOM   2461 C  CB  . PRO C  1 63  ? -1.688  -9.981  -54.391 1.00 136.71 ? 58  PRO C CB  1 
ATOM   2462 C  CG  . PRO C  1 63  ? -2.902  -10.727 -54.815 1.00 138.11 ? 58  PRO C CG  1 
ATOM   2463 C  CD  . PRO C  1 63  ? -2.424  -12.076 -55.257 1.00 129.33 ? 58  PRO C CD  1 
ATOM   2464 N  N   . LEU C  1 64  ? 1.747   -10.002 -55.293 1.00 122.95 ? 59  LEU C N   1 
ATOM   2465 C  CA  . LEU C  1 64  ? 3.097   -9.952  -54.787 1.00 120.89 ? 59  LEU C CA  1 
ATOM   2466 C  C   . LEU C  1 64  ? 3.360   -8.489  -54.623 1.00 130.11 ? 59  LEU C C   1 
ATOM   2467 O  O   . LEU C  1 64  ? 3.453   -7.747  -55.587 1.00 135.42 ? 59  LEU C O   1 
ATOM   2468 C  CB  . LEU C  1 64  ? 4.031   -10.563 -55.822 1.00 115.13 ? 59  LEU C CB  1 
ATOM   2469 C  CG  . LEU C  1 64  ? 3.439   -11.732 -56.611 1.00 110.68 ? 59  LEU C CG  1 
ATOM   2470 C  CD1 . LEU C  1 64  ? 4.456   -12.302 -57.582 1.00 105.18 ? 59  LEU C CD1 1 
ATOM   2471 C  CD2 . LEU C  1 64  ? 2.902   -12.834 -55.709 1.00 105.08 ? 59  LEU C CD2 1 
ATOM   2472 N  N   . ASP C  1 65  ? 3.204   -7.986  -53.413 1.00 133.82 ? 60  ASP C N   1 
ATOM   2473 C  CA  . ASP C  1 65  ? 2.672   -6.638  -53.306 1.00 145.27 ? 60  ASP C CA  1 
ATOM   2474 C  C   . ASP C  1 65  ? 3.602   -5.409  -53.130 1.00 134.93 ? 60  ASP C C   1 
ATOM   2475 O  O   . ASP C  1 65  ? 3.763   -4.638  -54.080 1.00 140.31 ? 60  ASP C O   1 
ATOM   2476 C  CB  . ASP C  1 65  ? 1.459   -6.627  -52.356 1.00 149.77 ? 60  ASP C CB  1 
ATOM   2477 C  CG  . ASP C  1 65  ? 0.653   -5.337  -52.439 1.00 160.64 ? 60  ASP C CG  1 
ATOM   2478 O  OD1 . ASP C  1 65  ? -0.602  -5.399  -52.512 1.00 165.96 ? 60  ASP C OD1 1 
ATOM   2479 O  OD2 . ASP C  1 65  ? 1.271   -4.252  -52.393 1.00 163.76 ? 60  ASP C OD2 1 
ATOM   2480 N  N   . GLN C  1 66  ? 4.246   -5.206  -51.989 1.00 130.23 ? 61  GLN C N   1 
ATOM   2481 C  CA  . GLN C  1 66  ? 4.223   -6.059  -50.834 1.00 121.20 ? 61  GLN C CA  1 
ATOM   2482 C  C   . GLN C  1 66  ? 2.958   -6.052  -49.998 1.00 124.61 ? 61  GLN C C   1 
ATOM   2483 O  O   . GLN C  1 66  ? 2.105   -5.180  -50.166 1.00 137.59 ? 61  GLN C O   1 
ATOM   2484 C  CB  . GLN C  1 66  ? 5.380   -5.713  -49.927 1.00 118.80 ? 61  GLN C CB  1 
ATOM   2485 C  CG  . GLN C  1 66  ? 6.667   -5.705  -50.686 1.00 115.35 ? 61  GLN C CG  1 
ATOM   2486 C  CD  . GLN C  1 66  ? 7.092   -7.100  -51.086 1.00 104.96 ? 61  GLN C CD  1 
ATOM   2487 O  OE1 . GLN C  1 66  ? 8.206   -7.491  -50.839 1.00 83.97  ? 61  GLN C OE1 1 
ATOM   2488 N  NE2 . GLN C  1 66  ? 6.198   -7.841  -51.717 1.00 105.42 ? 61  GLN C NE2 1 
ATOM   2489 N  N   . GLY C  1 67  ? 2.803   -7.065  -49.144 1.00 114.34 ? 62  GLY C N   1 
ATOM   2490 C  CA  . GLY C  1 67  ? 3.907   -7.899  -48.695 1.00 103.05 ? 62  GLY C CA  1 
ATOM   2491 C  C   . GLY C  1 67  ? 3.703   -9.375  -48.857 1.00 95.81  ? 62  GLY C C   1 
ATOM   2492 O  O   . GLY C  1 67  ? 3.508   -10.098 -47.885 1.00 97.74  ? 62  GLY C O   1 
ATOM   2493 N  N   . SER C  1 68  ? 3.775   -9.841  -50.093 1.00 89.48  ? 63  SER C N   1 
ATOM   2494 C  CA  . SER C  1 68  ? 3.943   -11.246 -50.294 1.00 83.20  ? 63  SER C CA  1 
ATOM   2495 C  C   . SER C  1 68  ? 5.383   -11.430 -49.896 1.00 77.18  ? 63  SER C C   1 
ATOM   2496 O  O   . SER C  1 68  ? 6.248   -10.691 -50.346 1.00 73.91  ? 63  SER C O   1 
ATOM   2497 C  CB  . SER C  1 68  ? 3.765   -11.621 -51.735 1.00 83.92  ? 63  SER C CB  1 
ATOM   2498 O  OG  . SER C  1 68  ? 3.878   -13.011 -51.876 1.00 78.84  ? 63  SER C OG  1 
ATOM   2499 N  N   . GLU C  1 69  ? 5.634   -12.379 -49.014 1.00 68.45  ? 64  GLU C N   1 
ATOM   2500 C  CA  . GLU C  1 69  ? 6.984   -12.507 -48.492 1.00 63.64  ? 64  GLU C CA  1 
ATOM   2501 C  C   . GLU C  1 69  ? 7.450   -13.949 -48.440 1.00 56.63  ? 64  GLU C C   1 
ATOM   2502 O  O   . GLU C  1 69  ? 6.645   -14.870 -48.316 1.00 56.00  ? 64  GLU C O   1 
ATOM   2503 C  CB  . GLU C  1 69  ? 7.075   -11.879 -47.102 1.00 69.75  ? 64  GLU C CB  1 
ATOM   2504 C  CG  . GLU C  1 69  ? 7.743   -10.518 -47.085 1.00 80.08  ? 64  GLU C CG  1 
ATOM   2505 C  CD  . GLU C  1 69  ? 7.284   -9.659  -45.924 1.00 90.90  ? 64  GLU C CD  1 
ATOM   2506 O  OE1 . GLU C  1 69  ? 6.203   -9.946  -45.368 1.00 95.28  ? 64  GLU C OE1 1 
ATOM   2507 O  OE2 . GLU C  1 69  ? 8.001   -8.697  -45.570 1.00 94.23  ? 64  GLU C OE2 1 
ATOM   2508 N  N   . LEU C  1 70  ? 8.759   -14.133 -48.559 1.00 52.21  ? 65  LEU C N   1 
ATOM   2509 C  CA  . LEU C  1 70  ? 9.368   -15.415 -48.268 1.00 46.10  ? 65  LEU C CA  1 
ATOM   2510 C  C   . LEU C  1 70  ? 9.751   -15.402 -46.800 1.00 45.48  ? 65  LEU C C   1 
ATOM   2511 O  O   . LEU C  1 70  ? 10.548  -14.571 -46.364 1.00 51.04  ? 65  LEU C O   1 
ATOM   2512 C  CB  . LEU C  1 70  ? 10.609  -15.645 -49.131 1.00 42.22  ? 65  LEU C CB  1 
ATOM   2513 C  CG  . LEU C  1 70  ? 11.354  -16.952 -48.841 1.00 36.36  ? 65  LEU C CG  1 
ATOM   2514 C  CD1 . LEU C  1 70  ? 10.447  -18.148 -49.096 1.00 35.86  ? 65  LEU C CD1 1 
ATOM   2515 C  CD2 . LEU C  1 70  ? 12.626  -17.051 -49.670 1.00 33.52  ? 65  LEU C CD2 1 
ATOM   2516 N  N   . HIS C  1 71  ? 9.162   -16.306 -46.031 1.00 44.53  ? 66  HIS C N   1 
ATOM   2517 C  CA  . HIS C  1 71  ? 9.476   -16.400 -44.617 1.00 44.27  ? 66  HIS C CA  1 
ATOM   2518 C  C   . HIS C  1 71  ? 10.457  -17.538 -44.402 1.00 38.59  ? 66  HIS C C   1 
ATOM   2519 O  O   . HIS C  1 71  ? 10.146  -18.692 -44.692 1.00 38.85  ? 66  HIS C O   1 
ATOM   2520 C  CB  . HIS C  1 71  ? 8.211   -16.639 -43.796 1.00 47.95  ? 66  HIS C CB  1 
ATOM   2521 C  CG  . HIS C  1 71  ? 8.419   -16.497 -42.322 1.00 59.18  ? 66  HIS C CG  1 
ATOM   2522 N  ND1 . HIS C  1 71  ? 7.512   -16.952 -41.390 1.00 65.22  ? 66  HIS C ND1 1 
ATOM   2523 C  CD2 . HIS C  1 71  ? 9.436   -15.944 -41.620 1.00 55.35  ? 66  HIS C CD2 1 
ATOM   2524 C  CE1 . HIS C  1 71  ? 7.963   -16.688 -40.176 1.00 63.98  ? 66  HIS C CE1 1 
ATOM   2525 N  NE2 . HIS C  1 71  ? 9.128   -16.076 -40.289 1.00 60.04  ? 66  HIS C NE2 1 
ATOM   2526 N  N   . VAL C  1 72  ? 11.645  -17.212 -43.903 1.00 36.88  ? 67  VAL C N   1 
ATOM   2527 C  CA  . VAL C  1 72  ? 12.654  -18.229 -43.633 1.00 32.13  ? 67  VAL C CA  1 
ATOM   2528 C  C   . VAL C  1 72  ? 13.019  -18.278 -42.158 1.00 32.96  ? 67  VAL C C   1 
ATOM   2529 O  O   . VAL C  1 72  ? 13.293  -17.251 -41.536 1.00 35.07  ? 67  VAL C O   1 
ATOM   2530 C  CB  . VAL C  1 72  ? 13.932  -18.014 -44.458 1.00 43.76  ? 67  VAL C CB  1 
ATOM   2531 C  CG1 . VAL C  1 72  ? 14.980  -19.035 -44.053 1.00 44.43  ? 67  VAL C CG1 1 
ATOM   2532 C  CG2 . VAL C  1 72  ? 13.623  -18.123 -45.937 1.00 29.02  ? 67  VAL C CG2 1 
ATOM   2533 N  N   . VAL C  1 73  ? 13.012  -19.484 -41.603 1.00 33.13  ? 68  VAL C N   1 
ATOM   2534 C  CA  . VAL C  1 73  ? 13.312  -19.678 -40.197 1.00 32.15  ? 68  VAL C CA  1 
ATOM   2535 C  C   . VAL C  1 73  ? 14.390  -20.738 -40.005 1.00 34.52  ? 68  VAL C C   1 
ATOM   2536 O  O   . VAL C  1 73  ? 14.278  -21.851 -40.520 1.00 35.25  ? 68  VAL C O   1 
ATOM   2537 C  CB  . VAL C  1 73  ? 12.052  -20.086 -39.420 1.00 35.78  ? 68  VAL C CB  1 
ATOM   2538 C  CG1 . VAL C  1 73  ? 12.402  -20.424 -37.982 1.00 35.50  ? 68  VAL C CG1 1 
ATOM   2539 C  CG2 . VAL C  1 73  ? 11.014  -18.973 -39.479 1.00 44.27  ? 68  VAL C CG2 1 
ATOM   2540 N  N   . VAL C  1 74  ? 15.437  -20.383 -39.270 1.00 32.49  ? 69  VAL C N   1 
ATOM   2541 C  CA  . VAL C  1 74  ? 16.476  -21.343 -38.925 1.00 32.52  ? 69  VAL C CA  1 
ATOM   2542 C  C   . VAL C  1 74  ? 16.187  -21.951 -37.558 1.00 30.87  ? 69  VAL C C   1 
ATOM   2543 O  O   . VAL C  1 74  ? 15.929  -21.236 -36.587 1.00 30.26  ? 69  VAL C O   1 
ATOM   2544 C  CB  . VAL C  1 74  ? 17.874  -20.700 -38.923 1.00 31.71  ? 69  VAL C CB  1 
ATOM   2545 C  CG1 . VAL C  1 74  ? 18.943  -21.755 -38.645 1.00 22.26  ? 69  VAL C CG1 1 
ATOM   2546 C  CG2 . VAL C  1 74  ? 18.133  -20.010 -40.254 1.00 21.78  ? 69  VAL C CG2 1 
ATOM   2547 N  N   . LYS C  1 75  ? 16.220  -23.277 -37.495 1.00 33.60  ? 70  LYS C N   1 
ATOM   2548 C  CA  . LYS C  1 75  ? 15.909  -23.992 -36.267 1.00 34.88  ? 70  LYS C CA  1 
ATOM   2549 C  C   . LYS C  1 75  ? 16.991  -25.006 -35.922 1.00 30.53  ? 70  LYS C C   1 
ATOM   2550 O  O   . LYS C  1 75  ? 17.713  -25.480 -36.794 1.00 28.15  ? 70  LYS C O   1 
ATOM   2551 C  CB  . LYS C  1 75  ? 14.572  -24.726 -36.398 1.00 38.77  ? 70  LYS C CB  1 
ATOM   2552 C  CG  . LYS C  1 75  ? 13.343  -23.838 -36.476 1.00 50.42  ? 70  LYS C CG  1 
ATOM   2553 C  CD  . LYS C  1 75  ? 12.117  -24.676 -36.815 1.00 52.16  ? 70  LYS C CD  1 
ATOM   2554 C  CE  . LYS C  1 75  ? 10.827  -23.876 -36.757 1.00 60.31  ? 70  LYS C CE  1 
ATOM   2555 N  NZ  . LYS C  1 75  ? 10.372  -23.650 -35.357 1.00 63.79  ? 70  LYS C NZ  1 
ATOM   2556 N  N   . ASP C  1 76  ? 17.092  -25.342 -34.643 1.00 37.51  ? 71  ASP C N   1 
ATOM   2557 C  CA  . ASP C  1 76  ? 17.960  -26.426 -34.208 1.00 33.47  ? 71  ASP C CA  1 
ATOM   2558 C  C   . ASP C  1 76  ? 17.167  -27.733 -34.242 1.00 36.02  ? 71  ASP C C   1 
ATOM   2559 O  O   . ASP C  1 76  ? 16.262  -27.916 -33.435 1.00 42.88  ? 71  ASP C O   1 
ATOM   2560 C  CB  . ASP C  1 76  ? 18.447  -26.148 -32.781 1.00 39.99  ? 71  ASP C CB  1 
ATOM   2561 C  CG  . ASP C  1 76  ? 19.513  -27.127 -32.320 1.00 44.16  ? 71  ASP C CG  1 
ATOM   2562 O  OD1 . ASP C  1 76  ? 20.242  -27.667 -33.177 1.00 42.62  ? 71  ASP C OD1 1 
ATOM   2563 O  OD2 . ASP C  1 76  ? 19.627  -27.348 -31.096 1.00 48.31  ? 71  ASP C OD2 1 
ATOM   2564 N  N   . HIS C  1 77  ? 17.520  -28.692 -35.071 1.00 73.87  ? 72  HIS C N   1 
ATOM   2565 C  CA  . HIS C  1 77  ? 16.896  -29.998 -34.966 1.00 70.89  ? 72  HIS C CA  1 
ATOM   2566 C  C   . HIS C  1 77  ? 17.714  -30.845 -34.026 1.00 76.93  ? 72  HIS C C   1 
ATOM   2567 O  O   . HIS C  1 77  ? 18.199  -31.905 -34.373 1.00 77.21  ? 72  HIS C O   1 
ATOM   2568 C  CB  . HIS C  1 77  ? 16.801  -30.663 -36.326 1.00 95.50  ? 72  HIS C CB  1 
ATOM   2569 C  CG  . HIS C  1 77  ? 16.307  -32.073 -36.282 1.00 70.39  ? 72  HIS C CG  1 
ATOM   2570 N  ND1 . HIS C  1 77  ? 15.292  -32.475 -35.453 1.00 89.41  ? 72  HIS C ND1 1 
ATOM   2571 C  CD2 . HIS C  1 77  ? 16.717  -33.179 -36.938 1.00 83.12  ? 72  HIS C CD2 1 
ATOM   2572 C  CE1 . HIS C  1 77  ? 15.084  -33.768 -35.608 1.00 90.75  ? 72  HIS C CE1 1 
ATOM   2573 N  NE2 . HIS C  1 77  ? 15.936  -34.219 -36.504 1.00 86.64  ? 72  HIS C NE2 1 
ATOM   2574 N  N   . GLU C  1 78  ? 17.900  -30.350 -32.832 1.00 83.76  ? 73  GLU C N   1 
ATOM   2575 C  CA  . GLU C  1 78  ? 18.657  -31.066 -31.847 1.00 99.08  ? 73  GLU C CA  1 
ATOM   2576 C  C   . GLU C  1 78  ? 17.645  -31.075 -30.722 1.00 114.94 ? 73  GLU C C   1 
ATOM   2577 O  O   . GLU C  1 78  ? 16.833  -32.006 -30.615 1.00 116.78 ? 73  GLU C O   1 
ATOM   2578 C  CB  . GLU C  1 78  ? 19.952  -30.312 -31.501 1.00 99.02  ? 73  GLU C CB  1 
ATOM   2579 C  CG  . GLU C  1 78  ? 20.878  -30.952 -30.472 1.00 107.56 ? 73  GLU C CG  1 
ATOM   2580 C  CD  . GLU C  1 78  ? 21.050  -32.451 -30.637 1.00 111.66 ? 73  GLU C CD  1 
ATOM   2581 O  OE1 . GLU C  1 78  ? 20.100  -33.172 -30.307 1.00 116.74 ? 73  GLU C OE1 1 
ATOM   2582 O  OE2 . GLU C  1 78  ? 22.136  -32.902 -31.070 1.00 110.58 ? 73  GLU C OE2 1 
ATOM   2583 N  N   . THR C  1 79  ? 17.578  -29.953 -30.013 1.00 123.26 ? 74  THR C N   1 
ATOM   2584 C  CA  . THR C  1 79  ? 16.748  -29.835 -28.846 1.00 136.05 ? 74  THR C CA  1 
ATOM   2585 C  C   . THR C  1 79  ? 15.385  -29.657 -29.458 1.00 141.51 ? 74  THR C C   1 
ATOM   2586 O  O   . THR C  1 79  ? 14.760  -28.598 -29.367 1.00 143.10 ? 74  THR C O   1 
ATOM   2587 C  CB  . THR C  1 79  ? 17.118  -28.565 -28.057 1.00 136.46 ? 74  THR C CB  1 
ATOM   2588 O  OG1 . THR C  1 79  ? 16.883  -27.423 -28.876 1.00 130.44 ? 74  THR C OG1 1 
ATOM   2589 C  CG2 . THR C  1 79  ? 18.582  -28.576 -27.646 1.00 135.24 ? 74  THR C CG2 1 
ATOM   2590 N  N   . MET C  1 80  ? 14.924  -30.728 -30.096 1.00 144.95 ? 75  MET C N   1 
ATOM   2591 C  CA  . MET C  1 80  ? 13.800  -30.628 -31.010 1.00 145.65 ? 75  MET C CA  1 
ATOM   2592 C  C   . MET C  1 80  ? 12.441  -30.638 -30.300 1.00 152.18 ? 75  MET C C   1 
ATOM   2593 O  O   . MET C  1 80  ? 11.410  -30.907 -30.914 1.00 153.11 ? 75  MET C O   1 
ATOM   2594 C  CB  . MET C  1 80  ? 13.907  -31.650 -32.145 1.00 142.62 ? 75  MET C CB  1 
ATOM   2595 C  CG  . MET C  1 80  ? 13.721  -33.087 -31.734 1.00 147.53 ? 75  MET C CG  1 
ATOM   2596 S  SD  . MET C  1 80  ? 12.969  -33.997 -33.088 1.00 146.73 ? 75  MET C SD  1 
ATOM   2597 C  CE  . MET C  1 80  ? 11.596  -32.928 -33.504 1.00 112.93 ? 75  MET C CE  1 
ATOM   2598 N  N   . GLY C  1 81  ? 12.502  -30.558 -28.982 1.00 156.49 ? 76  GLY C N   1 
ATOM   2599 C  CA  . GLY C  1 81  ? 11.376  -30.234 -28.143 1.00 162.46 ? 76  GLY C CA  1 
ATOM   2600 C  C   . GLY C  1 81  ? 11.730  -29.047 -27.263 1.00 162.33 ? 76  GLY C C   1 
ATOM   2601 O  O   . GLY C  1 81  ? 10.869  -28.512 -26.562 1.00 169.44 ? 76  GLY C O   1 
ATOM   2602 N  N   . ARG C  1 82  ? 13.011  -28.665 -27.269 1.00 153.33 ? 77  ARG C N   1 
ATOM   2603 C  CA  . ARG C  1 82  ? 13.496  -27.516 -26.508 1.00 148.82 ? 77  ARG C CA  1 
ATOM   2604 C  C   . ARG C  1 82  ? 14.391  -26.588 -27.324 1.00 136.76 ? 77  ARG C C   1 
ATOM   2605 O  O   . ARG C  1 82  ? 15.327  -27.048 -27.992 1.00 132.74 ? 77  ARG C O   1 
ATOM   2606 C  CB  . ARG C  1 82  ? 14.244  -27.965 -25.249 1.00 151.37 ? 77  ARG C CB  1 
ATOM   2607 C  CG  . ARG C  1 82  ? 14.784  -26.801 -24.420 1.00 149.65 ? 77  ARG C CG  1 
ATOM   2608 C  CD  . ARG C  1 82  ? 14.760  -27.054 -22.916 1.00 156.43 ? 77  ARG C CD  1 
ATOM   2609 N  NE  . ARG C  1 82  ? 13.608  -27.833 -22.478 1.00 161.86 ? 77  ARG C NE  1 
ATOM   2610 C  CZ  . ARG C  1 82  ? 12.582  -27.326 -21.807 1.00 167.16 ? 77  ARG C CZ  1 
ATOM   2611 N  NH1 . ARG C  1 82  ? 12.561  -26.043 -21.496 1.00 166.28 ? 77  ARG C NH1 1 
ATOM   2612 N  NH2 . ARG C  1 82  ? 11.582  -28.107 -21.443 1.00 174.35 ? 77  ARG C NH2 1 
ATOM   2613 N  N   . ASN C  1 83  ? 14.102  -25.290 -27.254 1.00 131.11 ? 78  ASN C N   1 
ATOM   2614 C  CA  . ASN C  1 83  ? 14.929  -24.227 -27.848 1.00 118.74 ? 78  ASN C CA  1 
ATOM   2615 C  C   . ASN C  1 83  ? 15.216  -24.394 -29.335 1.00 106.88 ? 78  ASN C C   1 
ATOM   2616 O  O   . ASN C  1 83  ? 16.303  -24.135 -29.804 1.00 97.94  ? 78  ASN C O   1 
ATOM   2617 C  CB  . ASN C  1 83  ? 16.198  -24.004 -27.038 1.00 117.02 ? 78  ASN C CB  1 
ATOM   2618 C  CG  . ASN C  1 83  ? 15.945  -23.161 -25.812 1.00 121.46 ? 78  ASN C CG  1 
ATOM   2619 O  OD1 . ASN C  1 83  ? 15.278  -22.147 -25.884 1.00 104.85 ? 78  ASN C OD1 1 
ATOM   2620 N  ND2 . ASN C  1 83  ? 16.470  -23.587 -24.679 1.00 108.21 ? 78  ASN C ND2 1 
ATOM   2621 N  N   . ARG C  1 84  ? 14.200  -24.850 -30.045 1.00 107.13 ? 79  ARG C N   1 
ATOM   2622 C  CA  . ARG C  1 84  ? 14.243  -25.099 -31.463 1.00 98.68  ? 79  ARG C CA  1 
ATOM   2623 C  C   . ARG C  1 84  ? 14.456  -23.849 -32.350 1.00 94.13  ? 79  ARG C C   1 
ATOM   2624 O  O   . ARG C  1 84  ? 15.213  -23.917 -33.294 1.00 74.90  ? 79  ARG C O   1 
ATOM   2625 C  CB  . ARG C  1 84  ? 12.974  -25.848 -31.857 1.00 88.24  ? 79  ARG C CB  1 
ATOM   2626 C  CG  . ARG C  1 84  ? 13.118  -26.707 -33.077 1.00 83.44  ? 79  ARG C CG  1 
ATOM   2627 C  CD  . ARG C  1 84  ? 12.905  -28.172 -32.825 1.00 95.65  ? 79  ARG C CD  1 
ATOM   2628 N  NE  . ARG C  1 84  ? 12.012  -28.707 -33.827 1.00 97.81  ? 79  ARG C NE  1 
ATOM   2629 C  CZ  . ARG C  1 84  ? 12.388  -29.445 -34.862 1.00 94.23  ? 79  ARG C CZ  1 
ATOM   2630 N  NH1 . ARG C  1 84  ? 13.650  -29.756 -35.026 1.00 90.61  ? 79  ARG C NH1 1 
ATOM   2631 N  NH2 . ARG C  1 84  ? 11.495  -29.889 -35.726 1.00 95.33  ? 79  ARG C NH2 1 
ATOM   2632 N  N   . PHE C  1 85  ? 13.802  -22.731 -32.041 1.00 40.17  ? 80  PHE C N   1 
ATOM   2633 C  CA  . PHE C  1 85  ? 13.887  -21.535 -32.869 1.00 41.35  ? 80  PHE C CA  1 
ATOM   2634 C  C   . PHE C  1 85  ? 15.230  -20.852 -32.634 1.00 37.84  ? 80  PHE C C   1 
ATOM   2635 O  O   . PHE C  1 85  ? 15.651  -20.684 -31.490 1.00 46.58  ? 80  PHE C O   1 
ATOM   2636 C  CB  . PHE C  1 85  ? 12.729  -20.583 -32.542 1.00 39.22  ? 80  PHE C CB  1 
ATOM   2637 C  CG  . PHE C  1 85  ? 12.746  -19.296 -33.328 1.00 42.64  ? 80  PHE C CG  1 
ATOM   2638 C  CD1 . PHE C  1 85  ? 13.475  -18.204 -32.884 1.00 45.81  ? 80  PHE C CD1 1 
ATOM   2639 C  CD2 . PHE C  1 85  ? 12.015  -19.171 -34.497 1.00 41.84  ? 80  PHE C CD2 1 
ATOM   2640 C  CE1 . PHE C  1 85  ? 13.487  -17.020 -33.598 1.00 44.94  ? 80  PHE C CE1 1 
ATOM   2641 C  CE2 . PHE C  1 85  ? 12.023  -17.990 -35.213 1.00 43.08  ? 80  PHE C CE2 1 
ATOM   2642 C  CZ  . PHE C  1 85  ? 12.761  -16.914 -34.763 1.00 42.84  ? 80  PHE C CZ  1 
ATOM   2643 N  N   . LEU C  1 86  ? 15.905  -20.470 -33.715 1.00 34.21  ? 81  LEU C N   1 
ATOM   2644 C  CA  . LEU C  1 86  ? 17.210  -19.822 -33.609 1.00 34.12  ? 81  LEU C CA  1 
ATOM   2645 C  C   . LEU C  1 86  ? 17.210  -18.424 -34.214 1.00 36.31  ? 81  LEU C C   1 
ATOM   2646 O  O   . LEU C  1 86  ? 17.943  -17.544 -33.766 1.00 39.31  ? 81  LEU C O   1 
ATOM   2647 C  CB  . LEU C  1 86  ? 18.292  -20.667 -34.282 1.00 32.41  ? 81  LEU C CB  1 
ATOM   2648 C  CG  . LEU C  1 86  ? 18.458  -22.089 -33.749 1.00 31.73  ? 81  LEU C CG  1 
ATOM   2649 C  CD1 . LEU C  1 86  ? 19.695  -22.734 -34.338 1.00 33.36  ? 81  LEU C CD1 1 
ATOM   2650 C  CD2 . LEU C  1 86  ? 18.514  -22.086 -32.228 1.00 32.23  ? 81  LEU C CD2 1 
ATOM   2651 N  N   . GLY C  1 87  ? 16.394  -18.226 -35.242 1.00 31.90  ? 82  GLY C N   1 
ATOM   2652 C  CA  . GLY C  1 87  ? 16.347  -16.948 -35.921 1.00 31.66  ? 82  GLY C CA  1 
ATOM   2653 C  C   . GLY C  1 87  ? 15.522  -16.985 -37.189 1.00 32.04  ? 82  GLY C C   1 
ATOM   2654 O  O   . GLY C  1 87  ? 15.326  -18.043 -37.789 1.00 28.33  ? 82  GLY C O   1 
ATOM   2655 N  N   . GLU C  1 88  ? 15.032  -15.823 -37.605 1.00 31.21  ? 83  GLU C N   1 
ATOM   2656 C  CA  . GLU C  1 88  ? 14.215  -15.751 -38.808 1.00 33.36  ? 83  GLU C CA  1 
ATOM   2657 C  C   . GLU C  1 88  ? 14.500  -14.514 -39.648 1.00 30.51  ? 83  GLU C C   1 
ATOM   2658 O  O   . GLU C  1 88  ? 14.980  -13.497 -39.148 1.00 32.85  ? 83  GLU C O   1 
ATOM   2659 C  CB  . GLU C  1 88  ? 12.726  -15.817 -38.459 1.00 31.65  ? 83  GLU C CB  1 
ATOM   2660 C  CG  . GLU C  1 88  ? 12.263  -14.749 -37.486 1.00 38.45  ? 83  GLU C CG  1 
ATOM   2661 C  CD  . GLU C  1 88  ? 10.789  -14.878 -37.153 1.00 57.58  ? 83  GLU C CD  1 
ATOM   2662 O  OE1 . GLU C  1 88  ? 9.996   -15.155 -38.077 1.00 63.47  ? 83  GLU C OE1 1 
ATOM   2663 O  OE2 . GLU C  1 88  ? 10.424  -14.715 -35.969 1.00 62.92  ? 83  GLU C OE2 1 
ATOM   2664 N  N   . ALA C  1 89  ? 14.198  -14.620 -40.936 1.00 32.26  ? 84  ALA C N   1 
ATOM   2665 C  CA  . ALA C  1 89  ? 14.328  -13.505 -41.856 1.00 33.76  ? 84  ALA C CA  1 
ATOM   2666 C  C   . ALA C  1 89  ? 13.099  -13.454 -42.749 1.00 37.46  ? 84  ALA C C   1 
ATOM   2667 O  O   . ALA C  1 89  ? 12.579  -14.488 -43.165 1.00 38.93  ? 84  ALA C O   1 
ATOM   2668 C  CB  . ALA C  1 89  ? 15.587  -13.653 -42.696 1.00 37.54  ? 84  ALA C CB  1 
ATOM   2669 N  N   . LYS C  1 90  ? 12.624  -12.248 -43.027 1.00 45.30  ? 85  LYS C N   1 
ATOM   2670 C  CA  . LYS C  1 90  ? 11.530  -12.075 -43.968 1.00 45.74  ? 85  LYS C CA  1 
ATOM   2671 C  C   . LYS C  1 90  ? 12.052  -11.422 -45.233 1.00 41.36  ? 85  LYS C C   1 
ATOM   2672 O  O   . LYS C  1 90  ? 12.609  -10.328 -45.193 1.00 45.44  ? 85  LYS C O   1 
ATOM   2673 C  CB  . LYS C  1 90  ? 10.407  -11.242 -43.353 1.00 54.38  ? 85  LYS C CB  1 
ATOM   2674 C  CG  . LYS C  1 90  ? 9.513   -12.024 -42.408 1.00 60.50  ? 85  LYS C CG  1 
ATOM   2675 C  CD  . LYS C  1 90  ? 8.435   -11.139 -41.810 1.00 70.78  ? 85  LYS C CD  1 
ATOM   2676 C  CE  . LYS C  1 90  ? 7.251   -11.977 -41.380 1.00 77.16  ? 85  LYS C CE  1 
ATOM   2677 N  NZ  . LYS C  1 90  ? 6.862   -12.895 -42.488 1.00 79.33  ? 85  LYS C NZ  1 
ATOM   2678 N  N   . VAL C  1 91  ? 11.886  -12.111 -46.355 1.00 35.96  ? 86  VAL C N   1 
ATOM   2679 C  CA  . VAL C  1 91  ? 12.358  -11.604 -47.632 1.00 41.15  ? 86  VAL C CA  1 
ATOM   2680 C  C   . VAL C  1 91  ? 11.210  -11.004 -48.427 1.00 41.70  ? 86  VAL C C   1 
ATOM   2681 O  O   . VAL C  1 91  ? 10.360  -11.728 -48.943 1.00 33.73  ? 86  VAL C O   1 
ATOM   2682 C  CB  . VAL C  1 91  ? 13.012  -12.711 -48.465 1.00 50.01  ? 86  VAL C CB  1 
ATOM   2683 C  CG1 . VAL C  1 91  ? 13.481  -12.154 -49.795 1.00 54.50  ? 86  VAL C CG1 1 
ATOM   2684 C  CG2 . VAL C  1 91  ? 14.167  -13.337 -47.697 1.00 49.18  ? 86  VAL C CG2 1 
ATOM   2685 N  N   . PRO C  1 92  ? 11.178  -9.669  -48.520 1.00 46.41  ? 87  PRO C N   1 
ATOM   2686 C  CA  . PRO C  1 92  ? 10.137  -8.997  -49.299 1.00 46.31  ? 87  PRO C CA  1 
ATOM   2687 C  C   . PRO C  1 92  ? 10.312  -9.259  -50.795 1.00 42.28  ? 87  PRO C C   1 
ATOM   2688 O  O   . PRO C  1 92  ? 11.384  -9.001  -51.340 1.00 47.98  ? 87  PRO C O   1 
ATOM   2689 C  CB  . PRO C  1 92  ? 10.356  -7.517  -48.967 1.00 48.37  ? 87  PRO C CB  1 
ATOM   2690 C  CG  . PRO C  1 92  ? 11.781  -7.423  -48.565 1.00 46.22  ? 87  PRO C CG  1 
ATOM   2691 C  CD  . PRO C  1 92  ? 12.104  -8.716  -47.886 1.00 44.92  ? 87  PRO C CD  1 
ATOM   2692 N  N   . LEU C  1 93  ? 9.267   -9.763  -51.447 1.00 36.81  ? 88  LEU C N   1 
ATOM   2693 C  CA  . LEU C  1 93  ? 9.362   -10.157 -52.854 1.00 44.89  ? 88  LEU C CA  1 
ATOM   2694 C  C   . LEU C  1 93  ? 9.377   -9.020  -53.891 1.00 48.30  ? 88  LEU C C   1 
ATOM   2695 O  O   . LEU C  1 93  ? 9.781   -9.250  -55.031 1.00 50.40  ? 88  LEU C O   1 
ATOM   2696 C  CB  . LEU C  1 93  ? 8.291   -11.192 -53.222 1.00 50.94  ? 88  LEU C CB  1 
ATOM   2697 C  CG  . LEU C  1 93  ? 8.641   -12.678 -53.052 1.00 58.32  ? 88  LEU C CG  1 
ATOM   2698 C  CD1 . LEU C  1 93  ? 10.149  -12.917 -53.031 1.00 56.92  ? 88  LEU C CD1 1 
ATOM   2699 C  CD2 . LEU C  1 93  ? 7.991   -13.254 -51.811 1.00 59.74  ? 88  LEU C CD2 1 
ATOM   2700 N  N   . ARG C  1 94  ? 8.943   -7.812  -53.526 1.00 43.79  ? 89  ARG C N   1 
ATOM   2701 C  CA  . ARG C  1 94  ? 9.053   -6.682  -54.462 1.00 42.39  ? 89  ARG C CA  1 
ATOM   2702 C  C   . ARG C  1 94  ? 10.514  -6.359  -54.705 1.00 36.50  ? 89  ARG C C   1 
ATOM   2703 O  O   . ARG C  1 94  ? 10.867  -5.753  -55.713 1.00 35.61  ? 89  ARG C O   1 
ATOM   2704 C  CB  . ARG C  1 94  ? 8.323   -5.421  -53.976 1.00 48.38  ? 89  ARG C CB  1 
ATOM   2705 C  CG  . ARG C  1 94  ? 8.739   -4.919  -52.600 1.00 57.52  ? 89  ARG C CG  1 
ATOM   2706 C  CD  . ARG C  1 94  ? 9.824   -3.851  -52.543 1.00 65.67  ? 89  ARG C CD  1 
ATOM   2707 N  NE  . ARG C  1 94  ? 10.461  -3.877  -51.224 1.00 67.40  ? 89  ARG C NE  1 
ATOM   2708 C  CZ  . ARG C  1 94  ? 9.891   -3.450  -50.099 1.00 67.98  ? 89  ARG C CZ  1 
ATOM   2709 N  NH1 . ARG C  1 94  ? 8.668   -2.937  -50.118 1.00 69.53  ? 89  ARG C NH1 1 
ATOM   2710 N  NH2 . ARG C  1 94  ? 10.548  -3.532  -48.948 1.00 64.00  ? 89  ARG C NH2 1 
ATOM   2711 N  N   . GLU C  1 95  ? 11.357  -6.760  -53.763 1.00 39.73  ? 90  GLU C N   1 
ATOM   2712 C  CA  . GLU C  1 95  ? 12.790  -6.582  -53.903 1.00 50.37  ? 90  GLU C CA  1 
ATOM   2713 C  C   . GLU C  1 95  ? 13.297  -7.475  -55.031 1.00 45.55  ? 90  GLU C C   1 
ATOM   2714 O  O   . GLU C  1 95  ? 14.242  -7.124  -55.735 1.00 43.09  ? 90  GLU C O   1 
ATOM   2715 C  CB  . GLU C  1 95  ? 13.494  -6.908  -52.588 1.00 59.34  ? 90  GLU C CB  1 
ATOM   2716 C  CG  . GLU C  1 95  ? 14.700  -6.035  -52.293 1.00 69.02  ? 90  GLU C CG  1 
ATOM   2717 C  CD  . GLU C  1 95  ? 14.975  -5.918  -50.807 1.00 74.34  ? 90  GLU C CD  1 
ATOM   2718 O  OE1 . GLU C  1 95  ? 14.009  -5.741  -50.037 1.00 76.34  ? 90  GLU C OE1 1 
ATOM   2719 O  OE2 . GLU C  1 95  ? 16.155  -6.009  -50.407 1.00 74.89  ? 90  GLU C OE2 1 
ATOM   2720 N  N   . VAL C  1 96  ? 12.656  -8.627  -55.205 1.00 35.88  ? 91  VAL C N   1 
ATOM   2721 C  CA  . VAL C  1 96  ? 12.971  -9.509  -56.323 1.00 35.85  ? 91  VAL C CA  1 
ATOM   2722 C  C   . VAL C  1 96  ? 12.329  -8.960  -57.593 1.00 38.92  ? 91  VAL C C   1 
ATOM   2723 O  O   . VAL C  1 96  ? 12.880  -9.088  -58.687 1.00 43.88  ? 91  VAL C O   1 
ATOM   2724 C  CB  . VAL C  1 96  ? 12.491  -10.954 -56.065 1.00 37.76  ? 91  VAL C CB  1 
ATOM   2725 C  CG1 . VAL C  1 96  ? 12.830  -11.854 -57.246 1.00 30.33  ? 91  VAL C CG1 1 
ATOM   2726 C  CG2 . VAL C  1 96  ? 13.115  -11.498 -54.787 1.00 36.15  ? 91  VAL C CG2 1 
ATOM   2727 N  N   . LEU C  1 97  ? 11.171  -8.327  -57.431 1.00 40.25  ? 92  LEU C N   1 
ATOM   2728 C  CA  . LEU C  1 97  ? 10.426  -7.749  -58.548 1.00 45.45  ? 92  LEU C CA  1 
ATOM   2729 C  C   . LEU C  1 97  ? 10.911  -6.362  -58.943 1.00 50.30  ? 92  LEU C C   1 
ATOM   2730 O  O   . LEU C  1 97  ? 10.331  -5.730  -59.824 1.00 55.15  ? 92  LEU C O   1 
ATOM   2731 C  CB  . LEU C  1 97  ? 8.945   -7.641  -58.193 1.00 50.25  ? 92  LEU C CB  1 
ATOM   2732 C  CG  . LEU C  1 97  ? 7.972   -8.673  -58.753 1.00 55.97  ? 92  LEU C CG  1 
ATOM   2733 C  CD1 . LEU C  1 97  ? 8.677   -9.717  -59.604 1.00 56.12  ? 92  LEU C CD1 1 
ATOM   2734 C  CD2 . LEU C  1 97  ? 7.260   -9.314  -57.593 1.00 55.51  ? 92  LEU C CD2 1 
ATOM   2735 N  N   . ALA C  1 98  ? 11.958  -5.883  -58.285 1.00 48.35  ? 93  ALA C N   1 
ATOM   2736 C  CA  . ALA C  1 98  ? 12.422  -4.518  -58.502 1.00 50.78  ? 93  ALA C CA  1 
ATOM   2737 C  C   . ALA C  1 98  ? 13.424  -4.413  -59.648 1.00 43.88  ? 93  ALA C C   1 
ATOM   2738 O  O   . ALA C  1 98  ? 13.760  -3.315  -60.087 1.00 49.96  ? 93  ALA C O   1 
ATOM   2739 C  CB  . ALA C  1 98  ? 13.025  -3.958  -57.224 1.00 58.20  ? 93  ALA C CB  1 
ATOM   2740 N  N   . THR C  1 99  ? 13.899  -5.558  -60.124 1.00 37.85  ? 94  THR C N   1 
ATOM   2741 C  CA  . THR C  1 99  ? 14.917  -5.596  -61.166 1.00 40.83  ? 94  THR C CA  1 
ATOM   2742 C  C   . THR C  1 99  ? 14.469  -6.469  -62.335 1.00 38.90  ? 94  THR C C   1 
ATOM   2743 O  O   . THR C  1 99  ? 13.819  -7.494  -62.127 1.00 39.84  ? 94  THR C O   1 
ATOM   2744 C  CB  . THR C  1 99  ? 16.251  -6.129  -60.607 1.00 47.79  ? 94  THR C CB  1 
ATOM   2745 O  OG1 . THR C  1 99  ? 17.042  -6.665  -61.675 1.00 47.27  ? 94  THR C OG1 1 
ATOM   2746 C  CG2 . THR C  1 99  ? 15.993  -7.223  -59.584 1.00 43.96  ? 94  THR C CG2 1 
ATOM   2747 N  N   . PRO C  1 100 ? 14.818  -6.065  -63.570 1.00 34.05  ? 95  PRO C N   1 
ATOM   2748 C  CA  . PRO C  1 100 ? 14.440  -6.782  -64.795 1.00 34.44  ? 95  PRO C CA  1 
ATOM   2749 C  C   . PRO C  1 100 ? 14.899  -8.232  -64.781 1.00 32.78  ? 95  PRO C C   1 
ATOM   2750 O  O   . PRO C  1 100 ? 14.287  -9.081  -65.432 1.00 33.13  ? 95  PRO C O   1 
ATOM   2751 C  CB  . PRO C  1 100 ? 15.195  -6.027  -65.892 1.00 45.84  ? 95  PRO C CB  1 
ATOM   2752 C  CG  . PRO C  1 100 ? 15.439  -4.691  -65.337 1.00 36.12  ? 95  PRO C CG  1 
ATOM   2753 C  CD  . PRO C  1 100 ? 15.616  -4.863  -63.864 1.00 34.87  ? 95  PRO C CD  1 
ATOM   2754 N  N   . SER C  1 101 ? 15.969  -8.505  -64.039 1.00 31.20  ? 96  SER C N   1 
ATOM   2755 C  CA  . SER C  1 101 ? 16.506  -9.853  -63.934 1.00 31.79  ? 96  SER C CA  1 
ATOM   2756 C  C   . SER C  1 101 ? 15.562  -10.754 -63.147 1.00 33.03  ? 96  SER C C   1 
ATOM   2757 O  O   . SER C  1 101 ? 15.725  -11.974 -63.145 1.00 30.70  ? 96  SER C O   1 
ATOM   2758 C  CB  . SER C  1 101 ? 17.883  -9.832  -63.264 1.00 33.68  ? 96  SER C CB  1 
ATOM   2759 O  OG  . SER C  1 101 ? 17.775  -9.511  -61.886 1.00 31.92  ? 96  SER C OG  1 
ATOM   2760 N  N   . LEU C  1 102 ? 14.582  -10.141 -62.484 1.00 30.08  ? 97  LEU C N   1 
ATOM   2761 C  CA  . LEU C  1 102 ? 13.627  -10.852 -61.635 1.00 29.89  ? 97  LEU C CA  1 
ATOM   2762 C  C   . LEU C  1 102 ? 14.333  -11.806 -60.683 1.00 31.15  ? 97  LEU C C   1 
ATOM   2763 O  O   . LEU C  1 102 ? 13.922  -12.953 -60.508 1.00 30.02  ? 97  LEU C O   1 
ATOM   2764 C  CB  . LEU C  1 102 ? 12.600  -11.608 -62.477 1.00 30.90  ? 97  LEU C CB  1 
ATOM   2765 C  CG  . LEU C  1 102 ? 11.706  -10.746 -63.366 1.00 34.14  ? 97  LEU C CG  1 
ATOM   2766 C  CD1 . LEU C  1 102 ? 10.829  -11.635 -64.225 1.00 33.87  ? 97  LEU C CD1 1 
ATOM   2767 C  CD2 . LEU C  1 102 ? 10.863  -9.787  -62.531 1.00 33.82  ? 97  LEU C CD2 1 
ATOM   2768 N  N   . SER C  1 103 ? 15.413  -11.320 -60.086 1.00 27.28  ? 98  SER C N   1 
ATOM   2769 C  CA  . SER C  1 103 ? 16.196  -12.112 -59.159 1.00 25.78  ? 98  SER C CA  1 
ATOM   2770 C  C   . SER C  1 103 ? 16.868  -11.183 -58.170 1.00 33.83  ? 98  SER C C   1 
ATOM   2771 O  O   . SER C  1 103 ? 17.019  -9.990  -58.428 1.00 33.62  ? 98  SER C O   1 
ATOM   2772 C  CB  . SER C  1 103 ? 17.256  -12.927 -59.900 1.00 28.58  ? 98  SER C CB  1 
ATOM   2773 O  OG  . SER C  1 103 ? 18.305  -12.097 -60.364 1.00 35.85  ? 98  SER C OG  1 
ATOM   2774 N  N   . ALA C  1 104 ? 17.265  -11.736 -57.034 1.00 24.35  ? 99  ALA C N   1 
ATOM   2775 C  CA  . ALA C  1 104 ? 17.966  -10.971 -56.024 1.00 24.09  ? 99  ALA C CA  1 
ATOM   2776 C  C   . ALA C  1 104 ? 18.628  -11.948 -55.078 1.00 22.78  ? 99  ALA C C   1 
ATOM   2777 O  O   . ALA C  1 104 ? 18.180  -13.084 -54.929 1.00 23.52  ? 99  ALA C O   1 
ATOM   2778 C  CB  . ALA C  1 104 ? 17.000  -10.072 -55.266 1.00 25.20  ? 99  ALA C CB  1 
ATOM   2779 N  N   . SER C  1 105 ? 19.703  -11.507 -54.445 1.00 27.49  ? 100 SER C N   1 
ATOM   2780 C  CA  . SER C  1 105 ? 20.366  -12.331 -53.456 1.00 28.53  ? 100 SER C CA  1 
ATOM   2781 C  C   . SER C  1 105 ? 20.362  -11.595 -52.141 1.00 25.51  ? 100 SER C C   1 
ATOM   2782 O  O   . SER C  1 105 ? 20.336  -10.364 -52.104 1.00 23.99  ? 100 SER C O   1 
ATOM   2783 C  CB  . SER C  1 105 ? 21.798  -12.600 -53.865 1.00 36.31  ? 100 SER C CB  1 
ATOM   2784 O  OG  . SER C  1 105 ? 22.547  -11.401 -53.776 1.00 40.86  ? 100 SER C OG  1 
ATOM   2785 N  N   . PHE C  1 106 ? 20.397  -12.352 -51.055 1.00 21.22  ? 101 PHE C N   1 
ATOM   2786 C  CA  . PHE C  1 106 ? 20.331  -11.758 -49.739 1.00 28.47  ? 101 PHE C CA  1 
ATOM   2787 C  C   . PHE C  1 106 ? 21.362  -12.390 -48.822 1.00 26.71  ? 101 PHE C C   1 
ATOM   2788 O  O   . PHE C  1 106 ? 21.541  -13.604 -48.810 1.00 28.61  ? 101 PHE C O   1 
ATOM   2789 C  CB  . PHE C  1 106 ? 18.928  -11.926 -49.151 1.00 31.11  ? 101 PHE C CB  1 
ATOM   2790 C  CG  . PHE C  1 106 ? 17.837  -11.340 -50.007 1.00 32.10  ? 101 PHE C CG  1 
ATOM   2791 C  CD1 . PHE C  1 106 ? 17.269  -12.077 -51.035 1.00 30.51  ? 101 PHE C CD1 1 
ATOM   2792 C  CD2 . PHE C  1 106 ? 17.379  -10.053 -49.779 1.00 31.48  ? 101 PHE C CD2 1 
ATOM   2793 C  CE1 . PHE C  1 106 ? 16.270  -11.538 -51.823 1.00 33.48  ? 101 PHE C CE1 1 
ATOM   2794 C  CE2 . PHE C  1 106 ? 16.377  -9.510  -50.561 1.00 33.92  ? 101 PHE C CE2 1 
ATOM   2795 C  CZ  . PHE C  1 106 ? 15.823  -10.252 -51.585 1.00 30.35  ? 101 PHE C CZ  1 
ATOM   2796 N  N   . ASN C  1 107 ? 22.070  -11.544 -48.086 1.00 28.45  ? 102 ASN C N   1 
ATOM   2797 C  CA  . ASN C  1 107 ? 22.798  -11.992 -46.916 1.00 23.78  ? 102 ASN C CA  1 
ATOM   2798 C  C   . ASN C  1 107 ? 22.093  -11.336 -45.742 1.00 23.55  ? 102 ASN C C   1 
ATOM   2799 O  O   . ASN C  1 107 ? 22.433  -10.226 -45.338 1.00 27.28  ? 102 ASN C O   1 
ATOM   2800 C  CB  . ASN C  1 107 ? 24.267  -11.581 -46.979 1.00 24.62  ? 102 ASN C CB  1 
ATOM   2801 C  CG  . ASN C  1 107 ? 25.098  -12.242 -45.897 1.00 36.07  ? 102 ASN C CG  1 
ATOM   2802 O  OD1 . ASN C  1 107 ? 24.556  -12.783 -44.934 1.00 20.03  ? 102 ASN C OD1 1 
ATOM   2803 N  ND2 . ASN C  1 107 ? 26.417  -12.202 -46.049 1.00 39.70  ? 102 ASN C ND2 1 
ATOM   2804 N  N   . ALA C  1 108 ? 21.083  -12.020 -45.218 1.00 25.94  ? 103 ALA C N   1 
ATOM   2805 C  CA  . ALA C  1 108 ? 20.160  -11.405 -44.275 1.00 28.00  ? 103 ALA C CA  1 
ATOM   2806 C  C   . ALA C  1 108 ? 20.506  -11.705 -42.826 1.00 28.76  ? 103 ALA C C   1 
ATOM   2807 O  O   . ALA C  1 108 ? 20.678  -12.864 -42.453 1.00 25.82  ? 103 ALA C O   1 
ATOM   2808 C  CB  . ALA C  1 108 ? 18.738  -11.849 -44.575 1.00 26.03  ? 103 ALA C CB  1 
ATOM   2809 N  N   . PRO C  1 109 ? 20.608  -10.654 -41.998 1.00 27.85  ? 104 PRO C N   1 
ATOM   2810 C  CA  . PRO C  1 109 ? 20.760  -10.883 -40.559 1.00 32.13  ? 104 PRO C CA  1 
ATOM   2811 C  C   . PRO C  1 109 ? 19.513  -11.554 -40.000 1.00 33.33  ? 104 PRO C C   1 
ATOM   2812 O  O   . PRO C  1 109 ? 18.396  -11.165 -40.342 1.00 37.74  ? 104 PRO C O   1 
ATOM   2813 C  CB  . PRO C  1 109 ? 20.913  -9.471  -39.989 1.00 29.27  ? 104 PRO C CB  1 
ATOM   2814 C  CG  . PRO C  1 109 ? 20.362  -8.560  -41.038 1.00 30.31  ? 104 PRO C CG  1 
ATOM   2815 C  CD  . PRO C  1 109 ? 20.668  -9.224  -42.342 1.00 26.96  ? 104 PRO C CD  1 
ATOM   2816 N  N   . LEU C  1 110 ? 19.711  -12.565 -39.164 1.00 29.71  ? 105 LEU C N   1 
ATOM   2817 C  CA  . LEU C  1 110 ? 18.602  -13.313 -38.590 1.00 24.57  ? 105 LEU C CA  1 
ATOM   2818 C  C   . LEU C  1 110 ? 18.131  -12.667 -37.293 1.00 31.87  ? 105 LEU C C   1 
ATOM   2819 O  O   . LEU C  1 110 ? 18.936  -12.359 -36.415 1.00 32.55  ? 105 LEU C O   1 
ATOM   2820 C  CB  . LEU C  1 110 ? 19.010  -14.770 -38.350 1.00 25.99  ? 105 LEU C CB  1 
ATOM   2821 C  CG  . LEU C  1 110 ? 19.290  -15.587 -39.613 1.00 27.80  ? 105 LEU C CG  1 
ATOM   2822 C  CD1 . LEU C  1 110 ? 19.946  -16.912 -39.272 1.00 28.63  ? 105 LEU C CD1 1 
ATOM   2823 C  CD2 . LEU C  1 110 ? 18.001  -15.808 -40.404 1.00 22.01  ? 105 LEU C CD2 1 
ATOM   2824 N  N   . LEU C  1 111 ? 16.823  -12.457 -37.184 1.00 32.38  ? 106 LEU C N   1 
ATOM   2825 C  CA  . LEU C  1 111 ? 16.237  -11.859 -35.990 1.00 34.73  ? 106 LEU C CA  1 
ATOM   2826 C  C   . LEU C  1 111 ? 15.716  -12.928 -35.038 1.00 39.23  ? 106 LEU C C   1 
ATOM   2827 O  O   . LEU C  1 111 ? 15.289  -13.996 -35.476 1.00 40.20  ? 106 LEU C O   1 
ATOM   2828 C  CB  . LEU C  1 111 ? 15.101  -10.910 -36.371 1.00 40.85  ? 106 LEU C CB  1 
ATOM   2829 C  CG  . LEU C  1 111 ? 15.463  -9.738  -37.282 1.00 45.56  ? 106 LEU C CG  1 
ATOM   2830 C  CD1 . LEU C  1 111 ? 14.309  -8.749  -37.355 1.00 43.85  ? 106 LEU C CD1 1 
ATOM   2831 C  CD2 . LEU C  1 111 ? 16.732  -9.058  -36.794 1.00 52.05  ? 106 LEU C CD2 1 
ATOM   2832 N  N   . ASP C  1 112 ? 15.743  -12.645 -33.739 1.00 39.38  ? 107 ASP C N   1 
ATOM   2833 C  CA  . ASP C  1 112 ? 15.218  -13.599 -32.766 1.00 42.56  ? 107 ASP C CA  1 
ATOM   2834 C  C   . ASP C  1 112 ? 13.707  -13.477 -32.591 1.00 46.71  ? 107 ASP C C   1 
ATOM   2835 O  O   . ASP C  1 112 ? 13.032  -12.786 -33.359 1.00 40.13  ? 107 ASP C O   1 
ATOM   2836 C  CB  . ASP C  1 112 ? 15.949  -13.518 -31.412 1.00 38.20  ? 107 ASP C CB  1 
ATOM   2837 C  CG  . ASP C  1 112 ? 15.766  -12.179 -30.703 1.00 43.48  ? 107 ASP C CG  1 
ATOM   2838 O  OD1 . ASP C  1 112 ? 14.865  -11.397 -31.070 1.00 47.45  ? 107 ASP C OD1 1 
ATOM   2839 O  OD2 . ASP C  1 112 ? 16.533  -11.912 -29.752 1.00 46.90  ? 107 ASP C OD2 1 
ATOM   2840 N  N   . THR C  1 113 ? 13.189  -14.150 -31.570 1.00 54.20  ? 108 THR C N   1 
ATOM   2841 C  CA  . THR C  1 113 ? 11.759  -14.156 -31.291 1.00 58.15  ? 108 THR C CA  1 
ATOM   2842 C  C   . THR C  1 113 ? 11.217  -12.764 -30.957 1.00 59.38  ? 108 THR C C   1 
ATOM   2843 O  O   . THR C  1 113 ? 10.067  -12.454 -31.265 1.00 59.30  ? 108 THR C O   1 
ATOM   2844 C  CB  . THR C  1 113 ? 11.414  -15.147 -30.161 1.00 57.41  ? 108 THR C CB  1 
ATOM   2845 O  OG1 . THR C  1 113 ? 10.108  -14.857 -29.651 1.00 63.71  ? 108 THR C OG1 1 
ATOM   2846 C  CG2 . THR C  1 113 ? 12.428  -15.045 -29.032 1.00 53.82  ? 108 THR C CG2 1 
ATOM   2847 N  N   . LYS C  1 114 ? 12.044  -11.928 -30.336 1.00 59.77  ? 109 LYS C N   1 
ATOM   2848 C  CA  . LYS C  1 114 ? 11.646  -10.552 -30.038 1.00 58.58  ? 109 LYS C CA  1 
ATOM   2849 C  C   . LYS C  1 114 ? 12.184  -9.552  -31.068 1.00 51.46  ? 109 LYS C C   1 
ATOM   2850 O  O   . LYS C  1 114 ? 12.375  -8.373  -30.764 1.00 47.27  ? 109 LYS C O   1 
ATOM   2851 C  CB  . LYS C  1 114 ? 12.059  -10.150 -28.617 1.00 58.10  ? 109 LYS C CB  1 
ATOM   2852 C  CG  . LYS C  1 114 ? 13.425  -10.658 -28.196 1.00 55.45  ? 109 LYS C CG  1 
ATOM   2853 C  CD  . LYS C  1 114 ? 13.983  -9.877  -27.010 1.00 64.03  ? 109 LYS C CD  1 
ATOM   2854 C  CE  . LYS C  1 114 ? 13.116  -10.014 -25.765 1.00 68.73  ? 109 LYS C CE  1 
ATOM   2855 N  NZ  . LYS C  1 114 ? 13.756  -9.375  -24.578 1.00 72.38  ? 109 LYS C NZ  1 
ATOM   2856 N  N   . LYS C  1 115 ? 12.426  -10.043 -32.282 1.00 51.18  ? 110 LYS C N   1 
ATOM   2857 C  CA  . LYS C  1 115 ? 12.812  -9.209  -33.423 1.00 50.30  ? 110 LYS C CA  1 
ATOM   2858 C  C   . LYS C  1 115 ? 14.131  -8.457  -33.244 1.00 48.42  ? 110 LYS C C   1 
ATOM   2859 O  O   . LYS C  1 115 ? 14.308  -7.360  -33.774 1.00 44.49  ? 110 LYS C O   1 
ATOM   2860 C  CB  . LYS C  1 115 ? 11.682  -8.242  -33.790 1.00 53.95  ? 110 LYS C CB  1 
ATOM   2861 C  CG  . LYS C  1 115 ? 10.410  -8.945  -34.234 1.00 60.13  ? 110 LYS C CG  1 
ATOM   2862 C  CD  . LYS C  1 115 ? 10.588  -9.592  -35.600 1.00 64.84  ? 110 LYS C CD  1 
ATOM   2863 C  CE  . LYS C  1 115 ? 9.767   -10.865 -35.733 1.00 65.44  ? 110 LYS C CE  1 
ATOM   2864 N  NZ  . LYS C  1 115 ? 10.498  -12.049 -35.196 1.00 65.68  ? 110 LYS C NZ  1 
ATOM   2865 N  N   . GLN C  1 116 ? 15.054  -9.061  -32.503 1.00 47.31  ? 111 GLN C N   1 
ATOM   2866 C  CA  . GLN C  1 116 ? 16.383  -8.495  -32.304 1.00 48.50  ? 111 GLN C CA  1 
ATOM   2867 C  C   . GLN C  1 116 ? 17.400  -9.330  -33.080 1.00 40.62  ? 111 GLN C C   1 
ATOM   2868 O  O   . GLN C  1 116 ? 17.206  -10.532 -33.249 1.00 40.25  ? 111 GLN C O   1 
ATOM   2869 C  CB  . GLN C  1 116 ? 16.732  -8.499  -30.812 1.00 53.82  ? 111 GLN C CB  1 
ATOM   2870 C  CG  . GLN C  1 116 ? 17.163  -7.153  -30.245 1.00 61.16  ? 111 GLN C CG  1 
ATOM   2871 C  CD  . GLN C  1 116 ? 15.991  -6.258  -29.894 1.00 63.06  ? 111 GLN C CD  1 
ATOM   2872 O  OE1 . GLN C  1 116 ? 14.945  -6.303  -30.540 1.00 66.90  ? 111 GLN C OE1 1 
ATOM   2873 N  NE2 . GLN C  1 116 ? 16.159  -5.443  -28.858 1.00 59.09  ? 111 GLN C NE2 1 
ATOM   2874 N  N   . PRO C  1 117 ? 18.484  -8.696  -33.562 1.00 39.98  ? 112 PRO C N   1 
ATOM   2875 C  CA  . PRO C  1 117 ? 19.531  -9.434  -34.280 1.00 33.33  ? 112 PRO C CA  1 
ATOM   2876 C  C   . PRO C  1 117 ? 20.183  -10.485 -33.385 1.00 36.51  ? 112 PRO C C   1 
ATOM   2877 O  O   . PRO C  1 117 ? 20.430  -10.215 -32.210 1.00 37.81  ? 112 PRO C O   1 
ATOM   2878 C  CB  . PRO C  1 117 ? 20.546  -8.344  -34.642 1.00 35.03  ? 112 PRO C CB  1 
ATOM   2879 C  CG  . PRO C  1 117 ? 19.772  -7.065  -34.606 1.00 37.40  ? 112 PRO C CG  1 
ATOM   2880 C  CD  . PRO C  1 117 ? 18.753  -7.248  -33.523 1.00 38.31  ? 112 PRO C CD  1 
ATOM   2881 N  N   . THR C  1 118 ? 20.443  -11.669 -33.932 1.00 34.19  ? 113 THR C N   1 
ATOM   2882 C  CA  . THR C  1 118 ? 21.032  -12.761 -33.163 1.00 35.90  ? 113 THR C CA  1 
ATOM   2883 C  C   . THR C  1 118 ? 22.541  -12.839 -33.361 1.00 36.79  ? 113 THR C C   1 
ATOM   2884 O  O   . THR C  1 118 ? 23.238  -13.531 -32.621 1.00 42.50  ? 113 THR C O   1 
ATOM   2885 C  CB  . THR C  1 118 ? 20.440  -14.118 -33.578 1.00 31.99  ? 113 THR C CB  1 
ATOM   2886 O  OG1 . THR C  1 118 ? 20.701  -14.339 -34.970 1.00 32.53  ? 113 THR C OG1 1 
ATOM   2887 C  CG2 . THR C  1 118 ? 18.940  -14.154 -33.332 1.00 30.49  ? 113 THR C CG2 1 
ATOM   2888 N  N   . GLY C  1 119 ? 23.041  -12.133 -34.369 1.00 43.05  ? 114 GLY C N   1 
ATOM   2889 C  CA  . GLY C  1 119 ? 24.445  -12.214 -34.729 1.00 41.95  ? 114 GLY C CA  1 
ATOM   2890 C  C   . GLY C  1 119 ? 24.656  -13.223 -35.841 1.00 33.83  ? 114 GLY C C   1 
ATOM   2891 O  O   . GLY C  1 119 ? 25.724  -13.289 -36.449 1.00 36.45  ? 114 GLY C O   1 
ATOM   2892 N  N   . ALA C  1 120 ? 23.627  -14.019 -36.102 1.00 25.44  ? 115 ALA C N   1 
ATOM   2893 C  CA  . ALA C  1 120 ? 23.664  -14.970 -37.200 1.00 26.17  ? 115 ALA C CA  1 
ATOM   2894 C  C   . ALA C  1 120 ? 23.183  -14.298 -38.477 1.00 28.95  ? 115 ALA C C   1 
ATOM   2895 O  O   . ALA C  1 120 ? 22.517  -13.265 -38.435 1.00 29.53  ? 115 ALA C O   1 
ATOM   2896 C  CB  . ALA C  1 120 ? 22.810  -16.187 -36.883 1.00 25.92  ? 115 ALA C CB  1 
ATOM   2897 N  N   . SER C  1 121 ? 23.528  -14.885 -39.615 1.00 23.04  ? 116 SER C N   1 
ATOM   2898 C  CA  . SER C  1 121 ? 23.056  -14.373 -40.891 1.00 26.22  ? 116 SER C CA  1 
ATOM   2899 C  C   . SER C  1 121 ? 22.760  -15.516 -41.845 1.00 25.40  ? 116 SER C C   1 
ATOM   2900 O  O   . SER C  1 121 ? 23.303  -16.609 -41.707 1.00 25.64  ? 116 SER C O   1 
ATOM   2901 C  CB  . SER C  1 121 ? 24.083  -13.427 -41.507 1.00 32.18  ? 116 SER C CB  1 
ATOM   2902 O  OG  . SER C  1 121 ? 25.266  -14.123 -41.856 1.00 34.39  ? 116 SER C OG  1 
ATOM   2903 N  N   . LEU C  1 122 ? 21.899  -15.259 -42.819 1.00 24.44  ? 117 LEU C N   1 
ATOM   2904 C  CA  . LEU C  1 122 ? 21.527  -16.293 -43.766 1.00 19.02  ? 117 LEU C CA  1 
ATOM   2905 C  C   . LEU C  1 122 ? 21.701  -15.833 -45.204 1.00 24.67  ? 117 LEU C C   1 
ATOM   2906 O  O   . LEU C  1 122 ? 21.191  -14.786 -45.600 1.00 21.24  ? 117 LEU C O   1 
ATOM   2907 C  CB  . LEU C  1 122 ? 20.084  -16.721 -43.537 1.00 20.62  ? 117 LEU C CB  1 
ATOM   2908 C  CG  . LEU C  1 122 ? 19.560  -17.694 -44.588 1.00 24.02  ? 117 LEU C CG  1 
ATOM   2909 C  CD1 . LEU C  1 122 ? 20.068  -19.107 -44.330 1.00 26.18  ? 117 LEU C CD1 1 
ATOM   2910 C  CD2 . LEU C  1 122 ? 18.052  -17.642 -44.604 1.00 27.62  ? 117 LEU C CD2 1 
ATOM   2911 N  N   . VAL C  1 123 ? 22.425  -16.628 -45.982 1.00 23.89  ? 118 VAL C N   1 
ATOM   2912 C  CA  . VAL C  1 123 ? 22.662  -16.316 -47.380 1.00 22.03  ? 118 VAL C CA  1 
ATOM   2913 C  C   . VAL C  1 123 ? 21.754  -17.148 -48.272 1.00 23.29  ? 118 VAL C C   1 
ATOM   2914 O  O   . VAL C  1 123 ? 21.763  -18.378 -48.211 1.00 19.20  ? 118 VAL C O   1 
ATOM   2915 C  CB  . VAL C  1 123 ? 24.128  -16.565 -47.772 1.00 25.22  ? 118 VAL C CB  1 
ATOM   2916 C  CG1 . VAL C  1 123 ? 24.310  -16.414 -49.272 1.00 22.16  ? 118 VAL C CG1 1 
ATOM   2917 C  CG2 . VAL C  1 123 ? 25.041  -15.608 -47.027 1.00 17.96  ? 118 VAL C CG2 1 
ATOM   2918 N  N   . LEU C  1 124 ? 20.965  -16.463 -49.094 1.00 21.02  ? 119 LEU C N   1 
ATOM   2919 C  CA  . LEU C  1 124 ? 20.067  -17.125 -50.031 1.00 18.86  ? 119 LEU C CA  1 
ATOM   2920 C  C   . LEU C  1 124 ? 19.868  -16.242 -51.253 1.00 19.35  ? 119 LEU C C   1 
ATOM   2921 O  O   . LEU C  1 124 ? 20.122  -15.041 -51.203 1.00 19.65  ? 119 LEU C O   1 
ATOM   2922 C  CB  . LEU C  1 124 ? 18.708  -17.412 -49.375 1.00 19.33  ? 119 LEU C CB  1 
ATOM   2923 C  CG  . LEU C  1 124 ? 17.797  -16.220 -49.044 1.00 27.09  ? 119 LEU C CG  1 
ATOM   2924 C  CD1 . LEU C  1 124 ? 16.346  -16.661 -48.990 1.00 29.19  ? 119 LEU C CD1 1 
ATOM   2925 C  CD2 . LEU C  1 124 ? 18.190  -15.542 -47.730 1.00 22.56  ? 119 LEU C CD2 1 
ATOM   2926 N  N   . GLN C  1 125 ? 19.429  -16.830 -52.358 1.00 23.68  ? 120 GLN C N   1 
ATOM   2927 C  CA  . GLN C  1 125 ? 18.991  -16.020 -53.485 1.00 27.68  ? 120 GLN C CA  1 
ATOM   2928 C  C   . GLN C  1 125 ? 17.676  -16.531 -54.046 1.00 27.35  ? 120 GLN C C   1 
ATOM   2929 O  O   . GLN C  1 125 ? 17.337  -17.713 -53.927 1.00 21.56  ? 120 GLN C O   1 
ATOM   2930 C  CB  . GLN C  1 125 ? 20.064  -15.900 -54.574 1.00 28.04  ? 120 GLN C CB  1 
ATOM   2931 C  CG  . GLN C  1 125 ? 20.102  -17.045 -55.546 1.00 32.50  ? 120 GLN C CG  1 
ATOM   2932 C  CD  . GLN C  1 125 ? 19.235  -16.834 -56.777 1.00 21.31  ? 120 GLN C CD  1 
ATOM   2933 O  OE1 . GLN C  1 125 ? 18.426  -17.687 -57.118 1.00 28.25  ? 120 GLN C OE1 1 
ATOM   2934 N  NE2 . GLN C  1 125 ? 19.408  -15.700 -57.450 1.00 28.07  ? 120 GLN C NE2 1 
ATOM   2935 N  N   . VAL C  1 126 ? 16.941  -15.612 -54.656 1.00 21.92  ? 121 VAL C N   1 
ATOM   2936 C  CA  . VAL C  1 126 ? 15.561  -15.839 -55.041 1.00 24.62  ? 121 VAL C CA  1 
ATOM   2937 C  C   . VAL C  1 126 ? 15.353  -15.304 -56.447 1.00 27.81  ? 121 VAL C C   1 
ATOM   2938 O  O   . VAL C  1 126 ? 15.920  -14.275 -56.812 1.00 23.87  ? 121 VAL C O   1 
ATOM   2939 C  CB  . VAL C  1 126 ? 14.609  -15.093 -54.075 1.00 27.50  ? 121 VAL C CB  1 
ATOM   2940 C  CG1 . VAL C  1 126 ? 13.158  -15.307 -54.461 1.00 28.57  ? 121 VAL C CG1 1 
ATOM   2941 C  CG2 . VAL C  1 126 ? 14.849  -15.534 -52.636 1.00 28.76  ? 121 VAL C CG2 1 
ATOM   2942 N  N   . SER C  1 127 ? 14.551  -16.004 -57.242 1.00 24.53  ? 122 SER C N   1 
ATOM   2943 C  CA  . SER C  1 127 ? 14.229  -15.525 -58.579 1.00 25.58  ? 122 SER C CA  1 
ATOM   2944 C  C   . SER C  1 127 ? 12.876  -16.027 -59.075 1.00 26.86  ? 122 SER C C   1 
ATOM   2945 O  O   . SER C  1 127 ? 12.335  -17.005 -58.563 1.00 26.88  ? 122 SER C O   1 
ATOM   2946 C  CB  . SER C  1 127 ? 15.321  -15.927 -59.569 1.00 25.27  ? 122 SER C CB  1 
ATOM   2947 O  OG  . SER C  1 127 ? 15.285  -17.318 -59.824 1.00 28.26  ? 122 SER C OG  1 
ATOM   2948 N  N   . TYR C  1 128 ? 12.335  -15.337 -60.073 1.00 28.10  ? 123 TYR C N   1 
ATOM   2949 C  CA  . TYR C  1 128 ? 11.156  -15.809 -60.783 1.00 31.62  ? 123 TYR C CA  1 
ATOM   2950 C  C   . TYR C  1 128 ? 11.599  -16.418 -62.095 1.00 35.17  ? 123 TYR C C   1 
ATOM   2951 O  O   . TYR C  1 128 ? 12.355  -15.798 -62.844 1.00 36.37  ? 123 TYR C O   1 
ATOM   2952 C  CB  . TYR C  1 128 ? 10.206  -14.655 -61.083 1.00 35.00  ? 123 TYR C CB  1 
ATOM   2953 C  CG  . TYR C  1 128 ? 9.512   -14.098 -59.871 1.00 45.06  ? 123 TYR C CG  1 
ATOM   2954 C  CD1 . TYR C  1 128 ? 10.152  -13.198 -59.036 1.00 49.54  ? 123 TYR C CD1 1 
ATOM   2955 C  CD2 . TYR C  1 128 ? 8.211   -14.461 -59.569 1.00 53.30  ? 123 TYR C CD2 1 
ATOM   2956 C  CE1 . TYR C  1 128 ? 9.520   -12.683 -57.926 1.00 54.25  ? 123 TYR C CE1 1 
ATOM   2957 C  CE2 . TYR C  1 128 ? 7.568   -13.952 -58.459 1.00 58.76  ? 123 TYR C CE2 1 
ATOM   2958 C  CZ  . TYR C  1 128 ? 8.228   -13.063 -57.641 1.00 60.57  ? 123 TYR C CZ  1 
ATOM   2959 O  OH  . TYR C  1 128 ? 7.594   -12.550 -56.535 1.00 64.24  ? 123 TYR C OH  1 
ATOM   2960 N  N   . THR C  1 129 ? 11.135  -17.624 -62.386 1.00 34.44  ? 124 THR C N   1 
ATOM   2961 C  CA  . THR C  1 129 ? 11.495  -18.256 -63.647 1.00 40.81  ? 124 THR C CA  1 
ATOM   2962 C  C   . THR C  1 129 ? 10.317  -18.953 -64.296 1.00 45.49  ? 124 THR C C   1 
ATOM   2963 O  O   . THR C  1 129 ? 9.357   -19.332 -63.626 1.00 47.26  ? 124 THR C O   1 
ATOM   2964 C  CB  . THR C  1 129 ? 12.658  -19.262 -63.488 1.00 43.88  ? 124 THR C CB  1 
ATOM   2965 O  OG1 . THR C  1 129 ? 12.400  -20.133 -62.381 1.00 49.93  ? 124 THR C OG1 1 
ATOM   2966 C  CG2 . THR C  1 129 ? 13.951  -18.533 -63.242 1.00 49.75  ? 124 THR C CG2 1 
ATOM   2967 N  N   . ALA C  1 130 ? 10.402  -19.107 -65.613 1.00 49.43  ? 125 ALA C N   1 
ATOM   2968 C  CA  . ALA C  1 130 ? 9.423   -19.868 -66.366 1.00 52.81  ? 125 ALA C CA  1 
ATOM   2969 C  C   . ALA C  1 130 ? 9.589   -21.337 -66.018 1.00 60.10  ? 125 ALA C C   1 
ATOM   2970 O  O   . ALA C  1 130 ? 10.710  -21.814 -65.831 1.00 59.42  ? 125 ALA C O   1 
ATOM   2971 C  CB  . ALA C  1 130 ? 9.620   -19.649 -67.854 1.00 55.47  ? 125 ALA C CB  1 
ATOM   2972 N  N   . ALA C  1 131 ? 8.472   -22.048 -65.924 1.00 65.13  ? 126 ALA C N   1 
ATOM   2973 C  CA  . ALA C  1 131 ? 8.487   -23.460 -65.564 1.00 65.05  ? 126 ALA C CA  1 
ATOM   2974 C  C   . ALA C  1 131 ? 9.196   -24.291 -66.627 1.00 64.12  ? 126 ALA C C   1 
ATOM   2975 O  O   . ALA C  1 131 ? 9.806   -25.315 -66.322 1.00 63.69  ? 126 ALA C O   1 
ATOM   2976 C  CB  . ALA C  1 131 ? 7.069   -23.965 -65.353 1.00 65.46  ? 126 ALA C CB  1 
ATOM   2977 N  N   . GLU D  1 4   ? -29.264 24.622  -85.734 1.00 61.97  ? -1  GLU D N   1 
ATOM   2978 C  CA  . GLU D  1 4   ? -30.283 24.163  -84.817 1.00 60.72  ? -1  GLU D CA  1 
ATOM   2979 C  C   . GLU D  1 4   ? -30.322 24.998  -83.536 1.00 55.23  ? -1  GLU D C   1 
ATOM   2980 O  O   . GLU D  1 4   ? -31.381 25.378  -83.099 1.00 55.02  ? -1  GLU D O   1 
ATOM   2981 C  CB  . GLU D  1 4   ? -30.103 22.681  -84.493 1.00 63.94  ? -1  GLU D CB  1 
ATOM   2982 C  CG  . GLU D  1 4   ? -31.205 21.790  -85.056 1.00 71.79  ? -1  GLU D CG  1 
ATOM   2983 C  CD  . GLU D  1 4   ? -31.265 20.418  -84.401 1.00 74.45  ? -1  GLU D CD  1 
ATOM   2984 O  OE1 . GLU D  1 4   ? -30.778 19.446  -85.011 1.00 78.85  ? -1  GLU D OE1 1 
ATOM   2985 O  OE2 . GLU D  1 4   ? -31.801 20.314  -83.286 1.00 71.78  ? -1  GLU D OE2 1 
ATOM   2986 N  N   . PHE D  1 5   ? -29.177 25.296  -82.946 1.00 51.69  ? 0   PHE D N   1 
ATOM   2987 C  CA  . PHE D  1 5   ? -29.173 25.930  -81.631 1.00 48.51  ? 0   PHE D CA  1 
ATOM   2988 C  C   . PHE D  1 5   ? -28.951 27.436  -81.661 1.00 43.67  ? 0   PHE D C   1 
ATOM   2989 O  O   . PHE D  1 5   ? -28.279 27.949  -82.534 1.00 42.70  ? 0   PHE D O   1 
ATOM   2990 C  CB  . PHE D  1 5   ? -28.141 25.286  -80.733 1.00 50.89  ? 0   PHE D CB  1 
ATOM   2991 C  CG  . PHE D  1 5   ? -28.679 24.159  -79.926 1.00 56.49  ? 0   PHE D CG  1 
ATOM   2992 C  CD1 . PHE D  1 5   ? -28.530 22.862  -80.352 1.00 58.11  ? 0   PHE D CD1 1 
ATOM   2993 C  CD2 . PHE D  1 5   ? -29.341 24.398  -78.747 1.00 57.08  ? 0   PHE D CD2 1 
ATOM   2994 C  CE1 . PHE D  1 5   ? -29.033 21.821  -79.612 1.00 59.67  ? 0   PHE D CE1 1 
ATOM   2995 C  CE2 . PHE D  1 5   ? -29.843 23.365  -77.999 1.00 57.88  ? 0   PHE D CE2 1 
ATOM   2996 C  CZ  . PHE D  1 5   ? -29.689 22.071  -78.433 1.00 58.52  ? 0   PHE D CZ  1 
ATOM   2997 N  N   . MET D  1 6   ? -29.522 28.132  -80.683 1.00 43.86  ? 1   MET D N   1 
ATOM   2998 C  CA  . MET D  1 6   ? -29.381 29.576  -80.596 1.00 38.30  ? 1   MET D CA  1 
ATOM   2999 C  C   . MET D  1 6   ? -29.089 29.998  -79.167 1.00 33.11  ? 1   MET D C   1 
ATOM   3000 O  O   . MET D  1 6   ? -29.528 29.353  -78.216 1.00 32.31  ? 1   MET D O   1 
ATOM   3001 C  CB  . MET D  1 6   ? -30.660 30.275  -81.051 1.00 28.50  ? 1   MET D CB  1 
ATOM   3002 C  CG  . MET D  1 6   ? -31.137 29.927  -82.446 1.00 34.25  ? 1   MET D CG  1 
ATOM   3003 S  SD  . MET D  1 6   ? -32.588 30.912  -82.861 1.00 103.01 ? 1   MET D SD  1 
ATOM   3004 C  CE  . MET D  1 6   ? -33.428 30.938  -81.276 1.00 68.61  ? 1   MET D CE  1 
ATOM   3005 N  N   . LEU D  1 7   ? -28.347 31.089  -79.023 1.00 24.77  ? 2   LEU D N   1 
ATOM   3006 C  CA  . LEU D  1 7   ? -28.207 31.735  -77.729 1.00 23.11  ? 2   LEU D CA  1 
ATOM   3007 C  C   . LEU D  1 7   ? -29.200 32.884  -77.660 1.00 20.66  ? 2   LEU D C   1 
ATOM   3008 O  O   . LEU D  1 7   ? -29.121 33.832  -78.440 1.00 26.44  ? 2   LEU D O   1 
ATOM   3009 C  CB  . LEU D  1 7   ? -26.789 32.265  -77.525 1.00 24.28  ? 2   LEU D CB  1 
ATOM   3010 C  CG  . LEU D  1 7   ? -26.539 32.805  -76.115 1.00 22.62  ? 2   LEU D CG  1 
ATOM   3011 C  CD1 . LEU D  1 7   ? -26.362 31.657  -75.129 1.00 22.17  ? 2   LEU D CD1 1 
ATOM   3012 C  CD2 . LEU D  1 7   ? -25.347 33.755  -76.083 1.00 20.11  ? 2   LEU D CD2 1 
ATOM   3013 N  N   . ARG D  1 8   ? -30.139 32.794  -76.728 1.00 19.56  ? 3   ARG D N   1 
ATOM   3014 C  CA  . ARG D  1 8   ? -31.153 33.824  -76.570 1.00 22.26  ? 3   ARG D CA  1 
ATOM   3015 C  C   . ARG D  1 8   ? -30.852 34.646  -75.325 1.00 20.77  ? 3   ARG D C   1 
ATOM   3016 O  O   . ARG D  1 8   ? -30.675 34.096  -74.238 1.00 20.66  ? 3   ARG D O   1 
ATOM   3017 C  CB  . ARG D  1 8   ? -32.542 33.190  -76.479 1.00 23.70  ? 3   ARG D CB  1 
ATOM   3018 C  CG  . ARG D  1 8   ? -33.685 34.183  -76.375 1.00 30.48  ? 3   ARG D CG  1 
ATOM   3019 C  CD  . ARG D  1 8   ? -35.027 33.470  -76.472 1.00 38.35  ? 3   ARG D CD  1 
ATOM   3020 N  NE  . ARG D  1 8   ? -35.173 32.451  -75.437 1.00 42.05  ? 3   ARG D NE  1 
ATOM   3021 C  CZ  . ARG D  1 8   ? -35.867 31.327  -75.584 1.00 42.45  ? 3   ARG D CZ  1 
ATOM   3022 N  NH1 . ARG D  1 8   ? -36.482 31.069  -76.732 1.00 40.72  ? 3   ARG D NH1 1 
ATOM   3023 N  NH2 . ARG D  1 8   ? -35.943 30.460  -74.585 1.00 39.32  ? 3   ARG D NH2 1 
ATOM   3024 N  N   . VAL D  1 9   ? -30.782 35.962  -75.494 1.00 17.59  ? 4   VAL D N   1 
ATOM   3025 C  CA  . VAL D  1 9   ? -30.465 36.863  -74.396 1.00 18.28  ? 4   VAL D CA  1 
ATOM   3026 C  C   . VAL D  1 9   ? -31.498 37.975  -74.271 1.00 16.23  ? 4   VAL D C   1 
ATOM   3027 O  O   . VAL D  1 9   ? -31.840 38.636  -75.253 1.00 18.07  ? 4   VAL D O   1 
ATOM   3028 C  CB  . VAL D  1 9   ? -29.075 37.509  -74.583 1.00 17.70  ? 4   VAL D CB  1 
ATOM   3029 C  CG1 . VAL D  1 9   ? -28.830 38.568  -73.518 1.00 15.49  ? 4   VAL D CG1 1 
ATOM   3030 C  CG2 . VAL D  1 9   ? -27.985 36.451  -74.551 1.00 23.93  ? 4   VAL D CG2 1 
ATOM   3031 N  N   . PHE D  1 10  ? -32.003 38.176  -73.061 1.00 17.18  ? 5   PHE D N   1 
ATOM   3032 C  CA  . PHE D  1 10  ? -32.875 39.308  -72.788 1.00 19.32  ? 5   PHE D CA  1 
ATOM   3033 C  C   . PHE D  1 10  ? -32.134 40.322  -71.936 1.00 20.01  ? 5   PHE D C   1 
ATOM   3034 O  O   . PHE D  1 10  ? -31.751 40.025  -70.808 1.00 18.18  ? 5   PHE D O   1 
ATOM   3035 C  CB  . PHE D  1 10  ? -34.155 38.863  -72.080 1.00 15.38  ? 5   PHE D CB  1 
ATOM   3036 C  CG  . PHE D  1 10  ? -34.972 37.883  -72.870 1.00 17.17  ? 5   PHE D CG  1 
ATOM   3037 C  CD1 . PHE D  1 10  ? -35.910 38.323  -73.790 1.00 19.40  ? 5   PHE D CD1 1 
ATOM   3038 C  CD2 . PHE D  1 10  ? -34.797 36.522  -72.698 1.00 17.11  ? 5   PHE D CD2 1 
ATOM   3039 C  CE1 . PHE D  1 10  ? -36.660 37.420  -74.520 1.00 21.61  ? 5   PHE D CE1 1 
ATOM   3040 C  CE2 . PHE D  1 10  ? -35.541 35.617  -73.423 1.00 20.36  ? 5   PHE D CE2 1 
ATOM   3041 C  CZ  . PHE D  1 10  ? -36.475 36.066  -74.335 1.00 22.01  ? 5   PHE D CZ  1 
ATOM   3042 N  N   . ILE D  1 11  ? -31.911 41.506  -72.496 1.00 20.61  ? 6   ILE D N   1 
ATOM   3043 C  CA  . ILE D  1 11  ? -31.364 42.627  -71.744 1.00 17.51  ? 6   ILE D CA  1 
ATOM   3044 C  C   . ILE D  1 11  ? -32.534 43.386  -71.150 1.00 16.17  ? 6   ILE D C   1 
ATOM   3045 O  O   . ILE D  1 11  ? -33.254 44.077  -71.867 1.00 22.14  ? 6   ILE D O   1 
ATOM   3046 C  CB  . ILE D  1 11  ? -30.597 43.603  -72.649 1.00 23.49  ? 6   ILE D CB  1 
ATOM   3047 C  CG1 . ILE D  1 11  ? -29.616 42.852  -73.551 1.00 23.08  ? 6   ILE D CG1 1 
ATOM   3048 C  CG2 . ILE D  1 11  ? -29.892 44.676  -71.808 1.00 18.99  ? 6   ILE D CG2 1 
ATOM   3049 C  CD1 . ILE D  1 11  ? -28.382 42.387  -72.849 1.00 30.72  ? 6   ILE D CD1 1 
ATOM   3050 N  N   . LEU D  1 12  ? -32.727 43.260  -69.844 1.00 19.78  ? 7   LEU D N   1 
ATOM   3051 C  CA  . LEU D  1 12  ? -33.890 43.854  -69.201 1.00 17.11  ? 7   LEU D CA  1 
ATOM   3052 C  C   . LEU D  1 12  ? -33.666 45.313  -68.818 1.00 18.82  ? 7   LEU D C   1 
ATOM   3053 O  O   . LEU D  1 12  ? -34.288 46.207  -69.388 1.00 22.18  ? 7   LEU D O   1 
ATOM   3054 C  CB  . LEU D  1 12  ? -34.311 43.015  -67.996 1.00 13.02  ? 7   LEU D CB  1 
ATOM   3055 C  CG  . LEU D  1 12  ? -34.683 41.602  -68.452 1.00 14.41  ? 7   LEU D CG  1 
ATOM   3056 C  CD1 . LEU D  1 12  ? -34.955 40.697  -67.277 1.00 19.86  ? 7   LEU D CD1 1 
ATOM   3057 C  CD2 . LEU D  1 12  ? -35.875 41.643  -69.404 1.00 17.64  ? 7   LEU D CD2 1 
ATOM   3058 N  N   . TYR D  1 13  ? -32.765 45.551  -67.872 1.00 18.11  ? 8   TYR D N   1 
ATOM   3059 C  CA  . TYR D  1 13  ? -32.497 46.908  -67.421 1.00 21.42  ? 8   TYR D CA  1 
ATOM   3060 C  C   . TYR D  1 13  ? -31.163 47.027  -66.693 1.00 21.31  ? 8   TYR D C   1 
ATOM   3061 O  O   . TYR D  1 13  ? -30.575 46.024  -66.286 1.00 18.10  ? 8   TYR D O   1 
ATOM   3062 C  CB  . TYR D  1 13  ? -33.626 47.381  -66.504 1.00 16.65  ? 8   TYR D CB  1 
ATOM   3063 C  CG  . TYR D  1 13  ? -33.798 46.546  -65.253 1.00 20.00  ? 8   TYR D CG  1 
ATOM   3064 C  CD1 . TYR D  1 13  ? -33.108 46.858  -64.086 1.00 22.32  ? 8   TYR D CD1 1 
ATOM   3065 C  CD2 . TYR D  1 13  ? -34.657 45.455  -65.234 1.00 25.74  ? 8   TYR D CD2 1 
ATOM   3066 C  CE1 . TYR D  1 13  ? -33.262 46.103  -62.938 1.00 22.55  ? 8   TYR D CE1 1 
ATOM   3067 C  CE2 . TYR D  1 13  ? -34.819 44.691  -64.088 1.00 25.54  ? 8   TYR D CE2 1 
ATOM   3068 C  CZ  . TYR D  1 13  ? -34.119 45.021  -62.944 1.00 26.00  ? 8   TYR D CZ  1 
ATOM   3069 O  OH  . TYR D  1 13  ? -34.277 44.267  -61.803 1.00 20.74  ? 8   TYR D OH  1 
ATOM   3070 N  N   . ALA D  1 14  ? -30.700 48.265  -66.534 1.00 23.58  ? 9   ALA D N   1 
ATOM   3071 C  CA  . ALA D  1 14  ? -29.556 48.574  -65.684 1.00 23.26  ? 9   ALA D CA  1 
ATOM   3072 C  C   . ALA D  1 14  ? -30.029 49.492  -64.555 1.00 19.02  ? 9   ALA D C   1 
ATOM   3073 O  O   . ALA D  1 14  ? -31.005 50.227  -64.717 1.00 22.74  ? 9   ALA D O   1 
ATOM   3074 C  CB  . ALA D  1 14  ? -28.443 49.230  -66.496 1.00 20.30  ? 9   ALA D CB  1 
ATOM   3075 N  N   . GLU D  1 15  ? -29.355 49.451  -63.411 1.00 50.99  ? 10  GLU D N   1 
ATOM   3076 C  CA  . GLU D  1 15  ? -29.893 50.098  -62.214 1.00 54.74  ? 10  GLU D CA  1 
ATOM   3077 C  C   . GLU D  1 15  ? -29.264 51.436  -61.835 1.00 60.08  ? 10  GLU D C   1 
ATOM   3078 O  O   . GLU D  1 15  ? -29.972 52.418  -61.638 1.00 77.02  ? 10  GLU D O   1 
ATOM   3079 C  CB  . GLU D  1 15  ? -29.813 49.152  -61.019 1.00 55.54  ? 10  GLU D CB  1 
ATOM   3080 C  CG  . GLU D  1 15  ? -30.815 48.030  -61.068 1.00 100.33 ? 10  GLU D CG  1 
ATOM   3081 C  CD  . GLU D  1 15  ? -31.007 47.386  -59.716 1.00 102.63 ? 10  GLU D CD  1 
ATOM   3082 O  OE1 . GLU D  1 15  ? -30.503 46.260  -59.520 1.00 98.51  ? 10  GLU D OE1 1 
ATOM   3083 O  OE2 . GLU D  1 15  ? -31.666 48.002  -58.851 1.00 107.55 ? 10  GLU D OE2 1 
ATOM   3084 N  N   . ASN D  1 16  ? -27.943 51.469  -61.708 1.00 61.76  ? 11  ASN D N   1 
ATOM   3085 C  CA  . ASN D  1 16  ? -27.252 52.655  -61.195 1.00 67.68  ? 11  ASN D CA  1 
ATOM   3086 C  C   . ASN D  1 16  ? -26.205 53.220  -62.147 1.00 68.66  ? 11  ASN D C   1 
ATOM   3087 O  O   . ASN D  1 16  ? -25.089 53.524  -61.734 1.00 72.17  ? 11  ASN D O   1 
ATOM   3088 C  CB  . ASN D  1 16  ? -26.592 52.347  -59.845 1.00 70.88  ? 11  ASN D CB  1 
ATOM   3089 C  CG  . ASN D  1 16  ? -27.284 53.034  -58.680 1.00 75.51  ? 11  ASN D CG  1 
ATOM   3090 O  OD1 . ASN D  1 16  ? -26.851 54.091  -58.218 1.00 81.32  ? 11  ASN D OD1 1 
ATOM   3091 N  ND2 . ASN D  1 16  ? -28.361 52.429  -58.194 1.00 73.32  ? 11  ASN D ND2 1 
ATOM   3092 N  N   . VAL D  1 17  ? -26.556 53.359  -63.420 1.00 65.95  ? 12  VAL D N   1 
ATOM   3093 C  CA  . VAL D  1 17  ? -25.602 53.873  -64.397 1.00 66.87  ? 12  VAL D CA  1 
ATOM   3094 C  C   . VAL D  1 17  ? -25.428 55.380  -64.196 1.00 94.10  ? 12  VAL D C   1 
ATOM   3095 O  O   . VAL D  1 17  ? -26.372 56.169  -64.309 1.00 75.63  ? 12  VAL D O   1 
ATOM   3096 C  CB  . VAL D  1 17  ? -25.959 53.442  -65.859 1.00 62.12  ? 12  VAL D CB  1 
ATOM   3097 C  CG1 . VAL D  1 17  ? -27.133 52.479  -65.848 1.00 57.68  ? 12  VAL D CG1 1 
ATOM   3098 C  CG2 . VAL D  1 17  ? -26.228 54.632  -66.780 1.00 64.98  ? 12  VAL D CG2 1 
ATOM   3099 N  N   . HIS D  1 18  ? -24.217 55.761  -63.814 1.00 77.39  ? 13  HIS D N   1 
ATOM   3100 C  CA  . HIS D  1 18  ? -23.908 57.163  -63.596 1.00 100.92 ? 13  HIS D CA  1 
ATOM   3101 C  C   . HIS D  1 18  ? -22.761 57.552  -64.507 1.00 100.40 ? 13  HIS D C   1 
ATOM   3102 O  O   . HIS D  1 18  ? -21.728 56.881  -64.558 1.00 97.32  ? 13  HIS D O   1 
ATOM   3103 C  CB  . HIS D  1 18  ? -23.549 57.441  -62.133 1.00 108.87 ? 13  HIS D CB  1 
ATOM   3104 C  CG  . HIS D  1 18  ? -24.733 57.569  -61.224 1.00 113.74 ? 13  HIS D CG  1 
ATOM   3105 N  ND1 . HIS D  1 18  ? -24.841 56.864  -60.044 1.00 116.36 ? 13  HIS D ND1 1 
ATOM   3106 C  CD2 . HIS D  1 18  ? -25.850 58.332  -61.306 1.00 117.04 ? 13  HIS D CD2 1 
ATOM   3107 C  CE1 . HIS D  1 18  ? -25.974 57.180  -59.445 1.00 118.74 ? 13  HIS D CE1 1 
ATOM   3108 N  NE2 . HIS D  1 18  ? -26.607 58.067  -60.191 1.00 119.40 ? 13  HIS D NE2 1 
ATOM   3109 N  N   . THR D  1 19  ? -22.976 58.623  -65.254 1.00 104.65 ? 14  THR D N   1 
ATOM   3110 C  CA  . THR D  1 19  ? -21.972 59.175  -66.135 1.00 109.33 ? 14  THR D CA  1 
ATOM   3111 C  C   . THR D  1 19  ? -21.839 60.627  -65.719 1.00 119.85 ? 14  THR D C   1 
ATOM   3112 O  O   . THR D  1 19  ? -22.753 61.424  -65.949 1.00 122.42 ? 14  THR D O   1 
ATOM   3113 C  CB  . THR D  1 19  ? -22.381 59.063  -67.614 1.00 108.62 ? 14  THR D CB  1 
ATOM   3114 O  OG1 . THR D  1 19  ? -22.087 60.289  -68.296 1.00 115.95 ? 14  THR D OG1 1 
ATOM   3115 C  CG2 . THR D  1 19  ? -23.863 58.739  -67.748 1.00 105.91 ? 14  THR D CG2 1 
ATOM   3116 N  N   . PRO D  1 20  ? -20.709 60.951  -65.062 1.00 125.81 ? 15  PRO D N   1 
ATOM   3117 C  CA  . PRO D  1 20  ? -20.321 62.193  -64.391 1.00 136.37 ? 15  PRO D CA  1 
ATOM   3118 C  C   . PRO D  1 20  ? -19.546 63.183  -65.270 1.00 140.39 ? 15  PRO D C   1 
ATOM   3119 O  O   . PRO D  1 20  ? -19.097 62.838  -66.366 1.00 135.21 ? 15  PRO D O   1 
ATOM   3120 C  CB  . PRO D  1 20  ? -19.388 61.687  -63.264 1.00 139.05 ? 15  PRO D CB  1 
ATOM   3121 C  CG  . PRO D  1 20  ? -19.487 60.210  -63.268 1.00 130.22 ? 15  PRO D CG  1 
ATOM   3122 C  CD  . PRO D  1 20  ? -19.778 59.877  -64.690 1.00 123.41 ? 15  PRO D CD  1 
ATOM   3123 N  N   . ASP D  1 21  ? -19.413 64.417  -64.790 1.00 150.68 ? 16  ASP D N   1 
ATOM   3124 C  CA  . ASP D  1 21  ? -20.126 64.853  -63.592 1.00 156.14 ? 16  ASP D CA  1 
ATOM   3125 C  C   . ASP D  1 21  ? -21.305 65.707  -63.977 1.00 159.15 ? 16  ASP D C   1 
ATOM   3126 O  O   . ASP D  1 21  ? -21.674 66.650  -63.281 1.00 165.36 ? 16  ASP D O   1 
ATOM   3127 C  CB  . ASP D  1 21  ? -19.210 65.567  -62.603 1.00 165.54 ? 16  ASP D CB  1 
ATOM   3128 C  CG  . ASP D  1 21  ? -18.477 66.737  -63.218 1.00 172.92 ? 16  ASP D CG  1 
ATOM   3129 O  OD1 . ASP D  1 21  ? -18.736 67.057  -64.396 1.00 173.07 ? 16  ASP D OD1 1 
ATOM   3130 O  OD2 . ASP D  1 21  ? -17.643 67.347  -62.513 1.00 178.92 ? 16  ASP D OD2 1 
ATOM   3131 N  N   . THR D  1 22  ? -21.910 65.303  -65.075 1.00 155.86 ? 17  THR D N   1 
ATOM   3132 C  CA  . THR D  1 22  ? -23.115 65.892  -65.584 1.00 159.83 ? 17  THR D CA  1 
ATOM   3133 C  C   . THR D  1 22  ? -24.151 64.777  -65.486 1.00 155.23 ? 17  THR D C   1 
ATOM   3134 O  O   . THR D  1 22  ? -23.793 63.602  -65.466 1.00 149.54 ? 17  THR D O   1 
ATOM   3135 C  CB  . THR D  1 22  ? -22.916 66.245  -67.041 1.00 160.59 ? 17  THR D CB  1 
ATOM   3136 O  OG1 . THR D  1 22  ? -21.593 66.747  -67.210 1.00 135.88 ? 17  THR D OG1 1 
ATOM   3137 C  CG2 . THR D  1 22  ? -23.908 67.262  -67.471 1.00 135.91 ? 17  THR D CG2 1 
ATOM   3138 N  N   . ASP D  1 23  ? -25.430 65.123  -65.446 1.00 156.19 ? 18  ASP D N   1 
ATOM   3139 C  CA  . ASP D  1 23  ? -26.446 64.098  -65.261 1.00 149.10 ? 18  ASP D CA  1 
ATOM   3140 C  C   . ASP D  1 23  ? -26.825 63.518  -66.638 1.00 140.42 ? 18  ASP D C   1 
ATOM   3141 O  O   . ASP D  1 23  ? -27.896 62.938  -66.846 1.00 135.82 ? 18  ASP D O   1 
ATOM   3142 C  CB  . ASP D  1 23  ? -27.641 64.600  -64.431 1.00 151.80 ? 18  ASP D CB  1 
ATOM   3143 C  CG  . ASP D  1 23  ? -28.478 65.630  -65.154 1.00 155.20 ? 18  ASP D CG  1 
ATOM   3144 O  OD1 . ASP D  1 23  ? -28.628 65.515  -66.379 1.00 153.11 ? 18  ASP D OD1 1 
ATOM   3145 O  OD2 . ASP D  1 23  ? -29.007 66.538  -64.491 1.00 159.97 ? 18  ASP D OD2 1 
ATOM   3146 N  N   . ILE D  1 24  ? -25.901 63.715  -67.576 1.00 138.90 ? 19  ILE D N   1 
ATOM   3147 C  CA  . ILE D  1 24  ? -26.010 63.233  -68.932 1.00 105.50 ? 19  ILE D CA  1 
ATOM   3148 C  C   . ILE D  1 24  ? -26.076 61.695  -69.006 1.00 117.26 ? 19  ILE D C   1 
ATOM   3149 O  O   . ILE D  1 24  ? -25.416 60.968  -68.265 1.00 114.95 ? 19  ILE D O   1 
ATOM   3150 C  CB  . ILE D  1 24  ? -24.864 63.768  -69.842 1.00 108.75 ? 19  ILE D CB  1 
ATOM   3151 C  CG1 . ILE D  1 24  ? -23.695 64.357  -69.036 1.00 114.55 ? 19  ILE D CG1 1 
ATOM   3152 C  CG2 . ILE D  1 24  ? -25.410 64.762  -70.849 1.00 113.57 ? 19  ILE D CG2 1 
ATOM   3153 C  CD1 . ILE D  1 24  ? -22.847 65.380  -69.760 1.00 121.16 ? 19  ILE D CD1 1 
ATOM   3154 N  N   . SER D  1 25  ? -26.905 61.220  -69.915 1.00 111.12 ? 20  SER D N   1 
ATOM   3155 C  CA  . SER D  1 25  ? -26.929 59.805  -70.265 1.00 103.17 ? 20  SER D CA  1 
ATOM   3156 C  C   . SER D  1 25  ? -27.533 59.580  -71.653 1.00 105.05 ? 20  SER D C   1 
ATOM   3157 O  O   . SER D  1 25  ? -28.647 60.025  -71.921 1.00 114.22 ? 20  SER D O   1 
ATOM   3158 C  CB  . SER D  1 25  ? -27.775 59.032  -69.258 1.00 88.91  ? 20  SER D CB  1 
ATOM   3159 O  OG  . SER D  1 25  ? -29.162 59.176  -69.543 1.00 85.88  ? 20  SER D OG  1 
ATOM   3160 N  N   . ASP D  1 26  ? -26.879 58.796  -72.480 1.00 92.17  ? 21  ASP D N   1 
ATOM   3161 C  CA  . ASP D  1 26  ? -27.557 58.225  -73.619 1.00 85.18  ? 21  ASP D CA  1 
ATOM   3162 C  C   . ASP D  1 26  ? -27.210 56.766  -73.480 1.00 67.05  ? 21  ASP D C   1 
ATOM   3163 O  O   . ASP D  1 26  ? -26.385 56.261  -74.202 1.00 64.65  ? 21  ASP D O   1 
ATOM   3164 C  CB  . ASP D  1 26  ? -27.037 58.794  -74.946 1.00 76.45  ? 21  ASP D CB  1 
ATOM   3165 C  CG  . ASP D  1 26  ? -27.010 60.313  -74.971 1.00 84.41  ? 21  ASP D CG  1 
ATOM   3166 O  OD1 . ASP D  1 26  ? -28.029 60.932  -74.671 1.00 87.67  ? 21  ASP D OD1 1 
ATOM   3167 O  OD2 . ASP D  1 26  ? -25.963 60.883  -75.287 1.00 87.71  ? 21  ASP D OD2 1 
ATOM   3168 N  N   . ALA D  1 27  ? -27.819 56.111  -72.505 1.00 39.12  ? 22  ALA D N   1 
ATOM   3169 C  CA  . ALA D  1 27  ? -27.437 54.752  -72.155 1.00 36.15  ? 22  ALA D CA  1 
ATOM   3170 C  C   . ALA D  1 27  ? -28.019 53.702  -73.087 1.00 43.39  ? 22  ALA D C   1 
ATOM   3171 O  O   . ALA D  1 27  ? -29.232 53.627  -73.295 1.00 32.45  ? 22  ALA D O   1 
ATOM   3172 C  CB  . ALA D  1 27  ? -27.835 54.451  -70.720 1.00 42.01  ? 22  ALA D CB  1 
ATOM   3173 N  N   . TYR D  1 28  ? -27.133 52.887  -73.642 1.00 35.18  ? 23  TYR D N   1 
ATOM   3174 C  CA  . TYR D  1 28  ? -27.538 51.688  -74.347 1.00 30.07  ? 23  TYR D CA  1 
ATOM   3175 C  C   . TYR D  1 28  ? -26.572 50.584  -73.975 1.00 28.73  ? 23  TYR D C   1 
ATOM   3176 O  O   . TYR D  1 28  ? -25.522 50.828  -73.379 1.00 31.01  ? 23  TYR D O   1 
ATOM   3177 C  CB  . TYR D  1 28  ? -27.546 51.899  -75.859 1.00 29.91  ? 23  TYR D CB  1 
ATOM   3178 C  CG  . TYR D  1 28  ? -26.176 52.076  -76.473 1.00 31.07  ? 23  TYR D CG  1 
ATOM   3179 C  CD1 . TYR D  1 28  ? -25.545 53.313  -76.460 1.00 36.62  ? 23  TYR D CD1 1 
ATOM   3180 C  CD2 . TYR D  1 28  ? -25.519 51.011  -77.078 1.00 29.57  ? 23  TYR D CD2 1 
ATOM   3181 C  CE1 . TYR D  1 28  ? -24.296 53.483  -77.022 1.00 44.19  ? 23  TYR D CE1 1 
ATOM   3182 C  CE2 . TYR D  1 28  ? -24.270 51.173  -77.646 1.00 30.84  ? 23  TYR D CE2 1 
ATOM   3183 C  CZ  . TYR D  1 28  ? -23.664 52.411  -77.616 1.00 45.46  ? 23  TYR D CZ  1 
ATOM   3184 O  OH  . TYR D  1 28  ? -22.422 52.579  -78.183 1.00 45.24  ? 23  TYR D OH  1 
ATOM   3185 N  N   A CYS D  1 29  ? -26.933 49.367  -74.347 0.62 25.81  ? 24  CYS D N   1 
ATOM   3186 N  N   B CYS D  1 29  ? -26.833 49.367  -74.347 0.38 30.62  ? 24  CYS D N   1 
ATOM   3187 C  CA  A CYS D  1 29  ? -26.180 48.198  -73.955 0.62 30.72  ? 24  CYS D CA  1 
ATOM   3188 C  CA  B CYS D  1 29  ? -26.080 48.198  -73.955 0.38 31.62  ? 24  CYS D CA  1 
ATOM   3189 C  C   A CYS D  1 29  ? -25.795 47.400  -75.194 0.62 33.58  ? 24  CYS D C   1 
ATOM   3190 C  C   B CYS D  1 29  ? -25.695 47.400  -75.194 0.38 33.96  ? 24  CYS D C   1 
ATOM   3191 O  O   A CYS D  1 29  ? -26.650 47.051  -76.007 0.62 36.11  ? 24  CYS D O   1 
ATOM   3192 O  O   B CYS D  1 29  ? -26.550 47.051  -76.007 0.38 35.41  ? 24  CYS D O   1 
ATOM   3193 C  CB  A CYS D  1 29  ? -27.032 47.356  -73.011 0.62 23.41  ? 24  CYS D CB  1 
ATOM   3194 C  CB  B CYS D  1 29  ? -26.932 47.356  -73.011 0.38 29.44  ? 24  CYS D CB  1 
ATOM   3195 S  SG  A CYS D  1 29  ? -26.300 45.805  -72.575 0.62 29.16  ? 24  CYS D SG  1 
ATOM   3196 S  SG  B CYS D  1 29  ? -27.296 48.150  -71.472 0.38 84.48  ? 24  CYS D SG  1 
ATOM   3197 N  N   . SER D  1 30  ? -24.504 47.133  -75.352 1.00 29.73  ? 25  SER D N   1 
ATOM   3198 C  CA  . SER D  1 30  ? -24.044 46.309  -76.460 1.00 30.21  ? 25  SER D CA  1 
ATOM   3199 C  C   . SER D  1 30  ? -23.622 44.939  -75.945 1.00 31.67  ? 25  SER D C   1 
ATOM   3200 O  O   . SER D  1 30  ? -23.024 44.825  -74.876 1.00 36.59  ? 25  SER D O   1 
ATOM   3201 C  CB  . SER D  1 30  ? -22.888 46.981  -77.199 1.00 33.28  ? 25  SER D CB  1 
ATOM   3202 O  OG  . SER D  1 30  ? -21.703 46.945  -76.427 1.00 44.43  ? 25  SER D OG  1 
ATOM   3203 N  N   . ALA D  1 31  ? -23.948 43.900  -76.705 1.00 21.26  ? 26  ALA D N   1 
ATOM   3204 C  CA  . ALA D  1 31  ? -23.603 42.538  -76.323 1.00 20.57  ? 26  ALA D CA  1 
ATOM   3205 C  C   . ALA D  1 31  ? -22.878 41.846  -77.460 1.00 33.23  ? 26  ALA D C   1 
ATOM   3206 O  O   . ALA D  1 31  ? -23.299 41.921  -78.613 1.00 28.93  ? 26  ALA D O   1 
ATOM   3207 C  CB  . ALA D  1 31  ? -24.850 41.758  -75.935 1.00 19.88  ? 26  ALA D CB  1 
ATOM   3208 N  N   . VAL D  1 32  ? -21.776 41.182  -77.135 1.00 33.97  ? 27  VAL D N   1 
ATOM   3209 C  CA  . VAL D  1 32  ? -21.036 40.445  -78.142 1.00 29.01  ? 27  VAL D CA  1 
ATOM   3210 C  C   . VAL D  1 32  ? -20.922 38.976  -77.777 1.00 27.91  ? 27  VAL D C   1 
ATOM   3211 O  O   . VAL D  1 32  ? -20.553 38.617  -76.657 1.00 29.91  ? 27  VAL D O   1 
ATOM   3212 C  CB  . VAL D  1 32  ? -19.630 41.025  -78.376 1.00 30.33  ? 27  VAL D CB  1 
ATOM   3213 C  CG1 . VAL D  1 32  ? -18.971 40.336  -79.562 1.00 30.99  ? 27  VAL D CG1 1 
ATOM   3214 C  CG2 . VAL D  1 32  ? -19.704 42.521  -78.614 1.00 23.08  ? 27  VAL D CG2 1 
ATOM   3215 N  N   . PHE D  1 33  ? -21.264 38.133  -78.739 1.00 28.11  ? 28  PHE D N   1 
ATOM   3216 C  CA  . PHE D  1 33  ? -21.068 36.706  -78.614 1.00 29.39  ? 28  PHE D CA  1 
ATOM   3217 C  C   . PHE D  1 33  ? -20.782 36.130  -79.992 1.00 32.72  ? 28  PHE D C   1 
ATOM   3218 O  O   . PHE D  1 33  ? -21.379 36.555  -80.983 1.00 25.29  ? 28  PHE D O   1 
ATOM   3219 C  CB  . PHE D  1 33  ? -22.300 36.041  -78.003 1.00 28.67  ? 28  PHE D CB  1 
ATOM   3220 C  CG  . PHE D  1 33  ? -22.192 34.556  -77.925 1.00 29.95  ? 28  PHE D CG  1 
ATOM   3221 C  CD1 . PHE D  1 33  ? -21.570 33.948  -76.851 1.00 32.28  ? 28  PHE D CD1 1 
ATOM   3222 C  CD2 . PHE D  1 33  ? -22.690 33.767  -78.938 1.00 31.11  ? 28  PHE D CD2 1 
ATOM   3223 C  CE1 . PHE D  1 33  ? -21.459 32.578  -76.792 1.00 33.95  ? 28  PHE D CE1 1 
ATOM   3224 C  CE2 . PHE D  1 33  ? -22.576 32.409  -78.883 1.00 35.12  ? 28  PHE D CE2 1 
ATOM   3225 C  CZ  . PHE D  1 33  ? -21.965 31.809  -77.812 1.00 38.69  ? 28  PHE D CZ  1 
ATOM   3226 N  N   . ALA D  1 34  ? -19.864 35.169  -80.046 1.00 33.76  ? 29  ALA D N   1 
ATOM   3227 C  CA  . ALA D  1 34  ? -19.502 34.506  -81.295 1.00 35.73  ? 29  ALA D CA  1 
ATOM   3228 C  C   . ALA D  1 34  ? -19.114 35.492  -82.393 1.00 37.17  ? 29  ALA D C   1 
ATOM   3229 O  O   . ALA D  1 34  ? -19.413 35.273  -83.566 1.00 34.64  ? 29  ALA D O   1 
ATOM   3230 C  CB  . ALA D  1 34  ? -20.634 33.617  -81.768 1.00 34.15  ? 29  ALA D CB  1 
ATOM   3231 N  N   . GLY D  1 35  ? -18.468 36.585  -82.006 1.00 32.95  ? 30  GLY D N   1 
ATOM   3232 C  CA  . GLY D  1 35  ? -18.010 37.571  -82.966 1.00 29.69  ? 30  GLY D CA  1 
ATOM   3233 C  C   . GLY D  1 35  ? -19.097 38.471  -83.522 1.00 32.60  ? 30  GLY D C   1 
ATOM   3234 O  O   . GLY D  1 35  ? -18.841 39.258  -84.430 1.00 37.67  ? 30  GLY D O   1 
ATOM   3235 N  N   . VAL D  1 36  ? -20.311 38.363  -82.989 1.00 33.15  ? 31  VAL D N   1 
ATOM   3236 C  CA  . VAL D  1 36  ? -21.407 39.218  -83.440 1.00 32.97  ? 31  VAL D CA  1 
ATOM   3237 C  C   . VAL D  1 36  ? -21.890 40.174  -82.346 1.00 31.87  ? 31  VAL D C   1 
ATOM   3238 O  O   . VAL D  1 36  ? -22.275 39.748  -81.255 1.00 32.92  ? 31  VAL D O   1 
ATOM   3239 C  CB  . VAL D  1 36  ? -22.604 38.401  -83.977 1.00 35.15  ? 31  VAL D CB  1 
ATOM   3240 C  CG1 . VAL D  1 36  ? -23.763 39.328  -84.322 1.00 30.63  ? 31  VAL D CG1 1 
ATOM   3241 C  CG2 . VAL D  1 36  ? -22.192 37.571  -85.193 1.00 31.63  ? 31  VAL D CG2 1 
ATOM   3242 N  N   . LYS D  1 37  ? -21.855 41.470  -82.648 1.00 29.99  ? 32  LYS D N   1 
ATOM   3243 C  CA  . LYS D  1 37  ? -22.331 42.494  -81.727 1.00 28.68  ? 32  LYS D CA  1 
ATOM   3244 C  C   . LYS D  1 37  ? -23.776 42.868  -82.005 1.00 31.30  ? 32  LYS D C   1 
ATOM   3245 O  O   . LYS D  1 37  ? -24.186 43.024  -83.155 1.00 33.39  ? 32  LYS D O   1 
ATOM   3246 C  CB  . LYS D  1 37  ? -21.462 43.755  -81.790 1.00 32.24  ? 32  LYS D CB  1 
ATOM   3247 C  CG  . LYS D  1 37  ? -22.083 44.951  -81.066 1.00 35.11  ? 32  LYS D CG  1 
ATOM   3248 C  CD  . LYS D  1 37  ? -21.167 46.166  -81.051 1.00 40.25  ? 32  LYS D CD  1 
ATOM   3249 C  CE  . LYS D  1 37  ? -19.966 45.945  -80.149 1.00 41.02  ? 32  LYS D CE  1 
ATOM   3250 N  NZ  . LYS D  1 37  ? -19.045 47.111  -80.151 1.00 46.52  ? 32  LYS D NZ  1 
ATOM   3251 N  N   . LYS D  1 38  ? -24.543 43.007  -80.934 1.00 29.75  ? 33  LYS D N   1 
ATOM   3252 C  CA  . LYS D  1 38  ? -25.904 43.492  -81.019 1.00 30.91  ? 33  LYS D CA  1 
ATOM   3253 C  C   . LYS D  1 38  ? -26.052 44.571  -79.955 1.00 31.69  ? 33  LYS D C   1 
ATOM   3254 O  O   . LYS D  1 38  ? -25.385 44.521  -78.922 1.00 28.50  ? 33  LYS D O   1 
ATOM   3255 C  CB  . LYS D  1 38  ? -26.881 42.335  -80.800 1.00 27.33  ? 33  LYS D CB  1 
ATOM   3256 C  CG  . LYS D  1 38  ? -26.733 41.230  -81.847 1.00 28.69  ? 33  LYS D CG  1 
ATOM   3257 C  CD  . LYS D  1 38  ? -27.379 39.935  -81.413 1.00 26.79  ? 33  LYS D CD  1 
ATOM   3258 C  CE  . LYS D  1 38  ? -27.231 38.853  -82.469 1.00 29.01  ? 33  LYS D CE  1 
ATOM   3259 N  NZ  . LYS D  1 38  ? -27.858 39.266  -83.755 1.00 26.78  ? 33  LYS D NZ  1 
ATOM   3260 N  N   . ARG D  1 39  ? -26.890 45.565  -80.219 1.00 23.45  ? 34  ARG D N   1 
ATOM   3261 C  CA  . ARG D  1 39  ? -27.093 46.633  -79.249 1.00 26.94  ? 34  ARG D CA  1 
ATOM   3262 C  C   . ARG D  1 39  ? -28.568 46.918  -79.020 1.00 28.82  ? 34  ARG D C   1 
ATOM   3263 O  O   . ARG D  1 39  ? -29.402 46.711  -79.900 1.00 26.02  ? 34  ARG D O   1 
ATOM   3264 C  CB  . ARG D  1 39  ? -26.367 47.915  -79.671 1.00 28.72  ? 34  ARG D CB  1 
ATOM   3265 C  CG  . ARG D  1 39  ? -26.742 48.425  -81.049 1.00 49.13  ? 34  ARG D CG  1 
ATOM   3266 C  CD  . ARG D  1 39  ? -26.364 49.889  -81.218 1.00 68.81  ? 34  ARG D CD  1 
ATOM   3267 N  NE  . ARG D  1 39  ? -27.488 50.777  -80.937 1.00 79.84  ? 34  ARG D NE  1 
ATOM   3268 C  CZ  . ARG D  1 39  ? -28.320 51.239  -81.865 1.00 83.95  ? 34  ARG D CZ  1 
ATOM   3269 N  NH1 . ARG D  1 39  ? -28.149 50.900  -83.136 1.00 86.43  ? 34  ARG D NH1 1 
ATOM   3270 N  NH2 . ARG D  1 39  ? -29.319 52.041  -81.525 1.00 85.19  ? 34  ARG D NH2 1 
ATOM   3271 N  N   . THR D  1 40  ? -28.879 47.383  -77.819 1.00 27.52  ? 35  THR D N   1 
ATOM   3272 C  CA  . THR D  1 40  ? -30.218 47.829  -77.500 1.00 28.99  ? 35  THR D CA  1 
ATOM   3273 C  C   . THR D  1 40  ? -30.393 49.215  -78.088 1.00 31.92  ? 35  THR D C   1 
ATOM   3274 O  O   . THR D  1 40  ? -29.453 49.793  -78.640 1.00 27.18  ? 35  THR D O   1 
ATOM   3275 C  CB  . THR D  1 40  ? -30.413 47.927  -75.984 1.00 28.12  ? 35  THR D CB  1 
ATOM   3276 O  OG1 . THR D  1 40  ? -29.669 49.044  -75.480 1.00 25.05  ? 35  THR D OG1 1 
ATOM   3277 C  CG2 . THR D  1 40  ? -29.933 46.652  -75.306 1.00 22.18  ? 35  THR D CG2 1 
ATOM   3278 N  N   . LYS D  1 41  ? -31.599 49.752  -77.971 1.00 26.88  ? 36  LYS D N   1 
ATOM   3279 C  CA  . LYS D  1 41  ? -31.816 51.142  -78.305 1.00 38.63  ? 36  LYS D CA  1 
ATOM   3280 C  C   . LYS D  1 41  ? -31.249 51.970  -77.170 1.00 40.28  ? 36  LYS D C   1 
ATOM   3281 O  O   . LYS D  1 41  ? -30.864 51.443  -76.125 1.00 28.42  ? 36  LYS D O   1 
ATOM   3282 C  CB  . LYS D  1 41  ? -33.304 51.438  -78.464 1.00 45.07  ? 36  LYS D CB  1 
ATOM   3283 C  CG  . LYS D  1 41  ? -34.096 51.268  -77.183 1.00 48.90  ? 36  LYS D CG  1 
ATOM   3284 C  CD  . LYS D  1 41  ? -35.585 51.416  -77.431 1.00 57.37  ? 36  LYS D CD  1 
ATOM   3285 C  CE  . LYS D  1 41  ? -36.382 50.992  -76.212 1.00 56.54  ? 36  LYS D CE  1 
ATOM   3286 N  NZ  . LYS D  1 41  ? -36.061 49.589  -75.817 1.00 54.77  ? 36  LYS D NZ  1 
ATOM   3287 N  N   . VAL D  1 42  ? -31.203 53.275  -77.379 1.00 38.93  ? 37  VAL D N   1 
ATOM   3288 C  CA  . VAL D  1 42  ? -30.765 54.179  -76.339 1.00 42.08  ? 37  VAL D CA  1 
ATOM   3289 C  C   . VAL D  1 42  ? -31.958 54.601  -75.513 1.00 39.01  ? 37  VAL D C   1 
ATOM   3290 O  O   . VAL D  1 42  ? -33.046 54.810  -76.042 1.00 39.48  ? 37  VAL D O   1 
ATOM   3291 C  CB  . VAL D  1 42  ? -30.106 55.413  -76.944 1.00 48.81  ? 37  VAL D CB  1 
ATOM   3292 C  CG1 . VAL D  1 42  ? -29.653 56.372  -75.857 1.00 49.16  ? 37  VAL D CG1 1 
ATOM   3293 C  CG2 . VAL D  1 42  ? -28.948 54.975  -77.769 1.00 51.53  ? 37  VAL D CG2 1 
ATOM   3294 N  N   . ILE D  1 43  ? -31.757 54.698  -74.208 1.00 34.02  ? 38  ILE D N   1 
ATOM   3295 C  CA  . ILE D  1 43  ? -32.752 55.294  -73.343 1.00 43.70  ? 38  ILE D CA  1 
ATOM   3296 C  C   . ILE D  1 43  ? -32.249 56.673  -72.939 1.00 50.05  ? 38  ILE D C   1 
ATOM   3297 O  O   . ILE D  1 43  ? -31.232 56.793  -72.256 1.00 51.90  ? 38  ILE D O   1 
ATOM   3298 C  CB  . ILE D  1 43  ? -32.996 54.436  -72.099 1.00 42.43  ? 38  ILE D CB  1 
ATOM   3299 C  CG1 . ILE D  1 43  ? -33.474 53.039  -72.507 1.00 38.99  ? 38  ILE D CG1 1 
ATOM   3300 C  CG2 . ILE D  1 43  ? -34.010 55.107  -71.189 1.00 46.61  ? 38  ILE D CG2 1 
ATOM   3301 C  CD1 . ILE D  1 43  ? -34.876 53.013  -73.073 1.00 34.20  ? 38  ILE D CD1 1 
ATOM   3302 N  N   . LYS D  1 44  ? -32.961 57.706  -73.364 1.00 49.51  ? 39  LYS D N   1 
ATOM   3303 C  CA  . LYS D  1 44  ? -32.540 59.071  -73.097 1.00 55.74  ? 39  LYS D CA  1 
ATOM   3304 C  C   . LYS D  1 44  ? -32.790 59.480  -71.651 1.00 55.82  ? 39  LYS D C   1 
ATOM   3305 O  O   . LYS D  1 44  ? -33.899 59.383  -71.158 1.00 49.63  ? 39  LYS D O   1 
ATOM   3306 C  CB  . LYS D  1 44  ? -33.258 60.040  -74.052 1.00 61.75  ? 39  LYS D CB  1 
ATOM   3307 C  CG  . LYS D  1 44  ? -32.926 59.888  -75.528 1.00 61.17  ? 39  LYS D CG  1 
ATOM   3308 C  CD  . LYS D  1 44  ? -31.434 59.903  -75.803 1.00 58.92  ? 39  LYS D CD  1 
ATOM   3309 C  CE  . LYS D  1 44  ? -31.004 61.176  -76.499 1.00 67.26  ? 39  LYS D CE  1 
ATOM   3310 N  NZ  . LYS D  1 44  ? -29.834 60.973  -77.382 1.00 70.62  ? 39  LYS D NZ  1 
ATOM   3311 N  N   . ASN D  1 45  ? -31.745 59.982  -71.006 1.00 61.13  ? 40  ASN D N   1 
ATOM   3312 C  CA  . ASN D  1 45  ? -31.840 60.524  -69.644 1.00 62.41  ? 40  ASN D CA  1 
ATOM   3313 C  C   . ASN D  1 45  ? -32.462 59.644  -68.543 1.00 62.03  ? 40  ASN D C   1 
ATOM   3314 O  O   . ASN D  1 45  ? -33.534 59.946  -68.028 1.00 65.19  ? 40  ASN D O   1 
ATOM   3315 C  CB  . ASN D  1 45  ? -32.464 61.922  -69.646 1.00 57.47  ? 40  ASN D CB  1 
ATOM   3316 C  CG  . ASN D  1 45  ? -32.170 62.701  -68.370 1.00 61.64  ? 40  ASN D CG  1 
ATOM   3317 O  OD1 . ASN D  1 45  ? -33.047 63.325  -67.819 1.00 63.72  ? 40  ASN D OD1 1 
ATOM   3318 N  ND2 . ASN D  1 45  ? -30.941 62.671  -67.923 1.00 59.07  ? 40  ASN D ND2 1 
ATOM   3319 N  N   . SER D  1 46  ? -31.843 58.507  -68.273 1.00 52.68  ? 41  SER D N   1 
ATOM   3320 C  CA  . SER D  1 46  ? -32.268 57.667  -67.173 1.00 51.47  ? 41  SER D CA  1 
ATOM   3321 C  C   . SER D  1 46  ? -31.098 57.052  -66.424 1.00 53.78  ? 41  SER D C   1 
ATOM   3322 O  O   . SER D  1 46  ? -30.127 56.632  -67.016 1.00 49.79  ? 41  SER D O   1 
ATOM   3323 C  CB  . SER D  1 46  ? -33.187 56.585  -67.694 1.00 52.27  ? 41  SER D CB  1 
ATOM   3324 O  OG  . SER D  1 46  ? -34.227 56.282  -66.809 1.00 57.62  ? 41  SER D OG  1 
ATOM   3325 N  N   . VAL D  1 47  ? -31.210 56.974  -65.110 1.00 52.19  ? 42  VAL D N   1 
ATOM   3326 C  CA  . VAL D  1 47  ? -30.227 56.232  -64.327 1.00 53.01  ? 42  VAL D CA  1 
ATOM   3327 C  C   . VAL D  1 47  ? -30.622 54.762  -64.208 1.00 51.50  ? 42  VAL D C   1 
ATOM   3328 O  O   . VAL D  1 47  ? -29.785 53.905  -63.929 1.00 44.46  ? 42  VAL D O   1 
ATOM   3329 C  CB  . VAL D  1 47  ? -30.041 56.837  -62.921 1.00 55.42  ? 42  VAL D CB  1 
ATOM   3330 C  CG1 . VAL D  1 47  ? -29.461 58.241  -63.026 1.00 58.90  ? 42  VAL D CG1 1 
ATOM   3331 C  CG2 . VAL D  1 47  ? -31.359 56.857  -62.166 1.00 56.51  ? 42  VAL D CG2 1 
ATOM   3332 N  N   . ASN D  1 48  ? -31.902 54.482  -64.429 1.00 47.78  ? 43  ASN D N   1 
ATOM   3333 C  CA  . ASN D  1 48  ? -32.411 53.113  -64.448 1.00 40.76  ? 43  ASN D CA  1 
ATOM   3334 C  C   . ASN D  1 48  ? -33.076 52.826  -65.795 1.00 34.33  ? 43  ASN D C   1 
ATOM   3335 O  O   . ASN D  1 48  ? -34.301 52.760  -65.886 1.00 41.16  ? 43  ASN D O   1 
ATOM   3336 C  CB  . ASN D  1 48  ? -33.382 52.893  -63.275 1.00 45.33  ? 43  ASN D CB  1 
ATOM   3337 C  CG  . ASN D  1 48  ? -34.109 51.553  -63.339 1.00 57.65  ? 43  ASN D CG  1 
ATOM   3338 O  OD1 . ASN D  1 48  ? -35.318 51.481  -63.101 1.00 63.37  ? 43  ASN D OD1 1 
ATOM   3339 N  ND2 . ASN D  1 48  ? -33.381 50.493  -63.673 1.00 52.92  ? 43  ASN D ND2 1 
ATOM   3340 N  N   . PRO D  1 49  ? -32.267 52.688  -66.860 1.00 32.78  ? 44  PRO D N   1 
ATOM   3341 C  CA  . PRO D  1 49  ? -32.858 52.455  -68.181 1.00 33.00  ? 44  PRO D CA  1 
ATOM   3342 C  C   . PRO D  1 49  ? -33.435 51.054  -68.299 1.00 35.52  ? 44  PRO D C   1 
ATOM   3343 O  O   . PRO D  1 49  ? -32.770 50.082  -67.941 1.00 33.90  ? 44  PRO D O   1 
ATOM   3344 C  CB  . PRO D  1 49  ? -31.667 52.611  -69.131 1.00 32.06  ? 44  PRO D CB  1 
ATOM   3345 C  CG  . PRO D  1 49  ? -30.482 52.278  -68.309 1.00 31.46  ? 44  PRO D CG  1 
ATOM   3346 C  CD  . PRO D  1 49  ? -30.795 52.756  -66.919 1.00 33.36  ? 44  PRO D CD  1 
ATOM   3347 N  N   . VAL D  1 50  ? -34.667 50.962  -68.786 1.00 29.77  ? 45  VAL D N   1 
ATOM   3348 C  CA  . VAL D  1 50  ? -35.291 49.677  -69.062 1.00 27.11  ? 45  VAL D CA  1 
ATOM   3349 C  C   . VAL D  1 50  ? -35.358 49.478  -70.571 1.00 31.99  ? 45  VAL D C   1 
ATOM   3350 O  O   . VAL D  1 50  ? -36.127 50.151  -71.257 1.00 32.76  ? 45  VAL D O   1 
ATOM   3351 C  CB  . VAL D  1 50  ? -36.718 49.602  -68.487 1.00 32.96  ? 45  VAL D CB  1 
ATOM   3352 C  CG1 . VAL D  1 50  ? -37.359 48.269  -68.834 1.00 32.72  ? 45  VAL D CG1 1 
ATOM   3353 C  CG2 . VAL D  1 50  ? -36.709 49.827  -66.978 1.00 35.76  ? 45  VAL D CG2 1 
ATOM   3354 N  N   . TRP D  1 51  ? -34.541 48.567  -71.090 1.00 25.71  ? 46  TRP D N   1 
ATOM   3355 C  CA  . TRP D  1 51  ? -34.535 48.283  -72.520 1.00 27.46  ? 46  TRP D CA  1 
ATOM   3356 C  C   . TRP D  1 51  ? -35.536 47.186  -72.856 1.00 27.21  ? 46  TRP D C   1 
ATOM   3357 O  O   . TRP D  1 51  ? -36.292 47.307  -73.818 1.00 28.38  ? 46  TRP D O   1 
ATOM   3358 C  CB  . TRP D  1 51  ? -33.143 47.864  -72.998 1.00 23.66  ? 46  TRP D CB  1 
ATOM   3359 C  CG  . TRP D  1 51  ? -32.089 48.911  -72.821 1.00 25.33  ? 46  TRP D CG  1 
ATOM   3360 C  CD1 . TRP D  1 51  ? -31.906 50.029  -73.582 1.00 27.55  ? 46  TRP D CD1 1 
ATOM   3361 C  CD2 . TRP D  1 51  ? -31.054 48.924  -71.833 1.00 24.68  ? 46  TRP D CD2 1 
ATOM   3362 N  NE1 . TRP D  1 51  ? -30.827 50.746  -73.119 1.00 27.60  ? 46  TRP D NE1 1 
ATOM   3363 C  CE2 . TRP D  1 51  ? -30.289 50.089  -72.044 1.00 26.20  ? 46  TRP D CE2 1 
ATOM   3364 C  CE3 . TRP D  1 51  ? -30.706 48.068  -70.783 1.00 24.13  ? 46  TRP D CE3 1 
ATOM   3365 C  CZ2 . TRP D  1 51  ? -29.191 50.414  -71.251 1.00 27.51  ? 46  TRP D CZ2 1 
ATOM   3366 C  CZ3 . TRP D  1 51  ? -29.622 48.396  -69.992 1.00 27.46  ? 46  TRP D CZ3 1 
ATOM   3367 C  CH2 . TRP D  1 51  ? -28.876 49.559  -70.230 1.00 26.59  ? 46  TRP D CH2 1 
ATOM   3368 N  N   . ASN D  1 52  ? -35.522 46.117  -72.061 1.00 24.60  ? 47  ASN D N   1 
ATOM   3369 C  CA  . ASN D  1 52  ? -36.407 44.973  -72.272 1.00 25.62  ? 47  ASN D CA  1 
ATOM   3370 C  C   . ASN D  1 52  ? -36.338 44.466  -73.714 1.00 23.67  ? 47  ASN D C   1 
ATOM   3371 O  O   . ASN D  1 52  ? -37.351 44.377  -74.403 1.00 25.00  ? 47  ASN D O   1 
ATOM   3372 C  CB  . ASN D  1 52  ? -37.846 45.341  -71.894 1.00 30.65  ? 47  ASN D CB  1 
ATOM   3373 C  CG  . ASN D  1 52  ? -38.786 44.152  -71.931 1.00 36.01  ? 47  ASN D CG  1 
ATOM   3374 O  OD1 . ASN D  1 52  ? -38.405 43.031  -71.596 1.00 36.55  ? 47  ASN D OD1 1 
ATOM   3375 N  ND2 . ASN D  1 52  ? -40.020 44.392  -72.353 1.00 31.19  ? 47  ASN D ND2 1 
ATOM   3376 N  N   . GLU D  1 53  ? -35.132 44.155  -74.175 1.00 22.76  ? 48  GLU D N   1 
ATOM   3377 C  CA  . GLU D  1 53  ? -34.945 43.727  -75.556 1.00 22.91  ? 48  GLU D CA  1 
ATOM   3378 C  C   . GLU D  1 53  ? -34.439 42.294  -75.659 1.00 22.54  ? 48  GLU D C   1 
ATOM   3379 O  O   . GLU D  1 53  ? -33.682 41.830  -74.806 1.00 24.60  ? 48  GLU D O   1 
ATOM   3380 C  CB  . GLU D  1 53  ? -33.995 44.672  -76.288 1.00 38.49  ? 48  GLU D CB  1 
ATOM   3381 C  CG  . GLU D  1 53  ? -34.526 46.086  -76.442 1.00 40.11  ? 48  GLU D CG  1 
ATOM   3382 C  CD  . GLU D  1 53  ? -33.682 46.917  -77.383 1.00 32.69  ? 48  GLU D CD  1 
ATOM   3383 O  OE1 . GLU D  1 53  ? -33.136 46.349  -78.352 1.00 34.64  ? 48  GLU D OE1 1 
ATOM   3384 O  OE2 . GLU D  1 53  ? -33.556 48.137  -77.150 1.00 38.45  ? 48  GLU D OE2 1 
ATOM   3385 N  N   . GLY D  1 54  ? -34.864 41.603  -76.714 1.00 23.45  ? 49  GLY D N   1 
ATOM   3386 C  CA  . GLY D  1 54  ? -34.472 40.223  -76.945 1.00 23.67  ? 49  GLY D CA  1 
ATOM   3387 C  C   . GLY D  1 54  ? -33.509 40.077  -78.108 1.00 32.25  ? 49  GLY D C   1 
ATOM   3388 O  O   . GLY D  1 54  ? -33.661 40.735  -79.138 1.00 30.58  ? 49  GLY D O   1 
ATOM   3389 N  N   . PHE D  1 55  ? -32.513 39.210  -77.940 1.00 22.99  ? 50  PHE D N   1 
ATOM   3390 C  CA  . PHE D  1 55  ? -31.524 38.949  -78.979 1.00 23.00  ? 50  PHE D CA  1 
ATOM   3391 C  C   . PHE D  1 55  ? -31.309 37.449  -79.146 1.00 26.97  ? 50  PHE D C   1 
ATOM   3392 O  O   . PHE D  1 55  ? -31.355 36.695  -78.174 1.00 28.33  ? 50  PHE D O   1 
ATOM   3393 C  CB  . PHE D  1 55  ? -30.182 39.605  -78.633 1.00 25.23  ? 50  PHE D CB  1 
ATOM   3394 C  CG  . PHE D  1 55  ? -30.260 41.092  -78.413 1.00 33.48  ? 50  PHE D CG  1 
ATOM   3395 C  CD1 . PHE D  1 55  ? -30.330 41.964  -79.484 1.00 36.08  ? 50  PHE D CD1 1 
ATOM   3396 C  CD2 . PHE D  1 55  ? -30.239 41.617  -77.133 1.00 31.15  ? 50  PHE D CD2 1 
ATOM   3397 C  CE1 . PHE D  1 55  ? -30.394 43.328  -79.288 1.00 34.43  ? 50  PHE D CE1 1 
ATOM   3398 C  CE2 . PHE D  1 55  ? -30.302 42.984  -76.930 1.00 38.01  ? 50  PHE D CE2 1 
ATOM   3399 C  CZ  . PHE D  1 55  ? -30.377 43.840  -78.008 1.00 30.95  ? 50  PHE D CZ  1 
ATOM   3400 N  N   . GLU D  1 56  ? -31.068 37.021  -80.380 1.00 26.00  ? 51  GLU D N   1 
ATOM   3401 C  CA  . GLU D  1 56  ? -30.754 35.625  -80.659 1.00 27.89  ? 51  GLU D CA  1 
ATOM   3402 C  C   . GLU D  1 56  ? -29.490 35.521  -81.504 1.00 28.11  ? 51  GLU D C   1 
ATOM   3403 O  O   . GLU D  1 56  ? -29.379 36.164  -82.545 1.00 30.72  ? 51  GLU D O   1 
ATOM   3404 C  CB  . GLU D  1 56  ? -31.912 34.947  -81.395 1.00 40.23  ? 51  GLU D CB  1 
ATOM   3405 C  CG  . GLU D  1 56  ? -33.258 35.066  -80.703 1.00 57.62  ? 51  GLU D CG  1 
ATOM   3406 C  CD  . GLU D  1 56  ? -34.417 34.905  -81.670 1.00 69.10  ? 51  GLU D CD  1 
ATOM   3407 O  OE1 . GLU D  1 56  ? -35.040 35.928  -82.024 1.00 73.71  ? 51  GLU D OE1 1 
ATOM   3408 O  OE2 . GLU D  1 56  ? -34.702 33.761  -82.081 1.00 68.61  ? 51  GLU D OE2 1 
ATOM   3409 N  N   . TRP D  1 57  ? -28.537 34.716  -81.045 1.00 32.17  ? 52  TRP D N   1 
ATOM   3410 C  CA  . TRP D  1 57  ? -27.358 34.393  -81.837 1.00 31.00  ? 52  TRP D CA  1 
ATOM   3411 C  C   . TRP D  1 57  ? -27.488 32.972  -82.351 1.00 37.11  ? 52  TRP D C   1 
ATOM   3412 O  O   . TRP D  1 57  ? -27.708 32.044  -81.575 1.00 35.60  ? 52  TRP D O   1 
ATOM   3413 C  CB  . TRP D  1 57  ? -26.091 34.472  -80.989 1.00 32.72  ? 52  TRP D CB  1 
ATOM   3414 C  CG  . TRP D  1 57  ? -25.579 35.847  -80.717 1.00 30.05  ? 52  TRP D CG  1 
ATOM   3415 C  CD1 . TRP D  1 57  ? -24.586 36.500  -81.389 1.00 26.88  ? 52  TRP D CD1 1 
ATOM   3416 C  CD2 . TRP D  1 57  ? -26.008 36.731  -79.677 1.00 24.84  ? 52  TRP D CD2 1 
ATOM   3417 N  NE1 . TRP D  1 57  ? -24.376 37.738  -80.837 1.00 24.83  ? 52  TRP D NE1 1 
ATOM   3418 C  CE2 . TRP D  1 57  ? -25.236 37.906  -79.784 1.00 22.70  ? 52  TRP D CE2 1 
ATOM   3419 C  CE3 . TRP D  1 57  ? -26.970 36.645  -78.666 1.00 34.17  ? 52  TRP D CE3 1 
ATOM   3420 C  CZ2 . TRP D  1 57  ? -25.398 38.987  -78.919 1.00 23.03  ? 52  TRP D CZ2 1 
ATOM   3421 C  CZ3 . TRP D  1 57  ? -27.132 37.720  -77.811 1.00 20.78  ? 52  TRP D CZ3 1 
ATOM   3422 C  CH2 . TRP D  1 57  ? -26.352 38.877  -77.945 1.00 24.72  ? 52  TRP D CH2 1 
ATOM   3423 N  N   . ASP D  1 58  ? -27.360 32.791  -83.653 1.00 43.03  ? 53  ASP D N   1 
ATOM   3424 C  CA  . ASP D  1 58  ? -27.440 31.456  -84.203 1.00 47.71  ? 53  ASP D CA  1 
ATOM   3425 C  C   . ASP D  1 58  ? -26.120 30.768  -83.920 1.00 53.31  ? 53  ASP D C   1 
ATOM   3426 O  O   . ASP D  1 58  ? -25.068 31.225  -84.316 1.00 59.33  ? 53  ASP D O   1 
ATOM   3427 C  CB  . ASP D  1 58  ? -27.736 31.501  -85.698 1.00 56.84  ? 53  ASP D CB  1 
ATOM   3428 C  CG  . ASP D  1 58  ? -29.131 32.042  -86.004 1.00 68.47  ? 53  ASP D CG  1 
ATOM   3429 O  OD1 . ASP D  1 58  ? -30.089 31.688  -85.288 1.00 66.69  ? 53  ASP D OD1 1 
ATOM   3430 O  OD2 . ASP D  1 58  ? -29.274 32.824  -86.961 1.00 76.04  ? 53  ASP D OD2 1 
ATOM   3431 N  N   . LEU D  1 59  ? -26.183 29.657  -83.217 1.00 78.19  ? 54  LEU D N   1 
ATOM   3432 C  CA  . LEU D  1 59  ? -24.978 29.032  -82.740 1.00 81.41  ? 54  LEU D CA  1 
ATOM   3433 C  C   . LEU D  1 59  ? -24.476 28.176  -83.879 1.00 89.05  ? 54  LEU D C   1 
ATOM   3434 O  O   . LEU D  1 59  ? -24.642 26.962  -83.887 1.00 92.36  ? 54  LEU D O   1 
ATOM   3435 C  CB  . LEU D  1 59  ? -25.245 28.190  -81.499 1.00 81.13  ? 54  LEU D CB  1 
ATOM   3436 C  CG  . LEU D  1 59  ? -25.218 28.921  -80.159 1.00 76.39  ? 54  LEU D CG  1 
ATOM   3437 C  CD1 . LEU D  1 59  ? -24.855 27.972  -79.043 1.00 76.16  ? 54  LEU D CD1 1 
ATOM   3438 C  CD2 . LEU D  1 59  ? -24.256 30.088  -80.189 1.00 74.97  ? 54  LEU D CD2 1 
ATOM   3439 N  N   . LYS D  1 60  ? -23.865 28.837  -84.852 1.00 90.75  ? 55  LYS D N   1 
ATOM   3440 C  CA  . LYS D  1 60  ? -23.724 28.274  -86.171 1.00 94.65  ? 55  LYS D CA  1 
ATOM   3441 C  C   . LYS D  1 60  ? -22.520 27.398  -86.058 1.00 93.86  ? 55  LYS D C   1 
ATOM   3442 O  O   . LYS D  1 60  ? -21.440 27.740  -86.503 1.00 97.79  ? 55  LYS D O   1 
ATOM   3443 C  CB  . LYS D  1 60  ? -23.484 29.364  -87.207 1.00 96.33  ? 55  LYS D CB  1 
ATOM   3444 C  CG  . LYS D  1 60  ? -22.647 30.522  -86.714 1.00 95.11  ? 55  LYS D CG  1 
ATOM   3445 C  CD  . LYS D  1 60  ? -23.074 31.809  -87.393 1.00 99.17  ? 55  LYS D CD  1 
ATOM   3446 C  CE  . LYS D  1 60  ? -22.324 33.013  -86.849 1.00 98.23  ? 55  LYS D CE  1 
ATOM   3447 N  NZ  . LYS D  1 60  ? -22.676 34.267  -87.567 1.00 98.70  ? 55  LYS D NZ  1 
ATOM   3448 N  N   . GLY D  1 61  ? -22.717 26.273  -85.396 1.00 93.11  ? 56  GLY D N   1 
ATOM   3449 C  CA  . GLY D  1 61  ? -21.743 25.214  -85.400 1.00 102.63 ? 56  GLY D CA  1 
ATOM   3450 C  C   . GLY D  1 61  ? -20.678 25.444  -84.362 1.00 105.30 ? 56  GLY D C   1 
ATOM   3451 O  O   . GLY D  1 61  ? -19.794 24.623  -84.204 1.00 111.87 ? 56  GLY D O   1 
ATOM   3452 N  N   . ILE D  1 62  ? -20.780 26.542  -83.625 1.00 101.53 ? 57  ILE D N   1 
ATOM   3453 C  CA  . ILE D  1 62  ? -19.893 26.779  -82.489 1.00 102.33 ? 57  ILE D CA  1 
ATOM   3454 C  C   . ILE D  1 62  ? -20.590 26.428  -81.174 1.00 102.95 ? 57  ILE D C   1 
ATOM   3455 O  O   . ILE D  1 62  ? -21.130 27.303  -80.505 1.00 100.33 ? 57  ILE D O   1 
ATOM   3456 C  CB  . ILE D  1 62  ? -19.327 28.242  -82.419 1.00 70.24  ? 57  ILE D CB  1 
ATOM   3457 C  CG1 . ILE D  1 62  ? -20.373 29.295  -82.818 1.00 94.38  ? 57  ILE D CG1 1 
ATOM   3458 C  CG2 . ILE D  1 62  ? -18.037 28.378  -83.223 1.00 75.90  ? 57  ILE D CG2 1 
ATOM   3459 C  CD1 . ILE D  1 62  ? -20.800 30.170  -81.641 1.00 85.86  ? 57  ILE D CD1 1 
ATOM   3460 N  N   . PRO D  1 63  ? -20.561 25.144  -80.787 1.00 106.93 ? 58  PRO D N   1 
ATOM   3461 C  CA  . PRO D  1 63  ? -21.243 24.714  -79.563 1.00 108.88 ? 58  PRO D CA  1 
ATOM   3462 C  C   . PRO D  1 63  ? -20.703 25.489  -78.369 1.00 111.47 ? 58  PRO D C   1 
ATOM   3463 O  O   . PRO D  1 63  ? -19.551 25.899  -78.410 1.00 116.04 ? 58  PRO D O   1 
ATOM   3464 C  CB  . PRO D  1 63  ? -20.841 23.252  -79.452 1.00 114.21 ? 58  PRO D CB  1 
ATOM   3465 C  CG  . PRO D  1 63  ? -19.504 23.188  -80.102 1.00 117.64 ? 58  PRO D CG  1 
ATOM   3466 C  CD  . PRO D  1 63  ? -19.587 24.143  -81.252 1.00 115.18 ? 58  PRO D CD  1 
ATOM   3467 N  N   . LEU D  1 64  ? -21.519 25.702  -77.343 1.00 108.24 ? 59  LEU D N   1 
ATOM   3468 C  CA  . LEU D  1 64  ? -21.107 26.470  -76.171 1.00 103.92 ? 59  LEU D CA  1 
ATOM   3469 C  C   . LEU D  1 64  ? -20.138 25.681  -75.292 1.00 109.12 ? 59  LEU D C   1 
ATOM   3470 O  O   . LEU D  1 64  ? -20.425 24.549  -74.895 1.00 113.82 ? 59  LEU D O   1 
ATOM   3471 C  CB  . LEU D  1 64  ? -22.338 26.860  -75.354 1.00 96.70  ? 59  LEU D CB  1 
ATOM   3472 C  CG  . LEU D  1 64  ? -22.412 28.207  -74.635 1.00 88.46  ? 59  LEU D CG  1 
ATOM   3473 C  CD1 . LEU D  1 64  ? -21.944 29.303  -75.546 1.00 88.93  ? 59  LEU D CD1 1 
ATOM   3474 C  CD2 . LEU D  1 64  ? -23.839 28.479  -74.189 1.00 78.46  ? 59  LEU D CD2 1 
ATOM   3475 N  N   . ASP D  1 65  ? -18.991 26.283  -74.989 1.00 108.27 ? 60  ASP D N   1 
ATOM   3476 C  CA  . ASP D  1 65  ? -18.004 25.648  -74.125 1.00 111.68 ? 60  ASP D CA  1 
ATOM   3477 C  C   . ASP D  1 65  ? -18.137 26.121  -72.685 1.00 104.14 ? 60  ASP D C   1 
ATOM   3478 O  O   . ASP D  1 65  ? -18.912 27.030  -72.381 1.00 98.80  ? 60  ASP D O   1 
ATOM   3479 C  CB  . ASP D  1 65  ? -16.592 25.960  -74.613 1.00 116.54 ? 60  ASP D CB  1 
ATOM   3480 C  CG  . ASP D  1 65  ? -16.480 25.927  -76.118 1.00 119.24 ? 60  ASP D CG  1 
ATOM   3481 O  OD1 . ASP D  1 65  ? -17.521 26.068  -76.785 1.00 115.32 ? 60  ASP D OD1 1 
ATOM   3482 O  OD2 . ASP D  1 65  ? -15.354 25.764  -76.633 1.00 125.14 ? 60  ASP D OD2 1 
ATOM   3483 N  N   . GLN D  1 66  ? -17.366 25.497  -71.802 1.00 103.10 ? 61  GLN D N   1 
ATOM   3484 C  CA  . GLN D  1 66  ? -17.232 25.961  -70.428 1.00 96.94  ? 61  GLN D CA  1 
ATOM   3485 C  C   . GLN D  1 66  ? -16.533 27.319  -70.444 1.00 89.23  ? 61  GLN D C   1 
ATOM   3486 O  O   . GLN D  1 66  ? -16.714 28.136  -69.539 1.00 86.01  ? 61  GLN D O   1 
ATOM   3487 C  CB  . GLN D  1 66  ? -16.419 24.956  -69.605 1.00 101.43 ? 61  GLN D CB  1 
ATOM   3488 C  CG  . GLN D  1 66  ? -16.564 25.099  -68.090 1.00 101.40 ? 61  GLN D CG  1 
ATOM   3489 C  CD  . GLN D  1 66  ? -15.367 25.771  -67.436 1.00 106.34 ? 61  GLN D CD  1 
ATOM   3490 O  OE1 . GLN D  1 66  ? -15.503 26.807  -66.785 1.00 102.25 ? 61  GLN D OE1 1 
ATOM   3491 N  NE2 . GLN D  1 66  ? -14.191 25.173  -67.593 1.00 114.48 ? 61  GLN D NE2 1 
ATOM   3492 N  N   . GLY D  1 67  ? -15.743 27.560  -71.488 1.00 85.43  ? 62  GLY D N   1 
ATOM   3493 C  CA  . GLY D  1 67  ? -14.995 28.797  -71.604 1.00 81.16  ? 62  GLY D CA  1 
ATOM   3494 C  C   . GLY D  1 67  ? -15.784 29.980  -72.140 1.00 76.66  ? 62  GLY D C   1 
ATOM   3495 O  O   . GLY D  1 67  ? -15.432 31.133  -71.879 1.00 77.78  ? 62  GLY D O   1 
ATOM   3496 N  N   . SER D  1 68  ? -16.849 29.695  -72.883 1.00 70.04  ? 63  SER D N   1 
ATOM   3497 C  CA  . SER D  1 68  ? -17.638 30.726  -73.554 1.00 66.71  ? 63  SER D CA  1 
ATOM   3498 C  C   . SER D  1 68  ? -18.131 31.820  -72.614 1.00 60.10  ? 63  SER D C   1 
ATOM   3499 O  O   . SER D  1 68  ? -18.625 31.544  -71.520 1.00 48.42  ? 63  SER D O   1 
ATOM   3500 C  CB  . SER D  1 68  ? -18.834 30.093  -74.264 1.00 69.72  ? 63  SER D CB  1 
ATOM   3501 O  OG  . SER D  1 68  ? -18.431 29.020  -75.098 1.00 81.29  ? 63  SER D OG  1 
ATOM   3502 N  N   . GLU D  1 69  ? -17.982 33.066  -73.048 1.00 48.38  ? 64  GLU D N   1 
ATOM   3503 C  CA  . GLU D  1 69  ? -18.493 34.196  -72.288 1.00 44.75  ? 64  GLU D CA  1 
ATOM   3504 C  C   . GLU D  1 69  ? -19.293 35.156  -73.154 1.00 42.05  ? 64  GLU D C   1 
ATOM   3505 O  O   . GLU D  1 69  ? -19.018 35.324  -74.340 1.00 43.55  ? 64  GLU D O   1 
ATOM   3506 C  CB  . GLU D  1 69  ? -17.354 34.938  -71.581 1.00 46.24  ? 64  GLU D CB  1 
ATOM   3507 C  CG  . GLU D  1 69  ? -16.647 34.081  -70.549 1.00 75.95  ? 64  GLU D CG  1 
ATOM   3508 C  CD  . GLU D  1 69  ? -15.637 34.847  -69.725 1.00 81.29  ? 64  GLU D CD  1 
ATOM   3509 O  OE1 . GLU D  1 69  ? -15.108 35.866  -70.218 1.00 84.87  ? 64  GLU D OE1 1 
ATOM   3510 O  OE2 . GLU D  1 69  ? -15.374 34.420  -68.582 1.00 82.96  ? 64  GLU D OE2 1 
ATOM   3511 N  N   . LEU D  1 70  ? -20.303 35.764  -72.548 1.00 38.46  ? 65  LEU D N   1 
ATOM   3512 C  CA  . LEU D  1 70  ? -21.055 36.827  -73.189 1.00 36.06  ? 65  LEU D CA  1 
ATOM   3513 C  C   . LEU D  1 70  ? -20.521 38.147  -72.661 1.00 35.79  ? 65  LEU D C   1 
ATOM   3514 O  O   . LEU D  1 70  ? -20.633 38.437  -71.469 1.00 43.40  ? 65  LEU D O   1 
ATOM   3515 C  CB  . LEU D  1 70  ? -22.545 36.700  -72.865 1.00 32.76  ? 65  LEU D CB  1 
ATOM   3516 C  CG  . LEU D  1 70  ? -23.433 37.864  -73.315 1.00 30.26  ? 65  LEU D CG  1 
ATOM   3517 C  CD1 . LEU D  1 70  ? -23.533 37.912  -74.829 1.00 31.20  ? 65  LEU D CD1 1 
ATOM   3518 C  CD2 . LEU D  1 70  ? -24.814 37.763  -72.685 1.00 27.40  ? 65  LEU D CD2 1 
ATOM   3519 N  N   . HIS D  1 71  ? -19.921 38.941  -73.538 1.00 37.34  ? 66  HIS D N   1 
ATOM   3520 C  CA  . HIS D  1 71  ? -19.448 40.250  -73.125 1.00 37.53  ? 66  HIS D CA  1 
ATOM   3521 C  C   . HIS D  1 71  ? -20.542 41.276  -73.324 1.00 37.18  ? 66  HIS D C   1 
ATOM   3522 O  O   . HIS D  1 71  ? -21.066 41.441  -74.425 1.00 38.17  ? 66  HIS D O   1 
ATOM   3523 C  CB  . HIS D  1 71  ? -18.199 40.679  -73.890 1.00 41.21  ? 66  HIS D CB  1 
ATOM   3524 C  CG  . HIS D  1 71  ? -17.519 41.870  -73.290 1.00 50.29  ? 66  HIS D CG  1 
ATOM   3525 N  ND1 . HIS D  1 71  ? -16.777 42.764  -74.031 1.00 56.99  ? 66  HIS D ND1 1 
ATOM   3526 C  CD2 . HIS D  1 71  ? -17.472 42.311  -72.011 1.00 45.85  ? 66  HIS D CD2 1 
ATOM   3527 C  CE1 . HIS D  1 71  ? -16.302 43.704  -73.234 1.00 58.36  ? 66  HIS D CE1 1 
ATOM   3528 N  NE2 . HIS D  1 71  ? -16.710 43.453  -72.003 1.00 52.94  ? 66  HIS D NE2 1 
ATOM   3529 N  N   . VAL D  1 72  ? -20.884 41.966  -72.248 1.00 33.25  ? 67  VAL D N   1 
ATOM   3530 C  CA  . VAL D  1 72  ? -21.894 42.999  -72.312 1.00 32.65  ? 67  VAL D CA  1 
ATOM   3531 C  C   . VAL D  1 72  ? -21.318 44.314  -71.820 1.00 32.46  ? 67  VAL D C   1 
ATOM   3532 O  O   . VAL D  1 72  ? -20.722 44.378  -70.745 1.00 33.24  ? 67  VAL D O   1 
ATOM   3533 C  CB  . VAL D  1 72  ? -23.110 42.629  -71.471 1.00 34.16  ? 67  VAL D CB  1 
ATOM   3534 C  CG1 . VAL D  1 72  ? -23.943 43.846  -71.248 1.00 43.98  ? 67  VAL D CG1 1 
ATOM   3535 C  CG2 . VAL D  1 72  ? -23.912 41.536  -72.160 1.00 28.35  ? 67  VAL D CG2 1 
ATOM   3536 N  N   . VAL D  1 73  ? -21.481 45.358  -72.623 1.00 37.74  ? 68  VAL D N   1 
ATOM   3537 C  CA  . VAL D  1 73  ? -20.934 46.664  -72.291 1.00 41.75  ? 68  VAL D CA  1 
ATOM   3538 C  C   . VAL D  1 73  ? -22.031 47.716  -72.307 1.00 39.90  ? 68  VAL D C   1 
ATOM   3539 O  O   . VAL D  1 73  ? -22.755 47.856  -73.290 1.00 38.25  ? 68  VAL D O   1 
ATOM   3540 C  CB  . VAL D  1 73  ? -19.833 47.079  -73.280 1.00 38.55  ? 68  VAL D CB  1 
ATOM   3541 C  CG1 . VAL D  1 73  ? -19.099 48.303  -72.763 1.00 43.07  ? 68  VAL D CG1 1 
ATOM   3542 C  CG2 . VAL D  1 73  ? -18.862 45.933  -73.507 1.00 40.20  ? 68  VAL D CG2 1 
ATOM   3543 N  N   . VAL D  1 74  ? -22.161 48.445  -71.206 1.00 36.79  ? 69  VAL D N   1 
ATOM   3544 C  CA  . VAL D  1 74  ? -23.120 49.535  -71.138 1.00 37.47  ? 69  VAL D CA  1 
ATOM   3545 C  C   . VAL D  1 74  ? -22.404 50.836  -71.456 1.00 36.39  ? 69  VAL D C   1 
ATOM   3546 O  O   . VAL D  1 74  ? -21.430 51.194  -70.799 1.00 42.06  ? 69  VAL D O   1 
ATOM   3547 C  CB  . VAL D  1 74  ? -23.800 49.622  -69.759 1.00 36.41  ? 69  VAL D CB  1 
ATOM   3548 C  CG1 . VAL D  1 74  ? -24.698 50.847  -69.689 1.00 31.74  ? 69  VAL D CG1 1 
ATOM   3549 C  CG2 . VAL D  1 74  ? -24.598 48.352  -69.481 1.00 32.25  ? 69  VAL D CG2 1 
ATOM   3550 N  N   . LYS D  1 75  ? -22.880 51.531  -72.481 1.00 37.19  ? 70  LYS D N   1 
ATOM   3551 C  CA  . LYS D  1 75  ? -22.219 52.741  -72.946 1.00 47.15  ? 70  LYS D CA  1 
ATOM   3552 C  C   . LYS D  1 75  ? -23.163 53.936  -72.970 1.00 48.41  ? 70  LYS D C   1 
ATOM   3553 O  O   . LYS D  1 75  ? -24.382 53.785  -73.070 1.00 39.12  ? 70  LYS D O   1 
ATOM   3554 C  CB  . LYS D  1 75  ? -21.598 52.507  -74.327 1.00 52.52  ? 70  LYS D CB  1 
ATOM   3555 C  CG  . LYS D  1 75  ? -20.445 51.507  -74.314 1.00 59.09  ? 70  LYS D CG  1 
ATOM   3556 C  CD  . LYS D  1 75  ? -20.346 50.722  -75.615 1.00 59.99  ? 70  LYS D CD  1 
ATOM   3557 C  CE  . LYS D  1 75  ? -19.831 51.581  -76.754 1.00 66.46  ? 70  LYS D CE  1 
ATOM   3558 N  NZ  . LYS D  1 75  ? -18.437 52.042  -76.523 1.00 76.68  ? 70  LYS D NZ  1 
ATOM   3559 N  N   . ASP D  1 76  ? -22.574 55.122  -72.864 1.00 48.90  ? 71  ASP D N   1 
ATOM   3560 C  CA  . ASP D  1 76  ? -23.296 56.381  -72.900 1.00 57.56  ? 71  ASP D CA  1 
ATOM   3561 C  C   . ASP D  1 76  ? -22.953 57.074  -74.212 1.00 65.29  ? 71  ASP D C   1 
ATOM   3562 O  O   . ASP D  1 76  ? -21.785 57.254  -74.524 1.00 72.32  ? 71  ASP D O   1 
ATOM   3563 C  CB  . ASP D  1 76  ? -22.847 57.250  -71.725 1.00 65.29  ? 71  ASP D CB  1 
ATOM   3564 C  CG  . ASP D  1 76  ? -23.370 58.662  -71.809 1.00 70.94  ? 71  ASP D CG  1 
ATOM   3565 O  OD1 . ASP D  1 76  ? -24.548 58.838  -72.185 1.00 66.13  ? 71  ASP D OD1 1 
ATOM   3566 O  OD2 . ASP D  1 76  ? -22.604 59.595  -71.491 1.00 80.68  ? 71  ASP D OD2 1 
ATOM   3567 N  N   . HIS D  1 77  ? -23.963 57.450  -74.991 1.00 66.12  ? 72  HIS D N   1 
ATOM   3568 C  CA  . HIS D  1 77  ? -23.716 58.141  -76.255 1.00 82.25  ? 72  HIS D CA  1 
ATOM   3569 C  C   . HIS D  1 77  ? -23.286 59.568  -76.002 1.00 99.37  ? 72  HIS D C   1 
ATOM   3570 O  O   . HIS D  1 77  ? -24.093 60.491  -76.002 1.00 101.88 ? 72  HIS D O   1 
ATOM   3571 C  CB  . HIS D  1 77  ? -24.922 58.104  -77.187 1.00 79.06  ? 72  HIS D CB  1 
ATOM   3572 C  CG  . HIS D  1 77  ? -24.724 58.871  -78.460 1.00 80.10  ? 72  HIS D CG  1 
ATOM   3573 N  ND1 . HIS D  1 77  ? -25.285 60.110  -78.686 1.00 81.86  ? 72  HIS D ND1 1 
ATOM   3574 C  CD2 . HIS D  1 77  ? -24.028 58.565  -79.580 1.00 81.51  ? 72  HIS D CD2 1 
ATOM   3575 C  CE1 . HIS D  1 77  ? -24.940 60.535  -79.890 1.00 85.57  ? 72  HIS D CE1 1 
ATOM   3576 N  NE2 . HIS D  1 77  ? -24.178 59.615  -80.453 1.00 84.62  ? 72  HIS D NE2 1 
ATOM   3577 N  N   . GLU D  1 78  ? -22.084 59.784  -75.514 1.00 111.36 ? 73  GLU D N   1 
ATOM   3578 C  CA  . GLU D  1 78  ? -21.777 61.154  -75.116 1.00 122.72 ? 73  GLU D CA  1 
ATOM   3579 C  C   . GLU D  1 78  ? -20.718 61.642  -76.050 1.00 134.32 ? 73  GLU D C   1 
ATOM   3580 O  O   . GLU D  1 78  ? -21.024 62.350  -77.026 1.00 139.52 ? 73  GLU D O   1 
ATOM   3581 C  CB  . GLU D  1 78  ? -21.406 61.266  -73.628 1.00 122.24 ? 73  GLU D CB  1 
ATOM   3582 C  CG  . GLU D  1 78  ? -20.138 62.021  -73.282 1.00 126.80 ? 73  GLU D CG  1 
ATOM   3583 C  CD  . GLU D  1 78  ? -19.183 61.207  -72.432 1.00 124.08 ? 73  GLU D CD  1 
ATOM   3584 O  OE1 . GLU D  1 78  ? -19.640 60.292  -71.720 1.00 118.04 ? 73  GLU D OE1 1 
ATOM   3585 O  OE2 . GLU D  1 78  ? -17.969 61.478  -72.485 1.00 126.90 ? 73  GLU D OE2 1 
ATOM   3586 N  N   . THR D  1 79  ? -19.487 61.220  -75.809 1.00 139.21 ? 74  THR D N   1 
ATOM   3587 C  CA  . THR D  1 79  ? -18.451 61.571  -76.746 1.00 148.20 ? 74  THR D CA  1 
ATOM   3588 C  C   . THR D  1 79  ? -18.304 60.384  -77.640 1.00 146.36 ? 74  THR D C   1 
ATOM   3589 O  O   . THR D  1 79  ? -17.923 59.287  -77.205 1.00 143.44 ? 74  THR D O   1 
ATOM   3590 C  CB  . THR D  1 79  ? -17.091 61.893  -76.111 1.00 153.50 ? 74  THR D CB  1 
ATOM   3591 O  OG1 . THR D  1 79  ? -16.176 62.268  -77.148 1.00 159.18 ? 74  THR D OG1 1 
ATOM   3592 C  CG2 . THR D  1 79  ? -16.523 60.697  -75.375 1.00 150.15 ? 74  THR D CG2 1 
ATOM   3593 N  N   . MET D  1 80  ? -18.586 60.605  -78.919 1.00 146.93 ? 75  MET D N   1 
ATOM   3594 C  CA  . MET D  1 80  ? -18.313 59.597  -79.919 1.00 143.01 ? 75  MET D CA  1 
ATOM   3595 C  C   . MET D  1 80  ? -16.818 59.648  -79.950 1.00 143.33 ? 75  MET D C   1 
ATOM   3596 O  O   . MET D  1 80  ? -16.231 60.737  -79.922 1.00 147.51 ? 75  MET D O   1 
ATOM   3597 C  CB  . MET D  1 80  ? -18.892 59.962  -81.276 1.00 145.93 ? 75  MET D CB  1 
ATOM   3598 C  CG  . MET D  1 80  ? -19.629 61.288  -81.342 1.00 148.89 ? 75  MET D CG  1 
ATOM   3599 S  SD  . MET D  1 80  ? -21.269 61.093  -82.053 1.00 187.74 ? 75  MET D SD  1 
ATOM   3600 C  CE  . MET D  1 80  ? -21.011 59.706  -83.172 1.00 159.31 ? 75  MET D CE  1 
ATOM   3601 N  N   . GLY D  1 81  ? -16.195 58.489  -79.919 1.00 138.06 ? 76  GLY D N   1 
ATOM   3602 C  CA  . GLY D  1 81  ? -14.780 58.472  -79.676 1.00 137.73 ? 76  GLY D CA  1 
ATOM   3603 C  C   . GLY D  1 81  ? -14.490 57.955  -78.289 1.00 131.12 ? 76  GLY D C   1 
ATOM   3604 O  O   . GLY D  1 81  ? -14.494 56.748  -78.046 1.00 126.46 ? 76  GLY D O   1 
ATOM   3605 N  N   . ARG D  1 82  ? -14.194 58.860  -77.365 1.00 130.13 ? 77  ARG D N   1 
ATOM   3606 C  CA  . ARG D  1 82  ? -13.320 58.433  -76.283 1.00 125.29 ? 77  ARG D CA  1 
ATOM   3607 C  C   . ARG D  1 82  ? -13.989 57.960  -75.011 1.00 120.45 ? 77  ARG D C   1 
ATOM   3608 O  O   . ARG D  1 82  ? -14.600 58.749  -74.294 1.00 120.47 ? 77  ARG D O   1 
ATOM   3609 C  CB  . ARG D  1 82  ? -12.359 59.568  -75.931 1.00 125.32 ? 77  ARG D CB  1 
ATOM   3610 C  CG  . ARG D  1 82  ? -11.067 59.562  -76.728 1.00 125.29 ? 77  ARG D CG  1 
ATOM   3611 C  CD  . ARG D  1 82  ? -9.999  58.754  -76.025 1.00 120.51 ? 77  ARG D CD  1 
ATOM   3612 N  NE  . ARG D  1 82  ? -9.276  57.918  -76.970 1.00 116.96 ? 77  ARG D NE  1 
ATOM   3613 C  CZ  . ARG D  1 82  ? -8.387  57.006  -76.621 1.00 113.20 ? 77  ARG D CZ  1 
ATOM   3614 N  NH1 . ARG D  1 82  ? -8.106  56.819  -75.345 1.00 110.59 ? 77  ARG D NH1 1 
ATOM   3615 N  NH2 . ARG D  1 82  ? -7.782  56.285  -77.549 1.00 113.61 ? 77  ARG D NH2 1 
ATOM   3616 N  N   . ASN D  1 83  ? -13.790 56.683  -74.695 1.00 116.12 ? 78  ASN D N   1 
ATOM   3617 C  CA  . ASN D  1 83  ? -14.231 56.155  -73.409 1.00 108.37 ? 78  ASN D CA  1 
ATOM   3618 C  C   . ASN D  1 83  ? -15.653 56.474  -72.985 1.00 96.74  ? 78  ASN D C   1 
ATOM   3619 O  O   . ASN D  1 83  ? -15.899 56.807  -71.829 1.00 93.62  ? 78  ASN D O   1 
ATOM   3620 C  CB  . ASN D  1 83  ? -13.255 56.603  -72.323 1.00 114.63 ? 78  ASN D CB  1 
ATOM   3621 C  CG  . ASN D  1 83  ? -13.440 58.059  -71.965 1.00 118.40 ? 78  ASN D CG  1 
ATOM   3622 O  OD1 . ASN D  1 83  ? -12.715 58.921  -72.453 1.00 123.97 ? 78  ASN D OD1 1 
ATOM   3623 N  ND2 . ASN D  1 83  ? -14.430 58.342  -71.133 1.00 115.04 ? 78  ASN D ND2 1 
ATOM   3624 N  N   . ARG D  1 84  ? -16.608 56.368  -73.901 1.00 90.10  ? 79  ARG D N   1 
ATOM   3625 C  CA  . ARG D  1 84  ? -17.992 56.460  -73.462 1.00 78.21  ? 79  ARG D CA  1 
ATOM   3626 C  C   . ARG D  1 84  ? -18.434 55.099  -72.914 1.00 70.81  ? 79  ARG D C   1 
ATOM   3627 O  O   . ARG D  1 84  ? -19.624 54.836  -72.715 1.00 50.79  ? 79  ARG D O   1 
ATOM   3628 C  CB  . ARG D  1 84  ? -18.879 56.893  -74.621 1.00 77.00  ? 79  ARG D CB  1 
ATOM   3629 C  CG  . ARG D  1 84  ? -18.703 56.068  -75.880 1.00 81.02  ? 79  ARG D CG  1 
ATOM   3630 C  CD  . ARG D  1 84  ? -19.710 56.452  -76.956 1.00 86.80  ? 79  ARG D CD  1 
ATOM   3631 N  NE  . ARG D  1 84  ? -19.718 55.466  -78.032 1.00 88.78  ? 79  ARG D NE  1 
ATOM   3632 C  CZ  . ARG D  1 84  ? -20.461 55.553  -79.130 1.00 87.31  ? 79  ARG D CZ  1 
ATOM   3633 N  NH1 . ARG D  1 84  ? -21.263 56.592  -79.316 1.00 86.40  ? 79  ARG D NH1 1 
ATOM   3634 N  NH2 . ARG D  1 84  ? -20.396 54.598  -80.047 1.00 86.46  ? 79  ARG D NH2 1 
ATOM   3635 N  N   . PHE D  1 85  ? -17.445 54.236  -72.711 1.00 55.31  ? 80  PHE D N   1 
ATOM   3636 C  CA  . PHE D  1 85  ? -17.571 53.006  -71.951 1.00 51.36  ? 80  PHE D CA  1 
ATOM   3637 C  C   . PHE D  1 85  ? -18.015 53.397  -70.548 1.00 48.35  ? 80  PHE D C   1 
ATOM   3638 O  O   . PHE D  1 85  ? -17.319 54.144  -69.867 1.00 51.47  ? 80  PHE D O   1 
ATOM   3639 C  CB  . PHE D  1 85  ? -16.189 52.336  -71.928 1.00 53.36  ? 80  PHE D CB  1 
ATOM   3640 C  CG  . PHE D  1 85  ? -16.071 51.138  -71.017 1.00 54.19  ? 80  PHE D CG  1 
ATOM   3641 C  CD1 . PHE D  1 85  ? -15.880 51.293  -69.651 1.00 57.11  ? 80  PHE D CD1 1 
ATOM   3642 C  CD2 . PHE D  1 85  ? -16.069 49.859  -71.539 1.00 51.24  ? 80  PHE D CD2 1 
ATOM   3643 C  CE1 . PHE D  1 85  ? -15.743 50.199  -68.825 1.00 58.44  ? 80  PHE D CE1 1 
ATOM   3644 C  CE2 . PHE D  1 85  ? -15.930 48.761  -70.711 1.00 52.27  ? 80  PHE D CE2 1 
ATOM   3645 C  CZ  . PHE D  1 85  ? -15.767 48.934  -69.353 1.00 54.16  ? 80  PHE D CZ  1 
ATOM   3646 N  N   . LEU D  1 86  ? -19.177 52.919  -70.117 1.00 42.75  ? 81  LEU D N   1 
ATOM   3647 C  CA  . LEU D  1 86  ? -19.632 53.191  -68.756 1.00 46.69  ? 81  LEU D CA  1 
ATOM   3648 C  C   . LEU D  1 86  ? -19.282 52.039  -67.826 1.00 45.37  ? 81  LEU D C   1 
ATOM   3649 O  O   . LEU D  1 86  ? -18.704 52.238  -66.759 1.00 47.79  ? 81  LEU D O   1 
ATOM   3650 C  CB  . LEU D  1 86  ? -21.136 53.465  -68.710 1.00 43.08  ? 81  LEU D CB  1 
ATOM   3651 C  CG  . LEU D  1 86  ? -21.607 54.802  -69.278 1.00 44.12  ? 81  LEU D CG  1 
ATOM   3652 C  CD1 . LEU D  1 86  ? -23.071 55.030  -68.931 1.00 43.22  ? 81  LEU D CD1 1 
ATOM   3653 C  CD2 . LEU D  1 86  ? -20.741 55.936  -68.757 1.00 41.04  ? 81  LEU D CD2 1 
ATOM   3654 N  N   . GLY D  1 87  ? -19.639 50.830  -68.240 1.00 42.91  ? 82  GLY D N   1 
ATOM   3655 C  CA  . GLY D  1 87  ? -19.376 49.648  -67.447 1.00 41.23  ? 82  GLY D CA  1 
ATOM   3656 C  C   . GLY D  1 87  ? -19.525 48.412  -68.304 1.00 42.06  ? 82  GLY D C   1 
ATOM   3657 O  O   . GLY D  1 87  ? -20.165 48.450  -69.357 1.00 31.21  ? 82  GLY D O   1 
ATOM   3658 N  N   . GLU D  1 88  ? -18.931 47.311  -67.861 1.00 30.00  ? 83  GLU D N   1 
ATOM   3659 C  CA  . GLU D  1 88  ? -19.023 46.073  -68.615 1.00 36.87  ? 83  GLU D CA  1 
ATOM   3660 C  C   . GLU D  1 88  ? -19.063 44.858  -67.706 1.00 28.12  ? 83  GLU D C   1 
ATOM   3661 O  O   . GLU D  1 88  ? -18.625 44.904  -66.559 1.00 36.33  ? 83  GLU D O   1 
ATOM   3662 C  CB  . GLU D  1 88  ? -17.864 45.951  -69.606 1.00 47.95  ? 83  GLU D CB  1 
ATOM   3663 C  CG  . GLU D  1 88  ? -16.529 45.615  -68.967 1.00 58.16  ? 83  GLU D CG  1 
ATOM   3664 C  CD  . GLU D  1 88  ? -15.401 45.562  -69.979 1.00 69.10  ? 83  GLU D CD  1 
ATOM   3665 O  OE1 . GLU D  1 88  ? -15.681 45.719  -71.186 1.00 65.61  ? 83  GLU D OE1 1 
ATOM   3666 O  OE2 . GLU D  1 88  ? -14.236 45.369  -69.570 1.00 77.96  ? 83  GLU D OE2 1 
ATOM   3667 N  N   . ALA D  1 89  ? -19.606 43.771  -68.235 1.00 39.66  ? 84  ALA D N   1 
ATOM   3668 C  CA  . ALA D  1 89  ? -19.625 42.508  -67.527 1.00 40.05  ? 84  ALA D CA  1 
ATOM   3669 C  C   . ALA D  1 89  ? -19.329 41.390  -68.506 1.00 44.64  ? 84  ALA D C   1 
ATOM   3670 O  O   . ALA D  1 89  ? -19.784 41.412  -69.651 1.00 36.71  ? 84  ALA D O   1 
ATOM   3671 C  CB  . ALA D  1 89  ? -20.975 42.287  -66.866 1.00 36.65  ? 84  ALA D CB  1 
ATOM   3672 N  N   . LYS D  1 90  ? -18.542 40.423  -68.057 1.00 44.00  ? 85  LYS D N   1 
ATOM   3673 C  CA  . LYS D  1 90  ? -18.380 39.188  -68.797 1.00 47.19  ? 85  LYS D CA  1 
ATOM   3674 C  C   . LYS D  1 90  ? -19.148 38.118  -68.048 1.00 44.33  ? 85  LYS D C   1 
ATOM   3675 O  O   . LYS D  1 90  ? -18.751 37.697  -66.963 1.00 54.85  ? 85  LYS D O   1 
ATOM   3676 C  CB  . LYS D  1 90  ? -16.904 38.822  -68.930 1.00 46.35  ? 85  LYS D CB  1 
ATOM   3677 C  CG  . LYS D  1 90  ? -16.066 39.951  -69.503 1.00 50.08  ? 85  LYS D CG  1 
ATOM   3678 C  CD  . LYS D  1 90  ? -14.666 39.490  -69.847 1.00 57.05  ? 85  LYS D CD  1 
ATOM   3679 C  CE  . LYS D  1 90  ? -13.932 38.982  -68.620 1.00 60.04  ? 85  LYS D CE  1 
ATOM   3680 N  NZ  . LYS D  1 90  ? -12.550 38.554  -68.965 1.00 64.12  ? 85  LYS D NZ  1 
ATOM   3681 N  N   . VAL D  1 91  ? -20.275 37.707  -68.612 1.00 34.77  ? 86  VAL D N   1 
ATOM   3682 C  CA  . VAL D  1 91  ? -21.110 36.712  -67.964 1.00 34.38  ? 86  VAL D CA  1 
ATOM   3683 C  C   . VAL D  1 91  ? -20.707 35.319  -68.447 1.00 38.23  ? 86  VAL D C   1 
ATOM   3684 O  O   . VAL D  1 91  ? -20.688 35.044  -69.651 1.00 37.97  ? 86  VAL D O   1 
ATOM   3685 C  CB  . VAL D  1 91  ? -22.629 37.033  -68.132 1.00 49.29  ? 86  VAL D CB  1 
ATOM   3686 C  CG1 . VAL D  1 91  ? -22.826 38.264  -69.013 1.00 46.05  ? 86  VAL D CG1 1 
ATOM   3687 C  CG2 . VAL D  1 91  ? -23.409 35.842  -68.664 1.00 49.10  ? 86  VAL D CG2 1 
ATOM   3688 N  N   . PRO D  1 92  ? -20.318 34.452  -67.501 1.00 44.08  ? 87  PRO D N   1 
ATOM   3689 C  CA  . PRO D  1 92  ? -19.855 33.104  -67.836 1.00 44.53  ? 87  PRO D CA  1 
ATOM   3690 C  C   . PRO D  1 92  ? -21.015 32.225  -68.282 1.00 44.88  ? 87  PRO D C   1 
ATOM   3691 O  O   . PRO D  1 92  ? -21.917 31.940  -67.493 1.00 47.52  ? 87  PRO D O   1 
ATOM   3692 C  CB  . PRO D  1 92  ? -19.271 32.598  -66.513 1.00 54.61  ? 87  PRO D CB  1 
ATOM   3693 C  CG  . PRO D  1 92  ? -20.002 33.361  -65.462 1.00 55.42  ? 87  PRO D CG  1 
ATOM   3694 C  CD  . PRO D  1 92  ? -20.264 34.716  -66.052 1.00 49.77  ? 87  PRO D CD  1 
ATOM   3695 N  N   . LEU D  1 93  ? -20.991 31.797  -69.541 1.00 36.79  ? 88  LEU D N   1 
ATOM   3696 C  CA  . LEU D  1 93  ? -22.035 30.921  -70.063 1.00 40.11  ? 88  LEU D CA  1 
ATOM   3697 C  C   . LEU D  1 93  ? -21.933 29.530  -69.444 1.00 45.08  ? 88  LEU D C   1 
ATOM   3698 O  O   . LEU D  1 93  ? -22.739 28.645  -69.730 1.00 40.36  ? 88  LEU D O   1 
ATOM   3699 C  CB  . LEU D  1 93  ? -21.977 30.845  -71.591 1.00 41.53  ? 88  LEU D CB  1 
ATOM   3700 C  CG  . LEU D  1 93  ? -22.713 31.929  -72.389 1.00 42.06  ? 88  LEU D CG  1 
ATOM   3701 C  CD1 . LEU D  1 93  ? -23.409 32.939  -71.480 1.00 38.97  ? 88  LEU D CD1 1 
ATOM   3702 C  CD2 . LEU D  1 93  ? -21.765 32.631  -73.347 1.00 45.62  ? 88  LEU D CD2 1 
ATOM   3703 N  N   . ARG D  1 94  ? -20.923 29.356  -68.597 1.00 47.70  ? 89  ARG D N   1 
ATOM   3704 C  CA  . ARG D  1 94  ? -20.758 28.163  -67.782 1.00 49.47  ? 89  ARG D CA  1 
ATOM   3705 C  C   . ARG D  1 94  ? -21.991 27.923  -66.914 1.00 42.12  ? 89  ARG D C   1 
ATOM   3706 O  O   . ARG D  1 94  ? -22.444 26.788  -66.771 1.00 38.86  ? 89  ARG D O   1 
ATOM   3707 C  CB  . ARG D  1 94  ? -19.525 28.327  -66.893 1.00 55.01  ? 89  ARG D CB  1 
ATOM   3708 C  CG  . ARG D  1 94  ? -19.198 27.131  -66.026 1.00 66.84  ? 89  ARG D CG  1 
ATOM   3709 C  CD  . ARG D  1 94  ? -18.078 27.472  -65.060 1.00 74.30  ? 89  ARG D CD  1 
ATOM   3710 N  NE  . ARG D  1 94  ? -18.458 28.540  -64.140 1.00 74.66  ? 89  ARG D NE  1 
ATOM   3711 C  CZ  . ARG D  1 94  ? -17.667 29.551  -63.799 1.00 74.02  ? 89  ARG D CZ  1 
ATOM   3712 N  NH1 . ARG D  1 94  ? -16.445 29.641  -64.305 1.00 73.75  ? 89  ARG D NH1 1 
ATOM   3713 N  NH2 . ARG D  1 94  ? -18.099 30.476  -62.952 1.00 73.40  ? 89  ARG D NH2 1 
ATOM   3714 N  N   . GLU D  1 95  ? -22.529 28.995  -66.338 1.00 36.47  ? 90  GLU D N   1 
ATOM   3715 C  CA  . GLU D  1 95  ? -23.701 28.899  -65.472 1.00 43.15  ? 90  GLU D CA  1 
ATOM   3716 C  C   . GLU D  1 95  ? -24.918 28.441  -66.268 1.00 40.64  ? 90  GLU D C   1 
ATOM   3717 O  O   . GLU D  1 95  ? -25.818 27.795  -65.733 1.00 39.85  ? 90  GLU D O   1 
ATOM   3718 C  CB  . GLU D  1 95  ? -23.999 30.246  -64.802 1.00 50.82  ? 90  GLU D CB  1 
ATOM   3719 C  CG  . GLU D  1 95  ? -22.772 31.017  -64.328 1.00 58.14  ? 90  GLU D CG  1 
ATOM   3720 C  CD  . GLU D  1 95  ? -22.077 30.375  -63.140 1.00 70.45  ? 90  GLU D CD  1 
ATOM   3721 O  OE1 . GLU D  1 95  ? -22.648 29.442  -62.537 1.00 75.56  ? 90  GLU D OE1 1 
ATOM   3722 O  OE2 . GLU D  1 95  ? -20.952 30.809  -62.808 1.00 71.10  ? 90  GLU D OE2 1 
ATOM   3723 N  N   . VAL D  1 96  ? -24.937 28.791  -67.550 1.00 38.03  ? 91  VAL D N   1 
ATOM   3724 C  CA  . VAL D  1 96  ? -26.015 28.394  -68.448 1.00 40.48  ? 91  VAL D CA  1 
ATOM   3725 C  C   . VAL D  1 96  ? -26.028 26.877  -68.642 1.00 42.48  ? 91  VAL D C   1 
ATOM   3726 O  O   . VAL D  1 96  ? -27.092 26.259  -68.685 1.00 48.03  ? 91  VAL D O   1 
ATOM   3727 C  CB  . VAL D  1 96  ? -25.894 29.111  -69.814 1.00 40.89  ? 91  VAL D CB  1 
ATOM   3728 C  CG1 . VAL D  1 96  ? -26.851 28.515  -70.833 1.00 41.83  ? 91  VAL D CG1 1 
ATOM   3729 C  CG2 . VAL D  1 96  ? -26.135 30.607  -69.652 1.00 38.58  ? 91  VAL D CG2 1 
ATOM   3730 N  N   . LEU D  1 97  ? -24.841 26.282  -68.733 1.00 38.35  ? 92  LEU D N   1 
ATOM   3731 C  CA  . LEU D  1 97  ? -24.708 24.838  -68.925 1.00 41.71  ? 92  LEU D CA  1 
ATOM   3732 C  C   . LEU D  1 97  ? -24.598 24.055  -67.619 1.00 40.01  ? 92  LEU D C   1 
ATOM   3733 O  O   . LEU D  1 97  ? -24.244 22.879  -67.630 1.00 42.20  ? 92  LEU D O   1 
ATOM   3734 C  CB  . LEU D  1 97  ? -23.473 24.518  -69.770 1.00 48.53  ? 92  LEU D CB  1 
ATOM   3735 C  CG  . LEU D  1 97  ? -23.406 24.873  -71.253 1.00 48.59  ? 92  LEU D CG  1 
ATOM   3736 C  CD1 . LEU D  1 97  ? -22.088 24.371  -71.815 1.00 46.15  ? 92  LEU D CD1 1 
ATOM   3737 C  CD2 . LEU D  1 97  ? -24.575 24.275  -72.013 1.00 50.15  ? 92  LEU D CD2 1 
ATOM   3738 N  N   . ALA D  1 98  ? -24.879 24.699  -66.494 1.00 41.12  ? 93  ALA D N   1 
ATOM   3739 C  CA  . ALA D  1 98  ? -24.769 24.018  -65.208 1.00 44.49  ? 93  ALA D CA  1 
ATOM   3740 C  C   . ALA D  1 98  ? -26.100 23.382  -64.847 1.00 40.09  ? 93  ALA D C   1 
ATOM   3741 O  O   . ALA D  1 98  ? -26.198 22.601  -63.901 1.00 38.66  ? 93  ALA D O   1 
ATOM   3742 C  CB  . ALA D  1 98  ? -24.340 24.992  -64.128 1.00 48.07  ? 93  ALA D CB  1 
ATOM   3743 N  N   . THR D  1 99  ? -27.117 23.717  -65.629 1.00 34.57  ? 94  THR D N   1 
ATOM   3744 C  CA  . THR D  1 99  ? -28.493 23.396  -65.298 1.00 39.59  ? 94  THR D CA  1 
ATOM   3745 C  C   . THR D  1 99  ? -29.188 22.695  -66.464 1.00 35.96  ? 94  THR D C   1 
ATOM   3746 O  O   . THR D  1 99  ? -28.906 22.987  -67.627 1.00 33.19  ? 94  THR D O   1 
ATOM   3747 C  CB  . THR D  1 99  ? -29.259 24.691  -64.952 1.00 41.92  ? 94  THR D CB  1 
ATOM   3748 O  OG1 . THR D  1 99  ? -30.657 24.414  -64.818 1.00 48.16  ? 94  THR D OG1 1 
ATOM   3749 C  CG2 . THR D  1 99  ? -29.050 25.736  -66.046 1.00 27.99  ? 94  THR D CG2 1 
ATOM   3750 N  N   . PRO D  1 100 ? -30.097 21.756  -66.155 1.00 33.41  ? 95  PRO D N   1 
ATOM   3751 C  CA  . PRO D  1 100 ? -30.897 21.092  -67.191 1.00 33.81  ? 95  PRO D CA  1 
ATOM   3752 C  C   . PRO D  1 100 ? -31.788 22.076  -67.941 1.00 31.05  ? 95  PRO D C   1 
ATOM   3753 O  O   . PRO D  1 100 ? -32.196 21.801  -69.068 1.00 31.43  ? 95  PRO D O   1 
ATOM   3754 C  CB  . PRO D  1 100 ? -31.761 20.113  -66.390 1.00 38.59  ? 95  PRO D CB  1 
ATOM   3755 C  CG  . PRO D  1 100 ? -30.985 19.860  -65.148 1.00 41.71  ? 95  PRO D CG  1 
ATOM   3756 C  CD  . PRO D  1 100 ? -30.319 21.165  -64.826 1.00 35.40  ? 95  PRO D CD  1 
ATOM   3757 N  N   . SER D  1 101 ? -32.079 23.214  -67.319 1.00 28.87  ? 96  SER D N   1 
ATOM   3758 C  CA  . SER D  1 101 ? -32.927 24.224  -67.937 1.00 30.30  ? 96  SER D CA  1 
ATOM   3759 C  C   . SER D  1 101 ? -32.188 24.953  -69.050 1.00 29.53  ? 96  SER D C   1 
ATOM   3760 O  O   . SER D  1 101 ? -32.806 25.656  -69.851 1.00 28.14  ? 96  SER D O   1 
ATOM   3761 C  CB  . SER D  1 101 ? -33.413 25.232  -66.895 1.00 26.37  ? 96  SER D CB  1 
ATOM   3762 O  OG  . SER D  1 101 ? -32.391 26.157  -66.563 1.00 30.61  ? 96  SER D OG  1 
ATOM   3763 N  N   . LEU D  1 102 ? -30.868 24.779  -69.087 1.00 26.52  ? 97  LEU D N   1 
ATOM   3764 C  CA  . LEU D  1 102 ? -30.008 25.448  -70.063 1.00 26.13  ? 97  LEU D CA  1 
ATOM   3765 C  C   . LEU D  1 102 ? -30.275 26.948  -70.110 1.00 23.72  ? 97  LEU D C   1 
ATOM   3766 O  O   . LEU D  1 102 ? -30.340 27.551  -71.183 1.00 23.77  ? 97  LEU D O   1 
ATOM   3767 C  CB  . LEU D  1 102 ? -30.182 24.832  -71.449 1.00 27.73  ? 97  LEU D CB  1 
ATOM   3768 C  CG  . LEU D  1 102 ? -29.830 23.349  -71.546 1.00 42.08  ? 97  LEU D CG  1 
ATOM   3769 C  CD1 . LEU D  1 102 ? -30.145 22.832  -72.934 1.00 47.00  ? 97  LEU D CD1 1 
ATOM   3770 C  CD2 . LEU D  1 102 ? -28.366 23.113  -71.195 1.00 41.04  ? 97  LEU D CD2 1 
ATOM   3771 N  N   . SER D  1 103 ? -30.442 27.535  -68.932 1.00 22.60  ? 98  SER D N   1 
ATOM   3772 C  CA  . SER D  1 103 ? -30.747 28.951  -68.814 1.00 29.03  ? 98  SER D CA  1 
ATOM   3773 C  C   . SER D  1 103 ? -30.285 29.482  -67.469 1.00 30.15  ? 98  SER D C   1 
ATOM   3774 O  O   . SER D  1 103 ? -30.205 28.742  -66.489 1.00 31.83  ? 98  SER D O   1 
ATOM   3775 C  CB  . SER D  1 103 ? -32.250 29.194  -68.969 1.00 22.38  ? 98  SER D CB  1 
ATOM   3776 O  OG  . SER D  1 103 ? -32.966 28.648  -67.875 1.00 34.46  ? 98  SER D OG  1 
ATOM   3777 N  N   . ALA D  1 104 ? -29.986 30.774  -67.430 1.00 22.79  ? 99  ALA D N   1 
ATOM   3778 C  CA  . ALA D  1 104 ? -29.576 31.424  -66.198 1.00 25.68  ? 99  ALA D CA  1 
ATOM   3779 C  C   . ALA D  1 104 ? -29.857 32.912  -66.294 1.00 26.02  ? 99  ALA D C   1 
ATOM   3780 O  O   . ALA D  1 104 ? -29.887 33.482  -67.385 1.00 22.10  ? 99  ALA D O   1 
ATOM   3781 C  CB  . ALA D  1 104 ? -28.101 31.179  -65.933 1.00 26.99  ? 99  ALA D CB  1 
ATOM   3782 N  N   . SER D  1 105 ? -30.077 33.538  -65.146 1.00 23.26  ? 100 SER D N   1 
ATOM   3783 C  CA  . SER D  1 105 ? -30.268 34.974  -65.104 1.00 20.98  ? 100 SER D CA  1 
ATOM   3784 C  C   . SER D  1 105 ? -29.116 35.594  -64.346 1.00 26.48  ? 100 SER D C   1 
ATOM   3785 O  O   . SER D  1 105 ? -28.532 34.968  -63.464 1.00 20.18  ? 100 SER D O   1 
ATOM   3786 C  CB  . SER D  1 105 ? -31.573 35.324  -64.407 1.00 25.35  ? 100 SER D CB  1 
ATOM   3787 O  OG  . SER D  1 105 ? -31.461 35.098  -63.013 1.00 32.43  ? 100 SER D OG  1 
ATOM   3788 N  N   . PHE D  1 106 ? -28.793 36.831  -64.689 1.00 21.85  ? 101 PHE D N   1 
ATOM   3789 C  CA  . PHE D  1 106 ? -27.690 37.519  -64.053 1.00 26.34  ? 101 PHE D CA  1 
ATOM   3790 C  C   . PHE D  1 106 ? -28.128 38.911  -63.632 1.00 28.47  ? 101 PHE D C   1 
ATOM   3791 O  O   . PHE D  1 106 ? -28.816 39.614  -64.373 1.00 24.05  ? 101 PHE D O   1 
ATOM   3792 C  CB  . PHE D  1 106 ? -26.496 37.606  -65.006 1.00 23.40  ? 101 PHE D CB  1 
ATOM   3793 C  CG  . PHE D  1 106 ? -26.040 36.273  -65.528 1.00 25.44  ? 101 PHE D CG  1 
ATOM   3794 C  CD1 . PHE D  1 106 ? -26.625 35.716  -66.654 1.00 20.95  ? 101 PHE D CD1 1 
ATOM   3795 C  CD2 . PHE D  1 106 ? -25.027 35.576  -64.892 1.00 24.48  ? 101 PHE D CD2 1 
ATOM   3796 C  CE1 . PHE D  1 106 ? -26.214 34.486  -67.131 1.00 26.76  ? 101 PHE D CE1 1 
ATOM   3797 C  CE2 . PHE D  1 106 ? -24.608 34.346  -65.368 1.00 28.56  ? 101 PHE D CE2 1 
ATOM   3798 C  CZ  . PHE D  1 106 ? -25.203 33.801  -66.488 1.00 29.54  ? 101 PHE D CZ  1 
ATOM   3799 N  N   . ASN D  1 107 ? -27.750 39.287  -62.420 1.00 23.42  ? 102 ASN D N   1 
ATOM   3800 C  CA  . ASN D  1 107 ? -27.823 40.671  -61.994 1.00 29.63  ? 102 ASN D CA  1 
ATOM   3801 C  C   . ASN D  1 107 ? -26.381 41.076  -61.741 1.00 26.62  ? 102 ASN D C   1 
ATOM   3802 O  O   . ASN D  1 107 ? -25.886 40.988  -60.623 1.00 31.14  ? 102 ASN D O   1 
ATOM   3803 C  CB  . ASN D  1 107 ? -28.663 40.794  -60.727 1.00 27.86  ? 102 ASN D CB  1 
ATOM   3804 C  CG  . ASN D  1 107 ? -29.094 42.220  -60.446 1.00 26.78  ? 102 ASN D CG  1 
ATOM   3805 O  OD1 . ASN D  1 107 ? -28.546 43.171  -61.002 1.00 32.37  ? 102 ASN D OD1 1 
ATOM   3806 N  ND2 . ASN D  1 107 ? -30.072 42.375  -59.563 1.00 29.39  ? 102 ASN D ND2 1 
ATOM   3807 N  N   . ALA D  1 108 ? -25.699 41.488  -62.801 1.00 23.09  ? 103 ALA D N   1 
ATOM   3808 C  CA  . ALA D  1 108 ? -24.248 41.612  -62.770 1.00 27.70  ? 103 ALA D CA  1 
ATOM   3809 C  C   . ALA D  1 108 ? -23.757 43.037  -62.539 1.00 25.20  ? 103 ALA D C   1 
ATOM   3810 O  O   . ALA D  1 108 ? -24.195 43.965  -63.214 1.00 28.68  ? 103 ALA D O   1 
ATOM   3811 C  CB  . ALA D  1 108 ? -23.651 41.049  -64.054 1.00 27.55  ? 103 ALA D CB  1 
ATOM   3812 N  N   . PRO D  1 109 ? -22.839 43.207  -61.575 1.00 28.33  ? 104 PRO D N   1 
ATOM   3813 C  CA  . PRO D  1 109 ? -22.172 44.494  -61.365 1.00 36.01  ? 104 PRO D CA  1 
ATOM   3814 C  C   . PRO D  1 109 ? -21.361 44.863  -62.598 1.00 34.17  ? 104 PRO D C   1 
ATOM   3815 O  O   . PRO D  1 109 ? -20.658 44.016  -63.151 1.00 34.36  ? 104 PRO D O   1 
ATOM   3816 C  CB  . PRO D  1 109 ? -21.222 44.213  -60.197 1.00 37.79  ? 104 PRO D CB  1 
ATOM   3817 C  CG  . PRO D  1 109 ? -21.780 43.019  -59.517 1.00 32.49  ? 104 PRO D CG  1 
ATOM   3818 C  CD  . PRO D  1 109 ? -22.420 42.197  -60.588 1.00 31.42  ? 104 PRO D CD  1 
ATOM   3819 N  N   . LEU D  1 110 ? -21.466 46.111  -63.029 1.00 32.96  ? 105 LEU D N   1 
ATOM   3820 C  CA  . LEU D  1 110 ? -20.699 46.578  -64.173 1.00 35.53  ? 105 LEU D CA  1 
ATOM   3821 C  C   . LEU D  1 110 ? -19.341 47.084  -63.707 1.00 38.97  ? 105 LEU D C   1 
ATOM   3822 O  O   . LEU D  1 110 ? -19.252 47.870  -62.766 1.00 39.77  ? 105 LEU D O   1 
ATOM   3823 C  CB  . LEU D  1 110 ? -21.467 47.671  -64.915 1.00 33.15  ? 105 LEU D CB  1 
ATOM   3824 C  CG  . LEU D  1 110 ? -22.747 47.178  -65.592 1.00 34.70  ? 105 LEU D CG  1 
ATOM   3825 C  CD1 . LEU D  1 110 ? -23.650 48.347  -65.952 1.00 36.40  ? 105 LEU D CD1 1 
ATOM   3826 C  CD2 . LEU D  1 110 ? -22.405 46.351  -66.825 1.00 33.93  ? 105 LEU D CD2 1 
ATOM   3827 N  N   . LEU D  1 111 ? -18.283 46.616  -64.359 1.00 42.48  ? 106 LEU D N   1 
ATOM   3828 C  CA  . LEU D  1 111 ? -16.926 46.953  -63.944 1.00 37.08  ? 106 LEU D CA  1 
ATOM   3829 C  C   . LEU D  1 111 ? -16.313 47.990  -64.876 1.00 37.04  ? 106 LEU D C   1 
ATOM   3830 O  O   . LEU D  1 111 ? -16.671 48.067  -66.053 1.00 42.74  ? 106 LEU D O   1 
ATOM   3831 C  CB  . LEU D  1 111 ? -16.062 45.691  -63.902 1.00 40.05  ? 106 LEU D CB  1 
ATOM   3832 C  CG  . LEU D  1 111 ? -16.695 44.508  -63.163 1.00 41.62  ? 106 LEU D CG  1 
ATOM   3833 C  CD1 . LEU D  1 111 ? -15.770 43.298  -63.175 1.00 42.25  ? 106 LEU D CD1 1 
ATOM   3834 C  CD2 . LEU D  1 111 ? -17.070 44.897  -61.738 1.00 42.40  ? 106 LEU D CD2 1 
ATOM   3835 N  N   . ASP D  1 112 ? -15.394 48.791  -64.349 1.00 40.20  ? 107 ASP D N   1 
ATOM   3836 C  CA  . ASP D  1 112 ? -14.777 49.849  -65.139 1.00 48.72  ? 107 ASP D CA  1 
ATOM   3837 C  C   . ASP D  1 112 ? -13.661 49.324  -66.032 1.00 51.51  ? 107 ASP D C   1 
ATOM   3838 O  O   . ASP D  1 112 ? -13.469 48.115  -66.168 1.00 46.10  ? 107 ASP D O   1 
ATOM   3839 C  CB  . ASP D  1 112 ? -14.266 50.989  -64.243 1.00 53.63  ? 107 ASP D CB  1 
ATOM   3840 C  CG  . ASP D  1 112 ? -13.280 50.517  -63.180 1.00 55.06  ? 107 ASP D CG  1 
ATOM   3841 O  OD1 . ASP D  1 112 ? -12.436 49.644  -63.468 1.00 53.84  ? 107 ASP D OD1 1 
ATOM   3842 O  OD2 . ASP D  1 112 ? -13.350 51.031  -62.043 1.00 56.13  ? 107 ASP D OD2 1 
ATOM   3843 N  N   . THR D  1 113 ? -12.919 50.255  -66.622 1.00 61.38  ? 108 THR D N   1 
ATOM   3844 C  CA  . THR D  1 113 ? -11.804 49.937  -67.507 1.00 68.30  ? 108 THR D CA  1 
ATOM   3845 C  C   . THR D  1 113 ? -10.704 49.107  -66.841 1.00 75.39  ? 108 THR D C   1 
ATOM   3846 O  O   . THR D  1 113 ? -9.842  48.554  -67.523 1.00 79.40  ? 108 THR D O   1 
ATOM   3847 C  CB  . THR D  1 113 ? -11.174 51.225  -68.070 1.00 66.98  ? 108 THR D CB  1 
ATOM   3848 O  OG1 . THR D  1 113 ? -11.269 52.266  -67.090 1.00 64.72  ? 108 THR D OG1 1 
ATOM   3849 C  CG2 . THR D  1 113 ? -11.901 51.667  -69.328 1.00 68.66  ? 108 THR D CG2 1 
ATOM   3850 N  N   . LYS D  1 114 ? -10.734 49.020  -65.513 1.00 76.11  ? 109 LYS D N   1 
ATOM   3851 C  CA  . LYS D  1 114 ? -9.690  48.320  -64.770 1.00 79.10  ? 109 LYS D CA  1 
ATOM   3852 C  C   . LYS D  1 114 ? -10.213 47.118  -63.980 1.00 74.53  ? 109 LYS D C   1 
ATOM   3853 O  O   . LYS D  1 114 ? -9.500  46.571  -63.136 1.00 75.65  ? 109 LYS D O   1 
ATOM   3854 C  CB  . LYS D  1 114 ? -8.988  49.290  -63.819 1.00 87.28  ? 109 LYS D CB  1 
ATOM   3855 C  CG  . LYS D  1 114 ? -8.199  50.386  -64.519 1.00 95.52  ? 109 LYS D CG  1 
ATOM   3856 C  CD  . LYS D  1 114 ? -7.549  51.325  -63.518 1.00 105.41 ? 109 LYS D CD  1 
ATOM   3857 C  CE  . LYS D  1 114 ? -6.741  52.406  -64.217 1.00 113.59 ? 109 LYS D CE  1 
ATOM   3858 N  NZ  . LYS D  1 114 ? -6.119  53.349  -63.248 1.00 120.34 ? 109 LYS D NZ  1 
ATOM   3859 N  N   . LYS D  1 115 ? -11.456 46.728  -64.263 1.00 65.23  ? 110 LYS D N   1 
ATOM   3860 C  CA  . LYS D  1 115 ? -12.113 45.561  -63.653 1.00 56.78  ? 110 LYS D CA  1 
ATOM   3861 C  C   . LYS D  1 115 ? -12.547 45.793  -62.207 1.00 57.29  ? 110 LYS D C   1 
ATOM   3862 O  O   . LYS D  1 115 ? -12.730 44.844  -61.443 1.00 53.66  ? 110 LYS D O   1 
ATOM   3863 C  CB  . LYS D  1 115 ? -11.267 44.283  -63.776 1.00 59.94  ? 110 LYS D CB  1 
ATOM   3864 C  CG  . LYS D  1 115 ? -11.348 43.599  -65.139 1.00 69.27  ? 110 LYS D CG  1 
ATOM   3865 C  CD  . LYS D  1 115 ? -10.742 44.455  -66.243 1.00 78.68  ? 110 LYS D CD  1 
ATOM   3866 C  CE  . LYS D  1 115 ? -11.661 44.544  -67.453 1.00 79.81  ? 110 LYS D CE  1 
ATOM   3867 N  NZ  . LYS D  1 115 ? -11.376 43.486  -68.462 1.00 81.50  ? 110 LYS D NZ  1 
ATOM   3868 N  N   . GLN D  1 116 ? -12.720 47.060  -61.846 1.00 58.19  ? 111 GLN D N   1 
ATOM   3869 C  CA  . GLN D  1 116 ? -13.199 47.430  -60.521 1.00 57.07  ? 111 GLN D CA  1 
ATOM   3870 C  C   . GLN D  1 116 ? -14.643 47.923  -60.621 1.00 54.96  ? 111 GLN D C   1 
ATOM   3871 O  O   . GLN D  1 116 ? -15.029 48.487  -61.643 1.00 52.93  ? 111 GLN D O   1 
ATOM   3872 C  CB  . GLN D  1 116 ? -12.281 48.494  -59.914 1.00 60.39  ? 111 GLN D CB  1 
ATOM   3873 C  CG  . GLN D  1 116 ? -10.841 48.020  -59.774 1.00 64.88  ? 111 GLN D CG  1 
ATOM   3874 C  CD  . GLN D  1 116 ? -9.951  49.015  -59.059 1.00 70.81  ? 111 GLN D CD  1 
ATOM   3875 O  OE1 . GLN D  1 116 ? -8.776  48.744  -58.810 1.00 73.15  ? 111 GLN D OE1 1 
ATOM   3876 N  NE2 . GLN D  1 116 ? -10.505 50.175  -58.722 1.00 70.16  ? 111 GLN D NE2 1 
ATOM   3877 N  N   . PRO D  1 117 ? -15.449 47.698  -59.567 1.00 56.40  ? 112 PRO D N   1 
ATOM   3878 C  CA  . PRO D  1 117 ? -16.885 48.015  -59.594 1.00 50.96  ? 112 PRO D CA  1 
ATOM   3879 C  C   . PRO D  1 117 ? -17.177 49.466  -59.969 1.00 48.65  ? 112 PRO D C   1 
ATOM   3880 O  O   . PRO D  1 117 ? -16.321 50.330  -59.790 1.00 49.77  ? 112 PRO D O   1 
ATOM   3881 C  CB  . PRO D  1 117 ? -17.328 47.760  -58.150 1.00 54.72  ? 112 PRO D CB  1 
ATOM   3882 C  CG  . PRO D  1 117 ? -16.345 46.794  -57.616 1.00 59.02  ? 112 PRO D CG  1 
ATOM   3883 C  CD  . PRO D  1 117 ? -15.039 47.122  -58.274 1.00 61.31  ? 112 PRO D CD  1 
ATOM   3884 N  N   . THR D  1 118 ? -18.373 49.722  -60.492 1.00 45.09  ? 113 THR D N   1 
ATOM   3885 C  CA  . THR D  1 118 ? -18.788 51.080  -60.830 1.00 46.33  ? 113 THR D CA  1 
ATOM   3886 C  C   . THR D  1 118 ? -19.950 51.517  -59.949 1.00 52.73  ? 113 THR D C   1 
ATOM   3887 O  O   . THR D  1 118 ? -20.291 52.698  -59.896 1.00 51.82  ? 113 THR D O   1 
ATOM   3888 C  CB  . THR D  1 118 ? -19.232 51.193  -62.302 1.00 44.03  ? 113 THR D CB  1 
ATOM   3889 O  OG1 . THR D  1 118 ? -20.354 50.329  -62.534 1.00 36.60  ? 113 THR D OG1 1 
ATOM   3890 C  CG2 . THR D  1 118 ? -18.093 50.818  -63.243 1.00 40.03  ? 113 THR D CG2 1 
ATOM   3891 N  N   . GLY D  1 119 ? -20.553 50.555  -59.258 1.00 41.57  ? 114 GLY D N   1 
ATOM   3892 C  CA  . GLY D  1 119 ? -21.750 50.806  -58.478 1.00 42.52  ? 114 GLY D CA  1 
ATOM   3893 C  C   . GLY D  1 119 ? -22.977 50.448  -59.293 1.00 47.29  ? 114 GLY D C   1 
ATOM   3894 O  O   . GLY D  1 119 ? -24.069 50.253  -58.757 1.00 48.58  ? 114 GLY D O   1 
ATOM   3895 N  N   . ALA D  1 120 ? -22.783 50.355  -60.605 1.00 40.50  ? 115 ALA D N   1 
ATOM   3896 C  CA  . ALA D  1 120 ? -23.866 50.048  -61.529 1.00 36.66  ? 115 ALA D CA  1 
ATOM   3897 C  C   . ALA D  1 120 ? -24.016 48.543  -61.742 1.00 35.86  ? 115 ALA D C   1 
ATOM   3898 O  O   . ALA D  1 120 ? -23.063 47.784  -61.576 1.00 32.27  ? 115 ALA D O   1 
ATOM   3899 C  CB  . ALA D  1 120 ? -23.638 50.755  -62.861 1.00 38.96  ? 115 ALA D CB  1 
ATOM   3900 N  N   . SER D  1 121 ? -25.220 48.116  -62.107 1.00 34.86  ? 116 SER D N   1 
ATOM   3901 C  CA  . SER D  1 121 ? -25.482 46.707  -62.375 1.00 28.87  ? 116 SER D CA  1 
ATOM   3902 C  C   . SER D  1 121 ? -26.439 46.520  -63.546 1.00 30.41  ? 116 SER D C   1 
ATOM   3903 O  O   . SER D  1 121 ? -27.192 47.425  -63.902 1.00 31.28  ? 116 SER D O   1 
ATOM   3904 C  CB  . SER D  1 121 ? -26.035 46.003  -61.133 1.00 28.55  ? 116 SER D CB  1 
ATOM   3905 O  OG  . SER D  1 121 ? -27.298 46.531  -60.763 1.00 41.52  ? 116 SER D OG  1 
ATOM   3906 N  N   . LEU D  1 122 ? -26.407 45.328  -64.129 1.00 23.68  ? 117 LEU D N   1 
ATOM   3907 C  CA  . LEU D  1 122 ? -27.232 45.015  -65.285 1.00 22.22  ? 117 LEU D CA  1 
ATOM   3908 C  C   . LEU D  1 122 ? -27.958 43.689  -65.105 1.00 22.03  ? 117 LEU D C   1 
ATOM   3909 O  O   . LEU D  1 122 ? -27.354 42.681  -64.729 1.00 23.48  ? 117 LEU D O   1 
ATOM   3910 C  CB  . LEU D  1 122 ? -26.369 44.950  -66.538 1.00 30.27  ? 117 LEU D CB  1 
ATOM   3911 C  CG  . LEU D  1 122 ? -27.124 44.561  -67.803 1.00 33.26  ? 117 LEU D CG  1 
ATOM   3912 C  CD1 . LEU D  1 122 ? -27.753 45.779  -68.449 1.00 35.52  ? 117 LEU D CD1 1 
ATOM   3913 C  CD2 . LEU D  1 122 ? -26.190 43.862  -68.749 1.00 34.47  ? 117 LEU D CD2 1 
ATOM   3914 N  N   . VAL D  1 123 ? -29.258 43.693  -65.372 1.00 21.81  ? 118 VAL D N   1 
ATOM   3915 C  CA  . VAL D  1 123 ? -30.044 42.475  -65.272 1.00 20.33  ? 118 VAL D CA  1 
ATOM   3916 C  C   . VAL D  1 123 ? -30.329 41.910  -66.654 1.00 25.63  ? 118 VAL D C   1 
ATOM   3917 O  O   . VAL D  1 123 ? -30.893 42.584  -67.518 1.00 22.69  ? 118 VAL D O   1 
ATOM   3918 C  CB  . VAL D  1 123 ? -31.374 42.695  -64.526 1.00 29.53  ? 118 VAL D CB  1 
ATOM   3919 C  CG1 . VAL D  1 123 ? -32.154 41.384  -64.460 1.00 21.32  ? 118 VAL D CG1 1 
ATOM   3920 C  CG2 . VAL D  1 123 ? -31.122 43.256  -63.123 1.00 23.76  ? 118 VAL D CG2 1 
ATOM   3921 N  N   . LEU D  1 124 ? -29.916 40.668  -66.856 1.00 18.11  ? 119 LEU D N   1 
ATOM   3922 C  CA  . LEU D  1 124 ? -30.145 39.978  -68.111 1.00 17.47  ? 119 LEU D CA  1 
ATOM   3923 C  C   . LEU D  1 124 ? -30.445 38.517  -67.829 1.00 25.78  ? 119 LEU D C   1 
ATOM   3924 O  O   . LEU D  1 124 ? -30.094 37.994  -66.771 1.00 17.17  ? 119 LEU D O   1 
ATOM   3925 C  CB  . LEU D  1 124 ? -28.924 40.095  -69.030 1.00 17.34  ? 119 LEU D CB  1 
ATOM   3926 C  CG  . LEU D  1 124 ? -27.614 39.414  -68.618 1.00 25.07  ? 119 LEU D CG  1 
ATOM   3927 C  CD1 . LEU D  1 124 ? -26.750 39.159  -69.839 1.00 25.66  ? 119 LEU D CD1 1 
ATOM   3928 C  CD2 . LEU D  1 124 ? -26.832 40.240  -67.596 1.00 26.31  ? 119 LEU D CD2 1 
ATOM   3929 N  N   . GLN D  1 125 ? -31.111 37.857  -68.764 1.00 22.15  ? 120 GLN D N   1 
ATOM   3930 C  CA  . GLN D  1 125 ? -31.236 36.414  -68.675 1.00 26.32  ? 120 GLN D CA  1 
ATOM   3931 C  C   . GLN D  1 125 ? -30.865 35.794  -70.004 1.00 23.86  ? 120 GLN D C   1 
ATOM   3932 O  O   . GLN D  1 125 ? -31.092 36.371  -71.073 1.00 20.47  ? 120 GLN D O   1 
ATOM   3933 C  CB  . GLN D  1 125 ? -32.626 35.977  -68.204 1.00 28.81  ? 120 GLN D CB  1 
ATOM   3934 C  CG  . GLN D  1 125 ? -33.584 35.616  -69.311 1.00 41.14  ? 120 GLN D CG  1 
ATOM   3935 C  CD  . GLN D  1 125 ? -33.466 34.177  -69.775 1.00 29.61  ? 120 GLN D CD  1 
ATOM   3936 O  OE1 . GLN D  1 125 ? -33.263 33.922  -70.959 1.00 32.95  ? 120 GLN D OE1 1 
ATOM   3937 N  NE2 . GLN D  1 125 ? -33.585 33.233  -68.847 1.00 28.76  ? 120 GLN D NE2 1 
ATOM   3938 N  N   . VAL D  1 126 ? -30.285 34.608  -69.918 1.00 20.05  ? 121 VAL D N   1 
ATOM   3939 C  CA  . VAL D  1 126 ? -29.689 33.949  -71.060 1.00 23.60  ? 121 VAL D CA  1 
ATOM   3940 C  C   . VAL D  1 126 ? -30.169 32.505  -71.110 1.00 25.15  ? 121 VAL D C   1 
ATOM   3941 O  O   . VAL D  1 126 ? -30.283 31.841  -70.077 1.00 20.68  ? 121 VAL D O   1 
ATOM   3942 C  CB  . VAL D  1 126 ? -28.154 33.973  -70.936 1.00 20.90  ? 121 VAL D CB  1 
ATOM   3943 C  CG1 . VAL D  1 126 ? -27.503 33.262  -72.110 1.00 27.27  ? 121 VAL D CG1 1 
ATOM   3944 C  CG2 . VAL D  1 126 ? -27.650 35.409  -70.818 1.00 22.11  ? 121 VAL D CG2 1 
ATOM   3945 N  N   . SER D  1 127 ? -30.465 32.019  -72.308 1.00 19.69  ? 122 SER D N   1 
ATOM   3946 C  CA  . SER D  1 127 ? -30.817 30.616  -72.460 1.00 21.53  ? 122 SER D CA  1 
ATOM   3947 C  C   . SER D  1 127 ? -30.279 30.003  -73.748 1.00 28.03  ? 122 SER D C   1 
ATOM   3948 O  O   . SER D  1 127 ? -30.036 30.687  -74.747 1.00 25.64  ? 122 SER D O   1 
ATOM   3949 C  CB  . SER D  1 127 ? -32.329 30.407  -72.363 1.00 20.89  ? 122 SER D CB  1 
ATOM   3950 O  OG  . SER D  1 127 ? -32.993 31.037  -73.442 1.00 26.89  ? 122 SER D OG  1 
ATOM   3951 N  N   . TYR D  1 128 ? -30.111 28.690  -73.690 1.00 27.00  ? 123 TYR D N   1 
ATOM   3952 C  CA  . TYR D  1 128 ? -29.574 27.887  -74.768 1.00 37.93  ? 123 TYR D CA  1 
ATOM   3953 C  C   . TYR D  1 128 ? -30.754 27.103  -75.314 1.00 32.82  ? 123 TYR D C   1 
ATOM   3954 O  O   . TYR D  1 128 ? -31.203 26.149  -74.683 1.00 37.21  ? 123 TYR D O   1 
ATOM   3955 C  CB  . TYR D  1 128 ? -28.560 26.926  -74.161 1.00 46.32  ? 123 TYR D CB  1 
ATOM   3956 C  CG  . TYR D  1 128 ? -27.523 26.378  -75.104 1.00 58.29  ? 123 TYR D CG  1 
ATOM   3957 C  CD1 . TYR D  1 128 ? -27.753 26.302  -76.468 1.00 63.77  ? 123 TYR D CD1 1 
ATOM   3958 C  CD2 . TYR D  1 128 ? -26.306 25.926  -74.619 1.00 65.65  ? 123 TYR D CD2 1 
ATOM   3959 C  CE1 . TYR D  1 128 ? -26.798 25.791  -77.317 1.00 67.77  ? 123 TYR D CE1 1 
ATOM   3960 C  CE2 . TYR D  1 128 ? -25.349 25.419  -75.458 1.00 70.61  ? 123 TYR D CE2 1 
ATOM   3961 C  CZ  . TYR D  1 128 ? -25.593 25.353  -76.807 1.00 71.22  ? 123 TYR D CZ  1 
ATOM   3962 O  OH  . TYR D  1 128 ? -24.625 24.844  -77.643 1.00 72.37  ? 123 TYR D OH  1 
ATOM   3963 N  N   . THR D  1 129 ? -31.273 27.503  -76.470 1.00 34.26  ? 124 THR D N   1 
ATOM   3964 C  CA  . THR D  1 129 ? -32.517 26.918  -76.962 1.00 40.66  ? 124 THR D CA  1 
ATOM   3965 C  C   . THR D  1 129 ? -32.444 26.449  -78.414 1.00 49.84  ? 124 THR D C   1 
ATOM   3966 O  O   . THR D  1 129 ? -31.607 26.909  -79.191 1.00 49.41  ? 124 THR D O   1 
ATOM   3967 C  CB  . THR D  1 129 ? -33.693 27.905  -76.809 1.00 43.07  ? 124 THR D CB  1 
ATOM   3968 O  OG1 . THR D  1 129 ? -34.930 27.224  -77.050 1.00 46.35  ? 124 THR D OG1 1 
ATOM   3969 C  CG2 . THR D  1 129 ? -33.554 29.066  -77.785 1.00 36.05  ? 124 THR D CG2 1 
ATOM   3970 N  N   . ALA D  1 130 ? -33.329 25.522  -78.766 1.00 59.17  ? 125 ALA D N   1 
ATOM   3971 C  CA  . ALA D  1 130 ? -33.445 25.058  -80.141 1.00 65.83  ? 125 ALA D CA  1 
ATOM   3972 C  C   . ALA D  1 130 ? -34.136 26.124  -80.980 1.00 70.24  ? 125 ALA D C   1 
ATOM   3973 O  O   . ALA D  1 130 ? -35.131 26.711  -80.554 1.00 69.92  ? 125 ALA D O   1 
ATOM   3974 C  CB  . ALA D  1 130 ? -34.217 23.750  -80.199 1.00 66.87  ? 125 ALA D CB  1 
ATOM   3975 N  N   . ALA D  1 131 ? -33.600 26.375  -82.170 1.00 73.92  ? 126 ALA D N   1 
ATOM   3976 C  CA  . ALA D  1 131 ? -34.151 27.384  -83.066 1.00 73.66  ? 126 ALA D CA  1 
ATOM   3977 C  C   . ALA D  1 131 ? -35.568 27.030  -83.506 1.00 77.66  ? 126 ALA D C   1 
ATOM   3978 O  O   . ALA D  1 131 ? -36.452 27.886  -83.535 1.00 78.79  ? 126 ALA D O   1 
ATOM   3979 C  CB  . ALA D  1 131 ? -33.249 27.561  -84.276 1.00 76.11  ? 126 ALA D CB  1 
ATOM   3980 N  N   . PHE E  1 5   ? -12.819 52.376  -54.749 1.00 61.82  ? 0   PHE E N   1 
ATOM   3981 C  CA  . PHE E  1 5   ? -13.495 51.458  -53.841 1.00 62.55  ? 0   PHE E CA  1 
ATOM   3982 C  C   . PHE E  1 5   ? -12.573 50.948  -52.742 1.00 62.39  ? 0   PHE E C   1 
ATOM   3983 O  O   . PHE E  1 5   ? -11.404 51.323  -52.668 1.00 65.30  ? 0   PHE E O   1 
ATOM   3984 C  CB  . PHE E  1 5   ? -14.120 50.292  -54.610 1.00 61.49  ? 0   PHE E CB  1 
ATOM   3985 C  CG  . PHE E  1 5   ? -15.427 50.635  -55.259 1.00 57.85  ? 0   PHE E CG  1 
ATOM   3986 C  CD1 . PHE E  1 5   ? -15.461 51.301  -56.470 1.00 57.68  ? 0   PHE E CD1 1 
ATOM   3987 C  CD2 . PHE E  1 5   ? -16.625 50.306  -54.647 1.00 56.24  ? 0   PHE E CD2 1 
ATOM   3988 C  CE1 . PHE E  1 5   ? -16.664 51.627  -57.062 1.00 60.94  ? 0   PHE E CE1 1 
ATOM   3989 C  CE2 . PHE E  1 5   ? -17.831 50.628  -55.235 1.00 55.49  ? 0   PHE E CE2 1 
ATOM   3990 C  CZ  . PHE E  1 5   ? -17.851 51.289  -56.446 1.00 56.14  ? 0   PHE E CZ  1 
ATOM   3991 N  N   . MET E  1 6   ? -13.118 50.095  -51.885 1.00 59.09  ? 1   MET E N   1 
ATOM   3992 C  CA  . MET E  1 6   ? -12.379 49.560  -50.757 1.00 52.64  ? 1   MET E CA  1 
ATOM   3993 C  C   . MET E  1 6   ? -12.726 48.092  -50.595 1.00 43.86  ? 1   MET E C   1 
ATOM   3994 O  O   . MET E  1 6   ? -13.895 47.721  -50.645 1.00 42.86  ? 1   MET E O   1 
ATOM   3995 C  CB  . MET E  1 6   ? -12.753 50.325  -49.487 1.00 55.87  ? 1   MET E CB  1 
ATOM   3996 C  CG  . MET E  1 6   ? -11.927 49.971  -48.267 1.00 56.49  ? 1   MET E CG  1 
ATOM   3997 S  SD  . MET E  1 6   ? -11.333 51.460  -47.446 1.00 100.86 ? 1   MET E SD  1 
ATOM   3998 C  CE  . MET E  1 6   ? -10.564 52.301  -48.828 1.00 61.20  ? 1   MET E CE  1 
ATOM   3999 N  N   . LEU E  1 7   ? -11.714 47.251  -50.420 1.00 37.64  ? 2   LEU E N   1 
ATOM   4000 C  CA  . LEU E  1 7   ? -11.970 45.858  -50.091 1.00 30.53  ? 2   LEU E CA  1 
ATOM   4001 C  C   . LEU E  1 7   ? -12.069 45.722  -48.583 1.00 30.82  ? 2   LEU E C   1 
ATOM   4002 O  O   . LEU E  1 7   ? -11.069 45.821  -47.869 1.00 32.82  ? 2   LEU E O   1 
ATOM   4003 C  CB  . LEU E  1 7   ? -10.879 44.935  -50.631 1.00 33.54  ? 2   LEU E CB  1 
ATOM   4004 C  CG  . LEU E  1 7   ? -11.210 43.452  -50.440 1.00 36.38  ? 2   LEU E CG  1 
ATOM   4005 C  CD1 . LEU E  1 7   ? -12.356 43.046  -51.360 1.00 36.57  ? 2   LEU E CD1 1 
ATOM   4006 C  CD2 . LEU E  1 7   ? -9.991  42.576  -50.669 1.00 38.37  ? 2   LEU E CD2 1 
ATOM   4007 N  N   . ARG E  1 8   ? -13.285 45.509  -48.101 1.00 29.71  ? 3   ARG E N   1 
ATOM   4008 C  CA  . ARG E  1 8   ? -13.518 45.372  -46.676 1.00 21.83  ? 3   ARG E CA  1 
ATOM   4009 C  C   . ARG E  1 8   ? -13.773 43.916  -46.332 1.00 26.21  ? 3   ARG E C   1 
ATOM   4010 O  O   . ARG E  1 8   ? -14.649 43.271  -46.910 1.00 21.82  ? 3   ARG E O   1 
ATOM   4011 C  CB  . ARG E  1 8   ? -14.697 46.240  -46.247 1.00 30.93  ? 3   ARG E CB  1 
ATOM   4012 C  CG  . ARG E  1 8   ? -15.016 46.176  -44.770 1.00 31.92  ? 3   ARG E CG  1 
ATOM   4013 C  CD  . ARG E  1 8   ? -16.147 47.125  -44.438 1.00 30.27  ? 3   ARG E CD  1 
ATOM   4014 N  NE  . ARG E  1 8   ? -17.335 46.839  -45.235 1.00 29.07  ? 3   ARG E NE  1 
ATOM   4015 C  CZ  . ARG E  1 8   ? -18.231 47.753  -45.592 1.00 32.67  ? 3   ARG E CZ  1 
ATOM   4016 N  NH1 . ARG E  1 8   ? -18.074 49.017  -45.222 1.00 36.30  ? 3   ARG E NH1 1 
ATOM   4017 N  NH2 . ARG E  1 8   ? -19.282 47.404  -46.321 1.00 26.61  ? 3   ARG E NH2 1 
ATOM   4018 N  N   . VAL E  1 9   ? -12.989 43.399  -45.394 1.00 23.54  ? 4   VAL E N   1 
ATOM   4019 C  CA  . VAL E  1 9   ? -13.114 42.014  -44.974 1.00 21.77  ? 4   VAL E CA  1 
ATOM   4020 C  C   . VAL E  1 9   ? -13.336 41.924  -43.472 1.00 17.98  ? 4   VAL E C   1 
ATOM   4021 O  O   . VAL E  1 9   ? -12.631 42.567  -42.691 1.00 18.88  ? 4   VAL E O   1 
ATOM   4022 C  CB  . VAL E  1 9   ? -11.850 41.212  -45.319 1.00 20.15  ? 4   VAL E CB  1 
ATOM   4023 C  CG1 . VAL E  1 9   ? -11.968 39.784  -44.795 1.00 16.09  ? 4   VAL E CG1 1 
ATOM   4024 C  CG2 . VAL E  1 9   ? -11.600 41.234  -46.820 1.00 23.45  ? 4   VAL E CG2 1 
ATOM   4025 N  N   . PHE E  1 10  ? -14.325 41.130  -43.077 1.00 20.85  ? 5   PHE E N   1 
ATOM   4026 C  CA  . PHE E  1 10  ? -14.532 40.808  -41.675 1.00 17.65  ? 5   PHE E CA  1 
ATOM   4027 C  C   . PHE E  1 10  ? -14.199 39.347  -41.447 1.00 24.15  ? 5   PHE E C   1 
ATOM   4028 O  O   . PHE E  1 10  ? -14.855 38.457  -41.988 1.00 20.00  ? 5   PHE E O   1 
ATOM   4029 C  CB  . PHE E  1 10  ? -15.972 41.092  -41.249 1.00 17.30  ? 5   PHE E CB  1 
ATOM   4030 C  CG  . PHE E  1 10  ? -16.341 42.542  -41.312 1.00 21.52  ? 5   PHE E CG  1 
ATOM   4031 C  CD1 . PHE E  1 10  ? -15.977 43.406  -40.292 1.00 19.89  ? 5   PHE E CD1 1 
ATOM   4032 C  CD2 . PHE E  1 10  ? -17.039 43.045  -42.396 1.00 17.07  ? 5   PHE E CD2 1 
ATOM   4033 C  CE1 . PHE E  1 10  ? -16.308 44.748  -40.349 1.00 18.85  ? 5   PHE E CE1 1 
ATOM   4034 C  CE2 . PHE E  1 10  ? -17.382 44.383  -42.456 1.00 18.66  ? 5   PHE E CE2 1 
ATOM   4035 C  CZ  . PHE E  1 10  ? -17.013 45.236  -41.430 1.00 19.58  ? 5   PHE E CZ  1 
ATOM   4036 N  N   . ILE E  1 11  ? -13.155 39.108  -40.665 1.00 17.20  ? 6   ILE E N   1 
ATOM   4037 C  CA  . ILE E  1 11  ? -12.813 37.762  -40.245 1.00 15.49  ? 6   ILE E CA  1 
ATOM   4038 C  C   . ILE E  1 11  ? -13.530 37.500  -38.930 1.00 13.27  ? 6   ILE E C   1 
ATOM   4039 O  O   . ILE E  1 11  ? -13.214 38.106  -37.905 1.00 16.68  ? 6   ILE E O   1 
ATOM   4040 C  CB  . ILE E  1 11  ? -11.296 37.603  -40.080 1.00 24.38  ? 6   ILE E CB  1 
ATOM   4041 C  CG1 . ILE E  1 11  ? -10.591 37.978  -41.389 1.00 24.21  ? 6   ILE E CG1 1 
ATOM   4042 C  CG2 . ILE E  1 11  ? -10.950 36.183  -39.658 1.00 25.97  ? 6   ILE E CG2 1 
ATOM   4043 C  CD1 . ILE E  1 11  ? -9.088  37.882  -41.322 1.00 34.92  ? 6   ILE E CD1 1 
ATOM   4044 N  N   . LEU E  1 12  ? -14.513 36.608  -38.965 1.00 13.18  ? 7   LEU E N   1 
ATOM   4045 C  CA  . LEU E  1 12  ? -15.396 36.428  -37.820 1.00 14.27  ? 7   LEU E CA  1 
ATOM   4046 C  C   . LEU E  1 12  ? -14.924 35.352  -36.855 1.00 16.28  ? 7   LEU E C   1 
ATOM   4047 O  O   . LEU E  1 12  ? -14.624 35.642  -35.701 1.00 17.04  ? 7   LEU E O   1 
ATOM   4048 C  CB  . LEU E  1 12  ? -16.819 36.153  -38.295 1.00 14.03  ? 7   LEU E CB  1 
ATOM   4049 C  CG  . LEU E  1 12  ? -17.353 37.336  -39.105 1.00 20.66  ? 7   LEU E CG  1 
ATOM   4050 C  CD1 . LEU E  1 12  ? -18.726 37.040  -39.685 1.00 19.89  ? 7   LEU E CD1 1 
ATOM   4051 C  CD2 . LEU E  1 12  ? -17.390 38.589  -38.243 1.00 20.51  ? 7   LEU E CD2 1 
ATOM   4052 N  N   . TYR E  1 13  ? -14.858 34.112  -37.324 1.00 14.34  ? 8   TYR E N   1 
ATOM   4053 C  CA  . TYR E  1 13  ? -14.403 33.025  -36.474 1.00 14.72  ? 8   TYR E CA  1 
ATOM   4054 C  C   . TYR E  1 13  ? -13.943 31.822  -37.280 1.00 19.26  ? 8   TYR E C   1 
ATOM   4055 O  O   . TYR E  1 13  ? -14.131 31.756  -38.496 1.00 18.96  ? 8   TYR E O   1 
ATOM   4056 C  CB  . TYR E  1 13  ? -15.506 32.605  -35.493 1.00 14.37  ? 8   TYR E CB  1 
ATOM   4057 C  CG  . TYR E  1 13  ? -16.758 32.071  -36.156 1.00 14.51  ? 8   TYR E CG  1 
ATOM   4058 C  CD1 . TYR E  1 13  ? -17.780 32.928  -36.536 1.00 14.47  ? 8   TYR E CD1 1 
ATOM   4059 C  CD2 . TYR E  1 13  ? -16.918 30.711  -36.399 1.00 15.15  ? 8   TYR E CD2 1 
ATOM   4060 C  CE1 . TYR E  1 13  ? -18.928 32.455  -37.147 1.00 16.12  ? 8   TYR E CE1 1 
ATOM   4061 C  CE2 . TYR E  1 13  ? -18.069 30.221  -37.011 1.00 19.85  ? 8   TYR E CE2 1 
ATOM   4062 C  CZ  . TYR E  1 13  ? -19.070 31.104  -37.381 1.00 17.53  ? 8   TYR E CZ  1 
ATOM   4063 O  OH  . TYR E  1 13  ? -20.217 30.648  -37.988 1.00 16.63  ? 8   TYR E OH  1 
ATOM   4064 N  N   . ALA E  1 14  ? -13.337 30.873  -36.580 1.00 16.97  ? 9   ALA E N   1 
ATOM   4065 C  CA  . ALA E  1 14  ? -12.971 29.595  -37.161 1.00 18.39  ? 9   ALA E CA  1 
ATOM   4066 C  C   . ALA E  1 14  ? -13.520 28.479  -36.279 1.00 16.61  ? 9   ALA E C   1 
ATOM   4067 O  O   . ALA E  1 14  ? -13.693 28.664  -35.077 1.00 26.15  ? 9   ALA E O   1 
ATOM   4068 C  CB  . ALA E  1 14  ? -11.466 29.487  -37.289 1.00 18.13  ? 9   ALA E CB  1 
ATOM   4069 N  N   . GLU E  1 15  ? -13.808 27.329  -36.878 1.00 19.40  ? 10  GLU E N   1 
ATOM   4070 C  CA  . GLU E  1 15  ? -14.331 26.197  -36.123 1.00 21.64  ? 10  GLU E CA  1 
ATOM   4071 C  C   . GLU E  1 15  ? -13.419 24.991  -36.248 1.00 27.35  ? 10  GLU E C   1 
ATOM   4072 O  O   . GLU E  1 15  ? -12.812 24.776  -37.295 1.00 20.86  ? 10  GLU E O   1 
ATOM   4073 C  CB  . GLU E  1 15  ? -15.731 25.817  -36.604 1.00 25.03  ? 10  GLU E CB  1 
ATOM   4074 C  CG  . GLU E  1 15  ? -16.815 26.826  -36.270 1.00 36.66  ? 10  GLU E CG  1 
ATOM   4075 C  CD  . GLU E  1 15  ? -18.202 26.219  -36.360 1.00 48.92  ? 10  GLU E CD  1 
ATOM   4076 O  OE1 . GLU E  1 15  ? -18.314 24.978  -36.261 1.00 54.56  ? 10  GLU E OE1 1 
ATOM   4077 O  OE2 . GLU E  1 15  ? -19.177 26.978  -36.534 1.00 54.94  ? 10  GLU E OE2 1 
ATOM   4078 N  N   . ASN E  1 16  ? -13.335 24.216  -35.168 1.00 27.82  ? 11  ASN E N   1 
ATOM   4079 C  CA  . ASN E  1 16  ? -12.601 22.954  -35.151 1.00 30.09  ? 11  ASN E CA  1 
ATOM   4080 C  C   . ASN E  1 16  ? -11.136 23.112  -35.533 1.00 32.10  ? 11  ASN E C   1 
ATOM   4081 O  O   . ASN E  1 16  ? -10.603 22.352  -36.344 1.00 25.77  ? 11  ASN E O   1 
ATOM   4082 C  CB  . ASN E  1 16  ? -13.293 21.927  -36.049 1.00 33.09  ? 11  ASN E CB  1 
ATOM   4083 C  CG  . ASN E  1 16  ? -14.742 21.707  -35.662 1.00 39.06  ? 11  ASN E CG  1 
ATOM   4084 O  OD1 . ASN E  1 16  ? -15.053 21.455  -34.498 1.00 43.73  ? 11  ASN E OD1 1 
ATOM   4085 N  ND2 . ASN E  1 16  ? -15.639 21.819  -36.633 1.00 46.30  ? 11  ASN E ND2 1 
ATOM   4086 N  N   . VAL E  1 17  ? -10.493 24.107  -34.932 1.00 28.85  ? 12  VAL E N   1 
ATOM   4087 C  CA  . VAL E  1 17  ? -9.108  24.431  -35.235 1.00 32.15  ? 12  VAL E CA  1 
ATOM   4088 C  C   . VAL E  1 17  ? -8.179  23.693  -34.291 1.00 26.48  ? 12  VAL E C   1 
ATOM   4089 O  O   . VAL E  1 17  ? -8.167  23.958  -33.090 1.00 29.91  ? 12  VAL E O   1 
ATOM   4090 C  CB  . VAL E  1 17  ? -8.853  25.933  -35.069 1.00 27.69  ? 12  VAL E CB  1 
ATOM   4091 C  CG1 . VAL E  1 17  ? -7.418  26.267  -35.423 1.00 27.78  ? 12  VAL E CG1 1 
ATOM   4092 C  CG2 . VAL E  1 17  ? -9.825  26.722  -35.922 1.00 23.58  ? 12  VAL E CG2 1 
ATOM   4093 N  N   . HIS E  1 18  ? -7.388  22.777  -34.836 1.00 30.86  ? 13  HIS E N   1 
ATOM   4094 C  CA  . HIS E  1 18  ? -6.552  21.937  -33.998 1.00 34.64  ? 13  HIS E CA  1 
ATOM   4095 C  C   . HIS E  1 18  ? -5.086  21.966  -34.366 1.00 44.36  ? 13  HIS E C   1 
ATOM   4096 O  O   . HIS E  1 18  ? -4.719  22.141  -35.527 1.00 50.39  ? 13  HIS E O   1 
ATOM   4097 C  CB  . HIS E  1 18  ? -7.004  20.483  -34.091 1.00 40.26  ? 13  HIS E CB  1 
ATOM   4098 C  CG  . HIS E  1 18  ? -8.347  20.223  -33.490 1.00 39.84  ? 13  HIS E CG  1 
ATOM   4099 N  ND1 . HIS E  1 18  ? -9.482  20.057  -34.253 1.00 42.77  ? 13  HIS E ND1 1 
ATOM   4100 C  CD2 . HIS E  1 18  ? -8.734  20.088  -32.201 1.00 40.26  ? 13  HIS E CD2 1 
ATOM   4101 C  CE1 . HIS E  1 18  ? -10.513 19.836  -33.458 1.00 44.24  ? 13  HIS E CE1 1 
ATOM   4102 N  NE2 . HIS E  1 18  ? -10.088 19.850  -32.209 1.00 44.48  ? 13  HIS E NE2 1 
ATOM   4103 N  N   . THR E  1 19  ? -4.257  21.789  -33.349 1.00 53.97  ? 14  THR E N   1 
ATOM   4104 C  CA  . THR E  1 19  ? -2.929  21.231  -33.522 1.00 72.81  ? 14  THR E CA  1 
ATOM   4105 C  C   . THR E  1 19  ? -2.539  20.621  -32.182 1.00 85.71  ? 14  THR E C   1 
ATOM   4106 O  O   . THR E  1 19  ? -2.227  21.334  -31.228 1.00 91.30  ? 14  THR E O   1 
ATOM   4107 C  CB  . THR E  1 19  ? -1.899  22.248  -34.093 1.00 71.90  ? 14  THR E CB  1 
ATOM   4108 O  OG1 . THR E  1 19  ? -0.592  21.658  -34.125 1.00 75.02  ? 14  THR E OG1 1 
ATOM   4109 C  CG2 . THR E  1 19  ? -1.889  23.561  -33.301 1.00 66.70  ? 14  THR E CG2 1 
ATOM   4110 N  N   . PRO E  1 20  ? -2.622  19.283  -32.094 1.00 93.48  ? 15  PRO E N   1 
ATOM   4111 C  CA  . PRO E  1 20  ? -2.273  18.559  -30.870 1.00 99.87  ? 15  PRO E CA  1 
ATOM   4112 C  C   . PRO E  1 20  ? -0.780  18.718  -30.648 1.00 104.33 ? 15  PRO E C   1 
ATOM   4113 O  O   . PRO E  1 20  ? -0.009  17.806  -30.941 1.00 110.17 ? 15  PRO E O   1 
ATOM   4114 C  CB  . PRO E  1 20  ? -2.626  17.106  -31.207 1.00 103.24 ? 15  PRO E CB  1 
ATOM   4115 C  CG  . PRO E  1 20  ? -2.544  17.025  -32.692 1.00 102.42 ? 15  PRO E CG  1 
ATOM   4116 C  CD  . PRO E  1 20  ? -2.932  18.378  -33.216 1.00 96.66  ? 15  PRO E CD  1 
ATOM   4117 N  N   . ASP E  1 21  ? -0.389  19.888  -30.151 1.00 101.00 ? 16  ASP E N   1 
ATOM   4118 C  CA  . ASP E  1 21  ? 1.013   20.253  -29.994 1.00 101.33 ? 16  ASP E CA  1 
ATOM   4119 C  C   . ASP E  1 21  ? 1.380   20.366  -28.529 1.00 100.51 ? 16  ASP E C   1 
ATOM   4120 O  O   . ASP E  1 21  ? 2.062   21.313  -28.112 1.00 104.68 ? 16  ASP E O   1 
ATOM   4121 C  CB  . ASP E  1 21  ? 1.303   21.568  -30.721 1.00 101.18 ? 16  ASP E CB  1 
ATOM   4122 C  CG  . ASP E  1 21  ? 1.524   21.365  -32.207 1.00 105.57 ? 16  ASP E CG  1 
ATOM   4123 O  OD1 . ASP E  1 21  ? 1.842   20.226  -32.605 1.00 109.87 ? 16  ASP E OD1 1 
ATOM   4124 O  OD2 . ASP E  1 21  ? 1.381   22.331  -32.977 1.00 105.43 ? 16  ASP E OD2 1 
ATOM   4125 N  N   . THR E  1 22  ? 0.937   19.369  -27.766 1.00 94.76  ? 17  THR E N   1 
ATOM   4126 C  CA  . THR E  1 22  ? 1.027   19.390  -26.321 1.00 86.07  ? 17  THR E CA  1 
ATOM   4127 C  C   . THR E  1 22  ? 0.446   20.707  -25.868 1.00 75.78  ? 17  THR E C   1 
ATOM   4128 O  O   . THR E  1 22  ? 0.970   21.354  -24.964 1.00 75.32  ? 17  THR E O   1 
ATOM   4129 C  CB  . THR E  1 22  ? 2.467   19.227  -25.835 1.00 84.54  ? 17  THR E CB  1 
ATOM   4130 O  OG1 . THR E  1 22  ? 3.221   20.404  -26.149 1.00 86.30  ? 17  THR E OG1 1 
ATOM   4131 C  CG2 . THR E  1 22  ? 3.101   18.030  -26.512 1.00 82.79  ? 17  THR E CG2 1 
ATOM   4132 N  N   . ASP E  1 23  ? -0.672  21.064  -26.495 1.00 68.93  ? 18  ASP E N   1 
ATOM   4133 C  CA  . ASP E  1 23  ? -1.319  22.338  -26.265 1.00 55.72  ? 18  ASP E CA  1 
ATOM   4134 C  C   . ASP E  1 23  ? -2.577  22.526  -27.107 1.00 53.17  ? 18  ASP E C   1 
ATOM   4135 O  O   . ASP E  1 23  ? -2.819  21.804  -28.072 1.00 47.60  ? 18  ASP E O   1 
ATOM   4136 C  CB  . ASP E  1 23  ? -0.345  23.471  -26.561 1.00 56.45  ? 18  ASP E CB  1 
ATOM   4137 C  CG  . ASP E  1 23  ? -0.764  24.764  -25.926 1.00 59.04  ? 18  ASP E CG  1 
ATOM   4138 O  OD1 . ASP E  1 23  ? -1.774  24.757  -25.189 1.00 61.93  ? 18  ASP E OD1 1 
ATOM   4139 O  OD2 . ASP E  1 23  ? -0.079  25.780  -26.153 1.00 59.05  ? 18  ASP E OD2 1 
ATOM   4140 N  N   . ILE E  1 24  ? -3.370  23.519  -26.724 1.00 48.23  ? 19  ILE E N   1 
ATOM   4141 C  CA  . ILE E  1 24  ? -4.556  23.910  -27.469 1.00 48.87  ? 19  ILE E CA  1 
ATOM   4142 C  C   . ILE E  1 24  ? -4.235  25.149  -28.310 1.00 32.67  ? 19  ILE E C   1 
ATOM   4143 O  O   . ILE E  1 24  ? -3.446  25.995  -27.890 1.00 33.20  ? 19  ILE E O   1 
ATOM   4144 C  CB  . ILE E  1 24  ? -5.719  24.193  -26.504 1.00 52.07  ? 19  ILE E CB  1 
ATOM   4145 C  CG1 . ILE E  1 24  ? -6.027  22.939  -25.685 1.00 56.17  ? 19  ILE E CG1 1 
ATOM   4146 C  CG2 . ILE E  1 24  ? -6.951  24.660  -27.253 1.00 44.18  ? 19  ILE E CG2 1 
ATOM   4147 C  CD1 . ILE E  1 24  ? -7.198  23.103  -24.757 1.00 58.22  ? 19  ILE E CD1 1 
ATOM   4148 N  N   . SER E  1 25  ? -4.840  25.248  -29.491 1.00 30.53  ? 20  SER E N   1 
ATOM   4149 C  CA  . SER E  1 25  ? -4.496  26.296  -30.452 1.00 31.25  ? 20  SER E CA  1 
ATOM   4150 C  C   . SER E  1 25  ? -4.630  27.719  -29.904 1.00 27.70  ? 20  SER E C   1 
ATOM   4151 O  O   . SER E  1 25  ? -5.607  28.050  -29.234 1.00 35.01  ? 20  SER E O   1 
ATOM   4152 C  CB  . SER E  1 25  ? -5.347  26.163  -31.719 1.00 34.37  ? 20  SER E CB  1 
ATOM   4153 O  OG  . SER E  1 25  ? -5.444  24.812  -32.141 1.00 44.06  ? 20  SER E OG  1 
ATOM   4154 N  N   . ASP E  1 26  ? -3.629  28.547  -30.186 1.00 30.03  ? 21  ASP E N   1 
ATOM   4155 C  CA  . ASP E  1 26  ? -3.739  29.987  -29.984 1.00 27.08  ? 21  ASP E CA  1 
ATOM   4156 C  C   . ASP E  1 26  ? -3.773  30.632  -31.363 1.00 25.42  ? 21  ASP E C   1 
ATOM   4157 O  O   . ASP E  1 26  ? -2.784  31.206  -31.826 1.00 26.66  ? 21  ASP E O   1 
ATOM   4158 C  CB  . ASP E  1 26  ? -2.558  30.523  -29.176 1.00 29.34  ? 21  ASP E CB  1 
ATOM   4159 C  CG  . ASP E  1 26  ? -2.268  29.687  -27.952 1.00 33.11  ? 21  ASP E CG  1 
ATOM   4160 O  OD1 . ASP E  1 26  ? -3.125  29.651  -27.044 1.00 34.90  ? 21  ASP E OD1 1 
ATOM   4161 O  OD2 . ASP E  1 26  ? -1.183  29.069  -27.900 1.00 36.02  ? 21  ASP E OD2 1 
ATOM   4162 N  N   . ALA E  1 27  ? -4.925  30.534  -32.012 1.00 23.43  ? 22  ALA E N   1 
ATOM   4163 C  CA  . ALA E  1 27  ? -5.021  30.832  -33.431 1.00 22.18  ? 22  ALA E CA  1 
ATOM   4164 C  C   . ALA E  1 27  ? -5.166  32.314  -33.743 1.00 27.89  ? 22  ALA E C   1 
ATOM   4165 O  O   . ALA E  1 27  ? -5.876  33.050  -33.054 1.00 20.58  ? 22  ALA E O   1 
ATOM   4166 C  CB  . ALA E  1 27  ? -6.172  30.048  -34.058 1.00 20.94  ? 22  ALA E CB  1 
ATOM   4167 N  N   . TYR E  1 28  ? -4.490  32.738  -34.803 1.00 24.71  ? 23  TYR E N   1 
ATOM   4168 C  CA  . TYR E  1 28  ? -4.753  34.036  -35.394 1.00 26.09  ? 23  TYR E CA  1 
ATOM   4169 C  C   . TYR E  1 28  ? -4.828  33.858  -36.892 1.00 26.76  ? 23  TYR E C   1 
ATOM   4170 O  O   . TYR E  1 28  ? -4.471  32.812  -37.427 1.00 23.86  ? 23  TYR E O   1 
ATOM   4171 C  CB  . TYR E  1 28  ? -3.683  35.061  -35.028 1.00 22.15  ? 23  TYR E CB  1 
ATOM   4172 C  CG  . TYR E  1 28  ? -2.340  34.809  -35.663 1.00 32.97  ? 23  TYR E CG  1 
ATOM   4173 C  CD1 . TYR E  1 28  ? -1.458  33.895  -35.111 1.00 25.75  ? 23  TYR E CD1 1 
ATOM   4174 C  CD2 . TYR E  1 28  ? -1.950  35.494  -36.810 1.00 30.64  ? 23  TYR E CD2 1 
ATOM   4175 C  CE1 . TYR E  1 28  ? -0.226  33.662  -35.678 1.00 28.99  ? 23  TYR E CE1 1 
ATOM   4176 C  CE2 . TYR E  1 28  ? -0.712  35.266  -37.388 1.00 28.00  ? 23  TYR E CE2 1 
ATOM   4177 C  CZ  . TYR E  1 28  ? 0.144   34.348  -36.815 1.00 30.58  ? 23  TYR E CZ  1 
ATOM   4178 O  OH  . TYR E  1 28  ? 1.380   34.107  -37.371 1.00 36.98  ? 23  TYR E OH  1 
ATOM   4179 N  N   A CYS E  1 29  ? -5.273  34.898  -37.571 0.54 24.92  ? 24  CYS E N   1 
ATOM   4180 N  N   B CYS E  1 29  ? -5.173  34.898  -37.571 0.46 25.61  ? 24  CYS E N   1 
ATOM   4181 C  CA  A CYS E  1 29  ? -5.619  34.777  -38.964 0.54 25.00  ? 24  CYS E CA  1 
ATOM   4182 C  CA  B CYS E  1 29  ? -5.519  34.777  -38.964 0.46 26.16  ? 24  CYS E CA  1 
ATOM   4183 C  C   A CYS E  1 29  ? -4.858  35.806  -39.779 0.54 31.20  ? 24  CYS E C   1 
ATOM   4184 C  C   B CYS E  1 29  ? -4.758  35.806  -39.779 0.46 31.99  ? 24  CYS E C   1 
ATOM   4185 O  O   A CYS E  1 29  ? -4.983  37.013  -39.558 0.54 36.74  ? 24  CYS E O   1 
ATOM   4186 O  O   B CYS E  1 29  ? -4.883  37.013  -39.558 0.46 36.41  ? 24  CYS E O   1 
ATOM   4187 C  CB  A CYS E  1 29  ? -7.126  34.971  -39.103 0.54 21.36  ? 24  CYS E CB  1 
ATOM   4188 C  CB  B CYS E  1 29  ? -7.026  34.971  -39.103 0.46 22.66  ? 24  CYS E CB  1 
ATOM   4189 S  SG  A CYS E  1 29  ? -7.809  34.575  -40.686 0.54 40.83  ? 24  CYS E SG  1 
ATOM   4190 S  SG  B CYS E  1 29  ? -7.986  33.488  -39.204 0.46 22.98  ? 24  CYS E SG  1 
ATOM   4191 N  N   . SER E  1 30  ? -4.044  35.315  -40.703 1.00 25.76  ? 25  SER E N   1 
ATOM   4192 C  CA  . SER E  1 30  ? -3.304  36.178  -41.603 1.00 26.30  ? 25  SER E CA  1 
ATOM   4193 C  C   . SER E  1 30  ? -4.051  36.320  -42.924 1.00 34.14  ? 25  SER E C   1 
ATOM   4194 O  O   . SER E  1 30  ? -4.408  35.326  -43.557 1.00 36.60  ? 25  SER E O   1 
ATOM   4195 C  CB  . SER E  1 30  ? -1.906  35.618  -41.846 1.00 35.00  ? 25  SER E CB  1 
ATOM   4196 O  OG  . SER E  1 30  ? -1.160  36.498  -42.659 1.00 48.94  ? 25  SER E OG  1 
ATOM   4197 N  N   . ALA E  1 31  ? -4.286  37.563  -43.334 1.00 30.95  ? 26  ALA E N   1 
ATOM   4198 C  CA  . ALA E  1 31  ? -4.967  37.837  -44.595 1.00 28.08  ? 26  ALA E CA  1 
ATOM   4199 C  C   . ALA E  1 31  ? -4.114  38.714  -45.506 1.00 32.82  ? 26  ALA E C   1 
ATOM   4200 O  O   . ALA E  1 31  ? -3.575  39.734  -45.076 1.00 32.25  ? 26  ALA E O   1 
ATOM   4201 C  CB  . ALA E  1 31  ? -6.321  38.486  -44.339 1.00 24.90  ? 26  ALA E CB  1 
ATOM   4202 N  N   . VAL E  1 32  ? -3.985  38.306  -46.765 1.00 31.01  ? 27  VAL E N   1 
ATOM   4203 C  CA  . VAL E  1 32  ? -3.152  39.031  -47.716 1.00 31.83  ? 27  VAL E CA  1 
ATOM   4204 C  C   . VAL E  1 32  ? -3.897  39.361  -49.006 1.00 34.68  ? 27  VAL E C   1 
ATOM   4205 O  O   . VAL E  1 32  ? -4.483  38.484  -49.643 1.00 36.02  ? 27  VAL E O   1 
ATOM   4206 C  CB  . VAL E  1 32  ? -1.876  38.241  -48.078 1.00 39.56  ? 27  VAL E CB  1 
ATOM   4207 C  CG1 . VAL E  1 32  ? -0.925  39.115  -48.885 1.00 42.46  ? 27  VAL E CG1 1 
ATOM   4208 C  CG2 . VAL E  1 32  ? -1.191  37.725  -46.821 1.00 39.56  ? 27  VAL E CG2 1 
ATOM   4209 N  N   . PHE E  1 33  ? -3.871  40.635  -49.379 1.00 35.28  ? 28  PHE E N   1 
ATOM   4210 C  CA  . PHE E  1 33  ? -4.424  41.078  -50.652 1.00 35.08  ? 28  PHE E CA  1 
ATOM   4211 C  C   . PHE E  1 33  ? -3.495  42.105  -51.288 1.00 38.35  ? 28  PHE E C   1 
ATOM   4212 O  O   . PHE E  1 33  ? -3.164  43.120  -50.669 1.00 34.30  ? 28  PHE E O   1 
ATOM   4213 C  CB  . PHE E  1 33  ? -5.827  41.666  -50.470 1.00 32.25  ? 28  PHE E CB  1 
ATOM   4214 C  CG  . PHE E  1 33  ? -6.413  42.229  -51.737 1.00 37.90  ? 28  PHE E CG  1 
ATOM   4215 C  CD1 . PHE E  1 33  ? -6.931  41.389  -52.708 1.00 38.95  ? 28  PHE E CD1 1 
ATOM   4216 C  CD2 . PHE E  1 33  ? -6.435  43.597  -51.961 1.00 39.50  ? 28  PHE E CD2 1 
ATOM   4217 C  CE1 . PHE E  1 33  ? -7.460  41.902  -53.878 1.00 40.88  ? 28  PHE E CE1 1 
ATOM   4218 C  CE2 . PHE E  1 33  ? -6.967  44.115  -53.130 1.00 43.11  ? 28  PHE E CE2 1 
ATOM   4219 C  CZ  . PHE E  1 33  ? -7.482  43.265  -54.087 1.00 41.39  ? 28  PHE E CZ  1 
ATOM   4220 N  N   . ALA E  1 34  ? -3.079  41.829  -52.522 1.00 36.14  ? 29  ALA E N   1 
ATOM   4221 C  CA  . ALA E  1 34  ? -2.155  42.692  -53.256 1.00 45.82  ? 29  ALA E CA  1 
ATOM   4222 C  C   . ALA E  1 34  ? -0.867  42.962  -52.479 1.00 45.98  ? 29  ALA E C   1 
ATOM   4223 O  O   . ALA E  1 34  ? -0.390  44.095  -52.418 1.00 43.38  ? 29  ALA E O   1 
ATOM   4224 C  CB  . ALA E  1 34  ? -2.832  43.999  -53.652 1.00 40.42  ? 29  ALA E CB  1 
ATOM   4225 N  N   . GLY E  1 35  ? -0.318  41.914  -51.873 1.00 45.48  ? 30  GLY E N   1 
ATOM   4226 C  CA  . GLY E  1 35  ? 0.940   42.020  -51.157 1.00 48.96  ? 30  GLY E CA  1 
ATOM   4227 C  C   . GLY E  1 35  ? 0.853   42.782  -49.847 1.00 49.21  ? 30  GLY E C   1 
ATOM   4228 O  O   . GLY E  1 35  ? 1.867   43.000  -49.185 1.00 42.80  ? 30  GLY E O   1 
ATOM   4229 N  N   . VAL E  1 36  ? -0.352  43.199  -49.473 1.00 42.45  ? 31  VAL E N   1 
ATOM   4230 C  CA  . VAL E  1 36  ? -0.555  43.879  -48.199 1.00 37.07  ? 31  VAL E CA  1 
ATOM   4231 C  C   . VAL E  1 36  ? -1.140  42.903  -47.191 1.00 35.82  ? 31  VAL E C   1 
ATOM   4232 O  O   . VAL E  1 36  ? -2.210  42.330  -47.406 1.00 33.71  ? 31  VAL E O   1 
ATOM   4233 C  CB  . VAL E  1 36  ? -1.474  45.107  -48.328 1.00 36.79  ? 31  VAL E CB  1 
ATOM   4234 C  CG1 . VAL E  1 36  ? -1.677  45.755  -46.966 1.00 36.73  ? 31  VAL E CG1 1 
ATOM   4235 C  CG2 . VAL E  1 36  ? -0.891  46.109  -49.317 1.00 40.42  ? 31  VAL E CG2 1 
ATOM   4236 N  N   . LYS E  1 37  ? -0.423  42.719  -46.089 1.00 34.08  ? 32  LYS E N   1 
ATOM   4237 C  CA  . LYS E  1 37  ? -0.753  41.692  -45.114 1.00 38.91  ? 32  LYS E CA  1 
ATOM   4238 C  C   . LYS E  1 37  ? -1.391  42.275  -43.860 1.00 35.59  ? 32  LYS E C   1 
ATOM   4239 O  O   . LYS E  1 37  ? -0.929  43.281  -43.323 1.00 31.75  ? 32  LYS E O   1 
ATOM   4240 C  CB  . LYS E  1 37  ? 0.506   40.900  -44.759 1.00 44.08  ? 32  LYS E CB  1 
ATOM   4241 C  CG  . LYS E  1 37  ? 0.327   39.864  -43.671 1.00 45.83  ? 32  LYS E CG  1 
ATOM   4242 C  CD  . LYS E  1 37  ? 1.101   38.601  -44.010 1.00 54.49  ? 32  LYS E CD  1 
ATOM   4243 C  CE  . LYS E  1 37  ? 1.571   37.886  -42.760 1.00 58.65  ? 32  LYS E CE  1 
ATOM   4244 N  NZ  . LYS E  1 37  ? 2.062   36.512  -43.047 1.00 63.09  ? 32  LYS E NZ  1 
ATOM   4245 N  N   . LYS E  1 38  ? -2.467  41.640  -43.409 1.00 32.35  ? 33  LYS E N   1 
ATOM   4246 C  CA  . LYS E  1 38  ? -3.144  42.043  -42.186 1.00 34.48  ? 33  LYS E CA  1 
ATOM   4247 C  C   . LYS E  1 38  ? -3.381  40.818  -41.311 1.00 32.22  ? 33  LYS E C   1 
ATOM   4248 O  O   . LYS E  1 38  ? -3.575  39.716  -41.818 1.00 31.85  ? 33  LYS E O   1 
ATOM   4249 C  CB  . LYS E  1 38  ? -4.454  42.762  -42.515 1.00 29.91  ? 33  LYS E CB  1 
ATOM   4250 C  CG  . LYS E  1 38  ? -4.246  44.045  -43.323 1.00 30.99  ? 33  LYS E CG  1 
ATOM   4251 C  CD  . LYS E  1 38  ? -5.555  44.643  -43.799 1.00 34.47  ? 33  LYS E CD  1 
ATOM   4252 C  CE  . LYS E  1 38  ? -5.313  45.836  -44.706 1.00 36.84  ? 33  LYS E CE  1 
ATOM   4253 N  NZ  . LYS E  1 38  ? -4.668  46.968  -43.985 1.00 34.47  ? 33  LYS E NZ  1 
ATOM   4254 N  N   . ARG E  1 39  ? -3.337  41.008  -39.998 1.00 32.61  ? 34  ARG E N   1 
ATOM   4255 C  CA  . ARG E  1 39  ? -3.464  39.890  -39.069 1.00 31.90  ? 34  ARG E CA  1 
ATOM   4256 C  C   . ARG E  1 39  ? -4.493  40.178  -37.982 1.00 25.27  ? 34  ARG E C   1 
ATOM   4257 O  O   . ARG E  1 39  ? -4.606  41.305  -37.508 1.00 26.41  ? 34  ARG E O   1 
ATOM   4258 C  CB  . ARG E  1 39  ? -2.113  39.576  -38.418 1.00 34.09  ? 34  ARG E CB  1 
ATOM   4259 C  CG  . ARG E  1 39  ? -0.980  39.240  -39.382 1.00 36.63  ? 34  ARG E CG  1 
ATOM   4260 C  CD  . ARG E  1 39  ? 0.316   39.039  -38.605 1.00 47.71  ? 34  ARG E CD  1 
ATOM   4261 N  NE  . ARG E  1 39  ? 1.497   38.898  -39.454 1.00 58.53  ? 34  ARG E NE  1 
ATOM   4262 C  CZ  . ARG E  1 39  ? 2.137   39.915  -40.025 1.00 64.52  ? 34  ARG E CZ  1 
ATOM   4263 N  NH1 . ARG E  1 39  ? 1.697   41.155  -39.865 1.00 65.65  ? 34  ARG E NH1 1 
ATOM   4264 N  NH2 . ARG E  1 39  ? 3.212   39.692  -40.769 1.00 69.39  ? 34  ARG E NH2 1 
ATOM   4265 N  N   . THR E  1 40  ? -5.239  39.153  -37.588 1.00 22.60  ? 35  THR E N   1 
ATOM   4266 C  CA  . THR E  1 40  ? -6.131  39.272  -36.445 1.00 19.72  ? 35  THR E CA  1 
ATOM   4267 C  C   . THR E  1 40  ? -5.322  39.153  -35.168 1.00 25.37  ? 35  THR E C   1 
ATOM   4268 O  O   . THR E  1 40  ? -4.123  38.877  -35.201 1.00 25.40  ? 35  THR E O   1 
ATOM   4269 C  CB  . THR E  1 40  ? -7.169  38.144  -36.411 1.00 22.08  ? 35  THR E CB  1 
ATOM   4270 O  OG1 . THR E  1 40  ? -6.506  36.899  -36.147 1.00 22.24  ? 35  THR E OG1 1 
ATOM   4271 C  CG2 . THR E  1 40  ? -7.917  38.067  -37.729 1.00 18.87  ? 35  THR E CG2 1 
ATOM   4272 N  N   . LYS E  1 41  ? -5.993  39.341  -34.039 1.00 22.44  ? 36  LYS E N   1 
ATOM   4273 C  CA  . LYS E  1 41  ? -5.376  39.097  -32.745 1.00 27.34  ? 36  LYS E CA  1 
ATOM   4274 C  C   . LYS E  1 41  ? -5.287  37.593  -32.514 1.00 24.97  ? 36  LYS E C   1 
ATOM   4275 O  O   . LYS E  1 41  ? -5.856  36.801  -33.269 1.00 22.04  ? 36  LYS E O   1 
ATOM   4276 C  CB  . LYS E  1 41  ? -6.199  39.743  -31.631 1.00 23.13  ? 36  LYS E CB  1 
ATOM   4277 C  CG  . LYS E  1 41  ? -7.521  39.035  -31.358 1.00 28.42  ? 36  LYS E CG  1 
ATOM   4278 C  CD  . LYS E  1 41  ? -8.314  39.732  -30.263 1.00 36.86  ? 36  LYS E CD  1 
ATOM   4279 C  CE  . LYS E  1 41  ? -9.121  40.894  -30.811 1.00 40.37  ? 36  LYS E CE  1 
ATOM   4280 N  NZ  . LYS E  1 41  ? -10.224 40.409  -31.686 1.00 37.11  ? 36  LYS E NZ  1 
ATOM   4281 N  N   . VAL E  1 42  ? -4.567  37.206  -31.469 1.00 24.30  ? 37  VAL E N   1 
ATOM   4282 C  CA  . VAL E  1 42  ? -4.470  35.810  -31.073 1.00 23.89  ? 37  VAL E CA  1 
ATOM   4283 C  C   . VAL E  1 42  ? -5.579  35.473  -30.088 1.00 23.47  ? 37  VAL E C   1 
ATOM   4284 O  O   . VAL E  1 42  ? -5.800  36.200  -29.121 1.00 24.58  ? 37  VAL E O   1 
ATOM   4285 C  CB  . VAL E  1 42  ? -3.107  35.512  -30.414 1.00 26.38  ? 37  VAL E CB  1 
ATOM   4286 C  CG1 . VAL E  1 42  ? -3.114  34.143  -29.744 1.00 26.95  ? 37  VAL E CG1 1 
ATOM   4287 C  CG2 . VAL E  1 42  ? -1.994  35.612  -31.442 1.00 35.45  ? 37  VAL E CG2 1 
ATOM   4288 N  N   . ILE E  1 43  ? -6.287  34.379  -30.345 1.00 24.33  ? 38  ILE E N   1 
ATOM   4289 C  CA  . ILE E  1 43  ? -7.268  33.866  -29.396 1.00 24.95  ? 38  ILE E CA  1 
ATOM   4290 C  C   . ILE E  1 43  ? -6.672  32.685  -28.634 1.00 24.06  ? 38  ILE E C   1 
ATOM   4291 O  O   . ILE E  1 43  ? -6.493  31.602  -29.194 1.00 23.88  ? 38  ILE E O   1 
ATOM   4292 C  CB  . ILE E  1 43  ? -8.563  33.412  -30.101 1.00 20.62  ? 38  ILE E CB  1 
ATOM   4293 C  CG1 . ILE E  1 43  ? -9.208  34.577  -30.860 1.00 19.43  ? 38  ILE E CG1 1 
ATOM   4294 C  CG2 . ILE E  1 43  ? -9.540  32.836  -29.093 1.00 23.59  ? 38  ILE E CG2 1 
ATOM   4295 C  CD1 . ILE E  1 43  ? -9.560  35.767  -29.986 1.00 20.17  ? 38  ILE E CD1 1 
ATOM   4296 N  N   . LYS E  1 44  ? -6.367  32.897  -27.357 1.00 26.00  ? 39  LYS E N   1 
ATOM   4297 C  CA  . LYS E  1 44  ? -5.726  31.871  -26.539 1.00 28.05  ? 39  LYS E CA  1 
ATOM   4298 C  C   . LYS E  1 44  ? -6.591  30.650  -26.316 1.00 27.97  ? 39  LYS E C   1 
ATOM   4299 O  O   . LYS E  1 44  ? -7.763  30.771  -25.967 1.00 28.17  ? 39  LYS E O   1 
ATOM   4300 C  CB  . LYS E  1 44  ? -5.342  32.423  -25.168 1.00 33.22  ? 39  LYS E CB  1 
ATOM   4301 C  CG  . LYS E  1 44  ? -4.366  33.555  -25.225 1.00 31.38  ? 39  LYS E CG  1 
ATOM   4302 C  CD  . LYS E  1 44  ? -3.731  33.803  -23.881 1.00 39.50  ? 39  LYS E CD  1 
ATOM   4303 C  CE  . LYS E  1 44  ? -3.245  35.230  -23.817 1.00 41.88  ? 39  LYS E CE  1 
ATOM   4304 N  NZ  . LYS E  1 44  ? -2.418  35.515  -22.621 1.00 40.55  ? 39  LYS E NZ  1 
ATOM   4305 N  N   . ASN E  1 45  ? -5.988  29.480  -26.504 1.00 28.92  ? 40  ASN E N   1 
ATOM   4306 C  CA  . ASN E  1 45  ? -6.564  28.213  -26.063 1.00 30.98  ? 40  ASN E CA  1 
ATOM   4307 C  C   . ASN E  1 45  ? -8.009  27.997  -26.481 1.00 31.63  ? 40  ASN E C   1 
ATOM   4308 O  O   . ASN E  1 45  ? -8.900  27.887  -25.639 1.00 30.37  ? 40  ASN E O   1 
ATOM   4309 C  CB  . ASN E  1 45  ? -6.434  28.091  -24.548 1.00 34.65  ? 40  ASN E CB  1 
ATOM   4310 C  CG  . ASN E  1 45  ? -4.993  28.104  -24.092 1.00 41.12  ? 40  ASN E CG  1 
ATOM   4311 O  OD1 . ASN E  1 45  ? -4.155  27.387  -24.636 1.00 39.14  ? 40  ASN E OD1 1 
ATOM   4312 N  ND2 . ASN E  1 45  ? -4.691  28.931  -23.097 1.00 44.95  ? 40  ASN E ND2 1 
ATOM   4313 N  N   . SER E  1 46  ? -8.232  27.940  -27.788 1.00 26.33  ? 41  SER E N   1 
ATOM   4314 C  CA  . SER E  1 46  ? -9.571  27.760  -28.322 1.00 30.85  ? 41  SER E CA  1 
ATOM   4315 C  C   . SER E  1 46  ? -9.521  27.026  -29.653 1.00 29.53  ? 41  SER E C   1 
ATOM   4316 O  O   . SER E  1 46  ? -8.731  27.367  -30.534 1.00 27.50  ? 41  SER E O   1 
ATOM   4317 C  CB  . SER E  1 46  ? -10.260 29.115  -28.491 1.00 29.09  ? 41  SER E CB  1 
ATOM   4318 O  OG  . SER E  1 46  ? -11.539 28.970  -29.083 1.00 32.92  ? 41  SER E OG  1 
ATOM   4319 N  N   . VAL E  1 47  ? -10.368 26.012  -29.789 1.00 29.34  ? 42  VAL E N   1 
ATOM   4320 C  CA  . VAL E  1 47  ? -10.498 25.284  -31.040 1.00 24.25  ? 42  VAL E CA  1 
ATOM   4321 C  C   . VAL E  1 47  ? -11.535 25.974  -31.918 1.00 29.30  ? 42  VAL E C   1 
ATOM   4322 O  O   . VAL E  1 47  ? -11.692 25.646  -33.096 1.00 30.07  ? 42  VAL E O   1 
ATOM   4323 C  CB  . VAL E  1 47  ? -10.921 23.829  -30.794 1.00 32.01  ? 42  VAL E CB  1 
ATOM   4324 C  CG1 . VAL E  1 47  ? -9.845  23.092  -30.003 1.00 31.76  ? 42  VAL E CG1 1 
ATOM   4325 C  CG2 . VAL E  1 47  ? -12.243 23.788  -30.054 1.00 32.74  ? 42  VAL E CG2 1 
ATOM   4326 N  N   . ASN E  1 48  ? -12.239 26.937  -31.331 1.00 22.86  ? 43  ASN E N   1 
ATOM   4327 C  CA  . ASN E  1 48  ? -13.247 27.706  -32.049 1.00 19.85  ? 43  ASN E CA  1 
ATOM   4328 C  C   . ASN E  1 48  ? -13.077 29.210  -31.838 1.00 20.30  ? 43  ASN E C   1 
ATOM   4329 O  O   . ASN E  1 48  ? -13.973 29.874  -31.314 1.00 21.26  ? 43  ASN E O   1 
ATOM   4330 C  CB  . ASN E  1 48  ? -14.651 27.279  -31.615 1.00 32.89  ? 43  ASN E CB  1 
ATOM   4331 C  CG  . ASN E  1 48  ? -14.871 25.782  -31.734 1.00 44.64  ? 43  ASN E CG  1 
ATOM   4332 O  OD1 . ASN E  1 48  ? -14.811 25.216  -32.825 1.00 45.21  ? 43  ASN E OD1 1 
ATOM   4333 N  ND2 . ASN E  1 48  ? -15.148 25.136  -30.607 1.00 52.79  ? 43  ASN E ND2 1 
ATOM   4334 N  N   . PRO E  1 49  ? -11.929 29.757  -32.263 1.00 18.28  ? 44  PRO E N   1 
ATOM   4335 C  CA  . PRO E  1 49  ? -11.613 31.159  -31.974 1.00 20.91  ? 44  PRO E CA  1 
ATOM   4336 C  C   . PRO E  1 49  ? -12.593 32.132  -32.629 1.00 27.65  ? 44  PRO E C   1 
ATOM   4337 O  O   . PRO E  1 49  ? -12.957 31.962  -33.792 1.00 22.37  ? 44  PRO E O   1 
ATOM   4338 C  CB  . PRO E  1 49  ? -10.220 31.329  -32.584 1.00 19.59  ? 44  PRO E CB  1 
ATOM   4339 C  CG  . PRO E  1 49  ? -10.181 30.328  -33.695 1.00 19.69  ? 44  PRO E CG  1 
ATOM   4340 C  CD  . PRO E  1 49  ? -10.955 29.147  -33.186 1.00 18.39  ? 44  PRO E CD  1 
ATOM   4341 N  N   . VAL E  1 50  ? -13.021 33.139  -31.875 1.00 24.95  ? 45  VAL E N   1 
ATOM   4342 C  CA  . VAL E  1 50  ? -13.835 34.213  -32.427 1.00 17.75  ? 45  VAL E CA  1 
ATOM   4343 C  C   . VAL E  1 50  ? -13.016 35.500  -32.444 1.00 21.31  ? 45  VAL E C   1 
ATOM   4344 O  O   . VAL E  1 50  ? -12.648 36.023  -31.392 1.00 20.63  ? 45  VAL E O   1 
ATOM   4345 C  CB  . VAL E  1 50  ? -15.121 34.433  -31.607 1.00 17.88  ? 45  VAL E CB  1 
ATOM   4346 C  CG1 . VAL E  1 50  ? -15.909 35.609  -32.163 1.00 19.99  ? 45  VAL E CG1 1 
ATOM   4347 C  CG2 . VAL E  1 50  ? -15.970 33.165  -31.589 1.00 17.29  ? 45  VAL E CG2 1 
ATOM   4348 N  N   . TRP E  1 51  ? -12.714 35.998  -33.639 1.00 17.06  ? 46  TRP E N   1 
ATOM   4349 C  CA  . TRP E  1 51  ? -11.943 37.232  -33.768 1.00 20.45  ? 46  TRP E CA  1 
ATOM   4350 C  C   . TRP E  1 51  ? -12.838 38.452  -33.960 1.00 21.88  ? 46  TRP E C   1 
ATOM   4351 O  O   . TRP E  1 51  ? -12.663 39.466  -33.287 1.00 21.02  ? 46  TRP E O   1 
ATOM   4352 C  CB  . TRP E  1 51  ? -10.963 37.140  -34.936 1.00 22.63  ? 46  TRP E CB  1 
ATOM   4353 C  CG  . TRP E  1 51  ? -9.965  36.038  -34.814 1.00 19.18  ? 46  TRP E CG  1 
ATOM   4354 C  CD1 . TRP E  1 51  ? -8.887  35.997  -33.977 1.00 23.00  ? 46  TRP E CD1 1 
ATOM   4355 C  CD2 . TRP E  1 51  ? -9.932  34.824  -35.570 1.00 18.42  ? 46  TRP E CD2 1 
ATOM   4356 N  NE1 . TRP E  1 51  ? -8.192  34.827  -34.157 1.00 24.53  ? 46  TRP E NE1 1 
ATOM   4357 C  CE2 . TRP E  1 51  ? -8.812  34.090  -35.133 1.00 21.08  ? 46  TRP E CE2 1 
ATOM   4358 C  CE3 . TRP E  1 51  ? -10.741 34.286  -36.577 1.00 16.82  ? 46  TRP E CE3 1 
ATOM   4359 C  CZ2 . TRP E  1 51  ? -8.484  32.844  -35.661 1.00 16.66  ? 46  TRP E CZ2 1 
ATOM   4360 C  CZ3 . TRP E  1 51  ? -10.413 33.048  -37.099 1.00 20.46  ? 46  TRP E CZ3 1 
ATOM   4361 C  CH2 . TRP E  1 51  ? -9.294  32.342  -36.641 1.00 17.89  ? 46  TRP E CH2 1 
ATOM   4362 N  N   . ASN E  1 52  ? -13.781 38.353  -34.895 1.00 19.22  ? 47  ASN E N   1 
ATOM   4363 C  CA  . ASN E  1 52  ? -14.696 39.454  -35.194 1.00 20.99  ? 47  ASN E CA  1 
ATOM   4364 C  C   . ASN E  1 52  ? -13.951 40.758  -35.498 1.00 23.10  ? 47  ASN E C   1 
ATOM   4365 O  O   . ASN E  1 52  ? -14.230 41.799  -34.903 1.00 21.74  ? 47  ASN E O   1 
ATOM   4366 C  CB  . ASN E  1 52  ? -15.682 39.647  -34.035 1.00 22.41  ? 47  ASN E CB  1 
ATOM   4367 C  CG  . ASN E  1 52  ? -16.795 40.617  -34.365 1.00 24.30  ? 47  ASN E CG  1 
ATOM   4368 O  OD1 . ASN E  1 52  ? -17.232 40.715  -35.511 1.00 34.33  ? 47  ASN E OD1 1 
ATOM   4369 N  ND2 . ASN E  1 52  ? -17.259 41.344  -33.358 1.00 26.27  ? 47  ASN E ND2 1 
ATOM   4370 N  N   . GLU E  1 53  ? -12.988 40.695  -36.414 1.00 22.31  ? 48  GLU E N   1 
ATOM   4371 C  CA  . GLU E  1 53  ? -12.193 41.871  -36.762 1.00 20.60  ? 48  GLU E CA  1 
ATOM   4372 C  C   . GLU E  1 53  ? -12.408 42.336  -38.200 1.00 21.42  ? 48  GLU E C   1 
ATOM   4373 O  O   . GLU E  1 53  ? -12.579 41.524  -39.109 1.00 24.03  ? 48  GLU E O   1 
ATOM   4374 C  CB  . GLU E  1 53  ? -10.706 41.604  -36.540 1.00 25.58  ? 48  GLU E CB  1 
ATOM   4375 C  CG  . GLU E  1 53  ? -10.298 41.499  -35.084 1.00 30.75  ? 48  GLU E CG  1 
ATOM   4376 C  CD  . GLU E  1 53  ? -8.797  41.386  -34.919 1.00 28.44  ? 48  GLU E CD  1 
ATOM   4377 O  OE1 . GLU E  1 53  ? -8.068  42.167  -35.564 1.00 33.57  ? 48  GLU E OE1 1 
ATOM   4378 O  OE2 . GLU E  1 53  ? -8.346  40.513  -34.151 1.00 31.04  ? 48  GLU E OE2 1 
ATOM   4379 N  N   . GLY E  1 54  ? -12.382 43.649  -38.395 1.00 20.52  ? 49  GLY E N   1 
ATOM   4380 C  CA  . GLY E  1 54  ? -12.511 44.224  -39.719 1.00 22.36  ? 49  GLY E CA  1 
ATOM   4381 C  C   . GLY E  1 54  ? -11.168 44.653  -40.275 1.00 26.18  ? 49  GLY E C   1 
ATOM   4382 O  O   . GLY E  1 54  ? -10.280 45.062  -39.529 1.00 29.08  ? 49  GLY E O   1 
ATOM   4383 N  N   . PHE E  1 55  ? -11.021 44.544  -41.590 1.00 24.76  ? 50  PHE E N   1 
ATOM   4384 C  CA  . PHE E  1 55  ? -9.819  44.993  -42.280 1.00 28.05  ? 50  PHE E CA  1 
ATOM   4385 C  C   . PHE E  1 55  ? -10.206 45.650  -43.595 1.00 30.83  ? 50  PHE E C   1 
ATOM   4386 O  O   . PHE E  1 55  ? -11.145 45.216  -44.267 1.00 32.88  ? 50  PHE E O   1 
ATOM   4387 C  CB  . PHE E  1 55  ? -8.877  43.821  -42.561 1.00 23.78  ? 50  PHE E CB  1 
ATOM   4388 C  CG  . PHE E  1 55  ? -8.510  43.030  -41.341 1.00 26.73  ? 50  PHE E CG  1 
ATOM   4389 C  CD1 . PHE E  1 55  ? -7.505  43.464  -40.491 1.00 25.13  ? 50  PHE E CD1 1 
ATOM   4390 C  CD2 . PHE E  1 55  ? -9.170  41.851  -41.043 1.00 29.38  ? 50  PHE E CD2 1 
ATOM   4391 C  CE1 . PHE E  1 55  ? -7.166  42.734  -39.367 1.00 25.13  ? 50  PHE E CE1 1 
ATOM   4392 C  CE2 . PHE E  1 55  ? -8.837  41.117  -39.921 1.00 25.97  ? 50  PHE E CE2 1 
ATOM   4393 C  CZ  . PHE E  1 55  ? -7.834  41.558  -39.083 1.00 23.03  ? 50  PHE E CZ  1 
ATOM   4394 N  N   . GLU E  1 56  ? -9.479  46.696  -43.965 1.00 27.21  ? 51  GLU E N   1 
ATOM   4395 C  CA  . GLU E  1 56  ? -9.744  47.377  -45.223 1.00 25.98  ? 51  GLU E CA  1 
ATOM   4396 C  C   . GLU E  1 56  ? -8.489  47.547  -46.068 1.00 35.69  ? 51  GLU E C   1 
ATOM   4397 O  O   . GLU E  1 56  ? -7.472  48.056  -45.596 1.00 33.16  ? 51  GLU E O   1 
ATOM   4398 C  CB  . GLU E  1 56  ? -10.400 48.738  -44.976 1.00 52.63  ? 51  GLU E CB  1 
ATOM   4399 C  CG  . GLU E  1 56  ? -11.806 48.647  -44.415 1.00 55.87  ? 51  GLU E CG  1 
ATOM   4400 C  CD  . GLU E  1 56  ? -12.580 49.942  -44.570 1.00 62.67  ? 51  GLU E CD  1 
ATOM   4401 O  OE1 . GLU E  1 56  ? -12.024 51.015  -44.250 1.00 65.06  ? 51  GLU E OE1 1 
ATOM   4402 O  OE2 . GLU E  1 56  ? -13.743 49.885  -45.021 1.00 61.09  ? 51  GLU E OE2 1 
ATOM   4403 N  N   . TRP E  1 57  ? -8.569  47.102  -47.317 1.00 28.07  ? 52  TRP E N   1 
ATOM   4404 C  CA  . TRP E  1 57  ? -7.535  47.378  -48.302 1.00 30.50  ? 52  TRP E CA  1 
ATOM   4405 C  C   . TRP E  1 57  ? -7.993  48.513  -49.203 1.00 43.38  ? 52  TRP E C   1 
ATOM   4406 O  O   . TRP E  1 57  ? -8.996  48.391  -49.909 1.00 37.31  ? 52  TRP E O   1 
ATOM   4407 C  CB  . TRP E  1 57  ? -7.245  46.142  -49.156 1.00 32.16  ? 52  TRP E CB  1 
ATOM   4408 C  CG  . TRP E  1 57  ? -6.480  45.071  -48.449 1.00 32.39  ? 52  TRP E CG  1 
ATOM   4409 C  CD1 . TRP E  1 57  ? -5.137  44.839  -48.520 1.00 34.13  ? 52  TRP E CD1 1 
ATOM   4410 C  CD2 . TRP E  1 57  ? -7.013  44.078  -47.567 1.00 29.02  ? 52  TRP E CD2 1 
ATOM   4411 N  NE1 . TRP E  1 57  ? -4.800  43.764  -47.734 1.00 32.50  ? 52  TRP E NE1 1 
ATOM   4412 C  CE2 . TRP E  1 57  ? -5.934  43.280  -47.138 1.00 35.88  ? 52  TRP E CE2 1 
ATOM   4413 C  CE3 . TRP E  1 57  ? -8.296  43.787  -47.098 1.00 27.51  ? 52  TRP E CE3 1 
ATOM   4414 C  CZ2 . TRP E  1 57  ? -6.101  42.208  -46.263 1.00 34.96  ? 52  TRP E CZ2 1 
ATOM   4415 C  CZ3 . TRP E  1 57  ? -8.459  42.726  -46.228 1.00 21.86  ? 52  TRP E CZ3 1 
ATOM   4416 C  CH2 . TRP E  1 57  ? -7.369  41.949  -45.821 1.00 30.88  ? 52  TRP E CH2 1 
ATOM   4417 N  N   . ASP E  1 58  ? -7.260  49.619  -49.161 1.00 47.69  ? 53  ASP E N   1 
ATOM   4418 C  CA  . ASP E  1 58  ? -7.484  50.733  -50.070 1.00 54.01  ? 53  ASP E CA  1 
ATOM   4419 C  C   . ASP E  1 58  ? -7.184  50.274  -51.497 1.00 62.49  ? 53  ASP E C   1 
ATOM   4420 O  O   . ASP E  1 58  ? -6.048  49.922  -51.818 1.00 64.83  ? 53  ASP E O   1 
ATOM   4421 C  CB  . ASP E  1 58  ? -6.605  51.919  -49.653 1.00 54.32  ? 53  ASP E CB  1 
ATOM   4422 C  CG  . ASP E  1 58  ? -6.282  52.857  -50.802 1.00 66.00  ? 53  ASP E CG  1 
ATOM   4423 O  OD1 . ASP E  1 58  ? -7.190  53.195  -51.591 1.00 66.59  ? 53  ASP E OD1 1 
ATOM   4424 O  OD2 . ASP E  1 58  ? -5.106  53.266  -50.907 1.00 77.23  ? 53  ASP E OD2 1 
ATOM   4425 N  N   . LEU E  1 59  ? -8.214  50.259  -52.341 1.00 64.48  ? 54  LEU E N   1 
ATOM   4426 C  CA  . LEU E  1 59  ? -8.075  49.788  -53.719 1.00 71.47  ? 54  LEU E CA  1 
ATOM   4427 C  C   . LEU E  1 59  ? -7.284  50.759  -54.582 1.00 77.55  ? 54  LEU E C   1 
ATOM   4428 O  O   . LEU E  1 59  ? -7.536  51.963  -54.567 1.00 72.80  ? 54  LEU E O   1 
ATOM   4429 C  CB  . LEU E  1 59  ? -9.442  49.519  -54.353 1.00 76.30  ? 54  LEU E CB  1 
ATOM   4430 C  CG  . LEU E  1 59  ? -10.005 48.115  -54.139 1.00 77.80  ? 54  LEU E CG  1 
ATOM   4431 C  CD1 . LEU E  1 59  ? -11.320 47.948  -54.878 1.00 78.22  ? 54  LEU E CD1 1 
ATOM   4432 C  CD2 . LEU E  1 59  ? -8.992  47.078  -54.594 1.00 80.74  ? 54  LEU E CD2 1 
ATOM   4433 N  N   . LYS E  1 60  ? -6.336  50.225  -55.345 1.00 86.94  ? 55  LYS E N   1 
ATOM   4434 C  CA  . LYS E  1 60  ? -5.406  51.067  -56.084 1.00 101.15 ? 55  LYS E CA  1 
ATOM   4435 C  C   . LYS E  1 60  ? -5.211  50.639  -57.538 1.00 110.96 ? 55  LYS E C   1 
ATOM   4436 O  O   . LYS E  1 60  ? -4.161  50.099  -57.898 1.00 115.68 ? 55  LYS E O   1 
ATOM   4437 C  CB  . LYS E  1 60  ? -4.065  51.144  -55.342 1.00 102.07 ? 55  LYS E CB  1 
ATOM   4438 C  CG  . LYS E  1 60  ? -4.158  51.891  -54.012 1.00 97.07  ? 55  LYS E CG  1 
ATOM   4439 C  CD  . LYS E  1 60  ? -2.814  52.027  -53.321 1.00 97.07  ? 55  LYS E CD  1 
ATOM   4440 C  CE  . LYS E  1 60  ? -2.498  50.835  -52.437 1.00 93.72  ? 55  LYS E CE  1 
ATOM   4441 N  NZ  . LYS E  1 60  ? -2.308  51.264  -51.022 1.00 95.00  ? 55  LYS E NZ  1 
ATOM   4442 N  N   . GLY E  1 61  ? -6.229  50.899  -58.361 1.00 116.21 ? 56  GLY E N   1 
ATOM   4443 C  CA  . GLY E  1 61  ? -6.186  50.647  -59.794 1.00 127.08 ? 56  GLY E CA  1 
ATOM   4444 C  C   . GLY E  1 61  ? -5.552  49.321  -60.170 1.00 135.54 ? 56  GLY E C   1 
ATOM   4445 O  O   . GLY E  1 61  ? -4.857  49.212  -61.177 1.00 141.72 ? 56  GLY E O   1 
ATOM   4446 N  N   . ILE E  1 62  ? -5.776  48.317  -59.332 1.00 132.98 ? 57  ILE E N   1 
ATOM   4447 C  CA  . ILE E  1 62  ? -5.195  46.999  -59.521 1.00 132.69 ? 57  ILE E CA  1 
ATOM   4448 C  C   . ILE E  1 62  ? -6.249  45.994  -59.949 1.00 127.49 ? 57  ILE E C   1 
ATOM   4449 O  O   . ILE E  1 62  ? -7.321  45.918  -59.360 1.00 121.81 ? 57  ILE E O   1 
ATOM   4450 C  CB  . ILE E  1 62  ? -4.538  46.498  -58.225 1.00 130.32 ? 57  ILE E CB  1 
ATOM   4451 C  CG1 . ILE E  1 62  ? -4.520  44.968  -58.199 1.00 129.62 ? 57  ILE E CG1 1 
ATOM   4452 C  CG2 . ILE E  1 62  ? -5.298  47.040  -57.025 1.00 124.73 ? 57  ILE E CG2 1 
ATOM   4453 C  CD1 . ILE E  1 62  ? -3.251  44.368  -57.647 1.00 129.79 ? 57  ILE E CD1 1 
ATOM   4454 N  N   . PRO E  1 63  ? -5.988  45.251  -61.005 1.00 129.56 ? 58  PRO E N   1 
ATOM   4455 C  CA  . PRO E  1 63  ? -6.816  44.083  -61.291 1.00 128.00 ? 58  PRO E CA  1 
ATOM   4456 C  C   . PRO E  1 63  ? -6.473  43.051  -60.236 1.00 125.06 ? 58  PRO E C   1 
ATOM   4457 O  O   . PRO E  1 63  ? -5.280  42.876  -59.983 1.00 128.85 ? 58  PRO E O   1 
ATOM   4458 C  CB  . PRO E  1 63  ? -6.305  43.613  -62.650 1.00 131.87 ? 58  PRO E CB  1 
ATOM   4459 C  CG  . PRO E  1 63  ? -4.943  44.204  -62.760 1.00 134.74 ? 58  PRO E CG  1 
ATOM   4460 C  CD  . PRO E  1 63  ? -5.052  45.537  -62.095 1.00 133.40 ? 58  PRO E CD  1 
ATOM   4461 N  N   . LEU E  1 64  ? -7.442  42.336  -59.665 1.00 117.24 ? 59  LEU E N   1 
ATOM   4462 C  CA  . LEU E  1 64  ? -8.880  42.489  -59.899 1.00 109.85 ? 59  LEU E CA  1 
ATOM   4463 C  C   . LEU E  1 64  ? -9.283  41.775  -61.174 1.00 111.91 ? 59  LEU E C   1 
ATOM   4464 O  O   . LEU E  1 64  ? -10.466 41.617  -61.458 1.00 110.69 ? 59  LEU E O   1 
ATOM   4465 C  CB  . LEU E  1 64  ? -9.317  43.944  -59.933 1.00 106.18 ? 59  LEU E CB  1 
ATOM   4466 C  CG  . LEU E  1 64  ? -10.351 44.396  -58.901 1.00 99.12  ? 59  LEU E CG  1 
ATOM   4467 C  CD1 . LEU E  1 64  ? -11.217 43.266  -58.359 1.00 94.40  ? 59  LEU E CD1 1 
ATOM   4468 C  CD2 . LEU E  1 64  ? -9.643  45.131  -57.784 1.00 95.53  ? 59  LEU E CD2 1 
ATOM   4469 N  N   . ASP E  1 65  ? -8.275  41.284  -61.889 1.00 114.77 ? 60  ASP E N   1 
ATOM   4470 C  CA  . ASP E  1 65  ? -8.433  40.582  -63.138 1.00 117.68 ? 60  ASP E CA  1 
ATOM   4471 C  C   . ASP E  1 65  ? -8.072  39.189  -62.718 1.00 117.29 ? 60  ASP E C   1 
ATOM   4472 O  O   . ASP E  1 65  ? -6.952  38.955  -62.280 1.00 118.81 ? 60  ASP E O   1 
ATOM   4473 C  CB  . ASP E  1 65  ? -7.429  41.166  -64.149 1.00 120.03 ? 60  ASP E CB  1 
ATOM   4474 C  CG  . ASP E  1 65  ? -7.031  40.190  -65.262 1.00 120.09 ? 60  ASP E CG  1 
ATOM   4475 O  OD1 . ASP E  1 65  ? -7.424  40.434  -66.418 1.00 120.11 ? 60  ASP E OD1 1 
ATOM   4476 O  OD2 . ASP E  1 65  ? -6.292  39.219  -64.996 1.00 119.39 ? 60  ASP E OD2 1 
ATOM   4477 N  N   . GLN E  1 66  ? -9.020  38.266  -62.814 1.00 115.55 ? 61  GLN E N   1 
ATOM   4478 C  CA  . GLN E  1 66  ? -8.789  36.938  -62.253 1.00 113.18 ? 61  GLN E CA  1 
ATOM   4479 C  C   . GLN E  1 66  ? -7.475  36.340  -62.752 1.00 117.70 ? 61  GLN E C   1 
ATOM   4480 O  O   . GLN E  1 66  ? -7.069  36.600  -63.884 1.00 121.98 ? 61  GLN E O   1 
ATOM   4481 C  CB  . GLN E  1 66  ? -9.958  36.032  -62.626 1.00 113.84 ? 61  GLN E CB  1 
ATOM   4482 C  CG  . GLN E  1 66  ? -11.204 36.813  -62.944 1.00 113.82 ? 61  GLN E CG  1 
ATOM   4483 C  CD  . GLN E  1 66  ? -12.119 36.084  -63.893 1.00 115.54 ? 61  GLN E CD  1 
ATOM   4484 O  OE1 . GLN E  1 66  ? -12.283 34.867  -63.811 1.00 114.73 ? 61  GLN E OE1 1 
ATOM   4485 N  NE2 . GLN E  1 66  ? -12.723 36.827  -64.807 1.00 119.05 ? 61  GLN E NE2 1 
ATOM   4486 N  N   . GLY E  1 67  ? -6.805  35.545  -61.919 1.00 115.08 ? 62  GLY E N   1 
ATOM   4487 C  CA  . GLY E  1 67  ? -7.296  35.186  -60.602 1.00 108.49 ? 62  GLY E CA  1 
ATOM   4488 C  C   . GLY E  1 67  ? -6.870  36.130  -59.495 1.00 103.27 ? 62  GLY E C   1 
ATOM   4489 O  O   . GLY E  1 67  ? -5.747  36.064  -58.999 1.00 106.22 ? 62  GLY E O   1 
ATOM   4490 N  N   . SER E  1 68  ? -7.775  37.023  -59.113 1.00 88.94  ? 63  SER E N   1 
ATOM   4491 C  CA  . SER E  1 68  ? -7.567  37.861  -57.942 1.00 72.81  ? 63  SER E CA  1 
ATOM   4492 C  C   . SER E  1 68  ? -8.221  37.206  -56.738 1.00 57.27  ? 63  SER E C   1 
ATOM   4493 O  O   . SER E  1 68  ? -9.406  36.875  -56.760 1.00 48.98  ? 63  SER E O   1 
ATOM   4494 C  CB  . SER E  1 68  ? -8.115  39.270  -58.167 1.00 74.71  ? 63  SER E CB  1 
ATOM   4495 O  OG  . SER E  1 68  ? -7.090  40.123  -58.643 1.00 82.26  ? 63  SER E OG  1 
ATOM   4496 N  N   . GLU E  1 69  ? -7.431  37.000  -55.691 1.00 54.43  ? 64  GLU E N   1 
ATOM   4497 C  CA  . GLU E  1 69  ? -7.895  36.259  -54.528 1.00 47.58  ? 64  GLU E CA  1 
ATOM   4498 C  C   . GLU E  1 69  ? -7.417  36.854  -53.216 1.00 37.92  ? 64  GLU E C   1 
ATOM   4499 O  O   . GLU E  1 69  ? -6.328  37.421  -53.132 1.00 43.03  ? 64  GLU E O   1 
ATOM   4500 C  CB  . GLU E  1 69  ? -7.434  34.804  -54.613 1.00 57.22  ? 64  GLU E CB  1 
ATOM   4501 C  CG  . GLU E  1 69  ? -8.198  33.971  -55.619 1.00 61.79  ? 64  GLU E CG  1 
ATOM   4502 C  CD  . GLU E  1 69  ? -7.569  32.613  -55.838 1.00 65.01  ? 64  GLU E CD  1 
ATOM   4503 O  OE1 . GLU E  1 69  ? -6.323  32.534  -55.881 1.00 67.83  ? 64  GLU E OE1 1 
ATOM   4504 O  OE2 . GLU E  1 69  ? -8.321  31.624  -55.961 1.00 61.40  ? 64  GLU E OE2 1 
ATOM   4505 N  N   . LEU E  1 70  ? -8.252  36.721  -52.193 1.00 29.52  ? 65  LEU E N   1 
ATOM   4506 C  CA  . LEU E  1 70  ? -7.846  37.021  -50.835 1.00 32.83  ? 65  LEU E CA  1 
ATOM   4507 C  C   . LEU E  1 70  ? -7.291  35.734  -50.248 1.00 38.57  ? 65  LEU E C   1 
ATOM   4508 O  O   . LEU E  1 70  ? -7.993  34.723  -50.178 1.00 32.83  ? 65  LEU E O   1 
ATOM   4509 C  CB  . LEU E  1 70  ? -9.041  37.503  -50.012 1.00 26.54  ? 65  LEU E CB  1 
ATOM   4510 C  CG  . LEU E  1 70  ? -8.792  37.825  -48.537 1.00 29.05  ? 65  LEU E CG  1 
ATOM   4511 C  CD1 . LEU E  1 70  ? -7.840  38.999  -48.387 1.00 27.51  ? 65  LEU E CD1 1 
ATOM   4512 C  CD2 . LEU E  1 70  ? -10.109 38.104  -47.829 1.00 25.87  ? 65  LEU E CD2 1 
ATOM   4513 N  N   . HIS E  1 71  ? -6.024  35.761  -49.853 1.00 35.41  ? 66  HIS E N   1 
ATOM   4514 C  CA  . HIS E  1 71  ? -5.401  34.582  -49.277 1.00 32.50  ? 66  HIS E CA  1 
ATOM   4515 C  C   . HIS E  1 71  ? -5.424  34.680  -47.767 1.00 32.40  ? 66  HIS E C   1 
ATOM   4516 O  O   . HIS E  1 71  ? -4.943  35.652  -47.184 1.00 33.94  ? 66  HIS E O   1 
ATOM   4517 C  CB  . HIS E  1 71  ? -3.963  34.407  -49.765 1.00 40.73  ? 66  HIS E CB  1 
ATOM   4518 C  CG  . HIS E  1 71  ? -3.343  33.115  -49.332 1.00 50.31  ? 66  HIS E CG  1 
ATOM   4519 N  ND1 . HIS E  1 71  ? -1.989  32.962  -49.124 1.00 54.72  ? 66  HIS E ND1 1 
ATOM   4520 C  CD2 . HIS E  1 71  ? -3.903  31.912  -49.060 1.00 52.71  ? 66  HIS E CD2 1 
ATOM   4521 C  CE1 . HIS E  1 71  ? -1.741  31.721  -48.745 1.00 53.36  ? 66  HIS E CE1 1 
ATOM   4522 N  NE2 . HIS E  1 71  ? -2.885  31.063  -48.698 1.00 53.19  ? 66  HIS E NE2 1 
ATOM   4523 N  N   . VAL E  1 72  ? -5.981  33.659  -47.134 1.00 25.78  ? 67  VAL E N   1 
ATOM   4524 C  CA  . VAL E  1 72  ? -6.123  33.671  -45.698 1.00 31.94  ? 67  VAL E CA  1 
ATOM   4525 C  C   . VAL E  1 72  ? -5.518  32.426  -45.062 1.00 33.90  ? 67  VAL E C   1 
ATOM   4526 O  O   . VAL E  1 72  ? -5.816  31.302  -45.464 1.00 33.91  ? 67  VAL E O   1 
ATOM   4527 C  CB  . VAL E  1 72  ? -7.586  33.786  -45.308 1.00 38.49  ? 67  VAL E CB  1 
ATOM   4528 C  CG1 . VAL E  1 72  ? -7.713  33.552  -43.860 1.00 41.89  ? 67  VAL E CG1 1 
ATOM   4529 C  CG2 . VAL E  1 72  ? -8.132  35.161  -45.688 1.00 36.10  ? 67  VAL E CG2 1 
ATOM   4530 N  N   . VAL E  1 73  ? -4.661  32.641  -44.070 1.00 32.07  ? 68  VAL E N   1 
ATOM   4531 C  CA  . VAL E  1 73  ? -3.960  31.555  -43.409 1.00 31.13  ? 68  VAL E CA  1 
ATOM   4532 C  C   . VAL E  1 73  ? -4.205  31.576  -41.904 1.00 28.59  ? 68  VAL E C   1 
ATOM   4533 O  O   . VAL E  1 73  ? -3.985  32.591  -41.243 1.00 21.62  ? 68  VAL E O   1 
ATOM   4534 C  CB  . VAL E  1 73  ? -2.441  31.649  -43.652 1.00 31.73  ? 68  VAL E CB  1 
ATOM   4535 C  CG1 . VAL E  1 73  ? -1.740  30.453  -43.043 1.00 28.12  ? 68  VAL E CG1 1 
ATOM   4536 C  CG2 . VAL E  1 73  ? -2.137  31.754  -45.142 1.00 25.82  ? 68  VAL E CG2 1 
ATOM   4537 N  N   . VAL E  1 74  ? -4.663  30.453  -41.363 1.00 25.58  ? 69  VAL E N   1 
ATOM   4538 C  CA  . VAL E  1 74  ? -4.805  30.327  -39.918 1.00 20.36  ? 69  VAL E CA  1 
ATOM   4539 C  C   . VAL E  1 74  ? -3.546  29.710  -39.328 1.00 24.58  ? 69  VAL E C   1 
ATOM   4540 O  O   . VAL E  1 74  ? -3.091  28.660  -39.777 1.00 26.77  ? 69  VAL E O   1 
ATOM   4541 C  CB  . VAL E  1 74  ? -6.031  29.489  -39.521 1.00 19.47  ? 69  VAL E CB  1 
ATOM   4542 C  CG1 . VAL E  1 74  ? -6.082  29.309  -38.009 1.00 22.26  ? 69  VAL E CG1 1 
ATOM   4543 C  CG2 . VAL E  1 74  ? -7.310  30.145  -40.028 1.00 20.68  ? 69  VAL E CG2 1 
ATOM   4544 N  N   . LYS E  1 75  ? -2.980  30.375  -38.327 1.00 23.38  ? 70  LYS E N   1 
ATOM   4545 C  CA  . LYS E  1 75  ? -1.749  29.907  -37.705 1.00 27.03  ? 70  LYS E CA  1 
ATOM   4546 C  C   . LYS E  1 75  ? -1.856  29.804  -36.189 1.00 32.12  ? 70  LYS E C   1 
ATOM   4547 O  O   . LYS E  1 75  ? -2.604  30.545  -35.552 1.00 25.54  ? 70  LYS E O   1 
ATOM   4548 C  CB  . LYS E  1 75  ? -0.573  30.812  -38.087 1.00 33.09  ? 70  LYS E CB  1 
ATOM   4549 C  CG  . LYS E  1 75  ? -0.132  30.667  -39.532 1.00 37.15  ? 70  LYS E CG  1 
ATOM   4550 C  CD  . LYS E  1 75  ? 0.982   31.637  -39.876 1.00 44.26  ? 70  LYS E CD  1 
ATOM   4551 C  CE  . LYS E  1 75  ? 1.539   31.351  -41.260 1.00 49.06  ? 70  LYS E CE  1 
ATOM   4552 N  NZ  . LYS E  1 75  ? 2.461   32.424  -41.721 1.00 52.53  ? 70  LYS E NZ  1 
ATOM   4553 N  N   . ASP E  1 76  ? -1.105  28.869  -35.621 1.00 34.47  ? 71  ASP E N   1 
ATOM   4554 C  CA  . ASP E  1 76  ? -1.016  28.733  -34.177 1.00 29.17  ? 71  ASP E CA  1 
ATOM   4555 C  C   . ASP E  1 76  ? 0.080   29.662  -33.681 1.00 41.10  ? 71  ASP E C   1 
ATOM   4556 O  O   . ASP E  1 76  ? 1.239   29.522  -34.074 1.00 38.57  ? 71  ASP E O   1 
ATOM   4557 C  CB  . ASP E  1 76  ? -0.698  27.284  -33.797 1.00 32.47  ? 71  ASP E CB  1 
ATOM   4558 C  CG  . ASP E  1 76  ? -0.651  27.065  -32.292 1.00 32.63  ? 71  ASP E CG  1 
ATOM   4559 O  OD1 . ASP E  1 76  ? -1.183  27.910  -31.543 1.00 32.25  ? 71  ASP E OD1 1 
ATOM   4560 O  OD2 . ASP E  1 76  ? -0.091  26.037  -31.859 1.00 57.05  ? 71  ASP E OD2 1 
ATOM   4561 N  N   . HIS E  1 77  ? -0.286  30.624  -32.840 1.00 31.21  ? 72  HIS E N   1 
ATOM   4562 C  CA  . HIS E  1 77  ? 0.708   31.511  -32.260 1.00 34.42  ? 72  HIS E CA  1 
ATOM   4563 C  C   . HIS E  1 77  ? 1.514   30.756  -31.221 1.00 40.78  ? 72  HIS E C   1 
ATOM   4564 O  O   . HIS E  1 77  ? 1.001   30.406  -30.157 1.00 40.69  ? 72  HIS E O   1 
ATOM   4565 C  CB  . HIS E  1 77  ? 0.064   32.738  -31.621 1.00 39.41  ? 72  HIS E CB  1 
ATOM   4566 C  CG  . HIS E  1 77  ? 1.052   33.753  -31.145 1.00 44.70  ? 72  HIS E CG  1 
ATOM   4567 N  ND1 . HIS E  1 77  ? 1.590   33.736  -29.877 1.00 53.05  ? 72  HIS E ND1 1 
ATOM   4568 C  CD2 . HIS E  1 77  ? 1.612   34.813  -31.777 1.00 48.77  ? 72  HIS E CD2 1 
ATOM   4569 C  CE1 . HIS E  1 77  ? 2.431   34.746  -29.744 1.00 53.70  ? 72  HIS E CE1 1 
ATOM   4570 N  NE2 . HIS E  1 77  ? 2.460   35.415  -30.882 1.00 54.98  ? 72  HIS E NE2 1 
ATOM   4571 N  N   . GLU E  1 78  ? 2.767   30.481  -31.562 1.00 52.09  ? 73  GLU E N   1 
ATOM   4572 C  CA  . GLU E  1 78  ? 3.752   29.968  -30.630 1.00 64.59  ? 73  GLU E CA  1 
ATOM   4573 C  C   . GLU E  1 78  ? 4.800   31.030  -30.644 1.00 73.27  ? 73  GLU E C   1 
ATOM   4574 O  O   . GLU E  1 78  ? 4.845   31.820  -31.586 1.00 78.12  ? 73  GLU E O   1 
ATOM   4575 C  CB  . GLU E  1 78  ? 4.391   28.718  -31.204 1.00 69.62  ? 73  GLU E CB  1 
ATOM   4576 C  CG  . GLU E  1 78  ? 3.423   27.702  -31.720 1.00 74.96  ? 73  GLU E CG  1 
ATOM   4577 C  CD  . GLU E  1 78  ? 3.316   26.547  -30.776 1.00 84.12  ? 73  GLU E CD  1 
ATOM   4578 O  OE1 . GLU E  1 78  ? 3.724   25.435  -31.159 1.00 89.00  ? 73  GLU E OE1 1 
ATOM   4579 O  OE2 . GLU E  1 78  ? 2.827   26.757  -29.648 1.00 86.21  ? 73  GLU E OE2 1 
ATOM   4580 N  N   . THR E  1 79  ? 5.597   31.156  -29.594 1.00 77.19  ? 74  THR E N   1 
ATOM   4581 C  CA  . THR E  1 79  ? 5.329   30.773  -28.207 1.00 87.14  ? 74  THR E CA  1 
ATOM   4582 C  C   . THR E  1 79  ? 5.337   31.955  -27.205 1.00 91.92  ? 74  THR E C   1 
ATOM   4583 O  O   . THR E  1 79  ? 4.510   31.954  -26.306 1.00 92.36  ? 74  THR E O   1 
ATOM   4584 C  CB  . THR E  1 79  ? 6.351   29.734  -27.662 1.00 135.36 ? 74  THR E CB  1 
ATOM   4585 O  OG1 . THR E  1 79  ? 6.215   28.505  -28.377 1.00 133.92 ? 74  THR E OG1 1 
ATOM   4586 C  CG2 . THR E  1 79  ? 6.115   29.454  -26.171 1.00 137.09 ? 74  THR E CG2 1 
ATOM   4587 N  N   . MET E  1 80  ? 6.209   32.973  -27.324 1.00 96.62  ? 75  MET E N   1 
ATOM   4588 C  CA  . MET E  1 80  ? 6.943   33.373  -28.548 1.00 97.92  ? 75  MET E CA  1 
ATOM   4589 C  C   . MET E  1 80  ? 8.072   32.432  -29.070 1.00 114.97 ? 75  MET E C   1 
ATOM   4590 O  O   . MET E  1 80  ? 8.930   31.930  -28.325 1.00 117.54 ? 75  MET E O   1 
ATOM   4591 C  CB  . MET E  1 80  ? 7.260   34.882  -28.593 1.00 101.69 ? 75  MET E CB  1 
ATOM   4592 C  CG  . MET E  1 80  ? 6.206   35.724  -29.397 1.00 70.12  ? 75  MET E CG  1 
ATOM   4593 S  SD  . MET E  1 80  ? 5.856   37.427  -28.808 1.00 213.08 ? 75  MET E SD  1 
ATOM   4594 C  CE  . MET E  1 80  ? 4.640   38.048  -29.920 1.00 86.65  ? 75  MET E CE  1 
ATOM   4595 N  N   . GLY E  1 81  ? 7.977   32.191  -30.379 1.00 116.69 ? 76  GLY E N   1 
ATOM   4596 C  CA  . GLY E  1 81  ? 8.560   31.060  -31.078 1.00 115.74 ? 76  GLY E CA  1 
ATOM   4597 C  C   . GLY E  1 81  ? 7.979   30.967  -32.488 1.00 111.55 ? 76  GLY E C   1 
ATOM   4598 O  O   . GLY E  1 81  ? 7.297   31.883  -32.952 1.00 111.57 ? 76  GLY E O   1 
ATOM   4599 N  N   . ARG E  1 82  ? 8.249   29.858  -33.169 1.00 100.11 ? 77  ARG E N   1 
ATOM   4600 C  CA  . ARG E  1 82  ? 7.866   29.677  -34.565 1.00 88.87  ? 77  ARG E CA  1 
ATOM   4601 C  C   . ARG E  1 82  ? 6.351   29.534  -34.681 1.00 71.05  ? 77  ARG E C   1 
ATOM   4602 O  O   . ARG E  1 82  ? 5.743   28.730  -33.982 1.00 68.60  ? 77  ARG E O   1 
ATOM   4603 C  CB  . ARG E  1 82  ? 8.637   28.479  -35.155 1.00 93.37  ? 77  ARG E CB  1 
ATOM   4604 C  CG  . ARG E  1 82  ? 7.841   27.456  -35.968 1.00 93.03  ? 77  ARG E CG  1 
ATOM   4605 C  CD  . ARG E  1 82  ? 7.261   26.329  -35.098 1.00 94.76  ? 77  ARG E CD  1 
ATOM   4606 N  NE  . ARG E  1 82  ? 7.989   25.061  -35.158 1.00 94.81  ? 77  ARG E NE  1 
ATOM   4607 C  CZ  . ARG E  1 82  ? 7.584   23.998  -35.850 1.00 88.74  ? 77  ARG E CZ  1 
ATOM   4608 N  NH1 . ARG E  1 82  ? 6.464   24.053  -36.562 1.00 83.48  ? 77  ARG E NH1 1 
ATOM   4609 N  NH2 . ARG E  1 82  ? 8.297   22.878  -35.838 1.00 91.55  ? 77  ARG E NH2 1 
ATOM   4610 N  N   . ASN E  1 83  ? 5.737   30.353  -35.530 1.00 58.53  ? 78  ASN E N   1 
ATOM   4611 C  CA  . ASN E  1 83  ? 4.288   30.306  -35.698 1.00 50.71  ? 78  ASN E CA  1 
ATOM   4612 C  C   . ASN E  1 83  ? 3.861   29.203  -36.661 1.00 51.14  ? 78  ASN E C   1 
ATOM   4613 O  O   . ASN E  1 83  ? 4.380   29.087  -37.776 1.00 57.26  ? 78  ASN E O   1 
ATOM   4614 C  CB  . ASN E  1 83  ? 3.713   31.683  -36.068 1.00 49.68  ? 78  ASN E CB  1 
ATOM   4615 C  CG  . ASN E  1 83  ? 3.677   32.633  -34.877 1.00 51.35  ? 78  ASN E CG  1 
ATOM   4616 O  OD1 . ASN E  1 83  ? 3.326   33.806  -35.003 1.00 51.54  ? 78  ASN E OD1 1 
ATOM   4617 N  ND2 . ASN E  1 83  ? 4.046   32.121  -33.713 1.00 39.58  ? 78  ASN E ND2 1 
ATOM   4618 N  N   . ARG E  1 84  ? 2.915   28.392  -36.198 1.00 48.66  ? 79  ARG E N   1 
ATOM   4619 C  CA  . ARG E  1 84  ? 2.593   27.104  -36.807 1.00 45.42  ? 79  ARG E CA  1 
ATOM   4620 C  C   . ARG E  1 84  ? 1.423   27.183  -37.783 1.00 39.10  ? 79  ARG E C   1 
ATOM   4621 O  O   . ARG E  1 84  ? 0.339   27.628  -37.416 1.00 33.47  ? 79  ARG E O   1 
ATOM   4622 C  CB  . ARG E  1 84  ? 2.276   26.105  -35.690 1.00 47.49  ? 79  ARG E CB  1 
ATOM   4623 C  CG  . ARG E  1 84  ? 1.828   24.727  -36.144 1.00 50.21  ? 79  ARG E CG  1 
ATOM   4624 C  CD  . ARG E  1 84  ? 2.693   23.630  -35.520 1.00 64.06  ? 79  ARG E CD  1 
ATOM   4625 N  NE  . ARG E  1 84  ? 3.271   24.033  -34.235 1.00 70.24  ? 79  ARG E NE  1 
ATOM   4626 C  CZ  . ARG E  1 84  ? 4.050   23.259  -33.482 1.00 81.11  ? 79  ARG E CZ  1 
ATOM   4627 N  NH1 . ARG E  1 84  ? 4.339   22.022  -33.865 1.00 82.60  ? 79  ARG E NH1 1 
ATOM   4628 N  NH2 . ARG E  1 84  ? 4.529   23.714  -32.333 1.00 86.35  ? 79  ARG E NH2 1 
ATOM   4629 N  N   . PHE E  1 85  ? 1.652   26.746  -39.020 1.00 37.93  ? 80  PHE E N   1 
ATOM   4630 C  CA  . PHE E  1 85  ? 0.608   26.718  -40.043 1.00 32.75  ? 80  PHE E CA  1 
ATOM   4631 C  C   . PHE E  1 85  ? -0.481  25.721  -39.657 1.00 31.75  ? 80  PHE E C   1 
ATOM   4632 O  O   . PHE E  1 85  ? -0.196  24.558  -39.386 1.00 38.98  ? 80  PHE E O   1 
ATOM   4633 C  CB  . PHE E  1 85  ? 1.213   26.358  -41.408 1.00 39.22  ? 80  PHE E CB  1 
ATOM   4634 C  CG  . PHE E  1 85  ? 0.202   26.266  -42.527 1.00 42.49  ? 80  PHE E CG  1 
ATOM   4635 C  CD1 . PHE E  1 85  ? -0.525  25.101  -42.734 1.00 44.88  ? 80  PHE E CD1 1 
ATOM   4636 C  CD2 . PHE E  1 85  ? -0.005  27.338  -43.384 1.00 42.46  ? 80  PHE E CD2 1 
ATOM   4637 C  CE1 . PHE E  1 85  ? -1.443  25.013  -43.757 1.00 44.37  ? 80  PHE E CE1 1 
ATOM   4638 C  CE2 . PHE E  1 85  ? -0.928  27.252  -44.416 1.00 41.92  ? 80  PHE E CE2 1 
ATOM   4639 C  CZ  . PHE E  1 85  ? -1.645  26.090  -44.599 1.00 41.02  ? 80  PHE E CZ  1 
ATOM   4640 N  N   . LEU E  1 86  ? -1.729  26.180  -39.637 1.00 30.51  ? 81  LEU E N   1 
ATOM   4641 C  CA  . LEU E  1 86  ? -2.855  25.311  -39.303 1.00 30.16  ? 81  LEU E CA  1 
ATOM   4642 C  C   . LEU E  1 86  ? -3.726  25.004  -40.520 1.00 30.61  ? 81  LEU E C   1 
ATOM   4643 O  O   . LEU E  1 86  ? -4.146  23.866  -40.724 1.00 26.46  ? 81  LEU E O   1 
ATOM   4644 C  CB  . LEU E  1 86  ? -3.696  25.927  -38.182 1.00 24.89  ? 81  LEU E CB  1 
ATOM   4645 C  CG  . LEU E  1 86  ? -2.935  26.117  -36.870 1.00 32.84  ? 81  LEU E CG  1 
ATOM   4646 C  CD1 . LEU E  1 86  ? -3.872  26.434  -35.716 1.00 25.39  ? 81  LEU E CD1 1 
ATOM   4647 C  CD2 . LEU E  1 86  ? -2.118  24.871  -36.577 1.00 34.11  ? 81  LEU E CD2 1 
ATOM   4648 N  N   . GLY E  1 87  ? -3.990  26.022  -41.330 1.00 28.63  ? 82  GLY E N   1 
ATOM   4649 C  CA  . GLY E  1 87  ? -4.815  25.847  -42.509 1.00 28.52  ? 82  GLY E CA  1 
ATOM   4650 C  C   . GLY E  1 87  ? -4.912  27.115  -43.328 1.00 31.96  ? 82  GLY E C   1 
ATOM   4651 O  O   . GLY E  1 87  ? -4.691  28.213  -42.817 1.00 35.50  ? 82  GLY E O   1 
ATOM   4652 N  N   . GLU E  1 88  ? -5.240  26.969  -44.606 1.00 25.25  ? 83  GLU E N   1 
ATOM   4653 C  CA  . GLU E  1 88  ? -5.382  28.130  -45.471 1.00 27.69  ? 83  GLU E CA  1 
ATOM   4654 C  C   . GLU E  1 88  ? -6.597  28.043  -46.383 1.00 33.44  ? 83  GLU E C   1 
ATOM   4655 O  O   . GLU E  1 88  ? -7.070  26.957  -46.720 1.00 26.71  ? 83  GLU E O   1 
ATOM   4656 C  CB  . GLU E  1 88  ? -4.114  28.365  -46.296 1.00 25.46  ? 83  GLU E CB  1 
ATOM   4657 C  CG  . GLU E  1 88  ? -3.731  27.231  -47.224 1.00 39.50  ? 83  GLU E CG  1 
ATOM   4658 C  CD  . GLU E  1 88  ? -2.451  27.528  -47.985 1.00 51.24  ? 83  GLU E CD  1 
ATOM   4659 O  OE1 . GLU E  1 88  ? -2.086  28.719  -48.090 1.00 45.18  ? 83  GLU E OE1 1 
ATOM   4660 O  OE2 . GLU E  1 88  ? -1.806  26.574  -48.468 1.00 61.08  ? 83  GLU E OE2 1 
ATOM   4661 N  N   . ALA E  1 89  ? -7.095  29.208  -46.772 1.00 37.35  ? 84  ALA E N   1 
ATOM   4662 C  CA  . ALA E  1 89  ? -8.215  29.294  -47.690 1.00 42.22  ? 84  ALA E CA  1 
ATOM   4663 C  C   . ALA E  1 89  ? -7.949  30.382  -48.715 1.00 42.15  ? 84  ALA E C   1 
ATOM   4664 O  O   . ALA E  1 89  ? -7.360  31.413  -48.398 1.00 39.19  ? 84  ALA E O   1 
ATOM   4665 C  CB  . ALA E  1 89  ? -9.499  29.587  -46.931 1.00 35.55  ? 84  ALA E CB  1 
ATOM   4666 N  N   . LYS E  1 90  ? -8.371  30.140  -49.949 1.00 40.28  ? 85  LYS E N   1 
ATOM   4667 C  CA  . LYS E  1 90  ? -8.328  31.161  -50.981 1.00 40.63  ? 85  LYS E CA  1 
ATOM   4668 C  C   . LYS E  1 90  ? -9.742  31.519  -51.403 1.00 43.30  ? 85  LYS E C   1 
ATOM   4669 O  O   . LYS E  1 90  ? -10.505 30.665  -51.853 1.00 47.76  ? 85  LYS E O   1 
ATOM   4670 C  CB  . LYS E  1 90  ? -7.510  30.690  -52.183 1.00 47.13  ? 85  LYS E CB  1 
ATOM   4671 C  CG  . LYS E  1 90  ? -6.010  30.695  -51.936 1.00 48.30  ? 85  LYS E CG  1 
ATOM   4672 C  CD  . LYS E  1 90  ? -5.244  30.150  -53.124 1.00 53.69  ? 85  LYS E CD  1 
ATOM   4673 C  CE  . LYS E  1 90  ? -3.746  30.160  -52.857 1.00 57.18  ? 85  LYS E CE  1 
ATOM   4674 N  NZ  . LYS E  1 90  ? -2.978  29.523  -53.963 1.00 62.17  ? 85  LYS E NZ  1 
ATOM   4675 N  N   . VAL E  1 91  ? -10.094 32.786  -51.231 1.00 43.31  ? 86  VAL E N   1 
ATOM   4676 C  CA  . VAL E  1 91  ? -11.397 33.275  -51.645 1.00 39.58  ? 86  VAL E CA  1 
ATOM   4677 C  C   . VAL E  1 91  ? -11.263 34.027  -52.961 1.00 39.81  ? 86  VAL E C   1 
ATOM   4678 O  O   . VAL E  1 91  ? -10.566 35.040  -53.043 1.00 41.27  ? 86  VAL E O   1 
ATOM   4679 C  CB  . VAL E  1 91  ? -12.034 34.172  -50.564 1.00 42.03  ? 86  VAL E CB  1 
ATOM   4680 C  CG1 . VAL E  1 91  ? -13.058 35.113  -51.176 1.00 44.67  ? 86  VAL E CG1 1 
ATOM   4681 C  CG2 . VAL E  1 91  ? -12.667 33.316  -49.480 1.00 40.34  ? 86  VAL E CG2 1 
ATOM   4682 N  N   . PRO E  1 92  ? -11.914 33.513  -54.011 1.00 44.92  ? 87  PRO E N   1 
ATOM   4683 C  CA  . PRO E  1 92  ? -11.861 34.193  -55.305 1.00 45.17  ? 87  PRO E CA  1 
ATOM   4684 C  C   . PRO E  1 92  ? -12.767 35.413  -55.268 1.00 42.41  ? 87  PRO E C   1 
ATOM   4685 O  O   . PRO E  1 92  ? -13.941 35.308  -54.911 1.00 41.02  ? 87  PRO E O   1 
ATOM   4686 C  CB  . PRO E  1 92  ? -12.381 33.135  -56.279 1.00 51.42  ? 87  PRO E CB  1 
ATOM   4687 C  CG  . PRO E  1 92  ? -13.248 32.258  -55.463 1.00 49.16  ? 87  PRO E CG  1 
ATOM   4688 C  CD  . PRO E  1 92  ? -12.765 32.312  -54.039 1.00 42.66  ? 87  PRO E CD  1 
ATOM   4689 N  N   . LEU E  1 93  ? -12.216 36.570  -55.612 1.00 43.88  ? 88  LEU E N   1 
ATOM   4690 C  CA  . LEU E  1 93  ? -12.959 37.813  -55.490 1.00 45.82  ? 88  LEU E CA  1 
ATOM   4691 C  C   . LEU E  1 93  ? -13.977 37.951  -56.617 1.00 47.52  ? 88  LEU E C   1 
ATOM   4692 O  O   . LEU E  1 93  ? -14.822 38.848  -56.602 1.00 51.81  ? 88  LEU E O   1 
ATOM   4693 C  CB  . LEU E  1 93  ? -12.006 39.006  -55.435 1.00 48.52  ? 88  LEU E CB  1 
ATOM   4694 C  CG  . LEU E  1 93  ? -11.029 38.974  -54.254 1.00 55.54  ? 88  LEU E CG  1 
ATOM   4695 C  CD1 . LEU E  1 93  ? -10.490 40.362  -53.997 1.00 59.99  ? 88  LEU E CD1 1 
ATOM   4696 C  CD2 . LEU E  1 93  ? -11.678 38.408  -52.993 1.00 52.14  ? 88  LEU E CD2 1 
ATOM   4697 N  N   . ARG E  1 94  ? -13.891 37.044  -57.586 1.00 46.47  ? 89  ARG E N   1 
ATOM   4698 C  CA  . ARG E  1 94  ? -14.899 36.935  -58.634 1.00 50.53  ? 89  ARG E CA  1 
ATOM   4699 C  C   . ARG E  1 94  ? -16.274 36.693  -58.016 1.00 51.22  ? 89  ARG E C   1 
ATOM   4700 O  O   . ARG E  1 94  ? -17.274 37.235  -58.482 1.00 37.44  ? 89  ARG E O   1 
ATOM   4701 C  CB  . ARG E  1 94  ? -14.543 35.812  -59.618 1.00 57.14  ? 89  ARG E CB  1 
ATOM   4702 C  CG  . ARG E  1 94  ? -15.650 34.779  -59.838 1.00 67.97  ? 89  ARG E CG  1 
ATOM   4703 C  CD  . ARG E  1 94  ? -15.285 33.764  -60.914 1.00 75.80  ? 89  ARG E CD  1 
ATOM   4704 N  NE  . ARG E  1 94  ? -13.858 33.458  -60.933 1.00 81.16  ? 89  ARG E NE  1 
ATOM   4705 C  CZ  . ARG E  1 94  ? -13.265 32.579  -60.131 1.00 82.02  ? 89  ARG E CZ  1 
ATOM   4706 N  NH1 . ARG E  1 94  ? -13.973 31.915  -59.228 1.00 83.11  ? 89  ARG E NH1 1 
ATOM   4707 N  NH2 . ARG E  1 94  ? -11.959 32.371  -60.229 1.00 81.44  ? 89  ARG E NH2 1 
ATOM   4708 N  N   . GLU E  1 95  ? -16.312 35.901  -56.947 1.00 50.74  ? 90  GLU E N   1 
ATOM   4709 C  CA  . GLU E  1 95  ? -17.567 35.561  -56.285 1.00 53.01  ? 90  GLU E CA  1 
ATOM   4710 C  C   . GLU E  1 95  ? -18.193 36.771  -55.604 1.00 51.04  ? 90  GLU E C   1 
ATOM   4711 O  O   . GLU E  1 95  ? -19.398 36.801  -55.360 1.00 48.91  ? 90  GLU E O   1 
ATOM   4712 C  CB  . GLU E  1 95  ? -17.357 34.441  -55.263 1.00 59.23  ? 90  GLU E CB  1 
ATOM   4713 C  CG  . GLU E  1 95  ? -16.762 33.168  -55.841 1.00 69.37  ? 90  GLU E CG  1 
ATOM   4714 C  CD  . GLU E  1 95  ? -17.001 31.961  -54.953 1.00 73.54  ? 90  GLU E CD  1 
ATOM   4715 O  OE1 . GLU E  1 95  ? -18.125 31.419  -54.986 1.00 77.36  ? 90  GLU E OE1 1 
ATOM   4716 O  OE2 . GLU E  1 95  ? -16.077 31.558  -54.215 1.00 72.19  ? 90  GLU E OE2 1 
ATOM   4717 N  N   . VAL E  1 96  ? -17.366 37.765  -55.295 1.00 47.72  ? 91  VAL E N   1 
ATOM   4718 C  CA  . VAL E  1 96  ? -17.841 38.993  -54.668 1.00 44.81  ? 91  VAL E CA  1 
ATOM   4719 C  C   . VAL E  1 96  ? -18.339 39.976  -55.730 1.00 51.04  ? 91  VAL E C   1 
ATOM   4720 O  O   . VAL E  1 96  ? -19.302 40.711  -55.509 1.00 54.77  ? 91  VAL E O   1 
ATOM   4721 C  CB  . VAL E  1 96  ? -16.739 39.641  -53.805 1.00 39.11  ? 91  VAL E CB  1 
ATOM   4722 C  CG1 . VAL E  1 96  ? -17.270 40.870  -53.089 1.00 38.58  ? 91  VAL E CG1 1 
ATOM   4723 C  CG2 . VAL E  1 96  ? -16.198 38.635  -52.802 1.00 34.35  ? 91  VAL E CG2 1 
ATOM   4724 N  N   . LEU E  1 97  ? -17.691 39.967  -56.892 1.00 52.78  ? 92  LEU E N   1 
ATOM   4725 C  CA  . LEU E  1 97  ? -18.107 40.799  -58.018 1.00 51.15  ? 92  LEU E CA  1 
ATOM   4726 C  C   . LEU E  1 97  ? -19.262 40.161  -58.780 1.00 46.82  ? 92  LEU E C   1 
ATOM   4727 O  O   . LEU E  1 97  ? -19.516 40.505  -59.934 1.00 47.03  ? 92  LEU E O   1 
ATOM   4728 C  CB  . LEU E  1 97  ? -16.939 41.021  -58.979 1.00 54.29  ? 92  LEU E CB  1 
ATOM   4729 C  CG  . LEU E  1 97  ? -15.783 41.894  -58.499 1.00 58.01  ? 92  LEU E CG  1 
ATOM   4730 C  CD1 . LEU E  1 97  ? -14.667 41.907  -59.532 1.00 66.59  ? 92  LEU E CD1 1 
ATOM   4731 C  CD2 . LEU E  1 97  ? -16.276 43.298  -58.230 1.00 54.97  ? 92  LEU E CD2 1 
ATOM   4732 N  N   . ALA E  1 98  ? -19.959 39.235  -58.130 1.00 48.29  ? 93  ALA E N   1 
ATOM   4733 C  CA  . ALA E  1 98  ? -20.997 38.451  -58.790 1.00 55.19  ? 93  ALA E CA  1 
ATOM   4734 C  C   . ALA E  1 98  ? -22.391 39.065  -58.677 1.00 52.58  ? 93  ALA E C   1 
ATOM   4735 O  O   . ALA E  1 98  ? -23.254 38.815  -59.518 1.00 44.59  ? 93  ALA E O   1 
ATOM   4736 C  CB  . ALA E  1 98  ? -21.002 37.027  -58.247 1.00 58.07  ? 93  ALA E CB  1 
ATOM   4737 N  N   . THR E  1 99  ? -22.606 39.870  -57.641 1.00 46.91  ? 94  THR E N   1 
ATOM   4738 C  CA  . THR E  1 99  ? -23.934 40.404  -57.355 1.00 46.29  ? 94  THR E CA  1 
ATOM   4739 C  C   . THR E  1 99  ? -23.875 41.910  -57.036 1.00 45.37  ? 94  THR E C   1 
ATOM   4740 O  O   . THR E  1 99  ? -22.849 42.396  -56.557 1.00 43.51  ? 94  THR E O   1 
ATOM   4741 C  CB  . THR E  1 99  ? -24.609 39.577  -56.227 1.00 51.35  ? 94  THR E CB  1 
ATOM   4742 O  OG1 . THR E  1 99  ? -25.893 39.118  -56.671 1.00 64.84  ? 94  THR E OG1 1 
ATOM   4743 C  CG2 . THR E  1 99  ? -24.768 40.386  -54.956 1.00 47.03  ? 94  THR E CG2 1 
ATOM   4744 N  N   . PRO E  1 100 ? -24.966 42.656  -57.321 1.00 48.13  ? 95  PRO E N   1 
ATOM   4745 C  CA  . PRO E  1 100 ? -24.994 44.119  -57.178 1.00 49.36  ? 95  PRO E CA  1 
ATOM   4746 C  C   . PRO E  1 100 ? -24.629 44.592  -55.783 1.00 48.90  ? 95  PRO E C   1 
ATOM   4747 O  O   . PRO E  1 100 ? -24.163 45.719  -55.617 1.00 52.49  ? 95  PRO E O   1 
ATOM   4748 C  CB  . PRO E  1 100 ? -26.459 44.471  -57.449 1.00 58.25  ? 95  PRO E CB  1 
ATOM   4749 C  CG  . PRO E  1 100 ? -26.960 43.377  -58.262 1.00 47.85  ? 95  PRO E CG  1 
ATOM   4750 C  CD  . PRO E  1 100 ? -26.263 42.143  -57.790 1.00 45.05  ? 95  PRO E CD  1 
ATOM   4751 N  N   . SER E  1 101 ? -24.844 43.736  -54.792 1.00 37.47  ? 96  SER E N   1 
ATOM   4752 C  CA  . SER E  1 101 ? -24.501 44.077  -53.423 1.00 41.95  ? 96  SER E CA  1 
ATOM   4753 C  C   . SER E  1 101 ? -22.990 44.220  -53.287 1.00 40.26  ? 96  SER E C   1 
ATOM   4754 O  O   . SER E  1 101 ? -22.514 44.886  -52.376 1.00 38.95  ? 96  SER E O   1 
ATOM   4755 C  CB  . SER E  1 101 ? -25.040 43.030  -52.443 1.00 39.01  ? 96  SER E CB  1 
ATOM   4756 O  OG  . SER E  1 101 ? -24.156 41.931  -52.319 1.00 33.37  ? 96  SER E OG  1 
ATOM   4757 N  N   . LEU E  1 102 ? -22.249 43.604  -54.208 1.00 33.18  ? 97  LEU E N   1 
ATOM   4758 C  CA  . LEU E  1 102 ? -20.787 43.637  -54.198 1.00 31.88  ? 97  LEU E CA  1 
ATOM   4759 C  C   . LEU E  1 102 ? -20.255 43.101  -52.879 1.00 29.71  ? 97  LEU E C   1 
ATOM   4760 O  O   . LEU E  1 102 ? -19.307 43.640  -52.311 1.00 32.06  ? 97  LEU E O   1 
ATOM   4761 C  CB  . LEU E  1 102 ? -20.264 45.055  -54.442 1.00 33.13  ? 97  LEU E CB  1 
ATOM   4762 C  CG  . LEU E  1 102 ? -20.605 45.705  -55.783 1.00 36.59  ? 97  LEU E CG  1 
ATOM   4763 C  CD1 . LEU E  1 102 ? -20.180 47.163  -55.775 1.00 37.88  ? 97  LEU E CD1 1 
ATOM   4764 C  CD2 . LEU E  1 102 ? -19.934 44.958  -56.916 1.00 37.91  ? 97  LEU E CD2 1 
ATOM   4765 N  N   . SER E  1 103 ? -20.888 42.041  -52.392 1.00 27.90  ? 98  SER E N   1 
ATOM   4766 C  CA  . SER E  1 103 ? -20.506 41.437  -51.129 1.00 25.43  ? 98  SER E CA  1 
ATOM   4767 C  C   . SER E  1 103 ? -20.873 39.965  -51.125 1.00 29.69  ? 98  SER E C   1 
ATOM   4768 O  O   . SER E  1 103 ? -21.778 39.538  -51.840 1.00 26.96  ? 98  SER E O   1 
ATOM   4769 C  CB  . SER E  1 103 ? -21.210 42.139  -49.971 1.00 26.48  ? 98  SER E CB  1 
ATOM   4770 O  OG  . SER E  1 103 ? -22.616 42.057  -50.116 1.00 31.74  ? 98  SER E OG  1 
ATOM   4771 N  N   . ALA E  1 104 ? -20.166 39.194  -50.311 1.00 24.78  ? 99  ALA E N   1 
ATOM   4772 C  CA  . ALA E  1 104 ? -20.411 37.769  -50.207 1.00 26.46  ? 99  ALA E CA  1 
ATOM   4773 C  C   . ALA E  1 104 ? -19.839 37.279  -48.895 1.00 22.90  ? 99  ALA E C   1 
ATOM   4774 O  O   . ALA E  1 104 ? -18.911 37.876  -48.349 1.00 22.53  ? 99  ALA E O   1 
ATOM   4775 C  CB  . ALA E  1 104 ? -19.774 37.029  -51.376 1.00 24.17  ? 99  ALA E CB  1 
ATOM   4776 N  N   . SER E  1 105 ? -20.407 36.201  -48.377 1.00 24.81  ? 100 SER E N   1 
ATOM   4777 C  CA  . SER E  1 105 ? -19.882 35.595  -47.170 1.00 30.44  ? 100 SER E CA  1 
ATOM   4778 C  C   . SER E  1 105 ? -19.344 34.222  -47.506 1.00 26.90  ? 100 SER E C   1 
ATOM   4779 O  O   . SER E  1 105 ? -19.796 33.572  -48.453 1.00 21.55  ? 100 SER E O   1 
ATOM   4780 C  CB  . SER E  1 105 ? -20.963 35.480  -46.105 1.00 36.09  ? 100 SER E CB  1 
ATOM   4781 O  OG  . SER E  1 105 ? -21.942 34.531  -46.490 1.00 44.96  ? 100 SER E OG  1 
ATOM   4782 N  N   . PHE E  1 106 ? -18.370 33.781  -46.725 1.00 22.99  ? 101 PHE E N   1 
ATOM   4783 C  CA  . PHE E  1 106 ? -17.738 32.504  -46.980 1.00 22.22  ? 101 PHE E CA  1 
ATOM   4784 C  C   . PHE E  1 106 ? -17.593 31.715  -45.693 1.00 26.65  ? 101 PHE E C   1 
ATOM   4785 O  O   . PHE E  1 106 ? -17.077 32.219  -44.695 1.00 20.63  ? 101 PHE E O   1 
ATOM   4786 C  CB  . PHE E  1 106 ? -16.366 32.711  -47.626 1.00 27.16  ? 101 PHE E CB  1 
ATOM   4787 C  CG  . PHE E  1 106 ? -16.413 33.492  -48.905 1.00 28.61  ? 101 PHE E CG  1 
ATOM   4788 C  CD1 . PHE E  1 106 ? -16.317 34.875  -48.893 1.00 24.40  ? 101 PHE E CD1 1 
ATOM   4789 C  CD2 . PHE E  1 106 ? -16.559 32.846  -50.119 1.00 32.06  ? 101 PHE E CD2 1 
ATOM   4790 C  CE1 . PHE E  1 106 ? -16.365 35.595  -50.072 1.00 27.69  ? 101 PHE E CE1 1 
ATOM   4791 C  CE2 . PHE E  1 106 ? -16.607 33.561  -51.299 1.00 32.54  ? 101 PHE E CE2 1 
ATOM   4792 C  CZ  . PHE E  1 106 ? -16.512 34.936  -51.275 1.00 27.93  ? 101 PHE E CZ  1 
ATOM   4793 N  N   . ASN E  1 107 ? -18.086 30.484  -45.713 1.00 23.67  ? 102 ASN E N   1 
ATOM   4794 C  CA  . ASN E  1 107 ? -17.743 29.517  -44.687 1.00 23.50  ? 102 ASN E CA  1 
ATOM   4795 C  C   . ASN E  1 107 ? -16.802 28.513  -45.329 1.00 24.37  ? 102 ASN E C   1 
ATOM   4796 O  O   . ASN E  1 107 ? -17.225 27.467  -45.823 1.00 28.29  ? 102 ASN E O   1 
ATOM   4797 C  CB  . ASN E  1 107 ? -18.987 28.828  -44.132 1.00 23.85  ? 102 ASN E CB  1 
ATOM   4798 C  CG  . ASN E  1 107 ? -18.682 27.978  -42.914 1.00 34.00  ? 102 ASN E CG  1 
ATOM   4799 O  OD1 . ASN E  1 107 ? -17.536 27.894  -42.471 1.00 26.17  ? 102 ASN E OD1 1 
ATOM   4800 N  ND2 . ASN E  1 107 ? -19.709 27.352  -42.359 1.00 38.40  ? 102 ASN E ND2 1 
ATOM   4801 N  N   . ALA E  1 108 ? -15.520 28.850  -45.335 1.00 24.26  ? 103 ALA E N   1 
ATOM   4802 C  CA  . ALA E  1 108 ? -14.549 28.123  -46.136 1.00 29.31  ? 103 ALA E CA  1 
ATOM   4803 C  C   . ALA E  1 108 ? -13.823 27.036  -45.353 1.00 26.69  ? 103 ALA E C   1 
ATOM   4804 O  O   . ALA E  1 108 ? -13.292 27.293  -44.273 1.00 22.68  ? 103 ALA E O   1 
ATOM   4805 C  CB  . ALA E  1 108 ? -13.548 29.094  -46.746 1.00 30.28  ? 103 ALA E CB  1 
ATOM   4806 N  N   . PRO E  1 109 ? -13.799 25.812  -45.902 1.00 27.19  ? 104 PRO E N   1 
ATOM   4807 C  CA  . PRO E  1 109 ? -12.983 24.737  -45.331 1.00 22.98  ? 104 PRO E CA  1 
ATOM   4808 C  C   . PRO E  1 109 ? -11.494 25.040  -45.489 1.00 30.49  ? 104 PRO E C   1 
ATOM   4809 O  O   . PRO E  1 109 ? -11.053 25.429  -46.569 1.00 30.65  ? 104 PRO E O   1 
ATOM   4810 C  CB  . PRO E  1 109 ? -13.369 23.519  -46.175 1.00 25.55  ? 104 PRO E CB  1 
ATOM   4811 C  CG  . PRO E  1 109 ? -13.869 24.087  -47.457 1.00 27.39  ? 104 PRO E CG  1 
ATOM   4812 C  CD  . PRO E  1 109 ? -14.561 25.361  -47.080 1.00 29.09  ? 104 PRO E CD  1 
ATOM   4813 N  N   . LEU E  1 110 ? -10.733 24.870  -44.414 1.00 28.72  ? 105 LEU E N   1 
ATOM   4814 C  CA  . LEU E  1 110 ? -9.302  25.140  -44.442 1.00 23.04  ? 105 LEU E CA  1 
ATOM   4815 C  C   . LEU E  1 110 ? -8.527  23.950  -45.004 1.00 27.49  ? 105 LEU E C   1 
ATOM   4816 O  O   . LEU E  1 110 ? -8.814  22.796  -44.675 1.00 29.16  ? 105 LEU E O   1 
ATOM   4817 C  CB  . LEU E  1 110 ? -8.802  25.495  -43.040 1.00 29.36  ? 105 LEU E CB  1 
ATOM   4818 C  CG  . LEU E  1 110 ? -9.440  26.740  -42.416 1.00 27.89  ? 105 LEU E CG  1 
ATOM   4819 C  CD1 . LEU E  1 110 ? -8.953  26.949  -40.987 1.00 20.71  ? 105 LEU E CD1 1 
ATOM   4820 C  CD2 . LEU E  1 110 ? -9.149  27.961  -43.273 1.00 24.93  ? 105 LEU E CD2 1 
ATOM   4821 N  N   . LEU E  1 111 ? -7.553  24.237  -45.863 1.00 26.60  ? 106 LEU E N   1 
ATOM   4822 C  CA  . LEU E  1 111 ? -6.724  23.196  -46.463 1.00 30.17  ? 106 LEU E CA  1 
ATOM   4823 C  C   . LEU E  1 111 ? -5.346  23.163  -45.818 1.00 31.01  ? 106 LEU E C   1 
ATOM   4824 O  O   . LEU E  1 111 ? -4.831  24.196  -45.393 1.00 27.83  ? 106 LEU E O   1 
ATOM   4825 C  CB  . LEU E  1 111 ? -6.571  23.430  -47.967 1.00 30.00  ? 106 LEU E CB  1 
ATOM   4826 C  CG  . LEU E  1 111 ? -7.843  23.464  -48.814 1.00 30.11  ? 106 LEU E CG  1 
ATOM   4827 C  CD1 . LEU E  1 111 ? -7.487  23.545  -50.288 1.00 36.70  ? 106 LEU E CD1 1 
ATOM   4828 C  CD2 . LEU E  1 111 ? -8.713  22.248  -48.531 1.00 31.06  ? 106 LEU E CD2 1 
ATOM   4829 N  N   . ASP E  1 112 ? -4.749  21.976  -45.749 1.00 32.91  ? 107 ASP E N   1 
ATOM   4830 C  CA  . ASP E  1 112 ? -3.383  21.856  -45.256 1.00 35.12  ? 107 ASP E CA  1 
ATOM   4831 C  C   . ASP E  1 112 ? -2.365  22.065  -46.376 1.00 40.78  ? 107 ASP E C   1 
ATOM   4832 O  O   . ASP E  1 112 ? -2.724  22.440  -47.494 1.00 40.65  ? 107 ASP E O   1 
ATOM   4833 C  CB  . ASP E  1 112 ? -3.148  20.522  -44.520 1.00 43.20  ? 107 ASP E CB  1 
ATOM   4834 C  CG  . ASP E  1 112 ? -3.368  19.293  -45.403 1.00 48.95  ? 107 ASP E CG  1 
ATOM   4835 O  OD1 . ASP E  1 112 ? -3.206  19.379  -46.637 1.00 43.74  ? 107 ASP E OD1 1 
ATOM   4836 O  OD2 . ASP E  1 112 ? -3.693  18.221  -44.848 1.00 52.94  ? 107 ASP E OD2 1 
ATOM   4837 N  N   . THR E  1 113 ? -1.100  21.814  -46.063 1.00 43.91  ? 108 THR E N   1 
ATOM   4838 C  CA  . THR E  1 113 ? -0.016  21.967  -47.023 1.00 51.38  ? 108 THR E CA  1 
ATOM   4839 C  C   . THR E  1 113 ? -0.203  21.055  -48.231 1.00 52.71  ? 108 THR E C   1 
ATOM   4840 O  O   . THR E  1 113 ? 0.230   21.381  -49.335 1.00 51.04  ? 108 THR E O   1 
ATOM   4841 C  CB  . THR E  1 113 ? 1.339   21.667  -46.368 1.00 56.16  ? 108 THR E CB  1 
ATOM   4842 O  OG1 . THR E  1 113 ? 1.300   20.363  -45.776 1.00 55.61  ? 108 THR E OG1 1 
ATOM   4843 C  CG2 . THR E  1 113 ? 1.637   22.691  -45.287 1.00 56.15  ? 108 THR E CG2 1 
ATOM   4844 N  N   . LYS E  1 114 ? -0.853  19.914  -48.012 1.00 56.19  ? 109 LYS E N   1 
ATOM   4845 C  CA  . LYS E  1 114 ? -1.127  18.963  -49.084 1.00 58.09  ? 109 LYS E CA  1 
ATOM   4846 C  C   . LYS E  1 114 ? -2.490  19.182  -49.736 1.00 56.08  ? 109 LYS E C   1 
ATOM   4847 O  O   . LYS E  1 114 ? -3.056  18.254  -50.314 1.00 58.87  ? 109 LYS E O   1 
ATOM   4848 C  CB  . LYS E  1 114 ? -1.066  17.527  -48.563 1.00 59.32  ? 109 LYS E CB  1 
ATOM   4849 C  CG  . LYS E  1 114 ? 0.306   17.044  -48.153 1.00 63.88  ? 109 LYS E CG  1 
ATOM   4850 C  CD  . LYS E  1 114 ? 0.254   15.556  -47.848 1.00 65.94  ? 109 LYS E CD  1 
ATOM   4851 C  CE  . LYS E  1 114 ? 1.637   14.988  -47.606 1.00 70.13  ? 109 LYS E CE  1 
ATOM   4852 N  NZ  . LYS E  1 114 ? 2.508   15.160  -48.800 1.00 72.35  ? 109 LYS E NZ  1 
ATOM   4853 N  N   . LYS E  1 115 ? -3.021  20.395  -49.622 1.00 55.68  ? 110 LYS E N   1 
ATOM   4854 C  CA  . LYS E  1 115 ? -4.319  20.733  -50.210 1.00 57.14  ? 110 LYS E CA  1 
ATOM   4855 C  C   . LYS E  1 115 ? -5.471  19.835  -49.748 1.00 52.35  ? 110 LYS E C   1 
ATOM   4856 O  O   . LYS E  1 115 ? -6.511  19.774  -50.400 1.00 40.01  ? 110 LYS E O   1 
ATOM   4857 C  CB  . LYS E  1 115 ? -4.237  20.735  -51.741 1.00 64.95  ? 110 LYS E CB  1 
ATOM   4858 C  CG  . LYS E  1 115 ? -4.100  22.117  -52.353 1.00 69.56  ? 110 LYS E CG  1 
ATOM   4859 C  CD  . LYS E  1 115 ? -2.821  22.804  -51.909 1.00 74.41  ? 110 LYS E CD  1 
ATOM   4860 C  CE  . LYS E  1 115 ? -2.783  24.246  -52.386 1.00 76.59  ? 110 LYS E CE  1 
ATOM   4861 N  NZ  . LYS E  1 115 ? -1.618  24.987  -51.831 1.00 78.45  ? 110 LYS E NZ  1 
ATOM   4862 N  N   . GLN E  1 116 ? -5.282  19.134  -48.634 1.00 48.97  ? 111 GLN E N   1 
ATOM   4863 C  CA  . GLN E  1 116 ? -6.346  18.323  -48.056 1.00 45.16  ? 111 GLN E CA  1 
ATOM   4864 C  C   . GLN E  1 116 ? -7.079  19.117  -46.984 1.00 42.36  ? 111 GLN E C   1 
ATOM   4865 O  O   . GLN E  1 116 ? -6.464  19.909  -46.271 1.00 44.45  ? 111 GLN E O   1 
ATOM   4866 C  CB  . GLN E  1 116 ? -5.778  17.042  -47.444 1.00 44.12  ? 111 GLN E CB  1 
ATOM   4867 C  CG  . GLN E  1 116 ? -5.210  16.068  -48.457 1.00 56.71  ? 111 GLN E CG  1 
ATOM   4868 C  CD  . GLN E  1 116 ? -4.417  14.952  -47.807 1.00 63.42  ? 111 GLN E CD  1 
ATOM   4869 O  OE1 . GLN E  1 116 ? -3.449  14.454  -48.379 1.00 74.76  ? 111 GLN E OE1 1 
ATOM   4870 N  NE2 . GLN E  1 116 ? -4.823  14.554  -46.606 1.00 58.82  ? 111 GLN E NE2 1 
ATOM   4871 N  N   . PRO E  1 117 ? -8.400  18.914  -46.872 1.00 37.78  ? 112 PRO E N   1 
ATOM   4872 C  CA  . PRO E  1 117 ? -9.173  19.564  -45.806 1.00 32.47  ? 112 PRO E CA  1 
ATOM   4873 C  C   . PRO E  1 117 ? -8.663  19.165  -44.422 1.00 41.44  ? 112 PRO E C   1 
ATOM   4874 O  O   . PRO E  1 117 ? -8.446  17.981  -44.158 1.00 34.56  ? 112 PRO E O   1 
ATOM   4875 C  CB  . PRO E  1 117 ? -10.590 19.026  -46.025 1.00 33.43  ? 112 PRO E CB  1 
ATOM   4876 C  CG  . PRO E  1 117 ? -10.634 18.657  -47.473 1.00 36.14  ? 112 PRO E CG  1 
ATOM   4877 C  CD  . PRO E  1 117 ? -9.258  18.151  -47.795 1.00 37.65  ? 112 PRO E CD  1 
ATOM   4878 N  N   . THR E  1 118 ? -8.465  20.152  -43.555 1.00 36.36  ? 113 THR E N   1 
ATOM   4879 C  CA  . THR E  1 118 ? -7.995  19.897  -42.200 1.00 38.69  ? 113 THR E CA  1 
ATOM   4880 C  C   . THR E  1 118 ? -9.155  19.482  -41.301 1.00 37.78  ? 113 THR E C   1 
ATOM   4881 O  O   . THR E  1 118 ? -8.953  18.899  -40.238 1.00 38.36  ? 113 THR E O   1 
ATOM   4882 C  CB  . THR E  1 118 ? -7.340  21.150  -41.592 1.00 34.67  ? 113 THR E CB  1 
ATOM   4883 O  OG1 . THR E  1 118 ? -8.329  22.178  -41.451 1.00 29.71  ? 113 THR E OG1 1 
ATOM   4884 C  CG2 . THR E  1 118 ? -6.209  21.655  -42.480 1.00 32.61  ? 113 THR E CG2 1 
ATOM   4885 N  N   . GLY E  1 119 ? -10.372 19.789  -41.736 1.00 29.18  ? 114 GLY E N   1 
ATOM   4886 C  CA  . GLY E  1 119 ? -11.549 19.561  -40.922 1.00 29.46  ? 114 GLY E CA  1 
ATOM   4887 C  C   . GLY E  1 119 ? -11.977 20.843  -40.233 1.00 31.39  ? 114 GLY E C   1 
ATOM   4888 O  O   . GLY E  1 119 ? -13.059 20.917  -39.650 1.00 30.15  ? 114 GLY E O   1 
ATOM   4889 N  N   . ALA E  1 120 ? -11.115 21.854  -40.296 1.00 25.27  ? 115 ALA E N   1 
ATOM   4890 C  CA  . ALA E  1 120 ? -11.427 23.163  -39.738 1.00 26.48  ? 115 ALA E CA  1 
ATOM   4891 C  C   . ALA E  1 120 ? -12.037 24.054  -40.811 1.00 21.99  ? 115 ALA E C   1 
ATOM   4892 O  O   . ALA E  1 120 ? -11.869 23.809  -42.006 1.00 26.37  ? 115 ALA E O   1 
ATOM   4893 C  CB  . ALA E  1 120 ? -10.175 23.811  -39.157 1.00 22.52  ? 115 ALA E CB  1 
ATOM   4894 N  N   . SER E  1 121 ? -12.753 25.087  -40.385 1.00 20.72  ? 116 SER E N   1 
ATOM   4895 C  CA  . SER E  1 121 ? -13.352 26.014  -41.334 1.00 28.58  ? 116 SER E CA  1 
ATOM   4896 C  C   . SER E  1 121 ? -13.256 27.451  -40.846 1.00 21.94  ? 116 SER E C   1 
ATOM   4897 O  O   . SER E  1 121 ? -13.141 27.709  -39.650 1.00 21.09  ? 116 SER E O   1 
ATOM   4898 C  CB  . SER E  1 121 ? -14.806 25.642  -41.621 1.00 29.00  ? 116 SER E CB  1 
ATOM   4899 O  OG  . SER E  1 121 ? -15.590 25.713  -40.447 1.00 28.94  ? 116 SER E OG  1 
ATOM   4900 N  N   . LEU E  1 122 ? -13.298 28.382  -41.788 1.00 19.74  ? 117 LEU E N   1 
ATOM   4901 C  CA  . LEU E  1 122 ? -13.160 29.792  -41.476 1.00 20.79  ? 117 LEU E CA  1 
ATOM   4902 C  C   . LEU E  1 122 ? -14.333 30.579  -42.035 1.00 23.15  ? 117 LEU E C   1 
ATOM   4903 O  O   . LEU E  1 122 ? -14.666 30.459  -43.214 1.00 20.04  ? 117 LEU E O   1 
ATOM   4904 C  CB  . LEU E  1 122 ? -11.864 30.321  -42.063 1.00 21.50  ? 117 LEU E CB  1 
ATOM   4905 C  CG  . LEU E  1 122 ? -11.672 31.822  -41.911 1.00 27.67  ? 117 LEU E CG  1 
ATOM   4906 C  CD1 . LEU E  1 122 ? -11.350 32.192  -40.474 1.00 28.76  ? 117 LEU E CD1 1 
ATOM   4907 C  CD2 . LEU E  1 122 ? -10.571 32.219  -42.822 1.00 25.38  ? 117 LEU E CD2 1 
ATOM   4908 N  N   . VAL E  1 123 ? -14.963 31.375  -41.180 1.00 17.48  ? 118 VAL E N   1 
ATOM   4909 C  CA  . VAL E  1 123 ? -16.095 32.190  -41.596 1.00 21.42  ? 118 VAL E CA  1 
ATOM   4910 C  C   . VAL E  1 123 ? -15.702 33.657  -41.738 1.00 20.68  ? 118 VAL E C   1 
ATOM   4911 O  O   . VAL E  1 123 ? -15.148 34.265  -40.820 1.00 16.87  ? 118 VAL E O   1 
ATOM   4912 C  CB  . VAL E  1 123 ? -17.282 32.048  -40.627 1.00 19.26  ? 118 VAL E CB  1 
ATOM   4913 C  CG1 . VAL E  1 123 ? -18.385 33.039  -40.983 1.00 23.39  ? 118 VAL E CG1 1 
ATOM   4914 C  CG2 . VAL E  1 123 ? -17.808 30.625  -40.657 1.00 17.93  ? 118 VAL E CG2 1 
ATOM   4915 N  N   . LEU E  1 124 ? -15.983 34.217  -42.906 1.00 17.25  ? 119 LEU E N   1 
ATOM   4916 C  CA  . LEU E  1 124 ? -15.620 35.593  -43.195 1.00 16.97  ? 119 LEU E CA  1 
ATOM   4917 C  C   . LEU E  1 124 ? -16.588 36.201  -44.199 1.00 20.46  ? 119 LEU E C   1 
ATOM   4918 O  O   . LEU E  1 124 ? -17.239 35.486  -44.966 1.00 22.23  ? 119 LEU E O   1 
ATOM   4919 C  CB  . LEU E  1 124 ? -14.183 35.675  -43.730 1.00 22.50  ? 119 LEU E CB  1 
ATOM   4920 C  CG  . LEU E  1 124 ? -13.880 35.014  -45.078 1.00 21.79  ? 119 LEU E CG  1 
ATOM   4921 C  CD1 . LEU E  1 124 ? -12.710 35.705  -45.757 1.00 22.38  ? 119 LEU E CD1 1 
ATOM   4922 C  CD2 . LEU E  1 124 ? -13.584 33.533  -44.913 1.00 23.82  ? 119 LEU E CD2 1 
ATOM   4923 N  N   . GLN E  1 125 ? -16.691 37.523  -44.183 1.00 18.53  ? 120 GLN E N   1 
ATOM   4924 C  CA  . GLN E  1 125 ? -17.483 38.227  -45.178 1.00 19.84  ? 120 GLN E CA  1 
ATOM   4925 C  C   . GLN E  1 125 ? -16.622 39.298  -45.840 1.00 17.03  ? 120 GLN E C   1 
ATOM   4926 O  O   . GLN E  1 125 ? -15.735 39.884  -45.213 1.00 18.45  ? 120 GLN E O   1 
ATOM   4927 C  CB  . GLN E  1 125 ? -18.740 38.835  -44.553 1.00 17.45  ? 120 GLN E CB  1 
ATOM   4928 C  CG  . GLN E  1 125 ? -18.601 40.295  -44.179 1.00 36.35  ? 120 GLN E CG  1 
ATOM   4929 C  CD  . GLN E  1 125 ? -19.102 41.228  -45.260 1.00 25.68  ? 120 GLN E CD  1 
ATOM   4930 O  OE1 . GLN E  1 125 ? -18.569 42.317  -45.447 1.00 36.83  ? 120 GLN E OE1 1 
ATOM   4931 N  NE2 . GLN E  1 125 ? -20.134 40.804  -45.977 1.00 31.09  ? 120 GLN E NE2 1 
ATOM   4932 N  N   . VAL E  1 126 ? -16.880 39.536  -47.119 1.00 18.09  ? 121 VAL E N   1 
ATOM   4933 C  CA  . VAL E  1 126 ? -16.033 40.399  -47.927 1.00 21.36  ? 121 VAL E CA  1 
ATOM   4934 C  C   . VAL E  1 126 ? -16.907 41.295  -48.789 1.00 26.24  ? 121 VAL E C   1 
ATOM   4935 O  O   . VAL E  1 126 ? -17.944 40.860  -49.292 1.00 22.62  ? 121 VAL E O   1 
ATOM   4936 C  CB  . VAL E  1 126 ? -15.132 39.562  -48.864 1.00 21.91  ? 121 VAL E CB  1 
ATOM   4937 C  CG1 . VAL E  1 126 ? -14.218 40.460  -49.689 1.00 23.46  ? 121 VAL E CG1 1 
ATOM   4938 C  CG2 . VAL E  1 126 ? -14.324 38.546  -48.074 1.00 22.46  ? 121 VAL E CG2 1 
ATOM   4939 N  N   . SER E  1 127 ? -16.493 42.543  -48.966 1.00 21.41  ? 122 SER E N   1 
ATOM   4940 C  CA  . SER E  1 127 ? -17.218 43.433  -49.859 1.00 26.82  ? 122 SER E CA  1 
ATOM   4941 C  C   . SER E  1 127 ? -16.343 44.511  -50.490 1.00 25.75  ? 122 SER E C   1 
ATOM   4942 O  O   . SER E  1 127 ? -15.247 44.808  -50.010 1.00 25.19  ? 122 SER E O   1 
ATOM   4943 C  CB  . SER E  1 127 ? -18.385 44.085  -49.121 1.00 25.43  ? 122 SER E CB  1 
ATOM   4944 O  OG  . SER E  1 127 ? -17.932 44.966  -48.112 1.00 23.26  ? 122 SER E OG  1 
ATOM   4945 N  N   . TYR E  1 128 ? -16.836 45.079  -51.586 1.00 27.73  ? 123 TYR E N   1 
ATOM   4946 C  CA  . TYR E  1 128 ? -16.288 46.318  -52.116 1.00 30.27  ? 123 TYR E CA  1 
ATOM   4947 C  C   . TYR E  1 128 ? -17.182 47.431  -51.608 1.00 35.26  ? 123 TYR E C   1 
ATOM   4948 O  O   . TYR E  1 128 ? -18.400 47.374  -51.765 1.00 40.86  ? 123 TYR E O   1 
ATOM   4949 C  CB  . TYR E  1 128 ? -16.244 46.305  -53.647 1.00 36.88  ? 123 TYR E CB  1 
ATOM   4950 C  CG  . TYR E  1 128 ? -15.369 45.207  -54.198 1.00 47.82  ? 123 TYR E CG  1 
ATOM   4951 C  CD1 . TYR E  1 128 ? -15.885 43.941  -54.424 1.00 51.61  ? 123 TYR E CD1 1 
ATOM   4952 C  CD2 . TYR E  1 128 ? -14.024 45.428  -54.476 1.00 52.50  ? 123 TYR E CD2 1 
ATOM   4953 C  CE1 . TYR E  1 128 ? -15.101 42.931  -54.912 1.00 53.22  ? 123 TYR E CE1 1 
ATOM   4954 C  CE2 . TYR E  1 128 ? -13.226 44.411  -54.969 1.00 53.57  ? 123 TYR E CE2 1 
ATOM   4955 C  CZ  . TYR E  1 128 ? -13.780 43.163  -55.183 1.00 56.38  ? 123 TYR E CZ  1 
ATOM   4956 O  OH  . TYR E  1 128 ? -13.043 42.111  -55.660 1.00 65.69  ? 123 TYR E OH  1 
ATOM   4957 N  N   . THR E  1 129 ? -16.584 48.428  -50.969 1.00 38.66  ? 124 THR E N   1 
ATOM   4958 C  CA  . THR E  1 129 ? -17.359 49.510  -50.383 1.00 43.80  ? 124 THR E CA  1 
ATOM   4959 C  C   . THR E  1 129 ? -16.746 50.862  -50.713 1.00 47.63  ? 124 THR E C   1 
ATOM   4960 O  O   . THR E  1 129 ? -15.571 50.951  -51.074 1.00 34.80  ? 124 THR E O   1 
ATOM   4961 C  CB  . THR E  1 129 ? -17.479 49.358  -48.852 1.00 46.94  ? 124 THR E CB  1 
ATOM   4962 O  OG1 . THR E  1 129 ? -18.398 50.332  -48.341 1.00 51.40  ? 124 THR E OG1 1 
ATOM   4963 C  CG2 . THR E  1 129 ? -16.125 49.539  -48.185 1.00 43.30  ? 124 THR E CG2 1 
ATOM   4964 N  N   . ALA E  1 130 ? -17.555 51.909  -50.596 1.00 56.38  ? 125 ALA E N   1 
ATOM   4965 C  CA  . ALA E  1 130 ? -17.094 53.266  -50.852 1.00 63.01  ? 125 ALA E CA  1 
ATOM   4966 C  C   . ALA E  1 130 ? -16.229 53.760  -49.699 1.00 67.72  ? 125 ALA E C   1 
ATOM   4967 O  O   . ALA E  1 130 ? -15.065 54.108  -49.890 1.00 75.42  ? 125 ALA E O   1 
ATOM   4968 C  CB  . ALA E  1 130 ? -18.276 54.197  -51.068 1.00 65.65  ? 125 ALA E CB  1 
ATOM   4969 N  N   . PHE F  1 5   ? -9.054  8.926   -46.947 1.00 58.16  ? 0   PHE F N   1 
ATOM   4970 C  CA  . PHE F  1 5   ? -9.507  10.144  -47.611 1.00 58.09  ? 0   PHE F CA  1 
ATOM   4971 C  C   . PHE F  1 5   ? -9.865  9.858   -49.066 1.00 45.56  ? 0   PHE F C   1 
ATOM   4972 O  O   . PHE F  1 5   ? -8.992  9.579   -49.890 1.00 43.58  ? 0   PHE F O   1 
ATOM   4973 C  CB  . PHE F  1 5   ? -8.444  11.233  -47.489 1.00 68.51  ? 0   PHE F CB  1 
ATOM   4974 C  CG  . PHE F  1 5   ? -8.057  11.526  -46.068 1.00 78.87  ? 0   PHE F CG  1 
ATOM   4975 C  CD1 . PHE F  1 5   ? -9.024  11.576  -45.077 1.00 80.72  ? 0   PHE F CD1 1 
ATOM   4976 C  CD2 . PHE F  1 5   ? -6.732  11.722  -45.714 1.00 84.66  ? 0   PHE F CD2 1 
ATOM   4977 C  CE1 . PHE F  1 5   ? -8.682  11.833  -43.764 1.00 83.32  ? 0   PHE F CE1 1 
ATOM   4978 C  CE2 . PHE F  1 5   ? -6.383  11.979  -44.400 1.00 88.60  ? 0   PHE F CE2 1 
ATOM   4979 C  CZ  . PHE F  1 5   ? -7.361  12.035  -43.424 1.00 87.19  ? 0   PHE F CZ  1 
ATOM   4980 N  N   . MET F  1 6   ? -11.159 9.919   -49.364 1.00 38.51  ? 1   MET F N   1 
ATOM   4981 C  CA  . MET F  1 6   ? -11.682 9.474   -50.649 1.00 35.08  ? 1   MET F CA  1 
ATOM   4982 C  C   . MET F  1 6   ? -12.579 10.516  -51.294 1.00 31.57  ? 1   MET F C   1 
ATOM   4983 O  O   . MET F  1 6   ? -13.212 11.317  -50.608 1.00 31.32  ? 1   MET F O   1 
ATOM   4984 C  CB  . MET F  1 6   ? -12.517 8.207   -50.462 1.00 36.91  ? 1   MET F CB  1 
ATOM   4985 C  CG  . MET F  1 6   ? -12.018 7.255   -49.393 1.00 47.53  ? 1   MET F CG  1 
ATOM   4986 S  SD  . MET F  1 6   ? -11.473 5.692   -50.096 1.00 79.39  ? 1   MET F SD  1 
ATOM   4987 C  CE  . MET F  1 6   ? -9.945  6.192   -50.870 1.00 65.72  ? 1   MET F CE  1 
ATOM   4988 N  N   . LEU F  1 7   ? -12.633 10.492  -52.621 1.00 28.89  ? 2   LEU F N   1 
ATOM   4989 C  CA  . LEU F  1 7   ? -13.686 11.182  -53.341 1.00 26.21  ? 2   LEU F CA  1 
ATOM   4990 C  C   . LEU F  1 7   ? -14.804 10.171  -53.537 1.00 29.19  ? 2   LEU F C   1 
ATOM   4991 O  O   . LEU F  1 7   ? -14.639 9.188   -54.260 1.00 25.45  ? 2   LEU F O   1 
ATOM   4992 C  CB  . LEU F  1 7   ? -13.196 11.685  -54.698 1.00 25.94  ? 2   LEU F CB  1 
ATOM   4993 C  CG  . LEU F  1 7   ? -14.211 12.565  -55.439 1.00 27.83  ? 2   LEU F CG  1 
ATOM   4994 C  CD1 . LEU F  1 7   ? -14.295 13.936  -54.777 1.00 30.88  ? 2   LEU F CD1 1 
ATOM   4995 C  CD2 . LEU F  1 7   ? -13.874 12.698  -56.915 1.00 32.75  ? 2   LEU F CD2 1 
ATOM   4996 N  N   . ARG F  1 8   ? -15.932 10.393  -52.873 1.00 23.97  ? 3   ARG F N   1 
ATOM   4997 C  CA  . ARG F  1 8   ? -17.062 9.481   -52.988 1.00 25.85  ? 3   ARG F CA  1 
ATOM   4998 C  C   . ARG F  1 8   ? -18.110 10.059  -53.929 1.00 28.31  ? 3   ARG F C   1 
ATOM   4999 O  O   . ARG F  1 8   ? -18.590 11.174  -53.730 1.00 20.32  ? 3   ARG F O   1 
ATOM   5000 C  CB  . ARG F  1 8   ? -17.673 9.205   -51.616 1.00 24.31  ? 3   ARG F CB  1 
ATOM   5001 C  CG  . ARG F  1 8   ? -18.728 8.117   -51.609 1.00 24.50  ? 3   ARG F CG  1 
ATOM   5002 C  CD  . ARG F  1 8   ? -19.194 7.850   -50.191 1.00 38.93  ? 3   ARG F CD  1 
ATOM   5003 N  NE  . ARG F  1 8   ? -19.557 9.093   -49.517 1.00 34.61  ? 3   ARG F NE  1 
ATOM   5004 C  CZ  . ARG F  1 8   ? -19.469 9.290   -48.206 1.00 27.67  ? 3   ARG F CZ  1 
ATOM   5005 N  NH1 . ARG F  1 8   ? -19.022 8.323   -47.413 1.00 30.25  ? 3   ARG F NH1 1 
ATOM   5006 N  NH2 . ARG F  1 8   ? -19.822 10.461  -47.691 1.00 28.24  ? 3   ARG F NH2 1 
ATOM   5007 N  N   . VAL F  1 9   ? -18.452 9.297   -54.961 1.00 20.53  ? 4   VAL F N   1 
ATOM   5008 C  CA  . VAL F  1 9   ? -19.402 9.752   -55.965 1.00 20.82  ? 4   VAL F CA  1 
ATOM   5009 C  C   . VAL F  1 9   ? -20.564 8.777   -56.085 1.00 23.71  ? 4   VAL F C   1 
ATOM   5010 O  O   . VAL F  1 9   ? -20.361 7.574   -56.250 1.00 20.61  ? 4   VAL F O   1 
ATOM   5011 C  CB  . VAL F  1 9   ? -18.731 9.904   -57.350 1.00 20.43  ? 4   VAL F CB  1 
ATOM   5012 C  CG1 . VAL F  1 9   ? -19.765 10.242  -58.422 1.00 17.44  ? 4   VAL F CG1 1 
ATOM   5013 C  CG2 . VAL F  1 9   ? -17.631 10.959  -57.304 1.00 21.40  ? 4   VAL F CG2 1 
ATOM   5014 N  N   . PHE F  1 10  ? -21.782 9.300   -55.984 1.00 20.56  ? 5   PHE F N   1 
ATOM   5015 C  CA  . PHE F  1 10  ? -22.971 8.515   -56.280 1.00 18.02  ? 5   PHE F CA  1 
ATOM   5016 C  C   . PHE F  1 10  ? -23.544 8.973   -57.610 1.00 20.12  ? 5   PHE F C   1 
ATOM   5017 O  O   . PHE F  1 10  ? -23.948 10.124  -57.760 1.00 19.56  ? 5   PHE F O   1 
ATOM   5018 C  CB  . PHE F  1 10  ? -24.029 8.665   -55.187 1.00 18.71  ? 5   PHE F CB  1 
ATOM   5019 C  CG  . PHE F  1 10  ? -23.585 8.172   -53.843 1.00 23.77  ? 5   PHE F CG  1 
ATOM   5020 C  CD1 . PHE F  1 10  ? -23.707 6.834   -53.507 1.00 24.48  ? 5   PHE F CD1 1 
ATOM   5021 C  CD2 . PHE F  1 10  ? -23.048 9.046   -52.914 1.00 20.59  ? 5   PHE F CD2 1 
ATOM   5022 C  CE1 . PHE F  1 10  ? -23.299 6.377   -52.270 1.00 24.84  ? 5   PHE F CE1 1 
ATOM   5023 C  CE2 . PHE F  1 10  ? -22.640 8.597   -51.676 1.00 23.31  ? 5   PHE F CE2 1 
ATOM   5024 C  CZ  . PHE F  1 10  ? -22.765 7.258   -51.354 1.00 26.62  ? 5   PHE F CZ  1 
ATOM   5025 N  N   A ILE F  1 11  ? -23.557 8.074   -58.582 0.52 22.93  ? 6   ILE F N   1 
ATOM   5026 N  N   B ILE F  1 11  ? -23.457 8.074   -58.582 0.48 22.92  ? 6   ILE F N   1 
ATOM   5027 C  CA  A ILE F  1 11  ? -24.230 8.347   -59.837 0.52 21.54  ? 6   ILE F CA  1 
ATOM   5028 C  CA  B ILE F  1 11  ? -24.130 8.347   -59.837 0.48 22.09  ? 6   ILE F CA  1 
ATOM   5029 C  C   A ILE F  1 11  ? -25.652 7.820   -59.698 0.52 20.00  ? 6   ILE F C   1 
ATOM   5030 C  C   B ILE F  1 11  ? -25.552 7.820   -59.698 0.48 20.39  ? 6   ILE F C   1 
ATOM   5031 O  O   A ILE F  1 11  ? -25.881 6.613   -59.687 0.52 19.61  ? 6   ILE F O   1 
ATOM   5032 O  O   B ILE F  1 11  ? -25.781 6.613   -59.687 0.48 20.32  ? 6   ILE F O   1 
ATOM   5033 C  CB  A ILE F  1 11  ? -23.497 7.695   -61.016 0.52 24.31  ? 6   ILE F CB  1 
ATOM   5034 C  CB  B ILE F  1 11  ? -23.397 7.695   -61.016 0.48 23.81  ? 6   ILE F CB  1 
ATOM   5035 C  CG1 A ILE F  1 11  ? -22.083 8.274   -61.125 0.52 21.96  ? 6   ILE F CG1 1 
ATOM   5036 C  CG1 B ILE F  1 11  ? -21.947 8.188   -61.056 0.48 21.10  ? 6   ILE F CG1 1 
ATOM   5037 C  CG2 A ILE F  1 11  ? -24.274 7.904   -62.312 0.52 25.05  ? 6   ILE F CG2 1 
ATOM   5038 C  CG2 B ILE F  1 11  ? -24.114 8.000   -62.328 0.48 24.94  ? 6   ILE F CG2 1 
ATOM   5039 C  CD1 A ILE F  1 11  ? -21.171 7.491   -62.036 0.52 22.49  ? 6   ILE F CD1 1 
ATOM   5040 C  CD1 B ILE F  1 11  ? -21.815 9.684   -61.196 0.48 16.26  ? 6   ILE F CD1 1 
ATOM   5041 N  N   . LEU F  1 12  ? -26.601 8.738   -59.558 1.00 18.94  ? 7   LEU F N   1 
ATOM   5042 C  CA  . LEU F  1 12  ? -27.963 8.369   -59.193 1.00 17.83  ? 7   LEU F CA  1 
ATOM   5043 C  C   . LEU F  1 12  ? -28.804 7.949   -60.393 1.00 20.92  ? 7   LEU F C   1 
ATOM   5044 O  O   . LEU F  1 12  ? -29.253 6.806   -60.471 1.00 19.23  ? 7   LEU F O   1 
ATOM   5045 C  CB  . LEU F  1 12  ? -28.633 9.511   -58.428 1.00 20.24  ? 7   LEU F CB  1 
ATOM   5046 C  CG  . LEU F  1 12  ? -27.895 9.886   -57.139 1.00 18.22  ? 7   LEU F CG  1 
ATOM   5047 C  CD1 . LEU F  1 12  ? -28.623 10.982  -56.384 1.00 20.31  ? 7   LEU F CD1 1 
ATOM   5048 C  CD2 . LEU F  1 12  ? -27.708 8.655   -56.263 1.00 19.24  ? 7   LEU F CD2 1 
ATOM   5049 N  N   . TYR F  1 13  ? -29.009 8.871   -61.326 1.00 17.78  ? 8   TYR F N   1 
ATOM   5050 C  CA  . TYR F  1 13  ? -29.823 8.582   -62.495 1.00 21.07  ? 8   TYR F CA  1 
ATOM   5051 C  C   . TYR F  1 13  ? -29.610 9.607   -63.599 1.00 18.17  ? 8   TYR F C   1 
ATOM   5052 O  O   . TYR F  1 13  ? -29.031 10.669  -63.375 1.00 23.09  ? 8   TYR F O   1 
ATOM   5053 C  CB  . TYR F  1 13  ? -31.306 8.533   -62.115 1.00 19.96  ? 8   TYR F CB  1 
ATOM   5054 C  CG  . TYR F  1 13  ? -31.846 9.830   -61.548 1.00 20.43  ? 8   TYR F CG  1 
ATOM   5055 C  CD1 . TYR F  1 13  ? -32.358 10.814  -62.381 1.00 21.09  ? 8   TYR F CD1 1 
ATOM   5056 C  CD2 . TYR F  1 13  ? -31.850 10.066  -60.175 1.00 21.81  ? 8   TYR F CD2 1 
ATOM   5057 C  CE1 . TYR F  1 13  ? -32.856 11.995  -61.871 1.00 22.11  ? 8   TYR F CE1 1 
ATOM   5058 C  CE2 . TYR F  1 13  ? -32.345 11.251  -59.652 1.00 21.60  ? 8   TYR F CE2 1 
ATOM   5059 C  CZ  . TYR F  1 13  ? -32.849 12.211  -60.510 1.00 22.91  ? 8   TYR F CZ  1 
ATOM   5060 O  OH  . TYR F  1 13  ? -33.352 13.393  -60.014 1.00 23.78  ? 8   TYR F OH  1 
ATOM   5061 N  N   . ALA F  1 14  ? -30.089 9.273   -64.790 1.00 19.86  ? 9   ALA F N   1 
ATOM   5062 C  CA  . ALA F  1 14  ? -30.124 10.212  -65.900 1.00 23.63  ? 9   ALA F CA  1 
ATOM   5063 C  C   . ALA F  1 14  ? -31.570 10.370  -66.346 1.00 22.65  ? 9   ALA F C   1 
ATOM   5064 O  O   . ALA F  1 14  ? -32.363 9.440   -66.220 1.00 21.82  ? 9   ALA F O   1 
ATOM   5065 C  CB  . ALA F  1 14  ? -29.264 9.714   -67.043 1.00 19.35  ? 9   ALA F CB  1 
ATOM   5066 N  N   . GLU F  1 15  ? -31.917 11.547  -66.852 1.00 22.76  ? 10  GLU F N   1 
ATOM   5067 C  CA  . GLU F  1 15  ? -33.269 11.785  -67.338 1.00 31.84  ? 10  GLU F CA  1 
ATOM   5068 C  C   . GLU F  1 15  ? -33.261 12.126  -68.819 1.00 31.07  ? 10  GLU F C   1 
ATOM   5069 O  O   . GLU F  1 15  ? -32.296 12.700  -69.324 1.00 35.71  ? 10  GLU F O   1 
ATOM   5070 C  CB  . GLU F  1 15  ? -33.952 12.898  -66.541 1.00 33.91  ? 10  GLU F CB  1 
ATOM   5071 C  CG  . GLU F  1 15  ? -34.047 12.613  -65.054 1.00 50.67  ? 10  GLU F CG  1 
ATOM   5072 C  CD  . GLU F  1 15  ? -35.288 13.210  -64.425 1.00 65.65  ? 10  GLU F CD  1 
ATOM   5073 O  OE1 . GLU F  1 15  ? -35.503 14.431  -64.569 1.00 70.67  ? 10  GLU F OE1 1 
ATOM   5074 O  OE2 . GLU F  1 15  ? -36.057 12.450  -63.797 1.00 70.51  ? 10  GLU F OE2 1 
ATOM   5075 N  N   . ASN F  1 16  ? -34.338 11.754  -69.506 1.00 30.10  ? 11  ASN F N   1 
ATOM   5076 C  CA  . ASN F  1 16  ? -34.524 12.071  -70.920 1.00 29.56  ? 11  ASN F CA  1 
ATOM   5077 C  C   . ASN F  1 16  ? -33.403 11.592  -71.839 1.00 28.73  ? 11  ASN F C   1 
ATOM   5078 O  O   . ASN F  1 16  ? -33.028 12.293  -72.773 1.00 32.36  ? 11  ASN F O   1 
ATOM   5079 C  CB  . ASN F  1 16  ? -34.719 13.577  -71.115 1.00 34.40  ? 11  ASN F CB  1 
ATOM   5080 C  CG  . ASN F  1 16  ? -35.796 14.152  -70.217 1.00 48.21  ? 11  ASN F CG  1 
ATOM   5081 O  OD1 . ASN F  1 16  ? -35.537 15.060  -69.428 1.00 50.45  ? 11  ASN F OD1 1 
ATOM   5082 N  ND2 . ASN F  1 16  ? -37.013 13.632  -70.337 1.00 57.49  ? 11  ASN F ND2 1 
ATOM   5083 N  N   . VAL F  1 17  ? -32.862 10.407  -71.582 1.00 27.07  ? 12  VAL F N   1 
ATOM   5084 C  CA  . VAL F  1 17  ? -31.808 9.886   -72.448 1.00 35.44  ? 12  VAL F CA  1 
ATOM   5085 C  C   . VAL F  1 17  ? -32.381 9.081   -73.622 1.00 36.85  ? 12  VAL F C   1 
ATOM   5086 O  O   . VAL F  1 17  ? -33.091 8.087   -73.442 1.00 31.78  ? 12  VAL F O   1 
ATOM   5087 C  CB  . VAL F  1 17  ? -30.682 9.144   -71.659 1.00 32.91  ? 12  VAL F CB  1 
ATOM   5088 C  CG1 . VAL F  1 17  ? -31.020 9.047   -70.170 1.00 30.30  ? 12  VAL F CG1 1 
ATOM   5089 C  CG2 . VAL F  1 17  ? -30.353 7.783   -72.271 1.00 30.51  ? 12  VAL F CG2 1 
ATOM   5090 N  N   . HIS F  1 18  ? -32.088 9.565   -74.826 1.00 35.43  ? 13  HIS F N   1 
ATOM   5091 C  CA  . HIS F  1 18  ? -32.580 8.972   -76.063 1.00 41.00  ? 13  HIS F CA  1 
ATOM   5092 C  C   . HIS F  1 18  ? -31.424 8.730   -77.020 1.00 46.74  ? 13  HIS F C   1 
ATOM   5093 O  O   . HIS F  1 18  ? -30.868 9.667   -77.589 1.00 46.20  ? 13  HIS F O   1 
ATOM   5094 C  CB  . HIS F  1 18  ? -33.605 9.889   -76.731 1.00 43.30  ? 13  HIS F CB  1 
ATOM   5095 C  CG  . HIS F  1 18  ? -34.881 10.032  -75.961 1.00 46.70  ? 13  HIS F CG  1 
ATOM   5096 N  ND1 . HIS F  1 18  ? -35.209 11.180  -75.275 1.00 47.58  ? 13  HIS F ND1 1 
ATOM   5097 C  CD2 . HIS F  1 18  ? -35.907 9.170   -75.771 1.00 45.53  ? 13  HIS F CD2 1 
ATOM   5098 C  CE1 . HIS F  1 18  ? -36.386 11.020  -74.694 1.00 51.01  ? 13  HIS F CE1 1 
ATOM   5099 N  NE2 . HIS F  1 18  ? -36.830 9.810   -74.979 1.00 48.59  ? 13  HIS F NE2 1 
ATOM   5100 N  N   . THR F  1 19  ? -31.065 7.464   -77.188 1.00 47.84  ? 14  THR F N   1 
ATOM   5101 C  CA  . THR F  1 19  ? -29.980 7.069   -78.075 1.00 45.95  ? 14  THR F CA  1 
ATOM   5102 C  C   . THR F  1 19  ? -30.358 7.333   -79.541 1.00 55.35  ? 14  THR F C   1 
ATOM   5103 O  O   . THR F  1 19  ? -31.392 6.862   -80.013 1.00 62.89  ? 14  THR F O   1 
ATOM   5104 C  CB  . THR F  1 19  ? -29.624 5.593   -77.836 1.00 42.28  ? 14  THR F CB  1 
ATOM   5105 O  OG1 . THR F  1 19  ? -29.248 5.414   -76.464 1.00 38.15  ? 14  THR F OG1 1 
ATOM   5106 C  CG2 . THR F  1 19  ? -28.489 5.157   -78.719 1.00 43.95  ? 14  THR F CG2 1 
ATOM   5107 N  N   . PRO F  1 20  ? -29.517 8.107   -80.252 1.00 58.64  ? 15  PRO F N   1 
ATOM   5108 C  CA  . PRO F  1 20  ? -29.796 8.753   -81.549 1.00 60.80  ? 15  PRO F CA  1 
ATOM   5109 C  C   . PRO F  1 20  ? -30.468 7.912   -82.647 1.00 66.41  ? 15  PRO F C   1 
ATOM   5110 O  O   . PRO F  1 20  ? -31.554 8.284   -83.101 1.00 70.50  ? 15  PRO F O   1 
ATOM   5111 C  CB  . PRO F  1 20  ? -28.414 9.250   -82.012 1.00 58.42  ? 15  PRO F CB  1 
ATOM   5112 C  CG  . PRO F  1 20  ? -27.466 8.986   -80.880 1.00 57.72  ? 15  PRO F CG  1 
ATOM   5113 C  CD  . PRO F  1 20  ? -28.244 8.575   -79.680 1.00 55.45  ? 15  PRO F CD  1 
ATOM   5114 N  N   . ASP F  1 21  ? -29.839 6.824   -83.081 1.00 62.85  ? 16  ASP F N   1 
ATOM   5115 C  CA  . ASP F  1 21  ? -30.404 6.021   -84.168 1.00 60.48  ? 16  ASP F CA  1 
ATOM   5116 C  C   . ASP F  1 21  ? -30.842 4.623   -83.735 1.00 47.86  ? 16  ASP F C   1 
ATOM   5117 O  O   . ASP F  1 21  ? -30.582 3.628   -84.420 1.00 49.86  ? 16  ASP F O   1 
ATOM   5118 C  CB  . ASP F  1 21  ? -29.450 5.945   -85.362 1.00 67.24  ? 16  ASP F CB  1 
ATOM   5119 C  CG  . ASP F  1 21  ? -30.139 6.282   -86.674 1.00 80.77  ? 16  ASP F CG  1 
ATOM   5120 O  OD1 . ASP F  1 21  ? -30.498 7.464   -86.863 1.00 84.39  ? 16  ASP F OD1 1 
ATOM   5121 O  OD2 . ASP F  1 21  ? -30.320 5.374   -87.514 1.00 83.74  ? 16  ASP F OD2 1 
ATOM   5122 N  N   . THR F  1 22  ? -31.519 4.569   -82.592 1.00 45.31  ? 17  THR F N   1 
ATOM   5123 C  CA  . THR F  1 22  ? -32.137 3.346   -82.105 1.00 56.24  ? 17  THR F CA  1 
ATOM   5124 C  C   . THR F  1 22  ? -33.411 3.728   -81.355 1.00 44.09  ? 17  THR F C   1 
ATOM   5125 O  O   . THR F  1 22  ? -33.593 4.895   -81.002 1.00 44.90  ? 17  THR F O   1 
ATOM   5126 C  CB  . THR F  1 22  ? -31.190 2.564   -81.186 1.00 53.08  ? 17  THR F CB  1 
ATOM   5127 O  OG1 . THR F  1 22  ? -31.591 1.189   -81.124 1.00 59.44  ? 17  THR F OG1 1 
ATOM   5128 C  CG2 . THR F  1 22  ? -31.206 3.153   -79.804 1.00 39.49  ? 17  THR F CG2 1 
ATOM   5129 N  N   . ASP F  1 23  ? -34.287 2.758   -81.108 1.00 48.06  ? 18  ASP F N   1 
ATOM   5130 C  CA  . ASP F  1 23  ? -35.607 3.056   -80.549 1.00 45.08  ? 18  ASP F CA  1 
ATOM   5131 C  C   . ASP F  1 23  ? -35.637 3.134   -79.021 1.00 42.14  ? 18  ASP F C   1 
ATOM   5132 O  O   . ASP F  1 23  ? -36.440 3.866   -78.444 1.00 41.87  ? 18  ASP F O   1 
ATOM   5133 C  CB  . ASP F  1 23  ? -36.652 2.057   -81.058 1.00 48.10  ? 18  ASP F CB  1 
ATOM   5134 C  CG  . ASP F  1 23  ? -36.349 0.627   -80.650 1.00 48.03  ? 18  ASP F CG  1 
ATOM   5135 O  OD1 . ASP F  1 23  ? -35.161 0.244   -80.624 1.00 46.89  ? 18  ASP F OD1 1 
ATOM   5136 O  OD2 . ASP F  1 23  ? -37.309 -0.119  -80.365 1.00 53.98  ? 18  ASP F OD2 1 
ATOM   5137 N  N   . ILE F  1 24  ? -34.775 2.367   -78.365 1.00 40.40  ? 19  ILE F N   1 
ATOM   5138 C  CA  . ILE F  1 24  ? -34.713 2.386   -76.907 1.00 41.08  ? 19  ILE F CA  1 
ATOM   5139 C  C   . ILE F  1 24  ? -33.283 2.601   -76.409 1.00 38.65  ? 19  ILE F C   1 
ATOM   5140 O  O   . ILE F  1 24  ? -32.330 2.465   -77.163 1.00 39.24  ? 19  ILE F O   1 
ATOM   5141 C  CB  . ILE F  1 24  ? -35.281 1.087   -76.300 1.00 50.25  ? 19  ILE F CB  1 
ATOM   5142 C  CG1 . ILE F  1 24  ? -34.491 -0.118  -76.803 1.00 51.31  ? 19  ILE F CG1 1 
ATOM   5143 C  CG2 . ILE F  1 24  ? -36.758 0.930   -76.644 1.00 55.46  ? 19  ILE F CG2 1 
ATOM   5144 C  CD1 . ILE F  1 24  ? -34.173 -1.132  -75.731 1.00 51.64  ? 19  ILE F CD1 1 
ATOM   5145 N  N   . SER F  1 25  ? -33.127 2.935   -75.136 1.00 37.11  ? 20  SER F N   1 
ATOM   5146 C  CA  . SER F  1 25  ? -31.793 3.184   -74.614 1.00 33.11  ? 20  SER F CA  1 
ATOM   5147 C  C   . SER F  1 25  ? -31.391 2.139   -73.580 1.00 33.80  ? 20  SER F C   1 
ATOM   5148 O  O   . SER F  1 25  ? -32.149 1.848   -72.656 1.00 37.85  ? 20  SER F O   1 
ATOM   5149 C  CB  . SER F  1 25  ? -31.706 4.589   -74.010 1.00 32.50  ? 20  SER F CB  1 
ATOM   5150 O  OG  . SER F  1 25  ? -32.420 5.523   -74.805 1.00 39.37  ? 20  SER F OG  1 
ATOM   5151 N  N   . ASP F  1 26  ? -30.202 1.569   -73.753 1.00 35.70  ? 21  ASP F N   1 
ATOM   5152 C  CA  . ASP F  1 26  ? -29.590 0.726   -72.732 1.00 33.90  ? 21  ASP F CA  1 
ATOM   5153 C  C   . ASP F  1 26  ? -28.366 1.469   -72.207 1.00 33.14  ? 21  ASP F C   1 
ATOM   5154 O  O   . ASP F  1 26  ? -27.246 1.229   -72.657 1.00 30.89  ? 21  ASP F O   1 
ATOM   5155 C  CB  . ASP F  1 26  ? -29.169 -0.619  -73.322 1.00 36.23  ? 21  ASP F CB  1 
ATOM   5156 C  CG  . ASP F  1 26  ? -30.326 -1.366  -73.964 1.00 40.73  ? 21  ASP F CG  1 
ATOM   5157 O  OD1 . ASP F  1 26  ? -31.421 -1.405  -73.361 1.00 39.95  ? 21  ASP F OD1 1 
ATOM   5158 O  OD2 . ASP F  1 26  ? -30.142 -1.909  -75.074 1.00 46.04  ? 21  ASP F OD2 1 
ATOM   5159 N  N   . ALA F  1 27  ? -28.585 2.374   -71.260 1.00 26.30  ? 22  ALA F N   1 
ATOM   5160 C  CA  . ALA F  1 27  ? -27.551 3.321   -70.866 1.00 24.66  ? 22  ALA F CA  1 
ATOM   5161 C  C   . ALA F  1 27  ? -26.701 2.865   -69.685 1.00 27.14  ? 22  ALA F C   1 
ATOM   5162 O  O   . ALA F  1 27  ? -27.174 2.167   -68.787 1.00 24.28  ? 22  ALA F O   1 
ATOM   5163 C  CB  . ALA F  1 27  ? -28.168 4.690   -70.572 1.00 23.33  ? 22  ALA F CB  1 
ATOM   5164 N  N   . TYR F  1 28  ? -25.433 3.255   -69.714 1.00 28.62  ? 23  TYR F N   1 
ATOM   5165 C  CA  . TYR F  1 28  ? -24.579 3.175   -68.538 1.00 26.03  ? 23  TYR F CA  1 
ATOM   5166 C  C   . TYR F  1 28  ? -23.733 4.433   -68.483 1.00 25.89  ? 23  TYR F C   1 
ATOM   5167 O  O   . TYR F  1 28  ? -23.538 5.104   -69.498 1.00 26.75  ? 23  TYR F O   1 
ATOM   5168 C  CB  . TYR F  1 28  ? -23.699 1.927   -68.554 1.00 27.29  ? 23  TYR F CB  1 
ATOM   5169 C  CG  . TYR F  1 28  ? -22.623 1.918   -69.616 1.00 36.10  ? 23  TYR F CG  1 
ATOM   5170 C  CD1 . TYR F  1 28  ? -22.926 1.627   -70.939 1.00 34.64  ? 23  TYR F CD1 1 
ATOM   5171 C  CD2 . TYR F  1 28  ? -21.297 2.179   -69.290 1.00 37.08  ? 23  TYR F CD2 1 
ATOM   5172 C  CE1 . TYR F  1 28  ? -21.944 1.609   -71.908 1.00 41.97  ? 23  TYR F CE1 1 
ATOM   5173 C  CE2 . TYR F  1 28  ? -20.306 2.161   -70.255 1.00 38.65  ? 23  TYR F CE2 1 
ATOM   5174 C  CZ  . TYR F  1 28  ? -20.635 1.874   -71.562 1.00 45.98  ? 23  TYR F CZ  1 
ATOM   5175 O  OH  . TYR F  1 28  ? -19.655 1.855   -72.529 1.00 52.28  ? 23  TYR F OH  1 
ATOM   5176 N  N   . CYS F  1 29  ? -23.240 4.760   -67.297 1.00 25.26  ? 24  CYS F N   1 
ATOM   5177 C  CA  . CYS F  1 29  ? -22.480 5.987   -67.116 1.00 28.39  ? 24  CYS F CA  1 
ATOM   5178 C  C   . CYS F  1 29  ? -21.022 5.685   -66.820 1.00 31.58  ? 24  CYS F C   1 
ATOM   5179 O  O   . CYS F  1 29  ? -20.706 4.853   -65.972 1.00 38.37  ? 24  CYS F O   1 
ATOM   5180 C  CB  . CYS F  1 29  ? -23.085 6.836   -65.997 1.00 30.72  ? 24  CYS F CB  1 
ATOM   5181 S  SG  . CYS F  1 29  ? -22.189 8.378   -65.676 1.00 44.61  ? 24  CYS F SG  1 
ATOM   5182 N  N   . SER F  1 30  ? -20.135 6.359   -67.540 1.00 31.52  ? 25  SER F N   1 
ATOM   5183 C  CA  . SER F  1 30  ? -18.710 6.233   -67.298 1.00 34.45  ? 25  SER F CA  1 
ATOM   5184 C  C   . SER F  1 30  ? -18.220 7.482   -66.581 1.00 35.13  ? 25  SER F C   1 
ATOM   5185 O  O   . SER F  1 30  ? -18.557 8.600   -66.969 1.00 37.83  ? 25  SER F O   1 
ATOM   5186 C  CB  . SER F  1 30  ? -17.956 6.048   -68.611 1.00 36.70  ? 25  SER F CB  1 
ATOM   5187 O  OG  . SER F  1 30  ? -16.584 5.807   -68.368 1.00 45.61  ? 25  SER F OG  1 
ATOM   5188 N  N   . ALA F  1 31  ? -17.434 7.289   -65.529 1.00 32.78  ? 26  ALA F N   1 
ATOM   5189 C  CA  . ALA F  1 31  ? -16.920 8.409   -64.752 1.00 31.69  ? 26  ALA F CA  1 
ATOM   5190 C  C   . ALA F  1 31  ? -15.398 8.357   -64.655 1.00 34.21  ? 26  ALA F C   1 
ATOM   5191 O  O   . ALA F  1 31  ? -14.819 7.313   -64.352 1.00 31.97  ? 26  ALA F O   1 
ATOM   5192 C  CB  . ALA F  1 31  ? -17.548 8.425   -63.368 1.00 20.77  ? 26  ALA F CB  1 
ATOM   5193 N  N   . VAL F  1 32  ? -14.753 9.488   -64.919 1.00 36.23  ? 27  VAL F N   1 
ATOM   5194 C  CA  . VAL F  1 32  ? -13.299 9.553   -64.872 1.00 38.74  ? 27  VAL F CA  1 
ATOM   5195 C  C   . VAL F  1 32  ? -12.809 10.647  -63.933 1.00 33.09  ? 27  VAL F C   1 
ATOM   5196 O  O   . VAL F  1 32  ? -13.155 11.820  -64.089 1.00 30.79  ? 27  VAL F O   1 
ATOM   5197 C  CB  . VAL F  1 32  ? -12.691 9.777   -66.271 1.00 40.54  ? 27  VAL F CB  1 
ATOM   5198 C  CG1 . VAL F  1 32  ? -11.176 9.910   -66.177 1.00 45.27  ? 27  VAL F CG1 1 
ATOM   5199 C  CG2 . VAL F  1 32  ? -13.074 8.640   -67.205 1.00 42.88  ? 27  VAL F CG2 1 
ATOM   5200 N  N   . PHE F  1 33  ? -12.014 10.243  -62.948 1.00 35.31  ? 28  PHE F N   1 
ATOM   5201 C  CA  . PHE F  1 33  ? -11.355 11.176  -62.045 1.00 39.31  ? 28  PHE F CA  1 
ATOM   5202 C  C   . PHE F  1 33  ? -9.942  10.698  -61.742 1.00 42.25  ? 28  PHE F C   1 
ATOM   5203 O  O   . PHE F  1 33  ? -9.702  9.497   -61.614 1.00 39.83  ? 28  PHE F O   1 
ATOM   5204 C  CB  . PHE F  1 33  ? -12.136 11.328  -60.741 1.00 37.54  ? 28  PHE F CB  1 
ATOM   5205 C  CG  . PHE F  1 33  ? -11.484 12.258  -59.760 1.00 38.52  ? 28  PHE F CG  1 
ATOM   5206 C  CD1 . PHE F  1 33  ? -11.456 13.620  -59.999 1.00 33.26  ? 28  PHE F CD1 1 
ATOM   5207 C  CD2 . PHE F  1 33  ? -10.887 11.772  -58.608 1.00 34.45  ? 28  PHE F CD2 1 
ATOM   5208 C  CE1 . PHE F  1 33  ? -10.848 14.480  -59.108 1.00 35.93  ? 28  PHE F CE1 1 
ATOM   5209 C  CE2 . PHE F  1 33  ? -10.281 12.632  -57.710 1.00 36.12  ? 28  PHE F CE2 1 
ATOM   5210 C  CZ  . PHE F  1 33  ? -10.265 13.988  -57.961 1.00 37.78  ? 28  PHE F CZ  1 
ATOM   5211 N  N   . ALA F  1 34  ? -9.013  11.646  -61.635 1.00 44.58  ? 29  ALA F N   1 
ATOM   5212 C  CA  . ALA F  1 34  ? -7.613  11.346  -61.338 1.00 38.28  ? 29  ALA F CA  1 
ATOM   5213 C  C   . ALA F  1 34  ? -7.029  10.270  -62.254 1.00 40.83  ? 29  ALA F C   1 
ATOM   5214 O  O   . ALA F  1 34  ? -6.182  9.483   -61.836 1.00 50.38  ? 29  ALA F O   1 
ATOM   5215 C  CB  . ALA F  1 34  ? -7.452  10.950  -59.876 1.00 38.29  ? 29  ALA F CB  1 
ATOM   5216 N  N   . GLY F  1 35  ? -7.497  10.236  -63.498 1.00 40.33  ? 30  GLY F N   1 
ATOM   5217 C  CA  . GLY F  1 35  ? -7.019  9.274   -64.474 1.00 42.96  ? 30  GLY F CA  1 
ATOM   5218 C  C   . GLY F  1 35  ? -7.567  7.869   -64.295 1.00 45.41  ? 30  GLY F C   1 
ATOM   5219 O  O   . GLY F  1 35  ? -7.170  6.949   -65.009 1.00 45.96  ? 30  GLY F O   1 
ATOM   5220 N  N   . VAL F  1 36  ? -8.476  7.696   -63.341 1.00 42.52  ? 31  VAL F N   1 
ATOM   5221 C  CA  . VAL F  1 36  ? -9.075  6.387   -63.096 1.00 38.68  ? 31  VAL F CA  1 
ATOM   5222 C  C   . VAL F  1 36  ? -10.534 6.337   -63.539 1.00 44.52  ? 31  VAL F C   1 
ATOM   5223 O  O   . VAL F  1 36  ? -11.375 7.089   -63.043 1.00 38.29  ? 31  VAL F O   1 
ATOM   5224 C  CB  . VAL F  1 36  ? -8.974  5.974   -61.615 1.00 38.86  ? 31  VAL F CB  1 
ATOM   5225 C  CG1 . VAL F  1 36  ? -9.695  4.655   -61.388 1.00 38.74  ? 31  VAL F CG1 1 
ATOM   5226 C  CG2 . VAL F  1 36  ? -7.515  5.871   -61.191 1.00 42.90  ? 31  VAL F CG2 1 
ATOM   5227 N  N   . LYS F  1 37  ? -10.825 5.438   -64.474 1.00 45.15  ? 32  LYS F N   1 
ATOM   5228 C  CA  . LYS F  1 37  ? -12.170 5.298   -65.020 1.00 41.19  ? 32  LYS F CA  1 
ATOM   5229 C  C   . LYS F  1 37  ? -12.974 4.191   -64.340 1.00 39.16  ? 32  LYS F C   1 
ATOM   5230 O  O   . LYS F  1 37  ? -12.518 3.055   -64.219 1.00 40.31  ? 32  LYS F O   1 
ATOM   5231 C  CB  . LYS F  1 37  ? -12.108 5.056   -66.531 1.00 43.94  ? 32  LYS F CB  1 
ATOM   5232 C  CG  . LYS F  1 37  ? -13.400 4.538   -67.146 1.00 47.85  ? 32  LYS F CG  1 
ATOM   5233 C  CD  . LYS F  1 37  ? -13.389 4.719   -68.659 1.00 59.25  ? 32  LYS F CD  1 
ATOM   5234 C  CE  . LYS F  1 37  ? -14.381 3.798   -69.353 1.00 67.65  ? 32  LYS F CE  1 
ATOM   5235 N  NZ  . LYS F  1 37  ? -14.572 4.171   -70.785 1.00 71.91  ? 32  LYS F NZ  1 
ATOM   5236 N  N   . LYS F  1 38  ? -14.174 4.545   -63.893 1.00 38.45  ? 33  LYS F N   1 
ATOM   5237 C  CA  . LYS F  1 38  ? -15.099 3.590   -63.302 1.00 34.36  ? 33  LYS F CA  1 
ATOM   5238 C  C   . LYS F  1 38  ? -16.414 3.676   -64.063 1.00 34.50  ? 33  LYS F C   1 
ATOM   5239 O  O   . LYS F  1 38  ? -16.693 4.685   -64.710 1.00 38.68  ? 33  LYS F O   1 
ATOM   5240 C  CB  . LYS F  1 38  ? -15.314 3.906   -61.821 1.00 37.25  ? 33  LYS F CB  1 
ATOM   5241 C  CG  . LYS F  1 38  ? -14.041 3.830   -60.981 1.00 37.62  ? 33  LYS F CG  1 
ATOM   5242 C  CD  . LYS F  1 38  ? -14.247 4.406   -59.588 1.00 29.34  ? 33  LYS F CD  1 
ATOM   5243 C  CE  . LYS F  1 38  ? -12.963 4.366   -58.776 1.00 34.37  ? 33  LYS F CE  1 
ATOM   5244 N  NZ  . LYS F  1 38  ? -12.612 2.981   -58.361 1.00 36.28  ? 33  LYS F NZ  1 
ATOM   5245 N  N   . ARG F  1 39  ? -17.222 2.623   -64.000 1.00 31.24  ? 34  ARG F N   1 
ATOM   5246 C  CA  . ARG F  1 39  ? -18.479 2.612   -64.743 1.00 37.18  ? 34  ARG F CA  1 
ATOM   5247 C  C   . ARG F  1 39  ? -19.627 1.949   -63.991 1.00 32.04  ? 34  ARG F C   1 
ATOM   5248 O  O   . ARG F  1 39  ? -19.420 1.054   -63.173 1.00 31.96  ? 34  ARG F O   1 
ATOM   5249 C  CB  . ARG F  1 39  ? -18.293 1.952   -66.113 1.00 38.13  ? 34  ARG F CB  1 
ATOM   5250 C  CG  . ARG F  1 39  ? -17.747 0.539   -66.049 1.00 48.56  ? 34  ARG F CG  1 
ATOM   5251 C  CD  . ARG F  1 39  ? -17.657 -0.096  -67.429 1.00 60.55  ? 34  ARG F CD  1 
ATOM   5252 N  NE  . ARG F  1 39  ? -18.959 -0.201  -68.083 1.00 65.89  ? 34  ARG F NE  1 
ATOM   5253 C  CZ  . ARG F  1 39  ? -19.891 -1.093  -67.758 1.00 67.37  ? 34  ARG F CZ  1 
ATOM   5254 N  NH1 . ARG F  1 39  ? -19.675 -1.954  -66.773 1.00 71.83  ? 34  ARG F NH1 1 
ATOM   5255 N  NH2 . ARG F  1 39  ? -21.045 -1.118  -68.411 1.00 62.81  ? 34  ARG F NH2 1 
ATOM   5256 N  N   . THR F  1 40  ? -20.840 2.406   -64.278 1.00 26.61  ? 35  THR F N   1 
ATOM   5257 C  CA  . THR F  1 40  ? -22.044 1.828   -63.702 1.00 29.65  ? 35  THR F CA  1 
ATOM   5258 C  C   . THR F  1 40  ? -22.461 0.609   -64.510 1.00 35.02  ? 35  THR F C   1 
ATOM   5259 O  O   . THR F  1 40  ? -21.847 0.288   -65.525 1.00 31.51  ? 35  THR F O   1 
ATOM   5260 C  CB  . THR F  1 40  ? -23.218 2.816   -63.757 1.00 27.59  ? 35  THR F CB  1 
ATOM   5261 O  OG1 . THR F  1 40  ? -23.629 2.985   -65.121 1.00 26.33  ? 35  THR F OG1 1 
ATOM   5262 C  CG2 . THR F  1 40  ? -22.821 4.165   -63.175 1.00 20.28  ? 35  THR F CG2 1 
ATOM   5263 N  N   . LYS F  1 41  ? -23.518 -0.059  -64.063 1.00 26.85  ? 36  LYS F N   1 
ATOM   5264 C  CA  . LYS F  1 41  ? -24.126 -1.115  -64.854 1.00 28.84  ? 36  LYS F CA  1 
ATOM   5265 C  C   . LYS F  1 41  ? -24.999 -0.485  -65.939 1.00 28.67  ? 36  LYS F C   1 
ATOM   5266 O  O   . LYS F  1 41  ? -25.210 0.719   -65.956 1.00 27.80  ? 36  LYS F O   1 
ATOM   5267 C  CB  . LYS F  1 41  ? -24.950 -2.050  -63.966 1.00 44.40  ? 36  LYS F CB  1 
ATOM   5268 C  CG  . LYS F  1 41  ? -26.121 -1.389  -63.243 1.00 46.48  ? 36  LYS F CG  1 
ATOM   5269 C  CD  . LYS F  1 41  ? -26.578 -2.236  -62.052 1.00 54.08  ? 36  LYS F CD  1 
ATOM   5270 C  CE  . LYS F  1 41  ? -27.791 -1.636  -61.352 1.00 52.18  ? 36  LYS F CE  1 
ATOM   5271 N  NZ  . LYS F  1 41  ? -27.470 -0.357  -60.658 1.00 48.32  ? 36  LYS F NZ  1 
ATOM   5272 N  N   . VAL F  1 42  ? -25.487 -1.309  -66.855 1.00 34.46  ? 37  VAL F N   1 
ATOM   5273 C  CA  . VAL F  1 42  ? -26.416 -0.863  -67.882 1.00 36.63  ? 37  VAL F CA  1 
ATOM   5274 C  C   . VAL F  1 42  ? -27.836 -1.101  -67.408 1.00 33.42  ? 37  VAL F C   1 
ATOM   5275 O  O   . VAL F  1 42  ? -28.135 -2.134  -66.820 1.00 31.12  ? 37  VAL F O   1 
ATOM   5276 C  CB  . VAL F  1 42  ? -26.189 -1.613  -69.215 1.00 45.39  ? 37  VAL F CB  1 
ATOM   5277 C  CG1 . VAL F  1 42  ? -27.452 -1.628  -70.064 1.00 48.73  ? 37  VAL F CG1 1 
ATOM   5278 C  CG2 . VAL F  1 42  ? -25.039 -0.989  -69.974 1.00 50.76  ? 37  VAL F CG2 1 
ATOM   5279 N  N   . ILE F  1 43  ? -28.702 -0.124  -67.636 1.00 31.62  ? 38  ILE F N   1 
ATOM   5280 C  CA  . ILE F  1 43  ? -30.115 -0.290  -67.369 1.00 31.91  ? 38  ILE F CA  1 
ATOM   5281 C  C   . ILE F  1 43  ? -30.778 -0.589  -68.701 1.00 35.77  ? 38  ILE F C   1 
ATOM   5282 O  O   . ILE F  1 43  ? -30.668 0.195   -69.644 1.00 35.30  ? 38  ILE F O   1 
ATOM   5283 C  CB  . ILE F  1 43  ? -30.717 0.988   -66.763 1.00 32.25  ? 38  ILE F CB  1 
ATOM   5284 C  CG1 . ILE F  1 43  ? -29.932 1.398   -65.514 1.00 25.24  ? 38  ILE F CG1 1 
ATOM   5285 C  CG2 . ILE F  1 43  ? -32.189 0.783   -66.442 1.00 32.88  ? 38  ILE F CG2 1 
ATOM   5286 C  CD1 . ILE F  1 43  ? -30.030 0.406   -64.378 1.00 26.90  ? 38  ILE F CD1 1 
ATOM   5287 N  N   . LYS F  1 44  ? -31.440 -1.736  -68.792 1.00 32.56  ? 39  LYS F N   1 
ATOM   5288 C  CA  . LYS F  1 44  ? -32.077 -2.133  -70.041 1.00 34.42  ? 39  LYS F CA  1 
ATOM   5289 C  C   . LYS F  1 44  ? -33.343 -1.325  -70.294 1.00 34.24  ? 39  LYS F C   1 
ATOM   5290 O  O   . LYS F  1 44  ? -34.159 -1.141  -69.393 1.00 38.58  ? 39  LYS F O   1 
ATOM   5291 C  CB  . LYS F  1 44  ? -32.375 -3.638  -70.048 1.00 63.23  ? 39  LYS F CB  1 
ATOM   5292 C  CG  . LYS F  1 44  ? -33.017 -4.163  -68.770 1.00 68.18  ? 39  LYS F CG  1 
ATOM   5293 C  CD  . LYS F  1 44  ? -34.535 -4.148  -68.853 1.00 70.82  ? 39  LYS F CD  1 
ATOM   5294 C  CE  . LYS F  1 44  ? -35.166 -4.088  -67.472 1.00 69.48  ? 39  LYS F CE  1 
ATOM   5295 N  NZ  . LYS F  1 44  ? -34.927 -5.328  -66.684 1.00 71.59  ? 39  LYS F NZ  1 
ATOM   5296 N  N   . ASN F  1 45  ? -33.477 -0.825  -71.520 1.00 41.93  ? 40  ASN F N   1 
ATOM   5297 C  CA  . ASN F  1 45  ? -34.700 -0.169  -71.983 1.00 35.08  ? 40  ASN F CA  1 
ATOM   5298 C  C   . ASN F  1 45  ? -35.266 0.880   -71.019 1.00 33.68  ? 40  ASN F C   1 
ATOM   5299 O  O   . ASN F  1 45  ? -36.329 0.684   -70.430 1.00 38.43  ? 40  ASN F O   1 
ATOM   5300 C  CB  . ASN F  1 45  ? -35.760 -1.228  -72.316 1.00 43.52  ? 40  ASN F CB  1 
ATOM   5301 C  CG  . ASN F  1 45  ? -36.992 -0.643  -72.989 1.00 49.85  ? 40  ASN F CG  1 
ATOM   5302 O  OD1 . ASN F  1 45  ? -36.994 0.508   -73.423 1.00 50.91  ? 40  ASN F OD1 1 
ATOM   5303 N  ND2 . ASN F  1 45  ? -38.048 -1.443  -73.078 1.00 57.60  ? 40  ASN F ND2 1 
ATOM   5304 N  N   . SER F  1 46  ? -34.550 1.988   -70.855 1.00 31.26  ? 41  SER F N   1 
ATOM   5305 C  CA  . SER F  1 46  ? -35.033 3.076   -70.011 1.00 30.23  ? 41  SER F CA  1 
ATOM   5306 C  C   . SER F  1 46  ? -34.578 4.446   -70.503 1.00 35.74  ? 41  SER F C   1 
ATOM   5307 O  O   . SER F  1 46  ? -33.420 4.639   -70.877 1.00 31.22  ? 41  SER F O   1 
ATOM   5308 C  CB  . SER F  1 46  ? -34.608 2.875   -68.553 1.00 32.63  ? 41  SER F CB  1 
ATOM   5309 O  OG  . SER F  1 46  ? -35.157 3.887   -67.723 1.00 28.53  ? 41  SER F OG  1 
ATOM   5310 N  N   . VAL F  1 47  ? -35.509 5.391   -70.493 1.00 38.00  ? 42  VAL F N   1 
ATOM   5311 C  CA  . VAL F  1 47  ? -35.223 6.773   -70.843 1.00 29.05  ? 42  VAL F CA  1 
ATOM   5312 C  C   . VAL F  1 47  ? -34.770 7.500   -69.578 1.00 27.20  ? 42  VAL F C   1 
ATOM   5313 O  O   . VAL F  1 47  ? -34.058 8.503   -69.634 1.00 34.20  ? 42  VAL F O   1 
ATOM   5314 C  CB  . VAL F  1 47  ? -36.466 7.434   -71.491 1.00 31.60  ? 42  VAL F CB  1 
ATOM   5315 C  CG1 . VAL F  1 47  ? -36.407 8.949   -71.415 1.00 31.59  ? 42  VAL F CG1 1 
ATOM   5316 C  CG2 . VAL F  1 47  ? -36.618 6.965   -72.942 1.00 33.42  ? 42  VAL F CG2 1 
ATOM   5317 N  N   . ASN F  1 48  ? -35.168 6.953   -68.433 1.00 29.91  ? 43  ASN F N   1 
ATOM   5318 C  CA  . ASN F  1 48  ? -34.752 7.451   -67.124 1.00 29.72  ? 43  ASN F CA  1 
ATOM   5319 C  C   . ASN F  1 48  ? -34.052 6.341   -66.315 1.00 29.48  ? 43  ASN F C   1 
ATOM   5320 O  O   . ASN F  1 48  ? -34.621 5.776   -65.382 1.00 25.70  ? 43  ASN F O   1 
ATOM   5321 C  CB  . ASN F  1 48  ? -35.970 8.045   -66.392 1.00 29.92  ? 43  ASN F CB  1 
ATOM   5322 C  CG  . ASN F  1 48  ? -35.732 8.273   -64.907 1.00 39.75  ? 43  ASN F CG  1 
ATOM   5323 O  OD1 . ASN F  1 48  ? -36.514 7.811   -64.073 1.00 41.72  ? 43  ASN F OD1 1 
ATOM   5324 N  ND2 . ASN F  1 48  ? -34.649 8.969   -64.569 1.00 33.15  ? 43  ASN F ND2 1 
ATOM   5325 N  N   . PRO F  1 49  ? -32.812 5.999   -66.697 1.00 23.43  ? 44  PRO F N   1 
ATOM   5326 C  CA  . PRO F  1 49  ? -32.134 4.900   -66.007 1.00 23.18  ? 44  PRO F CA  1 
ATOM   5327 C  C   . PRO F  1 49  ? -31.683 5.305   -64.610 1.00 23.39  ? 44  PRO F C   1 
ATOM   5328 O  O   . PRO F  1 49  ? -31.109 6.380   -64.432 1.00 24.07  ? 44  PRO F O   1 
ATOM   5329 C  CB  . PRO F  1 49  ? -30.924 4.619   -66.903 1.00 22.53  ? 44  PRO F CB  1 
ATOM   5330 C  CG  . PRO F  1 49  ? -30.662 5.909   -67.593 1.00 28.95  ? 44  PRO F CG  1 
ATOM   5331 C  CD  . PRO F  1 49  ? -32.008 6.535   -67.808 1.00 28.39  ? 44  PRO F CD  1 
ATOM   5332 N  N   . VAL F  1 50  ? -31.958 4.450   -63.632 1.00 23.17  ? 45  VAL F N   1 
ATOM   5333 C  CA  . VAL F  1 50  ? -31.525 4.677   -62.262 1.00 27.78  ? 45  VAL F CA  1 
ATOM   5334 C  C   . VAL F  1 50  ? -30.427 3.679   -61.912 1.00 22.81  ? 45  VAL F C   1 
ATOM   5335 O  O   . VAL F  1 50  ? -30.694 2.493   -61.745 1.00 24.68  ? 45  VAL F O   1 
ATOM   5336 C  CB  . VAL F  1 50  ? -32.692 4.504   -61.274 1.00 27.99  ? 45  VAL F CB  1 
ATOM   5337 C  CG1 . VAL F  1 50  ? -32.223 4.756   -59.848 1.00 29.44  ? 45  VAL F CG1 1 
ATOM   5338 C  CG2 . VAL F  1 50  ? -33.845 5.429   -61.643 1.00 25.89  ? 45  VAL F CG2 1 
ATOM   5339 N  N   . TRP F  1 51  ? -29.193 4.161   -61.813 1.00 23.30  ? 46  TRP F N   1 
ATOM   5340 C  CA  . TRP F  1 51  ? -28.069 3.291   -61.487 1.00 23.52  ? 46  TRP F CA  1 
ATOM   5341 C  C   . TRP F  1 51  ? -27.857 3.196   -59.981 1.00 22.45  ? 46  TRP F C   1 
ATOM   5342 O  O   . TRP F  1 51  ? -27.614 2.109   -59.453 1.00 28.12  ? 46  TRP F O   1 
ATOM   5343 C  CB  . TRP F  1 51  ? -26.791 3.777   -62.168 1.00 24.03  ? 46  TRP F CB  1 
ATOM   5344 C  CG  . TRP F  1 51  ? -26.883 3.809   -63.660 1.00 21.62  ? 46  TRP F CG  1 
ATOM   5345 C  CD1 . TRP F  1 51  ? -26.847 2.740   -64.506 1.00 21.85  ? 46  TRP F CD1 1 
ATOM   5346 C  CD2 . TRP F  1 51  ? -27.014 4.970   -64.486 1.00 20.30  ? 46  TRP F CD2 1 
ATOM   5347 N  NE1 . TRP F  1 51  ? -26.952 3.163   -65.809 1.00 23.39  ? 46  TRP F NE1 1 
ATOM   5348 C  CE2 . TRP F  1 51  ? -27.056 4.529   -65.823 1.00 22.19  ? 46  TRP F CE2 1 
ATOM   5349 C  CE3 . TRP F  1 51  ? -27.098 6.342   -64.225 1.00 22.52  ? 46  TRP F CE3 1 
ATOM   5350 C  CZ2 . TRP F  1 51  ? -27.181 5.408   -66.896 1.00 19.80  ? 46  TRP F CZ2 1 
ATOM   5351 C  CZ3 . TRP F  1 51  ? -27.226 7.213   -65.294 1.00 20.94  ? 46  TRP F CZ3 1 
ATOM   5352 C  CH2 . TRP F  1 51  ? -27.266 6.741   -66.612 1.00 18.80  ? 46  TRP F CH2 1 
ATOM   5353 N  N   . ASN F  1 52  ? -27.955 4.339   -59.304 1.00 27.11  ? 47  ASN F N   1 
ATOM   5354 C  CA  . ASN F  1 52  ? -27.806 4.413   -57.852 1.00 30.19  ? 47  ASN F CA  1 
ATOM   5355 C  C   . ASN F  1 52  ? -26.533 3.717   -57.371 1.00 22.82  ? 47  ASN F C   1 
ATOM   5356 O  O   . ASN F  1 52  ? -26.574 2.862   -56.487 1.00 24.95  ? 47  ASN F O   1 
ATOM   5357 C  CB  . ASN F  1 52  ? -29.040 3.823   -57.159 1.00 37.59  ? 47  ASN F CB  1 
ATOM   5358 C  CG  . ASN F  1 52  ? -29.122 4.201   -55.692 1.00 41.55  ? 47  ASN F CG  1 
ATOM   5359 O  OD1 . ASN F  1 52  ? -28.651 5.262   -55.290 1.00 41.13  ? 47  ASN F OD1 1 
ATOM   5360 N  ND2 . ASN F  1 52  ? -29.720 3.330   -54.885 1.00 27.93  ? 47  ASN F ND2 1 
ATOM   5361 N  N   . GLU F  1 53  ? -25.406 4.068   -57.978 1.00 21.60  ? 48  GLU F N   1 
ATOM   5362 C  CA  . GLU F  1 53  ? -24.147 3.398   -57.674 1.00 22.75  ? 48  GLU F CA  1 
ATOM   5363 C  C   . GLU F  1 53  ? -23.135 4.346   -57.058 1.00 26.93  ? 48  GLU F C   1 
ATOM   5364 O  O   . GLU F  1 53  ? -23.003 5.490   -57.487 1.00 25.94  ? 48  GLU F O   1 
ATOM   5365 C  CB  . GLU F  1 53  ? -23.549 2.763   -58.929 1.00 27.66  ? 48  GLU F CB  1 
ATOM   5366 C  CG  . GLU F  1 53  ? -24.248 1.500   -59.382 1.00 37.39  ? 48  GLU F CG  1 
ATOM   5367 C  CD  . GLU F  1 53  ? -23.574 0.866   -60.581 1.00 38.52  ? 48  GLU F CD  1 
ATOM   5368 O  OE1 . GLU F  1 53  ? -22.325 0.845   -60.628 1.00 42.05  ? 48  GLU F OE1 1 
ATOM   5369 O  OE2 . GLU F  1 53  ? -24.295 0.398   -61.482 1.00 38.50  ? 48  GLU F OE2 1 
ATOM   5370 N  N   . GLY F  1 54  ? -22.415 3.851   -56.057 1.00 25.46  ? 49  GLY F N   1 
ATOM   5371 C  CA  . GLY F  1 54  ? -21.398 4.632   -55.383 1.00 25.56  ? 49  GLY F CA  1 
ATOM   5372 C  C   . GLY F  1 54  ? -20.003 4.234   -55.819 1.00 24.43  ? 49  GLY F C   1 
ATOM   5373 O  O   . GLY F  1 54  ? -19.715 3.049   -55.995 1.00 28.18  ? 49  GLY F O   1 
ATOM   5374 N  N   . PHE F  1 55  ? -19.140 5.227   -56.003 1.00 23.55  ? 50  PHE F N   1 
ATOM   5375 C  CA  . PHE F  1 55  ? -17.751 4.984   -56.371 1.00 24.88  ? 50  PHE F CA  1 
ATOM   5376 C  C   . PHE F  1 55  ? -16.824 5.781   -55.467 1.00 30.31  ? 50  PHE F C   1 
ATOM   5377 O  O   . PHE F  1 55  ? -17.207 6.826   -54.944 1.00 24.05  ? 50  PHE F O   1 
ATOM   5378 C  CB  . PHE F  1 55  ? -17.499 5.384   -57.824 1.00 24.86  ? 50  PHE F CB  1 
ATOM   5379 C  CG  . PHE F  1 55  ? -18.393 4.691   -58.810 1.00 33.47  ? 50  PHE F CG  1 
ATOM   5380 C  CD1 . PHE F  1 55  ? -18.034 3.468   -59.346 1.00 32.01  ? 50  PHE F CD1 1 
ATOM   5381 C  CD2 . PHE F  1 55  ? -19.590 5.266   -59.204 1.00 38.96  ? 50  PHE F CD2 1 
ATOM   5382 C  CE1 . PHE F  1 55  ? -18.853 2.828   -60.257 1.00 43.45  ? 50  PHE F CE1 1 
ATOM   5383 C  CE2 . PHE F  1 55  ? -20.414 4.630   -60.114 1.00 38.99  ? 50  PHE F CE2 1 
ATOM   5384 C  CZ  . PHE F  1 55  ? -20.045 3.411   -60.642 1.00 34.13  ? 50  PHE F CZ  1 
ATOM   5385 N  N   . GLU F  1 56  ? -15.602 5.288   -55.291 1.00 31.39  ? 51  GLU F N   1 
ATOM   5386 C  CA  . GLU F  1 56  ? -14.608 5.983   -54.482 1.00 34.98  ? 51  GLU F CA  1 
ATOM   5387 C  C   . GLU F  1 56  ? -13.241 6.004   -55.165 1.00 38.27  ? 51  GLU F C   1 
ATOM   5388 O  O   . GLU F  1 56  ? -12.709 4.959   -55.539 1.00 35.26  ? 51  GLU F O   1 
ATOM   5389 C  CB  . GLU F  1 56  ? -14.489 5.341   -53.097 1.00 38.57  ? 51  GLU F CB  1 
ATOM   5390 C  CG  . GLU F  1 56  ? -15.785 5.313   -52.300 1.00 44.38  ? 51  GLU F CG  1 
ATOM   5391 C  CD  . GLU F  1 56  ? -15.591 4.801   -50.885 1.00 54.73  ? 51  GLU F CD  1 
ATOM   5392 O  OE1 . GLU F  1 56  ? -15.504 5.637   -49.960 1.00 54.02  ? 51  GLU F OE1 1 
ATOM   5393 O  OE2 . GLU F  1 56  ? -15.526 3.566   -50.698 1.00 62.46  ? 51  GLU F OE2 1 
ATOM   5394 N  N   . TRP F  1 57  ? -12.688 7.202   -55.336 1.00 36.44  ? 52  TRP F N   1 
ATOM   5395 C  CA  . TRP F  1 57  ? -11.324 7.363   -55.830 1.00 36.25  ? 52  TRP F CA  1 
ATOM   5396 C  C   . TRP F  1 57  ? -10.407 7.721   -54.672 1.00 40.54  ? 52  TRP F C   1 
ATOM   5397 O  O   . TRP F  1 57  ? -10.777 8.517   -53.808 1.00 37.14  ? 52  TRP F O   1 
ATOM   5398 C  CB  . TRP F  1 57  ? -11.245 8.486   -56.864 1.00 34.01  ? 52  TRP F CB  1 
ATOM   5399 C  CG  . TRP F  1 57  ? -11.817 8.166   -58.203 1.00 34.56  ? 52  TRP F CG  1 
ATOM   5400 C  CD1 . TRP F  1 57  ? -11.126 7.826   -59.329 1.00 34.95  ? 52  TRP F CD1 1 
ATOM   5401 C  CD2 . TRP F  1 57  ? -13.200 8.175   -58.568 1.00 26.86  ? 52  TRP F CD2 1 
ATOM   5402 N  NE1 . TRP F  1 57  ? -11.995 7.617   -60.372 1.00 29.69  ? 52  TRP F NE1 1 
ATOM   5403 C  CE2 . TRP F  1 57  ? -13.275 7.826   -59.929 1.00 26.96  ? 52  TRP F CE2 1 
ATOM   5404 C  CE3 . TRP F  1 57  ? -14.384 8.442   -57.874 1.00 24.75  ? 52  TRP F CE3 1 
ATOM   5405 C  CZ2 . TRP F  1 57  ? -14.486 7.739   -60.610 1.00 35.02  ? 52  TRP F CZ2 1 
ATOM   5406 C  CZ3 . TRP F  1 57  ? -15.584 8.350   -58.552 1.00 22.87  ? 52  TRP F CZ3 1 
ATOM   5407 C  CH2 . TRP F  1 57  ? -15.627 8.004   -59.905 1.00 22.94  ? 52  TRP F CH2 1 
ATOM   5408 N  N   . ASP F  1 58  ? -9.209  7.147   -54.662 1.00 39.90  ? 53  ASP F N   1 
ATOM   5409 C  CA  . ASP F  1 58  ? -8.214  7.506   -53.661 1.00 45.40  ? 53  ASP F CA  1 
ATOM   5410 C  C   . ASP F  1 58  ? -7.697  8.910   -53.921 1.00 45.47  ? 53  ASP F C   1 
ATOM   5411 O  O   . ASP F  1 58  ? -7.285  9.233   -55.035 1.00 51.21  ? 53  ASP F O   1 
ATOM   5412 C  CB  . ASP F  1 58  ? -7.052  6.514   -53.659 1.00 51.26  ? 53  ASP F CB  1 
ATOM   5413 C  CG  . ASP F  1 58  ? -5.911  6.962   -52.763 1.00 62.75  ? 53  ASP F CG  1 
ATOM   5414 O  OD1 . ASP F  1 58  ? -6.188  7.522   -51.680 1.00 61.18  ? 53  ASP F OD1 1 
ATOM   5415 O  OD2 . ASP F  1 58  ? -4.739  6.764   -53.149 1.00 67.60  ? 53  ASP F OD2 1 
ATOM   5416 N  N   . LEU F  1 59  ? -7.723  9.741   -52.886 1.00 44.20  ? 54  LEU F N   1 
ATOM   5417 C  CA  . LEU F  1 59  ? -7.260  11.117  -53.001 1.00 46.43  ? 54  LEU F CA  1 
ATOM   5418 C  C   . LEU F  1 59  ? -5.848  11.294  -52.458 1.00 54.20  ? 54  LEU F C   1 
ATOM   5419 O  O   . LEU F  1 59  ? -5.258  12.365  -52.605 1.00 54.37  ? 54  LEU F O   1 
ATOM   5420 C  CB  . LEU F  1 59  ? -8.221  12.067  -52.289 1.00 43.36  ? 54  LEU F CB  1 
ATOM   5421 C  CG  . LEU F  1 59  ? -9.512  12.379  -53.044 1.00 43.12  ? 54  LEU F CG  1 
ATOM   5422 C  CD1 . LEU F  1 59  ? -10.480 13.111  -52.142 1.00 39.40  ? 54  LEU F CD1 1 
ATOM   5423 C  CD2 . LEU F  1 59  ? -9.211  13.202  -54.286 1.00 45.03  ? 54  LEU F CD2 1 
ATOM   5424 N  N   . LYS F  1 60  ? -5.318  10.248  -51.827 1.00 57.42  ? 55  LYS F N   1 
ATOM   5425 C  CA  . LYS F  1 60  ? -3.955  10.281  -51.298 1.00 65.78  ? 55  LYS F CA  1 
ATOM   5426 C  C   . LYS F  1 60  ? -2.978  10.722  -52.377 1.00 68.26  ? 55  LYS F C   1 
ATOM   5427 O  O   . LYS F  1 60  ? -2.797  10.033  -53.381 1.00 63.44  ? 55  LYS F O   1 
ATOM   5428 C  CB  . LYS F  1 60  ? -3.538  8.913   -50.749 1.00 70.35  ? 55  LYS F CB  1 
ATOM   5429 C  CG  . LYS F  1 60  ? -2.039  8.766   -50.511 1.00 76.79  ? 55  LYS F CG  1 
ATOM   5430 C  CD  . LYS F  1 60  ? -1.568  9.582   -49.317 1.00 80.08  ? 55  LYS F CD  1 
ATOM   5431 C  CE  . LYS F  1 60  ? -0.048  9.604   -49.218 1.00 85.62  ? 55  LYS F CE  1 
ATOM   5432 N  NZ  . LYS F  1 60  ? 0.576   10.350  -50.347 1.00 84.01  ? 55  LYS F NZ  1 
ATOM   5433 N  N   . GLY F  1 61  ? -2.374  11.889  -52.178 1.00 74.74  ? 56  GLY F N   1 
ATOM   5434 C  CA  . GLY F  1 61  ? -1.419  12.418  -53.131 1.00 79.62  ? 56  GLY F CA  1 
ATOM   5435 C  C   . GLY F  1 61  ? -2.002  13.380  -54.153 1.00 75.31  ? 56  GLY F C   1 
ATOM   5436 O  O   . GLY F  1 61  ? -1.274  14.210  -54.698 1.00 79.05  ? 56  GLY F O   1 
ATOM   5437 N  N   . ILE F  1 62  ? -3.300  13.271  -54.428 1.00 73.43  ? 57  ILE F N   1 
ATOM   5438 C  CA  . ILE F  1 62  ? -3.953  14.182  -55.375 1.00 73.97  ? 57  ILE F CA  1 
ATOM   5439 C  C   . ILE F  1 62  ? -4.479  15.470  -54.681 1.00 74.44  ? 57  ILE F C   1 
ATOM   5440 O  O   . ILE F  1 62  ? -5.307  15.412  -53.770 1.00 71.18  ? 57  ILE F O   1 
ATOM   5441 C  CB  . ILE F  1 62  ? -5.000  13.429  -56.302 1.00 61.97  ? 57  ILE F CB  1 
ATOM   5442 C  CG1 . ILE F  1 62  ? -6.350  14.144  -56.396 1.00 55.91  ? 57  ILE F CG1 1 
ATOM   5443 C  CG2 . ILE F  1 62  ? -5.199  11.984  -55.853 1.00 62.22  ? 57  ILE F CG2 1 
ATOM   5444 C  CD1 . ILE F  1 62  ? -6.451  15.162  -57.522 1.00 54.86  ? 57  ILE F CD1 1 
ATOM   5445 N  N   . PRO F  1 63  ? -3.955  16.637  -55.106 1.00 78.14  ? 58  PRO F N   1 
ATOM   5446 C  CA  . PRO F  1 63  ? -4.162  18.014  -54.622 1.00 77.10  ? 58  PRO F CA  1 
ATOM   5447 C  C   . PRO F  1 63  ? -5.479  18.595  -55.157 1.00 72.09  ? 58  PRO F C   1 
ATOM   5448 O  O   . PRO F  1 63  ? -5.693  18.565  -56.367 1.00 76.54  ? 58  PRO F O   1 
ATOM   5449 C  CB  . PRO F  1 63  ? -2.945  18.771  -55.189 1.00 79.37  ? 58  PRO F CB  1 
ATOM   5450 C  CG  . PRO F  1 63  ? -2.152  17.738  -56.022 1.00 83.70  ? 58  PRO F CG  1 
ATOM   5451 C  CD  . PRO F  1 63  ? -3.088  16.614  -56.293 1.00 80.80  ? 58  PRO F CD  1 
ATOM   5452 N  N   . LEU F  1 64  ? -6.325  19.145  -54.286 1.00 69.45  ? 59  LEU F N   1 
ATOM   5453 C  CA  . LEU F  1 64  ? -7.771  19.241  -54.573 1.00 67.65  ? 59  LEU F CA  1 
ATOM   5454 C  C   . LEU F  1 64  ? -8.387  20.426  -55.332 1.00 76.85  ? 59  LEU F C   1 
ATOM   5455 O  O   . LEU F  1 64  ? -9.592  20.392  -55.600 1.00 75.01  ? 59  LEU F O   1 
ATOM   5456 C  CB  . LEU F  1 64  ? -8.583  19.060  -53.274 1.00 62.17  ? 59  LEU F CB  1 
ATOM   5457 C  CG  . LEU F  1 64  ? -9.346  17.745  -53.042 1.00 54.84  ? 59  LEU F CG  1 
ATOM   5458 C  CD1 . LEU F  1 64  ? -10.153 17.723  -51.739 1.00 51.23  ? 59  LEU F CD1 1 
ATOM   5459 C  CD2 . LEU F  1 64  ? -10.236 17.395  -54.231 1.00 52.02  ? 59  LEU F CD2 1 
ATOM   5460 N  N   . ASP F  1 65  ? -7.696  21.534  -55.530 1.00 86.19  ? 60  ASP F N   1 
ATOM   5461 C  CA  . ASP F  1 65  ? -8.441  22.769  -55.805 1.00 93.72  ? 60  ASP F CA  1 
ATOM   5462 C  C   . ASP F  1 65  ? -8.537  23.126  -57.296 1.00 95.94  ? 60  ASP F C   1 
ATOM   5463 O  O   . ASP F  1 65  ? -7.616  22.926  -58.077 1.00 94.52  ? 60  ASP F O   1 
ATOM   5464 C  CB  . ASP F  1 65  ? -8.043  23.869  -54.808 1.00 101.52 ? 60  ASP F CB  1 
ATOM   5465 C  CG  . ASP F  1 65  ? -9.245  24.610  -54.241 1.00 104.33 ? 60  ASP F CG  1 
ATOM   5466 O  OD1 . ASP F  1 65  ? -10.359 24.059  -54.305 1.00 105.20 ? 60  ASP F OD1 1 
ATOM   5467 O  OD2 . ASP F  1 65  ? -9.096  25.740  -53.739 1.00 105.32 ? 60  ASP F OD2 1 
ATOM   5468 N  N   . GLN F  1 66  ? -9.729  23.595  -57.653 1.00 97.59  ? 61  GLN F N   1 
ATOM   5469 C  CA  . GLN F  1 66  ? -10.241 24.727  -58.420 1.00 101.58 ? 61  GLN F CA  1 
ATOM   5470 C  C   . GLN F  1 66  ? -10.182 24.626  -59.932 1.00 94.84  ? 61  GLN F C   1 
ATOM   5471 O  O   . GLN F  1 66  ? -10.840 25.383  -60.647 1.00 95.34  ? 61  GLN F O   1 
ATOM   5472 C  CB  . GLN F  1 66  ? -9.609  26.037  -57.947 1.00 114.41 ? 61  GLN F CB  1 
ATOM   5473 C  CG  . GLN F  1 66  ? -10.595 27.210  -57.849 1.00 123.39 ? 61  GLN F CG  1 
ATOM   5474 C  CD  . GLN F  1 66  ? -11.469 27.194  -56.592 1.00 126.22 ? 61  GLN F CD  1 
ATOM   5475 O  OE1 . GLN F  1 66  ? -11.042 26.759  -55.524 1.00 127.56 ? 61  GLN F OE1 1 
ATOM   5476 N  NE2 . GLN F  1 66  ? -12.689 27.699  -56.717 1.00 125.99 ? 61  GLN F NE2 1 
ATOM   5477 N  N   . GLY F  1 67  ? -9.446  23.647  -60.419 1.00 86.99  ? 62  GLY F N   1 
ATOM   5478 C  CA  . GLY F  1 67  ? -9.512  23.316  -61.817 1.00 77.52  ? 62  GLY F CA  1 
ATOM   5479 C  C   . GLY F  1 67  ? -10.028 21.909  -61.902 1.00 64.65  ? 62  GLY F C   1 
ATOM   5480 O  O   . GLY F  1 67  ? -10.397 21.449  -62.957 1.00 65.39  ? 62  GLY F O   1 
ATOM   5481 N  N   . SER F  1 68  ? -10.033 21.239  -60.761 1.00 52.77  ? 63  SER F N   1 
ATOM   5482 C  CA  . SER F  1 68  ? -10.397 19.831  -60.677 1.00 49.44  ? 63  SER F CA  1 
ATOM   5483 C  C   . SER F  1 68  ? -11.809 19.561  -61.166 1.00 41.47  ? 63  SER F C   1 
ATOM   5484 O  O   . SER F  1 68  ? -12.767 20.189  -60.718 1.00 34.16  ? 63  SER F O   1 
ATOM   5485 C  CB  . SER F  1 68  ? -10.246 19.333  -59.240 1.00 52.64  ? 63  SER F CB  1 
ATOM   5486 O  OG  . SER F  1 68  ? -8.909  18.956  -58.971 1.00 61.61  ? 63  SER F OG  1 
ATOM   5487 N  N   . GLU F  1 69  ? -11.926 18.611  -62.085 1.00 40.38  ? 64  GLU F N   1 
ATOM   5488 C  CA  . GLU F  1 69  ? -13.213 18.284  -62.673 1.00 43.20  ? 64  GLU F CA  1 
ATOM   5489 C  C   . GLU F  1 69  ? -13.462 16.784  -62.738 1.00 36.93  ? 64  GLU F C   1 
ATOM   5490 O  O   . GLU F  1 69  ? -12.564 16.005  -63.051 1.00 34.14  ? 64  GLU F O   1 
ATOM   5491 C  CB  . GLU F  1 69  ? -13.332 18.900  -64.071 1.00 46.52  ? 64  GLU F CB  1 
ATOM   5492 C  CG  . GLU F  1 69  ? -13.314 20.423  -64.086 1.00 55.10  ? 64  GLU F CG  1 
ATOM   5493 C  CD  . GLU F  1 69  ? -13.255 20.993  -65.492 1.00 61.47  ? 64  GLU F CD  1 
ATOM   5494 O  OE1 . GLU F  1 69  ? -13.481 20.226  -66.454 1.00 61.07  ? 64  GLU F OE1 1 
ATOM   5495 O  OE2 . GLU F  1 69  ? -12.974 22.203  -65.633 1.00 68.96  ? 64  GLU F OE2 1 
ATOM   5496 N  N   . LEU F  1 70  ? -14.690 16.390  -62.425 1.00 30.76  ? 65  LEU F N   1 
ATOM   5497 C  CA  . LEU F  1 70  ? -15.130 15.021  -62.632 1.00 28.48  ? 65  LEU F CA  1 
ATOM   5498 C  C   . LEU F  1 70  ? -15.777 14.932  -64.007 1.00 31.46  ? 65  LEU F C   1 
ATOM   5499 O  O   . LEU F  1 70  ? -16.714 15.674  -64.311 1.00 33.43  ? 65  LEU F O   1 
ATOM   5500 C  CB  . LEU F  1 70  ? -16.124 14.605  -61.548 1.00 24.48  ? 65  LEU F CB  1 
ATOM   5501 C  CG  . LEU F  1 70  ? -16.826 13.254  -61.730 1.00 30.91  ? 65  LEU F CG  1 
ATOM   5502 C  CD1 . LEU F  1 70  ? -15.849 12.097  -61.626 1.00 31.82  ? 65  LEU F CD1 1 
ATOM   5503 C  CD2 . LEU F  1 70  ? -17.937 13.098  -60.709 1.00 32.08  ? 65  LEU F CD2 1 
ATOM   5504 N  N   . HIS F  1 71  ? -15.264 14.035  -64.840 1.00 24.67  ? 66  HIS F N   1 
ATOM   5505 C  CA  . HIS F  1 71  ? -15.785 13.853  -66.188 1.00 27.78  ? 66  HIS F CA  1 
ATOM   5506 C  C   . HIS F  1 71  ? -16.714 12.649  -66.240 1.00 33.43  ? 66  HIS F C   1 
ATOM   5507 O  O   . HIS F  1 71  ? -16.308 11.526  -65.944 1.00 26.90  ? 66  HIS F O   1 
ATOM   5508 C  CB  . HIS F  1 71  ? -14.643 13.676  -67.190 1.00 31.98  ? 66  HIS F CB  1 
ATOM   5509 C  CG  . HIS F  1 71  ? -15.091 13.644  -68.620 1.00 38.95  ? 66  HIS F CG  1 
ATOM   5510 N  ND1 . HIS F  1 71  ? -14.358 13.040  -69.617 1.00 42.46  ? 66  HIS F ND1 1 
ATOM   5511 C  CD2 . HIS F  1 71  ? -16.193 14.155  -69.220 1.00 39.30  ? 66  HIS F CD2 1 
ATOM   5512 C  CE1 . HIS F  1 71  ? -14.990 13.174  -70.770 1.00 41.52  ? 66  HIS F CE1 1 
ATOM   5513 N  NE2 . HIS F  1 71  ? -16.104 13.849  -70.557 1.00 37.65  ? 66  HIS F NE2 1 
ATOM   5514 N  N   . VAL F  1 72  ? -17.965 12.891  -66.615 1.00 22.25  ? 67  VAL F N   1 
ATOM   5515 C  CA  . VAL F  1 72  ? -18.947 11.823  -66.714 1.00 23.41  ? 67  VAL F CA  1 
ATOM   5516 C  C   . VAL F  1 72  ? -19.451 11.689  -68.148 1.00 24.26  ? 67  VAL F C   1 
ATOM   5517 O  O   . VAL F  1 72  ? -19.712 12.689  -68.817 1.00 28.17  ? 67  VAL F O   1 
ATOM   5518 C  CB  . VAL F  1 72  ? -20.126 12.054  -65.747 1.00 26.65  ? 67  VAL F CB  1 
ATOM   5519 C  CG1 . VAL F  1 72  ? -19.651 11.940  -64.307 1.00 22.96  ? 67  VAL F CG1 1 
ATOM   5520 C  CG2 . VAL F  1 72  ? -20.760 13.419  -65.992 1.00 28.70  ? 67  VAL F CG2 1 
ATOM   5521 N  N   . VAL F  1 73  ? -19.558 10.452  -68.623 1.00 22.13  ? 68  VAL F N   1 
ATOM   5522 C  CA  . VAL F  1 73  ? -20.045 10.188  -69.974 1.00 30.53  ? 68  VAL F CA  1 
ATOM   5523 C  C   . VAL F  1 73  ? -21.118 9.107   -69.954 1.00 36.35  ? 68  VAL F C   1 
ATOM   5524 O  O   . VAL F  1 73  ? -20.896 8.008   -69.446 1.00 37.18  ? 68  VAL F O   1 
ATOM   5525 C  CB  . VAL F  1 73  ? -18.908 9.749   -70.928 1.00 38.38  ? 68  VAL F CB  1 
ATOM   5526 C  CG1 . VAL F  1 73  ? -19.471 9.349   -72.285 1.00 44.07  ? 68  VAL F CG1 1 
ATOM   5527 C  CG2 . VAL F  1 73  ? -17.878 10.858  -71.084 1.00 42.50  ? 68  VAL F CG2 1 
ATOM   5528 N  N   . VAL F  1 74  ? -22.287 9.430   -70.499 1.00 29.93  ? 69  VAL F N   1 
ATOM   5529 C  CA  . VAL F  1 74  ? -23.369 8.463   -70.610 1.00 23.78  ? 69  VAL F CA  1 
ATOM   5530 C  C   . VAL F  1 74  ? -23.339 7.817   -71.989 1.00 25.81  ? 69  VAL F C   1 
ATOM   5531 O  O   . VAL F  1 74  ? -23.319 8.508   -73.007 1.00 32.56  ? 69  VAL F O   1 
ATOM   5532 C  CB  . VAL F  1 74  ? -24.741 9.119   -70.356 1.00 30.60  ? 69  VAL F CB  1 
ATOM   5533 C  CG1 . VAL F  1 74  ? -25.868 8.153   -70.685 1.00 31.54  ? 69  VAL F CG1 1 
ATOM   5534 C  CG2 . VAL F  1 74  ? -24.837 9.595   -68.911 1.00 23.80  ? 69  VAL F CG2 1 
ATOM   5535 N  N   . LYS F  1 75  ? -23.328 6.488   -72.015 1.00 27.83  ? 70  LYS F N   1 
ATOM   5536 C  CA  . LYS F  1 75  ? -23.201 5.749   -73.262 1.00 28.36  ? 70  LYS F CA  1 
ATOM   5537 C  C   . LYS F  1 75  ? -24.279 4.689   -73.380 1.00 35.26  ? 70  LYS F C   1 
ATOM   5538 O  O   . LYS F  1 75  ? -24.826 4.231   -72.380 1.00 34.54  ? 70  LYS F O   1 
ATOM   5539 C  CB  . LYS F  1 75  ? -21.817 5.105   -73.358 1.00 36.98  ? 70  LYS F CB  1 
ATOM   5540 C  CG  . LYS F  1 75  ? -20.696 6.121   -73.485 1.00 47.06  ? 70  LYS F CG  1 
ATOM   5541 C  CD  . LYS F  1 75  ? -19.363 5.586   -72.986 1.00 55.98  ? 70  LYS F CD  1 
ATOM   5542 C  CE  . LYS F  1 75  ? -18.513 5.081   -74.136 1.00 63.79  ? 70  LYS F CE  1 
ATOM   5543 N  NZ  . LYS F  1 75  ? -17.074 4.900   -73.788 1.00 66.62  ? 70  LYS F NZ  1 
ATOM   5544 N  N   . ASP F  1 76  ? -24.590 4.303   -74.608 1.00 42.09  ? 71  ASP F N   1 
ATOM   5545 C  CA  . ASP F  1 76  ? -25.575 3.260   -74.819 1.00 39.41  ? 71  ASP F CA  1 
ATOM   5546 C  C   . ASP F  1 76  ? -24.852 1.980   -75.161 1.00 44.07  ? 71  ASP F C   1 
ATOM   5547 O  O   . ASP F  1 76  ? -23.890 1.986   -75.931 1.00 46.09  ? 71  ASP F O   1 
ATOM   5548 C  CB  . ASP F  1 76  ? -26.538 3.633   -75.945 1.00 40.48  ? 71  ASP F CB  1 
ATOM   5549 C  CG  . ASP F  1 76  ? -27.721 2.690   -76.036 1.00 42.73  ? 71  ASP F CG  1 
ATOM   5550 O  OD1 . ASP F  1 76  ? -27.522 1.516   -76.387 1.00 45.29  ? 71  ASP F OD1 1 
ATOM   5551 O  OD2 . ASP F  1 76  ? -28.855 3.126   -75.756 1.00 47.65  ? 71  ASP F OD2 1 
ATOM   5552 N  N   . HIS F  1 77  ? -25.302 0.878   -74.579 1.00 120.58 ? 72  HIS F N   1 
ATOM   5553 C  CA  . HIS F  1 77  ? -24.741 -0.395  -74.969 1.00 143.75 ? 72  HIS F CA  1 
ATOM   5554 C  C   . HIS F  1 77  ? -25.596 -1.056  -76.039 1.00 159.07 ? 72  HIS F C   1 
ATOM   5555 O  O   . HIS F  1 77  ? -25.724 -2.276  -76.088 1.00 164.96 ? 72  HIS F O   1 
ATOM   5556 C  CB  . HIS F  1 77  ? -24.486 -1.309  -73.772 1.00 140.59 ? 72  HIS F CB  1 
ATOM   5557 C  CG  . HIS F  1 77  ? -23.042 -1.669  -73.590 1.00 151.50 ? 72  HIS F CG  1 
ATOM   5558 N  ND1 . HIS F  1 77  ? -22.016 -0.768  -73.780 1.00 156.35 ? 72  HIS F ND1 1 
ATOM   5559 C  CD2 . HIS F  1 77  ? -22.454 -2.834  -73.234 1.00 158.49 ? 72  HIS F CD2 1 
ATOM   5560 C  CE1 . HIS F  1 77  ? -20.859 -1.362  -73.546 1.00 139.97 ? 72  HIS F CE1 1 
ATOM   5561 N  NE2 . HIS F  1 77  ? -21.097 -2.619  -73.220 1.00 142.25 ? 72  HIS F NE2 1 
ATOM   5562 N  N   . GLU F  1 78  ? -26.162 -0.232  -76.917 1.00 168.53 ? 73  GLU F N   1 
ATOM   5563 C  CA  . GLU F  1 78  ? -26.423 -0.711  -78.255 1.00 177.28 ? 73  GLU F CA  1 
ATOM   5564 C  C   . GLU F  1 78  ? -25.051 -1.122  -78.727 1.00 185.99 ? 73  GLU F C   1 
ATOM   5565 O  O   . GLU F  1 78  ? -24.932 -2.071  -79.466 1.00 195.57 ? 73  GLU F O   1 
ATOM   5566 C  CB  . GLU F  1 78  ? -26.933 0.388   -79.183 1.00 180.88 ? 73  GLU F CB  1 
ATOM   5567 C  CG  . GLU F  1 78  ? -27.274 -0.118  -80.580 1.00 198.59 ? 73  GLU F CG  1 
ATOM   5568 C  CD  . GLU F  1 78  ? -28.568 -0.891  -80.620 1.00 199.77 ? 73  GLU F CD  1 
ATOM   5569 O  OE1 . GLU F  1 78  ? -29.556 -0.314  -81.112 1.00 195.96 ? 73  GLU F OE1 1 
ATOM   5570 O  OE2 . GLU F  1 78  ? -28.585 -2.060  -80.171 1.00 203.34 ? 73  GLU F OE2 1 
ATOM   5571 N  N   . THR F  1 79  ? -24.105 -0.341  -78.185 1.00 184.69 ? 74  THR F N   1 
ATOM   5572 C  CA  . THR F  1 79  ? -22.710 -0.209  -78.569 1.00 197.85 ? 74  THR F CA  1 
ATOM   5573 C  C   . THR F  1 79  ? -21.703 -0.634  -77.500 1.00 201.38 ? 74  THR F C   1 
ATOM   5574 O  O   . THR F  1 79  ? -21.640 -0.071  -76.415 1.00 192.57 ? 74  THR F O   1 
ATOM   5575 C  CB  . THR F  1 79  ? -22.380 1.264   -78.857 1.00 195.09 ? 74  THR F CB  1 
ATOM   5576 O  OG1 . THR F  1 79  ? -23.297 1.789   -79.823 1.00 190.89 ? 74  THR F OG1 1 
ATOM   5577 C  CG2 . THR F  1 79  ? -20.922 1.401   -79.340 1.00 209.52 ? 74  THR F CG2 1 
ATOM   5578 N  N   . MET F  1 80  ? -20.825 -1.554  -77.885 1.00 214.61 ? 75  MET F N   1 
ATOM   5579 C  CA  . MET F  1 80  ? -19.925 -2.205  -76.952 1.00 218.08 ? 75  MET F CA  1 
ATOM   5580 C  C   . MET F  1 80  ? -18.475 -2.222  -76.490 1.00 227.94 ? 75  MET F C   1 
ATOM   5581 O  O   . MET F  1 80  ? -18.209 -2.276  -75.291 1.00 223.27 ? 75  MET F O   1 
ATOM   5582 C  CB  . MET F  1 80  ? -19.776 -3.694  -77.313 1.00 227.28 ? 75  MET F CB  1 
ATOM   5583 C  CG  . MET F  1 80  ? -20.752 -4.644  -76.635 1.00 218.33 ? 75  MET F CG  1 
ATOM   5584 S  SD  . MET F  1 80  ? -19.857 -5.965  -75.802 1.00 199.69 ? 75  MET F SD  1 
ATOM   5585 C  CE  . MET F  1 80  ? -21.117 -6.578  -74.690 1.00 171.63 ? 75  MET F CE  1 
ATOM   5586 N  N   . GLY F  1 81  ? -17.540 -2.145  -77.429 1.00 241.86 ? 76  GLY F N   1 
ATOM   5587 C  CA  . GLY F  1 81  ? -16.191 -1.694  -77.191 1.00 250.66 ? 76  GLY F CA  1 
ATOM   5588 C  C   . GLY F  1 81  ? -16.103 -0.320  -77.776 1.00 249.51 ? 76  GLY F C   1 
ATOM   5589 O  O   . GLY F  1 81  ? -15.509 0.596   -77.201 1.00 246.38 ? 76  GLY F O   1 
ATOM   5590 N  N   . ARG F  1 82  ? -16.727 -0.177  -78.931 1.00 252.00 ? 77  ARG F N   1 
ATOM   5591 C  CA  . ARG F  1 82  ? -16.808 1.127   -79.561 1.00 250.12 ? 77  ARG F CA  1 
ATOM   5592 C  C   . ARG F  1 82  ? -17.704 1.922   -78.613 1.00 235.42 ? 77  ARG F C   1 
ATOM   5593 O  O   . ARG F  1 82  ? -18.334 1.325   -77.756 1.00 227.61 ? 77  ARG F O   1 
ATOM   5594 C  CB  . ARG F  1 82  ? -17.375 0.966   -80.984 1.00 254.53 ? 77  ARG F CB  1 
ATOM   5595 C  CG  . ARG F  1 82  ? -17.766 2.263   -81.662 1.00 248.15 ? 77  ARG F CG  1 
ATOM   5596 C  CD  . ARG F  1 82  ? -18.123 2.156   -83.139 1.00 254.53 ? 77  ARG F CD  1 
ATOM   5597 N  NE  . ARG F  1 82  ? -18.683 3.453   -83.589 1.00 245.60 ? 77  ARG F NE  1 
ATOM   5598 C  CZ  . ARG F  1 82  ? -18.898 3.821   -84.852 1.00 249.64 ? 77  ARG F CZ  1 
ATOM   5599 N  NH1 . ARG F  1 82  ? -18.616 3.001   -85.862 1.00 262.62 ? 77  ARG F NH1 1 
ATOM   5600 N  NH2 . ARG F  1 82  ? -19.413 5.018   -85.091 1.00 240.96 ? 77  ARG F NH2 1 
ATOM   5601 N  N   . ASN F  1 83  ? -17.747 3.246   -78.702 1.00 231.81 ? 78  ASN F N   1 
ATOM   5602 C  CA  . ASN F  1 83  ? -18.434 4.002   -77.651 1.00 219.89 ? 78  ASN F CA  1 
ATOM   5603 C  C   . ASN F  1 83  ? -19.984 3.937   -77.656 1.00 185.45 ? 78  ASN F C   1 
ATOM   5604 O  O   . ASN F  1 83  ? -20.568 3.231   -76.827 1.00 179.13 ? 78  ASN F O   1 
ATOM   5605 C  CB  . ASN F  1 83  ? -17.859 5.431   -77.497 1.00 219.95 ? 78  ASN F CB  1 
ATOM   5606 C  CG  . ASN F  1 83  ? -18.316 6.387   -78.580 1.00 220.44 ? 78  ASN F CG  1 
ATOM   5607 O  OD1 . ASN F  1 83  ? -19.227 6.090   -79.346 1.00 220.12 ? 78  ASN F OD1 1 
ATOM   5608 N  ND2 . ASN F  1 83  ? -17.687 7.551   -78.639 1.00 221.15 ? 78  ASN F ND2 1 
ATOM   5609 N  N   . ARG F  1 84  ? -20.614 4.605   -78.626 1.00 182.88 ? 79  ARG F N   1 
ATOM   5610 C  CA  . ARG F  1 84  ? -22.029 5.000   -78.578 1.00 169.17 ? 79  ARG F CA  1 
ATOM   5611 C  C   . ARG F  1 84  ? -22.206 6.001   -77.452 1.00 154.31 ? 79  ARG F C   1 
ATOM   5612 O  O   . ARG F  1 84  ? -22.969 5.777   -76.510 1.00 142.87 ? 79  ARG F O   1 
ATOM   5613 C  CB  . ARG F  1 84  ? -22.977 3.815   -78.396 1.00 168.98 ? 79  ARG F CB  1 
ATOM   5614 C  CG  . ARG F  1 84  ? -24.417 4.103   -78.650 1.00 161.59 ? 79  ARG F CG  1 
ATOM   5615 C  CD  . ARG F  1 84  ? -24.577 5.084   -79.779 1.00 164.96 ? 79  ARG F CD  1 
ATOM   5616 N  NE  . ARG F  1 84  ? -25.896 5.024   -80.387 1.00 161.76 ? 79  ARG F NE  1 
ATOM   5617 C  CZ  . ARG F  1 84  ? -26.246 5.776   -81.419 1.00 163.88 ? 79  ARG F CZ  1 
ATOM   5618 N  NH1 . ARG F  1 84  ? -25.370 6.624   -81.933 1.00 169.20 ? 79  ARG F NH1 1 
ATOM   5619 N  NH2 . ARG F  1 84  ? -27.455 5.685   -81.939 1.00 160.28 ? 79  ARG F NH2 1 
ATOM   5620 N  N   . PHE F  1 85  ? -21.467 7.098   -77.545 1.00 65.53  ? 80  PHE F N   1 
ATOM   5621 C  CA  . PHE F  1 85  ? -21.515 8.153   -76.542 1.00 61.39  ? 80  PHE F CA  1 
ATOM   5622 C  C   . PHE F  1 85  ? -22.758 9.011   -76.830 1.00 51.58  ? 80  PHE F C   1 
ATOM   5623 O  O   . PHE F  1 85  ? -22.956 9.499   -77.945 1.00 54.59  ? 80  PHE F O   1 
ATOM   5624 C  CB  . PHE F  1 85  ? -20.118 8.824   -76.507 1.00 62.77  ? 80  PHE F CB  1 
ATOM   5625 C  CG  . PHE F  1 85  ? -20.055 10.313  -76.184 1.00 53.46  ? 80  PHE F CG  1 
ATOM   5626 C  CD1 . PHE F  1 85  ? -21.096 11.062  -75.650 1.00 48.74  ? 80  PHE F CD1 1 
ATOM   5627 C  CD2 . PHE F  1 85  ? -18.855 10.951  -76.423 1.00 54.75  ? 80  PHE F CD2 1 
ATOM   5628 C  CE1 . PHE F  1 85  ? -20.936 12.408  -75.397 1.00 42.62  ? 80  PHE F CE1 1 
ATOM   5629 C  CE2 . PHE F  1 85  ? -18.688 12.291  -76.168 1.00 51.22  ? 80  PHE F CE2 1 
ATOM   5630 C  CZ  . PHE F  1 85  ? -19.729 13.023  -75.655 1.00 42.80  ? 80  PHE F CZ  1 
ATOM   5631 N  N   . LEU F  1 86  ? -23.603 9.146   -75.808 1.00 38.89  ? 81  LEU F N   1 
ATOM   5632 C  CA  . LEU F  1 86  ? -24.892 9.821   -75.925 1.00 40.39  ? 81  LEU F CA  1 
ATOM   5633 C  C   . LEU F  1 86  ? -24.779 11.251  -75.419 1.00 39.28  ? 81  LEU F C   1 
ATOM   5634 O  O   . LEU F  1 86  ? -25.317 12.178  -76.022 1.00 37.60  ? 81  LEU F O   1 
ATOM   5635 C  CB  . LEU F  1 86  ? -25.961 9.075   -75.114 1.00 39.41  ? 81  LEU F CB  1 
ATOM   5636 C  CG  . LEU F  1 86  ? -25.968 7.547   -75.213 1.00 43.98  ? 81  LEU F CG  1 
ATOM   5637 C  CD1 . LEU F  1 86  ? -27.097 6.934   -74.388 1.00 37.51  ? 81  LEU F CD1 1 
ATOM   5638 C  CD2 . LEU F  1 86  ? -26.054 7.107   -76.666 1.00 49.71  ? 81  LEU F CD2 1 
ATOM   5639 N  N   . GLY F  1 87  ? -24.078 11.419  -74.302 1.00 36.86  ? 82  GLY F N   1 
ATOM   5640 C  CA  . GLY F  1 87  ? -23.889 12.727  -73.700 1.00 35.48  ? 82  GLY F CA  1 
ATOM   5641 C  C   . GLY F  1 87  ? -22.798 12.715  -72.646 1.00 30.47  ? 82  GLY F C   1 
ATOM   5642 O  O   . GLY F  1 87  ? -22.500 11.672  -72.068 1.00 30.81  ? 82  GLY F O   1 
ATOM   5643 N  N   . GLU F  1 88  ? -22.197 13.875  -72.394 1.00 23.01  ? 83  GLU F N   1 
ATOM   5644 C  CA  . GLU F  1 88  ? -21.139 13.976  -71.394 1.00 22.78  ? 83  GLU F CA  1 
ATOM   5645 C  C   . GLU F  1 88  ? -21.216 15.283  -70.614 1.00 30.56  ? 83  GLU F C   1 
ATOM   5646 O  O   . GLU F  1 88  ? -21.853 16.241  -71.052 1.00 28.33  ? 83  GLU F O   1 
ATOM   5647 C  CB  . GLU F  1 88  ? -19.763 13.857  -72.049 1.00 35.43  ? 83  GLU F CB  1 
ATOM   5648 C  CG  . GLU F  1 88  ? -19.380 15.057  -72.897 1.00 49.49  ? 83  GLU F CG  1 
ATOM   5649 C  CD  . GLU F  1 88  ? -17.956 14.980  -73.412 1.00 64.52  ? 83  GLU F CD  1 
ATOM   5650 O  OE1 . GLU F  1 88  ? -17.234 14.032  -73.036 1.00 63.26  ? 83  GLU F OE1 1 
ATOM   5651 O  OE2 . GLU F  1 88  ? -17.559 15.872  -74.193 1.00 75.08  ? 83  GLU F OE2 1 
ATOM   5652 N  N   . ALA F  1 89  ? -20.555 15.323  -69.462 1.00 29.22  ? 84  ALA F N   1 
ATOM   5653 C  CA  . ALA F  1 89  ? -20.505 16.543  -68.665 1.00 34.88  ? 84  ALA F CA  1 
ATOM   5654 C  C   . ALA F  1 89  ? -19.249 16.632  -67.806 1.00 33.88  ? 84  ALA F C   1 
ATOM   5655 O  O   . ALA F  1 89  ? -18.740 15.621  -67.322 1.00 30.57  ? 84  ALA F O   1 
ATOM   5656 C  CB  . ALA F  1 89  ? -21.746 16.665  -67.798 1.00 33.02  ? 84  ALA F CB  1 
ATOM   5657 N  N   . LYS F  1 90  ? -18.755 17.854  -67.632 1.00 35.90  ? 85  LYS F N   1 
ATOM   5658 C  CA  . LYS F  1 90  ? -17.653 18.123  -66.717 1.00 34.55  ? 85  LYS F CA  1 
ATOM   5659 C  C   . LYS F  1 90  ? -18.195 18.742  -65.437 1.00 32.71  ? 85  LYS F C   1 
ATOM   5660 O  O   . LYS F  1 90  ? -18.925 19.732  -65.471 1.00 35.12  ? 85  LYS F O   1 
ATOM   5661 C  CB  . LYS F  1 90  ? -16.627 19.058  -67.359 1.00 41.13  ? 85  LYS F CB  1 
ATOM   5662 C  CG  . LYS F  1 90  ? -15.859 18.449  -68.527 1.00 53.01  ? 85  LYS F CG  1 
ATOM   5663 C  CD  . LYS F  1 90  ? -14.917 17.347  -68.068 1.00 63.73  ? 85  LYS F CD  1 
ATOM   5664 C  CE  . LYS F  1 90  ? -14.053 16.845  -69.217 1.00 70.58  ? 85  LYS F CE  1 
ATOM   5665 N  NZ  . LYS F  1 90  ? -13.161 17.908  -69.753 1.00 77.29  ? 85  LYS F NZ  1 
ATOM   5666 N  N   . VAL F  1 91  ? -17.833 18.149  -64.308 1.00 30.95  ? 86  VAL F N   1 
ATOM   5667 C  CA  . VAL F  1 91  ? -18.354 18.564  -63.019 1.00 34.55  ? 86  VAL F CA  1 
ATOM   5668 C  C   . VAL F  1 91  ? -17.263 19.284  -62.241 1.00 29.38  ? 86  VAL F C   1 
ATOM   5669 O  O   . VAL F  1 91  ? -16.211 18.706  -61.985 1.00 27.28  ? 86  VAL F O   1 
ATOM   5670 C  CB  . VAL F  1 91  ? -18.817 17.334  -62.222 1.00 40.74  ? 86  VAL F CB  1 
ATOM   5671 C  CG1 . VAL F  1 91  ? -19.402 17.751  -60.899 1.00 37.64  ? 86  VAL F CG1 1 
ATOM   5672 C  CG2 . VAL F  1 91  ? -19.823 16.523  -63.036 1.00 43.13  ? 86  VAL F CG2 1 
ATOM   5673 N  N   . PRO F  1 92  ? -17.506 20.551  -61.861 1.00 30.03  ? 87  PRO F N   1 
ATOM   5674 C  CA  . PRO F  1 92  ? -16.479 21.320  -61.148 1.00 29.24  ? 87  PRO F CA  1 
ATOM   5675 C  C   . PRO F  1 92  ? -16.420 20.959  -59.665 1.00 34.13  ? 87  PRO F C   1 
ATOM   5676 O  O   . PRO F  1 92  ? -17.332 21.278  -58.900 1.00 39.00  ? 87  PRO F O   1 
ATOM   5677 C  CB  . PRO F  1 92  ? -16.941 22.765  -61.333 1.00 29.67  ? 87  PRO F CB  1 
ATOM   5678 C  CG  . PRO F  1 92  ? -18.432 22.663  -61.422 1.00 31.25  ? 87  PRO F CG  1 
ATOM   5679 C  CD  . PRO F  1 92  ? -18.734 21.336  -62.084 1.00 28.31  ? 87  PRO F CD  1 
ATOM   5680 N  N   . LEU F  1 93  ? -15.339 20.302  -59.263 1.00 29.04  ? 88  LEU F N   1 
ATOM   5681 C  CA  . LEU F  1 93  ? -15.217 19.803  -57.898 1.00 28.37  ? 88  LEU F CA  1 
ATOM   5682 C  C   . LEU F  1 93  ? -14.930 20.897  -56.876 1.00 30.94  ? 88  LEU F C   1 
ATOM   5683 O  O   . LEU F  1 93  ? -14.962 20.651  -55.671 1.00 31.39  ? 88  LEU F O   1 
ATOM   5684 C  CB  . LEU F  1 93  ? -14.162 18.704  -57.837 1.00 28.36  ? 88  LEU F CB  1 
ATOM   5685 C  CG  . LEU F  1 93  ? -14.623 17.477  -58.620 1.00 26.61  ? 88  LEU F CG  1 
ATOM   5686 C  CD1 . LEU F  1 93  ? -13.496 16.492  -58.762 1.00 33.36  ? 88  LEU F CD1 1 
ATOM   5687 C  CD2 . LEU F  1 93  ? -15.815 16.841  -57.918 1.00 28.33  ? 88  LEU F CD2 1 
ATOM   5688 N  N   . ARG F  1 94  ? -14.664 22.105  -57.365 1.00 29.53  ? 89  ARG F N   1 
ATOM   5689 C  CA  . ARG F  1 94  ? -14.489 23.269  -56.503 1.00 35.76  ? 89  ARG F CA  1 
ATOM   5690 C  C   . ARG F  1 94  ? -15.714 23.465  -55.607 1.00 35.08  ? 89  ARG F C   1 
ATOM   5691 O  O   . ARG F  1 94  ? -15.602 23.930  -54.472 1.00 39.54  ? 89  ARG F O   1 
ATOM   5692 C  CB  . ARG F  1 94  ? -14.248 24.522  -57.352 1.00 42.27  ? 89  ARG F CB  1 
ATOM   5693 C  CG  . ARG F  1 94  ? -15.421 24.894  -58.256 1.00 51.20  ? 89  ARG F CG  1 
ATOM   5694 C  CD  . ARG F  1 94  ? -14.961 25.536  -59.556 1.00 61.40  ? 89  ARG F CD  1 
ATOM   5695 N  NE  . ARG F  1 94  ? -15.432 26.912  -59.696 1.00 66.11  ? 89  ARG F NE  1 
ATOM   5696 C  CZ  . ARG F  1 94  ? -16.612 27.252  -60.204 1.00 71.89  ? 89  ARG F CZ  1 
ATOM   5697 N  NH1 . ARG F  1 94  ? -17.455 26.316  -60.619 1.00 70.40  ? 89  ARG F NH1 1 
ATOM   5698 N  NH2 . ARG F  1 94  ? -16.952 28.531  -60.295 1.00 77.87  ? 89  ARG F NH2 1 
ATOM   5699 N  N   . GLU F  1 95  ? -16.878 23.086  -56.127 1.00 31.98  ? 90  GLU F N   1 
ATOM   5700 C  CA  . GLU F  1 95  ? -18.141 23.218  -55.413 1.00 34.02  ? 90  GLU F CA  1 
ATOM   5701 C  C   . GLU F  1 95  ? -18.162 22.334  -54.169 1.00 30.37  ? 90  GLU F C   1 
ATOM   5702 O  O   . GLU F  1 95  ? -18.879 22.612  -53.210 1.00 33.65  ? 90  GLU F O   1 
ATOM   5703 C  CB  . GLU F  1 95  ? -19.306 22.869  -56.346 1.00 38.48  ? 90  GLU F CB  1 
ATOM   5704 C  CG  . GLU F  1 95  ? -20.688 23.082  -55.753 1.00 56.36  ? 90  GLU F CG  1 
ATOM   5705 C  CD  . GLU F  1 95  ? -21.780 23.100  -56.808 1.00 70.98  ? 90  GLU F CD  1 
ATOM   5706 O  OE1 . GLU F  1 95  ? -21.516 23.578  -57.933 1.00 73.44  ? 90  GLU F OE1 1 
ATOM   5707 O  OE2 . GLU F  1 95  ? -22.903 22.637  -56.515 1.00 76.21  ? 90  GLU F OE2 1 
ATOM   5708 N  N   . VAL F  1 96  ? -17.367 21.269  -54.188 1.00 29.49  ? 91  VAL F N   1 
ATOM   5709 C  CA  . VAL F  1 96  ? -17.251 20.384  -53.036 1.00 32.19  ? 91  VAL F CA  1 
ATOM   5710 C  C   . VAL F  1 96  ? -16.507 21.082  -51.894 1.00 32.28  ? 91  VAL F C   1 
ATOM   5711 O  O   . VAL F  1 96  ? -16.788 20.841  -50.720 1.00 33.32  ? 91  VAL F O   1 
ATOM   5712 C  CB  . VAL F  1 96  ? -16.561 19.051  -53.416 1.00 36.33  ? 91  VAL F CB  1 
ATOM   5713 C  CG1 . VAL F  1 96  ? -16.327 18.180  -52.190 1.00 34.62  ? 91  VAL F CG1 1 
ATOM   5714 C  CG2 . VAL F  1 96  ? -17.396 18.306  -54.445 1.00 35.76  ? 91  VAL F CG2 1 
ATOM   5715 N  N   . LEU F  1 97  ? -15.573 21.965  -52.240 1.00 27.38  ? 92  LEU F N   1 
ATOM   5716 C  CA  . LEU F  1 97  ? -14.814 22.698  -51.226 1.00 31.08  ? 92  LEU F CA  1 
ATOM   5717 C  C   . LEU F  1 97  ? -15.382 24.089  -50.944 1.00 31.77  ? 92  LEU F C   1 
ATOM   5718 O  O   . LEU F  1 97  ? -14.689 24.951  -50.410 1.00 35.12  ? 92  LEU F O   1 
ATOM   5719 C  CB  . LEU F  1 97  ? -13.338 22.808  -51.620 1.00 35.27  ? 92  LEU F CB  1 
ATOM   5720 C  CG  . LEU F  1 97  ? -12.566 21.489  -51.706 1.00 42.51  ? 92  LEU F CG  1 
ATOM   5721 C  CD1 . LEU F  1 97  ? -11.070 21.739  -51.782 1.00 42.97  ? 92  LEU F CD1 1 
ATOM   5722 C  CD2 . LEU F  1 97  ? -12.903 20.584  -50.532 1.00 46.78  ? 92  LEU F CD2 1 
ATOM   5723 N  N   . ALA F  1 98  ? -16.644 24.301  -51.301 1.00 36.31  ? 93  ALA F N   1 
ATOM   5724 C  CA  . ALA F  1 98  ? -17.287 25.594  -51.093 1.00 39.67  ? 93  ALA F CA  1 
ATOM   5725 C  C   . ALA F  1 98  ? -17.749 25.788  -49.647 1.00 35.44  ? 93  ALA F C   1 
ATOM   5726 O  O   . ALA F  1 98  ? -17.792 26.912  -49.152 1.00 38.20  ? 93  ALA F O   1 
ATOM   5727 C  CB  . ALA F  1 98  ? -18.456 25.765  -52.058 1.00 39.66  ? 93  ALA F CB  1 
ATOM   5728 N  N   . THR F  1 99  ? -18.102 24.688  -48.981 1.00 31.23  ? 94  THR F N   1 
ATOM   5729 C  CA  . THR F  1 99  ? -18.601 24.718  -47.604 1.00 33.05  ? 94  THR F CA  1 
ATOM   5730 C  C   . THR F  1 99  ? -17.911 23.621  -46.777 1.00 28.48  ? 94  THR F C   1 
ATOM   5731 O  O   . THR F  1 99  ? -17.304 22.713  -47.347 1.00 27.13  ? 94  THR F O   1 
ATOM   5732 C  CB  . THR F  1 99  ? -20.140 24.511  -47.563 1.00 36.64  ? 94  THR F CB  1 
ATOM   5733 O  OG1 . THR F  1 99  ? -20.450 23.127  -47.757 1.00 31.17  ? 94  THR F OG1 1 
ATOM   5734 C  CG2 . THR F  1 99  ? -20.842 25.348  -48.629 1.00 39.57  ? 94  THR F CG2 1 
ATOM   5735 N  N   . PRO F  1 100 ? -17.997 23.692  -45.432 1.00 29.63  ? 95  PRO F N   1 
ATOM   5736 C  CA  . PRO F  1 100 ? -17.345 22.655  -44.616 1.00 29.29  ? 95  PRO F CA  1 
ATOM   5737 C  C   . PRO F  1 100 ? -18.014 21.284  -44.710 1.00 27.69  ? 95  PRO F C   1 
ATOM   5738 O  O   . PRO F  1 100 ? -17.465 20.307  -44.203 1.00 30.95  ? 95  PRO F O   1 
ATOM   5739 C  CB  . PRO F  1 100 ? -17.480 23.189  -43.184 1.00 31.29  ? 95  PRO F CB  1 
ATOM   5740 C  CG  . PRO F  1 100 ? -17.746 24.638  -43.328 1.00 42.89  ? 95  PRO F CG  1 
ATOM   5741 C  CD  . PRO F  1 100 ? -18.524 24.783  -44.595 1.00 31.85  ? 95  PRO F CD  1 
ATOM   5742 N  N   . SER F  1 101 ? -19.180 21.212  -45.341 1.00 26.85  ? 96  SER F N   1 
ATOM   5743 C  CA  . SER F  1 101 ? -19.857 19.934  -45.518 1.00 32.59  ? 96  SER F CA  1 
ATOM   5744 C  C   . SER F  1 101 ? -19.045 19.040  -46.449 1.00 31.51  ? 96  SER F C   1 
ATOM   5745 O  O   . SER F  1 101 ? -19.190 17.818  -46.434 1.00 25.40  ? 96  SER F O   1 
ATOM   5746 C  CB  . SER F  1 101 ? -21.265 20.135  -46.077 1.00 33.54  ? 96  SER F CB  1 
ATOM   5747 O  OG  . SER F  1 101 ? -21.224 20.440  -47.458 1.00 29.21  ? 96  SER F OG  1 
ATOM   5748 N  N   . LEU F  1 102 ? -18.191 19.672  -47.253 1.00 24.10  ? 97  LEU F N   1 
ATOM   5749 C  CA  . LEU F  1 102 ? -17.294 18.974  -48.169 1.00 23.35  ? 97  LEU F CA  1 
ATOM   5750 C  C   . LEU F  1 102 ? -18.056 18.040  -49.103 1.00 28.81  ? 97  LEU F C   1 
ATOM   5751 O  O   . LEU F  1 102 ? -17.605 16.936  -49.406 1.00 27.05  ? 97  LEU F O   1 
ATOM   5752 C  CB  . LEU F  1 102 ? -16.208 18.220  -47.394 1.00 24.24  ? 97  LEU F CB  1 
ATOM   5753 C  CG  . LEU F  1 102 ? -15.311 19.126  -46.542 1.00 25.94  ? 97  LEU F CG  1 
ATOM   5754 C  CD1 . LEU F  1 102 ? -14.334 18.316  -45.710 1.00 34.98  ? 97  LEU F CD1 1 
ATOM   5755 C  CD2 . LEU F  1 102 ? -14.572 20.125  -47.418 1.00 26.49  ? 97  LEU F CD2 1 
ATOM   5756 N  N   . SER F  1 103 ? -19.221 18.498  -49.549 1.00 26.62  ? 98  SER F N   1 
ATOM   5757 C  CA  . SER F  1 103 ? -20.044 17.734  -50.474 1.00 21.07  ? 98  SER F CA  1 
ATOM   5758 C  C   . SER F  1 103 ? -20.840 18.662  -51.381 1.00 29.75  ? 98  SER F C   1 
ATOM   5759 O  O   . SER F  1 103 ? -20.976 19.853  -51.103 1.00 28.93  ? 98  SER F O   1 
ATOM   5760 C  CB  . SER F  1 103 ? -21.002 16.819  -49.713 1.00 20.29  ? 98  SER F CB  1 
ATOM   5761 O  OG  . SER F  1 103 ? -21.965 17.573  -49.004 1.00 26.31  ? 98  SER F OG  1 
ATOM   5762 N  N   . ALA F  1 104 ? -21.367 18.101  -52.463 1.00 23.75  ? 99  ALA F N   1 
ATOM   5763 C  CA  . ALA F  1 104 ? -22.179 18.854  -53.406 1.00 21.68  ? 99  ALA F CA  1 
ATOM   5764 C  C   . ALA F  1 104 ? -22.943 17.884  -54.285 1.00 22.49  ? 99  ALA F C   1 
ATOM   5765 O  O   . ALA F  1 104 ? -22.498 16.759  -54.517 1.00 21.09  ? 99  ALA F O   1 
ATOM   5766 C  CB  . ALA F  1 104 ? -21.306 19.754  -54.266 1.00 19.63  ? 99  ALA F CB  1 
ATOM   5767 N  N   . SER F  1 105 ? -24.095 18.325  -54.770 1.00 18.57  ? 100 SER F N   1 
ATOM   5768 C  CA  . SER F  1 105 ? -24.835 17.559  -55.759 1.00 23.15  ? 100 SER F CA  1 
ATOM   5769 C  C   . SER F  1 105 ? -24.809 18.298  -57.082 1.00 29.49  ? 100 SER F C   1 
ATOM   5770 O  O   . SER F  1 105 ? -24.579 19.506  -57.128 1.00 23.07  ? 100 SER F O   1 
ATOM   5771 C  CB  . SER F  1 105 ? -26.278 17.341  -55.313 1.00 18.68  ? 100 SER F CB  1 
ATOM   5772 O  OG  . SER F  1 105 ? -26.991 18.565  -55.284 1.00 57.94  ? 100 SER F OG  1 
ATOM   5773 N  N   . PHE F  1 106 ? -25.038 17.566  -58.163 1.00 23.72  ? 101 PHE F N   1 
ATOM   5774 C  CA  . PHE F  1 106 ? -25.048 18.162  -59.485 1.00 21.86  ? 101 PHE F CA  1 
ATOM   5775 C  C   . PHE F  1 106 ? -26.173 17.566  -60.312 1.00 24.05  ? 101 PHE F C   1 
ATOM   5776 O  O   . PHE F  1 106 ? -26.363 16.350  -60.339 1.00 21.45  ? 101 PHE F O   1 
ATOM   5777 C  CB  . PHE F  1 106 ? -23.704 17.933  -60.185 1.00 22.64  ? 101 PHE F CB  1 
ATOM   5778 C  CG  . PHE F  1 106 ? -22.526 18.498  -59.438 1.00 26.38  ? 101 PHE F CG  1 
ATOM   5779 C  CD1 . PHE F  1 106 ? -21.880 17.749  -58.465 1.00 28.46  ? 101 PHE F CD1 1 
ATOM   5780 C  CD2 . PHE F  1 106 ? -22.071 19.780  -59.705 1.00 26.90  ? 101 PHE F CD2 1 
ATOM   5781 C  CE1 . PHE F  1 106 ? -20.799 18.270  -57.770 1.00 26.77  ? 101 PHE F CE1 1 
ATOM   5782 C  CE2 . PHE F  1 106 ? -20.988 20.307  -59.016 1.00 33.97  ? 101 PHE F CE2 1 
ATOM   5783 C  CZ  . PHE F  1 106 ? -20.351 19.550  -58.047 1.00 25.68  ? 101 PHE F CZ  1 
ATOM   5784 N  N   . ASN F  1 107 ? -26.938 18.432  -60.963 1.00 18.90  ? 102 ASN F N   1 
ATOM   5785 C  CA  . ASN F  1 107 ? -27.841 17.994  -62.012 1.00 21.36  ? 102 ASN F CA  1 
ATOM   5786 C  C   . ASN F  1 107 ? -27.354 18.622  -63.307 1.00 22.04  ? 102 ASN F C   1 
ATOM   5787 O  O   . ASN F  1 107 ? -27.647 19.780  -63.595 1.00 29.14  ? 102 ASN F O   1 
ATOM   5788 C  CB  . ASN F  1 107 ? -29.284 18.398  -61.716 1.00 24.74  ? 102 ASN F CB  1 
ATOM   5789 C  CG  . ASN F  1 107 ? -30.277 17.715  -62.639 1.00 22.72  ? 102 ASN F CG  1 
ATOM   5790 O  OD1 . ASN F  1 107 ? -29.900 17.153  -63.668 1.00 25.85  ? 102 ASN F OD1 1 
ATOM   5791 N  ND2 . ASN F  1 107 ? -31.553 17.762  -62.277 1.00 34.16  ? 102 ASN F ND2 1 
ATOM   5792 N  N   . ALA F  1 108 ? -26.583 17.857  -64.071 1.00 18.79  ? 103 ALA F N   1 
ATOM   5793 C  CA  . ALA F  1 108 ? -25.861 18.405  -65.207 1.00 23.38  ? 103 ALA F CA  1 
ATOM   5794 C  C   . ALA F  1 108 ? -26.481 17.999  -66.528 1.00 26.79  ? 103 ALA F C   1 
ATOM   5795 O  O   . ALA F  1 108 ? -26.746 16.821  -66.759 1.00 26.25  ? 103 ALA F O   1 
ATOM   5796 C  CB  . ALA F  1 108 ? -24.406 17.966  -65.163 1.00 22.50  ? 103 ALA F CB  1 
ATOM   5797 N  N   . PRO F  1 109 ? -26.710 18.981  -67.405 1.00 21.89  ? 104 PRO F N   1 
ATOM   5798 C  CA  . PRO F  1 109 ? -27.124 18.692  -68.777 1.00 31.62  ? 104 PRO F CA  1 
ATOM   5799 C  C   . PRO F  1 109 ? -25.996 17.996  -69.526 1.00 29.96  ? 104 PRO F C   1 
ATOM   5800 O  O   . PRO F  1 109 ? -24.837 18.400  -69.420 1.00 32.67  ? 104 PRO F O   1 
ATOM   5801 C  CB  . PRO F  1 109 ? -27.375 20.082  -69.365 1.00 25.24  ? 104 PRO F CB  1 
ATOM   5802 C  CG  . PRO F  1 109 ? -26.562 20.999  -68.530 1.00 29.07  ? 104 PRO F CG  1 
ATOM   5803 C  CD  . PRO F  1 109 ? -26.603 20.427  -67.153 1.00 24.89  ? 104 PRO F CD  1 
ATOM   5804 N  N   . LEU F  1 110 ? -26.334 16.947  -70.263 1.00 27.99  ? 105 LEU F N   1 
ATOM   5805 C  CA  . LEU F  1 110 ? -25.343 16.214  -71.033 1.00 29.88  ? 105 LEU F CA  1 
ATOM   5806 C  C   . LEU F  1 110 ? -25.189 16.835  -72.416 1.00 32.43  ? 105 LEU F C   1 
ATOM   5807 O  O   . LEU F  1 110 ? -26.177 17.165  -73.071 1.00 37.16  ? 105 LEU F O   1 
ATOM   5808 C  CB  . LEU F  1 110 ? -25.740 14.741  -71.142 1.00 28.61  ? 105 LEU F CB  1 
ATOM   5809 C  CG  . LEU F  1 110 ? -25.818 13.985  -69.812 1.00 28.69  ? 105 LEU F CG  1 
ATOM   5810 C  CD1 . LEU F  1 110 ? -26.483 12.634  -69.998 1.00 30.22  ? 105 LEU F CD1 1 
ATOM   5811 C  CD2 . LEU F  1 110 ? -24.432 13.818  -69.220 1.00 28.35  ? 105 LEU F CD2 1 
ATOM   5812 N  N   . LEU F  1 111 ? -23.944 17.000  -72.848 1.00 30.01  ? 106 LEU F N   1 
ATOM   5813 C  CA  . LEU F  1 111 ? -23.650 17.581  -74.151 1.00 33.63  ? 106 LEU F CA  1 
ATOM   5814 C  C   . LEU F  1 111 ? -23.090 16.501  -75.067 1.00 35.23  ? 106 LEU F C   1 
ATOM   5815 O  O   . LEU F  1 111 ? -22.348 15.627  -74.617 1.00 27.62  ? 106 LEU F O   1 
ATOM   5816 C  CB  . LEU F  1 111 ? -22.641 18.721  -74.004 1.00 31.69  ? 106 LEU F CB  1 
ATOM   5817 C  CG  . LEU F  1 111 ? -22.942 19.761  -72.920 1.00 33.32  ? 106 LEU F CG  1 
ATOM   5818 C  CD1 . LEU F  1 111 ? -21.855 20.827  -72.881 1.00 35.29  ? 106 LEU F CD1 1 
ATOM   5819 C  CD2 . LEU F  1 111 ? -24.304 20.397  -73.130 1.00 36.14  ? 106 LEU F CD2 1 
ATOM   5820 N  N   . ASP F  1 112 ? -23.439 16.556  -76.350 1.00 38.71  ? 107 ASP F N   1 
ATOM   5821 C  CA  . ASP F  1 112 ? -23.005 15.520  -77.283 1.00 41.90  ? 107 ASP F CA  1 
ATOM   5822 C  C   . ASP F  1 112 ? -21.555 15.678  -77.733 1.00 47.10  ? 107 ASP F C   1 
ATOM   5823 O  O   . ASP F  1 112 ? -20.794 16.455  -77.154 1.00 46.52  ? 107 ASP F O   1 
ATOM   5824 C  CB  . ASP F  1 112 ? -23.947 15.415  -78.493 1.00 45.05  ? 107 ASP F CB  1 
ATOM   5825 C  CG  . ASP F  1 112 ? -24.009 16.693  -79.317 1.00 54.25  ? 107 ASP F CG  1 
ATOM   5826 O  OD1 . ASP F  1 112 ? -23.044 17.488  -79.299 1.00 55.73  ? 107 ASP F OD1 1 
ATOM   5827 O  OD2 . ASP F  1 112 ? -25.036 16.894  -80.001 1.00 51.42  ? 107 ASP F OD2 1 
ATOM   5828 N  N   . THR F  1 113 ? -21.193 15.006  -78.816 1.00 55.16  ? 108 THR F N   1 
ATOM   5829 C  CA  . THR F  1 113 ? -19.818 15.016  -79.303 1.00 64.52  ? 108 THR F CA  1 
ATOM   5830 C  C   . THR F  1 113 ? -19.323 16.389  -79.724 1.00 71.56  ? 108 THR F C   1 
ATOM   5831 O  O   . THR F  1 113 ? -18.190 16.757  -79.456 1.00 72.29  ? 108 THR F O   1 
ATOM   5832 C  CB  . THR F  1 113 ? -19.660 14.100  -80.513 1.00 66.52  ? 108 THR F CB  1 
ATOM   5833 O  OG1 . THR F  1 113 ? -20.892 13.424  -80.758 1.00 67.47  ? 108 THR F OG1 1 
ATOM   5834 C  CG2 . THR F  1 113 ? -18.594 13.091  -80.254 1.00 67.97  ? 108 THR F CG2 1 
ATOM   5835 N  N   . LYS F  1 114 ? -20.151 17.125  -80.446 1.00 76.70  ? 109 LYS F N   1 
ATOM   5836 C  CA  . LYS F  1 114 ? -20.060 18.573  -80.453 1.00 77.70  ? 109 LYS F CA  1 
ATOM   5837 C  C   . LYS F  1 114 ? -20.713 19.065  -79.199 1.00 77.87  ? 109 LYS F C   1 
ATOM   5838 O  O   . LYS F  1 114 ? -21.762 18.560  -78.811 1.00 81.09  ? 109 LYS F O   1 
ATOM   5839 C  CB  . LYS F  1 114 ? -20.773 19.144  -81.667 1.00 77.63  ? 109 LYS F CB  1 
ATOM   5840 C  CG  . LYS F  1 114 ? -20.068 18.854  -82.979 1.00 82.22  ? 109 LYS F CG  1 
ATOM   5841 C  CD  . LYS F  1 114 ? -19.795 17.370  -83.142 1.00 81.72  ? 109 LYS F CD  1 
ATOM   5842 C  CE  . LYS F  1 114 ? -18.774 17.100  -84.236 1.00 84.72  ? 109 LYS F CE  1 
ATOM   5843 N  NZ  . LYS F  1 114 ? -17.975 15.880  -83.957 1.00 83.38  ? 109 LYS F NZ  1 
ATOM   5844 N  N   . LYS F  1 115 ? -20.135 20.062  -78.559 1.00 74.42  ? 110 LYS F N   1 
ATOM   5845 C  CA  . LYS F  1 115 ? -20.401 20.210  -77.156 1.00 65.18  ? 110 LYS F CA  1 
ATOM   5846 C  C   . LYS F  1 115 ? -21.762 20.870  -77.078 1.00 55.73  ? 110 LYS F C   1 
ATOM   5847 O  O   . LYS F  1 115 ? -21.936 21.888  -76.450 1.00 56.27  ? 110 LYS F O   1 
ATOM   5848 C  CB  . LYS F  1 115 ? -19.349 21.104  -76.500 1.00 69.23  ? 110 LYS F CB  1 
ATOM   5849 C  CG  . LYS F  1 115 ? -17.968 20.494  -76.352 1.00 71.74  ? 110 LYS F CG  1 
ATOM   5850 C  CD  . LYS F  1 115 ? -17.933 19.429  -75.285 1.00 72.08  ? 110 LYS F CD  1 
ATOM   5851 C  CE  . LYS F  1 115 ? -17.193 18.183  -75.758 1.00 76.88  ? 110 LYS F CE  1 
ATOM   5852 N  NZ  . LYS F  1 115 ? -17.553 16.966  -74.979 1.00 76.12  ? 110 LYS F NZ  1 
ATOM   5853 N  N   . GLN F  1 116 ? -22.746 20.227  -77.682 1.00 52.61  ? 111 GLN F N   1 
ATOM   5854 C  CA  . GLN F  1 116 ? -24.087 20.780  -77.730 1.00 57.34  ? 111 GLN F CA  1 
ATOM   5855 C  C   . GLN F  1 116 ? -25.161 19.905  -77.062 1.00 52.89  ? 111 GLN F C   1 
ATOM   5856 O  O   . GLN F  1 116 ? -25.152 18.690  -77.171 1.00 43.42  ? 111 GLN F O   1 
ATOM   5857 C  CB  . GLN F  1 116 ? -24.474 21.185  -79.154 1.00 65.08  ? 111 GLN F CB  1 
ATOM   5858 C  CG  . GLN F  1 116 ? -24.825 20.062  -80.102 1.00 67.46  ? 111 GLN F CG  1 
ATOM   5859 C  CD  . GLN F  1 116 ? -24.756 20.488  -81.563 1.00 72.82  ? 111 GLN F CD  1 
ATOM   5860 O  OE1 . GLN F  1 116 ? -25.027 21.632  -81.909 1.00 74.60  ? 111 GLN F OE1 1 
ATOM   5861 N  NE2 . GLN F  1 116 ? -24.389 19.558  -82.424 1.00 73.20  ? 111 GLN F NE2 1 
ATOM   5862 N  N   . PRO F  1 117 ? -26.056 20.563  -76.343 1.00 54.15  ? 112 PRO F N   1 
ATOM   5863 C  CA  . PRO F  1 117 ? -27.022 19.905  -75.453 1.00 52.72  ? 112 PRO F CA  1 
ATOM   5864 C  C   . PRO F  1 117 ? -27.857 18.821  -76.128 1.00 44.89  ? 112 PRO F C   1 
ATOM   5865 O  O   . PRO F  1 117 ? -28.370 19.013  -77.230 1.00 48.59  ? 112 PRO F O   1 
ATOM   5866 C  CB  . PRO F  1 117 ? -27.917 21.060  -75.005 1.00 57.97  ? 112 PRO F CB  1 
ATOM   5867 C  CG  . PRO F  1 117 ? -27.027 22.247  -75.052 1.00 58.16  ? 112 PRO F CG  1 
ATOM   5868 C  CD  . PRO F  1 117 ? -26.146 22.031  -76.249 1.00 56.18  ? 112 PRO F CD  1 
ATOM   5869 N  N   . THR F  1 118 ? -27.988 17.688  -75.447 1.00 40.09  ? 113 THR F N   1 
ATOM   5870 C  CA  . THR F  1 118 ? -28.723 16.545  -75.967 1.00 39.07  ? 113 THR F CA  1 
ATOM   5871 C  C   . THR F  1 118 ? -30.157 16.527  -75.453 1.00 38.18  ? 113 THR F C   1 
ATOM   5872 O  O   . THR F  1 118 ? -31.004 15.809  -75.983 1.00 40.38  ? 113 THR F O   1 
ATOM   5873 C  CB  . THR F  1 118 ? -28.050 15.230  -75.547 1.00 37.43  ? 113 THR F CB  1 
ATOM   5874 O  OG1 . THR F  1 118 ? -28.000 15.160  -74.116 1.00 35.23  ? 113 THR F OG1 1 
ATOM   5875 C  CG2 . THR F  1 118 ? -26.639 15.162  -76.093 1.00 39.32  ? 113 THR F CG2 1 
ATOM   5876 N  N   . GLY F  1 119 ? -30.421 17.317  -74.417 1.00 33.71  ? 114 GLY F N   1 
ATOM   5877 C  CA  . GLY F  1 119 ? -31.715 17.310  -73.757 1.00 31.90  ? 114 GLY F CA  1 
ATOM   5878 C  C   . GLY F  1 119 ? -31.709 16.387  -72.550 1.00 33.17  ? 114 GLY F C   1 
ATOM   5879 O  O   . GLY F  1 119 ? -32.617 16.413  -71.718 1.00 30.46  ? 114 GLY F O   1 
ATOM   5880 N  N   . ALA F  1 120 ? -30.674 15.560  -72.460 1.00 23.85  ? 115 ALA F N   1 
ATOM   5881 C  CA  . ALA F  1 120 ? -30.527 14.641  -71.342 1.00 24.78  ? 115 ALA F CA  1 
ATOM   5882 C  C   . ALA F  1 120 ? -29.815 15.333  -70.186 1.00 27.12  ? 115 ALA F C   1 
ATOM   5883 O  O   . ALA F  1 120 ? -29.067 16.288  -70.390 1.00 28.08  ? 115 ALA F O   1 
ATOM   5884 C  CB  . ALA F  1 120 ? -29.755 13.403  -71.775 1.00 31.09  ? 115 ALA F CB  1 
ATOM   5885 N  N   . SER F  1 121 ? -30.059 14.856  -68.972 1.00 23.05  ? 116 SER F N   1 
ATOM   5886 C  CA  . SER F  1 121 ? -29.338 15.357  -67.810 1.00 22.48  ? 116 SER F CA  1 
ATOM   5887 C  C   . SER F  1 121 ? -28.932 14.205  -66.900 1.00 24.76  ? 116 SER F C   1 
ATOM   5888 O  O   . SER F  1 121 ? -29.523 13.126  -66.952 1.00 22.76  ? 116 SER F O   1 
ATOM   5889 C  CB  . SER F  1 121 ? -30.172 16.390  -67.046 1.00 27.63  ? 116 SER F CB  1 
ATOM   5890 O  OG  . SER F  1 121 ? -31.358 15.819  -66.528 1.00 32.89  ? 116 SER F OG  1 
ATOM   5891 N  N   . LEU F  1 122 ? -27.916 14.440  -66.076 1.00 23.48  ? 117 LEU F N   1 
ATOM   5892 C  CA  . LEU F  1 122 ? -27.400 13.420  -65.173 1.00 19.27  ? 117 LEU F CA  1 
ATOM   5893 C  C   . LEU F  1 122 ? -27.341 13.945  -63.745 1.00 23.23  ? 117 LEU F C   1 
ATOM   5894 O  O   . LEU F  1 122 ? -26.803 15.024  -63.492 1.00 20.58  ? 117 LEU F O   1 
ATOM   5895 C  CB  . LEU F  1 122 ? -26.004 12.980  -65.605 1.00 24.24  ? 117 LEU F CB  1 
ATOM   5896 C  CG  . LEU F  1 122 ? -25.329 11.986  -64.660 1.00 29.48  ? 117 LEU F CG  1 
ATOM   5897 C  CD1 . LEU F  1 122 ? -25.791 10.562  -64.948 1.00 24.50  ? 117 LEU F CD1 1 
ATOM   5898 C  CD2 . LEU F  1 122 ? -23.817 12.108  -64.745 1.00 33.01  ? 117 LEU F CD2 1 
ATOM   5899 N  N   . VAL F  1 123 ? -27.892 13.176  -62.813 1.00 17.67  ? 118 VAL F N   1 
ATOM   5900 C  CA  . VAL F  1 123 ? -27.893 13.576  -61.413 1.00 18.73  ? 118 VAL F CA  1 
ATOM   5901 C  C   . VAL F  1 123 ? -26.880 12.766  -60.621 1.00 21.98  ? 118 VAL F C   1 
ATOM   5902 O  O   . VAL F  1 123 ? -26.874 11.533  -60.670 1.00 15.92  ? 118 VAL F O   1 
ATOM   5903 C  CB  . VAL F  1 123 ? -29.289 13.436  -60.777 1.00 18.92  ? 118 VAL F CB  1 
ATOM   5904 C  CG1 . VAL F  1 123 ? -29.220 13.712  -59.279 1.00 21.25  ? 118 VAL F CG1 1 
ATOM   5905 C  CG2 . VAL F  1 123 ? -30.274 14.385  -61.455 1.00 18.50  ? 118 VAL F CG2 1 
ATOM   5906 N  N   . LEU F  1 124 ? -26.019 13.471  -59.895 1.00 19.79  ? 119 LEU F N   1 
ATOM   5907 C  CA  . LEU F  1 124 ? -24.994 12.827  -59.089 1.00 20.76  ? 119 LEU F CA  1 
ATOM   5908 C  C   . LEU F  1 124 ? -24.676 13.627  -57.825 1.00 22.48  ? 119 LEU F C   1 
ATOM   5909 O  O   . LEU F  1 124 ? -24.953 14.824  -57.749 1.00 18.95  ? 119 LEU F O   1 
ATOM   5910 C  CB  . LEU F  1 124 ? -23.724 12.585  -59.913 1.00 22.08  ? 119 LEU F CB  1 
ATOM   5911 C  CG  . LEU F  1 124 ? -22.888 13.755  -60.443 1.00 26.48  ? 119 LEU F CG  1 
ATOM   5912 C  CD1 . LEU F  1 124 ? -21.522 13.240  -60.852 1.00 30.45  ? 119 LEU F CD1 1 
ATOM   5913 C  CD2 . LEU F  1 124 ? -23.545 14.457  -61.622 1.00 29.26  ? 119 LEU F CD2 1 
ATOM   5914 N  N   . GLN F  1 125 ? -24.116 12.949  -56.830 1.00 19.35  ? 120 GLN F N   1 
ATOM   5915 C  CA  . GLN F  1 125 ? -23.713 13.595  -55.585 1.00 24.79  ? 120 GLN F CA  1 
ATOM   5916 C  C   . GLN F  1 125 ? -22.261 13.244  -55.281 1.00 22.94  ? 120 GLN F C   1 
ATOM   5917 O  O   . GLN F  1 125 ? -21.840 12.101  -55.455 1.00 18.16  ? 120 GLN F O   1 
ATOM   5918 C  CB  . GLN F  1 125 ? -24.633 13.183  -54.430 1.00 17.25  ? 120 GLN F CB  1 
ATOM   5919 C  CG  . GLN F  1 125 ? -24.480 14.025  -53.160 1.00 17.95  ? 120 GLN F CG  1 
ATOM   5920 C  CD  . GLN F  1 125 ? -23.455 13.461  -52.189 1.00 18.42  ? 120 GLN F CD  1 
ATOM   5921 O  OE1 . GLN F  1 125 ? -22.937 12.361  -52.385 1.00 23.29  ? 120 GLN F OE1 1 
ATOM   5922 N  NE2 . GLN F  1 125 ? -23.164 14.211  -51.130 1.00 19.10  ? 120 GLN F NE2 1 
ATOM   5923 N  N   . VAL F  1 126 ? -21.491 14.234  -54.838 1.00 16.79  ? 121 VAL F N   1 
ATOM   5924 C  CA  . VAL F  1 126 ? -20.052 14.056  -54.648 1.00 17.32  ? 121 VAL F CA  1 
ATOM   5925 C  C   . VAL F  1 126 ? -19.608 14.591  -53.288 1.00 24.14  ? 121 VAL F C   1 
ATOM   5926 O  O   . VAL F  1 126 ? -20.041 15.664  -52.872 1.00 20.67  ? 121 VAL F O   1 
ATOM   5927 C  CB  . VAL F  1 126 ? -19.255 14.784  -55.756 1.00 24.71  ? 121 VAL F CB  1 
ATOM   5928 C  CG1 . VAL F  1 126 ? -17.761 14.605  -55.556 1.00 21.77  ? 121 VAL F CG1 1 
ATOM   5929 C  CG2 . VAL F  1 126 ? -19.672 14.294  -57.135 1.00 33.08  ? 121 VAL F CG2 1 
ATOM   5930 N  N   . SER F  1 127 ? -18.751 13.848  -52.592 1.00 20.86  ? 122 SER F N   1 
ATOM   5931 C  CA  . SER F  1 127 ? -18.237 14.312  -51.307 1.00 19.87  ? 122 SER F CA  1 
ATOM   5932 C  C   . SER F  1 127 ? -16.824 13.831  -51.006 1.00 31.42  ? 122 SER F C   1 
ATOM   5933 O  O   . SER F  1 127 ? -16.371 12.809  -51.522 1.00 25.75  ? 122 SER F O   1 
ATOM   5934 C  CB  . SER F  1 127 ? -19.169 13.901  -50.163 1.00 20.28  ? 122 SER F CB  1 
ATOM   5935 O  OG  . SER F  1 127 ? -19.044 12.525  -49.858 1.00 24.85  ? 122 SER F OG  1 
ATOM   5936 N  N   . TYR F  1 128 ? -16.140 14.590  -50.157 1.00 22.07  ? 123 TYR F N   1 
ATOM   5937 C  CA  . TYR F  1 128 ? -14.848 14.200  -49.619 1.00 35.77  ? 123 TYR F CA  1 
ATOM   5938 C  C   . TYR F  1 128 ? -15.092 13.434  -48.323 1.00 36.88  ? 123 TYR F C   1 
ATOM   5939 O  O   . TYR F  1 128 ? -15.834 13.896  -47.458 1.00 40.27  ? 123 TYR F O   1 
ATOM   5940 C  CB  . TYR F  1 128 ? -14.006 15.449  -49.350 1.00 45.44  ? 123 TYR F CB  1 
ATOM   5941 C  CG  . TYR F  1 128 ? -12.649 15.181  -48.740 1.00 61.13  ? 123 TYR F CG  1 
ATOM   5942 C  CD1 . TYR F  1 128 ? -12.495 15.058  -47.364 1.00 70.53  ? 123 TYR F CD1 1 
ATOM   5943 C  CD2 . TYR F  1 128 ? -11.518 15.070  -49.536 1.00 65.57  ? 123 TYR F CD2 1 
ATOM   5944 C  CE1 . TYR F  1 128 ? -11.260 14.816  -46.801 1.00 74.73  ? 123 TYR F CE1 1 
ATOM   5945 C  CE2 . TYR F  1 128 ? -10.272 14.828  -48.980 1.00 72.91  ? 123 TYR F CE2 1 
ATOM   5946 C  CZ  . TYR F  1 128 ? -10.150 14.703  -47.611 1.00 76.52  ? 123 TYR F CZ  1 
ATOM   5947 O  OH  . TYR F  1 128 ? -8.917  14.465  -47.050 1.00 79.66  ? 123 TYR F OH  1 
ATOM   5948 N  N   . THR F  1 129 ? -14.473 12.265  -48.188 1.00 35.62  ? 124 THR F N   1 
ATOM   5949 C  CA  . THR F  1 129 ? -14.696 11.432  -47.011 1.00 42.24  ? 124 THR F CA  1 
ATOM   5950 C  C   . THR F  1 129 ? -13.458 10.604  -46.666 1.00 44.59  ? 124 THR F C   1 
ATOM   5951 O  O   . THR F  1 129 ? -12.664 10.263  -47.542 1.00 40.73  ? 124 THR F O   1 
ATOM   5952 C  CB  . THR F  1 129 ? -15.930 10.511  -47.196 1.00 43.09  ? 124 THR F CB  1 
ATOM   5953 O  OG1 . THR F  1 129 ? -16.416 10.082  -45.918 1.00 45.58  ? 124 THR F OG1 1 
ATOM   5954 C  CG2 . THR F  1 129 ? -15.589 9.295   -48.047 1.00 35.29  ? 124 THR F CG2 1 
ATOM   5955 N  N   . ALA F  1 130 ? -13.296 10.296  -45.383 1.00 46.10  ? 125 ALA F N   1 
ATOM   5956 C  CA  . ALA F  1 130 ? -12.157 9.512   -44.919 1.00 46.11  ? 125 ALA F CA  1 
ATOM   5957 C  C   . ALA F  1 130 ? -12.437 8.017   -45.033 1.00 52.64  ? 125 ALA F C   1 
ATOM   5958 O  O   . ALA F  1 130 ? -11.555 7.233   -45.388 1.00 55.37  ? 125 ALA F O   1 
ATOM   5959 C  CB  . ALA F  1 130 ? -11.809 9.883   -43.485 1.00 39.61  ? 125 ALA F CB  1 
HETATM 5960 C  C   . FMT G  2 .   ? -0.186  10.903  -56.576 0.88 35.68  ? 201 FMT A C   1 
HETATM 5961 O  O1  . FMT G  2 .   ? 0.067   9.559   -56.888 0.88 42.33  ? 201 FMT A O1  1 
HETATM 5962 O  O2  . FMT G  2 .   ? 0.640   11.077  -55.455 0.88 34.57  ? 201 FMT A O2  1 
HETATM 5963 C  C   . FMT H  2 .   ? 19.829  9.246   -60.973 0.79 29.05  ? 202 FMT A C   1 
HETATM 5964 O  O1  . FMT H  2 .   ? 18.796  10.037  -61.477 0.79 24.20  ? 202 FMT A O1  1 
HETATM 5965 O  O2  . FMT H  2 .   ? 19.957  9.772   -59.684 0.79 37.81  ? 202 FMT A O2  1 
HETATM 5966 C  C   . FMT I  2 .   ? 1.378   14.207  -73.205 1.00 62.74  ? 203 FMT A C   1 
HETATM 5967 O  O1  . FMT I  2 .   ? 0.294   14.139  -72.317 1.00 59.61  ? 203 FMT A O1  1 
HETATM 5968 O  O2  . FMT I  2 .   ? 2.141   15.239  -72.638 1.00 57.73  ? 203 FMT A O2  1 
HETATM 5969 C  C   . FMT J  2 .   ? 11.146  11.527  -79.014 0.92 60.78  ? 204 FMT A C   1 
HETATM 5970 O  O1  . FMT J  2 .   ? 11.298  12.136  -77.765 0.92 59.83  ? 204 FMT A O1  1 
HETATM 5971 O  O2  . FMT J  2 .   ? 9.900   12.031  -79.406 0.92 64.65  ? 204 FMT A O2  1 
HETATM 5972 C  C   . FMT K  2 .   ? 17.789  -2.547  -69.493 0.89 53.79  ? 205 FMT A C   1 
HETATM 5973 O  O1  . FMT K  2 .   ? 16.551  -2.097  -69.035 0.89 53.26  ? 205 FMT A O1  1 
HETATM 5974 O  O2  . FMT K  2 .   ? 18.034  -1.675  -70.557 0.89 47.37  ? 205 FMT A O2  1 
HETATM 5975 C  C   . FMT L  2 .   ? 4.966   -9.598  -79.973 0.44 21.12  ? 206 FMT A C   1 
HETATM 5976 O  O1  . FMT L  2 .   ? 3.947   -8.635  -80.002 0.44 15.65  ? 206 FMT A O1  1 
HETATM 5977 O  O2  . FMT L  2 .   ? 4.227   -10.785 -80.099 0.44 26.24  ? 206 FMT A O2  1 
HETATM 5978 C  C   . FMT M  2 .   ? -6.122  13.174  -65.475 0.98 40.78  ? 207 FMT A C   1 
HETATM 5979 O  O1  . FMT M  2 .   ? -6.794  14.098  -64.658 0.98 38.93  ? 207 FMT A O1  1 
HETATM 5980 O  O2  . FMT M  2 .   ? -5.924  13.912  -66.647 0.98 34.09  ? 207 FMT A O2  1 
HETATM 5981 C  C   . FMT N  2 .   ? 13.701  11.740  -46.137 0.65 37.60  ? 208 FMT A C   1 
HETATM 5982 O  O1  . FMT N  2 .   ? 12.673  12.260  -45.338 0.65 35.40  ? 208 FMT A O1  1 
HETATM 5983 O  O2  . FMT N  2 .   ? 14.293  12.913  -46.627 0.65 29.21  ? 208 FMT A O2  1 
HETATM 5984 C  C   . FMT O  2 .   ? 17.906  6.360   -24.375 0.91 36.58  ? 201 FMT B C   1 
HETATM 5985 O  O1  . FMT O  2 .   ? 17.965  4.965   -24.497 0.91 32.56  ? 201 FMT B O1  1 
HETATM 5986 O  O2  . FMT O  2 .   ? 19.222  6.678   -24.004 0.91 35.75  ? 201 FMT B O2  1 
HETATM 5987 C  C   . FMT P  2 .   ? 10.825  4.672   -34.152 0.93 42.89  ? 202 FMT B C   1 
HETATM 5988 O  O1  . FMT P  2 .   ? 10.957  4.794   -32.764 0.93 37.80  ? 202 FMT B O1  1 
HETATM 5989 O  O2  . FMT P  2 .   ? 10.468  5.981   -34.516 0.93 38.38  ? 202 FMT B O2  1 
HETATM 5990 C  C   . FMT Q  2 .   ? 23.527  9.390   -25.971 0.75 14.12  ? 203 FMT B C   1 
HETATM 5991 O  O1  . FMT Q  2 .   ? 24.817  9.917   -26.124 0.75 29.97  ? 203 FMT B O1  1 
HETATM 5992 O  O2  . FMT Q  2 .   ? 23.821  8.044   -25.763 0.75 33.23  ? 203 FMT B O2  1 
HETATM 5993 C  C   . FMT R  2 .   ? 22.202  14.365  -25.629 1.00 54.06  ? 204 FMT B C   1 
HETATM 5994 O  O1  . FMT R  2 .   ? 20.851  14.740  -25.761 1.00 43.25  ? 204 FMT B O1  1 
HETATM 5995 O  O2  . FMT R  2 .   ? 22.098  13.068  -25.104 1.00 57.10  ? 204 FMT B O2  1 
HETATM 5996 C  C   . FMT S  2 .   ? 18.225  18.689  -50.141 0.68 41.47  ? 205 FMT B C   1 
HETATM 5997 O  O1  . FMT S  2 .   ? 18.250  18.704  -51.540 0.68 39.82  ? 205 FMT B O1  1 
HETATM 5998 O  O2  . FMT S  2 .   ? 16.867  18.931  -49.873 0.68 36.23  ? 205 FMT B O2  1 
HETATM 5999 C  C   . FMT T  2 .   ? 22.981  19.127  -51.560 1.00 64.47  ? 206 FMT B C   1 
HETATM 6000 O  O1  . FMT T  2 .   ? 24.270  18.728  -51.942 1.00 60.57  ? 206 FMT B O1  1 
HETATM 6001 O  O2  . FMT T  2 .   ? 23.151  19.318  -50.181 1.00 65.06  ? 206 FMT B O2  1 
HETATM 6002 C  C   . FMT U  2 .   ? 30.064  17.631  -50.289 0.85 48.12  ? 207 FMT B C   1 
HETATM 6003 O  O1  . FMT U  2 .   ? 30.304  16.646  -49.317 0.85 35.91  ? 207 FMT B O1  1 
HETATM 6004 O  O2  . FMT U  2 .   ? 28.671  17.487  -50.454 0.85 49.94  ? 207 FMT B O2  1 
HETATM 6005 C  C   . FMT V  2 .   ? 28.655  -27.011 -42.407 0.79 36.40  ? 201 FMT C C   1 
HETATM 6006 O  O1  . FMT V  2 .   ? 29.912  -26.465 -42.680 0.79 43.12  ? 201 FMT C O1  1 
HETATM 6007 O  O2  . FMT V  2 .   ? 28.238  -27.411 -43.680 0.79 25.91  ? 201 FMT C O2  1 
HETATM 6008 C  C   . FMT W  2 .   ? 2.836   -26.498 -46.174 0.91 44.52  ? 202 FMT C C   1 
HETATM 6009 O  O1  . FMT W  2 .   ? 1.969   -26.923 -45.165 0.91 39.54  ? 202 FMT C O1  1 
HETATM 6010 O  O2  . FMT W  2 .   ? 3.337   -27.709 -46.658 0.91 42.82  ? 202 FMT C O2  1 
HETATM 6011 C  C   . FMT X  2 .   ? 19.196  -7.363  -51.894 1.00 78.57  ? 203 FMT C C   1 
HETATM 6012 O  O1  . FMT X  2 .   ? 18.640  -6.557  -52.894 1.00 78.65  ? 203 FMT C O1  1 
HETATM 6013 O  O2  . FMT X  2 .   ? 20.563  -7.122  -52.079 1.00 79.08  ? 203 FMT C O2  1 
HETATM 6014 C  C   . FMT Y  2 .   ? 14.463  -1.302  -50.828 1.00 63.33  ? 204 FMT C C   1 
HETATM 6015 O  O1  . FMT Y  2 .   ? 15.440  -2.141  -50.280 1.00 62.01  ? 204 FMT C O1  1 
HETATM 6016 O  O2  . FMT Y  2 .   ? 15.179  -0.682  -51.858 1.00 64.33  ? 204 FMT C O2  1 
HETATM 6017 C  C   . FMT Z  2 .   ? -20.040 42.116  -85.132 0.79 34.74  ? 201 FMT D C   1 
HETATM 6018 O  O1  . FMT Z  2 .   ? -21.241 42.459  -85.774 0.79 24.17  ? 201 FMT D O1  1 
HETATM 6019 O  O2  . FMT Z  2 .   ? -19.464 41.181  -86.018 0.79 32.07  ? 201 FMT D O2  1 
HETATM 6020 C  C   . FMT AA 2 .   ? -27.343 35.489  -85.548 0.64 34.20  ? 202 FMT D C   1 
HETATM 6021 O  O1  . FMT AA 2 .   ? -25.976 35.264  -85.378 0.64 30.38  ? 202 FMT D O1  1 
HETATM 6022 O  O2  . FMT AA 2 .   ? -27.415 36.858  -85.282 0.64 34.23  ? 202 FMT D O2  1 
HETATM 6023 C  C   . FMT BA 2 .   ? -30.598 40.326  -82.421 0.92 42.60  ? 203 FMT D C   1 
HETATM 6024 O  O1  . FMT BA 2 .   ? -31.377 39.246  -82.818 0.92 24.27  ? 203 FMT D O1  1 
HETATM 6025 O  O2  . FMT BA 2 .   ? -30.930 41.303  -83.365 0.92 57.81  ? 203 FMT D O2  1 
HETATM 6026 C  C   . FMT CA 2 .   ? -38.758 47.699  -76.035 0.88 64.38  ? 204 FMT D C   1 
HETATM 6027 O  O1  . FMT CA 2 .   ? -37.786 47.598  -77.038 0.88 63.72  ? 204 FMT D O1  1 
HETATM 6028 O  O2  . FMT CA 2 .   ? -38.738 46.403  -75.508 0.88 62.57  ? 204 FMT D O2  1 
HETATM 6029 C  C   . FMT DA 2 .   ? -41.501 41.785  -77.207 1.00 48.52  ? 205 FMT D C   1 
HETATM 6030 O  O1  . FMT DA 2 .   ? -41.642 40.673  -78.048 1.00 42.37  ? 205 FMT D O1  1 
HETATM 6031 O  O2  . FMT DA 2 .   ? -40.184 42.173  -77.488 1.00 54.10  ? 205 FMT D O2  1 
HETATM 6032 C  C   . FMT EA 2 .   ? -26.107 41.311  -86.326 0.56 31.26  ? 206 FMT D C   1 
HETATM 6033 O  O1  . FMT EA 2 .   ? -27.174 41.180  -85.429 0.56 27.86  ? 206 FMT D O1  1 
HETATM 6034 O  O2  . FMT EA 2 .   ? -25.458 42.444  -85.815 0.56 35.68  ? 206 FMT D O2  1 
HETATM 6035 C  C   . FMT FA 2 .   ? -29.063 44.112  -83.430 0.72 35.67  ? 207 FMT D C   1 
HETATM 6036 O  O1  . FMT FA 2 .   ? -30.332 44.083  -82.833 0.72 39.43  ? 207 FMT D O1  1 
HETATM 6037 O  O2  . FMT FA 2 .   ? -28.478 45.195  -82.760 0.72 26.90  ? 207 FMT D O2  1 
HETATM 6038 C  C   . FMT GA 2 .   ? -24.337 46.328  -84.711 1.00 64.34  ? 208 FMT D C   1 
HETATM 6039 O  O1  . FMT GA 2 .   ? -25.595 46.941  -84.738 1.00 66.97  ? 208 FMT D O1  1 
HETATM 6040 O  O2  . FMT GA 2 .   ? -24.567 45.211  -85.521 1.00 64.74  ? 208 FMT D O2  1 
HETATM 6041 C  C   . FMT HA 2 .   ? -16.232 41.216  -77.309 0.66 31.63  ? 209 FMT D C   1 
HETATM 6042 O  O1  . FMT HA 2 .   ? -16.086 42.341  -76.486 0.66 35.59  ? 209 FMT D O1  1 
HETATM 6043 O  O2  . FMT HA 2 .   ? -15.418 40.276  -76.670 0.66 33.23  ? 209 FMT D O2  1 
HETATM 6044 C  C   . FMT IA 2 .   ? -17.815 33.259  -77.559 1.00 63.07  ? 210 FMT D C   1 
HETATM 6045 O  O1  . FMT IA 2 .   ? -17.965 34.560  -78.049 1.00 59.94  ? 210 FMT D O1  1 
HETATM 6046 O  O2  . FMT IA 2 .   ? -16.945 33.470  -76.481 1.00 63.81  ? 210 FMT D O2  1 
HETATM 6047 C  C   . FMT JA 2 .   ? -16.873 37.514  -77.801 0.80 38.17  ? 211 FMT D C   1 
HETATM 6048 O  O1  . FMT JA 2 .   ? -18.074 37.762  -77.118 0.80 32.71  ? 211 FMT D O1  1 
HETATM 6049 O  O2  . FMT JA 2 .   ? -17.354 37.094  -79.051 0.80 29.36  ? 211 FMT D O2  1 
HETATM 6050 C  C   . FMT KA 2 .   ? -31.896 38.700  -60.334 0.91 39.76  ? 212 FMT D C   1 
HETATM 6051 O  O1  . FMT KA 2 .   ? -32.736 39.607  -60.990 0.91 28.27  ? 212 FMT D O1  1 
HETATM 6052 O  O2  . FMT KA 2 .   ? -31.399 39.493  -59.292 0.91 50.79  ? 212 FMT D O2  1 
HETATM 6053 C  C   . FMT LA 2 .   ? -21.352 45.694  -49.683 0.93 51.45  ? 201 FMT E C   1 
HETATM 6054 O  O1  . FMT LA 2 .   ? -22.437 45.227  -48.926 0.93 43.65  ? 201 FMT E O1  1 
HETATM 6055 O  O2  . FMT LA 2 .   ? -21.431 47.078  -49.515 0.93 55.32  ? 201 FMT E O2  1 
HETATM 6056 C  C   . FMT MA 2 .   ? -3.256  44.626  -39.663 1.00 40.81  ? 202 FMT E C   1 
HETATM 6057 O  O1  . FMT MA 2 .   ? -2.470  43.658  -39.024 1.00 37.19  ? 202 FMT E O1  1 
HETATM 6058 O  O2  . FMT MA 2 .   ? -4.308  44.776  -38.756 1.00 38.74  ? 202 FMT E O2  1 
HETATM 6059 C  C   . FMT NA 2 .   ? 0.387   45.906  -41.913 1.00 69.10  ? 203 FMT E C   1 
HETATM 6060 O  O1  . FMT NA 2 .   ? -0.740  45.772  -41.097 1.00 70.40  ? 203 FMT E O1  1 
HETATM 6061 O  O2  . FMT NA 2 .   ? -0.204  45.954  -43.179 1.00 66.07  ? 203 FMT E O2  1 
HETATM 6062 C  C   . FMT OA 2 .   ? -5.335  43.932  -35.913 1.00 51.74  ? 204 FMT E C   1 
HETATM 6063 O  O1  . FMT OA 2 .   ? -5.721  42.945  -34.999 1.00 48.21  ? 204 FMT E O1  1 
HETATM 6064 O  O2  . FMT OA 2 .   ? -4.100  43.428  -36.343 1.00 48.13  ? 204 FMT E O2  1 
HETATM 6065 C  C   . FMT PA 2 .   ? -6.840  21.283  -37.784 0.94 55.98  ? 205 FMT E C   1 
HETATM 6066 O  O1  . FMT PA 2 .   ? -8.171  20.921  -37.547 0.94 59.57  ? 205 FMT E O1  1 
HETATM 6067 O  O2  . FMT PA 2 .   ? -6.926  22.679  -37.712 0.94 48.23  ? 205 FMT E O2  1 
HETATM 6068 C  C   . FMT QA 2 .   ? -10.632 27.867  -49.961 0.70 33.91  ? 206 FMT E C   1 
HETATM 6069 O  O1  . FMT QA 2 .   ? -11.075 26.691  -49.335 0.70 30.65  ? 206 FMT E O1  1 
HETATM 6070 O  O2  . FMT QA 2 .   ? -9.459  27.432  -50.596 0.70 27.10  ? 206 FMT E O2  1 
HETATM 6071 CA CA  . CA  RA 3 .   ? -2.392  27.394  -26.205 1.00 64.96  ? 207 CA  E CA  1 
HETATM 6072 C  C   . FMT SA 2 .   ? -30.200 16.890  -57.514 1.00 33.44  ? 201 FMT F C   1 
HETATM 6073 O  O1  . FMT SA 2 .   ? -29.102 17.727  -57.263 1.00 37.53  ? 201 FMT F O1  1 
HETATM 6074 O  O2  . FMT SA 2 .   ? -31.109 17.803  -58.044 1.00 34.54  ? 201 FMT F O2  1 
HETATM 6075 C  C   . FMT TA 2 .   ? -25.527 21.321  -54.344 0.81 44.60  ? 202 FMT F C   1 
HETATM 6076 O  O1  . FMT TA 2 .   ? -25.893 20.675  -53.159 0.81 48.90  ? 202 FMT F O1  1 
HETATM 6077 O  O2  . FMT TA 2 .   ? -24.140 21.393  -54.180 0.81 38.39  ? 202 FMT F O2  1 
HETATM 6078 O  O   . HOH UA 4 .   ? 17.765  10.765  -54.312 1.00 43.31  ? 301 HOH A O   1 
HETATM 6079 O  O   . HOH UA 4 .   ? 6.271   -0.769  -79.548 1.00 35.55  ? 302 HOH A O   1 
HETATM 6080 O  O   . HOH UA 4 .   ? 7.687   -3.479  -60.974 1.00 28.72  ? 303 HOH A O   1 
HETATM 6081 O  O   . HOH UA 4 .   ? 7.235   5.875   -52.038 1.00 35.90  ? 304 HOH A O   1 
HETATM 6082 O  O   . HOH UA 4 .   ? 6.515   4.325   -84.594 1.00 42.14  ? 305 HOH A O   1 
HETATM 6083 O  O   . HOH UA 4 .   ? -2.758  9.969   -58.792 1.00 37.36  ? 306 HOH A O   1 
HETATM 6084 O  O   . HOH UA 4 .   ? 8.665   -8.680  -66.008 1.00 32.40  ? 307 HOH A O   1 
HETATM 6085 O  O   . HOH UA 4 .   ? -2.212  8.488   -56.607 1.00 51.79  ? 308 HOH A O   1 
HETATM 6086 O  O   . HOH UA 4 .   ? 1.967   12.214  -53.879 1.00 46.31  ? 309 HOH A O   1 
HETATM 6087 O  O   . HOH UA 4 .   ? 0.708   8.434   -54.639 1.00 39.81  ? 310 HOH A O   1 
HETATM 6088 O  O   . HOH UA 4 .   ? 8.273   16.240  -50.828 1.00 55.41  ? 311 HOH A O   1 
HETATM 6089 O  O   . HOH UA 4 .   ? -0.307  -8.918  -70.725 1.00 46.48  ? 312 HOH A O   1 
HETATM 6090 O  O   . HOH UA 4 .   ? 16.352  -8.355  -74.873 1.00 67.19  ? 313 HOH A O   1 
HETATM 6091 O  O   . HOH UA 4 .   ? 19.108  -3.723  -72.223 1.00 52.62  ? 314 HOH A O   1 
HETATM 6092 O  O   . HOH UA 4 .   ? -3.569  5.157   -62.107 1.00 42.92  ? 315 HOH A O   1 
HETATM 6093 O  O   . HOH UA 4 .   ? 3.309   12.721  -75.921 1.00 41.58  ? 316 HOH A O   1 
HETATM 6094 O  O   . HOH UA 4 .   ? 21.042  8.496   -48.314 1.00 47.21  ? 317 HOH A O   1 
HETATM 6095 O  O   . HOH UA 4 .   ? 20.614  6.529   -49.758 1.00 51.75  ? 318 HOH A O   1 
HETATM 6096 O  O   . HOH UA 4 .   ? 12.923  14.124  -77.063 1.00 38.51  ? 319 HOH A O   1 
HETATM 6097 O  O   . HOH UA 4 .   ? -0.957  16.841  -69.097 1.00 48.07  ? 320 HOH A O   1 
HETATM 6098 O  O   . HOH UA 4 .   ? 3.185   -12.132 -78.571 1.00 51.25  ? 321 HOH A O   1 
HETATM 6099 O  O   . HOH UA 4 .   ? 11.696  3.038   -81.006 1.00 29.97  ? 322 HOH A O   1 
HETATM 6100 O  O   . HOH UA 4 .   ? 11.333  -0.460  -58.789 1.00 59.02  ? 323 HOH A O   1 
HETATM 6101 O  O   . HOH UA 4 .   ? 9.121   -1.155  -58.438 1.00 58.84  ? 324 HOH A O   1 
HETATM 6102 O  O   . HOH UA 4 .   ? 17.857  5.224   -58.246 1.00 45.16  ? 325 HOH A O   1 
HETATM 6103 O  O   . HOH UA 4 .   ? 22.272  10.451  -57.365 1.00 46.18  ? 326 HOH A O   1 
HETATM 6104 O  O   . HOH UA 4 .   ? 20.264  9.245   -57.453 1.00 54.13  ? 327 HOH A O   1 
HETATM 6105 O  O   . HOH UA 4 .   ? -1.523  -5.616  -61.862 1.00 75.44  ? 328 HOH A O   1 
HETATM 6106 O  O   . HOH UA 4 .   ? 19.228  6.474   -59.538 1.00 52.89  ? 329 HOH A O   1 
HETATM 6107 O  O   . HOH UA 4 .   ? 0.845   -14.483 -79.682 1.00 72.00  ? 330 HOH A O   1 
HETATM 6108 O  O   . HOH UA 4 .   ? 17.004  -2.383  -75.705 1.00 45.38  ? 331 HOH A O   1 
HETATM 6109 O  O   . HOH UA 4 .   ? 4.693   -8.212  -72.369 1.00 46.06  ? 332 HOH A O   1 
HETATM 6110 O  O   . HOH UA 4 .   ? -8.953  14.779  -62.411 1.00 35.64  ? 333 HOH A O   1 
HETATM 6111 O  O   . HOH UA 4 .   ? 10.556  21.377  -55.087 1.00 54.41  ? 334 HOH A O   1 
HETATM 6112 O  O   . HOH UA 4 .   ? 6.578   -1.193  -57.424 1.00 56.46  ? 335 HOH A O   1 
HETATM 6113 O  O   . HOH UA 4 .   ? 12.994  -0.102  -56.992 1.00 64.62  ? 336 HOH A O   1 
HETATM 6114 O  O   . HOH UA 4 .   ? 14.281  -0.059  -80.566 1.00 50.03  ? 337 HOH A O   1 
HETATM 6115 O  O   . HOH UA 4 .   ? 10.248  23.537  -67.508 1.00 53.58  ? 338 HOH A O   1 
HETATM 6116 O  O   . HOH UA 4 .   ? -5.437  9.933   -72.358 1.00 58.53  ? 339 HOH A O   1 
HETATM 6117 O  O   . HOH UA 4 .   ? -4.945  -17.773 -79.682 1.00 65.55  ? 340 HOH A O   1 
HETATM 6118 O  O   . HOH UA 4 .   ? 16.638  2.353   -58.285 1.00 56.09  ? 341 HOH A O   1 
HETATM 6119 O  O   . HOH UA 4 .   ? -3.885  6.215   -60.110 1.00 52.59  ? 342 HOH A O   1 
HETATM 6120 O  O   . HOH UA 4 .   ? 14.219  10.195  -79.099 1.00 73.91  ? 343 HOH A O   1 
HETATM 6121 O  O   . HOH UA 4 .   ? -3.154  -8.723  -66.848 1.00 64.90  ? 344 HOH A O   1 
HETATM 6122 O  O   . HOH UA 4 .   ? 12.821  -1.115  -82.490 1.00 72.68  ? 345 HOH A O   1 
HETATM 6123 O  O   . HOH UA 4 .   ? 13.649  14.127  -64.212 1.00 33.88  ? 346 HOH A O   1 
HETATM 6124 O  O   . HOH UA 4 .   ? 2.906   -1.106  -83.778 1.00 36.08  ? 347 HOH A O   1 
HETATM 6125 O  O   . HOH UA 4 .   ? 4.060   17.379  -69.616 1.00 28.25  ? 348 HOH A O   1 
HETATM 6126 O  O   . HOH UA 4 .   ? 0.480   18.977  -64.788 1.00 31.44  ? 349 HOH A O   1 
HETATM 6127 O  O   . HOH UA 4 .   ? 18.865  1.784   -65.982 1.00 45.35  ? 350 HOH A O   1 
HETATM 6128 O  O   . HOH UA 4 .   ? 17.438  8.674   -46.404 1.00 47.94  ? 351 HOH A O   1 
HETATM 6129 O  O   . HOH VA 4 .   ? 27.022  3.620   -35.356 1.00 18.75  ? 301 HOH B O   1 
HETATM 6130 O  O   . HOH VA 4 .   ? 25.347  26.009  -37.938 1.00 37.47  ? 302 HOH B O   1 
HETATM 6131 O  O   . HOH VA 4 .   ? 27.620  15.341  -48.145 1.00 26.70  ? 303 HOH B O   1 
HETATM 6132 O  O   . HOH VA 4 .   ? 23.396  -3.759  -42.724 1.00 42.01  ? 304 HOH B O   1 
HETATM 6133 O  O   . HOH VA 4 .   ? 15.268  0.096   -23.884 1.00 43.86  ? 305 HOH B O   1 
HETATM 6134 O  O   . HOH VA 4 .   ? 12.352  1.447   -41.751 1.00 39.68  ? 306 HOH B O   1 
HETATM 6135 O  O   . HOH VA 4 .   ? 21.543  -8.366  -47.992 1.00 39.30  ? 307 HOH B O   1 
HETATM 6136 O  O   . HOH VA 4 .   ? 25.107  16.196  -47.863 1.00 36.63  ? 308 HOH B O   1 
HETATM 6137 O  O   . HOH VA 4 .   ? 30.499  19.971  -46.401 1.00 43.20  ? 309 HOH B O   1 
HETATM 6138 O  O   . HOH VA 4 .   ? 17.820  12.590  -23.481 1.00 46.37  ? 310 HOH B O   1 
HETATM 6139 O  O   . HOH VA 4 .   ? 15.434  3.374   -25.709 1.00 43.42  ? 311 HOH B O   1 
HETATM 6140 O  O   . HOH VA 4 .   ? 11.086  8.482   -34.137 1.00 39.00  ? 312 HOH B O   1 
HETATM 6141 O  O   . HOH VA 4 .   ? 30.007  12.422  -29.198 1.00 32.89  ? 313 HOH B O   1 
HETATM 6142 O  O   . HOH VA 4 .   ? 31.521  27.412  -35.189 1.00 43.54  ? 314 HOH B O   1 
HETATM 6143 O  O   . HOH VA 4 .   ? 32.354  16.518  -31.884 1.00 51.16  ? 315 HOH B O   1 
HETATM 6144 O  O   . HOH VA 4 .   ? 29.679  2.478   -29.056 1.00 48.94  ? 316 HOH B O   1 
HETATM 6145 O  O   . HOH VA 4 .   ? 28.771  9.750   -27.371 1.00 42.89  ? 317 HOH B O   1 
HETATM 6146 O  O   . HOH VA 4 .   ? 12.701  4.025   -25.523 1.00 29.94  ? 318 HOH B O   1 
HETATM 6147 O  O   . HOH VA 4 .   ? 12.186  18.814  -31.993 1.00 55.93  ? 319 HOH B O   1 
HETATM 6148 O  O   . HOH VA 4 .   ? 14.651  24.830  -51.765 1.00 41.32  ? 320 HOH B O   1 
HETATM 6149 O  O   . HOH VA 4 .   ? 14.988  20.391  -29.659 1.00 43.86  ? 321 HOH B O   1 
HETATM 6150 O  O   . HOH VA 4 .   ? 15.259  12.862  -22.698 1.00 50.71  ? 322 HOH B O   1 
HETATM 6151 O  O   . HOH VA 4 .   ? 10.380  3.370   -43.646 1.00 61.22  ? 323 HOH B O   1 
HETATM 6152 O  O   . HOH VA 4 .   ? 10.359  0.946   -43.747 1.00 48.96  ? 324 HOH B O   1 
HETATM 6153 O  O   . HOH VA 4 .   ? 25.281  2.303   -46.221 1.00 30.50  ? 325 HOH B O   1 
HETATM 6154 O  O   . HOH VA 4 .   ? 31.394  23.151  -37.956 1.00 42.17  ? 326 HOH B O   1 
HETATM 6155 O  O   . HOH VA 4 .   ? 32.148  22.044  -36.113 1.00 39.14  ? 327 HOH B O   1 
HETATM 6156 O  O   . HOH VA 4 .   ? 25.130  4.440   -47.885 1.00 44.39  ? 328 HOH B O   1 
HETATM 6157 O  O   . HOH VA 4 .   ? 15.395  10.434  -21.793 1.00 58.88  ? 329 HOH B O   1 
HETATM 6158 O  O   . HOH VA 4 .   ? 29.044  4.091   -25.006 1.00 55.59  ? 330 HOH B O   1 
HETATM 6159 O  O   . HOH VA 4 .   ? 13.870  -5.472  -22.213 1.00 61.70  ? 331 HOH B O   1 
HETATM 6160 O  O   . HOH VA 4 .   ? 16.494  -8.105  -43.664 1.00 56.84  ? 332 HOH B O   1 
HETATM 6161 O  O   . HOH VA 4 .   ? 10.312  8.168   -31.666 1.00 50.02  ? 333 HOH B O   1 
HETATM 6162 O  O   . HOH VA 4 .   ? 2.629   30.060  -44.131 1.00 52.00  ? 334 HOH B O   1 
HETATM 6163 O  O   . HOH VA 4 .   ? 27.598  23.912  -50.218 1.00 56.24  ? 335 HOH B O   1 
HETATM 6164 O  O   . HOH VA 4 .   ? 12.477  -2.444  -38.854 1.00 58.78  ? 336 HOH B O   1 
HETATM 6165 O  O   . HOH VA 4 .   ? 31.648  3.806   -24.205 1.00 60.54  ? 337 HOH B O   1 
HETATM 6166 O  O   . HOH VA 4 .   ? 32.303  19.246  -33.390 1.00 50.91  ? 338 HOH B O   1 
HETATM 6167 O  O   . HOH VA 4 .   ? 21.178  21.710  -28.008 1.00 54.56  ? 339 HOH B O   1 
HETATM 6168 O  O   . HOH VA 4 .   ? 2.528   20.553  -41.865 1.00 63.22  ? 340 HOH B O   1 
HETATM 6169 O  O   . HOH VA 4 .   ? 27.059  13.539  -27.838 1.00 47.19  ? 341 HOH B O   1 
HETATM 6170 O  O   . HOH VA 4 .   ? 18.161  5.697   -47.768 1.00 53.27  ? 342 HOH B O   1 
HETATM 6171 O  O   . HOH VA 4 .   ? 29.534  -2.492  -29.133 1.00 31.81  ? 343 HOH B O   1 
HETATM 6172 O  O   . HOH VA 4 .   ? 24.127  12.003  -24.227 1.00 64.97  ? 344 HOH B O   1 
HETATM 6173 O  O   . HOH VA 4 .   ? 24.976  6.719   -48.196 1.00 54.91  ? 345 HOH B O   1 
HETATM 6174 O  O   . HOH VA 4 .   ? 25.171  16.914  -27.046 1.00 45.87  ? 346 HOH B O   1 
HETATM 6175 O  O   . HOH VA 4 .   ? 34.009  17.665  -33.246 1.00 61.11  ? 347 HOH B O   1 
HETATM 6176 O  O   . HOH VA 4 .   ? 31.861  -3.086  -27.391 1.00 72.46  ? 348 HOH B O   1 
HETATM 6177 O  O   . HOH VA 4 .   ? 11.677  -2.006  -41.001 1.00 64.14  ? 349 HOH B O   1 
HETATM 6178 O  O   . HOH VA 4 .   ? 8.015   10.154  -30.652 1.00 35.49  ? 350 HOH B O   1 
HETATM 6179 O  O   . HOH WA 4 .   ? 16.622  -18.506 -57.798 1.00 19.75  ? 301 HOH C O   1 
HETATM 6180 O  O   . HOH WA 4 .   ? 24.143  -26.742 -38.216 1.00 28.06  ? 302 HOH C O   1 
HETATM 6181 O  O   . HOH WA 4 .   ? 14.227  -0.539  -60.566 1.00 46.43  ? 303 HOH C O   1 
HETATM 6182 O  O   . HOH WA 4 .   ? 21.863  -11.035 -36.605 1.00 44.49  ? 304 HOH C O   1 
HETATM 6183 O  O   . HOH WA 4 .   ? 11.028  -27.738 -54.163 1.00 24.25  ? 305 HOH C O   1 
HETATM 6184 O  O   . HOH WA 4 .   ? 18.852  -28.938 -53.958 1.00 35.47  ? 306 HOH C O   1 
HETATM 6185 O  O   . HOH WA 4 .   ? 20.606  -8.722  -55.356 1.00 32.04  ? 307 HOH C O   1 
HETATM 6186 O  O   . HOH WA 4 .   ? 19.015  -6.561  -63.700 1.00 31.18  ? 308 HOH C O   1 
HETATM 6187 O  O   . HOH WA 4 .   ? 30.959  -26.741 -45.004 1.00 49.77  ? 309 HOH C O   1 
HETATM 6188 O  O   . HOH WA 4 .   ? 3.707   -15.669 -48.410 1.00 43.69  ? 310 HOH C O   1 
HETATM 6189 O  O   . HOH WA 4 .   ? 9.780   -27.277 -39.617 1.00 45.94  ? 311 HOH C O   1 
HETATM 6190 O  O   . HOH WA 4 .   ? 19.693  -4.035  -63.147 1.00 49.87  ? 312 HOH C O   1 
HETATM 6191 O  O   . HOH WA 4 .   ? 22.182  -30.455 -51.030 1.00 53.94  ? 313 HOH C O   1 
HETATM 6192 O  O   . HOH WA 4 .   ? 16.728  -9.835  -41.847 1.00 45.51  ? 314 HOH C O   1 
HETATM 6193 O  O   . HOH WA 4 .   ? 26.597  -23.713 -30.635 1.00 42.94  ? 315 HOH C O   1 
HETATM 6194 O  O   . HOH WA 4 .   ? 5.602   -16.337 -46.036 1.00 53.44  ? 316 HOH C O   1 
HETATM 6195 O  O   . HOH WA 4 .   ? 15.018  -24.578 -62.063 1.00 53.50  ? 317 HOH C O   1 
HETATM 6196 O  O   . HOH WA 4 .   ? 8.160   -29.888 -45.507 1.00 54.56  ? 318 HOH C O   1 
HETATM 6197 O  O   . HOH WA 4 .   ? 15.785  -31.549 -48.120 1.00 40.46  ? 319 HOH C O   1 
HETATM 6198 O  O   . HOH WA 4 .   ? 5.651   -26.705 -54.548 1.00 49.43  ? 320 HOH C O   1 
HETATM 6199 O  O   . HOH WA 4 .   ? 31.834  -15.420 -45.212 1.00 50.85  ? 321 HOH C O   1 
HETATM 6200 O  O   . HOH WA 4 .   ? 24.655  -31.329 -32.113 1.00 34.47  ? 322 HOH C O   1 
HETATM 6201 O  O   . HOH WA 4 .   ? 29.084  -12.091 -42.103 1.00 53.92  ? 323 HOH C O   1 
HETATM 6202 O  O   . HOH WA 4 .   ? 30.906  -12.139 -40.604 1.00 63.89  ? 324 HOH C O   1 
HETATM 6203 O  O   . HOH WA 4 .   ? 3.896   -19.852 -66.578 1.00 59.58  ? 325 HOH C O   1 
HETATM 6204 O  O   . HOH WA 4 .   ? 10.779  -29.680 -48.083 1.00 35.88  ? 326 HOH C O   1 
HETATM 6205 O  O   . HOH WA 4 .   ? 16.328  -13.619 -64.464 1.00 44.02  ? 327 HOH C O   1 
HETATM 6206 O  O   . HOH WA 4 .   ? 12.203  -30.083 -50.625 1.00 45.81  ? 328 HOH C O   1 
HETATM 6207 O  O   . HOH WA 4 .   ? 5.805   -29.146 -47.700 1.00 55.90  ? 329 HOH C O   1 
HETATM 6208 O  O   . HOH WA 4 .   ? 4.910   -17.554 -42.162 1.00 54.80  ? 330 HOH C O   1 
HETATM 6209 O  O   . HOH WA 4 .   ? 22.032  -17.908 -33.583 1.00 37.85  ? 331 HOH C O   1 
HETATM 6210 O  O   . HOH WA 4 .   ? 31.035  -24.544 -42.878 1.00 62.63  ? 332 HOH C O   1 
HETATM 6211 O  O   . HOH WA 4 .   ? 16.745  -2.895  -52.602 1.00 59.81  ? 333 HOH C O   1 
HETATM 6212 O  O   . HOH WA 4 .   ? 14.798  -13.172 -66.066 1.00 59.20  ? 334 HOH C O   1 
HETATM 6213 O  O   . HOH WA 4 .   ? 20.654  -12.625 -58.284 1.00 28.70  ? 335 HOH C O   1 
HETATM 6214 O  O   . HOH WA 4 .   ? 18.243  -14.476 -62.853 1.00 42.09  ? 336 HOH C O   1 
HETATM 6215 O  O   . HOH WA 4 .   ? 23.571  -33.416 -32.088 1.00 45.97  ? 337 HOH C O   1 
HETATM 6216 O  O   . HOH WA 4 .   ? 21.367  -26.842 -26.575 1.00 49.74  ? 338 HOH C O   1 
HETATM 6217 O  O   . HOH WA 4 .   ? 30.580  -19.273 -43.501 1.00 82.92  ? 339 HOH C O   1 
HETATM 6218 O  O   . HOH WA 4 .   ? 20.383  -25.136 -25.889 1.00 66.84  ? 340 HOH C O   1 
HETATM 6219 O  O   . HOH WA 4 .   ? 22.578  -8.420  -53.337 1.00 67.79  ? 341 HOH C O   1 
HETATM 6220 O  O   . HOH WA 4 .   ? 14.287  -30.246 -19.949 1.00 53.46  ? 342 HOH C O   1 
HETATM 6221 O  O   . HOH WA 4 .   ? 31.237  -28.357 -41.275 1.00 61.74  ? 343 HOH C O   1 
HETATM 6222 O  O   . HOH WA 4 .   ? 16.083  -6.890  -47.538 1.00 61.42  ? 344 HOH C O   1 
HETATM 6223 O  O   . HOH WA 4 .   ? 28.637  -30.488 -44.780 1.00 62.77  ? 345 HOH C O   1 
HETATM 6224 O  O   . HOH WA 4 .   ? 31.917  -28.933 -37.434 1.00 54.24  ? 346 HOH C O   1 
HETATM 6225 O  O   . HOH WA 4 .   ? 29.811  -32.059 -46.197 1.00 68.37  ? 347 HOH C O   1 
HETATM 6226 O  O   . HOH WA 4 .   ? 29.259  -30.454 -40.453 1.00 51.62  ? 348 HOH C O   1 
HETATM 6227 O  O   . HOH WA 4 .   ? 7.247   -29.229 -50.432 1.00 58.54  ? 349 HOH C O   1 
HETATM 6228 O  O   . HOH XA 4 .   ? -33.347 33.334  -73.038 1.00 23.04  ? 301 HOH D O   1 
HETATM 6229 O  O   . HOH XA 4 .   ? -36.875 42.901  -78.509 1.00 31.59  ? 302 HOH D O   1 
HETATM 6230 O  O   . HOH XA 4 .   ? -35.265 27.948  -69.552 1.00 31.55  ? 303 HOH D O   1 
HETATM 6231 O  O   . HOH XA 4 .   ? -17.427 47.037  -78.054 1.00 49.48  ? 304 HOH D O   1 
HETATM 6232 O  O   . HOH XA 4 .   ? -26.421 48.690  -58.475 1.00 44.43  ? 305 HOH D O   1 
HETATM 6233 O  O   . HOH XA 4 .   ? -32.355 47.449  -81.013 1.00 43.14  ? 306 HOH D O   1 
HETATM 6234 O  O   . HOH XA 4 .   ? -33.278 42.031  -82.451 1.00 61.53  ? 307 HOH D O   1 
HETATM 6235 O  O   . HOH XA 4 .   ? -19.522 43.214  -88.320 1.00 48.14  ? 308 HOH D O   1 
HETATM 6236 O  O   . HOH XA 4 .   ? -24.471 33.868  -84.155 1.00 41.47  ? 309 HOH D O   1 
HETATM 6237 O  O   . HOH XA 4 .   ? -31.640 53.503  -60.669 1.00 48.24  ? 310 HOH D O   1 
HETATM 6238 O  O   . HOH XA 4 .   ? -15.093 47.853  -78.993 1.00 55.25  ? 311 HOH D O   1 
HETATM 6239 O  O   . HOH XA 4 .   ? -36.803 53.024  -64.876 1.00 43.77  ? 312 HOH D O   1 
HETATM 6240 O  O   . HOH XA 4 .   ? -41.084 47.213  -71.881 1.00 33.09  ? 313 HOH D O   1 
HETATM 6241 O  O   . HOH XA 4 .   ? -30.160 31.710  -62.716 1.00 30.49  ? 314 HOH D O   1 
HETATM 6242 O  O   . HOH XA 4 .   ? -35.234 38.798  -81.259 1.00 53.87  ? 315 HOH D O   1 
HETATM 6243 O  O   . HOH XA 4 .   ? -37.097 26.048  -69.144 1.00 53.13  ? 316 HOH D O   1 
HETATM 6244 O  O   . HOH XA 4 .   ? -20.147 39.523  -87.515 1.00 51.67  ? 317 HOH D O   1 
HETATM 6245 O  O   . HOH XA 4 .   ? -25.749 21.347  -61.563 1.00 49.05  ? 318 HOH D O   1 
HETATM 6246 O  O   . HOH XA 4 .   ? -24.950 63.275  -74.150 1.00 47.54  ? 319 HOH D O   1 
HETATM 6247 O  O   . HOH XA 4 .   ? -29.840 28.957  -63.599 1.00 58.36  ? 320 HOH D O   1 
HETATM 6248 O  O   . HOH XA 4 .   ? -36.000 58.815  -69.648 1.00 54.05  ? 321 HOH D O   1 
HETATM 6249 O  O   . HOH XA 4 .   ? -14.663 34.197  -74.777 1.00 47.89  ? 322 HOH D O   1 
HETATM 6250 O  O   . HOH XA 4 .   ? -12.620 37.623  -71.506 1.00 66.46  ? 323 HOH D O   1 
HETATM 6251 O  O   . HOH XA 4 .   ? -37.255 27.784  -79.049 1.00 48.86  ? 324 HOH D O   1 
HETATM 6252 O  O   . HOH XA 4 .   ? -33.328 23.180  -63.998 1.00 32.58  ? 325 HOH D O   1 
HETATM 6253 O  O   . HOH XA 4 .   ? -36.506 53.481  -68.849 1.00 36.87  ? 326 HOH D O   1 
HETATM 6254 O  O   . HOH XA 4 .   ? -38.199 39.731  -77.913 1.00 58.84  ? 327 HOH D O   1 
HETATM 6255 O  O   . HOH XA 4 .   ? -36.734 32.107  -79.253 1.00 43.02  ? 328 HOH D O   1 
HETATM 6256 O  O   . HOH XA 4 .   ? -26.891 49.518  -62.155 1.00 64.04  ? 329 HOH D O   1 
HETATM 6257 O  O   . HOH XA 4 .   ? -33.304 31.245  -66.027 1.00 26.52  ? 330 HOH D O   1 
HETATM 6258 O  O   . HOH XA 4 .   ? -30.699 46.073  -81.557 1.00 54.50  ? 331 HOH D O   1 
HETATM 6259 O  O   . HOH XA 4 .   ? -41.210 47.286  -69.667 1.00 55.74  ? 332 HOH D O   1 
HETATM 6260 O  O   . HOH XA 4 .   ? -37.219 54.692  -62.369 1.00 59.36  ? 333 HOH D O   1 
HETATM 6261 O  O   . HOH XA 4 .   ? -19.182 28.128  -78.948 1.00 53.59  ? 334 HOH D O   1 
HETATM 6262 O  O   . HOH XA 4 .   ? -37.085 32.998  -83.280 1.00 49.32  ? 335 HOH D O   1 
HETATM 6263 O  O   . HOH XA 4 .   ? -30.998 36.757  -84.618 1.00 47.96  ? 336 HOH D O   1 
HETATM 6264 O  O   . HOH XA 4 .   ? -42.421 47.921  -67.903 1.00 54.05  ? 337 HOH D O   1 
HETATM 6265 O  O   . HOH XA 4 .   ? -26.113 25.399  -84.204 1.00 69.19  ? 338 HOH D O   1 
HETATM 6266 O  O   . HOH XA 4 .   ? -27.695 60.827  -61.171 1.00 46.69  ? 339 HOH D O   1 
HETATM 6267 O  O   . HOH XA 4 .   ? -21.124 49.867  -79.638 1.00 46.02  ? 340 HOH D O   1 
HETATM 6268 O  O   . HOH YA 4 .   ? -7.628  29.926  -30.963 1.00 23.87  ? 301 HOH E O   1 
HETATM 6269 O  O   . HOH YA 4 .   ? 1.982   35.881  -39.765 1.00 36.08  ? 302 HOH E O   1 
HETATM 6270 O  O   . HOH YA 4 .   ? -11.570 21.501  -43.732 1.00 27.13  ? 303 HOH E O   1 
HETATM 6271 O  O   . HOH YA 4 .   ? -15.815 50.246  -43.581 1.00 41.78  ? 304 HOH E O   1 
HETATM 6272 O  O   . HOH YA 4 .   ? -6.945  23.906  -39.837 1.00 40.09  ? 305 HOH E O   1 
HETATM 6273 O  O   . HOH YA 4 .   ? -1.165  39.150  -52.536 1.00 46.40  ? 306 HOH E O   1 
HETATM 6274 O  O   . HOH YA 4 .   ? -8.382  44.667  -36.685 1.00 42.12  ? 307 HOH E O   1 
HETATM 6275 O  O   . HOH YA 4 .   ? -22.531 35.100  -50.086 1.00 35.50  ? 308 HOH E O   1 
HETATM 6276 O  O   . HOH YA 4 .   ? -9.541  32.515  -25.347 1.00 36.36  ? 309 HOH E O   1 
HETATM 6277 O  O   . HOH YA 4 .   ? -17.151 43.834  -45.980 1.00 18.73  ? 310 HOH E O   1 
HETATM 6278 O  O   . HOH YA 4 .   ? -14.199 15.733  -38.819 1.00 72.66  ? 311 HOH E O   1 
HETATM 6279 O  O   . HOH YA 4 .   ? -3.869  21.681  -39.276 1.00 44.26  ? 312 HOH E O   1 
HETATM 6280 O  O   . HOH YA 4 .   ? -14.916 56.395  -48.994 1.00 65.50  ? 313 HOH E O   1 
HETATM 6281 O  O   . HOH YA 4 .   ? -17.159 29.633  -52.991 1.00 56.39  ? 314 HOH E O   1 
HETATM 6282 O  O   . HOH YA 4 .   ? -11.799 45.233  -36.226 1.00 31.87  ? 315 HOH E O   1 
HETATM 6283 O  O   . HOH YA 4 .   ? 0.085   20.940  -43.045 1.00 48.14  ? 316 HOH E O   1 
HETATM 6284 O  O   . HOH YA 4 .   ? -2.016  27.298  -51.353 1.00 52.17  ? 317 HOH E O   1 
HETATM 6285 O  O   . HOH YA 4 .   ? 10.488  25.932  -34.545 1.00 42.67  ? 318 HOH E O   1 
HETATM 6286 O  O   . HOH YA 4 .   ? -15.095 29.170  -50.396 1.00 47.74  ? 319 HOH E O   1 
HETATM 6287 O  O   . HOH YA 4 .   ? -11.537 16.331  -38.595 1.00 57.30  ? 320 HOH E O   1 
HETATM 6288 O  O   . HOH YA 4 .   ? -14.471 54.287  -52.748 1.00 65.86  ? 321 HOH E O   1 
HETATM 6289 O  O   . HOH YA 4 .   ? -14.750 18.968  -38.830 1.00 50.63  ? 322 HOH E O   1 
HETATM 6290 O  O   . HOH YA 4 .   ? -13.591 53.208  -43.355 1.00 54.20  ? 323 HOH E O   1 
HETATM 6291 O  O   . HOH YA 4 .   ? -3.667  47.749  -51.124 1.00 46.27  ? 324 HOH E O   1 
HETATM 6292 O  O   . HOH YA 4 .   ? -1.275  47.877  -52.190 1.00 44.96  ? 325 HOH E O   1 
HETATM 6293 O  O   . HOH YA 4 .   ? -18.715 27.737  -33.745 1.00 44.67  ? 326 HOH E O   1 
HETATM 6294 O  O   . HOH YA 4 .   ? -13.195 32.991  -28.935 1.00 24.41  ? 327 HOH E O   1 
HETATM 6295 O  O   . HOH YA 4 .   ? -12.384 31.845  -26.874 1.00 43.13  ? 328 HOH E O   1 
HETATM 6296 O  O   . HOH YA 4 .   ? -19.756 40.834  -63.055 1.00 38.55  ? 329 HOH E O   1 
HETATM 6297 O  O   . HOH YA 4 .   ? -15.949 33.028  -27.605 1.00 57.40  ? 330 HOH E O   1 
HETATM 6298 O  O   . HOH YA 4 .   ? -13.637 29.370  -52.124 1.00 68.10  ? 331 HOH E O   1 
HETATM 6299 O  O   . HOH YA 4 .   ? -2.747  12.536  -49.212 1.00 50.98  ? 332 HOH E O   1 
HETATM 6300 O  O   . HOH YA 4 .   ? -11.724 52.747  -57.019 1.00 59.88  ? 333 HOH E O   1 
HETATM 6301 O  O   . HOH YA 4 .   ? 4.803   31.561  -43.433 1.00 65.78  ? 334 HOH E O   1 
HETATM 6302 O  O   . HOH YA 4 .   ? -4.662  49.340  -45.941 1.00 41.06  ? 335 HOH E O   1 
HETATM 6303 O  O   . HOH YA 4 .   ? -21.011 49.640  -47.732 1.00 60.15  ? 336 HOH E O   1 
HETATM 6304 O  O   . HOH YA 4 .   ? 7.008   32.382  -41.610 1.00 49.20  ? 337 HOH E O   1 
HETATM 6305 O  O   . HOH YA 4 .   ? -16.490 29.240  -33.326 1.00 51.38  ? 338 HOH E O   1 
HETATM 6306 O  O   . HOH YA 4 .   ? -9.929  19.545  -37.479 1.00 52.65  ? 339 HOH E O   1 
HETATM 6307 O  O   . HOH YA 4 .   ? -1.180  28.831  -24.666 1.00 46.88  ? 340 HOH E O   1 
HETATM 6308 O  O   . HOH YA 4 .   ? -21.885 36.746  -63.347 1.00 58.64  ? 341 HOH E O   1 
HETATM 6309 O  O   . HOH YA 4 .   ? -22.079 39.571  -54.826 1.00 33.61  ? 342 HOH E O   1 
HETATM 6310 O  O   . HOH YA 4 .   ? -7.282  47.718  -41.715 1.00 29.92  ? 343 HOH E O   1 
HETATM 6311 O  O   . HOH YA 4 .   ? -5.682  56.380  -52.067 1.00 46.64  ? 344 HOH E O   1 
HETATM 6312 O  O   . HOH YA 4 .   ? 0.120   27.920  -29.686 1.00 50.35  ? 345 HOH E O   1 
HETATM 6313 O  O   . HOH YA 4 .   ? 0.641   31.913  -27.484 1.00 53.42  ? 346 HOH E O   1 
HETATM 6314 O  O   . HOH ZA 4 .   ? -20.640 11.113  -51.630 1.00 21.19  ? 301 HOH F O   1 
HETATM 6315 O  O   . HOH ZA 4 .   ? -31.181 3.019   -69.960 1.00 27.01  ? 302 HOH F O   1 
HETATM 6316 O  O   . HOH ZA 4 .   ? -19.089 21.879  -49.921 1.00 29.45  ? 303 HOH F O   1 
HETATM 6317 O  O   . HOH ZA 4 .   ? -28.676 18.512  -72.252 1.00 34.33  ? 304 HOH F O   1 
HETATM 6318 O  O   . HOH ZA 4 .   ? -35.819 2.929   -73.724 1.00 34.38  ? 305 HOH F O   1 
HETATM 6319 O  O   . HOH ZA 4 .   ? -33.897 15.436  -61.939 1.00 31.95  ? 306 HOH F O   1 
HETATM 6320 O  O   . HOH ZA 4 .   ? -9.003  12.105  -64.760 1.00 51.91  ? 307 HOH F O   1 
HETATM 6321 O  O   . HOH ZA 4 .   ? -33.993 2.496   -64.171 1.00 32.35  ? 308 HOH F O   1 
HETATM 6322 O  O   . HOH ZA 4 .   ? -33.666 7.618   -80.488 1.00 45.68  ? 309 HOH F O   1 
HETATM 6323 O  O   . HOH ZA 4 .   ? -18.211 5.928   -47.708 1.00 47.65  ? 310 HOH F O   1 
HETATM 6324 O  O   . HOH ZA 4 .   ? -16.775 3.107   -71.602 1.00 36.76  ? 311 HOH F O   1 
HETATM 6325 O  O   . HOH ZA 4 .   ? -4.912  8.738   -59.672 1.00 40.92  ? 312 HOH F O   1 
HETATM 6326 O  O   . HOH ZA 4 .   ? -13.307 22.637  -60.034 1.00 38.26  ? 313 HOH F O   1 
HETATM 6327 O  O   . HOH ZA 4 .   ? -33.003 0.361   -61.712 1.00 52.35  ? 314 HOH F O   1 
HETATM 6328 O  O   . HOH ZA 4 .   ? -25.835 11.829  -79.147 1.00 44.17  ? 315 HOH F O   1 
HETATM 6329 O  O   . HOH ZA 4 .   ? -15.069 20.165  -42.820 1.00 46.52  ? 316 HOH F O   1 
HETATM 6330 O  O   . HOH ZA 4 .   ? -7.628  8.122   -57.710 1.00 40.47  ? 317 HOH F O   1 
HETATM 6331 O  O   . HOH ZA 4 .   ? -28.149 0.656   -57.096 1.00 46.25  ? 318 HOH F O   1 
HETATM 6332 O  O   . HOH ZA 4 .   ? -9.377  17.389  -63.067 1.00 39.22  ? 319 HOH F O   1 
HETATM 6333 O  O   . HOH ZA 4 .   ? -24.640 22.332  -58.754 1.00 58.87  ? 320 HOH F O   1 
HETATM 6334 O  O   . HOH ZA 4 .   ? -36.582 10.868  -68.226 1.00 41.78  ? 321 HOH F O   1 
HETATM 6335 O  O   . HOH ZA 4 .   ? -33.619 16.130  -64.254 1.00 58.83  ? 322 HOH F O   1 
HETATM 6336 O  O   . HOH ZA 4 .   ? -33.330 16.821  -68.492 1.00 55.60  ? 323 HOH F O   1 
HETATM 6337 O  O   . HOH ZA 4 .   ? -35.339 17.178  -66.273 1.00 68.99  ? 324 HOH F O   1 
HETATM 6338 O  O   . HOH ZA 4 .   ? -15.121 2.203   -56.641 1.00 22.42  ? 325 HOH F O   1 
HETATM 6339 O  O   . HOH ZA 4 .   ? -17.239 -0.153  -59.312 1.00 62.38  ? 326 HOH F O   1 
HETATM 6340 O  O   . HOH ZA 4 .   ? -22.934 1.232   -55.238 1.00 31.34  ? 327 HOH F O   1 
HETATM 6341 O  O   . HOH ZA 4 .   ? -20.030 0.539   -58.442 1.00 43.71  ? 328 HOH F O   1 
HETATM 6342 O  O   . HOH ZA 4 .   ? -18.672 29.574  -48.659 1.00 38.77  ? 329 HOH F O   1 
HETATM 6343 O  O   . HOH ZA 4 .   ? -19.885 30.432  -50.758 1.00 49.75  ? 330 HOH F O   1 
HETATM 6344 O  O   . HOH ZA 4 .   ? -37.015 11.146  -65.815 1.00 52.42  ? 331 HOH F O   1 
HETATM 6345 O  O   . HOH ZA 4 .   ? -37.826 16.744  -64.902 1.00 47.03  ? 332 HOH F O   1 
HETATM 6346 O  O   . HOH ZA 4 .   ? -8.732  5.204   -56.582 1.00 29.83  ? 333 HOH F O   1 
HETATM 6347 O  O   . HOH ZA 4 .   ? -34.396 5.779   -77.256 1.00 47.28  ? 334 HOH F O   1 
HETATM 6348 O  O   . HOH ZA 4 .   ? -20.012 0.375   -56.020 1.00 48.58  ? 335 HOH F O   1 
HETATM 6349 O  O   . HOH ZA 4 .   ? -7.307  16.153  -54.454 1.00 97.75  ? 336 HOH F O   1 
HETATM 6350 O  O   . HOH ZA 4 .   ? -21.097 -1.249  -61.476 1.00 38.72  ? 337 HOH F O   1 
HETATM 6351 O  O   . HOH ZA 4 .   ? -18.745 -1.039  -62.132 1.00 50.67  ? 338 HOH F O   1 
HETATM 6352 O  O   . HOH ZA 4 .   ? -16.048 0.106   -62.558 1.00 41.12  ? 339 HOH F O   1 
HETATM 6353 O  O   . HOH ZA 4 .   ? -31.106 12.140  -75.014 1.00 53.08  ? 340 HOH F O   1 
HETATM 6354 O  O   . HOH ZA 4 .   ? -25.446 2.096   -81.519 1.00 75.96  ? 341 HOH F O   1 
HETATM 6355 O  O   . HOH ZA 4 .   ? -10.303 3.494   -56.903 1.00 63.29  ? 342 HOH F O   1 
HETATM 6356 O  O   . HOH ZA 4 .   ? -24.633 0.241   -54.037 1.00 55.43  ? 343 HOH F O   1 
HETATM 6357 O  O   . HOH ZA 4 .   ? -12.990 -0.105  -62.328 1.00 48.74  ? 344 HOH F O   1 
HETATM 6358 O  O   . HOH ZA 4 .   ? -9.635  18.347  -65.153 1.00 58.36  ? 345 HOH F O   1 
HETATM 6359 O  O   . HOH ZA 4 .   ? -20.400 19.956  -69.102 1.00 42.69  ? 346 HOH F O   1 
HETATM 6360 O  O   . HOH ZA 4 .   ? -15.836 7.941   -44.696 1.00 56.51  ? 347 HOH F O   1 
HETATM 6361 O  O   . HOH ZA 4 .   ? -32.662 -2.057  -60.284 1.00 66.44  ? 348 HOH F O   1 
HETATM 6362 O  O   . HOH ZA 4 .   ? -27.720 0.520   -54.293 0.50 59.54  ? 349 HOH F O   1 
HETATM 6363 O  O   . HOH ZA 4 .   ? -13.366 26.682  -50.794 1.00 47.89  ? 350 HOH F O   1 
HETATM 6364 O  O   . HOH ZA 4 .   ? -9.328  14.997  -44.420 1.00 53.69  ? 351 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PHE A 5   ? 0.5219 0.6131 0.7508 0.0341  0.1708  -0.1837 0   PHE A N   
2    C CA  . PHE A 5   ? 0.5156 0.6252 0.8511 0.0459  0.1519  -0.1846 0   PHE A CA  
3    C C   . PHE A 5   ? 0.3975 0.5133 0.7585 0.0562  0.1324  -0.1580 0   PHE A C   
4    O O   . PHE A 5   ? 0.4629 0.5928 0.8876 0.0527  0.1300  -0.1691 0   PHE A O   
5    C CB  . PHE A 5   ? 0.5830 0.6839 0.9689 0.0637  0.1196  -0.1776 0   PHE A CB  
6    C CG  . PHE A 5   ? 0.7324 0.8346 1.1325 0.0539  0.1356  -0.2105 0   PHE A CG  
7    C CD1 . PHE A 5   ? 0.8527 0.9585 1.1997 0.0290  0.1749  -0.2394 0   PHE A CD1 
8    C CD2 . PHE A 5   ? 0.7679 0.8626 1.2281 0.0650  0.1095  -0.2115 0   PHE A CD2 
9    C CE1 . PHE A 5   ? 0.9244 1.0327 1.2855 0.0168  0.1897  -0.2709 0   PHE A CE1 
10   C CE2 . PHE A 5   ? 0.8468 0.9448 1.3260 0.0560  0.1241  -0.2434 0   PHE A CE2 
11   C CZ  . PHE A 5   ? 0.9020 1.0098 1.3339 0.0325  0.1654  -0.2741 0   PHE A CZ  
12   N N   . MET A 6   ? 0.3473 0.4463 0.6471 0.0632  0.1096  -0.1190 1   MET A N   
13   C CA  . MET A 6   ? 0.3049 0.4044 0.6030 0.0654  0.0907  -0.0903 1   MET A CA  
14   C C   . MET A 6   ? 0.3428 0.4253 0.5394 0.0554  0.0935  -0.0679 1   MET A C   
15   O O   . MET A 6   ? 0.2705 0.3354 0.4016 0.0548  0.0891  -0.0605 1   MET A O   
16   C CB  . MET A 6   ? 0.3872 0.4733 0.7030 0.0781  0.0472  -0.0576 1   MET A CB  
17   C CG  . MET A 6   ? 0.4616 0.5450 0.8717 0.0894  0.0190  -0.0615 1   MET A CG  
18   S SD  . MET A 6   ? 1.4170 1.4660 1.7642 0.0852  -0.0224 -0.0135 1   MET A SD  
19   C CE  . MET A 6   ? 1.1031 1.1463 1.4542 0.0798  -0.0508 0.0148  1   MET A CE  
20   N N   . LEU A 7   ? 0.2977 0.3847 0.4935 0.0496  0.0945  -0.0579 2   LEU A N   
21   C CA  . LEU A 7   ? 0.3037 0.3718 0.4220 0.0444  0.0864  -0.0335 2   LEU A CA  
22   C C   . LEU A 7   ? 0.3262 0.3949 0.4592 0.0555  0.0534  -0.0057 2   LEU A C   
23   O O   . LEU A 7   ? 0.3218 0.4019 0.5117 0.0579  0.0414  -0.0011 2   LEU A O   
24   C CB  . LEU A 7   ? 0.3216 0.3909 0.4268 0.0261  0.1093  -0.0407 2   LEU A CB  
25   C CG  . LEU A 7   ? 0.3241 0.3632 0.3435 0.0190  0.0994  -0.0181 2   LEU A CG  
26   C CD1 . LEU A 7   ? 0.3991 0.4034 0.3349 0.0107  0.1005  -0.0205 2   LEU A CD1 
27   C CD2 . LEU A 7   ? 0.3266 0.3654 0.3405 -0.0008 0.1185  -0.0213 2   LEU A CD2 
28   N N   . ARG A 8   ? 0.3113 0.3667 0.3938 0.0592  0.0380  0.0092  3   ARG A N   
29   C CA  . ARG A 8   ? 0.2455 0.3008 0.3282 0.0600  0.0149  0.0295  3   ARG A CA  
30   C C   . ARG A 8   ? 0.3498 0.3975 0.3853 0.0567  0.0130  0.0372  3   ARG A C   
31   O O   . ARG A 8   ? 0.2880 0.3231 0.2830 0.0591  0.0154  0.0307  3   ARG A O   
32   C CB  . ARG A 8   ? 0.3556 0.4081 0.4314 0.0619  0.0047  0.0297  3   ARG A CB  
33   C CG  . ARG A 8   ? 0.4691 0.5190 0.5303 0.0512  -0.0114 0.0447  3   ARG A CG  
34   C CD  . ARG A 8   ? 0.5162 0.5643 0.5720 0.0453  -0.0144 0.0396  3   ARG A CD  
35   N NE  . ARG A 8   ? 0.5502 0.6060 0.5916 0.0552  -0.0047 0.0195  3   ARG A NE  
36   C CZ  . ARG A 8   ? 0.5645 0.6216 0.6145 0.0563  -0.0031 0.0077  3   ARG A CZ  
37   N NH1 . ARG A 8   ? 0.5877 0.6358 0.6579 0.0470  -0.0089 0.0151  3   ARG A NH1 
38   N NH2 . ARG A 8   ? 0.4400 0.5018 0.4780 0.0655  -0.0015 -0.0107 3   ARG A NH2 
39   N N   . VAL A 9   ? 0.2120 0.2627 0.2552 0.0508  0.0036  0.0503  4   VAL A N   
40   C CA  . VAL A 9   ? 0.2179 0.2612 0.2258 0.0474  0.0014  0.0550  4   VAL A CA  
41   C C   . VAL A 9   ? 0.3015 0.3491 0.3041 0.0390  -0.0126 0.0638  4   VAL A C   
42   O O   . VAL A 9   ? 0.3379 0.3871 0.3597 0.0295  -0.0243 0.0762  4   VAL A O   
43   C CB  . VAL A 9   ? 0.3357 0.3776 0.3512 0.0407  0.0112  0.0570  4   VAL A CB  
44   C CG1 . VAL A 9   ? 0.2995 0.3302 0.2830 0.0361  0.0044  0.0640  4   VAL A CG1 
45   C CG2 . VAL A 9   ? 0.2508 0.2830 0.2508 0.0366  0.0334  0.0435  4   VAL A CG2 
46   N N   . PHE A 10  ? 0.2159 0.2624 0.1930 0.0396  -0.0138 0.0543  5   PHE A N   
47   C CA  . PHE A 10  ? 0.2204 0.2736 0.1875 0.0245  -0.0179 0.0528  5   PHE A CA  
48   C C   . PHE A 10  ? 0.2818 0.3294 0.2373 0.0246  -0.0193 0.0504  5   PHE A C   
49   O O   . PHE A 10  ? 0.2323 0.2717 0.1823 0.0370  -0.0215 0.0369  5   PHE A O   
50   C CB  . PHE A 10  ? 0.2213 0.2867 0.1869 0.0213  -0.0129 0.0310  5   PHE A CB  
51   C CG  . PHE A 10  ? 0.2207 0.2881 0.1939 0.0171  -0.0114 0.0333  5   PHE A CG  
52   C CD1 . PHE A 10  ? 0.2401 0.3006 0.2011 -0.0080 -0.0154 0.0469  5   PHE A CD1 
53   C CD2 . PHE A 10  ? 0.2118 0.2800 0.1975 0.0351  -0.0100 0.0232  5   PHE A CD2 
54   C CE1 . PHE A 10  ? 0.2976 0.3516 0.2642 -0.0134 -0.0177 0.0506  5   PHE A CE1 
55   C CE2 . PHE A 10  ? 0.2788 0.3478 0.2743 0.0310  -0.0084 0.0235  5   PHE A CE2 
56   C CZ  . PHE A 10  ? 0.2814 0.3431 0.2701 0.0076  -0.0121 0.0373  5   PHE A CZ  
57   N N   . ILE A 11  ? 0.2943 0.3410 0.2478 0.0109  -0.0239 0.0640  6   ILE A N   
58   C CA  . ILE A 11  ? 0.2821 0.3237 0.2247 0.0070  -0.0250 0.0605  6   ILE A CA  
59   C C   . ILE A 11  ? 0.2631 0.3149 0.1918 -0.0108 -0.0219 0.0433  6   ILE A C   
60   O O   . ILE A 11  ? 0.2711 0.3237 0.1817 -0.0359 -0.0249 0.0520  6   ILE A O   
61   C CB  . ILE A 11  ? 0.3208 0.3589 0.2723 -0.0012 -0.0313 0.0788  6   ILE A CB  
62   C CG1 . ILE A 11  ? 0.3178 0.3556 0.2955 0.0097  -0.0255 0.0847  6   ILE A CG1 
63   C CG2 . ILE A 11  ? 0.3624 0.3927 0.3016 -0.0056 -0.0315 0.0743  6   ILE A CG2 
64   C CD1 . ILE A 11  ? 0.4510 0.4843 0.4375 0.0060  -0.0192 0.0870  6   ILE A CD1 
65   N N   . LEU A 12  ? 0.2581 0.3145 0.1957 -0.0011 -0.0176 0.0158  7   LEU A N   
66   C CA  . LEU A 12  ? 0.2676 0.3436 0.2074 -0.0198 -0.0056 -0.0157 7   LEU A CA  
67   C C   . LEU A 12  ? 0.3415 0.4161 0.2700 -0.0362 -0.0035 -0.0241 7   LEU A C   
68   O O   . LEU A 12  ? 0.3141 0.3937 0.2121 -0.0703 0.0049  -0.0246 7   LEU A O   
69   C CB  . LEU A 12  ? 0.3392 0.4275 0.3178 0.0003  -0.0051 -0.0521 7   LEU A CB  
70   C CG  . LEU A 12  ? 0.2470 0.3372 0.2356 0.0148  -0.0083 -0.0479 7   LEU A CG  
71   C CD1 . LEU A 12  ? 0.2465 0.3550 0.2828 0.0291  -0.0109 -0.0912 7   LEU A CD1 
72   C CD2 . LEU A 12  ? 0.2839 0.3818 0.2490 -0.0106 0.0040  -0.0322 7   LEU A CD2 
73   N N   . TYR A 13  ? 0.2851 0.3460 0.2303 -0.0161 -0.0136 -0.0296 8   TYR A N   
74   C CA  . TYR A 13  ? 0.3036 0.3618 0.2439 -0.0296 -0.0121 -0.0414 8   TYR A CA  
75   C C   . TYR A 13  ? 0.3578 0.3865 0.3079 -0.0074 -0.0294 -0.0340 8   TYR A C   
76   O O   . TYR A 13  ? 0.3071 0.3134 0.2618 0.0157  -0.0431 -0.0236 8   TYR A O   
77   C CB  . TYR A 13  ? 0.3192 0.4039 0.2831 -0.0442 0.0055  -0.0931 8   TYR A CB  
78   C CG  . TYR A 13  ? 0.3117 0.4027 0.3353 -0.0140 -0.0024 -0.1300 8   TYR A CG  
79   C CD1 . TYR A 13  ? 0.2992 0.4102 0.3462 -0.0079 0.0032  -0.1455 8   TYR A CD1 
80   C CD2 . TYR A 13  ? 0.3240 0.3963 0.3847 0.0084  -0.0220 -0.1498 8   TYR A CD2 
81   C CE1 . TYR A 13  ? 0.2971 0.4133 0.4082 0.0212  -0.0125 -0.1816 8   TYR A CE1 
82   C CE2 . TYR A 13  ? 0.3282 0.3979 0.4509 0.0382  -0.0426 -0.1834 8   TYR A CE2 
83   C CZ  . TYR A 13  ? 0.3136 0.4074 0.4640 0.0452  -0.0388 -0.2000 8   TYR A CZ  
84   O OH  . TYR A 13  ? 0.3221 0.4129 0.5432 0.0762  -0.0672 -0.2356 8   TYR A OH  
85   N N   . ALA A 14  ? 0.3249 0.3476 0.2690 -0.0199 -0.0295 -0.0389 9   ALA A N   
86   C CA  . ALA A 14  ? 0.3834 0.3724 0.3346 -0.0051 -0.0461 -0.0372 9   ALA A CA  
87   C C   . ALA A 14  ? 0.3617 0.3577 0.3433 -0.0086 -0.0446 -0.0809 9   ALA A C   
88   O O   . ALA A 14  ? 0.3652 0.3931 0.3457 -0.0337 -0.0237 -0.1058 9   ALA A O   
89   C CB  . ALA A 14  ? 0.3460 0.3201 0.2699 -0.0176 -0.0474 -0.0033 9   ALA A CB  
90   N N   . GLU A 15  ? 0.3849 0.3461 0.3912 0.0127  -0.0679 -0.0925 10  GLU A N   
91   C CA  . GLU A 15  ? 0.5072 0.4731 0.5603 0.0140  -0.0704 -0.1409 10  GLU A CA  
92   C C   . GLU A 15  ? 0.4373 0.3585 0.4786 0.0146  -0.0889 -0.1277 10  GLU A C   
93   O O   . GLU A 15  ? 0.4860 0.3614 0.4909 0.0208  -0.1073 -0.0866 10  GLU A O   
94   C CB  . GLU A 15  ? 0.5332 0.4971 0.6535 0.0435  -0.0912 -0.1814 10  GLU A CB  
95   C CG  . GLU A 15  ? 0.6577 0.6736 0.8044 0.0389  -0.0679 -0.2090 10  GLU A CG  
96   C CD  . GLU A 15  ? 0.7394 0.7634 0.9765 0.0673  -0.0891 -0.2631 10  GLU A CD  
97   O OE1 . GLU A 15  ? 0.7758 0.7468 1.0308 0.0991  -0.1373 -0.2518 10  GLU A OE1 
98   O OE2 . GLU A 15  ? 0.7389 0.8190 1.0297 0.0545  -0.0596 -0.3191 10  GLU A OE2 
99   N N   . ASN A 16  ? 0.4534 0.3871 0.5228 0.0031  -0.0805 -0.1663 11  ASN A N   
100  C CA  . ASN A 16  ? 0.6075 0.5002 0.6709 0.0008  -0.0968 -0.1599 11  ASN A CA  
101  C C   . ASN A 16  ? 0.5986 0.4764 0.5981 -0.0192 -0.0910 -0.1067 11  ASN A C   
102  O O   . ASN A 16  ? 0.5107 0.3375 0.4896 -0.0154 -0.1107 -0.0797 11  ASN A O   
103  C CB  . ASN A 16  ? 0.7747 0.6041 0.8687 0.0324  -0.1421 -0.1627 11  ASN A CB  
104  C CG  . ASN A 16  ? 0.8825 0.7230 1.0685 0.0518  -0.1555 -0.2303 11  ASN A CG  
105  O OD1 . ASN A 16  ? 0.9852 0.7938 1.2060 0.0575  -0.1757 -0.2541 11  ASN A OD1 
106  N ND2 . ASN A 16  ? 0.8580 0.7462 1.0930 0.0608  -0.1431 -0.2671 11  ASN A ND2 
107  N N   . VAL A 17  ? 0.4553 0.3743 0.4257 -0.0433 -0.0665 -0.0937 12  VAL A N   
108  C CA  . VAL A 17  ? 0.5114 0.4250 0.4438 -0.0604 -0.0647 -0.0518 12  VAL A CA  
109  C C   . VAL A 17  ? 0.5553 0.4666 0.4832 -0.0824 -0.0632 -0.0635 12  VAL A C   
110  O O   . VAL A 17  ? 0.5344 0.4733 0.4603 -0.1028 -0.0502 -0.0925 12  VAL A O   
111  C CB  . VAL A 17  ? 0.5612 0.5105 0.4722 -0.0743 -0.0524 -0.0309 12  VAL A CB  
112  C CG1 . VAL A 17  ? 0.5463 0.4913 0.4435 -0.0851 -0.0568 0.0061  12  VAL A CG1 
113  C CG2 . VAL A 17  ? 0.5120 0.4678 0.4307 -0.0543 -0.0510 -0.0269 12  VAL A CG2 
114  N N   . HIS A 18  ? 0.5638 0.4396 0.4843 -0.0835 -0.0744 -0.0430 13  HIS A N   
115  C CA  . HIS A 18  ? 0.6781 0.5487 0.5964 -0.1042 -0.0750 -0.0528 13  HIS A CA  
116  C C   . HIS A 18  ? 0.7262 0.5932 0.6285 -0.1204 -0.0758 -0.0172 13  HIS A C   
117  O O   . HIS A 18  ? 0.7720 0.6104 0.6679 -0.1150 -0.0782 0.0066  13  HIS A O   
118  C CB  . HIS A 18  ? 0.6430 0.4694 0.5850 -0.0919 -0.0901 -0.0786 13  HIS A CB  
119  C CG  . HIS A 18  ? 0.6813 0.5215 0.6651 -0.0771 -0.0893 -0.1287 13  HIS A CG  
120  N ND1 . HIS A 18  ? 0.6890 0.5712 0.6838 -0.0976 -0.0678 -0.1717 13  HIS A ND1 
121  C CD2 . HIS A 18  ? 0.7051 0.5240 0.7274 -0.0470 -0.1071 -0.1481 13  HIS A CD2 
122  C CE1 . HIS A 18  ? 0.7303 0.6243 0.7778 -0.0813 -0.0654 -0.2210 13  HIS A CE1 
123  N NE2 . HIS A 18  ? 0.7399 0.5967 0.8118 -0.0469 -0.0931 -0.2074 13  HIS A NE2 
124  N N   . THR A 19  ? 0.6757 0.5714 0.5712 -0.1443 -0.0742 -0.0168 14  THR A N   
125  C CA  . THR A 19  ? 0.6598 0.5615 0.5604 -0.1597 -0.0785 0.0081  14  THR A CA  
126  C C   . THR A 19  ? 0.7050 0.5828 0.6086 -0.1748 -0.0828 -0.0026 14  THR A C   
127  O O   . THR A 19  ? 0.7682 0.6471 0.6645 -0.1862 -0.0851 -0.0287 14  THR A O   
128  C CB  . THR A 19  ? 0.6533 0.5915 0.5487 -0.1770 -0.0879 0.0171  14  THR A CB  
129  O OG1 . THR A 19  ? 0.6304 0.5845 0.5184 -0.1656 -0.0852 0.0244  14  THR A OG1 
130  C CG2 . THR A 19  ? 0.7047 0.6556 0.6307 -0.1870 -0.0982 0.0374  14  THR A CG2 
131  N N   . PRO A 20  ? 0.7598 0.6146 0.6714 -0.1796 -0.0804 0.0140  15  PRO A N   
132  C CA  . PRO A 20  ? 0.8552 0.6833 0.7692 -0.1980 -0.0838 0.0070  15  PRO A CA  
133  C C   . PRO A 20  ? 0.8663 0.7267 0.7898 -0.2205 -0.0926 -0.0034 15  PRO A C   
134  O O   . PRO A 20  ? 0.8973 0.7955 0.8355 -0.2283 -0.0994 0.0087  15  PRO A O   
135  C CB  . PRO A 20  ? 0.8333 0.6468 0.7524 -0.2095 -0.0722 0.0287  15  PRO A CB  
136  C CG  . PRO A 20  ? 0.8497 0.6611 0.7572 -0.1918 -0.0636 0.0430  15  PRO A CG  
137  C CD  . PRO A 20  ? 0.7705 0.6233 0.6860 -0.1741 -0.0697 0.0371  15  PRO A CD  
138  N N   . ASP A 21  ? 0.8033 0.6439 0.7198 -0.2310 -0.0973 -0.0270 16  ASP A N   
139  C CA  . ASP A 21  ? 0.8548 0.7155 0.7693 -0.2577 -0.1077 -0.0396 16  ASP A CA  
140  C C   . ASP A 21  ? 0.6406 0.5368 0.5314 -0.2690 -0.1171 -0.0418 16  ASP A C   
141  O O   . ASP A 21  ? 0.6722 0.5859 0.5592 -0.2921 -0.1366 -0.0350 16  ASP A O   
142  C CB  . ASP A 21  ? 0.9720 0.8375 0.9146 -0.2760 -0.1130 -0.0249 16  ASP A CB  
143  C CG  . ASP A 21  ? 1.1270 0.9454 1.0736 -0.2797 -0.1036 -0.0267 16  ASP A CG  
144  O OD1 . ASP A 21  ? 1.2232 1.0113 1.1596 -0.2852 -0.1081 -0.0490 16  ASP A OD1 
145  O OD2 . ASP A 21  ? 1.1295 0.9367 1.0859 -0.2810 -0.0914 -0.0078 16  ASP A OD2 
146  N N   . THR A 22  ? 0.6296 0.5305 0.5015 -0.2559 -0.1066 -0.0516 17  THR A N   
147  C CA  . THR A 22  ? 0.7983 0.7205 0.6298 -0.2751 -0.1106 -0.0580 17  THR A CA  
148  C C   . THR A 22  ? 0.6563 0.5763 0.4752 -0.2721 -0.0872 -0.0991 17  THR A C   
149  O O   . THR A 22  ? 0.7969 0.7018 0.6501 -0.2429 -0.0769 -0.1119 17  THR A O   
150  C CB  . THR A 22  ? 0.7595 0.6993 0.5921 -0.2644 -0.1202 -0.0248 17  THR A CB  
151  O OG1 . THR A 22  ? 0.8365 0.7839 0.6293 -0.2950 -0.1453 -0.0138 17  THR A OG1 
152  C CG2 . THR A 22  ? 0.5882 0.5311 0.4158 -0.2433 -0.1002 -0.0336 17  THR A CG2 
153  N N   . ASP A 23  ? 0.7302 0.6623 0.5013 -0.3058 -0.0805 -0.1233 18  ASP A N   
154  C CA  . ASP A 23  ? 0.7786 0.7191 0.5499 -0.3096 -0.0508 -0.1753 18  ASP A CA  
155  C C   . ASP A 23  ? 0.8067 0.7641 0.5781 -0.2947 -0.0379 -0.1716 18  ASP A C   
156  O O   . ASP A 23  ? 0.8637 0.8271 0.6789 -0.2708 -0.0198 -0.2053 18  ASP A O   
157  C CB  . ASP A 23  ? 0.7744 0.7253 0.5065 -0.3391 -0.0338 -0.1980 18  ASP A CB  
158  C CG  . ASP A 23  ? 0.9152 0.8713 0.5779 -0.3675 -0.0376 -0.1670 18  ASP A CG  
159  O OD1 . ASP A 23  ? 0.7916 0.7390 0.4404 -0.3651 -0.0691 -0.1196 18  ASP A OD1 
160  O OD2 . ASP A 23  ? 0.9456 0.9114 0.5713 -0.3944 -0.0095 -0.1906 18  ASP A OD2 
161  N N   . ILE A 24  ? 0.7923 0.7546 0.5217 -0.3076 -0.0523 -0.1319 19  ILE A N   
162  C CA  . ILE A 24  ? 0.7792 0.7550 0.5019 -0.2986 -0.0414 -0.1255 19  ILE A CA  
163  C C   . ILE A 24  ? 0.7648 0.7374 0.5059 -0.2707 -0.0651 -0.0716 19  ILE A C   
164  O O   . ILE A 24  ? 0.8025 0.7674 0.5420 -0.2758 -0.0927 -0.0384 19  ILE A O   
165  C CB  . ILE A 24  ? 0.8615 0.8436 0.5226 -0.3340 -0.0259 -0.1266 19  ILE A CB  
166  C CG1 . ILE A 24  ? 0.9467 0.9075 0.5587 -0.3589 -0.0566 -0.0852 19  ILE A CG1 
167  C CG2 . ILE A 24  ? 0.9409 0.9389 0.6091 -0.3487 0.0136  -0.1811 19  ILE A CG2 
168  C CD1 . ILE A 24  ? 1.0215 0.9676 0.5829 -0.3791 -0.0691 -0.0489 19  ILE A CD1 
169  N N   . SER A 25  ? 0.7576 0.7388 0.5237 -0.2424 -0.0542 -0.0684 20  SER A N   
170  C CA  . SER A 25  ? 0.7242 0.7043 0.5154 -0.2146 -0.0699 -0.0262 20  SER A CA  
171  C C   . SER A 25  ? 0.6362 0.6201 0.3934 -0.2307 -0.0850 0.0014  20  SER A C   
172  O O   . SER A 25  ? 0.5876 0.5751 0.3037 -0.2524 -0.0728 -0.0126 20  SER A O   
173  C CB  . SER A 25  ? 0.7851 0.7642 0.6182 -0.1753 -0.0563 -0.0339 20  SER A CB  
174  O OG  . SER A 25  ? 0.8760 0.8514 0.7281 -0.1696 -0.0418 -0.0775 20  SER A OG  
175  N N   . ASP A 26  ? 0.6444 0.6259 0.4242 -0.2219 -0.1120 0.0371  21  ASP A N   
176  C CA  . ASP A 26  ? 0.7404 0.7176 0.5036 -0.2314 -0.1379 0.0659  21  ASP A CA  
177  C C   . ASP A 26  ? 0.7185 0.7076 0.5422 -0.1937 -0.1376 0.0839  21  ASP A C   
178  O O   . ASP A 26  ? 0.8603 0.8553 0.7334 -0.1836 -0.1574 0.1001  21  ASP A O   
179  C CB  . ASP A 26  ? 0.9111 0.8736 0.6602 -0.2575 -0.1811 0.0860  21  ASP A CB  
180  C CG  . ASP A 26  ? 1.0766 1.0166 0.8116 -0.2637 -0.2071 0.1138  21  ASP A CG  
181  O OD1 . ASP A 26  ? 1.1613 1.0916 0.8560 -0.2740 -0.1892 0.1108  21  ASP A OD1 
182  O OD2 . ASP A 26  ? 1.1255 1.0554 0.8990 -0.2576 -0.2436 0.1347  21  ASP A OD2 
183  N N   . ALA A 27  ? 0.5027 0.5199 0.3869 -0.0970 -0.1115 -0.0255 22  ALA A N   
184  C CA  . ALA A 27  ? 0.4736 0.5058 0.4050 -0.0876 -0.1042 -0.0119 22  ALA A CA  
185  C C   . ALA A 27  ? 0.3752 0.4462 0.3404 -0.0642 -0.1045 0.0077  22  ALA A C   
186  O O   . ALA A 27  ? 0.3286 0.3966 0.2800 -0.0483 -0.1002 0.0135  22  ALA A O   
187  C CB  . ALA A 27  ? 0.3851 0.3654 0.3073 -0.0772 -0.0842 -0.0168 22  ALA A CB  
188  N N   . TYR A 28  ? 0.3244 0.4276 0.3320 -0.0637 -0.1065 0.0169  23  TYR A N   
189  C CA  . TYR A 28  ? 0.2781 0.4052 0.3176 -0.0409 -0.1026 0.0316  23  TYR A CA  
190  C C   . TYR A 28  ? 0.3257 0.4534 0.3923 -0.0381 -0.0908 0.0327  23  TYR A C   
191  O O   . TYR A 28  ? 0.2673 0.3859 0.3319 -0.0555 -0.0878 0.0271  23  TYR A O   
192  C CB  . TYR A 28  ? 0.3164 0.4922 0.3780 -0.0363 -0.1199 0.0428  23  TYR A CB  
193  C CG  . TYR A 28  ? 0.2588 0.4814 0.3591 -0.0493 -0.1284 0.0418  23  TYR A CG  
194  C CD1 . TYR A 28  ? 0.2690 0.5145 0.3653 -0.0762 -0.1441 0.0321  23  TYR A CD1 
195  C CD2 . TYR A 28  ? 0.2311 0.4787 0.3730 -0.0367 -0.1191 0.0482  23  TYR A CD2 
196  C CE1 . TYR A 28  ? 0.3526 0.6511 0.4930 -0.0919 -0.1495 0.0304  23  TYR A CE1 
197  C CE2 . TYR A 28  ? 0.2671 0.5645 0.4483 -0.0484 -0.1219 0.0466  23  TYR A CE2 
198  C CZ  . TYR A 28  ? 0.3598 0.6840 0.5431 -0.0761 -0.1358 0.0381  23  TYR A CZ  
199  O OH  . TYR A 28  ? 0.3461 0.7133 0.5692 -0.0869 -0.1313 0.0329  23  TYR A OH  
200  N N   . CYS A 29  ? 0.2804 0.4158 0.3676 -0.0215 -0.0839 0.0389  24  CYS A N   
201  C CA  . CYS A 29  ? 0.2233 0.3566 0.3253 -0.0172 -0.0726 0.0386  24  CYS A CA  
202  C C   . CYS A 29  ? 0.2463 0.4192 0.3848 -0.0091 -0.0716 0.0439  24  CYS A C   
203  O O   . CYS A 29  ? 0.3175 0.5030 0.4705 0.0067  -0.0749 0.0495  24  CYS A O   
204  C CB  . CYS A 29  ? 0.2378 0.3447 0.3305 -0.0016 -0.0639 0.0362  24  CYS A CB  
205  S SG  . CYS A 29  ? 0.4829 0.5857 0.5805 0.0049  -0.0548 0.0347  24  CYS A SG  
206  N N   . SER A 30  ? 0.2041 0.3922 0.3554 -0.0161 -0.0652 0.0430  25  SER A N   
207  C CA  . SER A 30  ? 0.2486 0.4762 0.4352 -0.0068 -0.0592 0.0449  25  SER A CA  
208  C C   . SER A 30  ? 0.3819 0.5925 0.5605 0.0019  -0.0439 0.0408  25  SER A C   
209  O O   . SER A 30  ? 0.4464 0.6348 0.6007 -0.0092 -0.0371 0.0399  25  SER A O   
210  C CB  . SER A 30  ? 0.3342 0.6053 0.5452 -0.0268 -0.0594 0.0449  25  SER A CB  
211  O OG  . SER A 30  ? 0.4227 0.7396 0.6735 -0.0137 -0.0507 0.0454  25  SER A OG  
212  N N   . ALA A 31  ? 0.3627 0.5791 0.5566 0.0222  -0.0394 0.0383  26  ALA A N   
213  C CA  . ALA A 31  ? 0.1438 0.3465 0.3264 0.0298  -0.0272 0.0303  26  ALA A CA  
214  C C   . ALA A 31  ? 0.2781 0.5108 0.4874 0.0422  -0.0146 0.0253  26  ALA A C   
215  O O   . ALA A 31  ? 0.3040 0.5517 0.5410 0.0580  -0.0172 0.0270  26  ALA A O   
216  C CB  . ALA A 31  ? 0.1412 0.3127 0.3110 0.0397  -0.0314 0.0249  26  ALA A CB  
217  N N   . VAL A 32  ? 0.2416 0.4807 0.4389 0.0373  0.0004  0.0200  27  VAL A N   
218  C CA  . VAL A 32  ? 0.2098 0.4787 0.4290 0.0498  0.0180  0.0120  27  VAL A CA  
219  C C   . VAL A 32  ? 0.2652 0.5099 0.4525 0.0572  0.0294  -0.0022 27  VAL A C   
220  O O   . VAL A 32  ? 0.2964 0.5257 0.4452 0.0454  0.0325  -0.0014 27  VAL A O   
221  C CB  . VAL A 32  ? 0.1921 0.5060 0.4297 0.0339  0.0318  0.0169  27  VAL A CB  
222  C CG1 . VAL A 32  ? 0.2292 0.5763 0.4868 0.0488  0.0559  0.0059  27  VAL A CG1 
223  C CG2 . VAL A 32  ? 0.1692 0.5197 0.4454 0.0258  0.0177  0.0262  27  VAL A CG2 
224  N N   . PHE A 33  ? 0.2816 0.5190 0.4809 0.0774  0.0347  -0.0154 28  PHE A N   
225  C CA  . PHE A 33  ? 0.3674 0.5871 0.5371 0.0836  0.0472  -0.0346 28  PHE A CA  
226  C C   . PHE A 33  ? 0.3252 0.5536 0.5199 0.1067  0.0649  -0.0497 28  PHE A C   
227  O O   . PHE A 33  ? 0.2490 0.4801 0.4807 0.1229  0.0610  -0.0447 28  PHE A O   
228  C CB  . PHE A 33  ? 0.3419 0.5213 0.4836 0.0801  0.0316  -0.0435 28  PHE A CB  
229  C CG  . PHE A 33  ? 0.3853 0.5514 0.4868 0.0801  0.0382  -0.0640 28  PHE A CG  
230  C CD1 . PHE A 33  ? 0.2942 0.4640 0.3535 0.0697  0.0375  -0.0592 28  PHE A CD1 
231  C CD2 . PHE A 33  ? 0.3564 0.5015 0.4565 0.0905  0.0449  -0.0881 28  PHE A CD2 
232  C CE1 . PHE A 33  ? 0.3453 0.5055 0.3596 0.0705  0.0406  -0.0774 28  PHE A CE1 
233  C CE2 . PHE A 33  ? 0.4187 0.5529 0.4760 0.0882  0.0489  -0.1108 28  PHE A CE2 
234  C CZ  . PHE A 33  ? 0.3970 0.5423 0.4103 0.0787  0.0455  -0.1051 28  PHE A CZ  
235  N N   . ALA A 34  ? 0.2935 0.5229 0.4625 0.1104  0.0849  -0.0678 29  ALA A N   
236  C CA  . ALA A 34  ? 0.4366 0.6703 0.6228 0.1350  0.1072  -0.0872 29  ALA A CA  
237  C C   . ALA A 34  ? 0.4037 0.6878 0.6506 0.1516  0.1164  -0.0753 29  ALA A C   
238  O O   . ALA A 34  ? 0.4190 0.6994 0.6976 0.1805  0.1234  -0.0828 29  ALA A O   
239  C CB  . ALA A 34  ? 0.5033 0.6829 0.6837 0.1475  0.1003  -0.1044 29  ALA A CB  
240  N N   . GLY A 35  ? 0.3714 0.7020 0.6348 0.1333  0.1152  -0.0569 30  GLY A N   
241  C CA  . GLY A 35  ? 0.2656 0.6587 0.5921 0.1431  0.1188  -0.0457 30  GLY A CA  
242  C C   . GLY A 35  ? 0.3143 0.6945 0.6703 0.1535  0.0909  -0.0309 30  GLY A C   
243  O O   . GLY A 35  ? 0.3251 0.7316 0.7237 0.1614  0.0858  -0.0244 30  GLY A O   
244  N N   . VAL A 36  ? 0.2939 0.6246 0.6206 0.1490  0.0711  -0.0266 31  VAL A N   
245  C CA  . VAL A 36  ? 0.3141 0.6297 0.6581 0.1576  0.0473  -0.0109 31  VAL A CA  
246  C C   . VAL A 36  ? 0.2490 0.5608 0.5749 0.1305  0.0258  0.0047  31  VAL A C   
247  O O   . VAL A 36  ? 0.2576 0.5294 0.5432 0.1131  0.0218  0.0010  31  VAL A O   
248  C CB  . VAL A 36  ? 0.2493 0.5026 0.5791 0.1789  0.0467  -0.0177 31  VAL A CB  
249  C CG1 . VAL A 36  ? 0.2705 0.5041 0.6047 0.1847  0.0231  0.0005  31  VAL A CG1 
250  C CG2 . VAL A 36  ? 0.2981 0.5420 0.6400 0.2055  0.0691  -0.0372 31  VAL A CG2 
251  N N   . LYS A 37  ? 0.2010 0.5411 0.5469 0.1220  0.0098  0.0165  32  LYS A N   
252  C CA  . LYS A 37  ? 0.1615 0.4966 0.4890 0.0982  -0.0092 0.0282  32  LYS A CA  
253  C C   . LYS A 37  ? 0.1965 0.4920 0.5069 0.1074  -0.0273 0.0370  32  LYS A C   
254  O O   . LYS A 37  ? 0.1911 0.4862 0.5134 0.1265  -0.0351 0.0410  32  LYS A O   
255  C CB  . LYS A 37  ? 0.2168 0.5996 0.5664 0.0795  -0.0160 0.0317  32  LYS A CB  
256  C CG  . LYS A 37  ? 0.3167 0.6900 0.6457 0.0578  -0.0370 0.0403  32  LYS A CG  
257  C CD  . LYS A 37  ? 0.3220 0.7420 0.6735 0.0350  -0.0432 0.0398  32  LYS A CD  
258  C CE  . LYS A 37  ? 0.3341 0.7693 0.6829 0.0051  -0.0265 0.0381  32  LYS A CE  
259  N NZ  . LYS A 37  ? 0.4740 0.9447 0.8407 -0.0253 -0.0324 0.0364  32  LYS A NZ  
260  N N   . LYS A 38  ? 0.1555 0.4190 0.4376 0.0947  -0.0328 0.0414  33  LYS A N   
261  C CA  . LYS A 38  ? 0.2520 0.4816 0.5150 0.0978  -0.0456 0.0516  33  LYS A CA  
262  C C   . LYS A 38  ? 0.2397 0.4730 0.4827 0.0747  -0.0582 0.0571  33  LYS A C   
263  O O   . LYS A 38  ? 0.1749 0.4135 0.4095 0.0562  -0.0544 0.0509  33  LYS A O   
264  C CB  . LYS A 38  ? 0.2617 0.4415 0.5083 0.1018  -0.0366 0.0461  33  LYS A CB  
265  C CG  . LYS A 38  ? 0.2684 0.4321 0.5291 0.1228  -0.0224 0.0361  33  LYS A CG  
266  C CD  . LYS A 38  ? 0.3262 0.4381 0.5655 0.1162  -0.0147 0.0239  33  LYS A CD  
267  C CE  . LYS A 38  ? 0.2612 0.3503 0.5077 0.1329  0.0009  0.0071  33  LYS A CE  
268  N NZ  . LYS A 38  ? 0.2851 0.3510 0.5472 0.1602  0.0032  0.0188  33  LYS A NZ  
269  N N   . ARG A 39  ? 0.2652 0.4887 0.4930 0.0759  -0.0716 0.0678  34  ARG A N   
270  C CA  . ARG A 39  ? 0.2960 0.5216 0.5019 0.0557  -0.0833 0.0708  34  ARG A CA  
271  C C   . ARG A 39  ? 0.2171 0.4039 0.3912 0.0565  -0.0848 0.0781  34  ARG A C   
272  O O   . ARG A 39  ? 0.2693 0.4398 0.4412 0.0727  -0.0853 0.0902  34  ARG A O   
273  C CB  . ARG A 39  ? 0.3672 0.6293 0.5792 0.0495  -0.0988 0.0721  34  ARG A CB  
274  C CG  . ARG A 39  ? 0.4747 0.7790 0.7193 0.0412  -0.0943 0.0627  34  ARG A CG  
275  C CD  . ARG A 39  ? 0.5325 0.8741 0.7842 0.0260  -0.1117 0.0609  34  ARG A CD  
276  N NE  . ARG A 39  ? 0.5469 0.9365 0.8402 0.0199  -0.1066 0.0535  34  ARG A NE  
277  C CZ  . ARG A 39  ? 0.5300 0.9393 0.8332 -0.0092 -0.0990 0.0464  34  ARG A CZ  
278  N NH1 . ARG A 39  ? 0.5781 0.9589 0.8509 -0.0340 -0.0979 0.0454  34  ARG A NH1 
279  N NH2 . ARG A 39  ? 0.5062 0.9625 0.8507 -0.0146 -0.0912 0.0410  34  ARG A NH2 
280  N N   . THR A 40  ? 0.2325 0.4002 0.3794 0.0394  -0.0826 0.0705  35  THR A N   
281  C CA  . THR A 40  ? 0.3003 0.4390 0.4155 0.0373  -0.0809 0.0750  35  THR A CA  
282  C C   . THR A 40  ? 0.3266 0.4794 0.4200 0.0339  -0.0980 0.0841  35  THR A C   
283  O O   . THR A 40  ? 0.2972 0.4859 0.4050 0.0297  -0.1128 0.0836  35  THR A O   
284  C CB  . THR A 40  ? 0.3416 0.4599 0.4378 0.0251  -0.0717 0.0618  35  THR A CB  
285  O OG1 . THR A 40  ? 0.2759 0.4007 0.3576 0.0109  -0.0799 0.0548  35  THR A OG1 
286  C CG2 . THR A 40  ? 0.1675 0.2807 0.2824 0.0280  -0.0610 0.0520  35  THR A CG2 
287  N N   . LYS A 41  ? 0.3596 0.4882 0.4175 0.0338  -0.0957 0.0914  36  LYS A N   
288  C CA  . LYS A 41  ? 0.4156 0.5542 0.4392 0.0288  -0.1127 0.0977  36  LYS A CA  
289  C C   . LYS A 41  ? 0.3668 0.5049 0.3704 0.0074  -0.1151 0.0777  36  LYS A C   
290  O O   . LYS A 41  ? 0.3748 0.4965 0.3862 0.0010  -0.1010 0.0638  36  LYS A O   
291  C CB  . LYS A 41  ? 0.5120 0.6195 0.4941 0.0342  -0.1049 0.1124  36  LYS A CB  
292  C CG  . LYS A 41  ? 0.5430 0.6200 0.5078 0.0246  -0.0800 0.1012  36  LYS A CG  
293  C CD  . LYS A 41  ? 0.6880 0.7369 0.6187 0.0276  -0.0660 0.1186  36  LYS A CD  
294  C CE  . LYS A 41  ? 0.7335 0.7653 0.6575 0.0175  -0.0384 0.1059  36  LYS A CE  
295  N NZ  . LYS A 41  ? 0.6943 0.7312 0.6687 0.0175  -0.0275 0.0926  36  LYS A NZ  
296  N N   . VAL A 42  ? 0.3603 0.5138 0.3357 -0.0030 -0.1342 0.0760  37  VAL A N   
297  C CA  . VAL A 42  ? 0.4069 0.5477 0.3546 -0.0254 -0.1353 0.0543  37  VAL A CA  
298  C C   . VAL A 42  ? 0.4308 0.5312 0.3273 -0.0254 -0.1193 0.0484  37  VAL A C   
299  O O   . VAL A 42  ? 0.4489 0.5441 0.3152 -0.0166 -0.1187 0.0625  37  VAL A O   
300  C CB  . VAL A 42  ? 0.4463 0.6231 0.3845 -0.0422 -0.1639 0.0489  37  VAL A CB  
301  C CG1 . VAL A 42  ? 0.4540 0.6054 0.3606 -0.0691 -0.1626 0.0229  37  VAL A CG1 
302  C CG2 . VAL A 42  ? 0.4447 0.6736 0.4424 -0.0418 -0.1767 0.0541  37  VAL A CG2 
303  N N   . ILE A 43  ? 0.4078 0.4784 0.2943 -0.0333 -0.1039 0.0289  38  ILE A N   
304  C CA  . ILE A 43  ? 0.4491 0.4866 0.2894 -0.0328 -0.0867 0.0178  38  ILE A CA  
305  C C   . ILE A 43  ? 0.5417 0.5635 0.3367 -0.0525 -0.0975 -0.0039 38  ILE A C   
306  O O   . ILE A 43  ? 0.5714 0.5732 0.3723 -0.0638 -0.0964 -0.0211 38  ILE A O   
307  C CB  . ILE A 43  ? 0.4335 0.4478 0.2934 -0.0223 -0.0616 0.0086  38  ILE A CB  
308  C CG1 . ILE A 43  ? 0.3932 0.4243 0.2976 -0.0082 -0.0526 0.0250  38  ILE A CG1 
309  C CG2 . ILE A 43  ? 0.4552 0.4433 0.2731 -0.0189 -0.0411 -0.0050 38  ILE A CG2 
310  C CD1 . ILE A 43  ? 0.3814 0.4143 0.2705 -0.0028 -0.0422 0.0402  38  ILE A CD1 
311  N N   . LYS A 44  ? 0.5307 0.5567 0.2753 -0.0578 -0.1081 -0.0032 39  LYS A N   
312  C CA  . LYS A 44  ? 0.5870 0.5991 0.2820 -0.0799 -0.1215 -0.0276 39  LYS A CA  
313  C C   . LYS A 44  ? 0.7136 0.6718 0.3736 -0.0801 -0.0947 -0.0538 39  LYS A C   
314  O O   . LYS A 44  ? 0.6877 0.6308 0.3368 -0.0622 -0.0681 -0.0510 39  LYS A O   
315  C CB  . LYS A 44  ? 0.6426 0.6741 0.2830 -0.0834 -0.1415 -0.0200 39  LYS A CB  
316  C CG  . LYS A 44  ? 0.6936 0.7729 0.3629 -0.0702 -0.1638 0.0127  39  LYS A CG  
317  C CD  . LYS A 44  ? 0.6853 0.8108 0.4142 -0.0796 -0.1901 0.0135  39  LYS A CD  
318  C CE  . LYS A 44  ? 0.7890 0.9322 0.4963 -0.1074 -0.2163 -0.0106 39  LYS A CE  
319  N NZ  . LYS A 44  ? 0.7928 0.9874 0.5725 -0.1121 -0.2335 -0.0091 39  LYS A NZ  
320  N N   . ASN A 45  ? 0.6998 0.6293 0.3455 -0.1003 -0.1003 -0.0797 40  ASN A N   
321  C CA  . ASN A 45  ? 0.7644 0.6341 0.3642 -0.1001 -0.0780 -0.1090 40  ASN A CA  
322  C C   . ASN A 45  ? 0.7894 0.6355 0.4153 -0.0707 -0.0452 -0.1064 40  ASN A C   
323  O O   . ASN A 45  ? 0.8348 0.6748 0.4367 -0.0536 -0.0221 -0.1096 40  ASN A O   
324  C CB  . ASN A 45  ? 0.9352 0.7971 0.4592 -0.1048 -0.0772 -0.1224 40  ASN A CB  
325  C CG  . ASN A 45  ? 1.0140 0.9210 0.5171 -0.1247 -0.1146 -0.1140 40  ASN A CG  
326  O OD1 . ASN A 45  ? 1.0502 0.9941 0.5984 -0.1382 -0.1409 -0.1045 40  ASN A OD1 
327  N ND2 . ASN A 45  ? 1.0066 0.9146 0.4405 -0.1251 -0.1168 -0.1171 40  ASN A ND2 
328  N N   . SER A 46  ? 0.7107 0.5487 0.3856 -0.0649 -0.0431 -0.1003 41  SER A N   
329  C CA  . SER A 46  ? 0.6570 0.4825 0.3618 -0.0350 -0.0185 -0.0967 41  SER A CA  
330  C C   . SER A 46  ? 0.6505 0.4462 0.3840 -0.0313 -0.0187 -0.0961 41  SER A C   
331  O O   . SER A 46  ? 0.6074 0.4189 0.3674 -0.0472 -0.0355 -0.0839 41  SER A O   
332  C CB  . SER A 46  ? 0.6748 0.5524 0.4218 -0.0193 -0.0141 -0.0715 41  SER A CB  
333  O OG  . SER A 46  ? 0.7534 0.6302 0.5300 0.0070  0.0082  -0.0718 41  SER A OG  
334  N N   . VAL A 47  ? 0.6396 0.3927 0.3662 -0.0080 0.0013  -0.1081 42  VAL A N   
335  C CA  . VAL A 47  ? 0.6430 0.3591 0.3876 0.0024  0.0027  -0.1039 42  VAL A CA  
336  C C   . VAL A 47  ? 0.6260 0.3874 0.4260 0.0283  0.0045  -0.0820 42  VAL A C   
337  O O   . VAL A 47  ? 0.5822 0.3333 0.4028 0.0348  -0.0009 -0.0696 42  VAL A O   
338  C CB  . VAL A 47  ? 0.7647 0.4074 0.4723 0.0212  0.0218  -0.1267 42  VAL A CB  
339  C CG1 . VAL A 47  ? 0.7778 0.3712 0.4951 0.0346  0.0222  -0.1175 42  VAL A CG1 
340  C CG2 . VAL A 47  ? 0.8153 0.4102 0.4615 -0.0080 0.0205  -0.1542 42  VAL A CG2 
341  N N   A ASN A 48  ? 0.6099 0.4209 0.4301 0.0400  0.0123  -0.0777 43  ASN A N   
342  N N   B ASN A 48  ? 0.5997 0.4137 0.4224 0.0389  0.0109  -0.0761 43  ASN A N   
343  C CA  A ASN A 48  ? 0.6267 0.4847 0.4999 0.0596  0.0140  -0.0620 43  ASN A CA  
344  C CA  B ASN A 48  ? 0.4728 0.3332 0.3480 0.0597  0.0137  -0.0613 43  ASN A CA  
345  C C   A ASN A 48  ? 0.4264 0.3376 0.3203 0.0466  0.0092  -0.0484 43  ASN A C   
346  C C   B ASN A 48  ? 0.4214 0.3355 0.3194 0.0470  0.0084  -0.0470 43  ASN A C   
347  O O   A ASN A 48  ? 0.4527 0.3934 0.3603 0.0551  0.0236  -0.0481 43  ASN A O   
348  O O   B ASN A 48  ? 0.4150 0.3552 0.3213 0.0531  0.0220  -0.0472 43  ASN A O   
349  C CB  A ASN A 48  ? 0.4930 0.3541 0.3802 0.0926  0.0345  -0.0725 43  ASN A CB  
350  C CB  B ASN A 48  ? 0.6378 0.5013 0.5265 0.0926  0.0345  -0.0720 43  ASN A CB  
351  C CG  A ASN A 48  ? 0.5929 0.3886 0.4498 0.1107  0.0420  -0.0876 43  ASN A CG  
352  C CG  B ASN A 48  ? 0.6305 0.5578 0.5771 0.1066  0.0371  -0.0610 43  ASN A CG  
353  O OD1 A ASN A 48  ? 0.5963 0.3711 0.4664 0.1291  0.0359  -0.0800 43  ASN A OD1 
354  O OD1 B ASN A 48  ? 0.3941 0.3401 0.3719 0.1101  0.0230  -0.0484 43  ASN A OD1 
355  N ND2 A ASN A 48  ? 0.6646 0.4216 0.4744 0.1060  0.0555  -0.1090 43  ASN A ND2 
356  N ND2 B ASN A 48  ? 0.5878 0.5482 0.5461 0.1120  0.0567  -0.0675 43  ASN A ND2 
357  N N   . PRO A 49  ? 0.4024 0.3246 0.2998 0.0260  -0.0094 -0.0365 44  PRO A N   
358  C CA  . PRO A 49  ? 0.3704 0.3314 0.2805 0.0163  -0.0156 -0.0223 44  PRO A CA  
359  C C   . PRO A 49  ? 0.4421 0.4364 0.3982 0.0288  -0.0096 -0.0116 44  PRO A C   
360  O O   . PRO A 49  ? 0.3754 0.3753 0.3599 0.0364  -0.0149 -0.0088 44  PRO A O   
361  C CB  . PRO A 49  ? 0.3584 0.3251 0.2720 -0.0018 -0.0366 -0.0145 44  PRO A CB  
362  C CG  . PRO A 49  ? 0.3618 0.3031 0.2826 -0.0001 -0.0376 -0.0184 44  PRO A CG  
363  C CD  . PRO A 49  ? 0.4080 0.3076 0.3022 0.0128  -0.0234 -0.0344 44  PRO A CD  
364  N N   . VAL A 50  ? 0.4023 0.4158 0.3612 0.0285  0.0019  -0.0064 45  VAL A N   
365  C CA  . VAL A 50  ? 0.2859 0.3286 0.2877 0.0328  0.0082  0.0015  45  VAL A CA  
366  C C   . VAL A 50  ? 0.3119 0.3616 0.3157 0.0219  -0.0006 0.0187  45  VAL A C   
367  O O   . VAL A 50  ? 0.3625 0.4082 0.3417 0.0156  0.0059  0.0278  45  VAL A O   
368  C CB  . VAL A 50  ? 0.3011 0.3592 0.3103 0.0376  0.0331  -0.0047 45  VAL A CB  
369  C CG1 . VAL A 50  ? 0.3000 0.3896 0.3573 0.0349  0.0390  0.0006  45  VAL A CG1 
370  C CG2 . VAL A 50  ? 0.3231 0.3757 0.3321 0.0555  0.0431  -0.0226 45  VAL A CG2 
371  N N   . TRP A 51  ? 0.2692 0.3265 0.2984 0.0223  -0.0145 0.0241  46  TRP A N   
372  C CA  . TRP A 51  ? 0.2364 0.2983 0.2724 0.0184  -0.0220 0.0392  46  TRP A CA  
373  C C   . TRP A 51  ? 0.3228 0.3894 0.3839 0.0177  -0.0089 0.0437  46  TRP A C   
374  O O   . TRP A 51  ? 0.2986 0.3544 0.3488 0.0142  -0.0044 0.0581  46  TRP A O   
375  C CB  . TRP A 51  ? 0.2124 0.2823 0.2661 0.0197  -0.0376 0.0404  46  TRP A CB  
376  C CG  . TRP A 51  ? 0.2398 0.3060 0.2733 0.0130  -0.0493 0.0362  46  TRP A CG  
377  C CD1 . TRP A 51  ? 0.3301 0.4007 0.3422 0.0053  -0.0615 0.0414  46  TRP A CD1 
378  C CD2 . TRP A 51  ? 0.2908 0.3463 0.3220 0.0110  -0.0507 0.0260  46  TRP A CD2 
379  N NE1 . TRP A 51  ? 0.3331 0.3988 0.3338 -0.0062 -0.0695 0.0316  46  TRP A NE1 
380  C CE2 . TRP A 51  ? 0.2654 0.3158 0.2753 -0.0029 -0.0612 0.0235  46  TRP A CE2 
381  C CE3 . TRP A 51  ? 0.3599 0.4081 0.4023 0.0195  -0.0454 0.0198  46  TRP A CE3 
382  C CZ2 . TRP A 51  ? 0.2637 0.2933 0.2626 -0.0119 -0.0624 0.0151  46  TRP A CZ2 
383  C CZ3 . TRP A 51  ? 0.3168 0.3427 0.3437 0.0162  -0.0479 0.0152  46  TRP A CZ3 
384  C CH2 . TRP A 51  ? 0.3075 0.3201 0.3126 -0.0011 -0.0543 0.0129  46  TRP A CH2 
385  N N   . ASN A 52  ? 0.2378 0.3186 0.3302 0.0202  -0.0038 0.0316  47  ASN A N   
386  C CA  . ASN A 52  ? 0.2616 0.3511 0.3836 0.0136  0.0076  0.0300  47  ASN A CA  
387  C C   . ASN A 52  ? 0.2213 0.2929 0.3465 0.0103  0.0040  0.0416  47  ASN A C   
388  O O   . ASN A 52  ? 0.2382 0.2928 0.3599 0.0017  0.0167  0.0515  47  ASN A O   
389  C CB  . ASN A 52  ? 0.3187 0.4120 0.4356 0.0053  0.0297  0.0308  47  ASN A CB  
390  C CG  . ASN A 52  ? 0.3600 0.4696 0.5155 -0.0078 0.0436  0.0248  47  ASN A CG  
391  O OD1 . ASN A 52  ? 0.4747 0.5995 0.6622 -0.0080 0.0340  0.0137  47  ASN A OD1 
392  N ND2 . ASN A 52  ? 0.3303 0.4372 0.4804 -0.0216 0.0670  0.0313  47  ASN A ND2 
393  N N   . GLU A 53  ? 0.2141 0.2861 0.3440 0.0182  -0.0109 0.0410  48  GLU A N   
394  C CA  . GLU A 53  ? 0.2619 0.3171 0.3960 0.0219  -0.0138 0.0505  48  GLU A CA  
395  C C   . GLU A 53  ? 0.2091 0.2669 0.3690 0.0225  -0.0146 0.0365  48  GLU A C   
396  O O   . GLU A 53  ? 0.2321 0.3093 0.3996 0.0249  -0.0216 0.0238  48  GLU A O   
397  C CB  . GLU A 53  ? 0.3203 0.3795 0.4401 0.0319  -0.0280 0.0618  48  GLU A CB  
398  C CG  . GLU A 53  ? 0.4228 0.4695 0.5130 0.0331  -0.0297 0.0806  48  GLU A CG  
399  C CD  . GLU A 53  ? 0.3206 0.3832 0.4050 0.0425  -0.0484 0.0901  48  GLU A CD  
400  O OE1 . GLU A 53  ? 0.4066 0.4742 0.5128 0.0550  -0.0536 0.0944  48  GLU A OE1 
401  O OE2 . GLU A 53  ? 0.4017 0.4749 0.4617 0.0372  -0.0576 0.0908  48  GLU A OE2 
402  N N   . GLY A 54  ? 0.2654 0.2972 0.4324 0.0204  -0.0068 0.0392  49  GLY A N   
403  C CA  . GLY A 54  ? 0.2262 0.2523 0.4110 0.0197  -0.0062 0.0226  49  GLY A CA  
404  C C   . GLY A 54  ? 0.2683 0.2834 0.4519 0.0377  -0.0105 0.0275  49  GLY A C   
405  O O   . GLY A 54  ? 0.3470 0.3439 0.5224 0.0491  -0.0104 0.0463  49  GLY A O   
406  N N   . PHE A 55  ? 0.2632 0.2932 0.4542 0.0422  -0.0142 0.0109  50  PHE A N   
407  C CA  . PHE A 55  ? 0.2694 0.2964 0.4648 0.0600  -0.0134 0.0110  50  PHE A CA  
408  C C   . PHE A 55  ? 0.3322 0.3416 0.5313 0.0584  -0.0059 -0.0128 50  PHE A C   
409  O O   . PHE A 55  ? 0.2945 0.3149 0.4912 0.0443  -0.0087 -0.0309 50  PHE A O   
410  C CB  . PHE A 55  ? 0.2547 0.3206 0.4493 0.0660  -0.0214 0.0136  50  PHE A CB  
411  C CG  . PHE A 55  ? 0.3543 0.4361 0.5429 0.0652  -0.0303 0.0321  50  PHE A CG  
412  C CD1 . PHE A 55  ? 0.3808 0.4585 0.5719 0.0769  -0.0340 0.0498  50  PHE A CD1 
413  C CD2 . PHE A 55  ? 0.4126 0.5109 0.5896 0.0541  -0.0362 0.0310  50  PHE A CD2 
414  C CE1 . PHE A 55  ? 0.4032 0.4982 0.5836 0.0738  -0.0452 0.0636  50  PHE A CE1 
415  C CE2 . PHE A 55  ? 0.4782 0.5855 0.6447 0.0507  -0.0439 0.0430  50  PHE A CE2 
416  C CZ  . PHE A 55  ? 0.3861 0.4946 0.5534 0.0586  -0.0493 0.0581  50  PHE A CZ  
417  N N   . GLU A 56  ? 0.2791 0.2615 0.4828 0.0749  0.0026  -0.0139 51  GLU A N   
418  C CA  . GLU A 56  ? 0.3346 0.2934 0.5361 0.0749  0.0118  -0.0405 51  GLU A CA  
419  C C   . GLU A 56  ? 0.3891 0.3598 0.5955 0.1003  0.0185  -0.0448 51  GLU A C   
420  O O   . GLU A 56  ? 0.3643 0.3273 0.5837 0.1235  0.0220  -0.0288 51  GLU A O   
421  C CB  . GLU A 56  ? 0.5243 0.4210 0.7250 0.0684  0.0229  -0.0445 51  GLU A CB  
422  C CG  . GLU A 56  ? 0.5955 0.4855 0.7970 0.0377  0.0218  -0.0459 51  GLU A CG  
423  C CD  . GLU A 56  ? 0.7455 0.5736 0.9459 0.0208  0.0355  -0.0602 51  GLU A CD  
424  O OE1 . GLU A 56  ? 0.7999 0.5734 0.9942 0.0387  0.0468  -0.0567 51  GLU A OE1 
425  O OE2 . GLU A 56  ? 0.8108 0.6452 1.0187 -0.0105 0.0354  -0.0759 51  GLU A OE2 
426  N N   . TRP A 57  ? 0.3155 0.3093 0.5114 0.0973  0.0206  -0.0656 52  TRP A N   
427  C CA  . TRP A 57  ? 0.3321 0.3389 0.5315 0.1190  0.0334  -0.0747 52  TRP A CA  
428  C C   . TRP A 57  ? 0.5151 0.4764 0.7016 0.1232  0.0476  -0.1050 52  TRP A C   
429  O O   . TRP A 57  ? 0.5310 0.4848 0.6938 0.1037  0.0448  -0.1292 52  TRP A O   
430  C CB  . TRP A 57  ? 0.3227 0.3779 0.5089 0.1123  0.0319  -0.0780 52  TRP A CB  
431  C CG  . TRP A 57  ? 0.2615 0.3597 0.4626 0.1123  0.0246  -0.0525 52  TRP A CG  
432  C CD1 . TRP A 57  ? 0.2604 0.3958 0.4843 0.1267  0.0325  -0.0434 52  TRP A CD1 
433  C CD2 . TRP A 57  ? 0.2262 0.3361 0.4218 0.0953  0.0088  -0.0363 52  TRP A CD2 
434  N NE1 . TRP A 57  ? 0.2470 0.4142 0.4783 0.1151  0.0208  -0.0234 52  TRP A NE1 
435  C CE2 . TRP A 57  ? 0.2442 0.3912 0.4549 0.0974  0.0069  -0.0191 52  TRP A CE2 
436  C CE3 . TRP A 57  ? 0.2349 0.3304 0.4173 0.0790  -0.0029 -0.0366 52  TRP A CE3 
437  C CZ2 . TRP A 57  ? 0.2405 0.3990 0.4456 0.0828  -0.0059 -0.0040 52  TRP A CZ2 
438  C CZ3 . TRP A 57  ? 0.2122 0.3229 0.3920 0.0697  -0.0137 -0.0203 52  TRP A CZ3 
439  C CH2 . TRP A 57  ? 0.1707 0.3070 0.3580 0.0713  -0.0151 -0.0050 52  TRP A CH2 
440  N N   . ASP A 58  ? 0.5041 0.4336 0.7045 0.1497  0.0615  -0.1049 53  ASP A N   
441  C CA  . ASP A 58  ? 0.6022 0.4915 0.7878 0.1597  0.0798  -0.1379 53  ASP A CA  
442  C C   . ASP A 58  ? 0.5816 0.5227 0.7564 0.1651  0.0884  -0.1519 53  ASP A C   
443  O O   . ASP A 58  ? 0.6497 0.6424 0.8471 0.1811  0.0918  -0.1340 53  ASP A O   
444  C CB  . ASP A 58  ? 0.7157 0.5602 0.9202 0.1956  0.0949  -0.1325 53  ASP A CB  
445  C CG  . ASP A 58  ? 0.8532 0.6569 1.0392 0.2108  0.1173  -0.1691 53  ASP A CG  
446  O OD1 . ASP A 58  ? 0.9137 0.7019 1.0685 0.1862  0.1197  -0.2030 53  ASP A OD1 
447  O OD2 . ASP A 58  ? 0.9484 0.7416 1.1380 0.2445  0.1260  -0.1609 53  ASP A OD2 
448  N N   . LEU A 59  ? 0.5281 0.4575 0.6663 0.1488  0.0916  -0.1840 54  LEU A N   
449  C CA  . LEU A 59  ? 0.5483 0.5215 0.6619 0.1493  0.1002  -0.1959 54  LEU A CA  
450  C C   . LEU A 59  ? 0.6260 0.5932 0.7409 0.1795  0.1302  -0.2162 54  LEU A C   
451  O O   . LEU A 59  ? 0.6713 0.6718 0.7624 0.1816  0.1449  -0.2287 54  LEU A O   
452  C CB  . LEU A 59  ? 0.5555 0.5233 0.6226 0.1212  0.0874  -0.2200 54  LEU A CB  
453  C CG  . LEU A 59  ? 0.6150 0.6155 0.6827 0.0989  0.0608  -0.1965 54  LEU A CG  
454  C CD1 . LEU A 59  ? 0.6012 0.6086 0.6255 0.0774  0.0446  -0.2181 54  LEU A CD1 
455  C CD2 . LEU A 59  ? 0.6585 0.7085 0.7384 0.1070  0.0632  -0.1658 54  LEU A CD2 
456  N N   . LYS A 60  ? 0.6951 0.6180 0.8365 0.2045  0.1407  -0.2174 55  LYS A N   
457  C CA  . LYS A 60  ? 0.7405 0.6477 0.8787 0.2369  0.1658  -0.2289 55  LYS A CA  
458  C C   . LYS A 60  ? 0.7606 0.6595 0.8467 0.2300  0.1832  -0.2664 55  LYS A C   
459  O O   . LYS A 60  ? 0.7596 0.6948 0.8414 0.2482  0.2050  -0.2685 55  LYS A O   
460  C CB  . LYS A 60  ? 0.7183 0.6931 0.8984 0.2641  0.1733  -0.1993 55  LYS A CB  
461  C CG  . LYS A 60  ? 0.7489 0.7490 0.9722 0.2661  0.1509  -0.1608 55  LYS A CG  
462  C CD  . LYS A 60  ? 0.8591 0.8175 1.0957 0.2951  0.1429  -0.1475 55  LYS A CD  
463  C CE  . LYS A 60  ? 0.8660 0.8575 1.1364 0.2953  0.1177  -0.1104 55  LYS A CE  
464  N NZ  . LYS A 60  ? 0.9388 0.8807 1.2160 0.3170  0.1053  -0.0974 55  LYS A NZ  
465  N N   . GLY A 61  ? 0.7962 0.6514 0.8413 0.2014  0.1726  -0.2950 56  GLY A N   
466  C CA  . GLY A 61  ? 0.8833 0.7255 0.8683 0.1922  0.1833  -0.3307 56  GLY A CA  
467  C C   . GLY A 61  ? 0.8791 0.7819 0.8322 0.1732  0.1783  -0.3345 56  GLY A C   
468  O O   . GLY A 61  ? 0.9442 0.8345 0.8374 0.1567  0.1763  -0.3621 56  GLY A O   
469  N N   . ILE A 62  ? 0.8329 0.7990 0.8186 0.1751  0.1741  -0.3043 57  ILE A N   
470  C CA  . ILE A 62  ? 0.8561 0.8691 0.8011 0.1549  0.1649  -0.2940 57  ILE A CA  
471  C C   . ILE A 62  ? 0.8152 0.8200 0.7381 0.1242  0.1271  -0.2897 57  ILE A C   
472  O O   . ILE A 62  ? 0.6933 0.6956 0.6557 0.1164  0.1066  -0.2666 57  ILE A O   
473  C CB  . ILE A 62  ? 1.1187 1.1944 1.0979 0.1607  0.1723  -0.2545 57  ILE A CB  
474  C CG1 . ILE A 62  ? 1.1775 1.2868 1.1415 0.1762  0.2107  -0.2658 57  ILE A CG1 
475  C CG2 . ILE A 62  ? 1.0669 1.1677 1.0222 0.1344  0.1465  -0.2284 57  ILE A CG2 
476  C CD1 . ILE A 62  ? 1.1515 1.3233 1.1262 0.1665  0.2185  -0.2321 57  ILE A CD1 
477  N N   . PRO A 63  ? 0.8490 0.8528 0.7079 0.1082  0.1178  -0.3134 58  PRO A N   
478  C CA  . PRO A 63  ? 0.7823 0.7949 0.6239 0.0830  0.0799  -0.3080 58  PRO A CA  
479  C C   . PRO A 63  ? 0.6722 0.7304 0.5004 0.0803  0.0694  -0.2703 58  PRO A C   
480  O O   . PRO A 63  ? 0.6689 0.7483 0.4819 0.0907  0.0932  -0.2572 58  PRO A O   
481  C CB  . PRO A 63  ? 0.8674 0.8622 0.6423 0.0710  0.0742  -0.3523 58  PRO A CB  
482  C CG  . PRO A 63  ? 0.9552 0.9499 0.6907 0.0895  0.1108  -0.3674 58  PRO A CG  
483  C CD  . PRO A 63  ? 0.9141 0.9072 0.7125 0.1145  0.1411  -0.3504 58  PRO A CD  
484  N N   . LEU A 64  ? 0.6367 0.7081 0.4726 0.0664  0.0366  -0.2533 59  LEU A N   
485  C CA  . LEU A 64  ? 0.6595 0.7611 0.4758 0.0652  0.0245  -0.2192 59  LEU A CA  
486  C C   . LEU A 64  ? 0.7252 0.8341 0.4605 0.0633  0.0211  -0.2308 59  LEU A C   
487  O O   . LEU A 64  ? 0.8109 0.9095 0.5102 0.0568  0.0107  -0.2665 59  LEU A O   
488  C CB  . LEU A 64  ? 0.6337 0.7457 0.4781 0.0557  -0.0093 -0.2032 59  LEU A CB  
489  C CG  . LEU A 64  ? 0.5745 0.6775 0.4878 0.0523  -0.0133 -0.1952 59  LEU A CG  
490  C CD1 . LEU A 64  ? 0.4491 0.5723 0.3782 0.0447  -0.0431 -0.1794 59  LEU A CD1 
491  C CD2 . LEU A 64  ? 0.5288 0.6311 0.4800 0.0636  0.0090  -0.1702 59  LEU A CD2 
492  N N   . ASP A 65  ? 0.7838 0.9072 0.4857 0.0671  0.0301  -0.2012 60  ASP A N   
493  C CA  . ASP A 65  ? 0.8613 0.9897 0.4797 0.0655  0.0173  -0.1999 60  ASP A CA  
494  C C   . ASP A 65  ? 0.8026 0.9387 0.4146 0.0666  -0.0034 -0.1572 60  ASP A C   
495  O O   . ASP A 65  ? 0.6761 0.8144 0.3491 0.0662  -0.0108 -0.1369 60  ASP A O   
496  C CB  . ASP A 65  ? 0.9373 1.0631 0.4937 0.0692  0.0537  -0.2094 60  ASP A CB  
497  C CG  . ASP A 65  ? 0.9118 1.0480 0.4894 0.0712  0.0894  -0.1772 60  ASP A CG  
498  O OD1 . ASP A 65  ? 0.8318 0.9711 0.4186 0.0669  0.0802  -0.1387 60  ASP A OD1 
499  O OD2 . ASP A 65  ? 0.9486 1.0912 0.5343 0.0765  0.1279  -0.1926 60  ASP A OD2 
500  N N   . GLN A 66  ? 0.9245 1.0595 0.4578 0.0694  -0.0118 -0.1431 61  GLN A N   
501  C CA  . GLN A 66  ? 1.0219 1.1541 0.5407 0.0751  -0.0353 -0.1039 61  GLN A CA  
502  C C   . GLN A 66  ? 1.0028 1.1195 0.5304 0.0722  -0.0075 -0.0647 61  GLN A C   
503  O O   . GLN A 66  ? 1.0398 1.1415 0.5537 0.0769  -0.0219 -0.0311 61  GLN A O   
504  C CB  . GLN A 66  ? 1.1423 1.2744 0.5718 0.0824  -0.0615 -0.1004 61  GLN A CB  
505  C CG  . GLN A 66  ? 1.2526 1.3986 0.6884 0.0757  -0.0904 -0.1383 61  GLN A CG  
506  C CD  . GLN A 66  ? 1.4054 1.5535 0.8005 0.0787  -0.1272 -0.1231 61  GLN A CD  
507  O OE1 . GLN A 66  ? 1.4876 1.6157 0.8222 0.0841  -0.1241 -0.0907 61  GLN A OE1 
508  N NE2 . GLN A 66  ? 1.4170 1.5903 0.8478 0.0737  -0.1610 -0.1457 61  GLN A NE2 
509  N N   . GLY A 67  ? 0.8477 0.9688 0.4013 0.0645  0.0321  -0.0704 62  GLY A N   
510  C CA  . GLY A 67  ? 0.7493 0.8652 0.3223 0.0554  0.0589  -0.0386 62  GLY A CA  
511  C C   . GLY A 67  ? 0.6887 0.8169 0.3558 0.0523  0.0602  -0.0389 62  GLY A C   
512  O O   . GLY A 67  ? 0.6563 0.7833 0.3514 0.0424  0.0733  -0.0147 62  GLY A O   
513  N N   . SER A 68  ? 0.6394 0.7768 0.3510 0.0589  0.0460  -0.0668 63  SER A N   
514  C CA  . SER A 68  ? 0.5136 0.6595 0.3063 0.0586  0.0449  -0.0676 63  SER A CA  
515  C C   . SER A 68  ? 0.4865 0.6231 0.3013 0.0548  0.0258  -0.0398 63  SER A C   
516  O O   . SER A 68  ? 0.4903 0.6145 0.2768 0.0592  0.0003  -0.0314 63  SER A O   
517  C CB  . SER A 68  ? 0.5358 0.6799 0.3572 0.0643  0.0301  -0.0990 63  SER A CB  
518  O OG  . SER A 68  ? 0.7424 0.8874 0.5559 0.0693  0.0533  -0.1275 63  SER A OG  
519  N N   . GLU A 69  ? 0.4290 0.5738 0.2942 0.0483  0.0376  -0.0271 64  GLU A N   
520  C CA  . GLU A 69  ? 0.4844 0.6167 0.3700 0.0436  0.0222  -0.0056 64  GLU A CA  
521  C C   . GLU A 69  ? 0.4209 0.5678 0.3734 0.0419  0.0226  -0.0083 64  GLU A C   
522  O O   . GLU A 69  ? 0.3933 0.5632 0.3778 0.0413  0.0411  -0.0144 64  GLU A O   
523  C CB  . GLU A 69  ? 0.5650 0.6806 0.4175 0.0308  0.0352  0.0215  64  GLU A CB  
524  C CG  . GLU A 69  ? 0.7154 0.8043 0.4908 0.0357  0.0297  0.0335  64  GLU A CG  
525  C CD  . GLU A 69  ? 0.8815 0.9358 0.6215 0.0229  0.0401  0.0651  64  GLU A CD  
526  O OE1 . GLU A 69  ? 0.9287 0.9908 0.6772 0.0027  0.0692  0.0729  64  GLU A OE1 
527  O OE2 . GLU A 69  ? 0.9852 1.0039 0.6908 0.0332  0.0199  0.0817  64  GLU A OE2 
528  N N   . LEU A 70  ? 0.3855 0.5214 0.3576 0.0437  0.0020  -0.0034 65  LEU A N   
529  C CA  . LEU A 70  ? 0.3273 0.4719 0.3500 0.0414  0.0000  -0.0014 65  LEU A CA  
530  C C   . LEU A 70  ? 0.3535 0.4899 0.3756 0.0284  0.0013  0.0186  65  LEU A C   
531  O O   . LEU A 70  ? 0.3560 0.4657 0.3493 0.0276  -0.0084 0.0293  65  LEU A O   
532  C CB  . LEU A 70  ? 0.3470 0.4838 0.3870 0.0481  -0.0189 -0.0095 65  LEU A CB  
533  C CG  . LEU A 70  ? 0.3100 0.4484 0.3890 0.0463  -0.0231 -0.0044 65  LEU A CG  
534  C CD1 . LEU A 70  ? 0.3071 0.4582 0.4180 0.0512  -0.0129 -0.0112 65  LEU A CD1 
535  C CD2 . LEU A 70  ? 0.3000 0.4300 0.3857 0.0493  -0.0378 -0.0093 65  LEU A CD2 
536  N N   . HIS A 71  ? 0.2595 0.4189 0.3137 0.0187  0.0127  0.0224  66  HIS A N   
537  C CA  . HIS A 71  ? 0.3499 0.5034 0.4051 -0.0003 0.0144  0.0370  66  HIS A CA  
538  C C   . HIS A 71  ? 0.3041 0.4580 0.3880 -0.0012 -0.0011 0.0372  66  HIS A C   
539  O O   . HIS A 71  ? 0.2325 0.4141 0.3535 0.0054  -0.0037 0.0319  66  HIS A O   
540  C CB  . HIS A 71  ? 0.3882 0.5769 0.4628 -0.0161 0.0357  0.0399  66  HIS A CB  
541  C CG  . HIS A 71  ? 0.5056 0.6857 0.5776 -0.0438 0.0394  0.0524  66  HIS A CG  
542  N ND1 . HIS A 71  ? 0.5755 0.8011 0.6905 -0.0629 0.0483  0.0524  66  HIS A ND1 
543  C CD2 . HIS A 71  ? 0.5688 0.6981 0.6009 -0.0562 0.0354  0.0639  66  HIS A CD2 
544  C CE1 . HIS A 71  ? 0.6165 0.8186 0.7172 -0.0915 0.0497  0.0613  66  HIS A CE1 
545  N NE2 . HIS A 71  ? 0.5912 0.7285 0.6388 -0.0867 0.0432  0.0689  66  HIS A NE2 
546  N N   . VAL A 72  ? 0.3108 0.4303 0.3725 -0.0068 -0.0107 0.0438  67  VAL A N   
547  C CA  . VAL A 72  ? 0.2209 0.3367 0.2989 -0.0082 -0.0232 0.0424  67  VAL A CA  
548  C C   . VAL A 72  ? 0.2714 0.3705 0.3393 -0.0314 -0.0224 0.0482  67  VAL A C   
549  O O   . VAL A 72  ? 0.2897 0.3517 0.3240 -0.0404 -0.0164 0.0553  67  VAL A O   
550  C CB  . VAL A 72  ? 0.3075 0.3992 0.3729 0.0085  -0.0344 0.0386  67  VAL A CB  
551  C CG1 . VAL A 72  ? 0.3082 0.4184 0.3896 0.0237  -0.0358 0.0292  67  VAL A CG1 
552  C CG2 . VAL A 72  ? 0.3835 0.4377 0.4102 0.0129  -0.0355 0.0447  67  VAL A CG2 
553  N N   . VAL A 73  ? 0.2399 0.3642 0.3342 -0.0418 -0.0293 0.0452  68  VAL A N   
554  C CA  . VAL A 73  ? 0.2474 0.3601 0.3345 -0.0688 -0.0314 0.0453  68  VAL A CA  
555  C C   . VAL A 73  ? 0.2952 0.4001 0.3794 -0.0667 -0.0468 0.0390  68  VAL A C   
556  O O   . VAL A 73  ? 0.3114 0.4493 0.4189 -0.0548 -0.0558 0.0380  68  VAL A O   
557  C CB  . VAL A 73  ? 0.2456 0.4124 0.3697 -0.0910 -0.0261 0.0453  68  VAL A CB  
558  C CG1 . VAL A 73  ? 0.2799 0.4363 0.3980 -0.1259 -0.0305 0.0414  68  VAL A CG1 
559  C CG2 . VAL A 73  ? 0.3077 0.4862 0.4326 -0.0942 -0.0051 0.0509  68  VAL A CG2 
560  N N   . VAL A 74  ? 0.3692 0.4246 0.4195 -0.0769 -0.0480 0.0354  69  VAL A N   
561  C CA  . VAL A 74  ? 0.3651 0.4103 0.4038 -0.0787 -0.0594 0.0265  69  VAL A CA  
562  C C   . VAL A 74  ? 0.3659 0.4209 0.4057 -0.1131 -0.0659 0.0192  69  VAL A C   
563  O O   . VAL A 74  ? 0.3791 0.4093 0.4080 -0.1378 -0.0572 0.0187  69  VAL A O   
564  C CB  . VAL A 74  ? 0.3141 0.3002 0.3154 -0.0647 -0.0554 0.0221  69  VAL A CB  
565  C CG1 . VAL A 74  ? 0.3264 0.3050 0.3121 -0.0653 -0.0629 0.0110  69  VAL A CG1 
566  C CG2 . VAL A 74  ? 0.3274 0.3164 0.3355 -0.0345 -0.0516 0.0277  69  VAL A CG2 
567  N N   . LYS A 75  ? 0.3167 0.4087 0.3685 -0.1162 -0.0818 0.0142  70  LYS A N   
568  C CA  . LYS A 75  ? 0.3855 0.5038 0.4446 -0.1497 -0.0942 0.0048  70  LYS A CA  
569  C C   . LYS A 75  ? 0.4396 0.5478 0.4682 -0.1513 -0.1104 -0.0064 70  LYS A C   
570  O O   . LYS A 75  ? 0.3843 0.4876 0.4003 -0.1242 -0.1123 -0.0020 70  LYS A O   
571  C CB  . LYS A 75  ? 0.3786 0.5800 0.4935 -0.1512 -0.1022 0.0116  70  LYS A CB  
572  C CG  . LYS A 75  ? 0.4431 0.6633 0.5875 -0.1560 -0.0833 0.0192  70  LYS A CG  
573  C CD  . LYS A 75  ? 0.5031 0.8060 0.7051 -0.1423 -0.0882 0.0254  70  LYS A CD  
574  C CE  . LYS A 75  ? 0.6175 0.9628 0.8570 -0.1653 -0.0718 0.0260  70  LYS A CE  
575  N NZ  . LYS A 75  ? 0.6196 1.0367 0.9127 -0.1435 -0.0747 0.0267  70  LYS A NZ  
576  N N   . ASP A 76  ? 0.4821 0.5864 0.4957 -0.1859 -0.1209 -0.0221 71  ASP A N   
577  C CA  . ASP A 76  ? 0.5887 0.6876 0.5663 -0.1900 -0.1381 -0.0353 71  ASP A CA  
578  C C   . ASP A 76  ? 0.5896 0.7718 0.5989 -0.1963 -0.1652 -0.0323 71  ASP A C   
579  O O   . ASP A 76  ? 0.6066 0.8394 0.6621 -0.2118 -0.1686 -0.0314 71  ASP A O   
580  C CB  . ASP A 76  ? 0.7327 0.7693 0.6641 -0.2231 -0.1357 -0.0594 71  ASP A CB  
581  C CG  . ASP A 76  ? 0.8433 0.8581 0.7218 -0.2212 -0.1470 -0.0761 71  ASP A CG  
582  O OD1 . ASP A 76  ? 0.9282 1.0004 0.8103 -0.2226 -0.1709 -0.0752 71  ASP A OD1 
583  O OD2 . ASP A 76  ? 0.9111 0.8513 0.7420 -0.2155 -0.1314 -0.0894 71  ASP A OD2 
584  N N   . HIS A 77  ? 0.7390 1.6014 0.9845 0.2164  -0.2570 -0.2081 72  HIS A N   
585  C CA  . HIS A 77  ? 0.7832 1.6645 1.1102 0.1787  -0.3042 -0.1906 72  HIS A CA  
586  C C   . HIS A 77  ? 0.8653 1.7718 1.1886 0.1415  -0.3481 -0.2112 72  HIS A C   
587  O O   . HIS A 77  ? 0.9153 1.7994 1.2467 0.1100  -0.3917 -0.1840 72  HIS A O   
588  C CB  . HIS A 77  ? 0.7784 1.6176 1.0821 0.1866  -0.3138 -0.1593 72  HIS A CB  
589  C CG  . HIS A 77  ? 0.7735 1.6521 1.1669 0.1913  -0.3211 -0.1465 72  HIS A CG  
590  N ND1 . HIS A 77  ? 0.7396 1.6303 1.1798 0.2075  -0.2870 -0.1451 72  HIS A ND1 
591  C CD2 . HIS A 77  ? 0.6181 1.5275 1.0655 0.1843  -0.3575 -0.1311 72  HIS A CD2 
592  C CE1 . HIS A 77  ? 0.5576 1.4837 1.0769 0.2121  -0.2997 -0.1289 72  HIS A CE1 
593  N NE2 . HIS A 77  ? 0.7359 1.6769 1.2612 0.1993  -0.3434 -0.1199 72  HIS A NE2 
594  N N   . GLU A 78  ? 0.9325 1.8818 1.2332 0.1413  -0.3370 -0.2614 73  GLU A N   
595  C CA  . GLU A 78  ? 1.0665 2.0679 1.4057 0.0855  -0.3772 -0.2992 73  GLU A CA  
596  C C   . GLU A 78  ? 1.1131 2.1835 1.6038 0.0636  -0.3914 -0.2835 73  GLU A C   
597  O O   . GLU A 78  ? 1.1520 2.2371 1.6914 0.0208  -0.4417 -0.2626 73  GLU A O   
598  C CB  . GLU A 78  ? 1.0642 2.1124 1.3776 0.0796  -0.3492 -0.3685 73  GLU A CB  
599  C CG  . GLU A 78  ? 1.1549 2.2054 1.4378 -0.0005 -0.3826 -0.4219 73  GLU A CG  
600  C CD  . GLU A 78  ? 1.2535 2.1984 1.3932 -0.0157 -0.4177 -0.4025 73  GLU A CD  
601  O OE1 . GLU A 78  ? 1.3331 2.1955 1.3098 -0.0063 -0.3919 -0.4304 73  GLU A OE1 
602  O OE2 . GLU A 78  ? 1.2590 2.1884 1.4368 -0.0374 -0.4655 -0.3573 73  GLU A OE2 
603  N N   . THR A 79  ? 1.1153 2.2200 1.6715 0.0978  -0.3445 -0.2853 74  THR A N   
604  C CA  . THR A 79  ? 1.1680 2.3400 1.8707 0.0876  -0.3391 -0.2707 74  THR A CA  
605  C C   . THR A 79  ? 1.1737 2.2987 1.8828 0.1274  -0.3250 -0.2152 74  THR A C   
606  O O   . THR A 79  ? 1.1215 2.1776 1.7462 0.1667  -0.2900 -0.2057 74  THR A O   
607  C CB  . THR A 79  ? 1.1620 2.4021 1.9464 0.0878  -0.2825 -0.3183 74  THR A CB  
608  O OG1 . THR A 79  ? 1.2078 2.4864 1.9760 0.0409  -0.2843 -0.3834 74  THR A OG1 
609  C CG2 . THR A 79  ? 1.1589 2.4707 2.1033 0.0710  -0.2712 -0.2999 74  THR A CG2 
610  N N   . MET A 80  ? 1.2329 2.4004 2.0435 0.1123  -0.3519 -0.1794 75  MET A N   
611  C CA  . MET A 80  ? 1.2447 2.3688 2.0566 0.1411  -0.3474 -0.1294 75  MET A CA  
612  C C   . MET A 80  ? 1.2438 2.4066 2.1546 0.1680  -0.3064 -0.1148 75  MET A C   
613  O O   . MET A 80  ? 1.2330 2.3421 2.0954 0.2012  -0.2598 -0.1182 75  MET A O   
614  C CB  . MET A 80  ? 1.2900 2.4397 2.1325 0.1210  -0.4056 -0.1004 75  MET A CB  
615  C CG  . MET A 80  ? 1.3313 2.4354 2.0721 0.0998  -0.4435 -0.1112 75  MET A CG  
616  S SD  . MET A 80  ? 1.7259 2.8604 2.4958 0.1021  -0.4957 -0.0824 75  MET A SD  
617  C CE  . MET A 80  ? 1.8088 2.8625 2.4760 0.1553  -0.4593 -0.0826 75  MET A CE  
618  N N   . GLY A 81  ? 1.2659 2.5192 2.3123 0.1529  -0.3250 -0.0914 76  GLY A N   
619  C CA  . GLY A 81  ? 1.2499 2.5498 2.4052 0.1801  -0.2835 -0.0687 76  GLY A CA  
620  C C   . GLY A 81  ? 1.2326 2.5570 2.4228 0.1843  -0.2227 -0.1069 76  GLY A C   
621  O O   . GLY A 81  ? 1.2271 2.5253 2.4328 0.2197  -0.1656 -0.0960 76  GLY A O   
622  N N   . ARG A 82  ? 1.2063 2.5736 2.4061 0.1444  -0.2312 -0.1533 77  ARG A N   
623  C CA  . ARG A 82  ? 1.1468 2.5205 2.3610 0.1425  -0.1678 -0.2002 77  ARG A CA  
624  C C   . ARG A 82  ? 1.0061 2.2725 2.0629 0.1746  -0.1481 -0.2185 77  ARG A C   
625  O O   . ARG A 82  ? 0.9878 2.1931 1.9418 0.1860  -0.1880 -0.1991 77  ARG A O   
626  C CB  . ARG A 82  ? 1.2295 2.6857 2.5106 0.0765  -0.1828 -0.2504 77  ARG A CB  
627  C CG  . ARG A 82  ? 1.3382 2.9082 2.7686 0.0311  -0.2175 -0.2248 77  ARG A CG  
628  C CD  . ARG A 82  ? 1.4587 3.0877 2.9249 -0.0533 -0.2466 -0.2740 77  ARG A CD  
629  N NE  . ARG A 82  ? 1.5328 3.2078 3.0922 -0.0921 -0.1783 -0.3156 77  ARG A NE  
630  C CZ  . ARG A 82  ? 1.6337 3.3447 3.2227 -0.1805 -0.1822 -0.3666 77  ARG A CZ  
631  N NH1 . ARG A 82  ? 1.7021 3.4067 3.2255 -0.2348 -0.2569 -0.3808 77  ARG A NH1 
632  N NH2 . ARG A 82  ? 1.6681 3.4011 3.3355 -0.2214 -0.1069 -0.4013 77  ARG A NH2 
633  N N   . ASN A 83  ? 0.9158 2.1535 1.9483 0.1876  -0.0825 -0.2505 78  ASN A N   
634  C CA  . ASN A 83  ? 0.8137 1.9476 1.6954 0.2252  -0.0621 -0.2478 78  ASN A CA  
635  C C   . ASN A 83  ? 0.7660 1.8891 1.5395 0.2194  -0.0941 -0.2783 78  ASN A C   
636  O O   . ASN A 83  ? 0.7573 1.8313 1.4353 0.2294  -0.1381 -0.2525 78  ASN A O   
637  C CB  . ASN A 83  ? 0.7733 1.8409 1.6345 0.2504  0.0239  -0.2473 78  ASN A CB  
638  C CG  . ASN A 83  ? 0.7635 1.8654 1.6829 0.2232  0.0820  -0.2974 78  ASN A CG  
639  O OD1 . ASN A 83  ? 0.7850 1.9258 1.6910 0.1965  0.0730  -0.3465 78  ASN A OD1 
640  N ND2 . ASN A 83  ? 0.7602 1.8396 1.7363 0.2259  0.1492  -0.2871 78  ASN A ND2 
641  N N   . ARG A 84  ? 0.7379 1.9054 1.5302 0.1993  -0.0642 -0.3335 79  ARG A N   
642  C CA  . ARG A 84  ? 0.7141 1.8635 1.3904 0.2136  -0.0623 -0.3634 79  ARG A CA  
643  C C   . ARG A 84  ? 0.6901 1.7169 1.2264 0.2681  -0.0127 -0.3277 79  ARG A C   
644  O O   . ARG A 84  ? 0.5068 1.4875 0.9206 0.2928  -0.0423 -0.3037 79  ARG A O   
645  C CB  . ARG A 84  ? 0.5215 1.6776 1.1304 0.1994  -0.1489 -0.3537 79  ARG A CB  
646  C CG  . ARG A 84  ? 0.7290 1.8306 1.2103 0.1809  -0.1496 -0.3813 79  ARG A CG  
647  C CD  . ARG A 84  ? 0.8405 1.8370 1.2714 0.1466  -0.0619 -0.4082 79  ARG A CD  
648  N NE  . ARG A 84  ? 0.9866 1.8740 1.2651 0.1122  -0.0557 -0.4276 79  ARG A NE  
649  C CZ  . ARG A 84  ? 1.1061 1.8720 1.2978 0.0829  0.0209  -0.4510 79  ARG A CZ  
650  N NH1 . ARG A 84  ? 1.0927 1.8378 1.3407 0.0822  0.0954  -0.4582 79  ARG A NH1 
651  N NH2 . ARG A 84  ? 1.2386 1.8923 1.2769 0.0553  0.0272  -0.4669 79  ARG A NH2 
652  N N   . PHE A 85  ? 0.4308 0.5748 0.8348 -0.0356 -0.0833 -0.0715 80  PHE A N   
653  C CA  . PHE A 85  ? 0.4376 0.5777 0.8022 -0.0474 -0.0554 -0.0495 80  PHE A CA  
654  C C   . PHE A 85  ? 0.4013 0.5045 0.7201 -0.0520 -0.0549 -0.0250 80  PHE A C   
655  O O   . PHE A 85  ? 0.4638 0.5604 0.7964 -0.0639 -0.0563 -0.0242 80  PHE A O   
656  C CB  . PHE A 85  ? 0.4302 0.6094 0.8297 -0.0749 -0.0241 -0.0594 80  PHE A CB  
657  C CG  . PHE A 85  ? 0.4846 0.6540 0.8373 -0.0943 0.0020  -0.0351 80  PHE A CG  
658  C CD1 . PHE A 85  ? 0.5188 0.6580 0.8390 -0.1134 0.0067  -0.0108 80  PHE A CD1 
659  C CD2 . PHE A 85  ? 0.4724 0.6600 0.8158 -0.0942 0.0176  -0.0385 80  PHE A CD2 
660  C CE1 . PHE A 85  ? 0.5004 0.6222 0.7747 -0.1316 0.0219  0.0122  80  PHE A CE1 
661  C CE2 . PHE A 85  ? 0.4661 0.6413 0.7619 -0.1135 0.0377  -0.0166 80  PHE A CE2 
662  C CZ  . PHE A 85  ? 0.4584 0.5984 0.7176 -0.1323 0.0378  0.0098  80  PHE A CZ  
663  N N   . LEU A 86  ? 0.3706 0.4508 0.6423 -0.0420 -0.0547 -0.0093 81  LEU A N   
664  C CA  . LEU A 86  ? 0.3591 0.4098 0.6002 -0.0436 -0.0554 0.0059  81  LEU A CA  
665  C C   . LEU A 86  ? 0.3905 0.4360 0.6145 -0.0575 -0.0388 0.0248  81  LEU A C   
666  O O   . LEU A 86  ? 0.4109 0.4357 0.6321 -0.0683 -0.0416 0.0356  81  LEU A O   
667  C CB  . LEU A 86  ? 0.3387 0.3686 0.5429 -0.0270 -0.0658 0.0050  81  LEU A CB  
668  C CG  . LEU A 86  ? 0.4007 0.4135 0.5992 -0.0218 -0.0837 -0.0072 81  LEU A CG  
669  C CD1 . LEU A 86  ? 0.4182 0.4429 0.6572 -0.0252 -0.0964 -0.0195 81  LEU A CD1 
670  C CD2 . LEU A 86  ? 0.3407 0.3367 0.4965 -0.0129 -0.0941 -0.0116 81  LEU A CD2 
671  N N   . GLY A 87  ? 0.3335 0.3927 0.5447 -0.0574 -0.0262 0.0283  82  GLY A N   
672  C CA  . GLY A 87  ? 0.3415 0.3927 0.5283 -0.0720 -0.0137 0.0461  82  GLY A CA  
673  C C   . GLY A 87  ? 0.3079 0.3801 0.4849 -0.0697 0.0000  0.0432  82  GLY A C   
674  O O   . GLY A 87  ? 0.2666 0.3516 0.4532 -0.0524 -0.0046 0.0298  82  GLY A O   
675  N N   . GLU A 88  ? 0.2771 0.3478 0.4309 -0.0887 0.0138  0.0556  83  GLU A N   
676  C CA  . GLU A 88  ? 0.2695 0.3628 0.4151 -0.0890 0.0288  0.0494  83  GLU A CA  
677  C C   . GLU A 88  ? 0.3754 0.4475 0.4757 -0.1007 0.0323  0.0698  83  GLU A C   
678  O O   . GLU A 88  ? 0.3258 0.3664 0.4013 -0.1173 0.0245  0.0892  83  GLU A O   
679  C CB  . GLU A 88  ? 0.2744 0.4089 0.4522 -0.1079 0.0497  0.0278  83  GLU A CB  
680  C CG  . GLU A 88  ? 0.5278 0.6589 0.6880 -0.1478 0.0674  0.0370  83  GLU A CG  
681  C CD  . GLU A 88  ? 0.5761 0.7578 0.7731 -0.1717 0.0961  0.0070  83  GLU A CD  
682  O OE1 . GLU A 88  ? 0.5901 0.8097 0.8276 -0.1539 0.1002  -0.0214 83  GLU A OE1 
683  O OE2 . GLU A 88  ? 0.6280 0.8109 0.8161 -0.2102 0.1139  0.0093  83  GLU A OE2 
684  N N   . ALA A 89  ? 0.3220 0.4072 0.4117 -0.0920 0.0392  0.0650  84  ALA A N   
685  C CA  . ALA A 89  ? 0.3678 0.4360 0.4147 -0.1032 0.0412  0.0809  84  ALA A CA  
686  C C   . ALA A 89  ? 0.4223 0.5232 0.4667 -0.1100 0.0622  0.0656  84  ALA A C   
687  O O   . ALA A 89  ? 0.3592 0.4897 0.4393 -0.0934 0.0668  0.0432  84  ALA A O   
688  C CB  . ALA A 89  ? 0.3928 0.4352 0.4291 -0.0800 0.0214  0.0905  84  ALA A CB  
689  N N   . LYS A 90  ? 0.3965 0.4879 0.3970 -0.1359 0.0717  0.0765  85  LYS A N   
690  C CA  . LYS A 90  ? 0.4580 0.5774 0.4490 -0.1430 0.0911  0.0609  85  LYS A CA  
691  C C   . LYS A 90  ? 0.4837 0.5737 0.4363 -0.1325 0.0746  0.0783  85  LYS A C   
692  O O   . LYS A 90  ? 0.5691 0.6192 0.4756 -0.1480 0.0602  0.1028  85  LYS A O   
693  C CB  . LYS A 90  ? 0.5400 0.6738 0.5026 -0.1883 0.1189  0.0552  85  LYS A CB  
694  C CG  . LYS A 90  ? 0.6546 0.8232 0.6631 -0.2036 0.1383  0.0327  85  LYS A CG  
695  C CD  . LYS A 90  ? 0.7046 0.9210 0.7420 -0.2091 0.1643  -0.0079 85  LYS A CD  
696  C CE  . LYS A 90  ? 0.6854 0.9393 0.7891 -0.2097 0.1746  -0.0380 85  LYS A CE  
697  N NZ  . LYS A 90  ? 0.7617 0.9903 0.8432 -0.2362 0.1754  -0.0200 85  LYS A NZ  
698  N N   . VAL A 91  ? 0.4126 0.5177 0.3856 -0.1061 0.0723  0.0656  86  VAL A N   
699  C CA  . VAL A 91  ? 0.4571 0.5394 0.4022 -0.0961 0.0576  0.0777  86  VAL A CA  
700  C C   . VAL A 91  ? 0.4649 0.5635 0.3825 -0.1115 0.0733  0.0680  86  VAL A C   
701  O O   . VAL A 91  ? 0.3741 0.5111 0.3192 -0.1095 0.0925  0.0417  86  VAL A O   
702  C CB  . VAL A 91  ? 0.4894 0.5683 0.4641 -0.0631 0.0436  0.0736  86  VAL A CB  
703  C CG1 . VAL A 91  ? 0.5296 0.6025 0.5315 -0.0530 0.0360  0.0742  86  VAL A CG1 
704  C CG2 . VAL A 91  ? 0.4697 0.5746 0.4655 -0.0497 0.0531  0.0530  86  VAL A CG2 
705  N N   . PRO A 92  ? 0.5176 0.5849 0.3812 -0.1279 0.0619  0.0870  87  PRO A N   
706  C CA  . PRO A 92  ? 0.5364 0.6138 0.3599 -0.1488 0.0762  0.0789  87  PRO A CA  
707  C C   . PRO A 92  ? 0.5398 0.6302 0.3817 -0.1227 0.0714  0.0657  87  PRO A C   
708  O O   . PRO A 92  ? 0.5776 0.6415 0.4157 -0.1051 0.0463  0.0790  87  PRO A O   
709  C CB  . PRO A 92  ? 0.6448 0.6684 0.3991 -0.1732 0.0535  0.1087  87  PRO A CB  
710  C CG  . PRO A 92  ? 0.7043 0.6933 0.4796 -0.1488 0.0192  0.1281  87  PRO A CG  
711  C CD  . PRO A 92  ? 0.5927 0.6098 0.4304 -0.1286 0.0307  0.1150  87  PRO A CD  
712  N N   . LEU A 93  ? 0.5030 0.6351 0.3711 -0.1208 0.0944  0.0361  88  LEU A N   
713  C CA  . LEU A 93  ? 0.4840 0.6263 0.3736 -0.0966 0.0891  0.0223  88  LEU A CA  
714  C C   . LEU A 93  ? 0.5569 0.6877 0.3960 -0.1106 0.0858  0.0252  88  LEU A C   
715  O O   . LEU A 93  ? 0.4607 0.5962 0.3127 -0.0933 0.0796  0.0151  88  LEU A O   
716  C CB  . LEU A 93  ? 0.4547 0.6396 0.3992 -0.0852 0.1063  -0.0125 88  LEU A CB  
717  C CG  . LEU A 93  ? 0.3389 0.5272 0.3335 -0.0658 0.0992  -0.0152 88  LEU A CG  
718  C CD1 . LEU A 93  ? 0.4002 0.6194 0.4516 -0.0495 0.1028  -0.0494 88  LEU A CD1 
719  C CD2 . LEU A 93  ? 0.3773 0.5303 0.3693 -0.0450 0.0754  0.0087  88  LEU A CD2 
720  N N   . ARG A 94  ? 0.5971 0.7072 0.3734 -0.1445 0.0873  0.0402  89  ARG A N   
721  C CA  . ARG A 94  ? 0.7121 0.7991 0.4261 -0.1613 0.0765  0.0478  89  ARG A CA  
722  C C   . ARG A 94  ? 0.6505 0.7028 0.3711 -0.1338 0.0382  0.0661  89  ARG A C   
723  O O   . ARG A 94  ? 0.5533 0.5994 0.2562 -0.1299 0.0266  0.0618  89  ARG A O   
724  C CB  . ARG A 94  ? 0.8356 0.8870 0.4944 -0.1944 0.0716  0.0616  89  ARG A CB  
725  C CG  . ARG A 94  ? 0.9494 0.9487 0.5876 -0.1957 0.0396  0.0960  89  ARG A CG  
726  C CD  . ARG A 94  ? 1.1304 1.0892 0.7077 -0.2311 0.0309  0.1088  89  ARG A CD  
727  N NE  . ARG A 94  ? 1.2507 1.2380 0.8316 -0.2576 0.0659  0.0909  89  ARG A NE  
728  C CZ  . ARG A 94  ? 1.3223 1.3034 0.9154 -0.2658 0.0690  0.0987  89  ARG A CZ  
729  N NH1 . ARG A 94  ? 1.3202 1.2664 0.9230 -0.2491 0.0392  0.1243  89  ARG A NH1 
730  N NH2 . ARG A 94  ? 1.3634 1.3743 0.9629 -0.2908 0.1010  0.0778  89  ARG A NH2 
731  N N   . GLU A 95  ? 0.6549 0.6891 0.4075 -0.1153 0.0200  0.0815  90  GLU A N   
732  C CA  . GLU A 95  ? 0.6413 0.6517 0.4168 -0.0898 -0.0124 0.0901  90  GLU A CA  
733  C C   . GLU A 95  ? 0.5774 0.6162 0.3994 -0.0644 -0.0049 0.0688  90  GLU A C   
734  O O   . GLU A 95  ? 0.6489 0.6763 0.4834 -0.0503 -0.0258 0.0678  90  GLU A O   
735  C CB  . GLU A 95  ? 0.6556 0.6505 0.4639 -0.0773 -0.0261 0.1017  90  GLU A CB  
736  C CG  . GLU A 95  ? 0.8507 0.8062 0.6156 -0.1009 -0.0425 0.1258  90  GLU A CG  
737  C CD  . GLU A 95  ? 0.9421 0.8744 0.7443 -0.0834 -0.0685 0.1345  90  GLU A CD  
738  O OE1 . GLU A 95  ? 1.0322 0.9495 0.8604 -0.0635 -0.0976 0.1315  90  GLU A OE1 
739  O OE2 . GLU A 95  ? 0.9133 0.8457 0.7251 -0.0895 -0.0595 0.1396  90  GLU A OE2 
740  N N   . VAL A 96  ? 0.4432 0.5164 0.2937 -0.0598 0.0223  0.0502  91  VAL A N   
741  C CA  . VAL A 96  ? 0.4585 0.5499 0.3455 -0.0403 0.0272  0.0318  91  VAL A CA  
742  C C   . VAL A 96  ? 0.4815 0.5794 0.3444 -0.0471 0.0277  0.0196  91  VAL A C   
743  O O   . VAL A 96  ? 0.5468 0.6438 0.4276 -0.0333 0.0187  0.0120  91  VAL A O   
744  C CB  . VAL A 96  ? 0.4952 0.6116 0.4196 -0.0325 0.0460  0.0156  91  VAL A CB  
745  C CG1 . VAL A 96  ? 0.5165 0.6408 0.4695 -0.0164 0.0457  -0.0013 91  VAL A CG1 
746  C CG2 . VAL A 96  ? 0.3851 0.4920 0.3301 -0.0251 0.0422  0.0270  91  VAL A CG2 
747  N N   . LEU A 97  ? 0.4939 0.5980 0.3134 -0.0720 0.0398  0.0161  92  LEU A N   
748  C CA  . LEU A 97  ? 0.5561 0.6666 0.3430 -0.0837 0.0425  0.0019  92  LEU A CA  
749  C C   . LEU A 97  ? 0.6044 0.6751 0.3388 -0.0929 0.0115  0.0226  92  LEU A C   
750  O O   . LEU A 97  ? 0.6815 0.7480 0.3691 -0.1096 0.0095  0.0157  92  LEU A O   
751  C CB  . LEU A 97  ? 0.6175 0.7549 0.3756 -0.1131 0.0733  -0.0170 92  LEU A CB  
752  C CG  . LEU A 97  ? 0.6159 0.8000 0.4340 -0.1044 0.1010  -0.0509 92  LEU A CG  
753  C CD1 . LEU A 97  ? 0.6093 0.8232 0.4042 -0.1376 0.1321  -0.0760 92  LEU A CD1 
754  C CD2 . LEU A 97  ? 0.5821 0.7793 0.4471 -0.0775 0.0952  -0.0726 92  LEU A CD2 
755  N N   . ALA A 98  ? 0.5963 0.6365 0.3405 -0.0817 -0.0158 0.0447  93  ALA A N   
756  C CA  . ALA A 98  ? 0.6657 0.6606 0.3651 -0.0897 -0.0549 0.0646  93  ALA A CA  
757  C C   . ALA A 98  ? 0.5118 0.5009 0.2451 -0.0662 -0.0828 0.0565  93  ALA A C   
758  O O   . ALA A 98  ? 0.5675 0.5222 0.2640 -0.0721 -0.1185 0.0656  93  ALA A O   
759  C CB  . ALA A 98  ? 0.7638 0.7247 0.4568 -0.0932 -0.0752 0.0895  93  ALA A CB  
760  N N   . THR A 99  ? 0.4726 0.4916 0.2740 -0.0423 -0.0689 0.0392  94  THR A N   
761  C CA  . THR A 99  ? 0.4783 0.4999 0.3202 -0.0238 -0.0875 0.0258  94  THR A CA  
762  C C   . THR A 99  ? 0.3832 0.4382 0.2579 -0.0157 -0.0595 0.0036  94  THR A C   
763  O O   . THR A 99  ? 0.3577 0.4311 0.2400 -0.0172 -0.0316 -0.0005 94  THR A O   
764  C CB  . THR A 99  ? 0.6520 0.6676 0.5509 -0.0060 -0.1051 0.0260  94  THR A CB  
765  O OG1 . THR A 99  ? 0.4615 0.5048 0.4088 0.0037  -0.0756 0.0139  94  THR A OG1 
766  C CG2 . THR A 99  ? 0.7268 0.7129 0.6058 -0.0121 -0.1238 0.0473  94  THR A CG2 
767  N N   . PRO A 100 ? 0.4178 0.4773 0.3147 -0.0071 -0.0708 -0.0117 95  PRO A N   
768  C CA  . PRO A 100 ? 0.3883 0.4708 0.3115 -0.0019 -0.0492 -0.0313 95  PRO A CA  
769  C C   . PRO A 100 ? 0.3422 0.4343 0.3076 0.0061  -0.0289 -0.0334 95  PRO A C   
770  O O   . PRO A 100 ? 0.3718 0.4734 0.3488 0.0078  -0.0131 -0.0444 95  PRO A O   
771  C CB  . PRO A 100 ? 0.3819 0.4627 0.3281 0.0051  -0.0700 -0.0451 95  PRO A CB  
772  C CG  . PRO A 100 ? 0.4906 0.5473 0.4027 0.0006  -0.1044 -0.0344 95  PRO A CG  
773  C CD  . PRO A 100 ? 0.4827 0.5235 0.3819 -0.0026 -0.1083 -0.0132 95  PRO A CD  
774  N N   . SER A 101 ? 0.3120 0.3978 0.2979 0.0098  -0.0325 -0.0241 96  SER A N   
775  C CA  . SER A 101 ? 0.3197 0.4090 0.3337 0.0122  -0.0148 -0.0252 96  SER A CA  
776  C C   . SER A 101 ? 0.3727 0.4634 0.3707 0.0100  0.0014  -0.0184 96  SER A C   
777  O O   . SER A 101 ? 0.3545 0.4409 0.3658 0.0109  0.0117  -0.0188 96  SER A O   
778  C CB  . SER A 101 ? 0.3434 0.4294 0.3819 0.0144  -0.0208 -0.0220 96  SER A CB  
779  O OG  . SER A 101 ? 0.4377 0.5153 0.4554 0.0131  -0.0245 -0.0056 96  SER A OG  
780  N N   . LEU A 102 ? 0.3106 0.4056 0.2788 0.0044  0.0023  -0.0140 97  LEU A N   
781  C CA  . LEU A 102 ? 0.3313 0.4357 0.2951 0.0018  0.0177  -0.0149 97  LEU A CA  
782  C C   . LEU A 102 ? 0.3646 0.4616 0.3441 0.0056  0.0215  -0.0046 97  LEU A C   
783  O O   . LEU A 102 ? 0.4047 0.5028 0.3981 0.0096  0.0280  -0.0098 97  LEU A O   
784  C CB  . LEU A 102 ? 0.3968 0.5128 0.3761 0.0061  0.0255  -0.0353 97  LEU A CB  
785  C CG  . LEU A 102 ? 0.4151 0.5441 0.3770 0.0002  0.0261  -0.0514 97  LEU A CG  
786  C CD1 . LEU A 102 ? 0.3615 0.5015 0.3515 0.0078  0.0311  -0.0763 97  LEU A CD1 
787  C CD2 . LEU A 102 ? 0.3151 0.4549 0.2379 -0.0171 0.0347  -0.0497 97  LEU A CD2 
788  N N   . SER A 103 ? 0.3077 0.3946 0.2866 0.0048  0.0134  0.0077  98  SER A N   
789  C CA  . SER A 103 ? 0.3147 0.3951 0.3062 0.0068  0.0170  0.0149  98  SER A CA  
790  C C   . SER A 103 ? 0.3062 0.3785 0.2931 0.0046  0.0055  0.0263  98  SER A C   
791  O O   . SER A 103 ? 0.3587 0.4241 0.3382 0.0037  -0.0108 0.0283  98  SER A O   
792  C CB  . SER A 103 ? 0.2999 0.3738 0.3111 0.0086  0.0202  0.0080  98  SER A CB  
793  O OG  . SER A 103 ? 0.3879 0.4637 0.4165 0.0092  0.0121  0.0022  98  SER A OG  
794  N N   . ALA A 104 ? 0.2745 0.3429 0.2661 0.0041  0.0091  0.0333  99  ALA A N   
795  C CA  . ALA A 104 ? 0.2564 0.3128 0.2488 0.0029  -0.0049 0.0430  99  ALA A CA  
796  C C   . ALA A 104 ? 0.3294 0.3848 0.3389 0.0051  0.0017  0.0429  99  ALA A C   
797  O O   . ALA A 104 ? 0.2914 0.3515 0.2984 0.0044  0.0149  0.0417  99  ALA A O   
798  C CB  . ALA A 104 ? 0.2699 0.3181 0.2269 -0.0094 -0.0100 0.0570  99  ALA A CB  
799  N N   . SER A 105 ? 0.2793 0.3267 0.3085 0.0084  -0.0111 0.0416  100 SER A N   
800  C CA  . SER A 105 ? 0.2900 0.3367 0.3338 0.0090  -0.0053 0.0388  100 SER A CA  
801  C C   . SER A 105 ? 0.3381 0.3697 0.3748 0.0061  -0.0196 0.0531  100 SER A C   
802  O O   . SER A 105 ? 0.2961 0.3111 0.3214 0.0036  -0.0400 0.0631  100 SER A O   
803  C CB  . SER A 105 ? 0.2827 0.3366 0.3637 0.0130  -0.0050 0.0176  100 SER A CB  
804  O OG  . SER A 105 ? 0.3747 0.4216 0.4835 0.0204  -0.0303 0.0125  100 SER A OG  
805  N N   . PHE A 106 ? 0.2551 0.2870 0.2940 0.0041  -0.0116 0.0549  101 PHE A N   
806  C CA  . PHE A 106 ? 0.2594 0.2758 0.2933 -0.0013 -0.0236 0.0678  101 PHE A CA  
807  C C   . PHE A 106 ? 0.3181 0.3334 0.3796 0.0038  -0.0247 0.0575  101 PHE A C   
808  O O   . PHE A 106 ? 0.2184 0.2456 0.2837 0.0048  -0.0086 0.0467  101 PHE A O   
809  C CB  . PHE A 106 ? 0.3282 0.3502 0.3361 -0.0131 -0.0106 0.0790  101 PHE A CB  
810  C CG  . PHE A 106 ? 0.3180 0.3473 0.3000 -0.0209 -0.0041 0.0821  101 PHE A CG  
811  C CD1 . PHE A 106 ? 0.2833 0.3322 0.2693 -0.0152 0.0104  0.0704  101 PHE A CD1 
812  C CD2 . PHE A 106 ? 0.3818 0.3938 0.3311 -0.0362 -0.0145 0.0962  101 PHE A CD2 
813  C CE1 . PHE A 106 ? 0.3284 0.3871 0.2958 -0.0217 0.0169  0.0680  101 PHE A CE1 
814  C CE2 . PHE A 106 ? 0.4210 0.4413 0.3412 -0.0468 -0.0059 0.0953  101 PHE A CE2 
815  C CZ  . PHE A 106 ? 0.3799 0.4274 0.3140 -0.0380 0.0111  0.0788  101 PHE A CZ  
816  N N   . ASN A 107 ? 0.2880 0.2843 0.3655 0.0055  -0.0470 0.0602  102 ASN A N   
817  C CA  . ASN A 107 ? 0.3164 0.3100 0.4203 0.0089  -0.0502 0.0500  102 ASN A CA  
818  C C   . ASN A 107 ? 0.3732 0.3427 0.4596 -0.0013 -0.0637 0.0716  102 ASN A C   
819  O O   . ASN A 107 ? 0.4597 0.3994 0.5500 -0.0023 -0.0925 0.0805  102 ASN A O   
820  C CB  . ASN A 107 ? 0.3722 0.3646 0.5245 0.0208  -0.0680 0.0265  102 ASN A CB  
821  C CG  . ASN A 107 ? 0.3774 0.3811 0.5616 0.0238  -0.0597 0.0028  102 ASN A CG  
822  O OD1 . ASN A 107 ? 0.3872 0.3856 0.5574 0.0183  -0.0542 0.0112  102 ASN A OD1 
823  N ND2 . ASN A 107 ? 0.4166 0.4391 0.6465 0.0307  -0.0571 -0.0313 102 ASN A ND2 
824  N N   . ALA A 108 ? 0.3783 0.3578 0.4461 -0.0106 -0.0456 0.0790  103 ALA A N   
825  C CA  . ALA A 108 ? 0.4119 0.3752 0.4574 -0.0279 -0.0498 0.0986  103 ALA A CA  
826  C C   . ALA A 108 ? 0.3555 0.3128 0.4200 -0.0299 -0.0532 0.0962  103 ALA A C   
827  O O   . ALA A 108 ? 0.3559 0.3335 0.4340 -0.0240 -0.0390 0.0831  103 ALA A O   
828  C CB  . ALA A 108 ? 0.4356 0.4206 0.4560 -0.0398 -0.0265 0.1028  103 ALA A CB  
829  N N   . PRO A 109 ? 0.3502 0.2734 0.4119 -0.0396 -0.0760 0.1099  104 PRO A N   
830  C CA  . PRO A 109 ? 0.3816 0.2951 0.4596 -0.0451 -0.0808 0.1097  104 PRO A CA  
831  C C   . PRO A 109 ? 0.4219 0.3587 0.4877 -0.0607 -0.0556 0.1124  104 PRO A C   
832  O O   . PRO A 109 ? 0.4562 0.4012 0.4932 -0.0776 -0.0414 0.1220  104 PRO A O   
833  C CB  . PRO A 109 ? 0.4231 0.2859 0.4846 -0.0598 -0.1124 0.1313  104 PRO A CB  
834  C CG  . PRO A 109 ? 0.4436 0.2890 0.4987 -0.0503 -0.1336 0.1337  104 PRO A CG  
835  C CD  . PRO A 109 ? 0.3866 0.2710 0.4273 -0.0464 -0.1046 0.1269  104 PRO A CD  
836  N N   . LEU A 110 ? 0.4165 0.3666 0.5080 -0.0553 -0.0506 0.0995  105 LEU A N   
837  C CA  . LEU A 110 ? 0.4198 0.3935 0.5143 -0.0674 -0.0325 0.0962  105 LEU A CA  
838  C C   . LEU A 110 ? 0.3968 0.3499 0.4892 -0.0917 -0.0381 0.1086  105 LEU A C   
839  O O   . LEU A 110 ? 0.3871 0.3114 0.4920 -0.0897 -0.0588 0.1117  105 LEU A O   
840  C CB  . LEU A 110 ? 0.2785 0.2723 0.3970 -0.0504 -0.0292 0.0761  105 LEU A CB  
841  C CG  . LEU A 110 ? 0.2681 0.2759 0.3779 -0.0340 -0.0225 0.0663  105 LEU A CG  
842  C CD1 . LEU A 110 ? 0.3020 0.3110 0.4187 -0.0225 -0.0265 0.0502  105 LEU A CD1 
843  C CD2 . LEU A 110 ? 0.3375 0.3683 0.4408 -0.0379 -0.0084 0.0656  105 LEU A CD2 
844  N N   . LEU A 111 ? 0.4361 0.4044 0.5145 -0.1171 -0.0187 0.1128  106 LEU A N   
845  C CA  . LEU A 111 ? 0.4415 0.3895 0.5088 -0.1501 -0.0184 0.1253  106 LEU A CA  
846  C C   . LEU A 111 ? 0.4549 0.4379 0.5619 -0.1564 -0.0024 0.1057  106 LEU A C   
847  O O   . LEU A 111 ? 0.3530 0.3783 0.4875 -0.1417 0.0112  0.0839  106 LEU A O   
848  C CB  . LEU A 111 ? 0.4596 0.3984 0.4760 -0.1850 -0.0041 0.1413  106 LEU A CB  
849  C CG  . LEU A 111 ? 0.5616 0.4728 0.5363 -0.1793 -0.0187 0.1574  106 LEU A CG  
850  C CD1 . LEU A 111 ? 0.6134 0.5088 0.5256 -0.2216 -0.0054 0.1733  106 LEU A CD1 
851  C CD2 . LEU A 111 ? 0.5639 0.4237 0.5405 -0.1619 -0.0598 0.1711  106 LEU A CD2 
852  N N   . ASP A 112 ? 0.5032 0.4652 0.6161 -0.1780 -0.0085 0.1124  107 ASP A N   
853  C CA  . ASP A 112 ? 0.4762 0.4721 0.6311 -0.1889 0.0062  0.0920  107 ASP A CA  
854  C C   . ASP A 112 ? 0.4722 0.4993 0.6192 -0.2274 0.0401  0.0849  107 ASP A C   
855  O O   . ASP A 112 ? 0.4746 0.4992 0.5793 -0.2423 0.0530  0.0946  107 ASP A O   
856  C CB  . ASP A 112 ? 0.5119 0.4752 0.6817 -0.1976 -0.0129 0.0984  107 ASP A CB  
857  C CG  . ASP A 112 ? 0.6493 0.5560 0.7719 -0.2340 -0.0231 0.1293  107 ASP A CG  
858  O OD1 . ASP A 112 ? 0.6621 0.5602 0.7362 -0.2628 -0.0086 0.1443  107 ASP A OD1 
859  O OD2 . ASP A 112 ? 0.6547 0.5204 0.7854 -0.2355 -0.0487 0.1383  107 ASP A OD2 
860  N N   . THR A 113 ? 0.4620 0.5214 0.6518 -0.2456 0.0558  0.0637  108 THR A N   
861  C CA  . THR A 113 ? 0.5856 0.6852 0.7791 -0.2865 0.0942  0.0467  108 THR A CA  
862  C C   . THR A 113 ? 0.7121 0.7646 0.8349 -0.3182 0.1001  0.0732  108 THR A C   
863  O O   . THR A 113 ? 0.6966 0.7669 0.7915 -0.3367 0.1255  0.0649  108 THR A O   
864  C CB  . THR A 113 ? 0.5818 0.7309 0.8486 -0.2879 0.1059  0.0106  108 THR A CB  
865  O OG1 . THR A 113 ? 0.6139 0.7355 0.9016 -0.2872 0.0836  0.0177  108 THR A OG1 
866  C CG2 . THR A 113 ? 0.5147 0.7181 0.8461 -0.2523 0.1046  -0.0260 108 THR A CG2 
867  N N   . LYS A 114 ? 0.7870 0.7767 0.8788 -0.3228 0.0727  0.1020  109 LYS A N   
868  C CA  . LYS A 114 ? 0.8735 0.8080 0.8923 -0.3494 0.0676  0.1283  109 LYS A CA  
869  C C   . LYS A 114 ? 0.8927 0.7940 0.8506 -0.3389 0.0515  0.1494  109 LYS A C   
870  O O   . LYS A 114 ? 0.9644 0.8116 0.8578 -0.3553 0.0340  0.1733  109 LYS A O   
871  C CB  . LYS A 114 ? 0.9113 0.7894 0.9264 -0.3528 0.0372  0.1471  109 LYS A CB  
872  C CG  . LYS A 114 ? 0.8913 0.7986 0.9729 -0.3589 0.0467  0.1258  109 LYS A CG  
873  C CD  . LYS A 114 ? 0.9426 0.7902 1.0154 -0.3639 0.0167  0.1434  109 LYS A CD  
874  C CE  . LYS A 114 ? 0.9177 0.7444 1.0220 -0.3246 -0.0223 0.1452  109 LYS A CE  
875  N NZ  . LYS A 114 ? 0.8699 0.6646 0.9394 -0.2989 -0.0491 0.1636  109 LYS A NZ  
876  N N   . LYS A 115 ? 0.7924 0.7265 0.7731 -0.3121 0.0545  0.1390  110 LYS A N   
877  C CA  . LYS A 115 ? 0.8300 0.7403 0.7668 -0.2971 0.0387  0.1548  110 LYS A CA  
878  C C   . LYS A 115 ? 0.8350 0.6772 0.7465 -0.2830 -0.0076 0.1820  110 LYS A C   
879  O O   . LYS A 115 ? 0.9336 0.7370 0.7919 -0.2861 -0.0269 0.1990  110 LYS A O   
880  C CB  . LYS A 115 ? 0.9840 0.8992 0.8644 -0.3226 0.0603  0.1532  110 LYS A CB  
881  C CG  . LYS A 115 ? 1.0042 0.9918 0.9195 -0.3282 0.1024  0.1181  110 LYS A CG  
882  C CD  . LYS A 115 ? 0.9538 0.9790 0.9072 -0.2946 0.1039  0.1044  110 LYS A CD  
883  C CE  . LYS A 115 ? 0.9622 1.0573 0.9585 -0.2952 0.1387  0.0644  110 LYS A CE  
884  N NZ  . LYS A 115 ? 0.9132 1.0399 0.9423 -0.2629 0.1368  0.0512  110 LYS A NZ  
885  N N   . GLN A 116 ? 0.7328 0.5637 0.6898 -0.2661 -0.0284 0.1813  111 GLN A N   
886  C CA  . GLN A 116 ? 0.7774 0.5528 0.7328 -0.2454 -0.0742 0.1962  111 GLN A CA  
887  C C   . GLN A 116 ? 0.7071 0.4999 0.7220 -0.2070 -0.0879 0.1837  111 GLN A C   
888  O O   . GLN A 116 ? 0.5948 0.4387 0.6527 -0.1937 -0.0659 0.1603  111 GLN A O   
889  C CB  . GLN A 116 ? 0.8607 0.6009 0.8155 -0.2626 -0.0885 0.2027  111 GLN A CB  
890  C CG  . GLN A 116 ? 1.0453 0.7549 0.9324 -0.3019 -0.0829 0.2191  111 GLN A CG  
891  C CD  . GLN A 116 ? 1.1751 0.8622 1.0645 -0.3266 -0.0842 0.2227  111 GLN A CD  
892  O OE1 . GLN A 116 ? 1.2532 0.9323 1.0981 -0.3656 -0.0653 0.2293  111 GLN A OE1 
893  N NE2 . GLN A 116 ? 1.1884 0.8660 1.1299 -0.3052 -0.1064 0.2164  111 GLN A NE2 
894  N N   . PRO A 117 ? 0.7165 0.4775 0.7360 -0.1797 -0.1223 0.1873  112 PRO A N   
895  C CA  . PRO A 117 ? 0.6151 0.4060 0.6834 -0.1375 -0.1256 0.1632  112 PRO A CA  
896  C C   . PRO A 117 ? 0.5866 0.4013 0.7067 -0.1207 -0.1221 0.1391  112 PRO A C   
897  O O   . PRO A 117 ? 0.5671 0.3552 0.6989 -0.1339 -0.1361 0.1436  112 PRO A O   
898  C CB  . PRO A 117 ? 0.6977 0.4407 0.7698 -0.1209 -0.1683 0.1694  112 PRO A CB  
899  C CG  . PRO A 117 ? 0.7721 0.4796 0.7811 -0.1466 -0.1800 0.1929  112 PRO A CG  
900  C CD  . PRO A 117 ? 0.7274 0.4360 0.7093 -0.1818 -0.1573 0.2023  112 PRO A CD  
901  N N   . THR A 118 ? 0.5040 0.3636 0.6488 -0.0946 -0.1054 0.1146  113 THR A N   
902  C CA  . THR A 118 ? 0.4916 0.3709 0.6743 -0.0798 -0.1036 0.0907  113 THR A CA  
903  C C   . THR A 118 ? 0.5162 0.3867 0.7276 -0.0543 -0.1222 0.0705  113 THR A C   
904  O O   . THR A 118 ? 0.5199 0.3967 0.7602 -0.0447 -0.1262 0.0490  113 THR A O   
905  C CB  . THR A 118 ? 0.4097 0.3361 0.5936 -0.0714 -0.0778 0.0752  113 THR A CB  
906  O OG1 . THR A 118 ? 0.4548 0.3946 0.6258 -0.0546 -0.0710 0.0697  113 THR A OG1 
907  C CG2 . THR A 118 ? 0.3823 0.3283 0.5549 -0.0944 -0.0577 0.0839  113 THR A CG2 
908  N N   . GLY A 119 ? 0.5473 0.4063 0.7538 -0.0445 -0.1329 0.0730  114 GLY A N   
909  C CA  . GLY A 119 ? 0.4934 0.3553 0.7372 -0.0213 -0.1454 0.0451  114 GLY A CA  
910  C C   . GLY A 119 ? 0.4275 0.3297 0.6636 -0.0096 -0.1188 0.0272  114 GLY A C   
911  O O   . GLY A 119 ? 0.4180 0.3293 0.6786 0.0045  -0.1216 0.0041  114 GLY A O   
912  N N   . ALA A 120 ? 0.3667 0.2921 0.5723 -0.0172 -0.0943 0.0354  115 ALA A N   
913  C CA  . ALA A 120 ? 0.3090 0.2625 0.4975 -0.0103 -0.0727 0.0240  115 ALA A CA  
914  C C   . ALA A 120 ? 0.3217 0.2769 0.4886 -0.0115 -0.0679 0.0402  115 ALA A C   
915  O O   . ALA A 120 ? 0.3085 0.2473 0.4610 -0.0225 -0.0756 0.0630  115 ALA A O   
916  C CB  . ALA A 120 ? 0.2966 0.2664 0.4670 -0.0149 -0.0586 0.0232  115 ALA A CB  
917  N N   . SER A 121 ? 0.2954 0.2683 0.4552 -0.0041 -0.0545 0.0276  116 SER A N   
918  C CA  . SER A 121 ? 0.2791 0.2561 0.4207 -0.0040 -0.0497 0.0391  116 SER A CA  
919  C C   . SER A 121 ? 0.3017 0.2987 0.4200 -0.0034 -0.0287 0.0332  116 SER A C   
920  O O   . SER A 121 ? 0.2800 0.2831 0.3944 -0.0030 -0.0204 0.0171  116 SER A O   
921  C CB  . SER A 121 ? 0.3605 0.3303 0.5281 0.0054  -0.0644 0.0277  116 SER A CB  
922  O OG  . SER A 121 ? 0.4267 0.4137 0.6216 0.0126  -0.0558 -0.0051 116 SER A OG  
923  N N   . LEU A 122 ? 0.3078 0.3103 0.4063 -0.0055 -0.0223 0.0462  117 LEU A N   
924  C CA  . LEU A 122 ? 0.2244 0.2385 0.3018 -0.0047 -0.0084 0.0425  117 LEU A CA  
925  C C   . LEU A 122 ? 0.2777 0.2964 0.3499 -0.0019 -0.0037 0.0414  117 LEU A C   
926  O O   . LEU A 122 ? 0.2475 0.2639 0.3188 -0.0026 -0.0096 0.0525  117 LEU A O   
927  C CB  . LEU A 122 ? 0.2211 0.2423 0.2893 -0.0086 -0.0054 0.0524  117 LEU A CB  
928  C CG  . LEU A 122 ? 0.2264 0.2528 0.2784 -0.0054 0.0000  0.0491  117 LEU A CG  
929  C CD1 . LEU A 122 ? 0.2838 0.2970 0.3195 -0.0050 -0.0035 0.0399  117 LEU A CD1 
930  C CD2 . LEU A 122 ? 0.2985 0.3391 0.3602 -0.0071 0.0009  0.0508  117 LEU A CD2 
931  N N   . VAL A 123 ? 0.2640 0.2867 0.3278 -0.0023 0.0066  0.0277  118 VAL A N   
932  C CA  . VAL A 123 ? 0.2760 0.3050 0.3392 -0.0014 0.0126  0.0229  118 VAL A CA  
933  C C   . VAL A 123 ? 0.2726 0.3001 0.3069 -0.0043 0.0201  0.0299  118 VAL A C   
934  O O   . VAL A 123 ? 0.2533 0.2705 0.2641 -0.0102 0.0238  0.0274  118 VAL A O   
935  C CB  . VAL A 123 ? 0.2916 0.3286 0.3725 -0.0046 0.0218  -0.0029 118 VAL A CB  
936  C CG1 . VAL A 123 ? 0.2897 0.3356 0.3705 -0.0068 0.0309  -0.0102 118 VAL A CG1 
937  C CG2 . VAL A 123 ? 0.2210 0.2604 0.3463 0.0033  0.0078  -0.0156 118 VAL A CG2 
938  N N   . LEU A 124 ? 0.2070 0.2399 0.2404 -0.0011 0.0186  0.0381  119 LEU A N   
939  C CA  . LEU A 124 ? 0.2076 0.2393 0.2227 -0.0014 0.0223  0.0414  119 LEU A CA  
940  C C   . LEU A 124 ? 0.2542 0.2930 0.2713 0.0002  0.0247  0.0401  119 LEU A C   
941  O O   . LEU A 124 ? 0.2236 0.2673 0.2546 0.0024  0.0196  0.0398  119 LEU A O   
942  C CB  . LEU A 124 ? 0.2597 0.2962 0.2762 0.0008  0.0178  0.0483  119 LEU A CB  
943  C CG  . LEU A 124 ? 0.2522 0.3011 0.2771 -0.0020 0.0181  0.0552  119 LEU A CG  
944  C CD1 . LEU A 124 ? 0.2902 0.3544 0.3212 -0.0030 0.0221  0.0507  119 LEU A CD1 
945  C CD2 . LEU A 124 ? 0.3306 0.3739 0.3641 -0.0061 0.0128  0.0605  119 LEU A CD2 
946  N N   . GLN A 125 ? 0.2512 0.2856 0.2546 -0.0007 0.0277  0.0388  120 GLN A N   
947  C CA  . GLN A 125 ? 0.2473 0.2879 0.2523 0.0006  0.0298  0.0358  120 GLN A CA  
948  C C   . GLN A 125 ? 0.2757 0.3183 0.2756 0.0045  0.0271  0.0373  120 GLN A C   
949  O O   . GLN A 125 ? 0.2523 0.2826 0.2462 0.0056  0.0218  0.0369  120 GLN A O   
950  C CB  . GLN A 125 ? 0.2387 0.2717 0.2380 -0.0077 0.0379  0.0259  120 GLN A CB  
951  C CG  . GLN A 125 ? 0.3925 0.4247 0.3881 -0.0082 0.0389  0.0231  120 GLN A CG  
952  C CD  . GLN A 125 ? 0.4620 0.5118 0.4793 -0.0032 0.0368  0.0170  120 GLN A CD  
953  O OE1 . GLN A 125 ? 0.5226 0.5809 0.5601 -0.0008 0.0330  0.0122  120 GLN A OE1 
954  N NE2 . GLN A 125 ? 0.4048 0.4571 0.4197 -0.0009 0.0347  0.0155  120 GLN A NE2 
955  N N   . VAL A 126 ? 0.2021 0.2586 0.2056 0.0063  0.0278  0.0362  121 VAL A N   
956  C CA  . VAL A 126 ? 0.2040 0.2708 0.2107 0.0091  0.0285  0.0296  121 VAL A CA  
957  C C   . VAL A 126 ? 0.2907 0.3605 0.2953 0.0102  0.0292  0.0225  121 VAL A C   
958  O O   . VAL A 126 ? 0.2399 0.3121 0.2397 0.0079  0.0286  0.0245  121 VAL A O   
959  C CB  . VAL A 126 ? 0.2485 0.3344 0.2566 0.0036  0.0339  0.0299  121 VAL A CB  
960  C CG1 . VAL A 126 ? 0.2291 0.3345 0.2525 0.0051  0.0390  0.0127  121 VAL A CG1 
961  C CG2 . VAL A 126 ? 0.3271 0.4096 0.3401 0.0011  0.0326  0.0370  121 VAL A CG2 
962  N N   . SER A 127 ? 0.2755 0.3425 0.2876 0.0150  0.0259  0.0124  122 SER A N   
963  C CA  . SER A 127 ? 0.3536 0.4207 0.3665 0.0164  0.0250  0.0037  122 SER A CA  
964  C C   . SER A 127 ? 0.3675 0.4481 0.3988 0.0228  0.0229  -0.0145 122 SER A C   
965  O O   . SER A 127 ? 0.2781 0.3537 0.3275 0.0294  0.0141  -0.0220 122 SER A O   
966  C CB  . SER A 127 ? 0.3988 0.4379 0.4034 0.0128  0.0204  0.0071  122 SER A CB  
967  O OG  . SER A 127 ? 0.5453 0.5814 0.5540 0.0136  0.0178  -0.0023 122 SER A OG  
968  N N   . TYR A 128 ? 0.3381 0.4359 0.3680 0.0210  0.0286  -0.0254 123 TYR A N   
969  C CA  . TYR A 128 ? 0.3787 0.4979 0.4300 0.0249  0.0310  -0.0507 123 TYR A CA  
970  C C   . TYR A 128 ? 0.4113 0.5138 0.4709 0.0314  0.0202  -0.0594 123 TYR A C   
971  O O   . TYR A 128 ? 0.4777 0.5821 0.5229 0.0271  0.0231  -0.0587 123 TYR A O   
972  C CB  . TYR A 128 ? 0.3982 0.5454 0.4297 0.0121  0.0467  -0.0571 123 TYR A CB  
973  C CG  . TYR A 128 ? 0.4159 0.5978 0.4674 0.0083  0.0596  -0.0896 123 TYR A CG  
974  C CD1 . TYR A 128 ? 0.4472 0.6409 0.5484 0.0205  0.0550  -0.1147 123 TYR A CD1 
975  C CD2 . TYR A 128 ? 0.3988 0.6013 0.4196 -0.0095 0.0749  -0.0987 123 TYR A CD2 
976  C CE1 . TYR A 128 ? 0.4367 0.6711 0.5696 0.0168  0.0693  -0.1544 123 TYR A CE1 
977  C CE2 . TYR A 128 ? 0.4482 0.6886 0.4861 -0.0184 0.0931  -0.1350 123 TYR A CE2 
978  C CZ  . TYR A 128 ? 0.4082 0.6693 0.5086 -0.0044 0.0924  -0.1660 123 TYR A CZ  
979  O OH  . TYR A 128 ? 0.4699 0.7772 0.6002 -0.0135 0.1130  -0.2116 123 TYR A OH  
980  N N   . THR A 129 ? 0.4282 0.5097 0.5107 0.0412  0.0035  -0.0674 124 THR A N   
981  C CA  . THR A 129 ? 0.5286 0.5806 0.6121 0.0436  -0.0108 -0.0695 124 THR A CA  
982  C C   . THR A 129 ? 0.5312 0.5756 0.6539 0.0572  -0.0308 -0.0950 124 THR A C   
983  O O   . THR A 129 ? 0.4597 0.5152 0.6148 0.0671  -0.0391 -0.1108 124 THR A O   
984  C CB  . THR A 129 ? 0.5703 0.5770 0.6248 0.0345  -0.0194 -0.0438 124 THR A CB  
985  O OG1 . THR A 129 ? 0.6066 0.5879 0.6536 0.0283  -0.0257 -0.0440 124 THR A OG1 
986  C CG2 . THR A 129 ? 0.5643 0.5379 0.6205 0.0390  -0.0410 -0.0382 124 THR A CG2 
987  N N   . ALA A 130 ? 0.6474 0.6729 0.7737 0.0582  -0.0410 -0.1022 125 ALA A N   
988  C CA  . ALA A 130 ? 0.6593 0.6682 0.8263 0.0723  -0.0671 -0.1273 125 ALA A CA  
989  C C   . ALA A 130 ? 0.7222 0.6594 0.8699 0.0692  -0.0995 -0.1058 125 ALA A C   
990  O O   . ALA A 130 ? 0.8084 0.7160 0.9634 0.0761  -0.1249 -0.1016 125 ALA A O   
991  C CB  . ALA A 130 ? 0.6647 0.6952 0.8483 0.0742  -0.0605 -0.1522 125 ALA A CB  
992  N N   . PHE B 5   ? 0.8184 0.6443 0.7877 -0.0785 0.0865  0.3022  0   PHE B N   
993  C CA  . PHE B 5   ? 0.7796 0.6055 0.7729 -0.0633 0.0838  0.2544  0   PHE B CA  
994  C C   . PHE B 5   ? 0.6597 0.5452 0.6304 -0.0657 0.0873  0.2226  0   PHE B C   
995  O O   . PHE B 5   ? 0.6409 0.5610 0.5894 -0.0831 0.0989  0.2280  0   PHE B O   
996  C CB  . PHE B 5   ? 0.9037 0.6837 0.9309 -0.0767 0.0928  0.2319  0   PHE B CB  
997  C CG  . PHE B 5   ? 1.0912 0.7999 1.1478 -0.0690 0.0901  0.2504  0   PHE B CG  
998  C CD1 . PHE B 5   ? 1.1661 0.8585 1.2241 -0.0514 0.0791  0.2921  0   PHE B CD1 
999  C CD2 . PHE B 5   ? 1.1613 0.8171 1.2439 -0.0789 0.0962  0.2239  0   PHE B CD2 
1000 C CE1 . PHE B 5   ? 1.2751 0.9076 1.3600 -0.0403 0.0733  0.2979  0   PHE B CE1 
1001 C CE2 . PHE B 5   ? 1.2668 0.8557 1.3730 -0.0696 0.0932  0.2311  0   PHE B CE2 
1002 C CZ  . PHE B 5   ? 1.3213 0.9012 1.4301 -0.0486 0.0821  0.2666  0   PHE B CZ  
1003 N N   . MET B 6   ? 0.5617 0.4578 0.5406 -0.0477 0.0798  0.1901  1   MET B N   
1004 C CA  . MET B 6   ? 0.5404 0.4848 0.5023 -0.0478 0.0807  0.1610  1   MET B CA  
1005 C C   . MET B 6   ? 0.4721 0.4109 0.4535 -0.0419 0.0797  0.1220  1   MET B C   
1006 O O   . MET B 6   ? 0.4326 0.3373 0.4325 -0.0303 0.0771  0.1144  1   MET B O   
1007 C CB  . MET B 6   ? 0.6005 0.5768 0.5347 -0.0337 0.0676  0.1695  1   MET B CB  
1008 C CG  . MET B 6   ? 0.7414 0.7387 0.6340 -0.0451 0.0700  0.1991  1   MET B CG  
1009 S SD  . MET B 6   ? 1.0486 1.0638 0.9085 -0.0303 0.0435  0.2213  1   MET B SD  
1010 C CE  . MET B 6   ? 0.5639 0.5738 0.4713 -0.0066 0.0286  0.1962  1   MET B CE  
1011 N N   . LEU B 7   ? 0.4659 0.4376 0.4424 -0.0494 0.0829  0.0982  2   LEU B N   
1012 C CA  . LEU B 7   ? 0.3777 0.3492 0.3633 -0.0445 0.0783  0.0658  2   LEU B CA  
1013 C C   . LEU B 7   ? 0.3183 0.3133 0.2922 -0.0271 0.0697  0.0575  2   LEU B C   
1014 O O   . LEU B 7   ? 0.3678 0.3968 0.3264 -0.0269 0.0683  0.0549  2   LEU B O   
1015 C CB  . LEU B 7   ? 0.3275 0.3229 0.3217 -0.0599 0.0813  0.0486  2   LEU B CB  
1016 C CG  . LEU B 7   ? 0.3023 0.2948 0.3011 -0.0578 0.0723  0.0203  2   LEU B CG  
1017 C CD1 . LEU B 7   ? 0.3300 0.2764 0.3334 -0.0657 0.0706  0.0117  2   LEU B CD1 
1018 C CD2 . LEU B 7   ? 0.3392 0.3676 0.3518 -0.0668 0.0699  0.0084  2   LEU B CD2 
1019 N N   . ARG B 8   ? 0.3151 0.2915 0.2987 -0.0132 0.0659  0.0520  3   ARG B N   
1020 C CA  . ARG B 8   ? 0.3160 0.3155 0.2977 0.0001  0.0574  0.0458  3   ARG B CA  
1021 C C   . ARG B 8   ? 0.3227 0.3239 0.3051 -0.0007 0.0582  0.0189  3   ARG B C   
1022 O O   . ARG B 8   ? 0.3342 0.3081 0.3209 -0.0017 0.0648  0.0072  3   ARG B O   
1023 C CB  . ARG B 8   ? 0.3068 0.2948 0.3084 0.0167  0.0540  0.0617  3   ARG B CB  
1024 C CG  . ARG B 8   ? 0.3511 0.3686 0.3610 0.0274  0.0435  0.0586  3   ARG B CG  
1025 C CD  . ARG B 8   ? 0.3255 0.3397 0.3693 0.0449  0.0392  0.0782  3   ARG B CD  
1026 N NE  . ARG B 8   ? 0.3386 0.3150 0.4062 0.0537  0.0568  0.0712  3   ARG B NE  
1027 C CZ  . ARG B 8   ? 0.3818 0.3373 0.4821 0.0696  0.0589  0.0901  3   ARG B CZ  
1028 N NH1 . ARG B 8   ? 0.5022 0.4745 0.6156 0.0774  0.0403  0.1225  3   ARG B NH1 
1029 N NH2 . ARG B 8   ? 0.3762 0.2912 0.4945 0.0778  0.0787  0.0762  3   ARG B NH2 
1030 N N   . VAL B 9   ? 0.2600 0.2894 0.2339 -0.0012 0.0513  0.0093  4   VAL B N   
1031 C CA  . VAL B 9   ? 0.2570 0.2875 0.2301 -0.0030 0.0492  -0.0102 4   VAL B CA  
1032 C C   . VAL B 9   ? 0.2059 0.2536 0.1819 0.0042  0.0419  -0.0130 4   VAL B C   
1033 O O   . VAL B 9   ? 0.2536 0.3217 0.2247 0.0053  0.0338  -0.0101 4   VAL B O   
1034 C CB  . VAL B 9   ? 0.2691 0.3132 0.2393 -0.0124 0.0465  -0.0201 4   VAL B CB  
1035 C CG1 . VAL B 9   ? 0.2624 0.3052 0.2319 -0.0134 0.0393  -0.0343 4   VAL B CG1 
1036 C CG2 . VAL B 9   ? 0.2701 0.3032 0.2460 -0.0241 0.0521  -0.0165 4   VAL B CG2 
1037 N N   . PHE B 10  ? 0.2068 0.2453 0.1886 0.0067  0.0455  -0.0193 5   PHE B N   
1038 C CA  . PHE B 10  ? 0.2152 0.2695 0.2046 0.0085  0.0394  -0.0217 5   PHE B CA  
1039 C C   . PHE B 10  ? 0.2374 0.2858 0.2152 0.0009  0.0362  -0.0334 5   PHE B C   
1040 O O   . PHE B 10  ? 0.2165 0.2470 0.1829 -0.0031 0.0430  -0.0380 5   PHE B O   
1041 C CB  . PHE B 10  ? 0.2149 0.2695 0.2257 0.0162  0.0489  -0.0159 5   PHE B CB  
1042 C CG  . PHE B 10  ? 0.2587 0.3190 0.2911 0.0270  0.0486  -0.0002 5   PHE B CG  
1043 C CD1 . PHE B 10  ? 0.2921 0.3799 0.3405 0.0299  0.0325  0.0121  5   PHE B CD1 
1044 C CD2 . PHE B 10  ? 0.2904 0.3254 0.3272 0.0336  0.0616  0.0030  5   PHE B CD2 
1045 C CE1 . PHE B 10  ? 0.3223 0.4166 0.3917 0.0404  0.0269  0.0320  5   PHE B CE1 
1046 C CE2 . PHE B 10  ? 0.3192 0.3554 0.3809 0.0457  0.0592  0.0220  5   PHE B CE2 
1047 C CZ  . PHE B 10  ? 0.3331 0.4011 0.4117 0.0497  0.0408  0.0388  5   PHE B CZ  
1048 N N   A ILE B 11  ? 0.2573 0.3174 0.2354 -0.0010 0.0248  -0.0381 6   ILE B N   
1049 N N   B ILE B 11  ? 0.2740 0.3339 0.2520 -0.0011 0.0248  -0.0381 6   ILE B N   
1050 C CA  A ILE B 11  ? 0.2456 0.2981 0.2204 -0.0058 0.0183  -0.0442 6   ILE B CA  
1051 C CA  B ILE B 11  ? 0.2490 0.3020 0.2242 -0.0057 0.0181  -0.0441 6   ILE B CA  
1052 C C   A ILE B 11  ? 0.2338 0.2875 0.2175 -0.0084 0.0181  -0.0398 6   ILE B C   
1053 C C   B ILE B 11  ? 0.2078 0.2612 0.1914 -0.0085 0.0178  -0.0399 6   ILE B C   
1054 O O   A ILE B 11  ? 0.2432 0.3091 0.2401 -0.0084 0.0102  -0.0402 6   ILE B O   
1055 O O   B ILE B 11  ? 0.2566 0.3230 0.2538 -0.0080 0.0117  -0.0392 6   ILE B O   
1056 C CB  A ILE B 11  ? 0.2744 0.3342 0.2536 -0.0041 0.0087  -0.0529 6   ILE B CB  
1057 C CB  B ILE B 11  ? 0.3069 0.3674 0.2866 -0.0040 0.0082  -0.0530 6   ILE B CB  
1058 C CG1 A ILE B 11  ? 0.2603 0.3275 0.2389 -0.0031 0.0136  -0.0551 6   ILE B CG1 
1059 C CG1 B ILE B 11  ? 0.2773 0.3466 0.2561 -0.0021 0.0129  -0.0561 6   ILE B CG1 
1060 C CG2 A ILE B 11  ? 0.2713 0.3190 0.2547 -0.0065 -0.0010 -0.0549 6   ILE B CG2 
1061 C CG2 B ILE B 11  ? 0.2813 0.3297 0.2652 -0.0063 -0.0011 -0.0552 6   ILE B CG2 
1062 C CD1 A ILE B 11  ? 0.2640 0.3424 0.2535 0.0013  0.0110  -0.0659 6   ILE B CD1 
1063 C CD1 B ILE B 11  ? 0.1874 0.2482 0.1653 -0.0071 0.0149  -0.0532 6   ILE B CD1 
1064 N N   . LEU B 12  ? 0.2634 0.3049 0.2380 -0.0128 0.0273  -0.0361 7   LEU B N   
1065 C CA  . LEU B 12  ? 0.2641 0.3118 0.2519 -0.0167 0.0344  -0.0290 7   LEU B CA  
1066 C C   . LEU B 12  ? 0.3247 0.3657 0.3143 -0.0259 0.0227  -0.0257 7   LEU B C   
1067 O O   . LEU B 12  ? 0.2480 0.2991 0.2606 -0.0290 0.0135  -0.0251 7   LEU B O   
1068 C CB  . LEU B 12  ? 0.2182 0.2560 0.1914 -0.0176 0.0564  -0.0275 7   LEU B CB  
1069 C CG  . LEU B 12  ? 0.2566 0.2976 0.2418 -0.0061 0.0693  -0.0298 7   LEU B CG  
1070 C CD1 . LEU B 12  ? 0.2471 0.2743 0.2194 -0.0046 0.0958  -0.0342 7   LEU B CD1 
1071 C CD2 . LEU B 12  ? 0.2460 0.3154 0.2728 0.0012  0.0638  -0.0213 7   LEU B CD2 
1072 N N   . TYR B 13  ? 0.2236 0.2447 0.1885 -0.0317 0.0201  -0.0225 8   TYR B N   
1073 C CA  . TYR B 13  ? 0.2395 0.2473 0.2066 -0.0398 0.0076  -0.0144 8   TYR B CA  
1074 C C   . TYR B 13  ? 0.3652 0.3533 0.3074 -0.0414 -0.0049 -0.0103 8   TYR B C   
1075 O O   . TYR B 13  ? 0.2742 0.2608 0.1948 -0.0399 -0.0030 -0.0148 8   TYR B O   
1076 C CB  . TYR B 13  ? 0.2595 0.2684 0.2290 -0.0519 0.0214  -0.0005 8   TYR B CB  
1077 C CG  . TYR B 13  ? 0.2982 0.3015 0.2324 -0.0563 0.0432  0.0042  8   TYR B CG  
1078 C CD1 . TYR B 13  ? 0.2803 0.2987 0.2205 -0.0495 0.0666  -0.0028 8   TYR B CD1 
1079 C CD2 . TYR B 13  ? 0.3259 0.3061 0.2182 -0.0669 0.0397  0.0152  8   TYR B CD2 
1080 C CE1 . TYR B 13  ? 0.3152 0.3234 0.2195 -0.0525 0.0906  -0.0048 8   TYR B CE1 
1081 C CE2 . TYR B 13  ? 0.3635 0.3353 0.2108 -0.0731 0.0606  0.0154  8   TYR B CE2 
1082 C CZ  . TYR B 13  ? 0.4287 0.4132 0.2815 -0.0656 0.0882  0.0025  8   TYR B CZ  
1083 O OH  . TYR B 13  ? 0.4065 0.3776 0.2110 -0.0707 0.1130  -0.0034 8   TYR B OH  
1084 N N   . ALA B 14  ? 0.3688 0.3408 0.3181 -0.0453 -0.0206 -0.0006 9   ALA B N   
1085 C CA  . ALA B 14  ? 0.3413 0.2955 0.2719 -0.0473 -0.0376 0.0107  9   ALA B CA  
1086 C C   . ALA B 14  ? 0.3460 0.2786 0.2610 -0.0612 -0.0405 0.0341  9   ALA B C   
1087 O O   . ALA B 14  ? 0.3612 0.2916 0.2966 -0.0674 -0.0341 0.0388  9   ALA B O   
1088 C CB  . ALA B 14  ? 0.3634 0.3171 0.3269 -0.0339 -0.0570 0.0030  9   ALA B CB  
1089 N N   . GLU B 15  ? 0.3860 0.3030 0.2633 -0.0689 -0.0517 0.0507  10  GLU B N   
1090 C CA  . GLU B 15  ? 0.5211 0.4151 0.3735 -0.0846 -0.0546 0.0788  10  GLU B CA  
1091 C C   . GLU B 15  ? 0.5380 0.4089 0.3935 -0.0822 -0.0888 0.0994  10  GLU B C   
1092 O O   . GLU B 15  ? 0.4806 0.3581 0.3411 -0.0722 -0.1088 0.0938  10  GLU B O   
1093 C CB  . GLU B 15  ? 0.5679 0.4609 0.3572 -0.1000 -0.0334 0.0856  10  GLU B CB  
1094 C CG  . GLU B 15  ? 0.6852 0.6009 0.4806 -0.0988 0.0024  0.0670  10  GLU B CG  
1095 C CD  . GLU B 15  ? 0.8796 0.7915 0.6194 -0.1139 0.0316  0.0744  10  GLU B CD  
1096 O OE1 . GLU B 15  ? 0.9721 0.8650 0.6485 -0.1237 0.0235  0.0818  10  GLU B OE1 
1097 O OE2 . GLU B 15  ? 0.9349 0.8646 0.6948 -0.1163 0.0628  0.0724  10  GLU B OE2 
1098 N N   . ASN B 16  ? 0.5976 0.4424 0.4567 -0.0920 -0.0963 0.1257  11  ASN B N   
1099 C CA  . ASN B 16  ? 0.6556 0.4724 0.5233 -0.0888 -0.1306 0.1523  11  ASN B CA  
1100 C C   . ASN B 16  ? 0.6048 0.4268 0.5346 -0.0633 -0.1510 0.1342  11  ASN B C   
1101 O O   . ASN B 16  ? 0.6030 0.4262 0.5398 -0.0539 -0.1780 0.1439  11  ASN B O   
1102 C CB  . ASN B 16  ? 0.7583 0.5688 0.5607 -0.1008 -0.1469 0.1760  11  ASN B CB  
1103 C CG  . ASN B 16  ? 0.8522 0.6698 0.5839 -0.1214 -0.1154 0.1751  11  ASN B CG  
1104 O OD1 . ASN B 16  ? 0.9693 0.8017 0.6620 -0.1229 -0.1099 0.1577  11  ASN B OD1 
1105 N ND2 . ASN B 16  ? 0.8852 0.6918 0.6042 -0.1377 -0.0924 0.1925  11  ASN B ND2 
1106 N N   . VAL B 17  ? 0.5595 0.3876 0.5344 -0.0528 -0.1375 0.1075  12  VAL B N   
1107 C CA  . VAL B 17  ? 0.5887 0.4208 0.6196 -0.0285 -0.1484 0.0861  12  VAL B CA  
1108 C C   . VAL B 17  ? 0.6588 0.4496 0.7315 -0.0211 -0.1665 0.0987  12  VAL B C   
1109 O O   . VAL B 17  ? 0.7515 0.5211 0.8405 -0.0270 -0.1577 0.0901  12  VAL B O   
1110 C CB  . VAL B 17  ? 0.5294 0.3861 0.5777 -0.0212 -0.1252 0.0483  12  VAL B CB  
1111 C CG1 . VAL B 17  ? 0.5661 0.4317 0.6616 0.0034  -0.1304 0.0249  12  VAL B CG1 
1112 C CG2 . VAL B 17  ? 0.5329 0.4224 0.5437 -0.0289 -0.1065 0.0395  12  VAL B CG2 
1113 N N   . HIS B 18  ? 0.7062 0.4845 0.7997 -0.0087 -0.1944 0.1197  13  HIS B N   
1114 C CA  . HIS B 18  ? 0.7588 0.4927 0.8998 0.0030  -0.2146 0.1345  13  HIS B CA  
1115 C C   . HIS B 18  ? 0.7859 0.5297 0.9948 0.0362  -0.2223 0.1114  13  HIS B C   
1116 O O   . HIS B 18  ? 0.7603 0.5409 0.9810 0.0478  -0.2313 0.1110  13  HIS B O   
1117 C CB  . HIS B 18  ? 0.8374 0.5433 0.9543 -0.0081 -0.2441 0.1867  13  HIS B CB  
1118 C CG  . HIS B 18  ? 0.8970 0.5914 0.9459 -0.0413 -0.2320 0.2124  13  HIS B CG  
1119 N ND1 . HIS B 18  ? 0.9136 0.6276 0.8930 -0.0590 -0.2329 0.2317  13  HIS B ND1 
1120 C CD2 . HIS B 18  ? 0.9564 0.6233 0.9981 -0.0611 -0.2164 0.2207  13  HIS B CD2 
1121 C CE1 . HIS B 18  ? 0.9387 0.6401 0.8700 -0.0858 -0.2134 0.2495  13  HIS B CE1 
1122 N NE2 . HIS B 18  ? 0.9448 0.6217 0.9174 -0.0881 -0.2032 0.2446  13  HIS B NE2 
1123 N N   . THR B 19  ? 0.7952 0.5064 1.0505 0.0503  -0.2172 0.0904  14  THR B N   
1124 C CA  . THR B 19  ? 0.8401 0.5597 1.1596 0.0816  -0.2166 0.0673  14  THR B CA  
1125 C C   . THR B 19  ? 0.8522 0.5582 1.1935 0.0862  -0.2415 0.1036  14  THR B C   
1126 O O   . THR B 19  ? 0.8958 0.5671 1.2110 0.0678  -0.2530 0.1345  14  THR B O   
1127 C CB  . THR B 19  ? 0.9558 0.6486 1.2952 0.0879  -0.1951 0.0271  14  THR B CB  
1128 O OG1 . THR B 19  ? 0.9665 0.6702 1.2742 0.0767  -0.1754 -0.0025 14  THR B OG1 
1129 C CG2 . THR B 19  ? 0.9651 0.6721 1.3584 0.1183  -0.1834 -0.0022 14  THR B CG2 
1130 N N   . PRO B 20  ? 0.8130 0.5490 1.2025 0.1090  -0.2491 0.1019  15  PRO B N   
1131 C CA  . PRO B 20  ? 0.8402 0.5635 1.2485 0.1118  -0.2768 0.1398  15  PRO B CA  
1132 C C   . PRO B 20  ? 0.8557 0.5258 1.2914 0.1180  -0.2786 0.1446  15  PRO B C   
1133 O O   . PRO B 20  ? 0.8547 0.5038 1.2892 0.1129  -0.3029 0.1835  15  PRO B O   
1134 C CB  . PRO B 20  ? 0.8689 0.6393 1.3337 0.1358  -0.2808 0.1317  15  PRO B CB  
1135 C CG  . PRO B 20  ? 0.8422 0.6380 1.3290 0.1504  -0.2471 0.0832  15  PRO B CG  
1136 C CD  . PRO B 20  ? 0.7667 0.5537 1.1922 0.1289  -0.2347 0.0726  15  PRO B CD  
1137 N N   . ASP B 21  ? 0.8286 0.4754 1.2838 0.1272  -0.2544 0.1062  16  ASP B N   
1138 C CA  . ASP B 21  ? 0.9138 0.5064 1.3947 0.1323  -0.2568 0.1086  16  ASP B CA  
1139 C C   . ASP B 21  ? 0.9425 0.4904 1.3880 0.1082  -0.2461 0.1006  16  ASP B C   
1140 O O   . ASP B 21  ? 0.9226 0.4221 1.3874 0.1091  -0.2488 0.1031  16  ASP B O   
1141 C CB  . ASP B 21  ? 0.9677 0.5591 1.5138 0.1666  -0.2431 0.0755  16  ASP B CB  
1142 C CG  . ASP B 21  ? 0.9771 0.5855 1.5199 0.1748  -0.2085 0.0198  16  ASP B CG  
1143 O OD1 . ASP B 21  ? 0.9331 0.5495 1.4275 0.1542  -0.1978 0.0062  16  ASP B OD1 
1144 O OD2 . ASP B 21  ? 1.0278 0.6416 1.6144 0.2019  -0.1911 -0.0099 16  ASP B OD2 
1145 N N   . THR B 22  ? 0.8959 0.4594 1.2932 0.0858  -0.2350 0.0924  17  THR B N   
1146 C CA  . THR B 22  ? 0.9960 0.5253 1.3672 0.0612  -0.2242 0.0829  17  THR B CA  
1147 C C   . THR B 22  ? 1.1207 0.6517 1.4386 0.0263  -0.2275 0.1170  17  THR B C   
1148 O O   . THR B 22  ? 1.1333 0.6953 1.4192 0.0194  -0.2337 0.1406  17  THR B O   
1149 C CB  . THR B 22  ? 0.9247 0.4644 1.2920 0.0640  -0.1995 0.0283  17  THR B CB  
1150 O OG1 . THR B 22  ? 0.7832 0.3683 1.1205 0.0584  -0.1917 0.0213  17  THR B OG1 
1151 C CG2 . THR B 22  ? 0.9973 0.5361 1.4072 0.0964  -0.1879 -0.0093 17  THR B CG2 
1152 N N   . ASP B 23  ? 1.1924 0.6916 1.5007 0.0033  -0.2207 0.1168  18  ASP B N   
1153 C CA  . ASP B 23  ? 1.2134 0.7137 1.4788 -0.0317 -0.2175 0.1492  18  ASP B CA  
1154 C C   . ASP B 23  ? 1.1713 0.7079 1.4071 -0.0475 -0.1996 0.1292  18  ASP B C   
1155 O O   . ASP B 23  ? 1.2188 0.7663 1.4217 -0.0759 -0.1907 0.1525  18  ASP B O   
1156 C CB  . ASP B 23  ? 1.2373 0.6927 1.5146 -0.0509 -0.2166 0.1579  18  ASP B CB  
1157 C CG  . ASP B 23  ? 1.1872 0.6262 1.4887 -0.0492 -0.2060 0.1086  18  ASP B CG  
1158 O OD1 . ASP B 23  ? 1.2097 0.6620 1.5260 -0.0245 -0.2010 0.0686  18  ASP B OD1 
1159 O OD2 . ASP B 23  ? 1.1361 0.5510 1.4388 -0.0741 -0.2019 0.1093  18  ASP B OD2 
1160 N N   . ILE B 24  ? 1.0827 0.6394 1.3319 -0.0292 -0.1916 0.0855  19  ILE B N   
1161 C CA  . ILE B 24  ? 0.9714 0.5655 1.1952 -0.0391 -0.1775 0.0661  19  ILE B CA  
1162 C C   . ILE B 24  ? 0.8746 0.4933 1.1115 -0.0106 -0.1723 0.0269  19  ILE B C   
1163 O O   . ILE B 24  ? 0.9400 0.5493 1.2093 0.0154  -0.1744 0.0090  19  ILE B O   
1164 C CB  . ILE B 24  ? 1.0074 0.6026 1.2277 -0.0643 -0.1653 0.0461  19  ILE B CB  
1165 C CG1 . ILE B 24  ? 1.0138 0.5658 1.2590 -0.0700 -0.1705 0.0420  19  ILE B CG1 
1166 C CG2 . ILE B 24  ? 0.9994 0.6195 1.1905 -0.0949 -0.1557 0.0762  19  ILE B CG2 
1167 C CD1 . ILE B 24  ? 1.0174 0.5664 1.2702 -0.0723 -0.1642 -0.0052 19  ILE B CD1 
1168 N N   . SER B 25  ? 0.6962 0.3639 0.9025 -0.0154 -0.1571 0.0133  20  SER B N   
1169 C CA  . SER B 25  ? 0.6586 0.3635 0.8677 0.0075  -0.1449 -0.0226 20  SER B CA  
1170 C C   . SER B 25  ? 0.6046 0.3295 0.7961 -0.0018 -0.1290 -0.0589 20  SER B C   
1171 O O   . SER B 25  ? 0.4905 0.2241 0.6630 -0.0265 -0.1259 -0.0508 20  SER B O   
1172 C CB  . SER B 25  ? 0.7682 0.5211 0.9523 0.0117  -0.1412 -0.0057 20  SER B CB  
1173 O OG  . SER B 25  ? 0.8506 0.5896 1.0256 0.0050  -0.1585 0.0372  20  SER B OG  
1174 N N   . ASP B 26  ? 0.5516 0.2864 0.7508 0.0179  -0.1191 -0.0974 21  ASP B N   
1175 C CA  . ASP B 26  ? 0.5314 0.2935 0.7027 0.0109  -0.1057 -0.1291 21  ASP B CA  
1176 C C   . ASP B 26  ? 0.5269 0.3420 0.6807 0.0236  -0.0904 -0.1311 21  ASP B C   
1177 O O   . ASP B 26  ? 0.5297 0.3568 0.6888 0.0423  -0.0779 -0.1583 21  ASP B O   
1178 C CB  . ASP B 26  ? 0.5751 0.3100 0.7524 0.0202  -0.1011 -0.1701 21  ASP B CB  
1179 C CG  . ASP B 26  ? 0.6411 0.3261 0.8363 0.0102  -0.1127 -0.1635 21  ASP B CG  
1180 O OD1 . ASP B 26  ? 0.6921 0.3654 0.8868 -0.0151 -0.1246 -0.1397 21  ASP B OD1 
1181 O OD2 . ASP B 26  ? 0.7702 0.4284 0.9813 0.0269  -0.1077 -0.1816 21  ASP B OD2 
1182 N N   . ALA B 27  ? 0.4251 0.2702 0.5588 0.0125  -0.0891 -0.1029 22  ALA B N   
1183 C CA  . ALA B 27  ? 0.4677 0.3540 0.5909 0.0224  -0.0784 -0.0992 22  ALA B CA  
1184 C C   . ALA B 27  ? 0.4073 0.3280 0.5028 0.0193  -0.0628 -0.1172 22  ALA B C   
1185 O O   . ALA B 27  ? 0.3198 0.2441 0.3968 0.0042  -0.0633 -0.1188 22  ALA B O   
1186 C CB  . ALA B 27  ? 0.4956 0.3909 0.6049 0.0122  -0.0842 -0.0643 22  ALA B CB  
1187 N N   . TYR B 28  ? 0.3080 0.2545 0.4057 0.0334  -0.0505 -0.1281 23  TYR B N   
1188 C CA  . TYR B 28  ? 0.2839 0.2647 0.3545 0.0304  -0.0360 -0.1340 23  TYR B CA  
1189 C C   . TYR B 28  ? 0.3353 0.3439 0.4118 0.0348  -0.0295 -0.1192 23  TYR B C   
1190 O O   . TYR B 28  ? 0.3034 0.3106 0.4078 0.0430  -0.0362 -0.1110 23  TYR B O   
1191 C CB  . TYR B 28  ? 0.4272 0.4123 0.4849 0.0373  -0.0234 -0.1656 23  TYR B CB  
1192 C CG  . TYR B 28  ? 0.4262 0.4214 0.5080 0.0571  -0.0076 -0.1829 23  TYR B CG  
1193 C CD1 . TYR B 28  ? 0.4612 0.4295 0.5769 0.0720  -0.0096 -0.1989 23  TYR B CD1 
1194 C CD2 . TYR B 28  ? 0.4070 0.4389 0.4836 0.0609  0.0107  -0.1823 23  TYR B CD2 
1195 C CE1 . TYR B 28  ? 0.5139 0.4965 0.6623 0.0931  0.0083  -0.2156 23  TYR B CE1 
1196 C CE2 . TYR B 28  ? 0.4063 0.4551 0.5140 0.0782  0.0289  -0.1969 23  TYR B CE2 
1197 C CZ  . TYR B 28  ? 0.4741 0.5003 0.6198 0.0955  0.0282  -0.2139 23  TYR B CZ  
1198 O OH  . TYR B 28  ? 0.5090 0.5536 0.6877 0.1106  0.0468  -0.2195 23  TYR B OH  
1199 N N   . CYS B 29  ? 0.2976 0.3296 0.3499 0.0278  -0.0196 -0.1144 24  CYS B N   
1200 C CA  . CYS B 29  ? 0.2478 0.3010 0.3042 0.0274  -0.0143 -0.1024 24  CYS B CA  
1201 C C   . CYS B 29  ? 0.3498 0.4292 0.4026 0.0316  0.0042  -0.1133 24  CYS B C   
1202 O O   . CYS B 29  ? 0.3030 0.3873 0.3281 0.0279  0.0124  -0.1197 24  CYS B O   
1203 C CB  . CYS B 29  ? 0.2575 0.3076 0.2917 0.0146  -0.0176 -0.0838 24  CYS B CB  
1204 S SG  . CYS B 29  ? 0.5561 0.6205 0.5924 0.0100  -0.0160 -0.0724 24  CYS B SG  
1205 N N   . SER B 30  ? 0.3503 0.4488 0.4341 0.0381  0.0093  -0.1127 25  SER B N   
1206 C CA  . SER B 30  ? 0.4129 0.5414 0.5009 0.0393  0.0304  -0.1180 25  SER B CA  
1207 C C   . SER B 30  ? 0.4331 0.5749 0.5233 0.0271  0.0293  -0.0993 25  SER B C   
1208 O O   . SER B 30  ? 0.4667 0.6050 0.5759 0.0237  0.0131  -0.0888 25  SER B O   
1209 C CB  . SER B 30  ? 0.5042 0.6507 0.6392 0.0551  0.0402  -0.1316 25  SER B CB  
1210 O OG  . SER B 30  ? 0.5793 0.7601 0.7220 0.0532  0.0640  -0.1331 25  SER B OG  
1211 N N   . ALA B 31  ? 0.3408 0.4942 0.4086 0.0191  0.0447  -0.0948 26  ALA B N   
1212 C CA  . ALA B 31  ? 0.2928 0.4503 0.3614 0.0057  0.0446  -0.0785 26  ALA B CA  
1213 C C   . ALA B 31  ? 0.3105 0.4962 0.3898 0.0004  0.0667  -0.0751 26  ALA B C   
1214 O O   . ALA B 31  ? 0.3464 0.5393 0.4001 0.0022  0.0836  -0.0786 26  ALA B O   
1215 C CB  . ALA B 31  ? 0.2722 0.4054 0.3034 -0.0014 0.0396  -0.0686 26  ALA B CB  
1216 N N   . VAL B 32  ? 0.1876 0.3888 0.3016 -0.0092 0.0650  -0.0667 27  VAL B N   
1217 C CA  . VAL B 32  ? 0.2911 0.5242 0.4266 -0.0173 0.0881  -0.0607 27  VAL B CA  
1218 C C   . VAL B 32  ? 0.2823 0.5060 0.4188 -0.0383 0.0844  -0.0432 27  VAL B C   
1219 O O   . VAL B 32  ? 0.2721 0.4880 0.4293 -0.0474 0.0639  -0.0410 27  VAL B O   
1220 C CB  . VAL B 32  ? 0.3181 0.5921 0.5182 -0.0096 0.0950  -0.0688 27  VAL B CB  
1221 C CG1 . VAL B 32  ? 0.2600 0.5722 0.4921 -0.0233 0.1200  -0.0586 27  VAL B CG1 
1222 C CG2 . VAL B 32  ? 0.3652 0.6445 0.5652 0.0127  0.1071  -0.0898 27  VAL B CG2 
1223 N N   . PHE B 33  ? 0.3069 0.5273 0.4170 -0.0471 0.1025  -0.0306 28  PHE B N   
1224 C CA  . PHE B 33  ? 0.2738 0.4821 0.3906 -0.0679 0.1030  -0.0130 28  PHE B CA  
1225 C C   . PHE B 33  ? 0.2930 0.5259 0.4121 -0.0788 0.1321  0.0026  28  PHE B C   
1226 O O   . PHE B 33  ? 0.3252 0.5650 0.4074 -0.0706 0.1491  0.0039  28  PHE B O   
1227 C CB  . PHE B 33  ? 0.3639 0.5237 0.4398 -0.0689 0.0907  -0.0060 28  PHE B CB  
1228 C CG  . PHE B 33  ? 0.3704 0.5065 0.4522 -0.0887 0.0921  0.0101  28  PHE B CG  
1229 C CD1 . PHE B 33  ? 0.3360 0.4616 0.4454 -0.1044 0.0775  0.0047  28  PHE B CD1 
1230 C CD2 . PHE B 33  ? 0.3503 0.4712 0.4089 -0.0930 0.1055  0.0313  28  PHE B CD2 
1231 C CE1 . PHE B 33  ? 0.3171 0.4137 0.4327 -0.1248 0.0782  0.0160  28  PHE B CE1 
1232 C CE2 . PHE B 33  ? 0.3239 0.4151 0.3920 -0.1113 0.1066  0.0473  28  PHE B CE2 
1233 C CZ  . PHE B 33  ? 0.3269 0.4040 0.4245 -0.1275 0.0940  0.0375  28  PHE B CZ  
1234 N N   . ALA B 34  ? 0.2729 0.5187 0.4327 -0.0999 0.1371  0.0148  29  ALA B N   
1235 C CA  . ALA B 34  ? 0.3050 0.5745 0.4718 -0.1158 0.1671  0.0350  29  ALA B CA  
1236 C C   . ALA B 34  ? 0.3165 0.6277 0.4843 -0.1009 0.1947  0.0272  29  ALA B C   
1237 O O   . ALA B 34  ? 0.3583 0.6650 0.4884 -0.1003 0.2159  0.0417  29  ALA B O   
1238 C CB  . ALA B 34  ? 0.4716 0.6995 0.5847 -0.1226 0.1702  0.0582  29  ALA B CB  
1239 N N   . GLY B 35  ? 0.2920 0.6296 0.4980 -0.0841 0.1898  0.0052  30  GLY B N   
1240 C CA  . GLY B 35  ? 0.3484 0.7103 0.5574 -0.0637 0.2121  -0.0048 30  GLY B CA  
1241 C C   . GLY B 35  ? 0.3688 0.7040 0.5060 -0.0462 0.2162  -0.0182 30  GLY B C   
1242 O O   . GLY B 35  ? 0.3818 0.7266 0.5064 -0.0314 0.2363  -0.0289 30  GLY B O   
1243 N N   . VAL B 36  ? 0.3951 0.6970 0.4863 -0.0486 0.1962  -0.0178 31  VAL B N   
1244 C CA  . VAL B 36  ? 0.3676 0.6447 0.3948 -0.0352 0.1921  -0.0290 31  VAL B CA  
1245 C C   . VAL B 36  ? 0.3428 0.6065 0.3748 -0.0219 0.1676  -0.0508 31  VAL B C   
1246 O O   . VAL B 36  ? 0.2800 0.5296 0.3241 -0.0268 0.1463  -0.0460 31  VAL B O   
1247 C CB  . VAL B 36  ? 0.4151 0.6666 0.3834 -0.0465 0.1876  -0.0061 31  VAL B CB  
1248 C CG1 . VAL B 36  ? 0.4581 0.6900 0.3658 -0.0351 0.1786  -0.0177 31  VAL B CG1 
1249 C CG2 . VAL B 36  ? 0.4715 0.7304 0.4337 -0.0612 0.2113  0.0196  31  VAL B CG2 
1250 N N   . LYS B 37  ? 0.3965 0.6548 0.4169 -0.0050 0.1692  -0.0730 32  LYS B N   
1251 C CA  . LYS B 37  ? 0.3654 0.6079 0.3937 0.0074  0.1475  -0.0927 32  LYS B CA  
1252 C C   . LYS B 37  ? 0.4225 0.6351 0.3916 0.0085  0.1329  -0.0974 32  LYS B C   
1253 O O   . LYS B 37  ? 0.4995 0.7043 0.4231 0.0078  0.1416  -0.0993 32  LYS B O   
1254 C CB  . LYS B 37  ? 0.4110 0.6627 0.4778 0.0250  0.1555  -0.1140 32  LYS B CB  
1255 C CG  . LYS B 37  ? 0.4073 0.6355 0.4800 0.0379  0.1340  -0.1330 32  LYS B CG  
1256 C CD  . LYS B 37  ? 0.4254 0.6666 0.5643 0.0545  0.1344  -0.1444 32  LYS B CD  
1257 C CE  . LYS B 37  ? 0.5446 0.7776 0.6767 0.0696  0.1537  -0.1641 32  LYS B CE  
1258 N NZ  . LYS B 37  ? 0.6805 0.8725 0.7705 0.0739  0.1408  -0.1827 32  LYS B NZ  
1259 N N   . LYS B 38  ? 0.4167 0.6146 0.3880 0.0092  0.1102  -0.0986 33  LYS B N   
1260 C CA  . LYS B 38  ? 0.4359 0.6105 0.3669 0.0099  0.0926  -0.1033 33  LYS B CA  
1261 C C   . LYS B 38  ? 0.4565 0.6122 0.4134 0.0185  0.0738  -0.1172 33  LYS B C   
1262 O O   . LYS B 38  ? 0.3911 0.5464 0.3889 0.0215  0.0679  -0.1133 33  LYS B O   
1263 C CB  . LYS B 38  ? 0.4178 0.5811 0.3290 0.0004  0.0796  -0.0771 33  LYS B CB  
1264 C CG  . LYS B 38  ? 0.4529 0.6282 0.3412 -0.0094 0.0951  -0.0560 33  LYS B CG  
1265 C CD  . LYS B 38  ? 0.4782 0.6359 0.3640 -0.0150 0.0816  -0.0288 33  LYS B CD  
1266 C CE  . LYS B 38  ? 0.5107 0.6733 0.3797 -0.0258 0.0959  -0.0029 33  LYS B CE  
1267 N NZ  . LYS B 38  ? 0.5524 0.7238 0.3655 -0.0291 0.0985  0.0044  33  LYS B NZ  
1268 N N   . ARG B 39  ? 0.4523 0.5911 0.3844 0.0198  0.0620  -0.1311 34  ARG B N   
1269 C CA  . ARG B 39  ? 0.4314 0.5479 0.3877 0.0251  0.0448  -0.1409 34  ARG B CA  
1270 C C   . ARG B 39  ? 0.4032 0.5025 0.3386 0.0170  0.0241  -0.1381 34  ARG B C   
1271 O O   . ARG B 39  ? 0.4307 0.5349 0.3295 0.0103  0.0207  -0.1388 34  ARG B O   
1272 C CB  . ARG B 39  ? 0.4762 0.5871 0.4491 0.0379  0.0545  -0.1692 34  ARG B CB  
1273 C CG  . ARG B 39  ? 0.6768 0.7781 0.6080 0.0354  0.0625  -0.1821 34  ARG B CG  
1274 C CD  . ARG B 39  ? 0.8554 0.9540 0.8048 0.0492  0.0826  -0.2018 34  ARG B CD  
1275 N NE  . ARG B 39  ? 0.9392 1.0686 0.9013 0.0524  0.1079  -0.1926 34  ARG B NE  
1276 C CZ  . ARG B 39  ? 0.9779 1.1187 0.8977 0.0444  0.1241  -0.1847 34  ARG B CZ  
1277 N NH1 . ARG B 39  ? 0.9674 1.0926 0.8280 0.0339  0.1145  -0.1847 34  ARG B NH1 
1278 N NH2 . ARG B 39  ? 1.0180 1.1868 0.9569 0.0460  0.1482  -0.1747 34  ARG B NH2 
1279 N N   . THR B 40  ? 0.3405 0.4226 0.3007 0.0160  0.0092  -0.1319 35  THR B N   
1280 C CA  . THR B 40  ? 0.3701 0.4408 0.3244 0.0068  -0.0083 -0.1279 35  THR B CA  
1281 C C   . THR B 40  ? 0.4135 0.4640 0.3638 0.0060  -0.0169 -0.1534 35  THR B C   
1282 O O   . THR B 40  ? 0.3141 0.3553 0.2698 0.0162  -0.0072 -0.1744 35  THR B O   
1283 C CB  . THR B 40  ? 0.3791 0.4393 0.3588 0.0035  -0.0158 -0.1102 35  THR B CB  
1284 O OG1 . THR B 40  ? 0.3531 0.3929 0.3546 0.0085  -0.0200 -0.1174 35  THR B OG1 
1285 C CG2 . THR B 40  ? 0.3151 0.3861 0.2968 0.0045  -0.0064 -0.0919 35  THR B CG2 
1286 N N   . LYS B 41  ? 0.3032 0.3465 0.2501 -0.0061 -0.0347 -0.1527 36  LYS B N   
1287 C CA  . LYS B 41  ? 0.4506 0.4668 0.3975 -0.0112 -0.0466 -0.1772 36  LYS B CA  
1288 C C   . LYS B 41  ? 0.4380 0.4266 0.4237 -0.0077 -0.0497 -0.1729 36  LYS B C   
1289 O O   . LYS B 41  ? 0.3012 0.2958 0.3063 -0.0051 -0.0461 -0.1489 36  LYS B O   
1290 C CB  . LYS B 41  ? 0.5238 0.5447 0.4621 -0.0296 -0.0688 -0.1751 36  LYS B CB  
1291 C CG  . LYS B 41  ? 0.5526 0.5843 0.5265 -0.0384 -0.0768 -0.1457 36  LYS B CG  
1292 C CD  . LYS B 41  ? 0.5899 0.6405 0.5660 -0.0552 -0.0986 -0.1403 36  LYS B CD  
1293 C CE  . LYS B 41  ? 0.6650 0.7345 0.6848 -0.0616 -0.0992 -0.1109 36  LYS B CE  
1294 N NZ  . LYS B 41  ? 0.6959 0.7842 0.7174 -0.0477 -0.0799 -0.0894 36  LYS B NZ  
1295 N N   . VAL B 42  ? 0.3775 0.3321 0.3705 -0.0085 -0.0573 -0.1964 37  VAL B N   
1296 C CA  . VAL B 42  ? 0.4154 0.3367 0.4454 -0.0064 -0.0641 -0.1891 37  VAL B CA  
1297 C C   . VAL B 42  ? 0.4276 0.3419 0.4718 -0.0279 -0.0804 -0.1687 37  VAL B C   
1298 O O   . VAL B 42  ? 0.4689 0.3857 0.5039 -0.0444 -0.0928 -0.1782 37  VAL B O   
1299 C CB  . VAL B 42  ? 0.4761 0.3576 0.5130 0.0024  -0.0636 -0.2197 37  VAL B CB  
1300 C CG1 . VAL B 42  ? 0.4548 0.2946 0.5337 0.0036  -0.0755 -0.2091 37  VAL B CG1 
1301 C CG2 . VAL B 42  ? 0.4971 0.3930 0.5275 0.0245  -0.0403 -0.2348 37  VAL B CG2 
1302 N N   . ILE B 43  ? 0.3592 0.2684 0.4251 -0.0297 -0.0804 -0.1396 38  ILE B N   
1303 C CA  . ILE B 43  ? 0.3657 0.2652 0.4499 -0.0507 -0.0905 -0.1193 38  ILE B CA  
1304 C C   . ILE B 43  ? 0.4483 0.2967 0.5566 -0.0531 -0.1013 -0.1204 38  ILE B C   
1305 O O   . ILE B 43  ? 0.4117 0.2424 0.5302 -0.0423 -0.1001 -0.1042 38  ILE B O   
1306 C CB  . ILE B 43  ? 0.3727 0.2951 0.4576 -0.0545 -0.0805 -0.0853 38  ILE B CB  
1307 C CG1 . ILE B 43  ? 0.4041 0.3697 0.4709 -0.0492 -0.0691 -0.0838 38  ILE B CG1 
1308 C CG2 . ILE B 43  ? 0.3916 0.3084 0.4978 -0.0775 -0.0849 -0.0644 38  ILE B CG2 
1309 C CD1 . ILE B 43  ? 0.2965 0.2843 0.3645 -0.0596 -0.0773 -0.0935 38  ILE B CD1 
1310 N N   . LYS B 44  ? 0.4690 0.2914 0.5872 -0.0685 -0.1150 -0.1383 39  LYS B N   
1311 C CA  . LYS B 44  ? 0.5774 0.3437 0.7189 -0.0701 -0.1246 -0.1420 39  LYS B CA  
1312 C C   . LYS B 44  ? 0.5823 0.3297 0.7488 -0.0859 -0.1301 -0.1019 39  LYS B C   
1313 O O   . LYS B 44  ? 0.5560 0.3300 0.7265 -0.1076 -0.1281 -0.0791 39  LYS B O   
1314 C CB  . LYS B 44  ? 0.5997 0.3516 0.7317 -0.0837 -0.1309 -0.1658 39  LYS B CB  
1315 C CG  . LYS B 44  ? 0.6818 0.4518 0.7751 -0.0727 -0.1239 -0.2000 39  LYS B CG  
1316 C CD  . LYS B 44  ? 0.8003 0.5390 0.8891 -0.0475 -0.1119 -0.2239 39  LYS B CD  
1317 C CE  . LYS B 44  ? 0.9684 0.6670 1.0432 -0.0572 -0.1163 -0.2511 39  LYS B CE  
1318 N NZ  . LYS B 44  ? 1.0621 0.7835 1.0896 -0.0723 -0.1195 -0.2707 39  LYS B NZ  
1319 N N   . ASN B 45  ? 0.5597 0.2671 0.7413 -0.0728 -0.1337 -0.0897 40  ASN B N   
1320 C CA  . ASN B 45  ? 0.6451 0.3249 0.8424 -0.0876 -0.1398 -0.0490 40  ASN B CA  
1321 C C   . ASN B 45  ? 0.5836 0.3006 0.7646 -0.1033 -0.1295 -0.0112 40  ASN B C   
1322 O O   . ASN B 45  ? 0.6731 0.3973 0.8634 -0.1306 -0.1268 0.0068  40  ASN B O   
1323 C CB  . ASN B 45  ? 0.7602 0.4139 0.9723 -0.1077 -0.1450 -0.0524 40  ASN B CB  
1324 C CG  . ASN B 45  ? 0.9076 0.5380 1.1180 -0.0949 -0.1471 -0.0962 40  ASN B CG  
1325 O OD1 . ASN B 45  ? 0.9249 0.5625 1.1270 -0.1110 -0.1494 -0.1187 40  ASN B OD1 
1326 N ND2 . ASN B 45  ? 0.9653 0.5698 1.1831 -0.0665 -0.1458 -0.1075 40  ASN B ND2 
1327 N N   . SER B 46  ? 0.4959 0.2404 0.6521 -0.0858 -0.1208 -0.0005 41  SER B N   
1328 C CA  . SER B 46  ? 0.5382 0.3152 0.6678 -0.0973 -0.1066 0.0304  41  SER B CA  
1329 C C   . SER B 46  ? 0.5417 0.3203 0.6457 -0.0818 -0.1084 0.0485  41  SER B C   
1330 O O   . SER B 46  ? 0.5154 0.2973 0.6238 -0.0585 -0.1144 0.0308  41  SER B O   
1331 C CB  . SER B 46  ? 0.5471 0.3775 0.6660 -0.1000 -0.0900 0.0152  41  SER B CB  
1332 O OG  . SER B 46  ? 0.5105 0.3686 0.6046 -0.1071 -0.0719 0.0393  41  SER B OG  
1333 N N   . VAL B 47  ? 0.5747 0.3529 0.6515 -0.0970 -0.1029 0.0838  42  VAL B N   
1334 C CA  . VAL B 47  ? 0.5194 0.3005 0.5612 -0.0886 -0.1081 0.1028  42  VAL B CA  
1335 C C   . VAL B 47  ? 0.5227 0.3493 0.5307 -0.0875 -0.0870 0.0909  42  VAL B C   
1336 O O   . VAL B 47  ? 0.5240 0.3617 0.5065 -0.0775 -0.0912 0.0908  42  VAL B O   
1337 C CB  . VAL B 47  ? 0.5625 0.3134 0.5790 -0.1083 -0.1142 0.1482  42  VAL B CB  
1338 C CG1 . VAL B 47  ? 0.7284 0.4842 0.6969 -0.1041 -0.1234 0.1680  42  VAL B CG1 
1339 C CG2 . VAL B 47  ? 0.6111 0.3090 0.6669 -0.1083 -0.1371 0.1625  42  VAL B CG2 
1340 N N   . ASN B 48  ? 0.5076 0.3597 0.5224 -0.0976 -0.0663 0.0803  43  ASN B N   
1341 C CA  . ASN B 48  ? 0.4000 0.2907 0.3918 -0.0955 -0.0438 0.0696  43  ASN B CA  
1342 C C   . ASN B 48  ? 0.3540 0.2727 0.3749 -0.0862 -0.0389 0.0405  43  ASN B C   
1343 O O   . ASN B 48  ? 0.3415 0.2848 0.3772 -0.0951 -0.0240 0.0397  43  ASN B O   
1344 C CB  . ASN B 48  ? 0.4578 0.3582 0.4302 -0.1160 -0.0195 0.0915  43  ASN B CB  
1345 C CG  . ASN B 48  ? 0.5599 0.4942 0.5118 -0.1113 0.0071  0.0796  43  ASN B CG  
1346 O OD1 . ASN B 48  ? 0.4644 0.4047 0.3965 -0.0968 0.0047  0.0637  43  ASN B OD1 
1347 N ND2 . ASN B 48  ? 0.5349 0.4912 0.4980 -0.1237 0.0338  0.0874  43  ASN B ND2 
1348 N N   . PRO B 49  ? 0.3340 0.2517 0.3642 -0.0685 -0.0514 0.0185  44  PRO B N   
1349 C CA  . PRO B 49  ? 0.3048 0.2440 0.3530 -0.0620 -0.0499 -0.0067 44  PRO B CA  
1350 C C   . PRO B 49  ? 0.2963 0.2712 0.3329 -0.0592 -0.0322 -0.0096 44  PRO B C   
1351 O O   . PRO B 49  ? 0.3034 0.2834 0.3157 -0.0522 -0.0242 -0.0074 44  PRO B O   
1352 C CB  . PRO B 49  ? 0.3003 0.2308 0.3517 -0.0432 -0.0605 -0.0262 44  PRO B CB  
1353 C CG  . PRO B 49  ? 0.3079 0.2304 0.3438 -0.0374 -0.0643 -0.0109 44  PRO B CG  
1354 C CD  . PRO B 49  ? 0.3417 0.2434 0.3666 -0.0539 -0.0663 0.0175  44  PRO B CD  
1355 N N   . VAL B 50  ? 0.2702 0.2676 0.3276 -0.0652 -0.0286 -0.0139 45  VAL B N   
1356 C CA  . VAL B 50  ? 0.2546 0.2841 0.3113 -0.0587 -0.0147 -0.0156 45  VAL B CA  
1357 C C   . VAL B 50  ? 0.2232 0.2666 0.2847 -0.0504 -0.0261 -0.0334 45  VAL B C   
1358 O O   . VAL B 50  ? 0.2321 0.2812 0.3124 -0.0586 -0.0398 -0.0399 45  VAL B O   
1359 C CB  . VAL B 50  ? 0.2914 0.3447 0.3749 -0.0701 -0.0007 -0.0012 45  VAL B CB  
1360 C CG1 . VAL B 50  ? 0.2621 0.3471 0.3560 -0.0587 0.0117  -0.0029 45  VAL B CG1 
1361 C CG2 . VAL B 50  ? 0.2642 0.3043 0.3312 -0.0800 0.0168  0.0170  45  VAL B CG2 
1362 N N   . TRP B 51  ? 0.2884 0.3359 0.3294 -0.0370 -0.0215 -0.0406 46  TRP B N   
1363 C CA  . TRP B 51  ? 0.2046 0.2651 0.2398 -0.0304 -0.0290 -0.0539 46  TRP B CA  
1364 C C   . TRP B 51  ? 0.3053 0.3935 0.3492 -0.0276 -0.0243 -0.0443 46  TRP B C   
1365 O O   . TRP B 51  ? 0.2605 0.3651 0.3108 -0.0305 -0.0377 -0.0468 46  TRP B O   
1366 C CB  . TRP B 51  ? 0.2833 0.3363 0.2977 -0.0192 -0.0252 -0.0639 46  TRP B CB  
1367 C CG  . TRP B 51  ? 0.2678 0.2976 0.2850 -0.0170 -0.0317 -0.0732 46  TRP B CG  
1368 C CD1 . TRP B 51  ? 0.2852 0.3021 0.3061 -0.0158 -0.0409 -0.0916 46  TRP B CD1 
1369 C CD2 . TRP B 51  ? 0.2370 0.2517 0.2550 -0.0147 -0.0311 -0.0646 46  TRP B CD2 
1370 N NE1 . TRP B 51  ? 0.3116 0.3058 0.3443 -0.0096 -0.0443 -0.0939 46  TRP B NE1 
1371 C CE2 . TRP B 51  ? 0.2505 0.2455 0.2820 -0.0094 -0.0410 -0.0749 46  TRP B CE2 
1372 C CE3 . TRP B 51  ? 0.2641 0.2781 0.2704 -0.0169 -0.0249 -0.0500 46  TRP B CE3 
1373 C CZ2 . TRP B 51  ? 0.2471 0.2259 0.2877 -0.0049 -0.0481 -0.0657 46  TRP B CZ2 
1374 C CZ3 . TRP B 51  ? 0.2879 0.2859 0.2929 -0.0161 -0.0334 -0.0428 46  TRP B CZ3 
1375 C CH2 . TRP B 51  ? 0.3506 0.3332 0.3762 -0.0095 -0.0465 -0.0480 46  TRP B CH2 
1376 N N   . ASN B 52  ? 0.2606 0.3510 0.3036 -0.0218 -0.0069 -0.0338 47  ASN B N   
1377 C CA  . ASN B 52  ? 0.1759 0.2872 0.2355 -0.0149 0.0004  -0.0233 47  ASN B CA  
1378 C C   . ASN B 52  ? 0.2393 0.3606 0.2875 -0.0088 -0.0112 -0.0244 47  ASN B C   
1379 O O   . ASN B 52  ? 0.2062 0.3499 0.2733 -0.0077 -0.0220 -0.0151 47  ASN B O   
1380 C CB  . ASN B 52  ? 0.3228 0.4578 0.4240 -0.0216 -0.0009 -0.0130 47  ASN B CB  
1381 C CG  . ASN B 52  ? 0.3112 0.4688 0.4432 -0.0103 0.0109  -0.0001 47  ASN B CG  
1382 O OD1 . ASN B 52  ? 0.3738 0.5185 0.4933 0.0011  0.0284  0.0003  47  ASN B OD1 
1383 N ND2 . ASN B 52  ? 0.2452 0.4359 0.4230 -0.0132 -0.0001 0.0102  47  ASN B ND2 
1384 N N   . GLU B 53  ? 0.1800 0.2875 0.1983 -0.0060 -0.0097 -0.0336 48  GLU B N   
1385 C CA  . GLU B 53  ? 0.2582 0.3741 0.2562 -0.0033 -0.0167 -0.0340 48  GLU B CA  
1386 C C   . GLU B 53  ? 0.3004 0.4108 0.2891 0.0036  -0.0036 -0.0243 48  GLU B C   
1387 O O   . GLU B 53  ? 0.2470 0.3421 0.2322 0.0042  0.0087  -0.0282 48  GLU B O   
1388 C CB  . GLU B 53  ? 0.3255 0.4342 0.2998 -0.0066 -0.0220 -0.0536 48  GLU B CB  
1389 C CG  . GLU B 53  ? 0.4257 0.5355 0.4024 -0.0152 -0.0397 -0.0655 48  GLU B CG  
1390 C CD  . GLU B 53  ? 0.4677 0.5658 0.4176 -0.0156 -0.0412 -0.0898 48  GLU B CD  
1391 O OE1 . GLU B 53  ? 0.3743 0.4539 0.3346 -0.0185 -0.0457 -0.1046 48  GLU B OE1 
1392 O OE2 . GLU B 53  ? 0.4567 0.5625 0.3759 -0.0126 -0.0357 -0.0936 48  GLU B OE2 
1393 N N   . GLY B 54  ? 0.3727 0.4941 0.3572 0.0068  -0.0093 -0.0100 49  GLY B N   
1394 C CA  . GLY B 54  ? 0.2278 0.3395 0.2052 0.0114  0.0015  0.0030  49  GLY B CA  
1395 C C   . GLY B 54  ? 0.3194 0.4332 0.2627 0.0063  0.0038  0.0003  49  GLY B C   
1396 O O   . GLY B 54  ? 0.3650 0.4913 0.2845 0.0020  -0.0060 -0.0068 49  GLY B O   
1397 N N   . PHE B 55  ? 0.3120 0.4134 0.2526 0.0050  0.0185  0.0042  50  PHE B N   
1398 C CA  . PHE B 55  ? 0.2786 0.3866 0.1943 -0.0011 0.0271  0.0061  50  PHE B CA  
1399 C C   . PHE B 55  ? 0.3539 0.4477 0.2737 -0.0034 0.0363  0.0280  50  PHE B C   
1400 O O   . PHE B 55  ? 0.3649 0.4380 0.3079 -0.0003 0.0393  0.0315  50  PHE B O   
1401 C CB  . PHE B 55  ? 0.2447 0.3564 0.1650 -0.0041 0.0373  -0.0153 50  PHE B CB  
1402 C CG  . PHE B 55  ? 0.3831 0.4999 0.3034 -0.0011 0.0290  -0.0367 50  PHE B CG  
1403 C CD1 . PHE B 55  ? 0.4173 0.5453 0.3114 -0.0018 0.0278  -0.0491 50  PHE B CD1 
1404 C CD2 . PHE B 55  ? 0.3627 0.4685 0.3050 0.0009  0.0232  -0.0448 50  PHE B CD2 
1405 C CE1 . PHE B 55  ? 0.4307 0.5549 0.3273 0.0003  0.0197  -0.0712 50  PHE B CE1 
1406 C CE2 . PHE B 55  ? 0.4165 0.5209 0.3619 0.0022  0.0148  -0.0610 50  PHE B CE2 
1407 C CZ  . PHE B 55  ? 0.4216 0.5332 0.3476 0.0023  0.0125  -0.0752 50  PHE B CZ  
1408 N N   . GLU B 56  ? 0.4754 0.5770 0.3698 -0.0101 0.0423  0.0422  51  GLU B N   
1409 C CA  . GLU B 56  ? 0.4831 0.5676 0.3816 -0.0157 0.0512  0.0668  51  GLU B CA  
1410 C C   . GLU B 56  ? 0.4816 0.5797 0.3631 -0.0291 0.0698  0.0699  51  GLU B C   
1411 O O   . GLU B 56  ? 0.4479 0.5679 0.2940 -0.0323 0.0741  0.0687  51  GLU B O   
1412 C CB  . GLU B 56  ? 0.5486 0.6256 0.4384 -0.0100 0.0373  0.0978  51  GLU B CB  
1413 C CG  . GLU B 56  ? 0.6048 0.6717 0.5286 0.0048  0.0241  0.0986  51  GLU B CG  
1414 C CD  . GLU B 56  ? 0.7333 0.7988 0.6610 0.0133  0.0066  0.1321  51  GLU B CD  
1415 O OE1 . GLU B 56  ? 0.7825 0.8671 0.6730 0.0078  -0.0070 0.1473  51  GLU B OE1 
1416 O OE2 . GLU B 56  ? 0.7431 0.7880 0.7107 0.0261  0.0061  0.1432  51  GLU B OE2 
1417 N N   . TRP B 57  ? 0.4737 0.5599 0.3814 -0.0384 0.0820  0.0718  52  TRP B N   
1418 C CA  . TRP B 57  ? 0.4686 0.5711 0.3748 -0.0538 0.1024  0.0795  52  TRP B CA  
1419 C C   . TRP B 57  ? 0.4874 0.5658 0.3909 -0.0648 0.1069  0.1150  52  TRP B C   
1420 O O   . TRP B 57  ? 0.4941 0.5365 0.4210 -0.0635 0.0989  0.1223  52  TRP B O   
1421 C CB  . TRP B 57  ? 0.3319 0.4414 0.2793 -0.0609 0.1089  0.0599  52  TRP B CB  
1422 C CG  . TRP B 57  ? 0.4008 0.5385 0.3576 -0.0526 0.1094  0.0309  52  TRP B CG  
1423 C CD1 . TRP B 57  ? 0.3488 0.5223 0.3150 -0.0552 0.1275  0.0209  52  TRP B CD1 
1424 C CD2 . TRP B 57  ? 0.3702 0.5008 0.3331 -0.0399 0.0926  0.0096  52  TRP B CD2 
1425 N NE1 . TRP B 57  ? 0.2786 0.4636 0.2592 -0.0424 0.1206  -0.0056 52  TRP B NE1 
1426 C CE2 . TRP B 57  ? 0.2967 0.4545 0.2729 -0.0346 0.0982  -0.0110 52  TRP B CE2 
1427 C CE3 . TRP B 57  ? 0.3364 0.4405 0.2973 -0.0323 0.0762  0.0072  52  TRP B CE3 
1428 C CZ2 . TRP B 57  ? 0.3449 0.4990 0.3302 -0.0236 0.0841  -0.0305 52  TRP B CZ2 
1429 C CZ3 . TRP B 57  ? 0.3698 0.4754 0.3365 -0.0236 0.0654  -0.0121 52  TRP B CZ3 
1430 C CH2 . TRP B 57  ? 0.3948 0.5226 0.3724 -0.0201 0.0675  -0.0291 52  TRP B CH2 
1431 N N   . ASP B 58  ? 0.5057 0.6004 0.3791 -0.0762 0.1216  0.1370  53  ASP B N   
1432 C CA  . ASP B 58  ? 0.5851 0.6550 0.4557 -0.0900 0.1272  0.1764  53  ASP B CA  
1433 C C   . ASP B 58  ? 0.6107 0.6712 0.5286 -0.1082 0.1408  0.1745  53  ASP B C   
1434 O O   . ASP B 58  ? 0.6016 0.6966 0.5396 -0.1169 0.1564  0.1558  53  ASP B O   
1435 C CB  . ASP B 58  ? 0.6954 0.7847 0.5135 -0.0993 0.1404  0.1990  53  ASP B CB  
1436 C CG  . ASP B 58  ? 0.8660 0.9176 0.6718 -0.1072 0.1355  0.2412  53  ASP B CG  
1437 O OD1 . ASP B 58  ? 0.8967 0.9135 0.7428 -0.1130 0.1325  0.2573  53  ASP B OD1 
1438 O OD2 . ASP B 58  ? 0.9288 0.9808 0.6838 -0.1075 0.1339  0.2567  53  ASP B OD2 
1439 N N   . LEU B 59  ? 0.6370 0.6506 0.5775 -0.1139 0.1336  0.1930  54  LEU B N   
1440 C CA  . LEU B 59  ? 0.6247 0.6217 0.6104 -0.1340 0.1402  0.1873  54  LEU B CA  
1441 C C   . LEU B 59  ? 0.6256 0.6164 0.6179 -0.1612 0.1581  0.2239  54  LEU B C   
1442 O O   . LEU B 59  ? 0.5790 0.5538 0.6121 -0.1825 0.1616  0.2219  54  LEU B O   
1443 C CB  . LEU B 59  ? 0.6469 0.5883 0.6553 -0.1264 0.1232  0.1755  54  LEU B CB  
1444 C CG  . LEU B 59  ? 0.6149 0.5600 0.6283 -0.1091 0.1102  0.1355  54  LEU B CG  
1445 C CD1 . LEU B 59  ? 0.6572 0.5436 0.6868 -0.1055 0.1013  0.1245  54  LEU B CD1 
1446 C CD2 . LEU B 59  ? 0.5751 0.5613 0.6071 -0.1201 0.1134  0.1094  54  LEU B CD2 
1447 N N   . LYS B 60  ? 0.6484 0.6450 0.5951 -0.1589 0.1645  0.2478  55  LYS B N   
1448 C CA  . LYS B 60  ? 0.7731 0.7547 0.7137 -0.1794 0.1791  0.2724  55  LYS B CA  
1449 C C   . LYS B 60  ? 0.7297 0.7482 0.7062 -0.2005 0.2026  0.2560  55  LYS B C   
1450 O O   . LYS B 60  ? 0.6474 0.7168 0.6216 -0.1942 0.2176  0.2345  55  LYS B O   
1451 C CB  . LYS B 60  ? 0.9005 0.8885 0.7778 -0.1723 0.1833  0.2952  55  LYS B CB  
1452 C CG  . LYS B 60  ? 1.0406 0.9904 0.8918 -0.1548 0.1561  0.3205  55  LYS B CG  
1453 C CD  . LYS B 60  ? 1.1348 1.0244 1.0263 -0.1595 0.1446  0.3382  55  LYS B CD  
1454 C CE  . LYS B 60  ? 1.2105 1.0617 1.0848 -0.1402 0.1201  0.3684  55  LYS B CE  
1455 N NZ  . LYS B 60  ? 1.2921 1.1449 1.1133 -0.1461 0.1223  0.4014  55  LYS B NZ  
1456 N N   . GLY B 61  ? 0.7233 0.7145 0.7381 -0.2244 0.2043  0.2643  56  GLY B N   
1457 C CA  . GLY B 61  ? 0.7213 0.7487 0.7791 -0.2475 0.2237  0.2527  56  GLY B CA  
1458 C C   . GLY B 61  ? 0.6375 0.6954 0.7479 -0.2481 0.2135  0.2181  56  GLY B C   
1459 O O   . GLY B 61  ? 1.0286 1.1325 1.1799 -0.2607 0.2272  0.2044  56  GLY B O   
1460 N N   . ILE B 62  ? 0.5967 0.6291 0.7085 -0.2344 0.1891  0.2051  57  ILE B N   
1461 C CA  . ILE B 62  ? 0.6052 0.6598 0.7601 -0.2352 0.1748  0.1740  57  ILE B CA  
1462 C C   . ILE B 62  ? 0.6753 0.6695 0.8516 -0.2477 0.1508  0.1653  57  ILE B C   
1463 O O   . ILE B 62  ? 0.6844 0.6232 0.8358 -0.2331 0.1405  0.1678  57  ILE B O   
1464 C CB  . ILE B 62  ? 0.5547 0.6345 0.6857 -0.2048 0.1679  0.1538  57  ILE B CB  
1465 C CG1 . ILE B 62  ? 0.5975 0.7315 0.7048 -0.1927 0.1919  0.1559  57  ILE B CG1 
1466 C CG2 . ILE B 62  ? 0.4620 0.5543 0.6255 -0.2016 0.1474  0.1173  57  ILE B CG2 
1467 C CD1 . ILE B 62  ? 0.5867 0.7253 0.6454 -0.1635 0.1838  0.1425  57  ILE B CD1 
1468 N N   . PRO B 63  ? 0.7349 0.7379 0.9547 -0.2725 0.1413  0.1496  58  PRO B N   
1469 C CA  . PRO B 63  ? 0.8155 0.7596 1.0469 -0.2879 0.1165  0.1325  58  PRO B CA  
1470 C C   . PRO B 63  ? 0.8304 0.7719 1.0622 -0.2752 0.0954  0.0975  58  PRO B C   
1471 O O   . PRO B 63  ? 0.7998 0.7985 1.0537 -0.2736 0.0882  0.0817  58  PRO B O   
1472 C CB  . PRO B 63  ? 0.8271 0.7944 1.1000 -0.3205 0.1166  0.1299  58  PRO B CB  
1473 C CG  . PRO B 63  ? 0.7896 0.8444 1.0897 -0.3151 0.1352  0.1318  58  PRO B CG  
1474 C CD  . PRO B 63  ? 0.7290 0.8022 0.9893 -0.2845 0.1527  0.1427  58  PRO B CD  
1475 N N   . LEU B 64  ? 0.8830 0.7581 1.0785 -0.2611 0.0839  0.0816  59  LEU B N   
1476 C CA  . LEU B 64  ? 0.9304 0.7960 1.1017 -0.2468 0.0636  0.0443  59  LEU B CA  
1477 C C   . LEU B 64  ? 1.0270 0.8677 1.2167 -0.2786 0.0401  0.0203  59  LEU B C   
1478 O O   . LEU B 64  ? 1.0590 0.8506 1.2149 -0.2753 0.0257  -0.0090 59  LEU B O   
1479 C CB  . LEU B 64  ? 0.9543 0.7652 1.0809 -0.2175 0.0668  0.0367  59  LEU B CB  
1480 C CG  . LEU B 64  ? 0.9052 0.7406 1.0158 -0.1904 0.0835  0.0633  59  LEU B CG  
1481 C CD1 . LEU B 64  ? 0.9261 0.7078 1.0119 -0.1650 0.0866  0.0654  59  LEU B CD1 
1482 C CD2 . LEU B 64  ? 0.8034 0.7031 0.9047 -0.1731 0.0822  0.0535  59  LEU B CD2 
1483 N N   . ASP B 65  ? 1.0852 0.9659 1.3269 -0.3048 0.0338  0.0334  60  ASP B N   
1484 C CA  . ASP B 65  ? 1.1676 1.0321 1.4373 -0.3256 0.0099  0.0121  60  ASP B CA  
1485 C C   . ASP B 65  ? 1.0881 0.9975 1.3645 -0.3274 -0.0152 -0.0145 60  ASP B C   
1486 O O   . ASP B 65  ? 1.1093 0.9817 1.3529 -0.3282 -0.0399 -0.0428 60  ASP B O   
1487 C CB  . ASP B 65  ? 1.2660 1.1393 1.5603 -0.3570 0.0295  0.0250  60  ASP B CB  
1488 C CG  . ASP B 65  ? 1.2721 1.2239 1.6217 -0.3746 0.0225  0.0233  60  ASP B CG  
1489 O OD1 . ASP B 65  ? 1.2490 1.2685 1.6168 -0.3589 0.0299  0.0331  60  ASP B OD1 
1490 O OD2 . ASP B 65  ? 1.2971 1.2436 1.6734 -0.4018 0.0088  0.0114  60  ASP B OD2 
1491 N N   . GLN B 66  ? 1.0248 1.0116 1.3356 -0.3237 -0.0095 -0.0040 61  GLN B N   
1492 C CA  . GLN B 66  ? 0.9845 1.0198 1.3131 -0.3233 -0.0366 -0.0205 61  GLN B CA  
1493 C C   . GLN B 66  ? 0.9331 0.9460 1.2043 -0.3022 -0.0549 -0.0373 61  GLN B C   
1494 O O   . GLN B 66  ? 1.0014 0.9692 1.2200 -0.2894 -0.0412 -0.0388 61  GLN B O   
1495 C CB  . GLN B 66  ? 0.9220 1.0457 1.3068 -0.3178 -0.0229 -0.0034 61  GLN B CB  
1496 C CG  . GLN B 66  ? 0.8341 0.9965 1.2126 -0.2873 -0.0171 0.0007  61  GLN B CG  
1497 C CD  . GLN B 66  ? 0.7774 1.0154 1.2067 -0.2771 0.0101  0.0172  61  GLN B CD  
1498 O OE1 . GLN B 66  ? 0.8235 1.0882 1.2902 -0.2942 0.0250  0.0279  61  GLN B OE1 
1499 N NE2 . GLN B 66  ? 0.6548 0.9252 1.0831 -0.2486 0.0179  0.0175  61  GLN B NE2 
1500 N N   . GLY B 67  ? 0.8155 0.8578 1.0898 -0.2999 -0.0833 -0.0510 62  GLY B N   
1501 C CA  . GLY B 67  ? 0.7436 0.7713 0.9616 -0.2801 -0.0970 -0.0633 62  GLY B CA  
1502 C C   . GLY B 67  ? 0.6317 0.7128 0.8761 -0.2615 -0.0782 -0.0449 62  GLY B C   
1503 O O   . GLY B 67  ? 0.6751 0.8084 0.9515 -0.2497 -0.0907 -0.0412 62  GLY B O   
1504 N N   . SER B 68  ? 0.5139 0.5786 0.7438 -0.2480 -0.0434 -0.0342 63  SER B N   
1505 C CA  . SER B 68  ? 0.5155 0.6168 0.7491 -0.2170 -0.0179 -0.0225 63  SER B CA  
1506 C C   . SER B 68  ? 0.4339 0.5194 0.6162 -0.1891 -0.0241 -0.0348 63  SER B C   
1507 O O   . SER B 68  ? 0.3868 0.4211 0.5174 -0.1889 -0.0320 -0.0483 63  SER B O   
1508 C CB  . SER B 68  ? 0.6078 0.6899 0.8296 -0.2128 0.0152  -0.0060 63  SER B CB  
1509 O OG  . SER B 68  ? 0.6557 0.6694 0.8263 -0.2101 0.0162  -0.0131 63  SER B OG  
1510 N N   . GLU B 69  ? 0.3012 0.4302 0.5004 -0.1664 -0.0176 -0.0307 64  GLU B N   
1511 C CA  . GLU B 69  ? 0.3428 0.4616 0.5046 -0.1442 -0.0276 -0.0399 64  GLU B CA  
1512 C C   . GLU B 69  ? 0.3399 0.4762 0.4958 -0.1168 -0.0044 -0.0358 64  GLU B C   
1513 O O   . GLU B 69  ? 0.3544 0.5301 0.5461 -0.1117 0.0142  -0.0285 64  GLU B O   
1514 C CB  . GLU B 69  ? 0.3599 0.5066 0.5485 -0.1478 -0.0601 -0.0428 64  GLU B CB  
1515 C CG  . GLU B 69  ? 0.5130 0.6337 0.6851 -0.1759 -0.0919 -0.0510 64  GLU B CG  
1516 C CD  . GLU B 69  ? 0.6375 0.7964 0.8479 -0.1824 -0.1295 -0.0469 64  GLU B CD  
1517 O OE1 . GLU B 69  ? 0.6357 0.8494 0.9109 -0.1679 -0.1264 -0.0363 64  GLU B OE1 
1518 O OE2 . GLU B 69  ? 0.7012 0.8334 0.8742 -0.1961 -0.1580 -0.0553 64  GLU B OE2 
1519 N N   . LEU B 70  ? 0.2468 0.3534 0.3554 -0.1012 -0.0046 -0.0419 65  LEU B N   
1520 C CA  . LEU B 70  ? 0.3492 0.4696 0.4504 -0.0780 0.0085  -0.0416 65  LEU B CA  
1521 C C   . LEU B 70  ? 0.2882 0.4281 0.4079 -0.0675 -0.0096 -0.0463 65  LEU B C   
1522 O O   . LEU B 70  ? 0.3503 0.4714 0.4513 -0.0720 -0.0319 -0.0488 65  LEU B O   
1523 C CB  . LEU B 70  ? 0.3756 0.4588 0.4284 -0.0684 0.0156  -0.0433 65  LEU B CB  
1524 C CG  . LEU B 70  ? 0.2969 0.3893 0.3384 -0.0485 0.0224  -0.0448 65  LEU B CG  
1525 C CD1 . LEU B 70  ? 0.2738 0.3877 0.3213 -0.0436 0.0419  -0.0386 65  LEU B CD1 
1526 C CD2 . LEU B 70  ? 0.3339 0.3951 0.3398 -0.0422 0.0225  -0.0463 65  LEU B CD2 
1527 N N   . HIS B 71  ? 0.1919 0.3672 0.3465 -0.0535 0.0008  -0.0470 66  HIS B N   
1528 C CA  . HIS B 71  ? 0.3708 0.5614 0.5527 -0.0397 -0.0153 -0.0501 66  HIS B CA  
1529 C C   . HIS B 71  ? 0.3090 0.4818 0.4626 -0.0211 -0.0084 -0.0567 66  HIS B C   
1530 O O   . HIS B 71  ? 0.3240 0.5034 0.4696 -0.0124 0.0140  -0.0626 66  HIS B O   
1531 C CB  . HIS B 71  ? 0.3219 0.5630 0.5737 -0.0339 -0.0078 -0.0499 66  HIS B CB  
1532 C CG  . HIS B 71  ? 0.3973 0.6535 0.6913 -0.0181 -0.0283 -0.0502 66  HIS B CG  
1533 N ND1 . HIS B 71  ? 0.4383 0.7267 0.7844 0.0031  -0.0125 -0.0576 66  HIS B ND1 
1534 C CD2 . HIS B 71  ? 0.4778 0.7187 0.7688 -0.0197 -0.0634 -0.0426 66  HIS B CD2 
1535 C CE1 . HIS B 71  ? 0.4218 0.7124 0.8033 0.0160  -0.0385 -0.0533 66  HIS B CE1 
1536 N NE2 . HIS B 71  ? 0.4070 0.6699 0.7536 0.0013  -0.0713 -0.0417 66  HIS B NE2 
1537 N N   . VAL B 72  ? 0.2592 0.4085 0.3947 -0.0179 -0.0291 -0.0549 67  VAL B N   
1538 C CA  . VAL B 72  ? 0.2540 0.3843 0.3684 -0.0045 -0.0257 -0.0597 67  VAL B CA  
1539 C C   . VAL B 72  ? 0.2507 0.3835 0.3984 0.0088  -0.0426 -0.0586 67  VAL B C   
1540 O O   . VAL B 72  ? 0.3033 0.4343 0.4623 0.0042  -0.0677 -0.0473 67  VAL B O   
1541 C CB  . VAL B 72  ? 0.3571 0.4527 0.4196 -0.0126 -0.0291 -0.0556 67  VAL B CB  
1542 C CG1 . VAL B 72  ? 0.3571 0.4477 0.3956 -0.0178 -0.0097 -0.0571 67  VAL B CG1 
1543 C CG2 . VAL B 72  ? 0.3976 0.4783 0.4431 -0.0259 -0.0502 -0.0476 67  VAL B CG2 
1544 N N   . VAL B 73  ? 0.2165 0.3506 0.3788 0.0251  -0.0304 -0.0704 68  VAL B N   
1545 C CA  . VAL B 73  ? 0.2611 0.3883 0.4586 0.0408  -0.0444 -0.0707 68  VAL B CA  
1546 C C   . VAL B 73  ? 0.3085 0.3999 0.4758 0.0443  -0.0440 -0.0763 68  VAL B C   
1547 O O   . VAL B 73  ? 0.2909 0.3792 0.4350 0.0448  -0.0256 -0.0910 68  VAL B O   
1548 C CB  . VAL B 73  ? 0.2258 0.3848 0.4825 0.0594  -0.0288 -0.0847 68  VAL B CB  
1549 C CG1 . VAL B 73  ? 0.2945 0.4429 0.5992 0.0788  -0.0463 -0.0827 68  VAL B CG1 
1550 C CG2 . VAL B 73  ? 0.2401 0.4425 0.5335 0.0521  -0.0243 -0.0786 68  VAL B CG2 
1551 N N   . VAL B 74  ? 0.2596 0.3244 0.4261 0.0439  -0.0664 -0.0623 69  VAL B N   
1552 C CA  . VAL B 74  ? 0.3270 0.3575 0.4774 0.0452  -0.0679 -0.0654 69  VAL B CA  
1553 C C   . VAL B 74  ? 0.3079 0.3265 0.5070 0.0656  -0.0729 -0.0744 69  VAL B C   
1554 O O   . VAL B 74  ? 0.2884 0.3079 0.5262 0.0748  -0.0920 -0.0598 69  VAL B O   
1555 C CB  . VAL B 74  ? 0.3687 0.3724 0.4859 0.0301  -0.0851 -0.0418 69  VAL B CB  
1556 C CG1 . VAL B 74  ? 0.3267 0.2972 0.4377 0.0284  -0.0861 -0.0426 69  VAL B CG1 
1557 C CG2 . VAL B 74  ? 0.3415 0.3534 0.4134 0.0132  -0.0755 -0.0376 69  VAL B CG2 
1558 N N   . LYS B 75  ? 0.3552 0.3613 0.5528 0.0729  -0.0572 -0.0992 70  LYS B N   
1559 C CA  . LYS B 75  ? 0.4307 0.4190 0.6736 0.0944  -0.0564 -0.1159 70  LYS B CA  
1560 C C   . LYS B 75  ? 0.4115 0.3507 0.6401 0.0901  -0.0635 -0.1233 70  LYS B C   
1561 O O   . LYS B 75  ? 0.3692 0.2999 0.5540 0.0715  -0.0612 -0.1248 70  LYS B O   
1562 C CB  . LYS B 75  ? 0.4199 0.4357 0.6773 0.1088  -0.0269 -0.1476 70  LYS B CB  
1563 C CG  . LYS B 75  ? 0.3739 0.4388 0.6725 0.1175  -0.0182 -0.1419 70  LYS B CG  
1564 C CD  . LYS B 75  ? 0.4861 0.5693 0.8187 0.1385  0.0123  -0.1725 70  LYS B CD  
1565 C CE  . LYS B 75  ? 0.5431 0.6813 0.9094 0.1393  0.0273  -0.1636 70  LYS B CE  
1566 N NZ  . LYS B 75  ? 0.5244 0.6898 0.8488 0.1196  0.0393  -0.1605 70  LYS B NZ  
1567 N N   . ASP B 76  ? 0.4036 0.3106 0.6765 0.1072  -0.0730 -0.1271 71  ASP B N   
1568 C CA  . ASP B 76  ? 0.4968 0.3508 0.7649 0.1033  -0.0790 -0.1388 71  ASP B CA  
1569 C C   . ASP B 76  ? 0.5865 0.4337 0.8557 0.1156  -0.0559 -0.1827 71  ASP B C   
1570 O O   . ASP B 76  ? 0.5383 0.4079 0.8353 0.1345  -0.0391 -0.1938 71  ASP B O   
1571 C CB  . ASP B 76  ? 0.5135 0.3256 0.8233 0.1115  -0.1046 -0.1130 71  ASP B CB  
1572 C CG  . ASP B 76  ? 0.6088 0.3648 0.9125 0.1013  -0.1105 -0.1204 71  ASP B CG  
1573 O OD1 . ASP B 76  ? 0.5581 0.3058 0.8228 0.0806  -0.1057 -0.1342 71  ASP B OD1 
1574 O OD2 . ASP B 76  ? 0.7329 0.4592 1.0694 0.1110  -0.1199 -0.1098 71  ASP B OD2 
1575 N N   . HIS B 77  ? 0.6544 0.4785 0.8823 0.0978  -0.0540 -0.1996 72  HIS B N   
1576 C CA  . HIS B 77  ? 0.7308 0.5508 0.9317 0.0991  -0.0337 -0.2336 72  HIS B CA  
1577 C C   . HIS B 77  ? 0.7304 0.4983 0.9541 0.1055  -0.0395 -0.2418 72  HIS B C   
1578 O O   . HIS B 77  ? 0.6718 0.4031 0.9049 0.0929  -0.0612 -0.2241 72  HIS B O   
1579 C CB  . HIS B 77  ? 0.7975 0.6218 0.9417 0.0737  -0.0359 -0.2421 72  HIS B CB  
1580 C CG  . HIS B 77  ? 0.8790 0.7073 0.9791 0.0717  -0.0171 -0.2721 72  HIS B CG  
1581 N ND1 . HIS B 77  ? 0.9039 0.7728 0.9794 0.0780  0.0056  -0.2797 72  HIS B ND1 
1582 C CD2 . HIS B 77  ? 0.9291 0.7218 0.9999 0.0620  -0.0189 -0.2945 72  HIS B CD2 
1583 C CE1 . HIS B 77  ? 0.9701 0.8265 0.9991 0.0731  0.0170  -0.3041 72  HIS B CE1 
1584 N NE2 . HIS B 77  ? 0.9662 0.7761 0.9903 0.0635  0.0015  -0.3156 72  HIS B NE2 
1585 N N   . GLU B 78  ? 0.8543 0.6159 1.0865 0.1241  -0.0190 -0.2670 73  GLU B N   
1586 C CA  . GLU B 78  ? 0.9953 0.7049 1.2603 0.1354  -0.0249 -0.2719 73  GLU B CA  
1587 C C   . GLU B 78  ? 1.3309 0.9885 1.5653 0.1291  -0.0190 -0.3049 73  GLU B C   
1588 O O   . GLU B 78  ? 1.3428 0.9539 1.5864 0.1170  -0.0387 -0.2960 73  GLU B O   
1589 C CB  . GLU B 78  ? 1.0560 0.7774 1.3851 0.1656  -0.0198 -0.2607 73  GLU B CB  
1590 C CG  . GLU B 78  ? 1.0500 0.7874 1.4203 0.1664  -0.0460 -0.2161 73  GLU B CG  
1591 C CD  . GLU B 78  ? 1.1038 0.7898 1.4860 0.1548  -0.0757 -0.1883 73  GLU B CD  
1592 O OE1 . GLU B 78  ? 1.1284 0.7744 1.4798 0.1360  -0.0796 -0.1994 73  GLU B OE1 
1593 O OE2 . GLU B 78  ? 1.1058 0.7931 1.5266 0.1622  -0.0963 -0.1520 73  GLU B OE2 
1594 N N   . THR B 79  ? 1.4057 1.0646 1.6010 0.1345  0.0060  -0.3409 74  THR B N   
1595 C CA  . THR B 79  ? 1.4508 1.1594 1.6197 0.1426  0.0327  -0.3534 74  THR B CA  
1596 C C   . THR B 79  ? 1.5956 1.2624 1.7292 0.1500  0.0524  -0.3946 74  THR B C   
1597 O O   . THR B 79  ? 1.6500 1.2591 1.7871 0.1456  0.0396  -0.4053 74  THR B O   
1598 C CB  . THR B 79  ? 1.4378 1.1801 1.5537 0.1163  0.0255  -0.3449 74  THR B CB  
1599 O OG1 . THR B 79  ? 1.3967 1.1961 1.5093 0.1245  0.0453  -0.3380 74  THR B OG1 
1600 C CG2 . THR B 79  ? 1.5283 1.2436 1.5732 0.0957  0.0251  -0.3718 74  THR B CG2 
1601 N N   . MET B 80  ? 1.6601 1.3478 1.7569 0.1601  0.0829  -0.4184 75  MET B N   
1602 C CA  . MET B 80  ? 1.6358 1.3869 1.7135 0.1599  0.1011  -0.4086 75  MET B CA  
1603 C C   . MET B 80  ? 1.6452 1.4330 1.7817 0.1901  0.1267  -0.4041 75  MET B C   
1604 O O   . MET B 80  ? 1.6297 1.4708 1.7606 0.1911  0.1446  -0.3943 75  MET B O   
1605 C CB  . MET B 80  ? 1.6801 1.4271 1.6686 0.1471  0.1169  -0.4350 75  MET B CB  
1606 C CG  . MET B 80  ? 1.6285 1.3938 1.5572 0.1163  0.0990  -0.4222 75  MET B CG  
1607 S SD  . MET B 80  ? 3.6007 3.3388 3.4215 0.1038  0.1098  -0.4575 75  MET B SD  
1608 C CE  . MET B 80  ? 1.5052 1.3051 1.2826 0.0981  0.1265  -0.4386 75  MET B CE  
1609 N N   . GLY B 81  ? 1.6806 1.4403 1.8762 0.2140  0.1277  -0.4093 76  GLY B N   
1610 C CA  . GLY B 81  ? 1.6822 1.4781 1.9460 0.2442  0.1483  -0.4032 76  GLY B CA  
1611 C C   . GLY B 81  ? 1.5995 1.4377 1.9310 0.2458  0.1272  -0.3615 76  GLY B C   
1612 O O   . GLY B 81  ? 1.6125 1.4935 2.0023 0.2658  0.1400  -0.3505 76  GLY B O   
1613 N N   . ARG B 82  ? 1.5040 1.3311 1.8268 0.2240  0.0939  -0.3382 77  ARG B N   
1614 C CA  . ARG B 82  ? 1.4059 1.2665 1.7796 0.2226  0.0702  -0.2990 77  ARG B CA  
1615 C C   . ARG B 82  ? 1.2847 1.1613 1.6154 0.1947  0.0531  -0.2825 77  ARG B C   
1616 O O   . ARG B 82  ? 1.2950 1.1369 1.5820 0.1754  0.0387  -0.2875 77  ARG B O   
1617 C CB  . ARG B 82  ? 1.4534 1.2745 1.8811 0.2320  0.0406  -0.2784 77  ARG B CB  
1618 C CG  . ARG B 82  ? 1.5492 1.3570 2.0330 0.2628  0.0533  -0.2886 77  ARG B CG  
1619 C CD  . ARG B 82  ? 1.5892 1.3588 2.1251 0.2707  0.0212  -0.2617 77  ARG B CD  
1620 N NE  . ARG B 82  ? 1.6763 1.4357 2.2712 0.3036  0.0349  -0.2723 77  ARG B NE  
1621 C CZ  . ARG B 82  ? 1.6912 1.4930 2.3569 0.3249  0.0325  -0.2515 77  ARG B CZ  
1622 N NH1 . ARG B 82  ? 1.6256 1.4795 2.3075 0.3144  0.0146  -0.2186 77  ARG B NH1 
1623 N NH2 . ARG B 82  ? 1.7743 1.5654 2.4955 0.3566  0.0467  -0.2639 77  ARG B NH2 
1624 N N   . ASN B 83  ? 1.4479 1.1899 1.2529 0.3104  0.0030  -0.2569 78  ASN B N   
1625 C CA  . ASN B 83  ? 1.3220 1.0854 1.1425 0.2806  -0.0085 -0.2370 78  ASN B CA  
1626 C C   . ASN B 83  ? 1.1999 1.0011 1.0816 0.2747  0.0060  -0.2125 78  ASN B C   
1627 O O   . ASN B 83  ? 1.1710 1.0173 1.0685 0.2837  0.0371  -0.1984 78  ASN B O   
1628 C CB  . ASN B 83  ? 1.3050 1.0935 1.0837 0.2769  0.0050  -0.2324 78  ASN B CB  
1629 C CG  . ASN B 83  ? 1.3478 1.0983 1.0768 0.2695  -0.0242 -0.2490 78  ASN B CG  
1630 O OD1 . ASN B 83  ? 1.4554 1.1609 1.1617 0.2799  -0.0448 -0.2714 78  ASN B OD1 
1631 N ND2 . ASN B 83  ? 1.3142 1.0820 1.0296 0.2517  -0.0280 -0.2373 78  ASN B ND2 
1632 N N   . ARG B 84  ? 1.0970 0.8810 1.0163 0.2595  -0.0186 -0.2051 79  ARG B N   
1633 C CA  . ARG B 84  ? 0.9450 0.7566 0.9224 0.2578  -0.0107 -0.1830 79  ARG B CA  
1634 C C   . ARG B 84  ? 0.7814 0.6268 0.7787 0.2351  -0.0126 -0.1610 79  ARG B C   
1635 O O   . ARG B 84  ? 0.7203 0.5505 0.7088 0.2135  -0.0351 -0.1599 79  ARG B O   
1636 C CB  . ARG B 84  ? 0.9730 0.7483 0.9818 0.2571  -0.0351 -0.1837 79  ARG B CB  
1637 C CG  . ARG B 84  ? 0.9514 0.7487 1.0166 0.2466  -0.0404 -0.1565 79  ARG B CG  
1638 C CD  . ARG B 84  ? 1.0263 0.8075 1.1270 0.2633  -0.0425 -0.1537 79  ARG B CD  
1639 N NE  . ARG B 84  ? 1.1220 0.8512 1.1985 0.2733  -0.0570 -0.1788 79  ARG B NE  
1640 C CZ  . ARG B 84  ? 1.1362 0.8405 1.2354 0.2907  -0.0601 -0.1827 79  ARG B CZ  
1641 N NH1 . ARG B 84  ? 1.1278 0.8571 1.2755 0.3000  -0.0492 -0.1606 79  ARG B NH1 
1642 N NH2 . ARG B 84  ? 1.1590 0.8131 1.2334 0.2993  -0.0763 -0.2080 79  ARG B NH2 
1643 N N   . PHE B 85  ? 0.6962 0.5889 0.7239 0.2409  0.0110  -0.1429 80  PHE B N   
1644 C CA  . PHE B 85  ? 0.6240 0.5520 0.6759 0.2231  0.0097  -0.1218 80  PHE B CA  
1645 C C   . PHE B 85  ? 0.5816 0.4910 0.6605 0.2055  -0.0199 -0.1122 80  PHE B C   
1646 O O   . PHE B 85  ? 0.5586 0.4514 0.6655 0.2104  -0.0310 -0.1079 80  PHE B O   
1647 C CB  . PHE B 85  ? 0.6294 0.6094 0.7253 0.2337  0.0334  -0.1017 80  PHE B CB  
1648 C CG  . PHE B 85  ? 0.5408 0.5600 0.6659 0.2164  0.0287  -0.0795 80  PHE B CG  
1649 C CD1 . PHE B 85  ? 0.5416 0.5595 0.7000 0.2000  0.0049  -0.0641 80  PHE B CD1 
1650 C CD2 . PHE B 85  ? 0.5284 0.5853 0.6469 0.2111  0.0473  -0.0699 80  PHE B CD2 
1651 C CE1 . PHE B 85  ? 0.5226 0.5702 0.6968 0.1731  -0.0008 -0.0416 80  PHE B CE1 
1652 C CE2 . PHE B 85  ? 0.4546 0.5406 0.5979 0.1842  0.0400  -0.0471 80  PHE B CE2 
1653 C CZ  . PHE B 85  ? 0.4806 0.5597 0.6480 0.1653  0.0154  -0.0350 80  PHE B CZ  
1654 N N   . LEU B 86  ? 0.4872 0.4004 0.5592 0.1849  -0.0315 -0.1062 81  LEU B N   
1655 C CA  . LEU B 86  ? 0.4631 0.3675 0.5590 0.1610  -0.0538 -0.0877 81  LEU B CA  
1656 C C   . LEU B 86  ? 0.4459 0.3928 0.5578 0.1411  -0.0479 -0.0621 81  LEU B C   
1657 O O   . LEU B 86  ? 0.4981 0.4545 0.6399 0.1354  -0.0574 -0.0433 81  LEU B O   
1658 C CB  . LEU B 86  ? 0.4611 0.3338 0.5345 0.1429  -0.0717 -0.0937 81  LEU B CB  
1659 C CG  . LEU B 86  ? 0.5036 0.3288 0.5634 0.1513  -0.0883 -0.1144 81  LEU B CG  
1660 C CD1 . LEU B 86  ? 0.5619 0.3645 0.6132 0.1293  -0.1089 -0.1135 81  LEU B CD1 
1661 C CD2 . LEU B 86  ? 0.5223 0.3297 0.6148 0.1565  -0.0998 -0.1075 81  LEU B CD2 
1662 N N   . GLY B 87  ? 0.3850 0.3537 0.4751 0.1309  -0.0350 -0.0618 82  GLY B N   
1663 C CA  . GLY B 87  ? 0.3906 0.3915 0.4909 0.1126  -0.0326 -0.0425 82  GLY B CA  
1664 C C   . GLY B 87  ? 0.3705 0.3953 0.4553 0.1100  -0.0151 -0.0445 82  GLY B C   
1665 O O   . GLY B 87  ? 0.3779 0.3929 0.4353 0.1183  -0.0060 -0.0591 82  GLY B O   
1666 N N   . GLU B 88  ? 0.2791 0.3327 0.3811 0.0978  -0.0135 -0.0288 83  GLU B N   
1667 C CA  . GLU B 88  ? 0.2904 0.3665 0.3865 0.0928  0.0006  -0.0259 83  GLU B CA  
1668 C C   . GLU B 88  ? 0.3012 0.3861 0.4010 0.0699  -0.0097 -0.0140 83  GLU B C   
1669 O O   . GLU B 88  ? 0.3321 0.4123 0.4392 0.0607  -0.0263 -0.0066 83  GLU B O   
1670 C CB  . GLU B 88  ? 0.2265 0.3349 0.3511 0.1107  0.0197  -0.0193 83  GLU B CB  
1671 C CG  . GLU B 88  ? 0.2803 0.4142 0.4561 0.1105  0.0126  -0.0014 83  GLU B CG  
1672 C CD  . GLU B 88  ? 0.4670 0.6370 0.6798 0.1327  0.0355  0.0077  83  GLU B CD  
1673 O OE1 . GLU B 88  ? 0.5005 0.6848 0.6989 0.1417  0.0586  0.0066  83  GLU B OE1 
1674 O OE2 . GLU B 88  ? 0.6074 0.7937 0.8647 0.1426  0.0317  0.0184  83  GLU B OE2 
1675 N N   . ALA B 89  ? 0.2975 0.3922 0.3887 0.0622  -0.0011 -0.0125 84  ALA B N   
1676 C CA  . ALA B 89  ? 0.3218 0.4186 0.4144 0.0429  -0.0117 -0.0051 84  ALA B CA  
1677 C C   . ALA B 89  ? 0.3465 0.4612 0.4482 0.0388  -0.0001 0.0017  84  ALA B C   
1678 O O   . ALA B 89  ? 0.3429 0.4613 0.4311 0.0486  0.0166  -0.0016 84  ALA B O   
1679 C CB  . ALA B 89  ? 0.3181 0.3871 0.3758 0.0333  -0.0199 -0.0134 84  ALA B CB  
1680 N N   . LYS B 90  ? 0.3000 0.4233 0.4236 0.0240  -0.0115 0.0123  85  LYS B N   
1681 C CA  . LYS B 90  ? 0.3514 0.4877 0.4895 0.0162  -0.0048 0.0224  85  LYS B CA  
1682 C C   . LYS B 90  ? 0.2962 0.4050 0.4115 0.0007  -0.0194 0.0148  85  LYS B C   
1683 O O   . LYS B 90  ? 0.3671 0.4599 0.4767 -0.0081 -0.0396 0.0102  85  LYS B O   
1684 C CB  . LYS B 90  ? 0.3958 0.5651 0.5910 0.0113  -0.0083 0.0439  85  LYS B CB  
1685 C CG  . LYS B 90  ? 0.4365 0.6382 0.6607 0.0308  0.0109  0.0538  85  LYS B CG  
1686 C CD  . LYS B 90  ? 0.4891 0.7186 0.7745 0.0253  -0.0029 0.0733  85  LYS B CD  
1687 C CE  . LYS B 90  ? 0.4879 0.7539 0.8092 0.0488  0.0205  0.0850  85  LYS B CE  
1688 N NZ  . LYS B 90  ? 0.5037 0.8044 0.8441 0.0585  0.0518  0.1026  85  LYS B NZ  
1689 N N   . VAL B 91  ? 0.2603 0.3619 0.3592 -0.0003 -0.0094 0.0129  86  VAL B N   
1690 C CA  . VAL B 91  ? 0.2922 0.3670 0.3726 -0.0110 -0.0204 0.0051  86  VAL B CA  
1691 C C   . VAL B 91  ? 0.3143 0.3942 0.4245 -0.0228 -0.0252 0.0183  86  VAL B C   
1692 O O   . VAL B 91  ? 0.2904 0.3915 0.4181 -0.0205 -0.0103 0.0333  86  VAL B O   
1693 C CB  . VAL B 91  ? 0.5223 0.5794 0.5666 -0.0046 -0.0109 -0.0065 86  VAL B CB  
1694 C CG1 . VAL B 91  ? 0.6307 0.6811 0.6552 0.0035  -0.0104 -0.0157 86  VAL B CG1 
1695 C CG2 . VAL B 91  ? 0.4946 0.5649 0.5392 0.0012  0.0047  0.0007  86  VAL B CG2 
1696 N N   . PRO B 92  ? 0.3429 0.4014 0.4577 -0.0351 -0.0478 0.0137  87  PRO B N   
1697 C CA  . PRO B 92  ? 0.3283 0.3848 0.4787 -0.0491 -0.0598 0.0264  87  PRO B CA  
1698 C C   . PRO B 92  ? 0.3582 0.3951 0.4946 -0.0494 -0.0533 0.0236  87  PRO B C   
1699 O O   . PRO B 92  ? 0.4009 0.4037 0.5041 -0.0473 -0.0604 0.0044  87  PRO B O   
1700 C CB  . PRO B 92  ? 0.3462 0.3753 0.4937 -0.0598 -0.0919 0.0150  87  PRO B CB  
1701 C CG  . PRO B 92  ? 0.4124 0.4190 0.5033 -0.0488 -0.0903 -0.0074 87  PRO B CG  
1702 C CD  . PRO B 92  ? 0.3689 0.4014 0.4531 -0.0356 -0.0653 -0.0033 87  PRO B CD  
1703 N N   . LEU B 93  ? 0.2346 0.2946 0.3969 -0.0504 -0.0388 0.0450  88  LEU B N   
1704 C CA  . LEU B 93  ? 0.2812 0.3265 0.4350 -0.0503 -0.0331 0.0475  88  LEU B CA  
1705 C C   . LEU B 93  ? 0.3210 0.3346 0.4960 -0.0639 -0.0562 0.0468  88  LEU B C   
1706 O O   . LEU B 93  ? 0.3426 0.3390 0.5171 -0.0641 -0.0551 0.0493  88  LEU B O   
1707 C CB  . LEU B 93  ? 0.3055 0.3856 0.4757 -0.0466 -0.0117 0.0737  88  LEU B CB  
1708 C CG  . LEU B 93  ? 0.3170 0.4220 0.4616 -0.0304 0.0086  0.0703  88  LEU B CG  
1709 C CD1 . LEU B 93  ? 0.2700 0.4108 0.4264 -0.0240 0.0305  0.0966  88  LEU B CD1 
1710 C CD2 . LEU B 93  ? 0.3482 0.4313 0.4449 -0.0201 0.0113  0.0478  88  LEU B CD2 
1711 N N   . ARG B 94  ? 0.3619 0.3645 0.5562 -0.0749 -0.0803 0.0429  89  ARG B N   
1712 C CA  . ARG B 94  ? 0.4871 0.4476 0.6933 -0.0869 -0.1096 0.0343  89  ARG B CA  
1713 C C   . ARG B 94  ? 0.4979 0.4148 0.6501 -0.0742 -0.1095 0.0038  89  ARG B C   
1714 O O   . ARG B 94  ? 0.4760 0.3577 0.6326 -0.0764 -0.1212 -0.0022 89  ARG B O   
1715 C CB  . ARG B 94  ? 0.5593 0.5117 0.7845 -0.0995 -0.1409 0.0303  89  ARG B CB  
1716 C CG  . ARG B 94  ? 0.6743 0.5869 0.8407 -0.0920 -0.1579 -0.0047 89  ARG B CG  
1717 C CD  . ARG B 94  ? 0.7475 0.6487 0.9292 -0.1044 -0.1936 -0.0066 89  ARG B CD  
1718 N NE  . ARG B 94  ? 0.7636 0.7085 0.9697 -0.1066 -0.1906 0.0090  89  ARG B NE  
1719 C CZ  . ARG B 94  ? 0.8113 0.7525 0.9786 -0.0995 -0.1972 -0.0059 89  ARG B CZ  
1720 N NH1 . ARG B 94  ? 0.8682 0.7665 0.9656 -0.0889 -0.2037 -0.0353 89  ARG B NH1 
1721 N NH2 . ARG B 94  ? 0.7878 0.7699 0.9850 -0.0995 -0.1932 0.0112  89  ARG B NH2 
1722 N N   . GLU B 95  ? 0.4783 0.3992 0.5845 -0.0598 -0.0948 -0.0128 90  GLU B N   
1723 C CA  . GLU B 95  ? 0.5450 0.4350 0.6038 -0.0451 -0.0881 -0.0369 90  GLU B CA  
1724 C C   . GLU B 95  ? 0.4633 0.3517 0.5310 -0.0392 -0.0728 -0.0294 90  GLU B C   
1725 O O   . GLU B 95  ? 0.5065 0.3610 0.5586 -0.0308 -0.0749 -0.0444 90  GLU B O   
1726 C CB  . GLU B 95  ? 0.6002 0.5065 0.6224 -0.0330 -0.0716 -0.0450 90  GLU B CB  
1727 C CG  . GLU B 95  ? 0.7872 0.6682 0.7673 -0.0280 -0.0843 -0.0661 90  GLU B CG  
1728 C CD  . GLU B 95  ? 0.9031 0.7966 0.8955 -0.0387 -0.1036 -0.0605 90  GLU B CD  
1729 O OE1 . GLU B 95  ? 0.9836 0.8639 1.0016 -0.0523 -0.1298 -0.0584 90  GLU B OE1 
1730 O OE2 . GLU B 95  ? 0.8948 0.8109 0.8769 -0.0342 -0.0946 -0.0566 90  GLU B OE2 
1731 N N   . VAL B 96  ? 0.3624 0.2871 0.4530 -0.0415 -0.0575 -0.0063 91  VAL B N   
1732 C CA  . VAL B 96  ? 0.4097 0.3368 0.5073 -0.0365 -0.0455 0.0046  91  VAL B CA  
1733 C C   . VAL B 96  ? 0.3912 0.2905 0.5194 -0.0445 -0.0610 0.0116  91  VAL B C   
1734 O O   . VAL B 96  ? 0.4519 0.3337 0.5804 -0.0371 -0.0577 0.0106  91  VAL B O   
1735 C CB  . VAL B 96  ? 0.4003 0.3689 0.5078 -0.0370 -0.0294 0.0282  91  VAL B CB  
1736 C CG1 . VAL B 96  ? 0.4282 0.3979 0.5304 -0.0296 -0.0199 0.0361  91  VAL B CG1 
1737 C CG2 . VAL B 96  ? 0.3573 0.3477 0.4414 -0.0306 -0.0197 0.0202  91  VAL B CG2 
1738 N N   . LEU B 97  ? 0.3697 0.2635 0.5288 -0.0599 -0.0803 0.0197  92  LEU B N   
1739 C CA  . LEU B 97  ? 0.4146 0.2776 0.6106 -0.0706 -0.1007 0.0279  92  LEU B CA  
1740 C C   . LEU B 97  ? 0.4364 0.2421 0.6127 -0.0683 -0.1262 -0.0048 92  LEU B C   
1741 O O   . LEU B 97  ? 0.4391 0.2165 0.6442 -0.0785 -0.1503 -0.0023 92  LEU B O   
1742 C CB  . LEU B 97  ? 0.4438 0.3343 0.6964 -0.0908 -0.1097 0.0616  92  LEU B CB  
1743 C CG  . LEU B 97  ? 0.4321 0.3742 0.7018 -0.0904 -0.0834 0.0970  92  LEU B CG  
1744 C CD1 . LEU B 97  ? 0.5030 0.4764 0.8334 -0.1084 -0.0883 0.1343  92  LEU B CD1 
1745 C CD2 . LEU B 97  ? 0.3161 0.2472 0.5830 -0.0837 -0.0755 0.1065  92  LEU B CD2 
1746 N N   . ALA B 98  ? 0.4879 0.2804 0.6100 -0.0523 -0.1189 -0.0344 93  ALA B N   
1747 C CA  . ALA B 98  ? 0.5681 0.3050 0.6550 -0.0447 -0.1395 -0.0686 93  ALA B CA  
1748 C C   . ALA B 98  ? 0.5935 0.2950 0.6697 -0.0277 -0.1331 -0.0820 93  ALA B C   
1749 O O   . ALA B 98  ? 0.7123 0.3799 0.7762 -0.0236 -0.1481 -0.0977 93  ALA B O   
1750 C CB  . ALA B 98  ? 0.5107 0.2520 0.5404 -0.0323 -0.1309 -0.0902 93  ALA B CB  
1751 N N   . THR B 99  ? 0.4628 0.1842 0.5431 -0.0160 -0.1071 -0.0720 94  THR B N   
1752 C CA  . THR B 99  ? 0.5137 0.2043 0.5902 0.0034  -0.0988 -0.0834 94  THR B CA  
1753 C C   . THR B 99  ? 0.4598 0.1750 0.5838 -0.0014 -0.0896 -0.0509 94  THR B C   
1754 O O   . THR B 99  ? 0.4137 0.1749 0.5566 -0.0145 -0.0820 -0.0234 94  THR B O   
1755 C CB  . THR B 99  ? 0.7431 0.4388 0.7715 0.0289  -0.0721 -0.1033 94  THR B CB  
1756 O OG1 . THR B 99  ? 0.6011 0.3507 0.6397 0.0283  -0.0485 -0.0810 94  THR B OG1 
1757 C CG2 . THR B 99  ? 0.8361 0.5174 0.8109 0.0329  -0.0782 -0.1285 94  THR B CG2 
1758 N N   . PRO B 100 ? 0.4901 0.1760 0.6295 0.0112  -0.0897 -0.0536 95  PRO B N   
1759 C CA  . PRO B 100 ? 0.4669 0.1722 0.6508 0.0076  -0.0846 -0.0210 95  PRO B CA  
1760 C C   . PRO B 100 ? 0.4169 0.1725 0.5923 0.0147  -0.0594 -0.0060 95  PRO B C   
1761 O O   . PRO B 100 ? 0.5290 0.3085 0.7322 0.0091  -0.0572 0.0237  95  PRO B O   
1762 C CB  . PRO B 100 ? 0.5155 0.1877 0.7022 0.0244  -0.0851 -0.0328 95  PRO B CB  
1763 C CG  . PRO B 100 ? 0.5712 0.2038 0.7248 0.0274  -0.0984 -0.0643 95  PRO B CG  
1764 C CD  . PRO B 100 ? 0.5545 0.1975 0.6667 0.0272  -0.0938 -0.0818 95  PRO B CD  
1765 N N   . SER B 101 ? 0.4061 0.1757 0.5435 0.0264  -0.0433 -0.0248 96  SER B N   
1766 C CA  . SER B 101 ? 0.3784 0.1926 0.5115 0.0303  -0.0249 -0.0111 96  SER B CA  
1767 C C   . SER B 101 ? 0.3712 0.2224 0.5081 0.0113  -0.0278 0.0116  96  SER B C   
1768 O O   . SER B 101 ? 0.3096 0.1913 0.4508 0.0106  -0.0211 0.0298  96  SER B O   
1769 C CB  . SER B 101 ? 0.3927 0.2141 0.4896 0.0441  -0.0084 -0.0321 96  SER B CB  
1770 O OG  . SER B 101 ? 0.4802 0.3082 0.5495 0.0337  -0.0129 -0.0412 96  SER B OG  
1771 N N   . LEU B 102 ? 0.3286 0.1756 0.4644 -0.0028 -0.0388 0.0103  97  LEU B N   
1772 C CA  . LEU B 102 ? 0.3456 0.2291 0.4859 -0.0171 -0.0375 0.0311  97  LEU B CA  
1773 C C   . LEU B 102 ? 0.4173 0.3317 0.5280 -0.0111 -0.0228 0.0261  97  LEU B C   
1774 O O   . LEU B 102 ? 0.3952 0.3386 0.5038 -0.0132 -0.0165 0.0435  97  LEU B O   
1775 C CB  . LEU B 102 ? 0.3168 0.2154 0.4870 -0.0249 -0.0392 0.0646  97  LEU B CB  
1776 C CG  . LEU B 102 ? 0.3480 0.2172 0.5580 -0.0343 -0.0562 0.0769  97  LEU B CG  
1777 C CD1 . LEU B 102 ? 0.3597 0.2499 0.5966 -0.0415 -0.0551 0.1163  97  LEU B CD1 
1778 C CD2 . LEU B 102 ? 0.3815 0.2415 0.6050 -0.0489 -0.0703 0.0727  97  LEU B CD2 
1779 N N   . SER B 103 ? 0.4123 0.3170 0.4975 -0.0029 -0.0187 0.0024  98  SER B N   
1780 C CA  . SER B 103 ? 0.3716 0.3002 0.4342 0.0020  -0.0075 -0.0020 98  SER B CA  
1781 C C   . SER B 103 ? 0.3950 0.3126 0.4319 0.0058  -0.0069 -0.0229 98  SER B C   
1782 O O   . SER B 103 ? 0.3593 0.2469 0.3867 0.0107  -0.0122 -0.0387 98  SER B O   
1783 C CB  . SER B 103 ? 0.2902 0.2252 0.3564 0.0129  0.0011  0.0014  98  SER B CB  
1784 O OG  . SER B 103 ? 0.3077 0.2200 0.3723 0.0259  0.0067  -0.0130 98  SER B OG  
1785 N N   . ALA B 104 ? 0.3625 0.3015 0.3847 0.0049  -0.0018 -0.0233 99  ALA B N   
1786 C CA  . ALA B 104 ? 0.3246 0.2571 0.3213 0.0085  -0.0011 -0.0382 99  ALA B CA  
1787 C C   . ALA B 104 ? 0.2768 0.2330 0.2660 0.0103  0.0069  -0.0340 99  ALA B C   
1788 O O   . ALA B 104 ? 0.3041 0.2788 0.3033 0.0068  0.0075  -0.0234 99  ALA B O   
1789 C CB  . ALA B 104 ? 0.3324 0.2576 0.3283 -0.0015 -0.0161 -0.0421 99  ALA B CB  
1790 N N   . SER B 105 ? 0.2822 0.2349 0.2510 0.0166  0.0121  -0.0419 100 SER B N   
1791 C CA  . SER B 105 ? 0.3612 0.3317 0.3273 0.0167  0.0162  -0.0367 100 SER B CA  
1792 C C   . SER B 105 ? 0.3215 0.2904 0.2708 0.0136  0.0092  -0.0417 100 SER B C   
1793 O O   . SER B 105 ? 0.2748 0.2267 0.2063 0.0141  0.0028  -0.0510 100 SER B O   
1794 C CB  . SER B 105 ? 0.3512 0.3249 0.3168 0.0259  0.0291  -0.0333 100 SER B CB  
1795 O OG  . SER B 105 ? 0.4754 0.4339 0.4150 0.0348  0.0358  -0.0425 100 SER B OG  
1796 N N   . PHE B 106 ? 0.2577 0.2413 0.2122 0.0111  0.0075  -0.0363 101 PHE B N   
1797 C CA  . PHE B 106 ? 0.2666 0.2513 0.2118 0.0089  -0.0003 -0.0378 101 PHE B CA  
1798 C C   . PHE B 106 ? 0.2845 0.2758 0.2276 0.0119  0.0031  -0.0319 101 PHE B C   
1799 O O   . PHE B 106 ? 0.2668 0.2653 0.2244 0.0123  0.0053  -0.0273 101 PHE B O   
1800 C CB  . PHE B 106 ? 0.2698 0.2665 0.2333 0.0037  -0.0076 -0.0348 101 PHE B CB  
1801 C CG  . PHE B 106 ? 0.3419 0.3354 0.3178 -0.0022 -0.0122 -0.0341 101 PHE B CG  
1802 C CD1 . PHE B 106 ? 0.3396 0.3386 0.3283 -0.0025 -0.0058 -0.0280 101 PHE B CD1 
1803 C CD2 . PHE B 106 ? 0.3362 0.3196 0.3130 -0.0084 -0.0264 -0.0374 101 PHE B CD2 
1804 C CE1 . PHE B 106 ? 0.3210 0.3170 0.3268 -0.0091 -0.0107 -0.0226 101 PHE B CE1 
1805 C CE2 . PHE B 106 ? 0.3499 0.3280 0.3465 -0.0161 -0.0343 -0.0341 101 PHE B CE2 
1806 C CZ  . PHE B 106 ? 0.3289 0.3141 0.3420 -0.0166 -0.0251 -0.0253 101 PHE B CZ  
1807 N N   . ASN B 107 ? 0.2436 0.2296 0.1677 0.0137  0.0008  -0.0311 102 ASN B N   
1808 C CA  . ASN B 107 ? 0.2834 0.2753 0.2101 0.0145  0.0003  -0.0214 102 ASN B CA  
1809 C C   . ASN B 107 ? 0.3272 0.3199 0.2525 0.0120  -0.0137 -0.0216 102 ASN B C   
1810 O O   . ASN B 107 ? 0.3685 0.3540 0.2703 0.0122  -0.0207 -0.0218 102 ASN B O   
1811 C CB  . ASN B 107 ? 0.3185 0.3081 0.2255 0.0201  0.0114  -0.0133 102 ASN B CB  
1812 C CG  . ASN B 107 ? 0.3383 0.3364 0.2613 0.0190  0.0128  0.0036  102 ASN B CG  
1813 O OD1 . ASN B 107 ? 0.3457 0.3447 0.2867 0.0152  0.0012  0.0054  102 ASN B OD1 
1814 N ND2 . ASN B 107 ? 0.3620 0.3663 0.2821 0.0234  0.0276  0.0177  102 ASN B ND2 
1815 N N   . ALA B 108 ? 0.3066 0.3080 0.2559 0.0112  -0.0183 -0.0216 103 ALA B N   
1816 C CA  . ALA B 108 ? 0.3924 0.4002 0.3525 0.0102  -0.0299 -0.0205 103 ALA B CA  
1817 C C   . ALA B 108 ? 0.3537 0.3630 0.3236 0.0140  -0.0358 -0.0125 103 ALA B C   
1818 O O   . ALA B 108 ? 0.2776 0.2853 0.2599 0.0181  -0.0321 -0.0121 103 ALA B O   
1819 C CB  . ALA B 108 ? 0.2998 0.3203 0.2829 0.0106  -0.0271 -0.0233 103 ALA B CB  
1820 N N   . PRO B 109 ? 0.2856 0.2948 0.2502 0.0124  -0.0486 -0.0062 104 PRO B N   
1821 C CA  . PRO B 109 ? 0.3042 0.3150 0.2846 0.0164  -0.0568 0.0040  104 PRO B CA  
1822 C C   . PRO B 109 ? 0.3183 0.3407 0.3339 0.0233  -0.0565 0.0007  104 PRO B C   
1823 O O   . PRO B 109 ? 0.2813 0.3173 0.3111 0.0225  -0.0565 -0.0020 104 PRO B O   
1824 C CB  . PRO B 109 ? 0.2722 0.2817 0.2365 0.0126  -0.0736 0.0115  104 PRO B CB  
1825 C CG  . PRO B 109 ? 0.2900 0.2992 0.2443 0.0068  -0.0783 0.0014  104 PRO B CG  
1826 C CD  . PRO B 109 ? 0.2984 0.3025 0.2423 0.0071  -0.0603 -0.0086 104 PRO B CD  
1827 N N   . LEU B 110 ? 0.3124 0.3287 0.3432 0.0313  -0.0558 0.0018  105 LEU B N   
1828 C CA  . LEU B 110 ? 0.2938 0.3179 0.3514 0.0437  -0.0521 -0.0041 105 LEU B CA  
1829 C C   . LEU B 110 ? 0.3052 0.3390 0.3908 0.0493  -0.0637 0.0068  105 LEU B C   
1830 O O   . LEU B 110 ? 0.3106 0.3349 0.3958 0.0467  -0.0766 0.0183  105 LEU B O   
1831 C CB  . LEU B 110 ? 0.2936 0.2988 0.3503 0.0523  -0.0486 -0.0137 105 LEU B CB  
1832 C CG  . LEU B 110 ? 0.2866 0.2848 0.3220 0.0476  -0.0403 -0.0233 105 LEU B CG  
1833 C CD1 . LEU B 110 ? 0.2437 0.2178 0.2790 0.0529  -0.0461 -0.0317 105 LEU B CD1 
1834 C CD2 . LEU B 110 ? 0.2042 0.2192 0.2355 0.0515  -0.0277 -0.0308 105 LEU B CD2 
1835 N N   . LEU B 111 ? 0.3374 0.3930 0.4510 0.0573  -0.0585 0.0068  106 LEU B N   
1836 C CA  . LEU B 111 ? 0.3207 0.3916 0.4721 0.0639  -0.0692 0.0195  106 LEU B CA  
1837 C C   . LEU B 111 ? 0.3787 0.4511 0.5564 0.0870  -0.0573 0.0131  106 LEU B C   
1838 O O   . LEU B 111 ? 0.3932 0.4668 0.5618 0.0978  -0.0384 -0.0004 106 LEU B O   
1839 C CB  . LEU B 111 ? 0.3042 0.4034 0.4794 0.0559  -0.0737 0.0289  106 LEU B CB  
1840 C CG  . LEU B 111 ? 0.3822 0.4737 0.5269 0.0357  -0.0866 0.0291  106 LEU B CG  
1841 C CD1 . LEU B 111 ? 0.3638 0.4796 0.5414 0.0268  -0.0955 0.0381  106 LEU B CD1 
1842 C CD2 . LEU B 111 ? 0.3995 0.4722 0.5168 0.0284  -0.1073 0.0358  106 LEU B CD2 
1843 N N   . ASP B 112 ? 0.3262 0.3964 0.5333 0.0967  -0.0687 0.0224  107 ASP B N   
1844 C CA  . ASP B 112 ? 0.3222 0.3893 0.5545 0.1231  -0.0575 0.0139  107 ASP B CA  
1845 C C   . ASP B 112 ? 0.3317 0.4386 0.6039 0.1381  -0.0404 0.0196  107 ASP B C   
1846 O O   . ASP B 112 ? 0.2853 0.4213 0.5686 0.1246  -0.0390 0.0307  107 ASP B O   
1847 C CB  . ASP B 112 ? 0.4475 0.4939 0.7019 0.1307  -0.0756 0.0223  107 ASP B CB  
1848 C CG  . ASP B 112 ? 0.4487 0.5186 0.7407 0.1247  -0.0944 0.0477  107 ASP B CG  
1849 O OD1 . ASP B 112 ? 0.4058 0.5108 0.7215 0.1207  -0.0924 0.0571  107 ASP B OD1 
1850 O OD2 . ASP B 112 ? 0.3947 0.4473 0.6956 0.1231  -0.1141 0.0607  107 ASP B OD2 
1851 N N   . THR B 113 ? 0.3073 0.4147 0.6041 0.1669  -0.0274 0.0130  108 THR B N   
1852 C CA  . THR B 113 ? 0.4478 0.5977 0.7884 0.1869  -0.0049 0.0215  108 THR B CA  
1853 C C   . THR B 113 ? 0.4884 0.6727 0.8738 0.1705  -0.0208 0.0486  108 THR B C   
1854 O O   . THR B 113 ? 0.5351 0.7568 0.9459 0.1668  -0.0089 0.0606  108 THR B O   
1855 C CB  . THR B 113 ? 0.4322 0.5678 0.7717 0.2193  0.0090  0.0067  108 THR B CB  
1856 O OG1 . THR B 113 ? 0.4899 0.6120 0.8535 0.2190  -0.0123 0.0176  108 THR B OG1 
1857 C CG2 . THR B 113 ? 0.4609 0.5500 0.7483 0.2328  0.0181  -0.0212 108 THR B CG2 
1858 N N   . LYS B 114 ? 0.4234 0.5911 0.8147 0.1585  -0.0496 0.0589  109 LYS B N   
1859 C CA  . LYS B 114 ? 0.4333 0.6240 0.8570 0.1415  -0.0705 0.0821  109 LYS B CA  
1860 C C   . LYS B 114 ? 0.3741 0.5666 0.7784 0.1118  -0.0910 0.0891  109 LYS B C   
1861 O O   . LYS B 114 ? 0.4055 0.6054 0.8211 0.0940  -0.1150 0.1043  109 LYS B O   
1862 C CB  . LYS B 114 ? 0.4690 0.6383 0.8988 0.1427  -0.0920 0.0902  109 LYS B CB  
1863 C CG  . LYS B 114 ? 0.5521 0.6949 0.9783 0.1694  -0.0791 0.0756  109 LYS B CG  
1864 C CD  . LYS B 114 ? 0.5759 0.7410 1.0447 0.1930  -0.0648 0.0794  109 LYS B CD  
1865 C CE  . LYS B 114 ? 0.6442 0.7756 1.1017 0.2214  -0.0545 0.0614  109 LYS B CE  
1866 N NZ  . LYS B 114 ? 0.6898 0.8381 1.1904 0.2439  -0.0483 0.0682  109 LYS B NZ  
1867 N N   . LYS B 115 ? 0.3448 0.5254 0.7137 0.1072  -0.0823 0.0754  110 LYS B N   
1868 C CA  . LYS B 115 ? 0.4479 0.6196 0.7785 0.0800  -0.0967 0.0742  110 LYS B CA  
1869 C C   . LYS B 115 ? 0.4094 0.5534 0.7041 0.0648  -0.1258 0.0783  110 LYS B C   
1870 O O   . LYS B 115 ? 0.3766 0.5166 0.6485 0.0454  -0.1452 0.0814  110 LYS B O   
1871 C CB  . LYS B 115 ? 0.5426 0.7498 0.9145 0.0678  -0.1029 0.0892  110 LYS B CB  
1872 C CG  . LYS B 115 ? 0.5620 0.8007 0.9663 0.0825  -0.0692 0.0907  110 LYS B CG  
1873 C CD  . LYS B 115 ? 0.6104 0.8685 1.0289 0.0631  -0.0704 0.1001  110 LYS B CD  
1874 C CE  . LYS B 115 ? 0.6355 0.9065 1.0451 0.0738  -0.0359 0.0941  110 LYS B CE  
1875 N NZ  . LYS B 115 ? 0.6518 0.9284 1.0604 0.1050  -0.0043 0.0861  110 LYS B NZ  
1876 N N   . GLN B 116 ? 0.3400 0.4630 0.6278 0.0751  -0.1288 0.0788  111 GLN B N   
1877 C CA  . GLN B 116 ? 0.4505 0.5477 0.6987 0.0630  -0.1497 0.0858  111 GLN B CA  
1878 C C   . GLN B 116 ? 0.4654 0.5353 0.6610 0.0586  -0.1340 0.0702  111 GLN B C   
1879 O O   . GLN B 116 ? 0.4886 0.5510 0.6869 0.0700  -0.1140 0.0558  111 GLN B O   
1880 C CB  . GLN B 116 ? 0.5286 0.6175 0.8037 0.0745  -0.1615 0.1002  111 GLN B CB  
1881 C CG  . GLN B 116 ? 0.6642 0.7770 0.9921 0.0849  -0.1589 0.1076  111 GLN B CG  
1882 C CD  . GLN B 116 ? 0.7820 0.8794 1.1275 0.0963  -0.1635 0.1157  111 GLN B CD  
1883 O OE1 . GLN B 116 ? 0.8410 0.9470 1.2254 0.1156  -0.1504 0.1127  111 GLN B OE1 
1884 N NE2 . GLN B 116 ? 0.7927 0.8670 1.1076 0.0854  -0.1807 0.1270  111 GLN B NE2 
1885 N N   . PRO B 117 ? 0.4620 0.5175 0.6092 0.0435  -0.1435 0.0733  112 PRO B N   
1886 C CA  . PRO B 117 ? 0.4447 0.4795 0.5499 0.0393  -0.1287 0.0640  112 PRO B CA  
1887 C C   . PRO B 117 ? 0.3940 0.4111 0.5126 0.0480  -0.1244 0.0676  112 PRO B C   
1888 O O   . PRO B 117 ? 0.4011 0.4134 0.5392 0.0520  -0.1391 0.0845  112 PRO B O   
1889 C CB  . PRO B 117 ? 0.5432 0.5693 0.6008 0.0272  -0.1416 0.0741  112 PRO B CB  
1890 C CG  . PRO B 117 ? 0.5934 0.6327 0.6573 0.0214  -0.1623 0.0768  112 PRO B CG  
1891 C CD  . PRO B 117 ? 0.5478 0.6063 0.6755 0.0311  -0.1688 0.0850  112 PRO B CD  
1892 N N   . THR B 118 ? 0.3718 0.3770 0.4822 0.0502  -0.1081 0.0527  113 THR B N   
1893 C CA  . THR B 118 ? 0.4374 0.4199 0.5633 0.0570  -0.1089 0.0529  113 THR B CA  
1894 C C   . THR B 118 ? 0.4120 0.3808 0.5166 0.0446  -0.1101 0.0671  113 THR B C   
1895 O O   . THR B 118 ? 0.4498 0.3992 0.5735 0.0456  -0.1172 0.0766  113 THR B O   
1896 C CB  . THR B 118 ? 0.4414 0.4152 0.5713 0.0674  -0.0954 0.0283  113 THR B CB  
1897 O OG1 . THR B 118 ? 0.4190 0.3971 0.5185 0.0573  -0.0833 0.0190  113 THR B OG1 
1898 C CG2 . THR B 118 ? 0.4002 0.3916 0.5532 0.0837  -0.0880 0.0179  113 THR B CG2 
1899 N N   . GLY B 119 ? 0.3758 0.3543 0.4441 0.0341  -0.1026 0.0699  114 GLY B N   
1900 C CA  . GLY B 119 ? 0.3585 0.3314 0.4076 0.0253  -0.0965 0.0850  114 GLY B CA  
1901 C C   . GLY B 119 ? 0.3422 0.3113 0.3897 0.0226  -0.0824 0.0705  114 GLY B C   
1902 O O   . GLY B 119 ? 0.3832 0.3550 0.4178 0.0159  -0.0725 0.0812  114 GLY B O   
1903 N N   . ALA B 120 ? 0.2690 0.2342 0.3301 0.0294  -0.0810 0.0477  115 ALA B N   
1904 C CA  . ALA B 120 ? 0.3047 0.2655 0.3618 0.0275  -0.0719 0.0330  115 ALA B CA  
1905 C C   . ALA B 120 ? 0.2836 0.2603 0.3148 0.0252  -0.0590 0.0219  115 ALA B C   
1906 O O   . ALA B 120 ? 0.3329 0.3209 0.3581 0.0277  -0.0593 0.0171  115 ALA B O   
1907 C CB  . ALA B 120 ? 0.3658 0.3103 0.4401 0.0383  -0.0775 0.0137  115 ALA B CB  
1908 N N   . SER B 121 ? 0.2605 0.2377 0.2828 0.0199  -0.0497 0.0197  116 SER B N   
1909 C CA  . SER B 121 ? 0.3163 0.3039 0.3180 0.0183  -0.0387 0.0095  116 SER B CA  
1910 C C   . SER B 121 ? 0.2812 0.2656 0.2876 0.0188  -0.0346 -0.0026 116 SER B C   
1911 O O   . SER B 121 ? 0.2761 0.2496 0.2975 0.0176  -0.0408 -0.0011 116 SER B O   
1912 C CB  . SER B 121 ? 0.3954 0.3881 0.3745 0.0140  -0.0297 0.0205  116 SER B CB  
1913 O OG  . SER B 121 ? 0.4438 0.4359 0.4352 0.0109  -0.0246 0.0360  116 SER B OG  
1914 N N   . LEU B 122 ? 0.2744 0.2669 0.2694 0.0196  -0.0274 -0.0131 117 LEU B N   
1915 C CA  . LEU B 122 ? 0.3113 0.3022 0.3057 0.0205  -0.0244 -0.0223 117 LEU B CA  
1916 C C   . LEU B 122 ? 0.2435 0.2409 0.2285 0.0160  -0.0149 -0.0209 117 LEU B C   
1917 O O   . LEU B 122 ? 0.2545 0.2571 0.2294 0.0149  -0.0108 -0.0221 117 LEU B O   
1918 C CB  . LEU B 122 ? 0.3332 0.3276 0.3255 0.0290  -0.0232 -0.0338 117 LEU B CB  
1919 C CG  . LEU B 122 ? 0.3904 0.3838 0.3723 0.0314  -0.0202 -0.0416 117 LEU B CG  
1920 C CD1 . LEU B 122 ? 0.3951 0.3688 0.3761 0.0339  -0.0326 -0.0483 117 LEU B CD1 
1921 C CD2 . LEU B 122 ? 0.4549 0.4612 0.4311 0.0400  -0.0112 -0.0463 117 LEU B CD2 
1922 N N   . VAL B 123 ? 0.2346 0.2298 0.2265 0.0135  -0.0144 -0.0184 118 VAL B N   
1923 C CA  . VAL B 123 ? 0.2142 0.2149 0.2032 0.0118  -0.0050 -0.0163 118 VAL B CA  
1924 C C   . VAL B 123 ? 0.2421 0.2433 0.2304 0.0125  -0.0071 -0.0226 118 VAL B C   
1925 O O   . VAL B 123 ? 0.2343 0.2301 0.2268 0.0128  -0.0169 -0.0250 118 VAL B O   
1926 C CB  . VAL B 123 ? 0.2592 0.2635 0.2639 0.0098  -0.0001 -0.0026 118 VAL B CB  
1927 C CG1 . VAL B 123 ? 0.2514 0.2613 0.2568 0.0121  0.0112  -0.0014 118 VAL B CG1 
1928 C CG2 . VAL B 123 ? 0.2710 0.2773 0.2702 0.0105  0.0053  0.0080  118 VAL B CG2 
1929 N N   . LEU B 124 ? 0.1672 0.1723 0.1485 0.0126  -0.0005 -0.0248 119 LEU B N   
1930 C CA  . LEU B 124 ? 0.2227 0.2302 0.2029 0.0129  -0.0013 -0.0256 119 LEU B CA  
1931 C C   . LEU B 124 ? 0.2001 0.2075 0.1840 0.0114  0.0051  -0.0224 119 LEU B C   
1932 O O   . LEU B 124 ? 0.2293 0.2318 0.2095 0.0115  0.0095  -0.0246 119 LEU B O   
1933 C CB  . LEU B 124 ? 0.3064 0.3193 0.2774 0.0165  -0.0012 -0.0296 119 LEU B CB  
1934 C CG  . LEU B 124 ? 0.3389 0.3593 0.3141 0.0149  0.0032  -0.0284 119 LEU B CG  
1935 C CD1 . LEU B 124 ? 0.3662 0.3999 0.3426 0.0178  0.0086  -0.0239 119 LEU B CD1 
1936 C CD2 . LEU B 124 ? 0.3573 0.3773 0.3344 0.0167  -0.0003 -0.0311 119 LEU B CD2 
1937 N N   . GLN B 125 ? 0.2310 0.2402 0.2190 0.0112  0.0034  -0.0179 120 GLN B N   
1938 C CA  . GLN B 125 ? 0.2335 0.2393 0.2300 0.0106  0.0074  -0.0138 120 GLN B CA  
1939 C C   . GLN B 125 ? 0.2426 0.2537 0.2374 0.0086  0.0054  -0.0073 120 GLN B C   
1940 O O   . GLN B 125 ? 0.2799 0.2973 0.2642 0.0104  0.0017  -0.0045 120 GLN B O   
1941 C CB  . GLN B 125 ? 0.1705 0.1760 0.1835 0.0133  0.0082  -0.0076 120 GLN B CB  
1942 C CG  . GLN B 125 ? 0.2580 0.2555 0.2820 0.0170  0.0145  -0.0059 120 GLN B CG  
1943 C CD  . GLN B 125 ? 0.2290 0.2268 0.2630 0.0150  0.0083  0.0038  120 GLN B CD  
1944 O OE1 . GLN B 125 ? 0.2659 0.2719 0.2931 0.0117  0.0004  0.0099  120 GLN B OE1 
1945 N NE2 . GLN B 125 ? 0.2998 0.2861 0.3468 0.0183  0.0113  0.0053  120 GLN B NE2 
1946 N N   . VAL B 126 ? 0.2412 0.2479 0.2449 0.0053  0.0071  -0.0040 121 VAL B N   
1947 C CA  . VAL B 126 ? 0.2833 0.2991 0.2920 0.0018  0.0074  0.0082  121 VAL B CA  
1948 C C   . VAL B 126 ? 0.2038 0.2089 0.2314 -0.0016 0.0047  0.0173  121 VAL B C   
1949 O O   . VAL B 126 ? 0.2056 0.1923 0.2408 -0.0015 0.0026  0.0087  121 VAL B O   
1950 C CB  . VAL B 126 ? 0.2867 0.3104 0.3009 -0.0022 0.0088  0.0080  121 VAL B CB  
1951 C CG1 . VAL B 126 ? 0.2454 0.2851 0.2740 -0.0060 0.0126  0.0271  121 VAL B CG1 
1952 C CG2 . VAL B 126 ? 0.2939 0.3261 0.2939 0.0032  0.0112  -0.0007 121 VAL B CG2 
1953 N N   . SER B 127 ? 0.2573 0.2709 0.2892 -0.0029 0.0043  0.0345  122 SER B N   
1954 C CA  . SER B 127 ? 0.2296 0.2317 0.2847 -0.0064 -0.0001 0.0470  122 SER B CA  
1955 C C   . SER B 127 ? 0.2909 0.3083 0.3527 -0.0109 0.0011  0.0728  122 SER B C   
1956 O O   . SER B 127 ? 0.3347 0.3718 0.3737 -0.0072 0.0067  0.0805  122 SER B O   
1957 C CB  . SER B 127 ? 0.2657 0.2580 0.3265 0.0001  -0.0034 0.0457  122 SER B CB  
1958 O OG  . SER B 127 ? 0.2868 0.2932 0.3334 0.0027  -0.0068 0.0546  122 SER B OG  
1959 N N   . TYR B 128 ? 0.2818 0.2879 0.3735 -0.0179 -0.0042 0.0865  123 TYR B N   
1960 C CA  . TYR B 128 ? 0.3561 0.3762 0.4600 -0.0226 -0.0030 0.1179  123 TYR B CA  
1961 C C   . TYR B 128 ? 0.4277 0.4374 0.5349 -0.0183 -0.0105 0.1274  123 TYR B C   
1962 O O   . TYR B 128 ? 0.4973 0.4819 0.6253 -0.0164 -0.0179 0.1178  123 TYR B O   
1963 C CB  . TYR B 128 ? 0.4821 0.4955 0.6272 -0.0352 -0.0083 0.1331  123 TYR B CB  
1964 C CG  . TYR B 128 ? 0.5961 0.6230 0.7484 -0.0410 -0.0046 0.1281  123 TYR B CG  
1965 C CD1 . TYR B 128 ? 0.6917 0.7545 0.8293 -0.0371 0.0111  0.1396  123 TYR B CD1 
1966 C CD2 . TYR B 128 ? 0.6418 0.6445 0.8144 -0.0484 -0.0181 0.1115  123 TYR B CD2 
1967 C CE1 . TYR B 128 ? 0.7225 0.8012 0.8751 -0.0409 0.0147  0.1378  123 TYR B CE1 
1968 C CE2 . TYR B 128 ? 0.6978 0.7144 0.8816 -0.0546 -0.0190 0.1094  123 TYR B CE2 
1969 C CZ  . TYR B 128 ? 0.7245 0.7814 0.9032 -0.0510 -0.0019 0.1242  123 TYR B CZ  
1970 O OH  . TYR B 128 ? 0.7094 0.7836 0.9072 -0.0557 -0.0024 0.1248  123 TYR B OH  
1971 N N   . THR B 129 ? 0.4245 0.4527 0.5090 -0.0148 -0.0090 0.1459  124 THR B N   
1972 C CA  . THR B 129 ? 0.5115 0.5327 0.5985 -0.0108 -0.0200 0.1568  124 THR B CA  
1973 C C   . THR B 129 ? 0.5413 0.5778 0.6205 -0.0128 -0.0212 0.1929  124 THR B C   
1974 O O   . THR B 129 ? 0.5110 0.5699 0.5656 -0.0127 -0.0093 0.2062  124 THR B O   
1975 C CB  . THR B 129 ? 0.5146 0.5376 0.5737 -0.0027 -0.0256 0.1380  124 THR B CB  
1976 O OG1 . THR B 129 ? 0.5261 0.5415 0.6036 0.0003  -0.0393 0.1482  124 THR B OG1 
1977 C CG2 . THR B 129 ? 0.5045 0.5457 0.5135 0.0016  -0.0233 0.1398  124 THR B CG2 
1978 N N   . ALA B 130 ? 0.6067 0.6324 0.7079 -0.0129 -0.0339 0.2109  125 ALA B N   
1979 C CA  . ALA B 130 ? 0.6126 0.6515 0.7040 -0.0142 -0.0378 0.2489  125 ALA B CA  
1980 C C   . ALA B 130 ? 0.5933 0.6453 0.6278 -0.0055 -0.0445 0.2475  125 ALA B C   
1981 O O   . ALA B 130 ? 0.6687 0.7401 0.6582 -0.0019 -0.0361 0.2626  125 ALA B O   
1982 C CB  . ALA B 130 ? 0.5689 0.5891 0.7077 -0.0168 -0.0519 0.2675  125 ALA B CB  
1983 N N   . PHE C 5   ? 0.5365 0.9195 0.7428 -0.0692 -0.1941 0.1247  0   PHE C N   
1984 C CA  . PHE C 5   ? 0.5116 0.8595 0.7011 -0.0638 -0.1786 0.1224  0   PHE C CA  
1985 C C   . PHE C 5   ? 0.4098 0.7245 0.6130 -0.0762 -0.1657 0.1063  0   PHE C C   
1986 O O   . PHE C 5   ? 0.3654 0.6983 0.6034 -0.0910 -0.1719 0.1063  0   PHE C O   
1987 C CB  . PHE C 5   ? 0.5532 0.8955 0.7554 -0.0390 -0.1593 0.1471  0   PHE C CB  
1988 C CG  . PHE C 5   ? 0.6341 0.9867 0.8108 -0.0248 -0.1634 0.1630  0   PHE C CG  
1989 C CD1 . PHE C 5   ? 0.6547 0.9893 0.7897 -0.0223 -0.1600 0.1606  0   PHE C CD1 
1990 C CD2 . PHE C 5   ? 0.6660 1.0444 0.8592 -0.0137 -0.1678 0.1805  0   PHE C CD2 
1991 C CE1 . PHE C 5   ? 0.6681 1.0141 0.7799 -0.0106 -0.1616 0.1793  0   PHE C CE1 
1992 C CE2 . PHE C 5   ? 0.6729 1.0575 0.8423 -0.0015 -0.1707 0.1971  0   PHE C CE2 
1993 C CZ  . PHE C 5   ? 0.6771 1.0450 0.8057 -0.0007 -0.1668 0.1973  0   PHE C CZ  
1994 N N   . MET C 6   ? 0.4106 0.6787 0.5873 -0.0702 -0.1476 0.0952  1   MET C N   
1995 C CA  . MET C 6   ? 0.3498 0.5841 0.5369 -0.0765 -0.1325 0.0852  1   MET C CA  
1996 C C   . MET C 6   ? 0.3118 0.5153 0.4907 -0.0582 -0.1091 0.0906  1   MET C C   
1997 O O   . MET C 6   ? 0.3071 0.4993 0.4593 -0.0480 -0.1054 0.0912  1   MET C O   
1998 C CB  . MET C 6   ? 0.3878 0.5905 0.5481 -0.0937 -0.1412 0.0581  1   MET C CB  
1999 C CG  . MET C 6   ? 0.4474 0.6728 0.6172 -0.1164 -0.1677 0.0487  1   MET C CG  
2000 S SD  . MET C 6   ? 1.1831 1.3585 1.3362 -0.1389 -0.1763 0.0186  1   MET C SD  
2001 C CE  . MET C 6   ? 0.7476 0.8863 0.8384 -0.1217 -0.1714 -0.0046 1   MET C CE  
2002 N N   . LEU C 7   ? 0.2330 0.4259 0.4350 -0.0550 -0.0937 0.0952  2   LEU C N   
2003 C CA  . LEU C 7   ? 0.2055 0.3658 0.3983 -0.0403 -0.0746 0.0958  2   LEU C CA  
2004 C C   . LEU C 7   ? 0.3146 0.4365 0.4813 -0.0478 -0.0704 0.0766  2   LEU C C   
2005 O O   . LEU C 7   ? 0.2819 0.3928 0.4543 -0.0593 -0.0697 0.0693  2   LEU C O   
2006 C CB  . LEU C 7   ? 0.2605 0.4265 0.4823 -0.0308 -0.0602 0.1061  2   LEU C CB  
2007 C CG  . LEU C 7   ? 0.3067 0.4395 0.5178 -0.0143 -0.0436 0.1052  2   LEU C CG  
2008 C CD1 . LEU C 7   ? 0.2312 0.3644 0.4423 0.0013  -0.0446 0.1171  2   LEU C CD1 
2009 C CD2 . LEU C 7   ? 0.3016 0.4360 0.5305 -0.0065 -0.0286 0.1081  2   LEU C CD2 
2010 N N   . ARG C 8   ? 0.2623 0.3657 0.4026 -0.0409 -0.0674 0.0711  3   ARG C N   
2011 C CA  . ARG C 8   ? 0.2444 0.3166 0.3615 -0.0440 -0.0640 0.0536  3   ARG C CA  
2012 C C   . ARG C 8   ? 0.2768 0.3250 0.3926 -0.0335 -0.0493 0.0554  3   ARG C C   
2013 O O   . ARG C 8   ? 0.2704 0.3207 0.3873 -0.0242 -0.0446 0.0650  3   ARG C O   
2014 C CB  . ARG C 8   ? 0.2790 0.3556 0.3674 -0.0436 -0.0714 0.0443  3   ARG C CB  
2015 C CG  . ARG C 8   ? 0.3422 0.3904 0.4074 -0.0430 -0.0683 0.0247  3   ARG C CG  
2016 C CD  . ARG C 8   ? 0.3489 0.4053 0.3917 -0.0327 -0.0634 0.0240  3   ARG C CD  
2017 N NE  . ARG C 8   ? 0.4158 0.4892 0.4325 -0.0339 -0.0740 0.0142  3   ARG C NE  
2018 C CZ  . ARG C 8   ? 0.4573 0.5591 0.4602 -0.0278 -0.0736 0.0256  3   ARG C CZ  
2019 N NH1 . ARG C 8   ? 0.4542 0.5661 0.4717 -0.0220 -0.0636 0.0487  3   ARG C NH1 
2020 N NH2 . ARG C 8   ? 0.4207 0.5388 0.3933 -0.0277 -0.0840 0.0142  3   ARG C NH2 
2021 N N   . VAL C 9   ? 0.2493 0.2739 0.3633 -0.0360 -0.0440 0.0472  4   VAL C N   
2022 C CA  . VAL C 9   ? 0.2161 0.2199 0.3274 -0.0269 -0.0332 0.0474  4   VAL C CA  
2023 C C   . VAL C 9   ? 0.2666 0.2460 0.3600 -0.0270 -0.0326 0.0344  4   VAL C C   
2024 O O   . VAL C 9   ? 0.2767 0.2436 0.3655 -0.0341 -0.0363 0.0270  4   VAL C O   
2025 C CB  . VAL C 9   ? 0.2236 0.2263 0.3491 -0.0248 -0.0252 0.0541  4   VAL C CB  
2026 C CG1 . VAL C 9   ? 0.2012 0.1803 0.3161 -0.0157 -0.0170 0.0503  4   VAL C CG1 
2027 C CG2 . VAL C 9   ? 0.2243 0.2523 0.3706 -0.0188 -0.0238 0.0670  4   VAL C CG2 
2028 N N   . PHE C 10  ? 0.2675 0.2403 0.3540 -0.0193 -0.0288 0.0328  5   PHE C N   
2029 C CA  . PHE C 10  ? 0.2202 0.1745 0.2950 -0.0155 -0.0276 0.0230  5   PHE C CA  
2030 C C   . PHE C 10  ? 0.2641 0.2049 0.3409 -0.0102 -0.0231 0.0256  5   PHE C C   
2031 O O   . PHE C 10  ? 0.2820 0.2265 0.3647 -0.0069 -0.0216 0.0300  5   PHE C O   
2032 C CB  . PHE C 10  ? 0.2019 0.1670 0.2695 -0.0106 -0.0274 0.0191  5   PHE C CB  
2033 C CG  . PHE C 10  ? 0.2155 0.1939 0.2717 -0.0127 -0.0317 0.0131  5   PHE C CG  
2034 C CD1 . PHE C 10  ? 0.2309 0.2339 0.2885 -0.0147 -0.0330 0.0228  5   PHE C CD1 
2035 C CD2 . PHE C 10  ? 0.2848 0.2484 0.3261 -0.0114 -0.0356 -0.0028 5   PHE C CD2 
2036 C CE1 . PHE C 10  ? 0.2796 0.2972 0.3205 -0.0156 -0.0385 0.0163  5   PHE C CE1 
2037 C CE2 . PHE C 10  ? 0.3001 0.2732 0.3249 -0.0124 -0.0414 -0.0129 5   PHE C CE2 
2038 C CZ  . PHE C 10  ? 0.3400 0.3427 0.3629 -0.0146 -0.0430 -0.0037 5   PHE C CZ  
2039 N N   . ILE C 11  ? 0.2897 0.2131 0.3601 -0.0100 -0.0223 0.0231  6   ILE C N   
2040 C CA  . ILE C 11  ? 0.2240 0.1355 0.2886 -0.0035 -0.0199 0.0239  6   ILE C CA  
2041 C C   . ILE C 11  ? 0.2520 0.1564 0.3099 0.0025  -0.0239 0.0175  6   ILE C C   
2042 O O   . ILE C 11  ? 0.2644 0.1558 0.3153 0.0043  -0.0258 0.0140  6   ILE C O   
2043 C CB  . ILE C 11  ? 0.3381 0.2394 0.3977 -0.0048 -0.0154 0.0296  6   ILE C CB  
2044 C CG1 . ILE C 11  ? 0.3231 0.2409 0.3957 -0.0091 -0.0099 0.0374  6   ILE C CG1 
2045 C CG2 . ILE C 11  ? 0.3059 0.1969 0.3518 0.0039  -0.0139 0.0295  6   ILE C CG2 
2046 C CD1 . ILE C 11  ? 0.3398 0.2571 0.4112 -0.0106 -0.0019 0.0466  6   ILE C CD1 
2047 N N   . LEU C 12  ? 0.2159 0.1294 0.2791 0.0056  -0.0259 0.0166  7   LEU C N   
2048 C CA  . LEU C 12  ? 0.2570 0.1758 0.3218 0.0115  -0.0295 0.0124  7   LEU C CA  
2049 C C   . LEU C 12  ? 0.2183 0.1249 0.2748 0.0181  -0.0343 0.0116  7   LEU C C   
2050 O O   . LEU C 12  ? 0.2311 0.1273 0.2804 0.0251  -0.0358 0.0104  7   LEU C O   
2051 C CB  . LEU C 12  ? 0.2710 0.2114 0.3514 0.0085  -0.0302 0.0153  7   LEU C CB  
2052 C CG  . LEU C 12  ? 0.2930 0.2483 0.3776 0.0037  -0.0256 0.0196  7   LEU C CG  
2053 C CD1 . LEU C 12  ? 0.2475 0.2246 0.3483 -0.0006 -0.0248 0.0278  7   LEU C CD1 
2054 C CD2 . LEU C 12  ? 0.2844 0.2420 0.3582 0.0083  -0.0235 0.0123  7   LEU C CD2 
2055 N N   . TYR C 13  ? 0.2410 0.1463 0.2961 0.0169  -0.0379 0.0119  8   TYR C N   
2056 C CA  . TYR C 13  ? 0.2929 0.1901 0.3353 0.0235  -0.0449 0.0106  8   TYR C CA  
2057 C C   . TYR C 13  ? 0.2996 0.1882 0.3301 0.0226  -0.0475 0.0073  8   TYR C C   
2058 O O   . TYR C 13  ? 0.3395 0.2275 0.3771 0.0176  -0.0449 0.0054  8   TYR C O   
2059 C CB  . TYR C 13  ? 0.2521 0.1664 0.3078 0.0275  -0.0539 0.0088  8   TYR C CB  
2060 C CG  . TYR C 13  ? 0.2387 0.1716 0.3159 0.0186  -0.0585 0.0076  8   TYR C CG  
2061 C CD1 . TYR C 13  ? 0.2638 0.1932 0.3402 0.0138  -0.0697 0.0033  8   TYR C CD1 
2062 C CD2 . TYR C 13  ? 0.2981 0.2511 0.3950 0.0141  -0.0524 0.0114  8   TYR C CD2 
2063 C CE1 . TYR C 13  ? 0.3016 0.2431 0.4014 0.0020  -0.0758 0.0037  8   TYR C CE1 
2064 C CE2 . TYR C 13  ? 0.2573 0.2276 0.3767 0.0035  -0.0557 0.0155  8   TYR C CE2 
2065 C CZ  . TYR C 13  ? 0.3095 0.2721 0.4329 -0.0039 -0.0680 0.0121  8   TYR C CZ  
2066 O OH  . TYR C 13  ? 0.2585 0.2335 0.4078 -0.0179 -0.0731 0.0176  8   TYR C OH  
2067 N N   . ALA C 14  ? 0.3237 0.2044 0.3335 0.0296  -0.0531 0.0063  9   ALA C N   
2068 C CA  . ALA C 14  ? 0.3549 0.2270 0.3462 0.0318  -0.0580 -0.0015 9   ALA C CA  
2069 C C   . ALA C 14  ? 0.3305 0.2085 0.3180 0.0337  -0.0758 -0.0074 9   ALA C C   
2070 O O   . ALA C 14  ? 0.3418 0.2304 0.3351 0.0380  -0.0814 -0.0015 9   ALA C O   
2071 C CB  . ALA C 14  ? 0.3101 0.1721 0.2731 0.0394  -0.0478 0.0032  9   ALA C CB  
2072 N N   . GLU C 15  ? 0.3257 0.1966 0.3050 0.0310  -0.0863 -0.0198 10  GLU C N   
2073 C CA  . GLU C 15  ? 0.4619 0.3404 0.4383 0.0299  -0.1074 -0.0274 10  GLU C CA  
2074 C C   . GLU C 15  ? 0.3889 0.2518 0.3231 0.0380  -0.1152 -0.0394 10  GLU C C   
2075 O O   . GLU C 15  ? 0.4050 0.2489 0.3202 0.0414  -0.1066 -0.0482 10  GLU C O   
2076 C CB  . GLU C 15  ? 0.4663 0.3522 0.4764 0.0145  -0.1191 -0.0334 10  GLU C CB  
2077 C CG  . GLU C 15  ? 0.5780 0.4909 0.6275 0.0085  -0.1145 -0.0209 10  GLU C CG  
2078 C CD  . GLU C 15  ? 0.6422 0.5693 0.7274 -0.0086 -0.1263 -0.0220 10  GLU C CD  
2079 O OE1 . GLU C 15  ? 0.7176 0.6223 0.8024 -0.0184 -0.1311 -0.0301 10  GLU C OE1 
2080 O OE2 . GLU C 15  ? 0.6107 0.5715 0.7260 -0.0118 -0.1305 -0.0136 10  GLU C OE2 
2081 N N   . ASN C 16  ? 0.4113 0.2845 0.3295 0.0433  -0.1316 -0.0398 11  ASN C N   
2082 C CA  . ASN C 16  ? 0.4602 0.3229 0.3320 0.0521  -0.1427 -0.0522 11  ASN C CA  
2083 C C   . ASN C 16  ? 0.5152 0.3656 0.3476 0.0660  -0.1216 -0.0462 11  ASN C C   
2084 O O   . ASN C 16  ? 0.5112 0.3464 0.3110 0.0726  -0.1186 -0.0611 11  ASN C O   
2085 C CB  . ASN C 16  ? 0.8656 0.7121 0.7358 0.0426  -0.1587 -0.0766 11  ASN C CB  
2086 C CG  . ASN C 16  ? 0.9243 0.7850 0.8444 0.0235  -0.1753 -0.0776 11  ASN C CG  
2087 O OD1 . ASN C 16  ? 0.9499 0.7994 0.8980 0.0115  -0.1708 -0.0805 11  ASN C OD1 
2088 N ND2 . ASN C 16  ? 0.9532 0.8420 0.8870 0.0212  -0.1942 -0.0723 11  ASN C ND2 
2089 N N   . VAL C 17  ? 0.4920 0.3493 0.3292 0.0705  -0.1066 -0.0243 12  VAL C N   
2090 C CA  . VAL C 17  ? 0.5614 0.4133 0.3686 0.0803  -0.0858 -0.0121 12  VAL C CA  
2091 C C   . VAL C 17  ? 0.6022 0.4583 0.3638 0.0931  -0.0938 -0.0049 12  VAL C C   
2092 O O   . VAL C 17  ? 0.6315 0.4952 0.3973 0.0956  -0.1053 0.0084  12  VAL C O   
2093 C CB  . VAL C 17  ? 0.5028 0.3560 0.3374 0.0756  -0.0684 0.0089  12  VAL C CB  
2094 C CG1 . VAL C 17  ? 0.5255 0.3774 0.3340 0.0822  -0.0489 0.0263  12  VAL C CG1 
2095 C CG2 . VAL C 17  ? 0.4638 0.3161 0.3361 0.0646  -0.0603 0.0025  12  VAL C CG2 
2096 N N   . HIS C 18  ? 0.6113 0.4637 0.3278 0.1036  -0.0874 -0.0133 13  HIS C N   
2097 C CA  . HIS C 18  ? 0.6153 0.4740 0.2796 0.1172  -0.0959 -0.0079 13  HIS C CA  
2098 C C   . HIS C 18  ? 0.8724 0.7349 0.4968 0.1295  -0.0697 0.0063  13  HIS C C   
2099 O O   . HIS C 18  ? 0.8924 0.7522 0.5060 0.1343  -0.0536 -0.0071 13  HIS C O   
2100 C CB  . HIS C 18  ? 0.7347 0.5904 0.3713 0.1198  -0.1225 -0.0380 13  HIS C CB  
2101 C CG  . HIS C 18  ? 0.7774 0.6404 0.4498 0.1080  -0.1515 -0.0449 13  HIS C CG  
2102 N ND1 . HIS C 18  ? 0.8110 0.6664 0.5176 0.0934  -0.1641 -0.0669 13  HIS C ND1 
2103 C CD2 . HIS C 18  ? 0.7713 0.6518 0.4538 0.1091  -0.1696 -0.0303 13  HIS C CD2 
2104 C CE1 . HIS C 18  ? 0.7980 0.6707 0.5359 0.0845  -0.1876 -0.0650 13  HIS C CE1 
2105 N NE2 . HIS C 18  ? 0.7895 0.6788 0.5140 0.0953  -0.1914 -0.0440 13  HIS C NE2 
2106 N N   . THR C 19  ? 0.8482 0.7184 0.4530 0.1353  -0.0648 0.0356  14  THR C N   
2107 C CA  . THR C 19  ? 0.9346 0.8146 0.5008 0.1457  -0.0396 0.0559  14  THR C CA  
2108 C C   . THR C 19  ? 1.0859 0.9742 0.5833 0.1634  -0.0515 0.0476  14  THR C C   
2109 O O   . THR C 19  ? 1.0879 0.9748 0.5753 0.1647  -0.0815 0.0368  14  THR C O   
2110 C CB  . THR C 19  ? 0.9772 0.8569 0.5614 0.1397  -0.0279 0.0966  14  THR C CB  
2111 O OG1 . THR C 19  ? 1.0558 0.9298 0.6392 0.1421  -0.0522 0.1068  14  THR C OG1 
2112 C CG2 . THR C 19  ? 0.9168 0.7881 0.5616 0.1227  -0.0160 0.1009  14  THR C CG2 
2113 N N   . PRO C 20  ? 1.1956 1.0967 0.6455 0.1777  -0.0287 0.0518  15  PRO C N   
2114 C CA  . PRO C 20  ? 1.2661 1.1772 0.6440 0.1960  -0.0385 0.0418  15  PRO C CA  
2115 C C   . PRO C 20  ? 1.2742 1.1921 0.6496 0.1927  -0.0594 0.0644  15  PRO C C   
2116 O O   . PRO C 20  ? 1.2137 1.1397 0.5955 0.1899  -0.0447 0.1032  15  PRO C O   
2117 C CB  . PRO C 20  ? 1.2960 1.2294 0.6543 0.2043  -0.0012 0.0596  15  PRO C CB  
2118 C CG  . PRO C 20  ? 1.2469 1.1765 0.6408 0.2008  0.0218  0.0572  15  PRO C CG  
2119 C CD  . PRO C 20  ? 1.1981 1.1110 0.6611 0.1777  0.0080  0.0669  15  PRO C CD  
2120 N N   . ASP C 21  ? 1.3540 1.2691 0.7240 0.1916  -0.0937 0.0400  16  ASP C N   
2121 C CA  . ASP C 21  ? 1.4168 1.3342 0.8134 0.1854  -0.1197 0.0558  16  ASP C CA  
2122 C C   . ASP C 21  ? 1.4754 1.4087 0.8545 0.1895  -0.1241 0.0879  16  ASP C C   
2123 O O   . ASP C 21  ? 1.5633 1.5109 0.9099 0.1941  -0.1433 0.0780  16  ASP C O   
2124 C CB  . ASP C 21  ? 1.4294 1.3445 0.8421 0.1788  -0.1552 0.0205  16  ASP C CB  
2125 C CG  . ASP C 21  ? 1.3562 1.2562 0.8240 0.1675  -0.1609 0.0127  16  ASP C CG  
2126 O OD1 . ASP C 21  ? 1.3062 1.2023 0.8147 0.1620  -0.1433 0.0398  16  ASP C OD1 
2127 O OD2 . ASP C 21  ? 1.3288 1.2230 0.8162 0.1575  -0.1785 -0.0202 16  ASP C OD2 
2128 N N   . THR C 22  ? 1.4281 1.3557 0.8316 0.1862  -0.1078 0.1264  17  THR C N   
2129 C CA  . THR C 22  ? 1.4049 1.3371 0.8139 0.1871  -0.1197 0.1575  17  THR C CA  
2130 C C   . THR C 22  ? 1.2834 1.1972 0.7524 0.1801  -0.1228 0.1722  17  THR C C   
2131 O O   . THR C 22  ? 1.2369 1.1542 0.7342 0.1809  -0.1480 0.1632  17  THR C O   
2132 C CB  . THR C 22  ? 1.4265 1.3647 0.8037 0.1892  -0.0975 0.1920  17  THR C CB  
2133 O OG1 . THR C 22  ? 1.4797 1.4376 0.7990 0.1984  -0.0968 0.1754  17  THR C OG1 
2134 C CG2 . THR C 22  ? 1.3912 1.3255 0.7785 0.1895  -0.1112 0.2260  17  THR C CG2 
2135 N N   . ASP C 23  ? 1.2034 1.0996 0.6948 0.1725  -0.0967 0.1927  18  ASP C N   
2136 C CA  . ASP C 23  ? 1.1380 1.0119 0.6854 0.1652  -0.0975 0.2009  18  ASP C CA  
2137 C C   . ASP C 23  ? 1.1031 0.9727 0.6750 0.1630  -0.1052 0.1682  18  ASP C C   
2138 O O   . ASP C 23  ? 1.0936 0.9727 0.6401 0.1653  -0.1090 0.1404  18  ASP C O   
2139 C CB  . ASP C 23  ? 1.1958 1.0511 0.7619 0.1532  -0.0694 0.2280  18  ASP C CB  
2140 C CG  . ASP C 23  ? 1.2745 1.1023 0.8929 0.1459  -0.0737 0.2411  18  ASP C CG  
2141 O OD1 . ASP C 23  ? 1.3126 1.1402 0.9514 0.1537  -0.0957 0.2323  18  ASP C OD1 
2142 O OD2 . ASP C 23  ? 1.2909 1.0991 0.9318 0.1320  -0.0555 0.2583  18  ASP C OD2 
2143 N N   . ILE C 24  ? 1.0466 0.8990 0.6680 0.1578  -0.1077 0.1707  19  ILE C N   
2144 C CA  . ILE C 24  ? 0.9797 0.8338 0.6424 0.1479  -0.1125 0.1398  19  ILE C CA  
2145 C C   . ILE C 24  ? 0.9421 0.7794 0.6389 0.1326  -0.0873 0.1416  19  ILE C C   
2146 O O   . ILE C 24  ? 0.6507 0.4686 0.3551 0.1297  -0.0743 0.1679  19  ILE C O   
2147 C CB  . ILE C 24  ? 0.9936 0.8543 0.6910 0.1539  -0.1368 0.1352  19  ILE C CB  
2148 C CG1 . ILE C 24  ? 0.9081 0.7598 0.6621 0.1430  -0.1292 0.1237  19  ILE C CG1 
2149 C CG2 . ILE C 24  ? 1.0371 0.8945 0.7321 0.1647  -0.1423 0.1648  19  ILE C CG2 
2150 C CD1 . ILE C 24  ? 0.8535 0.7219 0.6304 0.1311  -0.1337 0.0920  19  ILE C CD1 
2151 N N   . SER C 25  ? 0.6013 0.4454 0.3181 0.1221  -0.0825 0.1143  20  SER C N   
2152 C CA  . SER C 25  ? 0.7043 0.5405 0.4474 0.1082  -0.0601 0.1130  20  SER C CA  
2153 C C   . SER C 25  ? 0.6091 0.4255 0.3909 0.1000  -0.0547 0.1266  20  SER C C   
2154 O O   . SER C 25  ? 0.5882 0.3996 0.3959 0.1027  -0.0681 0.1203  20  SER C O   
2155 C CB  . SER C 25  ? 0.6651 0.5104 0.4281 0.1008  -0.0620 0.0819  20  SER C CB  
2156 O OG  . SER C 25  ? 0.7626 0.6185 0.4919 0.1083  -0.0731 0.0635  20  SER C OG  
2157 N N   . ASP C 26  ? 0.5999 0.4066 0.3860 0.0902  -0.0351 0.1443  21  ASP C N   
2158 C CA  . ASP C 26  ? 0.5545 0.3395 0.3773 0.0781  -0.0301 0.1511  21  ASP C CA  
2159 C C   . ASP C 26  ? 0.5666 0.3628 0.4120 0.0631  -0.0155 0.1393  21  ASP C C   
2160 O O   . ASP C 26  ? 0.5528 0.3497 0.4027 0.0520  0.0005  0.1559  21  ASP C O   
2161 C CB  . ASP C 26  ? 0.5787 0.3403 0.3929 0.0757  -0.0234 0.1853  21  ASP C CB  
2162 C CG  . ASP C 26  ? 0.6962 0.4483 0.4841 0.0936  -0.0378 0.2017  21  ASP C CG  
2163 O OD1 . ASP C 26  ? 0.7099 0.4590 0.5090 0.1051  -0.0556 0.1884  21  ASP C OD1 
2164 O OD2 . ASP C 26  ? 0.6626 0.4184 0.4236 0.0948  -0.0317 0.2268  21  ASP C OD2 
2165 N N   . ALA C 27  ? 0.4629 0.2707 0.3249 0.0624  -0.0217 0.1129  22  ALA C N   
2166 C CA  . ALA C 27  ? 0.4505 0.2735 0.3282 0.0530  -0.0101 0.1012  22  ALA C CA  
2167 C C   . ALA C 27  ? 0.4414 0.2570 0.3550 0.0381  -0.0062 0.1006  22  ALA C C   
2168 O O   . ALA C 27  ? 0.4007 0.2011 0.3300 0.0371  -0.0161 0.0950  22  ALA C O   
2169 C CB  . ALA C 27  ? 0.4140 0.2500 0.2910 0.0584  -0.0189 0.0760  22  ALA C CB  
2170 N N   . TYR C 28  ? 0.4763 0.3047 0.4016 0.0279  0.0079  0.1063  23  TYR C N   
2171 C CA  . TYR C 28  ? 0.3898 0.2215 0.3480 0.0139  0.0094  0.1001  23  TYR C CA  
2172 C C   . TYR C 28  ? 0.3536 0.2128 0.3208 0.0143  0.0184  0.0911  23  TYR C C   
2173 O O   . TYR C 28  ? 0.3803 0.2524 0.3287 0.0245  0.0265  0.0913  23  TYR C O   
2174 C CB  . TYR C 28  ? 0.3923 0.2133 0.3656 -0.0022 0.0149  0.1197  23  TYR C CB  
2175 C CG  . TYR C 28  ? 0.4095 0.2520 0.3805 -0.0071 0.0324  0.1411  23  TYR C CG  
2176 C CD1 . TYR C 28  ? 0.4435 0.2865 0.3847 0.0022  0.0400  0.1587  23  TYR C CD1 
2177 C CD2 . TYR C 28  ? 0.4416 0.3091 0.4405 -0.0200 0.0418  0.1452  23  TYR C CD2 
2178 C CE1 . TYR C 28  ? 0.4944 0.3631 0.4326 -0.0009 0.0594  0.1801  23  TYR C CE1 
2179 C CE2 . TYR C 28  ? 0.4606 0.3563 0.4626 -0.0235 0.0604  0.1667  23  TYR C CE2 
2180 C CZ  . TYR C 28  ? 0.5416 0.4380 0.5122 -0.0136 0.0705  0.1842  23  TYR C CZ  
2181 O OH  . TYR C 28  ? 0.6443 0.5739 0.6158 -0.0150 0.0919  0.2070  23  TYR C OH  
2182 N N   A CYS C 29  ? 0.3674 0.2337 0.3613 0.0051  0.0161  0.0829  24  CYS C N   
2183 N N   B CYS C 29  ? 0.3721 0.2372 0.3650 0.0058  0.0152  0.0821  24  CYS C N   
2184 C CA  A CYS C 29  ? 0.3930 0.2842 0.4006 0.0060  0.0240  0.0785  24  CYS C CA  
2185 C CA  B CYS C 29  ? 0.3857 0.2752 0.3921 0.0065  0.0231  0.0777  24  CYS C CA  
2186 C C   A CYS C 29  ? 0.4529 0.3628 0.4858 -0.0075 0.0327  0.0927  24  CYS C C   
2187 C C   B CYS C 29  ? 0.4417 0.3497 0.4732 -0.0069 0.0319  0.0918  24  CYS C C   
2188 O O   A CYS C 29  ? 0.4714 0.3730 0.5210 -0.0225 0.0260  0.0961  24  CYS C O   
2189 O O   B CYS C 29  ? 0.4689 0.3686 0.5169 -0.0218 0.0252  0.0952  24  CYS C O   
2190 C CB  A CYS C 29  ? 0.3908 0.2832 0.4118 0.0062  0.0144  0.0622  24  CYS C CB  
2191 C CB  B CYS C 29  ? 0.3869 0.2779 0.4069 0.0066  0.0136  0.0614  24  CYS C CB  
2192 S SG  A CYS C 29  ? 0.3904 0.2704 0.3931 0.0183  0.0039  0.0463  24  CYS C SG  
2193 S SG  B CYS C 29  ? 0.4372 0.3478 0.4651 0.0154  0.0203  0.0549  24  CYS C SG  
2194 N N   . SER C 30  ? 0.4375 0.3743 0.4743 -0.0013 0.0471  0.0994  25  SER C N   
2195 C CA  . SER C 30  ? 0.4413 0.4080 0.5111 -0.0129 0.0548  0.1121  25  SER C CA  
2196 C C   . SER C 30  ? 0.4614 0.4478 0.5493 -0.0054 0.0532  0.1007  25  SER C C   
2197 O O   . SER C 30  ? 0.4582 0.4479 0.5332 0.0131  0.0593  0.0920  25  SER C O   
2198 C CB  . SER C 30  ? 0.4467 0.4387 0.5142 -0.0099 0.0750  0.1325  25  SER C CB  
2199 O OG  . SER C 30  ? 0.5432 0.5705 0.6498 -0.0237 0.0819  0.1479  25  SER C OG  
2200 N N   . ALA C 31  ? 0.2759 0.2718 0.3912 -0.0194 0.0432  0.1004  26  ALA C N   
2201 C CA  . ALA C 31  ? 0.2605 0.2764 0.3940 -0.0129 0.0403  0.0946  26  ALA C CA  
2202 C C   . ALA C 31  ? 0.2974 0.3555 0.4690 -0.0223 0.0440  0.1092  26  ALA C C   
2203 O O   . ALA C 31  ? 0.3018 0.3652 0.4905 -0.0432 0.0365  0.1162  26  ALA C O   
2204 C CB  . ALA C 31  ? 0.3052 0.3022 0.4350 -0.0181 0.0233  0.0814  26  ALA C CB  
2205 N N   . VAL C 32  ? 0.2853 0.3726 0.4710 -0.0059 0.0545  0.1130  27  VAL C N   
2206 C CA  . VAL C 32  ? 0.3168 0.4545 0.5439 -0.0113 0.0599  0.1295  27  VAL C CA  
2207 C C   . VAL C 32  ? 0.3391 0.4967 0.5866 -0.0005 0.0521  0.1268  27  VAL C C   
2208 O O   . VAL C 32  ? 0.2184 0.3637 0.4529 0.0228  0.0567  0.1182  27  VAL C O   
2209 C CB  . VAL C 32  ? 0.3306 0.4992 0.5629 0.0028  0.0849  0.1430  27  VAL C CB  
2210 C CG1 . VAL C 32  ? 0.2778 0.5085 0.5611 -0.0014 0.0913  0.1621  27  VAL C CG1 
2211 C CG2 . VAL C 32  ? 0.3209 0.4735 0.5328 -0.0087 0.0930  0.1517  27  VAL C CG2 
2212 N N   . PHE C 33  ? 0.2070 0.3929 0.4857 -0.0181 0.0384  0.1344  28  PHE C N   
2213 C CA  . PHE C 33  ? 0.1972 0.4108 0.4989 -0.0082 0.0300  0.1374  28  PHE C CA  
2214 C C   . PHE C 33  ? 0.1956 0.4693 0.5462 -0.0206 0.0269  0.1555  28  PHE C C   
2215 O O   . PHE C 33  ? 0.2299 0.5114 0.5938 -0.0493 0.0147  0.1589  28  PHE C O   
2216 C CB  . PHE C 33  ? 0.1898 0.3765 0.4731 -0.0156 0.0090  0.1256  28  PHE C CB  
2217 C CG  . PHE C 33  ? 0.2718 0.4858 0.5745 -0.0053 -0.0008 0.1324  28  PHE C CG  
2218 C CD1 . PHE C 33  ? 0.2838 0.4874 0.5816 0.0214  0.0065  0.1327  28  PHE C CD1 
2219 C CD2 . PHE C 33  ? 0.2982 0.5463 0.6235 -0.0221 -0.0191 0.1388  28  PHE C CD2 
2220 C CE1 . PHE C 33  ? 0.2656 0.4915 0.5817 0.0326  -0.0029 0.1428  28  PHE C CE1 
2221 C CE2 . PHE C 33  ? 0.3548 0.6309 0.6963 -0.0110 -0.0295 0.1480  28  PHE C CE2 
2222 C CZ  . PHE C 33  ? 0.2591 0.5238 0.5965 0.0171  -0.0207 0.1518  28  PHE C CZ  
2223 N N   . ALA C 34  ? 0.1951 0.5104 0.5743 0.0014  0.0367  0.1666  29  ALA C N   
2224 C CA  . ALA C 34  ? 0.2002 0.5746 0.6230 -0.0060 0.0342  0.1829  29  ALA C CA  
2225 C C   . ALA C 34  ? 0.2153 0.6020 0.6466 -0.0287 0.0421  0.1913  29  ALA C C   
2226 O O   . ALA C 34  ? 0.2279 0.6375 0.6800 -0.0516 0.0284  0.1969  29  ALA C O   
2227 C CB  . ALA C 34  ? 0.2603 0.6439 0.6908 -0.0219 0.0057  0.1808  29  ALA C CB  
2228 N N   . GLY C 35  ? 0.3136 0.6830 0.7269 -0.0223 0.0635  0.1925  30  GLY C N   
2229 C CA  . GLY C 35  ? 0.3415 0.7179 0.7577 -0.0414 0.0729  0.2037  30  GLY C CA  
2230 C C   . GLY C 35  ? 0.3382 0.6751 0.7415 -0.0752 0.0553  0.1988  30  GLY C C   
2231 O O   . GLY C 35  ? 0.2692 0.6036 0.6738 -0.0929 0.0602  0.2085  30  GLY C O   
2232 N N   . VAL C 36  ? 0.2306 0.5347 0.6199 -0.0829 0.0346  0.1834  31  VAL C N   
2233 C CA  . VAL C 36  ? 0.2426 0.4996 0.6120 -0.1092 0.0182  0.1735  31  VAL C CA  
2234 C C   . VAL C 36  ? 0.2877 0.4919 0.6144 -0.0978 0.0266  0.1634  31  VAL C C   
2235 O O   . VAL C 36  ? 0.2672 0.4490 0.5660 -0.0767 0.0248  0.1475  31  VAL C O   
2236 C CB  . VAL C 36  ? 0.2642 0.5121 0.6331 -0.1233 -0.0108 0.1581  31  VAL C CB  
2237 C CG1 . VAL C 36  ? 0.2762 0.4716 0.6215 -0.1464 -0.0260 0.1445  31  VAL C CG1 
2238 C CG2 . VAL C 36  ? 0.3333 0.6303 0.7356 -0.1310 -0.0214 0.1651  31  VAL C CG2 
2239 N N   . LYS C 37  ? 0.3189 0.4989 0.6345 -0.1101 0.0340  0.1714  32  LYS C N   
2240 C CA  . LYS C 37  ? 0.3374 0.4680 0.6061 -0.0958 0.0413  0.1619  32  LYS C CA  
2241 C C   . LYS C 37  ? 0.3316 0.4074 0.5779 -0.1106 0.0222  0.1475  32  LYS C C   
2242 O O   . LYS C 37  ? 0.3438 0.4095 0.6057 -0.1362 0.0107  0.1520  32  LYS C O   
2243 C CB  . LYS C 37  ? 0.3757 0.5168 0.6405 -0.0929 0.0645  0.1828  32  LYS C CB  
2244 C CG  . LYS C 37  ? 0.4798 0.5700 0.6974 -0.0836 0.0675  0.1768  32  LYS C CG  
2245 C CD  . LYS C 37  ? 0.5460 0.6509 0.7553 -0.0801 0.0905  0.2005  32  LYS C CD  
2246 C CE  . LYS C 37  ? 0.5540 0.6987 0.7570 -0.0515 0.1128  0.2015  32  LYS C CE  
2247 N NZ  . LYS C 37  ? 0.6773 0.8395 0.8642 -0.0451 0.1372  0.2240  32  LYS C NZ  
2248 N N   . LYS C 38  ? 0.2915 0.3315 0.5010 -0.0930 0.0186  0.1287  33  LYS C N   
2249 C CA  . LYS C 38  ? 0.3711 0.3617 0.5572 -0.0997 0.0040  0.1143  33  LYS C CA  
2250 C C   . LYS C 38  ? 0.4108 0.3699 0.5615 -0.0819 0.0125  0.1115  33  LYS C C   
2251 O O   . LYS C 38  ? 0.2801 0.2518 0.4181 -0.0625 0.0245  0.1116  33  LYS C O   
2252 C CB  . LYS C 38  ? 0.4152 0.4017 0.5959 -0.0973 -0.0123 0.0935  33  LYS C CB  
2253 C CG  . LYS C 38  ? 0.4407 0.4612 0.6530 -0.1143 -0.0243 0.0959  33  LYS C CG  
2254 C CD  . LYS C 38  ? 0.3911 0.4087 0.5909 -0.1110 -0.0405 0.0769  33  LYS C CD  
2255 C CE  . LYS C 38  ? 0.3168 0.3735 0.5458 -0.1266 -0.0548 0.0802  33  LYS C CE  
2256 N NZ  . LYS C 38  ? 0.3275 0.3724 0.5714 -0.1555 -0.0697 0.0789  33  LYS C NZ  
2257 N N   . ARG C 39  ? 0.3138 0.2311 0.4486 -0.0877 0.0046  0.1084  34  ARG C N   
2258 C CA  . ARG C 39  ? 0.4118 0.3024 0.5158 -0.0719 0.0101  0.1093  34  ARG C CA  
2259 C C   . ARG C 39  ? 0.4289 0.2808 0.5142 -0.0658 -0.0038 0.0912  34  ARG C C   
2260 O O   . ARG C 39  ? 0.4966 0.3267 0.5888 -0.0779 -0.0161 0.0832  34  ARG C O   
2261 C CB  . ARG C 39  ? 0.5311 0.4127 0.6346 -0.0808 0.0193  0.1340  34  ARG C CB  
2262 C CG  . ARG C 39  ? 0.6283 0.5539 0.7471 -0.0829 0.0382  0.1552  34  ARG C CG  
2263 C CD  . ARG C 39  ? 0.7378 0.6541 0.8526 -0.0920 0.0485  0.1833  34  ARG C CD  
2264 N NE  . ARG C 39  ? 0.8325 0.7982 0.9666 -0.0962 0.0685  0.2057  34  ARG C NE  
2265 C CZ  . ARG C 39  ? 0.8742 0.8657 1.0425 -0.1166 0.0672  0.2126  34  ARG C CZ  
2266 N NH1 . ARG C 39  ? 0.8684 0.8372 1.0523 -0.1358 0.0469  0.1996  34  ARG C NH1 
2267 N NH2 . ARG C 39  ? 0.9081 0.9495 1.0932 -0.1158 0.0863  0.2314  34  ARG C NH2 
2268 N N   . THR C 40  ? 0.3331 0.1780 0.3955 -0.0462 -0.0022 0.0839  35  THR C N   
2269 C CA  . THR C 40  ? 0.3564 0.1709 0.4037 -0.0370 -0.0126 0.0709  35  THR C CA  
2270 C C   . THR C 40  ? 0.3865 0.1676 0.4234 -0.0375 -0.0135 0.0848  35  THR C C   
2271 O O   . THR C 40  ? 0.3878 0.1717 0.4266 -0.0457 -0.0048 0.1060  35  THR C O   
2272 C CB  . THR C 40  ? 0.3755 0.1996 0.4077 -0.0181 -0.0123 0.0611  35  THR C CB  
2273 O OG1 . THR C 40  ? 0.3865 0.2131 0.4023 -0.0096 -0.0052 0.0729  35  THR C OG1 
2274 C CG2 . THR C 40  ? 0.2811 0.1340 0.3239 -0.0173 -0.0109 0.0518  35  THR C CG2 
2275 N N   . LYS C 41  ? 0.3990 0.1501 0.4254 -0.0273 -0.0229 0.0748  36  LYS C N   
2276 C CA  . LYS C 41  ? 0.4806 0.2006 0.4935 -0.0211 -0.0240 0.0875  36  LYS C CA  
2277 C C   . LYS C 41  ? 0.4202 0.1533 0.4146 -0.0059 -0.0196 0.0993  36  LYS C C   
2278 O O   . LYS C 41  ? 0.4199 0.1832 0.4104 0.0015  -0.0168 0.0895  36  LYS C O   
2279 C CB  . LYS C 41  ? 0.5168 0.2130 0.5242 -0.0080 -0.0323 0.0695  36  LYS C CB  
2280 C CG  . LYS C 41  ? 0.5808 0.2923 0.5834 0.0117  -0.0369 0.0562  36  LYS C CG  
2281 C CD  . LYS C 41  ? 0.6914 0.3863 0.6922 0.0272  -0.0422 0.0411  36  LYS C CD  
2282 C CE  . LYS C 41  ? 0.7256 0.4219 0.7328 0.0229  -0.0455 0.0190  36  LYS C CE  
2283 N NZ  . LYS C 41  ? 0.5928 0.3248 0.6060 0.0225  -0.0445 0.0121  36  LYS C NZ  
2284 N N   . VAL C 42  ? 0.4572 0.1681 0.4372 -0.0010 -0.0194 0.1189  37  VAL C N   
2285 C CA  . VAL C 42  ? 0.5155 0.2389 0.4710 0.0158  -0.0184 0.1277  37  VAL C CA  
2286 C C   . VAL C 42  ? 0.4877 0.2006 0.4376 0.0354  -0.0317 0.1154  37  VAL C C   
2287 O O   . VAL C 42  ? 0.5198 0.2092 0.4773 0.0401  -0.0356 0.1130  37  VAL C O   
2288 C CB  . VAL C 42  ? 0.5471 0.2559 0.4868 0.0133  -0.0121 0.1593  37  VAL C CB  
2289 C CG1 . VAL C 42  ? 0.5528 0.2713 0.4606 0.0337  -0.0155 0.1670  37  VAL C CG1 
2290 C CG2 . VAL C 42  ? 0.5053 0.2372 0.4530 -0.0044 0.0041  0.1741  37  VAL C CG2 
2291 N N   . ILE C 43  ? 0.4417 0.1830 0.3832 0.0470  -0.0352 0.1040  38  ILE C N   
2292 C CA  . ILE C 43  ? 0.4542 0.1962 0.3938 0.0655  -0.0480 0.0970  38  ILE C CA  
2293 C C   . ILE C 43  ? 0.4940 0.2360 0.4069 0.0776  -0.0529 0.1155  38  ILE C C   
2294 O O   . ILE C 43  ? 0.5135 0.2792 0.4076 0.0787  -0.0520 0.1149  38  ILE C O   
2295 C CB  . ILE C 43  ? 0.4251 0.2000 0.3760 0.0682  -0.0521 0.0755  38  ILE C CB  
2296 C CG1 . ILE C 43  ? 0.4042 0.1833 0.3766 0.0564  -0.0462 0.0606  38  ILE C CG1 
2297 C CG2 . ILE C 43  ? 0.4651 0.2482 0.4223 0.0861  -0.0651 0.0707  38  ILE C CG2 
2298 C CD1 . ILE C 43  ? 0.4243 0.1801 0.4084 0.0606  -0.0489 0.0544  38  ILE C CD1 
2299 N N   . LYS C 44  ? 0.5150 0.2311 0.4255 0.0872  -0.0581 0.1310  39  LYS C N   
2300 C CA  . LYS C 44  ? 0.6002 0.3190 0.4864 0.0987  -0.0633 0.1523  39  LYS C CA  
2301 C C   . LYS C 44  ? 0.6072 0.3526 0.4824 0.1161  -0.0793 0.1425  39  LYS C C   
2302 O O   . LYS C 44  ? 0.5808 0.3383 0.4802 0.1243  -0.0878 0.1262  39  LYS C O   
2303 C CB  . LYS C 44  ? 0.6861 0.3823 0.5872 0.1030  -0.0635 0.1684  39  LYS C CB  
2304 C CG  . LYS C 44  ? 0.8185 0.4880 0.7300 0.0852  -0.0493 0.1825  39  LYS C CG  
2305 C CD  . LYS C 44  ? 0.9568 0.6320 0.8450 0.0731  -0.0451 0.2098  39  LYS C CD  
2306 C CE  . LYS C 44  ? 1.0894 0.7202 0.9567 0.0561  -0.0303 0.2133  39  LYS C CE  
2307 N NZ  . LYS C 44  ? 1.1767 0.7742 1.0618 0.0636  -0.0264 0.2172  39  LYS C NZ  
2308 N N   . ASN C 45  ? 0.6325 0.3945 0.4740 0.1200  -0.0823 0.1514  40  ASN C N   
2309 C CA  . ASN C 45  ? 0.6040 0.3943 0.4336 0.1340  -0.1011 0.1443  40  ASN C CA  
2310 C C   . ASN C 45  ? 0.5923 0.4108 0.4506 0.1310  -0.1099 0.1155  40  ASN C C   
2311 O O   . ASN C 45  ? 0.6309 0.4629 0.5110 0.1427  -0.1238 0.1116  40  ASN C O   
2312 C CB  . ASN C 45  ? 0.6029 0.3917 0.4375 0.1489  -0.1120 0.1618  40  ASN C CB  
2313 C CG  . ASN C 45  ? 0.7679 0.5416 0.5772 0.1471  -0.1048 0.1915  40  ASN C CG  
2314 O OD1 . ASN C 45  ? 0.7647 0.5467 0.5356 0.1441  -0.1000 0.1992  40  ASN C OD1 
2315 N ND2 . ASN C 45  ? 0.8981 0.6498 0.7290 0.1491  -0.1036 0.2084  40  ASN C ND2 
2316 N N   . SER C 46  ? 0.4959 0.3248 0.3564 0.1160  -0.1011 0.0979  41  SER C N   
2317 C CA  . SER C 46  ? 0.5637 0.4174 0.4503 0.1100  -0.1090 0.0745  41  SER C CA  
2318 C C   . SER C 46  ? 0.6030 0.4661 0.4737 0.0992  -0.1068 0.0588  41  SER C C   
2319 O O   . SER C 46  ? 0.6022 0.4536 0.4572 0.0930  -0.0906 0.0609  41  SER C O   
2320 C CB  . SER C 46  ? 0.5072 0.3568 0.4315 0.1037  -0.0993 0.0666  41  SER C CB  
2321 O OG  . SER C 46  ? 0.5478 0.4228 0.4962 0.0955  -0.1039 0.0486  41  SER C OG  
2322 N N   . VAL C 47  ? 0.5793 0.4636 0.4568 0.0974  -0.1241 0.0430  42  VAL C N   
2323 C CA  . VAL C 47  ? 0.4995 0.3860 0.3643 0.0881  -0.1259 0.0241  42  VAL C CA  
2324 C C   . VAL C 47  ? 0.4525 0.3411 0.3556 0.0742  -0.1180 0.0126  42  VAL C C   
2325 O O   . VAL C 47  ? 0.4778 0.3584 0.3760 0.0665  -0.1118 0.0005  42  VAL C O   
2326 C CB  . VAL C 47  ? 0.5589 0.4628 0.4103 0.0905  -0.1528 0.0125  42  VAL C CB  
2327 C CG1 . VAL C 47  ? 0.5951 0.4946 0.4415 0.0789  -0.1586 -0.0118 42  VAL C CG1 
2328 C CG2 . VAL C 47  ? 0.6644 0.5663 0.4669 0.1054  -0.1597 0.0244  42  VAL C CG2 
2329 N N   . ASN C 48  ? 0.4106 0.3100 0.3501 0.0735  -0.1173 0.0174  43  ASN C N   
2330 C CA  . ASN C 48  ? 0.3462 0.2513 0.3195 0.0618  -0.1085 0.0107  43  ASN C CA  
2331 C C   . ASN C 48  ? 0.4087 0.3047 0.3946 0.0642  -0.0925 0.0194  43  ASN C C   
2332 O O   . ASN C 48  ? 0.4366 0.3465 0.4490 0.0670  -0.0927 0.0197  43  ASN C O   
2333 C CB  . ASN C 48  ? 0.3786 0.3132 0.3860 0.0566  -0.1232 0.0050  43  ASN C CB  
2334 C CG  . ASN C 48  ? 0.5196 0.4621 0.5165 0.0520  -0.1447 -0.0051 43  ASN C CG  
2335 O OD1 . ASN C 48  ? 0.5484 0.4780 0.5367 0.0414  -0.1468 -0.0176 43  ASN C OD1 
2336 N ND2 . ASN C 48  ? 0.5404 0.5028 0.5377 0.0609  -0.1625 -0.0008 43  ASN C ND2 
2337 N N   . PRO C 49  ? 0.3927 0.2668 0.3598 0.0630  -0.0788 0.0256  44  PRO C N   
2338 C CA  . PRO C 49  ? 0.3869 0.2467 0.3627 0.0633  -0.0678 0.0329  44  PRO C CA  
2339 C C   . PRO C 49  ? 0.3778 0.2464 0.3790 0.0546  -0.0609 0.0245  44  PRO C C   
2340 O O   . PRO C 49  ? 0.3145 0.1905 0.3209 0.0451  -0.0572 0.0188  44  PRO C O   
2341 C CB  . PRO C 49  ? 0.4082 0.2500 0.3618 0.0593  -0.0564 0.0426  44  PRO C CB  
2342 C CG  . PRO C 49  ? 0.3786 0.2295 0.3192 0.0559  -0.0554 0.0347  44  PRO C CG  
2343 C CD  . PRO C 49  ? 0.3513 0.2153 0.2903 0.0607  -0.0727 0.0253  44  PRO C CD  
2344 N N   . VAL C 50  ? 0.3229 0.1895 0.3373 0.0601  -0.0593 0.0239  45  VAL C N   
2345 C CA  . VAL C 50  ? 0.3742 0.2498 0.4054 0.0540  -0.0523 0.0164  45  VAL C CA  
2346 C C   . VAL C 50  ? 0.4198 0.2699 0.4445 0.0511  -0.0456 0.0171  45  VAL C C   
2347 O O   . VAL C 50  ? 0.3920 0.2226 0.4134 0.0608  -0.0476 0.0176  45  VAL C O   
2348 C CB  . VAL C 50  ? 0.3337 0.2335 0.3849 0.0638  -0.0552 0.0114  45  VAL C CB  
2349 C CG1 . VAL C 50  ? 0.3129 0.2241 0.3743 0.0592  -0.0463 0.0046  45  VAL C CG1 
2350 C CG2 . VAL C 50  ? 0.2909 0.2194 0.3556 0.0621  -0.0645 0.0120  45  VAL C CG2 
2351 N N   . TRP C 51  ? 0.3039 0.1533 0.3286 0.0377  -0.0392 0.0171  46  TRP C N   
2352 C CA  . TRP C 51  ? 0.2904 0.1193 0.3128 0.0301  -0.0358 0.0177  46  TRP C CA  
2353 C C   . TRP C 51  ? 0.3878 0.2235 0.4175 0.0291  -0.0355 0.0053  46  TRP C C   
2354 O O   . TRP C 51  ? 0.4529 0.2664 0.4782 0.0310  -0.0378 -0.0012 46  TRP C O   
2355 C CB  . TRP C 51  ? 0.3015 0.1333 0.3234 0.0168  -0.0298 0.0258  46  TRP C CB  
2356 C CG  . TRP C 51  ? 0.3450 0.1725 0.3538 0.0194  -0.0271 0.0375  46  TRP C CG  
2357 C CD1 . TRP C 51  ? 0.3863 0.1932 0.3838 0.0198  -0.0259 0.0505  46  TRP C CD1 
2358 C CD2 . TRP C 51  ? 0.3374 0.1804 0.3393 0.0226  -0.0253 0.0372  46  TRP C CD2 
2359 N NE1 . TRP C 51  ? 0.3679 0.1820 0.3491 0.0242  -0.0221 0.0593  46  TRP C NE1 
2360 C CE2 . TRP C 51  ? 0.3591 0.1937 0.3415 0.0267  -0.0223 0.0487  46  TRP C CE2 
2361 C CE3 . TRP C 51  ? 0.3769 0.2369 0.3860 0.0225  -0.0264 0.0285  46  TRP C CE3 
2362 C CZ2 . TRP C 51  ? 0.3744 0.2182 0.3399 0.0326  -0.0205 0.0475  46  TRP C CZ2 
2363 C CZ3 . TRP C 51  ? 0.4111 0.2740 0.4072 0.0270  -0.0262 0.0270  46  TRP C CZ3 
2364 C CH2 . TRP C 51  ? 0.3827 0.2382 0.3552 0.0329  -0.0233 0.0344  46  TRP C CH2 
2365 N N   . ASN C 52  ? 0.3650 0.2295 0.4035 0.0263  -0.0331 0.0023  47  ASN C N   
2366 C CA  . ASN C 52  ? 0.3667 0.2455 0.4079 0.0259  -0.0315 -0.0068 47  ASN C CA  
2367 C C   . ASN C 52  ? 0.3291 0.1916 0.3635 0.0165  -0.0335 -0.0124 47  ASN C C   
2368 O O   . ASN C 52  ? 0.2952 0.1479 0.3210 0.0219  -0.0358 -0.0253 47  ASN C O   
2369 C CB  . ASN C 52  ? 0.4209 0.3073 0.4628 0.0423  -0.0312 -0.0151 47  ASN C CB  
2370 C CG  . ASN C 52  ? 0.4470 0.3585 0.4885 0.0443  -0.0264 -0.0228 47  ASN C CG  
2371 O OD1 . ASN C 52  ? 0.5035 0.4356 0.5494 0.0338  -0.0241 -0.0171 47  ASN C OD1 
2372 N ND2 . ASN C 52  ? 0.3704 0.2795 0.4044 0.0598  -0.0246 -0.0354 47  ASN C ND2 
2373 N N   . GLU C 53  ? 0.3071 0.1678 0.3458 0.0030  -0.0333 -0.0040 48  GLU C N   
2374 C CA  . GLU C 53  ? 0.4168 0.2689 0.4549 -0.0095 -0.0381 -0.0083 48  GLU C CA  
2375 C C   . GLU C 53  ? 0.4225 0.3029 0.4705 -0.0202 -0.0380 -0.0031 48  GLU C C   
2376 O O   . GLU C 53  ? 0.3685 0.2668 0.4257 -0.0196 -0.0326 0.0076  48  GLU C O   
2377 C CB  . GLU C 53  ? 0.5854 0.4062 0.6241 -0.0182 -0.0408 -0.0024 48  GLU C CB  
2378 C CG  . GLU C 53  ? 0.6104 0.4293 0.6516 -0.0172 -0.0343 0.0143  48  GLU C CG  
2379 C CD  . GLU C 53  ? 0.5802 0.3656 0.6194 -0.0240 -0.0362 0.0233  48  GLU C CD  
2380 O OE1 . GLU C 53  ? 0.5261 0.3076 0.5763 -0.0418 -0.0383 0.0286  48  GLU C OE1 
2381 O OE2 . GLU C 53  ? 0.6113 0.3753 0.6402 -0.0122 -0.0367 0.0268  48  GLU C OE2 
2382 N N   . GLY C 54  ? 0.4051 0.2875 0.4497 -0.0283 -0.0456 -0.0120 49  GLY C N   
2383 C CA  . GLY C 54  ? 0.2952 0.2071 0.3488 -0.0371 -0.0486 -0.0066 49  GLY C CA  
2384 C C   . GLY C 54  ? 0.3144 0.2267 0.3840 -0.0541 -0.0540 0.0003  49  GLY C C   
2385 O O   . GLY C 54  ? 0.3037 0.1894 0.3726 -0.0636 -0.0601 -0.0049 49  GLY C O   
2386 N N   . PHE C 55  ? 0.3025 0.2457 0.3898 -0.0577 -0.0518 0.0136  50  PHE C N   
2387 C CA  . PHE C 55  ? 0.2674 0.2253 0.3776 -0.0733 -0.0560 0.0234  50  PHE C CA  
2388 C C   . PHE C 55  ? 0.2862 0.2816 0.4069 -0.0765 -0.0643 0.0270  50  PHE C C   
2389 O O   . PHE C 55  ? 0.2359 0.2464 0.3502 -0.0642 -0.0611 0.0298  50  PHE C O   
2390 C CB  . PHE C 55  ? 0.3208 0.2859 0.4469 -0.0699 -0.0419 0.0403  50  PHE C CB  
2391 C CG  . PHE C 55  ? 0.4201 0.3529 0.5334 -0.0656 -0.0345 0.0406  50  PHE C CG  
2392 C CD1 . PHE C 55  ? 0.4349 0.3462 0.5522 -0.0793 -0.0372 0.0442  50  PHE C CD1 
2393 C CD2 . PHE C 55  ? 0.4754 0.3992 0.5737 -0.0489 -0.0264 0.0391  50  PHE C CD2 
2394 C CE1 . PHE C 55  ? 0.4437 0.3256 0.5479 -0.0736 -0.0311 0.0483  50  PHE C CE1 
2395 C CE2 . PHE C 55  ? 0.4034 0.3017 0.4888 -0.0437 -0.0220 0.0407  50  PHE C CE2 
2396 C CZ  . PHE C 55  ? 0.4164 0.2939 0.5034 -0.0547 -0.0237 0.0463  50  PHE C CZ  
2397 N N   . GLU C 56  ? 0.2977 0.3088 0.4363 -0.0941 -0.0762 0.0289  51  GLU C N   
2398 C CA  . GLU C 56  ? 0.3005 0.3525 0.4515 -0.0972 -0.0870 0.0344  51  GLU C CA  
2399 C C   . GLU C 56  ? 0.2862 0.3719 0.4771 -0.1111 -0.0900 0.0504  51  GLU C C   
2400 O O   . GLU C 56  ? 0.3437 0.4202 0.5488 -0.1307 -0.0958 0.0497  51  GLU C O   
2401 C CB  . GLU C 56  ? 0.4223 0.4699 0.5488 -0.1043 -0.1061 0.0150  51  GLU C CB  
2402 C CG  . GLU C 56  ? 0.5410 0.5765 0.6320 -0.0867 -0.1012 0.0041  51  GLU C CG  
2403 C CD  . GLU C 56  ? 0.7138 0.7481 0.7747 -0.0904 -0.1180 -0.0167 51  GLU C CD  
2404 O OE1 . GLU C 56  ? 0.7892 0.8206 0.8545 -0.1086 -0.1362 -0.0274 51  GLU C OE1 
2405 O OE2 . GLU C 56  ? 0.7777 0.8152 0.8102 -0.0756 -0.1133 -0.0225 51  GLU C OE2 
2406 N N   . TRP C 57  ? 0.2378 0.3628 0.4493 -0.1003 -0.0855 0.0667  52  TRP C N   
2407 C CA  . TRP C 57  ? 0.2870 0.4574 0.5415 -0.1093 -0.0881 0.0838  52  TRP C CA  
2408 C C   . TRP C 57  ? 0.3342 0.5443 0.5976 -0.1133 -0.1090 0.0859  52  TRP C C   
2409 O O   . TRP C 57  ? 0.3263 0.5415 0.5716 -0.0969 -0.1104 0.0870  52  TRP C O   
2410 C CB  . TRP C 57  ? 0.2362 0.4247 0.5094 -0.0884 -0.0665 0.1012  52  TRP C CB  
2411 C CG  . TRP C 57  ? 0.2639 0.4284 0.5339 -0.0851 -0.0465 0.1036  52  TRP C CG  
2412 C CD1 . TRP C 57  ? 0.2118 0.3984 0.5108 -0.0925 -0.0354 0.1181  52  TRP C CD1 
2413 C CD2 . TRP C 57  ? 0.2458 0.3654 0.4818 -0.0729 -0.0352 0.0936  52  TRP C CD2 
2414 N NE1 . TRP C 57  ? 0.2396 0.3956 0.5191 -0.0847 -0.0179 0.1175  52  TRP C NE1 
2415 C CE2 . TRP C 57  ? 0.2579 0.3723 0.4994 -0.0727 -0.0191 0.1018  52  TRP C CE2 
2416 C CE3 . TRP C 57  ? 0.2601 0.3482 0.4634 -0.0626 -0.0375 0.0803  52  TRP C CE3 
2417 C CZ2 . TRP C 57  ? 0.2848 0.3621 0.4972 -0.0620 -0.0079 0.0955  52  TRP C CZ2 
2418 C CZ3 . TRP C 57  ? 0.2831 0.3369 0.4640 -0.0534 -0.0263 0.0743  52  TRP C CZ3 
2419 C CH2 . TRP C 57  ? 0.2828 0.3304 0.4668 -0.0529 -0.0131 0.0811  52  TRP C CH2 
2420 N N   . ASP C 58  ? 0.3707 0.6105 0.6627 -0.1363 -0.1264 0.0883  53  ASP C N   
2421 C CA  . ASP C 58  ? 0.3933 0.6755 0.6937 -0.1376 -0.1457 0.0915  53  ASP C CA  
2422 C C   . ASP C 58  ? 0.3327 0.6577 0.6650 -0.1165 -0.1320 0.1155  53  ASP C C   
2423 O O   . ASP C 58  ? 0.4058 0.7402 0.7650 -0.1130 -0.1136 0.1273  53  ASP C O   
2424 C CB  . ASP C 58  ? 0.4932 0.7796 0.8030 -0.1632 -0.1626 0.0806  53  ASP C CB  
2425 C CG  . ASP C 58  ? 0.6234 0.9479 0.9334 -0.1648 -0.1851 0.0784  53  ASP C CG  
2426 O OD1 . ASP C 58  ? 0.5987 0.9620 0.9233 -0.1463 -0.1818 0.0964  53  ASP C OD1 
2427 O OD2 . ASP C 58  ? 0.7167 1.0298 1.0109 -0.1833 -0.2065 0.0578  53  ASP C OD2 
2428 N N   . LEU C 59  ? 0.3880 0.9574 0.7705 -0.0753 -0.0560 0.4689  54  LEU C N   
2429 C CA  . LEU C 59  ? 0.5126 1.0828 0.9179 -0.0381 -0.0547 0.5078  54  LEU C CA  
2430 C C   . LEU C 59  ? 0.7428 1.3287 1.1443 0.0031  -0.0674 0.5332  54  LEU C C   
2431 O O   . LEU C 59  ? 0.8971 1.4274 1.2821 0.0520  -0.0873 0.5371  54  LEU C O   
2432 C CB  . LEU C 59  ? 0.5159 1.0084 0.8938 -0.0292 -0.0737 0.5052  54  LEU C CB  
2433 C CG  . LEU C 59  ? 0.4906 0.9164 0.8458 -0.0251 -0.0701 0.4812  54  LEU C CG  
2434 C CD1 . LEU C 59  ? 0.5655 0.8998 0.8740 -0.0117 -0.0877 0.4928  54  LEU C CD1 
2435 C CD2 . LEU C 59  ? 0.4977 0.9070 0.8490 0.0089  -0.0556 0.4734  54  LEU C CD2 
2436 N N   . LYS C 60  ? 0.7822 1.4368 1.1969 -0.0109 -0.0627 0.5467  55  LYS C N   
2437 C CA  . LYS C 60  ? 0.9366 1.6146 1.3566 0.0315  -0.0864 0.5634  55  LYS C CA  
2438 C C   . LYS C 60  ? 1.0053 1.6761 1.4395 0.0987  -0.1010 0.5585  55  LYS C C   
2439 O O   . LYS C 60  ? 1.0227 1.7215 1.4719 0.1073  -0.0826 0.5507  55  LYS C O   
2440 C CB  . LYS C 60  ? 0.9549 1.7131 1.3848 0.0076  -0.0776 0.5744  55  LYS C CB  
2441 C CG  . LYS C 60  ? 0.9275 1.6983 1.3489 -0.0605 -0.0557 0.5767  55  LYS C CG  
2442 C CD  . LYS C 60  ? 0.9861 1.7829 1.4110 -0.0805 -0.0686 0.5927  55  LYS C CD  
2443 C CE  . LYS C 60  ? 1.0070 1.7703 1.3843 -0.1109 -0.0690 0.5516  55  LYS C CE  
2444 N NZ  . LYS C 60  ? 1.0336 1.8219 1.3915 -0.1084 -0.0628 0.5492  55  LYS C NZ  
2445 N N   . GLY C 61  ? 1.0669 1.7029 1.5000 0.1477  -0.1364 0.5663  56  GLY C N   
2446 C CA  . GLY C 61  ? 1.1350 1.7805 1.6008 0.2200  -0.1593 0.5604  56  GLY C CA  
2447 C C   . GLY C 61  ? 1.1469 1.7655 1.6286 0.2564  -0.1514 0.5450  56  GLY C C   
2448 O O   . GLY C 61  ? 1.1441 1.8430 1.6762 0.2904  -0.1461 0.5280  56  GLY C O   
2449 N N   . ILE C 62  ? 1.1532 1.6693 1.5968 0.2498  -0.1490 0.5454  57  ILE C N   
2450 C CA  . ILE C 62  ? 1.1662 1.6620 1.6297 0.2882  -0.1410 0.5272  57  ILE C CA  
2451 C C   . ILE C 62  ? 1.2377 1.6055 1.6717 0.3348  -0.1716 0.5255  57  ILE C C   
2452 O O   . ILE C 62  ? 1.2501 1.5176 1.6232 0.3059  -0.1787 0.5393  57  ILE C O   
2453 C CB  . ILE C 62  ? 0.9972 1.5056 1.4510 0.2374  -0.0984 0.5196  57  ILE C CB  
2454 C CG1 . ILE C 62  ? 0.9213 1.5524 1.4065 0.2170  -0.0725 0.5156  57  ILE C CG1 
2455 C CG2 . ILE C 62  ? 1.0369 1.4823 1.4913 0.2718  -0.0936 0.5023  57  ILE C CG2 
2456 C CD1 . ILE C 62  ? 0.8387 1.4992 1.2989 0.1469  -0.0584 0.5289  57  ILE C CD1 
2457 N N   . PRO C 63  ? 1.3033 1.6762 1.7806 0.4075  -0.1908 0.5037  58  PRO C N   
2458 C CA  . PRO C 63  ? 1.4118 1.6608 1.8671 0.4564  -0.2161 0.4925  58  PRO C CA  
2459 C C   . PRO C 63  ? 1.3466 1.5316 1.7677 0.4166  -0.1822 0.4883  58  PRO C C   
2460 O O   . PRO C 63  ? 1.2534 1.5118 1.7086 0.4022  -0.1453 0.4717  58  PRO C O   
2461 C CB  . PRO C 63  ? 1.4446 1.7665 1.9833 0.5326  -0.2287 0.4535  58  PRO C CB  
2462 C CG  . PRO C 63  ? 1.3996 1.8579 1.9902 0.5341  -0.2316 0.4535  58  PRO C CG  
2463 C CD  . PRO C 63  ? 1.2848 1.7895 1.8399 0.4488  -0.1938 0.4820  58  PRO C CD  
2464 N N   . LEU C 64  ? 1.4221 1.4803 1.7690 0.3886  -0.1928 0.5057  59  LEU C N   
2465 C CA  . LEU C 64  ? 1.4331 1.4183 1.7418 0.3482  -0.1671 0.4989  59  LEU C CA  
2466 C C   . LEU C 64  ? 1.6095 1.4538 1.8800 0.3960  -0.1965 0.4925  59  LEU C C   
2467 O O   . LEU C 64  ? 1.7303 1.4769 1.9381 0.4017  -0.2254 0.5142  59  LEU C O   
2468 C CB  . LEU C 64  ? 1.3853 1.3502 1.6388 0.2719  -0.1547 0.5170  59  LEU C CB  
2469 C CG  . LEU C 64  ? 1.2835 1.3611 1.5608 0.2387  -0.1481 0.5284  59  LEU C CG  
2470 C CD1 . LEU C 64  ? 1.2346 1.2955 1.4662 0.1702  -0.1371 0.5316  59  LEU C CD1 
2471 C CD2 . LEU C 64  ? 1.1491 1.3543 1.4893 0.2319  -0.1192 0.5155  59  LEU C CD2 
2472 N N   . ASP C 65  ? 1.6449 1.4835 1.9562 0.4457  -0.1945 0.4601  60  ASP C N   
2473 C CA  . ASP C 65  ? 1.8219 1.5704 2.1274 0.5242  -0.2388 0.4447  60  ASP C CA  
2474 C C   . ASP C 65  ? 1.7754 1.3472 2.0040 0.5370  -0.2499 0.4397  60  ASP C C   
2475 O O   . ASP C 65  ? 1.9095 1.3662 2.0557 0.5429  -0.2715 0.4697  60  ASP C O   
2476 C CB  . ASP C 65  ? 1.8057 1.6692 2.2156 0.5939  -0.2465 0.4028  60  ASP C CB  
2477 C CG  . ASP C 65  ? 1.9620 1.7559 2.3856 0.6818  -0.3072 0.3794  60  ASP C CG  
2478 O OD1 . ASP C 65  ? 1.9666 1.8628 2.4764 0.7259  -0.3332 0.3629  60  ASP C OD1 
2479 O OD2 . ASP C 65  ? 2.0759 1.7212 2.4252 0.6994  -0.3200 0.3746  60  ASP C OD2 
2480 N N   . GLN C 66  ? 1.7204 1.2648 1.9630 0.5394  -0.2282 0.4065  61  GLN C N   
2481 C CA  . GLN C 66  ? 1.5398 1.2048 1.8604 0.5309  -0.1913 0.3750  61  GLN C CA  
2482 C C   . GLN C 66  ? 1.5106 1.2930 1.9311 0.6011  -0.1983 0.3345  61  GLN C C   
2483 O O   . GLN C 66  ? 1.6745 1.4319 2.1212 0.6677  -0.2447 0.3177  61  GLN C O   
2484 C CB  . GLN C 66  ? 1.5461 1.1283 1.8396 0.5132  -0.1688 0.3484  61  GLN C CB  
2485 C CG  . GLN C 66  ? 1.5644 1.0466 1.7716 0.4388  -0.1581 0.3790  61  GLN C CG  
2486 C CD  . GLN C 66  ? 1.3970 0.9788 1.6120 0.3643  -0.1267 0.3998  61  GLN C CD  
2487 O OE1 . GLN C 66  ? 1.1454 0.7088 1.3363 0.3109  -0.1015 0.3915  61  GLN C OE1 
2488 N NE2 . GLN C 66  ? 1.3577 1.0443 1.6036 0.3632  -0.1308 0.4219  61  GLN C NE2 
2489 N N   . GLY C 67  ? 1.3170 1.2344 1.7931 0.5837  -0.1524 0.3181  62  GLY C N   
2490 C CA  . GLY C 67  ? 1.1834 1.1042 1.6279 0.5193  -0.1070 0.3254  62  GLY C CA  
2491 C C   . GLY C 67  ? 1.0433 1.0954 1.5019 0.4682  -0.0740 0.3510  62  GLY C C   
2492 O O   . GLY C 67  ? 1.0233 1.1752 1.5151 0.4673  -0.0392 0.3313  62  GLY C O   
2493 N N   . SER C 68  ? 0.9753 1.0240 1.4003 0.4221  -0.0856 0.3925  63  SER C N   
2494 C CA  . SER C 68  ? 0.8668 1.0060 1.2883 0.3592  -0.0575 0.4134  63  SER C CA  
2495 C C   . SER C 68  ? 0.8294 0.8951 1.2081 0.3132  -0.0377 0.4062  63  SER C C   
2496 O O   . SER C 68  ? 0.8429 0.7911 1.1743 0.2984  -0.0524 0.4070  63  SER C O   
2497 C CB  . SER C 68  ? 0.8828 1.0278 1.2780 0.3212  -0.0757 0.4469  63  SER C CB  
2498 O OG  . SER C 68  ? 0.7888 1.0216 1.1850 0.2627  -0.0513 0.4576  63  SER C OG  
2499 N N   . GLU C 69  ? 0.6920 0.8255 1.0832 0.2916  -0.0064 0.3962  64  GLU C N   
2500 C CA  . GLU C 69  ? 0.6664 0.7298 1.0217 0.2575  0.0087  0.3803  64  GLU C CA  
2501 C C   . GLU C 69  ? 0.5608 0.6890 0.9020 0.1979  0.0258  0.3874  64  GLU C C   
2502 O O   . GLU C 69  ? 0.5089 0.7450 0.8739 0.1916  0.0348  0.4010  64  GLU C O   
2503 C CB  . GLU C 69  ? 0.7457 0.7836 1.1209 0.3083  0.0243  0.3413  64  GLU C CB  
2504 C CG  . GLU C 69  ? 0.9319 0.8298 1.2811 0.3289  0.0065  0.3191  64  GLU C CG  
2505 C CD  . GLU C 69  ? 1.0603 0.9502 1.4434 0.3984  0.0100  0.2717  64  GLU C CD  
2506 O OE1 . GLU C 69  ? 1.0611 1.0654 1.4937 0.4381  0.0219  0.2578  64  GLU C OE1 
2507 O OE2 . GLU C 69  ? 1.1484 0.9252 1.5066 0.4095  0.0001  0.2420  64  GLU C OE2 
2508 N N   . LEU C 70  ? 0.5412 0.6026 0.8397 0.1525  0.0258  0.3717  65  LEU C N   
2509 C CA  . LEU C 70  ? 0.4555 0.5598 0.7362 0.1052  0.0345  0.3589  65  LEU C CA  
2510 C C   . LEU C 70  ? 0.4548 0.5386 0.7345 0.1287  0.0550  0.3413  65  LEU C C   
2511 O O   . LEU C 70  ? 0.5613 0.5520 0.8260 0.1421  0.0585  0.3165  65  LEU C O   
2512 C CB  . LEU C 70  ? 0.4389 0.4924 0.6729 0.0542  0.0193  0.3327  65  LEU C CB  
2513 C CG  . LEU C 70  ? 0.3639 0.4459 0.5717 0.0164  0.0157  0.2985  65  LEU C CG  
2514 C CD1 . LEU C 70  ? 0.3162 0.4965 0.5496 0.0057  0.0076  0.3054  65  LEU C CD1 
2515 C CD2 . LEU C 70  ? 0.3597 0.3933 0.5206 -0.0164 0.0025  0.2657  65  LEU C CD2 
2516 N N   . HIS C 71  ? 0.4090 0.5810 0.7019 0.1337  0.0684  0.3520  66  HIS C N   
2517 C CA  . HIS C 71  ? 0.4139 0.5789 0.6892 0.1477  0.0894  0.3137  66  HIS C CA  
2518 C C   . HIS C 71  ? 0.3671 0.5127 0.5863 0.0888  0.0829  0.3005  66  HIS C C   
2519 O O   . HIS C 71  ? 0.3531 0.5627 0.5602 0.0510  0.0705  0.3124  66  HIS C O   
2520 C CB  . HIS C 71  ? 0.4121 0.6937 0.7162 0.1765  0.1097  0.3064  66  HIS C CB  
2521 C CG  . HIS C 71  ? 0.5640 0.8404 0.8442 0.1937  0.1343  0.2534  66  HIS C CG  
2522 N ND1 . HIS C 71  ? 0.6026 0.9880 0.8874 0.2005  0.1577  0.2401  66  HIS C ND1 
2523 C CD2 . HIS C 71  ? 0.5582 0.7376 0.8072 0.2030  0.1393  0.2091  66  HIS C CD2 
2524 C CE1 . HIS C 71  ? 0.6081 0.9620 0.8608 0.2147  0.1758  0.1911  66  HIS C CE1 
2525 N NE2 . HIS C 71  ? 0.6068 0.8348 0.8394 0.2188  0.1637  0.1704  66  HIS C NE2 
2526 N N   . VAL C 72  ? 0.3867 0.4416 0.5728 0.0822  0.0843  0.2597  67  VAL C N   
2527 C CA  . VAL C 72  ? 0.3520 0.3829 0.4859 0.0352  0.0725  0.2374  67  VAL C CA  
2528 C C   . VAL C 72  ? 0.3817 0.3910 0.4799 0.0476  0.0862  0.1864  67  VAL C C   
2529 O O   . VAL C 72  ? 0.4226 0.3809 0.5291 0.0832  0.1007  0.1514  67  VAL C O   
2530 C CB  . VAL C 72  ? 0.5289 0.4884 0.6452 0.0059  0.0523  0.2131  67  VAL C CB  
2531 C CG1 . VAL C 72  ? 0.5612 0.5012 0.6260 -0.0290 0.0360  0.1735  67  VAL C CG1 
2532 C CG2 . VAL C 72  ? 0.3272 0.3237 0.4519 -0.0096 0.0315  0.2200  67  VAL C CG2 
2533 N N   . VAL C 73  ? 0.3874 0.4305 0.4410 0.0173  0.0785  0.1831  68  VAL C N   
2534 C CA  . VAL C 73  ? 0.3967 0.4223 0.4026 0.0239  0.0878  0.1403  68  VAL C CA  
2535 C C   . VAL C 73  ? 0.4633 0.4409 0.4073 -0.0164 0.0578  0.1190  68  VAL C C   
2536 O O   . VAL C 73  ? 0.4707 0.4736 0.3948 -0.0540 0.0340  0.1469  68  VAL C O   
2537 C CB  . VAL C 73  ? 0.4136 0.5323 0.4134 0.0300  0.1089  0.1559  68  VAL C CB  
2538 C CG1 . VAL C 73  ? 0.4386 0.5380 0.3724 0.0277  0.1158  0.1162  68  VAL C CG1 
2539 C CG2 . VAL C 73  ? 0.4807 0.6540 0.5473 0.0813  0.1362  0.1623  68  VAL C CG2 
2540 N N   . VAL C 74  ? 0.4707 0.3777 0.3860 -0.0057 0.0550  0.0659  69  VAL C N   
2541 C CA  . VAL C 74  ? 0.5066 0.3672 0.3619 -0.0340 0.0222  0.0355  69  VAL C CA  
2542 C C   . VAL C 74  ? 0.5062 0.3726 0.2942 -0.0337 0.0234  0.0222  69  VAL C C   
2543 O O   . VAL C 74  ? 0.4989 0.3684 0.2824 -0.0023 0.0511  -0.0019 69  VAL C O   
2544 C CB  . VAL C 74  ? 0.5196 0.3053 0.3799 -0.0267 0.0132  -0.0197 69  VAL C CB  
2545 C CG1 . VAL C 74  ? 0.4312 0.1787 0.2358 -0.0507 -0.0278 -0.0560 69  VAL C CG1 
2546 C CG2 . VAL C 74  ? 0.3761 0.1563 0.2951 -0.0343 0.0165  -0.0027 69  VAL C CG2 
2547 N N   . LYS C 75  ? 0.5599 0.4252 0.2914 -0.0701 -0.0087 0.0382  70  LYS C N   
2548 C CA  . LYS C 75  ? 0.6030 0.4672 0.2552 -0.0813 -0.0125 0.0363  70  LYS C CA  
2549 C C   . LYS C 75  ? 0.5648 0.3797 0.2155 -0.0879 -0.0530 0.0072  70  LYS C C   
2550 O O   . LYS C 75  ? 0.5207 0.3248 0.2241 -0.0913 -0.0710 0.0059  70  LYS C O   
2551 C CB  . LYS C 75  ? 0.6127 0.5623 0.2982 -0.0975 -0.0020 0.0851  70  LYS C CB  
2552 C CG  . LYS C 75  ? 0.7212 0.7557 0.4386 -0.0845 0.0463  0.1163  70  LYS C CG  
2553 C CD  . LYS C 75  ? 0.7088 0.8014 0.4717 -0.0985 0.0438  0.1428  70  LYS C CD  
2554 C CE  . LYS C 75  ? 0.7640 0.9562 0.5711 -0.0834 0.0861  0.1631  70  LYS C CE  
2555 N NZ  . LYS C 75  ? 0.8089 1.0426 0.5724 -0.0770 0.1192  0.1489  70  LYS C NZ  
2556 N N   . ASP C 76  ? 0.6688 0.4731 0.2834 -0.0807 -0.0537 -0.0074 71  ASP C N   
2557 C CA  . ASP C 76  ? 0.6198 0.3988 0.2531 -0.0797 -0.0779 -0.0149 71  ASP C CA  
2558 C C   . ASP C 76  ? 0.6558 0.4373 0.2755 -0.1136 -0.0881 0.0188  71  ASP C C   
2559 O O   . ASP C 76  ? 0.7450 0.5575 0.3268 -0.1229 -0.0773 0.0328  71  ASP C O   
2560 C CB  . ASP C 76  ? 0.7177 0.4838 0.3178 -0.0606 -0.0760 -0.0442 71  ASP C CB  
2561 C CG  . ASP C 76  ? 0.8000 0.4971 0.3810 -0.0614 -0.1051 -0.0430 71  ASP C CG  
2562 O OD1 . ASP C 76  ? 0.7815 0.4492 0.3889 -0.0592 -0.1227 -0.0313 71  ASP C OD1 
2563 O OD2 . ASP C 76  ? 0.8757 0.5512 0.4085 -0.0591 -0.1107 -0.0525 71  ASP C OD2 
2564 N N   . HIS C 77  ? 0.7931 0.9802 1.0333 0.3499  0.1240  0.3494  72  HIS C N   
2565 C CA  . HIS C 77  ? 0.8052 0.9142 0.9741 0.3180  0.1061  0.3813  72  HIS C CA  
2566 C C   . HIS C 77  ? 1.0208 0.9343 0.9679 0.3332  0.0282  0.3414  72  HIS C C   
2567 O O   . HIS C 77  ? 1.0502 0.9284 0.9551 0.3400  -0.0709 0.3182  72  HIS C O   
2568 C CB  . HIS C 77  ? 1.0260 1.2700 1.3327 0.3073  0.0487  0.3908  72  HIS C CB  
2569 C CG  . HIS C 77  ? 0.7617 0.9214 0.9915 0.2786  0.0114  0.4174  72  HIS C CG  
2570 N ND1 . HIS C 77  ? 1.0712 1.1197 1.2063 0.2378  0.0776  0.4673  72  HIS C ND1 
2571 C CD2 . HIS C 77  ? 0.9215 1.0876 1.1489 0.2822  -0.0884 0.3964  72  HIS C CD2 
2572 C CE1 . HIS C 77  ? 1.1311 1.1143 1.2027 0.2148  0.0180  0.4830  72  HIS C CE1 
2573 N NE2 . HIS C 77  ? 1.0372 1.0879 1.1666 0.2449  -0.0854 0.4402  72  HIS C NE2 
2574 N N   . GLU C 78  ? 1.1978 0.9804 1.0041 0.3397  0.0664  0.3293  73  GLU C N   
2575 C CA  . GLU C 78  ? 1.5353 1.1122 1.1170 0.3505  -0.0097 0.2949  73  GLU C CA  
2576 C C   . GLU C 78  ? 1.8228 1.2713 1.2731 0.2996  0.0879  0.3433  73  GLU C C   
2577 O O   . GLU C 78  ? 1.8858 1.2731 1.2782 0.2502  0.0973  0.3870  73  GLU C O   
2578 C CB  . GLU C 78  ? 1.5571 1.1095 1.0956 0.4043  -0.0553 0.2268  73  GLU C CB  
2579 C CG  . GLU C 78  ? 1.8141 1.1480 1.1245 0.4236  -0.1486 0.1823  73  GLU C CG  
2580 C CD  . GLU C 78  ? 1.9267 1.1620 1.1540 0.4158  -0.2627 0.1757  73  GLU C CD  
2581 O OE1 . GLU C 78  ? 2.0478 1.1945 1.1933 0.3634  -0.2327 0.2332  73  GLU C OE1 
2582 O OE2 . GLU C 78  ? 1.8748 1.1649 1.1618 0.4293  -0.3571 0.0939  73  GLU C OE2 
2583 N N   . THR C 79  ? 1.9369 1.3759 1.3706 0.3059  0.1729  0.3364  74  THR C N   
2584 C CA  . THR C 79  ? 2.1826 1.5036 1.4832 0.2572  0.2710  0.3652  74  THR C CA  
2585 C C   . THR C 79  ? 2.1406 1.6138 1.6221 0.2194  0.3714  0.4159  74  THR C C   
2586 O O   . THR C 79  ? 2.0904 1.6589 1.6879 0.2180  0.4762  0.4222  74  THR C O   
2587 C CB  . THR C 79  ? 2.2062 1.5045 1.4740 0.2834  0.3318  0.3333  74  THR C CB  
2588 O OG1 . THR C 79  ? 1.9842 1.4837 1.4882 0.3116  0.3878  0.3335  74  THR C OG1 
2589 C CG2 . THR C 79  ? 2.2744 1.4571 1.4071 0.3324  0.2252  0.2762  74  THR C CG2 
2590 N N   . MET C 80  ? 2.1678 1.6612 1.6783 0.1903  0.3320  0.4491  75  MET C N   
2591 C CA  . MET C 80  ? 2.0485 1.7154 1.7701 0.1660  0.3979  0.4929  75  MET C CA  
2592 C C   . MET C 80  ? 2.1482 1.7904 1.8435 0.1003  0.5225  0.5306  75  MET C C   
2593 O O   . MET C 80  ? 2.0758 1.8301 1.9114 0.0664  0.5553  0.5572  75  MET C O   
2594 C CB  . MET C 80  ? 1.9645 1.6935 1.7610 0.1673  0.3042  0.5080  75  MET C CB  
2595 C CG  . MET C 80  ? 2.1384 1.7096 1.7574 0.1234  0.2494  0.5296  75  MET C CG  
2596 S SD  . MET C 80  ? 2.0280 1.7336 1.8136 0.0993  0.2196  0.5742  75  MET C SD  
2597 C CE  . MET C 80  ? 1.4576 1.3565 1.4766 0.0755  0.3690  0.6152  75  MET C CE  
2598 N N   . GLY C 81  ? 2.3233 1.8062 1.8163 0.0740  0.5639  0.5158  76  GLY C N   
2599 C CA  . GLY C 81  ? 2.3954 1.8908 1.8865 0.0146  0.6665  0.5047  76  GLY C CA  
2600 C C   . GLY C 81  ? 2.4174 1.8818 1.8685 0.0403  0.7251  0.4629  76  GLY C C   
2601 O O   . GLY C 81  ? 2.4851 1.9856 1.9674 0.0044  0.8037  0.4368  76  GLY C O   
2602 N N   . ARG C 82  ? 2.3524 1.7467 1.7266 0.1031  0.6764  0.4513  77  ARG C N   
2603 C CA  . ARG C 82  ? 2.3186 1.6820 1.6537 0.1354  0.7198  0.4095  77  ARG C CA  
2604 C C   . ARG C 82  ? 2.0733 1.5553 1.5676 0.2143  0.6652  0.3814  77  ARG C C   
2605 O O   . ARG C 82  ? 2.0222 1.5055 1.5157 0.2498  0.5500  0.3709  77  ARG C O   
2606 C CB  . ARG C 82  ? 2.5306 1.6571 1.5639 0.1168  0.6774  0.3878  77  ARG C CB  
2607 C CG  . ARG C 82  ? 2.5407 1.6251 1.5202 0.1494  0.7195  0.3435  77  ARG C CG  
2608 C CD  . ARG C 82  ? 2.7741 1.6672 1.5024 0.0925  0.7397  0.3231  77  ARG C CD  
2609 N NE  . ARG C 82  ? 2.8556 1.7417 1.5527 0.0034  0.7796  0.3398  77  ARG C NE  
2610 C CZ  . ARG C 82  ? 2.8813 1.8340 1.6361 -0.0445 0.8793  0.3194  77  ARG C CZ  
2611 N NH1 . ARG C 82  ? 2.8136 1.8378 1.6664 -0.0112 0.9429  0.2810  77  ARG C NH1 
2612 N NH2 . ARG C 82  ? 2.9864 1.9359 1.7024 -0.1246 0.9075  0.3344  77  ARG C NH2 
2613 N N   . ASN C 83  ? 1.9242 1.5047 1.5527 0.2375  0.7463  0.3647  78  ASN C N   
2614 C CA  . ASN C 83  ? 1.6929 1.3688 1.4497 0.3028  0.7060  0.3371  78  ASN C CA  
2615 C C   . ASN C 83  ? 1.4348 1.2574 1.3688 0.3273  0.6262  0.3532  78  ASN C C   
2616 O O   . ASN C 83  ? 1.3095 1.1558 1.2560 0.3688  0.5444  0.3257  78  ASN C O   
2617 C CB  . ASN C 83  ? 1.7812 1.3145 1.3506 0.3362  0.6498  0.2921  78  ASN C CB  
2618 C CG  . ASN C 83  ? 1.8929 1.3485 1.3736 0.3282  0.7452  0.2682  78  ASN C CG  
2619 O OD1 . ASN C 83  ? 1.5895 1.1551 1.2391 0.3277  0.8011  0.2591  78  ASN C OD1 
2620 N ND2 . ASN C 83  ? 1.8732 1.1361 1.1023 0.3120  0.7262  0.2487  78  ASN C ND2 
2621 N N   . ARG C 84  ? 1.3610 1.2825 1.4271 0.2948  0.6546  0.3953  79  ARG C N   
2622 C CA  . ARG C 84  ? 1.1512 1.2133 1.3850 0.3033  0.5901  0.4170  79  ARG C CA  
2623 C C   . ARG C 84  ? 1.0094 1.1729 1.3941 0.3120  0.5239  0.3890  79  ARG C C   
2624 O O   . ARG C 84  ? 0.7331 0.9575 1.1555 0.3188  0.4447  0.3813  79  ARG C O   
2625 C CB  . ARG C 84  ? 0.9843 1.0819 1.2866 0.2503  0.5958  0.4446  79  ARG C CB  
2626 C CG  . ARG C 84  ? 0.8693 1.0495 1.2516 0.2482  0.5267  0.4750  79  ARG C CG  
2627 C CD  . ARG C 84  ? 1.0972 1.1871 1.3500 0.2125  0.5174  0.5091  79  ARG C CD  
2628 N NE  . ARG C 84  ? 1.0435 1.2364 1.4363 0.1843  0.4930  0.5294  79  ARG C NE  
2629 C CZ  . ARG C 84  ? 0.9568 1.2156 1.4078 0.1888  0.4242  0.5548  79  ARG C CZ  
2630 N NH1 . ARG C 84  ? 0.9511 1.1702 1.3213 0.2220  0.3299  0.5203  79  ARG C NH1 
2631 N NH2 . ARG C 84  ? 0.9138 1.2414 1.4669 0.1641  0.3949  0.5591  79  ARG C NH2 
2632 N N   . PHE C 85  ? 0.3166 0.6444 0.5652 -0.0483 0.0038  0.1074  80  PHE C N   
2633 C CA  . PHE C 85  ? 0.3516 0.6423 0.5772 -0.0349 0.0123  0.0895  80  PHE C CA  
2634 C C   . PHE C 85  ? 0.3268 0.5818 0.5291 -0.0405 0.0181  0.0729  80  PHE C C   
2635 O O   . PHE C 85  ? 0.4330 0.7085 0.6282 -0.0463 0.0218  0.0718  80  PHE C O   
2636 C CB  . PHE C 85  ? 0.3242 0.6340 0.5320 -0.0128 0.0215  0.0852  80  PHE C CB  
2637 C CG  . PHE C 85  ? 0.3935 0.6553 0.5712 0.0044  0.0307  0.0661  80  PHE C CG  
2638 C CD1 . PHE C 85  ? 0.4551 0.6846 0.6007 0.0089  0.0405  0.0462  80  PHE C CD1 
2639 C CD2 . PHE C 85  ? 0.3861 0.6363 0.5673 0.0147  0.0289  0.0694  80  PHE C CD2 
2640 C CE1 . PHE C 85  ? 0.4687 0.6513 0.5876 0.0240  0.0482  0.0304  80  PHE C CE1 
2641 C CE2 . PHE C 85  ? 0.4241 0.6325 0.5804 0.0305  0.0369  0.0549  80  PHE C CE2 
2642 C CZ  . PHE C 85  ? 0.4431 0.6159 0.5688 0.0357  0.0465  0.0356  80  PHE C CZ  
2643 N N   . LEU C 86  ? 0.3013 0.5069 0.4918 -0.0405 0.0184  0.0613  81  LEU C N   
2644 C CA  . LEU C 86  ? 0.3187 0.4906 0.4872 -0.0479 0.0224  0.0478  81  LEU C CA  
2645 C C   . LEU C 86  ? 0.3727 0.4998 0.5069 -0.0344 0.0301  0.0287  81  LEU C C   
2646 O O   . LEU C 86  ? 0.4274 0.5320 0.5342 -0.0375 0.0357  0.0155  81  LEU C O   
2647 C CB  . LEU C 86  ? 0.2969 0.4515 0.4830 -0.0629 0.0155  0.0534  81  LEU C CB  
2648 C CG  . LEU C 86  ? 0.2645 0.4548 0.4862 -0.0764 0.0079  0.0734  81  LEU C CG  
2649 C CD1 . LEU C 86  ? 0.2926 0.4556 0.5195 -0.0851 0.0045  0.0737  81  LEU C CD1 
2650 C CD2 . LEU C 86  ? 0.2566 0.4889 0.4792 -0.0829 0.0102  0.0804  81  LEU C CD2 
2651 N N   . GLY C 87  ? 0.3206 0.4350 0.4564 -0.0210 0.0298  0.0286  82  GLY C N   
2652 C CA  . GLY C 87  ? 0.3409 0.4131 0.4488 -0.0075 0.0364  0.0140  82  GLY C CA  
2653 C C   . GLY C 87  ? 0.3446 0.4107 0.4620 0.0034  0.0337  0.0193  82  GLY C C   
2654 O O   . GLY C 87  ? 0.2838 0.3662 0.4263 -0.0048 0.0252  0.0307  82  GLY C O   
2655 N N   . GLU C 88  ? 0.3491 0.3910 0.4459 0.0213  0.0410  0.0114  83  GLU C N   
2656 C CA  . GLU C 88  ? 0.3739 0.4146 0.4791 0.0319  0.0389  0.0184  83  GLU C CA  
2657 C C   . GLU C 88  ? 0.3610 0.3549 0.4433 0.0417  0.0437  0.0083  83  GLU C C   
2658 O O   . GLU C 88  ? 0.4100 0.3721 0.4660 0.0466  0.0510  -0.0049 83  GLU C O   
2659 C CB  . GLU C 88  ? 0.3346 0.4175 0.4506 0.0490  0.0423  0.0303  83  GLU C CB  
2660 C CG  . GLU C 88  ? 0.4285 0.5102 0.5224 0.0697  0.0554  0.0220  83  GLU C CG  
2661 C CD  . GLU C 88  ? 0.6499 0.7810 0.7569 0.0880  0.0593  0.0364  83  GLU C CD  
2662 O OE1 . GLU C 88  ? 0.7132 0.8620 0.8365 0.0926  0.0547  0.0507  83  GLU C OE1 
2663 O OE2 . GLU C 88  ? 0.7113 0.8676 0.8119 0.0970  0.0667  0.0344  83  GLU C OE2 
2664 N N   . ALA C 89  ? 0.3812 0.3713 0.4730 0.0429  0.0389  0.0150  84  ALA C N   
2665 C CA  . ALA C 89  ? 0.4183 0.3709 0.4934 0.0524  0.0422  0.0102  84  ALA C CA  
2666 C C   . ALA C 89  ? 0.4534 0.4283 0.5416 0.0662  0.0418  0.0240  84  ALA C C   
2667 O O   . ALA C 89  ? 0.4532 0.4627 0.5633 0.0580  0.0342  0.0355  84  ALA C O   
2668 C CB  . ALA C 89  ? 0.4767 0.4011 0.5486 0.0341  0.0354  0.0047  84  ALA C CB  
2669 N N   . LYS C 90  ? 0.5639 0.5189 0.6383 0.0867  0.0499  0.0241  85  LYS C N   
2670 C CA  . LYS C 90  ? 0.5581 0.5349 0.6450 0.1000  0.0498  0.0399  85  LYS C CA  
2671 C C   . LYS C 90  ? 0.5159 0.4601 0.5956 0.0970  0.0469  0.0396  85  LYS C C   
2672 O O   . LYS C 90  ? 0.5891 0.4891 0.6482 0.1040  0.0525  0.0304  85  LYS C O   
2673 C CB  . LYS C 90  ? 0.6653 0.6536 0.7472 0.1297  0.0623  0.0456  85  LYS C CB  
2674 C CG  . LYS C 90  ? 0.7203 0.7613 0.8170 0.1340  0.0634  0.0543  85  LYS C CG  
2675 C CD  . LYS C 90  ? 0.8483 0.9022 0.9388 0.1666  0.0777  0.0596  85  LYS C CD  
2676 C CE  . LYS C 90  ? 0.8989 1.0210 1.0119 0.1711  0.0760  0.0783  85  LYS C CE  
2677 N NZ  . LYS C 90  ? 0.9075 1.0624 1.0442 0.1538  0.0624  0.0963  85  LYS C NZ  
2678 N N   . VAL C 91  ? 0.4346 0.4011 0.5305 0.0847  0.0376  0.0495  86  VAL C N   
2679 C CA  . VAL C 91  ? 0.5090 0.4540 0.6005 0.0797  0.0338  0.0511  86  VAL C CA  
2680 C C   . VAL C 91  ? 0.5063 0.4722 0.6061 0.0970  0.0365  0.0694  86  VAL C C   
2681 O O   . VAL C 91  ? 0.3847 0.3947 0.5023 0.0928  0.0312  0.0833  86  VAL C O   
2682 C CB  . VAL C 91  ? 0.6144 0.5699 0.7157 0.0542  0.0225  0.0487  86  VAL C CB  
2683 C CG1 . VAL C 91  ? 0.6785 0.6178 0.7746 0.0493  0.0189  0.0509  86  VAL C CG1 
2684 C CG2 . VAL C 91  ? 0.6113 0.5496 0.7076 0.0388  0.0205  0.0340  86  VAL C CG2 
2685 N N   . PRO C 92  ? 0.5807 0.5148 0.6677 0.1159  0.0446  0.0707  87  PRO C N   
2686 C CA  . PRO C 92  ? 0.5701 0.5230 0.6666 0.1346  0.0481  0.0910  87  PRO C CA  
2687 C C   . PRO C 92  ? 0.5105 0.4791 0.6168 0.1178  0.0377  0.1011  87  PRO C C   
2688 O O   . PRO C 92  ? 0.5967 0.5335 0.6927 0.1043  0.0331  0.0922  87  PRO C O   
2689 C CB  . PRO C 92  ? 0.6198 0.5211 0.6972 0.1562  0.0591  0.0861  87  PRO C CB  
2690 C CG  . PRO C 92  ? 0.6152 0.4690 0.6721 0.1385  0.0560  0.0644  87  PRO C CG  
2691 C CD  . PRO C 92  ? 0.5887 0.4668 0.6513 0.1199  0.0506  0.0544  87  PRO C CD  
2692 N N   . LEU C 93  ? 0.4177 0.4380 0.5427 0.1174  0.0338  0.1201  88  LEU C N   
2693 C CA  . LEU C 93  ? 0.5100 0.5525 0.6431 0.0982  0.0234  0.1287  88  LEU C CA  
2694 C C   . LEU C 93  ? 0.5571 0.5889 0.6894 0.1070  0.0247  0.1423  88  LEU C C   
2695 O O   . LEU C 93  ? 0.5794 0.6217 0.7137 0.0885  0.0160  0.1449  88  LEU C O   
2696 C CB  . LEU C 93  ? 0.5604 0.6637 0.7115 0.0883  0.0167  0.1436  88  LEU C CB  
2697 C CG  . LEU C 93  ? 0.6490 0.7642 0.8026 0.0617  0.0072  0.1305  88  LEU C CG  
2698 C CD1 . LEU C 93  ? 0.6508 0.7212 0.7909 0.0462  0.0045  0.1067  88  LEU C CD1 
2699 C CD2 . LEU C 93  ? 0.6581 0.7932 0.8187 0.0683  0.0100  0.1318  88  LEU C CD2 
2700 N N   . ARG C 94  ? 0.5075 0.5192 0.6370 0.1351  0.0356  0.1514  89  ARG C N   
2701 C CA  . ARG C 94  ? 0.4954 0.4904 0.6248 0.1435  0.0366  0.1654  89  ARG C CA  
2702 C C   . ARG C 94  ? 0.4432 0.3884 0.5551 0.1269  0.0316  0.1481  89  ARG C C   
2703 O O   . ARG C 94  ? 0.4339 0.3727 0.5466 0.1220  0.0273  0.1582  89  ARG C O   
2704 C CB  . ARG C 94  ? 0.5779 0.5531 0.7070 0.1794  0.0505  0.1781  89  ARG C CB  
2705 C CG  . ARG C 94  ? 0.7187 0.6397 0.8272 0.1943  0.0610  0.1565  89  ARG C CG  
2706 C CD  . ARG C 94  ? 0.8529 0.7030 0.9395 0.1943  0.0628  0.1436  89  ARG C CD  
2707 N NE  . ARG C 94  ? 0.8960 0.7048 0.9602 0.1933  0.0679  0.1170  89  ARG C NE  
2708 C CZ  . ARG C 94  ? 0.9114 0.7048 0.9667 0.2184  0.0813  0.1105  89  ARG C CZ  
2709 N NH1 . ARG C 94  ? 0.9198 0.7353 0.9868 0.2471  0.0911  0.1282  89  ARG C NH1 
2710 N NH2 . ARG C 94  ? 0.8793 0.6395 0.9131 0.2128  0.0845  0.0858  89  ARG C NH2 
2711 N N   . GLU C 95  ? 0.4993 0.4138 0.5964 0.1178  0.0319  0.1242  90  GLU C N   
2712 C CA  . GLU C 95  ? 0.6531 0.5268 0.7339 0.0998  0.0266  0.1085  90  GLU C CA  
2713 C C   . GLU C 95  ? 0.5794 0.4837 0.6676 0.0736  0.0150  0.1087  90  GLU C C   
2714 O O   . GLU C 95  ? 0.5565 0.4436 0.6373 0.0608  0.0095  0.1070  90  GLU C O   
2715 C CB  . GLU C 95  ? 0.7818 0.6254 0.8472 0.0953  0.0298  0.0857  90  GLU C CB  
2716 C CG  . GLU C 95  ? 0.9311 0.7175 0.9738 0.0898  0.0301  0.0734  90  GLU C CG  
2717 C CD  . GLU C 95  ? 1.0147 0.7698 1.0402 0.0950  0.0374  0.0556  90  GLU C CD  
2718 O OE1 . GLU C 95  ? 1.0376 0.7982 1.0646 0.1164  0.0469  0.0569  90  GLU C OE1 
2719 O OE2 . GLU C 95  ? 1.0354 0.7645 1.0457 0.0775  0.0337  0.0411  90  GLU C OE2 
2720 N N   . VAL C 96  ? 0.4372 0.3873 0.5390 0.0652  0.0112  0.1109  91  VAL C N   
2721 C CA  . VAL C 96  ? 0.4248 0.4051 0.5322 0.0416  0.0012  0.1102  91  VAL C CA  
2722 C C   . VAL C 96  ? 0.4501 0.4612 0.5674 0.0435  -0.0018 0.1328  91  VAL C C   
2723 O O   . VAL C 96  ? 0.5094 0.5323 0.6255 0.0266  -0.0089 0.1335  91  VAL C O   
2724 C CB  . VAL C 96  ? 0.4350 0.4486 0.5513 0.0296  -0.0025 0.1041  91  VAL C CB  
2725 C CG1 . VAL C 96  ? 0.3319 0.3705 0.4501 0.0052  -0.0118 0.1002  91  VAL C CG1 
2726 C CG2 . VAL C 96  ? 0.4256 0.4127 0.5351 0.0279  0.0003  0.0850  91  VAL C CG2 
2727 N N   . LEU C 97  ? 0.4582 0.4854 0.5858 0.0651  0.0042  0.1525  92  LEU C N   
2728 C CA  . LEU C 97  ? 0.5082 0.5702 0.6486 0.0698  0.0024  0.1790  92  LEU C CA  
2729 C C   . LEU C 97  ? 0.5826 0.6100 0.7185 0.0809  0.0049  0.1889  92  LEU C C   
2730 O O   . LEU C 97  ? 0.6313 0.6845 0.7795 0.0874  0.0042  0.2140  92  LEU C O   
2731 C CB  . LEU C 97  ? 0.5517 0.6499 0.7077 0.0906  0.0087  0.1999  92  LEU C CB  
2732 C CG  . LEU C 97  ? 0.5974 0.7616 0.7674 0.0763  0.0019  0.2125  92  LEU C CG  
2733 C CD1 . LEU C 97  ? 0.5971 0.7744 0.7608 0.0424  -0.0099 0.1977  92  LEU C CD1 
2734 C CD2 . LEU C 97  ? 0.5864 0.7626 0.7602 0.0850  0.0062  0.2087  92  LEU C CD2 
2735 N N   . ALA C 98  ? 0.5827 0.5531 0.7014 0.0820  0.0074  0.1712  93  ALA C N   
2736 C CA  . ALA C 98  ? 0.6295 0.5583 0.7414 0.0921  0.0096  0.1799  93  ALA C CA  
2737 C C   . ALA C 98  ? 0.5422 0.4743 0.6509 0.0692  -0.0009 0.1821  93  ALA C C   
2738 O O   . ALA C 98  ? 0.6281 0.5356 0.7347 0.0736  -0.0018 0.1949  93  ALA C O   
2739 C CB  . ALA C 98  ? 0.7515 0.6164 0.8436 0.1025  0.0169  0.1611  93  ALA C CB  
2740 N N   . THR C 99  ? 0.4559 0.4182 0.5640 0.0453  -0.0085 0.1698  94  THR C N   
2741 C CA  . THR C 99  ? 0.4926 0.4628 0.5959 0.0235  -0.0176 0.1688  94  THR C CA  
2742 C C   . THR C 99  ? 0.4437 0.4764 0.5581 0.0071  -0.0244 0.1757  94  THR C C   
2743 O O   . THR C 99  ? 0.4448 0.5050 0.5641 0.0036  -0.0239 0.1689  94  THR C O   
2744 C CB  . THR C 99  ? 0.5966 0.5359 0.6831 0.0087  -0.0195 0.1426  94  THR C CB  
2745 O OG1 . THR C 99  ? 0.5816 0.5482 0.6664 -0.0135 -0.0276 0.1391  94  THR C OG1 
2746 C CG2 . THR C 99  ? 0.5484 0.4882 0.6338 0.0097  -0.0154 0.1238  94  THR C CG2 
2747 N N   . PRO C 100 ? 0.3734 0.4294 0.4908 -0.0046 -0.0312 0.1895  95  PRO C N   
2748 C CA  . PRO C 100 ? 0.3554 0.4726 0.4803 -0.0224 -0.0379 0.1963  95  PRO C CA  
2749 C C   . PRO C 100 ? 0.3339 0.4623 0.4491 -0.0414 -0.0404 0.1690  95  PRO C C   
2750 O O   . PRO C 100 ? 0.3222 0.4953 0.4413 -0.0543 -0.0440 0.1691  95  PRO C O   
2751 C CB  . PRO C 100 ? 0.4970 0.6236 0.6211 -0.0329 -0.0444 0.2096  95  PRO C CB  
2752 C CG  . PRO C 100 ? 0.3906 0.4678 0.5141 -0.0153 -0.0409 0.2214  95  PRO C CG  
2753 C CD  . PRO C 100 ? 0.3957 0.4211 0.5082 -0.0032 -0.0335 0.2001  95  PRO C CD  
2754 N N   . SER C 101 ? 0.3320 0.4192 0.4344 -0.0435 -0.0384 0.1466  96  SER C N   
2755 C CA  . SER C 101 ? 0.3409 0.4316 0.4352 -0.0584 -0.0394 0.1210  96  SER C CA  
2756 C C   . SER C 101 ? 0.3531 0.4490 0.4529 -0.0541 -0.0363 0.1139  96  SER C C   
2757 O O   . SER C 101 ? 0.3224 0.4258 0.4183 -0.0669 -0.0377 0.0958  96  SER C O   
2758 C CB  . SER C 101 ? 0.3832 0.4313 0.4651 -0.0598 -0.0374 0.1036  96  SER C CB  
2759 O OG  . SER C 101 ? 0.3749 0.3827 0.4553 -0.0446 -0.0315 0.0996  96  SER C OG  
2760 N N   . LEU C 102 ? 0.3141 0.4058 0.4231 -0.0356 -0.0320 0.1290  97  LEU C N   
2761 C CA  . LEU C 102 ? 0.3068 0.4065 0.4224 -0.0295 -0.0291 0.1264  97  LEU C CA  
2762 C C   . LEU C 102 ? 0.3349 0.4060 0.4428 -0.0348 -0.0274 0.1012  97  LEU C C   
2763 O O   . LEU C 102 ? 0.3141 0.4014 0.4249 -0.0443 -0.0294 0.0926  97  LEU C O   
2764 C CB  . LEU C 102 ? 0.2987 0.4528 0.4225 -0.0426 -0.0347 0.1359  97  LEU C CB  
2765 C CG  . LEU C 102 ? 0.3228 0.5161 0.4582 -0.0372 -0.0363 0.1658  97  LEU C CG  
2766 C CD1 . LEU C 102 ? 0.2991 0.5488 0.4389 -0.0566 -0.0433 0.1726  97  LEU C CD1 
2767 C CD2 . LEU C 102 ? 0.3184 0.5019 0.4647 -0.0089 -0.0285 0.1851  97  LEU C CD2 
2768 N N   . SER C 103 ? 0.3029 0.3323 0.4012 -0.0302 -0.0242 0.0910  98  SER C N   
2769 C CA  . SER C 103 ? 0.2945 0.2981 0.3868 -0.0346 -0.0222 0.0702  98  SER C CA  
2770 C C   . SER C 103 ? 0.4139 0.3741 0.4974 -0.0229 -0.0171 0.0676  98  SER C C   
2771 O O   . SER C 103 ? 0.4178 0.3627 0.4968 -0.0156 -0.0165 0.0785  98  SER C O   
2772 C CB  . SER C 103 ? 0.3306 0.3388 0.4164 -0.0530 -0.0261 0.0552  98  SER C CB  
2773 O OG  . SER C 103 ? 0.4305 0.4242 0.5075 -0.0551 -0.0270 0.0570  98  SER C OG  
2774 N N   . ALA C 104 ? 0.3014 0.2418 0.3821 -0.0224 -0.0139 0.0538  99  ALA C N   
2775 C CA  . ALA C 104 ? 0.3152 0.2157 0.3845 -0.0154 -0.0096 0.0488  99  ALA C CA  
2776 C C   . ALA C 104 ? 0.3018 0.1937 0.3701 -0.0225 -0.0083 0.0332  99  ALA C C   
2777 O O   . ALA C 104 ? 0.3007 0.2133 0.3795 -0.0267 -0.0092 0.0288  99  ALA C O   
2778 C CB  . ALA C 104 ? 0.3335 0.2213 0.4028 0.0050  -0.0033 0.0578  99  ALA C CB  
2779 N N   . SER C 105 ? 0.3755 0.2375 0.4316 -0.0254 -0.0068 0.0265  100 SER C N   
2780 C CA  . SER C 105 ? 0.3906 0.2465 0.4469 -0.0315 -0.0050 0.0150  100 SER C CA  
2781 C C   . SER C 105 ? 0.3650 0.1937 0.4106 -0.0231 0.0000  0.0128  100 SER C C   
2782 O O   . SER C 105 ? 0.3584 0.1621 0.3911 -0.0163 0.0017  0.0170  100 SER C O   
2783 C CB  . SER C 105 ? 0.4923 0.3441 0.5431 -0.0454 -0.0078 0.0095  100 SER C CB  
2784 O OG  . SER C 105 ? 0.5640 0.3896 0.5988 -0.0472 -0.0085 0.0129  100 SER C OG  
2785 N N   . PHE C 106 ? 0.3077 0.1405 0.3580 -0.0243 0.0025  0.0061  101 PHE C N   
2786 C CA  . PHE C 106 ? 0.4101 0.2224 0.4493 -0.0174 0.0079  0.0024  101 PHE C CA  
2787 C C   . PHE C 106 ? 0.3889 0.1993 0.4265 -0.0296 0.0079  -0.0049 101 PHE C C   
2788 O O   . PHE C 106 ? 0.4004 0.2329 0.4537 -0.0364 0.0060  -0.0060 101 PHE C O   
2789 C CB  . PHE C 106 ? 0.4348 0.2638 0.4834 -0.0022 0.0122  0.0060  101 PHE C CB  
2790 C CG  . PHE C 106 ? 0.4430 0.2807 0.4959 0.0111  0.0129  0.0169  101 PHE C CG  
2791 C CD1 . PHE C 106 ? 0.4068 0.2766 0.4758 0.0070  0.0079  0.0241  101 PHE C CD1 
2792 C CD2 . PHE C 106 ? 0.4472 0.2610 0.4878 0.0274  0.0187  0.0204  101 PHE C CD2 
2793 C CE1 . PHE C 106 ? 0.4381 0.3220 0.5122 0.0178  0.0081  0.0370  101 PHE C CE1 
2794 C CE2 . PHE C 106 ? 0.4721 0.2971 0.5196 0.0412  0.0199  0.0338  101 PHE C CE2 
2795 C CZ  . PHE C 106 ? 0.4083 0.2716 0.4734 0.0358  0.0144  0.0433  101 PHE C CZ  
2796 N N   . ASN C 107 ? 0.4265 0.2098 0.4446 -0.0332 0.0098  -0.0091 102 ASN C N   
2797 C CA  . ASN C 107 ? 0.3676 0.1528 0.3831 -0.0429 0.0111  -0.0141 102 ASN C CA  
2798 C C   . ASN C 107 ? 0.3734 0.1452 0.3761 -0.0325 0.0173  -0.0189 102 ASN C C   
2799 O O   . ASN C 107 ? 0.4396 0.1789 0.4181 -0.0335 0.0194  -0.0238 102 ASN C O   
2800 C CB  . ASN C 107 ? 0.3885 0.1578 0.3892 -0.0592 0.0077  -0.0146 102 ASN C CB  
2801 C CG  . ASN C 107 ? 0.5274 0.3119 0.5311 -0.0703 0.0077  -0.0157 102 ASN C CG  
2802 O OD1 . ASN C 107 ? 0.3179 0.1140 0.3291 -0.0671 0.0117  -0.0178 102 ASN C OD1 
2803 N ND2 . ASN C 107 ? 0.5695 0.3658 0.5729 -0.0804 0.0028  -0.0116 102 ASN C ND2 
2804 N N   . ALA C 108 ? 0.3902 0.1873 0.4083 -0.0227 0.0203  -0.0175 103 ALA C N   
2805 C CA  . ALA C 108 ? 0.4214 0.2127 0.4296 -0.0078 0.0275  -0.0210 103 ALA C CA  
2806 C C   . ALA C 108 ? 0.4301 0.2295 0.4329 -0.0148 0.0304  -0.0269 103 ALA C C   
2807 O O   . ALA C 108 ? 0.3762 0.2065 0.3983 -0.0233 0.0276  -0.0227 103 ALA C O   
2808 C CB  . ALA C 108 ? 0.3804 0.2006 0.4080 0.0080  0.0290  -0.0131 103 ALA C CB  
2809 N N   . PRO C 109 ? 0.4373 0.2082 0.4128 -0.0118 0.0362  -0.0364 104 PRO C N   
2810 C CA  . PRO C 109 ? 0.4894 0.2732 0.4580 -0.0175 0.0398  -0.0424 104 PRO C CA  
2811 C C   . PRO C 109 ? 0.4855 0.3076 0.4731 -0.0028 0.0438  -0.0376 104 PRO C C   
2812 O O   . PRO C 109 ? 0.5405 0.3630 0.5304 0.0174  0.0484  -0.0353 104 PRO C O   
2813 C CB  . PRO C 109 ? 0.4806 0.2196 0.4120 -0.0145 0.0461  -0.0559 104 PRO C CB  
2814 C CG  . PRO C 109 ? 0.5062 0.2139 0.4315 0.0017  0.0478  -0.0544 104 PRO C CG  
2815 C CD  . PRO C 109 ? 0.4506 0.1745 0.3994 -0.0052 0.0392  -0.0424 104 PRO C CD  
2816 N N   . LEU C 110 ? 0.4228 0.2804 0.4257 -0.0133 0.0418  -0.0336 105 LEU C N   
2817 C CA  . LEU C 110 ? 0.3369 0.2366 0.3602 -0.0031 0.0437  -0.0262 105 LEU C CA  
2818 C C   . LEU C 110 ? 0.4349 0.3378 0.4382 0.0061  0.0528  -0.0352 105 LEU C C   
2819 O O   . LEU C 110 ? 0.4531 0.3465 0.4371 -0.0066 0.0546  -0.0440 105 LEU C O   
2820 C CB  . LEU C 110 ? 0.3328 0.2697 0.3850 -0.0190 0.0364  -0.0152 105 LEU C CB  
2821 C CG  . LEU C 110 ? 0.3485 0.2858 0.4221 -0.0255 0.0286  -0.0075 105 LEU C CG  
2822 C CD1 . LEU C 110 ? 0.3423 0.3053 0.4401 -0.0412 0.0230  0.0014  105 LEU C CD1 
2823 C CD2 . LEU C 110 ? 0.2658 0.2168 0.3536 -0.0116 0.0275  -0.0007 105 LEU C CD2 
2824 N N   . LEU C 111 ? 0.4348 0.3537 0.4419 0.0281  0.0590  -0.0325 106 LEU C N   
2825 C CA  . LEU C 111 ? 0.4685 0.3943 0.4568 0.0413  0.0696  -0.0415 106 LEU C CA  
2826 C C   . LEU C 111 ? 0.4980 0.4837 0.5090 0.0381  0.0681  -0.0309 106 LEU C C   
2827 O O   . LEU C 111 ? 0.4879 0.5086 0.5309 0.0348  0.0604  -0.0145 106 LEU C O   
2828 C CB  . LEU C 111 ? 0.5545 0.4648 0.5329 0.0708  0.0793  -0.0435 106 LEU C CB  
2829 C CG  . LEU C 111 ? 0.6414 0.4918 0.5980 0.0771  0.0816  -0.0518 106 LEU C CG  
2830 C CD1 . LEU C 111 ? 0.6278 0.4646 0.5736 0.1094  0.0939  -0.0535 106 LEU C CD1 
2831 C CD2 . LEU C 111 ? 0.7492 0.5548 0.6735 0.0590  0.0817  -0.0688 106 LEU C CD2 
2832 N N   . ASP C 112 ? 0.5016 0.4996 0.4952 0.0377  0.0750  -0.0400 107 ASP C N   
2833 C CA  . ASP C 112 ? 0.5141 0.5738 0.5291 0.0347  0.0736  -0.0283 107 ASP C CA  
2834 C C   . ASP C 112 ? 0.5533 0.6459 0.5755 0.0612  0.0810  -0.0218 107 ASP C C   
2835 O O   . ASP C 112 ? 0.4796 0.5497 0.4957 0.0823  0.0864  -0.0232 107 ASP C O   
2836 C CB  . ASP C 112 ? 0.4611 0.5323 0.4579 0.0190  0.0764  -0.0377 107 ASP C CB  
2837 C CG  . ASP C 112 ? 0.5523 0.5936 0.5062 0.0328  0.0903  -0.0605 107 ASP C CG  
2838 O OD1 . ASP C 112 ? 0.6130 0.6344 0.5555 0.0595  0.0995  -0.0666 107 ASP C OD1 
2839 O OD2 . ASP C 112 ? 0.6044 0.6424 0.5352 0.0165  0.0923  -0.0722 107 ASP C OD2 
2840 N N   . THR C 113 ? 0.6244 0.7742 0.6608 0.0599  0.0811  -0.0123 108 THR C N   
2841 C CA  . THR C 113 ? 0.6566 0.8501 0.7027 0.0834  0.0875  -0.0025 108 THR C CA  
2842 C C   . THR C 113 ? 0.6927 0.8596 0.7039 0.1120  0.1048  -0.0208 108 THR C C   
2843 O O   . THR C 113 ? 0.6846 0.8673 0.7012 0.1382  0.1117  -0.0134 108 THR C O   
2844 C CB  . THR C 113 ? 0.6168 0.8806 0.6841 0.0736  0.0836  0.0121  108 THR C CB  
2845 O OG1 . THR C 113 ? 0.6828 0.9884 0.7496 0.0990  0.0933  0.0173  108 THR C OG1 
2846 C CG2 . THR C 113 ? 0.5780 0.8407 0.6265 0.0554  0.0855  -0.0006 108 THR C CG2 
2847 N N   . LYS C 114 ? 0.7233 0.8494 0.6984 0.1068  0.1120  -0.0442 109 LYS C N   
2848 C CA  . LYS C 114 ? 0.7337 0.8211 0.6710 0.1330  0.1291  -0.0653 109 LYS C CA  
2849 C C   . LYS C 114 ? 0.6766 0.6860 0.5927 0.1370  0.1306  -0.0778 109 LYS C C   
2850 O O   . LYS C 114 ? 0.6537 0.6113 0.5312 0.1477  0.1421  -0.1001 109 LYS C O   
2851 C CB  . LYS C 114 ? 0.7374 0.8279 0.6424 0.1262  0.1378  -0.0855 109 LYS C CB  
2852 C CG  . LYS C 114 ? 0.7056 0.7936 0.6077 0.0884  0.1267  -0.0884 109 LYS C CG  
2853 C CD  . LYS C 114 ? 0.8353 0.9044 0.6932 0.0803  0.1362  -0.1142 109 LYS C CD  
2854 C CE  . LYS C 114 ? 0.8760 1.0049 0.7304 0.0935  0.1464  -0.1157 109 LYS C CE  
2855 N NZ  . LYS C 114 ? 0.9413 1.0569 0.7519 0.0800  0.1543  -0.1412 109 LYS C NZ  
2856 N N   . LYS C 115 ? 0.6674 0.6689 0.6083 0.1273  0.1185  -0.0631 110 LYS C N   
2857 C CA  . LYS C 115 ? 0.6815 0.6199 0.6097 0.1315  0.1181  -0.0689 110 LYS C CA  
2858 C C   . LYS C 115 ? 0.6897 0.5672 0.5830 0.1123  0.1175  -0.0896 110 LYS C C   
2859 O O   . LYS C 115 ? 0.6677 0.4856 0.5371 0.1217  0.1225  -0.1006 110 LYS C O   
2860 C CB  . LYS C 115 ? 0.7360 0.6580 0.6559 0.1685  0.1316  -0.0692 110 LYS C CB  
2861 C CG  . LYS C 115 ? 0.7821 0.7643 0.7383 0.1852  0.1301  -0.0443 110 LYS C CG  
2862 C CD  . LYS C 115 ? 0.8315 0.8165 0.8157 0.1711  0.1156  -0.0268 110 LYS C CD  
2863 C CE  . LYS C 115 ? 0.8027 0.8586 0.8250 0.1669  0.1068  -0.0027 110 LYS C CE  
2864 N NZ  . LYS C 115 ? 0.7921 0.8750 0.8286 0.1365  0.0950  -0.0003 110 LYS C NZ  
2865 N N   . GLN C 116 ? 0.6704 0.5652 0.5620 0.0843  0.1107  -0.0926 111 GLN C N   
2866 C CA  . GLN C 116 ? 0.7114 0.5588 0.5725 0.0604  0.1078  -0.1084 111 GLN C CA  
2867 C C   . GLN C 116 ? 0.6019 0.4551 0.4865 0.0340  0.0925  -0.0946 111 GLN C C   
2868 O O   . GLN C 116 ? 0.5686 0.4708 0.4899 0.0286  0.0849  -0.0765 111 GLN C O   
2869 C CB  . GLN C 116 ? 0.7796 0.6467 0.6185 0.0471  0.1124  -0.1213 111 GLN C CB  
2870 C CG  . GLN C 116 ? 0.9103 0.7169 0.6966 0.0462  0.1220  -0.1488 111 GLN C CG  
2871 C CD  . GLN C 116 ? 0.9471 0.7365 0.7124 0.0818  0.1393  -0.1628 111 GLN C CD  
2872 O OE1 . GLN C 116 ? 0.9843 0.7859 0.7717 0.1101  0.1435  -0.1510 111 GLN C OE1 
2873 N NE2 . GLN C 116 ? 0.9204 0.6828 0.6418 0.0806  0.1499  -0.1880 111 GLN C NE2 
2874 N N   . PRO C 117 ? 0.6176 0.4203 0.4810 0.0178  0.0881  -0.1026 112 PRO C N   
2875 C CA  . PRO C 117 ? 0.5246 0.3337 0.4081 -0.0060 0.0750  -0.0900 112 PRO C CA  
2876 C C   . PRO C 117 ? 0.5440 0.4010 0.4424 -0.0288 0.0693  -0.0823 112 PRO C C   
2877 O O   . PRO C 117 ? 0.5654 0.4293 0.4418 -0.0381 0.0737  -0.0925 112 PRO C O   
2878 C CB  . PRO C 117 ? 0.5778 0.3259 0.4273 -0.0193 0.0732  -0.1020 112 PRO C CB  
2879 C CG  . PRO C 117 ? 0.6331 0.3346 0.4532 0.0043  0.0845  -0.1173 112 PRO C CG  
2880 C CD  . PRO C 117 ? 0.6333 0.3693 0.4532 0.0218  0.0951  -0.1226 112 PRO C CD  
2881 N N   . THR C 118 ? 0.4914 0.3812 0.4267 -0.0375 0.0602  -0.0643 113 THR C N   
2882 C CA  . THR C 118 ? 0.4905 0.4271 0.4464 -0.0570 0.0548  -0.0527 113 THR C CA  
2883 C C   . THR C 118 ? 0.5076 0.4315 0.4586 -0.0824 0.0478  -0.0495 113 THR C C   
2884 O O   . THR C 118 ? 0.5649 0.5231 0.5269 -0.1007 0.0442  -0.0403 113 THR C O   
2885 C CB  . THR C 118 ? 0.4117 0.3913 0.4124 -0.0517 0.0491  -0.0335 113 THR C CB  
2886 O OG1 . THR C 118 ? 0.4214 0.3791 0.4355 -0.0507 0.0433  -0.0282 113 THR C OG1 
2887 C CG2 . THR C 118 ? 0.3822 0.3855 0.3909 -0.0291 0.0547  -0.0319 113 THR C CG2 
2888 N N   . GLY C 119 ? 0.6070 0.4857 0.5432 -0.0833 0.0456  -0.0548 114 GLY C N   
2889 C CA  . GLY C 119 ? 0.5966 0.4668 0.5306 -0.1057 0.0386  -0.0490 114 GLY C CA  
2890 C C   . GLY C 119 ? 0.4768 0.3621 0.4464 -0.1037 0.0323  -0.0339 114 GLY C C   
2891 O O   . GLY C 119 ? 0.5123 0.3894 0.4831 -0.1167 0.0272  -0.0282 114 GLY C O   
2892 N N   . ALA C 120 ? 0.3534 0.2621 0.3510 -0.0879 0.0329  -0.0274 115 ALA C N   
2893 C CA  . ALA C 120 ? 0.3493 0.2676 0.3775 -0.0849 0.0276  -0.0163 115 ALA C CA  
2894 C C   . ALA C 120 ? 0.3984 0.2833 0.4183 -0.0715 0.0278  -0.0222 115 ALA C C   
2895 O O   . ALA C 120 ? 0.4212 0.2817 0.4193 -0.0594 0.0326  -0.0320 115 ALA C O   
2896 C CB  . ALA C 120 ? 0.3215 0.2802 0.3829 -0.0784 0.0265  -0.0055 115 ALA C CB  
2897 N N   . SER C 121 ? 0.3178 0.2024 0.3552 -0.0729 0.0230  -0.0158 116 SER C N   
2898 C CA  . SER C 121 ? 0.3672 0.2285 0.4006 -0.0618 0.0222  -0.0188 116 SER C CA  
2899 C C   . SER C 121 ? 0.3408 0.2212 0.4030 -0.0591 0.0181  -0.0111 116 SER C C   
2900 O O   . SER C 121 ? 0.3304 0.2312 0.4128 -0.0678 0.0155  -0.0044 116 SER C O   
2901 C CB  . SER C 121 ? 0.4613 0.2896 0.4719 -0.0708 0.0203  -0.0227 116 SER C CB  
2902 O OG  . SER C 121 ? 0.4813 0.3219 0.5035 -0.0849 0.0160  -0.0157 116 SER C OG  
2903 N N   . LEU C 122 ? 0.3307 0.2037 0.3943 -0.0474 0.0177  -0.0117 117 LEU C N   
2904 C CA  . LEU C 122 ? 0.2489 0.1382 0.3355 -0.0467 0.0134  -0.0064 117 LEU C CA  
2905 C C   . LEU C 122 ? 0.3285 0.2006 0.4083 -0.0454 0.0111  -0.0082 117 LEU C C   
2906 O O   . LEU C 122 ? 0.2951 0.1512 0.3606 -0.0363 0.0128  -0.0097 117 LEU C O   
2907 C CB  . LEU C 122 ? 0.2569 0.1692 0.3573 -0.0364 0.0137  -0.0015 117 LEU C CB  
2908 C CG  . LEU C 122 ? 0.2888 0.2150 0.4086 -0.0379 0.0084  0.0031  117 LEU C CG  
2909 C CD1 . LEU C 122 ? 0.3043 0.2449 0.4455 -0.0493 0.0048  0.0068  117 LEU C CD1 
2910 C CD2 . LEU C 122 ? 0.3259 0.2717 0.4519 -0.0268 0.0084  0.0093  117 LEU C CD2 
2911 N N   . VAL C 123 ? 0.3134 0.1901 0.4041 -0.0538 0.0078  -0.0074 118 VAL C N   
2912 C CA  . VAL C 123 ? 0.2949 0.1620 0.3801 -0.0543 0.0054  -0.0089 118 VAL C CA  
2913 C C   . VAL C 123 ? 0.3003 0.1836 0.4010 -0.0516 0.0025  -0.0077 118 VAL C C   
2914 O O   . VAL C 123 ? 0.2386 0.1349 0.3561 -0.0564 0.0010  -0.0076 118 VAL C O   
2915 C CB  . VAL C 123 ? 0.3373 0.2021 0.4188 -0.0642 0.0043  -0.0094 118 VAL C CB  
2916 C CG1 . VAL C 123 ? 0.3004 0.1628 0.3787 -0.0648 0.0018  -0.0107 118 VAL C CG1 
2917 C CG2 . VAL C 123 ? 0.2568 0.1077 0.3178 -0.0698 0.0050  -0.0088 118 VAL C CG2 
2918 N N   . LEU C 124 ? 0.2741 0.1559 0.3685 -0.0449 0.0015  -0.0059 119 LEU C N   
2919 C CA  . LEU C 124 ? 0.2371 0.1369 0.3426 -0.0451 -0.0021 -0.0038 119 LEU C CA  
2920 C C   . LEU C 124 ? 0.2477 0.1443 0.3432 -0.0423 -0.0036 -0.0013 119 LEU C C   
2921 O O   . LEU C 124 ? 0.2620 0.1412 0.3436 -0.0370 -0.0016 0.0008  119 LEU C O   
2922 C CB  . LEU C 124 ? 0.2333 0.1521 0.3492 -0.0383 -0.0021 0.0027  119 LEU C CB  
2923 C CG  . LEU C 124 ? 0.3346 0.2527 0.4419 -0.0233 0.0017  0.0089  119 LEU C CG  
2924 C CD1 . LEU C 124 ? 0.3468 0.2950 0.4673 -0.0179 0.0001  0.0184  119 LEU C CD1 
2925 C CD2 . LEU C 124 ? 0.2863 0.1882 0.3826 -0.0174 0.0074  0.0054  119 LEU C CD2 
2926 N N   . GLN C 125 ? 0.2950 0.2080 0.3967 -0.0474 -0.0075 -0.0010 120 GLN C N   
2927 C CA  . GLN C 125 ? 0.3458 0.2649 0.4411 -0.0448 -0.0094 0.0051  120 GLN C CA  
2928 C C   . GLN C 125 ? 0.3290 0.2759 0.4341 -0.0458 -0.0130 0.0115  120 GLN C C   
2929 O O   . GLN C 125 ? 0.2485 0.2074 0.3634 -0.0536 -0.0157 0.0079  120 GLN C O   
2930 C CB  . GLN C 125 ? 0.3545 0.2691 0.4418 -0.0534 -0.0113 0.0004  120 GLN C CB  
2931 C CG  . GLN C 125 ? 0.4037 0.3350 0.4961 -0.0642 -0.0143 -0.0068 120 GLN C CG  
2932 C CD  . GLN C 125 ? 0.2547 0.2089 0.3462 -0.0673 -0.0184 -0.0008 120 GLN C CD  
2933 O OE1 . GLN C 125 ? 0.3346 0.3066 0.4324 -0.0737 -0.0215 -0.0021 120 GLN C OE1 
2934 N NE2 . GLN C 125 ? 0.3426 0.2977 0.4263 -0.0644 -0.0192 0.0074  120 GLN C NE2 
2935 N N   . VAL C 126 ? 0.2577 0.2150 0.3603 -0.0386 -0.0134 0.0227  121 VAL C N   
2936 C CA  . VAL C 126 ? 0.2782 0.2670 0.3901 -0.0374 -0.0163 0.0341  121 VAL C CA  
2937 C C   . VAL C 126 ? 0.3143 0.3195 0.4228 -0.0410 -0.0196 0.0421  121 VAL C C   
2938 O O   . VAL C 126 ? 0.2720 0.2625 0.3726 -0.0358 -0.0179 0.0452  121 VAL C O   
2939 C CB  . VAL C 126 ? 0.3123 0.3045 0.4279 -0.0189 -0.0112 0.0458  121 VAL C CB  
2940 C CG1 . VAL C 126 ? 0.3090 0.3408 0.4358 -0.0169 -0.0140 0.0615  121 VAL C CG1 
2941 C CG2 . VAL C 126 ? 0.3318 0.3113 0.4495 -0.0158 -0.0077 0.0383  121 VAL C CG2 
2942 N N   . SER C 127 ? 0.2601 0.2974 0.3744 -0.0519 -0.0251 0.0465  122 SER C N   
2943 C CA  . SER C 127 ? 0.2660 0.3277 0.3783 -0.0569 -0.0287 0.0567  122 SER C CA  
2944 C C   . SER C 127 ? 0.2653 0.3694 0.3860 -0.0645 -0.0339 0.0694  122 SER C C   
2945 O O   . SER C 127 ? 0.2606 0.3736 0.3869 -0.0714 -0.0365 0.0665  122 SER C O   
2946 C CB  . SER C 127 ? 0.2672 0.3234 0.3696 -0.0722 -0.0314 0.0424  122 SER C CB  
2947 O OG  . SER C 127 ? 0.3027 0.3665 0.4046 -0.0886 -0.0351 0.0287  122 SER C OG  
2948 N N   . TYR C 128 ? 0.2709 0.4036 0.3931 -0.0645 -0.0361 0.0858  123 TYR C N   
2949 C CA  . TYR C 128 ? 0.2978 0.4776 0.4261 -0.0767 -0.0424 0.0993  123 TYR C CA  
2950 C C   . TYR C 128 ? 0.3416 0.5354 0.4594 -0.1004 -0.0487 0.0883  123 TYR C C   
2951 O O   . TYR C 128 ? 0.3606 0.5497 0.4718 -0.1007 -0.0480 0.0867  123 TYR C O   
2952 C CB  . TYR C 128 ? 0.3272 0.5370 0.4655 -0.0615 -0.0405 0.1280  123 TYR C CB  
2953 C CG  . TYR C 128 ? 0.4532 0.6575 0.6014 -0.0368 -0.0334 0.1404  123 TYR C CG  
2954 C CD1 . TYR C 128 ? 0.5255 0.6868 0.6699 -0.0159 -0.0250 0.1354  123 TYR C CD1 
2955 C CD2 . TYR C 128 ? 0.5404 0.7844 0.7004 -0.0350 -0.0350 0.1574  123 TYR C CD2 
2956 C CE1 . TYR C 128 ? 0.5851 0.7405 0.7357 0.0073  -0.0172 0.1442  123 TYR C CE1 
2957 C CE2 . TYR C 128 ? 0.6070 0.8499 0.7756 -0.0105 -0.0272 0.1686  123 TYR C CE2 
2958 C CZ  . TYR C 128 ? 0.6470 0.8443 0.8102 0.0113  -0.0178 0.1606  123 TYR C CZ  
2959 O OH  . TYR C 128 ? 0.6921 0.8875 0.8610 0.0364  -0.0089 0.1692  123 TYR C OH  
2960 N N   . THR C 129 ? 0.3275 0.5385 0.4424 -0.1211 -0.0551 0.0805  124 THR C N   
2961 C CA  . THR C 129 ? 0.4084 0.6323 0.5099 -0.1444 -0.0603 0.0673  124 THR C CA  
2962 C C   . THR C 129 ? 0.4534 0.7209 0.5539 -0.1663 -0.0690 0.0761  124 THR C C   
2963 O O   . THR C 129 ? 0.4683 0.7493 0.5781 -0.1669 -0.0718 0.0871  124 THR C O   
2964 C CB  . THR C 129 ? 0.4646 0.6480 0.5545 -0.1525 -0.0584 0.0365  124 THR C CB  
2965 O OG1 . THR C 129 ? 0.5457 0.7092 0.6420 -0.1521 -0.0586 0.0302  124 THR C OG1 
2966 C CG2 . THR C 129 ? 0.5504 0.7019 0.6379 -0.1369 -0.0514 0.0293  124 THR C CG2 
2967 N N   . ALA C 130 ? 0.4990 0.7917 0.5874 -0.1858 -0.0736 0.0720  125 ALA C N   
2968 C CA  . ALA C 130 ? 0.5305 0.8636 0.6124 -0.2128 -0.0829 0.0762  125 ALA C CA  
2969 C C   . ALA C 130 ? 0.6368 0.9390 0.7078 -0.2303 -0.0861 0.0502  125 ALA C C   
2970 O O   . ALA C 130 ? 0.6460 0.9033 0.7082 -0.2272 -0.0811 0.0241  125 ALA C O   
2971 C CB  . ALA C 130 ? 0.5576 0.9234 0.6265 -0.2299 -0.0863 0.0753  125 ALA C CB  
2972 N N   . ALA C 131 ? 0.6957 1.0148 0.7641 -0.2429 -0.0921 0.0587  126 ALA C N   
2973 C CA  . ALA C 131 ? 0.7110 0.9931 0.7675 -0.2543 -0.0937 0.0374  126 ALA C CA  
2974 C C   . ALA C 131 ? 0.7160 0.9740 0.7463 -0.2692 -0.0922 0.0081  126 ALA C C   
2975 O O   . ALA C 131 ? 0.7281 0.9408 0.7512 -0.2713 -0.0900 -0.0162 126 ALA C O   
2976 C CB  . ALA C 131 ? 0.7077 1.0154 0.7641 -0.2638 -0.1002 0.0563  126 ALA C CB  
2977 N N   . GLU D 4   ? 0.8833 0.6941 0.7772 0.1136  0.0556  -0.2497 -1  GLU D N   
2978 C CA  . GLU D 4   ? 0.8189 0.6848 0.8033 0.0961  0.0281  -0.2611 -1  GLU D CA  
2979 C C   . GLU D 4   ? 0.7369 0.6128 0.7487 0.0812  0.0336  -0.2362 -1  GLU D C   
2980 O O   . GLU D 4   ? 0.7187 0.6231 0.7488 0.0820  0.0085  -0.2449 -1  GLU D O   
2981 C CB  . GLU D 4   ? 0.8183 0.7126 0.8985 0.0704  0.0355  -0.2706 -1  GLU D CB  
2982 C CG  . GLU D 4   ? 0.8921 0.8234 1.0122 0.0749  0.0057  -0.3096 -1  GLU D CG  
2983 C CD  . GLU D 4   ? 0.8780 0.8423 1.1083 0.0441  0.0161  -0.3156 -1  GLU D CD  
2984 O OE1 . GLU D 4   ? 0.9305 0.8900 1.1753 0.0429  0.0240  -0.3271 -1  GLU D OE1 
2985 O OE2 . GLU D 4   ? 0.8131 0.8035 1.1108 0.0220  0.0199  -0.3075 -1  GLU D OE2 
2986 N N   . PHE D 5   ? 0.6963 0.5523 0.7152 0.0653  0.0668  -0.2016 0   PHE D N   
2987 C CA  . PHE D 5   ? 0.6407 0.5110 0.6916 0.0452  0.0702  -0.1673 0   PHE D CA  
2988 C C   . PHE D 5   ? 0.6128 0.4576 0.5889 0.0586  0.0748  -0.1410 0   PHE D C   
2989 O O   . PHE D 5   ? 0.6378 0.4415 0.5429 0.0751  0.0936  -0.1344 0   PHE D O   
2990 C CB  . PHE D 5   ? 0.6486 0.5201 0.7649 0.0180  0.0943  -0.1407 0   PHE D CB  
2991 C CG  . PHE D 5   ? 0.6845 0.5803 0.8815 -0.0023 0.0883  -0.1497 0   PHE D CG  
2992 C CD1 . PHE D 5   ? 0.6901 0.5913 0.9266 -0.0077 0.0918  -0.1674 0   PHE D CD1 
2993 C CD2 . PHE D 5   ? 0.6771 0.5889 0.9027 -0.0166 0.0819  -0.1358 0   PHE D CD2 
2994 C CE1 . PHE D 5   ? 0.6813 0.6035 0.9823 -0.0263 0.0910  -0.1674 0   PHE D CE1 
2995 C CE2 . PHE D 5   ? 0.6621 0.5877 0.9493 -0.0353 0.0851  -0.1385 0   PHE D CE2 
2996 C CZ  . PHE D 5   ? 0.6564 0.5890 0.9781 -0.0386 0.0903  -0.1514 0   PHE D CZ  
2997 N N   . MET D 6   ? 0.6031 0.4678 0.5956 0.0505  0.0623  -0.1264 1   MET D N   
2998 C CA  . MET D 6   ? 0.5608 0.4026 0.4918 0.0615  0.0660  -0.1023 1   MET D CA  
2999 C C   . MET D 6   ? 0.4728 0.3327 0.4525 0.0372  0.0728  -0.0721 1   MET D C   
3000 O O   . MET D 6   ? 0.4312 0.3219 0.4743 0.0186  0.0646  -0.0737 1   MET D O   
3001 C CB  . MET D 6   ? 0.4528 0.2974 0.3327 0.0893  0.0320  -0.1248 1   MET D CB  
3002 C CG  . MET D 6   ? 0.5514 0.3774 0.3723 0.1229  0.0124  -0.1619 1   MET D CG  
3003 S SD  . MET D 6   ? 1.4340 1.2714 1.2087 0.1540  -0.0348 -0.1786 1   MET D SD  
3004 C CE  . MET D 6   ? 0.9466 0.8402 0.8200 0.1299  -0.0475 -0.1883 1   MET D CE  
3005 N N   . LEU D 7   ? 0.3866 0.2217 0.3329 0.0384  0.0903  -0.0460 2   LEU D N   
3006 C CA  . LEU D 7   ? 0.3493 0.2004 0.3283 0.0225  0.0894  -0.0228 2   LEU D CA  
3007 C C   . LEU D 7   ? 0.3329 0.1845 0.2677 0.0371  0.0705  -0.0238 2   LEU D C   
3008 O O   . LEU D 7   ? 0.4413 0.2567 0.3067 0.0573  0.0768  -0.0199 2   LEU D O   
3009 C CB  . LEU D 7   ? 0.3681 0.1981 0.3565 0.0139  0.1179  -0.0009 2   LEU D CB  
3010 C CG  . LEU D 7   ? 0.3269 0.1764 0.3562 -0.0005 0.1115  0.0176  2   LEU D CG  
3011 C CD1 . LEU D 7   ? 0.2926 0.1656 0.3843 -0.0154 0.1012  0.0195  2   LEU D CD1 
3012 C CD2 . LEU D 7   ? 0.2980 0.1346 0.3314 -0.0024 0.1331  0.0283  2   LEU D CD2 
3013 N N   . ARG D 8   ? 0.2945 0.1815 0.2672 0.0280  0.0506  -0.0293 3   ARG D N   
3014 C CA  . ARG D 8   ? 0.3353 0.2300 0.2804 0.0413  0.0305  -0.0352 3   ARG D CA  
3015 C C   . ARG D 8   ? 0.3082 0.2099 0.2711 0.0265  0.0367  -0.0100 3   ARG D C   
3016 O O   . ARG D 8   ? 0.2840 0.2049 0.2962 0.0056  0.0409  -0.0009 3   ARG D O   
3017 C CB  . ARG D 8   ? 0.3283 0.2609 0.3114 0.0423  0.0061  -0.0689 3   ARG D CB  
3018 C CG  . ARG D 8   ? 0.4148 0.3618 0.3817 0.0589  -0.0187 -0.0841 3   ARG D CG  
3019 C CD  . ARG D 8   ? 0.4828 0.4710 0.5032 0.0612  -0.0414 -0.1292 3   ARG D CD  
3020 N NE  . ARG D 8   ? 0.4945 0.5093 0.5939 0.0269  -0.0221 -0.1292 3   ARG D NE  
3021 C CZ  . ARG D 8   ? 0.4704 0.5106 0.6319 0.0178  -0.0236 -0.1641 3   ARG D CZ  
3022 N NH1 . ARG D 8   ? 0.4452 0.4967 0.6054 0.0420  -0.0506 -0.2071 3   ARG D NH1 
3023 N NH2 . ARG D 8   ? 0.4077 0.4567 0.6294 -0.0135 0.0024  -0.1576 3   ARG D NH2 
3024 N N   . VAL D 9   ? 0.2908 0.1702 0.2071 0.0401  0.0374  0.0007  4   VAL D N   
3025 C CA  . VAL D 9   ? 0.2928 0.1774 0.2245 0.0287  0.0420  0.0203  4   VAL D CA  
3026 C C   . VAL D 9   ? 0.2750 0.1633 0.1785 0.0436  0.0234  0.0138  4   VAL D C   
3027 O O   . VAL D 9   ? 0.3279 0.1866 0.1720 0.0693  0.0167  0.0077  4   VAL D O   
3028 C CB  . VAL D 9   ? 0.3006 0.1512 0.2209 0.0258  0.0693  0.0402  4   VAL D CB  
3029 C CG1 . VAL D 9   ? 0.2644 0.1217 0.2023 0.0177  0.0694  0.0531  4   VAL D CG1 
3030 C CG2 . VAL D 9   ? 0.3641 0.2173 0.3279 0.0110  0.0853  0.0430  4   VAL D CG2 
3031 N N   . PHE D 10  ? 0.2645 0.1839 0.2045 0.0304  0.0151  0.0145  5   PHE D N   
3032 C CA  . PHE D 10  ? 0.2951 0.2207 0.2184 0.0424  -0.0002 0.0083  5   PHE D CA  
3033 C C   . PHE D 10  ? 0.3066 0.2223 0.2315 0.0336  0.0111  0.0301  5   PHE D C   
3034 O O   . PHE D 10  ? 0.2649 0.1990 0.2268 0.0144  0.0159  0.0386  5   PHE D O   
3035 C CB  . PHE D 10  ? 0.2159 0.1853 0.1832 0.0347  -0.0149 -0.0147 5   PHE D CB  
3036 C CG  . PHE D 10  ? 0.2271 0.2136 0.2118 0.0424  -0.0277 -0.0457 5   PHE D CG  
3037 C CD1 . PHE D 10  ? 0.2628 0.2508 0.2237 0.0720  -0.0552 -0.0744 5   PHE D CD1 
3038 C CD2 . PHE D 10  ? 0.2086 0.2071 0.2345 0.0229  -0.0151 -0.0495 5   PHE D CD2 
3039 C CE1 . PHE D 10  ? 0.2758 0.2841 0.2610 0.0817  -0.0724 -0.1113 5   PHE D CE1 
3040 C CE2 . PHE D 10  ? 0.2351 0.2513 0.2873 0.0286  -0.0262 -0.0832 5   PHE D CE2 
3041 C CZ  . PHE D 10  ? 0.2587 0.2833 0.2943 0.0578  -0.0562 -0.1167 5   PHE D CZ  
3042 N N   . ILE D 11  ? 0.3408 0.2211 0.2214 0.0501  0.0156  0.0377  6   ILE D N   
3043 C CA  . ILE D 11  ? 0.3017 0.1735 0.1900 0.0435  0.0249  0.0515  6   ILE D CA  
3044 C C   . ILE D 11  ? 0.2778 0.1709 0.1659 0.0515  0.0037  0.0401  6   ILE D C   
3045 O O   . ILE D 11  ? 0.3739 0.2469 0.2203 0.0758  -0.0086 0.0321  6   ILE D O   
3046 C CB  . ILE D 11  ? 0.4042 0.2314 0.2570 0.0527  0.0458  0.0589  6   ILE D CB  
3047 C CG1 . ILE D 11  ? 0.4048 0.2164 0.2559 0.0483  0.0672  0.0596  6   ILE D CG1 
3048 C CG2 . ILE D 11  ? 0.3326 0.1685 0.2204 0.0391  0.0544  0.0622  6   ILE D CG2 
3049 C CD1 . ILE D 11  ? 0.4709 0.3099 0.3864 0.0250  0.0773  0.0604  6   ILE D CD1 
3050 N N   . LEU D 12  ? 0.2975 0.2267 0.2274 0.0340  -0.0008 0.0380  7   LEU D N   
3051 C CA  . LEU D 12  ? 0.2524 0.2068 0.1908 0.0384  -0.0165 0.0231  7   LEU D CA  
3052 C C   . LEU D 12  ? 0.2833 0.2215 0.2101 0.0445  -0.0157 0.0298  7   LEU D C   
3053 O O   . LEU D 12  ? 0.3414 0.2621 0.2392 0.0658  -0.0260 0.0231  7   LEU D O   
3054 C CB  . LEU D 12  ? 0.1754 0.1665 0.1528 0.0177  -0.0147 0.0169  7   LEU D CB  
3055 C CG  . LEU D 12  ? 0.1833 0.1865 0.1776 0.0118  -0.0125 0.0066  7   LEU D CG  
3056 C CD1 . LEU D 12  ? 0.2367 0.2581 0.2599 -0.0097 -0.0002 0.0062  7   LEU D CD1 
3057 C CD2 . LEU D 12  ? 0.2201 0.2357 0.2146 0.0306  -0.0302 -0.0220 7   LEU D CD2 
3058 N N   . TYR D 13  ? 0.2659 0.2070 0.2152 0.0288  -0.0060 0.0406  8   TYR D N   
3059 C CA  . TYR D 13  ? 0.3116 0.2407 0.2616 0.0319  -0.0044 0.0425  8   TYR D CA  
3060 C C   . TYR D 13  ? 0.3002 0.2279 0.2817 0.0173  0.0054  0.0495  8   TYR D C   
3061 O O   . TYR D 13  ? 0.2485 0.1897 0.2495 0.0064  0.0052  0.0524  8   TYR D O   
3062 C CB  . TYR D 13  ? 0.2378 0.1973 0.1974 0.0334  -0.0192 0.0273  8   TYR D CB  
3063 C CG  . TYR D 13  ? 0.2618 0.2544 0.2438 0.0161  -0.0201 0.0232  8   TYR D CG  
3064 C CD1 . TYR D 13  ? 0.2863 0.2830 0.2787 0.0075  -0.0202 0.0264  8   TYR D CD1 
3065 C CD2 . TYR D 13  ? 0.3251 0.3385 0.3142 0.0104  -0.0195 0.0142  8   TYR D CD2 
3066 C CE1 . TYR D 13  ? 0.2847 0.2963 0.2758 -0.0025 -0.0200 0.0256  8   TYR D CE1 
3067 C CE2 . TYR D 13  ? 0.3153 0.3429 0.3123 -0.0048 -0.0115 0.0142  8   TYR D CE2 
3068 C CZ  . TYR D 13  ? 0.3257 0.3477 0.3144 -0.0093 -0.0120 0.0223  8   TYR D CZ  
3069 O OH  . TYR D 13  ? 0.2637 0.2852 0.2393 -0.0188 -0.0033 0.0250  8   TYR D OH  
3070 N N   . ALA D 14  ? 0.3318 0.2420 0.3221 0.0195  0.0121  0.0487  9   ALA D N   
3071 C CA  . ALA D 14  ? 0.3104 0.2281 0.3453 0.0081  0.0146  0.0439  9   ALA D CA  
3072 C C   . ALA D 14  ? 0.2472 0.1841 0.2912 0.0096  -0.0005 0.0314  9   ALA D C   
3073 O O   . ALA D 14  ? 0.3037 0.2353 0.3248 0.0193  -0.0036 0.0287  9   ALA D O   
3074 C CB  . ALA D 14  ? 0.2795 0.1586 0.3333 0.0058  0.0427  0.0471  9   ALA D CB  
3075 N N   . GLU D 15  ? 0.8256 0.6450 0.4667 -0.0429 -0.3384 -0.0278 10  GLU D N   
3076 C CA  . GLU D 15  ? 0.8722 0.7214 0.4864 -0.0726 -0.3393 -0.0706 10  GLU D CA  
3077 C C   . GLU D 15  ? 0.9762 0.7667 0.5401 -0.1162 -0.3508 -0.1122 10  GLU D C   
3078 O O   . GLU D 15  ? 1.2275 0.9507 0.7484 -0.1208 -0.3454 -0.1572 10  GLU D O   
3079 C CB  . GLU D 15  ? 0.8276 0.8027 0.4801 -0.0893 -0.3316 -0.0691 10  GLU D CB  
3080 C CG  . GLU D 15  ? 1.3828 1.3733 1.0559 -0.0630 -0.3274 -0.0475 10  GLU D CG  
3081 C CD  . GLU D 15  ? 1.3787 1.4578 1.0628 -0.0756 -0.3300 -0.0561 10  GLU D CD  
3082 O OE1 . GLU D 15  ? 1.3085 1.4180 1.0166 -0.0717 -0.3333 -0.0249 10  GLU D OE1 
3083 O OE2 . GLU D 15  ? 1.4366 1.5453 1.1044 -0.0858 -0.3295 -0.0959 10  GLU D OE2 
3084 N N   . ASN D 16  ? 0.9849 0.8017 0.5599 -0.1509 -0.3573 -0.1044 11  ASN D N   
3085 C CA  . ASN D 16  ? 1.0788 0.8655 0.6272 -0.2081 -0.3547 -0.1560 11  ASN D CA  
3086 C C   . ASN D 16  ? 1.1349 0.8175 0.6564 -0.2259 -0.3640 -0.1430 11  ASN D C   
3087 O O   . ASN D 16  ? 1.1598 0.8840 0.6986 -0.2773 -0.3592 -0.1589 11  ASN D O   
3088 C CB  . ASN D 16  ? 1.0581 0.9849 0.6499 -0.2410 -0.3526 -0.1762 11  ASN D CB  
3089 C CG  . ASN D 16  ? 1.1086 1.0620 0.6986 -0.2589 -0.3442 -0.2410 11  ASN D CG  
3090 O OD1 . ASN D 16  ? 1.1946 1.1194 0.7759 -0.3056 -0.3348 -0.2926 11  ASN D OD1 
3091 N ND2 . ASN D 16  ? 1.0604 1.0627 0.6627 -0.2215 -0.3449 -0.2383 11  ASN D ND2 
3092 N N   . VAL D 17  ? 1.1584 0.7074 0.6401 -0.1765 -0.3779 -0.1170 12  VAL D N   
3093 C CA  . VAL D 17  ? 1.2173 0.6511 0.6723 -0.1832 -0.3875 -0.1044 12  VAL D CA  
3094 C C   . VAL D 17  ? 1.6026 0.9264 1.0465 -0.2234 -0.3320 -0.1686 12  VAL D C   
3095 O O   . VAL D 17  ? 1.4038 0.6368 0.8332 -0.1884 -0.2896 -0.1984 12  VAL D O   
3096 C CB  . VAL D 17  ? 1.1844 0.5449 0.6310 -0.0932 -0.4022 -0.0473 12  VAL D CB  
3097 C CG1 . VAL D 17  ? 1.0980 0.5294 0.5643 -0.0403 -0.4115 -0.0293 12  VAL D CG1 
3098 C CG2 . VAL D 17  ? 1.2683 0.4882 0.7125 -0.0410 -0.3410 -0.0511 12  VAL D CG2 
3099 N N   . HIS D 18  ? 1.3741 0.7259 0.8403 -0.2971 -0.3209 -0.1903 13  HIS D N   
3100 C CA  . HIS D 18  ? 1.6966 0.9598 1.1783 -0.3424 -0.2520 -0.2541 13  HIS D CA  
3101 C C   . HIS D 18  ? 1.7009 0.8982 1.2157 -0.3436 -0.2241 -0.2228 13  HIS D C   
3102 O O   . HIS D 18  ? 1.6287 0.9110 1.1581 -0.3732 -0.2629 -0.1900 13  HIS D O   
3103 C CB  . HIS D 18  ? 1.7319 1.1460 1.2587 -0.4147 -0.2383 -0.3176 13  HIS D CB  
3104 C CG  . HIS D 18  ? 1.7797 1.2387 1.3034 -0.4025 -0.2323 -0.3586 13  HIS D CG  
3105 N ND1 . HIS D 18  ? 1.7467 1.3787 1.2956 -0.4112 -0.2643 -0.3617 13  HIS D ND1 
3106 C CD2 . HIS D 18  ? 1.8646 1.2146 1.3678 -0.3734 -0.1938 -0.3930 13  HIS D CD2 
3107 C CE1 . HIS D 18  ? 1.7812 1.4080 1.3223 -0.3947 -0.2531 -0.3979 13  HIS D CE1 
3108 N NE2 . HIS D 18  ? 1.8529 1.3173 1.3664 -0.3748 -0.2114 -0.4197 13  HIS D NE2 
3109 N N   . THR D 19  ? 1.8012 0.8464 1.3288 -0.3050 -0.1539 -0.2271 14  THR D N   
3110 C CA  . THR D 19  ? 1.8763 0.8390 1.4388 -0.3027 -0.1124 -0.2001 14  THR D CA  
3111 C C   . THR D 19  ? 2.0274 0.9009 1.6256 -0.3520 -0.0245 -0.2745 14  THR D C   
3112 O O   . THR D 19  ? 2.0857 0.8714 1.6941 -0.2975 0.0306  -0.2824 14  THR D O   
3113 C CB  . THR D 19  ? 1.9002 0.7697 1.4572 -0.1894 -0.1016 -0.1185 14  THR D CB  
3114 O OG1 . THR D 19  ? 2.0235 0.7633 1.6189 -0.1687 -0.0149 -0.1170 14  THR D OG1 
3115 C CG2 . THR D 19  ? 1.8805 0.7438 1.3999 -0.1112 -0.1173 -0.1054 14  THR D CG2 
3116 N N   . PRO D 20  ? 2.0594 1.0150 1.7059 -0.4391 -0.0149 -0.3209 15  PRO D N   
3117 C CA  . PRO D 20  ? 2.1718 1.1305 1.8790 -0.4928 0.0492  -0.3932 15  PRO D CA  
3118 C C   . PRO D 20  ? 2.2411 1.0912 2.0019 -0.4810 0.1196  -0.3758 15  PRO D C   
3119 O O   . PRO D 20  ? 2.1928 0.9903 1.9543 -0.4370 0.1132  -0.3063 15  PRO D O   
3120 C CB  . PRO D 20  ? 2.1382 1.2861 1.8591 -0.5783 0.0002  -0.4328 15  PRO D CB  
3121 C CG  . PRO D 20  ? 2.0083 1.2578 1.6817 -0.5620 -0.0857 -0.3796 15  PRO D CG  
3122 C CD  . PRO D 20  ? 1.9827 1.0868 1.6197 -0.4904 -0.0885 -0.3030 15  PRO D CD  
3123 N N   . ASP D 21  ? 2.3655 1.1890 2.1706 -0.5159 0.1879  -0.4350 16  ASP D N   
3124 C CA  . ASP D 21  ? 2.4192 1.2936 2.2199 -0.5508 0.1996  -0.5076 16  ASP D CA  
3125 C C   . ASP D 21  ? 2.5007 1.2462 2.3001 -0.4833 0.2607  -0.4998 16  ASP D C   
3126 O O   . ASP D 21  ? 2.5755 1.3097 2.3976 -0.5096 0.3133  -0.5584 16  ASP D O   
3127 C CB  . ASP D 21  ? 2.4940 1.4548 2.3409 -0.6414 0.2310  -0.5856 16  ASP D CB  
3128 C CG  . ASP D 21  ? 2.6014 1.4619 2.5067 -0.6491 0.3171  -0.5928 16  ASP D CG  
3129 O OD1 . ASP D 21  ? 2.6461 1.3730 2.5568 -0.5773 0.3542  -0.5310 16  ASP D OD1 
3130 O OD2 . ASP D 21  ? 2.6414 1.5678 2.5890 -0.7231 0.3500  -0.6586 16  ASP D OD2 
3131 N N   . THR D 22  ? 2.4947 1.1607 2.2667 -0.3923 0.2498  -0.4230 17  THR D N   
3132 C CA  . THR D 22  ? 2.5790 1.1512 2.3426 -0.3079 0.2928  -0.3950 17  THR D CA  
3133 C C   . THR D 22  ? 2.5274 1.1414 2.2294 -0.2641 0.2238  -0.3737 17  THR D C   
3134 O O   . THR D 22  ? 2.4433 1.1257 2.1129 -0.2806 0.1543  -0.3552 17  THR D O   
3135 C CB  . THR D 22  ? 2.6094 1.0983 2.3940 -0.2261 0.3284  -0.3121 17  THR D CB  
3136 O OG1 . THR D 22  ? 2.2837 0.7630 2.1161 -0.2779 0.3629  -0.3217 17  THR D OG1 
3137 C CG2 . THR D 22  ? 2.3185 0.7309 2.1146 -0.1562 0.3947  -0.2926 17  THR D CG2 
3138 N N   . ASP D 23  ? 2.5574 1.1349 2.2421 -0.2080 0.2440  -0.3739 18  ASP D N   
3139 C CA  . ASP D 23  ? 2.4707 1.0962 2.0981 -0.1711 0.1824  -0.3630 18  ASP D CA  
3140 C C   . ASP D 23  ? 2.3750 0.9753 1.9851 -0.0656 0.1637  -0.2699 18  ASP D C   
3141 O O   . ASP D 23  ? 2.3210 0.9465 1.8931 -0.0026 0.1336  -0.2445 18  ASP D O   
3142 C CB  . ASP D 23  ? 2.5078 1.1364 2.1237 -0.1676 0.2014  -0.4128 18  ASP D CB  
3143 C CG  . ASP D 23  ? 2.5742 1.1123 2.2105 -0.0862 0.2687  -0.3791 18  ASP D CG  
3144 O OD1 . ASP D 23  ? 2.5557 1.0669 2.1949 -0.0035 0.2724  -0.3026 18  ASP D OD1 
3145 O OD2 . ASP D 23  ? 2.6381 1.1512 2.2889 -0.1047 0.3152  -0.4262 18  ASP D OD2 
3146 N N   . ILE D 24  ? 2.3529 0.9260 1.9985 -0.0483 0.1816  -0.2202 19  ILE D N   
3147 C CA  . ILE D 24  ? 1.9217 0.5151 1.5717 0.0425  0.1617  -0.1316 19  ILE D CA  
3148 C C   . ILE D 24  ? 2.0621 0.7323 1.6610 0.0546  0.0796  -0.1026 19  ILE D C   
3149 O O   . ILE D 24  ? 2.0375 0.7311 1.5989 -0.0185 0.0317  -0.1320 19  ILE D O   
3150 C CB  . ILE D 24  ? 1.9546 0.5221 1.6552 0.0460  0.1929  -0.0907 19  ILE D CB  
3151 C CG1 . ILE D 24  ? 2.0324 0.5617 1.7583 -0.0571 0.2254  -0.1519 19  ILE D CG1 
3152 C CG2 . ILE D 24  ? 2.0155 0.5557 1.7441 0.1235  0.2472  -0.0462 19  ILE D CG2 
3153 C CD1 . ILE D 24  ? 2.1165 0.5934 1.8936 -0.0529 0.2877  -0.1290 19  ILE D CD1 
3154 N N   . SER D 25  ? 1.9643 0.6959 1.5619 0.1423  0.0592  -0.0456 20  SER D N   
3155 C CA  . SER D 25  ? 1.8422 0.6699 1.4079 0.1653  -0.0139 -0.0075 20  SER D CA  
3156 C C   . SER D 25  ? 1.8160 0.7480 1.4276 0.2463  -0.0122 0.0524  20  SER D C   
3157 O O   . SER D 25  ? 1.9261 0.8718 1.5418 0.2919  0.0113  0.0530  20  SER D O   
3158 C CB  . SER D 25  ? 1.6790 0.5266 1.1727 0.1488  -0.0686 -0.0473 20  SER D CB  
3159 O OG  . SER D 25  ? 1.6292 0.5121 1.1217 0.2145  -0.0532 -0.0412 20  SER D OG  
3160 N N   . ASP D 26  ? 1.6115 0.6349 1.2557 0.2526  -0.0417 0.0933  21  ASP D N   
3161 C CA  . ASP D 26  ? 1.4669 0.6209 1.1488 0.2983  -0.0541 0.1248  21  ASP D CA  
3162 C C   . ASP D 26  ? 1.2092 0.4582 0.8803 0.2727  -0.1077 0.1260  21  ASP D C   
3163 O O   . ASP D 26  ? 1.1379 0.4576 0.8609 0.2611  -0.1133 0.1527  21  ASP D O   
3164 C CB  . ASP D 26  ? 1.3241 0.5048 1.0759 0.3181  -0.0297 0.1620  21  ASP D CB  
3165 C CG  . ASP D 26  ? 1.4628 0.5282 1.2162 0.3336  0.0240  0.1585  21  ASP D CG  
3166 O OD1 . ASP D 26  ? 1.5264 0.5523 1.2525 0.3600  0.0522  0.1419  21  ASP D OD1 
3167 O OD2 . ASP D 26  ? 1.5125 0.5281 1.2920 0.3182  0.0420  0.1712  21  ASP D OD2 
3168 N N   . ALA D 27  ? 0.7538 0.1993 0.5332 -0.0678 -0.0116 0.0130  22  ALA D N   
3169 C CA  . ALA D 27  ? 0.6912 0.2046 0.4778 -0.0691 -0.0199 0.0055  22  ALA D CA  
3170 C C   . ALA D 27  ? 0.7696 0.3247 0.5542 -0.0568 -0.0133 0.0309  22  ALA D C   
3171 O O   . ALA D 27  ? 0.6369 0.1896 0.4064 -0.0315 -0.0098 0.0419  22  ALA D O   
3172 C CB  . ALA D 27  ? 0.7657 0.2928 0.5378 -0.0485 -0.0311 -0.0204 22  ALA D CB  
3173 N N   . TYR D 28  ? 0.6456 0.2428 0.4483 -0.0747 -0.0119 0.0369  23  TYR D N   
3174 C CA  . TYR D 28  ? 0.5642 0.2083 0.3701 -0.0651 -0.0075 0.0504  23  TYR D CA  
3175 C C   . TYR D 28  ? 0.5262 0.2168 0.3487 -0.0767 -0.0102 0.0406  23  TYR D C   
3176 O O   . TYR D 28  ? 0.5513 0.2441 0.3828 -0.0931 -0.0162 0.0266  23  TYR D O   
3177 C CB  . TYR D 28  ? 0.5614 0.2073 0.3678 -0.0690 0.0015  0.0751  23  TYR D CB  
3178 C CG  . TYR D 28  ? 0.5686 0.2204 0.3917 -0.0969 0.0061  0.0827  23  TYR D CG  
3179 C CD1 . TYR D 28  ? 0.6522 0.2577 0.4816 -0.1149 0.0109  0.0856  23  TYR D CD1 
3180 C CD2 . TYR D 28  ? 0.5281 0.2312 0.3644 -0.1053 0.0080  0.0865  23  TYR D CD2 
3181 C CE1 . TYR D 28  ? 0.7365 0.3530 0.5893 -0.1414 0.0180  0.0932  23  TYR D CE1 
3182 C CE2 . TYR D 28  ? 0.5352 0.2488 0.3879 -0.1291 0.0137  0.0950  23  TYR D CE2 
3183 C CZ  . TYR D 28  ? 0.7314 0.4027 0.5932 -0.1482 0.0190  0.0995  23  TYR D CZ  
3184 O OH  . TYR D 28  ? 0.7131 0.4041 0.6015 -0.1703 0.0273  0.1074  23  TYR D OH  
3185 N N   A CYS D 29  ? 0.4740 0.2037 0.3031 -0.0674 -0.0051 0.0462  24  CYS D N   
3186 N N   B CYS D 29  ? 0.5342 0.2648 0.3642 -0.0690 -0.0053 0.0460  24  CYS D N   
3187 C CA  A CYS D 29  ? 0.5179 0.2885 0.3610 -0.0709 -0.0036 0.0400  24  CYS D CA  
3188 C CA  B CYS D 29  ? 0.5287 0.3003 0.3725 -0.0724 -0.0038 0.0397  24  CYS D CA  
3189 C C   A CYS D 29  ? 0.5387 0.3414 0.3958 -0.0800 0.0035  0.0508  24  CYS D C   
3190 C C   B CYS D 29  ? 0.5429 0.3466 0.4007 -0.0813 0.0034  0.0507  24  CYS D C   
3191 O O   A CYS D 29  ? 0.5676 0.3789 0.4257 -0.0709 0.0082  0.0567  24  CYS D O   
3192 O O   B CYS D 29  ? 0.5583 0.3703 0.4168 -0.0722 0.0081  0.0568  24  CYS D O   
3193 C CB  A CYS D 29  ? 0.4219 0.2042 0.2632 -0.0473 0.0008  0.0344  24  CYS D CB  
3194 C CB  B CYS D 29  ? 0.4979 0.2812 0.3396 -0.0486 0.0005  0.0342  24  CYS D CB  
3195 S SG  A CYS D 29  ? 0.4746 0.3013 0.3322 -0.0433 0.0101  0.0338  24  CYS D SG  
3196 S SG  B CYS D 29  ? 1.2108 0.9677 1.0316 -0.0319 -0.0075 0.0198  24  CYS D SG  
3197 N N   . SER D 30  ? 0.4784 0.3039 0.3472 -0.0966 0.0035  0.0507  25  SER D N   
3198 C CA  . SER D 30  ? 0.4694 0.3287 0.3499 -0.1025 0.0108  0.0590  25  SER D CA  
3199 C C   . SER D 30  ? 0.4724 0.3653 0.3655 -0.0953 0.0166  0.0523  25  SER D C   
3200 O O   . SER D 30  ? 0.5322 0.4325 0.4257 -0.0929 0.0136  0.0456  25  SER D O   
3201 C CB  . SER D 30  ? 0.5049 0.3682 0.3913 -0.1245 0.0111  0.0687  25  SER D CB  
3202 O OG  . SER D 30  ? 0.6364 0.5165 0.5353 -0.1373 0.0067  0.0595  25  SER D OG  
3203 N N   . ALA D 31  ? 0.3299 0.2443 0.2335 -0.0894 0.0259  0.0531  26  ALA D N   
3204 C CA  . ALA D 31  ? 0.3083 0.2468 0.2266 -0.0807 0.0369  0.0490  26  ALA D CA  
3205 C C   . ALA D 31  ? 0.4550 0.4234 0.3843 -0.0880 0.0430  0.0505  26  ALA D C   
3206 O O   . ALA D 31  ? 0.3985 0.3734 0.3274 -0.0906 0.0426  0.0499  26  ALA D O   
3207 C CB  . ALA D 31  ? 0.2989 0.2290 0.2276 -0.0644 0.0473  0.0433  26  ALA D CB  
3208 N N   . VAL D 32  ? 0.4541 0.4457 0.3909 -0.0874 0.0484  0.0521  27  VAL D N   
3209 C CA  . VAL D 32  ? 0.3781 0.3996 0.3247 -0.0909 0.0559  0.0529  27  VAL D CA  
3210 C C   . VAL D 32  ? 0.3555 0.3874 0.3176 -0.0751 0.0728  0.0484  27  VAL D C   
3211 O O   . VAL D 32  ? 0.3803 0.4135 0.3426 -0.0630 0.0780  0.0530  27  VAL D O   
3212 C CB  . VAL D 32  ? 0.3873 0.4330 0.3323 -0.1054 0.0501  0.0617  27  VAL D CB  
3213 C CG1 . VAL D 32  ? 0.3825 0.4606 0.3344 -0.1064 0.0587  0.0638  27  VAL D CG1 
3214 C CG2 . VAL D 32  ? 0.3053 0.3310 0.2406 -0.1221 0.0389  0.0682  27  VAL D CG2 
3215 N N   . PHE D 33  ? 0.3510 0.3909 0.3262 -0.0730 0.0824  0.0388  28  PHE D N   
3216 C CA  . PHE D 33  ? 0.3590 0.4038 0.3538 -0.0599 0.1024  0.0334  28  PHE D CA  
3217 C C   . PHE D 33  ? 0.3908 0.4588 0.3935 -0.0634 0.1063  0.0213  28  PHE D C   
3218 O O   . PHE D 33  ? 0.2956 0.3709 0.2944 -0.0706 0.0967  0.0111  28  PHE D O   
3219 C CB  . PHE D 33  ? 0.3529 0.3695 0.3669 -0.0501 0.1165  0.0257  28  PHE D CB  
3220 C CG  . PHE D 33  ? 0.3619 0.3736 0.4025 -0.0377 0.1429  0.0206  28  PHE D CG  
3221 C CD1 . PHE D 33  ? 0.3932 0.3998 0.4335 -0.0187 0.1598  0.0379  28  PHE D CD1 
3222 C CD2 . PHE D 33  ? 0.3674 0.3811 0.4337 -0.0427 0.1518  -0.0027 28  PHE D CD2 
3223 C CE1 . PHE D 33  ? 0.4102 0.4049 0.4747 -0.0043 0.1862  0.0365  28  PHE D CE1 
3224 C CE2 . PHE D 33  ? 0.4124 0.4143 0.5077 -0.0328 0.1789  -0.0097 28  PHE D CE2 
3225 C CZ  . PHE D 33  ? 0.4628 0.4505 0.5569 -0.0132 0.1972  0.0124  28  PHE D CZ  
3226 N N   . ALA D 34  ? 0.3960 0.4792 0.4074 -0.0542 0.1205  0.0224  29  ALA D N   
3227 C CA  . ALA D 34  ? 0.4109 0.5176 0.4289 -0.0534 0.1261  0.0084  29  ALA D CA  
3228 C C   . ALA D 34  ? 0.4262 0.5626 0.4236 -0.0647 0.1093  0.0127  29  ALA D C   
3229 O O   . ALA D 34  ? 0.3881 0.5429 0.3852 -0.0635 0.1078  -0.0035 29  ALA D O   
3230 C CB  . ALA D 34  ? 0.3874 0.4791 0.4310 -0.0511 0.1366  -0.0196 29  ALA D CB  
3231 N N   . GLY D 35  ? 0.3760 0.5181 0.3579 -0.0744 0.0980  0.0337  30  GLY D N   
3232 C CA  . GLY D 35  ? 0.3323 0.4973 0.2986 -0.0851 0.0883  0.0449  30  GLY D CA  
3233 C C   . GLY D 35  ? 0.3782 0.5292 0.3315 -0.0894 0.0775  0.0437  30  GLY D C   
3234 O O   . GLY D 35  ? 0.4415 0.6095 0.3801 -0.0934 0.0736  0.0563  30  GLY D O   
3235 N N   . VAL D 36  ? 0.3927 0.5152 0.3518 -0.0859 0.0749  0.0312  31  VAL D N   
3236 C CA  . VAL D 36  ? 0.3979 0.5105 0.3445 -0.0859 0.0643  0.0302  31  VAL D CA  
3237 C C   . VAL D 36  ? 0.3985 0.4732 0.3391 -0.0916 0.0570  0.0411  31  VAL D C   
3238 O O   . VAL D 36  ? 0.4151 0.4685 0.3672 -0.0885 0.0604  0.0349  31  VAL D O   
3239 C CB  . VAL D 36  ? 0.4177 0.5396 0.3782 -0.0758 0.0654  0.0016  31  VAL D CB  
3240 C CG1 . VAL D 36  ? 0.3661 0.4845 0.3132 -0.0718 0.0532  0.0018  31  VAL D CG1 
3241 C CG2 . VAL D 36  ? 0.3586 0.5210 0.3221 -0.0685 0.0700  -0.0153 31  VAL D CG2 
3242 N N   . LYS D 37  ? 0.3841 0.4492 0.3062 -0.0977 0.0494  0.0585  32  LYS D N   
3243 C CA  . LYS D 37  ? 0.3830 0.4092 0.2975 -0.1021 0.0422  0.0662  32  LYS D CA  
3244 C C   . LYS D 37  ? 0.4234 0.4369 0.3291 -0.0904 0.0369  0.0609  32  LYS D C   
3245 O O   . LYS D 37  ? 0.4460 0.4811 0.3414 -0.0815 0.0354  0.0621  32  LYS D O   
3246 C CB  . LYS D 37  ? 0.4350 0.4492 0.3406 -0.1170 0.0403  0.0871  32  LYS D CB  
3247 C CG  . LYS D 37  ? 0.4897 0.4587 0.3857 -0.1200 0.0335  0.0921  32  LYS D CG  
3248 C CD  . LYS D 37  ? 0.5604 0.5114 0.4577 -0.1391 0.0348  0.1083  32  LYS D CD  
3249 C CE  . LYS D 37  ? 0.5590 0.5241 0.4755 -0.1551 0.0326  0.1001  32  LYS D CE  
3250 N NZ  . LYS D 37  ? 0.6288 0.5811 0.5578 -0.1789 0.0346  0.1102  32  LYS D NZ  
3251 N N   . LYS D 38  ? 0.4122 0.3970 0.3210 -0.0870 0.0340  0.0551  33  LYS D N   
3252 C CA  . LYS D 38  ? 0.4334 0.4061 0.3350 -0.0753 0.0287  0.0517  33  LYS D CA  
3253 C C   . LYS D 38  ? 0.4620 0.3912 0.3510 -0.0772 0.0239  0.0614  33  LYS D C   
3254 O O   . LYS D 38  ? 0.4248 0.3402 0.3179 -0.0846 0.0244  0.0606  33  LYS D O   
3255 C CB  . LYS D 38  ? 0.3750 0.3623 0.3011 -0.0669 0.0332  0.0291  33  LYS D CB  
3256 C CG  . LYS D 38  ? 0.3729 0.4014 0.3160 -0.0661 0.0380  0.0117  33  LYS D CG  
3257 C CD  . LYS D 38  ? 0.3350 0.3687 0.3143 -0.0646 0.0487  -0.0120 33  LYS D CD  
3258 C CE  . LYS D 38  ? 0.3439 0.4150 0.3434 -0.0650 0.0536  -0.0358 33  LYS D CE  
3259 N NZ  . LYS D 38  ? 0.3064 0.4165 0.2947 -0.0564 0.0405  -0.0476 33  LYS D NZ  
3260 N N   . ARG D 39  ? 0.3694 0.2798 0.2417 -0.0679 0.0191  0.0694  34  ARG D N   
3261 C CA  . ARG D 39  ? 0.4330 0.2977 0.2927 -0.0679 0.0152  0.0753  34  ARG D CA  
3262 C C   . ARG D 39  ? 0.4627 0.3166 0.3159 -0.0483 0.0122  0.0711  34  ARG D C   
3263 O O   . ARG D 39  ? 0.4179 0.2993 0.2714 -0.0351 0.0114  0.0691  34  ARG D O   
3264 C CB  . ARG D 39  ? 0.4696 0.3066 0.3150 -0.0782 0.0162  0.0947  34  ARG D CB  
3265 C CG  . ARG D 39  ? 0.7298 0.5770 0.5597 -0.0661 0.0203  0.1131  34  ARG D CG  
3266 C CD  . ARG D 39  ? 0.9990 0.7999 0.8155 -0.0713 0.0268  0.1366  34  ARG D CD  
3267 N NE  . ARG D 39  ? 1.1570 0.9205 0.9559 -0.0522 0.0254  0.1416  34  ARG D NE  
3268 C CZ  . ARG D 39  ? 1.2138 0.9834 0.9924 -0.0269 0.0291  0.1590  34  ARG D CZ  
3269 N NH1 . ARG D 39  ? 1.2327 1.0468 1.0045 -0.0175 0.0336  0.1715  34  ARG D NH1 
3270 N NH2 . ARG D 39  ? 1.2462 0.9817 1.0089 -0.0073 0.0284  0.1638  34  ARG D NH2 
3271 N N   . THR D 40  ? 0.4591 0.2795 0.3068 -0.0446 0.0100  0.0677  35  THR D N   
3272 C CA  . THR D 40  ? 0.4851 0.2918 0.3245 -0.0247 0.0080  0.0662  35  THR D CA  
3273 C C   . THR D 40  ? 0.5409 0.3161 0.3557 -0.0176 0.0062  0.0834  35  THR D C   
3274 O O   . THR D 40  ? 0.4879 0.2488 0.2960 -0.0306 0.0087  0.0967  35  THR D O   
3275 C CB  . THR D 40  ? 0.4835 0.2644 0.3207 -0.0195 0.0075  0.0578  35  THR D CB  
3276 O OG1 . THR D 40  ? 0.4641 0.2034 0.2842 -0.0281 0.0027  0.0607  35  THR D OG1 
3277 C CG2 . THR D 40  ? 0.3933 0.1986 0.2509 -0.0248 0.0137  0.0482  35  THR D CG2 
3278 N N   . LYS D 41  ? 0.4846 0.2487 0.2880 0.0045  0.0046  0.0854  36  LYS D N   
3279 C CA  . LYS D 41  ? 0.6557 0.3782 0.4337 0.0161  0.0063  0.1039  36  LYS D CA  
3280 C C   . LYS D 41  ? 0.6983 0.3628 0.4693 0.0051  0.0060  0.0995  36  LYS D C   
3281 O O   . LYS D 41  ? 0.5437 0.2108 0.3254 -0.0051 0.0022  0.0820  36  LYS D O   
3282 C CB  . LYS D 41  ? 0.7375 0.4701 0.5051 0.0473  0.0047  0.1062  36  LYS D CB  
3283 C CG  . LYS D 41  ? 0.7872 0.5103 0.5604 0.0568  0.0025  0.0906  36  LYS D CG  
3284 C CD  . LYS D 41  ? 0.8873 0.6352 0.6573 0.0872  0.0012  0.0917  36  LYS D CD  
3285 C CE  . LYS D 41  ? 0.8710 0.6230 0.6541 0.0958  0.0022  0.0767  36  LYS D CE  
3286 N NZ  . LYS D 41  ? 0.8259 0.6128 0.6423 0.0770  0.0056  0.0609  36  LYS D NZ  
3287 N N   . VAL D 42  ? 0.7040 0.3173 0.4577 0.0095  0.0112  0.1147  37  VAL D N   
3288 C CA  . VAL D 42  ? 0.7646 0.3198 0.5146 -0.0004 0.0105  0.1043  37  VAL D CA  
3289 C C   . VAL D 42  ? 0.7388 0.2712 0.4724 0.0267  0.0075  0.0960  37  VAL D C   
3290 O O   . VAL D 42  ? 0.7444 0.2880 0.4676 0.0534  0.0104  0.1085  37  VAL D O   
3291 C CB  . VAL D 42  ? 0.8589 0.3793 0.6164 -0.0111 0.0212  0.1199  37  VAL D CB  
3292 C CG1 . VAL D 42  ? 0.8759 0.3486 0.6434 -0.0238 0.0197  0.0997  37  VAL D CG1 
3293 C CG2 . VAL D 42  ? 0.8796 0.4255 0.6527 -0.0354 0.0262  0.1307  37  VAL D CG2 
3294 N N   . ILE D 43  ? 0.6821 0.1947 0.4157 0.0224  0.0011  0.0728  38  ILE D N   
3295 C CA  . ILE D 43  ? 0.8167 0.3075 0.5362 0.0479  -0.0004 0.0630  38  ILE D CA  
3296 C C   . ILE D 43  ? 0.9138 0.3525 0.6352 0.0387  0.0017  0.0535  38  ILE D C   
3297 O O   . ILE D 43  ? 0.9406 0.3616 0.6698 0.0163  -0.0041 0.0327  38  ILE D O   
3298 C CB  . ILE D 43  ? 0.7932 0.3077 0.5112 0.0564  -0.0072 0.0428  38  ILE D CB  
3299 C CG1 . ILE D 43  ? 0.7219 0.3017 0.4579 0.0605  -0.0045 0.0498  38  ILE D CG1 
3300 C CG2 . ILE D 43  ? 0.8606 0.3507 0.5596 0.0855  -0.0075 0.0338  38  ILE D CG2 
3301 C CD1 . ILE D 43  ? 0.6556 0.2545 0.3893 0.0866  -0.0003 0.0618  38  ILE D CD1 
3302 N N   . LYS D 44  ? 0.9162 0.3320 0.6330 0.0563  0.0100  0.0668  39  LYS D N   
3303 C CA  . LYS D 44  ? 1.0100 0.3721 0.7357 0.0478  0.0157  0.0599  39  LYS D CA  
3304 C C   . LYS D 44  ? 1.0230 0.3595 0.7386 0.0568  0.0078  0.0284  39  LYS D C   
3305 O O   . LYS D 44  ? 0.9475 0.2947 0.6435 0.0860  0.0057  0.0264  39  LYS D O   
3306 C CB  . LYS D 44  ? 1.0932 0.4376 0.8155 0.0678  0.0292  0.0879  39  LYS D CB  
3307 C CG  . LYS D 44  ? 1.0762 0.4422 0.8056 0.0626  0.0384  0.1197  39  LYS D CG  
3308 C CD  . LYS D 44  ? 1.0417 0.3986 0.7983 0.0252  0.0418  0.1193  39  LYS D CD  
3309 C CE  . LYS D 44  ? 1.1555 0.4711 0.9291 0.0189  0.0575  0.1400  39  LYS D CE  
3310 N NZ  . LYS D 44  ? 1.1854 0.5166 0.9812 -0.0077 0.0643  0.1566  39  LYS D NZ  
3311 N N   . ASN D 45  ? 1.0945 0.4018 0.8263 0.0321  0.0037  0.0023  40  ASN D N   
3312 C CA  . ASN D 45  ? 1.1215 0.4045 0.8455 0.0399  -0.0048 -0.0339 40  ASN D CA  
3313 C C   . ASN D 45  ? 1.1156 0.4311 0.8100 0.0649  -0.0172 -0.0505 40  ASN D C   
3314 O O   . ASN D 45  ? 1.1632 0.4754 0.8385 0.0953  -0.0158 -0.0514 40  ASN D O   
3315 C CB  . ASN D 45  ? 1.0740 0.3083 0.8014 0.0546  0.0059  -0.0320 40  ASN D CB  
3316 C CG  . ASN D 45  ? 1.1353 0.3382 0.8684 0.0519  -0.0014 -0.0761 40  ASN D CG  
3317 O OD1 . ASN D 45  ? 1.1737 0.3564 0.8910 0.0779  0.0006  -0.0835 40  ASN D OD1 
3318 N ND2 . ASN D 45  ? 1.0942 0.2988 0.8515 0.0207  -0.0099 -0.1074 40  ASN D ND2 
3319 N N   . SER D 46  ? 0.9865 0.3371 0.6781 0.0547  -0.0269 -0.0583 41  SER D N   
3320 C CA  . SER D 46  ? 0.9688 0.3506 0.6362 0.0800  -0.0358 -0.0731 41  SER D CA  
3321 C C   . SER D 46  ? 0.9880 0.3972 0.6581 0.0643  -0.0496 -0.1010 41  SER D C   
3322 O O   . SER D 46  ? 0.9220 0.3535 0.6164 0.0343  -0.0505 -0.0953 41  SER D O   
3323 C CB  . SER D 46  ? 0.9678 0.3880 0.6303 0.0989  -0.0280 -0.0429 41  SER D CB  
3324 O OG  . SER D 46  ? 1.0337 0.4764 0.6790 0.1337  -0.0263 -0.0454 41  SER D OG  
3325 N N   . VAL D 47  ? 0.9679 0.3966 0.6186 0.0874  -0.0590 -0.1284 42  VAL D N   
3326 C CA  . VAL D 47  ? 0.9572 0.4439 0.6131 0.0819  -0.0707 -0.1490 42  VAL D CA  
3327 C C   . VAL D 47  ? 0.9181 0.4672 0.5714 0.1020  -0.0615 -0.1214 42  VAL D C   
3328 O O   . VAL D 47  ? 0.8089 0.4091 0.4714 0.0960  -0.0650 -0.1237 42  VAL D O   
3329 C CB  . VAL D 47  ? 0.9948 0.4822 0.6289 0.1010  -0.0861 -0.1950 42  VAL D CB  
3330 C CG1 . VAL D 47  ? 1.0470 0.4864 0.7046 0.0713  -0.0915 -0.2248 42  VAL D CG1 
3331 C CG2 . VAL D 47  ? 1.0193 0.5070 0.6210 0.1471  -0.0794 -0.1888 42  VAL D CG2 
3332 N N   . ASN D 48  ? 0.8754 0.4202 0.5198 0.1260  -0.0479 -0.0956 43  ASN D N   
3333 C CA  . ASN D 48  ? 0.7669 0.3623 0.4194 0.1410  -0.0339 -0.0683 43  ASN D CA  
3334 C C   . ASN D 48  ? 0.6806 0.2696 0.3542 0.1290  -0.0224 -0.0388 43  ASN D C   
3335 O O   . ASN D 48  ? 0.7681 0.3569 0.4389 0.1506  -0.0124 -0.0246 43  ASN D O   
3336 C CB  . ASN D 48  ? 0.8271 0.4402 0.4552 0.1848  -0.0265 -0.0685 43  ASN D CB  
3337 C CG  . ASN D 48  ? 0.9630 0.6193 0.6080 0.1994  -0.0054 -0.0374 43  ASN D CG  
3338 O OD1 . ASN D 48  ? 1.0359 0.6945 0.6772 0.2253  0.0073  -0.0247 43  ASN D OD1 
3339 N ND2 . ASN D 48  ? 0.8845 0.5743 0.5521 0.1824  0.0003  -0.0258 43  ASN D ND2 
3340 N N   . PRO D 49  ? 0.6539 0.2428 0.3489 0.0960  -0.0243 -0.0314 44  PRO D N   
3341 C CA  . PRO D 49  ? 0.6508 0.2408 0.3622 0.0879  -0.0156 -0.0071 44  PRO D CA  
3342 C C   . PRO D 49  ? 0.6593 0.2996 0.3907 0.0966  -0.0029 0.0082  44  PRO D C   
3343 O O   . PRO D 49  ? 0.6240 0.2970 0.3669 0.0910  0.0007  0.0077  44  PRO D O   
3344 C CB  . PRO D 49  ? 0.6360 0.2194 0.3627 0.0529  -0.0201 -0.0051 44  PRO D CB  
3345 C CG  . PRO D 49  ? 0.6202 0.2251 0.3502 0.0418  -0.0280 -0.0239 44  PRO D CG  
3346 C CD  . PRO D 49  ? 0.6557 0.2502 0.3615 0.0668  -0.0345 -0.0458 44  PRO D CD  
3347 N N   . VAL D 50  ? 0.5819 0.2290 0.3202 0.1108  0.0050  0.0206  45  VAL D N   
3348 C CA  . VAL D 50  ? 0.5228 0.2160 0.2914 0.1135  0.0186  0.0312  45  VAL D CA  
3349 C C   . VAL D 50  ? 0.5729 0.2809 0.3616 0.0955  0.0174  0.0388  45  VAL D C   
3350 O O   . VAL D 50  ? 0.5871 0.2876 0.3698 0.1047  0.0143  0.0440  45  VAL D O   
3351 C CB  . VAL D 50  ? 0.5921 0.2974 0.3630 0.1430  0.0293  0.0356  45  VAL D CB  
3352 C CG1 . VAL D 50  ? 0.5588 0.3113 0.3729 0.1399  0.0459  0.0433  45  VAL D CG1 
3353 C CG2 . VAL D 50  ? 0.6394 0.3345 0.3848 0.1673  0.0315  0.0290  45  VAL D CG2 
3354 N N   . TRP D 51  ? 0.4784 0.2105 0.2880 0.0740  0.0199  0.0393  46  TRP D N   
3355 C CA  . TRP D 51  ? 0.4876 0.2413 0.3146 0.0594  0.0184  0.0433  46  TRP D CA  
3356 C C   . TRP D 51  ? 0.4572 0.2559 0.3208 0.0642  0.0294  0.0404  46  TRP D C   
3357 O O   . TRP D 51  ? 0.4614 0.2825 0.3343 0.0681  0.0260  0.0395  46  TRP D O   
3358 C CB  . TRP D 51  ? 0.4357 0.1951 0.2682 0.0345  0.0159  0.0430  46  TRP D CB  
3359 C CG  . TRP D 51  ? 0.4772 0.1994 0.2858 0.0232  0.0061  0.0429  46  TRP D CG  
3360 C CD1 . TRP D 51  ? 0.5201 0.2129 0.3136 0.0175  0.0005  0.0503  46  TRP D CD1 
3361 C CD2 . TRP D 51  ? 0.4739 0.1877 0.2760 0.0162  0.0024  0.0339  46  TRP D CD2 
3362 N NE1 . TRP D 51  ? 0.5342 0.1961 0.3184 0.0025  -0.0051 0.0444  46  TRP D NE1 
3363 C CE2 . TRP D 51  ? 0.5091 0.1882 0.2981 0.0014  -0.0065 0.0314  46  TRP D CE2 
3364 C CE3 . TRP D 51  ? 0.4583 0.1936 0.2650 0.0233  0.0072  0.0281  46  TRP D CE3 
3365 C CZ2 . TRP D 51  ? 0.5295 0.2008 0.3151 -0.0102 -0.0142 0.0169  46  TRP D CZ2 
3366 C CZ3 . TRP D 51  ? 0.5055 0.2368 0.3010 0.0178  -0.0014 0.0168  46  TRP D CZ3 
3367 C CH2 . TRP D 51  ? 0.5069 0.2092 0.2942 -0.0007 -0.0137 0.0080  46  TRP D CH2 
3368 N N   . ASN D 52  ? 0.4114 0.2254 0.2977 0.0648  0.0438  0.0385  47  ASN D N   
3369 C CA  . ASN D 52  ? 0.3963 0.2486 0.3287 0.0646  0.0595  0.0335  47  ASN D CA  
3370 C C   . ASN D 52  ? 0.3525 0.2367 0.3100 0.0467  0.0547  0.0230  47  ASN D C   
3371 O O   . ASN D 52  ? 0.3507 0.2678 0.3313 0.0503  0.0531  0.0133  47  ASN D O   
3372 C CB  . ASN D 52  ? 0.4544 0.3165 0.3937 0.0859  0.0638  0.0340  47  ASN D CB  
3373 C CG  . ASN D 52  ? 0.4894 0.3922 0.4864 0.0833  0.0836  0.0270  47  ASN D CG  
3374 O OD1 . ASN D 52  ? 0.4848 0.3924 0.5114 0.0734  0.1022  0.0277  47  ASN D OD1 
3375 N ND2 . ASN D 52  ? 0.4117 0.3449 0.4285 0.0924  0.0813  0.0198  47  ASN D ND2 
3376 N N   . GLU D 53  ? 0.3440 0.2245 0.2962 0.0296  0.0514  0.0228  48  GLU D N   
3377 C CA  . GLU D 53  ? 0.3300 0.2417 0.2989 0.0158  0.0460  0.0121  48  GLU D CA  
3378 C C   . GLU D 53  ? 0.3071 0.2363 0.3131 0.0011  0.0610  0.0021  48  GLU D C   
3379 O O   . GLU D 53  ? 0.3402 0.2500 0.3444 -0.0003 0.0722  0.0108  48  GLU D O   
3380 C CB  . GLU D 53  ? 0.5453 0.4410 0.4764 0.0100  0.0307  0.0216  48  GLU D CB  
3381 C CG  . GLU D 53  ? 0.5837 0.4587 0.4816 0.0253  0.0194  0.0322  48  GLU D CG  
3382 C CD  . GLU D 53  ? 0.5034 0.3656 0.3733 0.0193  0.0106  0.0444  48  GLU D CD  
3383 O OE1 . GLU D 53  ? 0.5150 0.4067 0.3945 0.0087  0.0101  0.0408  48  GLU D OE1 
3384 O OE2 . GLU D 53  ? 0.6000 0.4211 0.4400 0.0258  0.0064  0.0577  48  GLU D OE2 
3385 N N   . GLY D 54  ? 0.2945 0.2627 0.3339 -0.0071 0.0613  -0.0177 49  GLY D N   
3386 C CA  . GLY D 54  ? 0.2792 0.2615 0.3589 -0.0212 0.0771  -0.0320 49  GLY D CA  
3387 C C   . GLY D 54  ? 0.3862 0.3849 0.4543 -0.0318 0.0667  -0.0395 49  GLY D C   
3388 O O   . GLY D 54  ? 0.3634 0.3860 0.4125 -0.0284 0.0492  -0.0442 49  GLY D O   
3389 N N   . PHE D 55  ? 0.2691 0.2575 0.3469 -0.0405 0.0795  -0.0382 50  PHE D N   
3390 C CA  . PHE D 55  ? 0.2665 0.2720 0.3353 -0.0491 0.0730  -0.0449 50  PHE D CA  
3391 C C   . PHE D 55  ? 0.2991 0.3132 0.4125 -0.0577 0.0930  -0.0643 50  PHE D C   
3392 O O   . PHE D 55  ? 0.3159 0.3065 0.4542 -0.0564 0.1155  -0.0582 50  PHE D O   
3393 C CB  . PHE D 55  ? 0.3167 0.2980 0.3438 -0.0500 0.0671  -0.0199 50  PHE D CB  
3394 C CG  . PHE D 55  ? 0.4407 0.4030 0.4281 -0.0443 0.0510  -0.0021 50  PHE D CG  
3395 C CD1 . PHE D 55  ? 0.4767 0.4530 0.4413 -0.0425 0.0364  0.0007  50  PHE D CD1 
3396 C CD2 . PHE D 55  ? 0.4273 0.3569 0.3994 -0.0380 0.0526  0.0119  50  PHE D CD2 
3397 C CE1 . PHE D 55  ? 0.4755 0.4256 0.4070 -0.0366 0.0264  0.0186  50  PHE D CE1 
3398 C CE2 . PHE D 55  ? 0.5329 0.4394 0.4719 -0.0336 0.0393  0.0237  50  PHE D CE2 
3399 C CZ  . PHE D 55  ? 0.4476 0.3602 0.3682 -0.0341 0.0276  0.0280  50  PHE D CZ  
3400 N N   . GLU D 56  ? 0.2729 0.3199 0.3952 -0.0637 0.0867  -0.0868 51  GLU D N   
3401 C CA  . GLU D 56  ? 0.2816 0.3333 0.4447 -0.0718 0.1054  -0.1090 51  GLU D CA  
3402 C C   . GLU D 56  ? 0.2885 0.3537 0.4258 -0.0725 0.0989  -0.1081 51  GLU D C   
3403 O O   . GLU D 56  ? 0.3198 0.4173 0.4302 -0.0696 0.0791  -0.1128 51  GLU D O   
3404 C CB  . GLU D 56  ? 0.4085 0.4964 0.6236 -0.0789 0.1067  -0.1518 51  GLU D CB  
3405 C CG  . GLU D 56  ? 0.6185 0.7048 0.8661 -0.0790 0.1129  -0.1556 51  GLU D CG  
3406 C CD  . GLU D 56  ? 0.7322 0.8749 1.0182 -0.0837 0.1008  -0.1988 51  GLU D CD  
3407 O OE1 . GLU D 56  ? 0.7896 0.9620 1.0489 -0.0727 0.0782  -0.1961 51  GLU D OE1 
3408 O OE2 . GLU D 56  ? 0.7011 0.8604 1.0454 -0.0972 0.1141  -0.2373 51  GLU D OE2 
3409 N N   . TRP D 57  ? 0.3450 0.3879 0.4894 -0.0730 0.1175  -0.0990 52  TRP D N   
3410 C CA  . TRP D 57  ? 0.3300 0.3892 0.4587 -0.0727 0.1158  -0.1013 52  TRP D CA  
3411 C C   . TRP D 57  ? 0.3895 0.4553 0.5651 -0.0766 0.1342  -0.1361 52  TRP D C   
3412 O O   . TRP D 57  ? 0.3682 0.4026 0.5818 -0.0774 0.1605  -0.1377 52  TRP D O   
3413 C CB  . TRP D 57  ? 0.3678 0.4034 0.4718 -0.0676 0.1238  -0.0681 52  TRP D CB  
3414 C CG  . TRP D 57  ? 0.3494 0.3837 0.4087 -0.0674 0.1046  -0.0401 52  TRP D CG  
3415 C CD1 . TRP D 57  ? 0.3128 0.3668 0.3418 -0.0701 0.0919  -0.0284 52  TRP D CD1 
3416 C CD2 . TRP D 57  ? 0.2966 0.3068 0.3405 -0.0651 0.0987  -0.0217 52  TRP D CD2 
3417 N NE1 . TRP D 57  ? 0.3008 0.3409 0.3019 -0.0728 0.0794  -0.0055 52  TRP D NE1 
3418 C CE2 . TRP D 57  ? 0.2807 0.2938 0.2882 -0.0688 0.0818  -0.0030 52  TRP D CE2 
3419 C CE3 . TRP D 57  ? 0.4173 0.4043 0.4766 -0.0596 0.1076  -0.0198 52  TRP D CE3 
3420 C CZ2 . TRP D 57  ? 0.2993 0.2899 0.2857 -0.0681 0.0722  0.0127  52  TRP D CZ2 
3421 C CZ3 . TRP D 57  ? 0.2626 0.2317 0.2953 -0.0553 0.0971  -0.0020 52  TRP D CZ3 
3422 C CH2 . TRP D 57  ? 0.3243 0.2938 0.3210 -0.0600 0.0787  0.0117  52  TRP D CH2 
3423 N N   . ASP D 58  ? 0.4518 0.5573 0.6256 -0.0772 0.1227  -0.1643 53  ASP D N   
3424 C CA  . ASP D 58  ? 0.4939 0.6057 0.7130 -0.0812 0.1389  -0.2043 53  ASP D CA  
3425 C C   . ASP D 58  ? 0.5756 0.6630 0.7868 -0.0746 0.1583  -0.1865 53  ASP D C   
3426 O O   . ASP D 58  ? 0.6600 0.7647 0.8296 -0.0675 0.1477  -0.1677 53  ASP D O   
3427 C CB  . ASP D 58  ? 0.5910 0.7618 0.8070 -0.0795 0.1180  -0.2444 53  ASP D CB  
3428 C CG  . ASP D 58  ? 0.7223 0.9268 0.9524 -0.0822 0.0999  -0.2670 53  ASP D CG  
3429 O OD1 . ASP D 58  ? 0.6909 0.8756 0.9673 -0.0924 0.1123  -0.2777 53  ASP D OD1 
3430 O OD2 . ASP D 58  ? 0.8132 1.0673 1.0087 -0.0716 0.0750  -0.2720 53  ASP D OD2 
3431 N N   . LEU D 59  ? 0.9361 1.1304 0.9045 0.3393  0.0585  -0.2599 54  LEU D N   
3432 C CA  . LEU D 59  ? 0.9634 1.1459 0.9838 0.3470  0.0812  -0.2449 54  LEU D CA  
3433 C C   . LEU D 59  ? 1.0544 1.2465 1.0827 0.3941  0.0891  -0.2593 54  LEU D C   
3434 O O   . LEU D 59  ? 1.0968 1.2677 1.1447 0.4052  0.0784  -0.2845 54  LEU D O   
3435 C CB  . LEU D 59  ? 0.9603 1.1094 1.0129 0.3186  0.0685  -0.2541 54  LEU D CB  
3436 C CG  . LEU D 59  ? 0.8987 1.0418 0.9621 0.2765  0.0704  -0.2322 54  LEU D CG  
3437 C CD1 . LEU D 59  ? 0.8880 1.0031 1.0027 0.2660  0.0666  -0.2268 54  LEU D CD1 
3438 C CD2 . LEU D 59  ? 0.8667 1.0362 0.9454 0.2788  0.0970  -0.1945 54  LEU D CD2 
3439 N N   . LYS D 60  ? 1.0705 1.2958 1.0816 0.4227  0.1068  -0.2436 55  LYS D N   
3440 C CA  . LYS D 60  ? 1.1195 1.3636 1.1131 0.4688  0.1092  -0.2633 55  LYS D CA  
3441 C C   . LYS D 60  ? 1.0869 1.3323 1.1470 0.4917  0.1297  -0.2575 55  LYS D C   
3442 O O   . LYS D 60  ? 1.1177 1.3979 1.2001 0.5153  0.1540  -0.2343 55  LYS D O   
3443 C CB  . LYS D 60  ? 1.1427 1.4252 1.0921 0.4919  0.1209  -0.2437 55  LYS D CB  
3444 C CG  . LYS D 60  ? 1.1172 1.4154 1.0812 0.4757  0.1424  -0.1992 55  LYS D CG  
3445 C CD  . LYS D 60  ? 1.1824 1.4985 1.0873 0.4807  0.1392  -0.1824 55  LYS D CD  
3446 C CE  . LYS D 60  ? 1.1625 1.4897 1.0802 0.4618  0.1577  -0.1384 55  LYS D CE  
3447 N NZ  . LYS D 60  ? 1.1818 1.5222 1.0460 0.4719  0.1559  -0.1191 55  LYS D NZ  
3448 N N   . GLY D 61  ? 1.0770 1.2858 1.1749 0.4842  0.1175  -0.2760 56  GLY D N   
3449 C CA  . GLY D 61  ? 1.1763 1.3802 1.3432 0.5139  0.1294  -0.2761 56  GLY D CA  
3450 C C   . GLY D 61  ? 1.1804 1.3909 1.4296 0.4990  0.1452  -0.2330 56  GLY D C   
3451 O O   . GLY D 61  ? 1.2381 1.4482 1.5643 0.5220  0.1518  -0.2232 56  GLY D O   
3452 N N   . ILE D 62  ? 1.1327 1.3514 1.3734 0.4610  0.1470  -0.2065 57  ILE D N   
3453 C CA  . ILE D 62  ? 1.1099 1.3395 1.4386 0.4401  0.1523  -0.1658 57  ILE D CA  
3454 C C   . ILE D 62  ? 1.1293 1.3142 1.4681 0.4048  0.1338  -0.1595 57  ILE D C   
3455 O O   . ILE D 62  ? 1.1076 1.2908 1.4139 0.3677  0.1291  -0.1519 57  ILE D O   
3456 C CB  . ILE D 62  ? 0.6896 0.9662 1.0131 0.4228  0.1635  -0.1356 57  ILE D CB  
3457 C CG1 . ILE D 62  ? 1.0332 1.3021 1.2508 0.4057  0.1617  -0.1462 57  ILE D CG1 
3458 C CG2 . ILE D 62  ? 0.7316 1.0636 1.0887 0.4590  0.1810  -0.1185 57  ILE D CG2 
3459 C CD1 . ILE D 62  ? 0.9303 1.1881 1.1438 0.3577  0.1538  -0.1303 57  ILE D CD1 
3460 N N   . PRO D 63  ? 1.1793 1.3299 1.5538 0.4212  0.1201  -0.1613 58  PRO D N   
3461 C CA  . PRO D 63  ? 1.2176 1.3412 1.5782 0.4054  0.0774  -0.1750 58  PRO D CA  
3462 C C   . PRO D 63  ? 1.2193 1.3854 1.6307 0.3884  0.0625  -0.1359 58  PRO D C   
3463 O O   . PRO D 63  ? 1.2384 1.4510 1.7195 0.4009  0.0820  -0.0867 58  PRO D O   
3464 C CB  . PRO D 63  ? 1.2785 1.3713 1.6896 0.4387  0.0526  -0.1822 58  PRO D CB  
3465 C CG  . PRO D 63  ? 1.2874 1.4170 1.7655 0.4760  0.0882  -0.1411 58  PRO D CG  
3466 C CD  . PRO D 63  ? 1.2586 1.4138 1.7041 0.4640  0.1277  -0.1525 58  PRO D CD  
3467 N N   . LEU D 64  ? 1.1853 1.3427 1.5846 0.3511  0.0238  -0.1623 59  LEU D N   
3468 C CA  . LEU D 64  ? 1.0892 1.2973 1.5619 0.3192  0.0001  -0.1294 59  LEU D CA  
3469 C C   . LEU D 64  ? 1.1226 1.3216 1.7016 0.2962  -0.0412 -0.0696 59  LEU D C   
3470 O O   . LEU D 64  ? 1.1954 1.3314 1.7978 0.2806  -0.0826 -0.0831 59  LEU D O   
3471 C CB  . LEU D 64  ? 1.0286 1.2078 1.4378 0.2412  -0.0239 -0.1597 59  LEU D CB  
3472 C CG  . LEU D 64  ? 0.9253 1.1393 1.2963 0.1727  -0.0165 -0.1241 59  LEU D CG  
3473 C CD1 . LEU D 64  ? 0.9171 1.1891 1.2726 0.2276  0.0338  -0.1156 59  LEU D CD1 
3474 C CD2 . LEU D 64  ? 0.8364 1.0215 1.1233 0.1162  -0.0303 -0.1772 59  LEU D CD2 
3475 N N   . ASP D 65  ? 1.0741 1.3310 1.7086 0.2869  -0.0307 0.0027  60  ASP D N   
3476 C CA  . ASP D 65  ? 1.0877 1.3412 1.8144 0.2576  -0.0690 0.0708  60  ASP D CA  
3477 C C   . ASP D 65  ? 0.9997 1.2443 1.7128 0.1452  -0.1051 0.1220  60  ASP D C   
3478 O O   . ASP D 65  ? 0.9565 1.2047 1.5928 0.0937  -0.0962 0.1049  60  ASP D O   
3479 C CB  . ASP D 65  ? 1.1125 1.4335 1.8821 0.3032  -0.0384 0.1155  60  ASP D CB  
3480 C CG  . ASP D 65  ? 1.1691 1.5048 1.8568 0.3843  0.0020  0.0510  60  ASP D CG  
3481 O OD1 . ASP D 65  ? 1.1546 1.4712 1.7558 0.4076  0.0178  -0.0100 60  ASP D OD1 
3482 O OD2 . ASP D 65  ? 1.2249 1.5940 1.9359 0.4176  0.0099  0.0585  60  ASP D OD2 
3483 N N   . GLN D 66  ? 0.9643 1.2000 1.7529 0.1098  -0.1472 0.1836  61  GLN D N   
3484 C CA  . GLN D 66  ? 0.8844 1.1272 1.6716 0.0070  -0.1814 0.2434  61  GLN D CA  
3485 C C   . GLN D 66  ? 0.7596 1.0798 1.5508 -0.0036 -0.1482 0.2846  61  GLN D C   
3486 O O   . GLN D 66  ? 0.7266 1.0592 1.4823 -0.0848 -0.1608 0.3105  61  GLN D O   
3487 C CB  . GLN D 66  ? 0.9187 1.1408 1.7943 -0.0162 -0.2336 0.3053  61  GLN D CB  
3488 C CG  . GLN D 66  ? 0.9274 1.1377 1.7876 -0.1302 -0.2814 0.3564  61  GLN D CG  
3489 C CD  . GLN D 66  ? 0.9688 1.2216 1.8501 -0.1561 -0.2785 0.4291  61  GLN D CD  
3490 O OE1 . GLN D 66  ? 0.9582 1.2044 1.7222 -0.1927 -0.2620 0.4270  61  GLN D OE1 
3491 N NE2 . GLN D 66  ? 1.0307 1.3045 2.0146 -0.1156 -0.2874 0.4739  61  GLN D NE2 
3492 N N   . GLY D 67  ? 0.6795 1.0530 1.5134 0.0781  -0.1059 0.2890  62  GLY D N   
3493 C CA  . GLY D 67  ? 0.5993 1.0438 1.4407 0.0711  -0.0730 0.3312  62  GLY D CA  
3494 C C   . GLY D 67  ? 0.5674 1.0241 1.3213 0.0712  -0.0338 0.2911  62  GLY D C   
3495 O O   . GLY D 67  ? 0.5760 1.0664 1.3128 0.0329  -0.0202 0.3250  62  GLY D O   
3496 N N   . SER D 68  ? 0.5197 0.9360 1.2054 0.1126  -0.0178 0.2150  63  SER D N   
3497 C CA  . SER D 68  ? 0.5045 0.9274 1.1027 0.1271  0.0202  0.1697  63  SER D CA  
3498 C C   . SER D 68  ? 0.4414 0.8580 0.9840 0.0383  0.0067  0.1816  63  SER D C   
3499 O O   . SER D 68  ? 0.3110 0.6921 0.8367 -0.0354 -0.0342 0.1818  63  SER D O   
3500 C CB  . SER D 68  ? 0.5806 0.9540 1.1144 0.1712  0.0261  0.0837  63  SER D CB  
3501 O OG  . SER D 68  ? 0.7111 1.0833 1.2942 0.2531  0.0343  0.0645  63  SER D OG  
3502 N N   . GLU D 69  ? 0.2905 0.7427 0.8048 0.0459  0.0404  0.1919  64  GLU D N   
3503 C CA  . GLU D 69  ? 0.2666 0.7094 0.7241 -0.0280 0.0303  0.1932  64  GLU D CA  
3504 C C   . GLU D 69  ? 0.2612 0.6993 0.6374 0.0068  0.0660  0.1440  64  GLU D C   
3505 O O   . GLU D 69  ? 0.2709 0.7358 0.6481 0.0816  0.1057  0.1387  64  GLU D O   
3506 C CB  . GLU D 69  ? 0.2724 0.7280 0.7565 -0.0737 0.0186  0.2610  64  GLU D CB  
3507 C CG  . GLU D 69  ? 0.6467 1.0746 1.1645 -0.1077 -0.0236 0.2969  64  GLU D CG  
3508 C CD  . GLU D 69  ? 0.7301 1.1374 1.2212 -0.1353 -0.0425 0.3340  64  GLU D CD  
3509 O OE1 . GLU D 69  ? 0.7694 1.1986 1.2568 -0.1194 -0.0211 0.3497  64  GLU D OE1 
3510 O OE2 . GLU D 69  ? 0.7679 1.1418 1.2424 -0.1669 -0.0795 0.3443  64  GLU D OE2 
3511 N N   . LEU D 70  ? 0.2498 0.6566 0.5549 -0.0468 0.0505  0.1071  65  LEU D N   
3512 C CA  . LEU D 70  ? 0.2469 0.6466 0.4765 -0.0239 0.0771  0.0659  65  LEU D CA  
3513 C C   . LEU D 70  ? 0.2367 0.6523 0.4710 -0.0746 0.0756  0.1139  65  LEU D C   
3514 O O   . LEU D 70  ? 0.3550 0.7272 0.5667 -0.1412 0.0392  0.1147  65  LEU D O   
3515 C CB  . LEU D 70  ? 0.2449 0.6038 0.3960 -0.0477 0.0600  -0.0109 65  LEU D CB  
3516 C CG  . LEU D 70  ? 0.2434 0.5916 0.3149 -0.0338 0.0785  -0.0567 65  LEU D CG  
3517 C CD1 . LEU D 70  ? 0.2676 0.6046 0.3134 0.0573  0.1124  -0.0765 65  LEU D CD1 
3518 C CD2 . LEU D 70  ? 0.2380 0.5582 0.2450 -0.0749 0.0549  -0.1255 65  LEU D CD2 
3519 N N   . HIS D 71  ? 0.2465 0.6849 0.4872 -0.0313 0.1090  0.1425  66  HIS D N   
3520 C CA  . HIS D 71  ? 0.2665 0.6722 0.4874 -0.0701 0.0965  0.1697  66  HIS D CA  
3521 C C   . HIS D 71  ? 0.2942 0.6776 0.4409 -0.0735 0.1054  0.1253  66  HIS D C   
3522 O O   . HIS D 71  ? 0.3193 0.7053 0.4257 -0.0124 0.1357  0.0944  66  HIS D O   
3523 C CB  . HIS D 71  ? 0.2935 0.7207 0.5515 -0.0331 0.1155  0.2220  66  HIS D CB  
3524 C CG  . HIS D 71  ? 0.4188 0.8187 0.6733 -0.0752 0.0936  0.2494  66  HIS D CG  
3525 N ND1 . HIS D 71  ? 0.4952 0.9096 0.7605 -0.0527 0.1104  0.2832  66  HIS D ND1 
3526 C CD2 . HIS D 71  ? 0.3828 0.7397 0.6194 -0.1298 0.0564  0.2396  66  HIS D CD2 
3527 C CE1 . HIS D 71  ? 0.5225 0.9094 0.7854 -0.0967 0.0843  0.2940  66  HIS D CE1 
3528 N NE2 . HIS D 71  ? 0.4728 0.8237 0.7149 -0.1383 0.0530  0.2651  66  HIS D NE2 
3529 N N   . VAL D 72  ? 0.2693 0.6084 0.3857 -0.1326 0.0719  0.1116  67  VAL D N   
3530 C CA  . VAL D 72  ? 0.2904 0.6100 0.3401 -0.1413 0.0736  0.0693  67  VAL D CA  
3531 C C   . VAL D 72  ? 0.2983 0.5838 0.3513 -0.1692 0.0572  0.0990  67  VAL D C   
3532 O O   . VAL D 72  ? 0.3121 0.5691 0.3816 -0.1964 0.0263  0.1131  67  VAL D O   
3533 C CB  . VAL D 72  ? 0.3356 0.6314 0.3308 -0.1766 0.0449  0.0038  67  VAL D CB  
3534 C CG1 . VAL D 72  ? 0.4896 0.7599 0.4216 -0.1963 0.0377  -0.0377 67  VAL D CG1 
3535 C CG2 . VAL D 72  ? 0.2593 0.5805 0.2373 -0.1383 0.0649  -0.0483 67  VAL D CG2 
3536 N N   . VAL D 73  ? 0.3730 0.6597 0.4012 -0.1495 0.0814  0.1038  68  VAL D N   
3537 C CA  . VAL D 73  ? 0.4315 0.6879 0.4670 -0.1752 0.0683  0.1322  68  VAL D CA  
3538 C C   . VAL D 73  ? 0.4381 0.6724 0.4056 -0.1927 0.0667  0.0917  68  VAL D C   
3539 O O   . VAL D 73  ? 0.4332 0.6726 0.3477 -0.1469 0.0969  0.0636  68  VAL D O   
3540 C CB  . VAL D 73  ? 0.3742 0.6451 0.4454 -0.1415 0.0953  0.1879  68  VAL D CB  
3541 C CG1 . VAL D 73  ? 0.4362 0.6770 0.5232 -0.1744 0.0755  0.2139  68  VAL D CG1 
3542 C CG2 . VAL D 73  ? 0.3646 0.6727 0.4903 -0.1185 0.1004  0.2158  68  VAL D CG2 
3543 N N   . VAL D 74  ? 0.4155 0.6128 0.3695 -0.2383 0.0293  0.0749  69  VAL D N   
3544 C CA  . VAL D 74  ? 0.4553 0.6227 0.3457 -0.2645 0.0247  0.0314  69  VAL D CA  
3545 C C   . VAL D 74  ? 0.4448 0.5837 0.3542 -0.2712 0.0264  0.0831  69  VAL D C   
3546 O O   . VAL D 74  ? 0.5043 0.6322 0.4617 -0.2797 0.0050  0.1165  69  VAL D O   
3547 C CB  . VAL D 74  ? 0.4673 0.5982 0.3177 -0.2733 -0.0019 -0.0126 69  VAL D CB  
3548 C CG1 . VAL D 74  ? 0.4313 0.5220 0.2526 -0.2681 -0.0012 -0.0489 69  VAL D CG1 
3549 C CG2 . VAL D 74  ? 0.4120 0.5570 0.2562 -0.2467 0.0142  -0.0414 69  VAL D CG2 
3550 N N   . LYS D 75  ? 0.4790 0.5910 0.3430 -0.2297 0.0487  0.0756  70  LYS D N   
3551 C CA  . LYS D 75  ? 0.6116 0.6907 0.4892 -0.2316 0.0523  0.1333  70  LYS D CA  
3552 C C   . LYS D 75  ? 0.6733 0.6784 0.4875 -0.2228 0.0329  0.0816  70  LYS D C   
3553 O O   . LYS D 75  ? 0.5811 0.5701 0.3352 -0.1880 0.0297  0.0025  70  LYS D O   
3554 C CB  . LYS D 75  ? 0.6626 0.7753 0.5578 -0.1682 0.0956  0.1914  70  LYS D CB  
3555 C CG  . LYS D 75  ? 0.7015 0.8694 0.6743 -0.1634 0.1069  0.2323  70  LYS D CG  
3556 C CD  . LYS D 75  ? 0.7001 0.9102 0.6689 -0.0901 0.1465  0.2415  70  LYS D CD  
3557 C CE  . LYS D 75  ? 0.7849 0.9886 0.7517 -0.0552 0.1663  0.2853  70  LYS D CE  
3558 N NZ  . LYS D 75  ? 0.8905 1.0996 0.9233 -0.0891 0.1518  0.3325  70  LYS D NZ  
3559 N N   . ASP D 76  ? 0.6882 0.6490 0.5207 -0.2553 0.0180  0.1273  71  ASP D N   
3560 C CA  . ASP D 76  ? 0.8414 0.7217 0.6240 -0.2483 -0.0045 0.0893  71  ASP D CA  
3561 C C   . ASP D 76  ? 0.9507 0.8045 0.7256 -0.1985 0.0195  0.1479  71  ASP D C   
3562 O O   . ASP D 76  ? 1.0148 0.8896 0.8433 -0.2180 0.0335  0.2355  71  ASP D O   
3563 C CB  . ASP D 76  ? 0.9428 0.7839 0.7539 -0.3293 -0.0456 0.0981  71  ASP D CB  
3564 C CG  . ASP D 76  ? 1.0581 0.8068 0.8304 -0.3236 -0.0714 0.0719  71  ASP D CG  
3565 O OD1 . ASP D 76  ? 1.0286 0.7458 0.7381 -0.2706 -0.0725 0.0018  71  ASP D OD1 
3566 O OD2 . ASP D 76  ? 1.1839 0.8905 0.9910 -0.3723 -0.0930 0.1207  71  ASP D OD2 
3567 N N   . HIS D 77  ? 0.9964 0.8104 0.7054 -0.1349 0.0244  0.1021  72  HIS D N   
3568 C CA  . HIS D 77  ? 1.2153 1.0022 0.9077 -0.0869 0.0449  0.1583  72  HIS D CA  
3569 C C   . HIS D 77  ? 1.4541 1.1611 1.1603 -0.1296 0.0151  0.1997  72  HIS D C   
3570 O O   . HIS D 77  ? 1.5277 1.1556 1.1876 -0.1139 -0.0117 0.1557  72  HIS D O   
3571 C CB  . HIS D 77  ? 1.2057 0.9755 0.8225 -0.0044 0.0562  0.0995  72  HIS D CB  
3572 C CG  . HIS D 77  ? 1.2374 0.9767 0.8293 0.0434  0.0734  0.1581  72  HIS D CG  
3573 N ND1 . HIS D 77  ? 1.3035 0.9529 0.8538 0.0584  0.0467  0.1466  72  HIS D ND1 
3574 C CD2 . HIS D 77  ? 1.2353 1.0249 0.8368 0.0799  0.1144  0.2296  72  HIS D CD2 
3575 C CE1 . HIS D 77  ? 1.3582 1.0012 0.8918 0.0992  0.0694  0.2138  72  HIS D CE1 
3576 N NE2 . HIS D 77  ? 1.3069 1.0388 0.8695 0.1124  0.1123  0.2642  72  HIS D NE2 
3577 N N   . GLU D 78  ? 1.5789 1.2995 1.3527 -0.1947 0.0094  0.2713  73  GLU D N   
3578 C CA  . GLU D 78  ? 1.7473 1.3821 1.5336 -0.2429 -0.0271 0.2981  73  GLU D CA  
3579 C C   . GLU D 78  ? 1.8805 1.5214 1.7017 -0.2430 -0.0039 0.4075  73  GLU D C   
3580 O O   . GLU D 78  ? 1.9765 1.5676 1.7569 -0.1981 0.0025  0.4287  73  GLU D O   
3581 C CB  . GLU D 78  ? 1.7290 1.3576 1.5580 -0.3280 -0.0652 0.2792  73  GLU D CB  
3582 C CG  . GLU D 78  ? 1.7565 1.3991 1.6624 -0.3653 -0.0733 0.3332  73  GLU D CG  
3583 C CD  . GLU D 78  ? 1.6657 1.4104 1.6384 -0.3805 -0.0648 0.3275  73  GLU D CD  
3584 O OE1 . GLU D 78  ? 1.5800 1.3619 1.5431 -0.3867 -0.0707 0.2794  73  GLU D OE1 
3585 O OE2 . GLU D 78  ? 1.6723 1.4520 1.6974 -0.3843 -0.0545 0.3690  73  GLU D OE2 
3586 N N   . THR D 79  ? 1.8880 1.6139 1.7874 -0.2621 0.0168  0.4351  74  THR D N   
3587 C CA  . THR D 79  ? 1.9838 1.7383 1.9088 -0.2417 0.0454  0.4899  74  THR D CA  
3588 C C   . THR D 79  ? 1.9351 1.7723 1.8537 -0.1913 0.0866  0.4968  74  THR D C   
3589 O O   . THR D 79  ? 1.8618 1.7702 1.8182 -0.1946 0.0949  0.4761  74  THR D O   
3590 C CB  . THR D 79  ? 2.0147 1.8052 2.0125 -0.2858 0.0357  0.5065  74  THR D CB  
3591 O OG1 . THR D 79  ? 2.0744 1.8883 2.0854 -0.2711 0.0590  0.5604  74  THR D OG1 
3592 C CG2 . THR D 79  ? 1.9290 1.8034 1.9726 -0.2948 0.0395  0.4820  74  THR D CG2 
3593 N N   . MET D 80  ? 1.9598 1.7898 1.8332 -0.1415 0.1086  0.5232  75  MET D N   
3594 C CA  . MET D 80  ? 1.8775 1.7985 1.7579 -0.0908 0.1455  0.5287  75  MET D CA  
3595 C C   . MET D 80  ? 1.8386 1.8148 1.7924 -0.1205 0.1503  0.5645  75  MET D C   
3596 O O   . MET D 80  ? 1.9004 1.8371 1.8673 -0.1535 0.1373  0.5983  75  MET D O   
3597 C CB  . MET D 80  ? 1.9380 1.8470 1.7598 -0.0308 0.1647  0.5456  75  MET D CB  
3598 C CG  . MET D 80  ? 2.0330 1.8287 1.7952 -0.0327 0.1386  0.5585  75  MET D CG  
3599 S SD  . MET D 80  ? 2.5691 2.3331 2.2311 0.0580  0.1500  0.5174  75  MET D SD  
3600 C CE  . MET D 80  ? 2.1593 2.0568 1.8371 0.1188  0.1994  0.4997  75  MET D CE  
3601 N N   . GLY D 81  ? 1.7260 1.7900 1.7296 -0.1091 0.1654  0.5568  76  GLY D N   
3602 C CA  . GLY D 81  ? 1.6802 1.7961 1.7567 -0.1389 0.1624  0.5869  76  GLY D CA  
3603 C C   . GLY D 81  ? 1.5816 1.7042 1.6962 -0.1772 0.1377  0.5562  76  GLY D C   
3604 O O   . GLY D 81  ? 1.4994 1.6719 1.6337 -0.1602 0.1429  0.5323  76  GLY D O   
3605 N N   . ARG D 82  ? 1.5807 1.6556 1.7081 -0.2269 0.1093  0.5573  77  ARG D N   
3606 C CA  . ARG D 82  ? 1.4884 1.6007 1.6711 -0.2582 0.0892  0.5482  77  ARG D CA  
3607 C C   . ARG D 82  ? 1.4383 1.5284 1.6097 -0.2775 0.0652  0.4951  77  ARG D C   
3608 O O   . ARG D 82  ? 1.4667 1.4957 1.6149 -0.3061 0.0419  0.4730  77  ARG D O   
3609 C CB  . ARG D 82  ? 1.4831 1.5796 1.6990 -0.2994 0.0709  0.5812  77  ARG D CB  
3610 C CG  . ARG D 82  ? 1.4435 1.6078 1.7090 -0.2924 0.0880  0.6355  77  ARG D CG  
3611 C CD  . ARG D 82  ? 1.3339 1.5763 1.6684 -0.3034 0.0735  0.6458  77  ARG D CD  
3612 N NE  . ARG D 82  ? 1.2472 1.5758 1.6209 -0.2670 0.1007  0.6788  77  ARG D NE  
3613 C CZ  . ARG D 82  ? 1.1535 1.5590 1.5885 -0.2620 0.0938  0.6948  77  ARG D CZ  
3614 N NH1 . ARG D 82  ? 1.1120 1.5184 1.5714 -0.2926 0.0585  0.6827  77  ARG D NH1 
3615 N NH2 . ARG D 82  ? 1.1226 1.6030 1.5911 -0.2244 0.1215  0.7240  77  ARG D NH2 
3616 N N   . ASN D 83  ? 1.3584 1.5018 1.5517 -0.2634 0.0677  0.4769  78  ASN D N   
3617 C CA  . ASN D 83  ? 1.2655 1.3984 1.4535 -0.2837 0.0430  0.4307  78  ASN D CA  
3618 C C   . ASN D 83  ? 1.1546 1.2304 1.2908 -0.2934 0.0320  0.3880  78  ASN D C   
3619 O O   . ASN D 83  ? 1.1245 1.1761 1.2565 -0.3254 0.0018  0.3581  78  ASN D O   
3620 C CB  . ASN D 83  ? 1.3272 1.4723 1.5561 -0.3234 0.0096  0.4438  78  ASN D CB  
3621 C CG  . ASN D 83  ? 1.4011 1.4840 1.6134 -0.3560 -0.0075 0.4430  78  ASN D CG  
3622 O OD1 . ASN D 83  ? 1.4657 1.5453 1.6994 -0.3668 -0.0052 0.4848  78  ASN D OD1 
3623 N ND2 . ASN D 83  ? 1.3866 1.4217 1.5628 -0.3719 -0.0263 0.3963  78  ASN D ND2 
3624 N N   . ARG D 84  ? 1.0904 1.1491 1.1838 -0.2639 0.0542  0.3847  79  ARG D N   
3625 C CA  . ARG D 84  ? 0.9703 0.9864 1.0149 -0.2746 0.0402  0.3420  79  ARG D CA  
3626 C C   . ARG D 84  ? 0.8632 0.9199 0.9072 -0.2686 0.0388  0.3013  79  ARG D C   
3627 O O   . ARG D 84  ? 0.6300 0.6722 0.6276 -0.2744 0.0321  0.2611  79  ARG D O   
3628 C CB  . ARG D 84  ? 0.9871 0.9659 0.9727 -0.2423 0.0617  0.3570  79  ARG D CB  
3629 C CG  . ARG D 84  ? 1.0228 1.0542 1.0014 -0.1821 0.1034  0.3784  79  ARG D CG  
3630 C CD  . ARG D 84  ? 1.1306 1.1320 1.0354 -0.1325 0.1240  0.3852  79  ARG D CD  
3631 N NE  . ARG D 84  ? 1.1364 1.2028 1.0340 -0.0651 0.1612  0.3814  79  ARG D NE  
3632 C CZ  . ARG D 84  ? 1.1401 1.2016 0.9756 0.0023  0.1860  0.3734  79  ARG D CZ  
3633 N NH1 . ARG D 84  ? 1.1759 1.1622 0.9447 0.0163  0.1764  0.3691  79  ARG D NH1 
3634 N NH2 . ARG D 84  ? 1.1066 1.2305 0.9480 0.0605  0.2133  0.3578  79  ARG D NH2 
3635 N N   . PHE D 85  ? 0.7385 0.7949 0.5682 -0.3644 -0.0241 0.0240  80  PHE D N   
3636 C CA  . PHE D 85  ? 0.6645 0.7615 0.5256 -0.3381 -0.0221 0.0135  80  PHE D CA  
3637 C C   . PHE D 85  ? 0.6312 0.7057 0.5001 -0.3283 -0.0321 0.0063  80  PHE D C   
3638 O O   . PHE D 85  ? 0.6713 0.7441 0.5401 -0.3433 -0.0346 -0.0005 80  PHE D O   
3639 C CB  . PHE D 85  ? 0.6565 0.8206 0.5502 -0.3426 -0.0101 0.0023  80  PHE D CB  
3640 C CG  . PHE D 85  ? 0.6394 0.8470 0.5726 -0.3170 -0.0127 -0.0065 80  PHE D CG  
3641 C CD1 . PHE D 85  ? 0.6706 0.8824 0.6167 -0.3124 -0.0260 -0.0113 80  PHE D CD1 
3642 C CD2 . PHE D 85  ? 0.5832 0.8257 0.5380 -0.3009 -0.0027 -0.0101 80  PHE D CD2 
3643 C CE1 . PHE D 85  ? 0.6653 0.9128 0.6423 -0.2916 -0.0331 -0.0154 80  PHE D CE1 
3644 C CE2 . PHE D 85  ? 0.5710 0.8500 0.5651 -0.2773 -0.0079 -0.0155 80  PHE D CE2 
3645 C CZ  . PHE D 85  ? 0.5908 0.8720 0.5952 -0.2726 -0.0250 -0.0162 80  PHE D CZ  
3646 N N   . LEU D 86  ? 0.5657 0.6204 0.4383 -0.3067 -0.0368 0.0060  81  LEU D N   
3647 C CA  . LEU D 86  ? 0.6229 0.6548 0.4964 -0.3005 -0.0409 -0.0059 81  LEU D CA  
3648 C C   . LEU D 86  ? 0.5853 0.6643 0.4744 -0.2861 -0.0415 -0.0147 81  LEU D C   
3649 O O   . LEU D 86  ? 0.6151 0.7014 0.4991 -0.2940 -0.0463 -0.0239 81  LEU D O   
3650 C CB  . LEU D 86  ? 0.5954 0.5724 0.4689 -0.2888 -0.0433 -0.0039 81  LEU D CB  
3651 C CG  . LEU D 86  ? 0.6318 0.5467 0.4980 -0.3007 -0.0480 0.0055  81  LEU D CG  
3652 C CD1 . LEU D 86  ? 0.6314 0.4931 0.5175 -0.2849 -0.0487 0.0038  81  LEU D CD1 
3653 C CD2 . LEU D 86  ? 0.6038 0.5014 0.4542 -0.3232 -0.0462 -0.0041 81  LEU D CD2 
3654 N N   . GLY D 87  ? 0.5392 0.6462 0.4449 -0.2662 -0.0390 -0.0103 82  GLY D N   
3655 C CA  . GLY D 87  ? 0.4984 0.6458 0.4222 -0.2499 -0.0420 -0.0149 82  GLY D CA  
3656 C C   . GLY D 87  ? 0.4913 0.6700 0.4367 -0.2320 -0.0363 -0.0097 82  GLY D C   
3657 O O   . GLY D 87  ? 0.3630 0.5232 0.2998 -0.2319 -0.0314 -0.0033 82  GLY D O   
3658 N N   . GLU D 88  ? 0.3148 0.5373 0.2876 -0.2183 -0.0393 -0.0119 83  GLU D N   
3659 C CA  . GLU D 88  ? 0.3848 0.6350 0.3812 -0.2013 -0.0319 -0.0108 83  GLU D CA  
3660 C C   . GLU D 88  ? 0.2585 0.5320 0.2778 -0.1798 -0.0409 -0.0107 83  GLU D C   
3661 O O   . GLU D 88  ? 0.3601 0.6399 0.3805 -0.1813 -0.0551 -0.0099 83  GLU D O   
3662 C CB  . GLU D 88  ? 0.5047 0.7922 0.5250 -0.2113 -0.0199 -0.0146 83  GLU D CB  
3663 C CG  . GLU D 88  ? 0.6024 0.9378 0.6696 -0.2100 -0.0267 -0.0180 83  GLU D CG  
3664 C CD  . GLU D 88  ? 0.7167 1.0901 0.8186 -0.2214 -0.0090 -0.0247 83  GLU D CD  
3665 O OE1 . GLU D 88  ? 0.6860 1.0446 0.7621 -0.2321 0.0098  -0.0278 83  GLU D OE1 
3666 O OE2 . GLU D 88  ? 0.7967 1.2132 0.9523 -0.2217 -0.0144 -0.0267 83  GLU D OE2 
3667 N N   . ALA D 89  ? 0.3975 0.6793 0.4302 -0.1625 -0.0347 -0.0102 84  ALA D N   
3668 C CA  . ALA D 89  ? 0.3871 0.6898 0.4447 -0.1413 -0.0434 -0.0078 84  ALA D CA  
3669 C C   . ALA D 89  ? 0.4227 0.7558 0.5176 -0.1284 -0.0306 -0.0123 84  ALA D C   
3670 O O   . ALA D 89  ? 0.3306 0.6527 0.4115 -0.1344 -0.0151 -0.0169 84  ALA D O   
3671 C CB  . ALA D 89  ? 0.3642 0.6340 0.3942 -0.1330 -0.0479 -0.0042 84  ALA D CB  
3672 N N   . LYS D 90  ? 0.3868 0.7554 0.5298 -0.1127 -0.0379 -0.0109 85  LYS D N   
3673 C CA  . LYS D 90  ? 0.4046 0.7977 0.5905 -0.0954 -0.0234 -0.0175 85  LYS D CA  
3674 C C   . LYS D 90  ? 0.3706 0.7542 0.5594 -0.0732 -0.0369 -0.0084 85  LYS D C   
3675 O O   . LYS D 90  ? 0.4944 0.8872 0.7023 -0.0628 -0.0597 0.0034  85  LYS D O   
3676 C CB  . LYS D 90  ? 0.3551 0.7949 0.6111 -0.0905 -0.0192 -0.0220 85  LYS D CB  
3677 C CG  . LYS D 90  ? 0.3995 0.8503 0.6531 -0.1155 -0.0073 -0.0287 85  LYS D CG  
3678 C CD  . LYS D 90  ? 0.4439 0.9442 0.7795 -0.1104 0.0052  -0.0350 85  LYS D CD  
3679 C CE  . LYS D 90  ? 0.4510 0.9799 0.8504 -0.0944 -0.0275 -0.0217 85  LYS D CE  
3680 N NZ  . LYS D 90  ? 0.4521 1.0332 0.9508 -0.0881 -0.0164 -0.0237 85  LYS D NZ  
3681 N N   . VAL D 91  ? 0.2657 0.6252 0.4303 -0.0686 -0.0256 -0.0116 86  VAL D N   
3682 C CA  . VAL D 91  ? 0.2725 0.6039 0.4297 -0.0474 -0.0343 -0.0021 86  VAL D CA  
3683 C C   . VAL D 91  ? 0.3005 0.6458 0.5062 -0.0249 -0.0240 -0.0081 86  VAL D C   
3684 O O   . VAL D 91  ? 0.2958 0.6403 0.5067 -0.0271 0.0004  -0.0246 86  VAL D O   
3685 C CB  . VAL D 91  ? 0.4948 0.7766 0.6015 -0.0521 -0.0295 -0.0004 86  VAL D CB  
3686 C CG1 . VAL D 91  ? 0.4656 0.7380 0.5460 -0.0748 -0.0215 -0.0064 86  VAL D CG1 
3687 C CG2 . VAL D 91  ? 0.4983 0.7581 0.6090 -0.0366 -0.0205 -0.0025 86  VAL D CG2 
3688 N N   . PRO D 92  ? 0.3601 0.7147 0.5999 -0.0054 -0.0430 0.0054  87  PRO D N   
3689 C CA  . PRO D 92  ? 0.3429 0.7074 0.6417 0.0199  -0.0352 0.0011  87  PRO D CA  
3690 C C   . PRO D 92  ? 0.3732 0.6889 0.6430 0.0290  -0.0217 -0.0035 87  PRO D C   
3691 O O   . PRO D 92  ? 0.4297 0.7108 0.6651 0.0319  -0.0361 0.0125  87  PRO D O   
3692 C CB  . PRO D 92  ? 0.4549 0.8328 0.7872 0.0341  -0.0708 0.0258  87  PRO D CB  
3693 C CG  . PRO D 92  ? 0.4991 0.8485 0.7581 0.0157  -0.0912 0.0416  87  PRO D CG  
3694 C CD  . PRO D 92  ? 0.4399 0.7908 0.6602 -0.0090 -0.0743 0.0262  87  PRO D CD  
3695 N N   . LEU D 93  ? 0.2688 0.5802 0.5488 0.0294  0.0076  -0.0264 88  LEU D N   
3696 C CA  . LEU D 93  ? 0.3354 0.6001 0.5884 0.0337  0.0188  -0.0332 88  LEU D CA  
3697 C C   . LEU D 93  ? 0.3895 0.6386 0.6848 0.0616  0.0103  -0.0239 88  LEU D C   
3698 O O   . LEU D 93  ? 0.3487 0.5563 0.6283 0.0663  0.0174  -0.0279 88  LEU D O   
3699 C CB  . LEU D 93  ? 0.3602 0.6182 0.5996 0.0199  0.0516  -0.0622 88  LEU D CB  
3700 C CG  . LEU D 93  ? 0.3949 0.6369 0.5665 -0.0116 0.0542  -0.0655 88  LEU D CG  
3701 C CD1 . LEU D 93  ? 0.3662 0.6042 0.5102 -0.0184 0.0274  -0.0419 88  LEU D CD1 
3702 C CD2 . LEU D 93  ? 0.4312 0.7011 0.6013 -0.0319 0.0782  -0.0838 88  LEU D CD2 
3703 N N   . ARG D 94  ? 0.3936 0.6745 0.7442 0.0779  -0.0086 -0.0092 89  ARG D N   
3704 C CA  . ARG D 94  ? 0.4081 0.6724 0.7993 0.1036  -0.0284 0.0101  89  ARG D CA  
3705 C C   . ARG D 94  ? 0.3523 0.5678 0.6803 0.0973  -0.0466 0.0329  89  ARG D C   
3706 O O   . ARG D 94  ? 0.3220 0.4982 0.6561 0.1106  -0.0478 0.0397  89  ARG D O   
3707 C CB  . ARG D 94  ? 0.4426 0.7529 0.8944 0.1144  -0.0585 0.0301  89  ARG D CB  
3708 C CG  . ARG D 94  ? 0.5858 0.8762 1.0776 0.1392  -0.0865 0.0557  89  ARG D CG  
3709 C CD  . ARG D 94  ? 0.6641 0.9863 1.1727 0.1372  -0.1207 0.0757  89  ARG D CD  
3710 N NE  . ARG D 94  ? 0.6914 1.0142 1.1312 0.1107  -0.1466 0.0933  89  ARG D NE  
3711 C CZ  . ARG D 94  ? 0.6715 1.0319 1.1089 0.0941  -0.1602 0.0925  89  ARG D CZ  
3712 N NH1 . ARG D 94  ? 0.6293 1.0373 1.1356 0.1019  -0.1516 0.0781  89  ARG D NH1 
3713 N NH2 . ARG D 94  ? 0.6924 1.0397 1.0565 0.0677  -0.1791 0.1045  89  ARG D NH2 
3714 N N   . GLU D 95  ? 0.2999 0.5159 0.5699 0.0757  -0.0570 0.0427  90  GLU D N   
3715 C CA  . GLU D 95  ? 0.4176 0.5919 0.6299 0.0660  -0.0662 0.0606  90  GLU D CA  
3716 C C   . GLU D 95  ? 0.4049 0.5434 0.5959 0.0618  -0.0440 0.0471  90  GLU D C   
3717 O O   . GLU D 95  ? 0.4149 0.5159 0.5832 0.0604  -0.0464 0.0601  90  GLU D O   
3718 C CB  . GLU D 95  ? 0.5293 0.7114 0.6902 0.0430  -0.0726 0.0656  90  GLU D CB  
3719 C CG  . GLU D 95  ? 0.6027 0.8262 0.7800 0.0381  -0.0924 0.0710  90  GLU D CG  
3720 C CD  . GLU D 95  ? 0.7546 0.9780 0.9440 0.0456  -0.1276 0.0994  90  GLU D CD  
3721 O OE1 . GLU D 95  ? 0.8394 1.0227 1.0087 0.0512  -0.1357 0.1175  90  GLU D OE1 
3722 O OE2 . GLU D 95  ? 0.7400 1.0025 0.9591 0.0433  -0.1503 0.1061  90  GLU D OE2 
3723 N N   . VAL D 96  ? 0.3666 0.5162 0.5620 0.0555  -0.0237 0.0222  91  VAL D N   
3724 C CA  . VAL D 96  ? 0.4152 0.5331 0.5896 0.0467  -0.0086 0.0090  91  VAL D CA  
3725 C C   . VAL D 96  ? 0.4428 0.5286 0.6428 0.0626  -0.0029 0.0054  91  VAL D C   
3726 O O   . VAL D 96  ? 0.5317 0.5805 0.7127 0.0564  -0.0013 0.0080  91  VAL D O   
3727 C CB  . VAL D 96  ? 0.4199 0.5520 0.5817 0.0310  0.0074  -0.0146 91  VAL D CB  
3728 C CG1 . VAL D 96  ? 0.4512 0.5478 0.5904 0.0194  0.0172  -0.0284 91  VAL D CG1 
3729 C CG2 . VAL D 96  ? 0.3938 0.5443 0.5277 0.0136  0.0000  -0.0084 91  VAL D CG2 
3730 N N   . LEU D 97  ? 0.3688 0.4688 0.6197 0.0832  0.0003  -0.0005 92  LEU D N   
3731 C CA  . LEU D 97  ? 0.4109 0.4767 0.6973 0.1022  0.0076  -0.0061 92  LEU D CA  
3732 C C   . LEU D 97  ? 0.3893 0.4349 0.6959 0.1197  -0.0188 0.0272  92  LEU D C   
3733 O O   . LEU D 97  ? 0.4114 0.4300 0.7619 0.1407  -0.0182 0.0280  92  LEU D O   
3734 C CB  . LEU D 97  ? 0.4699 0.5584 0.8156 0.1181  0.0302  -0.0329 92  LEU D CB  
3735 C CG  . LEU D 97  ? 0.4762 0.5695 0.8007 0.0999  0.0649  -0.0714 92  LEU D CG  
3736 C CD1 . LEU D 97  ? 0.4137 0.5286 0.8111 0.1197  0.0930  -0.0972 92  LEU D CD1 
3737 C CD2 . LEU D 97  ? 0.5314 0.5702 0.8038 0.0822  0.0759  -0.0864 92  LEU D CD2 
3738 N N   . ALA D 98  ? 0.4124 0.4657 0.6841 0.1094  -0.0417 0.0547  93  ALA D N   
3739 C CA  . ALA D 98  ? 0.4629 0.4917 0.7358 0.1184  -0.0700 0.0902  93  ALA D CA  
3740 C C   . ALA D 98  ? 0.4406 0.4155 0.6670 0.1049  -0.0660 0.1017  93  ALA D C   
3741 O O   . ALA D 98  ? 0.4374 0.3765 0.6549 0.1080  -0.0848 0.1311  93  ALA D O   
3742 C CB  . ALA D 98  ? 0.5072 0.5653 0.7540 0.1078  -0.0953 0.1124  93  ALA D CB  
3743 N N   . THR D 99  ? 0.3816 0.3511 0.5809 0.0876  -0.0432 0.0802  94  THR D N   
3744 C CA  . THR D 99  ? 0.4703 0.4026 0.6313 0.0689  -0.0370 0.0891  94  THR D CA  
3745 C C   . THR D 99  ? 0.4298 0.3358 0.6008 0.0642  -0.0193 0.0656  94  THR D C   
3746 O O   . THR D 99  ? 0.3850 0.3085 0.5675 0.0643  -0.0074 0.0378  94  THR D O   
3747 C CB  . THR D 99  ? 0.5051 0.4608 0.6269 0.0467  -0.0311 0.0893  94  THR D CB  
3748 O OG1 . THR D 99  ? 0.5996 0.5282 0.7023 0.0285  -0.0190 0.0925  94  THR D OG1 
3749 C CG2 . THR D 99  ? 0.3128 0.3070 0.4436 0.0435  -0.0221 0.0635  94  THR D CG2 
3750 N N   . PRO D 100 ? 0.4163 0.2765 0.5765 0.0553  -0.0178 0.0767  95  PRO D N   
3751 C CA  . PRO D 100 ? 0.4301 0.2613 0.5932 0.0437  -0.0047 0.0554  95  PRO D CA  
3752 C C   . PRO D 100 ? 0.3914 0.2506 0.5377 0.0207  0.0016  0.0395  95  PRO D C   
3753 O O   . PRO D 100 ? 0.4011 0.2473 0.5457 0.0087  0.0071  0.0174  95  PRO D O   
3754 C CB  . PRO D 100 ? 0.5105 0.2934 0.6625 0.0332  -0.0071 0.0784  95  PRO D CB  
3755 C CG  . PRO D 100 ? 0.5541 0.3271 0.7036 0.0486  -0.0233 0.1097  95  PRO D CG  
3756 C CD  . PRO D 100 ? 0.4586 0.2861 0.6002 0.0530  -0.0299 0.1110  95  PRO D CD  
3757 N N   . SER D 101 ? 0.3568 0.2499 0.4902 0.0134  -0.0009 0.0511  96  SER D N   
3758 C CA  . SER D 101 ? 0.3674 0.2868 0.4969 -0.0050 0.0010  0.0411  96  SER D CA  
3759 C C   . SER D 101 ? 0.3502 0.2952 0.4767 -0.0029 -0.0004 0.0203  96  SER D C   
3760 O O   . SER D 101 ? 0.3301 0.2882 0.4510 -0.0195 -0.0044 0.0120  96  SER D O   
3761 C CB  . SER D 101 ? 0.3124 0.2546 0.4347 -0.0113 0.0040  0.0567  96  SER D CB  
3762 O OG  . SER D 101 ? 0.3604 0.3307 0.4721 -0.0005 0.0001  0.0571  96  SER D OG  
3763 N N   . LEU D 102 ? 0.3072 0.2594 0.4410 0.0160  0.0020  0.0140  97  LEU D N   
3764 C CA  . LEU D 102 ? 0.2945 0.2726 0.4257 0.0162  0.0072  -0.0064 97  LEU D CA  
3765 C C   . LEU D 102 ? 0.2580 0.2695 0.3736 0.0033  0.0010  -0.0023 97  LEU D C   
3766 O O   . LEU D 102 ? 0.2617 0.2808 0.3606 -0.0119 0.0013  -0.0158 97  LEU D O   
3767 C CB  . LEU D 102 ? 0.3277 0.2798 0.4461 0.0034  0.0170  -0.0327 97  LEU D CB  
3768 C CG  . LEU D 102 ? 0.5167 0.4284 0.6536 0.0169  0.0282  -0.0438 97  LEU D CG  
3769 C CD1 . LEU D 102 ? 0.5991 0.4781 0.7084 -0.0039 0.0400  -0.0741 97  LEU D CD1 
3770 C CD2 . LEU D 102 ? 0.4848 0.4131 0.6614 0.0461  0.0369  -0.0466 97  LEU D CD2 
3771 N N   . SER D 103 ? 0.2392 0.2640 0.3554 0.0068  -0.0044 0.0167  98  SER D N   
3772 C CA  . SER D 103 ? 0.3157 0.3647 0.4226 -0.0035 -0.0077 0.0202  98  SER D CA  
3773 C C   . SER D 103 ? 0.3278 0.3894 0.4283 0.0033  -0.0091 0.0339  98  SER D C   
3774 O O   . SER D 103 ? 0.3554 0.4014 0.4525 0.0102  -0.0104 0.0473  98  SER D O   
3775 C CB  . SER D 103 ? 0.2328 0.2722 0.3455 -0.0187 -0.0097 0.0248  98  SER D CB  
3776 O OG  . SER D 103 ? 0.3884 0.4127 0.5081 -0.0177 -0.0029 0.0380  98  SER D OG  
3777 N N   . ALA D 104 ? 0.2298 0.3142 0.3219 -0.0025 -0.0106 0.0315  99  ALA D N   
3778 C CA  . ALA D 104 ? 0.2692 0.3616 0.3451 -0.0027 -0.0124 0.0408  99  ALA D CA  
3779 C C   . ALA D 104 ? 0.2721 0.3758 0.3407 -0.0141 -0.0092 0.0351  99  ALA D C   
3780 O O   . ALA D 104 ? 0.2169 0.3294 0.2935 -0.0195 -0.0118 0.0270  99  ALA D O   
3781 C CB  . ALA D 104 ? 0.2778 0.3888 0.3588 0.0079  -0.0234 0.0434  99  ALA D CB  
3782 N N   . SER D 105 ? 0.2461 0.3431 0.2948 -0.0203 -0.0031 0.0394  100 SER D N   
3783 C CA  . SER D 105 ? 0.2174 0.3183 0.2616 -0.0299 0.0022  0.0321  100 SER D CA  
3784 C C   . SER D 105 ? 0.2935 0.4041 0.3085 -0.0355 -0.0049 0.0317  100 SER D C   
3785 O O   . SER D 105 ? 0.2216 0.3300 0.2153 -0.0347 -0.0128 0.0409  100 SER D O   
3786 C CB  . SER D 105 ? 0.2778 0.3588 0.3266 -0.0356 0.0223  0.0308  100 SER D CB  
3787 O OG  . SER D 105 ? 0.3859 0.4507 0.3955 -0.0424 0.0329  0.0344  100 SER D OG  
3788 N N   . PHE D 106 ? 0.2326 0.3514 0.2462 -0.0437 -0.0061 0.0236  101 PHE D N   
3789 C CA  . PHE D 106 ? 0.2944 0.4237 0.2826 -0.0538 -0.0150 0.0217  101 PHE D CA  
3790 C C   . PHE D 106 ? 0.3339 0.4431 0.3046 -0.0676 -0.0027 0.0113  101 PHE D C   
3791 O O   . PHE D 106 ? 0.2729 0.3739 0.2671 -0.0670 0.0044  0.0064  101 PHE D O   
3792 C CB  . PHE D 106 ? 0.2394 0.4019 0.2480 -0.0529 -0.0283 0.0200  101 PHE D CB  
3793 C CG  . PHE D 106 ? 0.2506 0.4301 0.2861 -0.0375 -0.0339 0.0245  101 PHE D CG  
3794 C CD1 . PHE D 106 ? 0.1896 0.3634 0.2430 -0.0309 -0.0262 0.0203  101 PHE D CD1 
3795 C CD2 . PHE D 106 ? 0.2293 0.4270 0.2740 -0.0305 -0.0486 0.0330  101 PHE D CD2 
3796 C CE1 . PHE D 106 ? 0.2531 0.4346 0.3290 -0.0177 -0.0263 0.0194  101 PHE D CE1 
3797 C CE2 . PHE D 106 ? 0.2653 0.4742 0.3456 -0.0130 -0.0509 0.0354  101 PHE D CE2 
3798 C CZ  . PHE D 106 ? 0.2766 0.4752 0.3706 -0.0065 -0.0363 0.0260  101 PHE D CZ  
3799 N N   . ASN D 107 ? 0.2885 0.3850 0.2165 -0.0814 -0.0017 0.0083  102 ASN D N   
3800 C CA  . ASN D 107 ? 0.3817 0.4569 0.2872 -0.0977 0.0095  -0.0061 102 ASN D CA  
3801 C C   . ASN D 107 ? 0.3447 0.4398 0.2268 -0.1128 -0.0138 -0.0050 102 ASN D C   
3802 O O   . ASN D 107 ? 0.4202 0.5070 0.2559 -0.1280 -0.0229 -0.0033 102 ASN D O   
3803 C CB  . ASN D 107 ? 0.3854 0.4220 0.2513 -0.1082 0.0356  -0.0157 102 ASN D CB  
3804 C CG  . ASN D 107 ? 0.3849 0.3901 0.2428 -0.1202 0.0586  -0.0368 102 ASN D CG  
3805 O OD1 . ASN D 107 ? 0.4507 0.4600 0.3192 -0.1252 0.0479  -0.0414 102 ASN D OD1 
3806 N ND2 . ASN D 107 ? 0.4354 0.4058 0.2753 -0.1264 0.0937  -0.0512 102 ASN D ND2 
3807 N N   . ALA D 108 ? 0.2807 0.4026 0.1939 -0.1120 -0.0251 -0.0045 103 ALA D N   
3808 C CA  . ALA D 108 ? 0.3274 0.4837 0.2413 -0.1234 -0.0479 -0.0009 103 ALA D CA  
3809 C C   . ALA D 108 ? 0.3075 0.4522 0.1979 -0.1487 -0.0494 -0.0124 103 ALA D C   
3810 O O   . ALA D 108 ? 0.3549 0.4806 0.2542 -0.1521 -0.0369 -0.0200 103 ALA D O   
3811 C CB  . ALA D 108 ? 0.2955 0.4922 0.2589 -0.1107 -0.0537 0.0045  103 ALA D CB  
3812 N N   . PRO D 109 ? 0.3545 0.5074 0.2145 -0.1686 -0.0686 -0.0118 104 PRO D N   
3813 C CA  . PRO D 109 ? 0.4610 0.6012 0.3059 -0.1905 -0.0699 -0.0207 104 PRO D CA  
3814 C C   . PRO D 109 ? 0.4106 0.5835 0.3042 -0.1871 -0.0716 -0.0169 104 PRO D C   
3815 O O   . PRO D 109 ? 0.3850 0.5995 0.3211 -0.1720 -0.0794 -0.0069 104 PRO D O   
3816 C CB  . PRO D 109 ? 0.4887 0.6347 0.3125 -0.1997 -0.0915 -0.0115 104 PRO D CB  
3817 C CG  . PRO D 109 ? 0.4311 0.5693 0.2341 -0.1890 -0.0958 -0.0015 104 PRO D CG  
3818 C CD  . PRO D 109 ? 0.3964 0.5568 0.2408 -0.1650 -0.0872 0.0025  104 PRO D CD  
3819 N N   . LEU D 110 ? 0.4061 0.5550 0.2912 -0.2021 -0.0616 -0.0261 105 LEU D N   
3820 C CA  . LEU D 110 ? 0.4211 0.5917 0.3374 -0.2044 -0.0602 -0.0217 105 LEU D CA  
3821 C C   . LEU D 110 ? 0.4578 0.6470 0.3759 -0.2204 -0.0725 -0.0209 105 LEU D C   
3822 O O   . LEU D 110 ? 0.4892 0.6502 0.3716 -0.2390 -0.0768 -0.0279 105 LEU D O   
3823 C CB  . LEU D 110 ? 0.4074 0.5380 0.3140 -0.2138 -0.0481 -0.0268 105 LEU D CB  
3824 C CG  . LEU D 110 ? 0.4271 0.5447 0.3466 -0.1995 -0.0411 -0.0243 105 LEU D CG  
3825 C CD1 . LEU D 110 ? 0.4683 0.5320 0.3827 -0.2078 -0.0337 -0.0273 105 LEU D CD1 
3826 C CD2 . LEU D 110 ? 0.3961 0.5492 0.3438 -0.1858 -0.0407 -0.0130 105 LEU D CD2 
3827 N N   . LEU D 111 ? 0.4722 0.7083 0.4334 -0.2149 -0.0771 -0.0146 106 LEU D N   
3828 C CA  . LEU D 111 ? 0.3888 0.6527 0.3674 -0.2295 -0.0922 -0.0133 106 LEU D CA  
3829 C C   . LEU D 111 ? 0.3841 0.6515 0.3716 -0.2474 -0.0816 -0.0167 106 LEU D C   
3830 O O   . LEU D 111 ? 0.4563 0.7195 0.4480 -0.2442 -0.0644 -0.0166 106 LEU D O   
3831 C CB  . LEU D 111 ? 0.3903 0.7074 0.4239 -0.2125 -0.1064 -0.0056 106 LEU D CB  
3832 C CG  . LEU D 111 ? 0.4143 0.7265 0.4407 -0.1927 -0.1173 0.0017  106 LEU D CG  
3833 C CD1 . LEU D 111 ? 0.3839 0.7461 0.4753 -0.1745 -0.1340 0.0102  106 LEU D CD1 
3834 C CD2 . LEU D 111 ? 0.4570 0.7305 0.4237 -0.2076 -0.1311 0.0024  106 LEU D CD2 
3835 N N   . ASP D 112 ? 0.4232 0.6955 0.4088 -0.2693 -0.0932 -0.0188 107 ASP D N   
3836 C CA  . ASP D 112 ? 0.5295 0.8019 0.5196 -0.2905 -0.0839 -0.0214 107 ASP D CA  
3837 C C   . ASP D 112 ? 0.5249 0.8562 0.5761 -0.2888 -0.0789 -0.0195 107 ASP D C   
3838 O O   . ASP D 112 ? 0.4294 0.7985 0.5236 -0.2676 -0.0802 -0.0173 107 ASP D O   
3839 C CB  . ASP D 112 ? 0.6080 0.8587 0.5711 -0.3181 -0.0967 -0.0262 107 ASP D CB  
3840 C CG  . ASP D 112 ? 0.6061 0.8933 0.5925 -0.3224 -0.1240 -0.0234 107 ASP D CG  
3841 O OD1 . ASP D 112 ? 0.5508 0.8950 0.5996 -0.3110 -0.1325 -0.0179 107 ASP D OD1 
3842 O OD2 . ASP D 112 ? 0.6445 0.9008 0.5874 -0.3385 -0.1379 -0.0272 107 ASP D OD2 
3843 N N   . THR D 113 ? 0.6460 0.9829 0.7034 -0.3124 -0.0714 -0.0218 108 THR D N   
3844 C CA  . THR D 113 ? 0.6955 1.0867 0.8126 -0.3173 -0.0600 -0.0233 108 THR D CA  
3845 C C   . THR D 113 ? 0.7400 1.1918 0.9325 -0.3089 -0.0793 -0.0225 108 THR D C   
3846 O O   . THR D 113 ? 0.7505 1.2535 1.0127 -0.3056 -0.0672 -0.0250 108 THR D O   
3847 C CB  . THR D 113 ? 0.6858 1.0678 0.7914 -0.3499 -0.0505 -0.0251 108 THR D CB  
3848 O OG1 . THR D 113 ? 0.6827 1.0271 0.7490 -0.3676 -0.0682 -0.0256 108 THR D OG1 
3849 C CG2 . THR D 113 ? 0.7352 1.0786 0.7951 -0.3562 -0.0269 -0.0234 108 THR D CG2 
3850 N N   . LYS D 114 ? 0.7557 1.1998 0.9363 -0.3067 -0.1090 -0.0189 109 LYS D N   
3851 C CA  . LYS D 114 ? 0.7531 1.2495 1.0029 -0.3010 -0.1370 -0.0153 109 LYS D CA  
3852 C C   . LYS D 114 ? 0.6958 1.1909 0.9450 -0.2735 -0.1563 -0.0081 109 LYS D C   
3853 O O   . LYS D 114 ? 0.6857 1.2122 0.9765 -0.2690 -0.1878 -0.0023 109 LYS D O   
3854 C CB  . LYS D 114 ? 0.8627 1.3552 1.0983 -0.3299 -0.1632 -0.0154 109 LYS D CB  
3855 C CG  . LYS D 114 ? 0.9568 1.4614 1.2110 -0.3590 -0.1491 -0.0212 109 LYS D CG  
3856 C CD  . LYS D 114 ? 1.0902 1.5878 1.3272 -0.3892 -0.1770 -0.0221 109 LYS D CD  
3857 C CE  . LYS D 114 ? 1.1825 1.6923 1.4412 -0.4199 -0.1631 -0.0272 109 LYS D CE  
3858 N NZ  . LYS D 114 ? 1.2773 1.7777 1.5173 -0.4520 -0.1908 -0.0293 109 LYS D NZ  
3859 N N   . LYS D 115 ? 0.6060 1.0642 0.8081 -0.2567 -0.1392 -0.0078 110 LYS D N   
3860 C CA  . LYS D 115 ? 0.5036 0.9547 0.6992 -0.2312 -0.1518 -0.0004 110 LYS D CA  
3861 C C   . LYS D 115 ? 0.5448 0.9568 0.6750 -0.2407 -0.1768 0.0054  110 LYS D C   
3862 O O   . LYS D 115 ? 0.4994 0.9117 0.6277 -0.2260 -0.1965 0.0151  110 LYS D O   
3863 C CB  . LYS D 115 ? 0.4934 1.0022 0.7819 -0.2083 -0.1638 0.0036  110 LYS D CB  
3864 C CG  . LYS D 115 ? 0.5874 1.1193 0.9253 -0.1907 -0.1303 -0.0032 110 LYS D CG  
3865 C CD  . LYS D 115 ? 0.6947 1.2430 1.0518 -0.2114 -0.1022 -0.0126 110 LYS D CD  
3866 C CE  . LYS D 115 ? 0.7343 1.2534 1.0447 -0.2105 -0.0655 -0.0191 110 LYS D CE  
3867 N NZ  . LYS D 115 ? 0.7244 1.2772 1.0952 -0.1932 -0.0389 -0.0252 110 LYS D NZ  
3868 N N   . GLN D 116 ? 0.5880 0.9621 0.6610 -0.2674 -0.1737 -0.0008 111 GLN D N   
3869 C CA  . GLN D 116 ? 0.6132 0.9411 0.6140 -0.2825 -0.1885 0.0000  111 GLN D CA  
3870 C C   . GLN D 116 ? 0.6276 0.8962 0.5645 -0.2826 -0.1605 -0.0093 111 GLN D C   
3871 O O   . GLN D 116 ? 0.6036 0.8622 0.5451 -0.2818 -0.1363 -0.0160 111 GLN D O   
3872 C CB  . GLN D 116 ? 0.6601 0.9868 0.6477 -0.3150 -0.2062 -0.0034 111 GLN D CB  
3873 C CG  . GLN D 116 ? 0.6707 1.0612 0.7333 -0.3157 -0.2373 0.0053  111 GLN D CG  
3874 C CD  . GLN D 116 ? 0.7508 1.1409 0.7987 -0.3504 -0.2600 0.0030  111 GLN D CD  
3875 O OE1 . GLN D 116 ? 0.7430 1.1844 0.8521 -0.3553 -0.2896 0.0097  111 GLN D OE1 
3876 N NE2 . GLN D 116 ? 0.7874 1.1197 0.7588 -0.3751 -0.2465 -0.0075 111 GLN D NE2 
3877 N N   . PRO D 117 ? 0.6785 0.9066 0.5577 -0.2847 -0.1638 -0.0096 112 PRO D N   
3878 C CA  . PRO D 117 ? 0.6431 0.8188 0.4745 -0.2823 -0.1364 -0.0208 112 PRO D CA  
3879 C C   . PRO D 117 ? 0.6344 0.7720 0.4421 -0.3010 -0.1166 -0.0359 112 PRO D C   
3880 O O   . PRO D 117 ? 0.6496 0.7882 0.4534 -0.3232 -0.1258 -0.0389 112 PRO D O   
3881 C CB  . PRO D 117 ? 0.7243 0.8625 0.4925 -0.2935 -0.1445 -0.0214 112 PRO D CB  
3882 C CG  . PRO D 117 ? 0.7569 0.9352 0.5504 -0.2889 -0.1791 -0.0027 112 PRO D CG  
3883 C CD  . PRO D 117 ? 0.7484 0.9768 0.6044 -0.2919 -0.1938 0.0008  112 PRO D CD  
3884 N N   . THR D 118 ? 0.6047 0.7079 0.4005 -0.2924 -0.0921 -0.0450 113 THR D N   
3885 C CA  . THR D 118 ? 0.6424 0.6996 0.4185 -0.3075 -0.0750 -0.0589 113 THR D CA  
3886 C C   . THR D 118 ? 0.7628 0.7550 0.4855 -0.3145 -0.0556 -0.0783 113 THR D C   
3887 O O   . THR D 118 ? 0.7752 0.7172 0.4764 -0.3285 -0.0408 -0.0943 113 THR D O   
3888 C CB  . THR D 118 ? 0.5991 0.6615 0.4123 -0.2934 -0.0628 -0.0540 113 THR D CB  
3889 O OG1 . THR D 118 ? 0.5039 0.5623 0.3246 -0.2718 -0.0536 -0.0532 113 THR D OG1 
3890 C CG2 . THR D 118 ? 0.5135 0.6341 0.3735 -0.2893 -0.0720 -0.0398 113 THR D CG2 
3891 N N   . GLY D 119 ? 0.6288 0.6187 0.3319 -0.3046 -0.0529 -0.0782 114 GLY D N   
3892 C CA  . GLY D 119 ? 0.6766 0.6062 0.3328 -0.3089 -0.0254 -0.0994 114 GLY D CA  
3893 C C   . GLY D 119 ? 0.7302 0.6498 0.4168 -0.2867 -0.0055 -0.1047 114 GLY D C   
3894 O O   . GLY D 119 ? 0.7667 0.6482 0.4309 -0.2821 0.0211  -0.1209 114 GLY D O   
3895 N N   . ALA D 120 ? 0.6152 0.5685 0.3551 -0.2741 -0.0164 -0.0908 115 ALA D N   
3896 C CA  . ALA D 120 ? 0.5563 0.5025 0.3342 -0.2556 -0.0045 -0.0904 115 ALA D CA  
3897 C C   . ALA D 120 ? 0.5224 0.5167 0.3234 -0.2300 -0.0123 -0.0726 115 ALA D C   
3898 O O   . ALA D 120 ? 0.4619 0.5027 0.2614 -0.2326 -0.0342 -0.0607 115 ALA D O   
3899 C CB  . ALA D 120 ? 0.5706 0.5211 0.3885 -0.2556 -0.0119 -0.0785 115 ALA D CB  
3900 N N   . SER D 121 ? 0.5036 0.4855 0.3353 -0.2027 0.0055  -0.0693 116 SER D N   
3901 C CA  . SER D 121 ? 0.4080 0.4268 0.2622 -0.1795 0.0003  -0.0538 116 SER D CA  
3902 C C   . SER D 121 ? 0.4100 0.4290 0.3166 -0.1560 0.0060  -0.0434 116 SER D C   
3903 O O   . SER D 121 ? 0.4254 0.4095 0.3537 -0.1533 0.0166  -0.0475 116 SER D O   
3904 C CB  . SER D 121 ? 0.4214 0.4234 0.2401 -0.1775 0.0145  -0.0603 116 SER D CB  
3905 O OG  . SER D 121 ? 0.5998 0.5549 0.4227 -0.1719 0.0485  -0.0766 116 SER D OG  
3906 N N   . LEU D 122 ? 0.3055 0.3608 0.2335 -0.1401 -0.0037 -0.0293 117 LEU D N   
3907 C CA  . LEU D 122 ? 0.2729 0.3302 0.2413 -0.1235 -0.0047 -0.0181 117 LEU D CA  
3908 C C   . LEU D 122 ? 0.2621 0.3305 0.2447 -0.1043 0.0008  -0.0130 117 LEU D C   
3909 O O   . LEU D 122 ? 0.2767 0.3698 0.2458 -0.1013 -0.0052 -0.0095 117 LEU D O   
3910 C CB  . LEU D 122 ? 0.3630 0.4491 0.3381 -0.1307 -0.0213 -0.0079 117 LEU D CB  
3911 C CG  . LEU D 122 ? 0.3933 0.4778 0.3928 -0.1211 -0.0273 0.0044  117 LEU D CG  
3912 C CD1 . LEU D 122 ? 0.4303 0.4783 0.4410 -0.1285 -0.0333 0.0116  117 LEU D CD1 
3913 C CD2 . LEU D 122 ? 0.3987 0.5183 0.3927 -0.1269 -0.0341 0.0084  117 LEU D CD2 
3914 N N   . VAL D 123 ? 0.2542 0.3038 0.2708 -0.0918 0.0104  -0.0109 118 VAL D N   
3915 C CA  . VAL D 123 ? 0.2264 0.2848 0.2613 -0.0771 0.0163  -0.0057 118 VAL D CA  
3916 C C   . VAL D 123 ? 0.2791 0.3524 0.3422 -0.0704 -0.0013 0.0077  118 VAL D C   
3917 O O   . VAL D 123 ? 0.2372 0.2985 0.3266 -0.0717 -0.0113 0.0147  118 VAL D O   
3918 C CB  . VAL D 123 ? 0.3428 0.3754 0.4038 -0.0703 0.0424  -0.0141 118 VAL D CB  
3919 C CG1 . VAL D 123 ? 0.2283 0.2723 0.3094 -0.0593 0.0483  -0.0072 118 VAL D CG1 
3920 C CG2 . VAL D 123 ? 0.2925 0.3008 0.3094 -0.0830 0.0657  -0.0322 118 VAL D CG2 
3921 N N   . LEU D 124 ? 0.1795 0.2745 0.2339 -0.0654 -0.0069 0.0116  119 LEU D N   
3922 C CA  . LEU D 124 ? 0.1639 0.2676 0.2323 -0.0633 -0.0200 0.0194  119 LEU D CA  
3923 C C   . LEU D 124 ? 0.2653 0.3752 0.3391 -0.0522 -0.0152 0.0206  119 LEU D C   
3924 O O   . LEU D 124 ? 0.1602 0.2727 0.2196 -0.0475 -0.0066 0.0187  119 LEU D O   
3925 C CB  . LEU D 124 ? 0.1640 0.2847 0.2100 -0.0744 -0.0295 0.0185  119 LEU D CB  
3926 C CG  . LEU D 124 ? 0.2567 0.4051 0.2908 -0.0718 -0.0258 0.0123  119 LEU D CG  
3927 C CD1 . LEU D 124 ? 0.2598 0.4265 0.2887 -0.0804 -0.0270 0.0085  119 LEU D CD1 
3928 C CD2 . LEU D 124 ? 0.2752 0.4295 0.2952 -0.0791 -0.0249 0.0084  119 LEU D CD2 
3929 N N   . GLN D 125 ? 0.2147 0.3221 0.3049 -0.0514 -0.0237 0.0255  120 GLN D N   
3930 C CA  . GLN D 125 ? 0.2663 0.3753 0.3583 -0.0436 -0.0204 0.0254  120 GLN D CA  
3931 C C   . GLN D 125 ? 0.2381 0.3495 0.3192 -0.0496 -0.0304 0.0224  120 GLN D C   
3932 O O   . GLN D 125 ? 0.1993 0.3049 0.2737 -0.0631 -0.0431 0.0249  120 GLN D O   
3933 C CB  . GLN D 125 ? 0.2917 0.3887 0.4143 -0.0396 -0.0134 0.0303  120 GLN D CB  
3934 C CG  . GLN D 125 ? 0.4409 0.5331 0.5891 -0.0456 -0.0286 0.0357  120 GLN D CG  
3935 C CD  . GLN D 125 ? 0.3005 0.3877 0.4367 -0.0459 -0.0314 0.0331  120 GLN D CD  
3936 O OE1 . GLN D 125 ? 0.3500 0.4328 0.4694 -0.0559 -0.0449 0.0301  120 GLN D OE1 
3937 N NE2 . GLN D 125 ? 0.2908 0.3724 0.4297 -0.0377 -0.0174 0.0337  120 GLN D NE2 
3938 N N   . VAL D 126 ? 0.1903 0.3053 0.2663 -0.0414 -0.0242 0.0169  121 VAL D N   
3939 C CA  . VAL D 126 ? 0.2396 0.3547 0.3022 -0.0466 -0.0236 0.0065  121 VAL D CA  
3940 C C   . VAL D 126 ? 0.2622 0.3599 0.3334 -0.0397 -0.0204 0.0036  121 VAL D C   
3941 O O   . VAL D 126 ? 0.2022 0.2959 0.2876 -0.0261 -0.0159 0.0098  121 VAL D O   
3942 C CB  . VAL D 126 ? 0.1980 0.3373 0.2590 -0.0410 -0.0141 -0.0024 121 VAL D CB  
3943 C CG1 . VAL D 126 ? 0.2814 0.4205 0.3341 -0.0464 -0.0028 -0.0192 121 VAL D CG1 
3944 C CG2 . VAL D 126 ? 0.2113 0.3660 0.2629 -0.0516 -0.0174 0.0004  121 VAL D CG2 
3945 N N   . SER D 127 ? 0.2039 0.2852 0.2592 -0.0531 -0.0236 -0.0051 122 SER D N   
3946 C CA  . SER D 127 ? 0.2332 0.2920 0.2928 -0.0496 -0.0191 -0.0118 122 SER D CA  
3947 C C   . SER D 127 ? 0.3306 0.3735 0.3611 -0.0622 -0.0100 -0.0334 122 SER D C   
3948 O O   . SER D 127 ? 0.3114 0.3548 0.3079 -0.0827 -0.0121 -0.0401 122 SER D O   
3949 C CB  . SER D 127 ? 0.2253 0.2685 0.3000 -0.0582 -0.0328 0.0000  122 SER D CB  
3950 O OG  . SER D 127 ? 0.3081 0.3457 0.3680 -0.0811 -0.0524 0.0027  122 SER D OG  
3951 N N   . TYR D 128 ? 0.3209 0.3438 0.3612 -0.0518 0.0021  -0.0447 123 TYR D N   
3952 C CA  . TYR D 128 ? 0.4747 0.4749 0.4918 -0.0608 0.0200  -0.0718 123 TYR D CA  
3953 C C   . TYR D 128 ? 0.4299 0.3905 0.4266 -0.0798 0.0084  -0.0746 123 TYR D C   
3954 O O   . TYR D 128 ? 0.4830 0.4254 0.5054 -0.0677 0.0081  -0.0697 123 TYR D O   
3955 C CB  . TYR D 128 ? 0.5666 0.5688 0.6245 -0.0312 0.0405  -0.0811 123 TYR D CB  
3956 C CG  . TYR D 128 ? 0.7222 0.7162 0.7764 -0.0320 0.0712  -0.1140 123 TYR D CG  
3957 C CD1 . TYR D 128 ? 0.8201 0.7854 0.8176 -0.0635 0.0827  -0.1383 123 TYR D CD1 
3958 C CD2 . TYR D 128 ? 0.7901 0.8043 0.9000 -0.0027 0.0894  -0.1211 123 TYR D CD2 
3959 C CE1 . TYR D 128 ? 0.8767 0.8309 0.8673 -0.0669 0.1203  -0.1739 123 TYR D CE1 
3960 C CE2 . TYR D 128 ? 0.8503 0.8604 0.9722 -0.0010 0.1248  -0.1548 123 TYR D CE2 
3961 C CZ  . TYR D 128 ? 0.8892 0.8680 0.9488 -0.0336 0.1448  -0.1838 123 TYR D CZ  
3962 O OH  . TYR D 128 ? 0.9034 0.8748 0.9715 -0.0346 0.1894  -0.2230 123 TYR D OH  
3963 N N   . THR D 129 ? 0.4695 0.4145 0.4178 -0.1130 -0.0046 -0.0800 124 THR D N   
3964 C CA  . THR D 129 ? 0.5667 0.4794 0.4987 -0.1366 -0.0260 -0.0776 124 THR D CA  
3965 C C   . THR D 129 ? 0.7200 0.5917 0.5819 -0.1721 -0.0218 -0.1043 124 THR D C   
3966 O O   . THR D 129 ? 0.7301 0.6011 0.5462 -0.1859 -0.0058 -0.1206 124 THR D O   
3967 C CB  . THR D 129 ? 0.5851 0.5167 0.5345 -0.1484 -0.0623 -0.0477 124 THR D CB  
3968 O OG1 . THR D 129 ? 0.6314 0.5410 0.5886 -0.1671 -0.0844 -0.0423 124 THR D OG1 
3969 C CG2 . THR D 129 ? 0.5102 0.4459 0.4138 -0.1738 -0.0796 -0.0430 124 THR D CG2 
3970 N N   . ALA D 130 ? 0.8548 0.6896 0.7038 -0.1908 -0.0344 -0.1101 125 ALA D N   
3971 C CA  . ALA D 130 ? 0.9814 0.7685 0.7512 -0.2329 -0.0356 -0.1356 125 ALA D CA  
3972 C C   . ALA D 130 ? 1.0442 0.8450 0.7794 -0.2581 -0.0735 -0.1087 125 ALA D C   
3973 O O   . ALA D 130 ? 1.0160 0.8435 0.7970 -0.2527 -0.1082 -0.0757 125 ALA D O   
3974 C CB  . ALA D 130 ? 1.0082 0.7524 0.7801 -0.2442 -0.0404 -0.1466 125 ALA D CB  
3975 N N   . ALA D 131 ? 1.1200 0.9044 0.7844 -0.2794 -0.0613 -0.1195 126 ALA D N   
3976 C CA  . ALA D 131 ? 1.1273 0.9163 0.7553 -0.3010 -0.0932 -0.0893 126 ALA D CA  
3977 C C   . ALA D 131 ? 1.1815 0.9570 0.8123 -0.3167 -0.1331 -0.0691 126 ALA D C   
3978 O O   . ALA D 131 ? 1.1808 0.9751 0.8379 -0.3170 -0.1708 -0.0335 126 ALA D O   
3979 C CB  . ALA D 131 ? 1.1940 0.9585 0.7392 -0.3279 -0.0659 -0.1058 126 ALA D CB  
3980 N N   . PHE E 5   ? 0.8106 0.8034 0.7347 -0.1443 -0.0547 0.3009  0   PHE E N   
3981 C CA  . PHE E 5   ? 0.8161 0.8096 0.7510 -0.1285 -0.0553 0.2777  0   PHE E CA  
3982 C C   . PHE E 5   ? 0.8059 0.8072 0.7574 -0.1408 -0.0468 0.2577  0   PHE E C   
3983 O O   . PHE E 5   ? 0.8383 0.8469 0.7959 -0.1608 -0.0420 0.2609  0   PHE E O   
3984 C CB  . PHE E 5   ? 0.7893 0.8338 0.7131 -0.1133 -0.0533 0.2715  0   PHE E CB  
3985 C CG  . PHE E 5   ? 0.7510 0.7815 0.6655 -0.0939 -0.0676 0.2835  0   PHE E CG  
3986 C CD1 . PHE E 5   ? 0.7543 0.7879 0.6494 -0.0964 -0.0720 0.3056  0   PHE E CD1 
3987 C CD2 . PHE E 5   ? 0.7307 0.7475 0.6589 -0.0723 -0.0774 0.2732  0   PHE E CD2 
3988 C CE1 . PHE E 5   ? 0.8017 0.8242 0.6897 -0.0776 -0.0869 0.3163  0   PHE E CE1 
3989 C CE2 . PHE E 5   ? 0.7235 0.7344 0.6504 -0.0526 -0.0919 0.2832  0   PHE E CE2 
3990 C CZ  . PHE E 5   ? 0.7380 0.7511 0.6440 -0.0552 -0.0974 0.3044  0   PHE E CZ  
3991 N N   . MET E 6   ? 0.7613 0.7626 0.7214 -0.1286 -0.0460 0.2380  1   MET E N   
3992 C CA  . MET E 6   ? 0.6731 0.6788 0.6480 -0.1369 -0.0394 0.2166  1   MET E CA  
3993 C C   . MET E 6   ? 0.5464 0.5929 0.5271 -0.1179 -0.0313 0.1872  1   MET E C   
3994 O O   . MET E 6   ? 0.5354 0.5771 0.5160 -0.0966 -0.0352 0.1765  1   MET E O   
3995 C CB  . MET E 6   ? 0.7341 0.6733 0.7156 -0.1337 -0.0481 0.2055  1   MET E CB  
3996 C CG  . MET E 6   ? 0.7389 0.6763 0.7311 -0.1443 -0.0449 0.1838  1   MET E CG  
3997 S SD  . MET E 6   ? 1.3236 1.1956 1.3130 -0.1619 -0.0562 0.1856  1   MET E SD  
3998 C CE  . MET E 6   ? 0.8152 0.7084 0.8017 -0.1794 -0.0562 0.2152  1   MET E CE  
3999 N N   . LEU E 7   ? 0.4517 0.5388 0.4395 -0.1259 -0.0210 0.1755  2   LEU E N   
4000 C CA  . LEU E 7   ? 0.3509 0.4648 0.3445 -0.1086 -0.0148 0.1467  2   LEU E CA  
4001 C C   . LEU E 7   ? 0.3607 0.4426 0.3675 -0.1047 -0.0170 0.1261  2   LEU E C   
4002 O O   . LEU E 7   ? 0.3833 0.4653 0.3984 -0.1185 -0.0159 0.1237  2   LEU E O   
4003 C CB  . LEU E 7   ? 0.3697 0.5410 0.3638 -0.1130 -0.0026 0.1425  2   LEU E CB  
4004 C CG  . LEU E 7   ? 0.3982 0.5895 0.3944 -0.0934 0.0019  0.1134  2   LEU E CG  
4005 C CD1 . LEU E 7   ? 0.4045 0.6004 0.3844 -0.0789 -0.0026 0.1099  2   LEU E CD1 
4006 C CD2 . LEU E 7   ? 0.4056 0.6455 0.4069 -0.0941 0.0142  0.1057  2   LEU E CD2 
4007 N N   . ARG E 8   ? 0.3542 0.4121 0.3627 -0.0864 -0.0203 0.1125  3   ARG E N   
4008 C CA  . ARG E 8   ? 0.2619 0.2903 0.2774 -0.0806 -0.0202 0.0935  3   ARG E CA  
4009 C C   . ARG E 8   ? 0.3066 0.3607 0.3284 -0.0684 -0.0140 0.0720  3   ARG E C   
4010 O O   . ARG E 8   ? 0.2452 0.3155 0.2685 -0.0562 -0.0138 0.0675  3   ARG E O   
4011 C CB  . ARG E 8   ? 0.3928 0.3754 0.4072 -0.0680 -0.0256 0.0945  3   ARG E CB  
4012 C CG  . ARG E 8   ? 0.4152 0.3670 0.4308 -0.0601 -0.0229 0.0746  3   ARG E CG  
4013 C CD  . ARG E 8   ? 0.4087 0.3179 0.4235 -0.0440 -0.0256 0.0757  3   ARG E CD  
4014 N NE  . ARG E 8   ? 0.3821 0.3138 0.4088 -0.0268 -0.0259 0.0812  3   ARG E NE  
4015 C CZ  . ARG E 8   ? 0.4339 0.3430 0.4643 -0.0129 -0.0317 0.0929  3   ARG E CZ  
4016 N NH1 . ARG E 8   ? 0.5010 0.3570 0.5214 -0.0134 -0.0366 0.0993  3   ARG E NH1 
4017 N NH2 . ARG E 8   ? 0.3428 0.2808 0.3875 0.0017  -0.0344 0.0983  3   ARG E NH2 
4018 N N   . VAL E 9   ? 0.2707 0.3273 0.2963 -0.0730 -0.0112 0.0600  4   VAL E N   
4019 C CA  . VAL E 9   ? 0.2408 0.3149 0.2713 -0.0625 -0.0064 0.0420  4   VAL E CA  
4020 C C   . VAL E 9   ? 0.2029 0.2477 0.2327 -0.0592 -0.0062 0.0296  4   VAL E C   
4021 O O   . VAL E 9   ? 0.2222 0.2481 0.2470 -0.0695 -0.0100 0.0306  4   VAL E O   
4022 C CB  . VAL E 9   ? 0.2062 0.3186 0.2408 -0.0672 -0.0026 0.0398  4   VAL E CB  
4023 C CG1 . VAL E 9   ? 0.1509 0.2707 0.1895 -0.0550 0.0004  0.0217  4   VAL E CG1 
4024 C CG2 . VAL E 9   ? 0.2384 0.3843 0.2682 -0.0690 0.0005  0.0506  4   VAL E CG2 
4025 N N   . PHE E 10  ? 0.2392 0.2810 0.2721 -0.0465 -0.0024 0.0186  5   PHE E N   
4026 C CA  . PHE E 10  ? 0.2069 0.2281 0.2356 -0.0427 0.0005  0.0077  5   PHE E CA  
4027 C C   . PHE E 10  ? 0.2816 0.3219 0.3142 -0.0396 0.0027  -0.0010 5   PHE E C   
4028 O O   . PHE E 10  ? 0.2219 0.2759 0.2621 -0.0332 0.0047  -0.0049 5   PHE E O   
4029 C CB  . PHE E 10  ? 0.2079 0.2105 0.2388 -0.0309 0.0055  0.0048  5   PHE E CB  
4030 C CG  . PHE E 10  ? 0.2721 0.2473 0.2982 -0.0288 0.0030  0.0118  5   PHE E CG  
4031 C CD1 . PHE E 10  ? 0.2693 0.2077 0.2788 -0.0318 0.0020  0.0072  5   PHE E CD1 
4032 C CD2 . PHE E 10  ? 0.2103 0.1924 0.2459 -0.0234 -0.0002 0.0226  5   PHE E CD2 
4033 C CE1 . PHE E 10  ? 0.2698 0.1736 0.2729 -0.0286 -0.0014 0.0120  5   PHE E CE1 
4034 C CE2 . PHE E 10  ? 0.2422 0.1933 0.2737 -0.0190 -0.0036 0.0306  5   PHE E CE2 
4035 C CZ  . PHE E 10  ? 0.2732 0.1823 0.2886 -0.0212 -0.0039 0.0246  5   PHE E CZ  
4036 N N   . ILE E 11  ? 0.1956 0.2350 0.2231 -0.0446 0.0002  -0.0037 6   ILE E N   
4037 C CA  . ILE E 11  ? 0.1697 0.2192 0.1995 -0.0393 0.0008  -0.0105 6   ILE E CA  
4038 C C   . ILE E 11  ? 0.1537 0.1776 0.1728 -0.0356 0.0042  -0.0151 6   ILE E C   
4039 O O   . ILE E 11  ? 0.2081 0.2132 0.2124 -0.0397 0.0019  -0.0158 6   ILE E O   
4040 C CB  . ILE E 11  ? 0.2751 0.3430 0.3081 -0.0443 -0.0049 -0.0086 6   ILE E CB  
4041 C CG1 . ILE E 11  ? 0.2590 0.3583 0.3027 -0.0490 -0.0045 -0.0016 6   ILE E CG1 
4042 C CG2 . ILE E 11  ? 0.2921 0.3667 0.3281 -0.0347 -0.0056 -0.0145 6   ILE E CG2 
4043 C CD1 . ILE E 11  ? 0.3809 0.5101 0.4359 -0.0541 -0.0083 0.0025  6   ILE E CD1 
4044 N N   . LEU E 12  ? 0.1507 0.1745 0.1756 -0.0293 0.0096  -0.0180 7   LEU E N   
4045 C CA  . LEU E 12  ? 0.1733 0.1787 0.1900 -0.0266 0.0167  -0.0191 7   LEU E CA  
4046 C C   . LEU E 12  ? 0.2045 0.2026 0.2113 -0.0263 0.0154  -0.0193 7   LEU E C   
4047 O O   . LEU E 12  ? 0.2260 0.2088 0.2128 -0.0276 0.0154  -0.0190 7   LEU E O   
4048 C CB  . LEU E 12  ? 0.1625 0.1751 0.1953 -0.0231 0.0233  -0.0183 7   LEU E CB  
4049 C CG  . LEU E 12  ? 0.2423 0.2596 0.2832 -0.0206 0.0230  -0.0155 7   LEU E CG  
4050 C CD1 . LEU E 12  ? 0.2201 0.2531 0.2824 -0.0171 0.0259  -0.0135 7   LEU E CD1 
4051 C CD2 . LEU E 12  ? 0.2533 0.2471 0.2789 -0.0178 0.0271  -0.0160 7   LEU E CD2 
4052 N N   . TYR E 13  ? 0.1738 0.1795 0.1914 -0.0240 0.0130  -0.0200 8   TYR E N   
4053 C CA  . TYR E 13  ? 0.1852 0.1797 0.1943 -0.0221 0.0100  -0.0176 8   TYR E CA  
4054 C C   . TYR E 13  ? 0.2369 0.2368 0.2582 -0.0166 0.0038  -0.0213 8   TYR E C   
4055 O O   . TYR E 13  ? 0.2247 0.2374 0.2583 -0.0153 0.0032  -0.0274 8   TYR E O   
4056 C CB  . TYR E 13  ? 0.1887 0.1673 0.1899 -0.0247 0.0192  -0.0122 8   TYR E CB  
4057 C CG  . TYR E 13  ? 0.1819 0.1660 0.2034 -0.0277 0.0247  -0.0120 8   TYR E CG  
4058 C CD1 . TYR E 13  ? 0.1734 0.1698 0.2066 -0.0284 0.0321  -0.0126 8   TYR E CD1 
4059 C CD2 . TYR E 13  ? 0.1899 0.1657 0.2200 -0.0301 0.0204  -0.0109 8   TYR E CD2 
4060 C CE1 . TYR E 13  ? 0.1827 0.1908 0.2389 -0.0327 0.0342  -0.0113 8   TYR E CE1 
4061 C CE2 . TYR E 13  ? 0.2410 0.2221 0.2910 -0.0370 0.0220  -0.0111 8   TYR E CE2 
4062 C CZ  . TYR E 13  ? 0.2001 0.2013 0.2646 -0.0389 0.0286  -0.0108 8   TYR E CZ  
4063 O OH  . TYR E 13  ? 0.1768 0.1899 0.2653 -0.0470 0.0276  -0.0099 8   TYR E OH  
4064 N N   . ALA E 14  ? 0.2142 0.2018 0.2289 -0.0120 -0.0014 -0.0179 9   ALA E N   
4065 C CA  . ALA E 14  ? 0.2311 0.2132 0.2546 -0.0033 -0.0072 -0.0224 9   ALA E CA  
4066 C C   . ALA E 14  ? 0.2213 0.1726 0.2373 -0.0053 -0.0079 -0.0144 9   ALA E C   
4067 O O   . ALA E 14  ? 0.3507 0.2917 0.3511 -0.0101 -0.0051 -0.0037 9   ALA E O   
4068 C CB  . ALA E 14  ? 0.2210 0.2197 0.2483 0.0082  -0.0149 -0.0241 9   ALA E CB  
4069 N N   . GLU E 15  ? 0.2596 0.1938 0.2836 -0.0026 -0.0117 -0.0195 10  GLU E N   
4070 C CA  . GLU E 15  ? 0.3013 0.2012 0.3197 -0.0074 -0.0137 -0.0094 10  GLU E CA  
4071 C C   . GLU E 15  ? 0.3817 0.2580 0.3995 0.0078  -0.0251 -0.0121 10  GLU E C   
4072 O O   . GLU E 15  ? 0.2941 0.1785 0.3201 0.0207  -0.0292 -0.0274 10  GLU E O   
4073 C CB  . GLU E 15  ? 0.3432 0.2345 0.3734 -0.0222 -0.0100 -0.0108 10  GLU E CB  
4074 C CG  . GLU E 15  ? 0.4818 0.3948 0.5164 -0.0349 0.0025  -0.0044 10  GLU E CG  
4075 C CD  . GLU E 15  ? 0.6339 0.5405 0.6844 -0.0516 0.0056  0.0012  10  GLU E CD  
4076 O OE1 . GLU E 15  ? 0.7152 0.5910 0.7667 -0.0574 -0.0015 0.0052  10  GLU E OE1 
4077 O OE2 . GLU E 15  ? 0.6969 0.6292 0.7613 -0.0591 0.0141  0.0023  10  GLU E OE2 
4078 N N   . ASN E 16  ? 0.4014 0.2481 0.4074 0.0079  -0.0294 0.0035  11  ASN E N   
4079 C CA  . ASN E 16  ? 0.4413 0.2556 0.4464 0.0238  -0.0416 0.0043  11  ASN E CA  
4080 C C   . ASN E 16  ? 0.4563 0.2949 0.4685 0.0479  -0.0480 -0.0048 11  ASN E C   
4081 O O   . ASN E 16  ? 0.3767 0.2047 0.3977 0.0659  -0.0535 -0.0183 11  ASN E O   
4082 C CB  . ASN E 16  ? 0.4878 0.2684 0.5010 0.0201  -0.0455 -0.0071 11  ASN E CB  
4083 C CG  . ASN E 16  ? 0.5692 0.3320 0.5829 -0.0068 -0.0402 0.0048  11  ASN E CG  
4084 O OD1 . ASN E 16  ? 0.6374 0.3839 0.6401 -0.0166 -0.0376 0.0269  11  ASN E OD1 
4085 N ND2 . ASN E 16  ? 0.6539 0.4246 0.6807 -0.0193 -0.0383 -0.0084 11  ASN E ND2 
4086 N N   . VAL E 17  ? 0.4051 0.2773 0.4138 0.0479  -0.0472 0.0021  12  VAL E N   
4087 C CA  . VAL E 17  ? 0.4307 0.3384 0.4524 0.0660  -0.0528 -0.0034 12  VAL E CA  
4088 C C   . VAL E 17  ? 0.3641 0.2597 0.3825 0.0821  -0.0667 0.0108  12  VAL E C   
4089 O O   . VAL E 17  ? 0.4150 0.3061 0.4155 0.0736  -0.0717 0.0276  12  VAL E O   
4090 C CB  . VAL E 17  ? 0.3605 0.3096 0.3820 0.0540  -0.0485 -0.0024 12  VAL E CB  
4091 C CG1 . VAL E 17  ? 0.3408 0.3330 0.3817 0.0684  -0.0544 -0.0056 12  VAL E CG1 
4092 C CG2 . VAL E 17  ? 0.3046 0.2631 0.3284 0.0394  -0.0362 -0.0127 12  VAL E CG2 
4093 N N   . HIS E 18  ? 0.4161 0.3068 0.4497 0.1075  -0.0733 0.0037  13  HIS E N   
4094 C CA  . HIS E 18  ? 0.4695 0.3442 0.5026 0.1270  -0.0884 0.0185  13  HIS E CA  
4095 C C   . HIS E 18  ? 0.5682 0.4887 0.6288 0.1540  -0.0947 0.0136  13  HIS E C   
4096 O O   . HIS E 18  ? 0.6278 0.5788 0.7080 0.1650  -0.0857 -0.0051 13  HIS E O   
4097 C CB  . HIS E 18  ? 0.5639 0.3753 0.5904 0.1375  -0.0936 0.0190  13  HIS E CB  
4098 C CG  . HIS E 18  ? 0.5814 0.3475 0.5849 0.1108  -0.0901 0.0316  13  HIS E CG  
4099 N ND1 . HIS E 18  ? 0.6259 0.3702 0.6291 0.0944  -0.0809 0.0190  13  HIS E ND1 
4100 C CD2 . HIS E 18  ? 0.6019 0.3451 0.5826 0.0971  -0.0941 0.0569  13  HIS E CD2 
4101 C CE1 . HIS E 18  ? 0.6602 0.3737 0.6470 0.0711  -0.0786 0.0368  13  HIS E CE1 
4102 N NE2 . HIS E 18  ? 0.6692 0.3809 0.6400 0.0727  -0.0849 0.0600  13  HIS E NE2 
4103 N N   . THR E 19  ? 0.6866 0.6156 0.7484 0.1645  -0.1104 0.0319  14  THR E N   
4104 C CA  . THR E 19  ? 0.9065 0.8627 0.9973 0.1985  -0.1208 0.0322  14  THR E CA  
4105 C C   . THR E 19  ? 1.0818 1.0145 1.1603 0.2071  -0.1417 0.0580  14  THR E C   
4106 O O   . THR E 19  ? 1.1471 1.1058 1.2162 0.1929  -0.1521 0.0734  14  THR E O   
4107 C CB  . THR E 19  ? 0.8571 0.8944 0.9806 0.2013  -0.1165 0.0246  14  THR E CB  
4108 O OG1 . THR E 19  ? 0.8741 0.9452 1.0309 0.2361  -0.1270 0.0283  14  THR E OG1 
4109 C CG2 . THR E 19  ? 0.7842 0.8526 0.8974 0.1705  -0.1214 0.0360  14  THR E CG2 
4110 N N   . PRO E 20  ? 1.2005 1.0770 1.2743 0.2290  -0.1493 0.0631  15  PRO E N   
4111 C CA  . PRO E 20  ? 1.2946 1.1457 1.3545 0.2349  -0.1657 0.0904  15  PRO E CA  
4112 C C   . PRO E 20  ? 1.3185 1.2342 1.4113 0.2545  -0.1755 0.0972  15  PRO E C   
4113 O O   . PRO E 20  ? 1.3836 1.3011 1.5012 0.2808  -0.1752 0.0967  15  PRO E O   
4114 C CB  . PRO E 20  ? 1.3595 1.1470 1.4159 0.2472  -0.1606 0.0876  15  PRO E CB  
4115 C CG  . PRO E 20  ? 1.3374 1.1377 1.4166 0.2602  -0.1451 0.0561  15  PRO E CG  
4116 C CD  . PRO E 20  ? 1.2499 1.0916 1.3310 0.2430  -0.1371 0.0419  15  PRO E CD  
4117 N N   . ASP E 21  ? 1.2582 1.2269 1.3525 0.2396  -0.1842 0.1034  16  ASP E N   
4118 C CA  . ASP E 21  ? 1.2260 1.2669 1.3572 0.2498  -0.1938 0.1098  16  ASP E CA  
4119 C C   . ASP E 21  ? 1.2211 1.2670 1.3309 0.2403  -0.2157 0.1366  16  ASP E C   
4120 O O   . ASP E 21  ? 1.2516 1.3541 1.3715 0.2271  -0.2269 0.1415  16  ASP E O   
4121 C CB  . ASP E 21  ? 1.1943 1.3006 1.3493 0.2356  -0.1858 0.0936  16  ASP E CB  
4122 C CG  . ASP E 21  ? 1.2319 1.3594 1.4199 0.2519  -0.1637 0.0704  16  ASP E CG  
4123 O OD1 . ASP E 21  ? 1.2893 1.3949 1.4905 0.2780  -0.1585 0.0670  16  ASP E OD1 
4124 O OD2 . ASP E 21  ? 1.2148 1.3788 1.4121 0.2379  -0.1510 0.0557  16  ASP E OD2 
4125 N N   . THR E 22  ? 1.1784 1.1646 1.2575 0.2455  -0.2212 0.1539  17  THR E N   
4126 C CA  . THR E 22  ? 1.0826 1.0615 1.1263 0.2349  -0.2386 0.1794  17  THR E CA  
4127 C C   . THR E 22  ? 0.9599 0.9498 0.9694 0.2016  -0.2400 0.1747  17  THR E C   
4128 O O   . THR E 22  ? 0.9482 0.9710 0.9426 0.1900  -0.2546 0.1837  17  THR E O   
4129 C CB  . THR E 22  ? 1.0340 1.0694 1.1088 0.2531  -0.2560 0.1946  17  THR E CB  
4130 O OG1 . THR E 22  ? 1.0211 1.1319 1.1262 0.2425  -0.2596 0.1845  17  THR E OG1 
4131 C CG2 . THR E 22  ? 0.9992 1.0290 1.1173 0.2876  -0.2517 0.1951  17  THR E CG2 
4132 N N   . ASP E 23  ? 0.8887 0.8467 0.8837 0.1865  -0.2244 0.1596  18  ASP E N   
4133 C CA  . ASP E 23  ? 0.7284 0.6940 0.6948 0.1551  -0.2202 0.1519  18  ASP E CA  
4134 C C   . ASP E 23  ? 0.7076 0.6444 0.6681 0.1390  -0.1906 0.1333  18  ASP E C   
4135 O O   . ASP E 23  ? 0.6358 0.5535 0.6192 0.1536  -0.1794 0.1230  18  ASP E O   
4136 C CB  . ASP E 23  ? 0.7031 0.7407 0.7010 0.1489  -0.2276 0.1404  18  ASP E CB  
4137 C CG  . ASP E 23  ? 0.7459 0.7898 0.7074 0.1147  -0.2265 0.1355  18  ASP E CG  
4138 O OD1 . ASP E 23  ? 0.8151 0.8125 0.7256 0.0995  -0.2191 0.1415  18  ASP E OD1 
4139 O OD2 . ASP E 23  ? 0.7219 0.8165 0.7053 0.1033  -0.2328 0.1260  18  ASP E OD2 
4140 N N   . ILE E 24  ? 0.6566 0.5907 0.5853 0.1098  -0.1794 0.1283  19  ILE E N   
4141 C CA  . ILE E 24  ? 0.6711 0.5887 0.5970 0.0931  -0.1531 0.1115  19  ILE E CA  
4142 C C   . ILE E 24  ? 0.4413 0.4071 0.3929 0.0837  -0.1456 0.0905  19  ILE E C   
4143 O O   . ILE E 24  ? 0.4357 0.4377 0.3881 0.0768  -0.1588 0.0910  19  ILE E O   
4144 C CB  . ILE E 24  ? 0.7395 0.6234 0.6155 0.0702  -0.1428 0.1206  19  ILE E CB  
4145 C CG1 . ILE E 24  ? 0.8158 0.6524 0.6660 0.0767  -0.1495 0.1460  19  ILE E CG1 
4146 C CG2 . ILE E 24  ? 0.6416 0.5164 0.5206 0.0541  -0.1169 0.1045  19  ILE E CG2 
4147 C CD1 . ILE E 24  ? 0.8672 0.6753 0.6695 0.0549  -0.1355 0.1579  19  ILE E CD1 
4148 N N   . SER E 25  ? 0.4081 0.3728 0.3791 0.0817  -0.1263 0.0735  20  SER E N   
4149 C CA  . SER E 25  ? 0.3936 0.4025 0.3912 0.0750  -0.1188 0.0566  20  SER E CA  
4150 C C   . SER E 25  ? 0.3509 0.3737 0.3279 0.0503  -0.1193 0.0540  20  SER E C   
4151 O O   . SER E 25  ? 0.4657 0.4577 0.4067 0.0356  -0.1118 0.0557  20  SER E O   
4152 C CB  . SER E 25  ? 0.4326 0.4303 0.4432 0.0746  -0.0985 0.0407  20  SER E CB  
4153 O OG  . SER E 25  ? 0.5617 0.5309 0.5814 0.0945  -0.0984 0.0403  20  SER E OG  
4154 N N   . ASP E 26  ? 0.3571 0.4263 0.3577 0.0462  -0.1280 0.0501  21  ASP E N   
4155 C CA  . ASP E 26  ? 0.3212 0.3998 0.3080 0.0217  -0.1278 0.0433  21  ASP E CA  
4156 C C   . ASP E 26  ? 0.2813 0.3856 0.2989 0.0170  -0.1130 0.0312  21  ASP E C   
4157 O O   . ASP E 26  ? 0.2720 0.4213 0.3195 0.0128  -0.1197 0.0309  21  ASP E O   
4158 C CB  . ASP E 26  ? 0.3391 0.4485 0.3271 0.0141  -0.1529 0.0505  21  ASP E CB  
4159 C CG  . ASP E 26  ? 0.4004 0.4941 0.3635 0.0243  -0.1716 0.0658  21  ASP E CG  
4160 O OD1 . ASP E 26  ? 0.4534 0.5044 0.3681 0.0173  -0.1684 0.0690  21  ASP E OD1 
4161 O OD2 . ASP E 26  ? 0.4167 0.5431 0.4090 0.0405  -0.1889 0.0761  21  ASP E OD2 
4162 N N   . ALA E 27  ? 0.2672 0.3453 0.2778 0.0164  -0.0936 0.0231  22  ALA E N   
4163 C CA  . ALA E 27  ? 0.2355 0.3350 0.2725 0.0171  -0.0797 0.0134  22  ALA E CA  
4164 C C   . ALA E 27  ? 0.3052 0.4146 0.3401 -0.0042 -0.0757 0.0089  22  ALA E C   
4165 O O   . ALA E 27  ? 0.2319 0.3122 0.2377 -0.0179 -0.0748 0.0072  22  ALA E O   
4166 C CB  . ALA E 27  ? 0.2316 0.3004 0.2634 0.0251  -0.0646 0.0069  22  ALA E CB  
4167 N N   . TYR E 28  ? 0.2415 0.3911 0.3064 -0.0056 -0.0723 0.0074  23  TYR E N   
4168 C CA  . TYR E 28  ? 0.2574 0.4113 0.3224 -0.0245 -0.0660 0.0050  23  TYR E CA  
4169 C C   . TYR E 28  ? 0.2508 0.4288 0.3370 -0.0168 -0.0513 0.0012  23  TYR E C   
4170 O O   . TYR E 28  ? 0.2029 0.3988 0.3050 0.0029  -0.0473 -0.0017 23  TYR E O   
4171 C CB  . TYR E 28  ? 0.1949 0.3760 0.2707 -0.0434 -0.0808 0.0115  23  TYR E CB  
4172 C CG  . TYR E 28  ? 0.2971 0.5402 0.4153 -0.0383 -0.0843 0.0186  23  TYR E CG  
4173 C CD1 . TYR E 28  ? 0.1919 0.4601 0.3266 -0.0226 -0.0964 0.0236  23  TYR E CD1 
4174 C CD2 . TYR E 28  ? 0.2474 0.5269 0.3899 -0.0482 -0.0750 0.0220  23  TYR E CD2 
4175 C CE1 . TYR E 28  ? 0.1969 0.5290 0.3755 -0.0146 -0.0981 0.0302  23  TYR E CE1 
4176 C CE2 . TYR E 28  ? 0.1786 0.5231 0.3623 -0.0429 -0.0749 0.0296  23  TYR E CE2 
4177 C CZ  . TYR E 28  ? 0.1974 0.5655 0.3991 -0.0247 -0.0850 0.0322  23  TYR E CZ  
4178 O OH  . TYR E 28  ? 0.2517 0.6658 0.4875 -0.0149 -0.0796 0.0369  23  TYR E OH  
4179 N N   A CYS E 29  ? 0.2290 0.4052 0.3124 -0.0312 -0.0440 0.0009  24  CYS E N   
4180 N N   B CYS E 29  ? 0.2362 0.4156 0.3213 -0.0312 -0.0446 0.0014  24  CYS E N   
4181 C CA  A CYS E 29  ? 0.2222 0.4131 0.3144 -0.0249 -0.0300 -0.0026 24  CYS E CA  
4182 C CA  B CYS E 29  ? 0.2354 0.4294 0.3292 -0.0249 -0.0304 -0.0022 24  CYS E CA  
4183 C C   A CYS E 29  ? 0.2821 0.5115 0.3919 -0.0397 -0.0278 0.0062  24  CYS E C   
4184 C C   B CYS E 29  ? 0.2904 0.5232 0.4020 -0.0398 -0.0281 0.0067  24  CYS E C   
4185 O O   A CYS E 29  ? 0.3594 0.5749 0.4618 -0.0602 -0.0324 0.0123  24  CYS E O   
4186 O O   B CYS E 29  ? 0.3535 0.5723 0.4577 -0.0605 -0.0328 0.0129  24  CYS E O   
4187 C CB  A CYS E 29  ? 0.1973 0.3471 0.2674 -0.0271 -0.0227 -0.0082 24  CYS E CB  
4188 C CB  B CYS E 29  ? 0.2124 0.3648 0.2838 -0.0271 -0.0231 -0.0078 24  CYS E CB  
4189 S SG  A CYS E 29  ? 0.4397 0.5990 0.5125 -0.0178 -0.0100 -0.0147 24  CYS E SG  
4190 S SG  B CYS E 29  ? 0.2275 0.3547 0.2909 -0.0085 -0.0176 -0.0179 24  CYS E SG  
4191 N N   . SER E 30  ? 0.1899 0.4667 0.3223 -0.0288 -0.0202 0.0072  25  SER E N   
4192 C CA  . SER E 30  ? 0.1757 0.4972 0.3265 -0.0426 -0.0144 0.0185  25  SER E CA  
4193 C C   . SER E 30  ? 0.2800 0.5997 0.4175 -0.0399 0.0001  0.0162  25  SER E C   
4194 O O   . SER E 30  ? 0.3132 0.6333 0.4439 -0.0190 0.0086  0.0041  25  SER E O   
4195 C CB  . SER E 30  ? 0.2579 0.6337 0.4384 -0.0308 -0.0118 0.0222  25  SER E CB  
4196 O OG  . SER E 30  ? 0.4238 0.8242 0.6117 -0.0449 -0.0047 0.0346  25  SER E OG  
4197 N N   . ALA E 31  ? 0.2434 0.5576 0.3749 -0.0614 0.0007  0.0281  26  ALA E N   
4198 C CA  . ALA E 31  ? 0.2119 0.5263 0.3288 -0.0608 0.0116  0.0301  26  ALA E CA  
4199 C C   . ALA E 31  ? 0.2598 0.6047 0.3824 -0.0743 0.0175  0.0474  26  ALA E C   
4200 O O   . ALA E 31  ? 0.2530 0.5904 0.3821 -0.0946 0.0094  0.0605  26  ALA E O   
4201 C CB  . ALA E 31  ? 0.1980 0.4565 0.2916 -0.0677 0.0062  0.0291  26  ALA E CB  
4202 N N   . VAL E 32  ? 0.2300 0.6029 0.3455 -0.0623 0.0306  0.0462  27  VAL E N   
4203 C CA  . VAL E 32  ? 0.2300 0.6321 0.3472 -0.0726 0.0373  0.0628  27  VAL E CA  
4204 C C   . VAL E 32  ? 0.2744 0.6764 0.3669 -0.0731 0.0449  0.0683  27  VAL E C   
4205 O O   . VAL E 32  ? 0.2952 0.7017 0.3716 -0.0546 0.0518  0.0536  27  VAL E O   
4206 C CB  . VAL E 32  ? 0.3065 0.7560 0.4407 -0.0572 0.0468  0.0591  27  VAL E CB  
4207 C CG1 . VAL E 32  ? 0.3296 0.8126 0.4710 -0.0722 0.0532  0.0792  27  VAL E CG1 
4208 C CG2 . VAL E 32  ? 0.2973 0.7498 0.4560 -0.0523 0.0379  0.0533  27  VAL E CG2 
4209 N N   . PHE E 33  ? 0.2860 0.6803 0.3741 -0.0946 0.0419  0.0893  28  PHE E N   
4210 C CA  . PHE E 33  ? 0.2901 0.6878 0.3549 -0.0968 0.0475  0.0999  28  PHE E CA  
4211 C C   . PHE E 33  ? 0.3226 0.7411 0.3932 -0.1149 0.0500  0.1236  28  PHE E C   
4212 O O   . PHE E 33  ? 0.2740 0.6726 0.3568 -0.1359 0.0403  0.1376  28  PHE E O   
4213 C CB  . PHE E 33  ? 0.2746 0.6275 0.3234 -0.1039 0.0385  0.1041  28  PHE E CB  
4214 C CG  . PHE E 33  ? 0.3540 0.7078 0.3782 -0.1070 0.0408  0.1189  28  PHE E CG  
4215 C CD1 . PHE E 33  ? 0.3684 0.7413 0.3701 -0.0895 0.0478  0.1074  28  PHE E CD1 
4216 C CD2 . PHE E 33  ? 0.3824 0.7146 0.4037 -0.1268 0.0340  0.1436  28  PHE E CD2 
4217 C CE1 . PHE E 33  ? 0.4011 0.7751 0.3771 -0.0920 0.0474  0.1215  28  PHE E CE1 
4218 C CE2 . PHE E 33  ? 0.4360 0.7679 0.4342 -0.1284 0.0345  0.1593  28  PHE E CE2 
4219 C CZ  . PHE E 33  ? 0.4143 0.7690 0.3894 -0.1111 0.0409  0.1488  28  PHE E CZ  
4220 N N   . ALA E 34  ? 0.2853 0.7422 0.3456 -0.1070 0.0628  0.1270  29  ALA E N   
4221 C CA  . ALA E 34  ? 0.3967 0.8816 0.4628 -0.1233 0.0684  0.1501  29  ALA E CA  
4222 C C   . ALA E 34  ? 0.3808 0.8857 0.4807 -0.1356 0.0662  0.1567  29  ALA E C   
4223 O O   . ALA E 34  ? 0.3460 0.8461 0.4560 -0.1601 0.0605  0.1779  29  ALA E O   
4224 C CB  . ALA E 34  ? 0.3445 0.7961 0.3950 -0.1435 0.0601  0.1727  29  ALA E CB  
4225 N N   . GLY E 35  ? 0.3617 0.8871 0.4790 -0.1186 0.0693  0.1387  30  GLY E N   
4226 C CA  . GLY E 35  ? 0.3859 0.9374 0.5368 -0.1274 0.0668  0.1441  30  GLY E CA  
4227 C C   . GLY E 35  ? 0.3987 0.9098 0.5613 -0.1478 0.0476  0.1480  30  GLY E C   
4228 O O   . GLY E 35  ? 0.3025 0.8319 0.4919 -0.1589 0.0417  0.1535  30  GLY E O   
4229 N N   . VAL E 36  ? 0.3380 0.7948 0.4801 -0.1525 0.0375  0.1448  31  VAL E N   
4230 C CA  . VAL E 36  ? 0.2832 0.6948 0.4303 -0.1689 0.0195  0.1443  31  VAL E CA  
4231 C C   . VAL E 36  ? 0.2745 0.6663 0.4201 -0.1513 0.0148  0.1217  31  VAL E C   
4232 O O   . VAL E 36  ? 0.2593 0.6343 0.3873 -0.1360 0.0189  0.1103  31  VAL E O   
4233 C CB  . VAL E 36  ? 0.3039 0.6631 0.4308 -0.1861 0.0106  0.1563  31  VAL E CB  
4234 C CG1 . VAL E 36  ? 0.3197 0.6279 0.4479 -0.1998 -0.0075 0.1511  31  VAL E CG1 
4235 C CG2 . VAL E 36  ? 0.3440 0.7197 0.4723 -0.2049 0.0141  0.1810  31  VAL E CG2 
4236 N N   . LYS E 37  ? 0.2448 0.6406 0.4095 -0.1546 0.0052  0.1163  32  LYS E N   
4237 C CA  . LYS E 37  ? 0.3089 0.6942 0.4753 -0.1373 0.0005  0.0971  32  LYS E CA  
4238 C C   . LYS E 37  ? 0.2886 0.6197 0.4439 -0.1500 -0.0165 0.0918  32  LYS E C   
4239 O O   . LYS E 37  ? 0.2450 0.5584 0.4030 -0.1716 -0.0289 0.0999  32  LYS E O   
4240 C CB  . LYS E 37  ? 0.3496 0.7811 0.5440 -0.1273 0.0013  0.0942  32  LYS E CB  
4241 C CG  . LYS E 37  ? 0.3736 0.7956 0.5722 -0.1104 -0.0065 0.0777  32  LYS E CG  
4242 C CD  . LYS E 37  ? 0.4610 0.9299 0.6793 -0.0843 0.0037  0.0709  32  LYS E CD  
4243 C CE  . LYS E 37  ? 0.5073 0.9790 0.7423 -0.0749 -0.0098 0.0638  32  LYS E CE  
4244 N NZ  . LYS E 37  ? 0.5474 1.0520 0.7978 -0.0435 -0.0007 0.0545  32  LYS E NZ  
4245 N N   . LYS E 38  ? 0.2614 0.5653 0.4025 -0.1365 -0.0172 0.0772  33  LYS E N   
4246 C CA  . LYS E 38  ? 0.3101 0.5631 0.4368 -0.1449 -0.0315 0.0694  33  LYS E CA  
4247 C C   . LYS E 38  ? 0.2804 0.5358 0.4081 -0.1274 -0.0345 0.0537  33  LYS E C   
4248 O O   . LYS E 38  ? 0.2654 0.5460 0.3989 -0.1068 -0.0239 0.0469  33  LYS E O   
4249 C CB  . LYS E 38  ? 0.2746 0.4827 0.3791 -0.1498 -0.0300 0.0708  33  LYS E CB  
4250 C CG  . LYS E 38  ? 0.2924 0.4912 0.3937 -0.1672 -0.0301 0.0888  33  LYS E CG  
4251 C CD  . LYS E 38  ? 0.3564 0.5149 0.4382 -0.1673 -0.0282 0.0926  33  LYS E CD  
4252 C CE  . LYS E 38  ? 0.3900 0.5414 0.4686 -0.1823 -0.0287 0.1133  33  LYS E CE  
4253 N NZ  . LYS E 38  ? 0.3706 0.4900 0.4493 -0.2027 -0.0429 0.1177  33  LYS E NZ  
4254 N N   . ARG E 39  ? 0.2976 0.5247 0.4168 -0.1351 -0.0501 0.0477  34  ARG E N   
4255 C CA  . ARG E 39  ? 0.2889 0.5173 0.4060 -0.1201 -0.0559 0.0362  34  ARG E CA  
4256 C C   . ARG E 39  ? 0.2386 0.4023 0.3193 -0.1195 -0.0622 0.0248  34  ARG E C   
4257 O O   . ARG E 39  ? 0.2697 0.3989 0.3347 -0.1381 -0.0717 0.0251  34  ARG E O   
4258 C CB  . ARG E 39  ? 0.2996 0.5595 0.4361 -0.1202 -0.0671 0.0396  34  ARG E CB  
4259 C CG  . ARG E 39  ? 0.3022 0.6190 0.4707 -0.1127 -0.0567 0.0485  34  ARG E CG  
4260 C CD  . ARG E 39  ? 0.4258 0.7713 0.6157 -0.1143 -0.0702 0.0524  34  ARG E CD  
4261 N NE  . ARG E 39  ? 0.5337 0.9343 0.7558 -0.1103 -0.0607 0.0618  34  ARG E NE  
4262 C CZ  . ARG E 39  ? 0.6011 1.0171 0.8334 -0.1306 -0.0582 0.0743  34  ARG E CZ  
4263 N NH1 . ARG E 39  ? 0.6352 1.0110 0.8482 -0.1549 -0.0653 0.0783  34  ARG E NH1 
4264 N NH2 . ARG E 39  ? 0.6347 1.1054 0.8964 -0.1257 -0.0484 0.0830  34  ARG E NH2 
4265 N N   . THR E 40  ? 0.2154 0.3616 0.2818 -0.0979 -0.0562 0.0146  35  THR E N   
4266 C CA  . THR E 40  ? 0.2072 0.3021 0.2401 -0.0954 -0.0595 0.0050  35  THR E CA  
4267 C C   . THR E 40  ? 0.2817 0.3763 0.3058 -0.1017 -0.0772 0.0041  35  THR E C   
4268 O O   . THR E 40  ? 0.2594 0.3966 0.3089 -0.1058 -0.0874 0.0113  35  THR E O   
4269 C CB  . THR E 40  ? 0.2448 0.3259 0.2683 -0.0738 -0.0473 -0.0018 35  THR E CB  
4270 O OG1 . THR E 40  ? 0.2349 0.3401 0.2700 -0.0611 -0.0511 -0.0008 35  THR E OG1 
4271 C CG2 . THR E 40  ? 0.1983 0.2864 0.2321 -0.0668 -0.0332 -0.0015 35  THR E CG2 
4272 N N   . LYS E 41  ? 0.2715 0.3217 0.2594 -0.1009 -0.0805 -0.0046 36  LYS E N   
4273 C CA  . LYS E 41  ? 0.3411 0.3870 0.3107 -0.1043 -0.0978 -0.0062 36  LYS E CA  
4274 C C   . LYS E 41  ? 0.3025 0.3673 0.2791 -0.0839 -0.0954 -0.0022 36  LYS E C   
4275 O O   . LYS E 41  ? 0.2588 0.3298 0.2488 -0.0684 -0.0798 -0.0016 36  LYS E O   
4276 C CB  . LYS E 41  ? 0.3223 0.3133 0.2434 -0.1074 -0.0990 -0.0180 36  LYS E CB  
4277 C CG  . LYS E 41  ? 0.4040 0.3712 0.3045 -0.0878 -0.0797 -0.0223 36  LYS E CG  
4278 C CD  . LYS E 41  ? 0.5429 0.4622 0.3954 -0.0885 -0.0772 -0.0345 36  LYS E CD  
4279 C CE  . LYS E 41  ? 0.5976 0.4888 0.4474 -0.0903 -0.0666 -0.0421 36  LYS E CE  
4280 N NZ  . LYS E 41  ? 0.5463 0.4465 0.4172 -0.0751 -0.0451 -0.0384 36  LYS E NZ  
4281 N N   . VAL E 42  ? 0.2957 0.3663 0.2615 -0.0844 -0.1131 0.0009  37  VAL E N   
4282 C CA  . VAL E 42  ? 0.2872 0.3663 0.2542 -0.0648 -0.1140 0.0070  37  VAL E CA  
4283 C C   . VAL E 42  ? 0.3125 0.3452 0.2341 -0.0585 -0.1066 0.0035  37  VAL E C   
4284 O O   . VAL E 42  ? 0.3488 0.3534 0.2317 -0.0690 -0.1131 -0.0025 37  VAL E O   
4285 C CB  . VAL E 42  ? 0.3034 0.4159 0.2829 -0.0666 -0.1390 0.0158  37  VAL E CB  
4286 C CG1 . VAL E 42  ? 0.3158 0.4228 0.2854 -0.0457 -0.1430 0.0237  37  VAL E CG1 
4287 C CG2 . VAL E 42  ? 0.3809 0.5519 0.4142 -0.0689 -0.1422 0.0221  37  VAL E CG2 
4288 N N   . ILE E 43  ? 0.3248 0.3495 0.2501 -0.0422 -0.0925 0.0068  38  ILE E N   
4289 C CA  . ILE E 43  ? 0.3572 0.3461 0.2448 -0.0370 -0.0845 0.0086  38  ILE E CA  
4290 C C   . ILE E 43  ? 0.3471 0.3389 0.2281 -0.0263 -0.0979 0.0218  38  ILE E C   
4291 O O   . ILE E 43  ? 0.3327 0.3344 0.2401 -0.0121 -0.0963 0.0282  38  ILE E O   
4292 C CB  . ILE E 43  ? 0.3042 0.2792 0.2002 -0.0300 -0.0615 0.0064  38  ILE E CB  
4293 C CG1 . ILE E 43  ? 0.2876 0.2600 0.1905 -0.0378 -0.0496 -0.0042 38  ILE E CG1 
4294 C CG2 . ILE E 43  ? 0.3630 0.3084 0.2250 -0.0271 -0.0518 0.0121  38  ILE E CG2 
4295 C CD1 . ILE E 43  ? 0.3176 0.2645 0.1842 -0.0472 -0.0496 -0.0122 38  ILE E CD1 
4296 N N   . LYS E 44  ? 0.3885 0.3682 0.2311 -0.0320 -0.1123 0.0254  39  LYS E N   
4297 C CA  . LYS E 44  ? 0.4171 0.3993 0.2494 -0.0221 -0.1293 0.0410  39  LYS E CA  
4298 C C   . LYS E 44  ? 0.4291 0.3844 0.2493 -0.0103 -0.1159 0.0526  39  LYS E C   
4299 O O   . LYS E 44  ? 0.4501 0.3784 0.2418 -0.0153 -0.0974 0.0508  39  LYS E O   
4300 C CB  . LYS E 44  ? 0.5022 0.4739 0.2860 -0.0326 -0.1482 0.0421  39  LYS E CB  
4301 C CG  . LYS E 44  ? 0.4676 0.4629 0.2617 -0.0481 -0.1680 0.0326  39  LYS E CG  
4302 C CD  . LYS E 44  ? 0.5867 0.5770 0.3369 -0.0567 -0.1949 0.0357  39  LYS E CD  
4303 C CE  . LYS E 44  ? 0.6146 0.6093 0.3671 -0.0759 -0.2023 0.0185  39  LYS E CE  
4304 N NZ  . LYS E 44  ? 0.6033 0.6029 0.3345 -0.0811 -0.2225 0.0175  39  LYS E NZ  
4305 N N   . ASN E 45  ? 0.4306 0.3938 0.2744 0.0054  -0.1258 0.0652  40  ASN E N   
4306 C CA  . ASN E 45  ? 0.4724 0.4041 0.3006 0.0150  -0.1211 0.0813  40  ASN E CA  
4307 C C   . ASN E 45  ? 0.4901 0.3961 0.3156 0.0096  -0.0945 0.0777  40  ASN E C   
4308 O O   . ASN E 45  ? 0.4948 0.3760 0.2833 0.0021  -0.0838 0.0863  40  ASN E O   
4309 C CB  . ASN E 45  ? 0.5417 0.4567 0.3181 0.0116  -0.1345 0.0969  40  ASN E CB  
4310 C CG  . ASN E 45  ? 0.6125 0.5551 0.3948 0.0179  -0.1657 0.1041  40  ASN E CG  
4311 O OD1 . ASN E 45  ? 0.5671 0.5296 0.3905 0.0348  -0.1775 0.1102  40  ASN E OD1 
4312 N ND2 . ASN E 45  ? 0.6735 0.6192 0.4153 0.0052  -0.1798 0.1023  40  ASN E ND2 
4313 N N   . SER E 46  ? 0.4066 0.3226 0.2714 0.0131  -0.0841 0.0657  41  SER E N   
4314 C CA  . SER E 46  ? 0.4681 0.3664 0.3377 0.0068  -0.0624 0.0615  41  SER E CA  
4315 C C   . SER E 46  ? 0.4371 0.3384 0.3466 0.0168  -0.0604 0.0541  41  SER E C   
4316 O O   . SER E 46  ? 0.3929 0.3224 0.3296 0.0240  -0.0653 0.0428  41  SER E O   
4317 C CB  . SER E 46  ? 0.4448 0.3530 0.3074 -0.0058 -0.0481 0.0474  41  SER E CB  
4318 O OG  . SER E 46  ? 0.4922 0.3919 0.3667 -0.0107 -0.0289 0.0440  41  SER E OG  
4319 N N   . VAL E 47  ? 0.4438 0.3159 0.3550 0.0162  -0.0531 0.0605  42  VAL E N   
4320 C CA  . VAL E 47  ? 0.3712 0.2375 0.3128 0.0240  -0.0514 0.0501  42  VAL E CA  
4321 C C   . VAL E 47  ? 0.4271 0.3051 0.3810 0.0116  -0.0357 0.0363  42  VAL E C   
4322 O O   . VAL E 47  ? 0.4288 0.3087 0.4048 0.0155  -0.0342 0.0237  42  VAL E O   
4323 C CB  . VAL E 47  ? 0.4853 0.3079 0.4230 0.0264  -0.0548 0.0632  42  VAL E CB  
4324 C CG1 . VAL E 47  ? 0.4901 0.2992 0.4175 0.0428  -0.0728 0.0788  42  VAL E CG1 
4325 C CG2 . VAL E 47  ? 0.5076 0.3111 0.4253 0.0059  -0.0414 0.0768  42  VAL E CG2 
4326 N N   . ASN E 48  ? 0.3486 0.2341 0.2860 -0.0016 -0.0248 0.0383  43  ASN E N   
4327 C CA  . ASN E 48  ? 0.3019 0.2008 0.2516 -0.0111 -0.0108 0.0277  43  ASN E CA  
4328 C C   . ASN E 48  ? 0.3040 0.2235 0.2437 -0.0145 -0.0071 0.0207  43  ASN E C   
4329 O O   . ASN E 48  ? 0.3213 0.2391 0.2474 -0.0218 0.0054  0.0217  43  ASN E O   
4330 C CB  . ASN E 48  ? 0.4736 0.3570 0.4191 -0.0234 0.0025  0.0376  43  ASN E CB  
4331 C CG  . ASN E 48  ? 0.6294 0.4839 0.5829 -0.0248 -0.0031 0.0467  43  ASN E CG  
4332 O OD1 . ASN E 48  ? 0.6311 0.4805 0.6061 -0.0210 -0.0093 0.0359  43  ASN E OD1 
4333 N ND2 . ASN E 48  ? 0.7471 0.5792 0.6797 -0.0309 -0.0010 0.0665  43  ASN E ND2 
4334 N N   . PRO E 49  ? 0.2693 0.2081 0.2170 -0.0090 -0.0176 0.0136  44  PRO E N   
4335 C CA  . PRO E 49  ? 0.3025 0.2533 0.2385 -0.0150 -0.0184 0.0082  44  PRO E CA  
4336 C C   . PRO E 49  ? 0.3839 0.3392 0.3276 -0.0208 -0.0053 -0.0002 44  PRO E C   
4337 O O   . PRO E 49  ? 0.3055 0.2712 0.2733 -0.0193 -0.0016 -0.0049 44  PRO E O   
4338 C CB  . PRO E 49  ? 0.2710 0.2474 0.2261 -0.0102 -0.0320 0.0048  44  PRO E CB  
4339 C CG  . PRO E 49  ? 0.2613 0.2442 0.2426 0.0001  -0.0305 0.0016  44  PRO E CG  
4340 C CD  . PRO E 49  ? 0.2581 0.2107 0.2298 0.0024  -0.0274 0.0089  44  PRO E CD  
4341 N N   . VAL E 50  ? 0.3604 0.3062 0.2813 -0.0256 0.0006  -0.0025 45  VAL E N   
4342 C CA  . VAL E 50  ? 0.2661 0.2142 0.1941 -0.0276 0.0110  -0.0100 45  VAL E CA  
4343 C C   . VAL E 50  ? 0.3143 0.2618 0.2338 -0.0323 0.0017  -0.0165 45  VAL E C   
4344 O O   . VAL E 50  ? 0.3207 0.2527 0.2104 -0.0357 -0.0035 -0.0190 45  VAL E O   
4345 C CB  . VAL E 50  ? 0.2777 0.2131 0.1885 -0.0264 0.0279  -0.0090 45  VAL E CB  
4346 C CG1 . VAL E 50  ? 0.3005 0.2381 0.2211 -0.0239 0.0370  -0.0167 45  VAL E CG1 
4347 C CG2 . VAL E 50  ? 0.2652 0.2032 0.1885 -0.0269 0.0367  0.0007  45  VAL E CG2 
4348 N N   . TRP E 51  ? 0.2472 0.2103 0.1907 -0.0344 -0.0015 -0.0187 46  TRP E N   
4349 C CA  . TRP E 51  ? 0.2919 0.2536 0.2316 -0.0430 -0.0108 -0.0218 46  TRP E CA  
4350 C C   . TRP E 51  ? 0.3183 0.2609 0.2520 -0.0431 -0.0028 -0.0268 46  TRP E C   
4351 O O   . TRP E 51  ? 0.3232 0.2414 0.2339 -0.0481 -0.0072 -0.0326 46  TRP E O   
4352 C CB  . TRP E 51  ? 0.2999 0.2922 0.2678 -0.0465 -0.0184 -0.0178 46  TRP E CB  
4353 C CG  . TRP E 51  ? 0.2457 0.2592 0.2237 -0.0422 -0.0267 -0.0139 46  TRP E CG  
4354 C CD1 . TRP E 51  ? 0.2946 0.3138 0.2654 -0.0463 -0.0407 -0.0111 46  TRP E CD1 
4355 C CD2 . TRP E 51  ? 0.2239 0.2546 0.2215 -0.0311 -0.0232 -0.0130 46  TRP E CD2 
4356 N NE1 . TRP E 51  ? 0.3009 0.3423 0.2889 -0.0359 -0.0453 -0.0068 46  TRP E NE1 
4357 C CE2 . TRP E 51  ? 0.2509 0.2962 0.2538 -0.0259 -0.0341 -0.0092 46  TRP E CE2 
4358 C CE3 . TRP E 51  ? 0.1985 0.2321 0.2085 -0.0248 -0.0139 -0.0162 46  TRP E CE3 
4359 C CZ2 . TRP E 51  ? 0.1852 0.2430 0.2047 -0.0116 -0.0339 -0.0094 46  TRP E CZ2 
4360 C CZ3 . TRP E 51  ? 0.2369 0.2808 0.2596 -0.0138 -0.0149 -0.0181 46  TRP E CZ3 
4361 C CH2 . TRP E 51  ? 0.1997 0.2534 0.2268 -0.0060 -0.0239 -0.0152 46  TRP E CH2 
4362 N N   . ASN E 52  ? 0.2747 0.2267 0.2288 -0.0369 0.0071  -0.0250 47  ASN E N   
4363 C CA  . ASN E 52  ? 0.3019 0.2392 0.2562 -0.0329 0.0141  -0.0274 47  ASN E CA  
4364 C C   . ASN E 52  ? 0.3355 0.2578 0.2843 -0.0423 0.0035  -0.0275 47  ASN E C   
4365 O O   . ASN E 52  ? 0.3359 0.2254 0.2647 -0.0410 0.0039  -0.0339 47  ASN E O   
4366 C CB  . ASN E 52  ? 0.3343 0.2502 0.2670 -0.0238 0.0266  -0.0336 47  ASN E CB  
4367 C CG  . ASN E 52  ? 0.3595 0.2650 0.2990 -0.0132 0.0362  -0.0360 47  ASN E CG  
4368 O OD1 . ASN E 52  ? 0.4720 0.3940 0.4383 -0.0109 0.0358  -0.0299 47  ASN E OD1 
4369 N ND2 . ASN E 52  ? 0.4022 0.2802 0.3156 -0.0047 0.0444  -0.0453 47  ASN E ND2 
4370 N N   . GLU E 53  ? 0.3122 0.2575 0.2782 -0.0519 -0.0055 -0.0202 48  GLU E N   
4371 C CA  . GLU E 53  ? 0.2941 0.2294 0.2591 -0.0659 -0.0160 -0.0160 48  GLU E CA  
4372 C C   . GLU E 53  ? 0.2936 0.2426 0.2777 -0.0672 -0.0143 -0.0053 48  GLU E C   
4373 O O   . GLU E 53  ? 0.3105 0.2912 0.3115 -0.0615 -0.0095 -0.0012 48  GLU E O   
4374 C CB  . GLU E 53  ? 0.3488 0.3051 0.3181 -0.0800 -0.0286 -0.0128 48  GLU E CB  
4375 C CG  . GLU E 53  ? 0.4288 0.3664 0.3732 -0.0831 -0.0367 -0.0212 48  GLU E CG  
4376 C CD  . GLU E 53  ? 0.3876 0.3509 0.3421 -0.0982 -0.0528 -0.0160 48  GLU E CD  
4377 O OE1 . GLU E 53  ? 0.4439 0.4178 0.4138 -0.1144 -0.0605 -0.0082 48  GLU E OE1 
4378 O OE2 . GLU E 53  ? 0.4183 0.3937 0.3676 -0.0942 -0.0582 -0.0175 48  GLU E OE2 
4379 N N   . GLY E 54  ? 0.2936 0.2148 0.2714 -0.0750 -0.0198 -0.0008 49  GLY E N   
4380 C CA  . GLY E 54  ? 0.3094 0.2396 0.3005 -0.0782 -0.0202 0.0134  49  GLY E CA  
4381 C C   . GLY E 54  ? 0.3491 0.2971 0.3484 -0.1002 -0.0291 0.0263  49  GLY E C   
4382 O O   . GLY E 54  ? 0.3922 0.3277 0.3851 -0.1157 -0.0390 0.0241  49  GLY E O   
4383 N N   . PHE E 55  ? 0.3155 0.2962 0.3288 -0.1025 -0.0258 0.0402  50  PHE E N   
4384 C CA  . PHE E 55  ? 0.3454 0.3511 0.3692 -0.1237 -0.0304 0.0566  50  PHE E CA  
4385 C C   . PHE E 55  ? 0.3796 0.3878 0.4039 -0.1258 -0.0281 0.0751  50  PHE E C   
4386 O O   . PHE E 55  ? 0.4030 0.4203 0.4258 -0.1089 -0.0220 0.0742  50  PHE E O   
4387 C CB  . PHE E 55  ? 0.2665 0.3299 0.3069 -0.1230 -0.0254 0.0552  50  PHE E CB  
4388 C CG  . PHE E 55  ? 0.3037 0.3680 0.3439 -0.1181 -0.0289 0.0399  50  PHE E CG  
4389 C CD1 . PHE E 55  ? 0.2838 0.3447 0.3262 -0.1356 -0.0408 0.0408  50  PHE E CD1 
4390 C CD2 . PHE E 55  ? 0.3372 0.4049 0.3743 -0.0977 -0.0222 0.0265  50  PHE E CD2 
4391 C CE1 . PHE E 55  ? 0.2845 0.3471 0.3235 -0.1304 -0.0462 0.0288  50  PHE E CE1 
4392 C CE2 . PHE E 55  ? 0.2955 0.3617 0.3296 -0.0932 -0.0261 0.0162  50  PHE E CE2 
4393 C CZ  . PHE E 55  ? 0.2589 0.3233 0.2926 -0.1083 -0.0382 0.0176  50  PHE E CZ  
4394 N N   . GLU E 56  ? 0.3359 0.3363 0.3618 -0.1484 -0.0347 0.0936  51  GLU E N   
4395 C CA  . GLU E 56  ? 0.3207 0.3226 0.3438 -0.1529 -0.0336 0.1163  51  GLU E CA  
4396 C C   . GLU E 56  ? 0.4249 0.4719 0.4592 -0.1742 -0.0308 0.1364  51  GLU E C   
4397 O O   . GLU E 56  ? 0.3913 0.4362 0.4326 -0.1887 -0.0370 0.1367  51  GLU E O   
4398 C CB  . GLU E 56  ? 0.6854 0.6193 0.6952 -0.1556 -0.0438 0.1236  51  GLU E CB  
4399 C CG  . GLU E 56  ? 0.7413 0.6395 0.7421 -0.1276 -0.0424 0.1061  51  GLU E CG  
4400 C CD  . GLU E 56  ? 0.8504 0.6900 0.8408 -0.1226 -0.0502 0.1171  51  GLU E CD  
4401 O OE1 . GLU E 56  ? 0.8984 0.6928 0.8810 -0.1415 -0.0606 0.1247  51  GLU E OE1 
4402 O OE2 . GLU E 56  ? 0.8306 0.6685 0.8219 -0.0997 -0.0474 0.1185  51  GLU E OE2 
4403 N N   . TRP E 57  ? 0.3146 0.4042 0.3476 -0.1679 -0.0209 0.1474  52  TRP E N   
4404 C CA  . TRP E 57  ? 0.3308 0.4600 0.3680 -0.1777 -0.0159 0.1629  52  TRP E CA  
4405 C C   . TRP E 57  ? 0.5077 0.6100 0.5306 -0.1838 -0.0203 0.1858  52  TRP E C   
4406 O O   . TRP E 57  ? 0.4368 0.5353 0.4454 -0.1716 -0.0189 0.1921  52  TRP E O   
4407 C CB  . TRP E 57  ? 0.3301 0.5229 0.3690 -0.1642 -0.0014 0.1574  52  TRP E CB  
4408 C CG  . TRP E 57  ? 0.3166 0.5416 0.3725 -0.1570 0.0032  0.1381  52  TRP E CG  
4409 C CD1 . TRP E 57  ? 0.3196 0.5854 0.3917 -0.1609 0.0076  0.1392  52  TRP E CD1 
4410 C CD2 . TRP E 57  ? 0.2745 0.4938 0.3343 -0.1434 0.0032  0.1166  52  TRP E CD2 
4411 N NE1 . TRP E 57  ? 0.2890 0.5721 0.3739 -0.1486 0.0093  0.1200  52  TRP E NE1 
4412 C CE2 . TRP E 57  ? 0.3441 0.5982 0.4208 -0.1382 0.0064  0.1056  52  TRP E CE2 
4413 C CE3 . TRP E 57  ? 0.2720 0.4528 0.3203 -0.1282 -0.0008 0.1020  52  TRP E CE3 
4414 C CZ2 . TRP E 57  ? 0.3295 0.5856 0.4133 -0.1245 0.0059  0.0855  52  TRP E CZ2 
4415 C CZ3 . TRP E 57  ? 0.1998 0.3783 0.2524 -0.1126 -0.0006 0.0791  52  TRP E CZ3 
4416 C CH2 . TRP E 57  ? 0.2966 0.5110 0.3656 -0.1119 0.0023  0.0721  52  TRP E CH2 
4417 N N   . ASP E 58  ? 0.5674 0.6506 0.5941 -0.2027 -0.0271 0.1988  53  ASP E N   
4418 C CA  . ASP E 58  ? 0.6589 0.7194 0.6738 -0.2105 -0.0311 0.2228  53  ASP E CA  
4419 C C   . ASP E 58  ? 0.7487 0.8676 0.7580 -0.2077 -0.0187 0.2366  53  ASP E C   
4420 O O   . ASP E 58  ? 0.7576 0.9269 0.7788 -0.2156 -0.0098 0.2385  53  ASP E O   
4421 C CB  . ASP E 58  ? 0.6699 0.7017 0.6924 -0.2340 -0.0406 0.2321  53  ASP E CB  
4422 C CG  . ASP E 58  ? 0.8189 0.8534 0.8355 -0.2480 -0.0401 0.2606  53  ASP E CG  
4423 O OD1 . ASP E 58  ? 0.8385 0.8538 0.8379 -0.2383 -0.0409 0.2737  53  ASP E OD1 
4424 O OD2 . ASP E 58  ? 0.9492 1.0060 0.9791 -0.2690 -0.0397 0.2713  53  ASP E OD2 
4425 N N   . LEU E 59  ? 0.8533 0.8202 0.7765 -0.1663 0.0961  0.2184  54  LEU E N   
4426 C CA  . LEU E 59  ? 0.9471 0.9367 0.8318 -0.1486 0.1191  0.2305  54  LEU E CA  
4427 C C   . LEU E 59  ? 1.0298 1.0035 0.9131 -0.1577 0.1361  0.2608  54  LEU E C   
4428 O O   . LEU E 59  ? 0.9845 0.9138 0.8676 -0.1674 0.1247  0.2796  54  LEU E O   
4429 C CB  . LEU E 59  ? 1.0325 1.0094 0.8571 -0.1266 0.1076  0.2292  54  LEU E CB  
4430 C CG  . LEU E 59  ? 1.0448 1.0520 0.8593 -0.1071 0.1025  0.1922  54  LEU E CG  
4431 C CD1 . LEU E 59  ? 1.0727 1.0623 0.8370 -0.0806 0.0853  0.1829  54  LEU E CD1 
4432 C CD2 . LEU E 59  ? 1.0657 1.1180 0.8839 -0.1026 0.1283  0.1875  54  LEU E CD2 
4433 N N   . LYS E 60  ? 1.1384 1.1457 1.0191 -0.1548 0.1631  0.2647  55  LYS E N   
4434 C CA  . LYS E 60  ? 1.3189 1.3195 1.2049 -0.1690 0.1826  0.2931  55  LYS E CA  
4435 C C   . LYS E 60  ? 1.4567 1.4719 1.2872 -0.1536 0.2078  0.3043  55  LYS E C   
4436 O O   . LYS E 60  ? 1.4980 1.5521 1.3453 -0.1560 0.2316  0.3037  55  LYS E O   
4437 C CB  . LYS E 60  ? 1.2972 1.3257 1.2555 -0.1922 0.1888  0.2906  55  LYS E CB  
4438 C CG  . LYS E 60  ? 1.2272 1.2286 1.2325 -0.2113 0.1603  0.2831  55  LYS E CG  
4439 C CD  . LYS E 60  ? 1.1960 1.2230 1.2691 -0.2340 0.1611  0.2808  55  LYS E CD  
4440 C CE  . LYS E 60  ? 1.1307 1.1976 1.2327 -0.2277 0.1552  0.2508  55  LYS E CE  
4441 N NZ  . LYS E 60  ? 1.1379 1.1882 1.2835 -0.2447 0.1252  0.2353  55  LYS E NZ  
4442 N N   . GLY E 61  ? 1.5565 1.5392 1.3199 -0.1371 0.1999  0.3142  56  GLY E N   
4443 C CA  . GLY E 61  ? 1.7146 1.7010 1.4127 -0.1226 0.2172  0.3256  56  GLY E CA  
4444 C C   . GLY E 61  ? 1.8067 1.8422 1.5011 -0.1102 0.2371  0.3043  56  GLY E C   
4445 O O   . GLY E 61  ? 1.8875 1.9397 1.5573 -0.1076 0.2621  0.3174  56  GLY E O   
4446 N N   . ILE E 62  ? 1.7583 1.8158 1.4787 -0.1020 0.2264  0.2721  57  ILE E N   
4447 C CA  . ILE E 62  ? 1.7398 1.8382 1.4637 -0.0889 0.2416  0.2484  57  ILE E CA  
4448 C C   . ILE E 62  ? 1.6947 1.7875 1.3617 -0.0618 0.2260  0.2220  57  ILE E C   
4449 O O   . ILE E 62  ? 1.6302 1.7059 1.2922 -0.0561 0.1998  0.2088  57  ILE E O   
4450 C CB  . ILE E 62  ? 1.6750 1.8020 1.4747 -0.1000 0.2397  0.2303  57  ILE E CB  
4451 C CG1 . ILE E 62  ? 1.6591 1.8131 1.4525 -0.0793 0.2416  0.1978  57  ILE E CG1 
4452 C CG2 . ILE E 62  ? 1.6025 1.7057 1.4311 -0.1106 0.2121  0.2262  57  ILE E CG2 
4453 C CD1 . ILE E 62  ? 1.6273 1.8213 1.4826 -0.0859 0.2564  0.1898  57  ILE E CD1 
4454 N N   . PRO E 63  ? 1.7310 1.8376 1.3543 -0.0444 0.2403  0.2145  58  PRO E N   
4455 C CA  . PRO E 63  ? 1.7255 1.8304 1.3075 -0.0198 0.2234  0.1821  58  PRO E CA  
4456 C C   . PRO E 63  ? 1.6618 1.7916 1.2984 -0.0197 0.2223  0.1544  58  PRO E C   
4457 O O   . PRO E 63  ? 1.6852 1.8435 1.3671 -0.0282 0.2450  0.1583  58  PRO E O   
4458 C CB  . PRO E 63  ? 1.7886 1.9034 1.3186 -0.0034 0.2443  0.1832  58  PRO E CB  
4459 C CG  . PRO E 63  ? 1.8046 1.9432 1.3717 -0.0201 0.2786  0.2103  58  PRO E CG  
4460 C CD  . PRO E 63  ? 1.7825 1.9018 1.3843 -0.0453 0.2707  0.2370  58  PRO E CD  
4461 N N   . LEU E 64  ? 1.5663 1.6881 1.2004 -0.0096 0.1968  0.1275  59  LEU E N   
4462 C CA  . LEU E 64  ? 1.4967 1.5909 1.0860 0.0011  0.1665  0.1209  59  LEU E CA  
4463 C C   . LEU E 64  ? 1.5482 1.6330 1.0708 0.0237  0.1597  0.1057  59  LEU E C   
4464 O O   . LEU E 64  ? 1.5511 1.6164 1.0384 0.0359  0.1298  0.0928  59  LEU E O   
4465 C CB  . LEU E 64  ? 1.4615 1.5313 1.0415 -0.0105 0.1592  0.1522  59  LEU E CB  
4466 C CG  . LEU E 64  ? 1.3686 1.4259 0.9718 -0.0151 0.1329  0.1505  59  LEU E CG  
4467 C CD1 . LEU E 64  ? 1.3034 1.3717 0.9118 -0.0021 0.1105  0.1148  59  LEU E CD1 
4468 C CD2 . LEU E 64  ? 1.2988 1.3632 0.9676 -0.0399 0.1438  0.1665  59  LEU E CD2 
4469 N N   . ASP E 65  ? 1.5829 1.6840 1.0937 0.0300  0.1861  0.1052  60  ASP E N   
4470 C CA  . ASP E 65  ? 1.6436 1.7371 1.0906 0.0524  0.1848  0.0912  60  ASP E CA  
4471 C C   . ASP E 65  ? 1.6249 1.7336 1.0979 0.0620  0.1872  0.0589  60  ASP E C   
4472 O O   . ASP E 65  ? 1.6202 1.7554 1.1385 0.0556  0.2130  0.0625  60  ASP E O   
4473 C CB  . ASP E 65  ? 1.6792 1.7823 1.0993 0.0520  0.2186  0.1190  60  ASP E CB  
4474 C CG  . ASP E 65  ? 1.6950 1.8032 1.0645 0.0763  0.2323  0.1020  60  ASP E CG  
4475 O OD1 . ASP E 65  ? 1.7250 1.8142 1.0243 0.0898  0.2280  0.1089  60  ASP E OD1 
4476 O OD2 . ASP E 65  ? 1.6694 1.7991 1.0676 0.0831  0.2476  0.0831  60  ASP E OD2 
4477 N N   . GLN E 66  ? 1.6164 1.7079 1.0660 0.0766  0.1579  0.0281  61  GLN E N   
4478 C CA  . GLN E 66  ? 1.5737 1.6732 1.0535 0.0836  0.1556  -0.0020 61  GLN E CA  
4479 C C   . GLN E 66  ? 1.6242 1.7441 1.1036 0.0940  0.1894  -0.0032 61  GLN E C   
4480 O O   . GLN E 66  ? 1.6944 1.8144 1.1261 0.1044  0.2070  0.0079  61  GLN E O   
4481 C CB  . GLN E 66  ? 1.6025 1.6755 1.0474 0.0987  0.1191  -0.0336 61  GLN E CB  
4482 C CG  . GLN E 66  ? 1.6193 1.6714 1.0340 0.0971  0.0885  -0.0267 61  GLN E CG  
4483 C CD  . GLN E 66  ? 1.6667 1.6930 1.0302 0.1152  0.0567  -0.0520 61  GLN E CD  
4484 O OE1 . GLN E 66  ? 1.6568 1.6754 1.0272 0.1234  0.0434  -0.0821 61  GLN E OE1 
4485 N NE2 . GLN E 66  ? 1.7335 1.7436 1.0463 0.1213  0.0422  -0.0392 61  GLN E NE2 
4486 N N   . GLY E 67  ? 1.5677 1.7057 1.0992 0.0929  0.1988  -0.0157 62  GLY E N   
4487 C CA  . GLY E 67  ? 1.4679 1.6043 1.0499 0.0824  0.1783  -0.0282 62  GLY E CA  
4488 C C   . GLY E 67  ? 1.3753 1.5314 1.0172 0.0590  0.1878  -0.0042 62  GLY E C   
4489 O O   . GLY E 67  ? 1.3881 1.5705 1.0774 0.0528  0.2093  0.0041  62  GLY E O   
4490 N N   . SER E 68  ? 1.1985 1.3416 0.8393 0.0469  0.1696  0.0064  63  SER E N   
4491 C CA  . SER E 68  ? 0.9716 1.1270 0.6679 0.0257  0.1718  0.0244  63  SER E CA  
4492 C C   . SER E 68  ? 0.7629 0.9187 0.4946 0.0232  0.1496  0.0044  63  SER E C   
4493 O O   . SER E 68  ? 0.6708 0.8102 0.3801 0.0294  0.1242  -0.0129 63  SER E O   
4494 C CB  . SER E 68  ? 1.0067 1.1481 0.6838 0.0146  0.1666  0.0494  63  SER E CB  
4495 O OG  . SER E 68  ? 1.0973 1.2486 0.7795 0.0045  0.1930  0.0773  63  SER E OG  
4496 N N   . GLU E 69  ? 0.7008 0.8773 0.4899 0.0134  0.1576  0.0066  64  GLU E N   
4497 C CA  . GLU E 69  ? 0.6016 0.7816 0.4246 0.0104  0.1391  -0.0118 64  GLU E CA  
4498 C C   . GLU E 69  ? 0.4551 0.6509 0.3350 -0.0103 0.1390  0.0012  64  GLU E C   
4499 O O   . GLU E 69  ? 0.5059 0.7156 0.4132 -0.0188 0.1552  0.0199  64  GLU E O   
4500 C CB  . GLU E 69  ? 0.7218 0.9048 0.5478 0.0265  0.1420  -0.0331 64  GLU E CB  
4501 C CG  . GLU E 69  ? 0.8053 0.9641 0.5785 0.0452  0.1295  -0.0559 64  GLU E CG  
4502 C CD  . GLU E 69  ? 0.8462 1.0043 0.6195 0.0621  0.1357  -0.0752 64  GLU E CD  
4503 O OE1 . GLU E 69  ? 0.8680 1.0469 0.6622 0.0653  0.1603  -0.0654 64  GLU E OE1 
4504 O OE2 . GLU E 69  ? 0.8134 0.9499 0.5696 0.0719  0.1148  -0.1004 64  GLU E OE2 
4505 N N   . LEU E 70  ? 0.3443 0.5357 0.2416 -0.0196 0.1193  -0.0104 65  LEU E N   
4506 C CA  . LEU E 70  ? 0.3680 0.5672 0.3123 -0.0370 0.1146  -0.0050 65  LEU E CA  
4507 C C   . LEU E 70  ? 0.4291 0.6387 0.3976 -0.0297 0.1136  -0.0191 65  LEU E C   
4508 O O   . LEU E 70  ? 0.3625 0.5644 0.3206 -0.0212 0.1040  -0.0395 65  LEU E O   
4509 C CB  . LEU E 70  ? 0.2929 0.4775 0.2380 -0.0497 0.0977  -0.0111 65  LEU E CB  
4510 C CG  . LEU E 70  ? 0.3137 0.4956 0.2947 -0.0657 0.0899  -0.0090 65  LEU E CG  
4511 C CD1 . LEU E 70  ? 0.2871 0.4715 0.2867 -0.0794 0.0950  0.0123  65  LEU E CD1 
4512 C CD2 . LEU E 70  ? 0.2818 0.4435 0.2577 -0.0709 0.0764  -0.0183 65  LEU E CD2 
4513 N N   . HIS E 71  ? 0.3716 0.5992 0.3747 -0.0330 0.1228  -0.0079 66  HIS E N   
4514 C CA  . HIS E 71  ? 0.3224 0.5626 0.3501 -0.0250 0.1220  -0.0185 66  HIS E CA  
4515 C C   . HIS E 71  ? 0.3119 0.5502 0.3690 -0.0404 0.1057  -0.0187 66  HIS E C   
4516 O O   . HIS E 71  ? 0.3234 0.5645 0.4018 -0.0556 0.1020  -0.0047 66  HIS E O   
4517 C CB  . HIS E 71  ? 0.4106 0.6756 0.4615 -0.0164 0.1421  -0.0078 66  HIS E CB  
4518 C CG  . HIS E 71  ? 0.5192 0.7986 0.5935 -0.0032 0.1424  -0.0197 66  HIS E CG  
4519 N ND1 . HIS E 71  ? 0.5507 0.8590 0.6692 -0.0009 0.1534  -0.0102 66  HIS E ND1 
4520 C CD2 . HIS E 71  ? 0.5568 0.8257 0.6204 0.0086  0.1323  -0.0408 66  HIS E CD2 
4521 C CE1 . HIS E 71  ? 0.5268 0.8423 0.6584 0.0142  0.1498  -0.0239 66  HIS E CE1 
4522 N NE2 . HIS E 71  ? 0.5445 0.8344 0.6420 0.0199  0.1373  -0.0429 66  HIS E NE2 
4523 N N   . VAL E 72  ? 0.2308 0.4615 0.2873 -0.0362 0.0957  -0.0354 67  VAL E N   
4524 C CA  . VAL E 72  ? 0.3052 0.5292 0.3793 -0.0488 0.0819  -0.0360 67  VAL E CA  
4525 C C   . VAL E 72  ? 0.3175 0.5553 0.4153 -0.0405 0.0799  -0.0438 67  VAL E C   
4526 O O   . VAL E 72  ? 0.3209 0.5556 0.4119 -0.0261 0.0829  -0.0587 67  VAL E O   
4527 C CB  . VAL E 72  ? 0.4035 0.6022 0.4568 -0.0549 0.0728  -0.0449 67  VAL E CB  
4528 C CG1 . VAL E 72  ? 0.4455 0.6358 0.5102 -0.0632 0.0630  -0.0459 67  VAL E CG1 
4529 C CG2 . VAL E 72  ? 0.3824 0.5699 0.4194 -0.0636 0.0725  -0.0361 67  VAL E CG2 
4530 N N   . VAL E 73  ? 0.2804 0.5312 0.4068 -0.0490 0.0722  -0.0346 68  VAL E N   
4531 C CA  . VAL E 73  ? 0.2555 0.5193 0.4079 -0.0396 0.0662  -0.0381 68  VAL E CA  
4532 C C   . VAL E 73  ? 0.2325 0.4729 0.3807 -0.0498 0.0456  -0.0351 68  VAL E C   
4533 O O   . VAL E 73  ? 0.1437 0.3835 0.2943 -0.0653 0.0358  -0.0271 68  VAL E O   
4534 C CB  . VAL E 73  ? 0.2354 0.5397 0.4303 -0.0349 0.0727  -0.0271 68  VAL E CB  
4535 C CG1 . VAL E 73  ? 0.1763 0.4926 0.3995 -0.0199 0.0642  -0.0310 68  VAL E CG1 
4536 C CG2 . VAL E 73  ? 0.1611 0.4732 0.3469 -0.0220 0.0949  -0.0241 68  VAL E CG2 
4537 N N   . VAL E 74  ? 0.2055 0.4226 0.3437 -0.0405 0.0387  -0.0411 69  VAL E N   
4538 C CA  . VAL E 74  ? 0.1503 0.3451 0.2781 -0.0463 0.0219  -0.0355 69  VAL E CA  
4539 C C   . VAL E 74  ? 0.1886 0.4000 0.3453 -0.0376 0.0088  -0.0293 69  VAL E C   
4540 O O   . VAL E 74  ? 0.2068 0.4273 0.3831 -0.0206 0.0126  -0.0330 69  VAL E O   
4541 C CB  . VAL E 74  ? 0.1592 0.3185 0.2620 -0.0435 0.0224  -0.0393 69  VAL E CB  
4542 C CG1 . VAL E 74  ? 0.2079 0.3446 0.2933 -0.0467 0.0090  -0.0297 69  VAL E CG1 
4543 C CG2 . VAL E 74  ? 0.1851 0.3330 0.2678 -0.0518 0.0323  -0.0444 69  VAL E CG2 
4544 N N   . LYS E 75  ? 0.1718 0.3855 0.3312 -0.0477 -0.0092 -0.0212 70  LYS E N   
4545 C CA  . LYS E 75  ? 0.2011 0.4337 0.3922 -0.0403 -0.0278 -0.0141 70  LYS E CA  
4546 C C   . LYS E 75  ? 0.2867 0.4875 0.4463 -0.0429 -0.0524 -0.0084 70  LYS E C   
4547 O O   . LYS E 75  ? 0.2266 0.3991 0.3446 -0.0544 -0.0559 -0.0095 70  LYS E O   
4548 C CB  . LYS E 75  ? 0.2469 0.5246 0.4858 -0.0493 -0.0312 -0.0082 70  LYS E CB  
4549 C CG  . LYS E 75  ? 0.2735 0.5904 0.5476 -0.0402 -0.0046 -0.0094 70  LYS E CG  
4550 C CD  . LYS E 75  ? 0.3304 0.6947 0.6568 -0.0527 -0.0039 0.0018  70  LYS E CD  
4551 C CE  . LYS E 75  ? 0.3694 0.7689 0.7255 -0.0377 0.0270  0.0035  70  LYS E CE  
4552 N NZ  . LYS E 75  ? 0.3972 0.8124 0.7864 -0.0504 0.0341  0.0134  70  LYS E NZ  
4553 N N   . ASP E 76  ? 0.3098 0.5138 0.4860 -0.0291 -0.0690 -0.0021 71  ASP E N   
4554 C CA  . ASP E 76  ? 0.2634 0.4385 0.4063 -0.0287 -0.0958 0.0058  71  ASP E CA  
4555 C C   . ASP E 76  ? 0.3983 0.5975 0.5657 -0.0388 -0.1239 0.0083  71  ASP E C   
4556 O O   . ASP E 76  ? 0.3311 0.5741 0.5602 -0.0340 -0.1322 0.0118  71  ASP E O   
4557 C CB  . ASP E 76  ? 0.3070 0.4706 0.4561 -0.0082 -0.1045 0.0137  71  ASP E CB  
4558 C CG  . ASP E 76  ? 0.3355 0.4644 0.4399 -0.0054 -0.1319 0.0253  71  ASP E CG  
4559 O OD1 . ASP E 76  ? 0.3554 0.4600 0.4098 -0.0176 -0.1375 0.0245  71  ASP E OD1 
4560 O OD2 . ASP E 76  ? 0.6433 0.7662 0.7580 0.0114  -0.1477 0.0352  71  ASP E OD2 
4561 N N   . HIS E 77  ? 0.2975 0.4687 0.4199 -0.0525 -0.1387 0.0057  72  HIS E N   
4562 C CA  . HIS E 77  ? 0.3273 0.5119 0.4687 -0.0641 -0.1729 0.0058  72  HIS E CA  
4563 C C   . HIS E 77  ? 0.4094 0.5900 0.5499 -0.0511 -0.2081 0.0141  72  HIS E C   
4564 O O   . HIS E 77  ? 0.4459 0.5810 0.5192 -0.0434 -0.2198 0.0169  72  HIS E O   
4565 C CB  . HIS E 77  ? 0.4221 0.5681 0.5071 -0.0793 -0.1818 -0.0032 72  HIS E CB  
4566 C CG  . HIS E 77  ? 0.4786 0.6335 0.5864 -0.0950 -0.2199 -0.0062 72  HIS E CG  
4567 N ND1 . HIS E 77  ? 0.6019 0.7342 0.6795 -0.0913 -0.2612 -0.0069 72  HIS E ND1 
4568 C CD2 . HIS E 77  ? 0.5053 0.6855 0.6621 -0.1128 -0.2197 -0.0086 72  HIS E CD2 
4569 C CE1 . HIS E 77  ? 0.5976 0.7388 0.7039 -0.1028 -0.2746 -0.0127 72  HIS E CE1 
4570 N NE2 . HIS E 77  ? 0.5885 0.7575 0.7431 -0.1164 -0.2500 -0.0128 72  HIS E NE2 
4571 N N   . GLU E 78  ? 0.5109 0.7410 0.7272 -0.0469 -0.2229 0.0200  73  GLU E N   
4572 C CA  . GLU E 78  ? 0.6621 0.8983 0.8938 -0.0359 -0.2646 0.0283  73  GLU E CA  
4573 C C   . GLU E 78  ? 0.7460 1.0136 1.0242 -0.0521 -0.2795 0.0244  73  GLU E C   
4574 O O   . GLU E 78  ? 0.7871 1.0805 1.1006 -0.0669 -0.2550 0.0204  73  GLU E O   
4575 C CB  . GLU E 78  ? 0.6941 0.9660 0.9854 -0.0129 -0.2549 0.0368  73  GLU E CB  
4576 C CG  . GLU E 78  ? 0.7811 1.0260 1.0410 0.0023  -0.2184 0.0360  73  GLU E CG  
4577 C CD  . GLU E 78  ? 0.9234 1.1287 1.1440 0.0222  -0.2362 0.0469  73  GLU E CD  
4578 O OE1 . GLU E 78  ? 0.9686 1.1861 1.2268 0.0438  -0.2313 0.0518  73  GLU E OE1 
4579 O OE2 . GLU E 78  ? 0.9891 1.1484 1.1381 0.0176  -0.2546 0.0511  73  GLU E OE2 
4580 N N   . THR E 79  ? 0.8021 1.0601 1.0707 -0.0503 -0.3143 0.0251  74  THR E N   
4581 C CA  . THR E 79  ? 0.9711 1.1770 1.1628 -0.0395 -0.3451 0.0267  74  THR E CA  
4582 C C   . THR E 79  ? 1.0627 1.2300 1.1996 -0.0536 -0.3687 0.0147  74  THR E C   
4583 O O   . THR E 79  ? 1.1164 1.2287 1.1640 -0.0480 -0.3752 0.0114  74  THR E O   
4584 C CB  . THR E 79  ? 1.5665 1.7893 1.7871 -0.0189 -0.3705 0.0384  74  THR E CB  
4585 O OG1 . THR E 79  ? 1.5304 1.7728 1.7853 0.0007  -0.3513 0.0485  74  THR E OG1 
4586 C CG2 . THR E 79  ? 1.6372 1.8026 1.7691 -0.0084 -0.4014 0.0414  74  THR E CG2 
4587 N N   . MET E 80  ? 1.0987 1.2896 1.2829 -0.0705 -0.3795 0.0084  75  MET E N   
4588 C CA  . MET E 80  ? 1.0638 1.3143 1.3422 -0.0830 -0.3591 0.0115  75  MET E CA  
4589 C C   . MET E 80  ? 1.2312 1.5431 1.5943 -0.0695 -0.3571 0.0241  75  MET E C   
4590 O O   . MET E 80  ? 1.2562 1.5763 1.6336 -0.0586 -0.3876 0.0293  75  MET E O   
4591 C CB  . MET E 80  ? 1.1086 1.3546 1.4004 -0.1076 -0.3654 0.0025  75  MET E CB  
4592 C CG  . MET E 80  ? 0.7221 0.9502 0.9919 -0.1212 -0.3323 -0.0044 75  MET E CG  
4593 S SD  . MET E 80  ? 2.5667 2.7411 2.7885 -0.1412 -0.3482 -0.0201 75  MET E SD  
4594 C CE  . MET E 80  ? 0.9741 1.1372 1.1810 -0.1498 -0.3057 -0.0234 75  MET E CE  
4595 N N   . GLY E 81  ? 1.2230 1.5748 1.6358 -0.0680 -0.3183 0.0281  76  GLY E N   
4596 C CA  . GLY E 81  ? 1.1750 1.5746 1.6479 -0.0470 -0.3016 0.0375  76  GLY E CA  
4597 C C   . GLY E 81  ? 1.1078 1.5298 1.6010 -0.0461 -0.2539 0.0367  76  GLY E C   
4598 O O   . GLY E 81  ? 1.1204 1.5275 1.5912 -0.0646 -0.2358 0.0310  76  GLY E O   
4599 N N   . ARG E 82  ? 0.9392 1.3933 1.4711 -0.0225 -0.2338 0.0416  77  ARG E N   
4600 C CA  . ARG E 82  ? 0.7822 1.2605 1.3341 -0.0170 -0.1878 0.0394  77  ARG E CA  
4601 C C   . ARG E 82  ? 0.5911 1.0249 1.0835 -0.0189 -0.1755 0.0341  77  ARG E C   
4602 O O   . ARG E 82  ? 0.5840 0.9821 1.0403 -0.0066 -0.1933 0.0355  77  ARG E O   
4603 C CB  . ARG E 82  ? 0.8082 1.3275 1.4121 0.0136  -0.1724 0.0430  77  ARG E CB  
4604 C CG  . ARG E 82  ? 0.8117 1.3209 1.4023 0.0368  -0.1422 0.0382  77  ARG E CG  
4605 C CD  . ARG E 82  ? 0.8597 1.3231 1.4175 0.0559  -0.1670 0.0403  77  ARG E CD  
4606 N NE  . ARG E 82  ? 0.8442 1.3217 1.4365 0.0897  -0.1686 0.0431  77  ARG E NE  
4607 C CZ  . ARG E 82  ? 0.7714 1.2363 1.3640 0.1162  -0.1459 0.0364  77  ARG E CZ  
4608 N NH1 . ARG E 82  ? 0.7260 1.1643 1.2815 0.1110  -0.1183 0.0253  77  ARG E NH1 
4609 N NH2 . ARG E 82  ? 0.7957 1.2671 1.4158 0.1479  -0.1496 0.0384  77  ARG E NH2 
4610 N N   . ASN E 83  ? 0.4367 0.8700 0.9172 -0.0350 -0.1469 0.0294  78  ASN E N   
4611 C CA  . ASN E 83  ? 0.3683 0.7632 0.7953 -0.0388 -0.1336 0.0244  78  ASN E CA  
4612 C C   . ASN E 83  ? 0.3755 0.7704 0.7972 -0.0148 -0.0986 0.0188  78  ASN E C   
4613 O O   . ASN E 83  ? 0.4223 0.8620 0.8914 -0.0056 -0.0719 0.0194  78  ASN E O   
4614 C CB  . ASN E 83  ? 0.3682 0.7495 0.7698 -0.0648 -0.1211 0.0204  78  ASN E CB  
4615 C CG  . ASN E 83  ? 0.4139 0.7584 0.7787 -0.0832 -0.1555 0.0172  78  ASN E CG  
4616 O OD1 . ASN E 83  ? 0.4295 0.7551 0.7736 -0.1018 -0.1508 0.0125  78  ASN E OD1 
4617 N ND2 . ASN E 83  ? 0.2744 0.6036 0.6258 -0.0750 -0.1904 0.0189  78  ASN E ND2 
4618 N N   . ARG E 84  ? 0.3816 0.7237 0.7436 -0.0045 -0.0994 0.0135  79  ARG E N   
4619 C CA  . ARG E 84  ? 0.3462 0.6764 0.7033 0.0201  -0.0795 0.0075  79  ARG E CA  
4620 C C   . ARG E 84  ? 0.2861 0.5944 0.6051 0.0163  -0.0479 -0.0041 79  ARG E C   
4621 O O   . ARG E 84  ? 0.2444 0.5149 0.5125 0.0010  -0.0477 -0.0063 79  ARG E O   
4622 C CB  . ARG E 84  ? 0.4002 0.6834 0.7210 0.0316  -0.1018 0.0124  79  ARG E CB  
4623 C CG  . ARG E 84  ? 0.4470 0.7027 0.7581 0.0541  -0.0873 0.0069  79  ARG E CG  
4624 C CD  . ARG E 84  ? 0.6138 0.8681 0.9520 0.0785  -0.1105 0.0159  79  ARG E CD  
4625 N NE  . ARG E 84  ? 0.6928 0.9482 1.0278 0.0714  -0.1468 0.0299  79  ARG E NE  
4626 C CZ  . ARG E 84  ? 0.8249 1.0782 1.1787 0.0904  -0.1755 0.0413  79  ARG E CZ  
4627 N NH1 . ARG E 84  ? 0.8371 1.0849 1.2165 0.1185  -0.1703 0.0406  79  ARG E NH1 
4628 N NH2 . ARG E 84  ? 0.8953 1.1473 1.2385 0.0830  -0.2122 0.0524  79  ARG E NH2 
4629 N N   . PHE E 85  ? 0.2549 0.5878 0.5983 0.0323  -0.0222 -0.0120 80  PHE E N   
4630 C CA  . PHE E 85  ? 0.2085 0.5206 0.5153 0.0322  0.0031  -0.0248 80  PHE E CA  
4631 C C   . PHE E 85  ? 0.2291 0.4844 0.4930 0.0377  -0.0027 -0.0316 80  PHE E C   
4632 O O   . PHE E 85  ? 0.3226 0.5624 0.5961 0.0569  -0.0112 -0.0323 80  PHE E O   
4633 C CB  . PHE E 85  ? 0.2689 0.6169 0.6043 0.0535  0.0298  -0.0331 80  PHE E CB  
4634 C CG  . PHE E 85  ? 0.3325 0.6570 0.6250 0.0566  0.0511  -0.0484 80  PHE E CG  
4635 C CD1 . PHE E 85  ? 0.3868 0.6676 0.6510 0.0720  0.0493  -0.0637 80  PHE E CD1 
4636 C CD2 . PHE E 85  ? 0.3293 0.6732 0.6109 0.0440  0.0699  -0.0469 80  PHE E CD2 
4637 C CE1 . PHE E 85  ? 0.4002 0.6588 0.6268 0.0743  0.0624  -0.0795 80  PHE E CE1 
4638 C CE2 . PHE E 85  ? 0.3442 0.6655 0.5829 0.0486  0.0847  -0.0609 80  PHE E CE2 
4639 C CZ  . PHE E 85  ? 0.3557 0.6354 0.5675 0.0637  0.0793  -0.0785 80  PHE E CZ  
4640 N N   . LEU E 86  ? 0.2377 0.4623 0.4593 0.0208  0.0020  -0.0349 81  LEU E N   
4641 C CA  . LEU E 86  ? 0.2604 0.4358 0.4498 0.0215  -0.0009 -0.0382 81  LEU E CA  
4642 C C   . LEU E 86  ? 0.2751 0.4374 0.4505 0.0252  0.0151  -0.0548 81  LEU E C   
4643 O O   . LEU E 86  ? 0.2341 0.3657 0.4054 0.0362  0.0128  -0.0629 81  LEU E O   
4644 C CB  . LEU E 86  ? 0.2136 0.3633 0.3687 0.0015  -0.0093 -0.0279 81  LEU E CB  
4645 C CG  . LEU E 86  ? 0.3142 0.4649 0.4687 -0.0002 -0.0309 -0.0136 81  LEU E CG  
4646 C CD1 . LEU E 86  ? 0.2474 0.3623 0.3548 -0.0131 -0.0361 -0.0048 81  LEU E CD1 
4647 C CD2 . LEU E 86  ? 0.3238 0.4709 0.5013 0.0205  -0.0438 -0.0086 81  LEU E CD2 
4648 N N   . GLY E 87  ? 0.2462 0.4283 0.4134 0.0159  0.0283  -0.0596 82  GLY E N   
4649 C CA  . GLY E 87  ? 0.2550 0.4252 0.4033 0.0196  0.0392  -0.0753 82  GLY E CA  
4650 C C   . GLY E 87  ? 0.2937 0.4888 0.4318 0.0104  0.0524  -0.0752 82  GLY E C   
4651 O O   . GLY E 87  ? 0.3317 0.5428 0.4743 -0.0051 0.0513  -0.0626 82  GLY E O   
4652 N N   . GLU E 88  ? 0.2149 0.4088 0.3357 0.0206  0.0628  -0.0894 83  GLU E N   
4653 C CA  . GLU E 88  ? 0.2449 0.4577 0.3497 0.0137  0.0754  -0.0868 83  GLU E CA  
4654 C C   . GLU E 88  ? 0.3375 0.5253 0.4076 0.0150  0.0733  -0.1013 83  GLU E C   
4655 O O   . GLU E 88  ? 0.2643 0.4257 0.3248 0.0264  0.0652  -0.1181 83  GLU E O   
4656 C CB  . GLU E 88  ? 0.1980 0.4516 0.3176 0.0276  0.0950  -0.0832 83  GLU E CB  
4657 C CG  . GLU E 88  ? 0.3793 0.6310 0.4907 0.0570  0.1046  -0.1012 83  GLU E CG  
4658 C CD  . GLU E 88  ? 0.5128 0.7970 0.6371 0.0696  0.1262  -0.0888 83  GLU E CD  
4659 O OE1 . GLU E 88  ? 0.4276 0.7293 0.5596 0.0533  0.1340  -0.0677 83  GLU E OE1 
4660 O OE2 . GLU E 88  ? 0.6360 0.9208 0.7640 0.0951  0.1348  -0.0987 83  GLU E OE2 
4661 N N   . ALA E 89  ? 0.3907 0.5846 0.4440 0.0030  0.0773  -0.0945 84  ALA E N   
4662 C CA  . ALA E 89  ? 0.4692 0.6441 0.4908 0.0046  0.0721  -0.1061 84  ALA E CA  
4663 C C   . ALA E 89  ? 0.4697 0.6637 0.4680 0.0062  0.0863  -0.0983 84  ALA E C   
4664 O O   . ALA E 89  ? 0.4225 0.6322 0.4343 -0.0052 0.0933  -0.0777 84  ALA E O   
4665 C CB  . ALA E 89  ? 0.3901 0.5447 0.4159 -0.0129 0.0579  -0.1030 84  ALA E CB  
4666 N N   . LYS E 90  ? 0.4628 0.6434 0.4242 0.0202  0.0849  -0.1104 85  LYS E N   
4667 C CA  . LYS E 90  ? 0.4767 0.6592 0.4080 0.0218  0.0931  -0.0967 85  LYS E CA  
4668 C C   . LYS E 90  ? 0.5260 0.6894 0.4300 0.0174  0.0760  -0.1055 85  LYS E C   
4669 O O   . LYS E 90  ? 0.5954 0.7375 0.4816 0.0265  0.0593  -0.1272 85  LYS E O   
4670 C CB  . LYS E 90  ? 0.5687 0.7496 0.4725 0.0440  0.1079  -0.0994 85  LYS E CB  
4671 C CG  . LYS E 90  ? 0.5638 0.7716 0.4997 0.0474  0.1294  -0.0844 85  LYS E CG  
4672 C CD  . LYS E 90  ? 0.6412 0.8475 0.5512 0.0699  0.1481  -0.0896 85  LYS E CD  
4673 C CE  . LYS E 90  ? 0.6601 0.8993 0.6132 0.0724  0.1704  -0.0750 85  LYS E CE  
4674 N NZ  . LYS E 90  ? 0.7294 0.9707 0.6619 0.0950  0.1915  -0.0834 85  LYS E NZ  
4675 N N   . VAL E 91  ? 0.5240 0.6931 0.4285 0.0032  0.0770  -0.0888 86  VAL E N   
4676 C CA  . VAL E 91  ? 0.4890 0.6428 0.3719 0.0006  0.0600  -0.0934 86  VAL E CA  
4677 C C   . VAL E 91  ? 0.5083 0.6594 0.3449 0.0109  0.0665  -0.0829 86  VAL E C   
4678 O O   . VAL E 91  ? 0.5232 0.6843 0.3607 0.0048  0.0833  -0.0593 86  VAL E O   
4679 C CB  . VAL E 91  ? 0.5107 0.6619 0.4244 -0.0183 0.0536  -0.0804 86  VAL E CB  
4680 C CG1 . VAL E 91  ? 0.5547 0.6946 0.4478 -0.0182 0.0414  -0.0749 86  VAL E CG1 
4681 C CG2 . VAL E 91  ? 0.4804 0.6235 0.4288 -0.0252 0.0419  -0.0910 86  VAL E CG2 
4682 N N   . PRO E 92  ? 0.5931 0.7238 0.3900 0.0260  0.0510  -0.0986 87  PRO E N   
4683 C CA  . PRO E 92  ? 0.6170 0.7369 0.3624 0.0366  0.0554  -0.0871 87  PRO E CA  
4684 C C   . PRO E 92  ? 0.5845 0.7045 0.3222 0.0279  0.0433  -0.0744 87  PRO E C   
4685 O O   . PRO E 92  ? 0.5640 0.6765 0.3182 0.0234  0.0173  -0.0864 87  PRO E O   
4686 C CB  . PRO E 92  ? 0.7172 0.8106 0.4260 0.0531  0.0358  -0.1115 87  PRO E CB  
4687 C CG  . PRO E 92  ? 0.6781 0.7659 0.4240 0.0465  0.0110  -0.1332 87  PRO E CG  
4688 C CD  . PRO E 92  ? 0.5698 0.6817 0.3694 0.0315  0.0256  -0.1262 87  PRO E CD  
4689 N N   . LEU E 93  ? 0.6069 0.7312 0.3292 0.0241  0.0614  -0.0472 88  LEU E N   
4690 C CA  . LEU E 93  ? 0.6339 0.7527 0.3541 0.0154  0.0509  -0.0304 88  LEU E CA  
4691 C C   . LEU E 93  ? 0.6799 0.7776 0.3481 0.0312  0.0261  -0.0354 88  LEU E C   
4692 O O   . LEU E 93  ? 0.7373 0.8222 0.4091 0.0279  0.0092  -0.0243 88  LEU E O   
4693 C CB  . LEU E 93  ? 0.6640 0.7912 0.3881 0.0038  0.0766  0.0023  88  LEU E CB  
4694 C CG  . LEU E 93  ? 0.7273 0.8750 0.5079 -0.0137 0.0938  0.0073  88  LEU E CG  
4695 C CD1 . LEU E 93  ? 0.7788 0.9248 0.5756 -0.0312 0.1055  0.0378  88  LEU E CD1 
4696 C CD2 . LEU E 93  ? 0.6708 0.8147 0.4957 -0.0216 0.0760  -0.0127 88  LEU E CD2 
4697 N N   . ARG E 94  ? 0.6834 0.7675 0.3147 0.0464  0.0212  -0.0517 89  ARG E N   
4698 C CA  . ARG E 94  ? 0.7569 0.8174 0.3458 0.0592  -0.0093 -0.0619 89  ARG E CA  
4699 C C   . ARG E 94  ? 0.7537 0.8142 0.3782 0.0559  -0.0465 -0.0802 89  ARG E C   
4700 O O   . ARG E 94  ? 0.5875 0.6370 0.1981 0.0612  -0.0742 -0.0772 89  ARG E O   
4701 C CB  . ARG E 94  ? 0.8566 0.9029 0.4115 0.0722  -0.0091 -0.0808 89  ARG E CB  
4702 C CG  . ARG E 94  ? 0.9978 1.0274 0.5574 0.0774  -0.0478 -0.1108 89  ARG E CG  
4703 C CD  . ARG E 94  ? 1.1171 1.1287 0.6342 0.0924  -0.0481 -0.1288 89  ARG E CD  
4704 N NE  . ARG E 94  ? 1.1836 1.2058 0.6942 0.0968  -0.0090 -0.1236 89  ARG E NE  
4705 C CZ  . ARG E 94  ? 1.1787 1.2092 0.7285 0.0941  0.0029  -0.1351 89  ARG E CZ  
4706 N NH1 . ARG E 94  ? 1.1784 1.2058 0.7737 0.0853  -0.0196 -0.1515 89  ARG E NH1 
4707 N NH2 . ARG E 94  ? 1.1680 1.2112 0.7151 0.1000  0.0372  -0.1285 89  ARG E NH2 
4708 N N   . GLU E 95  ? 0.7253 0.7997 0.4028 0.0460  -0.0468 -0.0970 90  GLU E N   
4709 C CA  . GLU E 95  ? 0.7352 0.8100 0.4688 0.0366  -0.0756 -0.1100 90  GLU E CA  
4710 C C   . GLU E 95  ? 0.6952 0.7768 0.4675 0.0264  -0.0759 -0.0890 90  GLU E C   
4711 O O   . GLU E 95  ? 0.6545 0.7387 0.4651 0.0241  -0.1008 -0.0944 90  GLU E O   
4712 C CB  . GLU E 95  ? 0.7942 0.8772 0.5792 0.0254  -0.0688 -0.1253 90  GLU E CB  
4713 C CG  . GLU E 95  ? 0.9366 1.0057 0.6935 0.0361  -0.0686 -0.1459 90  GLU E CG  
4714 C CD  . GLU E 95  ? 0.9720 1.0401 0.7819 0.0260  -0.0763 -0.1630 90  GLU E CD  
4715 O OE1 . GLU E 95  ? 1.0140 1.0722 0.8530 0.0205  -0.1057 -0.1742 90  GLU E OE1 
4716 O OE2 . GLU E 95  ? 0.9463 1.0236 0.7728 0.0224  -0.0530 -0.1622 90  GLU E OE2 
4717 N N   . VAL E 96  ? 0.6544 0.7386 0.4203 0.0207  -0.0485 -0.0653 91  VAL E N   
4718 C CA  . VAL E 96  ? 0.6085 0.6907 0.4033 0.0136  -0.0479 -0.0466 91  VAL E CA  
4719 C C   . VAL E 96  ? 0.7073 0.7727 0.4592 0.0262  -0.0641 -0.0314 91  VAL E C   
4720 O O   . VAL E 96  ? 0.7479 0.8085 0.5245 0.0284  -0.0807 -0.0251 91  VAL E O   
4721 C CB  . VAL E 96  ? 0.5301 0.6159 0.3400 -0.0002 -0.0169 -0.0295 91  VAL E CB  
4722 C CG1 . VAL E 96  ? 0.5178 0.5934 0.3547 -0.0058 -0.0189 -0.0154 91  VAL E CG1 
4723 C CG2 . VAL E 96  ? 0.4530 0.5538 0.2984 -0.0101 -0.0040 -0.0433 91  VAL E CG2 
4724 N N   . LEU E 97  ? 0.7545 0.8106 0.4401 0.0371  -0.0585 -0.0248 92  LEU E N   
4725 C CA  . LEU E 97  ? 0.7587 0.7949 0.3897 0.0516  -0.0747 -0.0083 92  LEU E CA  
4726 C C   . LEU E 97  ? 0.7118 0.7417 0.3253 0.0669  -0.1169 -0.0299 92  LEU E C   
4727 O O   . LEU E 97  ? 0.7419 0.7534 0.2918 0.0835  -0.1349 -0.0223 92  LEU E O   
4728 C CB  . LEU E 97  ? 0.8242 0.8535 0.3849 0.0586  -0.0483 0.0100  92  LEU E CB  
4729 C CG  . LEU E 97  ? 0.8650 0.8992 0.4401 0.0428  -0.0104 0.0391  92  LEU E CG  
4730 C CD1 . LEU E 97  ? 0.9924 1.0264 0.5114 0.0482  0.0181  0.0558  92  LEU E CD1 
4731 C CD2 . LEU E 97  ? 0.8276 0.8419 0.4192 0.0367  -0.0187 0.0641  92  LEU E CD2 
4732 N N   . ALA E 98  ? 0.7068 0.7509 0.3771 0.0605  -0.1342 -0.0552 93  ALA E N   
4733 C CA  . ALA E 98  ? 0.7970 0.8372 0.4628 0.0706  -0.1774 -0.0792 93  ALA E CA  
4734 C C   . ALA E 98  ? 0.7466 0.7926 0.4587 0.0733  -0.2111 -0.0746 93  ALA E C   
4735 O O   . ALA E 98  ? 0.6497 0.6890 0.3556 0.0810  -0.2444 -0.0826 93  ALA E O   
4736 C CB  . ALA E 98  ? 0.8159 0.8663 0.5244 0.0601  -0.1785 -0.1066 93  ALA E CB  
4737 N N   . THR E 99  ? 0.6514 0.7095 0.4214 0.0641  -0.1941 -0.0588 94  THR E N   
4738 C CA  . THR E 99  ? 0.6200 0.6902 0.4484 0.0685  -0.2202 -0.0555 94  THR E CA  
4739 C C   . THR E 99  ? 0.6123 0.6707 0.4410 0.0730  -0.2047 -0.0279 94  THR E C   
4740 O O   . THR E 99  ? 0.5976 0.6456 0.4097 0.0641  -0.1694 -0.0145 94  THR E O   
4741 C CB  . THR E 99  ? 0.6437 0.7443 0.5629 0.0544  -0.2193 -0.0719 94  THR E CB  
4742 O OG1 . THR E 99  ? 0.7962 0.9119 0.7557 0.0597  -0.2633 -0.0850 94  THR E OG1 
4743 C CG2 . THR E 99  ? 0.5667 0.6792 0.5410 0.0489  -0.1919 -0.0580 94  THR E CG2 
4744 N N   . PRO E 100 ? 0.6403 0.6984 0.4901 0.0874  -0.2337 -0.0195 95  PRO E N   
4745 C CA  . PRO E 100 ? 0.6644 0.7023 0.5088 0.0960  -0.2255 0.0062  95  PRO E CA  
4746 C C   . PRO E 100 ? 0.6424 0.6832 0.5324 0.0840  -0.1890 0.0102  95  PRO E C   
4747 O O   . PRO E 100 ? 0.7037 0.7172 0.5736 0.0853  -0.1737 0.0301  95  PRO E O   
4748 C CB  . PRO E 100 ? 0.7582 0.8082 0.6467 0.1139  -0.2657 0.0059  95  PRO E CB  
4749 C CG  . PRO E 100 ? 0.6243 0.6885 0.5054 0.1163  -0.3020 -0.0140 95  PRO E CG  
4750 C CD  . PRO E 100 ? 0.5827 0.6596 0.4694 0.0967  -0.2794 -0.0343 95  PRO E CD  
4751 N N   . SER E 101 ? 0.4686 0.5385 0.4167 0.0725  -0.1769 -0.0082 96  SER E N   
4752 C CA  . SER E 101 ? 0.5133 0.5846 0.4959 0.0629  -0.1436 -0.0072 96  SER E CA  
4753 C C   . SER E 101 ? 0.5154 0.5652 0.4492 0.0484  -0.1150 0.0009  96  SER E C   
4754 O O   . SER E 101 ? 0.5004 0.5368 0.4429 0.0420  -0.0928 0.0070  96  SER E O   
4755 C CB  . SER E 101 ? 0.4425 0.5492 0.4905 0.0539  -0.1358 -0.0256 96  SER E CB  
4756 O OG  . SER E 101 ? 0.3754 0.4866 0.4058 0.0375  -0.1221 -0.0362 96  SER E OG  
4757 N N   . LEU E 102 ? 0.4435 0.4902 0.3270 0.0447  -0.1166 0.0002  97  LEU E N   
4758 C CA  . LEU E 102 ? 0.4437 0.4792 0.2883 0.0319  -0.0887 0.0093  97  LEU E CA  
4759 C C   . LEU E 102 ? 0.3986 0.4485 0.2819 0.0161  -0.0647 -0.0020 97  LEU E C   
4760 O O   . LEU E 102 ? 0.4338 0.4723 0.3119 0.0050  -0.0432 0.0081  97  LEU E O   
4761 C CB  . LEU E 102 ? 0.4802 0.4843 0.2942 0.0323  -0.0800 0.0367  97  LEU E CB  
4762 C CG  . LEU E 102 ? 0.5481 0.5308 0.3112 0.0481  -0.1007 0.0552  97  LEU E CG  
4763 C CD1 . LEU E 102 ? 0.5817 0.5290 0.3287 0.0457  -0.0913 0.0843  97  LEU E CD1 
4764 C CD2 . LEU E 102 ? 0.5838 0.5707 0.2861 0.0506  -0.0981 0.0554  97  LEU E CD2 
4765 N N   . SER E 103 ? 0.3546 0.4279 0.2776 0.0145  -0.0708 -0.0217 98  SER E N   
4766 C CA  . SER E 103 ? 0.3080 0.3937 0.2645 0.0016  -0.0501 -0.0311 98  SER E CA  
4767 C C   . SER E 103 ? 0.3471 0.4538 0.3272 -0.0017 -0.0584 -0.0497 98  SER E C   
4768 O O   . SER E 103 ? 0.3068 0.4213 0.2963 0.0057  -0.0838 -0.0579 98  SER E O   
4769 C CB  . SER E 103 ? 0.3079 0.3930 0.3053 0.0038  -0.0432 -0.0295 98  SER E CB  
4770 O OG  . SER E 103 ? 0.3561 0.4576 0.3924 0.0154  -0.0619 -0.0345 98  SER E OG  
4771 N N   . ALA E 104 ? 0.2792 0.3922 0.2702 -0.0131 -0.0401 -0.0560 99  ALA E N   
4772 C CA  . ALA E 104 ? 0.2881 0.4144 0.3026 -0.0180 -0.0465 -0.0718 99  ALA E CA  
4773 C C   . ALA E 104 ? 0.2346 0.3651 0.2703 -0.0293 -0.0238 -0.0722 99  ALA E C   
4774 O O   . ALA E 104 ? 0.2384 0.3608 0.2568 -0.0334 -0.0060 -0.0636 99  ALA E O   
4775 C CB  . ALA E 104 ? 0.2759 0.3951 0.2471 -0.0136 -0.0562 -0.0813 99  ALA E CB  
4776 N N   . SER E 105 ? 0.2422 0.3840 0.3164 -0.0351 -0.0266 -0.0809 100 SER E N   
4777 C CA  . SER E 105 ? 0.3084 0.4512 0.3969 -0.0445 -0.0070 -0.0796 100 SER E CA  
4778 C C   . SER E 105 ? 0.2663 0.4054 0.3505 -0.0483 -0.0127 -0.0909 100 SER E C   
4779 O O   . SER E 105 ? 0.1987 0.3361 0.2841 -0.0453 -0.0339 -0.1028 100 SER E O   
4780 C CB  . SER E 105 ? 0.3593 0.5156 0.4965 -0.0479 0.0007  -0.0754 100 SER E CB  
4781 O OG  . SER E 105 ? 0.4535 0.6227 0.6321 -0.0517 -0.0163 -0.0823 100 SER E OG  
4782 N N   . PHE E 106 ? 0.2204 0.3551 0.2981 -0.0533 0.0033  -0.0883 101 PHE E N   
4783 C CA  . PHE E 106 ? 0.2145 0.3422 0.2875 -0.0537 -0.0006 -0.0987 101 PHE E CA  
4784 C C   . PHE E 106 ? 0.2631 0.3885 0.3610 -0.0622 0.0109  -0.0933 101 PHE E C   
4785 O O   . PHE E 106 ? 0.1886 0.3147 0.2804 -0.0648 0.0267  -0.0825 101 PHE E O   
4786 C CB  . PHE E 106 ? 0.2917 0.4166 0.3237 -0.0463 0.0066  -0.0997 101 PHE E CB  
4787 C CG  . PHE E 106 ? 0.3214 0.4460 0.3198 -0.0372 -0.0009 -0.1005 101 PHE E CG  
4788 C CD1 . PHE E 106 ? 0.2715 0.3984 0.2572 -0.0379 0.0066  -0.0859 101 PHE E CD1 
4789 C CD2 . PHE E 106 ? 0.3756 0.4923 0.3501 -0.0269 -0.0168 -0.1156 101 PHE E CD2 
4790 C CE1 . PHE E 106 ? 0.3259 0.4490 0.2774 -0.0293 0.0002  -0.0823 101 PHE E CE1 
4791 C CE2 . PHE E 106 ? 0.3963 0.5100 0.3301 -0.0166 -0.0236 -0.1142 101 PHE E CE2 
4792 C CZ  . PHE E 106 ? 0.3401 0.4579 0.2634 -0.0182 -0.0142 -0.0954 101 PHE E CZ  
4793 N N   . ASN E 107 ? 0.2188 0.3378 0.3429 -0.0666 0.0005  -0.1005 102 ASN E N   
4794 C CA  . ASN E 107 ? 0.2144 0.3243 0.3540 -0.0730 0.0095  -0.0945 102 ASN E CA  
4795 C C   . ASN E 107 ? 0.2367 0.3305 0.3588 -0.0658 0.0007  -0.1081 102 ASN E C   
4796 O O   . ASN E 107 ? 0.2862 0.3650 0.4237 -0.0670 -0.0160 -0.1203 102 ASN E O   
4797 C CB  . ASN E 107 ? 0.2020 0.3137 0.3906 -0.0847 0.0068  -0.0883 102 ASN E CB  
4798 C CG  . ASN E 107 ? 0.3307 0.4309 0.5303 -0.0916 0.0204  -0.0751 102 ASN E CG  
4799 O OD1 . ASN E 107 ? 0.2444 0.3351 0.4149 -0.0862 0.0281  -0.0724 102 ASN E OD1 
4800 N ND2 . ASN E 107 ? 0.3737 0.4737 0.6117 -0.1011 0.0223  -0.0626 102 ASN E ND2 
4801 N N   . ALA E 108 ? 0.2441 0.3408 0.3367 -0.0576 0.0113  -0.1066 103 ALA E N   
4802 C CA  . ALA E 108 ? 0.3176 0.4057 0.3902 -0.0448 0.0071  -0.1204 103 ALA E CA  
4803 C C   . ALA E 108 ? 0.2846 0.3598 0.3695 -0.0431 0.0102  -0.1180 103 ALA E C   
4804 O O   . ALA E 108 ? 0.2304 0.3118 0.3195 -0.0473 0.0214  -0.1026 103 ALA E O   
4805 C CB  . ALA E 108 ? 0.3347 0.4396 0.3762 -0.0357 0.0184  -0.1181 103 ALA E CB  
4806 N N   . PRO E 109 ? 0.2976 0.3502 0.3853 -0.0357 -0.0028 -0.1341 104 PRO E N   
4807 C CA  . PRO E 109 ? 0.2469 0.2829 0.3433 -0.0291 -0.0017 -0.1332 104 PRO E CA  
4808 C C   . PRO E 109 ? 0.3418 0.3965 0.4202 -0.0130 0.0115  -0.1326 104 PRO E C   
4809 O O   . PRO E 109 ? 0.3477 0.4146 0.4023 -0.0004 0.0158  -0.1439 104 PRO E O   
4810 C CB  . PRO E 109 ? 0.2896 0.2930 0.3881 -0.0221 -0.0216 -0.1559 104 PRO E CB  
4811 C CG  . PRO E 109 ? 0.3192 0.3287 0.3929 -0.0171 -0.0307 -0.1727 104 PRO E CG  
4812 C CD  . PRO E 109 ? 0.3291 0.3658 0.4105 -0.0318 -0.0230 -0.1554 104 PRO E CD  
4813 N N   . LEU E 110 ? 0.3140 0.3724 0.4048 -0.0135 0.0178  -0.1177 105 LEU E N   
4814 C CA  . LEU E 110 ? 0.2351 0.3173 0.3230 -0.0002 0.0281  -0.1145 105 LEU E CA  
4815 C C   . LEU E 110 ? 0.2949 0.3644 0.3852 0.0226  0.0252  -0.1299 105 LEU E C   
4816 O O   . LEU E 110 ? 0.3237 0.3596 0.4246 0.0251  0.0133  -0.1343 105 LEU E O   
4817 C CB  . LEU E 110 ? 0.3082 0.3995 0.4079 -0.0091 0.0303  -0.0932 105 LEU E CB  
4818 C CG  . LEU E 110 ? 0.2891 0.3898 0.3807 -0.0273 0.0344  -0.0805 105 LEU E CG  
4819 C CD1 . LEU E 110 ? 0.1978 0.2983 0.2907 -0.0331 0.0325  -0.0633 105 LEU E CD1 
4820 C CD2 . LEU E 110 ? 0.2466 0.3734 0.3273 -0.0278 0.0426  -0.0828 105 LEU E CD2 
4821 N N   . LEU E 111 ? 0.2782 0.3733 0.3593 0.0400  0.0377  -0.1371 106 LEU E N   
4822 C CA  . LEU E 111 ? 0.3258 0.4132 0.4072 0.0675  0.0398  -0.1535 106 LEU E CA  
4823 C C   . LEU E 111 ? 0.3166 0.4339 0.4276 0.0781  0.0484  -0.1398 106 LEU E C   
4824 O O   . LEU E 111 ? 0.2599 0.4137 0.3840 0.0667  0.0568  -0.1218 106 LEU E O   
4825 C CB  . LEU E 111 ? 0.3316 0.4288 0.3796 0.0855  0.0514  -0.1721 106 LEU E CB  
4826 C CG  . LEU E 111 ? 0.3536 0.4225 0.3678 0.0796  0.0381  -0.1890 106 LEU E CG  
4827 C CD1 . LEU E 111 ? 0.4501 0.5238 0.4204 0.1035  0.0493  -0.2067 106 LEU E CD1 
4828 C CD2 . LEU E 111 ? 0.3793 0.3982 0.4027 0.0756  0.0129  -0.2029 106 LEU E CD2 
4829 N N   . ASP E 112 ? 0.3418 0.4420 0.4665 0.1003  0.0436  -0.1488 107 ASP E N   
4830 C CA  . ASP E 112 ? 0.3477 0.4801 0.5068 0.1154  0.0497  -0.1373 107 ASP E CA  
4831 C C   . ASP E 112 ? 0.4047 0.5779 0.5667 0.1407  0.0737  -0.1467 107 ASP E C   
4832 O O   . ASP E 112 ? 0.4135 0.5891 0.5418 0.1448  0.0866  -0.1597 107 ASP E O   
4833 C CB  . ASP E 112 ? 0.4557 0.5523 0.6334 0.1292  0.0327  -0.1378 107 ASP E CB  
4834 C CG  . ASP E 112 ? 0.5485 0.6015 0.7099 0.1543  0.0285  -0.1659 107 ASP E CG  
4835 O OD1 . ASP E 112 ? 0.4866 0.5495 0.6257 0.1725  0.0430  -0.1867 107 ASP E OD1 
4836 O OD2 . ASP E 112 ? 0.6130 0.6176 0.7809 0.1565  0.0099  -0.1669 107 ASP E OD2 
4837 N N   . THR E 113 ? 0.4196 0.6264 0.6223 0.1588  0.0800  -0.1386 108 THR E N   
4838 C CA  . THR E 113 ? 0.4959 0.7462 0.7103 0.1826  0.1070  -0.1406 108 THR E CA  
4839 C C   . THR E 113 ? 0.5414 0.7501 0.7112 0.2064  0.1146  -0.1633 108 THR E C   
4840 O O   . THR E 113 ? 0.5227 0.7450 0.6715 0.2136  0.1383  -0.1620 108 THR E O   
4841 C CB  . THR E 113 ? 0.5242 0.8115 0.7980 0.1968  0.1072  -0.1251 108 THR E CB  
4842 O OG1 . THR E 113 ? 0.5263 0.7755 0.8112 0.2176  0.0866  -0.1372 108 THR E OG1 
4843 C CG2 . THR E 113 ? 0.4969 0.8256 0.8110 0.1700  0.0966  -0.1011 108 THR E CG2 
4844 N N   . LYS E 114 ? 0.6085 0.7620 0.7646 0.2167  0.0931  -0.1836 109 LYS E N   
4845 C CA  . LYS E 114 ? 0.6634 0.7683 0.7755 0.2360  0.0928  -0.2074 109 LYS E CA  
4846 C C   . LYS E 114 ? 0.6676 0.7350 0.7280 0.2190  0.0809  -0.2225 109 LYS E C   
4847 O O   . LYS E 114 ? 0.7312 0.7456 0.7600 0.2275  0.0663  -0.2441 109 LYS E O   
4848 C CB  . LYS E 114 ? 0.6901 0.7467 0.8171 0.2542  0.0722  -0.2195 109 LYS E CB  
4849 C CG  . LYS E 114 ? 0.7232 0.8076 0.8961 0.2788  0.0815  -0.2084 109 LYS E CG  
4850 C CD  . LYS E 114 ? 0.7687 0.7924 0.9442 0.2977  0.0603  -0.2215 109 LYS E CD  
4851 C CE  . LYS E 114 ? 0.7992 0.8480 1.0177 0.3268  0.0702  -0.2121 109 LYS E CE  
4852 N NZ  . LYS E 114 ? 0.8184 0.9014 1.0293 0.3465  0.1043  -0.2179 109 LYS E NZ  
4853 N N   . LYS E 115 ? 0.6553 0.7496 0.7106 0.1939  0.0844  -0.2101 110 LYS E N   
4854 C CA  . LYS E 115 ? 0.6975 0.7631 0.7102 0.1768  0.0717  -0.2207 110 LYS E CA  
4855 C C   . LYS E 115 ? 0.6555 0.6644 0.6691 0.1671  0.0399  -0.2375 110 LYS E C   
4856 O O   . LYS E 115 ? 0.5203 0.4981 0.5019 0.1572  0.0244  -0.2495 110 LYS E O   
4857 C CB  . LYS E 115 ? 0.8174 0.8726 0.7779 0.1909  0.0836  -0.2307 110 LYS E CB  
4858 C CG  . LYS E 115 ? 0.8690 0.9626 0.8114 0.1798  0.1046  -0.2123 110 LYS E CG  
4859 C CD  . LYS E 115 ? 0.8975 1.0469 0.8827 0.1798  0.1309  -0.1869 110 LYS E CD  
4860 C CE  . LYS E 115 ? 0.9191 1.0988 0.8923 0.1624  0.1477  -0.1653 110 LYS E CE  
4861 N NZ  . LYS E 115 ? 0.9082 1.1393 0.9333 0.1548  0.1673  -0.1385 110 LYS E NZ  
4862 N N   . GLN E 116 ? 0.6043 0.5982 0.6582 0.1684  0.0286  -0.2347 111 GLN E N   
4863 C CA  . GLN E 116 ? 0.5714 0.5101 0.6344 0.1501  0.0004  -0.2371 111 GLN E CA  
4864 C C   . GLN E 116 ? 0.5239 0.4781 0.6074 0.1125  -0.0031 -0.2074 111 GLN E C   
4865 O O   . GLN E 116 ? 0.5310 0.5267 0.6313 0.1052  0.0103  -0.1839 111 GLN E O   
4866 C CB  . GLN E 116 ? 0.5612 0.4650 0.6500 0.1676  -0.0103 -0.2385 111 GLN E CB  
4867 C CG  . GLN E 116 ? 0.7377 0.6160 0.8012 0.1984  -0.0090 -0.2599 111 GLN E CG  
4868 C CD  . GLN E 116 ? 0.8209 0.6752 0.9135 0.2187  -0.0152 -0.2563 111 GLN E CD  
4869 O OE1 . GLN E 116 ? 0.9650 0.8252 1.0504 0.2476  -0.0023 -0.2638 111 GLN E OE1 
4870 N NE2 . GLN E 116 ? 0.7613 0.5865 0.8870 0.2038  -0.0339 -0.2421 111 GLN E NE2 
4871 N N   . PRO E 117 ? 0.4769 0.3981 0.5606 0.0894  -0.0214 -0.2093 112 PRO E N   
4872 C CA  . PRO E 117 ? 0.3989 0.3324 0.5024 0.0571  -0.0217 -0.1816 112 PRO E CA  
4873 C C   . PRO E 117 ? 0.5054 0.4347 0.6346 0.0534  -0.0208 -0.1563 112 PRO E C   
4874 O O   . PRO E 117 ? 0.4269 0.3178 0.5685 0.0638  -0.0324 -0.1592 112 PRO E O   
4875 C CB  . PRO E 117 ? 0.4219 0.3163 0.5321 0.0390  -0.0428 -0.1909 112 PRO E CB  
4876 C CG  . PRO E 117 ? 0.4732 0.3475 0.5527 0.0585  -0.0538 -0.2262 112 PRO E CG  
4877 C CD  . PRO E 117 ? 0.4968 0.3711 0.5628 0.0926  -0.0429 -0.2383 112 PRO E CD  
4878 N N   . THR E 118 ? 0.4280 0.3922 0.5613 0.0399  -0.0095 -0.1324 11