data_4IRG
# 
_entry.id   4IRG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IRG         
RCSB  RCSB077115   
WWPDB D_1000077115 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4IRH . unspecified 
PDB 4IRI . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IRG 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Regan, M.C.'      1 
'Horanyi, P.S.'    2 
'Pryor, E.E.'      3 
'Sarver, J.L.'     4 
'Cafiso, D.S.'     5 
'Bushweller, J.H.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                13374 
_citation.page_last                 13379 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23898196 
_citation.pdbx_database_id_DOI      10.1073/pnas.1301726110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Regan, M.C.'      1 
primary 'Horanyi, P.S.'    2 
primary 'Pryor, E.E.'      3 
primary 'Sarver, J.L.'     4 
primary 'Cafiso, D.S.'     5 
primary 'Bushweller, J.H.' 6 
# 
_cell.entry_id           4IRG 
_cell.length_a           44.699 
_cell.length_b           44.699 
_cell.length_c           175.112 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IRG 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Transcriptional regulator ERG' 12562.145 1  ? ? 'Ets Domain' ? 
2 water   nat water                           18.015    46 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Transforming protein ERG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGSGIQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKN
IMTKVHGKRYAYKFDFHGIAQALQPHPPE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSGIQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKN
IMTKVHGKRYAYKFDFHGIAQALQPHPPE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   ILE n 
1 8   GLN n 
1 9   ARG n 
1 10  PRO n 
1 11  GLY n 
1 12  SER n 
1 13  GLY n 
1 14  GLN n 
1 15  ILE n 
1 16  GLN n 
1 17  LEU n 
1 18  TRP n 
1 19  GLN n 
1 20  PHE n 
1 21  LEU n 
1 22  LEU n 
1 23  GLU n 
1 24  LEU n 
1 25  LEU n 
1 26  SER n 
1 27  ASP n 
1 28  SER n 
1 29  SER n 
1 30  ASN n 
1 31  SER n 
1 32  SER n 
1 33  CYS n 
1 34  ILE n 
1 35  THR n 
1 36  TRP n 
1 37  GLU n 
1 38  GLY n 
1 39  THR n 
1 40  ASN n 
1 41  GLY n 
1 42  GLU n 
1 43  PHE n 
1 44  LYS n 
1 45  MET n 
1 46  THR n 
1 47  ASP n 
1 48  PRO n 
1 49  ASP n 
1 50  GLU n 
1 51  VAL n 
1 52  ALA n 
1 53  ARG n 
1 54  ARG n 
1 55  TRP n 
1 56  GLY n 
1 57  GLU n 
1 58  ARG n 
1 59  LYS n 
1 60  SER n 
1 61  LYS n 
1 62  PRO n 
1 63  ASN n 
1 64  MET n 
1 65  ASN n 
1 66  TYR n 
1 67  ASP n 
1 68  LYS n 
1 69  LEU n 
1 70  SER n 
1 71  ARG n 
1 72  ALA n 
1 73  LEU n 
1 74  ARG n 
1 75  TYR n 
1 76  TYR n 
1 77  TYR n 
1 78  ASP n 
1 79  LYS n 
1 80  ASN n 
1 81  ILE n 
1 82  MET n 
1 83  THR n 
1 84  LYS n 
1 85  VAL n 
1 86  HIS n 
1 87  GLY n 
1 88  LYS n 
1 89  ARG n 
1 90  TYR n 
1 91  ALA n 
1 92  TYR n 
1 93  LYS n 
1 94  PHE n 
1 95  ASP n 
1 96  PHE n 
1 97  HIS n 
1 98  GLY n 
1 99  ILE n 
1 100 ALA n 
1 101 GLN n 
1 102 ALA n 
1 103 LEU n 
1 104 GLN n 
1 105 PRO n 
1 106 HIS n 
1 107 PRO n 
1 108 PRO n 
1 109 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ERG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERG_HUMAN 
_struct_ref.pdbx_db_accession          P11308 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKR
YAYKFDFHGIAQALQPHPPE
;
_struct_ref.pdbx_align_begin           313 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4IRG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 109 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P11308 
_struct_ref_seq.db_align_beg                  313 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  412 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       289 
_struct_ref_seq.pdbx_auth_seq_align_end       388 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IRG GLY A 1 ? UNP P11308 ? ? 'EXPRESSION TAG' 280 1 
1 4IRG ALA A 2 ? UNP P11308 ? ? 'EXPRESSION TAG' 281 2 
1 4IRG MET A 3 ? UNP P11308 ? ? 'EXPRESSION TAG' 282 3 
1 4IRG GLY A 4 ? UNP P11308 ? ? 'EXPRESSION TAG' 283 4 
1 4IRG SER A 5 ? UNP P11308 ? ? 'EXPRESSION TAG' 284 5 
1 4IRG GLY A 6 ? UNP P11308 ? ? 'EXPRESSION TAG' 285 6 
1 4IRG ILE A 7 ? UNP P11308 ? ? 'EXPRESSION TAG' 286 7 
1 4IRG GLN A 8 ? UNP P11308 ? ? 'EXPRESSION TAG' 287 8 
1 4IRG ARG A 9 ? UNP P11308 ? ? 'EXPRESSION TAG' 288 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4IRG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.density_percent_sol   38.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    '1.4M Sodium Citrate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2012-12-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
# 
_reflns.entry_id                     4IRG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.43 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   11537 
_reflns.number_all                   12118 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4IRG 
_refine.ls_number_reflns_obs                     11537 
_refine.ls_number_reflns_all                     12118 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.43 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.25 
_refine.ls_R_factor_obs                          0.18990 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18809 
_refine.ls_R_factor_R_free                       0.22756 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  580 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               21.615 
_refine.aniso_B[1][1]                            0.26 
_refine.aniso_B[2][2]                            0.26 
_refine.aniso_B[3][3]                            -0.83 
_refine.aniso_B[1][2]                            0.26 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.106 
_refine.pdbx_overall_ESU_R_Free                  0.107 
_refine.overall_SU_ML                            0.069 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.229 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        807 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               853 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        35.43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.022  0.019  ? 827  ? 'X-RAY DIFFRACTION' 
r_bond_other_d         0.001  0.020  ? 760  ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2.001  1.932  ? 1113 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      0.997  3.000  ? 1743 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.270  5.000  ? 97   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 31.966 23.409 ? 44   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 14.736 15.000 ? 146  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21.365 15.000 ? 7    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.139  0.200  ? 110  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.011  0.020  ? 945  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     0.001  0.020  ? 214  ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.747 
_refine_ls_shell.number_reflns_R_work             784 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.percent_reflns_obs               96.42 
_refine_ls_shell.R_factor_R_free                  0.308 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IRG 
_struct.title                     'Uninhibited DNA-binding domain of the Ets transcription factor ERG' 
_struct.pdbx_descriptor           'Transcriptional regulator ERG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IRG 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'winged Helix-Turn-Helix, Ets domain, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 16 ? SER A 26  ? GLN A 295 SER A 305 1 ? 11 
HELX_P HELX_P2 2 ASP A 27 ? SER A 31  ? ASP A 306 SER A 310 5 ? 5  
HELX_P HELX_P3 3 ASP A 47 ? SER A 60  ? ASP A 326 SER A 339 1 ? 14 
HELX_P HELX_P4 4 ASN A 65 ? LYS A 79  ? ASN A 344 LYS A 358 1 ? 15 
HELX_P HELX_P5 5 ASP A 95 ? LEU A 103 ? ASP A 374 LEU A 382 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 35 ? TRP A 36 ? THR A 314 TRP A 315 
A 2 GLU A 42 ? LYS A 44 ? GLU A 321 LYS A 323 
A 3 ALA A 91 ? PHE A 94 ? ALA A 370 PHE A 373 
A 4 MET A 82 ? LYS A 84 ? MET A 361 LYS A 363 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 35 ? N THR A 314 O LYS A 44 ? O LYS A 323 
A 2 3 N PHE A 43 ? N PHE A 322 O TYR A 92 ? O TYR A 371 
A 3 4 O LYS A 93 ? O LYS A 372 N THR A 83 ? N THR A 362 
# 
_database_PDB_matrix.entry_id          4IRG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IRG 
_atom_sites.fract_transf_matrix[1][1]   0.022372 
_atom_sites.fract_transf_matrix[1][2]   0.012916 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025833 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005711 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ILE A 1 7   ? 14.733  13.958 -15.778 1.00 27.53 ? 286 ILE A N   1 
ATOM   2   C CA  . ILE A 1 7   ? 14.969  13.367 -14.432 1.00 27.70 ? 286 ILE A CA  1 
ATOM   3   C C   . ILE A 1 7   ? 15.923  14.313 -13.697 1.00 26.10 ? 286 ILE A C   1 
ATOM   4   O O   . ILE A 1 7   ? 16.957  14.690 -14.244 1.00 25.55 ? 286 ILE A O   1 
ATOM   5   C CB  . ILE A 1 7   ? 15.704  11.999 -14.584 1.00 33.45 ? 286 ILE A CB  1 
ATOM   6   C CG1 . ILE A 1 7   ? 15.846  11.237 -13.281 1.00 31.33 ? 286 ILE A CG1 1 
ATOM   7   C CG2 . ILE A 1 7   ? 17.111  12.157 -15.227 1.00 38.24 ? 286 ILE A CG2 1 
ATOM   8   C CD1 . ILE A 1 7   ? 14.564  10.694 -12.732 1.00 32.73 ? 286 ILE A CD1 1 
ATOM   9   N N   . GLN A 1 8   ? 15.613  14.652 -12.457 1.00 21.77 ? 287 GLN A N   1 
ATOM   10  C CA  . GLN A 1 8   ? 16.584  15.353 -11.617 1.00 20.90 ? 287 GLN A CA  1 
ATOM   11  C C   . GLN A 1 8   ? 17.267  14.424 -10.632 1.00 20.15 ? 287 GLN A C   1 
ATOM   12  O O   . GLN A 1 8   ? 16.867  13.329 -10.431 1.00 18.76 ? 287 GLN A O   1 
ATOM   13  C CB  . GLN A 1 8   ? 15.895  16.508 -10.851 1.00 22.23 ? 287 GLN A CB  1 
ATOM   14  C CG  . GLN A 1 8   ? 15.206  17.523 -11.766 1.00 25.06 ? 287 GLN A CG  1 
ATOM   15  C CD  . GLN A 1 8   ? 16.164  18.356 -12.567 1.00 29.00 ? 287 GLN A CD  1 
ATOM   16  O OE1 . GLN A 1 8   ? 17.288  18.642 -12.153 1.00 29.49 ? 287 GLN A OE1 1 
ATOM   17  N NE2 . GLN A 1 8   ? 15.731  18.750 -13.767 1.00 32.20 ? 287 GLN A NE2 1 
ATOM   18  N N   . ARG A 1 9   ? 18.283  14.951 -9.945  1.00 19.68 ? 288 ARG A N   1 
ATOM   19  C CA  . ARG A 1 9   ? 19.043  14.182 -8.958  1.00 20.55 ? 288 ARG A CA  1 
ATOM   20  C C   . ARG A 1 9   ? 18.110  13.797 -7.819  1.00 19.15 ? 288 ARG A C   1 
ATOM   21  O O   . ARG A 1 9   ? 17.399  14.615 -7.338  1.00 18.49 ? 288 ARG A O   1 
ATOM   22  C CB  . ARG A 1 9   ? 20.218  15.069 -8.448  1.00 23.54 ? 288 ARG A CB  1 
ATOM   23  C CG  . ARG A 1 9   ? 20.896  14.646 -7.154  1.00 26.99 ? 288 ARG A CG  1 
ATOM   24  C CD  . ARG A 1 9   ? 22.199  15.417 -6.904  1.00 30.59 ? 288 ARG A CD  1 
ATOM   25  N NE  . ARG A 1 9   ? 23.284  14.488 -7.147  1.00 38.36 ? 288 ARG A NE  1 
ATOM   26  C CZ  . ARG A 1 9   ? 24.282  14.560 -8.028  1.00 42.33 ? 288 ARG A CZ  1 
ATOM   27  N NH1 . ARG A 1 9   ? 24.577  15.631 -8.795  1.00 46.29 ? 288 ARG A NH1 1 
ATOM   28  N NH2 . ARG A 1 9   ? 25.094  13.521 -8.058  1.00 50.30 ? 288 ARG A NH2 1 
ATOM   29  N N   . PRO A 1 10  ? 18.097  12.523 -7.407  1.00 17.90 ? 289 PRO A N   1 
ATOM   30  C CA  . PRO A 1 10  ? 17.244  12.104 -6.285  1.00 16.82 ? 289 PRO A CA  1 
ATOM   31  C C   . PRO A 1 10  ? 17.592  13.016 -5.063  1.00 16.45 ? 289 PRO A C   1 
ATOM   32  O O   . PRO A 1 10  ? 18.793  13.317 -4.833  1.00 17.60 ? 289 PRO A O   1 
ATOM   33  C CB  . PRO A 1 10  ? 17.656  10.648 -6.086  1.00 18.73 ? 289 PRO A CB  1 
ATOM   34  C CG  . PRO A 1 10  ? 18.083  10.216 -7.445  1.00 19.16 ? 289 PRO A CG  1 
ATOM   35  C CD  . PRO A 1 10  ? 18.818  11.391 -8.015  1.00 20.75 ? 289 PRO A CD  1 
ATOM   36  N N   . GLY A 1 11  ? 16.570  13.445 -4.355  1.00 15.01 ? 290 GLY A N   1 
ATOM   37  C CA  . GLY A 1 11  ? 16.717  14.233 -3.154  1.00 15.13 ? 290 GLY A CA  1 
ATOM   38  C C   . GLY A 1 11  ? 16.918  15.707 -3.420  1.00 15.34 ? 290 GLY A C   1 
ATOM   39  O O   . GLY A 1 11  ? 17.181  16.462 -2.476  1.00 16.09 ? 290 GLY A O   1 
ATOM   40  N N   . SER A 1 12  ? 16.915  16.148 -4.676  1.00 15.34 ? 291 SER A N   1 
ATOM   41  C CA  . SER A 1 12  ? 17.268  17.527 -4.969  1.00 16.19 ? 291 SER A CA  1 
ATOM   42  C C   . SER A 1 12  ? 16.086  18.452 -4.794  1.00 15.66 ? 291 SER A C   1 
ATOM   43  O O   . SER A 1 12  ? 14.924  18.033 -4.836  1.00 14.77 ? 291 SER A O   1 
ATOM   44  C CB  . SER A 1 12  ? 17.829  17.699 -6.409  1.00 17.55 ? 291 SER A CB  1 
ATOM   45  O OG  . SER A 1 12  ? 16.804  17.393 -7.282  1.00 20.02 ? 291 SER A OG  1 
ATOM   46  N N   . GLY A 1 13  ? 16.407  19.727 -4.590  1.00 16.83 ? 292 GLY A N   1 
ATOM   47  C CA  . GLY A 1 13  ? 15.412  20.776 -4.468  1.00 17.59 ? 292 GLY A CA  1 
ATOM   48  C C   . GLY A 1 13  ? 14.772  21.131 -5.775  1.00 18.55 ? 292 GLY A C   1 
ATOM   49  O O   . GLY A 1 13  ? 13.611  21.546 -5.757  1.00 19.84 ? 292 GLY A O   1 
ATOM   50  N N   . GLN A 1 14  ? 15.473  20.907 -6.881  1.00 19.22 ? 293 GLN A N   1 
ATOM   51  C CA  . GLN A 1 14  ? 14.917  21.121 -8.228  1.00 21.82 ? 293 GLN A CA  1 
ATOM   52  C C   . GLN A 1 14  ? 13.952  20.078 -8.736  1.00 19.32 ? 293 GLN A C   1 
ATOM   53  O O   . GLN A 1 14  ? 13.409  20.237 -9.817  1.00 19.11 ? 293 GLN A O   1 
ATOM   54  C CB  . GLN A 1 14  ? 16.069  21.298 -9.225  1.00 27.98 ? 293 GLN A CB  1 
ATOM   55  C CG  . GLN A 1 14  ? 16.689  22.656 -9.088  1.00 36.87 ? 293 GLN A CG  1 
ATOM   56  C CD  . GLN A 1 14  ? 18.115  22.733 -9.648  1.00 46.14 ? 293 GLN A CD  1 
ATOM   57  O OE1 . GLN A 1 14  ? 18.865  21.731 -9.701  1.00 50.63 ? 293 GLN A OE1 1 
ATOM   58  N NE2 . GLN A 1 14  ? 18.520  23.945 -10.005 1.00 51.71 ? 293 GLN A NE2 1 
ATOM   59  N N   . ILE A 1 15  ? 13.772  19.009 -7.988  1.00 16.22 ? 294 ILE A N   1 
ATOM   60  C CA  . ILE A 1 15  ? 12.920  17.889 -8.380  1.00 15.49 ? 294 ILE A CA  1 
ATOM   61  C C   . ILE A 1 15  ? 11.511  18.351 -8.729  1.00 15.25 ? 294 ILE A C   1 
ATOM   62  O O   . ILE A 1 15  ? 10.932  19.289 -8.109  1.00 14.84 ? 294 ILE A O   1 
ATOM   63  C CB  . ILE A 1 15  ? 12.942  16.851 -7.242  1.00 15.22 ? 294 ILE A CB  1 
ATOM   64  C CG1 . ILE A 1 15  ? 12.528  15.453 -7.698  1.00 14.35 ? 294 ILE A CG1 1 
ATOM   65  C CG2 . ILE A 1 15  ? 12.050  17.287 -6.093  1.00 14.42 ? 294 ILE A CG2 1 
ATOM   66  C CD1 . ILE A 1 15  ? 12.856  14.360 -6.742  1.00 14.56 ? 294 ILE A CD1 1 
ATOM   67  N N   . GLN A 1 16  ? 10.912  17.711 -9.725  1.00 15.23 ? 295 GLN A N   1 
ATOM   68  C CA  . GLN A 1 16  ? 9.485   17.895 -9.976  1.00 16.20 ? 295 GLN A CA  1 
ATOM   69  C C   . GLN A 1 16  ? 8.599   17.035 -9.082  1.00 13.81 ? 295 GLN A C   1 
ATOM   70  O O   . GLN A 1 16  ? 9.000   16.010 -8.611  1.00 13.02 ? 295 GLN A O   1 
ATOM   71  C CB  . GLN A 1 16  ? 9.153   17.654 -11.458 1.00 17.58 ? 295 GLN A CB  1 
ATOM   72  C CG  . GLN A 1 16  ? 9.951   18.568 -12.400 1.00 21.85 ? 295 GLN A CG  1 
ATOM   73  C CD  . GLN A 1 16  ? 9.607   19.997 -12.153 1.00 27.38 ? 295 GLN A CD  1 
ATOM   74  O OE1 . GLN A 1 16  ? 10.448  20.780 -11.687 1.00 37.12 ? 295 GLN A OE1 1 
ATOM   75  N NE2 . GLN A 1 16  ? 8.339   20.350 -12.415 1.00 30.42 ? 295 GLN A NE2 1 
ATOM   76  N N   . LEU A 1 17  ? 7.344   17.471 -8.911  1.00 13.58 ? 296 LEU A N   1 
ATOM   77  C CA  . LEU A 1 17  ? 6.415   16.753 -8.030  1.00 13.03 ? 296 LEU A CA  1 
ATOM   78  C C   . LEU A 1 17  ? 6.270   15.250 -8.363  1.00 12.97 ? 296 LEU A C   1 
ATOM   79  O O   . LEU A 1 17  ? 6.251   14.424 -7.472  1.00 12.84 ? 296 LEU A O   1 
ATOM   80  C CB  . LEU A 1 17  ? 5.077   17.465 -7.984  1.00 13.52 ? 296 LEU A CB  1 
ATOM   81  C CG  . LEU A 1 17  ? 4.008   16.855 -7.091  1.00 14.21 ? 296 LEU A CG  1 
ATOM   82  C CD1 . LEU A 1 17  ? 4.450   16.683 -5.661  1.00 13.64 ? 296 LEU A CD1 1 
ATOM   83  C CD2 . LEU A 1 17  ? 2.757   17.692 -7.175  1.00 16.12 ? 296 LEU A CD2 1 
ATOM   84  N N   . TRP A 1 18  ? 6.077   14.921 -9.642  1.00 15.10 ? 297 TRP A N   1 
ATOM   85  C CA  . TRP A 1 18  ? 5.928   13.489 -10.054 1.00 14.95 ? 297 TRP A CA  1 
ATOM   86  C C   . TRP A 1 18  ? 7.083   12.656 -9.592  1.00 14.04 ? 297 TRP A C   1 
ATOM   87  O O   . TRP A 1 18  ? 6.889   11.551 -9.002  1.00 14.85 ? 297 TRP A O   1 
ATOM   88  C CB  . TRP A 1 18  ? 5.689   13.368 -11.590 1.00 16.64 ? 297 TRP A CB  1 
ATOM   89  C CG  . TRP A 1 18  ? 6.884   13.716 -12.443 1.00 16.96 ? 297 TRP A CG  1 
ATOM   90  C CD1 . TRP A 1 18  ? 7.112   14.904 -13.031 1.00 19.03 ? 297 TRP A CD1 1 
ATOM   91  C CD2 . TRP A 1 18  ? 7.979   12.865 -12.834 1.00 18.01 ? 297 TRP A CD2 1 
ATOM   92  N NE1 . TRP A 1 18  ? 8.333   14.892 -13.704 1.00 19.90 ? 297 TRP A NE1 1 
ATOM   93  C CE2 . TRP A 1 18  ? 8.844   13.615 -13.618 1.00 18.78 ? 297 TRP A CE2 1 
ATOM   94  C CE3 . TRP A 1 18  ? 8.330   11.529 -12.556 1.00 18.02 ? 297 TRP A CE3 1 
ATOM   95  C CZ2 . TRP A 1 18  ? 10.028  13.083 -14.141 1.00 19.83 ? 297 TRP A CZ2 1 
ATOM   96  C CZ3 . TRP A 1 18  ? 9.494   11.013 -13.125 1.00 17.85 ? 297 TRP A CZ3 1 
ATOM   97  C CH2 . TRP A 1 18  ? 10.332  11.780 -13.838 1.00 19.76 ? 297 TRP A CH2 1 
ATOM   98  N N   . GLN A 1 19  ? 8.319   13.172 -9.677  1.00 13.87 ? 298 GLN A N   1 
ATOM   99  C CA  . GLN A 1 19  ? 9.479   12.417 -9.336  1.00 13.38 ? 298 GLN A CA  1 
ATOM   100 C C   . GLN A 1 19  ? 9.649   12.347 -7.814  1.00 12.39 ? 298 GLN A C   1 
ATOM   101 O O   . GLN A 1 19  ? 10.116  11.315 -7.264  1.00 11.24 ? 298 GLN A O   1 
ATOM   102 C CB  . GLN A 1 19  ? 10.730  13.007 -9.991  1.00 13.79 ? 298 GLN A CB  1 
ATOM   103 C CG  . GLN A 1 19  ? 11.948  12.140 -9.769  1.00 15.14 ? 298 GLN A CG  1 
ATOM   104 C CD  . GLN A 1 19  ? 13.243  12.735 -10.206 1.00 15.86 ? 298 GLN A CD  1 
ATOM   105 O OE1 . GLN A 1 19  ? 13.310  13.614 -11.076 1.00 18.88 ? 298 GLN A OE1 1 
ATOM   106 N NE2 . GLN A 1 19  ? 14.330  12.149 -9.706  1.00 18.26 ? 298 GLN A NE2 1 
ATOM   107 N N   . PHE A 1 20  ? 9.276   13.444 -7.153  1.00 10.91 ? 299 PHE A N   1 
ATOM   108 C CA  . PHE A 1 20  ? 9.301   13.462 -5.662  1.00 11.24 ? 299 PHE A CA  1 
ATOM   109 C C   . PHE A 1 20  ? 8.380   12.391 -5.081  1.00 10.98 ? 299 PHE A C   1 
ATOM   110 O O   . PHE A 1 20  ? 8.755   11.697 -4.166  1.00 10.42 ? 299 PHE A O   1 
ATOM   111 C CB  . PHE A 1 20  ? 8.902   14.830 -5.187  1.00 11.85 ? 299 PHE A CB  1 
ATOM   112 C CG  . PHE A 1 20  ? 8.764   15.004 -3.669  1.00 11.64 ? 299 PHE A CG  1 
ATOM   113 C CD1 . PHE A 1 20  ? 9.865   15.202 -2.874  1.00 12.19 ? 299 PHE A CD1 1 
ATOM   114 C CD2 . PHE A 1 20  ? 7.535   15.045 -3.101  1.00 13.03 ? 299 PHE A CD2 1 
ATOM   115 C CE1 . PHE A 1 20  ? 9.706   15.358 -1.492  1.00 12.66 ? 299 PHE A CE1 1 
ATOM   116 C CE2 . PHE A 1 20  ? 7.397   15.210 -1.707  1.00 12.95 ? 299 PHE A CE2 1 
ATOM   117 C CZ  . PHE A 1 20  ? 8.492   15.378 -0.943  1.00 12.35 ? 299 PHE A CZ  1 
ATOM   118 N N   . LEU A 1 21  ? 7.198   12.281 -5.620  1.00 12.32 ? 300 LEU A N   1 
ATOM   119 C CA  . LEU A 1 21  ? 6.236   11.227 -5.119  1.00 11.70 ? 300 LEU A CA  1 
ATOM   120 C C   . LEU A 1 21  ? 6.775   9.811  -5.406  1.00 12.23 ? 300 LEU A C   1 
ATOM   121 O O   . LEU A 1 21  ? 6.718   8.931  -4.516  1.00 10.79 ? 300 LEU A O   1 
ATOM   122 C CB  . LEU A 1 21  ? 4.890   11.443 -5.684  1.00 12.41 ? 300 LEU A CB  1 
ATOM   123 C CG  . LEU A 1 21  ? 4.206   12.747 -5.371  1.00 14.04 ? 300 LEU A CG  1 
ATOM   124 C CD1 . LEU A 1 21  ? 2.876   12.861 -6.130  1.00 16.56 ? 300 LEU A CD1 1 
ATOM   125 C CD2 . LEU A 1 21  ? 4.028   12.959 -3.866  1.00 14.66 ? 300 LEU A CD2 1 
ATOM   126 N N   . LEU A 1 22  ? 7.374   9.552  -6.587  1.00 11.61 ? 301 LEU A N   1 
ATOM   127 C CA  . LEU A 1 22  ? 8.017   8.278  -6.865  1.00 13.00 ? 301 LEU A CA  1 
ATOM   128 C C   . LEU A 1 22  ? 9.173   8.005  -5.899  1.00 12.05 ? 301 LEU A C   1 
ATOM   129 O O   . LEU A 1 22  ? 9.367   6.888  -5.458  1.00 12.56 ? 301 LEU A O   1 
ATOM   130 C CB  . LEU A 1 22  ? 8.512   8.136  -8.318  1.00 14.39 ? 301 LEU A CB  1 
ATOM   131 C CG  . LEU A 1 22  ? 7.530   7.980  -9.425  1.00 14.90 ? 301 LEU A CG  1 
ATOM   132 C CD1 . LEU A 1 22  ? 8.310   8.025  -10.754 1.00 16.50 ? 301 LEU A CD1 1 
ATOM   133 C CD2 . LEU A 1 22  ? 6.740   6.653  -9.322  1.00 15.29 ? 301 LEU A CD2 1 
ATOM   134 N N   . GLU A 1 23  ? 9.936   9.037  -5.536  1.00 12.88 ? 302 GLU A N   1 
ATOM   135 C CA  . GLU A 1 23  ? 11.033  8.908  -4.590  1.00 13.17 ? 302 GLU A CA  1 
ATOM   136 C C   . GLU A 1 23  ? 10.483  8.452  -3.218  1.00 12.16 ? 302 GLU A C   1 
ATOM   137 O O   . GLU A 1 23  ? 11.096  7.574  -2.579  1.00 13.27 ? 302 GLU A O   1 
ATOM   138 C CB  . GLU A 1 23  ? 11.730  10.291 -4.474  1.00 15.16 ? 302 GLU A CB  1 
ATOM   139 C CG  . GLU A 1 23  ? 12.919  10.303 -3.586  1.00 20.48 ? 302 GLU A CG  1 
ATOM   140 C CD  . GLU A 1 23  ? 13.643  11.661 -3.642  1.00 24.55 ? 302 GLU A CD  1 
ATOM   141 O OE1 . GLU A 1 23  ? 14.070  12.082 -4.745  1.00 24.70 ? 302 GLU A OE1 1 
ATOM   142 O OE2 . GLU A 1 23  ? 13.760  12.242 -2.542  1.00 27.77 ? 302 GLU A OE2 1 
ATOM   143 N N   . LEU A 1 24  ? 9.422   9.066  -2.741  1.00 10.70 ? 303 LEU A N   1 
ATOM   144 C CA  . LEU A 1 24  ? 8.867   8.685  -1.440  1.00 11.59 ? 303 LEU A CA  1 
ATOM   145 C C   . LEU A 1 24  ? 8.289   7.259  -1.504  1.00 11.07 ? 303 LEU A C   1 
ATOM   146 O O   . LEU A 1 24  ? 8.426   6.482  -0.603  1.00 12.03 ? 303 LEU A O   1 
ATOM   147 C CB  . LEU A 1 24  ? 7.741   9.617  -1.031  1.00 12.87 ? 303 LEU A CB  1 
ATOM   148 C CG  . LEU A 1 24  ? 8.069   11.071 -0.735  1.00 16.29 ? 303 LEU A CG  1 
ATOM   149 C CD1 . LEU A 1 24  ? 6.833   11.792 -0.301  1.00 16.71 ? 303 LEU A CD1 1 
ATOM   150 C CD2 . LEU A 1 24  ? 9.113   11.239 0.287   1.00 19.68 ? 303 LEU A CD2 1 
ATOM   151 N N   . LEU A 1 25  ? 7.672   6.940  -2.632  1.00 10.02 ? 304 LEU A N   1 
ATOM   152 C CA  . LEU A 1 25  ? 7.065   5.610  -2.798  1.00 10.69 ? 304 LEU A CA  1 
ATOM   153 C C   . LEU A 1 25  ? 8.089   4.492  -2.889  1.00 12.32 ? 304 LEU A C   1 
ATOM   154 O O   . LEU A 1 25  ? 7.816   3.321  -2.514  1.00 11.84 ? 304 LEU A O   1 
ATOM   155 C CB  . LEU A 1 25  ? 6.165   5.599  -4.034  1.00 10.26 ? 304 LEU A CB  1 
ATOM   156 C CG  . LEU A 1 25  ? 4.811   6.324  -3.908  1.00 10.68 ? 304 LEU A CG  1 
ATOM   157 C CD1 . LEU A 1 25  ? 4.238   6.664  -5.269  1.00 12.45 ? 304 LEU A CD1 1 
ATOM   158 C CD2 . LEU A 1 25  ? 3.799   5.520  -3.079  1.00 11.34 ? 304 LEU A CD2 1 
ATOM   159 N N   . SER A 1 26  ? 9.268   4.801  -3.442  1.00 11.88 ? 305 SER A N   1 
ATOM   160 C CA  . SER A 1 26  ? 10.310  3.811  -3.599  1.00 12.99 ? 305 SER A CA  1 
ATOM   161 C C   . SER A 1 26  ? 10.848  3.240  -2.273  1.00 13.37 ? 305 SER A C   1 
ATOM   162 O O   . SER A 1 26  ? 11.482  2.195  -2.283  1.00 15.70 ? 305 SER A O   1 
ATOM   163 C CB  . SER A 1 26  ? 11.496  4.430  -4.434  1.00 15.27 ? 305 SER A CB  1 
ATOM   164 O OG  . SER A 1 26  ? 12.252  5.329  -3.633  1.00 17.14 ? 305 SER A OG  1 
ATOM   165 N N   . ASP A 1 27  ? 10.671  4.000  -1.181  1.00 12.94 ? 306 ASP A N   1 
ATOM   166 C CA  . ASP A 1 27  ? 11.110  3.602  0.165   1.00 13.31 ? 306 ASP A CA  1 
ATOM   167 C C   . ASP A 1 27  ? 9.879   3.264  1.003   1.00 12.27 ? 306 ASP A C   1 
ATOM   168 O O   . ASP A 1 27  ? 9.130   4.141  1.407   1.00 11.21 ? 306 ASP A O   1 
ATOM   169 C CB  . ASP A 1 27  ? 11.910  4.760  0.762   1.00 15.56 ? 306 ASP A CB  1 
ATOM   170 C CG  . ASP A 1 27  ? 12.407  4.496  2.178   1.00 20.25 ? 306 ASP A CG  1 
ATOM   171 O OD1 . ASP A 1 27  ? 12.070  3.485  2.791   1.00 19.99 ? 306 ASP A OD1 1 
ATOM   172 O OD2 . ASP A 1 27  ? 13.196  5.344  2.691   1.00 22.86 ? 306 ASP A OD2 1 
ATOM   173 N N   . SER A 1 28  ? 9.656   1.967  1.232   1.00 12.22 ? 307 SER A N   1 
ATOM   174 C CA  . SER A 1 28  ? 8.442   1.508  1.974   1.00 13.61 ? 307 SER A CA  1 
ATOM   175 C C   . SER A 1 28  ? 8.326   2.101  3.348   1.00 13.20 ? 307 SER A C   1 
ATOM   176 O O   . SER A 1 28  ? 7.197   2.182  3.923   1.00 12.05 ? 307 SER A O   1 
ATOM   177 C CB  . SER A 1 28  ? 8.477   -0.058 2.068   1.00 14.71 ? 307 SER A CB  1 
ATOM   178 O OG  . SER A 1 28  ? 9.488   -0.407 2.908   1.00 19.85 ? 307 SER A OG  1 
ATOM   179 N N   . SER A 1 29  ? 9.446   2.598  3.922   1.00 12.63 ? 308 SER A N   1 
ATOM   180 C CA  . SER A 1 29  ? 9.346   3.231  5.216   1.00 13.53 ? 308 SER A CA  1 
ATOM   181 C C   . SER A 1 29  ? 8.537   4.516  5.275   1.00 12.88 ? 308 SER A C   1 
ATOM   182 O O   . SER A 1 29  ? 8.156   4.912  6.382   1.00 13.92 ? 308 SER A O   1 
ATOM   183 C CB  . SER A 1 29  ? 10.732  3.408  5.851   1.00 16.40 ? 308 SER A CB  1 
ATOM   184 O OG  . SER A 1 29  ? 11.369  4.519  5.363   1.00 17.62 ? 308 SER A OG  1 
ATOM   185 N N   . ASN A 1 30  ? 8.229   5.099  4.139   1.00 11.32 ? 309 ASN A N   1 
ATOM   186 C CA  . ASN A 1 30  ? 7.329   6.255  4.024   1.00 11.82 ? 309 ASN A CA  1 
ATOM   187 C C   . ASN A 1 30  ? 5.821   5.994  4.065   1.00 11.93 ? 309 ASN A C   1 
ATOM   188 O O   . ASN A 1 30  ? 5.005   6.931  3.921   1.00 12.00 ? 309 ASN A O   1 
ATOM   189 C CB  . ASN A 1 30  ? 7.654   7.113  2.796   1.00 12.33 ? 309 ASN A CB  1 
ATOM   190 C CG  . ASN A 1 30  ? 9.004   7.716  2.869   1.00 13.91 ? 309 ASN A CG  1 
ATOM   191 O OD1 . ASN A 1 30  ? 9.341   8.386  3.887   1.00 14.33 ? 309 ASN A OD1 1 
ATOM   192 N ND2 . ASN A 1 30  ? 9.765   7.566  1.817   1.00 12.98 ? 309 ASN A ND2 1 
ATOM   193 N N   . SER A 1 31  ? 5.473   4.722  4.303   1.00 11.93 ? 310 SER A N   1 
ATOM   194 C CA  . SER A 1 31  ? 4.064   4.266  4.064   1.00 11.78 ? 310 SER A CA  1 
ATOM   195 C C   . SER A 1 31  ? 3.027   4.890  4.988   1.00 13.09 ? 310 SER A C   1 
ATOM   196 O O   . SER A 1 31  ? 1.828   4.840  4.654   1.00 14.42 ? 310 SER A O   1 
ATOM   197 C CB  . SER A 1 31  ? 3.990   2.756  4.043   1.00 13.13 ? 310 SER A CB  1 
ATOM   198 O OG  . SER A 1 31  ? 4.534   2.191  2.858   1.00 12.63 ? 310 SER A OG  1 
ATOM   199 N N   . SER A 1 32  ? 3.452   5.477  6.105   1.00 12.62 ? 311 SER A N   1 
ATOM   200 C CA  . SER A 1 32  ? 2.551   6.210  6.956   1.00 14.21 ? 311 SER A CA  1 
ATOM   201 C C   . SER A 1 32  ? 2.091   7.507  6.373   1.00 14.79 ? 311 SER A C   1 
ATOM   202 O O   . SER A 1 32  ? 1.052   8.064  6.886   1.00 15.07 ? 311 SER A O   1 
ATOM   203 C CB  . SER A 1 32  ? 3.163   6.477  8.331   1.00 16.31 ? 311 SER A CB  1 
ATOM   204 O OG  . SER A 1 32  ? 3.325   5.244  9.080   1.00 21.49 ? 311 SER A OG  1 
ATOM   205 N N   . CYS A 1 33  ? 2.742   7.973  5.346   1.00 12.92 ? 312 CYS A N   1 
ATOM   206 C CA  . CYS A 1 33  ? 2.212   9.123  4.621   1.00 13.55 ? 312 CYS A CA  1 
ATOM   207 C C   . CYS A 1 33  ? 1.857   8.906  3.181   1.00 12.58 ? 312 CYS A C   1 
ATOM   208 O O   . CYS A 1 33  ? 0.924   9.548  2.675   1.00 12.79 ? 312 CYS A O   1 
ATOM   209 C CB  . CYS A 1 33  ? 3.065   10.336 4.765   1.00 15.65 ? 312 CYS A CB  1 
ATOM   210 S SG  . CYS A 1 33  ? 4.635   10.430 3.958   1.00 18.93 ? 312 CYS A SG  1 
ATOM   211 N N   . ILE A 1 34  ? 2.553   7.983  2.510   1.00 10.98 ? 313 ILE A N   1 
ATOM   212 C CA  . ILE A 1 34  ? 2.261   7.719  1.092   1.00 10.77 ? 313 ILE A CA  1 
ATOM   213 C C   . ILE A 1 34  ? 2.765   6.302  0.771   1.00 10.21 ? 313 ILE A C   1 
ATOM   214 O O   . ILE A 1 34  ? 3.894   5.938  1.167   1.00 11.00 ? 313 ILE A O   1 
ATOM   215 C CB  . ILE A 1 34  ? 2.922   8.764  0.132   1.00 11.33 ? 313 ILE A CB  1 
ATOM   216 C CG1 . ILE A 1 34  ? 2.456   8.527  -1.308  1.00 11.39 ? 313 ILE A CG1 1 
ATOM   217 C CG2 . ILE A 1 34  ? 4.435   8.823  0.193   1.00 12.46 ? 313 ILE A CG2 1 
ATOM   218 C CD1 . ILE A 1 34  ? 2.812   9.690  -2.257  1.00 12.15 ? 313 ILE A CD1 1 
ATOM   219 N N   . THR A 1 35  ? 1.940   5.501  0.089   1.00 9.94  ? 314 THR A N   1 
ATOM   220 C CA  . THR A 1 35  ? 2.266   4.097  -0.116  1.00 10.37 ? 314 THR A CA  1 
ATOM   221 C C   . THR A 1 35  ? 1.680   3.591  -1.419  1.00 10.83 ? 314 THR A C   1 
ATOM   222 O O   . THR A 1 35  ? 0.614   4.038  -1.838  1.00 10.36 ? 314 THR A O   1 
ATOM   223 C CB  . THR A 1 35  ? 1.799   3.241  1.076   1.00 11.67 ? 314 THR A CB  1 
ATOM   224 O OG1 . THR A 1 35  ? 2.444   1.960  1.078   1.00 12.47 ? 314 THR A OG1 1 
ATOM   225 C CG2 . THR A 1 35  ? 0.350   2.963  1.085   1.00 13.43 ? 314 THR A CG2 1 
ATOM   226 N N   . TRP A 1 36  ? 2.335   2.626  -2.033  1.00 10.39 ? 315 TRP A N   1 
ATOM   227 C CA  . TRP A 1 36  ? 1.708   1.951  -3.167  1.00 11.25 ? 315 TRP A CA  1 
ATOM   228 C C   . TRP A 1 36  ? 0.450   1.196  -2.782  1.00 12.85 ? 315 TRP A C   1 
ATOM   229 O O   . TRP A 1 36  ? 0.389   0.599  -1.730  1.00 11.95 ? 315 TRP A O   1 
ATOM   230 C CB  . TRP A 1 36  ? 2.708   0.957  -3.798  1.00 12.21 ? 315 TRP A CB  1 
ATOM   231 C CG  . TRP A 1 36  ? 3.891   1.550  -4.492  1.00 11.49 ? 315 TRP A CG  1 
ATOM   232 C CD1 . TRP A 1 36  ? 5.237   1.241  -4.260  1.00 10.82 ? 315 TRP A CD1 1 
ATOM   233 C CD2 . TRP A 1 36  ? 3.898   2.402  -5.643  1.00 10.21 ? 315 TRP A CD2 1 
ATOM   234 N NE1 . TRP A 1 36  ? 6.007   1.882  -5.123  1.00 10.60 ? 315 TRP A NE1 1 
ATOM   235 C CE2 . TRP A 1 36  ? 5.233   2.542  -6.053  1.00 10.65 ? 315 TRP A CE2 1 
ATOM   236 C CE3 . TRP A 1 36  ? 2.863   2.977  -6.440  1.00 12.01 ? 315 TRP A CE3 1 
ATOM   237 C CZ2 . TRP A 1 36  ? 5.594   3.358  -7.148  1.00 11.70 ? 315 TRP A CZ2 1 
ATOM   238 C CZ3 . TRP A 1 36  ? 3.234   3.722  -7.567  1.00 11.97 ? 315 TRP A CZ3 1 
ATOM   239 C CH2 . TRP A 1 36  ? 4.590   3.902  -7.888  1.00 12.07 ? 315 TRP A CH2 1 
ATOM   240 N N   . GLU A 1 37  ? -0.570  1.153  -3.643  1.00 13.53 ? 316 GLU A N   1 
ATOM   241 C CA  . GLU A 1 37  ? -1.804  0.427  -3.406  1.00 17.95 ? 316 GLU A CA  1 
ATOM   242 C C   . GLU A 1 37  ? -1.806  -1.044 -3.834  1.00 18.87 ? 316 GLU A C   1 
ATOM   243 O O   . GLU A 1 37  ? -2.589  -1.861 -3.277  1.00 21.92 ? 316 GLU A O   1 
ATOM   244 C CB  . GLU A 1 37  ? -2.922  1.186  -4.131  1.00 20.57 ? 316 GLU A CB  1 
ATOM   245 C CG  . GLU A 1 37  ? -4.288  0.689  -3.790  1.00 26.41 ? 316 GLU A CG  1 
ATOM   246 C CD  . GLU A 1 37  ? -4.759  -0.459 -4.689  1.00 31.73 ? 316 GLU A CD  1 
ATOM   247 O OE1 . GLU A 1 37  ? -4.134  -0.710 -5.772  1.00 34.45 ? 316 GLU A OE1 1 
ATOM   248 O OE2 . GLU A 1 37  ? -5.796  -1.095 -4.309  1.00 30.78 ? 316 GLU A OE2 1 
ATOM   249 N N   . GLY A 1 38  ? -0.941  -1.345 -4.794  1.00 19.97 ? 317 GLY A N   1 
ATOM   250 C CA  . GLY A 1 38  ? -0.734  -2.709 -5.311  1.00 22.37 ? 317 GLY A CA  1 
ATOM   251 C C   . GLY A 1 38  ? -1.066  -2.798 -6.778  1.00 25.49 ? 317 GLY A C   1 
ATOM   252 O O   . GLY A 1 38  ? -0.346  -3.446 -7.548  1.00 27.94 ? 317 GLY A O   1 
ATOM   253 N N   . THR A 1 39  ? -2.104  -2.097 -7.221  1.00 22.86 ? 318 THR A N   1 
ATOM   254 C CA  . THR A 1 39  ? -2.438  -2.084 -8.644  1.00 27.07 ? 318 THR A CA  1 
ATOM   255 C C   . THR A 1 39  ? -1.443  -1.217 -9.378  1.00 25.28 ? 318 THR A C   1 
ATOM   256 O O   . THR A 1 39  ? -1.172  -0.134 -8.899  1.00 27.00 ? 318 THR A O   1 
ATOM   257 C CB  . THR A 1 39  ? -3.726  -1.298 -8.861  1.00 30.28 ? 318 THR A CB  1 
ATOM   258 O OG1 . THR A 1 39  ? -4.753  -1.909 -8.143  1.00 32.49 ? 318 THR A OG1 1 
ATOM   259 C CG2 . THR A 1 39  ? -4.077  -1.179 -10.373 0.50 29.19 ? 318 THR A CG2 1 
ATOM   260 N N   . ASN A 1 40  ? -0.912  -1.654 -10.511 1.00 24.10 ? 319 ASN A N   1 
ATOM   261 C CA  . ASN A 1 40  ? 0.261   -1.007 -11.103 1.00 26.46 ? 319 ASN A CA  1 
ATOM   262 C C   . ASN A 1 40  ? 0.144   0.547  -11.239 1.00 22.30 ? 319 ASN A C   1 
ATOM   263 O O   . ASN A 1 40  ? -0.670  1.064  -11.995 1.00 26.00 ? 319 ASN A O   1 
ATOM   264 C CB  . ASN A 1 40  ? 0.592   -1.668 -12.431 1.00 27.90 ? 319 ASN A CB  1 
ATOM   265 C CG  . ASN A 1 40  ? 2.073   -1.541 -12.856 1.00 28.43 ? 319 ASN A CG  1 
ATOM   266 O OD1 . ASN A 1 40  ? 3.016   -1.360 -12.044 1.00 26.12 ? 319 ASN A OD1 1 
ATOM   267 N ND2 . ASN A 1 40  ? 2.274   -1.680 -14.186 1.00 31.22 ? 319 ASN A ND2 1 
ATOM   268 N N   . GLY A 1 41  ? 0.994   1.211  -10.488 1.00 21.70 ? 320 GLY A N   1 
ATOM   269 C CA  . GLY A 1 41  ? 1.072   2.643  -10.566 1.00 18.42 ? 320 GLY A CA  1 
ATOM   270 C C   . GLY A 1 41  ? 0.125   3.389  -9.603  1.00 16.12 ? 320 GLY A C   1 
ATOM   271 O O   . GLY A 1 41  ? 0.244   4.595  -9.531  1.00 14.74 ? 320 GLY A O   1 
ATOM   272 N N   . GLU A 1 42  ? -0.827  2.705  -8.988  1.00 15.34 ? 321 GLU A N   1 
ATOM   273 C CA  . GLU A 1 42  ? -1.780  3.377  -8.088  1.00 15.21 ? 321 GLU A CA  1 
ATOM   274 C C   . GLU A 1 42  ? -1.161  3.532  -6.705  1.00 13.37 ? 321 GLU A C   1 
ATOM   275 O O   . GLU A 1 42  ? -0.479  2.627  -6.182  1.00 12.21 ? 321 GLU A O   1 
ATOM   276 C CB  . GLU A 1 42  ? -2.988  2.568  -7.937  1.00 18.00 ? 321 GLU A CB  1 
ATOM   277 C CG  . GLU A 1 42  ? -4.086  3.231  -7.188  1.00 20.71 ? 321 GLU A CG  1 
ATOM   278 C CD  . GLU A 1 42  ? -5.419  2.434  -7.219  1.00 26.07 ? 321 GLU A CD  1 
ATOM   279 O OE1 . GLU A 1 42  ? -5.784  1.857  -8.304  1.00 28.80 ? 321 GLU A OE1 1 
ATOM   280 O OE2 . GLU A 1 42  ? -6.091  2.425  -6.128  1.00 31.43 ? 321 GLU A OE2 1 
ATOM   281 N N   . PHE A 1 43  ? -1.362  4.704  -6.103  1.00 12.68 ? 322 PHE A N   1 
ATOM   282 C CA  . PHE A 1 43  ? -0.843  4.956  -4.774  1.00 12.25 ? 322 PHE A CA  1 
ATOM   283 C C   . PHE A 1 43  ? -1.873  5.705  -3.931  1.00 13.84 ? 322 PHE A C   1 
ATOM   284 O O   . PHE A 1 43  ? -2.823  6.237  -4.461  1.00 13.90 ? 322 PHE A O   1 
ATOM   285 C CB  . PHE A 1 43  ? 0.453   5.740  -4.757  1.00 11.81 ? 322 PHE A CB  1 
ATOM   286 C CG  . PHE A 1 43  ? 0.390   7.124  -5.361  1.00 12.72 ? 322 PHE A CG  1 
ATOM   287 C CD1 . PHE A 1 43  ? 0.550   7.275  -6.751  1.00 14.46 ? 322 PHE A CD1 1 
ATOM   288 C CD2 . PHE A 1 43  ? 0.227   8.264  -4.578  1.00 14.06 ? 322 PHE A CD2 1 
ATOM   289 C CE1 . PHE A 1 43  ? 0.559   8.536  -7.323  1.00 15.40 ? 322 PHE A CE1 1 
ATOM   290 C CE2 . PHE A 1 43  ? 0.262   9.515  -5.166  1.00 13.35 ? 322 PHE A CE2 1 
ATOM   291 C CZ  . PHE A 1 43  ? 0.429   9.650  -6.535  1.00 13.95 ? 322 PHE A CZ  1 
ATOM   292 N N   . LYS A 1 44  ? -1.646  5.711  -2.628  1.00 13.32 ? 323 LYS A N   1 
ATOM   293 C CA  . LYS A 1 44  ? -2.564  6.504  -1.789  1.00 15.17 ? 323 LYS A CA  1 
ATOM   294 C C   . LYS A 1 44  ? -1.747  7.310  -0.797  1.00 13.83 ? 323 LYS A C   1 
ATOM   295 O O   . LYS A 1 44  ? -0.692  6.832  -0.294  1.00 12.51 ? 323 LYS A O   1 
ATOM   296 C CB  . LYS A 1 44  ? -3.572  5.673  -1.105  1.00 20.47 ? 323 LYS A CB  1 
ATOM   297 C CG  . LYS A 1 44  ? -3.108  4.566  -0.246  1.00 24.28 ? 323 LYS A CG  1 
ATOM   298 C CD  . LYS A 1 44  ? -4.241  3.532  0.052   1.00 30.39 ? 323 LYS A CD  1 
ATOM   299 C CE  . LYS A 1 44  ? -4.728  3.564  1.488   0.50 29.68 ? 323 LYS A CE  1 
ATOM   300 N NZ  . LYS A 1 44  ? -5.165  2.196  1.855   0.50 30.75 ? 323 LYS A NZ  1 
ATOM   301 N N   . MET A 1 45  ? -2.226  8.535  -0.548  1.00 12.94 ? 324 MET A N   1 
ATOM   302 C CA  . MET A 1 45  ? -1.658  9.385  0.466   1.00 14.23 ? 324 MET A CA  1 
ATOM   303 C C   . MET A 1 45  ? -2.348  9.074  1.745   1.00 14.78 ? 324 MET A C   1 
ATOM   304 O O   . MET A 1 45  ? -3.451  9.544  2.020   1.00 16.67 ? 324 MET A O   1 
ATOM   305 C CB  . MET A 1 45  ? -1.748  10.864 0.057   1.00 15.42 ? 324 MET A CB  1 
ATOM   306 C CG  . MET A 1 45  ? -0.936  11.179 -1.166  1.00 17.11 ? 324 MET A CG  1 
ATOM   307 S SD  . MET A 1 45  ? -1.040  12.947 -1.443  1.00 23.28 ? 324 MET A SD  1 
ATOM   308 C CE  . MET A 1 45  ? -0.446  13.083 -3.092  1.00 23.91 ? 324 MET A CE  1 
ATOM   309 N N   . THR A 1 46  ? -1.755  8.228  2.550   1.00 16.11 ? 325 THR A N   1 
ATOM   310 C CA  . THR A 1 46  ? -2.263  7.883  3.830   1.00 17.37 ? 325 THR A CA  1 
ATOM   311 C C   . THR A 1 46  ? -2.233  9.077  4.808   1.00 18.01 ? 325 THR A C   1 
ATOM   312 O O   . THR A 1 46  ? -3.019  9.121  5.728   1.00 19.82 ? 325 THR A O   1 
ATOM   313 C CB  . THR A 1 46  ? -1.528  6.675  4.407   1.00 22.78 ? 325 THR A CB  1 
ATOM   314 O OG1 . THR A 1 46  ? -0.144  6.921  4.349   1.00 22.02 ? 325 THR A OG1 1 
ATOM   315 C CG2 . THR A 1 46  ? -1.694  5.485  3.469   1.00 26.40 ? 325 THR A CG2 1 
ATOM   316 N N   . ASP A 1 47  ? -1.337  10.066 4.612   1.00 15.48 ? 326 ASP A N   1 
ATOM   317 C CA  . ASP A 1 47  ? -1.397  11.333 5.374   1.00 14.96 ? 326 ASP A CA  1 
ATOM   318 C C   . ASP A 1 47  ? -1.081  12.433 4.416   1.00 13.18 ? 326 ASP A C   1 
ATOM   319 O O   . ASP A 1 47  ? 0.071   12.797 4.213   1.00 12.31 ? 326 ASP A O   1 
ATOM   320 C CB  . ASP A 1 47  ? -0.355  11.368 6.506   1.00 15.90 ? 326 ASP A CB  1 
ATOM   321 C CG  . ASP A 1 47  ? -0.525  12.595 7.368   1.00 19.11 ? 326 ASP A CG  1 
ATOM   322 O OD1 . ASP A 1 47  ? -1.067  13.605 6.902   1.00 21.64 ? 326 ASP A OD1 1 
ATOM   323 O OD2 . ASP A 1 47  ? -0.058  12.452 8.522   1.00 24.23 ? 326 ASP A OD2 1 
ATOM   324 N N   . PRO A 1 48  ? -2.098  12.944 3.678   1.00 13.01 ? 327 PRO A N   1 
ATOM   325 C CA  . PRO A 1 48  ? -1.868  13.898 2.633   1.00 13.65 ? 327 PRO A CA  1 
ATOM   326 C C   . PRO A 1 48  ? -1.252  15.208 3.150   1.00 12.80 ? 327 PRO A C   1 
ATOM   327 O O   . PRO A 1 48  ? -0.523  15.890 2.409   1.00 12.69 ? 327 PRO A O   1 
ATOM   328 C CB  . PRO A 1 48  ? -3.259  14.100 2.050   1.00 15.20 ? 327 PRO A CB  1 
ATOM   329 C CG  . PRO A 1 48  ? -4.178  13.637 3.061   1.00 15.53 ? 327 PRO A CG  1 
ATOM   330 C CD  . PRO A 1 48  ? -3.476  12.501 3.703   1.00 15.37 ? 327 PRO A CD  1 
ATOM   331 N N   . ASP A 1 49  ? -1.564  15.575 4.391   1.00 13.96 ? 328 ASP A N   1 
ATOM   332 C CA  . ASP A 1 49  ? -0.965  16.771 4.941   1.00 14.01 ? 328 ASP A CA  1 
ATOM   333 C C   . ASP A 1 49  ? 0.543   16.582 5.172   1.00 13.36 ? 328 ASP A C   1 
ATOM   334 O O   . ASP A 1 49  ? 1.339   17.568 5.012   1.00 13.83 ? 328 ASP A O   1 
ATOM   335 C CB  . ASP A 1 49  ? -1.667  17.135 6.182   1.00 15.57 ? 328 ASP A CB  1 
ATOM   336 C CG  . ASP A 1 49  ? -3.079  17.682 5.920   1.00 18.36 ? 328 ASP A CG  1 
ATOM   337 O OD1 . ASP A 1 49  ? -3.270  18.295 4.844   1.00 17.80 ? 328 ASP A OD1 1 
ATOM   338 O OD2 . ASP A 1 49  ? -3.963  17.522 6.813   1.00 21.66 ? 328 ASP A OD2 1 
ATOM   339 N N   . GLU A 1 50  ? 0.957   15.386 5.536   1.00 13.22 ? 329 GLU A N   1 
ATOM   340 C CA  . GLU A 1 50  ? 2.366   15.116 5.669   1.00 14.38 ? 329 GLU A CA  1 
ATOM   341 C C   . GLU A 1 50  ? 3.123   15.126 4.337   1.00 12.78 ? 329 GLU A C   1 
ATOM   342 O O   . GLU A 1 50  ? 4.241   15.615 4.276   1.00 13.71 ? 329 GLU A O   1 
ATOM   343 C CB  . GLU A 1 50  ? 2.606   13.812 6.440   1.00 15.95 ? 329 GLU A CB  1 
ATOM   344 C CG  . GLU A 1 50  ? 4.069   13.422 6.583   1.00 17.48 ? 329 GLU A CG  1 
ATOM   345 C CD  . GLU A 1 50  ? 4.912   14.334 7.485   1.00 20.17 ? 329 GLU A CD  1 
ATOM   346 O OE1 . GLU A 1 50  ? 4.355   15.264 8.138   1.00 20.51 ? 329 GLU A OE1 1 
ATOM   347 O OE2 . GLU A 1 50  ? 6.162   14.023 7.585   1.00 21.07 ? 329 GLU A OE2 1 
ATOM   348 N N   . VAL A 1 51  ? 2.507   14.574 3.276   1.00 12.61 ? 330 VAL A N   1 
ATOM   349 C CA  . VAL A 1 51  ? 3.082   14.655 1.938   1.00 11.93 ? 330 VAL A CA  1 
ATOM   350 C C   . VAL A 1 51  ? 3.229   16.123 1.581   1.00 12.42 ? 330 VAL A C   1 
ATOM   351 O O   . VAL A 1 51  ? 4.304   16.496 1.109   1.00 12.57 ? 330 VAL A O   1 
ATOM   352 C CB  . VAL A 1 51  ? 2.243   13.902 0.898   1.00 11.52 ? 330 VAL A CB  1 
ATOM   353 C CG1 . VAL A 1 51  ? 2.858   14.009 -0.504  1.00 12.30 ? 330 VAL A CG1 1 
ATOM   354 C CG2 . VAL A 1 51  ? 2.094   12.425 1.291   1.00 11.55 ? 330 VAL A CG2 1 
ATOM   355 N N   . ALA A 1 52  ? 2.212   16.960 1.791   1.00 11.31 ? 331 ALA A N   1 
ATOM   356 C CA  . ALA A 1 52  ? 2.295   18.387 1.441   1.00 12.46 ? 331 ALA A CA  1 
ATOM   357 C C   . ALA A 1 52  ? 3.392   19.088 2.252   1.00 12.04 ? 331 ALA A C   1 
ATOM   358 O O   . ALA A 1 52  ? 4.136   19.921 1.690   1.00 12.31 ? 331 ALA A O   1 
ATOM   359 C CB  . ALA A 1 52  ? 0.959   19.096 1.578   1.00 12.77 ? 331 ALA A CB  1 
ATOM   360 N N   . ARG A 1 53  ? 3.539   18.699 3.518   1.00 13.69 ? 332 ARG A N   1 
ATOM   361 C CA  . ARG A 1 53  ? 4.552   19.312 4.365   1.00 13.85 ? 332 ARG A CA  1 
ATOM   362 C C   . ARG A 1 53  ? 5.955   18.973 3.820   1.00 13.89 ? 332 ARG A C   1 
ATOM   363 O O   . ARG A 1 53  ? 6.809   19.884 3.747   1.00 15.30 ? 332 ARG A O   1 
ATOM   364 C CB  . ARG A 1 53  ? 4.440   18.864 5.828   1.00 15.57 ? 332 ARG A CB  1 
ATOM   365 C CG  . ARG A 1 53  ? 5.344   19.571 6.823   1.00 18.08 ? 332 ARG A CG  1 
ATOM   366 C CD  . ARG A 1 53  ? 5.436   18.813 8.163   1.00 20.22 ? 332 ARG A CD  1 
ATOM   367 N NE  . ARG A 1 53  ? 6.170   17.561 8.092   1.00 22.26 ? 332 ARG A NE  1 
ATOM   368 C CZ  . ARG A 1 53  ? 7.488   17.407 7.874   1.00 23.78 ? 332 ARG A CZ  1 
ATOM   369 N NH1 . ARG A 1 53  ? 8.296   18.456 7.730   1.00 25.57 ? 332 ARG A NH1 1 
ATOM   370 N NH2 . ARG A 1 53  ? 8.008   16.191 7.794   1.00 24.50 ? 332 ARG A NH2 1 
ATOM   371 N N   . ARG A 1 54  ? 6.148   17.709 3.443   1.00 14.02 ? 333 ARG A N   1 
ATOM   372 C CA  . ARG A 1 54  ? 7.427   17.263 2.946   1.00 14.01 ? 333 ARG A CA  1 
ATOM   373 C C   . ARG A 1 54  ? 7.743   17.927 1.598   1.00 13.97 ? 333 ARG A C   1 
ATOM   374 O O   . ARG A 1 54  ? 8.909   18.263 1.306   1.00 13.54 ? 333 ARG A O   1 
ATOM   375 C CB  . ARG A 1 54  ? 7.446   15.756 2.893   1.00 15.22 ? 333 ARG A CB  1 
ATOM   376 C CG  . ARG A 1 54  ? 7.509   15.102 4.246   1.00 18.05 ? 333 ARG A CG  1 
ATOM   377 C CD  . ARG A 1 54  ? 7.840   13.681 4.019   1.00 23.15 ? 333 ARG A CD  1 
ATOM   378 N NE  . ARG A 1 54  ? 7.513   12.841 5.136   1.00 28.21 ? 333 ARG A NE  1 
ATOM   379 C CZ  . ARG A 1 54  ? 7.902   11.570 5.180   1.00 29.44 ? 333 ARG A CZ  1 
ATOM   380 N NH1 . ARG A 1 54  ? 8.728   11.165 4.271   1.00 25.47 ? 333 ARG A NH1 1 
ATOM   381 N NH2 . ARG A 1 54  ? 7.549   10.800 6.215   1.00 37.28 ? 333 ARG A NH2 1 
ATOM   382 N N   . TRP A 1 55  ? 6.734   18.103 0.757   1.00 12.35 ? 334 TRP A N   1 
ATOM   383 C CA  . TRP A 1 55  ? 6.926   18.812 -0.488  1.00 12.75 ? 334 TRP A CA  1 
ATOM   384 C C   . TRP A 1 55  ? 7.294   20.278 -0.249  1.00 13.30 ? 334 TRP A C   1 
ATOM   385 O O   . TRP A 1 55  ? 8.234   20.775 -0.859  1.00 13.98 ? 334 TRP A O   1 
ATOM   386 C CB  . TRP A 1 55  ? 5.644   18.661 -1.352  1.00 12.42 ? 334 TRP A CB  1 
ATOM   387 C CG  . TRP A 1 55  ? 5.646   19.368 -2.642  1.00 13.44 ? 334 TRP A CG  1 
ATOM   388 C CD1 . TRP A 1 55  ? 4.719   20.282 -3.052  1.00 14.67 ? 334 TRP A CD1 1 
ATOM   389 C CD2 . TRP A 1 55  ? 6.595   19.243 -3.766  1.00 13.35 ? 334 TRP A CD2 1 
ATOM   390 N NE1 . TRP A 1 55  ? 5.033   20.753 -4.324  1.00 15.94 ? 334 TRP A NE1 1 
ATOM   391 C CE2 . TRP A 1 55  ? 6.135   20.088 -4.785  1.00 14.20 ? 334 TRP A CE2 1 
ATOM   392 C CE3 . TRP A 1 55  ? 7.725   18.454 -4.010  1.00 13.62 ? 334 TRP A CE3 1 
ATOM   393 C CZ2 . TRP A 1 55  ? 6.829   20.244 -5.985  1.00 15.39 ? 334 TRP A CZ2 1 
ATOM   394 C CZ3 . TRP A 1 55  ? 8.422   18.610 -5.212  1.00 13.60 ? 334 TRP A CZ3 1 
ATOM   395 C CH2 . TRP A 1 55  ? 7.934   19.419 -6.189  1.00 13.99 ? 334 TRP A CH2 1 
ATOM   396 N N   . GLY A 1 56  ? 6.594   20.928 0.682   1.00 13.34 ? 335 GLY A N   1 
ATOM   397 C CA  . GLY A 1 56  ? 6.862   22.305 1.131   1.00 14.91 ? 335 GLY A CA  1 
ATOM   398 C C   . GLY A 1 56  ? 8.294   22.454 1.606   1.00 16.04 ? 335 GLY A C   1 
ATOM   399 O O   . GLY A 1 56  ? 8.984   23.440 1.295   1.00 17.29 ? 335 GLY A O   1 
ATOM   400 N N   . GLU A 1 57  ? 8.763   21.465 2.316   1.00 16.30 ? 336 GLU A N   1 
ATOM   401 C CA  . GLU A 1 57  ? 10.113  21.502 2.910   1.00 17.04 ? 336 GLU A CA  1 
ATOM   402 C C   . GLU A 1 57  ? 11.193  21.303 1.812   1.00 16.03 ? 336 GLU A C   1 
ATOM   403 O O   . GLU A 1 57  ? 12.216  22.006 1.821   1.00 16.49 ? 336 GLU A O   1 
ATOM   404 C CB  . GLU A 1 57  ? 10.196  20.404 3.944   1.00 20.32 ? 336 GLU A CB  1 
ATOM   405 C CG  . GLU A 1 57  ? 11.444  20.238 4.797   1.00 24.45 ? 336 GLU A CG  1 
ATOM   406 C CD  . GLU A 1 57  ? 11.273  19.025 5.738   1.00 29.28 ? 336 GLU A CD  1 
ATOM   407 O OE1 . GLU A 1 57  ? 11.014  17.875 5.231   1.00 29.59 ? 336 GLU A OE1 1 
ATOM   408 O OE2 . GLU A 1 57  ? 11.373  19.202 6.974   0.50 32.17 ? 336 GLU A OE2 1 
ATOM   409 N N   . ARG A 1 58  ? 10.920  20.388 0.876   1.00 14.08 ? 337 ARG A N   1 
ATOM   410 C CA  . ARG A 1 58  ? 11.847  20.117 -0.265  1.00 14.25 ? 337 ARG A CA  1 
ATOM   411 C C   . ARG A 1 58  ? 12.043  21.364 -1.125  1.00 14.93 ? 337 ARG A C   1 
ATOM   412 O O   . ARG A 1 58  ? 13.153  21.677 -1.570  1.00 15.23 ? 337 ARG A O   1 
ATOM   413 C CB  . ARG A 1 58  ? 11.367  18.971 -1.171  1.00 13.49 ? 337 ARG A CB  1 
ATOM   414 C CG  . ARG A 1 58  ? 12.380  18.598 -2.251  1.00 13.97 ? 337 ARG A CG  1 
ATOM   415 C CD  . ARG A 1 58  ? 13.711  18.127 -1.782  1.00 15.24 ? 337 ARG A CD  1 
ATOM   416 N NE  . ARG A 1 58  ? 13.604  16.828 -1.155  1.00 15.07 ? 337 ARG A NE  1 
ATOM   417 C CZ  . ARG A 1 58  ? 13.559  15.671 -1.846  1.00 14.92 ? 337 ARG A CZ  1 
ATOM   418 N NH1 . ARG A 1 58  ? 13.696  15.599 -3.192  1.00 13.82 ? 337 ARG A NH1 1 
ATOM   419 N NH2 . ARG A 1 58  ? 13.385  14.529 -1.157  1.00 16.54 ? 337 ARG A NH2 1 
ATOM   420 N N   . LYS A 1 59  ? 10.919  22.028 -1.423  1.00 15.32 ? 338 LYS A N   1 
ATOM   421 C CA  . LYS A 1 59  ? 10.867  23.162 -2.278  1.00 17.40 ? 338 LYS A CA  1 
ATOM   422 C C   . LYS A 1 59  ? 11.054  24.498 -1.553  1.00 18.32 ? 338 LYS A C   1 
ATOM   423 O O   . LYS A 1 59  ? 11.039  25.561 -2.203  1.00 19.39 ? 338 LYS A O   1 
ATOM   424 C CB  . LYS A 1 59  ? 9.521   23.176 -3.047  1.00 18.65 ? 338 LYS A CB  1 
ATOM   425 C CG  . LYS A 1 59  ? 9.288   21.951 -3.901  1.00 19.17 ? 338 LYS A CG  1 
ATOM   426 C CD  . LYS A 1 59  ? 10.441  21.524 -4.888  1.00 20.23 ? 338 LYS A CD  1 
ATOM   427 C CE  . LYS A 1 59  ? 10.315  22.330 -6.149  1.00 21.85 ? 338 LYS A CE  1 
ATOM   428 N NZ  . LYS A 1 59  ? 11.252  22.082 -7.270  1.00 22.56 ? 338 LYS A NZ  1 
ATOM   429 N N   . SER A 1 60  ? 11.100  24.432 -0.220  1.00 18.47 ? 339 SER A N   1 
ATOM   430 C CA  . SER A 1 60  ? 11.102  25.581 0.684   1.00 20.23 ? 339 SER A CA  1 
ATOM   431 C C   . SER A 1 60  ? 10.042  26.596 0.291   1.00 22.85 ? 339 SER A C   1 
ATOM   432 O O   . SER A 1 60  ? 10.297  27.778 0.137   1.00 24.51 ? 339 SER A O   1 
ATOM   433 C CB  . SER A 1 60  ? 12.537  26.155 0.825   1.00 20.19 ? 339 SER A CB  1 
ATOM   434 O OG  . SER A 1 60  ? 12.628  27.011 1.976   1.00 21.34 ? 339 SER A OG  1 
ATOM   435 N N   . LYS A 1 61  ? 8.817   26.105 0.113   1.00 24.20 ? 340 LYS A N   1 
ATOM   436 C CA  . LYS A 1 61  ? 7.707   26.913 -0.327  1.00 26.15 ? 340 LYS A CA  1 
ATOM   437 C C   . LYS A 1 61  ? 6.844   27.221 0.895   1.00 26.77 ? 340 LYS A C   1 
ATOM   438 O O   . LYS A 1 61  ? 6.336   26.292 1.538   1.00 24.18 ? 340 LYS A O   1 
ATOM   439 C CB  . LYS A 1 61  ? 6.894   26.227 -1.423  1.00 28.16 ? 340 LYS A CB  1 
ATOM   440 C CG  . LYS A 1 61  ? 7.349   26.507 -2.861  1.00 31.82 ? 340 LYS A CG  1 
ATOM   441 C CD  . LYS A 1 61  ? 6.859   25.425 -3.796  1.00 35.61 ? 340 LYS A CD  1 
ATOM   442 C CE  . LYS A 1 61  ? 7.176   25.611 -5.295  1.00 40.97 ? 340 LYS A CE  1 
ATOM   443 N NZ  . LYS A 1 61  ? 6.675   24.353 -5.951  1.00 39.97 ? 340 LYS A NZ  1 
ATOM   444 N N   . PRO A 1 62  ? 6.693   28.535 1.220   1.00 30.51 ? 341 PRO A N   1 
ATOM   445 C CA  . PRO A 1 62  ? 5.884   28.838 2.376   1.00 32.46 ? 341 PRO A CA  1 
ATOM   446 C C   . PRO A 1 62  ? 4.423   28.649 2.016   1.00 31.42 ? 341 PRO A C   1 
ATOM   447 O O   . PRO A 1 62  ? 4.008   28.786 0.837   1.00 30.47 ? 341 PRO A O   1 
ATOM   448 C CB  . PRO A 1 62  ? 6.250   30.289 2.725   1.00 36.45 ? 341 PRO A CB  1 
ATOM   449 C CG  . PRO A 1 62  ? 6.744   30.870 1.455   1.00 35.71 ? 341 PRO A CG  1 
ATOM   450 C CD  . PRO A 1 62  ? 7.359   29.751 0.688   1.00 35.32 ? 341 PRO A CD  1 
ATOM   451 N N   . ASN A 1 63  ? 3.668   28.274 3.036   1.00 32.48 ? 342 ASN A N   1 
ATOM   452 C CA  . ASN A 1 63  ? 2.229   28.120 2.903   1.00 31.05 ? 342 ASN A CA  1 
ATOM   453 C C   . ASN A 1 63  ? 1.876   26.984 1.938   1.00 27.49 ? 342 ASN A C   1 
ATOM   454 O O   . ASN A 1 63  ? 0.803   27.063 1.336   1.00 26.15 ? 342 ASN A O   1 
ATOM   455 C CB  . ASN A 1 63  ? 1.534   29.415 2.395   1.00 34.92 ? 342 ASN A CB  1 
ATOM   456 C CG  . ASN A 1 63  ? 1.797   30.630 3.292   1.00 37.14 ? 342 ASN A CG  1 
ATOM   457 O OD1 . ASN A 1 63  ? 1.780   30.526 4.523   1.00 42.20 ? 342 ASN A OD1 1 
ATOM   458 N ND2 . ASN A 1 63  ? 2.070   31.767 2.677   1.00 39.44 ? 342 ASN A ND2 1 
ATOM   459 N N   . MET A 1 64  ? 2.742   25.978 1.762   1.00 23.90 ? 343 MET A N   1 
ATOM   460 C CA  . MET A 1 64  ? 2.374   24.792 0.997   1.00 20.69 ? 343 MET A CA  1 
ATOM   461 C C   . MET A 1 64  ? 1.422   23.992 1.861   1.00 20.26 ? 343 MET A C   1 
ATOM   462 O O   . MET A 1 64  ? 1.514   23.993 3.072   1.00 20.51 ? 343 MET A O   1 
ATOM   463 C CB  . MET A 1 64  ? 3.589   23.934 0.652   1.00 19.98 ? 343 MET A CB  1 
ATOM   464 C CG  . MET A 1 64  ? 3.374   22.660 -0.131  1.00 18.09 ? 343 MET A CG  1 
ATOM   465 S SD  . MET A 1 64  ? 2.325   22.785 -1.573  1.00 19.16 ? 343 MET A SD  1 
ATOM   466 C CE  . MET A 1 64  ? 3.292   23.842 -2.623  1.00 22.41 ? 343 MET A CE  1 
ATOM   467 N N   . ASN A 1 65  ? 0.397   23.429 1.212   1.00 17.94 ? 344 ASN A N   1 
ATOM   468 C CA  . ASN A 1 65  ? -0.633  22.653 1.899   1.00 16.04 ? 344 ASN A CA  1 
ATOM   469 C C   . ASN A 1 65  ? -1.324  21.721 0.916   1.00 15.35 ? 344 ASN A C   1 
ATOM   470 O O   . ASN A 1 65  ? -1.026  21.728 -0.292  1.00 14.03 ? 344 ASN A O   1 
ATOM   471 C CB  . ASN A 1 65  ? -1.626  23.649 2.532   1.00 17.04 ? 344 ASN A CB  1 
ATOM   472 C CG  . ASN A 1 65  ? -2.219  24.605 1.526   1.00 17.87 ? 344 ASN A CG  1 
ATOM   473 O OD1 . ASN A 1 65  ? -2.712  24.170 0.487   1.00 19.08 ? 344 ASN A OD1 1 
ATOM   474 N ND2 . ASN A 1 65  ? -2.256  25.882 1.821   1.00 20.83 ? 344 ASN A ND2 1 
ATOM   475 N N   . TYR A 1 66  ? -2.189  20.865 1.423   1.00 15.21 ? 345 TYR A N   1 
ATOM   476 C CA  . TYR A 1 66  ? -2.859  19.856 0.560   1.00 14.97 ? 345 TYR A CA  1 
ATOM   477 C C   . TYR A 1 66  ? -3.673  20.540 -0.563  1.00 15.68 ? 345 TYR A C   1 
ATOM   478 O O   . TYR A 1 66  ? -3.638  20.082 -1.730  1.00 17.89 ? 345 TYR A O   1 
ATOM   479 C CB  . TYR A 1 66  ? -3.753  18.866 1.379   1.00 16.02 ? 345 TYR A CB  1 
ATOM   480 C CG  . TYR A 1 66  ? -4.365  17.861 0.404   1.00 16.81 ? 345 TYR A CG  1 
ATOM   481 C CD1 . TYR A 1 66  ? -3.575  16.939 -0.231  1.00 17.59 ? 345 TYR A CD1 1 
ATOM   482 C CD2 . TYR A 1 66  ? -5.714  17.932 0.050   1.00 19.89 ? 345 TYR A CD2 1 
ATOM   483 C CE1 . TYR A 1 66  ? -4.089  16.067 -1.155  1.00 18.66 ? 345 TYR A CE1 1 
ATOM   484 C CE2 . TYR A 1 66  ? -6.236  17.059 -0.937  1.00 20.71 ? 345 TYR A CE2 1 
ATOM   485 C CZ  . TYR A 1 66  ? -5.391  16.115 -1.493  1.00 20.30 ? 345 TYR A CZ  1 
ATOM   486 O OH  . TYR A 1 66  ? -5.905  15.238 -2.478  1.00 22.45 ? 345 TYR A OH  1 
ATOM   487 N N   . ASP A 1 67  ? -4.348  21.646 -0.293  1.00 16.32 ? 346 ASP A N   1 
ATOM   488 C CA  . ASP A 1 67  ? -5.080  22.399 -1.342  1.00 18.31 ? 346 ASP A CA  1 
ATOM   489 C C   . ASP A 1 67  ? -4.164  22.672 -2.567  1.00 18.34 ? 346 ASP A C   1 
ATOM   490 O O   . ASP A 1 67  ? -4.533  22.412 -3.729  1.00 17.86 ? 346 ASP A O   1 
ATOM   491 C CB  . ASP A 1 67  ? -5.682  23.674 -0.802  1.00 20.66 ? 346 ASP A CB  1 
ATOM   492 C CG  . ASP A 1 67  ? -6.345  24.477 -1.858  1.00 25.45 ? 346 ASP A CG  1 
ATOM   493 O OD1 . ASP A 1 67  ? -7.367  23.975 -2.323  1.00 28.12 ? 346 ASP A OD1 1 
ATOM   494 O OD2 . ASP A 1 67  ? -5.863  25.587 -2.220  1.00 28.51 ? 346 ASP A OD2 1 
ATOM   495 N N   . LYS A 1 68  ? -2.985  23.209 -2.279  1.00 18.40 ? 347 LYS A N   1 
ATOM   496 C CA  . LYS A 1 68  ? -2.008  23.527 -3.346  1.00 19.73 ? 347 LYS A CA  1 
ATOM   497 C C   . LYS A 1 68  ? -1.418  22.252 -3.987  1.00 19.19 ? 347 LYS A C   1 
ATOM   498 O O   . LYS A 1 68  ? -1.303  22.167 -5.203  1.00 20.79 ? 347 LYS A O   1 
ATOM   499 C CB  . LYS A 1 68  ? -0.913  24.432 -2.787  1.00 21.00 ? 347 LYS A CB  1 
ATOM   500 C CG  . LYS A 1 68  ? -1.392  25.769 -2.324  1.00 24.09 ? 347 LYS A CG  1 
ATOM   501 C CD  . LYS A 1 68  ? -0.208  26.613 -1.881  1.00 26.70 ? 347 LYS A CD  1 
ATOM   502 C CE  . LYS A 1 68  ? -0.631  27.978 -1.447  1.00 30.31 ? 347 LYS A CE  1 
ATOM   503 N NZ  . LYS A 1 68  ? 0.497   28.521 -0.659  0.80 33.70 ? 347 LYS A NZ  1 
ATOM   504 N N   . LEU A 1 69  ? -1.128  21.228 -3.214  1.00 17.50 ? 348 LEU A N   1 
ATOM   505 C CA  . LEU A 1 69  ? -0.556  20.008 -3.720  1.00 17.52 ? 348 LEU A CA  1 
ATOM   506 C C   . LEU A 1 69  ? -1.568  19.386 -4.668  1.00 18.45 ? 348 LEU A C   1 
ATOM   507 O O   . LEU A 1 69  ? -1.174  18.936 -5.746  1.00 18.25 ? 348 LEU A O   1 
ATOM   508 C CB  . LEU A 1 69  ? -0.315  19.064 -2.563  1.00 18.14 ? 348 LEU A CB  1 
ATOM   509 C CG  . LEU A 1 69  ? 0.260   17.698 -2.954  1.00 18.69 ? 348 LEU A CG  1 
ATOM   510 C CD1 . LEU A 1 69  ? 1.666   17.883 -3.441  1.00 20.82 ? 348 LEU A CD1 1 
ATOM   511 C CD2 . LEU A 1 69  ? 0.256   16.767 -1.729  1.00 20.95 ? 348 LEU A CD2 1 
ATOM   512 N N   . SER A 1 70  ? -2.841  19.414 -4.289  1.00 18.82 ? 349 SER A N   1 
ATOM   513 C CA  . SER A 1 70  ? -3.857  18.698 -5.115  1.00 19.97 ? 349 SER A CA  1 
ATOM   514 C C   . SER A 1 70  ? -4.057  19.423 -6.403  1.00 21.03 ? 349 SER A C   1 
ATOM   515 O O   . SER A 1 70  ? -4.263  18.785 -7.431  1.00 21.90 ? 349 SER A O   1 
ATOM   516 C CB  . SER A 1 70  ? -5.145  18.416 -4.352  1.00 20.46 ? 349 SER A CB  1 
ATOM   517 O OG  . SER A 1 70  ? -5.838  19.561 -4.083  1.00 22.12 ? 349 SER A OG  1 
ATOM   518 N N   . ARG A 1 71  ? -3.947  20.739 -6.377  1.00 21.55 ? 350 ARG A N   1 
ATOM   519 C CA  . ARG A 1 71  ? -4.075  21.515 -7.576  1.00 22.99 ? 350 ARG A CA  1 
ATOM   520 C C   . ARG A 1 71  ? -2.928  21.164 -8.575  1.00 23.86 ? 350 ARG A C   1 
ATOM   521 O O   . ARG A 1 71  ? -3.151  20.939 -9.773  1.00 25.95 ? 350 ARG A O   1 
ATOM   522 C CB  . ARG A 1 71  ? -4.056  23.000 -7.243  1.00 27.42 ? 350 ARG A CB  1 
ATOM   523 C CG  . ARG A 1 71  ? -4.265  23.851 -8.477  1.00 33.62 ? 350 ARG A CG  1 
ATOM   524 C CD  . ARG A 1 71  ? -4.815  25.235 -8.187  1.00 38.20 ? 350 ARG A CD  1 
ATOM   525 N NE  . ARG A 1 71  ? -5.951  25.136 -7.289  1.00 39.80 ? 350 ARG A NE  1 
ATOM   526 C CZ  . ARG A 1 71  ? -5.887  25.352 -5.973  1.00 39.64 ? 350 ARG A CZ  1 
ATOM   527 N NH1 . ARG A 1 71  ? -4.748  25.713 -5.422  1.00 38.68 ? 350 ARG A NH1 1 
ATOM   528 N NH2 . ARG A 1 71  ? -6.988  25.266 -5.214  1.00 38.59 ? 350 ARG A NH2 1 
ATOM   529 N N   . ALA A 1 72  ? -1.724  21.081 -8.058  1.00 21.61 ? 351 ALA A N   1 
ATOM   530 C CA  . ALA A 1 72  ? -0.565  20.587 -8.881  1.00 22.48 ? 351 ALA A CA  1 
ATOM   531 C C   . ALA A 1 72  ? -0.763  19.202 -9.481  1.00 22.09 ? 351 ALA A C   1 
ATOM   532 O O   . ALA A 1 72  ? -0.367  18.863 -10.651 1.00 24.23 ? 351 ALA A O   1 
ATOM   533 C CB  . ALA A 1 72  ? 0.674   20.643 -8.006  1.00 22.40 ? 351 ALA A CB  1 
ATOM   534 N N   . LEU A 1 73  ? -1.305  18.287 -8.698  1.00 21.32 ? 352 LEU A N   1 
ATOM   535 C CA  . LEU A 1 73  ? -1.603  16.955 -9.194  1.00 21.22 ? 352 LEU A CA  1 
ATOM   536 C C   . LEU A 1 73  ? -2.634  16.936 -10.311 1.00 24.73 ? 352 LEU A C   1 
ATOM   537 O O   . LEU A 1 73  ? -2.494  16.188 -11.267 1.00 21.84 ? 352 LEU A O   1 
ATOM   538 C CB  . LEU A 1 73  ? -2.053  16.049 -8.049  1.00 22.20 ? 352 LEU A CB  1 
ATOM   539 C CG  . LEU A 1 73  ? -0.999  15.788 -7.012  1.00 20.88 ? 352 LEU A CG  1 
ATOM   540 C CD1 . LEU A 1 73  ? -1.686  15.010 -5.953  1.00 24.28 ? 352 LEU A CD1 1 
ATOM   541 C CD2 . LEU A 1 73  ? 0.178   15.031 -7.524  1.00 24.07 ? 352 LEU A CD2 1 
ATOM   542 N N   . ARG A 1 74  ? -3.672  17.756 -10.190 1.00 24.78 ? 353 ARG A N   1 
ATOM   543 C CA  . ARG A 1 74  ? -4.680  17.934 -11.237 1.00 30.34 ? 353 ARG A CA  1 
ATOM   544 C C   . ARG A 1 74  ? -4.032  18.333 -12.586 1.00 27.97 ? 353 ARG A C   1 
ATOM   545 O O   . ARG A 1 74  ? -4.466  17.852 -13.684 1.00 26.80 ? 353 ARG A O   1 
ATOM   546 C CB  . ARG A 1 74  ? -5.681  19.040 -10.776 1.00 34.67 ? 353 ARG A CB  1 
ATOM   547 C CG  . ARG A 1 74  ? -7.095  18.996 -11.354 1.00 45.25 ? 353 ARG A CG  1 
ATOM   548 C CD  . ARG A 1 74  ? -8.135  19.924 -10.623 1.00 48.94 ? 353 ARG A CD  1 
ATOM   549 N NE  . ARG A 1 74  ? -8.104  19.804 -9.141  1.00 47.66 ? 353 ARG A NE  1 
ATOM   550 C CZ  . ARG A 1 74  ? -7.880  20.814 -8.278  1.00 51.82 ? 353 ARG A CZ  1 
ATOM   551 N NH1 . ARG A 1 74  ? -7.668  22.061 -8.710  1.00 55.48 ? 353 ARG A NH1 1 
ATOM   552 N NH2 . ARG A 1 74  ? -7.871  20.593 -6.962  1.00 47.59 ? 353 ARG A NH2 1 
ATOM   553 N N   . TYR A 1 75  ? -3.012  19.191 -12.538 1.00 25.76 ? 354 TYR A N   1 
ATOM   554 C CA  . TYR A 1 75  ? -2.260  19.669 -13.725 1.00 27.29 ? 354 TYR A CA  1 
ATOM   555 C C   . TYR A 1 75  ? -1.644  18.456 -14.505 1.00 24.32 ? 354 TYR A C   1 
ATOM   556 O O   . TYR A 1 75  ? -1.496  18.528 -15.731 1.00 25.10 ? 354 TYR A O   1 
ATOM   557 C CB  . TYR A 1 75  ? -1.133  20.710 -13.370 1.00 32.96 ? 354 TYR A CB  1 
ATOM   558 C CG  . TYR A 1 75  ? 0.092   20.839 -14.383 1.00 40.90 ? 354 TYR A CG  1 
ATOM   559 C CD1 . TYR A 1 75  ? 0.073   21.759 -15.482 1.00 52.47 ? 354 TYR A CD1 1 
ATOM   560 C CD2 . TYR A 1 75  ? 1.254   20.015 -14.244 1.00 44.89 ? 354 TYR A CD2 1 
ATOM   561 C CE1 . TYR A 1 75  ? 1.155   21.826 -16.385 1.00 56.73 ? 354 TYR A CE1 1 
ATOM   562 C CE2 . TYR A 1 75  ? 2.326   20.073 -15.143 1.00 49.37 ? 354 TYR A CE2 1 
ATOM   563 C CZ  . TYR A 1 75  ? 2.285   20.965 -16.205 1.00 56.75 ? 354 TYR A CZ  1 
ATOM   564 O OH  . TYR A 1 75  ? 3.376   20.984 -17.053 1.00 58.68 ? 354 TYR A OH  1 
ATOM   565 N N   . TYR A 1 76  ? -1.275  17.408 -13.789 1.00 20.04 ? 355 TYR A N   1 
ATOM   566 C CA  . TYR A 1 76  ? -0.648  16.211 -14.412 1.00 18.79 ? 355 TYR A CA  1 
ATOM   567 C C   . TYR A 1 76  ? -1.623  15.393 -15.212 1.00 19.75 ? 355 TYR A C   1 
ATOM   568 O O   . TYR A 1 76  ? -1.196  14.599 -16.045 1.00 19.18 ? 355 TYR A O   1 
ATOM   569 C CB  . TYR A 1 76  ? 0.024   15.333 -13.383 1.00 17.47 ? 355 TYR A CB  1 
ATOM   570 C CG  . TYR A 1 76  ? 1.341   15.832 -12.875 1.00 17.33 ? 355 TYR A CG  1 
ATOM   571 C CD1 . TYR A 1 76  ? 2.266   16.459 -13.723 1.00 17.90 ? 355 TYR A CD1 1 
ATOM   572 C CD2 . TYR A 1 76  ? 1.699   15.680 -11.552 1.00 17.69 ? 355 TYR A CD2 1 
ATOM   573 C CE1 . TYR A 1 76  ? 3.529   16.896 -13.257 1.00 18.91 ? 355 TYR A CE1 1 
ATOM   574 C CE2 . TYR A 1 76  ? 2.938   16.142 -11.094 1.00 19.16 ? 355 TYR A CE2 1 
ATOM   575 C CZ  . TYR A 1 76  ? 3.827   16.766 -11.947 1.00 17.94 ? 355 TYR A CZ  1 
ATOM   576 O OH  . TYR A 1 76  ? 5.030   17.172 -11.476 1.00 18.38 ? 355 TYR A OH  1 
ATOM   577 N N   . TYR A 1 77  ? -2.911  15.599 -15.038 1.00 20.63 ? 356 TYR A N   1 
ATOM   578 C CA  . TYR A 1 77  ? -3.847  14.854 -15.826 1.00 24.31 ? 356 TYR A CA  1 
ATOM   579 C C   . TYR A 1 77  ? -3.706  15.224 -17.295 1.00 25.07 ? 356 TYR A C   1 
ATOM   580 O O   . TYR A 1 77  ? -3.667  14.347 -18.162 1.00 23.34 ? 356 TYR A O   1 
ATOM   581 C CB  . TYR A 1 77  ? -5.298  15.071 -15.377 1.00 27.90 ? 356 TYR A CB  1 
ATOM   582 C CG  . TYR A 1 77  ? -6.274  14.275 -16.192 1.00 34.55 ? 356 TYR A CG  1 
ATOM   583 C CD1 . TYR A 1 77  ? -6.726  14.736 -17.477 1.00 38.29 ? 356 TYR A CD1 1 
ATOM   584 C CD2 . TYR A 1 77  ? -6.817  13.072 -15.691 1.00 39.43 ? 356 TYR A CD2 1 
ATOM   585 C CE1 . TYR A 1 77  ? -7.641  14.004 -18.244 1.00 41.55 ? 356 TYR A CE1 1 
ATOM   586 C CE2 . TYR A 1 77  ? -7.751  12.355 -16.433 1.00 41.54 ? 356 TYR A CE2 1 
ATOM   587 C CZ  . TYR A 1 77  ? -8.161  12.811 -17.694 1.00 43.46 ? 356 TYR A CZ  1 
ATOM   588 O OH  . TYR A 1 77  ? -9.087  12.072 -18.406 1.00 44.94 ? 356 TYR A OH  1 
ATOM   589 N N   . ASP A 1 78  ? -3.628  16.528 -17.608 1.00 26.44 ? 357 ASP A N   1 
ATOM   590 C CA  . ASP A 1 78  ? -3.504  16.965 -18.955 1.00 29.89 ? 357 ASP A CA  1 
ATOM   591 C C   . ASP A 1 78  ? -2.202  16.619 -19.609 1.00 26.62 ? 357 ASP A C   1 
ATOM   592 O O   . ASP A 1 78  ? -2.146  16.536 -20.823 1.00 28.11 ? 357 ASP A O   1 
ATOM   593 C CB  . ASP A 1 78  ? -3.709  18.486 -19.043 1.00 36.08 ? 357 ASP A CB  1 
ATOM   594 C CG  . ASP A 1 78  ? -5.174  18.891 -18.902 1.00 44.71 ? 357 ASP A CG  1 
ATOM   595 O OD1 . ASP A 1 78  ? -6.089  18.169 -19.422 1.00 47.13 ? 357 ASP A OD1 1 
ATOM   596 O OD2 . ASP A 1 78  ? -5.393  19.987 -18.314 1.00 51.89 ? 357 ASP A OD2 1 
ATOM   597 N N   . LYS A 1 79  ? -1.189  16.417 -18.809 1.00 23.52 ? 358 LYS A N   1 
ATOM   598 C CA  . LYS A 1 79  ? 0.124   16.056 -19.244 1.00 23.54 ? 358 LYS A CA  1 
ATOM   599 C C   . LYS A 1 79  ? 0.256   14.511 -19.387 1.00 22.07 ? 358 LYS A C   1 
ATOM   600 O O   . LYS A 1 79  ? 1.341   13.983 -19.680 1.00 21.35 ? 358 LYS A O   1 
ATOM   601 C CB  . LYS A 1 79  ? 1.170   16.616 -18.263 1.00 23.66 ? 358 LYS A CB  1 
ATOM   602 C CG  . LYS A 1 79  ? 1.346   18.118 -18.289 1.00 26.58 ? 358 LYS A CG  1 
ATOM   603 N N   . ASN A 1 80  ? -0.808  13.765 -19.117 1.00 20.93 ? 359 ASN A N   1 
ATOM   604 C CA  . ASN A 1 80  ? -0.727  12.266 -19.132 1.00 19.66 ? 359 ASN A CA  1 
ATOM   605 C C   . ASN A 1 80  ? 0.316   11.645 -18.216 1.00 18.56 ? 359 ASN A C   1 
ATOM   606 O O   . ASN A 1 80  ? 0.885   10.553 -18.507 1.00 17.95 ? 359 ASN A O   1 
ATOM   607 C CB  . ASN A 1 80  ? -0.445  11.752 -20.595 1.00 20.96 ? 359 ASN A CB  1 
ATOM   608 C CG  . ASN A 1 80  ? -1.387  12.300 -21.646 1.00 23.34 ? 359 ASN A CG  1 
ATOM   609 O OD1 . ASN A 1 80  ? -0.995  12.654 -22.830 1.00 24.58 ? 359 ASN A OD1 1 
ATOM   610 N ND2 . ASN A 1 80  ? -2.658  12.211 -21.330 1.00 23.49 ? 359 ASN A ND2 1 
ATOM   611 N N   . ILE A 1 81  ? 0.571   12.300 -17.067 1.00 16.03 ? 360 ILE A N   1 
ATOM   612 C CA  . ILE A 1 81  ? 1.489   11.826 -16.064 1.00 16.61 ? 360 ILE A CA  1 
ATOM   613 C C   . ILE A 1 81  ? 0.755   11.154 -14.885 1.00 16.09 ? 360 ILE A C   1 
ATOM   614 O O   . ILE A 1 81  ? 1.282   10.212 -14.313 1.00 15.40 ? 360 ILE A O   1 
ATOM   615 C CB  . ILE A 1 81  ? 2.349   13.011 -15.586 1.00 17.93 ? 360 ILE A CB  1 
ATOM   616 C CG1 . ILE A 1 81  ? 3.461   13.222 -16.630 1.00 21.77 ? 360 ILE A CG1 1 
ATOM   617 C CG2 . ILE A 1 81  ? 3.028   12.762 -14.260 1.00 18.28 ? 360 ILE A CG2 1 
ATOM   618 C CD1 . ILE A 1 81  ? 4.037   14.583 -16.609 1.00 24.79 ? 360 ILE A CD1 1 
ATOM   619 N N   . MET A 1 82  ? -0.463  11.603 -14.585 1.00 17.10 ? 361 MET A N   1 
ATOM   620 C CA  . MET A 1 82  ? -1.241  10.984 -13.529 1.00 19.81 ? 361 MET A CA  1 
ATOM   621 C C   . MET A 1 82  ? -2.709  11.187 -13.644 1.00 24.80 ? 361 MET A C   1 
ATOM   622 O O   . MET A 1 82  ? -3.136  12.141 -14.270 1.00 27.63 ? 361 MET A O   1 
ATOM   623 C CB  . MET A 1 82  ? -0.780  11.289 -12.115 1.00 25.25 ? 361 MET A CB  1 
ATOM   624 C CG  . MET A 1 82  ? -0.652  12.582 -11.479 1.00 26.55 ? 361 MET A CG  1 
ATOM   625 S SD  . MET A 1 82  ? -0.378  12.227 -9.657  1.00 27.71 ? 361 MET A SD  1 
ATOM   626 C CE  . MET A 1 82  ? 1.412   12.094 -9.759  1.00 24.92 ? 361 MET A CE  1 
ATOM   627 N N   . THR A 1 83  ? -3.491  10.262 -13.055 1.00 25.20 ? 362 THR A N   1 
ATOM   628 C CA  . THR A 1 83  ? -4.946  10.466 -12.875 1.00 25.85 ? 362 THR A CA  1 
ATOM   629 C C   . THR A 1 83  ? -5.386  10.231 -11.441 1.00 23.90 ? 362 THR A C   1 
ATOM   630 O O   . THR A 1 83  ? -4.665  9.634  -10.658 1.00 23.35 ? 362 THR A O   1 
ATOM   631 C CB  . THR A 1 83  ? -5.770  9.541  -13.767 1.00 30.42 ? 362 THR A CB  1 
ATOM   632 O OG1 . THR A 1 83  ? -5.390  8.196  -13.483 1.00 33.22 ? 362 THR A OG1 1 
ATOM   633 C CG2 . THR A 1 83  ? -5.396  9.780  -15.172 1.00 35.44 ? 362 THR A CG2 1 
ATOM   634 N N   . LYS A 1 84  ? -6.555  10.757 -11.078 1.00 24.94 ? 363 LYS A N   1 
ATOM   635 C CA  . LYS A 1 84  ? -7.150  10.454 -9.772  1.00 26.40 ? 363 LYS A CA  1 
ATOM   636 C C   . LYS A 1 84  ? -7.812  9.086  -9.869  1.00 24.94 ? 363 LYS A C   1 
ATOM   637 O O   . LYS A 1 84  ? -8.361  8.726  -10.861 1.00 26.76 ? 363 LYS A O   1 
ATOM   638 C CB  . LYS A 1 84  ? -8.279  11.424 -9.419  1.00 31.03 ? 363 LYS A CB  1 
ATOM   639 C CG  . LYS A 1 84  ? -7.764  12.746 -8.981  1.00 34.43 ? 363 LYS A CG  1 
ATOM   640 C CD  . LYS A 1 84  ? -8.759  13.395 -8.020  1.00 37.54 ? 363 LYS A CD  1 
ATOM   641 C CE  . LYS A 1 84  ? -8.884  14.829 -8.452  1.00 39.85 ? 363 LYS A CE  1 
ATOM   642 N NZ  . LYS A 1 84  ? -10.188 15.372 -8.007  1.00 44.17 ? 363 LYS A NZ  1 
ATOM   643 N N   . VAL A 1 85  ? -7.863  8.396  -8.756  1.00 24.17 ? 364 VAL A N   1 
ATOM   644 C CA  . VAL A 1 85  ? -8.625  7.211  -8.668  1.00 23.59 ? 364 VAL A CA  1 
ATOM   645 C C   . VAL A 1 85  ? -9.900  7.553  -7.853  1.00 26.48 ? 364 VAL A C   1 
ATOM   646 O O   . VAL A 1 85  ? -9.829  7.980  -6.666  1.00 24.98 ? 364 VAL A O   1 
ATOM   647 C CB  . VAL A 1 85  ? -7.815  6.144  -7.973  1.00 22.33 ? 364 VAL A CB  1 
ATOM   648 C CG1 . VAL A 1 85  ? -8.688  4.962  -7.618  1.00 24.02 ? 364 VAL A CG1 1 
ATOM   649 C CG2 . VAL A 1 85  ? -6.521  5.898  -8.774  1.00 22.11 ? 364 VAL A CG2 1 
ATOM   650 N N   . HIS A 1 86  ? -11.031 7.289  -8.481  1.00 29.36 ? 365 HIS A N   1 
ATOM   651 C CA  . HIS A 1 86  ? -12.344 7.458  -7.858  1.00 34.62 ? 365 HIS A CA  1 
ATOM   652 C C   . HIS A 1 86  ? -12.682 6.308  -6.936  1.00 34.68 ? 365 HIS A C   1 
ATOM   653 O O   . HIS A 1 86  ? -12.278 5.179  -7.184  1.00 34.45 ? 365 HIS A O   1 
ATOM   654 C CB  . HIS A 1 86  ? -13.372 7.639  -8.936  1.00 39.41 ? 365 HIS A CB  1 
ATOM   655 C CG  . HIS A 1 86  ? -13.041 8.762  -9.868  1.00 43.87 ? 365 HIS A CG  1 
ATOM   656 N ND1 . HIS A 1 86  ? -12.467 9.942  -9.431  1.00 47.13 ? 365 HIS A ND1 1 
ATOM   657 C CD2 . HIS A 1 86  ? -13.153 8.873  -11.214 1.00 50.41 ? 365 HIS A CD2 1 
ATOM   658 C CE1 . HIS A 1 86  ? -12.251 10.738 -10.465 1.00 49.29 ? 365 HIS A CE1 1 
ATOM   659 N NE2 . HIS A 1 86  ? -12.659 10.114 -11.556 1.00 51.76 ? 365 HIS A NE2 1 
ATOM   660 N N   . GLY A 1 87  ? -13.323 6.629  -5.816  1.00 34.73 ? 366 GLY A N   1 
ATOM   661 C CA  . GLY A 1 87  ? -13.905 5.643  -4.901  1.00 37.08 ? 366 GLY A CA  1 
ATOM   662 C C   . GLY A 1 87  ? -12.941 5.340  -3.776  1.00 36.11 ? 366 GLY A C   1 
ATOM   663 O O   . GLY A 1 87  ? -13.219 4.448  -2.941  1.00 36.48 ? 366 GLY A O   1 
ATOM   664 N N   . LYS A 1 88  ? -11.825 6.072  -3.743  1.00 31.98 ? 367 LYS A N   1 
ATOM   665 C CA  . LYS A 1 88  ? -10.785 5.810  -2.805  1.00 31.02 ? 367 LYS A CA  1 
ATOM   666 C C   . LYS A 1 88  ? -10.323 7.125  -2.259  1.00 31.94 ? 367 LYS A C   1 
ATOM   667 O O   . LYS A 1 88  ? -10.447 8.131  -2.946  1.00 35.49 ? 367 LYS A O   1 
ATOM   668 C CB  . LYS A 1 88  ? -9.639  5.092  -3.453  1.00 31.49 ? 367 LYS A CB  1 
ATOM   669 C CG  . LYS A 1 88  ? -10.056 3.757  -4.006  1.00 33.47 ? 367 LYS A CG  1 
ATOM   670 C CD  . LYS A 1 88  ? -8.863  2.943  -4.395  1.00 35.99 ? 367 LYS A CD  1 
ATOM   671 C CE  . LYS A 1 88  ? -9.269  1.708  -5.131  1.00 40.32 ? 367 LYS A CE  1 
ATOM   672 N NZ  . LYS A 1 88  ? -8.057  1.070  -5.690  1.00 39.56 ? 367 LYS A NZ  1 
ATOM   673 N N   . ARG A 1 89  ? -9.800  7.093  -1.043  1.00 27.39 ? 368 ARG A N   1 
ATOM   674 C CA  . ARG A 1 89  ? -9.358  8.310  -0.380  1.00 24.56 ? 368 ARG A CA  1 
ATOM   675 C C   . ARG A 1 89  ? -7.934  8.669  -0.682  1.00 20.61 ? 368 ARG A C   1 
ATOM   676 O O   . ARG A 1 89  ? -6.957  7.922  -0.379  1.00 18.70 ? 368 ARG A O   1 
ATOM   677 C CB  . ARG A 1 89  ? -9.679  8.214  1.126   1.00 27.45 ? 368 ARG A CB  1 
ATOM   678 C CG  . ARG A 1 89  ? -11.205 8.132  1.264   1.00 32.31 ? 368 ARG A CG  1 
ATOM   679 C CD  . ARG A 1 89  ? -11.878 8.789  2.469   1.00 36.36 ? 368 ARG A CD  1 
ATOM   680 N NE  . ARG A 1 89  ? -11.341 10.084 2.892   1.00 35.08 ? 368 ARG A NE  1 
ATOM   681 C CZ  . ARG A 1 89  ? -11.481 10.589 4.122   1.00 38.50 ? 368 ARG A CZ  1 
ATOM   682 N NH1 . ARG A 1 89  ? -12.151 9.916  5.059   1.00 43.28 ? 368 ARG A NH1 1 
ATOM   683 N NH2 . ARG A 1 89  ? -10.963 11.775 4.421   1.00 37.71 ? 368 ARG A NH2 1 
ATOM   684 N N   . TYR A 1 90  ? -7.727  9.859  -1.262  1.00 17.09 ? 369 TYR A N   1 
ATOM   685 C CA  . TYR A 1 90  ? -6.451  10.396 -1.566  1.00 16.14 ? 369 TYR A CA  1 
ATOM   686 C C   . TYR A 1 90  ? -5.606  9.434  -2.448  1.00 15.28 ? 369 TYR A C   1 
ATOM   687 O O   . TYR A 1 90  ? -4.442  9.314  -2.251  1.00 15.32 ? 369 TYR A O   1 
ATOM   688 C CB  . TYR A 1 90  ? -5.668  10.829 -0.312  1.00 14.90 ? 369 TYR A CB  1 
ATOM   689 C CG  . TYR A 1 90  ? -6.390  11.876 0.533   1.00 14.96 ? 369 TYR A CG  1 
ATOM   690 C CD1 . TYR A 1 90  ? -6.449  13.157 0.138   1.00 14.89 ? 369 TYR A CD1 1 
ATOM   691 C CD2 . TYR A 1 90  ? -7.010  11.527 1.715   1.00 15.98 ? 369 TYR A CD2 1 
ATOM   692 C CE1 . TYR A 1 90  ? -7.148  14.123 0.865   1.00 15.18 ? 369 TYR A CE1 1 
ATOM   693 C CE2 . TYR A 1 90  ? -7.690  12.488 2.500   1.00 16.46 ? 369 TYR A CE2 1 
ATOM   694 C CZ  . TYR A 1 90  ? -7.769  13.796 2.047   1.00 15.70 ? 369 TYR A CZ  1 
ATOM   695 O OH  . TYR A 1 90  ? -8.376  14.733 2.829   1.00 16.59 ? 369 TYR A OH  1 
ATOM   696 N N   . ALA A 1 91  ? -6.271  8.888  -3.433  1.00 17.33 ? 370 ALA A N   1 
ATOM   697 C CA  . ALA A 1 91  ? -5.645  7.881  -4.336  1.00 16.58 ? 370 ALA A CA  1 
ATOM   698 C C   . ALA A 1 91  ? -5.461  8.478  -5.697  1.00 15.29 ? 370 ALA A C   1 
ATOM   699 O O   . ALA A 1 91  ? -6.353  9.150  -6.192  1.00 15.25 ? 370 ALA A O   1 
ATOM   700 C CB  . ALA A 1 91  ? -6.470  6.652  -4.405  1.00 18.02 ? 370 ALA A CB  1 
ATOM   701 N N   . TYR A 1 92  ? -4.330  8.154  -6.303  1.00 14.17 ? 371 TYR A N   1 
ATOM   702 C CA  . TYR A 1 92  ? -3.927  8.650  -7.614  1.00 14.34 ? 371 TYR A CA  1 
ATOM   703 C C   . TYR A 1 92  ? -3.236  7.511  -8.335  1.00 15.55 ? 371 TYR A C   1 
ATOM   704 O O   . TYR A 1 92  ? -2.853  6.474  -7.662  1.00 13.78 ? 371 TYR A O   1 
ATOM   705 C CB  . TYR A 1 92  ? -2.964  9.813  -7.455  1.00 16.02 ? 371 TYR A CB  1 
ATOM   706 C CG  . TYR A 1 92  ? -3.570  11.047 -6.833  1.00 17.74 ? 371 TYR A CG  1 
ATOM   707 C CD1 . TYR A 1 92  ? -3.608  11.223 -5.459  1.00 19.27 ? 371 TYR A CD1 1 
ATOM   708 C CD2 . TYR A 1 92  ? -4.168  11.985 -7.649  1.00 21.67 ? 371 TYR A CD2 1 
ATOM   709 C CE1 . TYR A 1 92  ? -4.206  12.401 -4.897  1.00 22.23 ? 371 TYR A CE1 1 
ATOM   710 C CE2 . TYR A 1 92  ? -4.758  13.160 -7.113  1.00 24.36 ? 371 TYR A CE2 1 
ATOM   711 C CZ  . TYR A 1 92  ? -4.742  13.343 -5.738  1.00 23.95 ? 371 TYR A CZ  1 
ATOM   712 O OH  . TYR A 1 92  ? -5.426  14.514 -5.328  1.00 28.70 ? 371 TYR A OH  1 
ATOM   713 N N   . LYS A 1 93  ? -3.021  7.666  -9.642  1.00 15.31 ? 372 LYS A N   1 
ATOM   714 C CA  . LYS A 1 93  ? -2.366  6.574  -10.398 1.00 15.49 ? 372 LYS A CA  1 
ATOM   715 C C   . LYS A 1 93  ? -1.389  7.239  -11.366 1.00 15.34 ? 372 LYS A C   1 
ATOM   716 O O   . LYS A 1 93  ? -1.823  8.082  -12.155 1.00 17.88 ? 372 LYS A O   1 
ATOM   717 C CB  . LYS A 1 93  ? -3.373  5.757  -11.115 1.00 18.78 ? 372 LYS A CB  1 
ATOM   718 C CG  . LYS A 1 93  ? -2.864  4.588  -11.952 1.00 20.91 ? 372 LYS A CG  1 
ATOM   719 C CD  . LYS A 1 93  ? -3.975  3.882  -12.717 1.00 25.18 ? 372 LYS A CD  1 
ATOM   720 N N   . PHE A 1 94  ? -0.159  6.801  -11.386 1.00 13.91 ? 373 PHE A N   1 
ATOM   721 C CA  . PHE A 1 94  ? 0.781   7.266  -12.407 1.00 14.89 ? 373 PHE A CA  1 
ATOM   722 C C   . PHE A 1 94  ? 0.455   6.646  -13.727 1.00 16.06 ? 373 PHE A C   1 
ATOM   723 O O   . PHE A 1 94  ? -0.021  5.531  -13.812 1.00 16.91 ? 373 PHE A O   1 
ATOM   724 C CB  . PHE A 1 94  ? 2.193   6.851  -12.087 1.00 14.17 ? 373 PHE A CB  1 
ATOM   725 C CG  . PHE A 1 94  ? 2.826   7.610  -10.959 1.00 15.83 ? 373 PHE A CG  1 
ATOM   726 C CD1 . PHE A 1 94  ? 3.383   8.878  -11.188 1.00 16.04 ? 373 PHE A CD1 1 
ATOM   727 C CD2 . PHE A 1 94  ? 2.880   7.063  -9.722  1.00 15.19 ? 373 PHE A CD2 1 
ATOM   728 C CE1 . PHE A 1 94  ? 4.002   9.554  -10.114 1.00 18.00 ? 373 PHE A CE1 1 
ATOM   729 C CE2 . PHE A 1 94  ? 3.501   7.739  -8.675  1.00 17.00 ? 373 PHE A CE2 1 
ATOM   730 C CZ  . PHE A 1 94  ? 3.985   8.995  -8.876  1.00 16.07 ? 373 PHE A CZ  1 
ATOM   731 N N   . ASP A 1 95  ? 0.666   7.431  -14.797 1.00 17.72 ? 374 ASP A N   1 
ATOM   732 C CA  . ASP A 1 95  ? 0.515   6.972  -16.191 1.00 18.32 ? 374 ASP A CA  1 
ATOM   733 C C   . ASP A 1 95  ? 1.960   6.671  -16.736 1.00 17.76 ? 374 ASP A C   1 
ATOM   734 O O   . ASP A 1 95  ? 2.714   7.604  -16.870 1.00 17.94 ? 374 ASP A O   1 
ATOM   735 C CB  . ASP A 1 95  ? -0.219  8.108  -16.967 1.00 19.68 ? 374 ASP A CB  1 
ATOM   736 C CG  . ASP A 1 95  ? -0.552  7.739  -18.407 1.00 21.56 ? 374 ASP A CG  1 
ATOM   737 O OD1 . ASP A 1 95  ? 0.287   7.023  -19.001 1.00 21.35 ? 374 ASP A OD1 1 
ATOM   738 O OD2 . ASP A 1 95  ? -1.626  8.173  -18.999 1.00 22.07 ? 374 ASP A OD2 1 
ATOM   739 N N   . PHE A 1 96  ? 2.316   5.391  -16.999 1.00 17.82 ? 375 PHE A N   1 
ATOM   740 C CA  . PHE A 1 96  ? 3.608   5.001  -17.534 1.00 18.80 ? 375 PHE A CA  1 
ATOM   741 C C   . PHE A 1 96  ? 3.867   5.714  -18.846 1.00 17.22 ? 375 PHE A C   1 
ATOM   742 O O   . PHE A 1 96  ? 5.038   5.985  -19.199 1.00 17.43 ? 375 PHE A O   1 
ATOM   743 C CB  . PHE A 1 96  ? 3.701   3.448  -17.815 1.00 21.79 ? 375 PHE A CB  1 
ATOM   744 C CG  . PHE A 1 96  ? 4.712   2.724  -16.971 1.00 23.84 ? 375 PHE A CG  1 
ATOM   745 C CD1 . PHE A 1 96  ? 6.071   3.040  -17.062 1.00 26.55 ? 375 PHE A CD1 1 
ATOM   746 C CD2 . PHE A 1 96  ? 4.333   1.657  -16.158 1.00 24.84 ? 375 PHE A CD2 1 
ATOM   747 C CE1 . PHE A 1 96  ? 7.025   2.393  -16.238 1.00 23.75 ? 375 PHE A CE1 1 
ATOM   748 C CE2 . PHE A 1 96  ? 5.266   1.062  -15.319 1.00 27.23 ? 375 PHE A CE2 1 
ATOM   749 C CZ  . PHE A 1 96  ? 6.598   1.429  -15.360 1.00 23.85 ? 375 PHE A CZ  1 
ATOM   750 N N   . HIS A 1 97  ? 2.820   6.023  -19.596 1.00 16.14 ? 376 HIS A N   1 
ATOM   751 C CA  . HIS A 1 97  ? 3.036   6.597  -20.936 1.00 17.13 ? 376 HIS A CA  1 
ATOM   752 C C   . HIS A 1 97  ? 3.594   8.005  -20.852 1.00 17.05 ? 376 HIS A C   1 
ATOM   753 O O   . HIS A 1 97  ? 4.463   8.372  -21.635 1.00 17.14 ? 376 HIS A O   1 
ATOM   754 C CB  . HIS A 1 97  ? 1.734   6.584  -21.713 1.00 18.96 ? 376 HIS A CB  1 
ATOM   755 C CG  . HIS A 1 97  ? 1.091   5.251  -21.703 1.00 19.94 ? 376 HIS A CG  1 
ATOM   756 N ND1 . HIS A 1 97  ? -0.229  5.069  -21.378 1.00 21.59 ? 376 HIS A ND1 1 
ATOM   757 C CD2 . HIS A 1 97  ? 1.610   4.021  -21.862 1.00 21.26 ? 376 HIS A CD2 1 
ATOM   758 C CE1 . HIS A 1 97  ? -0.533  3.778  -21.451 1.00 23.52 ? 376 HIS A CE1 1 
ATOM   759 N NE2 . HIS A 1 97  ? 0.580   3.114  -21.696 1.00 23.13 ? 376 HIS A NE2 1 
ATOM   760 N N   . GLY A 1 98  ? 3.090   8.807  -19.916 1.00 16.68 ? 377 GLY A N   1 
ATOM   761 C CA  . GLY A 1 98  ? 3.671   10.145 -19.786 1.00 16.50 ? 377 GLY A CA  1 
ATOM   762 C C   . GLY A 1 98  ? 4.977   10.118 -19.011 1.00 16.34 ? 377 GLY A C   1 
ATOM   763 O O   . GLY A 1 98  ? 5.838   10.925 -19.329 1.00 17.59 ? 377 GLY A O   1 
ATOM   764 N N   . ILE A 1 99  ? 5.091   9.248  -18.038 1.00 16.19 ? 378 ILE A N   1 
ATOM   765 C CA  . ILE A 1 99  ? 6.340   9.090  -17.220 1.00 17.20 ? 378 ILE A CA  1 
ATOM   766 C C   . ILE A 1 99  ? 7.505   8.715  -18.177 1.00 17.25 ? 378 ILE A C   1 
ATOM   767 O O   . ILE A 1 99  ? 8.602   9.263  -18.094 1.00 17.05 ? 378 ILE A O   1 
ATOM   768 C CB  . ILE A 1 99  ? 6.207   8.054  -16.094 1.00 18.22 ? 378 ILE A CB  1 
ATOM   769 C CG1 . ILE A 1 99  ? 5.230   8.498  -14.961 1.00 20.67 ? 378 ILE A CG1 1 
ATOM   770 C CG2 . ILE A 1 99  ? 7.589   7.692  -15.522 1.00 19.32 ? 378 ILE A CG2 1 
ATOM   771 C CD1 . ILE A 1 99  ? 5.610   9.752  -14.224 1.00 21.45 ? 378 ILE A CD1 1 
ATOM   772 N N   . ALA A 1 100 ? 7.284   7.821  -19.123 1.00 16.50 ? 379 ALA A N   1 
ATOM   773 C CA  . ALA A 1 100 ? 8.391   7.457  -20.038 1.00 16.69 ? 379 ALA A CA  1 
ATOM   774 C C   . ALA A 1 100 ? 8.932   8.619  -20.791 1.00 17.97 ? 379 ALA A C   1 
ATOM   775 O O   . ALA A 1 100 ? 10.100  8.710  -21.127 1.00 19.51 ? 379 ALA A O   1 
ATOM   776 C CB  . ALA A 1 100 ? 7.944   6.420  -21.063 1.00 17.82 ? 379 ALA A CB  1 
ATOM   777 N N   . GLN A 1 101 ? 8.033   9.487  -21.261 1.00 17.80 ? 380 GLN A N   1 
ATOM   778 C CA  . GLN A 1 101 ? 8.464   10.680 -21.902 1.00 19.78 ? 380 GLN A CA  1 
ATOM   779 C C   . GLN A 1 101 ? 9.232   11.628 -20.970 1.00 20.17 ? 380 GLN A C   1 
ATOM   780 O O   . GLN A 1 101 ? 10.219  12.271 -21.416 1.00 20.36 ? 380 GLN A O   1 
ATOM   781 C CB  . GLN A 1 101 ? 7.297   11.408 -22.569 1.00 21.75 ? 380 GLN A CB  1 
ATOM   782 C CG  . GLN A 1 101 ? 6.878   10.746 -23.839 1.00 24.50 ? 380 GLN A CG  1 
ATOM   783 C CD  . GLN A 1 101 ? 5.957   11.625 -24.611 1.00 26.32 ? 380 GLN A CD  1 
ATOM   784 O OE1 . GLN A 1 101 ? 5.475   12.592 -24.065 1.00 27.65 ? 380 GLN A OE1 1 
ATOM   785 N NE2 . GLN A 1 101 ? 5.662   11.281 -25.783 1.00 27.81 ? 380 GLN A NE2 1 
ATOM   786 N N   . ALA A 1 102 ? 8.711   11.771 -19.761 1.00 21.55 ? 381 ALA A N   1 
ATOM   787 C CA  . ALA A 1 102 ? 9.327   12.621 -18.698 1.00 23.32 ? 381 ALA A CA  1 
ATOM   788 C C   . ALA A 1 102 ? 10.721  12.184 -18.332 1.00 25.33 ? 381 ALA A C   1 
ATOM   789 O O   . ALA A 1 102 ? 11.546  13.021 -17.935 1.00 28.29 ? 381 ALA A O   1 
ATOM   790 C CB  . ALA A 1 102 ? 8.463   12.625 -17.455 1.00 21.42 ? 381 ALA A CB  1 
ATOM   791 N N   . LEU A 1 103 ? 11.049  10.918 -18.565 1.00 24.92 ? 382 LEU A N   1 
ATOM   792 C CA  . LEU A 1 103 ? 12.469  10.467 -18.417 1.00 25.46 ? 382 LEU A CA  1 
ATOM   793 C C   . LEU A 1 103 ? 13.440  10.864 -19.501 1.00 28.34 ? 382 LEU A C   1 
ATOM   794 O O   . LEU A 1 103 ? 14.626  10.779 -19.286 1.00 31.83 ? 382 LEU A O   1 
ATOM   795 C CB  . LEU A 1 103 ? 12.591  8.942  -18.264 1.00 25.73 ? 382 LEU A CB  1 
ATOM   796 C CG  . LEU A 1 103 ? 11.683  8.285  -17.295 1.00 26.64 ? 382 LEU A CG  1 
ATOM   797 C CD1 . LEU A 1 103 ? 11.883  6.761  -17.290 1.00 29.04 ? 382 LEU A CD1 1 
ATOM   798 C CD2 . LEU A 1 103 ? 11.760  8.798  -15.884 1.00 28.23 ? 382 LEU A CD2 1 
ATOM   799 N N   . GLN A 1 104 ? 12.999  11.236 -20.690 1.00 27.42 ? 383 GLN A N   1 
ATOM   800 C CA  . GLN A 1 104 ? 13.928  11.558 -21.773 1.00 29.36 ? 383 GLN A CA  1 
ATOM   801 C C   . GLN A 1 104 ? 14.487  13.028 -21.755 1.00 36.43 ? 383 GLN A C   1 
ATOM   802 O O   . GLN A 1 104 ? 13.849  13.927 -21.141 1.00 36.14 ? 383 GLN A O   1 
ATOM   803 C CB  . GLN A 1 104 ? 13.226  11.326 -23.085 1.00 29.89 ? 383 GLN A CB  1 
ATOM   804 C CG  . GLN A 1 104 ? 12.404  10.059 -23.128 1.00 27.37 ? 383 GLN A CG  1 
ATOM   805 C CD  . GLN A 1 104 ? 13.247  8.886  -22.826 1.00 27.23 ? 383 GLN A CD  1 
ATOM   806 O OE1 . GLN A 1 104 ? 14.405  8.813  -23.325 1.00 29.66 ? 383 GLN A OE1 1 
ATOM   807 N NE2 . GLN A 1 104 ? 12.703  7.937  -22.090 1.00 26.20 ? 383 GLN A NE2 1 
HETATM 808 O O   . HOH B 2 .   ? -1.893  20.466 4.208   1.00 17.03 ? 401 HOH A O   1 
HETATM 809 O O   . HOH B 2 .   ? 6.231   18.764 -13.191 1.00 29.01 ? 402 HOH A O   1 
HETATM 810 O O   . HOH B 2 .   ? 6.637   20.232 -9.847  1.00 17.53 ? 403 HOH A O   1 
HETATM 811 O O   . HOH B 2 .   ? 11.999  15.896 -11.619 1.00 15.57 ? 404 HOH A O   1 
HETATM 812 O O   . HOH B 2 .   ? -11.137 5.690  -11.048 1.00 35.76 ? 405 HOH A O   1 
HETATM 813 O O   . HOH B 2 .   ? 5.444   7.015  -23.830 1.00 14.34 ? 406 HOH A O   1 
HETATM 814 O O   . HOH B 2 .   ? 5.758   9.973  -29.183 0.50 11.82 ? 407 HOH A O   1 
HETATM 815 O O   . HOH B 2 .   ? 5.438   2.433  -0.962  1.00 13.91 ? 408 HOH A O   1 
HETATM 816 O O   . HOH B 2 .   ? 6.148   4.320  0.860   1.00 14.74 ? 409 HOH A O   1 
HETATM 817 O O   . HOH B 2 .   ? 4.449   0.000  0.000   0.50 15.66 ? 410 HOH A O   1 
HETATM 818 O O   . HOH B 2 .   ? -2.149  0.000  0.000   0.50 41.12 ? 411 HOH A O   1 
HETATM 819 O O   . HOH B 2 .   ? 0.676   0.043  -6.669  1.00 19.73 ? 412 HOH A O   1 
HETATM 820 O O   . HOH B 2 .   ? -0.367  15.411 9.347   1.00 25.03 ? 413 HOH A O   1 
HETATM 821 O O   . HOH B 2 .   ? -3.813  14.525 6.527   1.00 30.55 ? 414 HOH A O   1 
HETATM 822 O O   . HOH B 2 .   ? 0.650   20.161 5.399   1.00 19.45 ? 415 HOH A O   1 
HETATM 823 O O   . HOH B 2 .   ? 2.617   21.970 4.945   1.00 23.64 ? 416 HOH A O   1 
HETATM 824 O O   . HOH B 2 .   ? 10.664  24.558 5.371   1.00 31.79 ? 417 HOH A O   1 
HETATM 825 O O   . HOH B 2 .   ? 14.197  21.640 6.145   1.00 29.88 ? 418 HOH A O   1 
HETATM 826 O O   . HOH B 2 .   ? 11.047  15.771 7.077   1.00 42.02 ? 419 HOH A O   1 
HETATM 827 O O   . HOH B 2 .   ? 11.118  16.860 2.463   1.00 22.81 ? 420 HOH A O   1 
HETATM 828 O O   . HOH B 2 .   ? 14.301  10.507 -7.141  1.00 25.74 ? 421 HOH A O   1 
HETATM 829 O O   . HOH B 2 .   ? 16.297  8.310  -3.465  1.00 34.75 ? 422 HOH A O   1 
HETATM 830 O O   . HOH B 2 .   ? 14.435  3.983  -2.281  1.00 31.05 ? 423 HOH A O   1 
HETATM 831 O O   . HOH B 2 .   ? 19.273  17.624 -10.765 1.00 27.43 ? 424 HOH A O   1 
HETATM 832 O O   . HOH B 2 .   ? 19.852  14.677 -14.178 1.00 28.59 ? 425 HOH A O   1 
HETATM 833 O O   . HOH B 2 .   ? 21.060  12.163 -14.591 0.50 47.79 ? 426 HOH A O   1 
HETATM 834 O O   . HOH B 2 .   ? 22.820  12.121 -10.450 1.00 39.78 ? 427 HOH A O   1 
HETATM 835 O O   . HOH B 2 .   ? 21.054  11.848 -4.609  1.00 23.14 ? 428 HOH A O   1 
HETATM 836 O O   . HOH B 2 .   ? 14.798  24.418 -5.573  1.00 36.25 ? 429 HOH A O   1 
HETATM 837 O O   . HOH B 2 .   ? 3.902   22.567 -6.276  1.00 27.82 ? 430 HOH A O   1 
HETATM 838 O O   . HOH B 2 .   ? 2.144   24.726 -6.122  1.00 38.05 ? 431 HOH A O   1 
HETATM 839 O O   . HOH B 2 .   ? -0.486  24.416 -6.781  1.00 27.96 ? 432 HOH A O   1 
HETATM 840 O O   . HOH B 2 .   ? -4.228  27.529 0.218   1.00 32.48 ? 433 HOH A O   1 
HETATM 841 O O   . HOH B 2 .   ? -2.038  8.020  -21.656 1.00 22.09 ? 434 HOH A O   1 
HETATM 842 O O   . HOH B 2 .   ? -4.402  11.985 -19.233 1.00 31.61 ? 435 HOH A O   1 
HETATM 843 O O   . HOH B 2 .   ? -8.335  10.553 -4.808  1.00 27.90 ? 436 HOH A O   1 
HETATM 844 O O   . HOH B 2 .   ? -9.051  27.812 -0.042  1.00 33.13 ? 437 HOH A O   1 
HETATM 845 O O   . HOH B 2 .   ? 2.539   10.508 8.661   1.00 34.70 ? 438 HOH A O   1 
HETATM 846 O O   . HOH B 2 .   ? -5.810  8.001  2.278   1.00 34.14 ? 439 HOH A O   1 
HETATM 847 O O   . HOH B 2 .   ? 9.095   25.758 4.432   1.00 43.87 ? 440 HOH A O   1 
HETATM 848 O O   . HOH B 2 .   ? -4.684  14.080 -12.536 1.00 35.34 ? 441 HOH A O   1 
HETATM 849 O O   . HOH B 2 .   ? -8.172  12.319 -12.989 1.00 31.90 ? 442 HOH A O   1 
HETATM 850 O O   . HOH B 2 .   ? 6.279   16.993 -16.526 1.00 43.57 ? 443 HOH A O   1 
HETATM 851 O O   . HOH B 2 .   ? 11.023  15.732 -17.480 1.00 34.91 ? 444 HOH A O   1 
HETATM 852 O O   . HOH B 2 .   ? 12.137  9.223  -8.208  1.00 24.35 ? 445 HOH A O   1 
HETATM 853 O O   . HOH B 2 .   ? 1.949   0.000  0.000   0.50 4.54  ? 446 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . ILE A 7   ? 0.3578 0.3750 0.3131 -0.0360 0.0592  0.0407  286 ILE A N   
2   C CA  . ILE A 7   ? 0.3497 0.3775 0.3251 -0.0345 0.0527  0.0304  286 ILE A CA  
3   C C   . ILE A 7   ? 0.3207 0.3538 0.3173 -0.0429 0.0583  0.0286  286 ILE A C   
4   O O   . ILE A 7   ? 0.3095 0.3499 0.3113 -0.0495 0.0695  0.0295  286 ILE A O   
5   C CB  . ILE A 7   ? 0.4169 0.4602 0.3940 -0.0296 0.0542  0.0216  286 ILE A CB  
6   C CG1 . ILE A 7   ? 0.3825 0.4336 0.3744 -0.0252 0.0466  0.0124  286 ILE A CG1 
7   C CG2 . ILE A 7   ? 0.4707 0.5278 0.4543 -0.0344 0.0674  0.0204  286 ILE A CG2 
8   C CD1 . ILE A 7   ? 0.4062 0.4466 0.3908 -0.0199 0.0359  0.0120  286 ILE A CD1 
9   N N   . GLN A 8   ? 0.2623 0.2932 0.2717 -0.0430 0.0510  0.0248  287 GLN A N   
10  C CA  . GLN A 8   ? 0.2411 0.2805 0.2727 -0.0505 0.0541  0.0193  287 GLN A CA  
11  C C   . GLN A 8   ? 0.2201 0.2787 0.2668 -0.0460 0.0489  0.0076  287 GLN A C   
12  O O   . GLN A 8   ? 0.2041 0.2648 0.2438 -0.0371 0.0426  0.0048  287 GLN A O   
13  C CB  . GLN A 8   ? 0.2621 0.2853 0.2972 -0.0537 0.0498  0.0219  287 GLN A CB  
14  C CG  . GLN A 8   ? 0.3105 0.3118 0.3298 -0.0563 0.0543  0.0342  287 GLN A CG  
15  C CD  . GLN A 8   ? 0.3606 0.3592 0.3821 -0.0671 0.0680  0.0392  287 GLN A CD  
16  O OE1 . GLN A 8   ? 0.3561 0.3669 0.3975 -0.0759 0.0737  0.0325  287 GLN A OE1 
17  N NE2 . GLN A 8   ? 0.4135 0.3963 0.4136 -0.0665 0.0737  0.0513  287 GLN A NE2 
18  N N   . ARG A 9   ? 0.2026 0.2743 0.2707 -0.0523 0.0510  0.0006  288 ARG A N   
19  C CA  . ARG A 9   ? 0.2019 0.2938 0.2852 -0.0468 0.0450  -0.0108 288 ARG A CA  
20  C C   . ARG A 9   ? 0.1893 0.2721 0.2663 -0.0386 0.0330  -0.0128 288 ARG A C   
21  O O   . ARG A 9   ? 0.1861 0.2552 0.2614 -0.0415 0.0300  -0.0103 288 ARG A O   
22  C CB  . ARG A 9   ? 0.2259 0.3338 0.3348 -0.0570 0.0487  -0.0185 288 ARG A CB  
23  C CG  . ARG A 9   ? 0.2573 0.3851 0.3832 -0.0517 0.0395  -0.0312 288 ARG A CG  
24  C CD  . ARG A 9   ? 0.2862 0.4358 0.4402 -0.0627 0.0440  -0.0404 288 ARG A CD  
25  N NE  . ARG A 9   ? 0.3712 0.5490 0.5372 -0.0571 0.0461  -0.0475 288 ARG A NE  
26  C CZ  . ARG A 9   ? 0.4108 0.6072 0.5905 -0.0639 0.0579  -0.0490 288 ARG A CZ  
27  N NH1 . ARG A 9   ? 0.4599 0.6523 0.6466 -0.0800 0.0711  -0.0444 288 ARG A NH1 
28  N NH2 . ARG A 9   ? 0.5005 0.7218 0.6889 -0.0539 0.0569  -0.0563 288 ARG A NH2 
29  N N   . PRO A 10  ? 0.1730 0.2620 0.2452 -0.0278 0.0271  -0.0170 289 PRO A N   
30  C CA  . PRO A 10  ? 0.1647 0.2446 0.2298 -0.0204 0.0175  -0.0182 289 PRO A CA  
31  C C   . PRO A 10  ? 0.1536 0.2385 0.2330 -0.0238 0.0129  -0.0246 289 PRO A C   
32  O O   . PRO A 10  ? 0.1560 0.2594 0.2533 -0.0273 0.0140  -0.0323 289 PRO A O   
33  C CB  . PRO A 10  ? 0.1874 0.2756 0.2486 -0.0094 0.0144  -0.0226 289 PRO A CB  
34  C CG  . PRO A 10  ? 0.1925 0.2853 0.2501 -0.0103 0.0222  -0.0205 289 PRO A CG  
35  C CD  . PRO A 10  ? 0.2051 0.3071 0.2762 -0.0215 0.0303  -0.0200 289 PRO A CD  
36  N N   . GLY A 11  ? 0.1425 0.2128 0.2150 -0.0229 0.0081  -0.0225 290 GLY A N   
37  C CA  . GLY A 11  ? 0.1404 0.2124 0.2220 -0.0246 0.0030  -0.0292 290 GLY A CA  
38  C C   . GLY A 11  ? 0.1413 0.2081 0.2336 -0.0366 0.0077  -0.0292 290 GLY A C   
39  O O   . GLY A 11  ? 0.1469 0.2154 0.2488 -0.0397 0.0039  -0.0367 290 GLY A O   
40  N N   . SER A 12  ? 0.1441 0.2042 0.2347 -0.0437 0.0164  -0.0215 291 SER A N   
41  C CA  . SER A 12  ? 0.1538 0.2069 0.2543 -0.0559 0.0226  -0.0209 291 SER A CA  
42  C C   . SER A 12  ? 0.1586 0.1872 0.2493 -0.0561 0.0212  -0.0151 291 SER A C   
43  O O   . SER A 12  ? 0.1558 0.1741 0.2315 -0.0479 0.0176  -0.0092 291 SER A O   
44  C CB  . SER A 12  ? 0.1706 0.2249 0.2714 -0.0636 0.0342  -0.0140 291 SER A CB  
45  O OG  . SER A 12  ? 0.2136 0.2529 0.2940 -0.0584 0.0355  -0.0029 291 SER A OG  
46  N N   . GLY A 13  ? 0.1731 0.1928 0.2737 -0.0658 0.0244  -0.0177 292 GLY A N   
47  C CA  . GLY A 13  ? 0.1938 0.1882 0.2864 -0.0661 0.0242  -0.0128 292 GLY A CA  
48  C C   . GLY A 13  ? 0.2169 0.1931 0.2949 -0.0665 0.0310  0.0014  292 GLY A C   
49  O O   . GLY A 13  ? 0.2430 0.2013 0.3094 -0.0604 0.0281  0.0073  292 GLY A O   
50  N N   . GLN A 14  ? 0.2235 0.2058 0.3010 -0.0721 0.0393  0.0066  293 GLN A N   
51  C CA  . GLN A 14  ? 0.2677 0.2342 0.3273 -0.0711 0.0456  0.0208  293 GLN A CA  
52  C C   . GLN A 14  ? 0.2407 0.2099 0.2834 -0.0594 0.0402  0.0264  293 GLN A C   
53  O O   . GLN A 14  ? 0.2474 0.2047 0.2739 -0.0570 0.0433  0.0371  293 GLN A O   
54  C CB  . GLN A 14  ? 0.3423 0.3144 0.4062 -0.0819 0.0581  0.0240  293 GLN A CB  
55  C CG  . GLN A 14  ? 0.4556 0.4142 0.5310 -0.0954 0.0660  0.0232  293 GLN A CG  
56  C CD  . GLN A 14  ? 0.5631 0.5368 0.6532 -0.1089 0.0785  0.0209  293 GLN A CD  
57  O OE1 . GLN A 14  ? 0.6074 0.6093 0.7070 -0.1076 0.0786  0.0143  293 GLN A OE1 
58  N NE2 . GLN A 14  ? 0.6386 0.5939 0.7322 -0.1222 0.0895  0.0254  293 GLN A NE2 
59  N N   . ILE A 15  ? 0.1954 0.1796 0.2413 -0.0524 0.0324  0.0190  294 ILE A N   
60  C CA  . ILE A 15  ? 0.1893 0.1773 0.2218 -0.0430 0.0275  0.0222  294 ILE A CA  
61  C C   . ILE A 15  ? 0.1962 0.1677 0.2155 -0.0372 0.0238  0.0303  294 ILE A C   
62  O O   . ILE A 15  ? 0.1944 0.1533 0.2163 -0.0362 0.0214  0.0306  294 ILE A O   
63  C CB  . ILE A 15  ? 0.1791 0.1810 0.2181 -0.0374 0.0203  0.0127  294 ILE A CB  
64  C CG1 . ILE A 15  ? 0.1693 0.1779 0.1979 -0.0307 0.0177  0.0137  294 ILE A CG1 
65  C CG2 . ILE A 15  ? 0.1711 0.1652 0.2117 -0.0334 0.0139  0.0100  294 ILE A CG2 
66  C CD1 . ILE A 15  ? 0.1666 0.1868 0.1997 -0.0257 0.0131  0.0057  294 ILE A CD1 
67  N N   . GLN A 16  ? 0.2006 0.1725 0.2057 -0.0324 0.0228  0.0362  295 GLN A N   
68  C CA  . GLN A 16  ? 0.2193 0.1822 0.2141 -0.0249 0.0168  0.0418  295 GLN A CA  
69  C C   . GLN A 16  ? 0.1846 0.1563 0.1837 -0.0190 0.0089  0.0356  295 GLN A C   
70  O O   . GLN A 16  ? 0.1694 0.1525 0.1729 -0.0193 0.0080  0.0292  295 GLN A O   
71  C CB  . GLN A 16  ? 0.2435 0.2038 0.2206 -0.0222 0.0178  0.0500  295 GLN A CB  
72  C CG  . GLN A 16  ? 0.3041 0.2527 0.2732 -0.0279 0.0274  0.0583  295 GLN A CG  
73  C CD  . GLN A 16  ? 0.3809 0.3094 0.3502 -0.0281 0.0286  0.0641  295 GLN A CD  
74  O OE1 . GLN A 16  ? 0.5029 0.4246 0.4828 -0.0364 0.0351  0.0624  295 GLN A OE1 
75  N NE2 . GLN A 16  ? 0.4259 0.3451 0.3849 -0.0187 0.0217  0.0699  295 GLN A NE2 
76  N N   . LEU A 17  ? 0.1844 0.1501 0.1815 -0.0130 0.0038  0.0383  296 LEU A N   
77  C CA  . LEU A 17  ? 0.1729 0.1470 0.1753 -0.0085 -0.0019 0.0328  296 LEU A CA  
78  C C   . LEU A 17  ? 0.1695 0.1553 0.1679 -0.0082 -0.0039 0.0298  296 LEU A C   
79  O O   . LEU A 17  ? 0.1641 0.1563 0.1676 -0.0081 -0.0049 0.0239  296 LEU A O   
80  C CB  . LEU A 17  ? 0.1809 0.1498 0.1829 -0.0017 -0.0063 0.0361  296 LEU A CB  
81  C CG  . LEU A 17  ? 0.1840 0.1628 0.1932 0.0024  -0.0105 0.0308  296 LEU A CG  
82  C CD1 . LEU A 17  ? 0.1735 0.1542 0.1907 0.0005  -0.0085 0.0236  296 LEU A CD1 
83  C CD2 . LEU A 17  ? 0.2086 0.1845 0.2194 0.0100  -0.0144 0.0340  296 LEU A CD2 
84  N N   . TRP A 18  ? 0.1998 0.1867 0.1874 -0.0074 -0.0047 0.0340  297 TRP A N   
85  C CA  . TRP A 18  ? 0.1965 0.1922 0.1793 -0.0076 -0.0067 0.0299  297 TRP A CA  
86  C C   . TRP A 18  ? 0.1826 0.1822 0.1685 -0.0107 -0.0026 0.0245  297 TRP A C   
87  O O   . TRP A 18  ? 0.1910 0.1944 0.1789 -0.0101 -0.0042 0.0192  297 TRP A O   
88  C CB  . TRP A 18  ? 0.2228 0.2184 0.1911 -0.0061 -0.0082 0.0344  297 TRP A CB  
89  C CG  . TRP A 18  ? 0.2313 0.2226 0.1907 -0.0089 -0.0013 0.0385  297 TRP A CG  
90  C CD1 . TRP A 18  ? 0.2630 0.2444 0.2157 -0.0090 0.0022  0.0467  297 TRP A CD1 
91  C CD2 . TRP A 18  ? 0.2440 0.2404 0.1999 -0.0118 0.0040  0.0348  297 TRP A CD2 
92  N NE1 . TRP A 18  ? 0.2761 0.2570 0.2228 -0.0134 0.0107  0.0486  297 TRP A NE1 
93  C CE2 . TRP A 18  ? 0.2576 0.2494 0.2066 -0.0145 0.0113  0.0407  297 TRP A CE2 
94  C CE3 . TRP A 18  ? 0.2411 0.2444 0.1992 -0.0120 0.0038  0.0269  297 TRP A CE3 
95  C CZ2 . TRP A 18  ? 0.2699 0.2675 0.2159 -0.0172 0.0187  0.0384  297 TRP A CZ2 
96  C CZ3 . TRP A 18  ? 0.2391 0.2464 0.1928 -0.0133 0.0101  0.0247  297 TRP A CZ3 
97  C CH2 . TRP A 18  ? 0.2650 0.2713 0.2145 -0.0159 0.0174  0.0298  297 TRP A CH2 
98  N N   . GLN A 19  ? 0.1801 0.1787 0.1681 -0.0138 0.0029  0.0253  298 GLN A N   
99  C CA  . GLN A 19  ? 0.1703 0.1757 0.1624 -0.0152 0.0062  0.0197  298 GLN A CA  
100 C C   . GLN A 19  ? 0.1535 0.1610 0.1562 -0.0141 0.0042  0.0143  298 GLN A C   
101 O O   . GLN A 19  ? 0.1371 0.1494 0.1407 -0.0117 0.0036  0.0092  298 GLN A O   
102 C CB  . GLN A 19  ? 0.1745 0.1819 0.1677 -0.0195 0.0133  0.0216  298 GLN A CB  
103 C CG  . GLN A 19  ? 0.1859 0.2046 0.1849 -0.0194 0.0163  0.0150  298 GLN A CG  
104 C CD  . GLN A 19  ? 0.1906 0.2159 0.1963 -0.0247 0.0242  0.0150  298 GLN A CD  
105 O OE1 . GLN A 19  ? 0.2324 0.2519 0.2332 -0.0292 0.0296  0.0216  298 GLN A OE1 
106 N NE2 . GLN A 19  ? 0.2131 0.2515 0.2292 -0.0236 0.0255  0.0077  298 GLN A NE2 
107 N N   . PHE A 20  ? 0.1344 0.1369 0.1431 -0.0147 0.0030  0.0155  299 PHE A N   
108 C CA  . PHE A 20  ? 0.1357 0.1395 0.1517 -0.0128 0.0007  0.0100  299 PHE A CA  
109 C C   . PHE A 20  ? 0.1337 0.1380 0.1454 -0.0087 -0.0023 0.0084  299 PHE A C   
110 O O   . PHE A 20  ? 0.1258 0.1325 0.1376 -0.0062 -0.0030 0.0041  299 PHE A O   
111 C CB  . PHE A 20  ? 0.1442 0.1406 0.1654 -0.0137 0.0002  0.0111  299 PHE A CB  
112 C CG  . PHE A 20  ? 0.1397 0.1365 0.1659 -0.0111 -0.0024 0.0050  299 PHE A CG  
113 C CD1 . PHE A 20  ? 0.1429 0.1444 0.1757 -0.0127 -0.0026 -0.0016 299 PHE A CD1 
114 C CD2 . PHE A 20  ? 0.1591 0.1526 0.1835 -0.0069 -0.0044 0.0055  299 PHE A CD2 
115 C CE1 . PHE A 20  ? 0.1484 0.1499 0.1825 -0.0093 -0.0056 -0.0075 299 PHE A CE1 
116 C CE2 . PHE A 20  ? 0.1574 0.1508 0.1837 -0.0039 -0.0058 0.0000  299 PHE A CE2 
117 C CZ  . PHE A 20  ? 0.1476 0.1441 0.1774 -0.0049 -0.0066 -0.0063 299 PHE A CZ  
118 N N   . LEU A 21  ? 0.1527 0.1548 0.1606 -0.0080 -0.0040 0.0118  300 LEU A N   
119 C CA  . LEU A 21  ? 0.1452 0.1482 0.1509 -0.0062 -0.0054 0.0100  300 LEU A CA  
120 C C   . LEU A 21  ? 0.1541 0.1573 0.1533 -0.0063 -0.0044 0.0076  300 LEU A C   
121 O O   . LEU A 21  ? 0.1374 0.1380 0.1344 -0.0046 -0.0037 0.0051  300 LEU A O   
122 C CB  . LEU A 21  ? 0.1536 0.1579 0.1600 -0.0061 -0.0079 0.0128  300 LEU A CB  
123 C CG  . LEU A 21  ? 0.1727 0.1757 0.1851 -0.0037 -0.0092 0.0150  300 LEU A CG  
124 C CD1 . LEU A 21  ? 0.2026 0.2104 0.2162 -0.0019 -0.0129 0.0174  300 LEU A CD1 
125 C CD2 . LEU A 21  ? 0.1790 0.1813 0.1965 -0.0016 -0.0077 0.0114  300 LEU A CD2 
126 N N   . LEU A 22  ? 0.1473 0.1519 0.1418 -0.0076 -0.0035 0.0083  301 LEU A N   
127 C CA  . LEU A 22  ? 0.1674 0.1711 0.1555 -0.0064 -0.0021 0.0050  301 LEU A CA  
128 C C   . LEU A 22  ? 0.1539 0.1592 0.1447 -0.0027 -0.0008 0.0017  301 LEU A C   
129 O O   . LEU A 22  ? 0.1635 0.1645 0.1491 0.0008  -0.0006 -0.0008 301 LEU A O   
130 C CB  . LEU A 22  ? 0.1864 0.1924 0.1681 -0.0075 -0.0005 0.0055  301 LEU A CB  
131 C CG  . LEU A 22  ? 0.1955 0.2005 0.1701 -0.0093 -0.0030 0.0069  301 LEU A CG  
132 C CD1 . LEU A 22  ? 0.2179 0.2252 0.1838 -0.0093 -0.0002 0.0078  301 LEU A CD1 
133 C CD2 . LEU A 22  ? 0.2031 0.2039 0.1740 -0.0101 -0.0050 0.0025  301 LEU A CD2 
134 N N   . GLU A 23  ? 0.1599 0.1708 0.1587 -0.0032 -0.0004 0.0014  302 GLU A N   
135 C CA  . GLU A 23  ? 0.1602 0.1765 0.1636 0.0006  -0.0009 -0.0031 302 GLU A CA  
136 C C   . GLU A 23  ? 0.1508 0.1612 0.1500 0.0050  -0.0034 -0.0041 302 GLU A C   
137 O O   . GLU A 23  ? 0.1666 0.1765 0.1613 0.0111  -0.0043 -0.0068 302 GLU A O   
138 C CB  . GLU A 23  ? 0.1794 0.2026 0.1941 -0.0033 -0.0003 -0.0041 302 GLU A CB  
139 C CG  . GLU A 23  ? 0.2409 0.2740 0.2634 -0.0003 -0.0020 -0.0104 302 GLU A CG  
140 C CD  . GLU A 23  ? 0.2855 0.3257 0.3215 -0.0069 -0.0005 -0.0127 302 GLU A CD  
141 O OE1 . GLU A 23  ? 0.2853 0.3282 0.3249 -0.0126 0.0046  -0.0102 302 GLU A OE1 
142 O OE2 . GLU A 23  ? 0.3240 0.3657 0.3653 -0.0064 -0.0041 -0.0171 302 GLU A OE2 
143 N N   . LEU A 24  ? 0.1333 0.1396 0.1335 0.0030  -0.0040 -0.0020 303 LEU A N   
144 C CA  . LEU A 24  ? 0.1482 0.1492 0.1431 0.0068  -0.0045 -0.0026 303 LEU A CA  
145 C C   . LEU A 24  ? 0.1479 0.1400 0.1328 0.0079  -0.0024 -0.0008 303 LEU A C   
146 O O   . LEU A 24  ? 0.1650 0.1507 0.1415 0.0128  -0.0018 -0.0010 303 LEU A O   
147 C CB  . LEU A 24  ? 0.1635 0.1632 0.1624 0.0046  -0.0043 -0.0011 303 LEU A CB  
148 C CG  . LEU A 24  ? 0.2029 0.2061 0.2100 0.0036  -0.0059 -0.0032 303 LEU A CG  
149 C CD1 . LEU A 24  ? 0.2085 0.2087 0.2177 0.0036  -0.0052 -0.0020 303 LEU A CD1 
150 C CD2 . LEU A 24  ? 0.2445 0.2514 0.2520 0.0071  -0.0083 -0.0087 303 LEU A CD2 
151 N N   . LEU A 25  ? 0.1349 0.1257 0.1200 0.0033  -0.0014 0.0008  304 LEU A N   
152 C CA  . LEU A 25  ? 0.1493 0.1304 0.1264 0.0021  0.0007  0.0012  304 LEU A CA  
153 C C   . LEU A 25  ? 0.1751 0.1496 0.1435 0.0073  0.0014  -0.0007 304 LEU A C   
154 O O   . LEU A 25  ? 0.1766 0.1379 0.1355 0.0087  0.0038  -0.0003 304 LEU A O   
155 C CB  . LEU A 25  ? 0.1420 0.1256 0.1221 -0.0041 0.0001  0.0015  304 LEU A CB  
156 C CG  . LEU A 25  ? 0.1429 0.1319 0.1310 -0.0081 -0.0005 0.0032  304 LEU A CG  
157 C CD1 . LEU A 25  ? 0.1620 0.1576 0.1533 -0.0116 -0.0037 0.0033  304 LEU A CD1 
158 C CD2 . LEU A 25  ? 0.1534 0.1368 0.1406 -0.0107 0.0031  0.0031  304 LEU A CD2 
159 N N   . SER A 26  ? 0.1656 0.1486 0.1374 0.0102  0.0000  -0.0029 305 SER A N   
160 C CA  . SER A 26  ? 0.1827 0.1624 0.1482 0.0168  0.0004  -0.0055 305 SER A CA  
161 C C   . SER A 26  ? 0.1920 0.1656 0.1505 0.0259  -0.0007 -0.0057 305 SER A C   
162 O O   . SER A 26  ? 0.2266 0.1928 0.1770 0.0332  -0.0004 -0.0071 305 SER A O   
163 C CB  . SER A 26  ? 0.2038 0.1986 0.1777 0.0175  0.0002  -0.0083 305 SER A CB  
164 O OG  . SER A 26  ? 0.2206 0.2269 0.2038 0.0197  -0.0020 -0.0098 305 SER A OG  
165 N N   . ASP A 27  ? 0.1845 0.1618 0.1454 0.0267  -0.0025 -0.0047 306 ASP A N   
166 C CA  . ASP A 27  ? 0.1938 0.1662 0.1455 0.0361  -0.0044 -0.0046 306 ASP A CA  
167 C C   . ASP A 27  ? 0.1890 0.1467 0.1303 0.0339  -0.0007 0.0000  306 ASP A C   
168 O O   . ASP A 27  ? 0.1724 0.1346 0.1188 0.0291  -0.0001 0.0008  306 ASP A O   
169 C CB  . ASP A 27  ? 0.2134 0.2027 0.1752 0.0384  -0.0092 -0.0087 306 ASP A CB  
170 C CG  . ASP A 27  ? 0.2767 0.2643 0.2284 0.0492  -0.0132 -0.0098 306 ASP A CG  
171 O OD1 . ASP A 27  ? 0.2846 0.2557 0.2193 0.0552  -0.0113 -0.0057 306 ASP A OD1 
172 O OD2 . ASP A 27  ? 0.3019 0.3048 0.2620 0.0517  -0.0184 -0.0152 306 ASP A OD2 
173 N N   . SER A 28  ? 0.1996 0.1386 0.1263 0.0373  0.0027  0.0031  307 SER A N   
174 C CA  . SER A 28  ? 0.2257 0.1491 0.1424 0.0334  0.0087  0.0081  307 SER A CA  
175 C C   . SER A 28  ? 0.2218 0.1473 0.1325 0.0380  0.0084  0.0098  307 SER A C   
176 O O   . SER A 28  ? 0.2100 0.1301 0.1178 0.0327  0.0142  0.0131  307 SER A O   
177 C CB  . SER A 28  ? 0.2537 0.1524 0.1530 0.0375  0.0130  0.0114  307 SER A CB  
178 O OG  . SER A 28  ? 0.3247 0.2184 0.2110 0.0513  0.0098  0.0124  307 SER A OG  
179 N N   . SER A 29  ? 0.2113 0.1471 0.1213 0.0476  0.0017  0.0065  308 SER A N   
180 C CA  . SER A 29  ? 0.2240 0.1628 0.1273 0.0522  0.0004  0.0064  308 SER A CA  
181 C C   . SER A 29  ? 0.2076 0.1579 0.1239 0.0440  0.0014  0.0042  308 SER A C   
182 O O   . SER A 29  ? 0.2239 0.1730 0.1320 0.0470  0.0026  0.0045  308 SER A O   
183 C CB  . SER A 29  ? 0.2584 0.2068 0.1580 0.0647  -0.0083 0.0018  308 SER A CB  
184 O OG  . SER A 29  ? 0.2603 0.2297 0.1796 0.0611  -0.0139 -0.0053 308 SER A OG  
185 N N   . ASN A 30  ? 0.1791 0.1384 0.1127 0.0349  0.0014  0.0025  309 ASN A N   
186 C CA  . ASN A 30  ? 0.1785 0.1462 0.1244 0.0278  0.0027  0.0014  309 ASN A CA  
187 C C   . ASN A 30  ? 0.1819 0.1438 0.1278 0.0214  0.0100  0.0053  309 ASN A C   
188 O O   . ASN A 30  ? 0.1763 0.1464 0.1335 0.0169  0.0109  0.0042  309 ASN A O   
189 C CB  . ASN A 30  ? 0.1755 0.1547 0.1383 0.0222  -0.0008 -0.0014 309 ASN A CB  
190 C CG  . ASN A 30  ? 0.1905 0.1795 0.1586 0.0260  -0.0067 -0.0065 309 ASN A CG  
191 O OD1 . ASN A 30  ? 0.1949 0.1880 0.1617 0.0301  -0.0098 -0.0105 309 ASN A OD1 
192 N ND2 . ASN A 30  ? 0.1746 0.1690 0.1496 0.0243  -0.0080 -0.0074 309 ASN A ND2 
193 N N   . SER A 31  ? 0.1907 0.1383 0.1241 0.0213  0.0155  0.0097  310 SER A N   
194 C CA  . SER A 31  ? 0.1888 0.1325 0.1263 0.0121  0.0232  0.0125  310 SER A CA  
195 C C   . SER A 31  ? 0.2031 0.1517 0.1424 0.0108  0.0287  0.0131  310 SER A C   
196 O O   . SER A 31  ? 0.2148 0.1682 0.1649 0.0026  0.0339  0.0136  310 SER A O   
197 C CB  . SER A 31  ? 0.2165 0.1414 0.1411 0.0106  0.0286  0.0164  310 SER A CB  
198 O OG  . SER A 31  ? 0.2099 0.1322 0.1377 0.0090  0.0249  0.0145  310 SER A OG  
199 N N   . SER A 32  ? 0.2001 0.1495 0.1301 0.0188  0.0275  0.0120  311 SER A N   
200 C CA  . SER A 32  ? 0.2177 0.1730 0.1493 0.0188  0.0325  0.0112  311 SER A CA  
201 C C   . SER A 32  ? 0.2131 0.1841 0.1648 0.0160  0.0288  0.0066  311 SER A C   
202 O O   . SER A 32  ? 0.2127 0.1902 0.1697 0.0152  0.0343  0.0057  311 SER A O   
203 C CB  . SER A 32  ? 0.2518 0.2028 0.1650 0.0291  0.0315  0.0101  311 SER A CB  
204 O OG  . SER A 32  ? 0.3309 0.2646 0.2212 0.0332  0.0371  0.0163  311 SER A OG  
205 N N   . CYS A 33  ? 0.1843 0.1606 0.1462 0.0149  0.0211  0.0044  312 CYS A N   
206 C CA  . CYS A 33  ? 0.1826 0.1702 0.1620 0.0121  0.0182  0.0019  312 CYS A CA  
207 C C   . CYS A 33  ? 0.1649 0.1570 0.1559 0.0057  0.0161  0.0033  312 CYS A C   
208 O O   . CYS A 33  ? 0.1603 0.1615 0.1642 0.0035  0.0158  0.0028  312 CYS A O   
209 C CB  . CYS A 33  ? 0.2074 0.1977 0.1894 0.0164  0.0119  -0.0026 312 CYS A CB  
210 S SG  . CYS A 33  ? 0.2485 0.2388 0.2320 0.0163  0.0043  -0.0042 312 CYS A SG  
211 N N   . ILE A 34  ? 0.1483 0.1346 0.1342 0.0037  0.0143  0.0048  313 ILE A N   
212 C CA  . ILE A 34  ? 0.1416 0.1318 0.1358 -0.0020 0.0118  0.0053  313 ILE A CA  
213 C C   . ILE A 34  ? 0.1414 0.1210 0.1256 -0.0038 0.0132  0.0063  313 ILE A C   
214 O O   . ILE A 34  ? 0.1573 0.1295 0.1311 0.0015  0.0121  0.0064  313 ILE A O   
215 C CB  . ILE A 34  ? 0.1446 0.1405 0.1454 -0.0009 0.0054  0.0044  313 ILE A CB  
216 C CG1 . ILE A 34  ? 0.1420 0.1424 0.1483 -0.0057 0.0029  0.0052  313 ILE A CG1 
217 C CG2 . ILE A 34  ? 0.1621 0.1545 0.1569 0.0026  0.0026  0.0031  313 ILE A CG2 
218 C CD1 . ILE A 34  ? 0.1485 0.1534 0.1598 -0.0046 -0.0018 0.0061  313 ILE A CD1 
219 N N   . THR A 35  ? 0.1371 0.1159 0.1249 -0.0108 0.0154  0.0063  314 THR A N   
220 C CA  . THR A 35  ? 0.1505 0.1154 0.1280 -0.0129 0.0179  0.0067  314 THR A CA  
221 C C   . THR A 35  ? 0.1531 0.1212 0.1374 -0.0205 0.0160  0.0039  314 THR A C   
222 O O   . THR A 35  ? 0.1385 0.1194 0.1358 -0.0256 0.0149  0.0023  314 THR A O   
223 C CB  . THR A 35  ? 0.1746 0.1266 0.1424 -0.0139 0.0264  0.0096  314 THR A CB  
224 O OG1 . THR A 35  ? 0.1959 0.1288 0.1490 -0.0125 0.0286  0.0110  314 THR A OG1 
225 C CG2 . THR A 35  ? 0.1918 0.1486 0.1698 -0.0234 0.0323  0.0091  314 THR A CG2 
226 N N   . TRP A 36  ? 0.1541 0.1111 0.1297 -0.0207 0.0154  0.0025  315 TRP A N   
227 C CA  . TRP A 36  ? 0.1635 0.1210 0.1431 -0.0286 0.0140  -0.0016 315 TRP A CA  
228 C C   . TRP A 36  ? 0.1831 0.1370 0.1680 -0.0382 0.0201  -0.0028 315 TRP A C   
229 O O   . TRP A 36  ? 0.1789 0.1191 0.1562 -0.0386 0.0275  0.0005  315 TRP A O   
230 C CB  . TRP A 36  ? 0.1847 0.1276 0.1516 -0.0260 0.0133  -0.0038 315 TRP A CB  
231 C CG  . TRP A 36  ? 0.1743 0.1238 0.1387 -0.0188 0.0082  -0.0043 315 TRP A CG  
232 C CD1 . TRP A 36  ? 0.1714 0.1133 0.1262 -0.0103 0.0085  -0.0037 315 TRP A CD1 
233 C CD2 . TRP A 36  ? 0.1511 0.1152 0.1216 -0.0196 0.0029  -0.0057 315 TRP A CD2 
234 N NE1 . TRP A 36  ? 0.1643 0.1170 0.1215 -0.0074 0.0049  -0.0050 315 TRP A NE1 
235 C CE2 . TRP A 36  ? 0.1587 0.1228 0.1232 -0.0131 0.0018  -0.0058 315 TRP A CE2 
236 C CE3 . TRP A 36  ? 0.1666 0.1437 0.1460 -0.0248 -0.0011 -0.0071 315 TRP A CE3 
237 C CZ2 . TRP A 36  ? 0.1676 0.1429 0.1340 -0.0125 -0.0014 -0.0059 315 TRP A CZ2 
238 C CZ3 . TRP A 36  ? 0.1633 0.1496 0.1419 -0.0226 -0.0058 -0.0069 315 TRP A CZ3 
239 C CH2 . TRP A 36  ? 0.1677 0.1518 0.1391 -0.0171 -0.0050 -0.0059 315 TRP A CH2 
240 N N   . GLU A 37  ? 0.1835 0.1495 0.1810 -0.0466 0.0173  -0.0077 316 GLU A N   
241 C CA  . GLU A 37  ? 0.2362 0.2027 0.2432 -0.0580 0.0230  -0.0106 316 GLU A CA  
242 C C   . GLU A 37  ? 0.2567 0.2039 0.2563 -0.0662 0.0262  -0.0149 316 GLU A C   
243 O O   . GLU A 37  ? 0.2971 0.2356 0.3002 -0.0762 0.0347  -0.0156 316 GLU A O   
244 C CB  . GLU A 37  ? 0.2538 0.2471 0.2808 -0.0622 0.0168  -0.0152 316 GLU A CB  
245 C CG  . GLU A 37  ? 0.3195 0.3215 0.3626 -0.0741 0.0227  -0.0190 316 GLU A CG  
246 C CD  . GLU A 37  ? 0.3868 0.3850 0.4337 -0.0861 0.0213  -0.0274 316 GLU A CD  
247 O OE1 . GLU A 37  ? 0.4261 0.4191 0.4637 -0.0838 0.0136  -0.0312 316 GLU A OE1 
248 O OE2 . GLU A 37  ? 0.3694 0.3708 0.4293 -0.0985 0.0284  -0.0310 316 GLU A OE2 
249 N N   . GLY A 38  ? 0.2763 0.2164 0.2659 -0.0621 0.0204  -0.0179 317 GLY A N   
250 C CA  . GLY A 38  ? 0.3172 0.2359 0.2968 -0.0674 0.0224  -0.0231 317 GLY A CA  
251 C C   . GLY A 38  ? 0.3511 0.2814 0.3362 -0.0723 0.0139  -0.0325 317 GLY A C   
252 O O   . GLY A 38  ? 0.3906 0.3079 0.3632 -0.0698 0.0116  -0.0368 317 GLY A O   
253 N N   . THR A 39  ? 0.3035 0.2592 0.3059 -0.0775 0.0085  -0.0359 318 THR A N   
254 C CA  . THR A 39  ? 0.3512 0.3203 0.3569 -0.0804 -0.0014 -0.0448 318 THR A CA  
255 C C   . THR A 39  ? 0.3301 0.3053 0.3250 -0.0680 -0.0080 -0.0415 318 THR A C   
256 O O   . THR A 39  ? 0.3481 0.3322 0.3455 -0.0605 -0.0082 -0.0338 318 THR A O   
257 C CB  . THR A 39  ? 0.3750 0.3738 0.4019 -0.0849 -0.0071 -0.0477 318 THR A CB  
258 O OG1 . THR A 39  ? 0.3977 0.3974 0.4393 -0.0972 0.0000  -0.0507 318 THR A OG1 
259 C CG2 . THR A 39  ? 0.3553 0.3704 0.3833 -0.0856 -0.0194 -0.0566 318 THR A CG2 
260 N N   . ASN A 40  ? 0.3210 0.2909 0.3038 -0.0663 -0.0127 -0.0473 319 ASN A N   
261 C CA  . ASN A 40  ? 0.3549 0.3258 0.3246 -0.0549 -0.0153 -0.0432 319 ASN A CA  
262 C C   . ASN A 40  ? 0.2932 0.2848 0.2694 -0.0486 -0.0202 -0.0363 319 ASN A C   
263 O O   . ASN A 40  ? 0.3325 0.3411 0.3145 -0.0499 -0.0278 -0.0389 319 ASN A O   
264 C CB  . ASN A 40  ? 0.3791 0.3453 0.3357 -0.0550 -0.0197 -0.0520 319 ASN A CB  
265 C CG  . ASN A 40  ? 0.3937 0.3523 0.3340 -0.0443 -0.0175 -0.0490 319 ASN A CG  
266 O OD1 . ASN A 40  ? 0.3677 0.3189 0.3059 -0.0377 -0.0118 -0.0421 319 ASN A OD1 
267 N ND2 . ASN A 40  ? 0.4318 0.3939 0.3605 -0.0425 -0.0223 -0.0553 319 ASN A ND2 
268 N N   . GLY A 41  ? 0.2874 0.2754 0.2616 -0.0415 -0.0159 -0.0281 320 GLY A N   
269 C CA  . GLY A 41  ? 0.2402 0.2416 0.2183 -0.0355 -0.0190 -0.0214 320 GLY A CA  
270 C C   . GLY A 41  ? 0.2024 0.2141 0.1962 -0.0367 -0.0186 -0.0178 320 GLY A C   
271 O O   . GLY A 41  ? 0.1815 0.2005 0.1779 -0.0311 -0.0204 -0.0122 320 GLY A O   
272 N N   . GLU A 42  ? 0.1889 0.2011 0.1927 -0.0442 -0.0160 -0.0215 321 GLU A N   
273 C CA  . GLU A 42  ? 0.1782 0.2023 0.1975 -0.0450 -0.0144 -0.0190 321 GLU A CA  
274 C C   . GLU A 42  ? 0.1597 0.1724 0.1759 -0.0415 -0.0064 -0.0131 321 GLU A C   
275 O O   . GLU A 42  ? 0.1542 0.1495 0.1604 -0.0423 -0.0008 -0.0127 321 GLU A O   
276 C CB  . GLU A 42  ? 0.2071 0.2374 0.2392 -0.0553 -0.0128 -0.0253 321 GLU A CB  
277 C CG  . GLU A 42  ? 0.2297 0.2770 0.2801 -0.0563 -0.0112 -0.0243 321 GLU A CG  
278 C CD  . GLU A 42  ? 0.2877 0.3472 0.3555 -0.0686 -0.0100 -0.0324 321 GLU A CD  
279 O OE1 . GLU A 42  ? 0.3196 0.3852 0.3893 -0.0743 -0.0169 -0.0404 321 GLU A OE1 
280 O OE2 . GLU A 42  ? 0.3502 0.4142 0.4299 -0.0725 -0.0017 -0.0310 321 GLU A OE2 
281 N N   . PHE A 43  ? 0.1456 0.1673 0.1689 -0.0363 -0.0065 -0.0088 322 PHE A N   
282 C CA  . PHE A 43  ? 0.1441 0.1572 0.1640 -0.0323 -0.0002 -0.0044 322 PHE A CA  
283 C C   . PHE A 43  ? 0.1558 0.1810 0.1890 -0.0317 0.0022  -0.0036 322 PHE A C   
284 O O   . PHE A 43  ? 0.1471 0.1884 0.1928 -0.0322 -0.0022 -0.0055 322 PHE A O   
285 C CB  . PHE A 43  ? 0.1432 0.1510 0.1544 -0.0245 -0.0019 -0.0007 322 PHE A CB  
286 C CG  . PHE A 43  ? 0.1497 0.1677 0.1659 -0.0199 -0.0074 0.0015  322 PHE A CG  
287 C CD1 . PHE A 43  ? 0.1720 0.1934 0.1842 -0.0195 -0.0130 0.0013  322 PHE A CD1 
288 C CD2 . PHE A 43  ? 0.1636 0.1851 0.1857 -0.0152 -0.0067 0.0040  322 PHE A CD2 
289 C CE1 . PHE A 43  ? 0.1818 0.2083 0.1950 -0.0147 -0.0171 0.0050  322 PHE A CE1 
290 C CE2 . PHE A 43  ? 0.1524 0.1781 0.1767 -0.0107 -0.0111 0.0067  322 PHE A CE2 
291 C CZ  . PHE A 43  ? 0.1610 0.1884 0.1805 -0.0104 -0.0161 0.0080  322 PHE A CZ  
292 N N   . LYS A 44  ? 0.1530 0.1706 0.1823 -0.0296 0.0090  -0.0010 323 LYS A N   
293 C CA  . LYS A 44  ? 0.1688 0.1980 0.2094 -0.0277 0.0122  -0.0007 323 LYS A CA  
294 C C   . LYS A 44  ? 0.1572 0.1790 0.1893 -0.0196 0.0138  0.0023  323 LYS A C   
295 O O   . LYS A 44  ? 0.1500 0.1575 0.1679 -0.0175 0.0158  0.0040  323 LYS A O   
296 C CB  . LYS A 44  ? 0.2329 0.2647 0.2802 -0.0353 0.0206  -0.0022 323 LYS A CB  
297 C CG  . LYS A 44  ? 0.2924 0.3047 0.3253 -0.0384 0.0291  0.0002  323 LYS A CG  
298 C CD  . LYS A 44  ? 0.3667 0.3803 0.4078 -0.0501 0.0382  -0.0017 323 LYS A CD  
299 C CE  . LYS A 44  ? 0.3589 0.3708 0.3981 -0.0499 0.0498  0.0015  323 LYS A CE  
300 N NZ  . LYS A 44  ? 0.3783 0.3765 0.4134 -0.0610 0.0607  0.0025  323 LYS A NZ  
301 N N   . MET A 45  ? 0.1395 0.1715 0.1806 -0.0143 0.0122  0.0020  324 MET A N   
302 C CA  . MET A 45  ? 0.1596 0.1861 0.1948 -0.0073 0.0138  0.0028  324 MET A CA  
303 C C   . MET A 45  ? 0.1664 0.1940 0.2012 -0.0078 0.0227  0.0022  324 MET A C   
304 O O   . MET A 45  ? 0.1820 0.2224 0.2292 -0.0070 0.0256  0.0004  324 MET A O   
305 C CB  . MET A 45  ? 0.1703 0.2027 0.2130 -0.0012 0.0082  0.0025  324 MET A CB  
306 C CG  . MET A 45  ? 0.1941 0.2225 0.2334 -0.0010 0.0012  0.0045  324 MET A CG  
307 S SD  . MET A 45  ? 0.2702 0.2991 0.3151 0.0065  -0.0033 0.0056  324 MET A SD  
308 C CE  . MET A 45  ? 0.2807 0.3067 0.3209 0.0051  -0.0096 0.0095  324 MET A CE  
309 N N   . THR A 46  ? 0.1924 0.2070 0.2125 -0.0084 0.0278  0.0040  325 THR A N   
310 C CA  . THR A 46  ? 0.2112 0.2232 0.2255 -0.0083 0.0374  0.0048  325 THR A CA  
311 C C   . THR A 46  ? 0.2189 0.2340 0.2312 0.0003  0.0380  0.0027  325 THR A C   
312 O O   . THR A 46  ? 0.2404 0.2598 0.2529 0.0011  0.0463  0.0021  325 THR A O   
313 C CB  . THR A 46  ? 0.2925 0.2860 0.2871 -0.0091 0.0418  0.0084  325 THR A CB  
314 O OG1 . THR A 46  ? 0.2892 0.2746 0.2730 -0.0025 0.0344  0.0083  325 THR A OG1 
315 C CG2 . THR A 46  ? 0.3392 0.3276 0.3362 -0.0180 0.0423  0.0093  325 THR A CG2 
316 N N   . ASP A 47  ? 0.1883 0.2011 0.1988 0.0062  0.0299  0.0007  326 ASP A N   
317 C CA  . ASP A 47  ? 0.1806 0.1959 0.1919 0.0136  0.0295  -0.0031 326 ASP A CA  
318 C C   . ASP A 47  ? 0.1540 0.1715 0.1752 0.0155  0.0210  -0.0045 326 ASP A C   
319 O O   . ASP A 47  ? 0.1473 0.1573 0.1631 0.0166  0.0154  -0.0053 326 ASP A O   
320 C CB  . ASP A 47  ? 0.2022 0.2067 0.1951 0.0191  0.0292  -0.0048 326 ASP A CB  
321 C CG  . ASP A 47  ? 0.2424 0.2488 0.2350 0.0261  0.0295  -0.0104 326 ASP A CG  
322 O OD1 . ASP A 47  ? 0.2678 0.2802 0.2742 0.0277  0.0274  -0.0127 326 ASP A OD1 
323 O OD2 . ASP A 47  ? 0.3148 0.3150 0.2909 0.0308  0.0315  -0.0123 326 ASP A OD2 
324 N N   . PRO A 48  ? 0.1431 0.1714 0.1797 0.0155  0.0198  -0.0045 327 PRO A N   
325 C CA  . PRO A 48  ? 0.1492 0.1769 0.1926 0.0176  0.0123  -0.0038 327 PRO A CA  
326 C C   . PRO A 48  ? 0.1426 0.1611 0.1826 0.0237  0.0100  -0.0070 327 PRO A C   
327 O O   . PRO A 48  ? 0.1438 0.1548 0.1837 0.0235  0.0046  -0.0058 327 PRO A O   
328 C CB  . PRO A 48  ? 0.1586 0.2013 0.2177 0.0188  0.0121  -0.0037 327 PRO A CB  
329 C CG  . PRO A 48  ? 0.1584 0.2103 0.2213 0.0185  0.0206  -0.0061 327 PRO A CG  
330 C CD  . PRO A 48  ? 0.1645 0.2068 0.2129 0.0130  0.0255  -0.0046 327 PRO A CD  
331 N N   . ASP A 49  ? 0.1584 0.1766 0.1953 0.0285  0.0146  -0.0115 328 ASP A N   
332 C CA  . ASP A 49  ? 0.1636 0.1719 0.1967 0.0336  0.0122  -0.0164 328 ASP A CA  
333 C C   . ASP A 49  ? 0.1621 0.1610 0.1844 0.0303  0.0086  -0.0181 328 ASP A C   
334 O O   . ASP A 49  ? 0.1707 0.1609 0.1939 0.0304  0.0042  -0.0212 328 ASP A O   
335 C CB  . ASP A 49  ? 0.1832 0.1942 0.2141 0.0399  0.0180  -0.0218 328 ASP A CB  
336 C CG  . ASP A 49  ? 0.2102 0.2319 0.2555 0.0453  0.0206  -0.0220 328 ASP A CG  
337 O OD1 . ASP A 49  ? 0.2002 0.2213 0.2550 0.0467  0.0152  -0.0193 328 ASP A OD1 
338 O OD2 . ASP A 49  ? 0.2485 0.2794 0.2949 0.0489  0.0283  -0.0250 328 ASP A OD2 
339 N N   . GLU A 50  ? 0.1630 0.1633 0.1760 0.0276  0.0104  -0.0164 329 GLU A N   
340 C CA  . GLU A 50  ? 0.1821 0.1772 0.1869 0.0259  0.0061  -0.0181 329 GLU A CA  
341 C C   . GLU A 50  ? 0.1601 0.1542 0.1715 0.0205  0.0015  -0.0147 329 GLU A C   
342 O O   . GLU A 50  ? 0.1728 0.1637 0.1845 0.0191  -0.0025 -0.0180 329 GLU A O   
343 C CB  . GLU A 50  ? 0.2068 0.2016 0.1977 0.0268  0.0091  -0.0165 329 GLU A CB  
344 C CG  . GLU A 50  ? 0.2296 0.2218 0.2126 0.0272  0.0037  -0.0184 329 GLU A CG  
345 C CD  . GLU A 50  ? 0.2654 0.2565 0.2445 0.0312  -0.0012 -0.0271 329 GLU A CD  
346 O OE1 . GLU A 50  ? 0.2701 0.2596 0.2495 0.0344  0.0003  -0.0321 329 GLU A OE1 
347 O OE2 . GLU A 50  ? 0.2775 0.2702 0.2530 0.0318  -0.0067 -0.0299 329 GLU A OE2 
348 N N   . VAL A 51  ? 0.1548 0.1529 0.1715 0.0172  0.0024  -0.0088 330 VAL A N   
349 C CA  . VAL A 51  ? 0.1451 0.1422 0.1660 0.0129  -0.0012 -0.0054 330 VAL A CA  
350 C C   . VAL A 51  ? 0.1512 0.1425 0.1782 0.0138  -0.0034 -0.0063 330 VAL A C   
351 O O   . VAL A 51  ? 0.1543 0.1414 0.1818 0.0103  -0.0054 -0.0065 330 VAL A O   
352 C CB  . VAL A 51  ? 0.1369 0.1396 0.1612 0.0102  -0.0006 -0.0003 330 VAL A CB  
353 C CG1 . VAL A 51  ? 0.1469 0.1481 0.1721 0.0067  -0.0040 0.0032  330 VAL A CG1 
354 C CG2 . VAL A 51  ? 0.1388 0.1433 0.1567 0.0081  0.0027  0.0003  330 VAL A CG2 
355 N N   . ALA A 52  ? 0.1360 0.1262 0.1677 0.0184  -0.0026 -0.0069 331 ALA A N   
356 C CA  . ALA A 52  ? 0.1526 0.1326 0.1884 0.0202  -0.0043 -0.0071 331 ALA A CA  
357 C C   . ALA A 52  ? 0.1507 0.1221 0.1844 0.0186  -0.0050 -0.0142 331 ALA A C   
358 O O   . ALA A 52  ? 0.1566 0.1183 0.1928 0.0147  -0.0061 -0.0137 331 ALA A O   
359 C CB  . ALA A 52  ? 0.1544 0.1350 0.1957 0.0277  -0.0035 -0.0071 331 ALA A CB  
360 N N   . ARG A 53  ? 0.1722 0.1474 0.2007 0.0209  -0.0042 -0.0206 332 ARG A N   
361 C CA  . ARG A 53  ? 0.1767 0.1467 0.2031 0.0198  -0.0065 -0.0293 332 ARG A CA  
362 C C   . ARG A 53  ? 0.1756 0.1482 0.2041 0.0126  -0.0091 -0.0292 332 ARG A C   
363 O O   . ARG A 53  ? 0.1936 0.1601 0.2276 0.0079  -0.0108 -0.0339 332 ARG A O   
364 C CB  . ARG A 53  ? 0.2000 0.1747 0.2169 0.0251  -0.0058 -0.0359 332 ARG A CB  
365 C CG  . ARG A 53  ? 0.2342 0.2050 0.2479 0.0255  -0.0095 -0.0470 332 ARG A CG  
366 C CD  . ARG A 53  ? 0.2639 0.2410 0.2635 0.0313  -0.0098 -0.0519 332 ARG A CD  
367 N NE  . ARG A 53  ? 0.2891 0.2740 0.2829 0.0302  -0.0117 -0.0483 332 ARG A NE  
368 C CZ  . ARG A 53  ? 0.3054 0.2952 0.3027 0.0265  -0.0173 -0.0514 332 ARG A CZ  
369 N NH1 . ARG A 53  ? 0.3253 0.3133 0.3329 0.0214  -0.0212 -0.0590 332 ARG A NH1 
370 N NH2 . ARG A 53  ? 0.3144 0.3106 0.3057 0.0279  -0.0184 -0.0474 332 ARG A NH2 
371 N N   . ARG A 54  ? 0.1754 0.1568 0.2005 0.0115  -0.0089 -0.0244 333 ARG A N   
372 C CA  . ARG A 54  ? 0.1728 0.1594 0.2003 0.0065  -0.0108 -0.0247 333 ARG A CA  
373 C C   . ARG A 54  ? 0.1713 0.1530 0.2064 0.0000  -0.0094 -0.0198 333 ARG A C   
374 O O   . ARG A 54  ? 0.1633 0.1466 0.2046 -0.0059 -0.0098 -0.0227 333 ARG A O   
375 C CB  . ARG A 54  ? 0.1881 0.1820 0.2084 0.0086  -0.0103 -0.0210 333 ARG A CB  
376 C CG  . ARG A 54  ? 0.2265 0.2230 0.2365 0.0146  -0.0115 -0.0254 333 ARG A CG  
377 C CD  . ARG A 54  ? 0.2920 0.2922 0.2953 0.0160  -0.0111 -0.0214 333 ARG A CD  
378 N NE  . ARG A 54  ? 0.3614 0.3597 0.3508 0.0224  -0.0099 -0.0214 333 ARG A NE  
379 C CZ  . ARG A 54  ? 0.3802 0.3779 0.3605 0.0253  -0.0098 -0.0185 333 ARG A CZ  
380 N NH1 . ARG A 54  ? 0.3269 0.3284 0.3124 0.0231  -0.0117 -0.0176 333 ARG A NH1 
381 N NH2 . ARG A 54  ? 0.4865 0.4789 0.4512 0.0313  -0.0075 -0.0170 333 ARG A NH2 
382 N N   . TRP A 55  ? 0.1527 0.1293 0.1873 0.0012  -0.0075 -0.0123 334 TRP A N   
383 C CA  . TRP A 55  ? 0.1593 0.1283 0.1968 -0.0032 -0.0059 -0.0064 334 TRP A CA  
384 C C   . TRP A 55  ? 0.1691 0.1247 0.2116 -0.0060 -0.0051 -0.0100 334 TRP A C   
385 O O   . TRP A 55  ? 0.1779 0.1290 0.2244 -0.0134 -0.0029 -0.0092 334 TRP A O   
386 C CB  . TRP A 55  ? 0.1566 0.1245 0.1909 0.0011  -0.0058 0.0018  334 TRP A CB  
387 C CG  . TRP A 55  ? 0.1731 0.1317 0.2058 -0.0008 -0.0047 0.0094  334 TRP A CG  
388 C CD1 . TRP A 55  ? 0.1925 0.1408 0.2240 0.0044  -0.0054 0.0142  334 TRP A CD1 
389 C CD2 . TRP A 55  ? 0.1730 0.1308 0.2032 -0.0072 -0.0022 0.0141  334 TRP A CD2 
390 N NE1 . TRP A 55  ? 0.2135 0.1525 0.2397 0.0019  -0.0038 0.0223  334 TRP A NE1 
391 C CE2 . TRP A 55  ? 0.1897 0.1351 0.2148 -0.0056 -0.0013 0.0224  334 TRP A CE2 
392 C CE3 . TRP A 55  ? 0.1731 0.1402 0.2040 -0.0128 -0.0005 0.0122  334 TRP A CE3 
393 C CZ2 . TRP A 55  ? 0.2083 0.1487 0.2277 -0.0106 0.0025  0.0291  334 TRP A CZ2 
394 C CZ3 . TRP A 55  ? 0.1748 0.1393 0.2028 -0.0179 0.0035  0.0178  334 TRP A CZ3 
395 C CH2 . TRP A 55  ? 0.1862 0.1379 0.2074 -0.0170 0.0052  0.0264  334 TRP A CH2 
396 N N   . GLY A 56  ? 0.1718 0.1209 0.2140 -0.0006 -0.0061 -0.0149 335 GLY A N   
397 C CA  . GLY A 56  ? 0.1956 0.1294 0.2415 -0.0024 -0.0057 -0.0207 335 GLY A CA  
398 C C   . GLY A 56  ? 0.2066 0.1442 0.2587 -0.0109 -0.0067 -0.0297 335 GLY A C   
399 O O   . GLY A 56  ? 0.2243 0.1502 0.2826 -0.0187 -0.0046 -0.0317 335 GLY A O   
400 N N   . GLU A 57  ? 0.2049 0.1588 0.2557 -0.0096 -0.0097 -0.0351 336 GLU A N   
401 C CA  . GLU A 57  ? 0.2089 0.1718 0.2667 -0.0155 -0.0127 -0.0455 336 GLU A CA  
402 C C   . GLU A 57  ? 0.1911 0.1606 0.2575 -0.0248 -0.0099 -0.0416 336 GLU A C   
403 O O   . GLU A 57  ? 0.1931 0.1628 0.2708 -0.0339 -0.0094 -0.0484 336 GLU A O   
404 C CB  . GLU A 57  ? 0.2479 0.2257 0.2985 -0.0084 -0.0172 -0.0504 336 GLU A CB  
405 C CG  . GLU A 57  ? 0.2943 0.2855 0.3492 -0.0100 -0.0229 -0.0622 336 GLU A CG  
406 C CD  . GLU A 57  ? 0.3564 0.3581 0.3980 0.0003  -0.0266 -0.0632 336 GLU A CD  
407 O OE1 . GLU A 57  ? 0.3608 0.3669 0.3965 0.0035  -0.0245 -0.0542 336 GLU A OE1 
408 O OE2 . GLU A 57  ? 0.3945 0.3983 0.4297 0.0053  -0.0313 -0.0728 336 GLU A OE2 
409 N N   . ARG A 58  ? 0.1662 0.1410 0.2279 -0.0229 -0.0076 -0.0316 337 ARG A N   
410 C CA  . ARG A 58  ? 0.1642 0.1457 0.2317 -0.0303 -0.0037 -0.0271 337 ARG A CA  
411 C C   . ARG A 58  ? 0.1765 0.1420 0.2486 -0.0391 0.0023  -0.0228 337 ARG A C   
412 O O   . ARG A 58  ? 0.1755 0.1454 0.2578 -0.0489 0.0063  -0.0248 337 ARG A O   
413 C CB  . ARG A 58  ? 0.1558 0.1424 0.2144 -0.0259 -0.0022 -0.0176 337 ARG A CB  
414 C CG  . ARG A 58  ? 0.1574 0.1528 0.2205 -0.0321 0.0022  -0.0146 337 ARG A CG  
415 C CD  . ARG A 58  ? 0.1639 0.1776 0.2376 -0.0346 0.0006  -0.0236 337 ARG A CD  
416 N NE  . ARG A 58  ? 0.1605 0.1847 0.2275 -0.0254 -0.0045 -0.0260 337 ARG A NE  
417 C CZ  . ARG A 58  ? 0.1592 0.1885 0.2193 -0.0215 -0.0031 -0.0210 337 ARG A CZ  
418 N NH1 . ARG A 58  ? 0.1460 0.1743 0.2049 -0.0256 0.0026  -0.0143 337 ARG A NH1 
419 N NH2 . ARG A 58  ? 0.1807 0.2146 0.2331 -0.0129 -0.0073 -0.0228 337 ARG A NH2 
420 N N   . LYS A 59  ? 0.1902 0.1374 0.2544 -0.0349 0.0035  -0.0159 338 LYS A N   
421 C CA  . LYS A 59  ? 0.2237 0.1506 0.2871 -0.0402 0.0091  -0.0090 338 LYS A CA  
422 C C   . LYS A 59  ? 0.2388 0.1485 0.3086 -0.0448 0.0097  -0.0167 338 LYS A C   
423 O O   . LYS A 59  ? 0.2603 0.1478 0.3285 -0.0497 0.0152  -0.0108 338 LYS A O   
424 C CB  . LYS A 59  ? 0.2475 0.1633 0.2979 -0.0311 0.0090  0.0029  338 LYS A CB  
425 C CG  . LYS A 59  ? 0.2516 0.1815 0.2951 -0.0278 0.0085  0.0099  338 LYS A CG  
426 C CD  . LYS A 59  ? 0.2619 0.2000 0.3067 -0.0363 0.0139  0.0132  338 LYS A CD  
427 C CE  . LYS A 59  ? 0.2913 0.2115 0.3272 -0.0388 0.0199  0.0247  338 LYS A CE  
428 N NZ  . LYS A 59  ? 0.2997 0.2244 0.3333 -0.0463 0.0272  0.0301  338 LYS A NZ  
429 N N   . SER A 60  ? 0.2369 0.1542 0.3108 -0.0419 0.0039  -0.0291 339 SER A N   
430 C CA  . SER A 60  ? 0.2629 0.1649 0.3408 -0.0439 0.0027  -0.0393 339 SER A CA  
431 C C   . SER A 60  ? 0.3080 0.1823 0.3778 -0.0386 0.0056  -0.0318 339 SER A C   
432 O O   . SER A 60  ? 0.3357 0.1873 0.4083 -0.0451 0.0096  -0.0329 339 SER A O   
433 C CB  . SER A 60  ? 0.2565 0.1610 0.3497 -0.0588 0.0046  -0.0493 339 SER A CB  
434 O OG  . SER A 60  ? 0.2726 0.1682 0.3701 -0.0602 0.0008  -0.0636 339 SER A OG  
435 N N   . LYS A 61  ? 0.3277 0.2040 0.3877 -0.0262 0.0037  -0.0240 340 LYS A N   
436 C CA  . LYS A 61  ? 0.3621 0.2169 0.4144 -0.0178 0.0052  -0.0161 340 LYS A CA  
437 C C   . LYS A 61  ? 0.3713 0.2236 0.4223 -0.0076 0.0015  -0.0254 340 LYS A C   
438 O O   . LYS A 61  ? 0.3324 0.2044 0.3818 -0.0008 -0.0018 -0.0284 340 LYS A O   
439 C CB  . LYS A 61  ? 0.3882 0.2494 0.4325 -0.0108 0.0051  -0.0023 340 LYS A CB  
440 C CG  . LYS A 61  ? 0.4400 0.2898 0.4793 -0.0170 0.0103  0.0100  340 LYS A CG  
441 C CD  . LYS A 61  ? 0.4849 0.3507 0.5172 -0.0121 0.0086  0.0194  340 LYS A CD  
442 C CE  . LYS A 61  ? 0.5594 0.4151 0.5822 -0.0158 0.0135  0.0325  340 LYS A CE  
443 N NZ  . LYS A 61  ? 0.5417 0.4180 0.5588 -0.0106 0.0098  0.0373  340 LYS A NZ  
444 N N   . PRO A 62  ? 0.4273 0.2540 0.4781 -0.0067 0.0031  -0.0299 341 PRO A N   
445 C CA  . PRO A 62  ? 0.4532 0.2781 0.5020 0.0039  0.0004  -0.0396 341 PRO A CA  
446 C C   . PRO A 62  ? 0.4410 0.2683 0.4845 0.0187  -0.0001 -0.0306 341 PRO A C   
447 O O   . PRO A 62  ? 0.4327 0.2522 0.4727 0.0216  0.0011  -0.0175 341 PRO A O   
448 C CB  . PRO A 62  ? 0.5133 0.3082 0.5637 -0.0004 0.0025  -0.0478 341 PRO A CB  
449 C CG  . PRO A 62  ? 0.5105 0.2854 0.5608 -0.0090 0.0077  -0.0363 341 PRO A CG  
450 C CD  . PRO A 62  ? 0.4970 0.2954 0.5497 -0.0163 0.0081  -0.0284 341 PRO A CD  
451 N N   . ASN A 63  ? 0.4503 0.2909 0.4930 0.0280  -0.0020 -0.0379 342 ASN A N   
452 C CA  . ASN A 63  ? 0.4303 0.2776 0.4717 0.0421  -0.0022 -0.0325 342 ASN A CA  
453 C C   . ASN A 63  ? 0.3784 0.2458 0.4204 0.0419  -0.0033 -0.0208 342 ASN A C   
454 O O   . ASN A 63  ? 0.3606 0.2299 0.4029 0.0517  -0.0042 -0.0136 342 ASN A O   
455 C CB  . ASN A 63  ? 0.4889 0.3097 0.5283 0.0515  -0.0012 -0.0280 342 ASN A CB  
456 C CG  . ASN A 63  ? 0.5256 0.3217 0.5638 0.0524  0.0003  -0.0402 342 ASN A CG  
457 O OD1 . ASN A 63  ? 0.5869 0.3912 0.6253 0.0542  -0.0001 -0.0532 342 ASN A OD1 
458 N ND2 . ASN A 63  ? 0.5662 0.3307 0.6017 0.0507  0.0022  -0.0362 342 ASN A ND2 
459 N N   . MET A 64  ? 0.3280 0.2099 0.3702 0.0317  -0.0038 -0.0197 343 MET A N   
460 C CA  . MET A 64  ? 0.2810 0.1821 0.3231 0.0317  -0.0048 -0.0112 343 MET A CA  
461 C C   . MET A 64  ? 0.2686 0.1888 0.3122 0.0386  -0.0048 -0.0154 343 MET A C   
462 O O   . MET A 64  ? 0.2714 0.1940 0.3139 0.0398  -0.0037 -0.0247 343 MET A O   
463 C CB  . MET A 64  ? 0.2692 0.1791 0.3107 0.0202  -0.0048 -0.0101 343 MET A CB  
464 C CG  . MET A 64  ? 0.2400 0.1672 0.2801 0.0190  -0.0057 -0.0028 343 MET A CG  
465 S SD  . MET A 64  ? 0.2549 0.1805 0.2926 0.0253  -0.0074 0.0092  343 MET A SD  
466 C CE  . MET A 64  ? 0.3056 0.2080 0.3380 0.0193  -0.0050 0.0161  343 MET A CE  
467 N N   . ASN A 65  ? 0.2340 0.1671 0.2803 0.0437  -0.0057 -0.0086 344 ASN A N   
468 C CA  . ASN A 65  ? 0.2022 0.1547 0.2524 0.0489  -0.0041 -0.0116 344 ASN A CA  
469 C C   . ASN A 65  ? 0.1867 0.1555 0.2409 0.0485  -0.0059 -0.0043 344 ASN A C   
470 O O   . ASN A 65  ? 0.1723 0.1368 0.2240 0.0458  -0.0090 0.0030  344 ASN A O   
471 C CB  . ASN A 65  ? 0.2152 0.1631 0.2694 0.0607  -0.0026 -0.0165 344 ASN A CB  
472 C CG  . ASN A 65  ? 0.2284 0.1655 0.2852 0.0688  -0.0056 -0.0101 344 ASN A CG  
473 O OD1 . ASN A 65  ? 0.2394 0.1866 0.2990 0.0700  -0.0088 -0.0023 344 ASN A OD1 
474 N ND2 . ASN A 65  ? 0.2732 0.1899 0.3285 0.0756  -0.0052 -0.0134 344 ASN A ND2 
475 N N   . TYR A 66  ? 0.1771 0.1645 0.2364 0.0501  -0.0035 -0.0065 345 TYR A N   
476 C CA  . TYR A 66  ? 0.1664 0.1711 0.2311 0.0477  -0.0053 -0.0016 345 TYR A CA  
477 C C   . TYR A 66  ? 0.1731 0.1794 0.2434 0.0555  -0.0107 0.0035  345 TYR A C   
478 O O   . TYR A 66  ? 0.2002 0.2107 0.2688 0.0526  -0.0151 0.0092  345 TYR A O   
479 C CB  . TYR A 66  ? 0.1711 0.1952 0.2425 0.0468  -0.0001 -0.0056 345 TYR A CB  
480 C CG  . TYR A 66  ? 0.1734 0.2137 0.2516 0.0423  -0.0027 -0.0019 345 TYR A CG  
481 C CD1 . TYR A 66  ? 0.1867 0.2240 0.2575 0.0335  -0.0044 0.0013  345 TYR A CD1 
482 C CD2 . TYR A 66  ? 0.2015 0.2601 0.2941 0.0479  -0.0042 -0.0026 345 TYR A CD2 
483 C CE1 . TYR A 66  ? 0.1945 0.2445 0.2702 0.0293  -0.0073 0.0032  345 TYR A CE1 
484 C CE2 . TYR A 66  ? 0.2045 0.2785 0.3038 0.0431  -0.0083 -0.0007 345 TYR A CE2 
485 C CZ  . TYR A 66  ? 0.2047 0.2726 0.2942 0.0333  -0.0094 0.0019  345 TYR A CZ  
486 O OH  . TYR A 66  ? 0.2253 0.3072 0.3204 0.0284  -0.0137 0.0022  345 TYR A OH  
487 N N   . ASP A 67  ? 0.1812 0.1828 0.2561 0.0666  -0.0111 0.0017  346 ASP A N   
488 C CA  . ASP A 67  ? 0.2058 0.2063 0.2837 0.0769  -0.0172 0.0073  346 ASP A CA  
489 C C   . ASP A 67  ? 0.2164 0.1990 0.2815 0.0729  -0.0212 0.0161  346 ASP A C   
490 O O   . ASP A 67  ? 0.2083 0.1982 0.2720 0.0750  -0.0268 0.0221  346 ASP A O   
491 C CB  . ASP A 67  ? 0.2375 0.2284 0.3191 0.0903  -0.0164 0.0041  346 ASP A CB  
492 C CG  . ASP A 67  ? 0.2995 0.2860 0.3815 0.1028  -0.0232 0.0107  346 ASP A CG  
493 O OD1 . ASP A 67  ? 0.3215 0.3328 0.4144 0.1078  -0.0274 0.0111  346 ASP A OD1 
494 O OD2 . ASP A 67  ? 0.3511 0.3097 0.4226 0.1076  -0.0243 0.0154  346 ASP A OD2 
495 N N   . LYS A 68  ? 0.2276 0.1879 0.2837 0.0671  -0.0179 0.0160  347 LYS A N   
496 C CA  . LYS A 68  ? 0.2543 0.1967 0.2987 0.0617  -0.0190 0.0240  347 LYS A CA  
497 C C   . LYS A 68  ? 0.2444 0.1994 0.2852 0.0510  -0.0195 0.0264  347 LYS A C   
498 O O   . LYS A 68  ? 0.2680 0.2209 0.3011 0.0507  -0.0224 0.0340  347 LYS A O   
499 C CB  . LYS A 68  ? 0.2801 0.1980 0.3196 0.0566  -0.0145 0.0214  347 LYS A CB  
500 C CG  . LYS A 68  ? 0.3253 0.2246 0.3654 0.0669  -0.0140 0.0193  347 LYS A CG  
501 C CD  . LYS A 68  ? 0.3683 0.2424 0.4039 0.0589  -0.0097 0.0159  347 LYS A CD  
502 C CE  . LYS A 68  ? 0.4219 0.2728 0.4569 0.0687  -0.0088 0.0131  347 LYS A CE  
503 N NZ  . LYS A 68  ? 0.4708 0.3045 0.5051 0.0584  -0.0048 0.0047  347 LYS A NZ  
504 N N   . LEU A 69  ? 0.2174 0.1853 0.2623 0.0437  -0.0168 0.0202  348 LEU A N   
505 C CA  . LEU A 69  ? 0.2157 0.1931 0.2569 0.0348  -0.0168 0.0215  348 LEU A CA  
506 C C   . LEU A 69  ? 0.2215 0.2145 0.2649 0.0381  -0.0218 0.0246  348 LEU A C   
507 O O   . LEU A 69  ? 0.2215 0.2148 0.2572 0.0344  -0.0241 0.0291  348 LEU A O   
508 C CB  . LEU A 69  ? 0.2192 0.2061 0.2639 0.0296  -0.0132 0.0143  348 LEU A CB  
509 C CG  . LEU A 69  ? 0.2249 0.2198 0.2656 0.0215  -0.0128 0.0148  348 LEU A CG  
510 C CD1 . LEU A 69  ? 0.2580 0.2418 0.2913 0.0157  -0.0118 0.0171  348 LEU A CD1 
511 C CD2 . LEU A 69  ? 0.2504 0.2528 0.2928 0.0188  -0.0091 0.0089  348 LEU A CD2 
512 N N   . SER A 70  ? 0.2179 0.2249 0.2722 0.0452  -0.0236 0.0215  349 SER A N   
513 C CA  . SER A 70  ? 0.2238 0.2510 0.2839 0.0470  -0.0292 0.0221  349 SER A CA  
514 C C   . SER A 70  ? 0.2419 0.2630 0.2941 0.0548  -0.0361 0.0294  349 SER A C   
515 O O   . SER A 70  ? 0.2509 0.2817 0.2993 0.0533  -0.0413 0.0314  349 SER A O   
516 C CB  . SER A 70  ? 0.2175 0.2656 0.2944 0.0509  -0.0284 0.0157  349 SER A CB  
517 O OG  . SER A 70  ? 0.2371 0.2836 0.3200 0.0630  -0.0297 0.0156  349 SER A OG  
518 N N   . ARG A 71  ? 0.2563 0.2589 0.3037 0.0630  -0.0359 0.0337  350 ARG A N   
519 C CA  . ARG A 71  ? 0.2819 0.2736 0.3178 0.0715  -0.0416 0.0425  350 ARG A CA  
520 C C   . ARG A 71  ? 0.3025 0.2826 0.3213 0.0627  -0.0402 0.0489  350 ARG A C   
521 O O   . ARG A 71  ? 0.3309 0.3152 0.3397 0.0657  -0.0460 0.0541  350 ARG A O   
522 C CB  . ARG A 71  ? 0.3472 0.3152 0.3796 0.0810  -0.0398 0.0460  350 ARG A CB  
523 C CG  . ARG A 71  ? 0.4354 0.3886 0.4532 0.0918  -0.0453 0.0569  350 ARG A CG  
524 C CD  . ARG A 71  ? 0.4996 0.4347 0.5173 0.1065  -0.0461 0.0595  350 ARG A CD  
525 N NE  . ARG A 71  ? 0.5058 0.4632 0.5434 0.1147  -0.0482 0.0503  350 ARG A NE  
526 C CZ  . ARG A 71  ? 0.5010 0.4561 0.5489 0.1126  -0.0417 0.0418  350 ARG A CZ  
527 N NH1 . ARG A 71  ? 0.4990 0.4310 0.5398 0.1029  -0.0344 0.0409  350 ARG A NH1 
528 N NH2 . ARG A 71  ? 0.4746 0.4515 0.5400 0.1208  -0.0424 0.0338  350 ARG A NH2 
529 N N   . ALA A 72  ? 0.2791 0.2471 0.2950 0.0522  -0.0328 0.0474  351 ALA A N   
530 C CA  . ALA A 72  ? 0.2964 0.2582 0.2996 0.0426  -0.0298 0.0515  351 ALA A CA  
531 C C   . ALA A 72  ? 0.2851 0.2667 0.2875 0.0383  -0.0333 0.0487  351 ALA A C   
532 O O   . ALA A 72  ? 0.3172 0.2975 0.3059 0.0365  -0.0347 0.0534  351 ALA A O   
533 C CB  . ALA A 72  ? 0.2977 0.2497 0.3037 0.0327  -0.0220 0.0476  351 ALA A CB  
534 N N   . LEU A 73  ? 0.2651 0.2642 0.2806 0.0355  -0.0339 0.0404  352 LEU A N   
535 C CA  . LEU A 73  ? 0.2580 0.2740 0.2743 0.0308  -0.0371 0.0365  352 LEU A CA  
536 C C   . LEU A 73  ? 0.2994 0.3272 0.3129 0.0380  -0.0464 0.0384  352 LEU A C   
537 O O   . LEU A 73  ? 0.2642 0.2972 0.2686 0.0349  -0.0496 0.0382  352 LEU A O   
538 C CB  . LEU A 73  ? 0.2611 0.2905 0.2920 0.0259  -0.0344 0.0280  352 LEU A CB  
539 C CG  . LEU A 73  ? 0.2475 0.2677 0.2780 0.0193  -0.0268 0.0254  352 LEU A CG  
540 C CD1 . LEU A 73  ? 0.2828 0.3149 0.3248 0.0168  -0.0243 0.0189  352 LEU A CD1 
541 C CD2 . LEU A 73  ? 0.2931 0.3080 0.3133 0.0121  -0.0244 0.0260  352 LEU A CD2 
542 N N   . ARG A 74  ? 0.2958 0.3287 0.3170 0.0487  -0.0512 0.0395  353 ARG A N   
543 C CA  . ARG A 74  ? 0.3630 0.4081 0.3818 0.0586  -0.0618 0.0416  353 ARG A CA  
544 C C   . ARG A 74  ? 0.3464 0.3759 0.3405 0.0619  -0.0643 0.0511  353 ARG A C   
545 O O   . ARG A 74  ? 0.3304 0.3717 0.3161 0.0648  -0.0727 0.0510  353 ARG A O   
546 C CB  . ARG A 74  ? 0.4134 0.4611 0.4430 0.0723  -0.0652 0.0426  353 ARG A CB  
547 C CG  . ARG A 74  ? 0.5356 0.6085 0.5752 0.0831  -0.0769 0.0397  353 ARG A CG  
548 C CD  . ARG A 74  ? 0.5742 0.6548 0.6306 0.0965  -0.0787 0.0379  353 ARG A CD  
549 N NE  . ARG A 74  ? 0.5520 0.6342 0.6246 0.0901  -0.0687 0.0312  353 ARG A NE  
550 C CZ  . ARG A 74  ? 0.6106 0.6748 0.6835 0.0957  -0.0626 0.0329  353 ARG A CZ  
551 N NH1 . ARG A 74  ? 0.6694 0.7099 0.7286 0.1072  -0.0647 0.0414  353 ARG A NH1 
552 N NH2 . ARG A 74  ? 0.5517 0.6195 0.6370 0.0900  -0.0540 0.0259  353 ARG A NH2 
553 N N   . TYR A 75  ? 0.3311 0.3348 0.3130 0.0610  -0.0570 0.0589  354 TYR A N   
554 C CA  . TYR A 75  ? 0.3648 0.3500 0.3220 0.0626  -0.0558 0.0695  354 TYR A CA  
555 C C   . TYR A 75  ? 0.3278 0.3213 0.2749 0.0534  -0.0551 0.0666  354 TYR A C   
556 O O   . TYR A 75  ? 0.3462 0.3349 0.2725 0.0573  -0.0580 0.0730  354 TYR A O   
557 C CB  . TYR A 75  ? 0.4487 0.4050 0.3988 0.0589  -0.0451 0.0766  354 TYR A CB  
558 C CG  . TYR A 75  ? 0.5624 0.5012 0.4903 0.0528  -0.0380 0.0854  354 TYR A CG  
559 C CD1 . TYR A 75  ? 0.7230 0.6427 0.6278 0.0614  -0.0386 0.0983  354 TYR A CD1 
560 C CD2 . TYR A 75  ? 0.6114 0.5535 0.5409 0.0393  -0.0301 0.0808  354 TYR A CD2 
561 C CE1 . TYR A 75  ? 0.7885 0.6940 0.6731 0.0551  -0.0304 0.1063  354 TYR A CE1 
562 C CE2 . TYR A 75  ? 0.6776 0.6083 0.5898 0.0338  -0.0226 0.0875  354 TYR A CE2 
563 C CZ  . TYR A 75  ? 0.7846 0.6973 0.6745 0.0408  -0.0220 0.1001  354 TYR A CZ  
564 O OH  . TYR A 75  ? 0.8181 0.7204 0.6909 0.0342  -0.0125 0.1067  354 TYR A OH  
565 N N   . TYR A 76  ? 0.2661 0.2696 0.2256 0.0426  -0.0510 0.0574  355 TYR A N   
566 C CA  . TYR A 76  ? 0.2511 0.2606 0.2022 0.0344  -0.0495 0.0534  355 TYR A CA  
567 C C   . TYR A 76  ? 0.2576 0.2860 0.2069 0.0372  -0.0600 0.0479  355 TYR A C   
568 O O   . TYR A 76  ? 0.2540 0.2844 0.1904 0.0334  -0.0604 0.0456  355 TYR A O   
569 C CB  . TYR A 76  ? 0.2294 0.2415 0.1930 0.0237  -0.0424 0.0457  355 TYR A CB  
570 C CG  . TYR A 76  ? 0.2333 0.2297 0.1953 0.0185  -0.0324 0.0491  355 TYR A CG  
571 C CD1 . TYR A 76  ? 0.2506 0.2329 0.1965 0.0181  -0.0273 0.0572  355 TYR A CD1 
572 C CD2 . TYR A 76  ? 0.2331 0.2295 0.2095 0.0137  -0.0276 0.0438  355 TYR A CD2 
573 C CE1 . TYR A 76  ? 0.2666 0.2375 0.2146 0.0114  -0.0176 0.0588  355 TYR A CE1 
574 C CE2 . TYR A 76  ? 0.2555 0.2405 0.2321 0.0088  -0.0197 0.0453  355 TYR A CE2 
575 C CZ  . TYR A 76  ? 0.2480 0.2213 0.2123 0.0072  -0.0148 0.0524  355 TYR A CZ  
576 O OH  . TYR A 76  ? 0.2548 0.2204 0.2231 0.0008  -0.0070 0.0522  355 TYR A OH  
577 N N   . TYR A 77  ? 0.2597 0.3028 0.2215 0.0444  -0.0687 0.0450  356 TYR A N   
578 C CA  . TYR A 77  ? 0.2993 0.3630 0.2614 0.0465  -0.0797 0.0383  356 TYR A CA  
579 C C   . TYR A 77  ? 0.3200 0.3776 0.2552 0.0546  -0.0858 0.0455  356 TYR A C   
580 O O   . TYR A 77  ? 0.2990 0.3646 0.2233 0.0516  -0.0903 0.0403  356 TYR A O   
581 C CB  . TYR A 77  ? 0.3305 0.4154 0.3143 0.0532  -0.0882 0.0332  356 TYR A CB  
582 C CG  . TYR A 77  ? 0.4052 0.5149 0.3925 0.0540  -0.1005 0.0244  356 TYR A CG  
583 C CD1 . TYR A 77  ? 0.4568 0.5714 0.4267 0.0664  -0.1127 0.0284  356 TYR A CD1 
584 C CD2 . TYR A 77  ? 0.4538 0.5826 0.4618 0.0428  -0.1006 0.0115  356 TYR A CD2 
585 C CE1 . TYR A 77  ? 0.4883 0.6284 0.4619 0.0673  -0.1258 0.0184  356 TYR A CE1 
586 C CE2 . TYR A 77  ? 0.4704 0.6234 0.4844 0.0420  -0.1124 0.0015  356 TYR A CE2 
587 C CZ  . TYR A 77  ? 0.4978 0.6579 0.4956 0.0542  -0.1255 0.0041  356 TYR A CZ  
588 O OH  . TYR A 77  ? 0.5054 0.6919 0.5103 0.0530  -0.1384 -0.0078 356 TYR A OH  
589 N N   . ASP A 78  ? 0.3470 0.3886 0.2690 0.0655  -0.0858 0.0577  357 ASP A N   
590 C CA  . ASP A 78  ? 0.4032 0.4360 0.2964 0.0744  -0.0906 0.0665  357 ASP A CA  
591 C C   . ASP A 78  ? 0.3741 0.3919 0.2455 0.0666  -0.0810 0.0705  357 ASP A C   
592 O O   . ASP A 78  ? 0.4018 0.4182 0.2482 0.0718  -0.0853 0.0741  357 ASP A O   
593 C CB  . ASP A 78  ? 0.4911 0.5054 0.3745 0.0881  -0.0911 0.0800  357 ASP A CB  
594 C CG  . ASP A 78  ? 0.5897 0.6221 0.4872 0.1020  -0.1046 0.0772  357 ASP A CG  
595 O OD1 . ASP A 78  ? 0.6096 0.6689 0.5121 0.1054  -0.1174 0.0683  357 ASP A OD1 
596 O OD2 . ASP A 78  ? 0.6831 0.7023 0.5862 0.1102  -0.1024 0.0837  357 ASP A OD2 
597 N N   . LYS A 79  ? 0.3350 0.3432 0.2155 0.0551  -0.0684 0.0691  358 LYS A N   
598 C CA  . LYS A 79  ? 0.3438 0.3410 0.2096 0.0469  -0.0577 0.0713  358 LYS A CA  
599 C C   . LYS A 79  ? 0.3187 0.3315 0.1883 0.0387  -0.0592 0.0583  358 LYS A C   
600 O O   . LYS A 79  ? 0.3145 0.3217 0.1748 0.0320  -0.0505 0.0573  358 LYS A O   
601 C CB  . LYS A 79  ? 0.3470 0.3286 0.2235 0.0392  -0.0445 0.0749  358 LYS A CB  
602 C CG  . LYS A 79  ? 0.3939 0.3537 0.2621 0.0448  -0.0400 0.0880  358 LYS A CG  
603 N N   . ASN A 80  ? 0.2928 0.3248 0.1777 0.0386  -0.0691 0.0477  359 ASN A N   
604 C CA  . ASN A 80  ? 0.2713 0.3143 0.1614 0.0296  -0.0698 0.0346  359 ASN A CA  
605 C C   . ASN A 80  ? 0.2563 0.2921 0.1569 0.0193  -0.0580 0.0310  359 ASN A C   
606 O O   . ASN A 80  ? 0.2503 0.2864 0.1453 0.0135  -0.0549 0.0238  359 ASN A O   
607 C CB  . ASN A 80  ? 0.2967 0.3401 0.1596 0.0318  -0.0732 0.0330  359 ASN A CB  
608 C CG  . ASN A 80  ? 0.3297 0.3805 0.1767 0.0436  -0.0862 0.0365  359 ASN A CG  
609 O OD1 . ASN A 80  ? 0.3583 0.4006 0.1751 0.0503  -0.0864 0.0438  359 ASN A OD1 
610 N ND2 . ASN A 80  ? 0.3194 0.3884 0.1847 0.0465  -0.0978 0.0299  359 ASN A ND2 
611 N N   . ILE A 81  ? 0.2215 0.2506 0.1372 0.0178  -0.0517 0.0351  360 ILE A N   
612 C CA  . ILE A 81  ? 0.2270 0.2507 0.1535 0.0099  -0.0421 0.0318  360 ILE A CA  
613 C C   . ILE A 81  ? 0.2101 0.2430 0.1583 0.0057  -0.0440 0.0237  360 ILE A C   
614 O O   . ILE A 81  ? 0.2002 0.2314 0.1534 -0.0005 -0.0390 0.0179  360 ILE A O   
615 C CB  . ILE A 81  ? 0.2481 0.2582 0.1752 0.0105  -0.0339 0.0409  360 ILE A CB  
616 C CG1 . ILE A 81  ? 0.3064 0.3073 0.2135 0.0099  -0.0272 0.0468  360 ILE A CG1 
617 C CG2 . ILE A 81  ? 0.2479 0.2558 0.1908 0.0045  -0.0269 0.0370  360 ILE A CG2 
618 C CD1 . ILE A 81  ? 0.3507 0.3373 0.2538 0.0111  -0.0206 0.0574  360 ILE A CD1 
619 N N   . MET A 82  ? 0.2158 0.2583 0.1756 0.0098  -0.0507 0.0233  361 MET A N   
620 C CA  . MET A 82  ? 0.2401 0.2927 0.2201 0.0053  -0.0511 0.0159  361 MET A CA  
621 C C   . MET A 82  ? 0.2934 0.3635 0.2855 0.0095  -0.0603 0.0129  361 MET A C   
622 O O   . MET A 82  ? 0.3304 0.4027 0.3168 0.0187  -0.0665 0.0184  361 MET A O   
623 C CB  . MET A 82  ? 0.3078 0.3528 0.2989 0.0031  -0.0429 0.0175  361 MET A CB  
624 C CG  . MET A 82  ? 0.3253 0.3632 0.3204 0.0083  -0.0403 0.0238  361 MET A CG  
625 S SD  . MET A 82  ? 0.3360 0.3712 0.3455 0.0032  -0.0322 0.0195  361 MET A SD  
626 C CE  . MET A 82  ? 0.3096 0.3305 0.3069 -0.0005 -0.0254 0.0218  361 MET A CE  
627 N N   . THR A 83  ? 0.2887 0.3713 0.2974 0.0027  -0.0608 0.0039  362 THR A N   
628 C CA  . THR A 83  ? 0.2836 0.3874 0.3112 0.0055  -0.0677 -0.0004 362 THR A CA  
629 C C   . THR A 83  ? 0.2507 0.3589 0.2984 0.0003  -0.0603 -0.0037 362 THR A C   
630 O O   . THR A 83  ? 0.2485 0.3442 0.2945 -0.0066 -0.0512 -0.0041 362 THR A O   
631 C CB  . THR A 83  ? 0.3345 0.4560 0.3653 0.0013  -0.0769 -0.0102 362 THR A CB  
632 O OG1 . THR A 83  ? 0.3719 0.4871 0.4034 -0.0111 -0.0708 -0.0173 362 THR A OG1 
633 C CG2 . THR A 83  ? 0.4069 0.5246 0.4151 0.0077  -0.0845 -0.0072 362 THR A CG2 
634 N N   . LYS A 84  ? 0.2518 0.3782 0.3178 0.0050  -0.0639 -0.0056 363 LYS A N   
635 C CA  . LYS A 84  ? 0.2609 0.3953 0.3468 -0.0004 -0.0562 -0.0098 363 LYS A CA  
636 C C   . LYS A 84  ? 0.2341 0.3819 0.3317 -0.0129 -0.0562 -0.0198 363 LYS A C   
637 O O   . LYS A 84  ? 0.2517 0.4136 0.3516 -0.0141 -0.0655 -0.0255 363 LYS A O   
638 C CB  . LYS A 84  ? 0.3074 0.4604 0.4113 0.0091  -0.0596 -0.0100 363 LYS A CB  
639 C CG  . LYS A 84  ? 0.3582 0.4958 0.4543 0.0201  -0.0570 -0.0015 363 LYS A CG  
640 C CD  . LYS A 84  ? 0.3859 0.5382 0.5023 0.0263  -0.0544 -0.0038 363 LYS A CD  
641 C CE  . LYS A 84  ? 0.4185 0.5660 0.5295 0.0423  -0.0610 0.0026  363 LYS A CE  
642 N NZ  . LYS A 84  ? 0.4580 0.6287 0.5914 0.0515  -0.0632 -0.0016 363 LYS A NZ  
643 N N   . VAL A 85  ? 0.2226 0.3668 0.3289 -0.0219 -0.0455 -0.0222 364 VAL A N   
644 C CA  . VAL A 85  ? 0.2066 0.3625 0.3271 -0.0347 -0.0433 -0.0313 364 VAL A CA  
645 C C   . VAL A 85  ? 0.2263 0.4063 0.3734 -0.0347 -0.0400 -0.0348 364 VAL A C   
646 O O   . VAL A 85  ? 0.2082 0.3827 0.3581 -0.0322 -0.0303 -0.0304 364 VAL A O   
647 C CB  . VAL A 85  ? 0.2020 0.3346 0.3118 -0.0447 -0.0322 -0.0306 364 VAL A CB  
648 C CG1 . VAL A 85  ? 0.2152 0.3563 0.3411 -0.0592 -0.0265 -0.0389 364 VAL A CG1 
649 C CG2 . VAL A 85  ? 0.2145 0.3260 0.2997 -0.0425 -0.0352 -0.0276 364 VAL A CG2 
650 N N   . HIS A 86  ? 0.2472 0.4547 0.4137 -0.0381 -0.0478 -0.0436 365 HIS A N   
651 C CA  . HIS A 86  ? 0.2941 0.5308 0.4904 -0.0397 -0.0449 -0.0493 365 HIS A CA  
652 C C   . HIS A 86  ? 0.2913 0.5268 0.4996 -0.0568 -0.0309 -0.0540 365 HIS A C   
653 O O   . HIS A 86  ? 0.2963 0.5167 0.4958 -0.0692 -0.0282 -0.0570 365 HIS A O   
654 C CB  . HIS A 86  ? 0.3385 0.6074 0.5517 -0.0360 -0.0599 -0.0577 365 HIS A CB  
655 C CG  . HIS A 86  ? 0.4010 0.6675 0.5983 -0.0181 -0.0732 -0.0514 365 HIS A CG  
656 N ND1 . HIS A 86  ? 0.4520 0.7020 0.6366 -0.0043 -0.0705 -0.0405 365 HIS A ND1 
657 C CD2 . HIS A 86  ? 0.4836 0.7589 0.6728 -0.0120 -0.0887 -0.0539 365 HIS A CD2 
658 C CE1 . HIS A 86  ? 0.4852 0.7326 0.6550 0.0090  -0.0827 -0.0357 365 HIS A CE1 
659 N NE2 . HIS A 86  ? 0.5109 0.7737 0.6820 0.0053  -0.0940 -0.0432 365 HIS A NE2 
660 N N   . GLY A 87  ? 0.2825 0.5298 0.5075 -0.0566 -0.0205 -0.0535 366 GLY A N   
661 C CA  . GLY A 87  ? 0.3059 0.5572 0.5458 -0.0728 -0.0057 -0.0578 366 GLY A CA  
662 C C   . GLY A 87  ? 0.3124 0.5298 0.5298 -0.0748 0.0087  -0.0488 366 GLY A C   
663 O O   . GLY A 87  ? 0.3175 0.5292 0.5394 -0.0879 0.0230  -0.0496 366 GLY A O   
664 N N   . LYS A 88  ? 0.2755 0.4708 0.4689 -0.0621 0.0052  -0.0403 367 LYS A N   
665 C CA  . LYS A 88  ? 0.2812 0.4457 0.4516 -0.0621 0.0155  -0.0326 367 LYS A CA  
666 C C   . LYS A 88  ? 0.2972 0.4572 0.4593 -0.0467 0.0146  -0.0265 367 LYS A C   
667 O O   . LYS A 88  ? 0.3371 0.5081 0.5032 -0.0359 0.0039  -0.0265 367 LYS A O   
668 C CB  . LYS A 88  ? 0.3034 0.4419 0.4511 -0.0652 0.0115  -0.0304 367 LYS A CB  
669 C CG  . LYS A 88  ? 0.3262 0.4651 0.4804 -0.0807 0.0124  -0.0376 367 LYS A CG  
670 C CD  . LYS A 88  ? 0.3763 0.4852 0.5059 -0.0829 0.0117  -0.0353 367 LYS A CD  
671 C CE  . LYS A 88  ? 0.4296 0.5377 0.5648 -0.0972 0.0104  -0.0440 367 LYS A CE  
672 N NZ  . LYS A 88  ? 0.4374 0.5178 0.5478 -0.0959 0.0077  -0.0425 367 LYS A NZ  
673 N N   . ARG A 89  ? 0.2498 0.3922 0.3988 -0.0456 0.0257  -0.0215 368 ARG A N   
674 C CA  . ARG A 89  ? 0.2184 0.3553 0.3593 -0.0322 0.0258  -0.0173 368 ARG A CA  
675 C C   . ARG A 89  ? 0.1840 0.2972 0.3020 -0.0257 0.0195  -0.0121 368 ARG A C   
676 O O   . ARG A 89  ? 0.1730 0.2646 0.2729 -0.0296 0.0233  -0.0090 368 ARG A O   
677 C CB  . ARG A 89  ? 0.2559 0.3910 0.3961 -0.0332 0.0406  -0.0162 368 ARG A CB  
678 C CG  . ARG A 89  ? 0.2978 0.4635 0.4664 -0.0382 0.0462  -0.0223 368 ARG A CG  
679 C CD  . ARG A 89  ? 0.3424 0.5199 0.5190 -0.0321 0.0570  -0.0232 368 ARG A CD  
680 N NE  . ARG A 89  ? 0.3329 0.5019 0.4982 -0.0163 0.0532  -0.0210 368 ARG A NE  
681 C CZ  . ARG A 89  ? 0.3782 0.5460 0.5388 -0.0100 0.0633  -0.0210 368 ARG A CZ  
682 N NH1 . ARG A 89  ? 0.4348 0.6098 0.6000 -0.0177 0.0787  -0.0218 368 ARG A NH1 
683 N NH2 . ARG A 89  ? 0.3746 0.5331 0.5253 0.0035  0.0586  -0.0205 368 ARG A NH2 
684 N N   . TYR A 90  ? 0.1385 0.2544 0.2566 -0.0150 0.0102  -0.0108 369 TYR A N   
685 C CA  . TYR A 90  ? 0.1388 0.2355 0.2389 -0.0093 0.0051  -0.0063 369 TYR A CA  
686 C C   . TYR A 90  ? 0.1361 0.2208 0.2239 -0.0161 0.0015  -0.0053 369 TYR A C   
687 O O   . TYR A 90  ? 0.1476 0.2147 0.2198 -0.0153 0.0026  -0.0023 369 TYR A O   
688 C CB  . TYR A 90  ? 0.1325 0.2136 0.2201 -0.0047 0.0116  -0.0040 369 TYR A CB  
689 C CG  . TYR A 90  ? 0.1271 0.2173 0.2239 0.0035  0.0150  -0.0059 369 TYR A CG  
690 C CD1 . TYR A 90  ? 0.1246 0.2162 0.2249 0.0132  0.0084  -0.0055 369 TYR A CD1 
691 C CD2 . TYR A 90  ? 0.1370 0.2328 0.2375 0.0015  0.0257  -0.0079 369 TYR A CD2 
692 C CE1 . TYR A 90  ? 0.1229 0.2219 0.2319 0.0221  0.0114  -0.0081 369 TYR A CE1 
693 C CE2 . TYR A 90  ? 0.1373 0.2423 0.2459 0.0100  0.0296  -0.0107 369 TYR A CE2 
694 C CZ  . TYR A 90  ? 0.1253 0.2322 0.2389 0.0207  0.0219  -0.0113 369 TYR A CZ  
695 O OH  . TYR A 90  ? 0.1323 0.2456 0.2525 0.0301  0.0258  -0.0147 369 TYR A OH  
696 N N   . ALA A 91  ? 0.1548 0.2520 0.2515 -0.0213 -0.0037 -0.0088 370 ALA A N   
697 C CA  . ALA A 91  ? 0.1522 0.2396 0.2382 -0.0280 -0.0069 -0.0098 370 ALA A CA  
698 C C   . ALA A 91  ? 0.1357 0.2274 0.2178 -0.0226 -0.0180 -0.0090 370 ALA A C   
699 O O   . ALA A 91  ? 0.1255 0.2346 0.2192 -0.0177 -0.0245 -0.0105 370 ALA A O   
700 C CB  . ALA A 91  ? 0.1645 0.2596 0.2606 -0.0398 -0.0036 -0.0157 370 ALA A CB  
701 N N   . TYR A 92  ? 0.1324 0.2085 0.1976 -0.0230 -0.0197 -0.0069 371 TYR A N   
702 C CA  . TYR A 92  ? 0.1376 0.2136 0.1935 -0.0181 -0.0282 -0.0049 371 TYR A CA  
703 C C   . TYR A 92  ? 0.1603 0.2266 0.2038 -0.0243 -0.0285 -0.0077 371 TYR A C   
704 O O   . TYR A 92  ? 0.1427 0.1978 0.1831 -0.0306 -0.0215 -0.0097 371 TYR A O   
705 C CB  . TYR A 92  ? 0.1661 0.2302 0.2124 -0.0101 -0.0275 0.0022  371 TYR A CB  
706 C CG  . TYR A 92  ? 0.1827 0.2525 0.2388 -0.0026 -0.0277 0.0046  371 TYR A CG  
707 C CD1 . TYR A 92  ? 0.2012 0.2682 0.2629 -0.0024 -0.0205 0.0041  371 TYR A CD1 
708 C CD2 . TYR A 92  ? 0.2290 0.3068 0.2875 0.0052  -0.0353 0.0069  371 TYR A CD2 
709 C CE1 . TYR A 92  ? 0.2340 0.3060 0.3045 0.0057  -0.0205 0.0051  371 TYR A CE1 
710 C CE2 . TYR A 92  ? 0.2589 0.3404 0.3262 0.0140  -0.0357 0.0088  371 TYR A CE2 
711 C CZ  . TYR A 92  ? 0.2527 0.3310 0.3262 0.0137  -0.0280 0.0074  371 TYR A CZ  
712 O OH  . TYR A 92  ? 0.3085 0.3911 0.3908 0.0236  -0.0290 0.0081  371 TYR A OH  
713 N N   . LYS A 93  ? 0.1600 0.2280 0.1939 -0.0215 -0.0358 -0.0076 372 LYS A N   
714 C CA  . LYS A 93  ? 0.1695 0.2285 0.1905 -0.0265 -0.0359 -0.0116 372 LYS A CA  
715 C C   . LYS A 93  ? 0.1754 0.2277 0.1796 -0.0198 -0.0385 -0.0063 372 LYS A C   
716 O O   . LYS A 93  ? 0.2056 0.2662 0.2075 -0.0140 -0.0454 -0.0035 372 LYS A O   
717 C CB  . LYS A 93  ? 0.2050 0.2762 0.2322 -0.0327 -0.0420 -0.0203 372 LYS A CB  
718 C CG  . LYS A 93  ? 0.2396 0.3013 0.2535 -0.0379 -0.0429 -0.0267 372 LYS A CG  
719 C CD  . LYS A 93  ? 0.2862 0.3624 0.3080 -0.0447 -0.0506 -0.0373 372 LYS A CD  
720 N N   . PHE A 94  ? 0.1659 0.2045 0.1582 -0.0205 -0.0332 -0.0053 373 PHE A N   
721 C CA  . PHE A 94  ? 0.1852 0.2188 0.1617 -0.0160 -0.0339 -0.0013 373 PHE A CA  
722 C C   . PHE A 94  ? 0.2020 0.2402 0.1680 -0.0169 -0.0401 -0.0067 373 PHE A C   
723 O O   . PHE A 94  ? 0.2114 0.2511 0.1800 -0.0227 -0.0418 -0.0151 373 PHE A O   
724 C CB  . PHE A 94  ? 0.1826 0.2041 0.1518 -0.0164 -0.0263 -0.0006 373 PHE A CB  
725 C CG  . PHE A 94  ? 0.2028 0.2199 0.1787 -0.0143 -0.0211 0.0045  373 PHE A CG  
726 C CD1 . PHE A 94  ? 0.2067 0.2226 0.1802 -0.0106 -0.0200 0.0112  373 PHE A CD1 
727 C CD2 . PHE A 94  ? 0.1938 0.2068 0.1767 -0.0162 -0.0172 0.0024  373 PHE A CD2 
728 C CE1 . PHE A 94  ? 0.2305 0.2425 0.2111 -0.0097 -0.0157 0.0138  373 PHE A CE1 
729 C CE2 . PHE A 94  ? 0.2162 0.2261 0.2038 -0.0138 -0.0134 0.0056  373 PHE A CE2 
730 C CZ  . PHE A 94  ? 0.2042 0.2147 0.1919 -0.0110 -0.0133 0.0105  373 PHE A CZ  
731 N N   . ASP A 95  ? 0.2269 0.2667 0.1797 -0.0111 -0.0437 -0.0017 374 ASP A N   
732 C CA  . ASP A 95  ? 0.2385 0.2820 0.1756 -0.0101 -0.0498 -0.0062 374 ASP A CA  
733 C C   . ASP A 95  ? 0.2412 0.2729 0.1608 -0.0093 -0.0422 -0.0049 374 ASP A C   
734 O O   . ASP A 95  ? 0.2471 0.2741 0.1603 -0.0054 -0.0374 0.0039  374 ASP A O   
735 C CB  . ASP A 95  ? 0.2547 0.3069 0.1862 -0.0022 -0.0582 -0.0002 374 ASP A CB  
736 C CG  . ASP A 95  ? 0.2824 0.3409 0.1960 0.0005  -0.0668 -0.0049 374 ASP A CG  
737 O OD1 . ASP A 95  ? 0.2873 0.3381 0.1857 -0.0015 -0.0627 -0.0085 374 ASP A OD1 
738 O OD2 . ASP A 95  ? 0.2845 0.3564 0.1978 0.0060  -0.0782 -0.0054 374 ASP A OD2 
739 N N   . PHE A 96  ? 0.2453 0.2725 0.1591 -0.0131 -0.0404 -0.0140 375 PHE A N   
740 C CA  . PHE A 96  ? 0.2655 0.2843 0.1644 -0.0113 -0.0333 -0.0145 375 PHE A CA  
741 C C   . PHE A 96  ? 0.2514 0.2727 0.1303 -0.0058 -0.0345 -0.0095 375 PHE A C   
742 O O   . PHE A 96  ? 0.2590 0.2756 0.1277 -0.0035 -0.0260 -0.0050 375 PHE A O   
743 C CB  . PHE A 96  ? 0.3073 0.3200 0.2005 -0.0148 -0.0332 -0.0269 375 PHE A CB  
744 C CG  . PHE A 96  ? 0.3355 0.3371 0.2332 -0.0154 -0.0244 -0.0286 375 PHE A CG  
745 C CD1 . PHE A 96  ? 0.3725 0.3719 0.2643 -0.0106 -0.0162 -0.0242 375 PHE A CD1 
746 C CD2 . PHE A 96  ? 0.3480 0.3413 0.2545 -0.0202 -0.0240 -0.0352 375 PHE A CD2 
747 C CE1 . PHE A 96  ? 0.3378 0.3296 0.2351 -0.0091 -0.0094 -0.0260 375 PHE A CE1 
748 C CE2 . PHE A 96  ? 0.3812 0.3633 0.2901 -0.0183 -0.0166 -0.0352 375 PHE A CE2 
749 C CZ  . PHE A 96  ? 0.3397 0.3222 0.2443 -0.0121 -0.0102 -0.0310 375 PHE A CZ  
750 N N   . HIS A 97  ? 0.2371 0.2665 0.1095 -0.0034 -0.0446 -0.0100 376 HIS A N   
751 C CA  . HIS A 97  ? 0.2576 0.2875 0.1056 0.0030  -0.0462 -0.0051 376 HIS A CA  
752 C C   . HIS A 97  ? 0.2595 0.2840 0.1043 0.0071  -0.0398 0.0097  376 HIS A C   
753 O O   . HIS A 97  ? 0.2688 0.2876 0.0949 0.0098  -0.0327 0.0155  376 HIS A O   
754 C CB  . HIS A 97  ? 0.2792 0.3204 0.1209 0.0061  -0.0604 -0.0097 376 HIS A CB  
755 C CG  . HIS A 97  ? 0.2874 0.3340 0.1363 -0.0003 -0.0668 -0.0252 376 HIS A CG  
756 N ND1 . HIS A 97  ? 0.2981 0.3578 0.1644 -0.0034 -0.0772 -0.0317 376 HIS A ND1 
757 C CD2 . HIS A 97  ? 0.3081 0.3478 0.1519 -0.0049 -0.0629 -0.0359 376 HIS A CD2 
758 C CE1 . HIS A 97  ? 0.3211 0.3814 0.1913 -0.0110 -0.0799 -0.0460 376 HIS A CE1 
759 N NE2 . HIS A 97  ? 0.3255 0.3717 0.1817 -0.0117 -0.0712 -0.0486 376 HIS A NE2 
760 N N   . GLY A 98  ? 0.2487 0.2740 0.1111 0.0071  -0.0414 0.0154  377 GLY A N   
761 C CA  . GLY A 98  ? 0.2501 0.2667 0.1099 0.0099  -0.0345 0.0285  377 GLY A CA  
762 C C   . GLY A 98  ? 0.2470 0.2573 0.1165 0.0045  -0.0221 0.0296  377 GLY A C   
763 O O   . GLY A 98  ? 0.2679 0.2711 0.1294 0.0048  -0.0136 0.0380  377 GLY A O   
764 N N   . ILE A 99  ? 0.2387 0.2517 0.1247 0.0000  -0.0211 0.0214  378 ILE A N   
765 C CA  . ILE A 99  ? 0.2492 0.2589 0.1455 -0.0036 -0.0110 0.0207  378 ILE A CA  
766 C C   . ILE A 99  ? 0.2552 0.2641 0.1362 -0.0032 -0.0030 0.0198  378 ILE A C   
767 O O   . ILE A 99  ? 0.2523 0.2600 0.1356 -0.0047 0.0065  0.0243  378 ILE A O   
768 C CB  . ILE A 99  ? 0.2565 0.2675 0.1682 -0.0065 -0.0122 0.0121  378 ILE A CB  
769 C CG1 . ILE A 99  ? 0.2816 0.2941 0.2099 -0.0074 -0.0170 0.0135  378 ILE A CG1 
770 C CG2 . ILE A 99  ? 0.2691 0.2785 0.1865 -0.0076 -0.0034 0.0101  378 ILE A CG2 
771 C CD1 . ILE A 99  ? 0.2894 0.2988 0.2267 -0.0070 -0.0132 0.0208  378 ILE A CD1 
772 N N   . ALA A 100 ? 0.2502 0.2608 0.1160 -0.0013 -0.0061 0.0134  379 ALA A N   
773 C CA  . ALA A 100 ? 0.2577 0.2683 0.1082 0.0001  0.0026  0.0118  379 ALA A CA  
774 C C   . ALA A 100 ? 0.2790 0.2872 0.1167 0.0011  0.0100  0.0230  379 ALA A C   
775 O O   . ALA A 100 ? 0.2993 0.3088 0.1332 0.0001  0.0214  0.0247  379 ALA A O   
776 C CB  . ALA A 100 ? 0.2778 0.2892 0.1100 0.0026  -0.0028 0.0027  379 ALA A CB  
777 N N   . GLN A 101 ? 0.2815 0.2862 0.1088 0.0039  0.0037  0.0310  380 GLN A N   
778 C CA  . GLN A 101 ? 0.3134 0.3112 0.1271 0.0049  0.0111  0.0436  380 GLN A CA  
779 C C   . GLN A 101 ? 0.3133 0.3069 0.1460 -0.0006 0.0202  0.0502  380 GLN A C   
780 O O   . GLN A 101 ? 0.3192 0.3089 0.1455 -0.0036 0.0326  0.0573  380 GLN A O   
781 C CB  . GLN A 101 ? 0.3454 0.3385 0.1427 0.0113  0.0012  0.0512  380 GLN A CB  
782 C CG  . GLN A 101 ? 0.3877 0.3845 0.1588 0.0169  -0.0049 0.0468  380 GLN A CG  
783 C CD  . GLN A 101 ? 0.4189 0.4109 0.1700 0.0250  -0.0133 0.0564  380 GLN A CD  
784 O OE1 . GLN A 101 ? 0.4345 0.4210 0.1952 0.0267  -0.0161 0.0646  380 GLN A OE1 
785 N NE2 . GLN A 101 ? 0.4459 0.4402 0.1704 0.0310  -0.0183 0.0545  380 GLN A NE2 
786 N N   . ALA A 102 ? 0.3235 0.3177 0.1777 -0.0022 0.0141  0.0480  381 ALA A N   
787 C CA  . ALA A 102 ? 0.3404 0.3312 0.2145 -0.0074 0.0204  0.0516  381 ALA A CA  
788 C C   . ALA A 102 ? 0.3595 0.3577 0.2454 -0.0125 0.0306  0.0462  381 ALA A C   
789 O O   . ALA A 102 ? 0.3938 0.3903 0.2906 -0.0178 0.0389  0.0502  381 ALA A O   
790 C CB  . ALA A 102 ? 0.3096 0.3015 0.2025 -0.0069 0.0114  0.0478  381 ALA A CB  
791 N N   . LEU A 103 ? 0.3524 0.3589 0.2357 -0.0106 0.0306  0.0371  382 LEU A N   
792 C CA  . LEU A 103 ? 0.3529 0.3688 0.2456 -0.0132 0.0409  0.0318  382 LEU A CA  
793 C C   . LEU A 103 ? 0.3927 0.4108 0.2734 -0.0152 0.0538  0.0366  382 LEU A C   
794 O O   . LEU A 103 ? 0.4293 0.4574 0.3226 -0.0183 0.0632  0.0333  382 LEU A O   
795 C CB  . LEU A 103 ? 0.3539 0.3760 0.2478 -0.0090 0.0375  0.0201  382 LEU A CB  
796 C CG  . LEU A 103 ? 0.3634 0.3825 0.2663 -0.0075 0.0269  0.0146  382 LEU A CG  
797 C CD1 . LEU A 103 ? 0.3942 0.4146 0.2946 -0.0036 0.0254  0.0039  382 LEU A CD1 
798 C CD2 . LEU A 103 ? 0.3763 0.3961 0.3002 -0.0100 0.0252  0.0155  382 LEU A CD2 
799 N N   . GLN A 104 ? 0.3918 0.4022 0.2477 -0.0130 0.0549  0.0440  383 GLN A N   
800 C CA  . GLN A 104 ? 0.4210 0.4328 0.2620 -0.0149 0.0691  0.0492  383 GLN A CA  
801 C C   . GLN A 104 ? 0.5115 0.5157 0.3570 -0.0227 0.0804  0.0612  383 GLN A C   
802 O O   . GLN A 104 ? 0.5093 0.5022 0.3615 -0.0244 0.0747  0.0674  383 GLN A O   
803 C CB  . GLN A 104 ? 0.4406 0.4460 0.2490 -0.0084 0.0656  0.0523  383 GLN A CB  
804 C CG  . GLN A 104 ? 0.4093 0.4183 0.2125 -0.0021 0.0525  0.0408  383 GLN A CG  
805 C CD  . GLN A 104 ? 0.4001 0.4198 0.2147 -0.0017 0.0566  0.0283  383 GLN A CD  
806 O OE1 . GLN A 104 ? 0.4293 0.4563 0.2413 -0.0026 0.0701  0.0277  383 GLN A OE1 
807 N NE2 . GLN A 104 ? 0.3830 0.4037 0.2088 0.0002  0.0462  0.0185  383 GLN A NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   280 ?   ?   ?   A . n 
A 1 2   ALA 2   281 ?   ?   ?   A . n 
A 1 3   MET 3   282 ?   ?   ?   A . n 
A 1 4   GLY 4   283 ?   ?   ?   A . n 
A 1 5   SER 5   284 ?   ?   ?   A . n 
A 1 6   GLY 6   285 ?   ?   ?   A . n 
A 1 7   ILE 7   286 286 ILE ILE A . n 
A 1 8   GLN 8   287 287 GLN GLN A . n 
A 1 9   ARG 9   288 288 ARG ARG A . n 
A 1 10  PRO 10  289 289 PRO PRO A . n 
A 1 11  GLY 11  290 290 GLY GLY A . n 
A 1 12  SER 12  291 291 SER SER A . n 
A 1 13  GLY 13  292 292 GLY GLY A . n 
A 1 14  GLN 14  293 293 GLN GLN A . n 
A 1 15  ILE 15  294 294 ILE ILE A . n 
A 1 16  GLN 16  295 295 GLN GLN A . n 
A 1 17  LEU 17  296 296 LEU LEU A . n 
A 1 18  TRP 18  297 297 TRP TRP A . n 
A 1 19  GLN 19  298 298 GLN GLN A . n 
A 1 20  PHE 20  299 299 PHE PHE A . n 
A 1 21  LEU 21  300 300 LEU LEU A . n 
A 1 22  LEU 22  301 301 LEU LEU A . n 
A 1 23  GLU 23  302 302 GLU GLU A . n 
A 1 24  LEU 24  303 303 LEU LEU A . n 
A 1 25  LEU 25  304 304 LEU LEU A . n 
A 1 26  SER 26  305 305 SER SER A . n 
A 1 27  ASP 27  306 306 ASP ASP A . n 
A 1 28  SER 28  307 307 SER SER A . n 
A 1 29  SER 29  308 308 SER SER A . n 
A 1 30  ASN 30  309 309 ASN ASN A . n 
A 1 31  SER 31  310 310 SER SER A . n 
A 1 32  SER 32  311 311 SER SER A . n 
A 1 33  CYS 33  312 312 CYS CYS A . n 
A 1 34  ILE 34  313 313 ILE ILE A . n 
A 1 35  THR 35  314 314 THR THR A . n 
A 1 36  TRP 36  315 315 TRP TRP A . n 
A 1 37  GLU 37  316 316 GLU GLU A . n 
A 1 38  GLY 38  317 317 GLY GLY A . n 
A 1 39  THR 39  318 318 THR THR A . n 
A 1 40  ASN 40  319 319 ASN ASN A . n 
A 1 41  GLY 41  320 320 GLY GLY A . n 
A 1 42  GLU 42  321 321 GLU GLU A . n 
A 1 43  PHE 43  322 322 PHE PHE A . n 
A 1 44  LYS 44  323 323 LYS LYS A . n 
A 1 45  MET 45  324 324 MET MET A . n 
A 1 46  THR 46  325 325 THR THR A . n 
A 1 47  ASP 47  326 326 ASP ASP A . n 
A 1 48  PRO 48  327 327 PRO PRO A . n 
A 1 49  ASP 49  328 328 ASP ASP A . n 
A 1 50  GLU 50  329 329 GLU GLU A . n 
A 1 51  VAL 51  330 330 VAL VAL A . n 
A 1 52  ALA 52  331 331 ALA ALA A . n 
A 1 53  ARG 53  332 332 ARG ARG A . n 
A 1 54  ARG 54  333 333 ARG ARG A . n 
A 1 55  TRP 55  334 334 TRP TRP A . n 
A 1 56  GLY 56  335 335 GLY GLY A . n 
A 1 57  GLU 57  336 336 GLU GLU A . n 
A 1 58  ARG 58  337 337 ARG ARG A . n 
A 1 59  LYS 59  338 338 LYS LYS A . n 
A 1 60  SER 60  339 339 SER SER A . n 
A 1 61  LYS 61  340 340 LYS LYS A . n 
A 1 62  PRO 62  341 341 PRO PRO A . n 
A 1 63  ASN 63  342 342 ASN ASN A . n 
A 1 64  MET 64  343 343 MET MET A . n 
A 1 65  ASN 65  344 344 ASN ASN A . n 
A 1 66  TYR 66  345 345 TYR TYR A . n 
A 1 67  ASP 67  346 346 ASP ASP A . n 
A 1 68  LYS 68  347 347 LYS LYS A . n 
A 1 69  LEU 69  348 348 LEU LEU A . n 
A 1 70  SER 70  349 349 SER SER A . n 
A 1 71  ARG 71  350 350 ARG ARG A . n 
A 1 72  ALA 72  351 351 ALA ALA A . n 
A 1 73  LEU 73  352 352 LEU LEU A . n 
A 1 74  ARG 74  353 353 ARG ARG A . n 
A 1 75  TYR 75  354 354 TYR TYR A . n 
A 1 76  TYR 76  355 355 TYR TYR A . n 
A 1 77  TYR 77  356 356 TYR TYR A . n 
A 1 78  ASP 78  357 357 ASP ASP A . n 
A 1 79  LYS 79  358 358 LYS LYS A . n 
A 1 80  ASN 80  359 359 ASN ASN A . n 
A 1 81  ILE 81  360 360 ILE ILE A . n 
A 1 82  MET 82  361 361 MET MET A . n 
A 1 83  THR 83  362 362 THR THR A . n 
A 1 84  LYS 84  363 363 LYS LYS A . n 
A 1 85  VAL 85  364 364 VAL VAL A . n 
A 1 86  HIS 86  365 365 HIS HIS A . n 
A 1 87  GLY 87  366 366 GLY GLY A . n 
A 1 88  LYS 88  367 367 LYS LYS A . n 
A 1 89  ARG 89  368 368 ARG ARG A . n 
A 1 90  TYR 90  369 369 TYR TYR A . n 
A 1 91  ALA 91  370 370 ALA ALA A . n 
A 1 92  TYR 92  371 371 TYR TYR A . n 
A 1 93  LYS 93  372 372 LYS LYS A . n 
A 1 94  PHE 94  373 373 PHE PHE A . n 
A 1 95  ASP 95  374 374 ASP ASP A . n 
A 1 96  PHE 96  375 375 PHE PHE A . n 
A 1 97  HIS 97  376 376 HIS HIS A . n 
A 1 98  GLY 98  377 377 GLY GLY A . n 
A 1 99  ILE 99  378 378 ILE ILE A . n 
A 1 100 ALA 100 379 379 ALA ALA A . n 
A 1 101 GLN 101 380 380 GLN GLN A . n 
A 1 102 ALA 102 381 381 ALA ALA A . n 
A 1 103 LEU 103 382 382 LEU LEU A . n 
A 1 104 GLN 104 383 383 GLN GLN A . n 
A 1 105 PRO 105 384 ?   ?   ?   A . n 
A 1 106 HIS 106 385 ?   ?   ?   A . n 
A 1 107 PRO 107 386 ?   ?   ?   A . n 
A 1 108 PRO 108 387 ?   ?   ?   A . n 
A 1 109 GLU 109 388 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1930  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  10440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z        1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_554 x,x-y,-z-1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -29.1853333333 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 407 ? B HOH . 
2 1 A HOH 410 ? B HOH . 
3 1 A HOH 411 ? B HOH . 
4 1 A HOH 426 ? B HOH . 
5 1 A HOH 446 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-07-31 
2 'Structure model' 1 1 2013-08-14 
3 'Structure model' 1 2 2013-08-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         3.2028 
_pdbx_refine_tls.origin_y         12.9128 
_pdbx_refine_tls.origin_z         -6.1583 
_pdbx_refine_tls.T[1][1]          0.0133 
_pdbx_refine_tls.T[2][2]          0.0195 
_pdbx_refine_tls.T[3][3]          0.0257 
_pdbx_refine_tls.T[1][2]          -0.0023 
_pdbx_refine_tls.T[1][3]          -0.0123 
_pdbx_refine_tls.T[2][3]          0.0176 
_pdbx_refine_tls.L[1][1]          1.5693 
_pdbx_refine_tls.L[2][2]          1.7385 
_pdbx_refine_tls.L[3][3]          2.1591 
_pdbx_refine_tls.L[1][2]          -0.4856 
_pdbx_refine_tls.L[1][3]          -0.2954 
_pdbx_refine_tls.L[2][3]          0.5814 
_pdbx_refine_tls.S[1][1]          -0.0137 
_pdbx_refine_tls.S[1][2]          0.1367 
_pdbx_refine_tls.S[1][3]          0.1453 
_pdbx_refine_tls.S[2][1]          -0.1254 
_pdbx_refine_tls.S[2][2]          0.0079 
_pdbx_refine_tls.S[2][3]          0.0944 
_pdbx_refine_tls.S[3][1]          -0.0959 
_pdbx_refine_tls.S[3][2]          -0.1184 
_pdbx_refine_tls.S[3][3]          0.0058 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     286 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     383 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.7.0029 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    417 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    440 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 288 ? ? CZ A ARG 288 ? ? NH1 A ARG 288 ? ? 125.58 120.30 5.28  0.50 N 
2 1 NE A ARG 288 ? ? CZ A ARG 288 ? ? NH2 A ARG 288 ? ? 115.68 120.30 -4.62 0.50 N 
3 1 NE A ARG 337 ? ? CZ A ARG 337 ? ? NH1 A ARG 337 ? ? 123.46 120.30 3.16  0.50 N 
4 1 CA A MET 361 ? ? CB A MET 361 ? ? CG  A MET 361 ? ? 128.02 113.30 14.72 1.70 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 358 ? CD ? A LYS 79 CD 
2 1 Y 1 A LYS 358 ? CE ? A LYS 79 CE 
3 1 Y 1 A LYS 358 ? NZ ? A LYS 79 NZ 
4 1 Y 1 A LYS 372 ? CE ? A LYS 93 CE 
5 1 Y 1 A LYS 372 ? NZ ? A LYS 93 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 280 ? A GLY 1   
2  1 Y 1 A ALA 281 ? A ALA 2   
3  1 Y 1 A MET 282 ? A MET 3   
4  1 Y 1 A GLY 283 ? A GLY 4   
5  1 Y 1 A SER 284 ? A SER 5   
6  1 Y 1 A GLY 285 ? A GLY 6   
7  1 Y 1 A PRO 384 ? A PRO 105 
8  1 Y 1 A HIS 385 ? A HIS 106 
9  1 Y 1 A PRO 386 ? A PRO 107 
10 1 Y 1 A PRO 387 ? A PRO 108 
11 1 Y 1 A GLU 388 ? A GLU 109 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  401 1  HOH HOH A . 
B 2 HOH 2  402 2  HOH HOH A . 
B 2 HOH 3  403 3  HOH HOH A . 
B 2 HOH 4  404 4  HOH HOH A . 
B 2 HOH 5  405 5  HOH HOH A . 
B 2 HOH 6  406 6  HOH HOH A . 
B 2 HOH 7  407 7  HOH HOH A . 
B 2 HOH 8  408 8  HOH HOH A . 
B 2 HOH 9  409 9  HOH HOH A . 
B 2 HOH 10 410 10 HOH HOH A . 
B 2 HOH 11 411 11 HOH HOH A . 
B 2 HOH 12 412 12 HOH HOH A . 
B 2 HOH 13 413 13 HOH HOH A . 
B 2 HOH 14 414 14 HOH HOH A . 
B 2 HOH 15 415 15 HOH HOH A . 
B 2 HOH 16 416 16 HOH HOH A . 
B 2 HOH 17 417 17 HOH HOH A . 
B 2 HOH 18 418 18 HOH HOH A . 
B 2 HOH 19 419 19 HOH HOH A . 
B 2 HOH 20 420 20 HOH HOH A . 
B 2 HOH 21 421 21 HOH HOH A . 
B 2 HOH 22 422 22 HOH HOH A . 
B 2 HOH 23 423 23 HOH HOH A . 
B 2 HOH 24 424 24 HOH HOH A . 
B 2 HOH 25 425 25 HOH HOH A . 
B 2 HOH 26 426 26 HOH HOH A . 
B 2 HOH 27 427 27 HOH HOH A . 
B 2 HOH 28 428 28 HOH HOH A . 
B 2 HOH 29 429 29 HOH HOH A . 
B 2 HOH 30 430 30 HOH HOH A . 
B 2 HOH 31 431 31 HOH HOH A . 
B 2 HOH 32 432 32 HOH HOH A . 
B 2 HOH 33 433 33 HOH HOH A . 
B 2 HOH 34 434 34 HOH HOH A . 
B 2 HOH 35 435 35 HOH HOH A . 
B 2 HOH 36 436 36 HOH HOH A . 
B 2 HOH 37 437 37 HOH HOH A . 
B 2 HOH 38 438 38 HOH HOH A . 
B 2 HOH 39 439 39 HOH HOH A . 
B 2 HOH 40 440 40 HOH HOH A . 
B 2 HOH 41 441 41 HOH HOH A . 
B 2 HOH 42 442 42 HOH HOH A . 
B 2 HOH 43 443 43 HOH HOH A . 
B 2 HOH 44 444 44 HOH HOH A . 
B 2 HOH 45 445 45 HOH HOH A . 
B 2 HOH 46 446 46 HOH HOH A . 
#