data_4KYI
# 
_entry.id   4KYI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KYI         
RCSB  RCSB079954   
WWPDB D_1000079954 
# 
_pdbx_database_status.entry_id                        4KYI 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lucas, M.'           1 
'Gaspar, A.H.'        2 
'Pallara, C.'         3 
'Rojas, A.L.'         4 
'Fernandez-Recio, J.' 5 
'Machner, M.P.'       6 
'Hierro, A.'          7 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the recruitment and activation of the Legionella phospholipase VipD by the host GTPase Rab5.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                E3514 
_citation.page_last                 E3523 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25114243 
_citation.pdbx_database_id_DOI      10.1073/pnas.1405391111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lucas, M.'           1 
primary 'Gaspar, A.H.'        2 
primary 'Pallara, C.'         3 
primary 'Rojas, A.L.'         4 
primary 'Fernandez-Recio, J.' 5 
primary 'Machner, M.P.'       6 
primary 'Hierro, A.'          7 
# 
_cell.length_a           94.275 
_cell.length_b           97.976 
_cell.length_c           109.849 
_cell.angle_alpha        76.570 
_cell.angle_beta         80.710 
_cell.angle_gamma        78.910 
_cell.entry_id           4KYI 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         4KYI 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man VipD                                          61229.688 4 ? ?    'unp Residues 19-564' ? 
2 polymer     man 'Ras-related protein Rab-5C'                  18791.492 4 ? Q80L 'unp Residues 18-182' ? 
3 non-polymer syn 1,2-ETHANEDIOL                                62.068    6 ? ?    ?                     ? 
4 non-polymer syn GLYCEROL                                      92.094    3 ? ?    ?                     ? 
5 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   4 ? ?    ?                     ? 
6 non-polymer syn 'MAGNESIUM ION'                               24.305    4 ? ?    ?                     ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'L1880, RAB5L' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMGSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKK
LIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNV
DDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSE
DTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAIS
WFKARMDSLVEATIGGKWLHATSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTF
DHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKE
KAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKVEVQPEP
;
;GAMGSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKK
LIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNV
DDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSE
DTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAIS
WFKARMDSLVEATIGGKWLHATSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTF
DHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKE
KAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKVEVQPEP
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;GAMGSKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYR
GAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVN
EIFMAIAKKL
;
;GAMGSKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYR
GAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVN
EIFMAIAKKL
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   GLU n 
1 7   ILE n 
1 8   SER n 
1 9   LYS n 
1 10  THR n 
1 11  GLU n 
1 12  ALA n 
1 13  GLY n 
1 14  GLN n 
1 15  TYR n 
1 16  SER n 
1 17  VAL n 
1 18  SER n 
1 19  ALA n 
1 20  PRO n 
1 21  GLU n 
1 22  HIS n 
1 23  LYS n 
1 24  GLY n 
1 25  LEU n 
1 26  VAL n 
1 27  LEU n 
1 28  SER n 
1 29  GLY n 
1 30  GLY n 
1 31  GLY n 
1 32  ALA n 
1 33  LYS n 
1 34  GLY n 
1 35  ILE n 
1 36  SER n 
1 37  TYR n 
1 38  LEU n 
1 39  GLY n 
1 40  MET n 
1 41  ILE n 
1 42  GLN n 
1 43  ALA n 
1 44  LEU n 
1 45  GLN n 
1 46  GLU n 
1 47  ARG n 
1 48  GLY n 
1 49  LYS n 
1 50  ILE n 
1 51  LYS n 
1 52  ASN n 
1 53  LEU n 
1 54  THR n 
1 55  HIS n 
1 56  VAL n 
1 57  SER n 
1 58  GLY n 
1 59  ALA n 
1 60  SER n 
1 61  ALA n 
1 62  GLY n 
1 63  ALA n 
1 64  MET n 
1 65  THR n 
1 66  ALA n 
1 67  SER n 
1 68  ILE n 
1 69  LEU n 
1 70  ALA n 
1 71  VAL n 
1 72  GLY n 
1 73  MET n 
1 74  ASP n 
1 75  ILE n 
1 76  LYS n 
1 77  ASP n 
1 78  ILE n 
1 79  LYS n 
1 80  LYS n 
1 81  LEU n 
1 82  ILE n 
1 83  GLU n 
1 84  GLY n 
1 85  LEU n 
1 86  ASP n 
1 87  ILE n 
1 88  THR n 
1 89  LYS n 
1 90  LEU n 
1 91  LEU n 
1 92  ASP n 
1 93  ASN n 
1 94  SER n 
1 95  GLY n 
1 96  VAL n 
1 97  GLY n 
1 98  PHE n 
1 99  ARG n 
1 100 ALA n 
1 101 ARG n 
1 102 GLY n 
1 103 ASP n 
1 104 ARG n 
1 105 PHE n 
1 106 ARG n 
1 107 ASN n 
1 108 ILE n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 ILE n 
1 113 TYR n 
1 114 MET n 
1 115 MET n 
1 116 GLN n 
1 117 MET n 
1 118 LYS n 
1 119 LYS n 
1 120 HIS n 
1 121 LEU n 
1 122 GLU n 
1 123 SER n 
1 124 VAL n 
1 125 GLN n 
1 126 GLN n 
1 127 PRO n 
1 128 ILE n 
1 129 PRO n 
1 130 PRO n 
1 131 GLU n 
1 132 GLN n 
1 133 GLN n 
1 134 MET n 
1 135 ASN n 
1 136 TYR n 
1 137 GLY n 
1 138 ILE n 
1 139 LEU n 
1 140 LYS n 
1 141 GLN n 
1 142 LYS n 
1 143 ILE n 
1 144 ALA n 
1 145 LEU n 
1 146 TYR n 
1 147 GLU n 
1 148 ASP n 
1 149 LYS n 
1 150 LEU n 
1 151 SER n 
1 152 ARG n 
1 153 ALA n 
1 154 GLY n 
1 155 ILE n 
1 156 VAL n 
1 157 ILE n 
1 158 ASN n 
1 159 ASN n 
1 160 VAL n 
1 161 ASP n 
1 162 ASP n 
1 163 ILE n 
1 164 ILE n 
1 165 ASN n 
1 166 LEU n 
1 167 THR n 
1 168 LYS n 
1 169 SER n 
1 170 VAL n 
1 171 LYS n 
1 172 ASP n 
1 173 LEU n 
1 174 GLU n 
1 175 LYS n 
1 176 LEU n 
1 177 ASP n 
1 178 LYS n 
1 179 ALA n 
1 180 LEU n 
1 181 ASN n 
1 182 SER n 
1 183 ILE n 
1 184 PRO n 
1 185 THR n 
1 186 GLU n 
1 187 LEU n 
1 188 LYS n 
1 189 GLY n 
1 190 ALA n 
1 191 LYS n 
1 192 GLY n 
1 193 GLU n 
1 194 GLN n 
1 195 LEU n 
1 196 GLU n 
1 197 ASN n 
1 198 PRO n 
1 199 ARG n 
1 200 LEU n 
1 201 THR n 
1 202 LEU n 
1 203 GLY n 
1 204 ASP n 
1 205 LEU n 
1 206 GLY n 
1 207 ARG n 
1 208 LEU n 
1 209 ARG n 
1 210 GLU n 
1 211 LEU n 
1 212 LEU n 
1 213 PRO n 
1 214 GLU n 
1 215 GLU n 
1 216 ASN n 
1 217 LYS n 
1 218 HIS n 
1 219 LEU n 
1 220 ILE n 
1 221 LYS n 
1 222 ASN n 
1 223 LEU n 
1 224 SER n 
1 225 VAL n 
1 226 VAL n 
1 227 VAL n 
1 228 THR n 
1 229 ASN n 
1 230 GLN n 
1 231 THR n 
1 232 LYS n 
1 233 HIS n 
1 234 GLU n 
1 235 LEU n 
1 236 GLU n 
1 237 ARG n 
1 238 TYR n 
1 239 SER n 
1 240 GLU n 
1 241 ASP n 
1 242 THR n 
1 243 THR n 
1 244 PRO n 
1 245 GLN n 
1 246 GLN n 
1 247 SER n 
1 248 ILE n 
1 249 ALA n 
1 250 GLN n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 TRP n 
1 255 SER n 
1 256 GLY n 
1 257 ALA n 
1 258 HIS n 
1 259 PRO n 
1 260 VAL n 
1 261 LEU n 
1 262 PHE n 
1 263 VAL n 
1 264 PRO n 
1 265 GLY n 
1 266 ARG n 
1 267 ASN n 
1 268 ALA n 
1 269 LYS n 
1 270 GLY n 
1 271 GLU n 
1 272 TYR n 
1 273 ILE n 
1 274 ALA n 
1 275 ASP n 
1 276 GLY n 
1 277 GLY n 
1 278 ILE n 
1 279 LEU n 
1 280 ASP n 
1 281 ASN n 
1 282 MET n 
1 283 PRO n 
1 284 GLU n 
1 285 ILE n 
1 286 GLU n 
1 287 GLY n 
1 288 LEU n 
1 289 ASP n 
1 290 ARG n 
1 291 GLU n 
1 292 GLU n 
1 293 VAL n 
1 294 LEU n 
1 295 CYS n 
1 296 VAL n 
1 297 LYS n 
1 298 ALA n 
1 299 GLU n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 PHE n 
1 305 GLU n 
1 306 ASP n 
1 307 ARG n 
1 308 VAL n 
1 309 ASN n 
1 310 LYS n 
1 311 ALA n 
1 312 LYS n 
1 313 GLN n 
1 314 SER n 
1 315 ALA n 
1 316 MET n 
1 317 GLU n 
1 318 ALA n 
1 319 ILE n 
1 320 SER n 
1 321 TRP n 
1 322 PHE n 
1 323 LYS n 
1 324 ALA n 
1 325 ARG n 
1 326 MET n 
1 327 ASP n 
1 328 SER n 
1 329 LEU n 
1 330 VAL n 
1 331 GLU n 
1 332 ALA n 
1 333 THR n 
1 334 ILE n 
1 335 GLY n 
1 336 GLY n 
1 337 LYS n 
1 338 TRP n 
1 339 LEU n 
1 340 HIS n 
1 341 ALA n 
1 342 THR n 
1 343 SER n 
1 344 SER n 
1 345 VAL n 
1 346 LEU n 
1 347 ASN n 
1 348 ARG n 
1 349 GLU n 
1 350 LYS n 
1 351 VAL n 
1 352 TYR n 
1 353 TYR n 
1 354 ASN n 
1 355 ILE n 
1 356 ASP n 
1 357 ASN n 
1 358 MET n 
1 359 ILE n 
1 360 TYR n 
1 361 ILE n 
1 362 ASN n 
1 363 THR n 
1 364 GLY n 
1 365 GLU n 
1 366 VAL n 
1 367 THR n 
1 368 THR n 
1 369 THR n 
1 370 ASN n 
1 371 THR n 
1 372 SER n 
1 373 PRO n 
1 374 THR n 
1 375 PRO n 
1 376 GLU n 
1 377 GLN n 
1 378 ARG n 
1 379 ALA n 
1 380 ARG n 
1 381 ALA n 
1 382 VAL n 
1 383 LYS n 
1 384 ASN n 
1 385 GLY n 
1 386 TYR n 
1 387 ASP n 
1 388 GLN n 
1 389 THR n 
1 390 MET n 
1 391 GLN n 
1 392 LEU n 
1 393 LEU n 
1 394 ASP n 
1 395 SER n 
1 396 HIS n 
1 397 LYS n 
1 398 GLN n 
1 399 THR n 
1 400 PHE n 
1 401 ASP n 
1 402 HIS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 ALA n 
1 407 ILE n 
1 408 LEU n 
1 409 TYR n 
1 410 ILE n 
1 411 GLY n 
1 412 HIS n 
1 413 ASP n 
1 414 LYS n 
1 415 LEU n 
1 416 LYS n 
1 417 ASP n 
1 418 ALA n 
1 419 LEU n 
1 420 ILE n 
1 421 ASP n 
1 422 GLU n 
1 423 LYS n 
1 424 SER n 
1 425 GLU n 
1 426 LYS n 
1 427 GLU n 
1 428 ILE n 
1 429 PHE n 
1 430 GLU n 
1 431 ALA n 
1 432 SER n 
1 433 ALA n 
1 434 HIS n 
1 435 ALA n 
1 436 GLN n 
1 437 ALA n 
1 438 ILE n 
1 439 LEU n 
1 440 HIS n 
1 441 LEU n 
1 442 GLN n 
1 443 GLU n 
1 444 GLN n 
1 445 ILE n 
1 446 VAL n 
1 447 LYS n 
1 448 GLU n 
1 449 MET n 
1 450 ASN n 
1 451 ASP n 
1 452 GLY n 
1 453 ASP n 
1 454 TYR n 
1 455 SER n 
1 456 SER n 
1 457 VAL n 
1 458 GLN n 
1 459 ASN n 
1 460 TYR n 
1 461 LEU n 
1 462 ASP n 
1 463 GLN n 
1 464 ILE n 
1 465 GLU n 
1 466 ASP n 
1 467 ILE n 
1 468 LEU n 
1 469 THR n 
1 470 VAL n 
1 471 ASP n 
1 472 ALA n 
1 473 LYS n 
1 474 MET n 
1 475 ASP n 
1 476 ASP n 
1 477 ILE n 
1 478 GLN n 
1 479 LYS n 
1 480 GLU n 
1 481 LYS n 
1 482 ALA n 
1 483 PHE n 
1 484 ALA n 
1 485 LEU n 
1 486 CYS n 
1 487 ILE n 
1 488 LYS n 
1 489 GLN n 
1 490 VAL n 
1 491 ASN n 
1 492 PHE n 
1 493 LEU n 
1 494 SER n 
1 495 GLU n 
1 496 GLY n 
1 497 LYS n 
1 498 LEU n 
1 499 GLU n 
1 500 THR n 
1 501 TYR n 
1 502 LEU n 
1 503 ASN n 
1 504 LYS n 
1 505 VAL n 
1 506 GLU n 
1 507 ALA n 
1 508 GLU n 
1 509 ALA n 
1 510 LYS n 
1 511 ALA n 
1 512 ALA n 
1 513 ALA n 
1 514 GLU n 
1 515 PRO n 
1 516 SER n 
1 517 TRP n 
1 518 ALA n 
1 519 THR n 
1 520 LYS n 
1 521 ILE n 
1 522 LEU n 
1 523 ASN n 
1 524 LEU n 
1 525 LEU n 
1 526 TRP n 
1 527 ALA n 
1 528 PRO n 
1 529 ILE n 
1 530 GLU n 
1 531 TRP n 
1 532 VAL n 
1 533 VAL n 
1 534 SER n 
1 535 LEU n 
1 536 PHE n 
1 537 LYS n 
1 538 GLY n 
1 539 PRO n 
1 540 ALA n 
1 541 GLN n 
1 542 ASP n 
1 543 PHE n 
1 544 LYS n 
1 545 VAL n 
1 546 GLU n 
1 547 VAL n 
1 548 GLN n 
1 549 PRO n 
1 550 GLU n 
1 551 PRO n 
2 1   GLY n 
2 2   ALA n 
2 3   MET n 
2 4   GLY n 
2 5   SER n 
2 6   LYS n 
2 7   ILE n 
2 8   CYS n 
2 9   GLN n 
2 10  PHE n 
2 11  LYS n 
2 12  LEU n 
2 13  VAL n 
2 14  LEU n 
2 15  LEU n 
2 16  GLY n 
2 17  GLU n 
2 18  SER n 
2 19  ALA n 
2 20  VAL n 
2 21  GLY n 
2 22  LYS n 
2 23  SER n 
2 24  SER n 
2 25  LEU n 
2 26  VAL n 
2 27  LEU n 
2 28  ARG n 
2 29  PHE n 
2 30  VAL n 
2 31  LYS n 
2 32  GLY n 
2 33  GLN n 
2 34  PHE n 
2 35  HIS n 
2 36  GLU n 
2 37  TYR n 
2 38  GLN n 
2 39  GLU n 
2 40  SER n 
2 41  THR n 
2 42  ILE n 
2 43  GLY n 
2 44  ALA n 
2 45  ALA n 
2 46  PHE n 
2 47  LEU n 
2 48  THR n 
2 49  GLN n 
2 50  THR n 
2 51  VAL n 
2 52  CYS n 
2 53  LEU n 
2 54  ASP n 
2 55  ASP n 
2 56  THR n 
2 57  THR n 
2 58  VAL n 
2 59  LYS n 
2 60  PHE n 
2 61  GLU n 
2 62  ILE n 
2 63  TRP n 
2 64  ASP n 
2 65  THR n 
2 66  ALA n 
2 67  GLY n 
2 68  LEU n 
2 69  GLU n 
2 70  ARG n 
2 71  TYR n 
2 72  HIS n 
2 73  SER n 
2 74  LEU n 
2 75  ALA n 
2 76  PRO n 
2 77  MET n 
2 78  TYR n 
2 79  TYR n 
2 80  ARG n 
2 81  GLY n 
2 82  ALA n 
2 83  GLN n 
2 84  ALA n 
2 85  ALA n 
2 86  ILE n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ASP n 
2 91  ILE n 
2 92  THR n 
2 93  ASN n 
2 94  THR n 
2 95  ASP n 
2 96  THR n 
2 97  PHE n 
2 98  ALA n 
2 99  ARG n 
2 100 ALA n 
2 101 LYS n 
2 102 ASN n 
2 103 TRP n 
2 104 VAL n 
2 105 LYS n 
2 106 GLU n 
2 107 LEU n 
2 108 GLN n 
2 109 ARG n 
2 110 GLN n 
2 111 ALA n 
2 112 SER n 
2 113 PRO n 
2 114 ASN n 
2 115 ILE n 
2 116 VAL n 
2 117 ILE n 
2 118 ALA n 
2 119 LEU n 
2 120 ALA n 
2 121 GLY n 
2 122 ASN n 
2 123 LYS n 
2 124 ALA n 
2 125 ASP n 
2 126 LEU n 
2 127 ALA n 
2 128 SER n 
2 129 LYS n 
2 130 ARG n 
2 131 ALA n 
2 132 VAL n 
2 133 GLU n 
2 134 PHE n 
2 135 GLN n 
2 136 GLU n 
2 137 ALA n 
2 138 GLN n 
2 139 ALA n 
2 140 TYR n 
2 141 ALA n 
2 142 ASP n 
2 143 ASP n 
2 144 ASN n 
2 145 SER n 
2 146 LEU n 
2 147 LEU n 
2 148 PHE n 
2 149 MET n 
2 150 GLU n 
2 151 THR n 
2 152 SER n 
2 153 ALA n 
2 154 LYS n 
2 155 THR n 
2 156 ALA n 
2 157 MET n 
2 158 ASN n 
2 159 VAL n 
2 160 ASN n 
2 161 GLU n 
2 162 ILE n 
2 163 PHE n 
2 164 MET n 
2 165 ALA n 
2 166 ILE n 
2 167 ALA n 
2 168 LYS n 
2 169 LYS n 
2 170 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ?     ? 'vipD, lpg2831' ? 'Philadelphia 1 / ATCC 33152 / DSM 7513' ? ? ? ? 
'Legionella pneumophila subsp. pneumophila' 272624 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
2 1 sample ? ? ? human ? 'RAB5C, RABL'   ? ?                                        ? ? ? ? 'Homo sapiens' 9606   ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q5ZRP9_LEGPH Q5ZRP9 1 
;EISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGL
DITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIIN
LTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQ
QSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKAR
MDSLVEATIGGKWLHATSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLM
AILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFAL
CIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKVEVQPEP
;
19 ? 
2 UNP RAB5C_HUMAN  P51148 2 
;KICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAA
IVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMA
IAKKL
;
18 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KYI A 6 ? 551 ? Q5ZRP9 19 ? 564 ? 19 564 
2 2 4KYI B 6 ? 170 ? P51148 18 ? 182 ? 18 182 
3 1 4KYI C 6 ? 551 ? Q5ZRP9 19 ? 564 ? 19 564 
4 2 4KYI D 6 ? 170 ? P51148 18 ? 182 ? 18 182 
5 1 4KYI E 6 ? 551 ? Q5ZRP9 19 ? 564 ? 19 564 
6 2 4KYI F 6 ? 170 ? P51148 18 ? 182 ? 18 182 
7 1 4KYI G 6 ? 551 ? Q5ZRP9 19 ? 564 ? 19 564 
8 2 4KYI H 6 ? 170 ? P51148 18 ? 182 ? 18 182 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KYI GLY A 1  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      14 1  
1 4KYI ALA A 2  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      15 2  
1 4KYI MET A 3  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      16 3  
1 4KYI GLY A 4  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      17 4  
1 4KYI SER A 5  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      18 5  
2 4KYI GLY B 1  ? UNP P51148 ?   ?  'EXPRESSION TAG'      13 6  
2 4KYI ALA B 2  ? UNP P51148 ?   ?  'EXPRESSION TAG'      14 7  
2 4KYI MET B 3  ? UNP P51148 ?   ?  'EXPRESSION TAG'      15 8  
2 4KYI GLY B 4  ? UNP P51148 ?   ?  'EXPRESSION TAG'      16 9  
2 4KYI SER B 5  ? UNP P51148 ?   ?  'EXPRESSION TAG'      17 10 
2 4KYI LEU B 68 ? UNP P51148 GLN 80 'ENGINEERED MUTATION' 80 11 
3 4KYI GLY C 1  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      14 12 
3 4KYI ALA C 2  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      15 13 
3 4KYI MET C 3  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      16 14 
3 4KYI GLY C 4  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      17 15 
3 4KYI SER C 5  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      18 16 
4 4KYI GLY D 1  ? UNP P51148 ?   ?  'EXPRESSION TAG'      13 17 
4 4KYI ALA D 2  ? UNP P51148 ?   ?  'EXPRESSION TAG'      14 18 
4 4KYI MET D 3  ? UNP P51148 ?   ?  'EXPRESSION TAG'      15 19 
4 4KYI GLY D 4  ? UNP P51148 ?   ?  'EXPRESSION TAG'      16 20 
4 4KYI SER D 5  ? UNP P51148 ?   ?  'EXPRESSION TAG'      17 21 
4 4KYI LEU D 68 ? UNP P51148 GLN 80 'ENGINEERED MUTATION' 80 22 
5 4KYI GLY E 1  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      14 23 
5 4KYI ALA E 2  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      15 24 
5 4KYI MET E 3  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      16 25 
5 4KYI GLY E 4  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      17 26 
5 4KYI SER E 5  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      18 27 
6 4KYI GLY F 1  ? UNP P51148 ?   ?  'EXPRESSION TAG'      13 28 
6 4KYI ALA F 2  ? UNP P51148 ?   ?  'EXPRESSION TAG'      14 29 
6 4KYI MET F 3  ? UNP P51148 ?   ?  'EXPRESSION TAG'      15 30 
6 4KYI GLY F 4  ? UNP P51148 ?   ?  'EXPRESSION TAG'      16 31 
6 4KYI SER F 5  ? UNP P51148 ?   ?  'EXPRESSION TAG'      17 32 
6 4KYI LEU F 68 ? UNP P51148 GLN 80 'ENGINEERED MUTATION' 80 33 
7 4KYI GLY G 1  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      14 34 
7 4KYI ALA G 2  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      15 35 
7 4KYI MET G 3  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      16 36 
7 4KYI GLY G 4  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      17 37 
7 4KYI SER G 5  ? UNP Q5ZRP9 ?   ?  'EXPRESSION TAG'      18 38 
8 4KYI GLY H 1  ? UNP P51148 ?   ?  'EXPRESSION TAG'      13 39 
8 4KYI ALA H 2  ? UNP P51148 ?   ?  'EXPRESSION TAG'      14 40 
8 4KYI MET H 3  ? UNP P51148 ?   ?  'EXPRESSION TAG'      15 41 
8 4KYI GLY H 4  ? UNP P51148 ?   ?  'EXPRESSION TAG'      16 42 
8 4KYI SER H 5  ? UNP P51148 ?   ?  'EXPRESSION TAG'      17 43 
8 4KYI LEU H 68 ? UNP P51148 GLN 80 'ENGINEERED MUTATION' 80 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'        89.093 
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?                               'C3 H7 N O2 S'      
121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                'ETHYLENE GLYCOL'               'C2 H6 O2'          62.068 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'        75.067 
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ?                               'C10 H17 N6 O13 P3' 
522.196 
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094 
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'    
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'     
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ?                               'Mg 2'              24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4KYI 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'16% PEG6000, 0.1 M Tris-HCl, 0.2 M LiCl, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-05-22 
_diffrn_detector.details                'Compound Refractive Lenses' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double crystal' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97625 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     4KYI 
_reflns.d_resolution_high            3.070 
_reflns.number_obs                   67490 
_reflns.pdbx_Rmerge_I_obs            0.060 
_reflns.pdbx_netI_over_sigmaI        17.010 
_reflns.percent_possible_obs         97.400 
_reflns.B_iso_Wilson_estimate        81.195 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.070 3.260 36557 ? 10270 0.631 2.090  ? ? ? ? ? 92.600 1 1 
3.260 3.480 35901 ? 10285 0.332 3.890  ? ? ? ? ? 98.500 2 1 
3.480 3.760 33636 ? 9553  0.186 6.880  ? ? ? ? ? 98.400 3 1 
3.760 4.110 31702 ? 8875  0.098 12.460 ? ? ? ? ? 98.700 4 1 
4.110 4.580 27938 ? 8019  0.057 19.610 ? ? ? ? ? 98.700 5 1 
4.580 5.270 25148 ? 7082  0.042 26.240 ? ? ? ? ? 98.800 6 1 
5.270 6.400 20999 ? 5986  0.040 27.240 ? ? ? ? ? 98.800 7 1 
6.400 8.860 16399 ? 4700  0.023 44.290 ? ? ? ? ? 98.200 8 1 
8.860 ?     9541  ? 2720  0.014 72.190 ? ? ? ? ? 93.700 9 1 
# 
_refine.entry_id                                 4KYI 
_refine.ls_d_res_high                            3.0750 
_refine.ls_d_res_low                             29.8270 
_refine.pdbx_ls_sigma_F                          1.930 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.6000 
_refine.ls_number_reflns_obs                     67479 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2353 
_refine.ls_R_factor_R_work                       0.2329 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2803 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0500 
_refine.ls_number_reflns_R_free                  3407 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               54.2796 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7335 
_refine.B_iso_max                                202.870 
_refine.B_iso_min                                0.010 
_refine.pdbx_overall_phase_error                 33.2500 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21659 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         174 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               21833 
_refine_hist.d_res_high                       3.0750 
_refine_hist.d_res_low                        29.8270 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           22162 0.002  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          29922 0.631  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     3406  0.042  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      3830  0.002  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 8325  13.601 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.0748 3.1187  24 76.0000 2037 . 0.3811 0.4057 . 119 . 2156 . . 'X-RAY DIFFRACTION' 
3.1187 3.1652  24 98.0000 2707 . 0.3544 0.4638 . 138 . 2845 . . 'X-RAY DIFFRACTION' 
3.1652 3.2146  24 98.0000 2697 . 0.3455 0.3970 . 134 . 2831 . . 'X-RAY DIFFRACTION' 
3.2146 3.2672  24 98.0000 2720 . 0.3343 0.3616 . 152 . 2872 . . 'X-RAY DIFFRACTION' 
3.2672 3.3235  24 99.0000 2689 . 0.3207 0.3699 . 142 . 2831 . . 'X-RAY DIFFRACTION' 
3.3235 3.3839  24 98.0000 2715 . 0.3128 0.3563 . 144 . 2859 . . 'X-RAY DIFFRACTION' 
3.3839 3.4488  24 99.0000 2639 . 0.3013 0.3317 . 149 . 2788 . . 'X-RAY DIFFRACTION' 
3.4488 3.5191  24 98.0000 2695 . 0.2873 0.3463 . 150 . 2845 . . 'X-RAY DIFFRACTION' 
3.5191 3.5955  24 98.0000 2672 . 0.2990 0.3788 . 160 . 2832 . . 'X-RAY DIFFRACTION' 
3.5955 3.6790  24 98.0000 2723 . 0.2821 0.3650 . 126 . 2849 . . 'X-RAY DIFFRACTION' 
3.6790 3.7709  24 99.0000 2739 . 0.2760 0.3423 . 123 . 2862 . . 'X-RAY DIFFRACTION' 
3.7709 3.8726  24 99.0000 2667 . 0.2568 0.3772 . 136 . 2803 . . 'X-RAY DIFFRACTION' 
3.8726 3.9863  24 99.0000 2708 . 0.2421 0.3057 . 141 . 2849 . . 'X-RAY DIFFRACTION' 
3.9863 4.1147  24 99.0000 2757 . 0.2349 0.2877 . 130 . 2887 . . 'X-RAY DIFFRACTION' 
4.1147 4.2613  24 99.0000 2692 . 0.2241 0.2759 . 148 . 2840 . . 'X-RAY DIFFRACTION' 
4.2613 4.4314  24 99.0000 2690 . 0.2217 0.2683 . 154 . 2844 . . 'X-RAY DIFFRACTION' 
4.4314 4.6324  24 99.0000 2706 . 0.2154 0.2623 . 126 . 2832 . . 'X-RAY DIFFRACTION' 
4.6324 4.8756  24 99.0000 2707 . 0.2140 0.2655 . 156 . 2863 . . 'X-RAY DIFFRACTION' 
4.8756 5.1796  24 99.0000 2711 . 0.2170 0.2993 . 149 . 2860 . . 'X-RAY DIFFRACTION' 
5.1796 5.5771  24 99.0000 2687 . 0.2234 0.2653 . 144 . 2831 . . 'X-RAY DIFFRACTION' 
5.5771 6.1340  24 99.0000 2720 . 0.2352 0.2730 . 150 . 2870 . . 'X-RAY DIFFRACTION' 
6.1340 7.0115  24 99.0000 2686 . 0.2218 0.2808 . 152 . 2838 . . 'X-RAY DIFFRACTION' 
7.0115 8.7960  24 98.0000 2695 . 0.1771 0.1973 . 136 . 2831 . . 'X-RAY DIFFRACTION' 
8.7960 29.8280 24 96.0000 2613 . 0.1624 0.1771 . 148 . 2761 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4KYI 
_struct.title                     
'Crystal structure of the phospholipase VipD from Legionella pneumophila in complex with the human GTPase Rab5' 
_struct.pdbx_descriptor           'VipD, Ras-related protein Rab-5C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KYI 
_struct_keywords.pdbx_keywords   'protein binding/transport protein' 
_struct_keywords.text            'Phospholipase, protein binding-transport protein complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 3 ? 
O N N 3 ? 
P N N 6 ? 
Q N N 5 ? 
R N N 6 ? 
S N N 3 ? 
T N N 4 ? 
U N N 5 ? 
V N N 6 ? 
W N N 3 ? 
X N N 5 ? 
Y N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LYS A 33  ? SER A 36  ? LYS A 46  SER A 49  5 ? 4  
HELX_P HELX_P2   2   TYR A 37  ? ARG A 47  ? TYR A 50  ARG A 60  1 ? 11 
HELX_P HELX_P3   3   SER A 60  ? ALA A 66  ? SER A 73  ALA A 79  1 ? 7  
HELX_P HELX_P4   4   ALA A 66  ? VAL A 71  ? ALA A 79  VAL A 84  1 ? 6  
HELX_P HELX_P5   5   ASP A 74  ? GLY A 84  ? ASP A 87  GLY A 97  1 ? 11 
HELX_P HELX_P6   6   ASP A 86  ? LEU A 91  ? ASP A 99  LEU A 104 5 ? 6  
HELX_P HELX_P7   7   GLY A 102 ? LYS A 119 ? GLY A 115 LYS A 132 1 ? 18 
HELX_P HELX_P8   8   PRO A 129 ? ARG A 152 ? PRO A 142 ARG A 165 1 ? 24 
HELX_P HELX_P9   9   VAL A 160 ? LYS A 168 ? VAL A 173 LYS A 181 1 ? 9  
HELX_P HELX_P10  10  SER A 169 ? ASN A 181 ? SER A 182 ASN A 194 1 ? 13 
HELX_P HELX_P11  11  THR A 201 ? LEU A 212 ? THR A 214 LEU A 225 1 ? 12 
HELX_P HELX_P12  12  ASN A 216 ? ILE A 220 ? ASN A 229 ILE A 233 5 ? 5  
HELX_P HELX_P13  13  SER A 247 ? GLY A 256 ? SER A 260 GLY A 269 1 ? 10 
HELX_P HELX_P14  14  ASP A 289 ? GLU A 291 ? ASP A 302 GLU A 304 5 ? 3  
HELX_P HELX_P15  15  ALA A 300 ? ASP A 327 ? ALA A 313 ASP A 340 1 ? 28 
HELX_P HELX_P16  16  THR A 374 ? ASP A 394 ? THR A 387 ASP A 407 1 ? 21 
HELX_P HELX_P17  17  HIS A 402 ? ILE A 410 ? HIS A 415 ILE A 423 1 ? 9  
HELX_P HELX_P18  18  GLU A 425 ? GLY A 452 ? GLU A 438 GLY A 465 1 ? 28 
HELX_P HELX_P19  19  SER A 456 ? ASP A 471 ? SER A 469 ASP A 484 1 ? 16 
HELX_P HELX_P20  20  ILE A 477 ? SER A 494 ? ILE A 490 SER A 507 1 ? 18 
HELX_P HELX_P21  21  GLY A 496 ? ALA A 511 ? GLY A 509 ALA A 524 1 ? 16 
HELX_P HELX_P22  22  TRP A 517 ? TRP A 526 ? TRP A 530 TRP A 539 1 ? 10 
HELX_P HELX_P23  23  PRO A 528 ? VAL A 533 ? PRO A 541 VAL A 546 1 ? 6  
HELX_P HELX_P24  24  GLY B 21  ? VAL B 30  ? GLY B 33  VAL B 42  1 ? 10 
HELX_P HELX_P25  25  LEU B 68  ? SER B 73  ? LEU B 80  SER B 85  5 ? 6  
HELX_P HELX_P26  26  LEU B 74  ? ARG B 80  ? LEU B 86  ARG B 92  1 ? 7  
HELX_P HELX_P27  27  ASN B 93  ? ALA B 111 ? ASN B 105 ALA B 123 1 ? 19 
HELX_P HELX_P28  28  LEU B 126 ? ARG B 130 ? LEU B 138 ARG B 142 5 ? 5  
HELX_P HELX_P29  29  GLU B 133 ? ASN B 144 ? GLU B 145 ASN B 156 1 ? 12 
HELX_P HELX_P30  30  ASN B 158 ? LEU B 170 ? ASN B 170 LEU B 182 1 ? 13 
HELX_P HELX_P31  31  GLU C 11  ? GLY C 13  ? GLU C 24  GLY C 26  5 ? 3  
HELX_P HELX_P32  32  LYS C 33  ? SER C 36  ? LYS C 46  SER C 49  5 ? 4  
HELX_P HELX_P33  33  TYR C 37  ? ARG C 47  ? TYR C 50  ARG C 60  1 ? 11 
HELX_P HELX_P34  34  ALA C 61  ? VAL C 71  ? ALA C 74  VAL C 84  1 ? 11 
HELX_P HELX_P35  35  ASP C 74  ? LEU C 85  ? ASP C 87  LEU C 98  1 ? 12 
HELX_P HELX_P36  36  ARG C 104 ? GLU C 122 ? ARG C 117 GLU C 135 1 ? 19 
HELX_P HELX_P37  37  GLN C 132 ? ALA C 153 ? GLN C 145 ALA C 166 1 ? 22 
HELX_P HELX_P38  38  ASN C 159 ? THR C 167 ? ASN C 172 THR C 180 1 ? 9  
HELX_P HELX_P39  39  SER C 169 ? ASN C 181 ? SER C 182 ASN C 194 1 ? 13 
HELX_P HELX_P40  40  LEU C 202 ? LEU C 212 ? LEU C 215 LEU C 225 1 ? 11 
HELX_P HELX_P41  41  SER C 247 ? GLY C 256 ? SER C 260 GLY C 269 1 ? 10 
HELX_P HELX_P42  42  ASP C 289 ? GLU C 291 ? ASP C 302 GLU C 304 5 ? 3  
HELX_P HELX_P43  43  ALA C 300 ? ILE C 319 ? ALA C 313 ILE C 332 1 ? 20 
HELX_P HELX_P44  44  ILE C 319 ? ASP C 327 ? ILE C 332 ASP C 340 1 ? 9  
HELX_P HELX_P45  45  THR C 374 ? ASP C 394 ? THR C 387 ASP C 407 1 ? 21 
HELX_P HELX_P46  46  SER C 395 ? LYS C 397 ? SER C 408 LYS C 410 5 ? 3  
HELX_P HELX_P47  47  HIS C 402 ? ILE C 410 ? HIS C 415 ILE C 423 1 ? 9  
HELX_P HELX_P48  48  GLU C 425 ? GLY C 452 ? GLU C 438 GLY C 465 1 ? 28 
HELX_P HELX_P49  49  SER C 456 ? VAL C 470 ? SER C 469 VAL C 483 1 ? 15 
HELX_P HELX_P50  50  LYS C 479 ? SER C 494 ? LYS C 492 SER C 507 1 ? 16 
HELX_P HELX_P51  51  GLY C 496 ? ALA C 512 ? GLY C 509 ALA C 525 1 ? 17 
HELX_P HELX_P52  52  TRP C 517 ? TRP C 526 ? TRP C 530 TRP C 539 1 ? 10 
HELX_P HELX_P53  53  PRO C 528 ? VAL C 533 ? PRO C 541 VAL C 546 1 ? 6  
HELX_P HELX_P54  54  GLY D 21  ? VAL D 30  ? GLY D 33  VAL D 42  1 ? 10 
HELX_P HELX_P55  55  LEU D 68  ? SER D 73  ? LEU D 80  SER D 85  5 ? 6  
HELX_P HELX_P56  56  LEU D 74  ? ARG D 80  ? LEU D 86  ARG D 92  1 ? 7  
HELX_P HELX_P57  57  ASN D 93  ? GLN D 110 ? ASN D 105 GLN D 122 1 ? 18 
HELX_P HELX_P58  58  LEU D 126 ? ARG D 130 ? LEU D 138 ARG D 142 5 ? 5  
HELX_P HELX_P59  59  GLU D 133 ? SER D 145 ? GLU D 145 SER D 157 1 ? 13 
HELX_P HELX_P60  60  ASN D 158 ? LYS D 168 ? ASN D 170 LYS D 180 1 ? 11 
HELX_P HELX_P61  61  LYS E 33  ? SER E 36  ? LYS E 46  SER E 49  5 ? 4  
HELX_P HELX_P62  62  TYR E 37  ? GLY E 48  ? TYR E 50  GLY E 61  1 ? 12 
HELX_P HELX_P63  63  ALA E 61  ? VAL E 71  ? ALA E 74  VAL E 84  1 ? 11 
HELX_P HELX_P64  64  ASP E 74  ? GLY E 84  ? ASP E 87  GLY E 97  1 ? 11 
HELX_P HELX_P65  65  ASP E 86  ? LEU E 91  ? ASP E 99  LEU E 104 5 ? 6  
HELX_P HELX_P66  66  GLY E 102 ? GLU E 122 ? GLY E 115 GLU E 135 1 ? 21 
HELX_P HELX_P67  67  PRO E 129 ? GLN E 132 ? PRO E 142 GLN E 145 5 ? 4  
HELX_P HELX_P68  68  GLN E 133 ? ALA E 153 ? GLN E 146 ALA E 166 1 ? 21 
HELX_P HELX_P69  69  VAL E 160 ? ASN E 165 ? VAL E 173 ASN E 178 1 ? 6  
HELX_P HELX_P70  70  SER E 169 ? ASN E 181 ? SER E 182 ASN E 194 1 ? 13 
HELX_P HELX_P71  71  LEU E 202 ? LEU E 212 ? LEU E 215 LEU E 225 1 ? 11 
HELX_P HELX_P72  72  SER E 247 ? GLY E 256 ? SER E 260 GLY E 269 1 ? 10 
HELX_P HELX_P73  73  ALA E 268 ? GLY E 270 ? ALA E 281 GLY E 283 5 ? 3  
HELX_P HELX_P74  74  ASP E 289 ? GLU E 291 ? ASP E 302 GLU E 304 5 ? 3  
HELX_P HELX_P75  75  ALA E 300 ? ASP E 327 ? ALA E 313 ASP E 340 1 ? 28 
HELX_P HELX_P76  76  SER E 343 ? ASN E 347 ? SER E 356 ASN E 360 5 ? 5  
HELX_P HELX_P77  77  THR E 374 ? ASP E 394 ? THR E 387 ASP E 407 1 ? 21 
HELX_P HELX_P78  78  SER E 395 ? LYS E 397 ? SER E 408 LYS E 410 5 ? 3  
HELX_P HELX_P79  79  HIS E 402 ? GLY E 411 ? HIS E 415 GLY E 424 1 ? 10 
HELX_P HELX_P80  80  GLU E 425 ? ASN E 450 ? GLU E 438 ASN E 463 1 ? 26 
HELX_P HELX_P81  81  SER E 456 ? ASP E 471 ? SER E 469 ASP E 484 1 ? 16 
HELX_P HELX_P82  82  ASP E 476 ? SER E 494 ? ASP E 489 SER E 507 1 ? 19 
HELX_P HELX_P83  83  GLY E 496 ? ALA E 511 ? GLY E 509 ALA E 524 1 ? 16 
HELX_P HELX_P84  84  TRP E 517 ? TRP E 526 ? TRP E 530 TRP E 539 1 ? 10 
HELX_P HELX_P85  85  PRO E 528 ? VAL E 533 ? PRO E 541 VAL E 546 1 ? 6  
HELX_P HELX_P86  86  LYS F 22  ? LYS F 31  ? LYS F 34  LYS F 43  1 ? 10 
HELX_P HELX_P87  87  GLU F 69  ? LEU F 74  ? GLU F 81  LEU F 86  5 ? 6  
HELX_P HELX_P88  88  ALA F 75  ? ARG F 80  ? ALA F 87  ARG F 92  1 ? 6  
HELX_P HELX_P89  89  ASN F 93  ? ALA F 111 ? ASN F 105 ALA F 123 1 ? 19 
HELX_P HELX_P90  90  LEU F 126 ? ARG F 130 ? LEU F 138 ARG F 142 5 ? 5  
HELX_P HELX_P91  91  GLU F 133 ? ASN F 144 ? GLU F 145 ASN F 156 1 ? 12 
HELX_P HELX_P92  92  ASN F 158 ? LYS F 169 ? ASN F 170 LYS F 181 1 ? 12 
HELX_P HELX_P93  93  LYS G 33  ? SER G 36  ? LYS G 46  SER G 49  5 ? 4  
HELX_P HELX_P94  94  TYR G 37  ? ARG G 47  ? TYR G 50  ARG G 60  1 ? 11 
HELX_P HELX_P95  95  ALA G 61  ? VAL G 71  ? ALA G 74  VAL G 84  1 ? 11 
HELX_P HELX_P96  96  ASP G 74  ? LEU G 85  ? ASP G 87  LEU G 98  1 ? 12 
HELX_P HELX_P97  97  ASP G 86  ? LEU G 91  ? ASP G 99  LEU G 104 5 ? 6  
HELX_P HELX_P98  98  ARG G 104 ? GLU G 122 ? ARG G 117 GLU G 135 1 ? 19 
HELX_P HELX_P99  99  PRO G 129 ? GLU G 131 ? PRO G 142 GLU G 144 5 ? 3  
HELX_P HELX_P100 100 GLN G 132 ? ARG G 152 ? GLN G 145 ARG G 165 1 ? 21 
HELX_P HELX_P101 101 ASN G 159 ? ASN G 165 ? ASN G 172 ASN G 178 1 ? 7  
HELX_P HELX_P102 102 SER G 169 ? ASN G 181 ? SER G 182 ASN G 194 1 ? 13 
HELX_P HELX_P103 103 GLY G 203 ? LEU G 212 ? GLY G 216 LEU G 225 1 ? 10 
HELX_P HELX_P104 104 PRO G 213 ? LYS G 217 ? PRO G 226 LYS G 230 5 ? 5  
HELX_P HELX_P105 105 SER G 247 ? GLY G 256 ? SER G 260 GLY G 269 1 ? 10 
HELX_P HELX_P106 106 ASP G 289 ? GLU G 291 ? ASP G 302 GLU G 304 5 ? 3  
HELX_P HELX_P107 107 ALA G 300 ? ALA G 324 ? ALA G 313 ALA G 337 1 ? 25 
HELX_P HELX_P108 108 THR G 374 ? HIS G 396 ? THR G 387 HIS G 409 1 ? 23 
HELX_P HELX_P109 109 HIS G 402 ? GLY G 411 ? HIS G 415 GLY G 424 1 ? 10 
HELX_P HELX_P110 110 HIS G 412 ? LEU G 415 ? HIS G 425 LEU G 428 5 ? 4  
HELX_P HELX_P111 111 GLU G 425 ? ASN G 450 ? GLU G 438 ASN G 463 1 ? 26 
HELX_P HELX_P112 112 SER G 456 ? VAL G 470 ? SER G 469 VAL G 483 1 ? 15 
HELX_P HELX_P113 113 ILE G 477 ? SER G 494 ? ILE G 490 SER G 507 1 ? 18 
HELX_P HELX_P114 114 GLY G 496 ? ALA G 511 ? GLY G 509 ALA G 524 1 ? 16 
HELX_P HELX_P115 115 TRP G 517 ? TRP G 526 ? TRP G 530 TRP G 539 1 ? 10 
HELX_P HELX_P116 116 PRO G 528 ? VAL G 533 ? PRO G 541 VAL G 546 1 ? 6  
HELX_P HELX_P117 117 GLY H 21  ? GLY H 32  ? GLY H 33  GLY H 44  1 ? 12 
HELX_P HELX_P118 118 LEU H 68  ? SER H 73  ? LEU H 80  SER H 85  5 ? 6  
HELX_P HELX_P119 119 LEU H 74  ? ARG H 80  ? LEU H 86  ARG H 92  1 ? 7  
HELX_P HELX_P120 120 ASN H 93  ? GLN H 110 ? ASN H 105 GLN H 122 1 ? 18 
HELX_P HELX_P121 121 LEU H 126 ? ARG H 130 ? LEU H 138 ARG H 142 5 ? 5  
HELX_P HELX_P122 122 GLU H 133 ? ASN H 144 ? GLU H 145 ASN H 156 1 ? 12 
HELX_P HELX_P123 123 ASN H 158 ? LYS H 169 ? ASN H 170 LYS H 181 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 52 SG  ? ? ? 1_555 D CYS 52 SG ? ? B CYS 64  D CYS 64  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2  disulf ? ? F CYS 52 SG  ? ? ? 1_555 H CYS 52 SG ? ? F CYS 64  H CYS 64  1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? D SER 23 OG  ? ? ? 1_555 R MG  .  MG ? ? D SER 35  D MG  302 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc2  metalc ? ? H THR 41 OG1 ? ? ? 1_555 Y MG  .  MG ? ? H THR 53  H MG  302 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc3  metalc ? ? X GNP .  O2B ? ? ? 1_555 Y MG  .  MG ? ? H GNP 301 H MG  302 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc4  metalc ? ? Q GNP .  O2B ? ? ? 1_555 R MG  .  MG ? ? D GNP 301 D MG  302 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc5  metalc ? ? D THR 41 OG1 ? ? ? 1_555 R MG  .  MG ? ? D THR 53  D MG  302 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc6  metalc ? ? Q GNP .  O2G ? ? ? 1_555 R MG  .  MG ? ? D GNP 301 D MG  302 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc7  metalc ? ? B SER 23 OG  ? ? ? 1_555 P MG  .  MG ? ? B SER 35  B MG  304 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc8  metalc ? ? F THR 41 OG1 ? ? ? 1_555 V MG  .  MG ? ? F THR 53  F MG  302 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc9  metalc ? ? U GNP .  O2B ? ? ? 1_555 V MG  .  MG ? ? F GNP 301 F MG  302 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc10 metalc ? ? B THR 41 OG1 ? ? ? 1_555 P MG  .  MG ? ? B THR 53  B MG  304 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc11 metalc ? ? M GNP .  O2G ? ? ? 1_555 P MG  .  MG ? ? B GNP 301 B MG  304 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc12 metalc ? ? H SER 23 OG  ? ? ? 1_555 Y MG  .  MG ? ? H SER 35  H MG  302 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc13 metalc ? ? U GNP .  O2G ? ? ? 1_555 V MG  .  MG ? ? F GNP 301 F MG  302 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc14 metalc ? ? F SER 23 OG  ? ? ? 1_555 V MG  .  MG ? ? F SER 35  F MG  302 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc15 metalc ? ? M GNP .  O2B ? ? ? 1_555 P MG  .  MG ? ? B GNP 301 B MG  304 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc16 metalc ? ? X GNP .  O2G ? ? ? 1_555 Y MG  .  MG ? ? H GNP 301 H MG  302 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc17 metalc ? ? M GNP .  O3G ? ? ? 1_555 P MG  .  MG ? ? B GNP 301 B MG  304 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc18 metalc ? ? U GNP .  O3G ? ? ? 1_555 V MG  .  MG ? ? F GNP 301 F MG  302 1_555 ? ? ? ? ? ? ? 2.722 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 126 A . ? GLN 139 A PRO 127 A ? PRO 140 A 1 1.92  
2  ALA 190 A . ? ALA 203 A LYS 191 A ? LYS 204 A 1 7.74  
3  LEU 346 A . ? LEU 359 A ASN 347 A ? ASN 360 A 1 -1.37 
4  GLN 126 C . ? GLN 139 C PRO 127 C ? PRO 140 C 1 3.03  
5  THR 367 C . ? THR 380 C THR 368 C ? THR 381 C 1 7.25  
6  ILE 410 C . ? ILE 423 C GLY 411 C ? GLY 424 C 1 4.28  
7  SER 424 C . ? SER 437 C GLU 425 C ? GLU 438 C 1 -7.50 
8  SER 94  E . ? SER 107 E GLY 95  E ? GLY 108 E 1 -1.30 
9  GLN 126 E . ? GLN 139 E PRO 127 E ? PRO 140 E 1 5.13  
10 GLY 192 E . ? GLY 205 E GLU 193 E ? GLU 206 E 1 -9.31 
11 VAL 330 E . ? VAL 343 E GLU 331 E ? GLU 344 E 1 -1.24 
12 ILE 410 E . ? ILE 423 E GLY 411 E ? GLY 424 E 1 -1.06 
13 SER 424 E . ? SER 437 E GLU 425 E ? GLU 438 E 1 -4.47 
14 VAL 96  G . ? VAL 109 G GLY 97  G ? GLY 110 G 1 -0.78 
15 GLN 126 G . ? GLN 139 G PRO 127 G ? PRO 140 G 1 1.56  
16 VAL 330 G . ? VAL 343 G GLU 331 G ? GLU 344 G 1 -1.94 
17 SER 344 G . ? SER 357 G VAL 345 G ? VAL 358 G 1 0.43  
18 ILE 410 G . ? ILE 423 G GLY 411 G ? GLY 424 G 1 -1.18 
19 SER 424 G . ? SER 437 G GLU 425 G ? GLU 438 G 1 -4.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 6 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 3 ? 
I ? 6 ? 
J ? 3 ? 
K ? 4 ? 
L ? 6 ? 
M ? 6 ? 
N ? 3 ? 
O ? 4 ? 
P ? 6 ? 
Q ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
P 3 4 ? parallel      
P 4 5 ? parallel      
P 5 6 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 7   ? LYS A 9   ? ILE A 20  LYS A 22  
A 2 TYR A 15  ? VAL A 17  ? TYR A 28  VAL A 30  
A 3 THR A 399 ? PHE A 400 ? THR A 412 PHE A 413 
B 1 GLU A 234 ? SER A 239 ? GLU A 247 SER A 252 
B 2 ASN A 222 ? ASN A 229 ? ASN A 235 ASN A 242 
B 3 TYR A 272 ? ALA A 274 ? TYR A 285 ALA A 287 
B 4 GLY A 265 ? ARG A 266 ? GLY A 278 ARG A 279 
C 1 GLU A 234 ? SER A 239 ? GLU A 247 SER A 252 
C 2 ASN A 222 ? ASN A 229 ? ASN A 235 ASN A 242 
C 3 HIS A 55  ? GLY A 58  ? HIS A 68  GLY A 71  
C 4 GLY A 24  ? LEU A 27  ? GLY A 37  LEU A 40  
C 5 VAL A 293 ? GLU A 299 ? VAL A 306 GLU A 312 
C 6 MET A 358 ? ASN A 362 ? MET A 371 ASN A 375 
D 1 ALA B 44  ? LEU B 53  ? ALA B 56  LEU B 65  
D 2 THR B 56  ? THR B 65  ? THR B 68  THR B 77  
D 3 CYS B 8   ? LEU B 15  ? CYS B 20  LEU B 27  
D 4 ALA B 84  ? ASP B 90  ? ALA B 96  ASP B 102 
D 5 VAL B 116 ? ASN B 122 ? VAL B 128 ASN B 134 
D 6 LEU B 147 ? GLU B 150 ? LEU B 159 GLU B 162 
E 1 ILE C 7   ? LYS C 9   ? ILE C 20  LYS C 22  
E 2 TYR C 15  ? VAL C 17  ? TYR C 28  VAL C 30  
E 3 THR C 399 ? PHE C 400 ? THR C 412 PHE C 413 
F 1 GLU C 234 ? SER C 239 ? GLU C 247 SER C 252 
F 2 ASN C 222 ? ASN C 229 ? ASN C 235 ASN C 242 
F 3 TYR C 272 ? ALA C 274 ? TYR C 285 ALA C 287 
F 4 GLY C 265 ? ARG C 266 ? GLY C 278 ARG C 279 
G 1 GLU C 234 ? SER C 239 ? GLU C 247 SER C 252 
G 2 ASN C 222 ? ASN C 229 ? ASN C 235 ASN C 242 
G 3 HIS C 55  ? ALA C 59  ? HIS C 68  ALA C 72  
G 4 GLY C 24  ? LEU C 27  ? GLY C 37  LEU C 40  
G 5 VAL C 293 ? GLU C 299 ? VAL C 306 GLU C 312 
G 6 MET C 358 ? ASN C 362 ? MET C 371 ASN C 375 
H 1 ALA D 44  ? PHE D 46  ? ALA D 56  PHE D 58  
H 2 THR D 56  ? THR D 65  ? THR D 68  THR D 77  
H 3 GLN D 49  ? LEU D 53  ? GLN D 61  LEU D 65  
I 1 ALA D 44  ? PHE D 46  ? ALA D 56  PHE D 58  
I 2 THR D 56  ? THR D 65  ? THR D 68  THR D 77  
I 3 CYS D 8   ? GLY D 16  ? CYS D 20  GLY D 28  
I 4 ALA D 84  ? ASP D 90  ? ALA D 96  ASP D 102 
I 5 VAL D 116 ? ASN D 122 ? VAL D 128 ASN D 134 
I 6 LEU D 147 ? GLU D 150 ? LEU D 159 GLU D 162 
J 1 ILE E 7   ? LYS E 9   ? ILE E 20  LYS E 22  
J 2 TYR E 15  ? VAL E 17  ? TYR E 28  VAL E 30  
J 3 THR E 399 ? PHE E 400 ? THR E 412 PHE E 413 
K 1 GLU E 234 ? TYR E 238 ? GLU E 247 TYR E 251 
K 2 ASN E 222 ? ASN E 229 ? ASN E 235 ASN E 242 
K 3 TYR E 272 ? ALA E 274 ? TYR E 285 ALA E 287 
K 4 GLY E 265 ? ARG E 266 ? GLY E 278 ARG E 279 
L 1 GLU E 234 ? TYR E 238 ? GLU E 247 TYR E 251 
L 2 ASN E 222 ? ASN E 229 ? ASN E 235 ASN E 242 
L 3 HIS E 55  ? GLY E 58  ? HIS E 68  GLY E 71  
L 4 GLY E 24  ? LEU E 27  ? GLY E 37  LEU E 40  
L 5 VAL E 293 ? GLU E 299 ? VAL E 306 GLU E 312 
L 6 MET E 358 ? ASN E 362 ? MET E 371 ASN E 375 
M 1 ALA F 44  ? CYS F 52  ? ALA F 56  CYS F 64  
M 2 THR F 57  ? THR F 65  ? THR F 69  THR F 77  
M 3 CYS F 8   ? GLY F 16  ? CYS F 20  GLY F 28  
M 4 ALA F 84  ? ASP F 90  ? ALA F 96  ASP F 102 
M 5 VAL F 116 ? ASN F 122 ? VAL F 128 ASN F 134 
M 6 LEU F 147 ? MET F 149 ? LEU F 159 MET F 161 
N 1 ILE G 7   ? LYS G 9   ? ILE G 20  LYS G 22  
N 2 TYR G 15  ? VAL G 17  ? TYR G 28  VAL G 30  
N 3 THR G 399 ? PHE G 400 ? THR G 412 PHE G 413 
O 1 GLU G 234 ? SER G 239 ? GLU G 247 SER G 252 
O 2 ASN G 222 ? ASN G 229 ? ASN G 235 ASN G 242 
O 3 TYR G 272 ? ALA G 274 ? TYR G 285 ALA G 287 
O 4 GLY G 265 ? ARG G 266 ? GLY G 278 ARG G 279 
P 1 GLU G 234 ? SER G 239 ? GLU G 247 SER G 252 
P 2 ASN G 222 ? ASN G 229 ? ASN G 235 ASN G 242 
P 3 HIS G 55  ? ALA G 59  ? HIS G 68  ALA G 72  
P 4 GLY G 24  ? LEU G 27  ? GLY G 37  LEU G 40  
P 5 VAL G 293 ? LYS G 297 ? VAL G 306 LYS G 310 
P 6 MET G 358 ? TYR G 360 ? MET G 371 TYR G 373 
Q 1 ALA H 44  ? CYS H 52  ? ALA H 56  CYS H 64  
Q 2 THR H 57  ? THR H 65  ? THR H 69  THR H 77  
Q 3 CYS H 8   ? GLY H 16  ? CYS H 20  GLY H 28  
Q 4 ALA H 84  ? ASP H 90  ? ALA H 96  ASP H 102 
Q 5 VAL H 116 ? ASN H 122 ? VAL H 128 ASN H 134 
Q 6 LEU H 147 ? MET H 149 ? LEU H 159 MET H 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 8   ? N SER A 21  O SER A 16  ? O SER A 29  
A 2 3 N TYR A 15  ? N TYR A 28  O PHE A 400 ? O PHE A 413 
B 1 2 O GLU A 234 ? O GLU A 247 N ASN A 229 ? N ASN A 242 
B 2 3 N THR A 228 ? N THR A 241 O ALA A 274 ? O ALA A 287 
B 3 4 O ILE A 273 ? O ILE A 286 N GLY A 265 ? N GLY A 278 
C 1 2 O GLU A 234 ? O GLU A 247 N ASN A 229 ? N ASN A 242 
C 2 3 O ASN A 222 ? O ASN A 235 N VAL A 56  ? N VAL A 69  
C 3 4 O SER A 57  ? O SER A 70  N LEU A 25  ? N LEU A 38  
C 4 5 N GLY A 24  ? N GLY A 37  O LEU A 294 ? O LEU A 307 
C 5 6 N CYS A 295 ? N CYS A 308 O ILE A 359 ? O ILE A 372 
D 1 2 N VAL B 51  ? N VAL B 63  O VAL B 58  ? O VAL B 70  
D 2 3 O LYS B 59  ? O LYS B 71  N PHE B 10  ? N PHE B 22  
D 3 4 N LEU B 15  ? N LEU B 27  O VAL B 88  ? O VAL B 100 
D 4 5 N ALA B 85  ? N ALA B 97  O ALA B 118 ? O ALA B 130 
D 5 6 N LEU B 119 ? N LEU B 131 O LEU B 147 ? O LEU B 159 
E 1 2 N SER C 8   ? N SER C 21  O SER C 16  ? O SER C 29  
E 2 3 N TYR C 15  ? N TYR C 28  O PHE C 400 ? O PHE C 413 
F 1 2 O TYR C 238 ? O TYR C 251 N VAL C 225 ? N VAL C 238 
F 2 3 N THR C 228 ? N THR C 241 O ALA C 274 ? O ALA C 287 
F 3 4 O ILE C 273 ? O ILE C 286 N GLY C 265 ? N GLY C 278 
G 1 2 O TYR C 238 ? O TYR C 251 N VAL C 225 ? N VAL C 238 
G 2 3 O ASN C 222 ? O ASN C 235 N VAL C 56  ? N VAL C 69  
G 3 4 O SER C 57  ? O SER C 70  N LEU C 25  ? N LEU C 38  
G 4 5 N GLY C 24  ? N GLY C 37  O LEU C 294 ? O LEU C 307 
G 5 6 N CYS C 295 ? N CYS C 308 O ILE C 359 ? O ILE C 372 
H 1 2 N ALA D 45  ? N ALA D 57  O ASP D 64  ? O ASP D 76  
H 2 3 O VAL D 58  ? O VAL D 70  N VAL D 51  ? N VAL D 63  
I 1 2 N ALA D 45  ? N ALA D 57  O ASP D 64  ? O ASP D 76  
I 2 3 O LYS D 59  ? O LYS D 71  N CYS D 8   ? N CYS D 20  
I 3 4 N LEU D 15  ? N LEU D 27  O VAL D 88  ? O VAL D 100 
I 4 5 N VAL D 87  ? N VAL D 99  O ALA D 118 ? O ALA D 130 
I 5 6 N LEU D 119 ? N LEU D 131 O LEU D 147 ? O LEU D 159 
J 1 2 N SER E 8   ? N SER E 21  O SER E 16  ? O SER E 29  
J 2 3 N TYR E 15  ? N TYR E 28  O PHE E 400 ? O PHE E 413 
K 1 2 O TYR E 238 ? O TYR E 251 N VAL E 225 ? N VAL E 238 
K 2 3 N THR E 228 ? N THR E 241 O ALA E 274 ? O ALA E 287 
K 3 4 O ILE E 273 ? O ILE E 286 N GLY E 265 ? N GLY E 278 
L 1 2 O TYR E 238 ? O TYR E 251 N VAL E 225 ? N VAL E 238 
L 2 3 O ASN E 222 ? O ASN E 235 N VAL E 56  ? N VAL E 69  
L 3 4 O SER E 57  ? O SER E 70  N LEU E 25  ? N LEU E 38  
L 4 5 N VAL E 26  ? N VAL E 39  O LEU E 294 ? O LEU E 307 
L 5 6 N CYS E 295 ? N CYS E 308 O ILE E 359 ? O ILE E 372 
M 1 2 N LEU F 47  ? N LEU F 59  O ILE F 62  ? O ILE F 74  
M 2 3 O GLU F 61  ? O GLU F 73  N PHE F 10  ? N PHE F 22  
M 3 4 N LEU F 15  ? N LEU F 27  O VAL F 88  ? O VAL F 100 
M 4 5 N TYR F 89  ? N TYR F 101 O ALA F 120 ? O ALA F 132 
M 5 6 N LEU F 119 ? N LEU F 131 O MET F 149 ? O MET F 161 
N 1 2 N SER G 8   ? N SER G 21  O SER G 16  ? O SER G 29  
N 2 3 N TYR G 15  ? N TYR G 28  O PHE G 400 ? O PHE G 413 
O 1 2 O GLU G 236 ? O GLU G 249 N VAL G 227 ? N VAL G 240 
O 2 3 N THR G 228 ? N THR G 241 O ALA G 274 ? O ALA G 287 
O 3 4 O ILE G 273 ? O ILE G 286 N GLY G 265 ? N GLY G 278 
P 1 2 O GLU G 236 ? O GLU G 249 N VAL G 227 ? N VAL G 240 
P 2 3 O ASN G 222 ? O ASN G 235 N VAL G 56  ? N VAL G 69  
P 3 4 O SER G 57  ? O SER G 70  N LEU G 25  ? N LEU G 38  
P 4 5 N GLY G 24  ? N GLY G 37  O LEU G 294 ? O LEU G 307 
P 5 6 N CYS G 295 ? N CYS G 308 O ILE G 359 ? O ILE G 372 
Q 1 2 N ALA H 45  ? N ALA H 57  O ASP H 64  ? O ASP H 76  
Q 2 3 O GLU H 61  ? O GLU H 73  N PHE H 10  ? N PHE H 22  
Q 3 4 N LEU H 15  ? N LEU H 27  O VAL H 88  ? O VAL H 100 
Q 4 5 N VAL H 87  ? N VAL H 99  O ALA H 118 ? O ALA H 130 
Q 5 6 N GLY H 121 ? N GLY H 133 O MET H 149 ? O MET H 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 601' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 602' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GOL A 603' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 604' 
AC5 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GNP B 301' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO B 302' 
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO B 303' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG B 304'  
AC9 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE GNP D 301' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 302'  
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO E 601' 
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL E 602' 
BC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GNP F 301' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG F 302'  
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO G 601' 
BC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE GNP H 301' 
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG H 302'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 2  ARG A 325 ? ARG A 338 . ? 1_555 ? 
2   AC1 2  THR A 342 ? THR A 355 . ? 1_555 ? 
3   AC2 5  LYS A 232 ? LYS A 245 . ? 1_555 ? 
4   AC2 5  GLU A 236 ? GLU A 249 . ? 1_555 ? 
5   AC2 5  ASN A 267 ? ASN A 280 . ? 1_555 ? 
6   AC2 5  LYS A 269 ? LYS A 282 . ? 1_555 ? 
7   AC2 5  GLU A 271 ? GLU A 284 . ? 1_555 ? 
8   AC3 2  SER A 344 ? SER A 357 . ? 1_555 ? 
9   AC3 2  GLU A 349 ? GLU A 362 . ? 1_555 ? 
10  AC4 3  ALA A 318 ? ALA A 331 . ? 1_555 ? 
11  AC4 3  ARG A 348 ? ARG A 361 . ? 1_555 ? 
12  AC4 3  ILE A 529 ? ILE A 542 . ? 1_555 ? 
13  AC5 21 SER B 18  ? SER B 30  . ? 1_555 ? 
14  AC5 21 ALA B 19  ? ALA B 31  . ? 1_555 ? 
15  AC5 21 VAL B 20  ? VAL B 32  . ? 1_555 ? 
16  AC5 21 GLY B 21  ? GLY B 33  . ? 1_555 ? 
17  AC5 21 LYS B 22  ? LYS B 34  . ? 1_555 ? 
18  AC5 21 SER B 23  ? SER B 35  . ? 1_555 ? 
19  AC5 21 SER B 24  ? SER B 36  . ? 1_555 ? 
20  AC5 21 PHE B 34  ? PHE B 46  . ? 1_555 ? 
21  AC5 21 HIS B 35  ? HIS B 47  . ? 1_555 ? 
22  AC5 21 GLU B 36  ? GLU B 48  . ? 1_555 ? 
23  AC5 21 SER B 40  ? SER B 52  . ? 1_555 ? 
24  AC5 21 THR B 41  ? THR B 53  . ? 1_555 ? 
25  AC5 21 GLY B 67  ? GLY B 79  . ? 1_555 ? 
26  AC5 21 ASN B 122 ? ASN B 134 . ? 1_555 ? 
27  AC5 21 LYS B 123 ? LYS B 135 . ? 1_555 ? 
28  AC5 21 ASP B 125 ? ASP B 137 . ? 1_555 ? 
29  AC5 21 LEU B 126 ? LEU B 138 . ? 1_555 ? 
30  AC5 21 SER B 152 ? SER B 164 . ? 1_555 ? 
31  AC5 21 ALA B 153 ? ALA B 165 . ? 1_555 ? 
32  AC5 21 LYS B 154 ? LYS B 166 . ? 1_555 ? 
33  AC5 21 MG  P .   ? MG  B 304 . ? 1_555 ? 
34  AC6 3  SER B 23  ? SER B 35  . ? 1_555 ? 
35  AC6 3  LEU B 47  ? LEU B 59  . ? 1_555 ? 
36  AC6 3  ASP B 64  ? ASP B 76  . ? 1_555 ? 
37  AC7 6  GLN A 463 ? GLN A 476 . ? 1_555 ? 
38  AC7 6  ILE A 467 ? ILE A 480 . ? 1_555 ? 
39  AC7 6  LYS B 11  ? LYS B 23  . ? 1_555 ? 
40  AC7 6  TRP B 63  ? TRP B 75  . ? 1_555 ? 
41  AC7 6  MET B 77  ? MET B 89  . ? 1_555 ? 
42  AC7 6  TYR B 78  ? TYR B 90  . ? 1_555 ? 
43  AC8 4  SER B 23  ? SER B 35  . ? 1_555 ? 
44  AC8 4  THR B 41  ? THR B 53  . ? 1_555 ? 
45  AC8 4  ASP B 64  ? ASP B 76  . ? 1_555 ? 
46  AC8 4  GNP M .   ? GNP B 301 . ? 1_555 ? 
47  AC9 20 SER D 18  ? SER D 30  . ? 1_555 ? 
48  AC9 20 ALA D 19  ? ALA D 31  . ? 1_555 ? 
49  AC9 20 VAL D 20  ? VAL D 32  . ? 1_555 ? 
50  AC9 20 GLY D 21  ? GLY D 33  . ? 1_555 ? 
51  AC9 20 LYS D 22  ? LYS D 34  . ? 1_555 ? 
52  AC9 20 SER D 23  ? SER D 35  . ? 1_555 ? 
53  AC9 20 SER D 24  ? SER D 36  . ? 1_555 ? 
54  AC9 20 HIS D 35  ? HIS D 47  . ? 1_555 ? 
55  AC9 20 GLU D 36  ? GLU D 48  . ? 1_555 ? 
56  AC9 20 SER D 40  ? SER D 52  . ? 1_555 ? 
57  AC9 20 THR D 41  ? THR D 53  . ? 1_555 ? 
58  AC9 20 GLY D 67  ? GLY D 79  . ? 1_555 ? 
59  AC9 20 ASN D 122 ? ASN D 134 . ? 1_555 ? 
60  AC9 20 LYS D 123 ? LYS D 135 . ? 1_555 ? 
61  AC9 20 ASP D 125 ? ASP D 137 . ? 1_555 ? 
62  AC9 20 LEU D 126 ? LEU D 138 . ? 1_555 ? 
63  AC9 20 SER D 152 ? SER D 164 . ? 1_555 ? 
64  AC9 20 ALA D 153 ? ALA D 165 . ? 1_555 ? 
65  AC9 20 LYS D 154 ? LYS D 166 . ? 1_555 ? 
66  AC9 20 MG  R .   ? MG  D 302 . ? 1_555 ? 
67  BC1 3  SER D 23  ? SER D 35  . ? 1_555 ? 
68  BC1 3  THR D 41  ? THR D 53  . ? 1_555 ? 
69  BC1 3  GNP Q .   ? GNP D 301 . ? 1_555 ? 
70  BC2 2  SER E 320 ? SER E 333 . ? 1_555 ? 
71  BC2 2  TRP E 321 ? TRP E 334 . ? 1_555 ? 
72  BC3 3  SER E 344 ? SER E 357 . ? 1_555 ? 
73  BC3 3  ASN E 347 ? ASN E 360 . ? 1_555 ? 
74  BC3 3  GLU E 349 ? GLU E 362 . ? 1_555 ? 
75  BC4 21 SER F 18  ? SER F 30  . ? 1_555 ? 
76  BC4 21 ALA F 19  ? ALA F 31  . ? 1_555 ? 
77  BC4 21 VAL F 20  ? VAL F 32  . ? 1_555 ? 
78  BC4 21 GLY F 21  ? GLY F 33  . ? 1_555 ? 
79  BC4 21 LYS F 22  ? LYS F 34  . ? 1_555 ? 
80  BC4 21 SER F 23  ? SER F 35  . ? 1_555 ? 
81  BC4 21 SER F 24  ? SER F 36  . ? 1_555 ? 
82  BC4 21 PHE F 34  ? PHE F 46  . ? 1_555 ? 
83  BC4 21 HIS F 35  ? HIS F 47  . ? 1_555 ? 
84  BC4 21 GLU F 36  ? GLU F 48  . ? 1_555 ? 
85  BC4 21 SER F 40  ? SER F 52  . ? 1_555 ? 
86  BC4 21 THR F 41  ? THR F 53  . ? 1_555 ? 
87  BC4 21 THR F 65  ? THR F 77  . ? 1_555 ? 
88  BC4 21 GLY F 67  ? GLY F 79  . ? 1_555 ? 
89  BC4 21 ASN F 122 ? ASN F 134 . ? 1_555 ? 
90  BC4 21 LYS F 123 ? LYS F 135 . ? 1_555 ? 
91  BC4 21 ASP F 125 ? ASP F 137 . ? 1_555 ? 
92  BC4 21 SER F 152 ? SER F 164 . ? 1_555 ? 
93  BC4 21 ALA F 153 ? ALA F 165 . ? 1_555 ? 
94  BC4 21 LYS F 154 ? LYS F 166 . ? 1_555 ? 
95  BC4 21 MG  V .   ? MG  F 302 . ? 1_555 ? 
96  BC5 3  SER F 23  ? SER F 35  . ? 1_555 ? 
97  BC5 3  THR F 41  ? THR F 53  . ? 1_555 ? 
98  BC5 3  GNP U .   ? GNP F 301 . ? 1_555 ? 
99  BC6 6  SER G 224 ? SER G 237 . ? 1_555 ? 
100 BC6 6  ARG G 237 ? ARG G 250 . ? 1_555 ? 
101 BC6 6  SER G 239 ? SER G 252 . ? 1_555 ? 
102 BC6 6  GLU G 284 ? GLU G 297 . ? 1_555 ? 
103 BC6 6  ILE G 285 ? ILE G 298 . ? 1_555 ? 
104 BC6 6  GLU G 286 ? GLU G 299 . ? 1_555 ? 
105 BC7 20 SER H 18  ? SER H 30  . ? 1_555 ? 
106 BC7 20 ALA H 19  ? ALA H 31  . ? 1_555 ? 
107 BC7 20 VAL H 20  ? VAL H 32  . ? 1_555 ? 
108 BC7 20 GLY H 21  ? GLY H 33  . ? 1_555 ? 
109 BC7 20 LYS H 22  ? LYS H 34  . ? 1_555 ? 
110 BC7 20 SER H 23  ? SER H 35  . ? 1_555 ? 
111 BC7 20 SER H 24  ? SER H 36  . ? 1_555 ? 
112 BC7 20 PHE H 34  ? PHE H 46  . ? 1_555 ? 
113 BC7 20 HIS H 35  ? HIS H 47  . ? 1_555 ? 
114 BC7 20 GLU H 36  ? GLU H 48  . ? 1_555 ? 
115 BC7 20 SER H 40  ? SER H 52  . ? 1_555 ? 
116 BC7 20 THR H 41  ? THR H 53  . ? 1_555 ? 
117 BC7 20 GLY H 67  ? GLY H 79  . ? 1_555 ? 
118 BC7 20 ASN H 122 ? ASN H 134 . ? 1_555 ? 
119 BC7 20 LYS H 123 ? LYS H 135 . ? 1_555 ? 
120 BC7 20 ASP H 125 ? ASP H 137 . ? 1_555 ? 
121 BC7 20 SER H 152 ? SER H 164 . ? 1_555 ? 
122 BC7 20 ALA H 153 ? ALA H 165 . ? 1_555 ? 
123 BC7 20 LYS H 154 ? LYS H 166 . ? 1_555 ? 
124 BC7 20 MG  Y .   ? MG  H 302 . ? 1_555 ? 
125 BC8 4  SER H 23  ? SER H 35  . ? 1_555 ? 
126 BC8 4  THR H 41  ? THR H 53  . ? 1_555 ? 
127 BC8 4  ASP H 64  ? ASP H 76  . ? 1_555 ? 
128 BC8 4  GNP X .   ? GNP H 301 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KYI 
_atom_sites.fract_transf_matrix[1][1]   0.010607 
_atom_sites.fract_transf_matrix[1][2]   -0.002080 
_atom_sites.fract_transf_matrix[1][3]   -0.001332 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010401 
_atom_sites.fract_transf_matrix[2][3]   -0.002209 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009430 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 4   ? -20.500  -17.914 17.731  1.00 70.69  ? 17  GLY A N     1 
ATOM   2     C  CA    . GLY A 1 4   ? -20.255  -18.122 19.145  1.00 70.69  ? 17  GLY A CA    1 
ATOM   3     C  C     . GLY A 1 4   ? -20.539  -16.880 19.965  1.00 70.69  ? 17  GLY A C     1 
ATOM   4     O  O     . GLY A 1 4   ? -19.846  -16.595 20.942  1.00 70.69  ? 17  GLY A O     1 
ATOM   5     N  N     . SER A 1 5   ? -21.567  -16.139 19.566  1.00 35.77  ? 18  SER A N     1 
ATOM   6     C  CA    . SER A 1 5   ? -21.934  -14.906 20.250  1.00 35.77  ? 18  SER A CA    1 
ATOM   7     C  C     . SER A 1 5   ? -22.828  -15.177 21.454  1.00 35.77  ? 18  SER A C     1 
ATOM   8     O  O     . SER A 1 5   ? -23.493  -16.208 21.523  1.00 35.77  ? 18  SER A O     1 
ATOM   9     C  CB    . SER A 1 5   ? -22.646  -13.960 19.285  1.00 35.77  ? 18  SER A CB    1 
ATOM   10    O  OG    . SER A 1 5   ? -21.839  -13.679 18.159  1.00 35.77  ? 18  SER A OG    1 
ATOM   11    N  N     . GLU A 1 6   ? -22.837  -14.247 22.403  1.00 28.84  ? 19  GLU A N     1 
ATOM   12    C  CA    . GLU A 1 6   ? -23.742  -14.329 23.541  1.00 28.84  ? 19  GLU A CA    1 
ATOM   13    C  C     . GLU A 1 6   ? -24.666  -13.117 23.575  1.00 28.84  ? 19  GLU A C     1 
ATOM   14    O  O     . GLU A 1 6   ? -24.420  -12.118 22.899  1.00 28.84  ? 19  GLU A O     1 
ATOM   15    C  CB    . GLU A 1 6   ? -22.968  -14.428 24.858  1.00 28.84  ? 19  GLU A CB    1 
ATOM   16    C  CG    . GLU A 1 6   ? -22.290  -15.768 25.096  1.00 28.84  ? 19  GLU A CG    1 
ATOM   17    C  CD    . GLU A 1 6   ? -21.725  -15.890 26.500  1.00 28.84  ? 19  GLU A CD    1 
ATOM   18    O  OE1   . GLU A 1 6   ? -21.835  -14.917 27.272  1.00 28.84  ? 19  GLU A OE1   1 
ATOM   19    O  OE2   . GLU A 1 6   ? -21.175  -16.961 26.831  1.00 28.84  ? 19  GLU A OE2   1 
ATOM   20    N  N     . ILE A 1 7   ? -25.729  -13.213 24.365  1.00 2.26   ? 20  ILE A N     1 
ATOM   21    C  CA    . ILE A 1 7   ? -26.629  -12.087 24.564  1.00 2.26   ? 20  ILE A CA    1 
ATOM   22    C  C     . ILE A 1 7   ? -26.605  -11.662 26.027  1.00 2.26   ? 20  ILE A C     1 
ATOM   23    O  O     . ILE A 1 7   ? -26.828  -12.478 26.922  1.00 2.26   ? 20  ILE A O     1 
ATOM   24    C  CB    . ILE A 1 7   ? -28.059  -12.427 24.125  1.00 2.26   ? 20  ILE A CB    1 
ATOM   25    C  CG1   . ILE A 1 7   ? -28.084  -12.716 22.627  1.00 2.26   ? 20  ILE A CG1   1 
ATOM   26    C  CG2   . ILE A 1 7   ? -29.010  -11.291 24.455  1.00 2.26   ? 20  ILE A CG2   1 
ATOM   27    C  CD1   . ILE A 1 7   ? -29.444  -13.072 22.101  1.00 2.26   ? 20  ILE A CD1   1 
ATOM   28    N  N     . SER A 1 8   ? -26.324  -10.385 26.264  1.00 27.24  ? 21  SER A N     1 
ATOM   29    C  CA    . SER A 1 8   ? -26.161  -9.879  27.621  1.00 27.24  ? 21  SER A CA    1 
ATOM   30    C  C     . SER A 1 8   ? -27.182  -8.793  27.939  1.00 27.24  ? 21  SER A C     1 
ATOM   31    O  O     . SER A 1 8   ? -27.406  -7.890  27.135  1.00 27.24  ? 21  SER A O     1 
ATOM   32    C  CB    . SER A 1 8   ? -24.746  -9.331  27.811  1.00 27.24  ? 21  SER A CB    1 
ATOM   33    O  OG    . SER A 1 8   ? -24.522  -8.936  29.152  1.00 27.24  ? 21  SER A OG    1 
ATOM   34    N  N     . LYS A 1 9   ? -27.799  -8.884  29.114  1.00 17.02  ? 22  LYS A N     1 
ATOM   35    C  CA    . LYS A 1 9   ? -28.728  -7.856  29.567  1.00 17.02  ? 22  LYS A CA    1 
ATOM   36    C  C     . LYS A 1 9   ? -27.939  -6.625  29.991  1.00 17.02  ? 22  LYS A C     1 
ATOM   37    O  O     . LYS A 1 9   ? -26.943  -6.740  30.703  1.00 17.02  ? 22  LYS A O     1 
ATOM   38    C  CB    . LYS A 1 9   ? -29.565  -8.362  30.741  1.00 17.02  ? 22  LYS A CB    1 
ATOM   39    C  CG    . LYS A 1 9   ? -30.734  -7.462  31.108  1.00 17.02  ? 22  LYS A CG    1 
ATOM   40    C  CD    . LYS A 1 9   ? -31.227  -7.742  32.516  1.00 17.02  ? 22  LYS A CD    1 
ATOM   41    C  CE    . LYS A 1 9   ? -31.541  -9.213  32.719  1.00 17.02  ? 22  LYS A CE    1 
ATOM   42    N  NZ    . LYS A 1 9   ? -31.913  -9.509  34.131  1.00 17.02  ? 22  LYS A NZ    1 
ATOM   43    N  N     . THR A 1 10  ? -28.381  -5.450  29.554  1.00 11.71  ? 23  THR A N     1 
ATOM   44    C  CA    . THR A 1 10  ? -27.670  -4.209  29.853  1.00 11.71  ? 23  THR A CA    1 
ATOM   45    C  C     . THR A 1 10  ? -28.133  -3.582  31.166  1.00 11.71  ? 23  THR A C     1 
ATOM   46    O  O     . THR A 1 10  ? -29.102  -4.038  31.770  1.00 11.71  ? 23  THR A O     1 
ATOM   47    C  CB    . THR A 1 10  ? -27.811  -3.185  28.710  1.00 11.71  ? 23  THR A CB    1 
ATOM   48    O  OG1   . THR A 1 10  ? -29.192  -2.855  28.524  1.00 11.71  ? 23  THR A OG1   1 
ATOM   49    C  CG2   . THR A 1 10  ? -27.255  -3.750  27.415  1.00 11.71  ? 23  THR A CG2   1 
ATOM   50    N  N     . GLU A 1 11  ? -27.433  -2.536  31.597  1.00 33.54  ? 24  GLU A N     1 
ATOM   51    C  CA    . GLU A 1 11  ? -27.746  -1.845  32.844  1.00 33.54  ? 24  GLU A CA    1 
ATOM   52    C  C     . GLU A 1 11  ? -29.108  -1.158  32.806  1.00 33.54  ? 24  GLU A C     1 
ATOM   53    O  O     . GLU A 1 11  ? -29.647  -0.785  33.847  1.00 33.54  ? 24  GLU A O     1 
ATOM   54    C  CB    . GLU A 1 11  ? -26.656  -0.821  33.176  1.00 33.54  ? 24  GLU A CB    1 
ATOM   55    C  CG    . GLU A 1 11  ? -25.663  -1.268  34.243  1.00 33.54  ? 24  GLU A CG    1 
ATOM   56    C  CD    . GLU A 1 11  ? -24.384  -0.450  34.230  1.00 33.54  ? 24  GLU A CD    1 
ATOM   57    O  OE1   . GLU A 1 11  ? -23.974  0.041   35.303  1.00 33.54  ? 24  GLU A OE1   1 
ATOM   58    O  OE2   . GLU A 1 11  ? -23.784  -0.304  33.145  1.00 33.54  ? 24  GLU A OE2   1 
ATOM   59    N  N     . ALA A 1 12  ? -29.659  -0.989  31.608  1.00 16.58  ? 25  ALA A N     1 
ATOM   60    C  CA    . ALA A 1 12  ? -30.956  -0.339  31.453  1.00 16.58  ? 25  ALA A CA    1 
ATOM   61    C  C     . ALA A 1 12  ? -31.996  -1.251  30.811  1.00 16.58  ? 25  ALA A C     1 
ATOM   62    O  O     . ALA A 1 12  ? -32.869  -0.786  30.081  1.00 16.58  ? 25  ALA A O     1 
ATOM   63    C  CB    . ALA A 1 12  ? -30.817  0.944   30.656  1.00 16.58  ? 25  ALA A CB    1 
ATOM   64    N  N     . GLY A 1 13  ? -31.894  -2.548  31.078  1.00 16.83  ? 26  GLY A N     1 
ATOM   65    C  CA    . GLY A 1 13  ? -32.923  -3.492  30.681  1.00 16.83  ? 26  GLY A CA    1 
ATOM   66    C  C     . GLY A 1 13  ? -33.027  -3.823  29.203  1.00 16.83  ? 26  GLY A C     1 
ATOM   67    O  O     . GLY A 1 13  ? -34.046  -4.358  28.764  1.00 16.83  ? 26  GLY A O     1 
ATOM   68    N  N     . GLN A 1 14  ? -31.991  -3.512  28.430  1.00 11.58  ? 27  GLN A N     1 
ATOM   69    C  CA    . GLN A 1 14  ? -31.971  -3.888  27.018  1.00 11.58  ? 27  GLN A CA    1 
ATOM   70    C  C     . GLN A 1 14  ? -31.070  -5.097  26.808  1.00 11.58  ? 27  GLN A C     1 
ATOM   71    O  O     . GLN A 1 14  ? -30.492  -5.614  27.762  1.00 11.58  ? 27  GLN A O     1 
ATOM   72    C  CB    . GLN A 1 14  ? -31.529  -2.717  26.140  1.00 11.58  ? 27  GLN A CB    1 
ATOM   73    C  CG    . GLN A 1 14  ? -32.569  -1.611  26.020  1.00 11.58  ? 27  GLN A CG    1 
ATOM   74    C  CD    . GLN A 1 14  ? -32.068  -0.409  25.247  1.00 11.58  ? 27  GLN A CD    1 
ATOM   75    O  OE1   . GLN A 1 14  ? -30.864  -0.180  25.143  1.00 11.58  ? 27  GLN A OE1   1 
ATOM   76    N  NE2   . GLN A 1 14  ? -32.994  0.368   24.700  1.00 11.58  ? 27  GLN A NE2   1 
ATOM   77    N  N     . TYR A 1 15  ? -30.951  -5.552  25.565  1.00 27.08  ? 28  TYR A N     1 
ATOM   78    C  CA    . TYR A 1 15  ? -30.196  -6.769  25.290  1.00 27.08  ? 28  TYR A CA    1 
ATOM   79    C  C     . TYR A 1 15  ? -29.183  -6.601  24.166  1.00 27.08  ? 28  TYR A C     1 
ATOM   80    O  O     . TYR A 1 15  ? -29.505  -6.743  22.985  1.00 27.08  ? 28  TYR A O     1 
ATOM   81    C  CB    . TYR A 1 15  ? -31.147  -7.943  25.040  1.00 27.08  ? 28  TYR A CB    1 
ATOM   82    C  CG    . TYR A 1 15  ? -32.023  -8.205  26.239  1.00 27.08  ? 28  TYR A CG    1 
ATOM   83    C  CD1   . TYR A 1 15  ? -33.223  -7.533  26.402  1.00 27.08  ? 28  TYR A CD1   1 
ATOM   84    C  CD2   . TYR A 1 15  ? -31.629  -9.090  27.230  1.00 27.08  ? 28  TYR A CD2   1 
ATOM   85    C  CE1   . TYR A 1 15  ? -34.012  -7.745  27.504  1.00 27.08  ? 28  TYR A CE1   1 
ATOM   86    C  CE2   . TYR A 1 15  ? -32.417  -9.311  28.339  1.00 27.08  ? 28  TYR A CE2   1 
ATOM   87    C  CZ    . TYR A 1 15  ? -33.608  -8.635  28.467  1.00 27.08  ? 28  TYR A CZ    1 
ATOM   88    O  OH    . TYR A 1 15  ? -34.408  -8.837  29.562  1.00 27.08  ? 28  TYR A OH    1 
ATOM   89    N  N     . SER A 1 16  ? -27.954  -6.283  24.558  1.00 36.06  ? 29  SER A N     1 
ATOM   90    C  CA    . SER A 1 16  ? -26.853  -6.140  23.619  1.00 36.06  ? 29  SER A CA    1 
ATOM   91    C  C     . SER A 1 16  ? -26.235  -7.505  23.356  1.00 36.06  ? 29  SER A C     1 
ATOM   92    O  O     . SER A 1 16  ? -26.204  -8.359  24.240  1.00 36.06  ? 29  SER A O     1 
ATOM   93    C  CB    . SER A 1 16  ? -25.798  -5.188  24.181  1.00 36.06  ? 29  SER A CB    1 
ATOM   94    O  OG    . SER A 1 16  ? -24.826  -4.858  23.207  1.00 36.06  ? 29  SER A OG    1 
ATOM   95    N  N     . VAL A 1 17  ? -25.753  -7.714  22.136  1.00 22.02  ? 30  VAL A N     1 
ATOM   96    C  CA    . VAL A 1 17  ? -25.087  -8.962  21.793  1.00 22.02  ? 30  VAL A CA    1 
ATOM   97    C  C     . VAL A 1 17  ? -23.579  -8.760  21.891  1.00 22.02  ? 30  VAL A C     1 
ATOM   98    O  O     . VAL A 1 17  ? -23.101  -7.625  21.857  1.00 22.02  ? 30  VAL A O     1 
ATOM   99    C  CB    . VAL A 1 17  ? -25.485  -9.442  20.387  1.00 22.02  ? 30  VAL A CB    1 
ATOM   100   C  CG1   . VAL A 1 17  ? -26.914  -9.036  20.093  1.00 22.02  ? 30  VAL A CG1   1 
ATOM   101   C  CG2   . VAL A 1 17  ? -24.556  -8.868  19.335  1.00 22.02  ? 30  VAL A CG2   1 
ATOM   102   N  N     . SER A 1 18  ? -22.838  -9.855  22.031  1.00 35.48  ? 31  SER A N     1 
ATOM   103   C  CA    . SER A 1 18  ? -21.389  -9.783  22.187  1.00 35.48  ? 31  SER A CA    1 
ATOM   104   C  C     . SER A 1 18  ? -20.744  -9.069  21.006  1.00 35.48  ? 31  SER A C     1 
ATOM   105   O  O     . SER A 1 18  ? -20.978  -9.425  19.851  1.00 35.48  ? 31  SER A O     1 
ATOM   106   C  CB    . SER A 1 18  ? -20.792  -11.182 22.337  1.00 35.48  ? 31  SER A CB    1 
ATOM   107   O  OG    . SER A 1 18  ? -20.980  -11.941 21.158  1.00 35.48  ? 31  SER A OG    1 
ATOM   108   N  N     . ALA A 1 19  ? -19.948  -8.047  21.305  1.00 11.18  ? 32  ALA A N     1 
ATOM   109   C  CA    . ALA A 1 19  ? -19.258  -7.280  20.275  1.00 11.18  ? 32  ALA A CA    1 
ATOM   110   C  C     . ALA A 1 19  ? -18.340  -8.175  19.452  1.00 11.18  ? 32  ALA A C     1 
ATOM   111   O  O     . ALA A 1 19  ? -17.615  -9.001  20.005  1.00 11.18  ? 32  ALA A O     1 
ATOM   112   C  CB    . ALA A 1 19  ? -18.470  -6.144  20.900  1.00 11.18  ? 32  ALA A CB    1 
ATOM   113   N  N     . PRO A 1 20  ? -18.369  -8.010  18.121  1.00 21.43  ? 33  PRO A N     1 
ATOM   114   C  CA    . PRO A 1 20  ? -17.557  -8.844  17.231  1.00 21.43  ? 33  PRO A CA    1 
ATOM   115   C  C     . PRO A 1 20  ? -16.074  -8.525  17.360  1.00 21.43  ? 33  PRO A C     1 
ATOM   116   O  O     . PRO A 1 20  ? -15.719  -7.396  17.697  1.00 21.43  ? 33  PRO A O     1 
ATOM   117   C  CB    . PRO A 1 20  ? -18.051  -8.447  15.840  1.00 21.43  ? 33  PRO A CB    1 
ATOM   118   C  CG    . PRO A 1 20  ? -18.543  -7.050  16.004  1.00 21.43  ? 33  PRO A CG    1 
ATOM   119   C  CD    . PRO A 1 20  ? -19.147  -7.002  17.377  1.00 21.43  ? 33  PRO A CD    1 
ATOM   120   N  N     . GLU A 1 21  ? -15.223  -9.510  17.096  1.00 57.05  ? 34  GLU A N     1 
ATOM   121   C  CA    . GLU A 1 21  ? -13.783  -9.299  17.146  1.00 57.05  ? 34  GLU A CA    1 
ATOM   122   C  C     . GLU A 1 21  ? -13.163  -9.457  15.764  1.00 57.05  ? 34  GLU A C     1 
ATOM   123   O  O     . GLU A 1 21  ? -13.316  -10.495 15.119  1.00 57.05  ? 34  GLU A O     1 
ATOM   124   C  CB    . GLU A 1 21  ? -13.131  -10.262 18.141  1.00 57.05  ? 34  GLU A CB    1 
ATOM   125   C  CG    . GLU A 1 21  ? -13.623  -10.094 19.573  1.00 57.05  ? 34  GLU A CG    1 
ATOM   126   C  CD    . GLU A 1 21  ? -12.970  -11.061 20.544  1.00 57.05  ? 34  GLU A CD    1 
ATOM   127   O  OE1   . GLU A 1 21  ? -13.374  -12.243 20.575  1.00 57.05  ? 34  GLU A OE1   1 
ATOM   128   O  OE2   . GLU A 1 21  ? -12.054  -10.638 21.282  1.00 57.05  ? 34  GLU A OE2   1 
ATOM   129   N  N     . HIS A 1 22  ? -12.468  -8.419  15.312  1.00 15.38  ? 35  HIS A N     1 
ATOM   130   C  CA    . HIS A 1 22  ? -11.825  -8.442  14.007  1.00 15.38  ? 35  HIS A CA    1 
ATOM   131   C  C     . HIS A 1 22  ? -10.327  -8.703  14.144  1.00 15.38  ? 35  HIS A C     1 
ATOM   132   O  O     . HIS A 1 22  ? -9.622   -7.967  14.835  1.00 15.38  ? 35  HIS A O     1 
ATOM   133   C  CB    . HIS A 1 22  ? -12.071  -7.124  13.268  1.00 15.38  ? 35  HIS A CB    1 
ATOM   134   C  CG    . HIS A 1 22  ? -13.514  -6.857  12.971  1.00 15.38  ? 35  HIS A CG    1 
ATOM   135   N  ND1   . HIS A 1 22  ? -14.414  -6.463  13.939  1.00 15.38  ? 35  HIS A ND1   1 
ATOM   136   C  CD2   . HIS A 1 22  ? -14.214  -6.926  11.815  1.00 15.38  ? 35  HIS A CD2   1 
ATOM   137   C  CE1   . HIS A 1 22  ? -15.603  -6.301  13.392  1.00 15.38  ? 35  HIS A CE1   1 
ATOM   138   N  NE2   . HIS A 1 22  ? -15.511  -6.576  12.101  1.00 15.38  ? 35  HIS A NE2   1 
ATOM   139   N  N     . LYS A 1 23  ? -9.850   -9.758  13.490  1.00 45.01  ? 36  LYS A N     1 
ATOM   140   C  CA    . LYS A 1 23  ? -8.440   -10.126 13.554  1.00 45.01  ? 36  LYS A CA    1 
ATOM   141   C  C     . LYS A 1 23  ? -7.732   -9.869  12.228  1.00 45.01  ? 36  LYS A C     1 
ATOM   142   O  O     . LYS A 1 23  ? -6.549   -10.177 12.076  1.00 45.01  ? 36  LYS A O     1 
ATOM   143   C  CB    . LYS A 1 23  ? -8.280   -11.593 13.962  1.00 45.01  ? 36  LYS A CB    1 
ATOM   144   C  CG    . LYS A 1 23  ? -8.872   -11.928 15.322  1.00 45.01  ? 36  LYS A CG    1 
ATOM   145   C  CD    . LYS A 1 23  ? -8.297   -13.220 15.889  1.00 45.01  ? 36  LYS A CD    1 
ATOM   146   C  CE    . LYS A 1 23  ? -8.542   -14.401 14.966  1.00 45.01  ? 36  LYS A CE    1 
ATOM   147   N  NZ    . LYS A 1 23  ? -7.984   -15.664 15.525  1.00 45.01  ? 36  LYS A NZ    1 
ATOM   148   N  N     . GLY A 1 24  ? -8.461   -9.302  11.272  1.00 25.63  ? 37  GLY A N     1 
ATOM   149   C  CA    . GLY A 1 24  ? -7.904   -9.014  9.963   1.00 25.63  ? 37  GLY A CA    1 
ATOM   150   C  C     . GLY A 1 24  ? -8.223   -7.615  9.469   1.00 25.63  ? 37  GLY A C     1 
ATOM   151   O  O     . GLY A 1 24  ? -9.236   -7.025  9.851   1.00 25.63  ? 37  GLY A O     1 
ATOM   152   N  N     . LEU A 1 25  ? -7.348   -7.084  8.620   1.00 3.69   ? 38  LEU A N     1 
ATOM   153   C  CA    . LEU A 1 25  ? -7.549   -5.772  8.014   1.00 3.69   ? 38  LEU A CA    1 
ATOM   154   C  C     . LEU A 1 25  ? -6.933   -5.746  6.621   1.00 3.69   ? 38  LEU A C     1 
ATOM   155   O  O     . LEU A 1 25  ? -5.755   -6.070  6.453   1.00 3.69   ? 38  LEU A O     1 
ATOM   156   C  CB    . LEU A 1 25  ? -6.940   -4.670  8.881   1.00 3.69   ? 38  LEU A CB    1 
ATOM   157   C  CG    . LEU A 1 25  ? -7.029   -3.246  8.331   1.00 3.69   ? 38  LEU A CG    1 
ATOM   158   C  CD1   . LEU A 1 25  ? -8.472   -2.853  8.113   1.00 3.69   ? 38  LEU A CD1   1 
ATOM   159   C  CD2   . LEU A 1 25  ? -6.353   -2.262  9.265   1.00 3.69   ? 38  LEU A CD2   1 
ATOM   160   N  N     . VAL A 1 26  ? -7.727   -5.362  5.626   1.00 14.83  ? 39  VAL A N     1 
ATOM   161   C  CA    . VAL A 1 26  ? -7.257   -5.334  4.242   1.00 14.83  ? 39  VAL A CA    1 
ATOM   162   C  C     . VAL A 1 26  ? -7.576   -4.007  3.553   1.00 14.83  ? 39  VAL A C     1 
ATOM   163   O  O     . VAL A 1 26  ? -8.710   -3.530  3.597   1.00 14.83  ? 39  VAL A O     1 
ATOM   164   C  CB    . VAL A 1 26  ? -7.831   -6.516  3.431   1.00 14.83  ? 39  VAL A CB    1 
ATOM   165   C  CG1   . VAL A 1 26  ? -9.237   -6.841  3.886   1.00 14.83  ? 39  VAL A CG1   1 
ATOM   166   C  CG2   . VAL A 1 26  ? -7.796   -6.223  1.942   1.00 14.83  ? 39  VAL A CG2   1 
ATOM   167   N  N     . LEU A 1 27  ? -6.564   -3.415  2.923   1.00 3.34   ? 40  LEU A N     1 
ATOM   168   C  CA    . LEU A 1 27  ? -6.721   -2.127  2.256   1.00 3.34   ? 40  LEU A CA    1 
ATOM   169   C  C     . LEU A 1 27  ? -6.724   -2.294  0.734   1.00 3.34   ? 40  LEU A C     1 
ATOM   170   O  O     . LEU A 1 27  ? -5.902   -3.023  0.178   1.00 3.34   ? 40  LEU A O     1 
ATOM   171   C  CB    . LEU A 1 27  ? -5.622   -1.161  2.700   1.00 3.34   ? 40  LEU A CB    1 
ATOM   172   C  CG    . LEU A 1 27  ? -5.433   -1.054  4.214   1.00 3.34   ? 40  LEU A CG    1 
ATOM   173   C  CD1   . LEU A 1 27  ? -4.416   0.013   4.583   1.00 3.34   ? 40  LEU A CD1   1 
ATOM   174   C  CD2   . LEU A 1 27  ? -6.754   -0.779  4.896   1.00 3.34   ? 40  LEU A CD2   1 
ATOM   175   N  N     . SER A 1 28  ? -7.655   -1.615  0.069   1.00 53.16  ? 41  SER A N     1 
ATOM   176   C  CA    . SER A 1 28  ? -7.883   -1.809  -1.360  1.00 53.16  ? 41  SER A CA    1 
ATOM   177   C  C     . SER A 1 28  ? -6.775   -1.247  -2.241  1.00 53.16  ? 41  SER A C     1 
ATOM   178   O  O     . SER A 1 28  ? -6.102   -0.282  -1.879  1.00 53.16  ? 41  SER A O     1 
ATOM   179   C  CB    . SER A 1 28  ? -9.215   -1.187  -1.776  1.00 53.16  ? 41  SER A CB    1 
ATOM   180   O  OG    . SER A 1 28  ? -9.177   0.223   -1.655  1.00 53.16  ? 41  SER A OG    1 
ATOM   181   N  N     . GLY A 1 29  ? -6.598   -1.862  -3.405  1.00 40.21  ? 42  GLY A N     1 
ATOM   182   C  CA    . GLY A 1 29  ? -5.704   -1.333  -4.415  1.00 40.21  ? 42  GLY A CA    1 
ATOM   183   C  C     . GLY A 1 29  ? -6.453   -0.378  -5.320  1.00 40.21  ? 42  GLY A C     1 
ATOM   184   O  O     . GLY A 1 29  ? -7.300   -0.796  -6.111  1.00 40.21  ? 42  GLY A O     1 
ATOM   185   N  N     . GLY A 1 30  ? -6.151   0.910   -5.198  1.00 15.21  ? 43  GLY A N     1 
ATOM   186   C  CA    . GLY A 1 30  ? -6.806   1.918   -6.010  1.00 15.21  ? 43  GLY A CA    1 
ATOM   187   C  C     . GLY A 1 30  ? -5.922   3.121   -6.274  1.00 15.21  ? 43  GLY A C     1 
ATOM   188   O  O     . GLY A 1 30  ? -4.702   3.052   -6.122  1.00 15.21  ? 43  GLY A O     1 
ATOM   189   N  N     . GLY A 1 31  ? -6.540   4.227   -6.675  1.00 7.21   ? 44  GLY A N     1 
ATOM   190   C  CA    . GLY A 1 31  ? -5.813   5.458   -6.911  1.00 7.21   ? 44  GLY A CA    1 
ATOM   191   C  C     . GLY A 1 31  ? -5.761   6.309   -5.661  1.00 7.21   ? 44  GLY A C     1 
ATOM   192   O  O     . GLY A 1 31  ? -5.587   7.525   -5.725  1.00 7.21   ? 44  GLY A O     1 
ATOM   193   N  N     . ALA A 1 32  ? -5.912   5.659   -4.514  1.00 6.25   ? 45  ALA A N     1 
ATOM   194   C  CA    . ALA A 1 32  ? -5.895   6.346   -3.230  1.00 6.25   ? 45  ALA A CA    1 
ATOM   195   C  C     . ALA A 1 32  ? -4.494   6.798   -2.842  1.00 6.25   ? 45  ALA A C     1 
ATOM   196   O  O     . ALA A 1 32  ? -3.499   6.172   -3.211  1.00 6.25   ? 45  ALA A O     1 
ATOM   197   C  CB    . ALA A 1 32  ? -6.466   5.448   -2.152  1.00 6.25   ? 45  ALA A CB    1 
ATOM   198   N  N     . LYS A 1 33  ? -4.427   7.888   -2.086  1.00 31.80  ? 46  LYS A N     1 
ATOM   199   C  CA    . LYS A 1 33  ? -3.170   8.348   -1.517  1.00 31.80  ? 46  LYS A CA    1 
ATOM   200   C  C     . LYS A 1 33  ? -3.080   7.838   -0.085  1.00 31.80  ? 46  LYS A C     1 
ATOM   201   O  O     . LYS A 1 33  ? -4.101   7.553   0.539   1.00 31.80  ? 46  LYS A O     1 
ATOM   202   C  CB    . LYS A 1 33  ? -3.097   9.874   -1.547  1.00 31.80  ? 46  LYS A CB    1 
ATOM   203   C  CG    . LYS A 1 33  ? -3.503   10.492  -2.879  1.00 31.80  ? 46  LYS A CG    1 
ATOM   204   C  CD    . LYS A 1 33  ? -2.546   10.113  -4.000  1.00 31.80  ? 46  LYS A CD    1 
ATOM   205   C  CE    . LYS A 1 33  ? -3.078   10.565  -5.354  1.00 31.80  ? 46  LYS A CE    1 
ATOM   206   N  NZ    . LYS A 1 33  ? -3.481   11.998  -5.349  1.00 31.80  ? 46  LYS A NZ    1 
ATOM   207   N  N     . GLY A 1 34  ? -1.862   7.722   0.434   1.00 13.43  ? 47  GLY A N     1 
ATOM   208   C  CA    . GLY A 1 34  ? -1.654   7.189   1.768   1.00 13.43  ? 47  GLY A CA    1 
ATOM   209   C  C     . GLY A 1 34  ? -2.285   8.014   2.874   1.00 13.43  ? 47  GLY A C     1 
ATOM   210   O  O     . GLY A 1 34  ? -2.504   7.518   3.980   1.00 13.43  ? 47  GLY A O     1 
ATOM   211   N  N     . ILE A 1 35  ? -2.584   9.274   2.574   1.00 26.97  ? 48  ILE A N     1 
ATOM   212   C  CA    . ILE A 1 35  ? -3.164   10.184  3.552   1.00 26.97  ? 48  ILE A CA    1 
ATOM   213   C  C     . ILE A 1 35  ? -4.606   9.795   3.863   1.00 26.97  ? 48  ILE A C     1 
ATOM   214   O  O     . ILE A 1 35  ? -5.129   10.119  4.929   1.00 26.97  ? 48  ILE A O     1 
ATOM   215   C  CB    . ILE A 1 35  ? -3.152   11.641  3.046   1.00 26.97  ? 48  ILE A CB    1 
ATOM   216   C  CG1   . ILE A 1 35  ? -2.031   11.863  2.023   1.00 26.97  ? 48  ILE A CG1   1 
ATOM   217   C  CG2   . ILE A 1 35  ? -3.056   12.617  4.216   1.00 26.97  ? 48  ILE A CG2   1 
ATOM   218   C  CD1   . ILE A 1 35  ? -0.629   11.840  2.608   1.00 26.97  ? 48  ILE A CD1   1 
ATOM   219   N  N     . SER A 1 36  ? -5.244   9.102   2.925   1.00 30.74  ? 49  SER A N     1 
ATOM   220   C  CA    . SER A 1 36  ? -6.646   8.724   3.069   1.00 30.74  ? 49  SER A CA    1 
ATOM   221   C  C     . SER A 1 36  ? -6.852   7.625   4.111   1.00 30.74  ? 49  SER A C     1 
ATOM   222   O  O     . SER A 1 36  ? -7.958   7.447   4.619   1.00 30.74  ? 49  SER A O     1 
ATOM   223   C  CB    . SER A 1 36  ? -7.224   8.288   1.723   1.00 30.74  ? 49  SER A CB    1 
ATOM   224   O  OG    . SER A 1 36  ? -7.073   9.302   0.747   1.00 30.74  ? 49  SER A OG    1 
ATOM   225   N  N     . TYR A 1 37  ? -5.788   6.893   4.423   1.00 16.37  ? 50  TYR A N     1 
ATOM   226   C  CA    . TYR A 1 37  ? -5.863   5.823   5.409   1.00 16.37  ? 50  TYR A CA    1 
ATOM   227   C  C     . TYR A 1 37  ? -5.477   6.311   6.803   1.00 16.37  ? 50  TYR A C     1 
ATOM   228   O  O     . TYR A 1 37  ? -5.472   5.534   7.757   1.00 16.37  ? 50  TYR A O     1 
ATOM   229   C  CB    . TYR A 1 37  ? -4.962   4.655   5.011   1.00 16.37  ? 50  TYR A CB    1 
ATOM   230   C  CG    . TYR A 1 37  ? -5.334   3.980   3.710   1.00 16.37  ? 50  TYR A CG    1 
ATOM   231   C  CD1   . TYR A 1 37  ? -6.470   3.192   3.614   1.00 16.37  ? 50  TYR A CD1   1 
ATOM   232   C  CD2   . TYR A 1 37  ? -4.533   4.113   2.585   1.00 16.37  ? 50  TYR A CD2   1 
ATOM   233   C  CE1   . TYR A 1 37  ? -6.806   2.568   2.429   1.00 16.37  ? 50  TYR A CE1   1 
ATOM   234   C  CE2   . TYR A 1 37  ? -4.862   3.492   1.397   1.00 16.37  ? 50  TYR A CE2   1 
ATOM   235   C  CZ    . TYR A 1 37  ? -5.999   2.721   1.326   1.00 16.37  ? 50  TYR A CZ    1 
ATOM   236   O  OH    . TYR A 1 37  ? -6.329   2.101   0.144   1.00 16.37  ? 50  TYR A OH    1 
ATOM   237   N  N     . LEU A 1 38  ? -5.151   7.595   6.918   1.00 13.93  ? 51  LEU A N     1 
ATOM   238   C  CA    . LEU A 1 38  ? -4.710   8.155   8.190   1.00 13.93  ? 51  LEU A CA    1 
ATOM   239   C  C     . LEU A 1 38  ? -5.855   8.189   9.199   1.00 13.93  ? 51  LEU A C     1 
ATOM   240   O  O     . LEU A 1 38  ? -5.706   7.741   10.337  1.00 13.93  ? 51  LEU A O     1 
ATOM   241   C  CB    . LEU A 1 38  ? -4.151   9.564   7.991   1.00 13.93  ? 51  LEU A CB    1 
ATOM   242   C  CG    . LEU A 1 38  ? -2.978   10.033  8.861   1.00 13.93  ? 51  LEU A CG    1 
ATOM   243   C  CD1   . LEU A 1 38  ? -3.195   11.467  9.313   1.00 13.93  ? 51  LEU A CD1   1 
ATOM   244   C  CD2   . LEU A 1 38  ? -2.734   9.122   10.057  1.00 13.93  ? 51  LEU A CD2   1 
ATOM   245   N  N     . GLY A 1 39  ? -6.997   8.721   8.776   1.00 22.64  ? 52  GLY A N     1 
ATOM   246   C  CA    . GLY A 1 39  ? -8.158   8.825   9.642   1.00 22.64  ? 52  GLY A CA    1 
ATOM   247   C  C     . GLY A 1 39  ? -8.735   7.478   10.039  1.00 22.64  ? 52  GLY A C     1 
ATOM   248   O  O     . GLY A 1 39  ? -9.343   7.344   11.101  1.00 22.64  ? 52  GLY A O     1 
ATOM   249   N  N     . MET A 1 40  ? -8.545   6.478   9.184   1.00 16.76  ? 53  MET A N     1 
ATOM   250   C  CA    . MET A 1 40  ? -9.037   5.132   9.455   1.00 16.76  ? 53  MET A CA    1 
ATOM   251   C  C     . MET A 1 40  ? -8.254   4.466   10.587  1.00 16.76  ? 53  MET A C     1 
ATOM   252   O  O     . MET A 1 40  ? -8.837   3.829   11.466  1.00 16.76  ? 53  MET A O     1 
ATOM   253   C  CB    . MET A 1 40  ? -8.983   4.283   8.182   1.00 16.76  ? 53  MET A CB    1 
ATOM   254   C  CG    . MET A 1 40  ? -9.473   2.854   8.347   1.00 16.76  ? 53  MET A CG    1 
ATOM   255   S  SD    . MET A 1 40  ? -8.159   1.694   8.773   1.00 16.76  ? 53  MET A SD    1 
ATOM   256   C  CE    . MET A 1 40  ? -7.085   1.865   7.351   1.00 16.76  ? 53  MET A CE    1 
ATOM   257   N  N     . ILE A 1 41  ? -6.933   4.619   10.560  1.00 25.57  ? 54  ILE A N     1 
ATOM   258   C  CA    . ILE A 1 41  ? -6.069   4.070   11.602  1.00 25.57  ? 54  ILE A CA    1 
ATOM   259   C  C     . ILE A 1 41  ? -6.261   4.821   12.918  1.00 25.57  ? 54  ILE A C     1 
ATOM   260   O  O     . ILE A 1 41  ? -6.269   4.220   13.993  1.00 25.57  ? 54  ILE A O     1 
ATOM   261   C  CB    . ILE A 1 41  ? -4.587   4.120   11.185  1.00 25.57  ? 54  ILE A CB    1 
ATOM   262   C  CG1   . ILE A 1 41  ? -4.366   3.330   9.898   1.00 25.57  ? 54  ILE A CG1   1 
ATOM   263   C  CG2   . ILE A 1 41  ? -3.691   3.569   12.283  1.00 25.57  ? 54  ILE A CG2   1 
ATOM   264   C  CD1   . ILE A 1 41  ? -2.917   3.239   9.496   1.00 25.57  ? 54  ILE A CD1   1 
ATOM   265   N  N     . GLN A 1 42  ? -6.418   6.139   12.816  1.00 28.72  ? 55  GLN A N     1 
ATOM   266   C  CA    . GLN A 1 42  ? -6.679   6.993   13.969  1.00 28.72  ? 55  GLN A CA    1 
ATOM   267   C  C     . GLN A 1 42  ? -7.969   6.567   14.660  1.00 28.72  ? 55  GLN A C     1 
ATOM   268   O  O     . GLN A 1 42  ? -8.105   6.682   15.876  1.00 28.72  ? 55  GLN A O     1 
ATOM   269   C  CB    . GLN A 1 42  ? -6.790   8.450   13.518  1.00 28.72  ? 55  GLN A CB    1 
ATOM   270   C  CG    . GLN A 1 42  ? -5.930   9.431   14.301  1.00 28.72  ? 55  GLN A CG    1 
ATOM   271   C  CD    . GLN A 1 42  ? -5.822   10.782  13.618  1.00 28.72  ? 55  GLN A CD    1 
ATOM   272   O  OE1   . GLN A 1 42  ? -6.817   11.484  13.442  1.00 28.72  ? 55  GLN A OE1   1 
ATOM   273   N  NE2   . GLN A 1 42  ? -4.608   11.149  13.221  1.00 28.72  ? 55  GLN A NE2   1 
ATOM   274   N  N     . ALA A 1 43  ? -8.911   6.069   13.867  1.00 17.08  ? 56  ALA A N     1 
ATOM   275   C  CA    . ALA A 1 43  ? -10.200  5.618   14.372  1.00 17.08  ? 56  ALA A CA    1 
ATOM   276   C  C     . ALA A 1 43  ? -10.093  4.244   15.031  1.00 17.08  ? 56  ALA A C     1 
ATOM   277   O  O     . ALA A 1 43  ? -10.666  4.013   16.096  1.00 17.08  ? 56  ALA A O     1 
ATOM   278   C  CB    . ALA A 1 43  ? -11.215  5.588   13.247  1.00 17.08  ? 56  ALA A CB    1 
ATOM   279   N  N     . LEU A 1 44  ? -9.366   3.334   14.388  1.00 24.58  ? 57  LEU A N     1 
ATOM   280   C  CA    . LEU A 1 44  ? -9.183   1.985   14.915  1.00 24.58  ? 57  LEU A CA    1 
ATOM   281   C  C     . LEU A 1 44  ? -8.377   1.994   16.213  1.00 24.58  ? 57  LEU A C     1 
ATOM   282   O  O     . LEU A 1 44  ? -8.526   1.105   17.052  1.00 24.58  ? 57  LEU A O     1 
ATOM   283   C  CB    . LEU A 1 44  ? -8.510   1.080   13.882  1.00 24.58  ? 57  LEU A CB    1 
ATOM   284   C  CG    . LEU A 1 44  ? -9.266   0.788   12.587  1.00 24.58  ? 57  LEU A CG    1 
ATOM   285   C  CD1   . LEU A 1 44  ? -8.595   -0.336  11.810  1.00 24.58  ? 57  LEU A CD1   1 
ATOM   286   C  CD2   . LEU A 1 44  ? -10.714  0.447   12.876  1.00 24.58  ? 57  LEU A CD2   1 
ATOM   287   N  N     . GLN A 1 45  ? -7.519   2.998   16.363  1.00 34.91  ? 58  GLN A N     1 
ATOM   288   C  CA    . GLN A 1 45  ? -6.763   3.197   17.593  1.00 34.91  ? 58  GLN A CA    1 
ATOM   289   C  C     . GLN A 1 45  ? -7.694   3.660   18.705  1.00 34.91  ? 58  GLN A C     1 
ATOM   290   O  O     . GLN A 1 45  ? -7.685   3.119   19.812  1.00 34.91  ? 58  GLN A O     1 
ATOM   291   C  CB    . GLN A 1 45  ? -5.669   4.241   17.368  1.00 34.91  ? 58  GLN A CB    1 
ATOM   292   C  CG    . GLN A 1 45  ? -5.133   4.885   18.642  1.00 34.91  ? 58  GLN A CG    1 
ATOM   293   C  CD    . GLN A 1 45  ? -4.175   3.987   19.400  1.00 34.91  ? 58  GLN A CD    1 
ATOM   294   O  OE1   . GLN A 1 45  ? -3.736   2.958   18.890  1.00 34.91  ? 58  GLN A OE1   1 
ATOM   295   N  NE2   . GLN A 1 45  ? -3.843   4.377   20.625  1.00 34.91  ? 58  GLN A NE2   1 
ATOM   296   N  N     . GLU A 1 46  ? -8.504   4.663   18.386  1.00 42.32  ? 59  GLU A N     1 
ATOM   297   C  CA    . GLU A 1 46  ? -9.423   5.274   19.338  1.00 42.32  ? 59  GLU A CA    1 
ATOM   298   C  C     . GLU A 1 46  ? -10.435  4.269   19.893  1.00 42.32  ? 59  GLU A C     1 
ATOM   299   O  O     . GLU A 1 46  ? -10.909  4.414   21.020  1.00 42.32  ? 59  GLU A O     1 
ATOM   300   C  CB    . GLU A 1 46  ? -10.140  6.449   18.669  1.00 42.32  ? 59  GLU A CB    1 
ATOM   301   C  CG    . GLU A 1 46  ? -11.038  7.263   19.582  1.00 42.32  ? 59  GLU A CG    1 
ATOM   302   C  CD    . GLU A 1 46  ? -11.538  8.530   18.916  1.00 42.32  ? 59  GLU A CD    1 
ATOM   303   O  OE1   . GLU A 1 46  ? -12.706  8.905   19.147  1.00 42.32  ? 59  GLU A OE1   1 
ATOM   304   O  OE2   . GLU A 1 46  ? -10.760  9.154   18.163  1.00 42.32  ? 59  GLU A OE2   1 
ATOM   305   N  N     . ARG A 1 47  ? -10.754  3.249   19.103  1.00 27.50  ? 60  ARG A N     1 
ATOM   306   C  CA    . ARG A 1 47  ? -11.691  2.216   19.531  1.00 27.50  ? 60  ARG A CA    1 
ATOM   307   C  C     . ARG A 1 47  ? -10.991  0.900   19.861  1.00 27.50  ? 60  ARG A C     1 
ATOM   308   O  O     . ARG A 1 47  ? -11.636  -0.067  20.263  1.00 27.50  ? 60  ARG A O     1 
ATOM   309   C  CB    . ARG A 1 47  ? -12.775  1.995   18.473  1.00 27.50  ? 60  ARG A CB    1 
ATOM   310   C  CG    . ARG A 1 47  ? -13.783  3.130   18.372  1.00 27.50  ? 60  ARG A CG    1 
ATOM   311   C  CD    . ARG A 1 47  ? -14.947  2.763   17.466  1.00 27.50  ? 60  ARG A CD    1 
ATOM   312   N  NE    . ARG A 1 47  ? -16.028  3.739   17.536  1.00 27.50  ? 60  ARG A NE    1 
ATOM   313   C  CZ    . ARG A 1 47  ? -17.000  3.706   18.441  1.00 27.50  ? 60  ARG A CZ    1 
ATOM   314   N  NH1   . ARG A 1 47  ? -17.023  2.746   19.355  1.00 27.50  ? 60  ARG A NH1   1 
ATOM   315   N  NH2   . ARG A 1 47  ? -17.949  4.633   18.439  1.00 27.50  ? 60  ARG A NH2   1 
ATOM   316   N  N     . GLY A 1 48  ? -9.674   0.867   19.688  1.00 30.34  ? 61  GLY A N     1 
ATOM   317   C  CA    . GLY A 1 48  ? -8.891   -0.310  20.026  1.00 30.34  ? 61  GLY A CA    1 
ATOM   318   C  C     . GLY A 1 48  ? -9.222   -1.532  19.189  1.00 30.34  ? 61  GLY A C     1 
ATOM   319   O  O     . GLY A 1 48  ? -9.360   -2.636  19.717  1.00 30.34  ? 61  GLY A O     1 
ATOM   320   N  N     . LYS A 1 49  ? -9.351   -1.335  17.882  1.00 13.91  ? 62  LYS A N     1 
ATOM   321   C  CA    . LYS A 1 49  ? -9.638   -2.433  16.968  1.00 13.91  ? 62  LYS A CA    1 
ATOM   322   C  C     . LYS A 1 49  ? -8.346   -3.024  16.413  1.00 13.91  ? 62  LYS A C     1 
ATOM   323   O  O     . LYS A 1 49  ? -8.362   -4.048  15.730  1.00 13.91  ? 62  LYS A O     1 
ATOM   324   C  CB    . LYS A 1 49  ? -10.525  -1.956  15.818  1.00 13.91  ? 62  LYS A CB    1 
ATOM   325   C  CG    . LYS A 1 49  ? -11.904  -1.475  16.236  1.00 13.91  ? 62  LYS A CG    1 
ATOM   326   C  CD    . LYS A 1 49  ? -12.724  -2.601  16.837  1.00 13.91  ? 62  LYS A CD    1 
ATOM   327   C  CE    . LYS A 1 49  ? -12.954  -3.714  15.833  1.00 13.91  ? 62  LYS A CE    1 
ATOM   328   N  NZ    . LYS A 1 49  ? -13.651  -4.877  16.444  1.00 13.91  ? 62  LYS A NZ    1 
ATOM   329   N  N     . ILE A 1 50  ? -7.228   -2.373  16.723  1.00 13.70  ? 63  ILE A N     1 
ATOM   330   C  CA    . ILE A 1 50  ? -5.928   -2.733  16.159  1.00 13.70  ? 63  ILE A CA    1 
ATOM   331   C  C     . ILE A 1 50  ? -5.181   -3.816  16.947  1.00 13.70  ? 63  ILE A C     1 
ATOM   332   O  O     . ILE A 1 50  ? -4.623   -4.740  16.354  1.00 13.70  ? 63  ILE A O     1 
ATOM   333   C  CB    . ILE A 1 50  ? -5.034   -1.479  15.987  1.00 13.70  ? 63  ILE A CB    1 
ATOM   334   C  CG1   . ILE A 1 50  ? -5.421   -0.725  14.715  1.00 13.70  ? 63  ILE A CG1   1 
ATOM   335   C  CG2   . ILE A 1 50  ? -3.561   -1.851  15.936  1.00 13.70  ? 63  ILE A CG2   1 
ATOM   336   C  CD1   . ILE A 1 50  ? -4.582   0.503   14.444  1.00 13.70  ? 63  ILE A CD1   1 
ATOM   337   N  N     . LYS A 1 51  ? -5.179   -3.699  18.273  1.00 23.70  ? 64  LYS A N     1 
ATOM   338   C  CA    . LYS A 1 51  ? -4.419   -4.602  19.141  1.00 23.70  ? 64  LYS A CA    1 
ATOM   339   C  C     . LYS A 1 51  ? -4.712   -6.081  18.890  1.00 23.70  ? 64  LYS A C     1 
ATOM   340   O  O     . LYS A 1 51  ? -3.808   -6.917  18.940  1.00 23.70  ? 64  LYS A O     1 
ATOM   341   C  CB    . LYS A 1 51  ? -4.681   -4.272  20.612  1.00 23.70  ? 64  LYS A CB    1 
ATOM   342   C  CG    . LYS A 1 51  ? -3.847   -5.084  21.598  1.00 23.70  ? 64  LYS A CG    1 
ATOM   343   C  CD    . LYS A 1 51  ? -4.488   -5.100  22.981  1.00 23.70  ? 64  LYS A CD    1 
ATOM   344   C  CE    . LYS A 1 51  ? -3.605   -5.792  24.011  1.00 23.70  ? 64  LYS A CE    1 
ATOM   345   N  NZ    . LYS A 1 51  ? -2.404   -4.983  24.362  1.00 23.70  ? 64  LYS A NZ    1 
ATOM   346   N  N     . ASN A 1 52  ? -5.973   -6.398  18.615  1.00 40.72  ? 65  ASN A N     1 
ATOM   347   C  CA    . ASN A 1 52  ? -6.385   -7.786  18.435  1.00 40.72  ? 65  ASN A CA    1 
ATOM   348   C  C     . ASN A 1 52  ? -6.273   -8.270  16.991  1.00 40.72  ? 65  ASN A C     1 
ATOM   349   O  O     . ASN A 1 52  ? -6.700   -9.378  16.667  1.00 40.72  ? 65  ASN A O     1 
ATOM   350   C  CB    . ASN A 1 52  ? -7.806   -7.996  18.964  1.00 40.72  ? 65  ASN A CB    1 
ATOM   351   C  CG    . ASN A 1 52  ? -7.956   -7.566  20.412  1.00 40.72  ? 65  ASN A CG    1 
ATOM   352   O  OD1   . ASN A 1 52  ? -8.324   -6.427  20.697  1.00 40.72  ? 65  ASN A OD1   1 
ATOM   353   N  ND2   . ASN A 1 52  ? -7.669   -8.477  21.334  1.00 40.72  ? 65  ASN A ND2   1 
ATOM   354   N  N     . LEU A 1 53  ? -5.695   -7.439  16.129  1.00 15.68  ? 66  LEU A N     1 
ATOM   355   C  CA    . LEU A 1 53  ? -5.434   -7.835  14.750  1.00 15.68  ? 66  LEU A CA    1 
ATOM   356   C  C     . LEU A 1 53  ? -4.236   -8.774  14.691  1.00 15.68  ? 66  LEU A C     1 
ATOM   357   O  O     . LEU A 1 53  ? -3.178   -8.475  15.242  1.00 15.68  ? 66  LEU A O     1 
ATOM   358   C  CB    . LEU A 1 53  ? -5.172   -6.614  13.866  1.00 15.68  ? 66  LEU A CB    1 
ATOM   359   C  CG    . LEU A 1 53  ? -6.340   -5.666  13.597  1.00 15.68  ? 66  LEU A CG    1 
ATOM   360   C  CD1   . LEU A 1 53  ? -5.867   -4.426  12.857  1.00 15.68  ? 66  LEU A CD1   1 
ATOM   361   C  CD2   . LEU A 1 53  ? -7.427   -6.369  12.806  1.00 15.68  ? 66  LEU A CD2   1 
ATOM   362   N  N     . THR A 1 54  ? -4.410   -9.911  14.028  1.00 9.54   ? 67  THR A N     1 
ATOM   363   C  CA    . THR A 1 54  ? -3.317   -10.852 13.828  1.00 9.54   ? 67  THR A CA    1 
ATOM   364   C  C     . THR A 1 54  ? -2.717   -10.658 12.444  1.00 9.54   ? 67  THR A C     1 
ATOM   365   O  O     . THR A 1 54  ? -1.499   -10.683 12.273  1.00 9.54   ? 67  THR A O     1 
ATOM   366   C  CB    . THR A 1 54  ? -3.791   -12.309 13.959  1.00 9.54   ? 67  THR A CB    1 
ATOM   367   O  OG1   . THR A 1 54  ? -4.682   -12.625 12.882  1.00 9.54   ? 67  THR A OG1   1 
ATOM   368   C  CG2   . THR A 1 54  ? -4.502   -12.521 15.279  1.00 9.54   ? 67  THR A CG2   1 
ATOM   369   N  N     . HIS A 1 55  ? -3.588   -10.459 11.460  1.00 9.70   ? 68  HIS A N     1 
ATOM   370   C  CA    . HIS A 1 55  ? -3.164   -10.310 10.075  1.00 9.70   ? 68  HIS A CA    1 
ATOM   371   C  C     . HIS A 1 55  ? -3.467   -8.920  9.524   1.00 9.70   ? 68  HIS A C     1 
ATOM   372   O  O     . HIS A 1 55  ? -4.363   -8.227  10.011  1.00 9.70   ? 68  HIS A O     1 
ATOM   373   C  CB    . HIS A 1 55  ? -3.836   -11.365 9.196   1.00 9.70   ? 68  HIS A CB    1 
ATOM   374   C  CG    . HIS A 1 55  ? -3.398   -12.765 9.489   1.00 9.70   ? 68  HIS A CG    1 
ATOM   375   N  ND1   . HIS A 1 55  ? -3.351   -13.277 10.767  1.00 9.70   ? 68  HIS A ND1   1 
ATOM   376   C  CD2   . HIS A 1 55  ? -2.994   -13.762 8.669   1.00 9.70   ? 68  HIS A CD2   1 
ATOM   377   C  CE1   . HIS A 1 55  ? -2.932   -14.530 10.722  1.00 9.70   ? 68  HIS A CE1   1 
ATOM   378   N  NE2   . HIS A 1 55  ? -2.708   -14.848 9.459   1.00 9.70   ? 68  HIS A NE2   1 
ATOM   379   N  N     . VAL A 1 56  ? -2.712   -8.522  8.505   1.00 10.44  ? 69  VAL A N     1 
ATOM   380   C  CA    . VAL A 1 56  ? -2.969   -7.270  7.806   1.00 10.44  ? 69  VAL A CA    1 
ATOM   381   C  C     . VAL A 1 56  ? -2.604   -7.423  6.330   1.00 10.44  ? 69  VAL A C     1 
ATOM   382   O  O     . VAL A 1 56  ? -1.609   -8.067  5.991   1.00 10.44  ? 69  VAL A O     1 
ATOM   383   C  CB    . VAL A 1 56  ? -2.223   -6.081  8.459   1.00 10.44  ? 69  VAL A CB    1 
ATOM   384   C  CG1   . VAL A 1 56  ? -0.725   -6.193  8.247   1.00 10.44  ? 69  VAL A CG1   1 
ATOM   385   C  CG2   . VAL A 1 56  ? -2.741   -4.761  7.922   1.00 10.44  ? 69  VAL A CG2   1 
ATOM   386   N  N     . SER A 1 57  ? -3.429   -6.859  5.454   1.00 10.37  ? 70  SER A N     1 
ATOM   387   C  CA    . SER A 1 57  ? -3.204   -6.971  4.017   1.00 10.37  ? 70  SER A CA    1 
ATOM   388   C  C     . SER A 1 57  ? -3.315   -5.612  3.345   1.00 10.37  ? 70  SER A C     1 
ATOM   389   O  O     . SER A 1 57  ? -3.860   -4.671  3.922   1.00 10.37  ? 70  SER A O     1 
ATOM   390   C  CB    . SER A 1 57  ? -4.198   -7.946  3.391   1.00 10.37  ? 70  SER A CB    1 
ATOM   391   O  OG    . SER A 1 57  ? -3.991   -8.050  1.995   1.00 10.37  ? 70  SER A OG    1 
ATOM   392   N  N     . GLY A 1 58  ? -2.795   -5.507  2.127   1.00 16.16  ? 71  GLY A N     1 
ATOM   393   C  CA    . GLY A 1 58  ? -2.837   -4.249  1.407   1.00 16.16  ? 71  GLY A CA    1 
ATOM   394   C  C     . GLY A 1 58  ? -2.345   -4.334  -0.025  1.00 16.16  ? 71  GLY A C     1 
ATOM   395   O  O     . GLY A 1 58  ? -1.570   -5.223  -0.381  1.00 16.16  ? 71  GLY A O     1 
ATOM   396   N  N     . ALA A 1 59  ? -2.814   -3.401  -0.847  1.00 6.81   ? 72  ALA A N     1 
ATOM   397   C  CA    . ALA A 1 59  ? -2.351   -3.252  -2.220  1.00 6.81   ? 72  ALA A CA    1 
ATOM   398   C  C     . ALA A 1 59  ? -2.243   -1.763  -2.512  1.00 6.81   ? 72  ALA A C     1 
ATOM   399   O  O     . ALA A 1 59  ? -2.893   -0.958  -1.845  1.00 6.81   ? 72  ALA A O     1 
ATOM   400   C  CB    . ALA A 1 59  ? -3.309   -3.916  -3.184  1.00 6.81   ? 72  ALA A CB    1 
ATOM   401   N  N     . SER A 1 60  ? -1.429   -1.401  -3.501  1.00 14.17  ? 73  SER A N     1 
ATOM   402   C  CA    . SER A 1 60  ? -1.184   0.004   -3.833  1.00 14.17  ? 73  SER A CA    1 
ATOM   403   C  C     . SER A 1 60  ? -0.659   0.791   -2.635  1.00 14.17  ? 73  SER A C     1 
ATOM   404   O  O     . SER A 1 60  ? 0.320    0.397   -2.004  1.00 14.17  ? 73  SER A O     1 
ATOM   405   C  CB    . SER A 1 60  ? -2.443   0.665   -4.400  1.00 14.17  ? 73  SER A CB    1 
ATOM   406   O  OG    . SER A 1 60  ? -2.890   -0.011  -5.560  1.00 14.17  ? 73  SER A OG    1 
ATOM   407   N  N     . ALA A 1 61  ? -1.317   1.904   -2.326  1.00 31.03  ? 74  ALA A N     1 
ATOM   408   C  CA    . ALA A 1 61  ? -0.935   2.723   -1.184  1.00 31.03  ? 74  ALA A CA    1 
ATOM   409   C  C     . ALA A 1 61  ? -1.318   2.036   0.120   1.00 31.03  ? 74  ALA A C     1 
ATOM   410   O  O     . ALA A 1 61  ? -0.834   2.403   1.191   1.00 31.03  ? 74  ALA A O     1 
ATOM   411   C  CB    . ALA A 1 61  ? -1.580   4.092   -1.272  1.00 31.03  ? 74  ALA A CB    1 
ATOM   412   N  N     . GLY A 1 62  ? -2.199   1.044   0.024   1.00 27.88  ? 75  GLY A N     1 
ATOM   413   C  CA    . GLY A 1 62  ? -2.582   0.256   1.178   1.00 27.88  ? 75  GLY A CA    1 
ATOM   414   C  C     . GLY A 1 62  ? -1.474   -0.699  1.576   1.00 27.88  ? 75  GLY A C     1 
ATOM   415   O  O     . GLY A 1 62  ? -1.252   -0.941  2.759   1.00 27.88  ? 75  GLY A O     1 
ATOM   416   N  N     . ALA A 1 63  ? -0.775   -1.235  0.580   1.00 4.95   ? 76  ALA A N     1 
ATOM   417   C  CA    . ALA A 1 63  ? 0.342    -2.141  0.821   1.00 4.95   ? 76  ALA A CA    1 
ATOM   418   C  C     . ALA A 1 63  ? 1.412    -1.481  1.686   1.00 4.95   ? 76  ALA A C     1 
ATOM   419   O  O     . ALA A 1 63  ? 2.060    -2.144  2.494   1.00 4.95   ? 76  ALA A O     1 
ATOM   420   C  CB    . ALA A 1 63  ? 0.935    -2.608  -0.494  1.00 4.95   ? 76  ALA A CB    1 
ATOM   421   N  N     . MET A 1 64  ? 1.593    -0.176  1.506   1.00 40.92  ? 77  MET A N     1 
ATOM   422   C  CA    . MET A 1 64  ? 2.534    0.591   2.317   1.00 40.92  ? 77  MET A CA    1 
ATOM   423   C  C     . MET A 1 64  ? 1.978    0.856   3.713   1.00 40.92  ? 77  MET A C     1 
ATOM   424   O  O     . MET A 1 64  ? 2.667    0.661   4.714   1.00 40.92  ? 77  MET A O     1 
ATOM   425   C  CB    . MET A 1 64  ? 2.883    1.915   1.638   1.00 40.92  ? 77  MET A CB    1 
ATOM   426   C  CG    . MET A 1 64  ? 3.731    2.841   2.502   1.00 40.92  ? 77  MET A CG    1 
ATOM   427   S  SD    . MET A 1 64  ? 3.848    4.521   1.855   1.00 40.92  ? 77  MET A SD    1 
ATOM   428   C  CE    . MET A 1 64  ? 4.772    5.316   3.166   1.00 40.92  ? 77  MET A CE    1 
ATOM   429   N  N     . THR A 1 65  ? 0.728    1.306   3.766   1.00 8.28   ? 78  THR A N     1 
ATOM   430   C  CA    . THR A 1 65  ? 0.067    1.616   5.027   1.00 8.28   ? 78  THR A CA    1 
ATOM   431   C  C     . THR A 1 65  ? -0.079   0.366   5.893   1.00 8.28   ? 78  THR A C     1 
ATOM   432   O  O     . THR A 1 65  ? 0.064    0.424   7.113   1.00 8.28   ? 78  THR A O     1 
ATOM   433   C  CB    . THR A 1 65  ? -1.307   2.265   4.786   1.00 8.28   ? 78  THR A CB    1 
ATOM   434   O  OG1   . THR A 1 65  ? -1.142   3.472   4.031   1.00 8.28   ? 78  THR A OG1   1 
ATOM   435   C  CG2   . THR A 1 65  ? -1.983   2.596   6.098   1.00 8.28   ? 78  THR A CG2   1 
ATOM   436   N  N     . ALA A 1 66  ? -0.345   -0.767  5.254   1.00 24.10  ? 79  ALA A N     1 
ATOM   437   C  CA    . ALA A 1 66  ? -0.472   -2.029  5.969   1.00 24.10  ? 79  ALA A CA    1 
ATOM   438   C  C     . ALA A 1 66  ? 0.889    -2.576  6.392   1.00 24.10  ? 79  ALA A C     1 
ATOM   439   O  O     . ALA A 1 66  ? 0.968    -3.515  7.180   1.00 24.10  ? 79  ALA A O     1 
ATOM   440   C  CB    . ALA A 1 66  ? -1.208   -3.045  5.118   1.00 24.10  ? 79  ALA A CB    1 
ATOM   441   N  N     . SER A 1 67  ? 1.957    -1.988  5.863   1.00 10.37  ? 80  SER A N     1 
ATOM   442   C  CA    . SER A 1 67  ? 3.306    -2.440  6.174   1.00 10.37  ? 80  SER A CA    1 
ATOM   443   C  C     . SER A 1 67  ? 3.862    -1.738  7.409   1.00 10.37  ? 80  SER A C     1 
ATOM   444   O  O     . SER A 1 67  ? 4.647    -2.317  8.157   1.00 10.37  ? 80  SER A O     1 
ATOM   445   C  CB    . SER A 1 67  ? 4.235    -2.216  4.984   1.00 10.37  ? 80  SER A CB    1 
ATOM   446   O  OG    . SER A 1 67  ? 4.486    -0.838  4.787   1.00 10.37  ? 80  SER A OG    1 
ATOM   447   N  N     . ILE A 1 68  ? 3.456    -0.491  7.618   1.00 26.73  ? 81  ILE A N     1 
ATOM   448   C  CA    . ILE A 1 68  ? 3.893    0.260   8.789   1.00 26.73  ? 81  ILE A CA    1 
ATOM   449   C  C     . ILE A 1 68  ? 2.954    0.009   9.966   1.00 26.73  ? 81  ILE A C     1 
ATOM   450   O  O     . ILE A 1 68  ? 3.121    0.582   11.043  1.00 26.73  ? 81  ILE A O     1 
ATOM   451   C  CB    . ILE A 1 68  ? 3.987    1.767   8.500   1.00 26.73  ? 81  ILE A CB    1 
ATOM   452   C  CG1   . ILE A 1 68  ? 2.601    2.359   8.264   1.00 26.73  ? 81  ILE A CG1   1 
ATOM   453   C  CG2   . ILE A 1 68  ? 4.877    2.023   7.296   1.00 26.73  ? 81  ILE A CG2   1 
ATOM   454   C  CD1   . ILE A 1 68  ? 2.632    3.833   7.944   1.00 26.73  ? 81  ILE A CD1   1 
ATOM   455   N  N     . LEU A 1 69  ? 1.959    -0.845  9.740   1.00 16.99  ? 82  LEU A N     1 
ATOM   456   C  CA    . LEU A 1 69  ? 1.108    -1.350  10.809  1.00 16.99  ? 82  LEU A CA    1 
ATOM   457   C  C     . LEU A 1 69  ? 1.655    -2.694  11.266  1.00 16.99  ? 82  LEU A C     1 
ATOM   458   O  O     . LEU A 1 69  ? 1.677    -2.997  12.455  1.00 16.99  ? 82  LEU A O     1 
ATOM   459   C  CB    . LEU A 1 69  ? -0.334   -1.519  10.329  1.00 16.99  ? 82  LEU A CB    1 
ATOM   460   C  CG    . LEU A 1 69  ? -1.221   -0.278  10.246  1.00 16.99  ? 82  LEU A CG    1 
ATOM   461   C  CD1   . LEU A 1 69  ? -2.610   -0.642  9.757   1.00 16.99  ? 82  LEU A CD1   1 
ATOM   462   C  CD2   . LEU A 1 69  ? -1.302   0.404   11.596  1.00 16.99  ? 82  LEU A CD2   1 
ATOM   463   N  N     . ALA A 1 70  ? 2.101    -3.495  10.303  1.00 36.81  ? 83  ALA A N     1 
ATOM   464   C  CA    . ALA A 1 70  ? 2.654    -4.812  10.588  1.00 36.81  ? 83  ALA A CA    1 
ATOM   465   C  C     . ALA A 1 70  ? 4.001    -4.710  11.295  1.00 36.81  ? 83  ALA A C     1 
ATOM   466   O  O     . ALA A 1 70  ? 4.443    -5.659  11.943  1.00 36.81  ? 83  ALA A O     1 
ATOM   467   C  CB    . ALA A 1 70  ? 2.790    -5.615  9.308   1.00 36.81  ? 83  ALA A CB    1 
ATOM   468   N  N     . VAL A 1 71  ? 4.651    -3.558  11.161  1.00 21.61  ? 84  VAL A N     1 
ATOM   469   C  CA    . VAL A 1 71  ? 5.938    -3.326  11.799  1.00 21.61  ? 84  VAL A CA    1 
ATOM   470   C  C     . VAL A 1 71  ? 5.732    -2.844  13.234  1.00 21.61  ? 84  VAL A C     1 
ATOM   471   O  O     . VAL A 1 71  ? 6.673    -2.794  14.026  1.00 21.61  ? 84  VAL A O     1 
ATOM   472   C  CB    . VAL A 1 71  ? 6.785    -2.309  11.009  1.00 21.61  ? 84  VAL A CB    1 
ATOM   473   C  CG1   . VAL A 1 71  ? 6.410    -0.888  11.392  1.00 21.61  ? 84  VAL A CG1   1 
ATOM   474   C  CG2   . VAL A 1 71  ? 8.260    -2.549  11.253  1.00 21.61  ? 84  VAL A CG2   1 
ATOM   475   N  N     . GLY A 1 72  ? 4.493    -2.495  13.564  1.00 6.12   ? 85  GLY A N     1 
ATOM   476   C  CA    . GLY A 1 72  ? 4.155    -2.092  14.916  1.00 6.12   ? 85  GLY A CA    1 
ATOM   477   C  C     . GLY A 1 72  ? 4.542    -0.670  15.265  1.00 6.12   ? 85  GLY A C     1 
ATOM   478   O  O     . GLY A 1 72  ? 4.802    -0.361  16.428  1.00 6.12   ? 85  GLY A O     1 
ATOM   479   N  N     . MET A 1 73  ? 4.576    0.200   14.261  1.00 20.78  ? 86  MET A N     1 
ATOM   480   C  CA    . MET A 1 73  ? 4.896    1.604   14.491  1.00 20.78  ? 86  MET A CA    1 
ATOM   481   C  C     . MET A 1 73  ? 3.817    2.278   15.335  1.00 20.78  ? 86  MET A C     1 
ATOM   482   O  O     . MET A 1 73  ? 2.626    2.060   15.119  1.00 20.78  ? 86  MET A O     1 
ATOM   483   C  CB    . MET A 1 73  ? 5.070    2.342   13.163  1.00 20.78  ? 86  MET A CB    1 
ATOM   484   C  CG    . MET A 1 73  ? 5.423    3.810   13.320  1.00 20.78  ? 86  MET A CG    1 
ATOM   485   S  SD    . MET A 1 73  ? 5.767    4.632   11.753  1.00 20.78  ? 86  MET A SD    1 
ATOM   486   C  CE    . MET A 1 73  ? 7.155    3.664   11.163  1.00 20.78  ? 86  MET A CE    1 
ATOM   487   N  N     . ASP A 1 74  ? 4.243    3.090   16.299  1.00 50.76  ? 87  ASP A N     1 
ATOM   488   C  CA    . ASP A 1 74  ? 3.318    3.802   17.175  1.00 50.76  ? 87  ASP A CA    1 
ATOM   489   C  C     . ASP A 1 74  ? 2.426    4.744   16.368  1.00 50.76  ? 87  ASP A C     1 
ATOM   490   O  O     . ASP A 1 74  ? 2.850    5.286   15.349  1.00 50.76  ? 87  ASP A O     1 
ATOM   491   C  CB    . ASP A 1 74  ? 4.096    4.584   18.234  1.00 50.76  ? 87  ASP A CB    1 
ATOM   492   C  CG    . ASP A 1 74  ? 3.205    5.129   19.329  1.00 50.76  ? 87  ASP A CG    1 
ATOM   493   O  OD1   . ASP A 1 74  ? 3.013    4.426   20.344  1.00 50.76  ? 87  ASP A OD1   1 
ATOM   494   O  OD2   . ASP A 1 74  ? 2.703    6.262   19.180  1.00 50.76  ? 87  ASP A OD2   1 
ATOM   495   N  N     . ILE A 1 75  ? 1.193    4.932   16.831  1.00 28.87  ? 88  ILE A N     1 
ATOM   496   C  CA    . ILE A 1 75  ? 0.202    5.729   16.109  1.00 28.87  ? 88  ILE A CA    1 
ATOM   497   C  C     . ILE A 1 75  ? 0.605    7.205   16.026  1.00 28.87  ? 88  ILE A C     1 
ATOM   498   O  O     . ILE A 1 75  ? 0.132    7.939   15.158  1.00 28.87  ? 88  ILE A O     1 
ATOM   499   C  CB    . ILE A 1 75  ? -1.209   5.569   16.737  1.00 28.87  ? 88  ILE A CB    1 
ATOM   500   C  CG1   . ILE A 1 75  ? -2.292   5.467   15.654  1.00 28.87  ? 88  ILE A CG1   1 
ATOM   501   C  CG2   . ILE A 1 75  ? -1.500   6.688   17.737  1.00 28.87  ? 88  ILE A CG2   1 
ATOM   502   C  CD1   . ILE A 1 75  ? -2.803   6.802   15.147  1.00 28.87  ? 88  ILE A CD1   1 
ATOM   503   N  N     . LYS A 1 76  ? 1.492    7.631   16.922  1.00 38.27  ? 89  LYS A N     1 
ATOM   504   C  CA    . LYS A 1 76  ? 2.002    8.997   16.904  1.00 38.27  ? 89  LYS A CA    1 
ATOM   505   C  C     . LYS A 1 76  ? 2.981    9.190   15.750  1.00 38.27  ? 89  LYS A C     1 
ATOM   506   O  O     . LYS A 1 76  ? 2.974    10.224  15.078  1.00 38.27  ? 89  LYS A O     1 
ATOM   507   C  CB    . LYS A 1 76  ? 2.686    9.333   18.229  1.00 38.27  ? 89  LYS A CB    1 
ATOM   508   C  CG    . LYS A 1 76  ? 3.420    10.664  18.220  1.00 38.27  ? 89  LYS A CG    1 
ATOM   509   C  CD    . LYS A 1 76  ? 4.216    10.881  19.496  1.00 38.27  ? 89  LYS A CD    1 
ATOM   510   C  CE    . LYS A 1 76  ? 4.968    12.200  19.446  1.00 38.27  ? 89  LYS A CE    1 
ATOM   511   N  NZ    . LYS A 1 76  ? 4.061    13.338  19.125  1.00 38.27  ? 89  LYS A NZ    1 
ATOM   512   N  N     . ASP A 1 77  ? 3.823    8.185   15.523  1.00 35.72  ? 90  ASP A N     1 
ATOM   513   C  CA    . ASP A 1 77  ? 4.804    8.238   14.446  1.00 35.72  ? 90  ASP A CA    1 
ATOM   514   C  C     . ASP A 1 77  ? 4.137    8.087   13.081  1.00 35.72  ? 90  ASP A C     1 
ATOM   515   O  O     . ASP A 1 77  ? 4.502    8.774   12.128  1.00 35.72  ? 90  ASP A O     1 
ATOM   516   C  CB    . ASP A 1 77  ? 5.871    7.159   14.636  1.00 35.72  ? 90  ASP A CB    1 
ATOM   517   C  CG    . ASP A 1 77  ? 6.633    7.310   15.938  1.00 35.72  ? 90  ASP A CG    1 
ATOM   518   O  OD1   . ASP A 1 77  ? 6.656    8.428   16.492  1.00 35.72  ? 90  ASP A OD1   1 
ATOM   519   O  OD2   . ASP A 1 77  ? 7.214    6.308   16.405  1.00 35.72  ? 90  ASP A OD2   1 
ATOM   520   N  N     . ILE A 1 78  ? 3.163    7.183   12.999  1.00 25.05  ? 91  ILE A N     1 
ATOM   521   C  CA    . ILE A 1 78  ? 2.395    6.975   11.774  1.00 25.05  ? 91  ILE A CA    1 
ATOM   522   C  C     . ILE A 1 78  ? 1.752    8.278   11.311  1.00 25.05  ? 91  ILE A C     1 
ATOM   523   O  O     . ILE A 1 78  ? 1.797    8.613   10.128  1.00 25.05  ? 91  ILE A O     1 
ATOM   524   C  CB    . ILE A 1 78  ? 1.307    5.897   11.960  1.00 25.05  ? 91  ILE A CB    1 
ATOM   525   C  CG1   . ILE A 1 78  ? 1.942    4.537   12.239  1.00 25.05  ? 91  ILE A CG1   1 
ATOM   526   C  CG2   . ILE A 1 78  ? 0.423    5.806   10.732  1.00 25.05  ? 91  ILE A CG2   1 
ATOM   527   C  CD1   . ILE A 1 78  ? 0.949    3.394   12.298  1.00 25.05  ? 91  ILE A CD1   1 
ATOM   528   N  N     . LYS A 1 79  ? 1.169    9.013   12.253  1.00 43.85  ? 92  LYS A N     1 
ATOM   529   C  CA    . LYS A 1 79  ? 0.567    10.308  11.960  1.00 43.85  ? 92  LYS A CA    1 
ATOM   530   C  C     . LYS A 1 79  ? 1.601    11.280  11.400  1.00 43.85  ? 92  LYS A C     1 
ATOM   531   O  O     . LYS A 1 79  ? 1.319    12.018  10.458  1.00 43.85  ? 92  LYS A O     1 
ATOM   532   C  CB    . LYS A 1 79  ? -0.086   10.898  13.212  1.00 43.85  ? 92  LYS A CB    1 
ATOM   533   C  CG    . LYS A 1 79  ? -0.737   12.257  12.988  1.00 43.85  ? 92  LYS A CG    1 
ATOM   534   C  CD    . LYS A 1 79  ? -1.454   12.751  14.235  1.00 43.85  ? 92  LYS A CD    1 
ATOM   535   C  CE    . LYS A 1 79  ? -2.127   14.093  13.995  1.00 43.85  ? 92  LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1 79  ? -1.139   15.161  13.688  1.00 43.85  ? 92  LYS A NZ    1 
ATOM   537   N  N     . LYS A 1 80  ? 2.798    11.275  11.980  1.00 60.99  ? 93  LYS A N     1 
ATOM   538   C  CA    . LYS A 1 80  ? 3.889    12.106  11.480  1.00 60.99  ? 93  LYS A CA    1 
ATOM   539   C  C     . LYS A 1 80  ? 4.444    11.560  10.170  1.00 60.99  ? 93  LYS A C     1 
ATOM   540   O  O     . LYS A 1 80  ? 4.877    12.321  9.307   1.00 60.99  ? 93  LYS A O     1 
ATOM   541   C  CB    . LYS A 1 80  ? 5.013    12.220  12.513  1.00 60.99  ? 93  LYS A CB    1 
ATOM   542   C  CG    . LYS A 1 80  ? 4.806    13.311  13.551  1.00 60.99  ? 93  LYS A CG    1 
ATOM   543   C  CD    . LYS A 1 80  ? 6.045    13.488  14.416  1.00 60.99  ? 93  LYS A CD    1 
ATOM   544   C  CE    . LYS A 1 80  ? 6.379    12.213  15.170  1.00 60.99  ? 93  LYS A CE    1 
ATOM   545   N  NZ    . LYS A 1 80  ? 7.575    12.381  16.040  1.00 60.99  ? 93  LYS A NZ    1 
ATOM   546   N  N     . LEU A 1 81  ? 4.428    10.238  10.028  1.00 15.42  ? 94  LEU A N     1 
ATOM   547   C  CA    . LEU A 1 81  ? 4.954    9.594   8.829   1.00 15.42  ? 94  LEU A CA    1 
ATOM   548   C  C     . LEU A 1 81  ? 4.008    9.787   7.646   1.00 15.42  ? 94  LEU A C     1 
ATOM   549   O  O     . LEU A 1 81  ? 4.415    10.252  6.585   1.00 15.42  ? 94  LEU A O     1 
ATOM   550   C  CB    . LEU A 1 81  ? 5.200    8.104   9.087   1.00 15.42  ? 94  LEU A CB    1 
ATOM   551   C  CG    . LEU A 1 81  ? 6.205    7.354   8.209   1.00 15.42  ? 94  LEU A CG    1 
ATOM   552   C  CD1   . LEU A 1 81  ? 5.581    6.883   6.907   1.00 15.42  ? 94  LEU A CD1   1 
ATOM   553   C  CD2   . LEU A 1 81  ? 7.416    8.226   7.928   1.00 15.42  ? 94  LEU A CD2   1 
ATOM   554   N  N     . ILE A 1 82  ? 2.742    9.434   7.842   1.00 45.15  ? 95  ILE A N     1 
ATOM   555   C  CA    . ILE A 1 82  ? 1.745    9.495   6.776   1.00 45.15  ? 95  ILE A CA    1 
ATOM   556   C  C     . ILE A 1 82  ? 1.451    10.927  6.306   1.00 45.15  ? 95  ILE A C     1 
ATOM   557   O  O     . ILE A 1 82  ? 1.374    11.186  5.103   1.00 45.15  ? 95  ILE A O     1 
ATOM   558   C  CB    . ILE A 1 82  ? 0.437    8.787   7.189   1.00 45.15  ? 95  ILE A CB    1 
ATOM   559   C  CG1   . ILE A 1 82  ? 0.679    7.289   7.379   1.00 45.15  ? 95  ILE A CG1   1 
ATOM   560   C  CG2   . ILE A 1 82  ? -0.648   9.008   6.152   1.00 45.15  ? 95  ILE A CG2   1 
ATOM   561   C  CD1   . ILE A 1 82  ? 1.154    6.585   6.124   1.00 45.15  ? 95  ILE A CD1   1 
ATOM   562   N  N     . GLU A 1 83  ? 1.293    11.851  7.250   1.00 72.02  ? 96  GLU A N     1 
ATOM   563   C  CA    . GLU A 1 83  ? 1.004    13.245  6.915   1.00 72.02  ? 96  GLU A CA    1 
ATOM   564   C  C     . GLU A 1 83  ? 2.150    13.927  6.173   1.00 72.02  ? 96  GLU A C     1 
ATOM   565   O  O     . GLU A 1 83  ? 1.927    14.648  5.201   1.00 72.02  ? 96  GLU A O     1 
ATOM   566   C  CB    . GLU A 1 83  ? 0.654    14.055  8.167   1.00 72.02  ? 96  GLU A CB    1 
ATOM   567   C  CG    . GLU A 1 83  ? -0.818   14.036  8.546   1.00 72.02  ? 96  GLU A CG    1 
ATOM   568   C  CD    . GLU A 1 83  ? -1.135   14.949  9.718   1.00 72.02  ? 96  GLU A CD    1 
ATOM   569   O  OE1   . GLU A 1 83  ? -0.224   15.226  10.527  1.00 72.02  ? 96  GLU A OE1   1 
ATOM   570   O  OE2   . GLU A 1 83  ? -2.297   15.393  9.827   1.00 72.02  ? 96  GLU A OE2   1 
ATOM   571   N  N     . GLY A 1 84  ? 3.374    13.703  6.639   1.00 63.77  ? 97  GLY A N     1 
ATOM   572   C  CA    . GLY A 1 84  ? 4.532    14.374  6.077   1.00 63.77  ? 97  GLY A CA    1 
ATOM   573   C  C     . GLY A 1 84  ? 5.415    13.491  5.217   1.00 63.77  ? 97  GLY A C     1 
ATOM   574   O  O     . GLY A 1 84  ? 6.615    13.373  5.469   1.00 63.77  ? 97  GLY A O     1 
ATOM   575   N  N     . LEU A 1 85  ? 4.827    12.873  4.198   1.00 40.55  ? 98  LEU A N     1 
ATOM   576   C  CA    . LEU A 1 85  ? 5.592    12.056  3.264   1.00 40.55  ? 98  LEU A CA    1 
ATOM   577   C  C     . LEU A 1 85  ? 4.954    12.051  1.880   1.00 40.55  ? 98  LEU A C     1 
ATOM   578   O  O     . LEU A 1 85  ? 4.145    11.178  1.560   1.00 40.55  ? 98  LEU A O     1 
ATOM   579   C  CB    . LEU A 1 85  ? 5.739    10.624  3.783   1.00 40.55  ? 98  LEU A CB    1 
ATOM   580   C  CG    . LEU A 1 85  ? 6.664    9.695   2.995   1.00 40.55  ? 98  LEU A CG    1 
ATOM   581   C  CD1   . LEU A 1 85  ? 8.041    10.312  2.853   1.00 40.55  ? 98  LEU A CD1   1 
ATOM   582   C  CD2   . LEU A 1 85  ? 6.762    8.342   3.672   1.00 40.55  ? 98  LEU A CD2   1 
ATOM   583   N  N     . ASP A 1 86  ? 5.321    13.035  1.065   1.00 137.47 ? 99  ASP A N     1 
ATOM   584   C  CA    . ASP A 1 86  ? 4.851    13.096  -0.312  1.00 137.47 ? 99  ASP A CA    1 
ATOM   585   C  C     . ASP A 1 86  ? 5.632    12.110  -1.176  1.00 137.47 ? 99  ASP A C     1 
ATOM   586   O  O     . ASP A 1 86  ? 6.858    12.180  -1.260  1.00 137.47 ? 99  ASP A O     1 
ATOM   587   C  CB    . ASP A 1 86  ? 4.989    14.516  -0.867  1.00 137.47 ? 99  ASP A CB    1 
ATOM   588   C  CG    . ASP A 1 86  ? 4.223    15.540  -0.049  1.00 137.47 ? 99  ASP A CG    1 
ATOM   589   O  OD1   . ASP A 1 86  ? 4.821    16.136  0.872   1.00 137.47 ? 99  ASP A OD1   1 
ATOM   590   O  OD2   . ASP A 1 86  ? 3.024    15.750  -0.328  1.00 137.47 ? 99  ASP A OD2   1 
ATOM   591   N  N     . ILE A 1 87  ? 4.912    11.187  -1.805  1.00 60.36  ? 100 ILE A N     1 
ATOM   592   C  CA    . ILE A 1 87  ? 5.518    10.182  -2.673  1.00 60.36  ? 100 ILE A CA    1 
ATOM   593   C  C     . ILE A 1 87  ? 6.184    10.845  -3.881  1.00 60.36  ? 100 ILE A C     1 
ATOM   594   O  O     . ILE A 1 87  ? 7.223    10.388  -4.362  1.00 60.36  ? 100 ILE A O     1 
ATOM   595   C  CB    . ILE A 1 87  ? 4.473    9.120   -3.111  1.00 60.36  ? 100 ILE A CB    1 
ATOM   596   C  CG1   . ILE A 1 87  ? 4.449    7.948   -2.127  1.00 60.36  ? 100 ILE A CG1   1 
ATOM   597   C  CG2   . ILE A 1 87  ? 4.763    8.595   -4.508  1.00 60.36  ? 100 ILE A CG2   1 
ATOM   598   C  CD1   . ILE A 1 87  ? 3.991    8.304   -0.727  1.00 60.36  ? 100 ILE A CD1   1 
ATOM   599   N  N     . THR A 1 88  ? 5.589    11.944  -4.339  1.00 67.90  ? 101 THR A N     1 
ATOM   600   C  CA    . THR A 1 88  ? 6.117    12.725  -5.455  1.00 67.90  ? 101 THR A CA    1 
ATOM   601   C  C     . THR A 1 88  ? 7.571    13.144  -5.219  1.00 67.90  ? 101 THR A C     1 
ATOM   602   O  O     . THR A 1 88  ? 8.360    13.247  -6.160  1.00 67.90  ? 101 THR A O     1 
ATOM   603   C  CB    . THR A 1 88  ? 5.245    13.972  -5.713  1.00 67.90  ? 101 THR A CB    1 
ATOM   604   O  OG1   . THR A 1 88  ? 3.883    13.571  -5.907  1.00 67.90  ? 101 THR A OG1   1 
ATOM   605   C  CG2   . THR A 1 88  ? 5.723    14.730  -6.942  1.00 67.90  ? 101 THR A CG2   1 
ATOM   606   N  N     . LYS A 1 89  ? 7.920    13.372  -3.957  1.00 71.22  ? 102 LYS A N     1 
ATOM   607   C  CA    . LYS A 1 89  ? 9.291    13.695  -3.580  1.00 71.22  ? 102 LYS A CA    1 
ATOM   608   C  C     . LYS A 1 89  ? 10.230   12.530  -3.875  1.00 71.22  ? 102 LYS A C     1 
ATOM   609   O  O     . LYS A 1 89  ? 11.393   12.729  -4.226  1.00 71.22  ? 102 LYS A O     1 
ATOM   610   C  CB    . LYS A 1 89  ? 9.365    14.036  -2.091  1.00 71.22  ? 102 LYS A CB    1 
ATOM   611   C  CG    . LYS A 1 89  ? 8.490    15.202  -1.661  1.00 71.22  ? 102 LYS A CG    1 
ATOM   612   C  CD    . LYS A 1 89  ? 9.068    16.530  -2.117  1.00 71.22  ? 102 LYS A CD    1 
ATOM   613   C  CE    . LYS A 1 89  ? 10.424   16.792  -1.479  1.00 71.22  ? 102 LYS A CE    1 
ATOM   614   N  NZ    . LYS A 1 89  ? 11.004   18.091  -1.918  1.00 71.22  ? 102 LYS A NZ    1 
ATOM   615   N  N     . LEU A 1 90  ? 9.713    11.313  -3.732  1.00 48.76  ? 103 LEU A N     1 
ATOM   616   C  CA    . LEU A 1 90  ? 10.527   10.109  -3.851  1.00 48.76  ? 103 LEU A CA    1 
ATOM   617   C  C     . LEU A 1 90  ? 10.550   9.542   -5.269  1.00 48.76  ? 103 LEU A C     1 
ATOM   618   O  O     . LEU A 1 90  ? 10.721   8.338   -5.460  1.00 48.76  ? 103 LEU A O     1 
ATOM   619   C  CB    . LEU A 1 90  ? 10.040   9.042   -2.865  1.00 48.76  ? 103 LEU A CB    1 
ATOM   620   C  CG    . LEU A 1 90  ? 9.992    9.476   -1.399  1.00 48.76  ? 103 LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1 90  ? 9.581    8.323   -0.497  1.00 48.76  ? 103 LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1 90  ? 11.334   10.046  -0.970  1.00 48.76  ? 103 LEU A CD2   1 
ATOM   623   N  N     . LEU A 1 91  ? 10.382   10.410  -6.262  1.00 42.52  ? 104 LEU A N     1 
ATOM   624   C  CA    . LEU A 1 91  ? 10.459   9.988   -7.656  1.00 42.52  ? 104 LEU A CA    1 
ATOM   625   C  C     . LEU A 1 91  ? 11.864   10.204  -8.209  1.00 42.52  ? 104 LEU A C     1 
ATOM   626   O  O     . LEU A 1 91  ? 12.374   11.326  -8.210  1.00 42.52  ? 104 LEU A O     1 
ATOM   627   C  CB    . LEU A 1 91  ? 9.425    10.723  -8.510  1.00 42.52  ? 104 LEU A CB    1 
ATOM   628   C  CG    . LEU A 1 91  ? 7.964    10.339  -8.277  1.00 42.52  ? 104 LEU A CG    1 
ATOM   629   C  CD1   . LEU A 1 91  ? 7.037    11.172  -9.145  1.00 42.52  ? 104 LEU A CD1   1 
ATOM   630   C  CD2   . LEU A 1 91  ? 7.758    8.861   -8.544  1.00 42.52  ? 104 LEU A CD2   1 
ATOM   631   N  N     . ASP A 1 92  ? 12.485   9.122   -8.671  1.00 45.67  ? 105 ASP A N     1 
ATOM   632   C  CA    . ASP A 1 92  ? 13.831   9.190   -9.228  1.00 45.67  ? 105 ASP A CA    1 
ATOM   633   C  C     . ASP A 1 92  ? 13.870   8.702   -10.675 1.00 45.67  ? 105 ASP A C     1 
ATOM   634   O  O     . ASP A 1 92  ? 14.177   7.541   -10.945 1.00 45.67  ? 105 ASP A O     1 
ATOM   635   C  CB    . ASP A 1 92  ? 14.818   8.398   -8.365  1.00 45.67  ? 105 ASP A CB    1 
ATOM   636   C  CG    . ASP A 1 92  ? 14.358   6.976   -8.101  1.00 45.67  ? 105 ASP A CG    1 
ATOM   637   O  OD1   . ASP A 1 92  ? 13.153   6.696   -8.267  1.00 45.67  ? 105 ASP A OD1   1 
ATOM   638   O  OD2   . ASP A 1 92  ? 15.202   6.138   -7.723  1.00 45.67  ? 105 ASP A OD2   1 
ATOM   639   N  N     . ASN A 1 93  ? 13.553   9.599   -11.602 1.00 38.52  ? 106 ASN A N     1 
ATOM   640   C  CA    . ASN A 1 93  ? 13.620   9.275   -13.018 1.00 38.52  ? 106 ASN A CA    1 
ATOM   641   C  C     . ASN A 1 93  ? 15.053   8.950   -13.425 1.00 38.52  ? 106 ASN A C     1 
ATOM   642   O  O     . ASN A 1 93  ? 16.004   9.507   -12.876 1.00 38.52  ? 106 ASN A O     1 
ATOM   643   C  CB    . ASN A 1 93  ? 13.090   10.434  -13.863 1.00 38.52  ? 106 ASN A CB    1 
ATOM   644   C  CG    . ASN A 1 93  ? 11.655   10.793  -13.532 1.00 38.52  ? 106 ASN A CG    1 
ATOM   645   O  OD1   . ASN A 1 93  ? 11.397   11.612  -12.651 1.00 38.52  ? 106 ASN A OD1   1 
ATOM   646   N  ND2   . ASN A 1 93  ? 10.714   10.187  -14.245 1.00 38.52  ? 106 ASN A ND2   1 
ATOM   647   N  N     . SER A 1 94  ? 15.201   8.046   -14.388 1.00 79.44  ? 107 SER A N     1 
ATOM   648   C  CA    . SER A 1 94  ? 16.513   7.688   -14.911 1.00 79.44  ? 107 SER A CA    1 
ATOM   649   C  C     . SER A 1 94  ? 17.095   8.874   -15.669 1.00 79.44  ? 107 SER A C     1 
ATOM   650   O  O     . SER A 1 94  ? 18.300   8.948   -15.912 1.00 79.44  ? 107 SER A O     1 
ATOM   651   C  CB    . SER A 1 94  ? 16.393   6.486   -15.844 1.00 79.44  ? 107 SER A CB    1 
ATOM   652   O  OG    . SER A 1 94  ? 15.444   5.555   -15.357 1.00 79.44  ? 107 SER A OG    1 
ATOM   653   N  N     . GLY A 1 95  ? 16.212   9.796   -16.037 1.00 46.93  ? 108 GLY A N     1 
ATOM   654   C  CA    . GLY A 1 95  ? 16.568   10.996  -16.767 1.00 46.93  ? 108 GLY A CA    1 
ATOM   655   C  C     . GLY A 1 95  ? 15.286   11.689  -17.183 1.00 46.93  ? 108 GLY A C     1 
ATOM   656   O  O     . GLY A 1 95  ? 14.196   11.248  -16.817 1.00 46.93  ? 108 GLY A O     1 
ATOM   657   N  N     . VAL A 1 96  ? 15.403   12.767  -17.950 1.00 73.63  ? 109 VAL A N     1 
ATOM   658   C  CA    . VAL A 1 96  ? 14.223   13.493  -18.413 1.00 73.63  ? 109 VAL A CA    1 
ATOM   659   C  C     . VAL A 1 96  ? 13.540   12.768  -19.570 1.00 73.63  ? 109 VAL A C     1 
ATOM   660   O  O     . VAL A 1 96  ? 14.158   12.507  -20.603 1.00 73.63  ? 109 VAL A O     1 
ATOM   661   C  CB    . VAL A 1 96  ? 14.568   14.932  -18.832 1.00 73.63  ? 109 VAL A CB    1 
ATOM   662   C  CG1   . VAL A 1 96  ? 13.344   15.626  -19.407 1.00 73.63  ? 109 VAL A CG1   1 
ATOM   663   C  CG2   . VAL A 1 96  ? 15.108   15.709  -17.644 1.00 73.63  ? 109 VAL A CG2   1 
ATOM   664   N  N     . GLY A 1 97  ? 12.263   12.446  -19.388 1.00 36.61  ? 110 GLY A N     1 
ATOM   665   C  CA    . GLY A 1 97  ? 11.504   11.718  -20.389 1.00 36.61  ? 110 GLY A CA    1 
ATOM   666   C  C     . GLY A 1 97  ? 11.300   10.265  -20.004 1.00 36.61  ? 110 GLY A C     1 
ATOM   667   O  O     . GLY A 1 97  ? 10.736   9.481   -20.767 1.00 36.61  ? 110 GLY A O     1 
ATOM   668   N  N     . PHE A 1 98  ? 11.756   9.908   -18.807 1.00 62.51  ? 111 PHE A N     1 
ATOM   669   C  CA    . PHE A 1 98  ? 11.698   8.527   -18.343 1.00 62.51  ? 111 PHE A CA    1 
ATOM   670   C  C     . PHE A 1 98  ? 10.775   8.359   -17.140 1.00 62.51  ? 111 PHE A C     1 
ATOM   671   O  O     . PHE A 1 98  ? 10.457   9.327   -16.450 1.00 62.51  ? 111 PHE A O     1 
ATOM   672   C  CB    . PHE A 1 98  ? 13.101   8.039   -17.981 1.00 62.51  ? 111 PHE A CB    1 
ATOM   673   C  CG    . PHE A 1 98  ? 14.003   7.856   -19.165 1.00 62.51  ? 111 PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1 98  ? 13.538   7.245   -20.318 1.00 62.51  ? 111 PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1 98  ? 15.314   8.300   -19.127 1.00 62.51  ? 111 PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1 98  ? 14.367   7.075   -21.411 1.00 62.51  ? 111 PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1 98  ? 16.148   8.134   -20.215 1.00 62.51  ? 111 PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1 98  ? 15.674   7.521   -21.358 1.00 62.51  ? 111 PHE A CZ    1 
ATOM   679   N  N     . ARG A 1 99  ? 10.348   7.123   -16.898 1.00 29.62  ? 112 ARG A N     1 
ATOM   680   C  CA    . ARG A 1 99  ? 9.575    6.799   -15.706 1.00 29.62  ? 112 ARG A CA    1 
ATOM   681   C  C     . ARG A 1 99  ? 10.519   6.591   -14.527 1.00 29.62  ? 112 ARG A C     1 
ATOM   682   O  O     . ARG A 1 99  ? 11.707   6.329   -14.715 1.00 29.62  ? 112 ARG A O     1 
ATOM   683   C  CB    . ARG A 1 99  ? 8.721    5.548   -15.929 1.00 29.62  ? 112 ARG A CB    1 
ATOM   684   C  CG    . ARG A 1 99  ? 7.530    5.757   -16.852 1.00 29.62  ? 112 ARG A CG    1 
ATOM   685   C  CD    . ARG A 1 99  ? 6.754    4.466   -17.058 1.00 29.62  ? 112 ARG A CD    1 
ATOM   686   N  NE    . ARG A 1 99  ? 7.566    3.432   -17.690 1.00 29.62  ? 112 ARG A NE    1 
ATOM   687   C  CZ    . ARG A 1 99  ? 7.131    2.211   -17.985 1.00 29.62  ? 112 ARG A CZ    1 
ATOM   688   N  NH1   . ARG A 1 99  ? 5.885    1.863   -17.704 1.00 29.62  ? 112 ARG A NH1   1 
ATOM   689   N  NH2   . ARG A 1 99  ? 7.944    1.336   -18.561 1.00 29.62  ? 112 ARG A NH2   1 
ATOM   690   N  N     . ALA A 1 100 ? 9.985    6.716   -13.316 1.00 23.36  ? 113 ALA A N     1 
ATOM   691   C  CA    . ALA A 1 100 ? 10.783   6.590   -12.099 1.00 23.36  ? 113 ALA A CA    1 
ATOM   692   C  C     . ALA A 1 100 ? 11.406   5.204   -11.965 1.00 23.36  ? 113 ALA A C     1 
ATOM   693   O  O     . ALA A 1 100 ? 10.824   4.211   -12.399 1.00 23.36  ? 113 ALA A O     1 
ATOM   694   C  CB    . ALA A 1 100 ? 9.935    6.906   -10.880 1.00 23.36  ? 113 ALA A CB    1 
ATOM   695   N  N     . ARG A 1 101 ? 12.592   5.147   -11.364 1.00 53.46  ? 114 ARG A N     1 
ATOM   696   C  CA    . ARG A 1 101 ? 13.283   3.883   -11.140 1.00 53.46  ? 114 ARG A CA    1 
ATOM   697   C  C     . ARG A 1 101 ? 12.511   2.981   -10.185 1.00 53.46  ? 114 ARG A C     1 
ATOM   698   O  O     . ARG A 1 101 ? 12.369   1.782   -10.427 1.00 53.46  ? 114 ARG A O     1 
ATOM   699   C  CB    . ARG A 1 101 ? 14.683   4.125   -10.577 1.00 53.46  ? 114 ARG A CB    1 
ATOM   700   C  CG    . ARG A 1 101 ? 15.761   4.367   -11.618 1.00 53.46  ? 114 ARG A CG    1 
ATOM   701   C  CD    . ARG A 1 101 ? 17.141   4.199   -11.000 1.00 53.46  ? 114 ARG A CD    1 
ATOM   702   N  NE    . ARG A 1 101 ? 18.211   4.295   -11.986 1.00 53.46  ? 114 ARG A NE    1 
ATOM   703   C  CZ    . ARG A 1 101 ? 18.862   5.418   -12.273 1.00 53.46  ? 114 ARG A CZ    1 
ATOM   704   N  NH1   . ARG A 1 101 ? 18.550   6.545   -11.650 1.00 53.46  ? 114 ARG A NH1   1 
ATOM   705   N  NH2   . ARG A 1 101 ? 19.825   5.414   -13.183 1.00 53.46  ? 114 ARG A NH2   1 
ATOM   706   N  N     . GLY A 1 102 ? 12.021   3.563   -9.096  1.00 37.10  ? 115 GLY A N     1 
ATOM   707   C  CA    . GLY A 1 102 ? 11.348   2.797   -8.066  1.00 37.10  ? 115 GLY A CA    1 
ATOM   708   C  C     . GLY A 1 102 ? 12.347   2.248   -7.065  1.00 37.10  ? 115 GLY A C     1 
ATOM   709   O  O     . GLY A 1 102 ? 11.997   1.444   -6.200  1.00 37.10  ? 115 GLY A O     1 
ATOM   710   N  N     . ASP A 1 103 ? 13.598   2.682   -7.188  1.00 42.75  ? 116 ASP A N     1 
ATOM   711   C  CA    . ASP A 1 103 ? 14.649   2.258   -6.271  1.00 42.75  ? 116 ASP A CA    1 
ATOM   712   C  C     . ASP A 1 103 ? 14.707   3.160   -5.042  1.00 42.75  ? 116 ASP A C     1 
ATOM   713   O  O     . ASP A 1 103 ? 15.082   2.718   -3.960  1.00 42.75  ? 116 ASP A O     1 
ATOM   714   C  CB    . ASP A 1 103 ? 16.011   2.240   -6.972  1.00 42.75  ? 116 ASP A CB    1 
ATOM   715   C  CG    . ASP A 1 103 ? 16.185   1.041   -7.887  1.00 42.75  ? 116 ASP A CG    1 
ATOM   716   O  OD1   . ASP A 1 103 ? 16.803   1.200   -8.960  1.00 42.75  ? 116 ASP A OD1   1 
ATOM   717   O  OD2   . ASP A 1 103 ? 15.711   -0.056  -7.531  1.00 42.75  ? 116 ASP A OD2   1 
ATOM   718   N  N     . ARG A 1 104 ? 14.331   4.424   -5.214  1.00 29.45  ? 117 ARG A N     1 
ATOM   719   C  CA    . ARG A 1 104 ? 14.363   5.391   -4.119  1.00 29.45  ? 117 ARG A CA    1 
ATOM   720   C  C     . ARG A 1 104 ? 13.203   5.197   -3.149  1.00 29.45  ? 117 ARG A C     1 
ATOM   721   O  O     . ARG A 1 104 ? 13.389   5.240   -1.933  1.00 29.45  ? 117 ARG A O     1 
ATOM   722   C  CB    . ARG A 1 104 ? 14.368   6.820   -4.661  1.00 29.45  ? 117 ARG A CB    1 
ATOM   723   C  CG    . ARG A 1 104 ? 14.203   7.890   -3.596  1.00 29.45  ? 117 ARG A CG    1 
ATOM   724   C  CD    . ARG A 1 104 ? 14.534   9.261   -4.150  1.00 29.45  ? 117 ARG A CD    1 
ATOM   725   N  NE    . ARG A 1 104 ? 15.921   9.331   -4.599  1.00 29.45  ? 117 ARG A NE    1 
ATOM   726   C  CZ    . ARG A 1 104 ? 16.463   10.383  -5.202  1.00 29.45  ? 117 ARG A CZ    1 
ATOM   727   N  NH1   . ARG A 1 104 ? 15.735   11.465  -5.435  1.00 29.45  ? 117 ARG A NH1   1 
ATOM   728   N  NH2   . ARG A 1 104 ? 17.735   10.351  -5.576  1.00 29.45  ? 117 ARG A NH2   1 
ATOM   729   N  N     . PHE A 1 105 ? 12.007   4.988   -3.689  1.00 29.02  ? 118 PHE A N     1 
ATOM   730   C  CA    . PHE A 1 105 ? 10.838   4.721   -2.862  1.00 29.02  ? 118 PHE A CA    1 
ATOM   731   C  C     . PHE A 1 105 ? 11.057   3.436   -2.074  1.00 29.02  ? 118 PHE A C     1 
ATOM   732   O  O     . PHE A 1 105 ? 10.643   3.329   -0.924  1.00 29.02  ? 118 PHE A O     1 
ATOM   733   C  CB    . PHE A 1 105 ? 9.579    4.613   -3.724  1.00 29.02  ? 118 PHE A CB    1 
ATOM   734   C  CG    . PHE A 1 105 ? 8.315    4.431   -2.932  1.00 29.02  ? 118 PHE A CG    1 
ATOM   735   C  CD1   . PHE A 1 105 ? 7.793    5.477   -2.186  1.00 29.02  ? 118 PHE A CD1   1 
ATOM   736   C  CD2   . PHE A 1 105 ? 7.644    3.218   -2.938  1.00 29.02  ? 118 PHE A CD2   1 
ATOM   737   C  CE1   . PHE A 1 105 ? 6.631    5.313   -1.453  1.00 29.02  ? 118 PHE A CE1   1 
ATOM   738   C  CE2   . PHE A 1 105 ? 6.481    3.048   -2.209  1.00 29.02  ? 118 PHE A CE2   1 
ATOM   739   C  CZ    . PHE A 1 105 ? 5.975    4.097   -1.466  1.00 29.02  ? 118 PHE A CZ    1 
ATOM   740   N  N     . ARG A 1 106 ? 11.725   2.471   -2.700  1.00 14.95  ? 119 ARG A N     1 
ATOM   741   C  CA    . ARG A 1 106 ? 12.029   1.197   -2.063  1.00 14.95  ? 119 ARG A CA    1 
ATOM   742   C  C     . ARG A 1 106 ? 13.017   1.367   -0.910  1.00 14.95  ? 119 ARG A C     1 
ATOM   743   O  O     . ARG A 1 106 ? 12.990   0.608   0.060   1.00 14.95  ? 119 ARG A O     1 
ATOM   744   C  CB    . ARG A 1 106 ? 12.583   0.211   -3.092  1.00 14.95  ? 119 ARG A CB    1 
ATOM   745   C  CG    . ARG A 1 106 ? 12.776   -1.202  -2.572  1.00 14.95  ? 119 ARG A CG    1 
ATOM   746   C  CD    . ARG A 1 106 ? 14.244   -1.609  -2.565  1.00 14.95  ? 119 ARG A CD    1 
ATOM   747   N  NE    . ARG A 1 106 ? 14.765   -1.894  -3.902  1.00 14.95  ? 119 ARG A NE    1 
ATOM   748   C  CZ    . ARG A 1 106 ? 15.778   -1.244  -4.466  1.00 14.95  ? 119 ARG A CZ    1 
ATOM   749   N  NH1   . ARG A 1 106 ? 16.386   -0.264  -3.812  1.00 14.95  ? 119 ARG A NH1   1 
ATOM   750   N  NH2   . ARG A 1 106 ? 16.189   -1.573  -5.682  1.00 14.95  ? 119 ARG A NH2   1 
ATOM   751   N  N     . ASN A 1 107 ? 13.885   2.370   -1.015  1.00 25.67  ? 120 ASN A N     1 
ATOM   752   C  CA    . ASN A 1 107 ? 14.917   2.590   -0.004  1.00 25.67  ? 120 ASN A CA    1 
ATOM   753   C  C     . ASN A 1 107 ? 14.425   3.321   1.244   1.00 25.67  ? 120 ASN A C     1 
ATOM   754   O  O     . ASN A 1 107 ? 14.926   3.084   2.340   1.00 25.67  ? 120 ASN A O     1 
ATOM   755   C  CB    . ASN A 1 107 ? 16.123   3.313   -0.611  1.00 25.67  ? 120 ASN A CB    1 
ATOM   756   C  CG    . ASN A 1 107 ? 16.856   2.467   -1.634  1.00 25.67  ? 120 ASN A CG    1 
ATOM   757   O  OD1   . ASN A 1 107 ? 16.941   1.246   -1.504  1.00 25.67  ? 120 ASN A OD1   1 
ATOM   758   N  ND2   . ASN A 1 107 ? 17.382   3.114   -2.668  1.00 25.67  ? 120 ASN A ND2   1 
ATOM   759   N  N     . ILE A 1 108 ? 13.454   4.214   1.074   1.00 12.17  ? 121 ILE A N     1 
ATOM   760   C  CA    . ILE A 1 108 ? 12.842   4.895   2.211   1.00 12.17  ? 121 ILE A CA    1 
ATOM   761   C  C     . ILE A 1 108 ? 12.044   3.886   3.040   1.00 12.17  ? 121 ILE A C     1 
ATOM   762   O  O     . ILE A 1 108 ? 11.997   3.970   4.270   1.00 12.17  ? 121 ILE A O     1 
ATOM   763   C  CB    . ILE A 1 108 ? 11.940   6.063   1.757   1.00 12.17  ? 121 ILE A CB    1 
ATOM   764   C  CG1   . ILE A 1 108 ? 12.767   7.133   1.043   1.00 12.17  ? 121 ILE A CG1   1 
ATOM   765   C  CG2   . ILE A 1 108 ? 11.203   6.677   2.939   1.00 12.17  ? 121 ILE A CG2   1 
ATOM   766   C  CD1   . ILE A 1 108 ? 13.797   7.803   1.933   1.00 12.17  ? 121 ILE A CD1   1 
ATOM   767   N  N     . LEU A 1 109 ? 11.434   2.922   2.358   1.00 10.03  ? 122 LEU A N     1 
ATOM   768   C  CA    . LEU A 1 109 ? 10.699   1.851   3.024   1.00 10.03  ? 122 LEU A CA    1 
ATOM   769   C  C     . LEU A 1 109 ? 11.618   1.017   3.916   1.00 10.03  ? 122 LEU A C     1 
ATOM   770   O  O     . LEU A 1 109 ? 11.273   0.709   5.057   1.00 10.03  ? 122 LEU A O     1 
ATOM   771   C  CB    . LEU A 1 109 ? 10.009   0.953   1.995   1.00 10.03  ? 122 LEU A CB    1 
ATOM   772   C  CG    . LEU A 1 109 ? 8.948    1.615   1.114   1.00 10.03  ? 122 LEU A CG    1 
ATOM   773   C  CD1   . LEU A 1 109 ? 8.410    0.639   0.084   1.00 10.03  ? 122 LEU A CD1   1 
ATOM   774   C  CD2   . LEU A 1 109 ? 7.820    2.178   1.959   1.00 10.03  ? 122 LEU A CD2   1 
ATOM   775   N  N     . ASP A 1 110 ? 12.786   0.658   3.391   1.00 26.68  ? 123 ASP A N     1 
ATOM   776   C  CA    . ASP A 1 110 ? 13.766   -0.116  4.147   1.00 26.68  ? 123 ASP A CA    1 
ATOM   777   C  C     . ASP A 1 110 ? 14.270   0.643   5.374   1.00 26.68  ? 123 ASP A C     1 
ATOM   778   O  O     . ASP A 1 110 ? 14.492   0.049   6.427   1.00 26.68  ? 123 ASP A O     1 
ATOM   779   C  CB    . ASP A 1 110 ? 14.939   -0.518  3.253   1.00 26.68  ? 123 ASP A CB    1 
ATOM   780   C  CG    . ASP A 1 110 ? 14.782   -1.909  2.671   1.00 26.68  ? 123 ASP A CG    1 
ATOM   781   O  OD1   . ASP A 1 110 ? 14.228   -2.789  3.362   1.00 26.68  ? 123 ASP A OD1   1 
ATOM   782   O  OD2   . ASP A 1 110 ? 15.217   -2.124  1.520   1.00 26.68  ? 123 ASP A OD2   1 
ATOM   783   N  N     . VAL A 1 111 ? 14.451   1.953   5.229   1.00 29.02  ? 124 VAL A N     1 
ATOM   784   C  CA    . VAL A 1 111 ? 14.858   2.804   6.344   1.00 29.02  ? 124 VAL A CA    1 
ATOM   785   C  C     . VAL A 1 111 ? 13.781   2.845   7.426   1.00 29.02  ? 124 VAL A C     1 
ATOM   786   O  O     . VAL A 1 111 ? 14.072   2.708   8.616   1.00 29.02  ? 124 VAL A O     1 
ATOM   787   C  CB    . VAL A 1 111 ? 15.172   4.237   5.871   1.00 29.02  ? 124 VAL A CB    1 
ATOM   788   C  CG1   . VAL A 1 111 ? 15.320   5.176   7.059   1.00 29.02  ? 124 VAL A CG1   1 
ATOM   789   C  CG2   . VAL A 1 111 ? 16.429   4.248   5.009   1.00 29.02  ? 124 VAL A CG2   1 
ATOM   790   N  N     . ILE A 1 112 ? 12.535   3.032   6.999   1.00 26.27  ? 125 ILE A N     1 
ATOM   791   C  CA    . ILE A 1 112 ? 11.387   3.012   7.899   1.00 26.27  ? 125 ILE A CA    1 
ATOM   792   C  C     . ILE A 1 112 ? 11.316   1.695   8.666   1.00 26.27  ? 125 ILE A C     1 
ATOM   793   O  O     . ILE A 1 112 ? 11.165   1.686   9.887   1.00 26.27  ? 125 ILE A O     1 
ATOM   794   C  CB    . ILE A 1 112 ? 10.069   3.225   7.126   1.00 26.27  ? 125 ILE A CB    1 
ATOM   795   C  CG1   . ILE A 1 112 ? 9.957    4.669   6.644   1.00 26.27  ? 125 ILE A CG1   1 
ATOM   796   C  CG2   . ILE A 1 112 ? 8.871    2.880   7.992   1.00 26.27  ? 125 ILE A CG2   1 
ATOM   797   C  CD1   . ILE A 1 112 ? 8.714    4.943   5.828   1.00 26.27  ? 125 ILE A CD1   1 
ATOM   798   N  N     . TYR A 1 113 ? 11.438   0.588   7.940   1.00 23.08  ? 126 TYR A N     1 
ATOM   799   C  CA    . TYR A 1 113 ? 11.344   -0.736  8.539   1.00 23.08  ? 126 TYR A CA    1 
ATOM   800   C  C     . TYR A 1 113 ? 12.500   -0.998  9.499   1.00 23.08  ? 126 TYR A C     1 
ATOM   801   O  O     . TYR A 1 113 ? 12.287   -1.456  10.619  1.00 23.08  ? 126 TYR A O     1 
ATOM   802   C  CB    . TYR A 1 113 ? 11.299   -1.821  7.460   1.00 23.08  ? 126 TYR A CB    1 
ATOM   803   C  CG    . TYR A 1 113 ? 10.147   -1.686  6.486   1.00 23.08  ? 126 TYR A CG    1 
ATOM   804   C  CD1   . TYR A 1 113 ? 8.993    -0.996  6.832   1.00 23.08  ? 126 TYR A CD1   1 
ATOM   805   C  CD2   . TYR A 1 113 ? 10.216   -2.250  5.220   1.00 23.08  ? 126 TYR A CD2   1 
ATOM   806   C  CE1   . TYR A 1 113 ? 7.944    -0.869  5.943   1.00 23.08  ? 126 TYR A CE1   1 
ATOM   807   C  CE2   . TYR A 1 113 ? 9.173    -2.128  4.325   1.00 23.08  ? 126 TYR A CE2   1 
ATOM   808   C  CZ    . TYR A 1 113 ? 8.040    -1.439  4.692   1.00 23.08  ? 126 TYR A CZ    1 
ATOM   809   O  OH    . TYR A 1 113 ? 7.001    -1.317  3.802   1.00 23.08  ? 126 TYR A OH    1 
ATOM   810   N  N     . MET A 1 114 ? 13.721   -0.698  9.064   1.00 55.17  ? 127 MET A N     1 
ATOM   811   C  CA    . MET A 1 114 ? 14.903   -0.968  9.879   1.00 55.17  ? 127 MET A CA    1 
ATOM   812   C  C     . MET A 1 114 ? 14.949   -0.120  11.149  1.00 55.17  ? 127 MET A C     1 
ATOM   813   O  O     . MET A 1 114 ? 15.516   -0.540  12.152  1.00 55.17  ? 127 MET A O     1 
ATOM   814   C  CB    . MET A 1 114 ? 16.193   -0.801  9.063   1.00 55.17  ? 127 MET A CB    1 
ATOM   815   C  CG    . MET A 1 114 ? 16.577   0.637   8.728   1.00 55.17  ? 127 MET A CG    1 
ATOM   816   S  SD    . MET A 1 114 ? 17.597   1.444   9.980   1.00 55.17  ? 127 MET A SD    1 
ATOM   817   C  CE    . MET A 1 114 ? 18.897   0.231   10.182  1.00 55.17  ? 127 MET A CE    1 
ATOM   818   N  N     . MET A 1 115 ? 14.357   1.068   11.101  1.00 29.10  ? 128 MET A N     1 
ATOM   819   C  CA    . MET A 1 115 ? 14.331   1.947   12.267  1.00 29.10  ? 128 MET A CA    1 
ATOM   820   C  C     . MET A 1 115 ? 13.360   1.437   13.328  1.00 29.10  ? 128 MET A C     1 
ATOM   821   O  O     . MET A 1 115 ? 13.614   1.562   14.525  1.00 29.10  ? 128 MET A O     1 
ATOM   822   C  CB    . MET A 1 115 ? 13.961   3.375   11.865  1.00 29.10  ? 128 MET A CB    1 
ATOM   823   C  CG    . MET A 1 115 ? 14.137   4.395   12.979  1.00 29.10  ? 128 MET A CG    1 
ATOM   824   S  SD    . MET A 1 115 ? 12.728   5.505   13.150  1.00 29.10  ? 128 MET A SD    1 
ATOM   825   C  CE    . MET A 1 115 ? 11.465   4.357   13.691  1.00 29.10  ? 128 MET A CE    1 
ATOM   826   N  N     . GLN A 1 116 ? 12.249   0.859   12.884  1.00 38.05  ? 129 GLN A N     1 
ATOM   827   C  CA    . GLN A 1 116 ? 11.222   0.378   13.801  1.00 38.05  ? 129 GLN A CA    1 
ATOM   828   C  C     . GLN A 1 116 ? 11.443   -1.083  14.202  1.00 38.05  ? 129 GLN A C     1 
ATOM   829   O  O     . GLN A 1 116 ? 11.052   -1.498  15.294  1.00 38.05  ? 129 GLN A O     1 
ATOM   830   C  CB    . GLN A 1 116 ? 9.830    0.563   13.192  1.00 38.05  ? 129 GLN A CB    1 
ATOM   831   C  CG    . GLN A 1 116 ? 8.686    0.424   14.190  1.00 38.05  ? 129 GLN A CG    1 
ATOM   832   C  CD    . GLN A 1 116 ? 8.716    1.492   15.267  1.00 38.05  ? 129 GLN A CD    1 
ATOM   833   O  OE1   . GLN A 1 116 ? 8.859    2.679   14.977  1.00 38.05  ? 129 GLN A OE1   1 
ATOM   834   N  NE2   . GLN A 1 116 ? 8.586    1.073   16.520  1.00 38.05  ? 129 GLN A NE2   1 
ATOM   835   N  N     . MET A 1 117 ? 12.068   -1.862  13.322  1.00 28.53  ? 130 MET A N     1 
ATOM   836   C  CA    . MET A 1 117 ? 12.400   -3.247  13.647  1.00 28.53  ? 130 MET A CA    1 
ATOM   837   C  C     . MET A 1 117 ? 13.621   -3.312  14.558  1.00 28.53  ? 130 MET A C     1 
ATOM   838   O  O     . MET A 1 117 ? 13.919   -4.355  15.139  1.00 28.53  ? 130 MET A O     1 
ATOM   839   C  CB    . MET A 1 117 ? 12.633   -4.082  12.383  1.00 28.53  ? 130 MET A CB    1 
ATOM   840   C  CG    . MET A 1 117 ? 11.381   -4.339  11.563  1.00 28.53  ? 130 MET A CG    1 
ATOM   841   S  SD    . MET A 1 117 ? 11.630   -5.485  10.192  1.00 28.53  ? 130 MET A SD    1 
ATOM   842   C  CE    . MET A 1 117 ? 11.895   -7.021  11.074  1.00 28.53  ? 130 MET A CE    1 
ATOM   843   N  N     . LYS A 1 118 ? 14.323   -2.189  14.677  1.00 55.34  ? 131 LYS A N     1 
ATOM   844   C  CA    . LYS A 1 118 ? 15.479   -2.097  15.558  1.00 55.34  ? 131 LYS A CA    1 
ATOM   845   C  C     . LYS A 1 118 ? 15.024   -1.755  16.968  1.00 55.34  ? 131 LYS A C     1 
ATOM   846   O  O     . LYS A 1 118 ? 15.462   -2.371  17.937  1.00 55.34  ? 131 LYS A O     1 
ATOM   847   C  CB    . LYS A 1 118 ? 16.455   -1.034  15.056  1.00 55.34  ? 131 LYS A CB    1 
ATOM   848   C  CG    . LYS A 1 118 ? 17.900   -1.295  15.435  1.00 55.34  ? 131 LYS A CG    1 
ATOM   849   C  CD    . LYS A 1 118 ? 18.510   -0.117  16.171  1.00 55.34  ? 131 LYS A CD    1 
ATOM   850   C  CE    . LYS A 1 118 ? 19.937   -0.424  16.589  1.00 55.34  ? 131 LYS A CE    1 
ATOM   851   N  NZ    . LYS A 1 118 ? 20.024   -1.717  17.324  1.00 55.34  ? 131 LYS A NZ    1 
ATOM   852   N  N     . LYS A 1 119 ? 14.126   -0.778  17.074  1.00 44.35  ? 132 LYS A N     1 
ATOM   853   C  CA    . LYS A 1 119 ? 13.612   -0.332  18.366  1.00 44.35  ? 132 LYS A CA    1 
ATOM   854   C  C     . LYS A 1 119 ? 12.737   -1.391  19.038  1.00 44.35  ? 132 LYS A C     1 
ATOM   855   O  O     . LYS A 1 119 ? 12.291   -1.209  20.171  1.00 44.35  ? 132 LYS A O     1 
ATOM   856   C  CB    . LYS A 1 119 ? 12.840   0.982   18.212  1.00 44.35  ? 132 LYS A CB    1 
ATOM   857   C  CG    . LYS A 1 119 ? 13.698   2.156   17.757  1.00 44.35  ? 132 LYS A CG    1 
ATOM   858   C  CD    . LYS A 1 119 ? 12.852   3.360   17.361  1.00 44.35  ? 132 LYS A CD    1 
ATOM   859   C  CE    . LYS A 1 119 ? 11.914   3.779   18.478  1.00 44.35  ? 132 LYS A CE    1 
ATOM   860   N  NZ    . LYS A 1 119 ? 11.091   4.968   18.110  1.00 44.35  ? 132 LYS A NZ    1 
ATOM   861   N  N     . HIS A 1 120 ? 12.494   -2.493  18.334  1.00 43.58  ? 133 HIS A N     1 
ATOM   862   C  CA    . HIS A 1 120 ? 11.764   -3.620  18.896  1.00 43.58  ? 133 HIS A CA    1 
ATOM   863   C  C     . HIS A 1 120 ? 12.725   -4.677  19.430  1.00 43.58  ? 133 HIS A C     1 
ATOM   864   O  O     . HIS A 1 120 ? 12.376   -5.444  20.325  1.00 43.58  ? 133 HIS A O     1 
ATOM   865   C  CB    . HIS A 1 120 ? 10.818   -4.233  17.859  1.00 43.58  ? 133 HIS A CB    1 
ATOM   866   C  CG    . HIS A 1 120 ? 9.554    -3.444  17.654  1.00 43.58  ? 133 HIS A CG    1 
ATOM   867   N  ND1   . HIS A 1 120 ? 8.511    -3.918  16.901  1.00 43.58  ? 133 HIS A ND1   1 
ATOM   868   C  CD2   . HIS A 1 120 ? 9.185    -2.229  18.108  1.00 43.58  ? 133 HIS A CD2   1 
ATOM   869   C  CE1   . HIS A 1 120 ? 7.530    -3.014  16.895  1.00 43.58  ? 133 HIS A CE1   1 
ATOM   870   N  NE2   . HIS A 1 120 ? 7.926    -1.984  17.623  1.00 43.58  ? 133 HIS A NE2   1 
ATOM   871   N  N     . LEU A 1 121 ? 13.934   -4.715  18.877  1.00 42.25  ? 134 LEU A N     1 
ATOM   872   C  CA    . LEU A 1 121 ? 14.965   -5.629  19.362  1.00 42.25  ? 134 LEU A CA    1 
ATOM   873   C  C     . LEU A 1 121 ? 15.599   -5.114  20.650  1.00 42.25  ? 134 LEU A C     1 
ATOM   874   O  O     . LEU A 1 121 ? 16.142   -5.889  21.437  1.00 42.25  ? 134 LEU A O     1 
ATOM   875   C  CB    . LEU A 1 121 ? 16.040   -5.862  18.298  1.00 42.25  ? 134 LEU A CB    1 
ATOM   876   C  CG    . LEU A 1 121 ? 15.727   -6.950  17.271  1.00 42.25  ? 134 LEU A CG    1 
ATOM   877   C  CD1   . LEU A 1 121 ? 16.917   -7.214  16.361  1.00 42.25  ? 134 LEU A CD1   1 
ATOM   878   C  CD2   . LEU A 1 121 ? 15.308   -8.219  17.983  1.00 42.25  ? 134 LEU A CD2   1 
ATOM   879   N  N     . GLU A 1 122 ? 15.519   -3.804  20.859  1.00 61.06  ? 135 GLU A N     1 
ATOM   880   C  CA    . GLU A 1 122 ? 16.062   -3.179  22.058  1.00 61.06  ? 135 GLU A CA    1 
ATOM   881   C  C     . GLU A 1 122 ? 15.158   -3.439  23.262  1.00 61.06  ? 135 GLU A C     1 
ATOM   882   O  O     . GLU A 1 122 ? 15.587   -3.320  24.409  1.00 61.06  ? 135 GLU A O     1 
ATOM   883   C  CB    . GLU A 1 122 ? 16.232   -1.673  21.842  1.00 61.06  ? 135 GLU A CB    1 
ATOM   884   C  CG    . GLU A 1 122 ? 17.092   -1.305  20.637  1.00 61.06  ? 135 GLU A CG    1 
ATOM   885   C  CD    . GLU A 1 122 ? 17.188   0.194   20.423  1.00 61.06  ? 135 GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1 122 ? 17.945   0.621   19.526  1.00 61.06  ? 135 GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1 122 ? 16.506   0.945   21.150  1.00 61.06  ? 135 GLU A OE2   1 
ATOM   888   N  N     . SER A 1 123 ? 13.906   -3.793  22.992  1.00 62.59  ? 136 SER A N     1 
ATOM   889   C  CA    . SER A 1 123 ? 12.934   -4.041  24.051  1.00 62.59  ? 136 SER A CA    1 
ATOM   890   C  C     . SER A 1 123 ? 12.956   -5.497  24.509  1.00 62.59  ? 136 SER A C     1 
ATOM   891   O  O     . SER A 1 123 ? 12.365   -5.841  25.532  1.00 62.59  ? 136 SER A O     1 
ATOM   892   C  CB    . SER A 1 123 ? 11.526   -3.662  23.588  1.00 62.59  ? 136 SER A CB    1 
ATOM   893   O  OG    . SER A 1 123 ? 11.066   -4.541  22.578  1.00 62.59  ? 136 SER A OG    1 
ATOM   894   N  N     . VAL A 1 124 ? 13.639   -6.349  23.750  1.00 61.02  ? 137 VAL A N     1 
ATOM   895   C  CA    . VAL A 1 124 ? 13.739   -7.765  24.089  1.00 61.02  ? 137 VAL A CA    1 
ATOM   896   C  C     . VAL A 1 124 ? 14.642   -7.946  25.305  1.00 61.02  ? 137 VAL A C     1 
ATOM   897   O  O     . VAL A 1 124 ? 15.569   -7.165  25.519  1.00 61.02  ? 137 VAL A O     1 
ATOM   898   C  CB    . VAL A 1 124 ? 14.281   -8.589  22.905  1.00 61.02  ? 137 VAL A CB    1 
ATOM   899   C  CG1   . VAL A 1 124 ? 14.084   -10.077 23.148  1.00 61.02  ? 137 VAL A CG1   1 
ATOM   900   C  CG2   . VAL A 1 124 ? 13.587   -8.182  21.623  1.00 61.02  ? 137 VAL A CG2   1 
ATOM   901   N  N     . GLN A 1 125 ? 14.365   -8.973  26.104  1.00 117.61 ? 138 GLN A N     1 
ATOM   902   C  CA    . GLN A 1 125 ? 15.120   -9.221  27.327  1.00 117.61 ? 138 GLN A CA    1 
ATOM   903   C  C     . GLN A 1 125 ? 16.237   -10.239 27.113  1.00 117.61 ? 138 GLN A C     1 
ATOM   904   O  O     . GLN A 1 125 ? 15.982   -11.383 26.736  1.00 117.61 ? 138 GLN A O     1 
ATOM   905   C  CB    . GLN A 1 125 ? 14.181   -9.697  28.438  1.00 117.61 ? 138 GLN A CB    1 
ATOM   906   C  CG    . GLN A 1 125 ? 12.962   -8.808  28.632  1.00 117.61 ? 138 GLN A CG    1 
ATOM   907   C  CD    . GLN A 1 125 ? 12.073   -9.267  29.771  1.00 117.61 ? 138 GLN A CD    1 
ATOM   908   O  OE1   . GLN A 1 125 ? 12.452   -10.128 30.565  1.00 117.61 ? 138 GLN A OE1   1 
ATOM   909   N  NE2   . GLN A 1 125 ? 10.879   -8.692  29.857  1.00 117.61 ? 138 GLN A NE2   1 
ATOM   910   N  N     . GLN A 1 126 ? 17.474   -9.812  27.355  1.00 114.29 ? 139 GLN A N     1 
ATOM   911   C  CA    . GLN A 1 126 ? 18.629   -10.698 27.256  1.00 114.29 ? 139 GLN A CA    1 
ATOM   912   C  C     . GLN A 1 126 ? 18.806   -11.477 28.557  1.00 114.29 ? 139 GLN A C     1 
ATOM   913   O  O     . GLN A 1 126 ? 18.454   -10.979 29.627  1.00 114.29 ? 139 GLN A O     1 
ATOM   914   C  CB    . GLN A 1 126 ? 19.896   -9.900  26.930  1.00 114.29 ? 139 GLN A CB    1 
ATOM   915   C  CG    . GLN A 1 126 ? 19.880   -9.240  25.561  1.00 114.29 ? 139 GLN A CG    1 
ATOM   916   C  CD    . GLN A 1 126 ? 21.260   -8.807  25.108  1.00 114.29 ? 139 GLN A CD    1 
ATOM   917   O  OE1   . GLN A 1 126 ? 22.225   -8.873  25.868  1.00 114.29 ? 139 GLN A OE1   1 
ATOM   918   N  NE2   . GLN A 1 126 ? 21.361   -8.367  23.859  1.00 114.29 ? 139 GLN A NE2   1 
ATOM   919   N  N     . PRO A 1 127 ? 19.358   -12.700 28.478  1.00 67.19  ? 140 PRO A N     1 
ATOM   920   C  CA    . PRO A 1 127 ? 19.867   -13.409 27.296  1.00 67.19  ? 140 PRO A CA    1 
ATOM   921   C  C     . PRO A 1 127 ? 18.771   -13.953 26.381  1.00 67.19  ? 140 PRO A C     1 
ATOM   922   O  O     . PRO A 1 127 ? 17.593   -13.650 26.567  1.00 67.19  ? 140 PRO A O     1 
ATOM   923   C  CB    . PRO A 1 127 ? 20.650   -14.584 27.900  1.00 67.19  ? 140 PRO A CB    1 
ATOM   924   C  CG    . PRO A 1 127 ? 20.827   -14.251 29.349  1.00 67.19  ? 140 PRO A CG    1 
ATOM   925   C  CD    . PRO A 1 127 ? 19.624   -13.453 29.713  1.00 67.19  ? 140 PRO A CD    1 
ATOM   926   N  N     . ILE A 1 128 ? 19.172   -14.760 25.403  1.00 28.46  ? 141 ILE A N     1 
ATOM   927   C  CA    . ILE A 1 128 ? 18.245   -15.306 24.421  1.00 28.46  ? 141 ILE A CA    1 
ATOM   928   C  C     . ILE A 1 128 ? 18.310   -16.835 24.383  1.00 28.46  ? 141 ILE A C     1 
ATOM   929   O  O     . ILE A 1 128 ? 19.373   -17.406 24.148  1.00 28.46  ? 141 ILE A O     1 
ATOM   930   C  CB    . ILE A 1 128 ? 18.517   -14.741 23.005  1.00 28.46  ? 141 ILE A CB    1 
ATOM   931   C  CG1   . ILE A 1 128 ? 18.182   -13.248 22.933  1.00 28.46  ? 141 ILE A CG1   1 
ATOM   932   C  CG2   . ILE A 1 128 ? 17.715   -15.502 21.965  1.00 28.46  ? 141 ILE A CG2   1 
ATOM   933   C  CD1   . ILE A 1 128 ? 19.318   -12.322 23.336  1.00 28.46  ? 141 ILE A CD1   1 
ATOM   934   N  N     . PRO A 1 129 ? 17.165   -17.496 24.634  1.00 69.40  ? 142 PRO A N     1 
ATOM   935   C  CA    . PRO A 1 129 ? 16.948   -18.950 24.607  1.00 69.40  ? 142 PRO A CA    1 
ATOM   936   C  C     . PRO A 1 129 ? 17.602   -19.675 23.424  1.00 69.40  ? 142 PRO A C     1 
ATOM   937   O  O     . PRO A 1 129 ? 17.814   -19.064 22.377  1.00 69.40  ? 142 PRO A O     1 
ATOM   938   C  CB    . PRO A 1 129 ? 15.417   -19.071 24.513  1.00 69.40  ? 142 PRO A CB    1 
ATOM   939   C  CG    . PRO A 1 129 ? 14.863   -17.660 24.710  1.00 69.40  ? 142 PRO A CG    1 
ATOM   940   C  CD    . PRO A 1 129 ? 15.990   -16.802 25.180  1.00 69.40  ? 142 PRO A CD    1 
ATOM   941   N  N     . PRO A 1 130 ? 17.914   -20.974 23.597  1.00 117.40 ? 143 PRO A N     1 
ATOM   942   C  CA    . PRO A 1 130 ? 18.572   -21.816 22.586  1.00 117.40 ? 143 PRO A CA    1 
ATOM   943   C  C     . PRO A 1 130 ? 17.828   -21.883 21.253  1.00 117.40 ? 143 PRO A C     1 
ATOM   944   O  O     . PRO A 1 130 ? 18.419   -21.602 20.211  1.00 117.40 ? 143 PRO A O     1 
ATOM   945   C  CB    . PRO A 1 130 ? 18.580   -23.200 23.241  1.00 117.40 ? 143 PRO A CB    1 
ATOM   946   C  CG    . PRO A 1 130 ? 18.578   -22.920 24.697  1.00 117.40 ? 143 PRO A CG    1 
ATOM   947   C  CD    . PRO A 1 130 ? 17.722   -21.700 24.866  1.00 117.40 ? 143 PRO A CD    1 
ATOM   948   N  N     . GLU A 1 131 ? 16.554   -22.260 21.285  1.00 120.14 ? 144 GLU A N     1 
ATOM   949   C  CA    . GLU A 1 131 ? 15.761   -22.356 20.064  1.00 120.14 ? 144 GLU A CA    1 
ATOM   950   C  C     . GLU A 1 131 ? 15.411   -20.973 19.523  1.00 120.14 ? 144 GLU A C     1 
ATOM   951   O  O     . GLU A 1 131 ? 14.824   -20.845 18.449  1.00 120.14 ? 144 GLU A O     1 
ATOM   952   C  CB    . GLU A 1 131 ? 14.487   -23.170 20.305  1.00 120.14 ? 144 GLU A CB    1 
ATOM   953   C  CG    . GLU A 1 131 ? 13.610   -22.640 21.431  1.00 120.14 ? 144 GLU A CG    1 
ATOM   954   C  CD    . GLU A 1 131 ? 12.332   -23.443 21.605  1.00 120.14 ? 144 GLU A CD    1 
ATOM   955   O  OE1   . GLU A 1 131 ? 12.160   -24.068 22.673  1.00 120.14 ? 144 GLU A OE1   1 
ATOM   956   O  OE2   . GLU A 1 131 ? 11.498   -23.444 20.675  1.00 120.14 ? 144 GLU A OE2   1 
ATOM   957   N  N     . GLN A 1 132 ? 15.778   -19.941 20.276  1.00 71.01  ? 145 GLN A N     1 
ATOM   958   C  CA    . GLN A 1 132 ? 15.537   -18.564 19.876  1.00 71.01  ? 145 GLN A CA    1 
ATOM   959   C  C     . GLN A 1 132 ? 16.857   -17.877 19.543  1.00 71.01  ? 145 GLN A C     1 
ATOM   960   O  O     . GLN A 1 132 ? 16.875   -16.736 19.082  1.00 71.01  ? 145 GLN A O     1 
ATOM   961   C  CB    . GLN A 1 132 ? 14.827   -17.806 20.999  1.00 71.01  ? 145 GLN A CB    1 
ATOM   962   C  CG    . GLN A 1 132 ? 13.761   -16.839 20.521  1.00 71.01  ? 145 GLN A CG    1 
ATOM   963   C  CD    . GLN A 1 132 ? 12.606   -17.543 19.838  1.00 71.01  ? 145 GLN A CD    1 
ATOM   964   O  OE1   . GLN A 1 132 ? 12.099   -17.082 18.817  1.00 71.01  ? 145 GLN A OE1   1 
ATOM   965   N  NE2   . GLN A 1 132 ? 12.184   -18.669 20.401  1.00 71.01  ? 145 GLN A NE2   1 
ATOM   966   N  N     . GLN A 1 133 ? 17.958   -18.585 19.781  1.00 100.83 ? 146 GLN A N     1 
ATOM   967   C  CA    . GLN A 1 133 ? 19.302   -18.042 19.588  1.00 100.83 ? 146 GLN A CA    1 
ATOM   968   C  C     . GLN A 1 133 ? 19.546   -17.602 18.147  1.00 100.83 ? 146 GLN A C     1 
ATOM   969   O  O     . GLN A 1 133 ? 20.158   -16.561 17.900  1.00 100.83 ? 146 GLN A O     1 
ATOM   970   C  CB    . GLN A 1 133 ? 20.349   -19.084 19.986  1.00 100.83 ? 146 GLN A CB    1 
ATOM   971   C  CG    . GLN A 1 133 ? 21.581   -18.516 20.669  1.00 100.83 ? 146 GLN A CG    1 
ATOM   972   C  CD    . GLN A 1 133 ? 21.510   -18.625 22.180  1.00 100.83 ? 146 GLN A CD    1 
ATOM   973   O  OE1   . GLN A 1 133 ? 20.712   -19.390 22.722  1.00 100.83 ? 146 GLN A OE1   1 
ATOM   974   N  NE2   . GLN A 1 133 ? 22.348   -17.860 22.870  1.00 100.83 ? 146 GLN A NE2   1 
ATOM   975   N  N     . MET A 1 134 ? 19.066   -18.403 17.202  1.00 68.65  ? 147 MET A N     1 
ATOM   976   C  CA    . MET A 1 134 ? 19.277   -18.142 15.783  1.00 68.65  ? 147 MET A CA    1 
ATOM   977   C  C     . MET A 1 134 ? 18.585   -16.862 15.321  1.00 68.65  ? 147 MET A C     1 
ATOM   978   O  O     . MET A 1 134 ? 19.235   -15.947 14.809  1.00 68.65  ? 147 MET A O     1 
ATOM   979   C  CB    . MET A 1 134 ? 18.793   -19.328 14.944  1.00 68.65  ? 147 MET A CB    1 
ATOM   980   C  CG    . MET A 1 134 ? 18.990   -19.152 13.447  1.00 68.65  ? 147 MET A CG    1 
ATOM   981   S  SD    . MET A 1 134 ? 18.349   -20.530 12.474  1.00 68.65  ? 147 MET A SD    1 
ATOM   982   C  CE    . MET A 1 134 ? 19.322   -21.885 13.122  1.00 68.65  ? 147 MET A CE    1 
ATOM   983   N  N     . ASN A 1 135 ? 17.269   -16.809 15.512  1.00 69.82  ? 148 ASN A N     1 
ATOM   984   C  CA    . ASN A 1 135 ? 16.444   -15.700 15.035  1.00 69.82  ? 148 ASN A CA    1 
ATOM   985   C  C     . ASN A 1 135 ? 16.959   -14.315 15.428  1.00 69.82  ? 148 ASN A C     1 
ATOM   986   O  O     . ASN A 1 135 ? 16.847   -13.365 14.655  1.00 69.82  ? 148 ASN A O     1 
ATOM   987   C  CB    . ASN A 1 135 ? 14.995   -15.872 15.498  1.00 69.82  ? 148 ASN A CB    1 
ATOM   988   C  CG    . ASN A 1 135 ? 14.386   -17.184 15.041  1.00 69.82  ? 148 ASN A CG    1 
ATOM   989   O  OD1   . ASN A 1 135 ? 15.096   -18.155 14.785  1.00 69.82  ? 148 ASN A OD1   1 
ATOM   990   N  ND2   . ASN A 1 135 ? 13.062   -17.217 14.936  1.00 69.82  ? 148 ASN A ND2   1 
ATOM   991   N  N     . TYR A 1 136 ? 17.524   -14.203 16.627  1.00 64.83  ? 149 TYR A N     1 
ATOM   992   C  CA    . TYR A 1 136 ? 18.097   -12.939 17.072  1.00 64.83  ? 149 TYR A CA    1 
ATOM   993   C  C     . TYR A 1 136 ? 19.335   -12.599 16.252  1.00 64.83  ? 149 TYR A C     1 
ATOM   994   O  O     . TYR A 1 136 ? 19.586   -11.434 15.947  1.00 64.83  ? 149 TYR A O     1 
ATOM   995   C  CB    . TYR A 1 136 ? 18.450   -12.987 18.561  1.00 64.83  ? 149 TYR A CB    1 
ATOM   996   C  CG    . TYR A 1 136 ? 18.959   -11.670 19.108  1.00 64.83  ? 149 TYR A CG    1 
ATOM   997   C  CD1   . TYR A 1 136 ? 18.086   -10.738 19.648  1.00 64.83  ? 149 TYR A CD1   1 
ATOM   998   C  CD2   . TYR A 1 136 ? 20.312   -11.358 19.080  1.00 64.83  ? 149 TYR A CD2   1 
ATOM   999   C  CE1   . TYR A 1 136 ? 18.543   -9.534  20.145  1.00 64.83  ? 149 TYR A CE1   1 
ATOM   1000  C  CE2   . TYR A 1 136 ? 20.779   -10.157 19.574  1.00 64.83  ? 149 TYR A CE2   1 
ATOM   1001  C  CZ    . TYR A 1 136 ? 19.889   -9.249  20.105  1.00 64.83  ? 149 TYR A CZ    1 
ATOM   1002  O  OH    . TYR A 1 136 ? 20.346   -8.050  20.600  1.00 64.83  ? 149 TYR A OH    1 
ATOM   1003  N  N     . GLY A 1 137 ? 20.105   -13.623 15.897  1.00 41.45  ? 150 GLY A N     1 
ATOM   1004  C  CA    . GLY A 1 137 ? 21.323   -13.432 15.131  1.00 41.45  ? 150 GLY A CA    1 
ATOM   1005  C  C     . GLY A 1 137 ? 21.088   -12.865 13.743  1.00 41.45  ? 150 GLY A C     1 
ATOM   1006  O  O     . GLY A 1 137 ? 21.732   -11.893 13.345  1.00 41.45  ? 150 GLY A O     1 
ATOM   1007  N  N     . ILE A 1 138 ? 20.163   -13.476 13.008  1.00 44.76  ? 151 ILE A N     1 
ATOM   1008  C  CA    . ILE A 1 138 ? 19.860   -13.066 11.639  1.00 44.76  ? 151 ILE A CA    1 
ATOM   1009  C  C     . ILE A 1 138 ? 19.393   -11.613 11.566  1.00 44.76  ? 151 ILE A C     1 
ATOM   1010  O  O     . ILE A 1 138 ? 19.886   -10.841 10.745  1.00 44.76  ? 151 ILE A O     1 
ATOM   1011  C  CB    . ILE A 1 138 ? 18.797   -13.981 11.000  1.00 44.76  ? 151 ILE A CB    1 
ATOM   1012  C  CG1   . ILE A 1 138 ? 19.237   -15.444 11.068  1.00 44.76  ? 151 ILE A CG1   1 
ATOM   1013  C  CG2   . ILE A 1 138 ? 18.543   -13.579 9.558   1.00 44.76  ? 151 ILE A CG2   1 
ATOM   1014  C  CD1   . ILE A 1 138 ? 18.224   -16.416 10.505  1.00 44.76  ? 151 ILE A CD1   1 
ATOM   1015  N  N     . LEU A 1 139 ? 18.448   -11.249 12.428  1.00 22.93  ? 152 LEU A N     1 
ATOM   1016  C  CA    . LEU A 1 139 ? 17.919   -9.888  12.461  1.00 22.93  ? 152 LEU A CA    1 
ATOM   1017  C  C     . LEU A 1 139 ? 19.003   -8.873  12.814  1.00 22.93  ? 152 LEU A C     1 
ATOM   1018  O  O     . LEU A 1 139 ? 19.053   -7.782  12.246  1.00 22.93  ? 152 LEU A O     1 
ATOM   1019  C  CB    . LEU A 1 139 ? 16.756   -9.778  13.452  1.00 22.93  ? 152 LEU A CB    1 
ATOM   1020  C  CG    . LEU A 1 139 ? 15.532   -10.658 13.197  1.00 22.93  ? 152 LEU A CG    1 
ATOM   1021  C  CD1   . LEU A 1 139 ? 14.355   -10.204 14.041  1.00 22.93  ? 152 LEU A CD1   1 
ATOM   1022  C  CD2   . LEU A 1 139 ? 15.164   -10.657 11.729  1.00 22.93  ? 152 LEU A CD2   1 
ATOM   1023  N  N     . LYS A 1 140 ? 19.868   -9.242  13.754  1.00 68.42  ? 153 LYS A N     1 
ATOM   1024  C  CA    . LYS A 1 140 ? 20.966   -8.381  14.173  1.00 68.42  ? 153 LYS A CA    1 
ATOM   1025  C  C     . LYS A 1 140 ? 21.976   -8.180  13.049  1.00 68.42  ? 153 LYS A C     1 
ATOM   1026  O  O     . LYS A 1 140 ? 22.560   -7.105  12.914  1.00 68.42  ? 153 LYS A O     1 
ATOM   1027  C  CB    . LYS A 1 140 ? 21.664   -8.966  15.401  1.00 68.42  ? 153 LYS A CB    1 
ATOM   1028  C  CG    . LYS A 1 140 ? 21.365   -8.234  16.698  1.00 68.42  ? 153 LYS A CG    1 
ATOM   1029  C  CD    . LYS A 1 140 ? 21.715   -6.760  16.586  1.00 68.42  ? 153 LYS A CD    1 
ATOM   1030  C  CE    . LYS A 1 140 ? 21.767   -6.093  17.951  1.00 68.42  ? 153 LYS A CE    1 
ATOM   1031  N  NZ    . LYS A 1 140 ? 20.484   -6.224  18.693  1.00 68.42  ? 153 LYS A NZ    1 
ATOM   1032  N  N     . GLN A 1 141 ? 22.176   -9.221  12.248  1.00 52.65  ? 154 GLN A N     1 
ATOM   1033  C  CA    . GLN A 1 141 ? 23.125   -9.170  11.142  1.00 52.65  ? 154 GLN A CA    1 
ATOM   1034  C  C     . GLN A 1 141 ? 22.651   -8.212  10.053  1.00 52.65  ? 154 GLN A C     1 
ATOM   1035  O  O     . GLN A 1 141 ? 23.443   -7.451  9.494   1.00 52.65  ? 154 GLN A O     1 
ATOM   1036  C  CB    . GLN A 1 141 ? 23.337   -10.569 10.555  1.00 52.65  ? 154 GLN A CB    1 
ATOM   1037  C  CG    . GLN A 1 141 ? 24.369   -10.631 9.433   1.00 52.65  ? 154 GLN A CG    1 
ATOM   1038  C  CD    . GLN A 1 141 ? 24.527   -12.027 8.859   1.00 52.65  ? 154 GLN A CD    1 
ATOM   1039  O  OE1   . GLN A 1 141 ? 23.850   -12.964 9.281   1.00 52.65  ? 154 GLN A OE1   1 
ATOM   1040  N  NE2   . GLN A 1 141 ? 25.424   -12.172 7.890   1.00 52.65  ? 154 GLN A NE2   1 
ATOM   1041  N  N     . LYS A 1 142 ? 21.353   -8.251  9.763   1.00 28.25  ? 155 LYS A N     1 
ATOM   1042  C  CA    . LYS A 1 142 ? 20.777   -7.436  8.699   1.00 28.25  ? 155 LYS A CA    1 
ATOM   1043  C  C     . LYS A 1 142 ? 20.797   -5.947  9.026   1.00 28.25  ? 155 LYS A C     1 
ATOM   1044  O  O     . LYS A 1 142 ? 21.180   -5.132  8.191   1.00 28.25  ? 155 LYS A O     1 
ATOM   1045  C  CB    . LYS A 1 142 ? 19.353   -7.892  8.383   1.00 28.25  ? 155 LYS A CB    1 
ATOM   1046  C  CG    . LYS A 1 142 ? 19.259   -9.347  7.967   1.00 28.25  ? 155 LYS A CG    1 
ATOM   1047  C  CD    . LYS A 1 142 ? 17.912   -9.661  7.350   1.00 28.25  ? 155 LYS A CD    1 
ATOM   1048  C  CE    . LYS A 1 142 ? 17.843   -11.113 6.919   1.00 28.25  ? 155 LYS A CE    1 
ATOM   1049  N  NZ    . LYS A 1 142 ? 16.595   -11.420 6.172   1.00 28.25  ? 155 LYS A NZ    1 
ATOM   1050  N  N     . ILE A 1 143 ? 20.382   -5.598  10.241  1.00 48.39  ? 156 ILE A N     1 
ATOM   1051  C  CA    . ILE A 1 143 ? 20.384   -4.206  10.681  1.00 48.39  ? 156 ILE A CA    1 
ATOM   1052  C  C     . ILE A 1 143 ? 21.798   -3.628  10.627  1.00 48.39  ? 156 ILE A C     1 
ATOM   1053  O  O     . ILE A 1 143 ? 21.989   -2.452  10.314  1.00 48.39  ? 156 ILE A O     1 
ATOM   1054  C  CB    . ILE A 1 143 ? 19.800   -4.056  12.100  1.00 48.39  ? 156 ILE A CB    1 
ATOM   1055  C  CG1   . ILE A 1 143 ? 18.397   -4.659  12.164  1.00 48.39  ? 156 ILE A CG1   1 
ATOM   1056  C  CG2   . ILE A 1 143 ? 19.755   -2.595  12.516  1.00 48.39  ? 156 ILE A CG2   1 
ATOM   1057  C  CD1   . ILE A 1 143 ? 17.739   -4.538  13.520  1.00 48.39  ? 156 ILE A CD1   1 
ATOM   1058  N  N     . ALA A 1 144 ? 22.785   -4.469  10.920  1.00 60.49  ? 157 ALA A N     1 
ATOM   1059  C  CA    . ALA A 1 144 ? 24.182   -4.079  10.796  1.00 60.49  ? 157 ALA A CA    1 
ATOM   1060  C  C     . ALA A 1 144 ? 24.485   -3.659  9.362   1.00 60.49  ? 157 ALA A C     1 
ATOM   1061  O  O     . ALA A 1 144 ? 25.077   -2.607  9.132   1.00 60.49  ? 157 ALA A O     1 
ATOM   1062  C  CB    . ALA A 1 144 ? 25.088   -5.220  11.216  1.00 60.49  ? 157 ALA A CB    1 
ATOM   1063  N  N     . LEU A 1 145 ? 24.065   -4.487  8.407   1.00 35.81  ? 158 LEU A N     1 
ATOM   1064  C  CA    . LEU A 1 145 ? 24.252   -4.214  6.983   1.00 35.81  ? 158 LEU A CA    1 
ATOM   1065  C  C     . LEU A 1 145 ? 23.631   -2.874  6.595   1.00 35.81  ? 158 LEU A C     1 
ATOM   1066  O  O     . LEU A 1 145 ? 24.232   -2.090  5.863   1.00 35.81  ? 158 LEU A O     1 
ATOM   1067  C  CB    . LEU A 1 145 ? 23.625   -5.336  6.149   1.00 35.81  ? 158 LEU A CB    1 
ATOM   1068  C  CG    . LEU A 1 145 ? 24.320   -5.826  4.876   1.00 35.81  ? 158 LEU A CG    1 
ATOM   1069  C  CD1   . LEU A 1 145 ? 23.508   -6.943  4.245   1.00 35.81  ? 158 LEU A CD1   1 
ATOM   1070  C  CD2   . LEU A 1 145 ? 24.542   -4.704  3.879   1.00 35.81  ? 158 LEU A CD2   1 
ATOM   1071  N  N     . TYR A 1 146 ? 22.423   -2.624  7.090   1.00 50.44  ? 159 TYR A N     1 
ATOM   1072  C  CA    . TYR A 1 146 ? 21.729   -1.370  6.830   1.00 50.44  ? 159 TYR A CA    1 
ATOM   1073  C  C     . TYR A 1 146 ? 22.451   -0.192  7.477   1.00 50.44  ? 159 TYR A C     1 
ATOM   1074  O  O     . TYR A 1 146 ? 22.660   0.842   6.845   1.00 50.44  ? 159 TYR A O     1 
ATOM   1075  C  CB    . TYR A 1 146 ? 20.287   -1.444  7.333   1.00 50.44  ? 159 TYR A CB    1 
ATOM   1076  C  CG    . TYR A 1 146 ? 19.345   -2.176  6.407   1.00 50.44  ? 159 TYR A CG    1 
ATOM   1077  C  CD1   . TYR A 1 146 ? 19.261   -3.561  6.419   1.00 50.44  ? 159 TYR A CD1   1 
ATOM   1078  C  CD2   . TYR A 1 146 ? 18.533   -1.480  5.525   1.00 50.44  ? 159 TYR A CD2   1 
ATOM   1079  C  CE1   . TYR A 1 146 ? 18.400   -4.231  5.576   1.00 50.44  ? 159 TYR A CE1   1 
ATOM   1080  C  CE2   . TYR A 1 146 ? 17.670   -2.142  4.680   1.00 50.44  ? 159 TYR A CE2   1 
ATOM   1081  C  CZ    . TYR A 1 146 ? 17.606   -3.516  4.709   1.00 50.44  ? 159 TYR A CZ    1 
ATOM   1082  O  OH    . TYR A 1 146 ? 16.742   -4.174  3.866   1.00 50.44  ? 159 TYR A OH    1 
ATOM   1083  N  N     . GLU A 1 147 ? 22.829   -0.356  8.740   1.00 71.34  ? 160 GLU A N     1 
ATOM   1084  C  CA    . GLU A 1 147 ? 23.545   0.688   9.465   1.00 71.34  ? 160 GLU A CA    1 
ATOM   1085  C  C     . GLU A 1 147 ? 24.966   0.853   8.937   1.00 71.34  ? 160 GLU A C     1 
ATOM   1086  O  O     . GLU A 1 147 ? 25.566   1.918   9.074   1.00 71.34  ? 160 GLU A O     1 
ATOM   1087  C  CB    . GLU A 1 147 ? 23.551   0.391   10.967  1.00 71.34  ? 160 GLU A CB    1 
ATOM   1088  C  CG    . GLU A 1 147 ? 22.189   0.561   11.624  1.00 71.34  ? 160 GLU A CG    1 
ATOM   1089  C  CD    . GLU A 1 147 ? 22.161   0.080   13.061  1.00 71.34  ? 160 GLU A CD    1 
ATOM   1090  O  OE1   . GLU A 1 147 ? 22.920   -0.854  13.393  1.00 71.34  ? 160 GLU A OE1   1 
ATOM   1091  O  OE2   . GLU A 1 147 ? 21.377   0.637   13.857  1.00 71.34  ? 160 GLU A OE2   1 
ATOM   1092  N  N     . ASP A 1 148 ? 25.499   -0.207  8.337   1.00 88.35  ? 161 ASP A N     1 
ATOM   1093  C  CA    . ASP A 1 148 ? 26.797   -0.145  7.675   1.00 88.35  ? 161 ASP A CA    1 
ATOM   1094  C  C     . ASP A 1 148 ? 26.745   0.843   6.513   1.00 88.35  ? 161 ASP A C     1 
ATOM   1095  O  O     . ASP A 1 148 ? 27.435   1.861   6.525   1.00 88.35  ? 161 ASP A O     1 
ATOM   1096  C  CB    . ASP A 1 148 ? 27.207   -1.533  7.173   1.00 88.35  ? 161 ASP A CB    1 
ATOM   1097  C  CG    . ASP A 1 148 ? 28.443   -1.502  6.293   1.00 88.35  ? 161 ASP A CG    1 
ATOM   1098  O  OD1   . ASP A 1 148 ? 29.307   -0.628  6.501   1.00 88.35  ? 161 ASP A OD1   1 
ATOM   1099  O  OD2   . ASP A 1 148 ? 28.553   -2.362  5.394   1.00 88.35  ? 161 ASP A OD2   1 
ATOM   1100  N  N     . LYS A 1 149 ? 25.915   0.533   5.521   1.00 29.23  ? 162 LYS A N     1 
ATOM   1101  C  CA    . LYS A 1 149 ? 25.774   1.363   4.328   1.00 29.23  ? 162 LYS A CA    1 
ATOM   1102  C  C     . LYS A 1 149 ? 25.382   2.807   4.644   1.00 29.23  ? 162 LYS A C     1 
ATOM   1103  O  O     . LYS A 1 149 ? 25.869   3.743   4.007   1.00 29.23  ? 162 LYS A O     1 
ATOM   1104  C  CB    . LYS A 1 149 ? 24.758   0.745   3.366   1.00 29.23  ? 162 LYS A CB    1 
ATOM   1105  C  CG    . LYS A 1 149 ? 25.355   -0.150  2.285   1.00 29.23  ? 162 LYS A CG    1 
ATOM   1106  C  CD    . LYS A 1 149 ? 25.939   -1.434  2.845   1.00 29.23  ? 162 LYS A CD    1 
ATOM   1107  C  CE    . LYS A 1 149 ? 26.321   -2.394  1.723   1.00 29.23  ? 162 LYS A CE    1 
ATOM   1108  N  NZ    . LYS A 1 149 ? 27.248   -1.777  0.735   1.00 29.23  ? 162 LYS A NZ    1 
ATOM   1109  N  N     . LEU A 1 150 ? 24.503   2.983   5.626   1.00 60.58  ? 163 LEU A N     1 
ATOM   1110  C  CA    . LEU A 1 150 ? 24.044   4.313   6.016   1.00 60.58  ? 163 LEU A CA    1 
ATOM   1111  C  C     . LEU A 1 150 ? 25.156   5.128   6.669   1.00 60.58  ? 163 LEU A C     1 
ATOM   1112  O  O     . LEU A 1 150 ? 25.220   6.347   6.509   1.00 60.58  ? 163 LEU A O     1 
ATOM   1113  C  CB    . LEU A 1 150 ? 22.832   4.218   6.948   1.00 60.58  ? 163 LEU A CB    1 
ATOM   1114  C  CG    . LEU A 1 150 ? 21.520   3.767   6.302   1.00 60.58  ? 163 LEU A CG    1 
ATOM   1115  C  CD1   . LEU A 1 150 ? 20.409   3.680   7.332   1.00 60.58  ? 163 LEU A CD1   1 
ATOM   1116  C  CD2   . LEU A 1 150 ? 21.133   4.710   5.182   1.00 60.58  ? 163 LEU A CD2   1 
ATOM   1117  N  N     . SER A 1 151 ? 26.032   4.448   7.402   1.00 79.13  ? 164 SER A N     1 
ATOM   1118  C  CA    . SER A 1 151 ? 27.189   5.098   8.007   1.00 79.13  ? 164 SER A CA    1 
ATOM   1119  C  C     . SER A 1 151 ? 28.228   5.437   6.944   1.00 79.13  ? 164 SER A C     1 
ATOM   1120  O  O     . SER A 1 151 ? 29.018   6.366   7.106   1.00 79.13  ? 164 SER A O     1 
ATOM   1121  C  CB    . SER A 1 151 ? 27.802   4.203   9.085   1.00 79.13  ? 164 SER A CB    1 
ATOM   1122  O  OG    . SER A 1 151 ? 27.988   2.882   8.606   1.00 79.13  ? 164 SER A OG    1 
ATOM   1123  N  N     . ARG A 1 152 ? 28.215   4.677   5.853   1.00 70.60  ? 165 ARG A N     1 
ATOM   1124  C  CA    . ARG A 1 152 ? 29.119   4.908   4.734   1.00 70.60  ? 165 ARG A CA    1 
ATOM   1125  C  C     . ARG A 1 152 ? 28.674   6.110   3.902   1.00 70.60  ? 165 ARG A C     1 
ATOM   1126  O  O     . ARG A 1 152 ? 29.375   6.533   2.983   1.00 70.60  ? 165 ARG A O     1 
ATOM   1127  C  CB    . ARG A 1 152 ? 29.195   3.662   3.846   1.00 70.60  ? 165 ARG A CB    1 
ATOM   1128  C  CG    . ARG A 1 152 ? 30.389   2.749   4.113   1.00 70.60  ? 165 ARG A CG    1 
ATOM   1129  C  CD    . ARG A 1 152 ? 30.465   2.304   5.564   1.00 70.60  ? 165 ARG A CD    1 
ATOM   1130  N  NE    . ARG A 1 152 ? 31.469   1.261   5.767   1.00 70.60  ? 165 ARG A NE    1 
ATOM   1131  C  CZ    . ARG A 1 152 ? 31.845   0.808   6.958   1.00 70.60  ? 165 ARG A CZ    1 
ATOM   1132  N  NH1   . ARG A 1 152 ? 31.301   1.307   8.058   1.00 70.60  ? 165 ARG A NH1   1 
ATOM   1133  N  NH2   . ARG A 1 152 ? 32.762   -0.146  7.051   1.00 70.60  ? 165 ARG A NH2   1 
ATOM   1134  N  N     . ALA A 1 153 ? 27.506   6.656   4.231   1.00 37.30  ? 166 ALA A N     1 
ATOM   1135  C  CA    . ALA A 1 153 ? 26.941   7.775   3.486   1.00 37.30  ? 166 ALA A CA    1 
ATOM   1136  C  C     . ALA A 1 153 ? 26.737   9.001   4.368   1.00 37.30  ? 166 ALA A C     1 
ATOM   1137  O  O     . ALA A 1 153 ? 26.460   10.094  3.872   1.00 37.30  ? 166 ALA A O     1 
ATOM   1138  C  CB    . ALA A 1 153 ? 25.631   7.370   2.838   1.00 37.30  ? 166 ALA A CB    1 
ATOM   1139  N  N     . GLY A 1 154 ? 26.859   8.814   5.677   1.00 58.33  ? 167 GLY A N     1 
ATOM   1140  C  CA    . GLY A 1 154 ? 26.732   9.916   6.612   1.00 58.33  ? 167 GLY A CA    1 
ATOM   1141  C  C     . GLY A 1 154 ? 25.299   10.262  6.972   1.00 58.33  ? 167 GLY A C     1 
ATOM   1142  O  O     . GLY A 1 154 ? 24.969   11.431  7.174   1.00 58.33  ? 167 GLY A O     1 
ATOM   1143  N  N     . ILE A 1 155 ? 24.444   9.247   7.049   1.00 36.80  ? 168 ILE A N     1 
ATOM   1144  C  CA    . ILE A 1 155 ? 23.072   9.445   7.497   1.00 36.80  ? 168 ILE A CA    1 
ATOM   1145  C  C     . ILE A 1 155 ? 22.778   8.542   8.689   1.00 36.80  ? 168 ILE A C     1 
ATOM   1146  O  O     . ILE A 1 155 ? 22.924   7.323   8.604   1.00 36.80  ? 168 ILE A O     1 
ATOM   1147  C  CB    . ILE A 1 155 ? 22.051   9.149   6.382   1.00 36.80  ? 168 ILE A CB    1 
ATOM   1148  C  CG1   . ILE A 1 155 ? 22.618   9.515   5.011   1.00 36.80  ? 168 ILE A CG1   1 
ATOM   1149  C  CG2   . ILE A 1 155 ? 20.751   9.895   6.639   1.00 36.80  ? 168 ILE A CG2   1 
ATOM   1150  C  CD1   . ILE A 1 155 ? 21.653   9.280   3.871   1.00 36.80  ? 168 ILE A CD1   1 
ATOM   1151  N  N     . VAL A 1 156 ? 22.368   9.146   9.801   1.00 67.51  ? 169 VAL A N     1 
ATOM   1152  C  CA    . VAL A 1 156 ? 22.009   8.388   10.994  1.00 67.51  ? 169 VAL A CA    1 
ATOM   1153  C  C     . VAL A 1 156 ? 20.500   8.431   11.227  1.00 67.51  ? 169 VAL A C     1 
ATOM   1154  O  O     . VAL A 1 156 ? 19.898   9.505   11.278  1.00 67.51  ? 169 VAL A O     1 
ATOM   1155  C  CB    . VAL A 1 156 ? 22.754   8.904   12.242  1.00 67.51  ? 169 VAL A CB    1 
ATOM   1156  C  CG1   . VAL A 1 156 ? 24.193   8.416   12.243  1.00 67.51  ? 169 VAL A CG1   1 
ATOM   1157  C  CG2   . VAL A 1 156 ? 22.708   10.417  12.299  1.00 67.51  ? 169 VAL A CG2   1 
ATOM   1158  N  N     . ILE A 1 157 ? 19.891   7.257   11.356  1.00 40.71  ? 170 ILE A N     1 
ATOM   1159  C  CA    . ILE A 1 157 ? 18.443   7.167   11.508  1.00 40.71  ? 170 ILE A CA    1 
ATOM   1160  C  C     . ILE A 1 157 ? 18.039   6.407   12.770  1.00 40.71  ? 170 ILE A C     1 
ATOM   1161  O  O     . ILE A 1 157 ? 18.044   5.175   12.796  1.00 40.71  ? 170 ILE A O     1 
ATOM   1162  C  CB    . ILE A 1 157 ? 17.780   6.501   10.280  1.00 40.71  ? 170 ILE A CB    1 
ATOM   1163  C  CG1   . ILE A 1 157 ? 18.201   7.204   8.987   1.00 40.71  ? 170 ILE A CG1   1 
ATOM   1164  C  CG2   . ILE A 1 157 ? 16.267   6.508   10.423  1.00 40.71  ? 170 ILE A CG2   1 
ATOM   1165  C  CD1   . ILE A 1 157 ? 17.762   8.651   8.899   1.00 40.71  ? 170 ILE A CD1   1 
ATOM   1166  N  N     . ASN A 1 158 ? 17.699   7.156   13.814  1.00 89.02  ? 171 ASN A N     1 
ATOM   1167  C  CA    . ASN A 1 158 ? 17.163   6.581   15.042  1.00 89.02  ? 171 ASN A CA    1 
ATOM   1168  C  C     . ASN A 1 158 ? 15.897   7.316   15.476  1.00 89.02  ? 171 ASN A C     1 
ATOM   1169  O  O     . ASN A 1 158 ? 15.375   7.099   16.570  1.00 89.02  ? 171 ASN A O     1 
ATOM   1170  C  CB    . ASN A 1 158 ? 18.217   6.579   16.154  1.00 89.02  ? 171 ASN A CB    1 
ATOM   1171  C  CG    . ASN A 1 158 ? 19.237   7.691   15.996  1.00 89.02  ? 171 ASN A CG    1 
ATOM   1172  O  OD1   . ASN A 1 158 ? 18.902   8.806   15.597  1.00 89.02  ? 171 ASN A OD1   1 
ATOM   1173  N  ND2   . ASN A 1 158 ? 20.494   7.386   16.298  1.00 89.02  ? 171 ASN A ND2   1 
ATOM   1174  N  N     . ASN A 1 159 ? 15.415   8.189   14.595  1.00 46.58  ? 172 ASN A N     1 
ATOM   1175  C  CA    . ASN A 1 159 ? 14.163   8.908   14.797  1.00 46.58  ? 172 ASN A CA    1 
ATOM   1176  C  C     . ASN A 1 159 ? 13.303   8.839   13.535  1.00 46.58  ? 172 ASN A C     1 
ATOM   1177  O  O     . ASN A 1 159 ? 13.804   8.526   12.455  1.00 46.58  ? 172 ASN A O     1 
ATOM   1178  C  CB    . ASN A 1 159 ? 14.438   10.366  15.172  1.00 46.58  ? 172 ASN A CB    1 
ATOM   1179  C  CG    . ASN A 1 159 ? 13.185   11.109  15.598  1.00 46.58  ? 172 ASN A CG    1 
ATOM   1180  O  OD1   . ASN A 1 159 ? 12.229   10.507  16.085  1.00 46.58  ? 172 ASN A OD1   1 
ATOM   1181  N  ND2   . ASN A 1 159 ? 13.182   12.423  15.411  1.00 46.58  ? 172 ASN A ND2   1 
ATOM   1182  N  N     . VAL A 1 160 ? 12.012   9.122   13.673  1.00 42.57  ? 173 VAL A N     1 
ATOM   1183  C  CA    . VAL A 1 160 ? 11.099   9.108   12.536  1.00 42.57  ? 173 VAL A CA    1 
ATOM   1184  C  C     . VAL A 1 160 ? 11.243   10.386  11.714  1.00 42.57  ? 173 VAL A C     1 
ATOM   1185  O  O     . VAL A 1 160 ? 11.215   10.351  10.482  1.00 42.57  ? 173 VAL A O     1 
ATOM   1186  C  CB    . VAL A 1 160 ? 9.637    8.950   12.992  1.00 42.57  ? 173 VAL A CB    1 
ATOM   1187  C  CG1   . VAL A 1 160 ? 8.710    8.828   11.793  1.00 42.57  ? 173 VAL A CG1   1 
ATOM   1188  C  CG2   . VAL A 1 160 ? 9.495    7.738   13.896  1.00 42.57  ? 173 VAL A CG2   1 
ATOM   1189  N  N     . ASP A 1 161 ? 11.409   11.511  12.405  1.00 57.36  ? 174 ASP A N     1 
ATOM   1190  C  CA    . ASP A 1 161 ? 11.552   12.806  11.747  1.00 57.36  ? 174 ASP A CA    1 
ATOM   1191  C  C     . ASP A 1 161 ? 12.831   12.890  10.915  1.00 57.36  ? 174 ASP A C     1 
ATOM   1192  O  O     . ASP A 1 161 ? 12.944   13.733  10.025  1.00 57.36  ? 174 ASP A O     1 
ATOM   1193  C  CB    . ASP A 1 161 ? 11.509   13.944  12.772  1.00 57.36  ? 174 ASP A CB    1 
ATOM   1194  C  CG    . ASP A 1 161 ? 10.141   14.106  13.412  1.00 57.36  ? 174 ASP A CG    1 
ATOM   1195  O  OD1   . ASP A 1 161 ? 9.944    13.595  14.534  1.00 57.36  ? 174 ASP A OD1   1 
ATOM   1196  O  OD2   . ASP A 1 161 ? 9.265    14.745  12.794  1.00 57.36  ? 174 ASP A OD2   1 
ATOM   1197  N  N     . ASP A 1 162 ? 13.790   12.015  11.206  1.00 76.42  ? 175 ASP A N     1 
ATOM   1198  C  CA    . ASP A 1 162 ? 15.024   11.945  10.431  1.00 76.42  ? 175 ASP A CA    1 
ATOM   1199  C  C     . ASP A 1 162 ? 14.761   11.368  9.041   1.00 76.42  ? 175 ASP A C     1 
ATOM   1200  O  O     . ASP A 1 162 ? 15.417   11.740  8.071   1.00 76.42  ? 175 ASP A O     1 
ATOM   1201  C  CB    . ASP A 1 162 ? 16.077   11.103  11.157  1.00 76.42  ? 175 ASP A CB    1 
ATOM   1202  C  CG    . ASP A 1 162 ? 16.454   11.675  12.510  1.00 76.42  ? 175 ASP A CG    1 
ATOM   1203  O  OD1   . ASP A 1 162 ? 16.075   12.829  12.800  1.00 76.42  ? 175 ASP A OD1   1 
ATOM   1204  O  OD2   . ASP A 1 162 ? 17.141   10.970  13.281  1.00 76.42  ? 175 ASP A OD2   1 
ATOM   1205  N  N     . ILE A 1 163 ? 13.802   10.452  8.956   1.00 36.34  ? 176 ILE A N     1 
ATOM   1206  C  CA    . ILE A 1 163 ? 13.403   9.869   7.681   1.00 36.34  ? 176 ILE A CA    1 
ATOM   1207  C  C     . ILE A 1 163 ? 12.673   10.909  6.836   1.00 36.34  ? 176 ILE A C     1 
ATOM   1208  O  O     . ILE A 1 163 ? 12.836   10.965  5.618   1.00 36.34  ? 176 ILE A O     1 
ATOM   1209  C  CB    . ILE A 1 163 ? 12.486   8.642   7.884   1.00 36.34  ? 176 ILE A CB    1 
ATOM   1210  C  CG1   . ILE A 1 163 ? 13.123   7.645   8.848   1.00 36.34  ? 176 ILE A CG1   1 
ATOM   1211  C  CG2   . ILE A 1 163 ? 12.182   7.967   6.556   1.00 36.34  ? 176 ILE A CG2   1 
ATOM   1212  C  CD1   . ILE A 1 163 ? 12.285   6.408   9.087   1.00 36.34  ? 176 ILE A CD1   1 
ATOM   1213  N  N     . ILE A 1 164 ? 11.874   11.739  7.501   1.00 52.24  ? 177 ILE A N     1 
ATOM   1214  C  CA    . ILE A 1 164 ? 11.063   12.751  6.831   1.00 52.24  ? 177 ILE A CA    1 
ATOM   1215  C  C     . ILE A 1 164 ? 11.903   13.806  6.112   1.00 52.24  ? 177 ILE A C     1 
ATOM   1216  O  O     . ILE A 1 164 ? 11.769   13.992  4.902   1.00 52.24  ? 177 ILE A O     1 
ATOM   1217  C  CB    . ILE A 1 164 ? 10.096   13.437  7.815   1.00 52.24  ? 177 ILE A CB    1 
ATOM   1218  C  CG1   . ILE A 1 164 ? 9.065    12.434  8.337   1.00 52.24  ? 177 ILE A CG1   1 
ATOM   1219  C  CG2   . ILE A 1 164 ? 9.397    14.610  7.153   1.00 52.24  ? 177 ILE A CG2   1 
ATOM   1220  C  CD1   . ILE A 1 164 ? 8.077    13.027  9.316   1.00 52.24  ? 177 ILE A CD1   1 
ATOM   1221  N  N     . ASN A 1 165 ? 12.766   14.495  6.853   1.00 70.00  ? 178 ASN A N     1 
ATOM   1222  C  CA    . ASN A 1 165 ? 13.608   15.534  6.263   1.00 70.00  ? 178 ASN A CA    1 
ATOM   1223  C  C     . ASN A 1 165 ? 14.688   14.974  5.336   1.00 70.00  ? 178 ASN A C     1 
ATOM   1224  O  O     . ASN A 1 165 ? 15.266   15.708  4.534   1.00 70.00  ? 178 ASN A O     1 
ATOM   1225  C  CB    . ASN A 1 165 ? 14.220   16.431  7.347   1.00 70.00  ? 178 ASN A CB    1 
ATOM   1226  C  CG    . ASN A 1 165 ? 14.879   15.640  8.459   1.00 70.00  ? 178 ASN A CG    1 
ATOM   1227  O  OD1   . ASN A 1 165 ? 15.241   14.478  8.280   1.00 70.00  ? 178 ASN A OD1   1 
ATOM   1228  N  ND2   . ASN A 1 165 ? 15.039   16.268  9.617   1.00 70.00  ? 178 ASN A ND2   1 
ATOM   1229  N  N     . LEU A 1 166 ? 14.952   13.675  5.457   1.00 39.95  ? 179 LEU A N     1 
ATOM   1230  C  CA    . LEU A 1 166 ? 15.845   12.972  4.542   1.00 39.95  ? 179 LEU A CA    1 
ATOM   1231  C  C     . LEU A 1 166 ? 15.289   13.122  3.133   1.00 39.95  ? 179 LEU A C     1 
ATOM   1232  O  O     . LEU A 1 166 ? 16.023   13.398  2.186   1.00 39.95  ? 179 LEU A O     1 
ATOM   1233  C  CB    . LEU A 1 166 ? 15.924   11.489  4.917   1.00 39.95  ? 179 LEU A CB    1 
ATOM   1234  C  CG    . LEU A 1 166 ? 17.184   10.660  4.643   1.00 39.95  ? 179 LEU A CG    1 
ATOM   1235  C  CD1   . LEU A 1 166 ? 16.989   9.236   5.136   1.00 39.95  ? 179 LEU A CD1   1 
ATOM   1236  C  CD2   . LEU A 1 166 ? 17.560   10.653  3.177   1.00 39.95  ? 179 LEU A CD2   1 
ATOM   1237  N  N     . THR A 1 167 ? 13.977   12.948  3.012   1.00 37.51  ? 180 THR A N     1 
ATOM   1238  C  CA    . THR A 1 167 ? 13.283   13.076  1.738   1.00 37.51  ? 180 THR A CA    1 
ATOM   1239  C  C     . THR A 1 167 ? 13.338   14.505  1.206   1.00 37.51  ? 180 THR A C     1 
ATOM   1240  O  O     . THR A 1 167 ? 13.271   14.727  -0.002  1.00 37.51  ? 180 THR A O     1 
ATOM   1241  C  CB    . THR A 1 167 ? 11.805   12.664  1.867   1.00 37.51  ? 180 THR A CB    1 
ATOM   1242  O  OG1   . THR A 1 167 ? 11.102   13.633  2.654   1.00 37.51  ? 180 THR A OG1   1 
ATOM   1243  C  CG2   . THR A 1 167 ? 11.686   11.301  2.528   1.00 37.51  ? 180 THR A CG2   1 
ATOM   1244  N  N     . LYS A 1 168 ? 13.460   15.467  2.115   1.00 76.85  ? 181 LYS A N     1 
ATOM   1245  C  CA    . LYS A 1 168 ? 13.445   16.882  1.752   1.00 76.85  ? 181 LYS A CA    1 
ATOM   1246  C  C     . LYS A 1 168 ? 14.792   17.369  1.218   1.00 76.85  ? 181 LYS A C     1 
ATOM   1247  O  O     . LYS A 1 168 ? 14.945   18.544  0.881   1.00 76.85  ? 181 LYS A O     1 
ATOM   1248  C  CB    . LYS A 1 168 ? 13.022   17.734  2.949   1.00 76.85  ? 181 LYS A CB    1 
ATOM   1249  C  CG    . LYS A 1 168 ? 11.693   17.330  3.565   1.00 76.85  ? 181 LYS A CG    1 
ATOM   1250  C  CD    . LYS A 1 168 ? 11.338   18.232  4.738   1.00 76.85  ? 181 LYS A CD    1 
ATOM   1251  C  CE    . LYS A 1 168 ? 10.061   17.776  5.429   1.00 76.85  ? 181 LYS A CE    1 
ATOM   1252  N  NZ    . LYS A 1 168 ? 8.897    17.752  4.503   1.00 76.85  ? 181 LYS A NZ    1 
ATOM   1253  N  N     . SER A 1 169 ? 15.764   16.466  1.142   1.00 50.76  ? 182 SER A N     1 
ATOM   1254  C  CA    . SER A 1 169 ? 17.096   16.812  0.655   1.00 50.76  ? 182 SER A CA    1 
ATOM   1255  C  C     . SER A 1 169 ? 17.589   15.792  -0.368  1.00 50.76  ? 182 SER A C     1 
ATOM   1256  O  O     . SER A 1 169 ? 17.877   14.646  -0.022  1.00 50.76  ? 182 SER A O     1 
ATOM   1257  C  CB    . SER A 1 169 ? 18.078   16.910  1.823   1.00 50.76  ? 182 SER A CB    1 
ATOM   1258  O  OG    . SER A 1 169 ? 19.386   17.207  1.368   1.00 50.76  ? 182 SER A OG    1 
ATOM   1259  N  N     . VAL A 1 170 ? 17.685   16.218  -1.625  1.00 60.68  ? 183 VAL A N     1 
ATOM   1260  C  CA    . VAL A 1 170 ? 18.096   15.339  -2.717  1.00 60.68  ? 183 VAL A CA    1 
ATOM   1261  C  C     . VAL A 1 170 ? 19.525   14.835  -2.526  1.00 60.68  ? 183 VAL A C     1 
ATOM   1262  O  O     . VAL A 1 170 ? 19.859   13.719  -2.930  1.00 60.68  ? 183 VAL A O     1 
ATOM   1263  C  CB    . VAL A 1 170 ? 17.991   16.049  -4.080  1.00 60.68  ? 183 VAL A CB    1 
ATOM   1264  C  CG1   . VAL A 1 170 ? 18.044   15.037  -5.216  1.00 60.68  ? 183 VAL A CG1   1 
ATOM   1265  C  CG2   . VAL A 1 170 ? 16.710   16.861  -4.158  1.00 60.68  ? 183 VAL A CG2   1 
ATOM   1266  N  N     . LYS A 1 171 ? 20.361   15.663  -1.907  1.00 71.31  ? 184 LYS A N     1 
ATOM   1267  C  CA    . LYS A 1 171 ? 21.755   15.313  -1.661  1.00 71.31  ? 184 LYS A CA    1 
ATOM   1268  C  C     . LYS A 1 171 ? 21.862   14.061  -0.797  1.00 71.31  ? 184 LYS A C     1 
ATOM   1269  O  O     . LYS A 1 171 ? 22.549   13.106  -1.156  1.00 71.31  ? 184 LYS A O     1 
ATOM   1270  C  CB    . LYS A 1 171 ? 22.490   16.479  -0.997  1.00 71.31  ? 184 LYS A CB    1 
ATOM   1271  C  CG    . LYS A 1 171 ? 22.201   17.834  -1.631  1.00 71.31  ? 184 LYS A CG    1 
ATOM   1272  C  CD    . LYS A 1 171 ? 21.240   18.650  -0.780  1.00 71.31  ? 184 LYS A CD    1 
ATOM   1273  C  CE    . LYS A 1 171 ? 20.379   19.569  -1.633  1.00 71.31  ? 184 LYS A CE    1 
ATOM   1274  N  NZ    . LYS A 1 171 ? 19.425   18.800  -2.482  1.00 71.31  ? 184 LYS A NZ    1 
ATOM   1275  N  N     . ASP A 1 172 ? 21.167   14.069  0.337   1.00 70.86  ? 185 ASP A N     1 
ATOM   1276  C  CA    . ASP A 1 172 ? 21.143   12.921  1.236   1.00 70.86  ? 185 ASP A CA    1 
ATOM   1277  C  C     . ASP A 1 172 ? 20.333   11.774  0.630   1.00 70.86  ? 185 ASP A C     1 
ATOM   1278  O  O     . ASP A 1 172 ? 20.446   10.626  1.057   1.00 70.86  ? 185 ASP A O     1 
ATOM   1279  C  CB    . ASP A 1 172 ? 20.554   13.317  2.592   1.00 70.86  ? 185 ASP A CB    1 
ATOM   1280  C  CG    . ASP A 1 172 ? 21.264   14.504  3.214   1.00 70.86  ? 185 ASP A CG    1 
ATOM   1281  O  OD1   . ASP A 1 172 ? 20.930   15.653  2.856   1.00 70.86  ? 185 ASP A OD1   1 
ATOM   1282  O  OD2   . ASP A 1 172 ? 22.151   14.293  4.067   1.00 70.86  ? 185 ASP A OD2   1 
ATOM   1283  N  N     . LEU A 1 173 ? 19.517   12.100  -0.368  1.00 29.69  ? 186 LEU A N     1 
ATOM   1284  C  CA    . LEU A 1 173 ? 18.681   11.113  -1.040  1.00 29.69  ? 186 LEU A CA    1 
ATOM   1285  C  C     . LEU A 1 173 ? 19.502   10.291  -2.030  1.00 29.69  ? 186 LEU A C     1 
ATOM   1286  O  O     . LEU A 1 173 ? 19.376   9.067   -2.090  1.00 29.69  ? 186 LEU A O     1 
ATOM   1287  C  CB    . LEU A 1 173 ? 17.521   11.808  -1.754  1.00 29.69  ? 186 LEU A CB    1 
ATOM   1288  C  CG    . LEU A 1 173 ? 16.114   11.262  -1.513  1.00 29.69  ? 186 LEU A CG    1 
ATOM   1289  C  CD1   . LEU A 1 173 ? 15.892   11.001  -0.040  1.00 29.69  ? 186 LEU A CD1   1 
ATOM   1290  C  CD2   . LEU A 1 173 ? 15.070   12.234  -2.041  1.00 29.69  ? 186 LEU A CD2   1 
ATOM   1291  N  N     . GLU A 1 174 ? 20.344   10.971  -2.804  1.00 61.48  ? 187 GLU A N     1 
ATOM   1292  C  CA    . GLU A 1 174 ? 21.232   10.301  -3.750  1.00 61.48  ? 187 GLU A CA    1 
ATOM   1293  C  C     . GLU A 1 174 ? 22.329   9.538   -3.013  1.00 61.48  ? 187 GLU A C     1 
ATOM   1294  O  O     . GLU A 1 174 ? 22.814   8.516   -3.498  1.00 61.48  ? 187 GLU A O     1 
ATOM   1295  C  CB    . GLU A 1 174 ? 21.840   11.307  -4.730  1.00 61.48  ? 187 GLU A CB    1 
ATOM   1296  C  CG    . GLU A 1 174 ? 20.851   11.858  -5.750  1.00 61.48  ? 187 GLU A CG    1 
ATOM   1297  C  CD    . GLU A 1 174 ? 21.438   12.979  -6.587  1.00 61.48  ? 187 GLU A CD    1 
ATOM   1298  O  OE1   . GLU A 1 174 ? 22.387   13.640  -6.115  1.00 61.48  ? 187 GLU A OE1   1 
ATOM   1299  O  OE2   . GLU A 1 174 ? 20.952   13.198  -7.717  1.00 61.48  ? 187 GLU A OE2   1 
ATOM   1300  N  N     . LYS A 1 175 ? 22.717   10.042  -1.845  1.00 70.51  ? 188 LYS A N     1 
ATOM   1301  C  CA    . LYS A 1 175 ? 23.645   9.332   -0.974  1.00 70.51  ? 188 LYS A CA    1 
ATOM   1302  C  C     . LYS A 1 175 ? 23.032   7.998   -0.570  1.00 70.51  ? 188 LYS A C     1 
ATOM   1303  O  O     . LYS A 1 175 ? 23.717   6.977   -0.495  1.00 70.51  ? 188 LYS A O     1 
ATOM   1304  C  CB    . LYS A 1 175 ? 23.945   10.152  0.282   1.00 70.51  ? 188 LYS A CB    1 
ATOM   1305  C  CG    . LYS A 1 175 ? 24.901   11.319  0.083   1.00 70.51  ? 188 LYS A CG    1 
ATOM   1306  C  CD    . LYS A 1 175 ? 25.168   12.023  1.409   1.00 70.51  ? 188 LYS A CD    1 
ATOM   1307  C  CE    . LYS A 1 175 ? 26.314   13.019  1.303   1.00 70.51  ? 188 LYS A CE    1 
ATOM   1308  N  NZ    . LYS A 1 175 ? 26.008   14.142  0.378   1.00 70.51  ? 188 LYS A NZ    1 
ATOM   1309  N  N     . LEU A 1 176 ? 21.728   8.025   -0.314  1.00 43.53  ? 189 LEU A N     1 
ATOM   1310  C  CA    . LEU A 1 176 ? 20.987   6.846   0.115   1.00 43.53  ? 189 LEU A CA    1 
ATOM   1311  C  C     . LEU A 1 176 ? 20.872   5.812   -1.001  1.00 43.53  ? 189 LEU A C     1 
ATOM   1312  O  O     . LEU A 1 176 ? 21.016   4.612   -0.763  1.00 43.53  ? 189 LEU A O     1 
ATOM   1313  C  CB    . LEU A 1 176 ? 19.596   7.255   0.600   1.00 43.53  ? 189 LEU A CB    1 
ATOM   1314  C  CG    . LEU A 1 176 ? 18.638   6.137   1.014   1.00 43.53  ? 189 LEU A CG    1 
ATOM   1315  C  CD1   . LEU A 1 176 ? 19.236   5.317   2.138   1.00 43.53  ? 189 LEU A CD1   1 
ATOM   1316  C  CD2   . LEU A 1 176 ? 17.295   6.712   1.425   1.00 43.53  ? 189 LEU A CD2   1 
ATOM   1317  N  N     . ASP A 1 177 ? 20.613   6.285   -2.217  1.00 43.39  ? 190 ASP A N     1 
ATOM   1318  C  CA    . ASP A 1 177 ? 20.453   5.399   -3.366  1.00 43.39  ? 190 ASP A CA    1 
ATOM   1319  C  C     . ASP A 1 177 ? 21.741   4.655   -3.710  1.00 43.39  ? 190 ASP A C     1 
ATOM   1320  O  O     . ASP A 1 177 ? 21.706   3.487   -4.086  1.00 43.39  ? 190 ASP A O     1 
ATOM   1321  C  CB    . ASP A 1 177 ? 19.952   6.177   -4.584  1.00 43.39  ? 190 ASP A CB    1 
ATOM   1322  C  CG    . ASP A 1 177 ? 18.471   6.492   -4.510  1.00 43.39  ? 190 ASP A CG    1 
ATOM   1323  O  OD1   . ASP A 1 177 ? 17.904   6.439   -3.400  1.00 43.39  ? 190 ASP A OD1   1 
ATOM   1324  O  OD2   . ASP A 1 177 ? 17.877   6.799   -5.565  1.00 43.39  ? 190 ASP A OD2   1 
ATOM   1325  N  N     . LYS A 1 178 ? 22.875   5.336   -3.582  1.00 67.10  ? 191 LYS A N     1 
ATOM   1326  C  CA    . LYS A 1 178 ? 24.169   4.720   -3.863  1.00 67.10  ? 191 LYS A CA    1 
ATOM   1327  C  C     . LYS A 1 178 ? 24.519   3.681   -2.802  1.00 67.10  ? 191 LYS A C     1 
ATOM   1328  O  O     . LYS A 1 178 ? 25.145   2.662   -3.094  1.00 67.10  ? 191 LYS A O     1 
ATOM   1329  C  CB    . LYS A 1 178 ? 25.265   5.785   -3.941  1.00 67.10  ? 191 LYS A CB    1 
ATOM   1330  C  CG    . LYS A 1 178 ? 26.657   5.233   -4.212  1.00 67.10  ? 191 LYS A CG    1 
ATOM   1331  C  CD    . LYS A 1 178 ? 27.696   6.342   -4.243  1.00 67.10  ? 191 LYS A CD    1 
ATOM   1332  C  CE    . LYS A 1 178 ? 29.093   5.783   -4.442  1.00 67.10  ? 191 LYS A CE    1 
ATOM   1333  N  NZ    . LYS A 1 178 ? 29.182   4.965   -5.680  1.00 67.10  ? 191 LYS A NZ    1 
ATOM   1334  N  N     . ALA A 1 179 ? 24.099   3.942   -1.569  1.00 55.76  ? 192 ALA A N     1 
ATOM   1335  C  CA    . ALA A 1 179 ? 24.406   3.060   -0.450  1.00 55.76  ? 192 ALA A CA    1 
ATOM   1336  C  C     . ALA A 1 179 ? 23.626   1.745   -0.498  1.00 55.76  ? 192 ALA A C     1 
ATOM   1337  O  O     . ALA A 1 179 ? 24.217   0.669   -0.577  1.00 55.76  ? 192 ALA A O     1 
ATOM   1338  C  CB    . ALA A 1 179 ? 24.154   3.775   0.867   1.00 55.76  ? 192 ALA A CB    1 
ATOM   1339  N  N     . LEU A 1 180 ? 22.300   1.840   -0.456  1.00 21.95  ? 193 LEU A N     1 
ATOM   1340  C  CA    . LEU A 1 180 ? 21.447   0.660   -0.320  1.00 21.95  ? 193 LEU A CA    1 
ATOM   1341  C  C     . LEU A 1 180 ? 21.326   -0.208  -1.576  1.00 21.95  ? 193 LEU A C     1 
ATOM   1342  O  O     . LEU A 1 180 ? 21.154   -1.424  -1.473  1.00 21.95  ? 193 LEU A O     1 
ATOM   1343  C  CB    . LEU A 1 180 ? 20.056   1.052   0.191   1.00 21.95  ? 193 LEU A CB    1 
ATOM   1344  C  CG    . LEU A 1 180 ? 19.984   1.500   1.650   1.00 21.95  ? 193 LEU A CG    1 
ATOM   1345  C  CD1   . LEU A 1 180 ? 18.548   1.733   2.080   1.00 21.95  ? 193 LEU A CD1   1 
ATOM   1346  C  CD2   . LEU A 1 180 ? 20.647   0.474   2.550   1.00 21.95  ? 193 LEU A CD2   1 
ATOM   1347  N  N     . ASN A 1 181 ? 21.413   0.405   -2.754  1.00 55.96  ? 194 ASN A N     1 
ATOM   1348  C  CA    . ASN A 1 181 ? 21.298   -0.341  -4.009  1.00 55.96  ? 194 ASN A CA    1 
ATOM   1349  C  C     . ASN A 1 181 ? 22.399   -1.382  -4.197  1.00 55.96  ? 194 ASN A C     1 
ATOM   1350  O  O     . ASN A 1 181 ? 22.257   -2.308  -4.995  1.00 55.96  ? 194 ASN A O     1 
ATOM   1351  C  CB    . ASN A 1 181 ? 21.266   0.608   -5.208  1.00 55.96  ? 194 ASN A CB    1 
ATOM   1352  C  CG    . ASN A 1 181 ? 19.944   1.339   -5.341  1.00 55.96  ? 194 ASN A CG    1 
ATOM   1353  O  OD1   . ASN A 1 181 ? 18.875   0.741   -5.222  1.00 55.96  ? 194 ASN A OD1   1 
ATOM   1354  N  ND2   . ASN A 1 181 ? 20.011   2.642   -5.587  1.00 55.96  ? 194 ASN A ND2   1 
ATOM   1355  N  N     . SER A 1 182 ? 23.495   -1.219  -3.462  1.00 66.32  ? 195 SER A N     1 
ATOM   1356  C  CA    . SER A 1 182 ? 24.603   -2.167  -3.496  1.00 66.32  ? 195 SER A CA    1 
ATOM   1357  C  C     . SER A 1 182 ? 24.164   -3.548  -3.020  1.00 66.32  ? 195 SER A C     1 
ATOM   1358  O  O     . SER A 1 182 ? 24.627   -4.566  -3.532  1.00 66.32  ? 195 SER A O     1 
ATOM   1359  C  CB    . SER A 1 182 ? 25.756   -1.665  -2.629  1.00 66.32  ? 195 SER A CB    1 
ATOM   1360  O  OG    . SER A 1 182 ? 25.335   -1.457  -1.292  1.00 66.32  ? 195 SER A OG    1 
ATOM   1361  N  N     . ILE A 1 183 ? 23.269   -3.569  -2.036  1.00 35.22  ? 196 ILE A N     1 
ATOM   1362  C  CA    . ILE A 1 183 ? 22.751   -4.814  -1.482  1.00 35.22  ? 196 ILE A CA    1 
ATOM   1363  C  C     . ILE A 1 183 ? 22.015   -5.618  -2.549  1.00 35.22  ? 196 ILE A C     1 
ATOM   1364  O  O     . ILE A 1 183 ? 20.982   -5.180  -3.057  1.00 35.22  ? 196 ILE A O     1 
ATOM   1365  C  CB    . ILE A 1 183 ? 21.800   -4.546  -0.300  1.00 35.22  ? 196 ILE A CB    1 
ATOM   1366  C  CG1   . ILE A 1 183 ? 22.458   -3.616  0.719   1.00 35.22  ? 196 ILE A CG1   1 
ATOM   1367  C  CG2   . ILE A 1 183 ? 21.384   -5.849  0.358   1.00 35.22  ? 196 ILE A CG2   1 
ATOM   1368  C  CD1   . ILE A 1 183 ? 21.599   -3.332  1.933   1.00 35.22  ? 196 ILE A CD1   1 
ATOM   1369  N  N     . PRO A 1 184 ? 22.547   -6.803  -2.888  1.00 50.19  ? 197 PRO A N     1 
ATOM   1370  C  CA    . PRO A 1 184 ? 21.974   -7.661  -3.931  1.00 50.19  ? 197 PRO A CA    1 
ATOM   1371  C  C     . PRO A 1 184 ? 20.541   -8.067  -3.607  1.00 50.19  ? 197 PRO A C     1 
ATOM   1372  O  O     . PRO A 1 184 ? 20.109   -7.952  -2.460  1.00 50.19  ? 197 PRO A O     1 
ATOM   1373  C  CB    . PRO A 1 184 ? 22.881   -8.894  -3.908  1.00 50.19  ? 197 PRO A CB    1 
ATOM   1374  C  CG    . PRO A 1 184 ? 24.157   -8.425  -3.301  1.00 50.19  ? 197 PRO A CG    1 
ATOM   1375  C  CD    . PRO A 1 184 ? 23.752   -7.400  -2.288  1.00 50.19  ? 197 PRO A CD    1 
ATOM   1376  N  N     . THR A 1 185 ? 19.815   -8.539  -4.614  1.00 55.09  ? 198 THR A N     1 
ATOM   1377  C  CA    . THR A 1 185 ? 18.423   -8.922  -4.432  1.00 55.09  ? 198 THR A CA    1 
ATOM   1378  C  C     . THR A 1 185 ? 18.306   -10.426 -4.245  1.00 55.09  ? 198 THR A C     1 
ATOM   1379  O  O     . THR A 1 185 ? 17.328   -10.919 -3.681  1.00 55.09  ? 198 THR A O     1 
ATOM   1380  C  CB    . THR A 1 185 ? 17.565   -8.510  -5.642  1.00 55.09  ? 198 THR A CB    1 
ATOM   1381  O  OG1   . THR A 1 185 ? 17.703   -9.484  -6.684  1.00 55.09  ? 198 THR A OG1   1 
ATOM   1382  C  CG2   . THR A 1 185 ? 17.989   -7.145  -6.159  1.00 55.09  ? 198 THR A CG2   1 
ATOM   1383  N  N     . GLU A 1 186 ? 19.315   -11.149 -4.720  1.00 77.28  ? 199 GLU A N     1 
ATOM   1384  C  CA    . GLU A 1 186 ? 19.279   -12.605 -4.712  1.00 77.28  ? 199 GLU A CA    1 
ATOM   1385  C  C     . GLU A 1 186 ? 20.678   -13.198 -4.597  1.00 77.28  ? 199 GLU A C     1 
ATOM   1386  O  O     . GLU A 1 186 ? 21.446   -13.193 -5.559  1.00 77.28  ? 199 GLU A O     1 
ATOM   1387  C  CB    . GLU A 1 186 ? 18.589   -13.114 -5.979  1.00 77.28  ? 199 GLU A CB    1 
ATOM   1388  C  CG    . GLU A 1 186 ? 18.487   -14.624 -6.088  1.00 77.28  ? 199 GLU A CG    1 
ATOM   1389  C  CD    . GLU A 1 186 ? 17.648   -15.060 -7.275  1.00 77.28  ? 199 GLU A CD    1 
ATOM   1390  O  OE1   . GLU A 1 186 ? 16.631   -14.395 -7.563  1.00 77.28  ? 199 GLU A OE1   1 
ATOM   1391  O  OE2   . GLU A 1 186 ? 18.008   -16.064 -7.924  1.00 77.28  ? 199 GLU A OE2   1 
ATOM   1392  N  N     . LEU A 1 187 ? 21.002   -13.707 -3.413  1.00 37.52  ? 200 LEU A N     1 
ATOM   1393  C  CA    . LEU A 1 187 ? 22.289   -14.353 -3.174  1.00 37.52  ? 200 LEU A CA    1 
ATOM   1394  C  C     . LEU A 1 187 ? 22.232   -15.831 -3.550  1.00 37.52  ? 200 LEU A C     1 
ATOM   1395  O  O     . LEU A 1 187 ? 21.238   -16.509 -3.289  1.00 37.52  ? 200 LEU A O     1 
ATOM   1396  C  CB    . LEU A 1 187 ? 22.706   -14.204 -1.707  1.00 37.52  ? 200 LEU A CB    1 
ATOM   1397  C  CG    . LEU A 1 187 ? 23.526   -12.979 -1.295  1.00 37.52  ? 200 LEU A CG    1 
ATOM   1398  C  CD1   . LEU A 1 187 ? 22.816   -11.692 -1.654  1.00 37.52  ? 200 LEU A CD1   1 
ATOM   1399  C  CD2   . LEU A 1 187 ? 23.830   -13.012 0.195   1.00 37.52  ? 200 LEU A CD2   1 
ATOM   1400  N  N     . LYS A 1 188 ? 23.299   -16.322 -4.171  1.00 70.55  ? 201 LYS A N     1 
ATOM   1401  C  CA    . LYS A 1 188 ? 23.398   -17.733 -4.529  1.00 70.55  ? 201 LYS A CA    1 
ATOM   1402  C  C     . LYS A 1 188 ? 24.804   -18.269 -4.293  1.00 70.55  ? 201 LYS A C     1 
ATOM   1403  O  O     . LYS A 1 188 ? 25.597   -17.667 -3.568  1.00 70.55  ? 201 LYS A O     1 
ATOM   1404  C  CB    . LYS A 1 188 ? 22.989   -17.961 -5.986  1.00 70.55  ? 201 LYS A CB    1 
ATOM   1405  C  CG    . LYS A 1 188 ? 21.493   -18.105 -6.204  1.00 70.55  ? 201 LYS A CG    1 
ATOM   1406  C  CD    . LYS A 1 188 ? 21.189   -18.537 -7.630  1.00 70.55  ? 201 LYS A CD    1 
ATOM   1407  C  CE    . LYS A 1 188 ? 19.713   -18.851 -7.815  1.00 70.55  ? 201 LYS A CE    1 
ATOM   1408  N  NZ    . LYS A 1 188 ? 19.413   -19.321 -9.196  1.00 70.55  ? 201 LYS A NZ    1 
ATOM   1409  N  N     . GLY A 1 189 ? 25.104   -19.403 -4.917  1.00 101.82 ? 202 GLY A N     1 
ATOM   1410  C  CA    . GLY A 1 189 ? 26.383   -20.065 -4.752  1.00 101.82 ? 202 GLY A CA    1 
ATOM   1411  C  C     . GLY A 1 189 ? 26.190   -21.568 -4.757  1.00 101.82 ? 202 GLY A C     1 
ATOM   1412  O  O     . GLY A 1 189 ? 25.083   -22.048 -4.511  1.00 101.82 ? 202 GLY A O     1 
ATOM   1413  N  N     . ALA A 1 190 ? 27.262   -22.304 -5.044  1.00 69.36  ? 203 ALA A N     1 
ATOM   1414  C  CA    . ALA A 1 190 ? 27.217   -23.763 -5.095  1.00 69.36  ? 203 ALA A CA    1 
ATOM   1415  C  C     . ALA A 1 190 ? 26.590   -24.324 -3.826  1.00 69.36  ? 203 ALA A C     1 
ATOM   1416  O  O     . ALA A 1 190 ? 27.024   -23.994 -2.723  1.00 69.36  ? 203 ALA A O     1 
ATOM   1417  C  CB    . ALA A 1 190 ? 28.612   -24.324 -5.289  1.00 69.36  ? 203 ALA A CB    1 
ATOM   1418  N  N     . LYS A 1 191 ? 25.582   -25.181 -3.978  1.00 88.33  ? 204 LYS A N     1 
ATOM   1419  C  CA    . LYS A 1 191 ? 25.182   -25.713 -5.279  1.00 88.33  ? 204 LYS A CA    1 
ATOM   1420  C  C     . LYS A 1 191 ? 23.974   -25.023 -5.915  1.00 88.33  ? 204 LYS A C     1 
ATOM   1421  O  O     . LYS A 1 191 ? 23.046   -25.689 -6.372  1.00 88.33  ? 204 LYS A O     1 
ATOM   1422  C  CB    . LYS A 1 191 ? 24.912   -27.216 -5.163  1.00 88.33  ? 204 LYS A CB    1 
ATOM   1423  C  CG    . LYS A 1 191 ? 24.401   -27.667 -3.794  1.00 88.33  ? 204 LYS A CG    1 
ATOM   1424  C  CD    . LYS A 1 191 ? 22.971   -27.209 -3.512  1.00 88.33  ? 204 LYS A CD    1 
ATOM   1425  C  CE    . LYS A 1 191 ? 21.959   -27.940 -4.382  1.00 88.33  ? 204 LYS A CE    1 
ATOM   1426  N  NZ    . LYS A 1 191 ? 20.556   -27.597 -4.016  1.00 88.33  ? 204 LYS A NZ    1 
ATOM   1427  N  N     . GLY A 1 192 ? 23.987   -23.696 -5.961  1.00 45.21  ? 205 GLY A N     1 
ATOM   1428  C  CA    . GLY A 1 192 ? 22.884   -22.960 -6.553  1.00 45.21  ? 205 GLY A CA    1 
ATOM   1429  C  C     . GLY A 1 192 ? 21.741   -22.790 -5.572  1.00 45.21  ? 205 GLY A C     1 
ATOM   1430  O  O     . GLY A 1 192 ? 20.683   -22.261 -5.915  1.00 45.21  ? 205 GLY A O     1 
ATOM   1431  N  N     . GLU A 1 193 ? 21.962   -23.252 -4.346  1.00 85.02  ? 206 GLU A N     1 
ATOM   1432  C  CA    . GLU A 1 193 ? 20.989   -23.102 -3.274  1.00 85.02  ? 206 GLU A CA    1 
ATOM   1433  C  C     . GLU A 1 193 ? 20.788   -21.626 -2.958  1.00 85.02  ? 206 GLU A C     1 
ATOM   1434  O  O     . GLU A 1 193 ? 21.720   -20.831 -3.064  1.00 85.02  ? 206 GLU A O     1 
ATOM   1435  C  CB    . GLU A 1 193 ? 21.467   -23.841 -2.023  1.00 85.02  ? 206 GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1 193 ? 22.883   -23.471 -1.597  1.00 85.02  ? 206 GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1 193 ? 23.380   -24.286 -0.419  1.00 85.02  ? 206 GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1 193 ? 24.610   -24.470 -0.301  1.00 85.02  ? 206 GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1 193 ? 22.544   -24.734 0.393   1.00 85.02  ? 206 GLU A OE2   1 
ATOM   1440  N  N     . GLN A 1 194 ? 19.569   -21.258 -2.581  1.00 55.80  ? 207 GLN A N     1 
ATOM   1441  C  CA    . GLN A 1 194 ? 19.285   -19.878 -2.212  1.00 55.80  ? 207 GLN A CA    1 
ATOM   1442  C  C     . GLN A 1 194 ? 19.813   -19.568 -0.820  1.00 55.80  ? 207 GLN A C     1 
ATOM   1443  O  O     . GLN A 1 194 ? 19.571   -20.316 0.127   1.00 55.80  ? 207 GLN A O     1 
ATOM   1444  C  CB    . GLN A 1 194 ? 17.784   -19.591 -2.279  1.00 55.80  ? 207 GLN A CB    1 
ATOM   1445  C  CG    . GLN A 1 194 ? 17.254   -19.348 -3.685  1.00 55.80  ? 207 GLN A CG    1 
ATOM   1446  C  CD    . GLN A 1 194 ? 17.688   -18.011 -4.254  1.00 55.80  ? 207 GLN A CD    1 
ATOM   1447  O  OE1   . GLN A 1 194 ? 18.177   -17.143 -3.532  1.00 55.80  ? 207 GLN A OE1   1 
ATOM   1448  N  NE2   . GLN A 1 194 ? 17.508   -17.838 -5.557  1.00 55.80  ? 207 GLN A NE2   1 
ATOM   1449  N  N     . LEU A 1 195 ? 20.542   -18.464 -0.702  1.00 55.30  ? 208 LEU A N     1 
ATOM   1450  C  CA    . LEU A 1 195 ? 21.030   -18.011 0.593   1.00 55.30  ? 208 LEU A CA    1 
ATOM   1451  C  C     . LEU A 1 195 ? 20.101   -16.929 1.133   1.00 55.30  ? 208 LEU A C     1 
ATOM   1452  O  O     . LEU A 1 195 ? 19.361   -16.308 0.370   1.00 55.30  ? 208 LEU A O     1 
ATOM   1453  C  CB    . LEU A 1 195 ? 22.468   -17.493 0.488   1.00 55.30  ? 208 LEU A CB    1 
ATOM   1454  C  CG    . LEU A 1 195 ? 23.588   -18.527 0.331   1.00 55.30  ? 208 LEU A CG    1 
ATOM   1455  C  CD1   . LEU A 1 195 ? 23.416   -19.667 1.323   1.00 55.30  ? 208 LEU A CD1   1 
ATOM   1456  C  CD2   . LEU A 1 195 ? 23.680   -19.064 -1.089  1.00 55.30  ? 208 LEU A CD2   1 
ATOM   1457  N  N     . GLU A 1 196 ? 20.135   -16.720 2.446   1.00 49.98  ? 209 GLU A N     1 
ATOM   1458  C  CA    . GLU A 1 196 ? 19.265   -15.749 3.105   1.00 49.98  ? 209 GLU A CA    1 
ATOM   1459  C  C     . GLU A 1 196 ? 19.367   -14.357 2.486   1.00 49.98  ? 209 GLU A C     1 
ATOM   1460  O  O     . GLU A 1 196 ? 20.465   -13.854 2.244   1.00 49.98  ? 209 GLU A O     1 
ATOM   1461  C  CB    . GLU A 1 196 ? 19.584   -15.683 4.600   1.00 49.98  ? 209 GLU A CB    1 
ATOM   1462  C  CG    . GLU A 1 196 ? 18.530   -16.320 5.494   1.00 49.98  ? 209 GLU A CG    1 
ATOM   1463  C  CD    . GLU A 1 196 ? 17.474   -15.332 5.939   1.00 49.98  ? 209 GLU A CD    1 
ATOM   1464  O  OE1   . GLU A 1 196 ? 17.779   -14.124 5.999   1.00 49.98  ? 209 GLU A OE1   1 
ATOM   1465  O  OE2   . GLU A 1 196 ? 16.340   -15.761 6.230   1.00 49.98  ? 209 GLU A OE2   1 
ATOM   1466  N  N     . ASN A 1 197 ? 18.217   -13.746 2.220   1.00 42.73  ? 210 ASN A N     1 
ATOM   1467  C  CA    . ASN A 1 197 ? 18.177   -12.411 1.642   1.00 42.73  ? 210 ASN A CA    1 
ATOM   1468  C  C     . ASN A 1 197 ? 18.720   -11.383 2.626   1.00 42.73  ? 210 ASN A C     1 
ATOM   1469  O  O     . ASN A 1 197 ? 18.235   -11.282 3.752   1.00 42.73  ? 210 ASN A O     1 
ATOM   1470  C  CB    . ASN A 1 197 ? 16.750   -12.052 1.226   1.00 42.73  ? 210 ASN A CB    1 
ATOM   1471  C  CG    . ASN A 1 197 ? 16.679   -10.760 0.434   1.00 42.73  ? 210 ASN A CG    1 
ATOM   1472  O  OD1   . ASN A 1 197 ? 16.569   -9.677  1.004   1.00 42.73  ? 210 ASN A OD1   1 
ATOM   1473  N  ND2   . ASN A 1 197 ? 16.735   -10.871 -0.887  1.00 42.73  ? 210 ASN A ND2   1 
ATOM   1474  N  N     . PRO A 1 198 ? 19.736   -10.620 2.201   1.00 25.96  ? 211 PRO A N     1 
ATOM   1475  C  CA    . PRO A 1 198 ? 20.416   -9.622  3.036   1.00 25.96  ? 211 PRO A CA    1 
ATOM   1476  C  C     . PRO A 1 198 ? 19.502   -8.483  3.490   1.00 25.96  ? 211 PRO A C     1 
ATOM   1477  O  O     . PRO A 1 198 ? 19.866   -7.743  4.404   1.00 25.96  ? 211 PRO A O     1 
ATOM   1478  C  CB    . PRO A 1 198 ? 21.523   -9.092  2.117   1.00 25.96  ? 211 PRO A CB    1 
ATOM   1479  C  CG    . PRO A 1 198 ? 21.076   -9.424  0.734   1.00 25.96  ? 211 PRO A CG    1 
ATOM   1480  C  CD    . PRO A 1 198 ? 20.326   -10.706 0.855   1.00 25.96  ? 211 PRO A CD    1 
ATOM   1481  N  N     . ARG A 1 199 ? 18.338   -8.345  2.862   1.00 43.92  ? 212 ARG A N     1 
ATOM   1482  C  CA    . ARG A 1 199 ? 17.361   -7.345  3.280   1.00 43.92  ? 212 ARG A CA    1 
ATOM   1483  C  C     . ARG A 1 199 ? 16.345   -7.940  4.248   1.00 43.92  ? 212 ARG A C     1 
ATOM   1484  O  O     . ARG A 1 199 ? 16.144   -9.154  4.281   1.00 43.92  ? 212 ARG A O     1 
ATOM   1485  C  CB    . ARG A 1 199 ? 16.631   -6.756  2.072   1.00 43.92  ? 212 ARG A CB    1 
ATOM   1486  C  CG    . ARG A 1 199 ? 17.464   -5.812  1.226   1.00 43.92  ? 212 ARG A CG    1 
ATOM   1487  C  CD    . ARG A 1 199 ? 16.587   -5.021  0.271   1.00 43.92  ? 212 ARG A CD    1 
ATOM   1488  N  NE    . ARG A 1 199 ? 17.346   -4.008  -0.455  1.00 43.92  ? 212 ARG A NE    1 
ATOM   1489  C  CZ    . ARG A 1 199 ? 18.009   -4.242  -1.582  1.00 43.92  ? 212 ARG A CZ    1 
ATOM   1490  N  NH1   . ARG A 1 199 ? 18.009   -5.458  -2.110  1.00 43.92  ? 212 ARG A NH1   1 
ATOM   1491  N  NH2   . ARG A 1 199 ? 18.675   -3.265  -2.179  1.00 43.92  ? 212 ARG A NH2   1 
ATOM   1492  N  N     . LEU A 1 200 ? 15.711   -7.077  5.036   1.00 12.30  ? 213 LEU A N     1 
ATOM   1493  C  CA    . LEU A 1 200 ? 14.634   -7.494  5.926   1.00 12.30  ? 213 LEU A CA    1 
ATOM   1494  C  C     . LEU A 1 200 ? 13.463   -8.027  5.101   1.00 12.30  ? 213 LEU A C     1 
ATOM   1495  O  O     . LEU A 1 200 ? 12.920   -7.323  4.250   1.00 12.30  ? 213 LEU A O     1 
ATOM   1496  C  CB    . LEU A 1 200 ? 14.186   -6.327  6.809   1.00 12.30  ? 213 LEU A CB    1 
ATOM   1497  C  CG    . LEU A 1 200 ? 15.199   -5.823  7.840   1.00 12.30  ? 213 LEU A CG    1 
ATOM   1498  C  CD1   . LEU A 1 200 ? 14.766   -4.497  8.448   1.00 12.30  ? 213 LEU A CD1   1 
ATOM   1499  C  CD2   . LEU A 1 200 ? 15.402   -6.859  8.929   1.00 12.30  ? 213 LEU A CD2   1 
ATOM   1500  N  N     . THR A 1 201 ? 13.084   -9.277  5.354   1.00 29.04  ? 214 THR A N     1 
ATOM   1501  C  CA    . THR A 1 201 ? 12.045   -9.944  4.575   1.00 29.04  ? 214 THR A CA    1 
ATOM   1502  C  C     . THR A 1 201 ? 10.705   -9.995  5.306   1.00 29.04  ? 214 THR A C     1 
ATOM   1503  O  O     . THR A 1 201 ? 10.572   -9.488  6.418   1.00 29.04  ? 214 THR A O     1 
ATOM   1504  C  CB    . THR A 1 201 ? 12.461   -11.379 4.224   1.00 29.04  ? 214 THR A CB    1 
ATOM   1505  O  OG1   . THR A 1 201 ? 12.685   -12.123 5.428   1.00 29.04  ? 214 THR A OG1   1 
ATOM   1506  C  CG2   . THR A 1 201 ? 13.733   -11.376 3.399   1.00 29.04  ? 214 THR A CG2   1 
ATOM   1507  N  N     . LEU A 1 202 ? 9.713    -10.607 4.665   1.00 30.84  ? 215 LEU A N     1 
ATOM   1508  C  CA    . LEU A 1 202 ? 8.422    -10.837 5.299   1.00 30.84  ? 215 LEU A CA    1 
ATOM   1509  C  C     . LEU A 1 202 ? 8.581    -11.794 6.476   1.00 30.84  ? 215 LEU A C     1 
ATOM   1510  O  O     . LEU A 1 202 ? 7.882    -11.678 7.482   1.00 30.84  ? 215 LEU A O     1 
ATOM   1511  C  CB    . LEU A 1 202 ? 7.413    -11.409 4.298   1.00 30.84  ? 215 LEU A CB    1 
ATOM   1512  C  CG    . LEU A 1 202 ? 6.446    -10.464 3.578   1.00 30.84  ? 215 LEU A CG    1 
ATOM   1513  C  CD1   . LEU A 1 202 ? 6.440    -9.080  4.208   1.00 30.84  ? 215 LEU A CD1   1 
ATOM   1514  C  CD2   . LEU A 1 202 ? 6.747    -10.381 2.090   1.00 30.84  ? 215 LEU A CD2   1 
ATOM   1515  N  N     . GLY A 1 203 ? 9.510    -12.737 6.344   1.00 38.35  ? 216 GLY A N     1 
ATOM   1516  C  CA    . GLY A 1 203 ? 9.742    -13.734 7.374   1.00 38.35  ? 216 GLY A CA    1 
ATOM   1517  C  C     . GLY A 1 203 ? 10.444   -13.178 8.599   1.00 38.35  ? 216 GLY A C     1 
ATOM   1518  O  O     . GLY A 1 203 ? 10.369   -13.758 9.683   1.00 38.35  ? 216 GLY A O     1 
ATOM   1519  N  N     . ASP A 1 204 ? 11.133   -12.055 8.427   1.00 26.74  ? 217 ASP A N     1 
ATOM   1520  C  CA    . ASP A 1 204 ? 11.800   -11.397 9.540   1.00 26.74  ? 217 ASP A CA    1 
ATOM   1521  C  C     . ASP A 1 204 ? 10.772   -10.772 10.479  1.00 26.74  ? 217 ASP A C     1 
ATOM   1522  O  O     . ASP A 1 204 ? 11.044   -10.545 11.659  1.00 26.74  ? 217 ASP A O     1 
ATOM   1523  C  CB    . ASP A 1 204 ? 12.775   -10.339 9.026   1.00 26.74  ? 217 ASP A CB    1 
ATOM   1524  C  CG    . ASP A 1 204 ? 13.939   -10.941 8.265   1.00 26.74  ? 217 ASP A CG    1 
ATOM   1525  O  OD1   . ASP A 1 204 ? 13.718   -11.874 7.467   1.00 26.74  ? 217 ASP A OD1   1 
ATOM   1526  O  OD2   . ASP A 1 204 ? 15.078   -10.481 8.475   1.00 26.74  ? 217 ASP A OD2   1 
ATOM   1527  N  N     . LEU A 1 205 ? 9.590    -10.497 9.941   1.00 22.46  ? 218 LEU A N     1 
ATOM   1528  C  CA    . LEU A 1 205 ? 8.473    -10.025 10.742  1.00 22.46  ? 218 LEU A CA    1 
ATOM   1529  C  C     . LEU A 1 205 ? 8.046    -11.146 11.681  1.00 22.46  ? 218 LEU A C     1 
ATOM   1530  O  O     . LEU A 1 205 ? 7.658    -10.904 12.825  1.00 22.46  ? 218 LEU A O     1 
ATOM   1531  C  CB    . LEU A 1 205 ? 7.308    -9.617  9.840   1.00 22.46  ? 218 LEU A CB    1 
ATOM   1532  C  CG    . LEU A 1 205 ? 6.802    -8.175  9.927   1.00 22.46  ? 218 LEU A CG    1 
ATOM   1533  C  CD1   . LEU A 1 205 ? 7.931    -7.192  9.702   1.00 22.46  ? 218 LEU A CD1   1 
ATOM   1534  C  CD2   . LEU A 1 205 ? 5.686    -7.938  8.923   1.00 22.46  ? 218 LEU A CD2   1 
ATOM   1535  N  N     . GLY A 1 206 ? 8.136    -12.380 11.193  1.00 43.87  ? 219 GLY A N     1 
ATOM   1536  C  CA    . GLY A 1 206 ? 7.802    -13.543 11.994  1.00 43.87  ? 219 GLY A CA    1 
ATOM   1537  C  C     . GLY A 1 206 ? 8.885    -13.870 13.005  1.00 43.87  ? 219 GLY A C     1 
ATOM   1538  O  O     . GLY A 1 206 ? 8.592    -14.341 14.103  1.00 43.87  ? 219 GLY A O     1 
ATOM   1539  N  N     . ARG A 1 207 ? 10.138   -13.623 12.632  1.00 49.46  ? 220 ARG A N     1 
ATOM   1540  C  CA    . ARG A 1 207 ? 11.267   -13.857 13.525  1.00 49.46  ? 220 ARG A CA    1 
ATOM   1541  C  C     . ARG A 1 207 ? 11.247   -12.889 14.701  1.00 49.46  ? 220 ARG A C     1 
ATOM   1542  O  O     . ARG A 1 207 ? 11.477   -13.284 15.843  1.00 49.46  ? 220 ARG A O     1 
ATOM   1543  C  CB    . ARG A 1 207 ? 12.592   -13.731 12.772  1.00 49.46  ? 220 ARG A CB    1 
ATOM   1544  C  CG    . ARG A 1 207 ? 12.927   -14.901 11.860  1.00 49.46  ? 220 ARG A CG    1 
ATOM   1545  C  CD    . ARG A 1 207 ? 14.362   -14.808 11.360  1.00 49.46  ? 220 ARG A CD    1 
ATOM   1546  N  NE    . ARG A 1 207 ? 14.797   -16.030 10.688  1.00 49.46  ? 220 ARG A NE    1 
ATOM   1547  C  CZ    . ARG A 1 207 ? 14.894   -16.167 9.370   1.00 49.46  ? 220 ARG A CZ    1 
ATOM   1548  N  NH1   . ARG A 1 207 ? 14.591   -15.154 8.570   1.00 49.46  ? 220 ARG A NH1   1 
ATOM   1549  N  NH2   . ARG A 1 207 ? 15.300   -17.318 8.850   1.00 49.46  ? 220 ARG A NH2   1 
ATOM   1550  N  N     . LEU A 1 208 ? 10.978   -11.619 14.411  1.00 21.71  ? 221 LEU A N     1 
ATOM   1551  C  CA    . LEU A 1 208 ? 10.909   -10.583 15.438  1.00 21.71  ? 221 LEU A CA    1 
ATOM   1552  C  C     . LEU A 1 208 ? 9.827    -10.914 16.462  1.00 21.71  ? 221 LEU A C     1 
ATOM   1553  O  O     . LEU A 1 208 ? 10.038   -10.782 17.668  1.00 21.71  ? 221 LEU A O     1 
ATOM   1554  C  CB    . LEU A 1 208 ? 10.615   -9.223  14.797  1.00 21.71  ? 221 LEU A CB    1 
ATOM   1555  C  CG    . LEU A 1 208 ? 11.230   -7.943  15.371  1.00 21.71  ? 221 LEU A CG    1 
ATOM   1556  C  CD1   . LEU A 1 208 ? 10.634   -6.721  14.694  1.00 21.71  ? 221 LEU A CD1   1 
ATOM   1557  C  CD2   . LEU A 1 208 ? 11.062   -7.842  16.875  1.00 21.71  ? 221 LEU A CD2   1 
ATOM   1558  N  N     . ARG A 1 209 ? 8.670    -11.347 15.973  1.00 32.14  ? 222 ARG A N     1 
ATOM   1559  C  CA    . ARG A 1 209 ? 7.516    -11.596 16.828  1.00 32.14  ? 222 ARG A CA    1 
ATOM   1560  C  C     . ARG A 1 209 ? 7.744    -12.752 17.802  1.00 32.14  ? 222 ARG A C     1 
ATOM   1561  O  O     . ARG A 1 209 ? 7.325    -12.684 18.957  1.00 32.14  ? 222 ARG A O     1 
ATOM   1562  C  CB    . ARG A 1 209 ? 6.270    -11.844 15.976  1.00 32.14  ? 222 ARG A CB    1 
ATOM   1563  C  CG    . ARG A 1 209 ? 4.976    -11.946 16.763  1.00 32.14  ? 222 ARG A CG    1 
ATOM   1564  C  CD    . ARG A 1 209 ? 3.792    -11.896 15.824  1.00 32.14  ? 222 ARG A CD    1 
ATOM   1565  N  NE    . ARG A 1 209 ? 4.005    -12.746 14.659  1.00 32.14  ? 222 ARG A NE    1 
ATOM   1566  C  CZ    . ARG A 1 209 ? 3.595    -12.448 13.432  1.00 32.14  ? 222 ARG A CZ    1 
ATOM   1567  N  NH1   . ARG A 1 209 ? 2.948    -11.316 13.204  1.00 32.14  ? 222 ARG A NH1   1 
ATOM   1568  N  NH2   . ARG A 1 209 ? 3.836    -13.282 12.431  1.00 32.14  ? 222 ARG A NH2   1 
ATOM   1569  N  N     . GLU A 1 210 ? 8.413    -13.806 17.338  1.00 44.02  ? 223 GLU A N     1 
ATOM   1570  C  CA    . GLU A 1 210 ? 8.732    -14.943 18.196  1.00 44.02  ? 223 GLU A CA    1 
ATOM   1571  C  C     . GLU A 1 210 ? 9.672    -14.518 19.322  1.00 44.02  ? 223 GLU A C     1 
ATOM   1572  O  O     . GLU A 1 210 ? 9.649    -15.088 20.412  1.00 44.02  ? 223 GLU A O     1 
ATOM   1573  C  CB    . GLU A 1 210 ? 9.368    -16.076 17.388  1.00 44.02  ? 223 GLU A CB    1 
ATOM   1574  C  CG    . GLU A 1 210 ? 8.478    -16.667 16.306  1.00 44.02  ? 223 GLU A CG    1 
ATOM   1575  C  CD    . GLU A 1 210 ? 9.149    -17.805 15.558  1.00 44.02  ? 223 GLU A CD    1 
ATOM   1576  O  OE1   . GLU A 1 210 ? 10.059   -18.440 16.131  1.00 44.02  ? 223 GLU A OE1   1 
ATOM   1577  O  OE2   . GLU A 1 210 ? 8.766    -18.063 14.398  1.00 44.02  ? 223 GLU A OE2   1 
ATOM   1578  N  N     . LEU A 1 211 ? 10.498   -13.514 19.044  1.00 41.01  ? 224 LEU A N     1 
ATOM   1579  C  CA    . LEU A 1 211 ? 11.445   -12.993 20.022  1.00 41.01  ? 224 LEU A CA    1 
ATOM   1580  C  C     . LEU A 1 211 ? 10.741   -12.210 21.123  1.00 41.01  ? 224 LEU A C     1 
ATOM   1581  O  O     . LEU A 1 211 ? 11.009   -12.411 22.308  1.00 41.01  ? 224 LEU A O     1 
ATOM   1582  C  CB    . LEU A 1 211 ? 12.489   -12.107 19.341  1.00 41.01  ? 224 LEU A CB    1 
ATOM   1583  C  CG    . LEU A 1 211 ? 13.816   -12.754 18.942  1.00 41.01  ? 224 LEU A CG    1 
ATOM   1584  C  CD1   . LEU A 1 211 ? 13.581   -14.059 18.212  1.00 41.01  ? 224 LEU A CD1   1 
ATOM   1585  C  CD2   . LEU A 1 211 ? 14.635   -11.805 18.082  1.00 41.01  ? 224 LEU A CD2   1 
ATOM   1586  N  N     . LEU A 1 212 ? 9.844    -11.314 20.723  1.00 54.29  ? 225 LEU A N     1 
ATOM   1587  C  CA    . LEU A 1 212 ? 9.092    -10.494 21.670  1.00 54.29  ? 225 LEU A CA    1 
ATOM   1588  C  C     . LEU A 1 212 ? 8.297    -11.352 22.649  1.00 54.29  ? 225 LEU A C     1 
ATOM   1589  O  O     . LEU A 1 212 ? 7.836    -12.438 22.295  1.00 54.29  ? 225 LEU A O     1 
ATOM   1590  C  CB    . LEU A 1 212 ? 8.151    -9.543  20.924  1.00 54.29  ? 225 LEU A CB    1 
ATOM   1591  C  CG    . LEU A 1 212 ? 8.804    -8.441  20.093  1.00 54.29  ? 225 LEU A CG    1 
ATOM   1592  C  CD1   . LEU A 1 212 ? 7.757    -7.558  19.433  1.00 54.29  ? 225 LEU A CD1   1 
ATOM   1593  C  CD2   . LEU A 1 212 ? 9.729    -7.613  20.964  1.00 54.29  ? 225 LEU A CD2   1 
ATOM   1594  N  N     . PRO A 1 213 ? 8.150    -10.872 23.892  1.00 68.73  ? 226 PRO A N     1 
ATOM   1595  C  CA    . PRO A 1 213 ? 7.346    -11.584 24.891  1.00 68.73  ? 226 PRO A CA    1 
ATOM   1596  C  C     . PRO A 1 213 ? 5.883    -11.663 24.466  1.00 68.73  ? 226 PRO A C     1 
ATOM   1597  O  O     . PRO A 1 213 ? 5.425    -10.800 23.717  1.00 68.73  ? 226 PRO A O     1 
ATOM   1598  C  CB    . PRO A 1 213 ? 7.473    -10.699 26.135  1.00 68.73  ? 226 PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1 213 ? 8.729    -9.921  25.930  1.00 68.73  ? 226 PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1 213 ? 8.808    -9.681  24.455  1.00 68.73  ? 226 PRO A CD    1 
ATOM   1601  N  N     . GLU A 1 214 ? 5.166    -12.679 24.943  1.00 58.30  ? 227 GLU A N     1 
ATOM   1602  C  CA    . GLU A 1 214 ? 3.738    -12.826 24.668  1.00 58.30  ? 227 GLU A CA    1 
ATOM   1603  C  C     . GLU A 1 214 ? 2.963    -11.582 25.090  1.00 58.30  ? 227 GLU A C     1 
ATOM   1604  O  O     . GLU A 1 214 ? 1.891    -11.292 24.560  1.00 58.30  ? 227 GLU A O     1 
ATOM   1605  C  CB    . GLU A 1 214 ? 3.179    -14.058 25.381  1.00 58.30  ? 227 GLU A CB    1 
ATOM   1606  C  CG    . GLU A 1 214 ? 3.387    -15.367 24.637  1.00 58.30  ? 227 GLU A CG    1 
ATOM   1607  C  CD    . GLU A 1 214 ? 2.315    -15.619 23.596  1.00 58.30  ? 227 GLU A CD    1 
ATOM   1608  O  OE1   . GLU A 1 214 ? 1.253    -14.965 23.666  1.00 58.30  ? 227 GLU A OE1   1 
ATOM   1609  O  OE2   . GLU A 1 214 ? 2.530    -16.474 22.711  1.00 58.30  ? 227 GLU A OE2   1 
ATOM   1610  N  N     . GLU A 1 215 ? 3.521    -10.859 26.055  1.00 74.84  ? 228 GLU A N     1 
ATOM   1611  C  CA    . GLU A 1 215 ? 2.989    -9.579  26.498  1.00 74.84  ? 228 GLU A CA    1 
ATOM   1612  C  C     . GLU A 1 215 ? 2.871    -8.598  25.332  1.00 74.84  ? 228 GLU A C     1 
ATOM   1613  O  O     . GLU A 1 215 ? 1.911    -7.831  25.251  1.00 74.84  ? 228 GLU A O     1 
ATOM   1614  C  CB    . GLU A 1 215 ? 3.904    -8.995  27.579  1.00 74.84  ? 228 GLU A CB    1 
ATOM   1615  C  CG    . GLU A 1 215 ? 3.513    -7.613  28.077  1.00 74.84  ? 228 GLU A CG    1 
ATOM   1616  C  CD    . GLU A 1 215 ? 4.620    -6.950  28.877  1.00 74.84  ? 228 GLU A CD    1 
ATOM   1617  O  OE1   . GLU A 1 215 ? 5.781    -7.396  28.769  1.00 74.84  ? 228 GLU A OE1   1 
ATOM   1618  O  OE2   . GLU A 1 215 ? 4.331    -5.984  29.613  1.00 74.84  ? 228 GLU A OE2   1 
ATOM   1619  N  N     . ASN A 1 216 ? 3.844    -8.639  24.425  1.00 56.87  ? 229 ASN A N     1 
ATOM   1620  C  CA    . ASN A 1 216 ? 3.904    -7.689  23.315  1.00 56.87  ? 229 ASN A CA    1 
ATOM   1621  C  C     . ASN A 1 216 ? 4.076    -8.319  21.929  1.00 56.87  ? 229 ASN A C     1 
ATOM   1622  O  O     . ASN A 1 216 ? 4.571    -7.666  21.011  1.00 56.87  ? 229 ASN A O     1 
ATOM   1623  C  CB    . ASN A 1 216 ? 5.013    -6.658  23.559  1.00 56.87  ? 229 ASN A CB    1 
ATOM   1624  C  CG    . ASN A 1 216 ? 4.577    -5.535  24.480  1.00 56.87  ? 229 ASN A CG    1 
ATOM   1625  O  OD1   . ASN A 1 216 ? 3.444    -5.512  24.958  1.00 56.87  ? 229 ASN A OD1   1 
ATOM   1626  N  ND2   . ASN A 1 216 ? 5.482    -4.597  24.736  1.00 56.87  ? 229 ASN A ND2   1 
ATOM   1627  N  N     . LYS A 1 217 ? 3.663    -9.574  21.774  1.00 37.62  ? 230 LYS A N     1 
ATOM   1628  C  CA    . LYS A 1 217 ? 3.724    -10.236 20.471  1.00 37.62  ? 230 LYS A CA    1 
ATOM   1629  C  C     . LYS A 1 217 ? 2.663    -9.691  19.519  1.00 37.62  ? 230 LYS A C     1 
ATOM   1630  O  O     . LYS A 1 217 ? 2.652    -10.020 18.334  1.00 37.62  ? 230 LYS A O     1 
ATOM   1631  C  CB    . LYS A 1 217 ? 3.560    -11.752 20.611  1.00 37.62  ? 230 LYS A CB    1 
ATOM   1632  C  CG    . LYS A 1 217 ? 4.813    -12.495 21.050  1.00 37.62  ? 230 LYS A CG    1 
ATOM   1633  C  CD    . LYS A 1 217 ? 4.676    -13.992 20.803  1.00 37.62  ? 230 LYS A CD    1 
ATOM   1634  C  CE    . LYS A 1 217 ? 5.945    -14.744 21.181  1.00 37.62  ? 230 LYS A CE    1 
ATOM   1635  N  NZ    . LYS A 1 217 ? 5.851    -16.196 20.860  1.00 37.62  ? 230 LYS A NZ    1 
ATOM   1636  N  N     . HIS A 1 218 ? 1.773    -8.858  20.047  1.00 32.54  ? 231 HIS A N     1 
ATOM   1637  C  CA    . HIS A 1 218 ? 0.660    -8.320  19.275  1.00 32.54  ? 231 HIS A CA    1 
ATOM   1638  C  C     . HIS A 1 218 ? 1.067    -7.093  18.468  1.00 32.54  ? 231 HIS A C     1 
ATOM   1639  O  O     . HIS A 1 218 ? 0.260    -6.539  17.723  1.00 32.54  ? 231 HIS A O     1 
ATOM   1640  C  CB    . HIS A 1 218 ? -0.493   -7.952  20.208  1.00 32.54  ? 231 HIS A CB    1 
ATOM   1641  C  CG    . HIS A 1 218 ? -0.218   -6.751  21.060  1.00 32.54  ? 231 HIS A CG    1 
ATOM   1642  N  ND1   . HIS A 1 218 ? -0.393   -5.462  20.606  1.00 32.54  ? 231 HIS A ND1   1 
ATOM   1643  C  CD2   . HIS A 1 218 ? 0.224    -6.644  22.335  1.00 32.54  ? 231 HIS A CD2   1 
ATOM   1644  C  CE1   . HIS A 1 218 ? -0.073   -4.612  21.565  1.00 32.54  ? 231 HIS A CE1   1 
ATOM   1645  N  NE2   . HIS A 1 218 ? 0.305    -5.304  22.626  1.00 32.54  ? 231 HIS A NE2   1 
ATOM   1646  N  N     . LEU A 1 219 ? 2.315    -6.664  18.624  1.00 22.01  ? 232 LEU A N     1 
ATOM   1647  C  CA    . LEU A 1 219 ? 2.807    -5.488  17.916  1.00 22.01  ? 232 LEU A CA    1 
ATOM   1648  C  C     . LEU A 1 219 ? 3.108    -5.801  16.454  1.00 22.01  ? 232 LEU A C     1 
ATOM   1649  O  O     . LEU A 1 219 ? 3.050    -4.920  15.599  1.00 22.01  ? 232 LEU A O     1 
ATOM   1650  C  CB    . LEU A 1 219 ? 4.052    -4.924  18.602  1.00 22.01  ? 232 LEU A CB    1 
ATOM   1651  C  CG    . LEU A 1 219 ? 3.853    -4.352  20.004  1.00 22.01  ? 232 LEU A CG    1 
ATOM   1652  C  CD1   . LEU A 1 219 ? 5.155    -3.793  20.548  1.00 22.01  ? 232 LEU A CD1   1 
ATOM   1653  C  CD2   . LEU A 1 219 ? 2.783    -3.280  19.990  1.00 22.01  ? 232 LEU A CD2   1 
ATOM   1654  N  N     . ILE A 1 220 ? 3.426    -7.059  16.173  1.00 20.14  ? 233 ILE A N     1 
ATOM   1655  C  CA    . ILE A 1 220 ? 3.786    -7.465  14.820  1.00 20.14  ? 233 ILE A CA    1 
ATOM   1656  C  C     . ILE A 1 220 ? 2.653    -8.239  14.145  1.00 20.14  ? 233 ILE A C     1 
ATOM   1657  O  O     . ILE A 1 220 ? 2.201    -9.261  14.660  1.00 20.14  ? 233 ILE A O     1 
ATOM   1658  C  CB    . ILE A 1 220 ? 5.068    -8.313  14.813  1.00 20.14  ? 233 ILE A CB    1 
ATOM   1659  C  CG1   . ILE A 1 220 ? 6.167    -7.626  15.625  1.00 20.14  ? 233 ILE A CG1   1 
ATOM   1660  C  CG2   . ILE A 1 220 ? 5.524    -8.569  13.387  1.00 20.14  ? 233 ILE A CG2   1 
ATOM   1661  C  CD1   . ILE A 1 220 ? 6.560    -6.261  15.095  1.00 20.14  ? 233 ILE A CD1   1 
ATOM   1662  N  N     . LYS A 1 221 ? 2.206    -7.751  12.991  1.00 19.32  ? 234 LYS A N     1 
ATOM   1663  C  CA    . LYS A 1 221 ? 1.093    -8.366  12.274  1.00 19.32  ? 234 LYS A CA    1 
ATOM   1664  C  C     . LYS A 1 221 ? 1.592    -9.223  11.114  1.00 19.32  ? 234 LYS A C     1 
ATOM   1665  O  O     . LYS A 1 221 ? 2.702    -9.027  10.622  1.00 19.32  ? 234 LYS A O     1 
ATOM   1666  C  CB    . LYS A 1 221 ? 0.142    -7.292  11.744  1.00 19.32  ? 234 LYS A CB    1 
ATOM   1667  C  CG    . LYS A 1 221 ? -0.135   -6.153  12.716  1.00 19.32  ? 234 LYS A CG    1 
ATOM   1668  C  CD    . LYS A 1 221 ? -0.771   -6.648  14.003  1.00 19.32  ? 234 LYS A CD    1 
ATOM   1669  C  CE    . LYS A 1 221 ? -1.032   -5.492  14.955  1.00 19.32  ? 234 LYS A CE    1 
ATOM   1670  N  NZ    . LYS A 1 221 ? -1.605   -5.956  16.248  1.00 19.32  ? 234 LYS A NZ    1 
ATOM   1671  N  N     . ASN A 1 222 ? 0.771    -10.177 10.684  1.00 14.21  ? 235 ASN A N     1 
ATOM   1672  C  CA    . ASN A 1 222 ? 1.091    -10.986 9.513   1.00 14.21  ? 235 ASN A CA    1 
ATOM   1673  C  C     . ASN A 1 222 ? 0.807    -10.198 8.242   1.00 14.21  ? 235 ASN A C     1 
ATOM   1674  O  O     . ASN A 1 222 ? -0.350   -10.032 7.855   1.00 14.21  ? 235 ASN A O     1 
ATOM   1675  C  CB    . ASN A 1 222 ? 0.283    -12.284 9.518   1.00 14.21  ? 235 ASN A CB    1 
ATOM   1676  C  CG    . ASN A 1 222 ? 0.617    -13.187 8.344   1.00 14.21  ? 235 ASN A CG    1 
ATOM   1677  O  OD1   . ASN A 1 222 ? 0.138    -12.982 7.230   1.00 14.21  ? 235 ASN A OD1   1 
ATOM   1678  N  ND2   . ASN A 1 222 ? 1.432    -14.203 8.595   1.00 14.21  ? 235 ASN A ND2   1 
ATOM   1679  N  N     . LEU A 1 223 ? 1.865    -9.715  7.594   1.00 15.82  ? 236 LEU A N     1 
ATOM   1680  C  CA    . LEU A 1 223 ? 1.717    -8.870  6.411   1.00 15.82  ? 236 LEU A CA    1 
ATOM   1681  C  C     . LEU A 1 223 ? 1.586    -9.678  5.124   1.00 15.82  ? 236 LEU A C     1 
ATOM   1682  O  O     . LEU A 1 223 ? 2.287    -10.669 4.924   1.00 15.82  ? 236 LEU A O     1 
ATOM   1683  C  CB    . LEU A 1 223 ? 2.885    -7.888  6.298   1.00 15.82  ? 236 LEU A CB    1 
ATOM   1684  C  CG    . LEU A 1 223 ? 2.860    -6.915  5.120   1.00 15.82  ? 236 LEU A CG    1 
ATOM   1685  C  CD1   . LEU A 1 223 ? 1.602    -6.072  5.156   1.00 15.82  ? 236 LEU A CD1   1 
ATOM   1686  C  CD2   . LEU A 1 223 ? 4.088    -6.025  5.118   1.00 15.82  ? 236 LEU A CD2   1 
ATOM   1687  N  N     . SER A 1 224 ? 0.675    -9.244  4.259   1.00 24.85  ? 237 SER A N     1 
ATOM   1688  C  CA    . SER A 1 224 ? 0.519    -9.837  2.939   1.00 24.85  ? 237 SER A CA    1 
ATOM   1689  C  C     . SER A 1 224 ? 0.149    -8.752  1.935   1.00 24.85  ? 237 SER A C     1 
ATOM   1690  O  O     . SER A 1 224 ? -0.760   -7.961  2.179   1.00 24.85  ? 237 SER A O     1 
ATOM   1691  C  CB    . SER A 1 224 ? -0.550   -10.927 2.959   1.00 24.85  ? 237 SER A CB    1 
ATOM   1692  O  OG    . SER A 1 224 ? -1.828   -10.393 3.249   1.00 24.85  ? 237 SER A OG    1 
ATOM   1693  N  N     . VAL A 1 225 ? 0.863    -8.702  0.815   1.00 13.53  ? 238 VAL A N     1 
ATOM   1694  C  CA    . VAL A 1 225 ? 0.566    -7.713  -0.214  1.00 13.53  ? 238 VAL A CA    1 
ATOM   1695  C  C     . VAL A 1 225 ? 0.220    -8.380  -1.540  1.00 13.53  ? 238 VAL A C     1 
ATOM   1696  O  O     . VAL A 1 225 ? 0.596    -9.526  -1.791  1.00 13.53  ? 238 VAL A O     1 
ATOM   1697  C  CB    . VAL A 1 225 ? 1.730    -6.727  -0.428  1.00 13.53  ? 238 VAL A CB    1 
ATOM   1698  C  CG1   . VAL A 1 225 ? 2.245    -6.207  0.904   1.00 13.53  ? 238 VAL A CG1   1 
ATOM   1699  C  CG2   . VAL A 1 225 ? 2.845    -7.392  -1.196  1.00 13.53  ? 238 VAL A CG2   1 
ATOM   1700  N  N     . VAL A 1 226 ? -0.503   -7.651  -2.385  1.00 13.14  ? 239 VAL A N     1 
ATOM   1701  C  CA    . VAL A 1 226 ? -0.909   -8.163  -3.687  1.00 13.14  ? 239 VAL A CA    1 
ATOM   1702  C  C     . VAL A 1 226 ? -0.391   -7.254  -4.800  1.00 13.14  ? 239 VAL A C     1 
ATOM   1703  O  O     . VAL A 1 226 ? -0.514   -6.032  -4.720  1.00 13.14  ? 239 VAL A O     1 
ATOM   1704  C  CB    . VAL A 1 226 ? -2.440   -8.298  -3.787  1.00 13.14  ? 239 VAL A CB    1 
ATOM   1705  C  CG1   . VAL A 1 226 ? -2.841   -8.799  -5.154  1.00 13.14  ? 239 VAL A CG1   1 
ATOM   1706  C  CG2   . VAL A 1 226 ? -2.959   -9.239  -2.716  1.00 13.14  ? 239 VAL A CG2   1 
ATOM   1707  N  N     . VAL A 1 227 ? 0.200    -7.857  -5.828  1.00 24.45  ? 240 VAL A N     1 
ATOM   1708  C  CA    . VAL A 1 227 ? 0.747    -7.107  -6.951  1.00 24.45  ? 240 VAL A CA    1 
ATOM   1709  C  C     . VAL A 1 227 ? 0.134    -7.585  -8.262  1.00 24.45  ? 240 VAL A C     1 
ATOM   1710  O  O     . VAL A 1 227 ? -0.667   -8.518  -8.276  1.00 24.45  ? 240 VAL A O     1 
ATOM   1711  C  CB    . VAL A 1 227 ? 2.276    -7.260  -7.038  1.00 24.45  ? 240 VAL A CB    1 
ATOM   1712  C  CG1   . VAL A 1 227 ? 2.929    -6.866  -5.725  1.00 24.45  ? 240 VAL A CG1   1 
ATOM   1713  C  CG2   . VAL A 1 227 ? 2.644    -8.690  -7.407  1.00 24.45  ? 240 VAL A CG2   1 
ATOM   1714  N  N     . THR A 1 228 ? 0.513    -6.942  -9.361  1.00 21.00  ? 241 THR A N     1 
ATOM   1715  C  CA    . THR A 1 228 ? 0.081    -7.378  -10.682 1.00 21.00  ? 241 THR A CA    1 
ATOM   1716  C  C     . THR A 1 228 ? 1.264    -7.952  -11.455 1.00 21.00  ? 241 THR A C     1 
ATOM   1717  O  O     . THR A 1 228 ? 2.314    -7.318  -11.553 1.00 21.00  ? 241 THR A O     1 
ATOM   1718  C  CB    . THR A 1 228 ? -0.533   -6.228  -11.495 1.00 21.00  ? 241 THR A CB    1 
ATOM   1719  O  OG1   . THR A 1 228 ? -1.606   -5.630  -10.758 1.00 21.00  ? 241 THR A OG1   1 
ATOM   1720  C  CG2   . THR A 1 228 ? -1.059   -6.734  -12.825 1.00 21.00  ? 241 THR A CG2   1 
ATOM   1721  N  N     . ASN A 1 229 ? 1.093    -9.154  -11.996 1.00 36.04  ? 242 ASN A N     1 
ATOM   1722  C  CA    . ASN A 1 229 ? 2.119    -9.762  -12.828 1.00 36.04  ? 242 ASN A CA    1 
ATOM   1723  C  C     . ASN A 1 229 ? 1.857    -9.448  -14.298 1.00 36.04  ? 242 ASN A C     1 
ATOM   1724  O  O     . ASN A 1 229 ? 1.083    -10.139 -14.959 1.00 36.04  ? 242 ASN A O     1 
ATOM   1725  C  CB    . ASN A 1 229 ? 2.165    -11.274 -12.605 1.00 36.04  ? 242 ASN A CB    1 
ATOM   1726  C  CG    . ASN A 1 229 ? 3.429    -11.906 -13.154 1.00 36.04  ? 242 ASN A CG    1 
ATOM   1727  O  OD1   . ASN A 1 229 ? 3.585    -12.061 -14.365 1.00 36.04  ? 242 ASN A OD1   1 
ATOM   1728  N  ND2   . ASN A 1 229 ? 4.338    -12.282 -12.262 1.00 36.04  ? 242 ASN A ND2   1 
ATOM   1729  N  N     . GLN A 1 230 ? 2.510    -8.403  -14.802 1.00 41.95  ? 243 GLN A N     1 
ATOM   1730  C  CA    . GLN A 1 230 ? 2.277    -7.925  -16.163 1.00 41.95  ? 243 GLN A CA    1 
ATOM   1731  C  C     . GLN A 1 230 ? 2.678    -8.936  -17.237 1.00 41.95  ? 243 GLN A C     1 
ATOM   1732  O  O     . GLN A 1 230 ? 2.310    -8.788  -18.402 1.00 41.95  ? 243 GLN A O     1 
ATOM   1733  C  CB    . GLN A 1 230 ? 2.992    -6.591  -16.395 1.00 41.95  ? 243 GLN A CB    1 
ATOM   1734  C  CG    . GLN A 1 230 ? 2.398    -5.418  -15.622 1.00 41.95  ? 243 GLN A CG    1 
ATOM   1735  C  CD    . GLN A 1 230 ? 3.069    -4.098  -15.955 1.00 41.95  ? 243 GLN A CD    1 
ATOM   1736  O  OE1   . GLN A 1 230 ? 4.217    -4.065  -16.394 1.00 41.95  ? 243 GLN A OE1   1 
ATOM   1737  N  NE2   . GLN A 1 230 ? 2.349    -3.001  -15.753 1.00 41.95  ? 243 GLN A NE2   1 
ATOM   1738  N  N     . THR A 1 231 ? 3.435    -9.954  -16.843 1.00 51.57  ? 244 THR A N     1 
ATOM   1739  C  CA    . THR A 1 231 ? 3.810    -11.023 -17.761 1.00 51.57  ? 244 THR A CA    1 
ATOM   1740  C  C     . THR A 1 231 ? 2.742    -12.114 -17.779 1.00 51.57  ? 244 THR A C     1 
ATOM   1741  O  O     . THR A 1 231 ? 2.321    -12.565 -18.846 1.00 51.57  ? 244 THR A O     1 
ATOM   1742  C  CB    . THR A 1 231 ? 5.180    -11.633 -17.400 1.00 51.57  ? 244 THR A CB    1 
ATOM   1743  O  OG1   . THR A 1 231 ? 6.220    -10.698 -17.713 1.00 51.57  ? 244 THR A OG1   1 
ATOM   1744  C  CG2   . THR A 1 231 ? 5.419    -12.919 -18.176 1.00 51.57  ? 244 THR A CG2   1 
ATOM   1745  N  N     . LYS A 1 232 ? 2.299    -12.529 -16.596 1.00 48.71  ? 245 LYS A N     1 
ATOM   1746  C  CA    . LYS A 1 232 ? 1.289    -13.577 -16.487 1.00 48.71  ? 245 LYS A CA    1 
ATOM   1747  C  C     . LYS A 1 232 ? -0.132   -13.018 -16.519 1.00 48.71  ? 245 LYS A C     1 
ATOM   1748  O  O     . LYS A 1 232 ? -1.102   -13.776 -16.495 1.00 48.71  ? 245 LYS A O     1 
ATOM   1749  C  CB    . LYS A 1 232 ? 1.505    -14.418 -15.225 1.00 48.71  ? 245 LYS A CB    1 
ATOM   1750  C  CG    . LYS A 1 232 ? 2.861    -15.106 -15.169 1.00 48.71  ? 245 LYS A CG    1 
ATOM   1751  C  CD    . LYS A 1 232 ? 2.803    -16.397 -14.367 1.00 48.71  ? 245 LYS A CD    1 
ATOM   1752  C  CE    . LYS A 1 232 ? 2.301    -16.161 -12.955 1.00 48.71  ? 245 LYS A CE    1 
ATOM   1753  N  NZ    . LYS A 1 232 ? 2.136    -17.441 -12.213 1.00 48.71  ? 245 LYS A NZ    1 
ATOM   1754  N  N     . HIS A 1 233 ? -0.239   -11.693 -16.574 1.00 37.44  ? 246 HIS A N     1 
ATOM   1755  C  CA    . HIS A 1 233 ? -1.525   -11.004 -16.681 1.00 37.44  ? 246 HIS A CA    1 
ATOM   1756  C  C     . HIS A 1 233 ? -2.523   -11.401 -15.595 1.00 37.44  ? 246 HIS A C     1 
ATOM   1757  O  O     . HIS A 1 233 ? -3.713   -11.564 -15.860 1.00 37.44  ? 246 HIS A O     1 
ATOM   1758  C  CB    . HIS A 1 233 ? -2.127   -11.201 -18.074 1.00 37.44  ? 246 HIS A CB    1 
ATOM   1759  C  CG    . HIS A 1 233 ? -1.306   -10.602 -19.172 1.00 37.44  ? 246 HIS A CG    1 
ATOM   1760  N  ND1   . HIS A 1 233 ? -1.257   -9.245  -19.407 1.00 37.44  ? 246 HIS A ND1   1 
ATOM   1761  C  CD2   . HIS A 1 233 ? -0.496   -11.172 -20.094 1.00 37.44  ? 246 HIS A CD2   1 
ATOM   1762  C  CE1   . HIS A 1 233 ? -0.456   -9.005  -20.428 1.00 37.44  ? 246 HIS A CE1   1 
ATOM   1763  N  NE2   . HIS A 1 233 ? 0.022    -10.159 -20.863 1.00 37.44  ? 246 HIS A NE2   1 
ATOM   1764  N  N     . GLU A 1 234 ? -2.025   -11.554 -14.373 1.00 56.96  ? 247 GLU A N     1 
ATOM   1765  C  CA    . GLU A 1 234 ? -2.871   -11.879 -13.232 1.00 56.96  ? 247 GLU A CA    1 
ATOM   1766  C  C     . GLU A 1 234 ? -2.290   -11.299 -11.950 1.00 56.96  ? 247 GLU A C     1 
ATOM   1767  O  O     . GLU A 1 234 ? -1.306   -10.560 -11.981 1.00 56.96  ? 247 GLU A O     1 
ATOM   1768  C  CB    . GLU A 1 234 ? -3.052   -13.391 -13.095 1.00 56.96  ? 247 GLU A CB    1 
ATOM   1769  C  CG    . GLU A 1 234 ? -1.757   -14.157 -12.871 1.00 56.96  ? 247 GLU A CG    1 
ATOM   1770  C  CD    . GLU A 1 234 ? -1.997   -15.615 -12.534 1.00 56.96  ? 247 GLU A CD    1 
ATOM   1771  O  OE1   . GLU A 1 234 ? -3.095   -15.938 -12.034 1.00 56.96  ? 247 GLU A OE1   1 
ATOM   1772  O  OE2   . GLU A 1 234 ? -1.089   -16.438 -12.771 1.00 56.96  ? 247 GLU A OE2   1 
ATOM   1773  N  N     . LEU A 1 235 ? -2.900   -11.645 -10.822 1.00 29.01  ? 248 LEU A N     1 
ATOM   1774  C  CA    . LEU A 1 235 ? -2.486   -11.103 -9.534  1.00 29.01  ? 248 LEU A CA    1 
ATOM   1775  C  C     . LEU A 1 235 ? -1.629   -12.088 -8.740  1.00 29.01  ? 248 LEU A C     1 
ATOM   1776  O  O     . LEU A 1 235 ? -1.909   -13.286 -8.709  1.00 29.01  ? 248 LEU A O     1 
ATOM   1777  C  CB    . LEU A 1 235 ? -3.712   -10.697 -8.717  1.00 29.01  ? 248 LEU A CB    1 
ATOM   1778  C  CG    . LEU A 1 235 ? -3.974   -9.202  -8.550  1.00 29.01  ? 248 LEU A CG    1 
ATOM   1779  C  CD1   . LEU A 1 235 ? -3.868   -8.477  -9.870  1.00 29.01  ? 248 LEU A CD1   1 
ATOM   1780  C  CD2   . LEU A 1 235 ? -5.340   -8.984  -7.945  1.00 29.01  ? 248 LEU A CD2   1 
ATOM   1781  N  N     . GLU A 1 236 ? -0.578   -11.574 -8.108  1.00 30.60  ? 249 GLU A N     1 
ATOM   1782  C  CA    . GLU A 1 236 ? 0.250    -12.376 -7.215  1.00 30.60  ? 249 GLU A CA    1 
ATOM   1783  C  C     . GLU A 1 236 ? 0.100    -11.894 -5.780  1.00 30.60  ? 249 GLU A C     1 
ATOM   1784  O  O     . GLU A 1 236 ? -0.110   -10.705 -5.538  1.00 30.60  ? 249 GLU A O     1 
ATOM   1785  C  CB    . GLU A 1 236 ? 1.722    -12.319 -7.626  1.00 30.60  ? 249 GLU A CB    1 
ATOM   1786  C  CG    . GLU A 1 236 ? 2.093    -13.239 -8.774  1.00 30.60  ? 249 GLU A CG    1 
ATOM   1787  C  CD    . GLU A 1 236 ? 3.585    -13.266 -9.034  1.00 30.60  ? 249 GLU A CD    1 
ATOM   1788  O  OE1   . GLU A 1 236 ? 4.324    -12.532 -8.347  1.00 30.60  ? 249 GLU A OE1   1 
ATOM   1789  O  OE2   . GLU A 1 236 ? 4.020    -14.024 -9.925  1.00 30.60  ? 249 GLU A OE2   1 
ATOM   1790  N  N     . ARG A 1 237 ? 0.213    -12.818 -4.831  1.00 41.90  ? 250 ARG A N     1 
ATOM   1791  C  CA    . ARG A 1 237 ? 0.119    -12.473 -3.418  1.00 41.90  ? 250 ARG A CA    1 
ATOM   1792  C  C     . ARG A 1 237 ? 1.363    -12.921 -2.657  1.00 41.90  ? 250 ARG A C     1 
ATOM   1793  O  O     . ARG A 1 237 ? 1.711    -14.102 -2.658  1.00 41.90  ? 250 ARG A O     1 
ATOM   1794  C  CB    . ARG A 1 237 ? -1.131   -13.091 -2.793  1.00 41.90  ? 250 ARG A CB    1 
ATOM   1795  C  CG    . ARG A 1 237 ? -1.222   -12.907 -1.290  1.00 41.90  ? 250 ARG A CG    1 
ATOM   1796  C  CD    . ARG A 1 237 ? -1.387   -14.243 -0.587  1.00 41.90  ? 250 ARG A CD    1 
ATOM   1797  N  NE    . ARG A 1 237 ? -2.757   -14.735 -0.650  1.00 41.90  ? 250 ARG A NE    1 
ATOM   1798  C  CZ    . ARG A 1 237 ? -3.658   -14.549 0.309   1.00 41.90  ? 250 ARG A CZ    1 
ATOM   1799  N  NH1   . ARG A 1 237 ? -3.331   -13.883 1.408   1.00 41.90  ? 250 ARG A NH1   1 
ATOM   1800  N  NH2   . ARG A 1 237 ? -4.886   -15.031 0.171   1.00 41.90  ? 250 ARG A NH2   1 
ATOM   1801  N  N     . TYR A 1 238 ? 2.031    -11.968 -2.015  1.00 30.24  ? 251 TYR A N     1 
ATOM   1802  C  CA    . TYR A 1 238 ? 3.214    -12.260 -1.217  1.00 30.24  ? 251 TYR A CA    1 
ATOM   1803  C  C     . TYR A 1 238 ? 2.871    -12.159 0.265   1.00 30.24  ? 251 TYR A C     1 
ATOM   1804  O  O     . TYR A 1 238 ? 2.401    -11.120 0.726   1.00 30.24  ? 251 TYR A O     1 
ATOM   1805  C  CB    . TYR A 1 238 ? 4.345    -11.293 -1.570  1.00 30.24  ? 251 TYR A CB    1 
ATOM   1806  C  CG    . TYR A 1 238 ? 4.930    -11.501 -2.950  1.00 30.24  ? 251 TYR A CG    1 
ATOM   1807  C  CD1   . TYR A 1 238 ? 6.154    -12.133 -3.115  1.00 30.24  ? 251 TYR A CD1   1 
ATOM   1808  C  CD2   . TYR A 1 238 ? 4.260    -11.068 -4.086  1.00 30.24  ? 251 TYR A CD2   1 
ATOM   1809  C  CE1   . TYR A 1 238 ? 6.696    -12.327 -4.370  1.00 30.24  ? 251 TYR A CE1   1 
ATOM   1810  C  CE2   . TYR A 1 238 ? 4.793    -11.259 -5.347  1.00 30.24  ? 251 TYR A CE2   1 
ATOM   1811  C  CZ    . TYR A 1 238 ? 6.011    -11.889 -5.483  1.00 30.24  ? 251 TYR A CZ    1 
ATOM   1812  O  OH    . TYR A 1 238 ? 6.545    -12.080 -6.735  1.00 30.24  ? 251 TYR A OH    1 
ATOM   1813  N  N     . SER A 1 239 ? 3.100    -13.240 1.005   1.00 56.71  ? 252 SER A N     1 
ATOM   1814  C  CA    . SER A 1 239 ? 2.740    -13.284 2.420   1.00 56.71  ? 252 SER A CA    1 
ATOM   1815  C  C     . SER A 1 239 ? 3.899    -13.708 3.310   1.00 56.71  ? 252 SER A C     1 
ATOM   1816  O  O     . SER A 1 239 ? 4.923    -14.187 2.831   1.00 56.71  ? 252 SER A O     1 
ATOM   1817  C  CB    . SER A 1 239 ? 1.564    -14.232 2.643   1.00 56.71  ? 252 SER A CB    1 
ATOM   1818  O  OG    . SER A 1 239 ? 0.421    -13.798 1.938   1.00 56.71  ? 252 SER A OG    1 
ATOM   1819  N  N     . GLU A 1 240 ? 3.718    -13.532 4.615   1.00 29.78  ? 253 GLU A N     1 
ATOM   1820  C  CA    . GLU A 1 240 ? 4.697    -13.961 5.601   1.00 29.78  ? 253 GLU A CA    1 
ATOM   1821  C  C     . GLU A 1 240 ? 4.776    -15.484 5.635   1.00 29.78  ? 253 GLU A C     1 
ATOM   1822  O  O     . GLU A 1 240 ? 5.838    -16.058 5.885   1.00 29.78  ? 253 GLU A O     1 
ATOM   1823  C  CB    . GLU A 1 240 ? 4.319    -13.416 6.980   1.00 29.78  ? 253 GLU A CB    1 
ATOM   1824  C  CG    . GLU A 1 240 ? 5.094    -14.018 8.144   1.00 29.78  ? 253 GLU A CG    1 
ATOM   1825  C  CD    . GLU A 1 240 ? 4.581    -13.544 9.493   1.00 29.78  ? 253 GLU A CD    1 
ATOM   1826  O  OE1   . GLU A 1 240 ? 4.228    -12.353 9.610   1.00 29.78  ? 253 GLU A OE1   1 
ATOM   1827  O  OE2   . GLU A 1 240 ? 4.529    -14.364 10.431  1.00 29.78  ? 253 GLU A OE2   1 
ATOM   1828  N  N     . ASP A 1 241 ? 3.647    -16.134 5.367   1.00 36.93  ? 254 ASP A N     1 
ATOM   1829  C  CA    . ASP A 1 241 ? 3.566    -17.589 5.424   1.00 36.93  ? 254 ASP A CA    1 
ATOM   1830  C  C     . ASP A 1 241 ? 3.974    -18.241 4.107   1.00 36.93  ? 254 ASP A C     1 
ATOM   1831  O  O     . ASP A 1 241 ? 4.648    -19.269 4.096   1.00 36.93  ? 254 ASP A O     1 
ATOM   1832  C  CB    . ASP A 1 241 ? 2.147    -18.029 5.790   1.00 36.93  ? 254 ASP A CB    1 
ATOM   1833  C  CG    . ASP A 1 241 ? 1.613    -17.319 7.015   1.00 36.93  ? 254 ASP A CG    1 
ATOM   1834  O  OD1   . ASP A 1 241 ? 1.939    -16.130 7.202   1.00 36.93  ? 254 ASP A OD1   1 
ATOM   1835  O  OD2   . ASP A 1 241 ? 0.859    -17.950 7.786   1.00 36.93  ? 254 ASP A OD2   1 
ATOM   1836  N  N     . THR A 1 242 ? 3.558    -17.636 2.999   1.00 46.52  ? 255 THR A N     1 
ATOM   1837  C  CA    . THR A 1 242 ? 3.780    -18.206 1.673   1.00 46.52  ? 255 THR A CA    1 
ATOM   1838  C  C     . THR A 1 242 ? 5.144    -17.834 1.099   1.00 46.52  ? 255 THR A C     1 
ATOM   1839  O  O     . THR A 1 242 ? 5.880    -18.694 0.619   1.00 46.52  ? 255 THR A O     1 
ATOM   1840  C  CB    . THR A 1 242 ? 2.683    -17.769 0.687   1.00 46.52  ? 255 THR A CB    1 
ATOM   1841  O  OG1   . THR A 1 242 ? 2.828    -16.375 0.395   1.00 46.52  ? 255 THR A OG1   1 
ATOM   1842  C  CG2   . THR A 1 242 ? 1.308    -18.016 1.285   1.00 46.52  ? 255 THR A CG2   1 
ATOM   1843  N  N     . THR A 1 243 ? 5.474    -16.548 1.145   1.00 31.34  ? 256 THR A N     1 
ATOM   1844  C  CA    . THR A 1 243 ? 6.768    -16.069 0.664   1.00 31.34  ? 256 THR A CA    1 
ATOM   1845  C  C     . THR A 1 243 ? 7.534    -15.330 1.762   1.00 31.34  ? 256 THR A C     1 
ATOM   1846  O  O     . THR A 1 243 ? 7.585    -14.098 1.764   1.00 31.34  ? 256 THR A O     1 
ATOM   1847  C  CB    . THR A 1 243 ? 6.608    -15.132 -0.551  1.00 31.34  ? 256 THR A CB    1 
ATOM   1848  O  OG1   . THR A 1 243 ? 5.895    -13.953 -0.158  1.00 31.34  ? 256 THR A OG1   1 
ATOM   1849  C  CG2   . THR A 1 243 ? 5.847    -15.827 -1.667  1.00 31.34  ? 256 THR A CG2   1 
ATOM   1850  N  N     . PRO A 1 244 ? 8.133    -16.082 2.702   1.00 17.04  ? 257 PRO A N     1 
ATOM   1851  C  CA    . PRO A 1 244 ? 8.845    -15.473 3.831   1.00 17.04  ? 257 PRO A CA    1 
ATOM   1852  C  C     . PRO A 1 244 ? 10.241   -14.986 3.455   1.00 17.04  ? 257 PRO A C     1 
ATOM   1853  O  O     . PRO A 1 244 ? 10.844   -14.224 4.210   1.00 17.04  ? 257 PRO A O     1 
ATOM   1854  C  CB    . PRO A 1 244 ? 8.944    -16.623 4.832   1.00 17.04  ? 257 PRO A CB    1 
ATOM   1855  C  CG    . PRO A 1 244 ? 8.996    -17.840 3.984   1.00 17.04  ? 257 PRO A CG    1 
ATOM   1856  C  CD    . PRO A 1 244 ? 8.128    -17.554 2.785   1.00 17.04  ? 257 PRO A CD    1 
ATOM   1857  N  N     . GLN A 1 245 ? 10.745   -15.424 2.305   1.00 23.07  ? 258 GLN A N     1 
ATOM   1858  C  CA    . GLN A 1 245 ? 12.068   -15.014 1.845   1.00 23.07  ? 258 GLN A CA    1 
ATOM   1859  C  C     . GLN A 1 245 ? 12.016   -13.760 0.978   1.00 23.07  ? 258 GLN A C     1 
ATOM   1860  O  O     . GLN A 1 245 ? 13.019   -13.365 0.382   1.00 23.07  ? 258 GLN A O     1 
ATOM   1861  C  CB    . GLN A 1 245 ? 12.749   -16.150 1.078   1.00 23.07  ? 258 GLN A CB    1 
ATOM   1862  C  CG    . GLN A 1 245 ? 13.805   -16.889 1.884   1.00 23.07  ? 258 GLN A CG    1 
ATOM   1863  C  CD    . GLN A 1 245 ? 14.900   -15.968 2.387   1.00 23.07  ? 258 GLN A CD    1 
ATOM   1864  O  OE1   . GLN A 1 245 ? 15.799   -15.588 1.638   1.00 23.07  ? 258 GLN A OE1   1 
ATOM   1865  N  NE2   . GLN A 1 245 ? 14.827   -15.602 3.661   1.00 23.07  ? 258 GLN A NE2   1 
ATOM   1866  N  N     . GLN A 1 246 ? 10.846   -13.135 0.921   1.00 29.06  ? 259 GLN A N     1 
ATOM   1867  C  CA    . GLN A 1 246 ? 10.646   -11.959 0.086   1.00 29.06  ? 259 GLN A CA    1 
ATOM   1868  C  C     . GLN A 1 246 ? 10.773   -10.667 0.888   1.00 29.06  ? 259 GLN A C     1 
ATOM   1869  O  O     . GLN A 1 246 ? 10.133   -10.509 1.926   1.00 29.06  ? 259 GLN A O     1 
ATOM   1870  C  CB    . GLN A 1 246 ? 9.275    -12.026 -0.580  1.00 29.06  ? 259 GLN A CB    1 
ATOM   1871  C  CG    . GLN A 1 246 ? 8.928    -10.803 -1.389  1.00 29.06  ? 259 GLN A CG    1 
ATOM   1872  C  CD    . GLN A 1 246 ? 9.874    -10.577 -2.551  1.00 29.06  ? 259 GLN A CD    1 
ATOM   1873  O  OE1   . GLN A 1 246 ? 10.337   -9.461  -2.778  1.00 29.06  ? 259 GLN A OE1   1 
ATOM   1874  N  NE2   . GLN A 1 246 ? 10.158   -11.636 -3.299  1.00 29.06  ? 259 GLN A NE2   1 
ATOM   1875  N  N     . SER A 1 247 ? 11.605   -9.750  0.402   1.00 22.66  ? 260 SER A N     1 
ATOM   1876  C  CA    . SER A 1 247 ? 11.815   -8.463  1.064   1.00 22.66  ? 260 SER A CA    1 
ATOM   1877  C  C     . SER A 1 247 ? 10.522   -7.658  1.139   1.00 22.66  ? 260 SER A C     1 
ATOM   1878  O  O     . SER A 1 247 ? 9.708    -7.698  0.220   1.00 22.66  ? 260 SER A O     1 
ATOM   1879  C  CB    . SER A 1 247 ? 12.885   -7.655  0.330   1.00 22.66  ? 260 SER A CB    1 
ATOM   1880  O  OG    . SER A 1 247 ? 13.054   -6.377  0.915   1.00 22.66  ? 260 SER A OG    1 
ATOM   1881  N  N     . ILE A 1 248 ? 10.341   -6.932  2.239   1.00 27.85  ? 261 ILE A N     1 
ATOM   1882  C  CA    . ILE A 1 248 ? 9.137    -6.136  2.450   1.00 27.85  ? 261 ILE A CA    1 
ATOM   1883  C  C     . ILE A 1 248 ? 9.140    -4.893  1.567   1.00 27.85  ? 261 ILE A C     1 
ATOM   1884  O  O     . ILE A 1 248 ? 8.149    -4.588  0.907   1.00 27.85  ? 261 ILE A O     1 
ATOM   1885  C  CB    . ILE A 1 248 ? 8.998    -5.695  3.920   1.00 27.85  ? 261 ILE A CB    1 
ATOM   1886  C  CG1   . ILE A 1 248 ? 9.405    -6.822  4.866   1.00 27.85  ? 261 ILE A CG1   1 
ATOM   1887  C  CG2   . ILE A 1 248 ? 7.577    -5.241  4.211   1.00 27.85  ? 261 ILE A CG2   1 
ATOM   1888  C  CD1   . ILE A 1 248 ? 9.336    -6.447  6.328   1.00 27.85  ? 261 ILE A CD1   1 
ATOM   1889  N  N     . ALA A 1 249 ? 10.262   -4.182  1.561   1.00 36.45  ? 262 ALA A N     1 
ATOM   1890  C  CA    . ALA A 1 249 ? 10.389   -2.943  0.801   1.00 36.45  ? 262 ALA A CA    1 
ATOM   1891  C  C     . ALA A 1 249 ? 10.251   -3.169  -0.701  1.00 36.45  ? 262 ALA A C     1 
ATOM   1892  O  O     . ALA A 1 249 ? 9.893    -2.255  -1.441  1.00 36.45  ? 262 ALA A O     1 
ATOM   1893  C  CB    . ALA A 1 249 ? 11.709   -2.268  1.115   1.00 36.45  ? 262 ALA A CB    1 
ATOM   1894  N  N     . GLN A 1 250 ? 10.538   -4.388  -1.146  1.00 44.34  ? 263 GLN A N     1 
ATOM   1895  C  CA    . GLN A 1 250 ? 10.455   -4.725  -2.561  1.00 44.34  ? 263 GLN A CA    1 
ATOM   1896  C  C     . GLN A 1 250 ? 9.001    -4.860  -3.015  1.00 44.34  ? 263 GLN A C     1 
ATOM   1897  O  O     . GLN A 1 250 ? 8.581    -4.205  -3.967  1.00 44.34  ? 263 GLN A O     1 
ATOM   1898  C  CB    . GLN A 1 250 ? 11.235   -6.011  -2.850  1.00 44.34  ? 263 GLN A CB    1 
ATOM   1899  C  CG    . GLN A 1 250 ? 11.513   -6.270  -4.329  1.00 44.34  ? 263 GLN A CG    1 
ATOM   1900  C  CD    . GLN A 1 250 ? 12.412   -7.474  -4.553  1.00 44.34  ? 263 GLN A CD    1 
ATOM   1901  O  OE1   . GLN A 1 250 ? 12.710   -8.220  -3.622  1.00 44.34  ? 263 GLN A OE1   1 
ATOM   1902  N  NE2   . GLN A 1 250 ? 12.854   -7.664  -5.790  1.00 44.34  ? 263 GLN A NE2   1 
ATOM   1903  N  N     . VAL A 1 251 ? 8.236    -5.701  -2.324  1.00 9.82   ? 264 VAL A N     1 
ATOM   1904  C  CA    . VAL A 1 251 ? 6.841    -5.953  -2.691  1.00 9.82   ? 264 VAL A CA    1 
ATOM   1905  C  C     . VAL A 1 251 ? 5.910    -4.774  -2.430  1.00 9.82   ? 264 VAL A C     1 
ATOM   1906  O  O     . VAL A 1 251 ? 4.897    -4.618  -3.110  1.00 9.82   ? 264 VAL A O     1 
ATOM   1907  C  CB    . VAL A 1 251 ? 6.270    -7.189  -1.972  1.00 9.82   ? 264 VAL A CB    1 
ATOM   1908  C  CG1   . VAL A 1 251 ? 6.735    -8.458  -2.641  1.00 9.82   ? 264 VAL A CG1   1 
ATOM   1909  C  CG2   . VAL A 1 251 ? 6.642    -7.175  -0.500  1.00 9.82   ? 264 VAL A CG2   1 
ATOM   1910  N  N     . VAL A 1 252 ? 6.244    -3.957  -1.438  1.00 7.59   ? 265 VAL A N     1 
ATOM   1911  C  CA    . VAL A 1 252 ? 5.436    -2.784  -1.125  1.00 7.59   ? 265 VAL A CA    1 
ATOM   1912  C  C     . VAL A 1 252 ? 5.577    -1.718  -2.212  1.00 7.59   ? 265 VAL A C     1 
ATOM   1913  O  O     . VAL A 1 252 ? 4.586    -1.136  -2.657  1.00 7.59   ? 265 VAL A O     1 
ATOM   1914  C  CB    . VAL A 1 252 ? 5.786    -2.204  0.254   1.00 7.59   ? 265 VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1 252 ? 5.158    -0.842  0.432   1.00 7.59   ? 265 VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1 252 ? 5.318    -3.143  1.352   1.00 7.59   ? 265 VAL A CG2   1 
ATOM   1917  N  N     . GLN A 1 253 ? 6.811    -1.474  -2.640  1.00 28.20  ? 266 GLN A N     1 
ATOM   1918  C  CA    . GLN A 1 253 ? 7.069    -0.573  -3.757  1.00 28.20  ? 266 GLN A CA    1 
ATOM   1919  C  C     . GLN A 1 253 ? 6.465    -1.152  -5.035  1.00 28.20  ? 266 GLN A C     1 
ATOM   1920  O  O     . GLN A 1 253 ? 5.888    -0.426  -5.843  1.00 28.20  ? 266 GLN A O     1 
ATOM   1921  C  CB    . GLN A 1 253 ? 8.574    -0.343  -3.923  1.00 28.20  ? 266 GLN A CB    1 
ATOM   1922  C  CG    . GLN A 1 253 ? 8.955    0.554   -5.097  1.00 28.20  ? 266 GLN A CG    1 
ATOM   1923  C  CD    . GLN A 1 253 ? 9.254    -0.228  -6.364  1.00 28.20  ? 266 GLN A CD    1 
ATOM   1924  O  OE1   . GLN A 1 253 ? 9.746    -1.353  -6.308  1.00 28.20  ? 266 GLN A OE1   1 
ATOM   1925  N  NE2   . GLN A 1 253 ? 8.954    0.366   -7.513  1.00 28.20  ? 266 GLN A NE2   1 
ATOM   1926  N  N     . TRP A 1 254 ? 6.600    -2.467  -5.197  1.00 16.34  ? 267 TRP A N     1 
ATOM   1927  C  CA    . TRP A 1 254 ? 6.005    -3.198  -6.312  1.00 16.34  ? 267 TRP A CA    1 
ATOM   1928  C  C     . TRP A 1 254 ? 4.503    -2.981  -6.388  1.00 16.34  ? 267 TRP A C     1 
ATOM   1929  O  O     . TRP A 1 254 ? 3.971    -2.590  -7.425  1.00 16.34  ? 267 TRP A O     1 
ATOM   1930  C  CB    . TRP A 1 254 ? 6.261    -4.694  -6.156  1.00 16.34  ? 267 TRP A CB    1 
ATOM   1931  C  CG    . TRP A 1 254 ? 7.572    -5.168  -6.687  1.00 16.34  ? 267 TRP A CG    1 
ATOM   1932  C  CD1   . TRP A 1 254 ? 8.509    -4.431  -7.348  1.00 16.34  ? 267 TRP A CD1   1 
ATOM   1933  C  CD2   . TRP A 1 254 ? 8.097    -6.500  -6.607  1.00 16.34  ? 267 TRP A CD2   1 
ATOM   1934  N  NE1   . TRP A 1 254 ? 9.582    -5.220  -7.683  1.00 16.34  ? 267 TRP A NE1   1 
ATOM   1935  C  CE2   . TRP A 1 254 ? 9.351    -6.497  -7.236  1.00 16.34  ? 267 TRP A CE2   1 
ATOM   1936  C  CE3   . TRP A 1 254 ? 7.619    -7.696  -6.057  1.00 16.34  ? 267 TRP A CE3   1 
ATOM   1937  C  CZ2   . TRP A 1 254 ? 10.140   -7.643  -7.338  1.00 16.34  ? 267 TRP A CZ2   1 
ATOM   1938  C  CZ3   . TRP A 1 254 ? 8.403    -8.830  -6.157  1.00 16.34  ? 267 TRP A CZ3   1 
ATOM   1939  C  CH2   . TRP A 1 254 ? 9.649    -8.797  -6.790  1.00 16.34  ? 267 TRP A CH2   1 
ATOM   1940  N  N     . SER A 1 255 ? 3.827    -3.250  -5.276  1.00 32.50  ? 268 SER A N     1 
ATOM   1941  C  CA    . SER A 1 255 ? 2.375    -3.175  -5.212  1.00 32.50  ? 268 SER A CA    1 
ATOM   1942  C  C     . SER A 1 255 ? 1.885    -1.748  -5.417  1.00 32.50  ? 268 SER A C     1 
ATOM   1943  O  O     . SER A 1 255 ? 0.731    -1.529  -5.778  1.00 32.50  ? 268 SER A O     1 
ATOM   1944  C  CB    . SER A 1 255 ? 1.878    -3.724  -3.876  1.00 32.50  ? 268 SER A CB    1 
ATOM   1945  O  OG    . SER A 1 255 ? 0.467    -3.791  -3.836  1.00 32.50  ? 268 SER A OG    1 
ATOM   1946  N  N     . GLY A 1 256 ? 2.770    -0.781  -5.195  1.00 31.56  ? 269 GLY A N     1 
ATOM   1947  C  CA    . GLY A 1 256 ? 2.441    0.615   -5.413  1.00 31.56  ? 269 GLY A CA    1 
ATOM   1948  C  C     . GLY A 1 256 ? 3.172    1.198   -6.606  1.00 31.56  ? 269 GLY A C     1 
ATOM   1949  O  O     . GLY A 1 256 ? 3.262    2.416   -6.750  1.00 31.56  ? 269 GLY A O     1 
ATOM   1950  N  N     . ALA A 1 257 ? 3.695    0.328   -7.464  1.00 47.41  ? 270 ALA A N     1 
ATOM   1951  C  CA    . ALA A 1 257 ? 4.387    0.766   -8.670  1.00 47.41  ? 270 ALA A CA    1 
ATOM   1952  C  C     . ALA A 1 257 ? 3.423    0.905   -9.842  1.00 47.41  ? 270 ALA A C     1 
ATOM   1953  O  O     . ALA A 1 257 ? 3.308    0.003   -10.672 1.00 47.41  ? 270 ALA A O     1 
ATOM   1954  C  CB    . ALA A 1 257 ? 5.506    -0.198  -9.025  1.00 47.41  ? 270 ALA A CB    1 
ATOM   1955  N  N     . HIS A 1 258 ? 2.731    2.038   -9.904  1.00 37.95  ? 271 HIS A N     1 
ATOM   1956  C  CA    . HIS A 1 258 ? 1.830    2.322   -11.012 1.00 37.95  ? 271 HIS A CA    1 
ATOM   1957  C  C     . HIS A 1 258 ? 2.652    2.498   -12.284 1.00 37.95  ? 271 HIS A C     1 
ATOM   1958  O  O     . HIS A 1 258 ? 3.649    3.222   -12.284 1.00 37.95  ? 271 HIS A O     1 
ATOM   1959  C  CB    . HIS A 1 258 ? 1.019    3.586   -10.720 1.00 37.95  ? 271 HIS A CB    1 
ATOM   1960  C  CG    . HIS A 1 258 ? -0.241   3.704   -11.521 1.00 37.95  ? 271 HIS A CG    1 
ATOM   1961  N  ND1   . HIS A 1 258 ? -1.094   2.642   -11.734 1.00 37.95  ? 271 HIS A ND1   1 
ATOM   1962  C  CD2   . HIS A 1 258 ? -0.803   4.767   -12.142 1.00 37.95  ? 271 HIS A CD2   1 
ATOM   1963  C  CE1   . HIS A 1 258 ? -2.120   3.042   -12.462 1.00 37.95  ? 271 HIS A CE1   1 
ATOM   1964  N  NE2   . HIS A 1 258 ? -1.968   4.329   -12.723 1.00 37.95  ? 271 HIS A NE2   1 
ATOM   1965  N  N     . PRO A 1 259 ? 2.240    1.832   -13.373 1.00 33.44  ? 272 PRO A N     1 
ATOM   1966  C  CA    . PRO A 1 259 ? 2.979    1.871   -14.640 1.00 33.44  ? 272 PRO A CA    1 
ATOM   1967  C  C     . PRO A 1 259 ? 3.019    3.265   -15.264 1.00 33.44  ? 272 PRO A C     1 
ATOM   1968  O  O     . PRO A 1 259 ? 3.826    3.506   -16.162 1.00 33.44  ? 272 PRO A O     1 
ATOM   1969  C  CB    . PRO A 1 259 ? 2.188    0.911   -15.534 1.00 33.44  ? 272 PRO A CB    1 
ATOM   1970  C  CG    . PRO A 1 259 ? 0.823    0.871   -14.938 1.00 33.44  ? 272 PRO A CG    1 
ATOM   1971  C  CD    . PRO A 1 259 ? 1.041    0.983   -13.464 1.00 33.44  ? 272 PRO A CD    1 
ATOM   1972  N  N     . VAL A 1 260 ? 2.159    4.164   -14.797 1.00 20.20  ? 273 VAL A N     1 
ATOM   1973  C  CA    . VAL A 1 260 ? 2.154    5.541   -15.278 1.00 20.20  ? 273 VAL A CA    1 
ATOM   1974  C  C     . VAL A 1 260 ? 3.358    6.308   -14.739 1.00 20.20  ? 273 VAL A C     1 
ATOM   1975  O  O     . VAL A 1 260 ? 3.988    7.083   -15.460 1.00 20.20  ? 273 VAL A O     1 
ATOM   1976  C  CB    . VAL A 1 260 ? 0.861    6.269   -14.871 1.00 20.20  ? 273 VAL A CB    1 
ATOM   1977  C  CG1   . VAL A 1 260 ? 0.894    7.718   -15.321 1.00 20.20  ? 273 VAL A CG1   1 
ATOM   1978  C  CG2   . VAL A 1 260 ? -0.343   5.564   -15.459 1.00 20.20  ? 273 VAL A CG2   1 
ATOM   1979  N  N     . LEU A 1 261 ? 3.681    6.074   -13.471 1.00 21.15  ? 274 LEU A N     1 
ATOM   1980  C  CA    . LEU A 1 261 ? 4.759    6.803   -12.809 1.00 21.15  ? 274 LEU A CA    1 
ATOM   1981  C  C     . LEU A 1 261 ? 6.026    5.964   -12.651 1.00 21.15  ? 274 LEU A C     1 
ATOM   1982  O  O     . LEU A 1 261 ? 7.136    6.491   -12.719 1.00 21.15  ? 274 LEU A O     1 
ATOM   1983  C  CB    . LEU A 1 261 ? 4.303    7.325   -11.441 1.00 21.15  ? 274 LEU A CB    1 
ATOM   1984  C  CG    . LEU A 1 261 ? 3.248    8.433   -11.391 1.00 21.15  ? 274 LEU A CG    1 
ATOM   1985  C  CD1   . LEU A 1 261 ? 1.845    7.880   -11.575 1.00 21.15  ? 274 LEU A CD1   1 
ATOM   1986  C  CD2   . LEU A 1 261 ? 3.346    9.213   -10.090 1.00 21.15  ? 274 LEU A CD2   1 
ATOM   1987  N  N     . PHE A 1 262 ? 5.856    4.662   -12.442 1.00 24.59  ? 275 PHE A N     1 
ATOM   1988  C  CA    . PHE A 1 262 ? 6.988    3.776   -12.194 1.00 24.59  ? 275 PHE A CA    1 
ATOM   1989  C  C     . PHE A 1 262 ? 7.192    2.764   -13.317 1.00 24.59  ? 275 PHE A C     1 
ATOM   1990  O  O     . PHE A 1 262 ? 6.230    2.292   -13.922 1.00 24.59  ? 275 PHE A O     1 
ATOM   1991  C  CB    . PHE A 1 262 ? 6.799    3.028   -10.870 1.00 24.59  ? 275 PHE A CB    1 
ATOM   1992  C  CG    . PHE A 1 262 ? 6.855    3.910   -9.656  1.00 24.59  ? 275 PHE A CG    1 
ATOM   1993  C  CD1   . PHE A 1 262 ? 5.724    4.578   -9.214  1.00 24.59  ? 275 PHE A CD1   1 
ATOM   1994  C  CD2   . PHE A 1 262 ? 8.037    4.059   -8.947  1.00 24.59  ? 275 PHE A CD2   1 
ATOM   1995  C  CE1   . PHE A 1 262 ? 5.772    5.387   -8.094  1.00 24.59  ? 275 PHE A CE1   1 
ATOM   1996  C  CE2   . PHE A 1 262 ? 8.092    4.866   -7.825  1.00 24.59  ? 275 PHE A CE2   1 
ATOM   1997  C  CZ    . PHE A 1 262 ? 6.957    5.531   -7.400  1.00 24.59  ? 275 PHE A CZ    1 
ATOM   1998  N  N     . VAL A 1 263 ? 8.453    2.438   -13.590 1.00 24.04  ? 276 VAL A N     1 
ATOM   1999  C  CA    . VAL A 1 263 ? 8.778    1.326   -14.472 1.00 24.04  ? 276 VAL A CA    1 
ATOM   2000  C  C     . VAL A 1 263 ? 8.372    0.041   -13.759 1.00 24.04  ? 276 VAL A C     1 
ATOM   2001  O  O     . VAL A 1 263 ? 8.351    -0.003  -12.530 1.00 24.04  ? 276 VAL A O     1 
ATOM   2002  C  CB    . VAL A 1 263 ? 10.286   1.284   -14.813 1.00 24.04  ? 276 VAL A CB    1 
ATOM   2003  C  CG1   . VAL A 1 263 ? 10.695   2.517   -15.604 1.00 24.04  ? 276 VAL A CG1   1 
ATOM   2004  C  CG2   . VAL A 1 263 ? 11.121   1.163   -13.551 1.00 24.04  ? 276 VAL A CG2   1 
ATOM   2005  N  N     . PRO A 1 264 ? 8.029    -1.008  -14.523 1.00 36.83  ? 277 PRO A N     1 
ATOM   2006  C  CA    . PRO A 1 264 ? 7.649    -2.275  -13.890 1.00 36.83  ? 277 PRO A CA    1 
ATOM   2007  C  C     . PRO A 1 264 ? 8.817    -2.892  -13.129 1.00 36.83  ? 277 PRO A C     1 
ATOM   2008  O  O     . PRO A 1 264 ? 9.968    -2.533  -13.377 1.00 36.83  ? 277 PRO A O     1 
ATOM   2009  C  CB    . PRO A 1 264 ? 7.266    -3.161  -15.081 1.00 36.83  ? 277 PRO A CB    1 
ATOM   2010  C  CG    . PRO A 1 264 ? 7.957    -2.550  -16.255 1.00 36.83  ? 277 PRO A CG    1 
ATOM   2011  C  CD    . PRO A 1 264 ? 7.950    -1.079  -15.992 1.00 36.83  ? 277 PRO A CD    1 
ATOM   2012  N  N     . GLY A 1 265 ? 8.523    -3.802  -12.207 1.00 8.79   ? 278 GLY A N     1 
ATOM   2013  C  CA    . GLY A 1 265 ? 9.565    -4.438  -11.423 1.00 8.79   ? 278 GLY A CA    1 
ATOM   2014  C  C     . GLY A 1 265 ? 10.000   -5.767  -12.007 1.00 8.79   ? 278 GLY A C     1 
ATOM   2015  O  O     . GLY A 1 265 ? 9.395    -6.265  -12.957 1.00 8.79   ? 278 GLY A O     1 
ATOM   2016  N  N     . ARG A 1 266 ? 11.054   -6.344  -11.438 1.00 66.55  ? 279 ARG A N     1 
ATOM   2017  C  CA    . ARG A 1 266 ? 11.546   -7.637  -11.896 1.00 66.55  ? 279 ARG A CA    1 
ATOM   2018  C  C     . ARG A 1 266 ? 11.278   -8.745  -10.884 1.00 66.55  ? 279 ARG A C     1 
ATOM   2019  O  O     . ARG A 1 266 ? 11.835   -8.748  -9.786  1.00 66.55  ? 279 ARG A O     1 
ATOM   2020  C  CB    . ARG A 1 266 ? 13.038   -7.561  -12.229 1.00 66.55  ? 279 ARG A CB    1 
ATOM   2021  C  CG    . ARG A 1 266 ? 13.326   -7.091  -13.645 1.00 66.55  ? 279 ARG A CG    1 
ATOM   2022  C  CD    . ARG A 1 266 ? 14.553   -6.194  -13.714 1.00 66.55  ? 279 ARG A CD    1 
ATOM   2023  N  NE    . ARG A 1 266 ? 14.869   -5.825  -15.091 1.00 66.55  ? 279 ARG A NE    1 
ATOM   2024  C  CZ    . ARG A 1 266 ? 14.263   -4.851  -15.763 1.00 66.55  ? 279 ARG A CZ    1 
ATOM   2025  N  NH1   . ARG A 1 266 ? 13.305   -4.139  -15.187 1.00 66.55  ? 279 ARG A NH1   1 
ATOM   2026  N  NH2   . ARG A 1 266 ? 14.615   -4.588  -17.015 1.00 66.55  ? 279 ARG A NH2   1 
ATOM   2027  N  N     . ASN A 1 267 ? 10.420   -9.685  -11.269 1.00 45.85  ? 280 ASN A N     1 
ATOM   2028  C  CA    . ASN A 1 267 ? 10.134   -10.865 -10.461 1.00 45.85  ? 280 ASN A CA    1 
ATOM   2029  C  C     . ASN A 1 267 ? 11.402   -11.693 -10.277 1.00 45.85  ? 280 ASN A C     1 
ATOM   2030  O  O     . ASN A 1 267 ? 12.406   -11.457 -10.946 1.00 45.85  ? 280 ASN A O     1 
ATOM   2031  C  CB    . ASN A 1 267 ? 9.057    -11.707 -11.149 1.00 45.85  ? 280 ASN A CB    1 
ATOM   2032  C  CG    . ASN A 1 267 ? 8.464    -12.770 -10.241 1.00 45.85  ? 280 ASN A CG    1 
ATOM   2033  O  OD1   . ASN A 1 267 ? 8.980    -13.042 -9.159  1.00 45.85  ? 280 ASN A OD1   1 
ATOM   2034  N  ND2   . ASN A 1 267 ? 7.377    -13.386 -10.689 1.00 45.85  ? 280 ASN A ND2   1 
ATOM   2035  N  N     . ALA A 1 268 ? 11.354   -12.676 -9.383  1.00 32.07  ? 281 ALA A N     1 
ATOM   2036  C  CA    . ALA A 1 268 ? 12.484   -13.577 -9.184  1.00 32.07  ? 281 ALA A CA    1 
ATOM   2037  C  C     . ALA A 1 268 ? 12.691   -14.480 -10.400 1.00 32.07  ? 281 ALA A C     1 
ATOM   2038  O  O     . ALA A 1 268 ? 13.619   -15.287 -10.432 1.00 32.07  ? 281 ALA A O     1 
ATOM   2039  C  CB    . ALA A 1 268 ? 12.288   -14.407 -7.930  1.00 32.07  ? 281 ALA A CB    1 
ATOM   2040  N  N     . LYS A 1 269 ? 11.810   -14.345 -11.387 1.00 57.77  ? 282 LYS A N     1 
ATOM   2041  C  CA    . LYS A 1 269 ? 11.950   -15.038 -12.660 1.00 57.77  ? 282 LYS A CA    1 
ATOM   2042  C  C     . LYS A 1 269 ? 12.287   -14.038 -13.760 1.00 57.77  ? 282 LYS A C     1 
ATOM   2043  O  O     . LYS A 1 269 ? 12.694   -14.421 -14.857 1.00 57.77  ? 282 LYS A O     1 
ATOM   2044  C  CB    . LYS A 1 269 ? 10.660   -15.778 -13.011 1.00 57.77  ? 282 LYS A CB    1 
ATOM   2045  C  CG    . LYS A 1 269 ? 10.324   -16.929 -12.080 1.00 57.77  ? 282 LYS A CG    1 
ATOM   2046  C  CD    . LYS A 1 269 ? 9.009    -17.585 -12.467 1.00 57.77  ? 282 LYS A CD    1 
ATOM   2047  C  CE    . LYS A 1 269 ? 8.848    -18.935 -11.789 1.00 57.77  ? 282 LYS A CE    1 
ATOM   2048  N  NZ    . LYS A 1 269 ? 9.887    -19.902 -12.237 1.00 57.77  ? 282 LYS A NZ    1 
ATOM   2049  N  N     . GLY A 1 270 ? 12.111   -12.755 -13.460 1.00 71.34  ? 283 GLY A N     1 
ATOM   2050  C  CA    . GLY A 1 270 ? 12.337   -11.707 -14.436 1.00 71.34  ? 283 GLY A CA    1 
ATOM   2051  C  C     . GLY A 1 270 ? 11.033   -11.200 -15.023 1.00 71.34  ? 283 GLY A C     1 
ATOM   2052  O  O     . GLY A 1 270 ? 11.030   -10.354 -15.917 1.00 71.34  ? 283 GLY A O     1 
ATOM   2053  N  N     . GLU A 1 271 ? 9.922    -11.726 -14.516 1.00 22.77  ? 284 GLU A N     1 
ATOM   2054  C  CA    . GLU A 1 271 ? 8.597    -11.328 -14.974 1.00 22.77  ? 284 GLU A CA    1 
ATOM   2055  C  C     . GLU A 1 271 ? 8.303    -9.887  -14.568 1.00 22.77  ? 284 GLU A C     1 
ATOM   2056  O  O     . GLU A 1 271 ? 8.859    -9.389  -13.588 1.00 22.77  ? 284 GLU A O     1 
ATOM   2057  C  CB    . GLU A 1 271 ? 7.535    -12.274 -14.408 1.00 22.77  ? 284 GLU A CB    1 
ATOM   2058  C  CG    . GLU A 1 271 ? 7.778    -13.745 -14.730 1.00 22.77  ? 284 GLU A CG    1 
ATOM   2059  C  CD    . GLU A 1 271 ? 6.753    -14.669 -14.095 1.00 22.77  ? 284 GLU A CD    1 
ATOM   2060  O  OE1   . GLU A 1 271 ? 6.558    -15.786 -14.619 1.00 22.77  ? 284 GLU A OE1   1 
ATOM   2061  O  OE2   . GLU A 1 271 ? 6.151    -14.284 -13.072 1.00 22.77  ? 284 GLU A OE2   1 
ATOM   2062  N  N     . TYR A 1 272 ? 7.436    -9.218  -15.322 1.00 61.70  ? 285 TYR A N     1 
ATOM   2063  C  CA    . TYR A 1 272 ? 7.112    -7.820  -15.045 1.00 61.70  ? 285 TYR A CA    1 
ATOM   2064  C  C     . TYR A 1 272 ? 6.063    -7.678  -13.943 1.00 61.70  ? 285 TYR A C     1 
ATOM   2065  O  O     . TYR A 1 272 ? 5.061    -8.394  -13.930 1.00 61.70  ? 285 TYR A O     1 
ATOM   2066  C  CB    . TYR A 1 272 ? 6.675    -7.099  -16.324 1.00 61.70  ? 285 TYR A CB    1 
ATOM   2067  C  CG    . TYR A 1 272 ? 7.817    -6.835  -17.283 1.00 61.70  ? 285 TYR A CG    1 
ATOM   2068  C  CD1   . TYR A 1 272 ? 8.773    -5.869  -17.001 1.00 61.70  ? 285 TYR A CD1   1 
ATOM   2069  C  CD2   . TYR A 1 272 ? 7.940    -7.549  -18.468 1.00 61.70  ? 285 TYR A CD2   1 
ATOM   2070  C  CE1   . TYR A 1 272 ? 9.818    -5.622  -17.867 1.00 61.70  ? 285 TYR A CE1   1 
ATOM   2071  C  CE2   . TYR A 1 272 ? 8.986    -7.307  -19.342 1.00 61.70  ? 285 TYR A CE2   1 
ATOM   2072  C  CZ    . TYR A 1 272 ? 9.921    -6.341  -19.035 1.00 61.70  ? 285 TYR A CZ    1 
ATOM   2073  O  OH    . TYR A 1 272 ? 10.965   -6.091  -19.896 1.00 61.70  ? 285 TYR A OH    1 
ATOM   2074  N  N     . ILE A 1 273 ? 6.310    -6.752  -13.020 1.00 14.38  ? 286 ILE A N     1 
ATOM   2075  C  CA    . ILE A 1 273 ? 5.448    -6.563  -11.857 1.00 14.38  ? 286 ILE A CA    1 
ATOM   2076  C  C     . ILE A 1 273 ? 5.124    -5.085  -11.621 1.00 14.38  ? 286 ILE A C     1 
ATOM   2077  O  O     . ILE A 1 273 ? 6.022    -4.245  -11.591 1.00 14.38  ? 286 ILE A O     1 
ATOM   2078  C  CB    . ILE A 1 273 ? 6.087    -7.178  -10.589 1.00 14.38  ? 286 ILE A CB    1 
ATOM   2079  C  CG1   . ILE A 1 273 ? 6.012    -8.702  -10.648 1.00 14.38  ? 286 ILE A CG1   1 
ATOM   2080  C  CG2   . ILE A 1 273 ? 5.408    -6.674  -9.326  1.00 14.38  ? 286 ILE A CG2   1 
ATOM   2081  C  CD1   . ILE A 1 273 ? 6.564    -9.391  -9.424  1.00 14.38  ? 286 ILE A CD1   1 
ATOM   2082  N  N     . ALA A 1 274 ? 3.837    -4.778  -11.459 1.00 11.55  ? 287 ALA A N     1 
ATOM   2083  C  CA    . ALA A 1 274 ? 3.392    -3.405  -11.222 1.00 11.55  ? 287 ALA A CA    1 
ATOM   2084  C  C     . ALA A 1 274 ? 2.382    -3.317  -10.079 1.00 11.55  ? 287 ALA A C     1 
ATOM   2085  O  O     . ALA A 1 274 ? 2.237    -4.256  -9.298  1.00 11.55  ? 287 ALA A O     1 
ATOM   2086  C  CB    . ALA A 1 274 ? 2.808    -2.808  -12.489 1.00 11.55  ? 287 ALA A CB    1 
ATOM   2087  N  N     . ASP A 1 275 ? 1.688    -2.183  -10.003 1.00 15.65  ? 288 ASP A N     1 
ATOM   2088  C  CA    . ASP A 1 275 ? 0.687    -1.913  -8.967  1.00 15.65  ? 288 ASP A CA    1 
ATOM   2089  C  C     . ASP A 1 275 ? -0.331   -3.043  -8.841  1.00 15.65  ? 288 ASP A C     1 
ATOM   2090  O  O     . ASP A 1 275 ? -0.792   -3.585  -9.841  1.00 15.65  ? 288 ASP A O     1 
ATOM   2091  C  CB    . ASP A 1 275 ? -0.035   -0.597  -9.278  1.00 15.65  ? 288 ASP A CB    1 
ATOM   2092  C  CG    . ASP A 1 275 ? -0.871   -0.081  -8.111  1.00 15.65  ? 288 ASP A CG    1 
ATOM   2093  O  OD1   . ASP A 1 275 ? -1.472   -0.888  -7.372  1.00 15.65  ? 288 ASP A OD1   1 
ATOM   2094  O  OD2   . ASP A 1 275 ? -0.935   1.155   -7.946  1.00 15.65  ? 288 ASP A OD2   1 
ATOM   2095  N  N     . GLY A 1 276 ? -0.682   -3.385  -7.605  1.00 9.50   ? 289 GLY A N     1 
ATOM   2096  C  CA    . GLY A 1 276 ? -1.653   -4.434  -7.355  1.00 9.50   ? 289 GLY A CA    1 
ATOM   2097  C  C     . GLY A 1 276 ? -3.076   -3.939  -7.505  1.00 9.50   ? 289 GLY A C     1 
ATOM   2098  O  O     . GLY A 1 276 ? -4.029   -4.714  -7.403  1.00 9.50   ? 289 GLY A O     1 
ATOM   2099  N  N     . GLY A 1 277 ? -3.220   -2.641  -7.751  1.00 32.65  ? 290 GLY A N     1 
ATOM   2100  C  CA    . GLY A 1 277 ? -4.531   -2.045  -7.916  1.00 32.65  ? 290 GLY A CA    1 
ATOM   2101  C  C     . GLY A 1 277 ? -4.644   -1.169  -9.147  1.00 32.65  ? 290 GLY A C     1 
ATOM   2102  O  O     . GLY A 1 277 ? -5.196   -0.070  -9.083  1.00 32.65  ? 290 GLY A O     1 
ATOM   2103  N  N     . ILE A 1 278 ? -4.110   -1.650  -10.267 1.00 42.00  ? 291 ILE A N     1 
ATOM   2104  C  CA    . ILE A 1 278 ? -4.309   -0.990  -11.553 1.00 42.00  ? 291 ILE A CA    1 
ATOM   2105  C  C     . ILE A 1 278 ? -5.805   -0.986  -11.845 1.00 42.00  ? 291 ILE A C     1 
ATOM   2106  O  O     . ILE A 1 278 ? -6.368   0.022   -12.272 1.00 42.00  ? 291 ILE A O     1 
ATOM   2107  C  CB    . ILE A 1 278 ? -3.539   -1.697  -12.683 1.00 42.00  ? 291 ILE A CB    1 
ATOM   2108  C  CG1   . ILE A 1 278 ? -2.030   -1.553  -12.469 1.00 42.00  ? 291 ILE A CG1   1 
ATOM   2109  C  CG2   . ILE A 1 278 ? -3.932   -1.133  -14.036 1.00 42.00  ? 291 ILE A CG2   1 
ATOM   2110  C  CD1   . ILE A 1 278 ? -1.187   -2.154  -13.576 1.00 42.00  ? 291 ILE A CD1   1 
ATOM   2111  N  N     . LEU A 1 279 ? -6.437   -2.129  -11.603 1.00 21.87  ? 292 LEU A N     1 
ATOM   2112  C  CA    . LEU A 1 279 ? -7.886   -2.209  -11.518 1.00 21.87  ? 292 LEU A CA    1 
ATOM   2113  C  C     . LEU A 1 279 ? -8.227   -2.356  -10.042 1.00 21.87  ? 292 LEU A C     1 
ATOM   2114  O  O     . LEU A 1 279 ? -7.417   -2.874  -9.272  1.00 21.87  ? 292 LEU A O     1 
ATOM   2115  C  CB    . LEU A 1 279 ? -8.411   -3.414  -12.294 1.00 21.87  ? 292 LEU A CB    1 
ATOM   2116  C  CG    . LEU A 1 279 ? -8.102   -3.492  -13.787 1.00 21.87  ? 292 LEU A CG    1 
ATOM   2117  C  CD1   . LEU A 1 279 ? -8.734   -4.731  -14.395 1.00 21.87  ? 292 LEU A CD1   1 
ATOM   2118  C  CD2   . LEU A 1 279 ? -8.582   -2.246  -14.501 1.00 21.87  ? 292 LEU A CD2   1 
ATOM   2119  N  N     . ASP A 1 280 ? -9.408   -1.891  -9.643  1.00 26.11  ? 293 ASP A N     1 
ATOM   2120  C  CA    . ASP A 1 280 ? -9.837   -2.021  -8.255  1.00 26.11  ? 293 ASP A CA    1 
ATOM   2121  C  C     . ASP A 1 280 ? -9.883   -3.489  -7.842  1.00 26.11  ? 293 ASP A C     1 
ATOM   2122  O  O     . ASP A 1 280 ? -10.447  -4.327  -8.548  1.00 26.11  ? 293 ASP A O     1 
ATOM   2123  C  CB    . ASP A 1 280 ? -11.198  -1.357  -8.039  1.00 26.11  ? 293 ASP A CB    1 
ATOM   2124  C  CG    . ASP A 1 280 ? -11.104  0.156   -7.962  1.00 26.11  ? 293 ASP A CG    1 
ATOM   2125  O  OD1   . ASP A 1 280 ? -10.082  0.711   -8.413  1.00 26.11  ? 293 ASP A OD1   1 
ATOM   2126  O  OD2   . ASP A 1 280 ? -12.053  0.790   -7.453  1.00 26.11  ? 293 ASP A OD2   1 
ATOM   2127  N  N     . ASN A 1 281 ? -9.272   -3.795  -6.702  1.00 38.06  ? 294 ASN A N     1 
ATOM   2128  C  CA    . ASN A 1 281 ? -9.194   -5.168  -6.225  1.00 38.06  ? 294 ASN A CA    1 
ATOM   2129  C  C     . ASN A 1 281 ? -9.096   -5.245  -4.707  1.00 38.06  ? 294 ASN A C     1 
ATOM   2130  O  O     . ASN A 1 281 ? -8.308   -4.529  -4.089  1.00 38.06  ? 294 ASN A O     1 
ATOM   2131  C  CB    . ASN A 1 281 ? -8.002   -5.884  -6.861  1.00 38.06  ? 294 ASN A CB    1 
ATOM   2132  C  CG    . ASN A 1 281 ? -7.850   -7.308  -6.371  1.00 38.06  ? 294 ASN A CG    1 
ATOM   2133  O  OD1   . ASN A 1 281 ? -8.502   -8.222  -6.874  1.00 38.06  ? 294 ASN A OD1   1 
ATOM   2134  N  ND2   . ASN A 1 281 ? -6.976   -7.507  -5.392  1.00 38.06  ? 294 ASN A ND2   1 
ATOM   2135  N  N     . MET A 1 282 ? -9.905   -6.117  -4.112  1.00 35.14  ? 295 MET A N     1 
ATOM   2136  C  CA    . MET A 1 282 ? -9.886   -6.314  -2.670  1.00 35.14  ? 295 MET A CA    1 
ATOM   2137  C  C     . MET A 1 282 ? -9.282   -7.670  -2.327  1.00 35.14  ? 295 MET A C     1 
ATOM   2138  O  O     . MET A 1 282 ? -9.911   -8.706  -2.544  1.00 35.14  ? 295 MET A O     1 
ATOM   2139  C  CB    . MET A 1 282 ? -11.295  -6.209  -2.093  1.00 35.14  ? 295 MET A CB    1 
ATOM   2140  C  CG    . MET A 1 282 ? -11.376  -6.472  -0.599  1.00 35.14  ? 295 MET A CG    1 
ATOM   2141  S  SD    . MET A 1 282 ? -11.821  -5.009  0.352   1.00 35.14  ? 295 MET A SD    1 
ATOM   2142  C  CE    . MET A 1 282 ? -10.351  -4.010  0.155   1.00 35.14  ? 295 MET A CE    1 
ATOM   2143  N  N     . PRO A 1 283 ? -8.049   -7.667  -1.798  1.00 48.18  ? 296 PRO A N     1 
ATOM   2144  C  CA    . PRO A 1 283 ? -7.362   -8.898  -1.397  1.00 48.18  ? 296 PRO A CA    1 
ATOM   2145  C  C     . PRO A 1 283 ? -8.123   -9.626  -0.299  1.00 48.18  ? 296 PRO A C     1 
ATOM   2146  O  O     . PRO A 1 283 ? -8.935   -9.014  0.394   1.00 48.18  ? 296 PRO A O     1 
ATOM   2147  C  CB    . PRO A 1 283 ? -6.032   -8.387  -0.840  1.00 48.18  ? 296 PRO A CB    1 
ATOM   2148  C  CG    . PRO A 1 283 ? -5.828   -7.062  -1.487  1.00 48.18  ? 296 PRO A CG    1 
ATOM   2149  C  CD    . PRO A 1 283 ? -7.196   -6.477  -1.630  1.00 48.18  ? 296 PRO A CD    1 
ATOM   2150  N  N     . GLU A 1 284 ? -7.864   -10.920 -0.147  1.00 58.36  ? 297 GLU A N     1 
ATOM   2151  C  CA    . GLU A 1 284 ? -8.471   -11.697 0.924   1.00 58.36  ? 297 GLU A CA    1 
ATOM   2152  C  C     . GLU A 1 284 ? -7.390   -12.348 1.777   1.00 58.36  ? 297 GLU A C     1 
ATOM   2153  O  O     . GLU A 1 284 ? -6.441   -12.932 1.253   1.00 58.36  ? 297 GLU A O     1 
ATOM   2154  C  CB    . GLU A 1 284 ? -9.416   -12.759 0.357   1.00 58.36  ? 297 GLU A CB    1 
ATOM   2155  C  CG    . GLU A 1 284 ? -10.605  -12.192 -0.407  1.00 58.36  ? 297 GLU A CG    1 
ATOM   2156  C  CD    . GLU A 1 284 ? -11.575  -13.266 -0.864  1.00 58.36  ? 297 GLU A CD    1 
ATOM   2157  O  OE1   . GLU A 1 284 ? -11.286  -14.461 -0.654  1.00 58.36  ? 297 GLU A OE1   1 
ATOM   2158  O  OE2   . GLU A 1 284 ? -12.629  -12.912 -1.433  1.00 58.36  ? 297 GLU A OE2   1 
ATOM   2159  N  N     . ILE A 1 285 ? -7.534   -12.239 3.093   1.00 13.57  ? 298 ILE A N     1 
ATOM   2160  C  CA    . ILE A 1 285 ? -6.584   -12.845 4.017   1.00 13.57  ? 298 ILE A CA    1 
ATOM   2161  C  C     . ILE A 1 285 ? -6.892   -14.327 4.205   1.00 13.57  ? 298 ILE A C     1 
ATOM   2162  O  O     . ILE A 1 285 ? -7.942   -14.688 4.735   1.00 13.57  ? 298 ILE A O     1 
ATOM   2163  C  CB    . ILE A 1 285 ? -6.607   -12.145 5.384   1.00 13.57  ? 298 ILE A CB    1 
ATOM   2164  C  CG1   . ILE A 1 285 ? -6.385   -10.642 5.217   1.00 13.57  ? 298 ILE A CG1   1 
ATOM   2165  C  CG2   . ILE A 1 285 ? -5.555   -12.741 6.298   1.00 13.57  ? 298 ILE A CG2   1 
ATOM   2166  C  CD1   . ILE A 1 285 ? -6.473   -9.858  6.512   1.00 13.57  ? 298 ILE A CD1   1 
ATOM   2167  N  N     . GLU A 1 286 ? -5.971   -15.182 3.767   1.00 54.45  ? 299 GLU A N     1 
ATOM   2168  C  CA    . GLU A 1 286 ? -6.169   -16.624 3.848   1.00 54.45  ? 299 GLU A CA    1 
ATOM   2169  C  C     . GLU A 1 286 ? -6.070   -17.120 5.284   1.00 54.45  ? 299 GLU A C     1 
ATOM   2170  O  O     . GLU A 1 286 ? -5.152   -16.751 6.013   1.00 54.45  ? 299 GLU A O     1 
ATOM   2171  C  CB    . GLU A 1 286 ? -5.155   -17.356 2.968   1.00 54.45  ? 299 GLU A CB    1 
ATOM   2172  C  CG    . GLU A 1 286 ? -5.279   -18.873 3.009   1.00 54.45  ? 299 GLU A CG    1 
ATOM   2173  C  CD    . GLU A 1 286 ? -4.463   -19.556 1.930   1.00 54.45  ? 299 GLU A CD    1 
ATOM   2174  O  OE1   . GLU A 1 286 ? -4.823   -20.688 1.543   1.00 54.45  ? 299 GLU A OE1   1 
ATOM   2175  O  OE2   . GLU A 1 286 ? -3.464   -18.964 1.469   1.00 54.45  ? 299 GLU A OE2   1 
ATOM   2176  N  N     . GLY A 1 287 ? -7.023   -17.955 5.685   1.00 38.06  ? 300 GLY A N     1 
ATOM   2177  C  CA    . GLY A 1 287 ? -7.021   -18.527 7.018   1.00 38.06  ? 300 GLY A CA    1 
ATOM   2178  C  C     . GLY A 1 287 ? -7.988   -17.852 7.970   1.00 38.06  ? 300 GLY A C     1 
ATOM   2179  O  O     . GLY A 1 287 ? -8.037   -18.191 9.152   1.00 38.06  ? 300 GLY A O     1 
ATOM   2180  N  N     . LEU A 1 288 ? -8.758   -16.896 7.459   1.00 16.92  ? 301 LEU A N     1 
ATOM   2181  C  CA    . LEU A 1 288 ? -9.732   -16.179 8.276   1.00 16.92  ? 301 LEU A CA    1 
ATOM   2182  C  C     . LEU A 1 288 ? -11.119  -16.223 7.640   1.00 16.92  ? 301 LEU A C     1 
ATOM   2183  O  O     . LEU A 1 288 ? -11.255  -16.531 6.456   1.00 16.92  ? 301 LEU A O     1 
ATOM   2184  C  CB    . LEU A 1 288 ? -9.303   -14.724 8.476   1.00 16.92  ? 301 LEU A CB    1 
ATOM   2185  C  CG    . LEU A 1 288 ? -7.919   -14.459 9.066   1.00 16.92  ? 301 LEU A CG    1 
ATOM   2186  C  CD1   . LEU A 1 288 ? -7.699   -12.970 9.263   1.00 16.92  ? 301 LEU A CD1   1 
ATOM   2187  C  CD2   . LEU A 1 288 ? -7.745   -15.198 10.375  1.00 16.92  ? 301 LEU A CD2   1 
ATOM   2188  N  N     . ASP A 1 289 ? -12.144  -15.919 8.431   1.00 48.31  ? 302 ASP A N     1 
ATOM   2189  C  CA    . ASP A 1 289 ? -13.509  -15.839 7.924   1.00 48.31  ? 302 ASP A CA    1 
ATOM   2190  C  C     . ASP A 1 289 ? -13.788  -14.423 7.435   1.00 48.31  ? 302 ASP A C     1 
ATOM   2191  O  O     . ASP A 1 289 ? -12.979  -13.524 7.648   1.00 48.31  ? 302 ASP A O     1 
ATOM   2192  C  CB    . ASP A 1 289 ? -14.512  -16.231 9.010   1.00 48.31  ? 302 ASP A CB    1 
ATOM   2193  C  CG    . ASP A 1 289 ? -14.381  -17.683 9.434   1.00 48.31  ? 302 ASP A CG    1 
ATOM   2194  O  OD1   . ASP A 1 289 ? -14.188  -18.545 8.553   1.00 48.31  ? 302 ASP A OD1   1 
ATOM   2195  O  OD2   . ASP A 1 289 ? -14.468  -17.960 10.650  1.00 48.31  ? 302 ASP A OD2   1 
ATOM   2196  N  N     . ARG A 1 290 ? -14.929  -14.226 6.781   1.00 30.04  ? 303 ARG A N     1 
ATOM   2197  C  CA    . ARG A 1 290 ? -15.280  -12.916 6.243   1.00 30.04  ? 303 ARG A CA    1 
ATOM   2198  C  C     . ARG A 1 290 ? -15.699  -11.948 7.348   1.00 30.04  ? 303 ARG A C     1 
ATOM   2199  O  O     . ARG A 1 290 ? -15.438  -10.749 7.265   1.00 30.04  ? 303 ARG A O     1 
ATOM   2200  C  CB    . ARG A 1 290 ? -16.404  -13.042 5.211   1.00 30.04  ? 303 ARG A CB    1 
ATOM   2201  C  CG    . ARG A 1 290 ? -16.728  -11.746 4.476   1.00 30.04  ? 303 ARG A CG    1 
ATOM   2202  C  CD    . ARG A 1 290 ? -18.185  -11.693 4.033   1.00 30.04  ? 303 ARG A CD    1 
ATOM   2203  N  NE    . ARG A 1 290 ? -19.096  -11.618 5.171   1.00 30.04  ? 303 ARG A NE    1 
ATOM   2204  C  CZ    . ARG A 1 290 ? -19.458  -10.485 5.763   1.00 30.04  ? 303 ARG A CZ    1 
ATOM   2205  N  NH1   . ARG A 1 290 ? -18.987  -9.327  5.324   1.00 30.04  ? 303 ARG A NH1   1 
ATOM   2206  N  NH2   . ARG A 1 290 ? -20.292  -10.506 6.794   1.00 30.04  ? 303 ARG A NH2   1 
ATOM   2207  N  N     . GLU A 1 291 ? -16.338  -12.481 8.384   1.00 36.93  ? 304 GLU A N     1 
ATOM   2208  C  CA    . GLU A 1 291 ? -16.920  -11.658 9.441   1.00 36.93  ? 304 GLU A CA    1 
ATOM   2209  C  C     . GLU A 1 291 ? -15.931  -11.229 10.526  1.00 36.93  ? 304 GLU A C     1 
ATOM   2210  O  O     . GLU A 1 291 ? -16.321  -10.597 11.509  1.00 36.93  ? 304 GLU A O     1 
ATOM   2211  C  CB    . GLU A 1 291 ? -18.121  -12.369 10.075  1.00 36.93  ? 304 GLU A CB    1 
ATOM   2212  C  CG    . GLU A 1 291 ? -18.065  -13.887 10.001  1.00 36.93  ? 304 GLU A CG    1 
ATOM   2213  C  CD    . GLU A 1 291 ? -18.754  -14.437 8.766   1.00 36.93  ? 304 GLU A CD    1 
ATOM   2214  O  OE1   . GLU A 1 291 ? -19.879  -13.989 8.462   1.00 36.93  ? 304 GLU A OE1   1 
ATOM   2215  O  OE2   . GLU A 1 291 ? -18.175  -15.319 8.101   1.00 36.93  ? 304 GLU A OE2   1 
ATOM   2216  N  N     . GLU A 1 292 ? -14.659  -11.569 10.353  1.00 32.29  ? 305 GLU A N     1 
ATOM   2217  C  CA    . GLU A 1 292 ? -13.632  -11.123 11.288  1.00 32.29  ? 305 GLU A CA    1 
ATOM   2218  C  C     . GLU A 1 292 ? -12.528  -10.365 10.562  1.00 32.29  ? 305 GLU A C     1 
ATOM   2219  O  O     . GLU A 1 292 ? -11.391  -10.298 11.032  1.00 32.29  ? 305 GLU A O     1 
ATOM   2220  C  CB    . GLU A 1 292 ? -13.051  -12.300 12.079  1.00 32.29  ? 305 GLU A CB    1 
ATOM   2221  C  CG    . GLU A 1 292 ? -12.460  -13.411 11.222  1.00 32.29  ? 305 GLU A CG    1 
ATOM   2222  C  CD    . GLU A 1 292 ? -11.960  -14.584 12.048  1.00 32.29  ? 305 GLU A CD    1 
ATOM   2223  O  OE1   . GLU A 1 292 ? -11.480  -15.569 11.450  1.00 32.29  ? 305 GLU A OE1   1 
ATOM   2224  O  OE2   . GLU A 1 292 ? -12.046  -14.524 13.293  1.00 32.29  ? 305 GLU A OE2   1 
ATOM   2225  N  N     . VAL A 1 293 ? -12.877  -9.793  9.413   1.00 11.21  ? 306 VAL A N     1 
ATOM   2226  C  CA    . VAL A 1 293 ? -11.930  -9.030  8.608   1.00 11.21  ? 306 VAL A CA    1 
ATOM   2227  C  C     . VAL A 1 293 ? -12.506  -7.671  8.223   1.00 11.21  ? 306 VAL A C     1 
ATOM   2228  O  O     . VAL A 1 293 ? -13.541  -7.597  7.564   1.00 11.21  ? 306 VAL A O     1 
ATOM   2229  C  CB    . VAL A 1 293 ? -11.550  -9.785  7.322   1.00 11.21  ? 306 VAL A CB    1 
ATOM   2230  C  CG1   . VAL A 1 293 ? -10.611  -8.947  6.478   1.00 11.21  ? 306 VAL A CG1   1 
ATOM   2231  C  CG2   . VAL A 1 293 ? -10.909  -11.118 7.653   1.00 11.21  ? 306 VAL A CG2   1 
ATOM   2232  N  N     . LEU A 1 294 ? -11.832  -6.600  8.631   1.00 1.85   ? 307 LEU A N     1 
ATOM   2233  C  CA    . LEU A 1 294 ? -12.241  -5.255  8.242   1.00 1.85   ? 307 LEU A CA    1 
ATOM   2234  C  C     . LEU A 1 294 ? -11.729  -4.922  6.842   1.00 1.85   ? 307 LEU A C     1 
ATOM   2235  O  O     . LEU A 1 294 ? -10.525  -4.961  6.588   1.00 1.85   ? 307 LEU A O     1 
ATOM   2236  C  CB    . LEU A 1 294 ? -11.736  -4.218  9.247   1.00 1.85   ? 307 LEU A CB    1 
ATOM   2237  C  CG    . LEU A 1 294 ? -12.452  -4.154  10.597  1.00 1.85   ? 307 LEU A CG    1 
ATOM   2238  C  CD1   . LEU A 1 294 ? -11.706  -3.265  11.575  1.00 1.85   ? 307 LEU A CD1   1 
ATOM   2239  C  CD2   . LEU A 1 294 ? -13.871  -3.654  10.418  1.00 1.85   ? 307 LEU A CD2   1 
ATOM   2240  N  N     . CYS A 1 295 ? -12.647  -4.604  5.936   1.00 15.99  ? 308 CYS A N     1 
ATOM   2241  C  CA    . CYS A 1 295 ? -12.279  -4.263  4.566   1.00 15.99  ? 308 CYS A CA    1 
ATOM   2242  C  C     . CYS A 1 295 ? -12.411  -2.764  4.317   1.00 15.99  ? 308 CYS A C     1 
ATOM   2243  O  O     . CYS A 1 295 ? -13.425  -2.157  4.661   1.00 15.99  ? 308 CYS A O     1 
ATOM   2244  C  CB    . CYS A 1 295 ? -13.139  -5.042  3.574   1.00 15.99  ? 308 CYS A CB    1 
ATOM   2245  S  SG    . CYS A 1 295 ? -12.780  -6.810  3.500   1.00 15.99  ? 308 CYS A SG    1 
ATOM   2246  N  N     . VAL A 1 296 ? -11.382  -2.173  3.719   1.00 30.24  ? 309 VAL A N     1 
ATOM   2247  C  CA    . VAL A 1 296 ? -11.367  -0.739  3.453   1.00 30.24  ? 309 VAL A CA    1 
ATOM   2248  C  C     . VAL A 1 296 ? -11.181  -0.454  1.965   1.00 30.24  ? 309 VAL A C     1 
ATOM   2249  O  O     . VAL A 1 296 ? -10.231  -0.940  1.349   1.00 30.24  ? 309 VAL A O     1 
ATOM   2250  C  CB    . VAL A 1 296 ? -10.253  -0.037  4.245   1.00 30.24  ? 309 VAL A CB    1 
ATOM   2251  C  CG1   . VAL A 1 296 ? -10.171  1.426   3.866   1.00 30.24  ? 309 VAL A CG1   1 
ATOM   2252  C  CG2   . VAL A 1 296 ? -10.493  -0.182  5.735   1.00 30.24  ? 309 VAL A CG2   1 
ATOM   2253  N  N     . LYS A 1 297 ? -12.089  0.333   1.394   1.00 16.57  ? 310 LYS A N     1 
ATOM   2254  C  CA    . LYS A 1 297 ? -12.019  0.685   -0.021  1.00 16.57  ? 310 LYS A CA    1 
ATOM   2255  C  C     . LYS A 1 297 ? -12.164  2.186   -0.234  1.00 16.57  ? 310 LYS A C     1 
ATOM   2256  O  O     . LYS A 1 297 ? -13.134  2.797   0.209   1.00 16.57  ? 310 LYS A O     1 
ATOM   2257  C  CB    . LYS A 1 297 ? -13.087  -0.068  -0.818  1.00 16.57  ? 310 LYS A CB    1 
ATOM   2258  C  CG    . LYS A 1 297 ? -13.270  0.415   -2.254  1.00 16.57  ? 310 LYS A CG    1 
ATOM   2259  C  CD    . LYS A 1 297 ? -14.101  -0.575  -3.063  1.00 16.57  ? 310 LYS A CD    1 
ATOM   2260  C  CE    . LYS A 1 297 ? -14.628  0.043   -4.352  1.00 16.57  ? 310 LYS A CE    1 
ATOM   2261  N  NZ    . LYS A 1 297 ? -13.548  0.589   -5.217  1.00 16.57  ? 310 LYS A NZ    1 
ATOM   2262  N  N     . ALA A 1 298 ? -11.187  2.777   -0.911  1.00 30.17  ? 311 ALA A N     1 
ATOM   2263  C  CA    . ALA A 1 298 ? -11.247  4.190   -1.254  1.00 30.17  ? 311 ALA A CA    1 
ATOM   2264  C  C     . ALA A 1 298 ? -11.879  4.361   -2.629  1.00 30.17  ? 311 ALA A C     1 
ATOM   2265  O  O     . ALA A 1 298 ? -11.379  3.827   -3.619  1.00 30.17  ? 311 ALA A O     1 
ATOM   2266  C  CB    . ALA A 1 298 ? -9.863   4.800   -1.227  1.00 30.17  ? 311 ALA A CB    1 
ATOM   2267  N  N     . GLU A 1 299 ? -12.979  5.103   -2.685  1.00 32.08  ? 312 GLU A N     1 
ATOM   2268  C  CA    . GLU A 1 299 ? -13.665  5.361   -3.945  1.00 32.08  ? 312 GLU A CA    1 
ATOM   2269  C  C     . GLU A 1 299 ? -13.499  6.818   -4.357  1.00 32.08  ? 312 GLU A C     1 
ATOM   2270  O  O     . GLU A 1 299 ? -13.186  7.673   -3.532  1.00 32.08  ? 312 GLU A O     1 
ATOM   2271  C  CB    . GLU A 1 299 ? -15.153  5.017   -3.826  1.00 32.08  ? 312 GLU A CB    1 
ATOM   2272  C  CG    . GLU A 1 299 ? -15.446  3.539   -3.613  1.00 32.08  ? 312 GLU A CG    1 
ATOM   2273  C  CD    . GLU A 1 299 ? -16.910  3.268   -3.312  1.00 32.08  ? 312 GLU A CD    1 
ATOM   2274  O  OE1   . GLU A 1 299 ? -17.419  2.205   -3.727  1.00 32.08  ? 312 GLU A OE1   1 
ATOM   2275  O  OE2   . GLU A 1 299 ? -17.547  4.113   -2.651  1.00 32.08  ? 312 GLU A OE2   1 
ATOM   2276  N  N     . ALA A 1 300 ? -13.710  7.093   -5.640  1.00 30.33  ? 313 ALA A N     1 
ATOM   2277  C  CA    . ALA A 1 300 ? -13.682  8.461   -6.144  1.00 30.33  ? 313 ALA A CA    1 
ATOM   2278  C  C     . ALA A 1 300 ? -14.847  9.249   -5.556  1.00 30.33  ? 313 ALA A C     1 
ATOM   2279  O  O     . ALA A 1 300 ? -15.791  8.662   -5.029  1.00 30.33  ? 313 ALA A O     1 
ATOM   2280  C  CB    . ALA A 1 300 ? -13.750  8.467   -7.657  1.00 30.33  ? 313 ALA A CB    1 
ATOM   2281  N  N     . GLY A 1 301 ? -14.778  10.573  -5.650  1.00 43.68  ? 314 GLY A N     1 
ATOM   2282  C  CA    . GLY A 1 301 ? -15.820  11.429  -5.111  1.00 43.68  ? 314 GLY A CA    1 
ATOM   2283  C  C     . GLY A 1 301 ? -17.184  11.153  -5.713  1.00 43.68  ? 314 GLY A C     1 
ATOM   2284  O  O     . GLY A 1 301 ? -18.177  11.028  -4.995  1.00 43.68  ? 314 GLY A O     1 
ATOM   2285  N  N     . THR A 1 302 ? -17.231  11.050  -7.037  1.00 69.73  ? 315 THR A N     1 
ATOM   2286  C  CA    . THR A 1 302 ? -18.474  10.765  -7.740  1.00 69.73  ? 315 THR A CA    1 
ATOM   2287  C  C     . THR A 1 302 ? -18.936  9.342   -7.456  1.00 69.73  ? 315 THR A C     1 
ATOM   2288  O  O     . THR A 1 302 ? -20.130  9.082   -7.320  1.00 69.73  ? 315 THR A O     1 
ATOM   2289  C  CB    . THR A 1 302 ? -18.310  10.931  -9.258  1.00 69.73  ? 315 THR A CB    1 
ATOM   2290  O  OG1   . THR A 1 302 ? -17.681  9.766   -9.805  1.00 69.73  ? 315 THR A OG1   1 
ATOM   2291  C  CG2   . THR A 1 302 ? -17.472  12.158  -9.575  1.00 69.73  ? 315 THR A CG2   1 
ATOM   2292  N  N     . ALA A 1 303 ? -17.980  8.422   -7.374  1.00 51.85  ? 316 ALA A N     1 
ATOM   2293  C  CA    . ALA A 1 303 ? -18.285  7.022   -7.104  1.00 51.85  ? 316 ALA A CA    1 
ATOM   2294  C  C     . ALA A 1 303 ? -18.788  6.823   -5.679  1.00 51.85  ? 316 ALA A C     1 
ATOM   2295  O  O     . ALA A 1 303 ? -19.556  5.902   -5.408  1.00 51.85  ? 316 ALA A O     1 
ATOM   2296  C  CB    . ALA A 1 303 ? -17.066  6.155   -7.360  1.00 51.85  ? 316 ALA A CB    1 
ATOM   2297  N  N     . PHE A 1 304 ? -18.345  7.688   -4.771  1.00 32.24  ? 317 PHE A N     1 
ATOM   2298  C  CA    . PHE A 1 304 ? -18.751  7.606   -3.373  1.00 32.24  ? 317 PHE A CA    1 
ATOM   2299  C  C     . PHE A 1 304 ? -20.194  8.061   -3.198  1.00 32.24  ? 317 PHE A C     1 
ATOM   2300  O  O     . PHE A 1 304 ? -21.027  7.318   -2.679  1.00 32.24  ? 317 PHE A O     1 
ATOM   2301  C  CB    . PHE A 1 304 ? -17.827  8.454   -2.498  1.00 32.24  ? 317 PHE A CB    1 
ATOM   2302  C  CG    . PHE A 1 304 ? -18.080  8.307   -1.023  1.00 32.24  ? 317 PHE A CG    1 
ATOM   2303  C  CD1   . PHE A 1 304 ? -17.466  7.296   -0.302  1.00 32.24  ? 317 PHE A CD1   1 
ATOM   2304  C  CD2   . PHE A 1 304 ? -18.925  9.182   -0.357  1.00 32.24  ? 317 PHE A CD2   1 
ATOM   2305  C  CE1   . PHE A 1 304 ? -17.693  7.155   1.055   1.00 32.24  ? 317 PHE A CE1   1 
ATOM   2306  C  CE2   . PHE A 1 304 ? -19.157  9.047   0.999   1.00 32.24  ? 317 PHE A CE2   1 
ATOM   2307  C  CZ    . PHE A 1 304 ? -18.539  8.031   1.705   1.00 32.24  ? 317 PHE A CZ    1 
ATOM   2308  N  N     . GLU A 1 305 ? -20.480  9.287   -3.629  1.00 57.40  ? 318 GLU A N     1 
ATOM   2309  C  CA    . GLU A 1 305 ? -21.813  9.869   -3.503  1.00 57.40  ? 318 GLU A CA    1 
ATOM   2310  C  C     . GLU A 1 305 ? -22.871  9.037   -4.222  1.00 57.40  ? 318 GLU A C     1 
ATOM   2311  O  O     . GLU A 1 305 ? -24.001  8.920   -3.752  1.00 57.40  ? 318 GLU A O     1 
ATOM   2312  C  CB    . GLU A 1 305 ? -21.822  11.301  -4.044  1.00 57.40  ? 318 GLU A CB    1 
ATOM   2313  C  CG    . GLU A 1 305 ? -20.902  12.261  -3.306  1.00 57.40  ? 318 GLU A CG    1 
ATOM   2314  C  CD    . GLU A 1 305 ? -20.781  13.601  -4.005  1.00 57.40  ? 318 GLU A CD    1 
ATOM   2315  O  OE1   . GLU A 1 305 ? -21.087  13.670  -5.213  1.00 57.40  ? 318 GLU A OE1   1 
ATOM   2316  O  OE2   . GLU A 1 305 ? -20.381  14.585  -3.347  1.00 57.40  ? 318 GLU A OE2   1 
ATOM   2317  N  N     . ASP A 1 306 ? -22.496  8.464   -5.360  1.00 61.11  ? 319 ASP A N     1 
ATOM   2318  C  CA    . ASP A 1 306 ? -23.411  7.655   -6.158  1.00 61.11  ? 319 ASP A CA    1 
ATOM   2319  C  C     . ASP A 1 306 ? -23.904  6.444   -5.367  1.00 61.11  ? 319 ASP A C     1 
ATOM   2320  O  O     . ASP A 1 306 ? -25.088  6.112   -5.400  1.00 61.11  ? 319 ASP A O     1 
ATOM   2321  C  CB    . ASP A 1 306 ? -22.725  7.202   -7.449  1.00 61.11  ? 319 ASP A CB    1 
ATOM   2322  C  CG    . ASP A 1 306 ? -23.696  7.026   -8.601  1.00 61.11  ? 319 ASP A CG    1 
ATOM   2323  O  OD1   . ASP A 1 306 ? -24.893  6.780   -8.346  1.00 61.11  ? 319 ASP A OD1   1 
ATOM   2324  O  OD2   . ASP A 1 306 ? -23.258  7.133   -9.767  1.00 61.11  ? 319 ASP A OD2   1 
ATOM   2325  N  N     . ARG A 1 307 ? -22.993  5.799   -4.644  1.00 32.16  ? 320 ARG A N     1 
ATOM   2326  C  CA    . ARG A 1 307 ? -23.333  4.623   -3.846  1.00 32.16  ? 320 ARG A CA    1 
ATOM   2327  C  C     . ARG A 1 307 ? -24.159  4.997   -2.618  1.00 32.16  ? 320 ARG A C     1 
ATOM   2328  O  O     . ARG A 1 307 ? -25.084  4.279   -2.240  1.00 32.16  ? 320 ARG A O     1 
ATOM   2329  C  CB    . ARG A 1 307 ? -22.068  3.883   -3.409  1.00 32.16  ? 320 ARG A CB    1 
ATOM   2330  C  CG    . ARG A 1 307 ? -22.336  2.548   -2.728  1.00 32.16  ? 320 ARG A CG    1 
ATOM   2331  C  CD    . ARG A 1 307 ? -21.198  2.143   -1.803  1.00 32.16  ? 320 ARG A CD    1 
ATOM   2332  N  NE    . ARG A 1 307 ? -21.224  2.888   -0.547  1.00 32.16  ? 320 ARG A NE    1 
ATOM   2333  C  CZ    . ARG A 1 307 ? -20.428  3.915   -0.270  1.00 32.16  ? 320 ARG A CZ    1 
ATOM   2334  N  NH1   . ARG A 1 307 ? -19.533  4.320   -1.158  1.00 32.16  ? 320 ARG A NH1   1 
ATOM   2335  N  NH2   . ARG A 1 307 ? -20.522  4.537   0.898   1.00 32.16  ? 320 ARG A NH2   1 
ATOM   2336  N  N     . VAL A 1 308 ? -23.815  6.122   -1.997  1.00 29.96  ? 321 VAL A N     1 
ATOM   2337  C  CA    . VAL A 1 308 ? -24.524  6.592   -0.813  1.00 29.96  ? 321 VAL A CA    1 
ATOM   2338  C  C     . VAL A 1 308 ? -25.946  7.023   -1.165  1.00 29.96  ? 321 VAL A C     1 
ATOM   2339  O  O     . VAL A 1 308 ? -26.888  6.753   -0.418  1.00 29.96  ? 321 VAL A O     1 
ATOM   2340  C  CB    . VAL A 1 308 ? -23.778  7.756   -0.132  1.00 29.96  ? 321 VAL A CB    1 
ATOM   2341  C  CG1   . VAL A 1 308 ? -24.519  8.217   1.110   1.00 29.96  ? 321 VAL A CG1   1 
ATOM   2342  C  CG2   . VAL A 1 308 ? -22.364  7.337   0.231   1.00 29.96  ? 321 VAL A CG2   1 
ATOM   2343  N  N     . ASN A 1 309 ? -26.097  7.684   -2.309  1.00 24.99  ? 322 ASN A N     1 
ATOM   2344  C  CA    . ASN A 1 309 ? -27.406  8.142   -2.762  1.00 24.99  ? 322 ASN A CA    1 
ATOM   2345  C  C     . ASN A 1 309 ? -28.340  6.998   -3.152  1.00 24.99  ? 322 ASN A C     1 
ATOM   2346  O  O     . ASN A 1 309 ? -29.531  7.036   -2.851  1.00 24.99  ? 322 ASN A O     1 
ATOM   2347  C  CB    . ASN A 1 309 ? -27.265  9.129   -3.924  1.00 24.99  ? 322 ASN A CB    1 
ATOM   2348  C  CG    . ASN A 1 309 ? -26.589  10.423  -3.513  1.00 24.99  ? 322 ASN A CG    1 
ATOM   2349  O  OD1   . ASN A 1 309 ? -26.661  10.835  -2.356  1.00 24.99  ? 322 ASN A OD1   1 
ATOM   2350  N  ND2   . ASN A 1 309 ? -25.928  11.072  -4.466  1.00 24.99  ? 322 ASN A ND2   1 
ATOM   2351  N  N     . LYS A 1 310 ? -27.798  5.982   -3.819  1.00 45.33  ? 323 LYS A N     1 
ATOM   2352  C  CA    . LYS A 1 310 ? -28.591  4.816   -4.203  1.00 45.33  ? 323 LYS A CA    1 
ATOM   2353  C  C     . LYS A 1 310 ? -28.959  3.962   -2.992  1.00 45.33  ? 323 LYS A C     1 
ATOM   2354  O  O     . LYS A 1 310 ? -29.773  3.045   -3.094  1.00 45.33  ? 323 LYS A O     1 
ATOM   2355  C  CB    . LYS A 1 310 ? -27.864  3.970   -5.253  1.00 45.33  ? 323 LYS A CB    1 
ATOM   2356  C  CG    . LYS A 1 310 ? -27.731  4.640   -6.614  1.00 45.33  ? 323 LYS A CG    1 
ATOM   2357  C  CD    . LYS A 1 310 ? -27.824  3.627   -7.749  1.00 45.33  ? 323 LYS A CD    1 
ATOM   2358  C  CE    . LYS A 1 310 ? -26.741  2.563   -7.657  1.00 45.33  ? 323 LYS A CE    1 
ATOM   2359  N  NZ    . LYS A 1 310 ? -25.380  3.120   -7.892  1.00 45.33  ? 323 LYS A NZ    1 
ATOM   2360  N  N     . ALA A 1 311 ? -28.355  4.269   -1.848  1.00 30.36  ? 324 ALA A N     1 
ATOM   2361  C  CA    . ALA A 1 311 ? -28.682  3.595   -0.597  1.00 30.36  ? 324 ALA A CA    1 
ATOM   2362  C  C     . ALA A 1 311 ? -29.709  4.407   0.185   1.00 30.36  ? 324 ALA A C     1 
ATOM   2363  O  O     . ALA A 1 311 ? -30.622  3.849   0.794   1.00 30.36  ? 324 ALA A O     1 
ATOM   2364  C  CB    . ALA A 1 311 ? -27.432  3.378   0.231   1.00 30.36  ? 324 ALA A CB    1 
ATOM   2365  N  N     . LYS A 1 312 ? -29.549  5.728   0.169   1.00 48.25  ? 325 LYS A N     1 
ATOM   2366  C  CA    . LYS A 1 312 ? -30.521  6.625   0.782   1.00 48.25  ? 325 LYS A CA    1 
ATOM   2367  C  C     . LYS A 1 312 ? -31.843  6.556   0.030   1.00 48.25  ? 325 LYS A C     1 
ATOM   2368  O  O     . LYS A 1 312 ? -32.901  6.837   0.588   1.00 48.25  ? 325 LYS A O     1 
ATOM   2369  C  CB    . LYS A 1 312 ? -30.005  8.065   0.778   1.00 48.25  ? 325 LYS A CB    1 
ATOM   2370  C  CG    . LYS A 1 312 ? -28.854  8.332   1.733   1.00 48.25  ? 325 LYS A CG    1 
ATOM   2371  C  CD    . LYS A 1 312 ? -28.353  9.763   1.590   1.00 48.25  ? 325 LYS A CD    1 
ATOM   2372  C  CE    . LYS A 1 312 ? -27.225  10.063  2.567   1.00 48.25  ? 325 LYS A CE    1 
ATOM   2373  N  NZ    . LYS A 1 312 ? -26.581  11.377  2.285   1.00 48.25  ? 325 LYS A NZ    1 
ATOM   2374  N  N     . GLN A 1 313 ? -31.769  6.180   -1.242  1.00 67.63  ? 326 GLN A N     1 
ATOM   2375  C  CA    . GLN A 1 313 ? -32.943  6.090   -2.099  1.00 67.63  ? 326 GLN A CA    1 
ATOM   2376  C  C     . GLN A 1 313 ? -33.750  4.836   -1.777  1.00 67.63  ? 326 GLN A C     1 
ATOM   2377  O  O     . GLN A 1 313 ? -34.948  4.911   -1.509  1.00 67.63  ? 326 GLN A O     1 
ATOM   2378  C  CB    . GLN A 1 313 ? -32.513  6.079   -3.567  1.00 67.63  ? 326 GLN A CB    1 
ATOM   2379  C  CG    . GLN A 1 313 ? -33.544  6.629   -4.538  1.00 67.63  ? 326 GLN A CG    1 
ATOM   2380  C  CD    . GLN A 1 313 ? -32.967  6.862   -5.921  1.00 67.63  ? 326 GLN A CD    1 
ATOM   2381  O  OE1   . GLN A 1 313 ? -31.881  6.379   -6.241  1.00 67.63  ? 326 GLN A OE1   1 
ATOM   2382  N  NE2   . GLN A 1 313 ? -33.688  7.611   -6.746  1.00 67.63  ? 326 GLN A NE2   1 
ATOM   2383  N  N     . SER A 1 314 ? -33.079  3.687   -1.791  1.00 40.13  ? 327 SER A N     1 
ATOM   2384  C  CA    . SER A 1 314 ? -33.727  2.403   -1.535  1.00 40.13  ? 327 SER A CA    1 
ATOM   2385  C  C     . SER A 1 314 ? -34.189  2.258   -0.084  1.00 40.13  ? 327 SER A C     1 
ATOM   2386  O  O     . SER A 1 314 ? -34.906  1.317   0.255   1.00 40.13  ? 327 SER A O     1 
ATOM   2387  C  CB    . SER A 1 314 ? -32.791  1.253   -1.910  1.00 40.13  ? 327 SER A CB    1 
ATOM   2388  O  OG    . SER A 1 314 ? -33.418  -0.001  -1.712  1.00 40.13  ? 327 SER A OG    1 
ATOM   2389  N  N     . ALA A 1 315 ? -33.772  3.191   0.766   1.00 41.62  ? 328 ALA A N     1 
ATOM   2390  C  CA    . ALA A 1 315 ? -34.215  3.215   2.155   1.00 41.62  ? 328 ALA A CA    1 
ATOM   2391  C  C     . ALA A 1 315 ? -35.423  4.131   2.321   1.00 41.62  ? 328 ALA A C     1 
ATOM   2392  O  O     . ALA A 1 315 ? -36.178  4.004   3.285   1.00 41.62  ? 328 ALA A O     1 
ATOM   2393  C  CB    . ALA A 1 315 ? -33.085  3.651   3.068   1.00 41.62  ? 328 ALA A CB    1 
ATOM   2394  N  N     . MET A 1 316 ? -35.593  5.062   1.385   1.00 58.96  ? 329 MET A N     1 
ATOM   2395  C  CA    . MET A 1 316 ? -36.771  5.925   1.368   1.00 58.96  ? 329 MET A CA    1 
ATOM   2396  C  C     . MET A 1 316 ? -37.955  5.195   0.747   1.00 58.96  ? 329 MET A C     1 
ATOM   2397  O  O     . MET A 1 316 ? -39.097  5.375   1.169   1.00 58.96  ? 329 MET A O     1 
ATOM   2398  C  CB    . MET A 1 316 ? -36.506  7.213   0.586   1.00 58.96  ? 329 MET A CB    1 
ATOM   2399  C  CG    . MET A 1 316 ? -35.649  8.239   1.304   1.00 58.96  ? 329 MET A CG    1 
ATOM   2400  S  SD    . MET A 1 316 ? -35.737  9.856   0.509   1.00 58.96  ? 329 MET A SD    1 
ATOM   2401  C  CE    . MET A 1 316 ? -35.568  9.395   -1.214  1.00 58.96  ? 329 MET A CE    1 
ATOM   2402  N  N     . GLU A 1 317 ? -37.673  4.378   -0.264  1.00 46.41  ? 330 GLU A N     1 
ATOM   2403  C  CA    . GLU A 1 317 ? -38.702  3.604   -0.947  1.00 46.41  ? 330 GLU A CA    1 
ATOM   2404  C  C     . GLU A 1 317 ? -39.281  2.543   -0.018  1.00 46.41  ? 330 GLU A C     1 
ATOM   2405  O  O     . GLU A 1 317 ? -40.449  2.179   -0.130  1.00 46.41  ? 330 GLU A O     1 
ATOM   2406  C  CB    . GLU A 1 317 ? -38.128  2.944   -2.204  1.00 46.41  ? 330 GLU A CB    1 
ATOM   2407  C  CG    . GLU A 1 317 ? -37.509  3.917   -3.202  1.00 46.41  ? 330 GLU A CG    1 
ATOM   2408  C  CD    . GLU A 1 317 ? -36.819  3.212   -4.356  1.00 46.41  ? 330 GLU A CD    1 
ATOM   2409  O  OE1   . GLU A 1 317 ? -37.016  1.990   -4.512  1.00 46.41  ? 330 GLU A OE1   1 
ATOM   2410  O  OE2   . GLU A 1 317 ? -36.076  3.881   -5.104  1.00 46.41  ? 330 GLU A OE2   1 
ATOM   2411  N  N     . ALA A 1 318 ? -38.451  2.051   0.896   1.00 43.85  ? 331 ALA A N     1 
ATOM   2412  C  CA    . ALA A 1 318 ? -38.875  1.048   1.865   1.00 43.85  ? 331 ALA A CA    1 
ATOM   2413  C  C     . ALA A 1 318 ? -40.015  1.571   2.735   1.00 43.85  ? 331 ALA A C     1 
ATOM   2414  O  O     . ALA A 1 318 ? -40.935  0.832   3.080   1.00 43.85  ? 331 ALA A O     1 
ATOM   2415  C  CB    . ALA A 1 318 ? -37.700  0.622   2.728   1.00 43.85  ? 331 ALA A CB    1 
ATOM   2416  N  N     . ILE A 1 319 ? -39.941  2.851   3.086   1.00 32.12  ? 332 ILE A N     1 
ATOM   2417  C  CA    . ILE A 1 319 ? -40.985  3.507   3.863   1.00 32.12  ? 332 ILE A CA    1 
ATOM   2418  C  C     . ILE A 1 319 ? -42.157  3.867   2.957   1.00 32.12  ? 332 ILE A C     1 
ATOM   2419  O  O     . ILE A 1 319 ? -43.318  3.764   3.352   1.00 32.12  ? 332 ILE A O     1 
ATOM   2420  C  CB    . ILE A 1 319 ? -40.457  4.788   4.528   1.00 32.12  ? 332 ILE A CB    1 
ATOM   2421  C  CG1   . ILE A 1 319 ? -39.099  4.530   5.178   1.00 32.12  ? 332 ILE A CG1   1 
ATOM   2422  C  CG2   . ILE A 1 319 ? -41.450  5.311   5.551   1.00 32.12  ? 332 ILE A CG2   1 
ATOM   2423  C  CD1   . ILE A 1 319 ? -38.405  5.780   5.658   1.00 32.12  ? 332 ILE A CD1   1 
ATOM   2424  N  N     . SER A 1 320 ? -41.835  4.292   1.739   1.00 49.56  ? 333 SER A N     1 
ATOM   2425  C  CA    . SER A 1 320 ? -42.839  4.675   0.753   1.00 49.56  ? 333 SER A CA    1 
ATOM   2426  C  C     . SER A 1 320 ? -43.753  3.508   0.394   1.00 49.56  ? 333 SER A C     1 
ATOM   2427  O  O     . SER A 1 320 ? -44.974  3.654   0.352   1.00 49.56  ? 333 SER A O     1 
ATOM   2428  C  CB    . SER A 1 320 ? -42.158  5.210   -0.507  1.00 49.56  ? 333 SER A CB    1 
ATOM   2429  O  OG    . SER A 1 320 ? -43.099  5.450   -1.535  1.00 49.56  ? 333 SER A OG    1 
ATOM   2430  N  N     . TRP A 1 321 ? -43.154  2.349   0.141   1.00 53.71  ? 334 TRP A N     1 
ATOM   2431  C  CA    . TRP A 1 321 ? -43.909  1.161   -0.241  1.00 53.71  ? 334 TRP A CA    1 
ATOM   2432  C  C     . TRP A 1 321 ? -44.832  0.671   0.869   1.00 53.71  ? 334 TRP A C     1 
ATOM   2433  O  O     . TRP A 1 321 ? -45.855  0.045   0.601   1.00 53.71  ? 334 TRP A O     1 
ATOM   2434  C  CB    . TRP A 1 321 ? -42.964  0.041   -0.677  1.00 53.71  ? 334 TRP A CB    1 
ATOM   2435  C  CG    . TRP A 1 321 ? -42.548  0.150   -2.106  1.00 53.71  ? 334 TRP A CG    1 
ATOM   2436  C  CD1   . TRP A 1 321 ? -41.317  0.488   -2.583  1.00 53.71  ? 334 TRP A CD1   1 
ATOM   2437  C  CD2   . TRP A 1 321 ? -43.378  -0.073  -3.253  1.00 53.71  ? 334 TRP A CD2   1 
ATOM   2438  N  NE1   . TRP A 1 321 ? -41.327  0.483   -3.958  1.00 53.71  ? 334 TRP A NE1   1 
ATOM   2439  C  CE2   . TRP A 1 321 ? -42.577  0.144   -4.390  1.00 53.71  ? 334 TRP A CE2   1 
ATOM   2440  C  CE3   . TRP A 1 321 ? -44.715  -0.436  -3.422  1.00 53.71  ? 334 TRP A CE3   1 
ATOM   2441  C  CZ2   . TRP A 1 321 ? -43.080  0.007   -5.685  1.00 53.71  ? 334 TRP A CZ2   1 
ATOM   2442  C  CZ3   . TRP A 1 321 ? -45.208  -0.570  -4.704  1.00 53.71  ? 334 TRP A CZ3   1 
ATOM   2443  C  CH2   . TRP A 1 321 ? -44.394  -0.349  -5.819  1.00 53.71  ? 334 TRP A CH2   1 
ATOM   2444  N  N     . PHE A 1 322 ? -44.467  0.950   2.115   1.00 25.77  ? 335 PHE A N     1 
ATOM   2445  C  CA    . PHE A 1 322 ? -45.321  0.598   3.238   1.00 25.77  ? 335 PHE A CA    1 
ATOM   2446  C  C     . PHE A 1 322 ? -46.538  1.511   3.289   1.00 25.77  ? 335 PHE A C     1 
ATOM   2447  O  O     . PHE A 1 322 ? -47.668  1.042   3.410   1.00 25.77  ? 335 PHE A O     1 
ATOM   2448  C  CB    . PHE A 1 322 ? -44.558  0.679   4.555   1.00 25.77  ? 335 PHE A CB    1 
ATOM   2449  C  CG    . PHE A 1 322 ? -45.420  0.447   5.755   1.00 25.77  ? 335 PHE A CG    1 
ATOM   2450  C  CD1   . PHE A 1 322 ? -45.839  -0.832  6.082   1.00 25.77  ? 335 PHE A CD1   1 
ATOM   2451  C  CD2   . PHE A 1 322 ? -45.825  1.506   6.550   1.00 25.77  ? 335 PHE A CD2   1 
ATOM   2452  C  CE1   . PHE A 1 322 ? -46.639  -1.053  7.184   1.00 25.77  ? 335 PHE A CE1   1 
ATOM   2453  C  CE2   . PHE A 1 322 ? -46.627  1.294   7.649   1.00 25.77  ? 335 PHE A CE2   1 
ATOM   2454  C  CZ    . PHE A 1 322 ? -47.032  0.011   7.970   1.00 25.77  ? 335 PHE A CZ    1 
ATOM   2455  N  N     . LYS A 1 323 ? -46.296  2.816   3.202   1.00 34.12  ? 336 LYS A N     1 
ATOM   2456  C  CA    . LYS A 1 323 ? -47.373  3.798   3.169   1.00 34.12  ? 336 LYS A CA    1 
ATOM   2457  C  C     . LYS A 1 323 ? -48.241  3.570   1.935   1.00 34.12  ? 336 LYS A C     1 
ATOM   2458  O  O     . LYS A 1 323 ? -49.440  3.838   1.948   1.00 34.12  ? 336 LYS A O     1 
ATOM   2459  C  CB    . LYS A 1 323 ? -46.801  5.219   3.163   1.00 34.12  ? 336 LYS A CB    1 
ATOM   2460  C  CG    . LYS A 1 323 ? -47.847  6.328   3.217   1.00 34.12  ? 336 LYS A CG    1 
ATOM   2461  C  CD    . LYS A 1 323 ? -47.236  7.711   2.994   1.00 34.12  ? 336 LYS A CD    1 
ATOM   2462  C  CE    . LYS A 1 323 ? -46.602  8.285   4.259   1.00 34.12  ? 336 LYS A CE    1 
ATOM   2463  N  NZ    . LYS A 1 323 ? -45.324  7.619   4.645   1.00 34.12  ? 336 LYS A NZ    1 
ATOM   2464  N  N     . ALA A 1 324 ? -47.624  3.060   0.874   1.00 59.53  ? 337 ALA A N     1 
ATOM   2465  C  CA    . ALA A 1 324 ? -48.340  2.749   -0.356  1.00 59.53  ? 337 ALA A CA    1 
ATOM   2466  C  C     . ALA A 1 324 ? -49.299  1.580   -0.157  1.00 59.53  ? 337 ALA A C     1 
ATOM   2467  O  O     . ALA A 1 324 ? -50.275  1.436   -0.893  1.00 59.53  ? 337 ALA A O     1 
ATOM   2468  C  CB    . ALA A 1 324 ? -47.358  2.444   -1.473  1.00 59.53  ? 337 ALA A CB    1 
ATOM   2469  N  N     . ARG A 1 325 ? -49.011  0.744   0.836   1.00 34.47  ? 338 ARG A N     1 
ATOM   2470  C  CA    . ARG A 1 325 ? -49.838  -0.421  1.129   1.00 34.47  ? 338 ARG A CA    1 
ATOM   2471  C  C     . ARG A 1 325 ? -50.935  -0.056  2.122   1.00 34.47  ? 338 ARG A C     1 
ATOM   2472  O  O     . ARG A 1 325 ? -52.040  -0.595  2.066   1.00 34.47  ? 338 ARG A O     1 
ATOM   2473  C  CB    . ARG A 1 325 ? -48.975  -1.562  1.675   1.00 34.47  ? 338 ARG A CB    1 
ATOM   2474  C  CG    . ARG A 1 325 ? -49.529  -2.961  1.415   1.00 34.47  ? 338 ARG A CG    1 
ATOM   2475  C  CD    . ARG A 1 325 ? -50.562  -3.375  2.449   1.00 34.47  ? 338 ARG A CD    1 
ATOM   2476  N  NE    . ARG A 1 325 ? -51.279  -4.581  2.049   1.00 34.47  ? 338 ARG A NE    1 
ATOM   2477  C  CZ    . ARG A 1 325 ? -52.225  -5.161  2.778   1.00 34.47  ? 338 ARG A CZ    1 
ATOM   2478  N  NH1   . ARG A 1 325 ? -52.826  -6.254  2.337   1.00 34.47  ? 338 ARG A NH1   1 
ATOM   2479  N  NH2   . ARG A 1 325 ? -52.568  -4.649  3.949   1.00 34.47  ? 338 ARG A NH2   1 
ATOM   2480  N  N     . MET A 1 326 ? -50.624  0.861   3.032   1.00 44.30  ? 339 MET A N     1 
ATOM   2481  C  CA    . MET A 1 326 ? -51.604  1.324   4.006   1.00 44.30  ? 339 MET A CA    1 
ATOM   2482  C  C     . MET A 1 326 ? -52.592  2.287   3.352   1.00 44.30  ? 339 MET A C     1 
ATOM   2483  O  O     . MET A 1 326 ? -53.750  2.376   3.763   1.00 44.30  ? 339 MET A O     1 
ATOM   2484  C  CB    . MET A 1 326 ? -50.915  1.994   5.195   1.00 44.30  ? 339 MET A CB    1 
ATOM   2485  C  CG    . MET A 1 326 ? -49.822  1.152   5.829   1.00 44.30  ? 339 MET A CG    1 
ATOM   2486  S  SD    . MET A 1 326 ? -50.377  -0.492  6.314   1.00 44.30  ? 339 MET A SD    1 
ATOM   2487  C  CE    . MET A 1 326 ? -51.420  -0.098  7.714   1.00 44.30  ? 339 MET A CE    1 
ATOM   2488  N  N     . ASP A 1 327 ? -52.129  3.004   2.332   1.00 64.08  ? 340 ASP A N     1 
ATOM   2489  C  CA    . ASP A 1 327 ? -52.995  3.894   1.568   1.00 64.08  ? 340 ASP A CA    1 
ATOM   2490  C  C     . ASP A 1 327 ? -53.713  3.127   0.460   1.00 64.08  ? 340 ASP A C     1 
ATOM   2491  O  O     . ASP A 1 327 ? -54.639  3.646   -0.160  1.00 64.08  ? 340 ASP A O     1 
ATOM   2492  C  CB    . ASP A 1 327 ? -52.203  5.066   0.982   1.00 64.08  ? 340 ASP A CB    1 
ATOM   2493  C  CG    . ASP A 1 327 ? -51.715  6.032   2.046   1.00 64.08  ? 340 ASP A CG    1 
ATOM   2494  O  OD1   . ASP A 1 327 ? -52.284  6.034   3.157   1.00 64.08  ? 340 ASP A OD1   1 
ATOM   2495  O  OD2   . ASP A 1 327 ? -50.768  6.797   1.765   1.00 64.08  ? 340 ASP A OD2   1 
ATOM   2496  N  N     . SER A 1 328 ? -53.276  1.895   0.212   1.00 54.77  ? 341 SER A N     1 
ATOM   2497  C  CA    . SER A 1 328 ? -53.968  1.017   -0.725  1.00 54.77  ? 341 SER A CA    1 
ATOM   2498  C  C     . SER A 1 328 ? -55.325  0.679   -0.132  1.00 54.77  ? 341 SER A C     1 
ATOM   2499  O  O     . SER A 1 328 ? -56.347  0.718   -0.816  1.00 54.77  ? 341 SER A O     1 
ATOM   2500  C  CB    . SER A 1 328 ? -53.171  -0.264  -0.971  1.00 54.77  ? 341 SER A CB    1 
ATOM   2501  O  OG    . SER A 1 328 ? -53.230  -1.128  0.150   1.00 54.77  ? 341 SER A OG    1 
ATOM   2502  N  N     . LEU A 1 329 ? -55.316  0.343   1.153   1.00 64.08  ? 342 LEU A N     1 
ATOM   2503  C  CA    . LEU A 1 329 ? -56.538  0.219   1.930   1.00 64.08  ? 342 LEU A CA    1 
ATOM   2504  C  C     . LEU A 1 329 ? -57.179  1.600   1.972   1.00 64.08  ? 342 LEU A C     1 
ATOM   2505  O  O     . LEU A 1 329 ? -56.472  2.606   1.904   1.00 64.08  ? 342 LEU A O     1 
ATOM   2506  C  CB    . LEU A 1 329 ? -56.215  -0.250  3.352   1.00 64.08  ? 342 LEU A CB    1 
ATOM   2507  C  CG    . LEU A 1 329 ? -55.998  -1.735  3.675   1.00 64.08  ? 342 LEU A CG    1 
ATOM   2508  C  CD1   . LEU A 1 329 ? -55.382  -2.517  2.523   1.00 64.08  ? 342 LEU A CD1   1 
ATOM   2509  C  CD2   . LEU A 1 329 ? -55.157  -1.890  4.939   1.00 64.08  ? 342 LEU A CD2   1 
ATOM   2510  N  N     . VAL A 1 330 ? -58.506  1.640   2.078   1.00 53.10  ? 343 VAL A N     1 
ATOM   2511  C  CA    . VAL A 1 330 ? -59.285  2.887   2.101   1.00 53.10  ? 343 VAL A CA    1 
ATOM   2512  C  C     . VAL A 1 330 ? -58.867  3.903   1.036   1.00 53.10  ? 343 VAL A C     1 
ATOM   2513  O  O     . VAL A 1 330 ? -59.301  3.827   -0.114  1.00 53.10  ? 343 VAL A O     1 
ATOM   2514  C  CB    . VAL A 1 330 ? -59.289  3.560   3.500   1.00 53.10  ? 343 VAL A CB    1 
ATOM   2515  C  CG1   . VAL A 1 330 ? -58.096  4.492   3.666   1.00 53.10  ? 343 VAL A CG1   1 
ATOM   2516  C  CG2   . VAL A 1 330 ? -60.581  4.334   3.708   1.00 53.10  ? 343 VAL A CG2   1 
ATOM   2517  N  N     . THR A 1 342 ? -45.467  -4.428  -8.090  1.00 58.98  ? 355 THR A N     1 
ATOM   2518  C  CA    . THR A 1 342 ? -46.061  -4.251  -6.770  1.00 58.98  ? 355 THR A CA    1 
ATOM   2519  C  C     . THR A 1 342 ? -46.026  -5.545  -5.955  1.00 58.98  ? 355 THR A C     1 
ATOM   2520  O  O     . THR A 1 342 ? -47.043  -5.972  -5.408  1.00 58.98  ? 355 THR A O     1 
ATOM   2521  C  CB    . THR A 1 342 ? -47.510  -3.746  -6.866  1.00 58.98  ? 355 THR A CB    1 
ATOM   2522  O  OG1   . THR A 1 342 ? -48.297  -4.686  -7.608  1.00 58.98  ? 355 THR A OG1   1 
ATOM   2523  C  CG2   . THR A 1 342 ? -47.553  -2.396  -7.564  1.00 58.98  ? 355 THR A CG2   1 
ATOM   2524  N  N     . SER A 1 343 ? -44.850  -6.164  -5.885  1.00 81.15  ? 356 SER A N     1 
ATOM   2525  C  CA    . SER A 1 343 ? -44.644  -7.339  -5.045  1.00 81.15  ? 356 SER A CA    1 
ATOM   2526  C  C     . SER A 1 343 ? -43.481  -7.081  -4.093  1.00 81.15  ? 356 SER A C     1 
ATOM   2527  O  O     . SER A 1 343 ? -42.604  -6.269  -4.386  1.00 81.15  ? 356 SER A O     1 
ATOM   2528  C  CB    . SER A 1 343 ? -44.364  -8.575  -5.896  1.00 81.15  ? 356 SER A CB    1 
ATOM   2529  O  OG    . SER A 1 343 ? -43.069  -8.520  -6.466  1.00 81.15  ? 356 SER A OG    1 
ATOM   2530  N  N     . SER A 1 344 ? -43.468  -7.772  -2.957  1.00 69.50  ? 357 SER A N     1 
ATOM   2531  C  CA    . SER A 1 344 ? -42.468  -7.509  -1.922  1.00 69.50  ? 357 SER A CA    1 
ATOM   2532  C  C     . SER A 1 344 ? -41.093  -8.090  -2.241  1.00 69.50  ? 357 SER A C     1 
ATOM   2533  O  O     . SER A 1 344 ? -40.498  -8.779  -1.414  1.00 69.50  ? 357 SER A O     1 
ATOM   2534  C  CB    . SER A 1 344 ? -42.947  -8.009  -0.558  1.00 69.50  ? 357 SER A CB    1 
ATOM   2535  O  OG    . SER A 1 344 ? -41.999  -7.721  0.454   1.00 69.50  ? 357 SER A OG    1 
ATOM   2536  N  N     . VAL A 1 345 ? -40.600  -7.815  -3.445  1.00 78.11  ? 358 VAL A N     1 
ATOM   2537  C  CA    . VAL A 1 345 ? -39.215  -8.106  -3.794  1.00 78.11  ? 358 VAL A CA    1 
ATOM   2538  C  C     . VAL A 1 345 ? -38.563  -6.779  -4.173  1.00 78.11  ? 358 VAL A C     1 
ATOM   2539  O  O     . VAL A 1 345 ? -37.632  -6.727  -4.979  1.00 78.11  ? 358 VAL A O     1 
ATOM   2540  C  CB    . VAL A 1 345 ? -39.102  -9.111  -4.957  1.00 78.11  ? 358 VAL A CB    1 
ATOM   2541  C  CG1   . VAL A 1 345 ? -37.783  -9.866  -4.878  1.00 78.11  ? 358 VAL A CG1   1 
ATOM   2542  C  CG2   . VAL A 1 345 ? -40.256  -10.093 -4.924  1.00 78.11  ? 358 VAL A CG2   1 
ATOM   2543  N  N     . LEU A 1 346 ? -39.078  -5.705  -3.581  1.00 51.60  ? 359 LEU A N     1 
ATOM   2544  C  CA    . LEU A 1 346 ? -38.573  -4.359  -3.818  1.00 51.60  ? 359 LEU A CA    1 
ATOM   2545  C  C     . LEU A 1 346 ? -38.328  -3.662  -2.482  1.00 51.60  ? 359 LEU A C     1 
ATOM   2546  O  O     . LEU A 1 346 ? -39.278  -3.203  -1.848  1.00 51.60  ? 359 LEU A O     1 
ATOM   2547  C  CB    . LEU A 1 346 ? -39.593  -3.542  -4.615  1.00 51.60  ? 359 LEU A CB    1 
ATOM   2548  C  CG    . LEU A 1 346 ? -40.421  -4.245  -5.693  1.00 51.60  ? 359 LEU A CG    1 
ATOM   2549  C  CD1   . LEU A 1 346 ? -41.522  -3.325  -6.199  1.00 51.60  ? 359 LEU A CD1   1 
ATOM   2550  C  CD2   . LEU A 1 346 ? -39.546  -4.717  -6.843  1.00 51.60  ? 359 LEU A CD2   1 
ATOM   2551  N  N     . ASN A 1 347 ? -37.074  -3.577  -2.039  1.00 97.37  ? 360 ASN A N     1 
ATOM   2552  C  CA    . ASN A 1 347 ? -35.916  -4.131  -2.731  1.00 97.37  ? 360 ASN A CA    1 
ATOM   2553  C  C     . ASN A 1 347 ? -34.851  -4.477  -1.695  1.00 97.37  ? 360 ASN A C     1 
ATOM   2554  O  O     . ASN A 1 347 ? -34.922  -4.003  -0.561  1.00 97.37  ? 360 ASN A O     1 
ATOM   2555  C  CB    . ASN A 1 347 ? -35.351  -3.112  -3.725  1.00 97.37  ? 360 ASN A CB    1 
ATOM   2556  C  CG    . ASN A 1 347 ? -34.219  -3.675  -4.562  1.00 97.37  ? 360 ASN A CG    1 
ATOM   2557  O  OD1   . ASN A 1 347 ? -34.126  -4.884  -4.768  1.00 97.37  ? 360 ASN A OD1   1 
ATOM   2558  N  ND2   . ASN A 1 347 ? -33.346  -2.798  -5.041  1.00 97.37  ? 360 ASN A ND2   1 
ATOM   2559  N  N     . ARG A 1 348 ? -33.875  -5.296  -2.090  1.00 76.13  ? 361 ARG A N     1 
ATOM   2560  C  CA    . ARG A 1 348 ? -32.696  -5.630  -1.275  1.00 76.13  ? 361 ARG A CA    1 
ATOM   2561  C  C     . ARG A 1 348 ? -32.957  -5.816  0.225   1.00 76.13  ? 361 ARG A C     1 
ATOM   2562  O  O     . ARG A 1 348 ? -32.152  -5.403  1.059   1.00 76.13  ? 361 ARG A O     1 
ATOM   2563  C  CB    . ARG A 1 348 ? -31.573  -4.602  -1.490  1.00 76.13  ? 361 ARG A CB    1 
ATOM   2564  C  CG    . ARG A 1 348 ? -31.926  -3.176  -1.079  1.00 76.13  ? 361 ARG A CG    1 
ATOM   2565  C  CD    . ARG A 1 348 ? -30.695  -2.348  -0.771  1.00 76.13  ? 361 ARG A CD    1 
ATOM   2566  N  NE    . ARG A 1 348 ? -30.018  -1.887  -1.977  1.00 76.13  ? 361 ARG A NE    1 
ATOM   2567  C  CZ    . ARG A 1 348 ? -28.995  -1.040  -1.975  1.00 76.13  ? 361 ARG A CZ    1 
ATOM   2568  N  NH1   . ARG A 1 348 ? -28.434  -0.667  -3.117  1.00 76.13  ? 361 ARG A NH1   1 
ATOM   2569  N  NH2   . ARG A 1 348 ? -28.534  -0.563  -0.827  1.00 76.13  ? 361 ARG A NH2   1 
ATOM   2570  N  N     . GLU A 1 349 ? -34.080  -6.442  0.560   1.00 34.39  ? 362 GLU A N     1 
ATOM   2571  C  CA    . GLU A 1 349 ? -34.471  -6.596  1.955   1.00 34.39  ? 362 GLU A CA    1 
ATOM   2572  C  C     . GLU A 1 349 ? -33.780  -7.789  2.605   1.00 34.39  ? 362 GLU A C     1 
ATOM   2573  O  O     . GLU A 1 349 ? -34.145  -8.940  2.362   1.00 34.39  ? 362 GLU A O     1 
ATOM   2574  C  CB    . GLU A 1 349 ? -35.990  -6.738  2.071   1.00 34.39  ? 362 GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1 349 ? -36.541  -6.430  3.454   1.00 34.39  ? 362 GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1 349 ? -38.054  -6.499  3.506   1.00 34.39  ? 362 GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1 349 ? -38.640  -7.327  2.779   1.00 34.39  ? 362 GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1 349 ? -38.657  -5.721  4.273   1.00 34.39  ? 362 GLU A OE2   1 
ATOM   2579  N  N     . LYS A 1 350 ? -32.778  -7.506  3.432   1.00 28.05  ? 363 LYS A N     1 
ATOM   2580  C  CA    . LYS A 1 350 ? -32.070  -8.553  4.161   1.00 28.05  ? 363 LYS A CA    1 
ATOM   2581  C  C     . LYS A 1 350 ? -32.742  -8.802  5.508   1.00 28.05  ? 363 LYS A C     1 
ATOM   2582  O  O     . LYS A 1 350 ? -32.893  -7.885  6.318   1.00 28.05  ? 363 LYS A O     1 
ATOM   2583  C  CB    . LYS A 1 350 ? -30.592  -8.190  4.326   1.00 28.05  ? 363 LYS A CB    1 
ATOM   2584  C  CG    . LYS A 1 350 ? -29.803  -8.253  3.023   1.00 28.05  ? 363 LYS A CG    1 
ATOM   2585  C  CD    . LYS A 1 350 ? -28.400  -7.680  3.171   1.00 28.05  ? 363 LYS A CD    1 
ATOM   2586  C  CE    . LYS A 1 350 ? -28.431  -6.174  3.372   1.00 28.05  ? 363 LYS A CE    1 
ATOM   2587  N  NZ    . LYS A 1 350 ? -27.062  -5.598  3.462   1.00 28.05  ? 363 LYS A NZ    1 
ATOM   2588  N  N     . VAL A 1 351 ? -33.140  -10.049 5.737   1.00 11.63  ? 364 VAL A N     1 
ATOM   2589  C  CA    . VAL A 1 351 ? -33.994  -10.390 6.869   1.00 11.63  ? 364 VAL A CA    1 
ATOM   2590  C  C     . VAL A 1 351 ? -33.252  -11.168 7.967   1.00 11.63  ? 364 VAL A C     1 
ATOM   2591  O  O     . VAL A 1 351 ? -33.782  -11.380 9.060   1.00 11.63  ? 364 VAL A O     1 
ATOM   2592  C  CB    . VAL A 1 351 ? -35.249  -11.158 6.391   1.00 11.63  ? 364 VAL A CB    1 
ATOM   2593  C  CG1   . VAL A 1 351 ? -34.942  -12.631 6.207   1.00 11.63  ? 364 VAL A CG1   1 
ATOM   2594  C  CG2   . VAL A 1 351 ? -36.401  -10.960 7.354   1.00 11.63  ? 364 VAL A CG2   1 
ATOM   2595  N  N     . TYR A 1 352 ? -32.026  -11.587 7.671   1.00 28.77  ? 365 TYR A N     1 
ATOM   2596  C  CA    . TYR A 1 352 ? -31.141  -12.157 8.684   1.00 28.77  ? 365 TYR A CA    1 
ATOM   2597  C  C     . TYR A 1 352 ? -29.935  -11.241 8.860   1.00 28.77  ? 365 TYR A C     1 
ATOM   2598  O  O     . TYR A 1 352 ? -29.530  -10.564 7.917   1.00 28.77  ? 365 TYR A O     1 
ATOM   2599  C  CB    . TYR A 1 352 ? -30.682  -13.559 8.285   1.00 28.77  ? 365 TYR A CB    1 
ATOM   2600  C  CG    . TYR A 1 352 ? -31.763  -14.613 8.353   1.00 28.77  ? 365 TYR A CG    1 
ATOM   2601  C  CD1   . TYR A 1 352 ? -32.010  -15.306 9.529   1.00 28.77  ? 365 TYR A CD1   1 
ATOM   2602  C  CD2   . TYR A 1 352 ? -32.527  -14.923 7.238   1.00 28.77  ? 365 TYR A CD2   1 
ATOM   2603  C  CE1   . TYR A 1 352 ? -32.993  -16.273 9.595   1.00 28.77  ? 365 TYR A CE1   1 
ATOM   2604  C  CE2   . TYR A 1 352 ? -33.514  -15.888 7.294   1.00 28.77  ? 365 TYR A CE2   1 
ATOM   2605  C  CZ    . TYR A 1 352 ? -33.742  -16.559 8.474   1.00 28.77  ? 365 TYR A CZ    1 
ATOM   2606  O  OH    . TYR A 1 352 ? -34.721  -17.521 8.538   1.00 28.77  ? 365 TYR A OH    1 
ATOM   2607  N  N     . TYR A 1 353 ? -29.355  -11.214 10.056  1.00 17.87  ? 366 TYR A N     1 
ATOM   2608  C  CA    . TYR A 1 353 ? -28.235  -10.309 10.303  1.00 17.87  ? 366 TYR A CA    1 
ATOM   2609  C  C     . TYR A 1 353 ? -26.909  -10.794 9.724   1.00 17.87  ? 366 TYR A C     1 
ATOM   2610  O  O     . TYR A 1 353 ? -26.447  -11.894 10.026  1.00 17.87  ? 366 TYR A O     1 
ATOM   2611  C  CB    . TYR A 1 353 ? -28.064  -10.007 11.793  1.00 17.87  ? 366 TYR A CB    1 
ATOM   2612  C  CG    . TYR A 1 353 ? -26.906  -9.071  12.065  1.00 17.87  ? 366 TYR A CG    1 
ATOM   2613  C  CD1   . TYR A 1 353 ? -26.990  -7.725  11.740  1.00 17.87  ? 366 TYR A CD1   1 
ATOM   2614  C  CD2   . TYR A 1 353 ? -25.726  -9.534  12.631  1.00 17.87  ? 366 TYR A CD2   1 
ATOM   2615  C  CE1   . TYR A 1 353 ? -25.936  -6.865  11.976  1.00 17.87  ? 366 TYR A CE1   1 
ATOM   2616  C  CE2   . TYR A 1 353 ? -24.666  -8.681  12.870  1.00 17.87  ? 366 TYR A CE2   1 
ATOM   2617  C  CZ    . TYR A 1 353 ? -24.777  -7.347  12.540  1.00 17.87  ? 366 TYR A CZ    1 
ATOM   2618  O  OH    . TYR A 1 353 ? -23.725  -6.493  12.777  1.00 17.87  ? 366 TYR A OH    1 
ATOM   2619  N  N     . ASN A 1 354 ? -26.311  -9.955  8.885   1.00 36.80  ? 367 ASN A N     1 
ATOM   2620  C  CA    . ASN A 1 354 ? -24.950  -10.160 8.410   1.00 36.80  ? 367 ASN A CA    1 
ATOM   2621  C  C     . ASN A 1 354 ? -24.125  -8.911  8.691   1.00 36.80  ? 367 ASN A C     1 
ATOM   2622  O  O     . ASN A 1 354 ? -24.533  -7.802  8.346   1.00 36.80  ? 367 ASN A O     1 
ATOM   2623  C  CB    . ASN A 1 354 ? -24.936  -10.483 6.917   1.00 36.80  ? 367 ASN A CB    1 
ATOM   2624  C  CG    . ASN A 1 354 ? -24.578  -11.929 6.638   1.00 36.80  ? 367 ASN A CG    1 
ATOM   2625  O  OD1   . ASN A 1 354 ? -24.935  -12.827 7.399   1.00 36.80  ? 367 ASN A OD1   1 
ATOM   2626  N  ND2   . ASN A 1 354 ? -23.859  -12.159 5.544   1.00 36.80  ? 367 ASN A ND2   1 
ATOM   2627  N  N     . ILE A 1 355 ? -22.967  -9.090  9.321   1.00 3.83   ? 368 ILE A N     1 
ATOM   2628  C  CA    . ILE A 1 355 ? -22.140  -7.956  9.734   1.00 3.83   ? 368 ILE A CA    1 
ATOM   2629  C  C     . ILE A 1 355 ? -21.574  -7.178  8.546   1.00 3.83   ? 368 ILE A C     1 
ATOM   2630  O  O     . ILE A 1 355 ? -21.207  -7.762  7.525   1.00 3.83   ? 368 ILE A O     1 
ATOM   2631  C  CB    . ILE A 1 355 ? -20.996  -8.394  10.686  1.00 3.83   ? 368 ILE A CB    1 
ATOM   2632  C  CG1   . ILE A 1 355 ? -20.342  -7.179  11.346  1.00 3.83   ? 368 ILE A CG1   1 
ATOM   2633  C  CG2   . ILE A 1 355 ? -19.966  -9.241  9.957   1.00 3.83   ? 368 ILE A CG2   1 
ATOM   2634  C  CD1   . ILE A 1 355 ? -19.287  -7.529  12.370  1.00 3.83   ? 368 ILE A CD1   1 
ATOM   2635  N  N     . ASP A 1 356 ? -21.526  -5.855  8.685   1.00 23.13  ? 369 ASP A N     1 
ATOM   2636  C  CA    . ASP A 1 356 ? -20.973  -4.992  7.650   1.00 23.13  ? 369 ASP A CA    1 
ATOM   2637  C  C     . ASP A 1 356 ? -19.574  -4.542  8.049   1.00 23.13  ? 369 ASP A C     1 
ATOM   2638  O  O     . ASP A 1 356 ? -19.407  -3.759  8.983   1.00 23.13  ? 369 ASP A O     1 
ATOM   2639  C  CB    . ASP A 1 356 ? -21.873  -3.776  7.429   1.00 23.13  ? 369 ASP A CB    1 
ATOM   2640  C  CG    . ASP A 1 356 ? -21.447  -2.944  6.234   1.00 23.13  ? 369 ASP A CG    1 
ATOM   2641  O  OD1   . ASP A 1 356 ? -20.869  -3.512  5.282   1.00 23.13  ? 369 ASP A OD1   1 
ATOM   2642  O  OD2   . ASP A 1 356 ? -21.698  -1.722  6.245   1.00 23.13  ? 369 ASP A OD2   1 
ATOM   2643  N  N     . ASN A 1 357 ? -18.571  -5.047  7.338   1.00 38.75  ? 370 ASN A N     1 
ATOM   2644  C  CA    . ASN A 1 357 ? -17.180  -4.724  7.635   1.00 38.75  ? 370 ASN A CA    1 
ATOM   2645  C  C     . ASN A 1 357 ? -16.546  -3.819  6.584   1.00 38.75  ? 370 ASN A C     1 
ATOM   2646  O  O     . ASN A 1 357 ? -15.346  -3.551  6.630   1.00 38.75  ? 370 ASN A O     1 
ATOM   2647  C  CB    . ASN A 1 357 ? -16.356  -6.006  7.770   1.00 38.75  ? 370 ASN A CB    1 
ATOM   2648  C  CG    . ASN A 1 357 ? -16.740  -6.826  8.984   1.00 38.75  ? 370 ASN A CG    1 
ATOM   2649  O  OD1   . ASN A 1 357 ? -16.961  -6.288  10.066  1.00 38.75  ? 370 ASN A OD1   1 
ATOM   2650  N  ND2   . ASN A 1 357 ? -16.819  -8.139  8.808   1.00 38.75  ? 370 ASN A ND2   1 
ATOM   2651  N  N     . MET A 1 358 ? -17.356  -3.347  5.642   1.00 28.82  ? 371 MET A N     1 
ATOM   2652  C  CA    . MET A 1 358 ? -16.844  -2.571  4.518   1.00 28.82  ? 371 MET A CA    1 
ATOM   2653  C  C     . MET A 1 358 ? -16.727  -1.082  4.839   1.00 28.82  ? 371 MET A C     1 
ATOM   2654  O  O     . MET A 1 358 ? -17.734  -0.392  4.987   1.00 28.82  ? 371 MET A O     1 
ATOM   2655  C  CB    . MET A 1 358 ? -17.744  -2.765  3.300   1.00 28.82  ? 371 MET A CB    1 
ATOM   2656  C  CG    . MET A 1 358 ? -17.108  -2.381  1.982   1.00 28.82  ? 371 MET A CG    1 
ATOM   2657  S  SD    . MET A 1 358 ? -15.784  -3.496  1.484   1.00 28.82  ? 371 MET A SD    1 
ATOM   2658  C  CE    . MET A 1 358 ? -16.667  -5.052  1.408   1.00 28.82  ? 371 MET A CE    1 
ATOM   2659  N  N     . ILE A 1 359 ? -15.495  -0.590  4.935   1.00 17.77  ? 372 ILE A N     1 
ATOM   2660  C  CA    . ILE A 1 359 ? -15.248  0.834   5.147   1.00 17.77  ? 372 ILE A CA    1 
ATOM   2661  C  C     . ILE A 1 359 ? -14.979  1.535   3.817   1.00 17.77  ? 372 ILE A C     1 
ATOM   2662  O  O     . ILE A 1 359 ? -14.000  1.228   3.138   1.00 17.77  ? 372 ILE A O     1 
ATOM   2663  C  CB    . ILE A 1 359 ? -14.046  1.069   6.082   1.00 17.77  ? 372 ILE A CB    1 
ATOM   2664  C  CG1   . ILE A 1 359 ? -14.247  0.350   7.414   1.00 17.77  ? 372 ILE A CG1   1 
ATOM   2665  C  CG2   . ILE A 1 359 ? -13.832  2.552   6.315   1.00 17.77  ? 372 ILE A CG2   1 
ATOM   2666  C  CD1   . ILE A 1 359 ? -13.117  0.548   8.400   1.00 17.77  ? 372 ILE A CD1   1 
ATOM   2667  N  N     . TYR A 1 360 ? -15.847  2.474   3.448   1.00 19.25  ? 373 TYR A N     1 
ATOM   2668  C  CA    . TYR A 1 360 ? -15.647  3.257   2.233   1.00 19.25  ? 373 TYR A CA    1 
ATOM   2669  C  C     . TYR A 1 360 ? -15.053  4.620   2.566   1.00 19.25  ? 373 TYR A C     1 
ATOM   2670  O  O     . TYR A 1 360 ? -15.524  5.299   3.473   1.00 19.25  ? 373 TYR A O     1 
ATOM   2671  C  CB    . TYR A 1 360 ? -16.962  3.431   1.471   1.00 19.25  ? 373 TYR A CB    1 
ATOM   2672  C  CG    . TYR A 1 360 ? -17.489  2.157   0.854   1.00 19.25  ? 373 TYR A CG    1 
ATOM   2673  C  CD1   . TYR A 1 360 ? -16.959  1.668   -0.331  1.00 19.25  ? 373 TYR A CD1   1 
ATOM   2674  C  CD2   . TYR A 1 360 ? -18.518  1.446   1.452   1.00 19.25  ? 373 TYR A CD2   1 
ATOM   2675  C  CE1   . TYR A 1 360 ? -17.436  0.504   -0.899  1.00 19.25  ? 373 TYR A CE1   1 
ATOM   2676  C  CE2   . TYR A 1 360 ? -19.002  0.283   0.890   1.00 19.25  ? 373 TYR A CE2   1 
ATOM   2677  C  CZ    . TYR A 1 360 ? -18.457  -0.184  -0.285  1.00 19.25  ? 373 TYR A CZ    1 
ATOM   2678  O  OH    . TYR A 1 360 ? -18.934  -1.344  -0.848  1.00 19.25  ? 373 TYR A OH    1 
ATOM   2679  N  N     . ILE A 1 361 ? -14.020  5.022   1.833   1.00 7.60   ? 374 ILE A N     1 
ATOM   2680  C  CA    . ILE A 1 361 ? -13.387  6.314   2.076   1.00 7.60   ? 374 ILE A CA    1 
ATOM   2681  C  C     . ILE A 1 361 ? -13.489  7.232   0.858   1.00 7.60   ? 374 ILE A C     1 
ATOM   2682  O  O     . ILE A 1 361 ? -13.157  6.838   -0.260  1.00 7.60   ? 374 ILE A O     1 
ATOM   2683  C  CB    . ILE A 1 361 ? -11.918  6.149   2.519   1.00 7.60   ? 374 ILE A CB    1 
ATOM   2684  C  CG1   . ILE A 1 361 ? -11.849  5.376   3.836   1.00 7.60   ? 374 ILE A CG1   1 
ATOM   2685  C  CG2   . ILE A 1 361 ? -11.248  7.502   2.684   1.00 7.60   ? 374 ILE A CG2   1 
ATOM   2686  C  CD1   . ILE A 1 361 ? -10.443  5.052   4.288   1.00 7.60   ? 374 ILE A CD1   1 
ATOM   2687  N  N     . ASN A 1 362 ? -13.966  8.453   1.088   1.00 32.78  ? 375 ASN A N     1 
ATOM   2688  C  CA    . ASN A 1 362 ? -14.106  9.442   0.027   1.00 32.78  ? 375 ASN A CA    1 
ATOM   2689  C  C     . ASN A 1 362 ? -12.802  10.200  -0.199  1.00 32.78  ? 375 ASN A C     1 
ATOM   2690  O  O     . ASN A 1 362 ? -12.397  11.015  0.630   1.00 32.78  ? 375 ASN A O     1 
ATOM   2691  C  CB    . ASN A 1 362 ? -15.228  10.426  0.365   1.00 32.78  ? 375 ASN A CB    1 
ATOM   2692  C  CG    . ASN A 1 362 ? -15.621  11.303  -0.813  1.00 32.78  ? 375 ASN A CG    1 
ATOM   2693  O  OD1   . ASN A 1 362 ? -14.936  11.346  -1.833  1.00 32.78  ? 375 ASN A OD1   1 
ATOM   2694  N  ND2   . ASN A 1 362 ? -16.732  12.017  -0.670  1.00 32.78  ? 375 ASN A ND2   1 
ATOM   2695  N  N     . THR A 1 363 ? -12.154  9.926   -1.327  1.00 38.05  ? 376 THR A N     1 
ATOM   2696  C  CA    . THR A 1 363 ? -10.928  10.621  -1.703  1.00 38.05  ? 376 THR A CA    1 
ATOM   2697  C  C     . THR A 1 363 ? -11.208  12.104  -1.917  1.00 38.05  ? 376 THR A C     1 
ATOM   2698  O  O     . THR A 1 363 ? -10.401  12.957  -1.552  1.00 38.05  ? 376 THR A O     1 
ATOM   2699  C  CB    . THR A 1 363 ? -10.310  10.026  -2.981  1.00 38.05  ? 376 THR A CB    1 
ATOM   2700  O  OG1   . THR A 1 363 ? -11.225  10.173  -4.073  1.00 38.05  ? 376 THR A OG1   1 
ATOM   2701  C  CG2   . THR A 1 363 ? -9.998   8.552   -2.785  1.00 38.05  ? 376 THR A CG2   1 
ATOM   2702  N  N     . GLY A 1 364 ? -12.360  12.400  -2.512  1.00 67.64  ? 377 GLY A N     1 
ATOM   2703  C  CA    . GLY A 1 364 ? -12.807  13.771  -2.684  1.00 67.64  ? 377 GLY A CA    1 
ATOM   2704  C  C     . GLY A 1 364 ? -11.969  14.588  -3.648  1.00 67.64  ? 377 GLY A C     1 
ATOM   2705  O  O     . GLY A 1 364 ? -11.978  14.346  -4.854  1.00 67.64  ? 377 GLY A O     1 
ATOM   2706  N  N     . GLU A 1 365 ? -11.249  15.568  -3.110  1.00 98.65  ? 378 GLU A N     1 
ATOM   2707  C  CA    . GLU A 1 365 ? -10.435  16.461  -3.924  1.00 98.65  ? 378 GLU A CA    1 
ATOM   2708  C  C     . GLU A 1 365 ? -9.005   15.951  -4.054  1.00 98.65  ? 378 GLU A C     1 
ATOM   2709  O  O     . GLU A 1 365 ? -8.188   16.542  -4.762  1.00 98.65  ? 378 GLU A O     1 
ATOM   2710  C  CB    . GLU A 1 365 ? -10.441  17.871  -3.336  1.00 98.65  ? 378 GLU A CB    1 
ATOM   2711  C  CG    . GLU A 1 365 ? -11.828  18.472  -3.186  1.00 98.65  ? 378 GLU A CG    1 
ATOM   2712  C  CD    . GLU A 1 365 ? -11.799  19.866  -2.591  1.00 98.65  ? 378 GLU A CD    1 
ATOM   2713  O  OE1   . GLU A 1 365 ? -11.333  20.798  -3.280  1.00 98.65  ? 378 GLU A OE1   1 
ATOM   2714  O  OE2   . GLU A 1 365 ? -12.240  20.028  -1.434  1.00 98.65  ? 378 GLU A OE2   1 
ATOM   2715  N  N     . VAL A 1 366 ? -8.707   14.854  -3.365  1.00 57.52  ? 379 VAL A N     1 
ATOM   2716  C  CA    . VAL A 1 366 ? -7.394   14.228  -3.454  1.00 57.52  ? 379 VAL A CA    1 
ATOM   2717  C  C     . VAL A 1 366 ? -7.427   13.150  -4.533  1.00 57.52  ? 379 VAL A C     1 
ATOM   2718  O  O     . VAL A 1 366 ? -6.951   12.033  -4.331  1.00 57.52  ? 379 VAL A O     1 
ATOM   2719  C  CB    . VAL A 1 366 ? -6.965   13.609  -2.108  1.00 57.52  ? 379 VAL A CB    1 
ATOM   2720  C  CG1   . VAL A 1 366 ? -5.451   13.493  -2.031  1.00 57.52  ? 379 VAL A CG1   1 
ATOM   2721  C  CG2   . VAL A 1 366 ? -7.471   14.455  -0.957  1.00 57.52  ? 379 VAL A CG2   1 
ATOM   2722  N  N     . THR A 1 367 ? -8.000   13.496  -5.682  1.00 92.63  ? 380 THR A N     1 
ATOM   2723  C  CA    . THR A 1 367 ? -8.096   12.571  -6.806  1.00 92.63  ? 380 THR A CA    1 
ATOM   2724  C  C     . THR A 1 367 ? -6.716   12.198  -7.332  1.00 92.63  ? 380 THR A C     1 
ATOM   2725  O  O     . THR A 1 367 ? -5.717   12.824  -6.981  1.00 92.63  ? 380 THR A O     1 
ATOM   2726  C  CB    . THR A 1 367 ? -8.921   13.170  -7.966  1.00 92.63  ? 380 THR A CB    1 
ATOM   2727  O  OG1   . THR A 1 367 ? -8.276   14.351  -8.459  1.00 92.63  ? 380 THR A OG1   1 
ATOM   2728  C  CG2   . THR A 1 367 ? -10.324  13.522  -7.505  1.00 92.63  ? 380 THR A CG2   1 
ATOM   2729  N  N     . THR A 1 368 ? -6.668   11.174  -8.177  1.00 83.24  ? 381 THR A N     1 
ATOM   2730  C  CA    . THR A 1 368 ? -5.426   10.767  -8.822  1.00 83.24  ? 381 THR A CA    1 
ATOM   2731  C  C     . THR A 1 368 ? -5.004   11.798  -9.866  1.00 83.24  ? 381 THR A C     1 
ATOM   2732  O  O     . THR A 1 368 ? -3.871   11.784  -10.345 1.00 83.24  ? 381 THR A O     1 
ATOM   2733  C  CB    . THR A 1 368 ? -5.574   9.390   -9.486  1.00 83.24  ? 381 THR A CB    1 
ATOM   2734  O  OG1   . THR A 1 368 ? -4.570   9.233   -10.496 1.00 83.24  ? 381 THR A OG1   1 
ATOM   2735  C  CG2   . THR A 1 368 ? -6.941   9.266   -10.126 1.00 83.24  ? 381 THR A CG2   1 
ATOM   2736  N  N     . THR A 1 369 ? -5.928   12.689  -10.208 1.00 77.49  ? 382 THR A N     1 
ATOM   2737  C  CA    . THR A 1 369 ? -5.662   13.772  -11.147 1.00 77.49  ? 382 THR A CA    1 
ATOM   2738  C  C     . THR A 1 369 ? -5.094   14.999  -10.438 1.00 77.49  ? 382 THR A C     1 
ATOM   2739  O  O     . THR A 1 369 ? -4.399   15.812  -11.048 1.00 77.49  ? 382 THR A O     1 
ATOM   2740  C  CB    . THR A 1 369 ? -6.937   14.179  -11.901 1.00 77.49  ? 382 THR A CB    1 
ATOM   2741  O  OG1   . THR A 1 369 ? -8.001   14.387  -10.963 1.00 77.49  ? 382 THR A OG1   1 
ATOM   2742  C  CG2   . THR A 1 369 ? -7.345   13.095  -12.882 1.00 77.49  ? 382 THR A CG2   1 
ATOM   2743  N  N     . ASN A 1 370 ? -5.398   15.131  -9.152  1.00 89.65  ? 383 ASN A N     1 
ATOM   2744  C  CA    . ASN A 1 370 ? -4.919   16.266  -8.371  1.00 89.65  ? 383 ASN A CA    1 
ATOM   2745  C  C     . ASN A 1 370 ? -3.419   16.167  -8.109  1.00 89.65  ? 383 ASN A C     1 
ATOM   2746  O  O     . ASN A 1 370 ? -2.973   15.362  -7.292  1.00 89.65  ? 383 ASN A O     1 
ATOM   2747  C  CB    . ASN A 1 370 ? -5.689   16.368  -7.052  1.00 89.65  ? 383 ASN A CB    1 
ATOM   2748  C  CG    . ASN A 1 370 ? -5.671   17.769  -6.470  1.00 89.65  ? 383 ASN A CG    1 
ATOM   2749  O  OD1   . ASN A 1 370 ? -4.635   18.431  -6.437  1.00 89.65  ? 383 ASN A OD1   1 
ATOM   2750  N  ND2   . ASN A 1 370 ? -6.829   18.230  -6.012  1.00 89.65  ? 383 ASN A ND2   1 
ATOM   2751  N  N     . THR A 1 371 ? -2.651   16.990  -8.817  1.00 125.34 ? 384 THR A N     1 
ATOM   2752  C  CA    . THR A 1 371 ? -1.195   16.985  -8.717  1.00 125.34 ? 384 THR A CA    1 
ATOM   2753  C  C     . THR A 1 371 ? -0.721   17.278  -7.297  1.00 125.34 ? 384 THR A C     1 
ATOM   2754  O  O     . THR A 1 371 ? 0.103    16.549  -6.746  1.00 125.34 ? 384 THR A O     1 
ATOM   2755  C  CB    . THR A 1 371 ? -0.568   18.012  -9.678  1.00 125.34 ? 384 THR A CB    1 
ATOM   2756  O  OG1   . THR A 1 371 ? -1.045   19.323  -9.354  1.00 125.34 ? 384 THR A OG1   1 
ATOM   2757  C  CG2   . THR A 1 371 ? -0.933   17.688  -11.119 1.00 125.34 ? 384 THR A CG2   1 
ATOM   2758  N  N     . SER A 1 372 ? -1.246   18.349  -6.711  1.00 114.27 ? 385 SER A N     1 
ATOM   2759  C  CA    . SER A 1 372 ? -0.896   18.720  -5.345  1.00 114.27 ? 385 SER A CA    1 
ATOM   2760  C  C     . SER A 1 372 ? -2.097   19.298  -4.605  1.00 114.27 ? 385 SER A C     1 
ATOM   2761  O  O     . SER A 1 372 ? -2.658   20.313  -5.019  1.00 114.27 ? 385 SER A O     1 
ATOM   2762  C  CB    . SER A 1 372 ? 0.265    19.716  -5.336  1.00 114.27 ? 385 SER A CB    1 
ATOM   2763  O  OG    . SER A 1 372 ? 1.436    19.136  -5.885  1.00 114.27 ? 385 SER A OG    1 
ATOM   2764  N  N     . PRO A 1 373 ? -2.495   18.646  -3.502  1.00 61.07  ? 386 PRO A N     1 
ATOM   2765  C  CA    . PRO A 1 373 ? -3.665   19.041  -2.714  1.00 61.07  ? 386 PRO A CA    1 
ATOM   2766  C  C     . PRO A 1 373 ? -3.323   19.959  -1.544  1.00 61.07  ? 386 PRO A C     1 
ATOM   2767  O  O     . PRO A 1 373 ? -2.283   19.790  -0.908  1.00 61.07  ? 386 PRO A O     1 
ATOM   2768  C  CB    . PRO A 1 373 ? -4.190   17.703  -2.190  1.00 61.07  ? 386 PRO A CB    1 
ATOM   2769  C  CG    . PRO A 1 373 ? -2.994   16.763  -2.214  1.00 61.07  ? 386 PRO A CG    1 
ATOM   2770  C  CD    . PRO A 1 373 ? -1.866   17.430  -2.962  1.00 61.07  ? 386 PRO A CD    1 
ATOM   2771  N  N     . THR A 1 374 ? -4.200   20.919  -1.268  1.00 42.46  ? 387 THR A N     1 
ATOM   2772  C  CA    . THR A 1 374 ? -4.012   21.835  -0.148  1.00 42.46  ? 387 THR A CA    1 
ATOM   2773  C  C     . THR A 1 374 ? -4.227   21.112  1.177   1.00 42.46  ? 387 THR A C     1 
ATOM   2774  O  O     . THR A 1 374 ? -5.031   20.183  1.251   1.00 42.46  ? 387 THR A O     1 
ATOM   2775  C  CB    . THR A 1 374 ? -4.958   23.059  -0.248  1.00 42.46  ? 387 THR A CB    1 
ATOM   2776  O  OG1   . THR A 1 374 ? -4.877   23.839  0.951   1.00 42.46  ? 387 THR A OG1   1 
ATOM   2777  C  CG2   . THR A 1 374 ? -6.394   22.624  -0.456  1.00 42.46  ? 387 THR A CG2   1 
ATOM   2778  N  N     . PRO A 1 375 ? -3.496   21.527  2.227   1.00 77.19  ? 388 PRO A N     1 
ATOM   2779  C  CA    . PRO A 1 375 ? -3.681   20.988  3.581   1.00 77.19  ? 388 PRO A CA    1 
ATOM   2780  C  C     . PRO A 1 375 ? -5.114   21.161  4.083   1.00 77.19  ? 388 PRO A C     1 
ATOM   2781  O  O     . PRO A 1 375 ? -5.508   20.524  5.061   1.00 77.19  ? 388 PRO A O     1 
ATOM   2782  C  CB    . PRO A 1 375 ? -2.708   21.818  4.432   1.00 77.19  ? 388 PRO A CB    1 
ATOM   2783  C  CG    . PRO A 1 375 ? -2.308   22.983  3.568   1.00 77.19  ? 388 PRO A CG    1 
ATOM   2784  C  CD    . PRO A 1 375 ? -2.367   22.468  2.171   1.00 77.19  ? 388 PRO A CD    1 
ATOM   2785  N  N     . GLU A 1 376 ? -5.872   22.028  3.418   1.00 82.08  ? 389 GLU A N     1 
ATOM   2786  C  CA    . GLU A 1 376 ? -7.303   22.146  3.651   1.00 82.08  ? 389 GLU A CA    1 
ATOM   2787  C  C     . GLU A 1 376 ? -7.990   20.851  3.235   1.00 82.08  ? 389 GLU A C     1 
ATOM   2788  O  O     . GLU A 1 376 ? -8.636   20.191  4.048   1.00 82.08  ? 389 GLU A O     1 
ATOM   2789  C  CB    . GLU A 1 376 ? -7.878   23.306  2.836   1.00 82.08  ? 389 GLU A CB    1 
ATOM   2790  C  CG    . GLU A 1 376 ? -7.194   24.648  3.060   1.00 82.08  ? 389 GLU A CG    1 
ATOM   2791  C  CD    . GLU A 1 376 ? -7.778   25.419  4.224   1.00 82.08  ? 389 GLU A CD    1 
ATOM   2792  O  OE1   . GLU A 1 376 ? -7.148   26.406  4.658   1.00 82.08  ? 389 GLU A OE1   1 
ATOM   2793  O  OE2   . GLU A 1 376 ? -8.870   25.046  4.703   1.00 82.08  ? 389 GLU A OE2   1 
ATOM   2794  N  N     . GLN A 1 377 ? -7.836   20.487  1.963   1.00 56.76  ? 390 GLN A N     1 
ATOM   2795  C  CA    . GLN A 1 377 ? -8.507   19.314  1.407   1.00 56.76  ? 390 GLN A CA    1 
ATOM   2796  C  C     . GLN A 1 377 ? -7.759   18.011  1.698   1.00 56.76  ? 390 GLN A C     1 
ATOM   2797  O  O     . GLN A 1 377 ? -8.180   16.938  1.266   1.00 56.76  ? 390 GLN A O     1 
ATOM   2798  C  CB    . GLN A 1 377 ? -8.737   19.481  -0.100  1.00 56.76  ? 390 GLN A CB    1 
ATOM   2799  C  CG    . GLN A 1 377 ? -7.496   19.290  -0.961  1.00 56.76  ? 390 GLN A CG    1 
ATOM   2800  C  CD    . GLN A 1 377 ? -7.630   19.935  -2.329  1.00 56.76  ? 390 GLN A CD    1 
ATOM   2801  O  OE1   . GLN A 1 377 ? -8.377   20.897  -2.505  1.00 56.76  ? 390 GLN A OE1   1 
ATOM   2802  N  NE2   . GLN A 1 377 ? -6.903   19.409  -3.305  1.00 56.76  ? 390 GLN A NE2   1 
ATOM   2803  N  N     . ARG A 1 378 ? -6.650   18.111  2.425   1.00 35.88  ? 391 ARG A N     1 
ATOM   2804  C  CA    . ARG A 1 378 ? -5.957   16.926  2.915   1.00 35.88  ? 391 ARG A CA    1 
ATOM   2805  C  C     . ARG A 1 378 ? -6.595   16.477  4.221   1.00 35.88  ? 391 ARG A C     1 
ATOM   2806  O  O     . ARG A 1 378 ? -6.921   15.305  4.394   1.00 35.88  ? 391 ARG A O     1 
ATOM   2807  C  CB    . ARG A 1 378 ? -4.465   17.198  3.123   1.00 35.88  ? 391 ARG A CB    1 
ATOM   2808  C  CG    . ARG A 1 378 ? -3.621   17.086  1.862   1.00 35.88  ? 391 ARG A CG    1 
ATOM   2809  C  CD    . ARG A 1 378 ? -2.374   16.243  2.103   1.00 35.88  ? 391 ARG A CD    1 
ATOM   2810  N  NE    . ARG A 1 378 ? -1.541   16.776  3.177   1.00 35.88  ? 391 ARG A NE    1 
ATOM   2811  C  CZ    . ARG A 1 378 ? -0.423   16.203  3.613   1.00 35.88  ? 391 ARG A CZ    1 
ATOM   2812  N  NH1   . ARG A 1 378 ? 0.003    15.074  3.069   1.00 35.88  ? 391 ARG A NH1   1 
ATOM   2813  N  NH2   . ARG A 1 378 ? 0.270    16.759  4.597   1.00 35.88  ? 391 ARG A NH2   1 
ATOM   2814  N  N     . ALA A 1 379 ? -6.785   17.426  5.132   1.00 56.01  ? 392 ALA A N     1 
ATOM   2815  C  CA    . ALA A 1 379 ? -7.442   17.158  6.406   1.00 56.01  ? 392 ALA A CA    1 
ATOM   2816  C  C     . ALA A 1 379 ? -8.929   16.866  6.211   1.00 56.01  ? 392 ALA A C     1 
ATOM   2817  O  O     . ALA A 1 379 ? -9.610   16.424  7.136   1.00 56.01  ? 392 ALA A O     1 
ATOM   2818  C  CB    . ALA A 1 379 ? -7.248   18.326  7.358   1.00 56.01  ? 392 ALA A CB    1 
ATOM   2819  N  N     . ARG A 1 380 ? -9.426   17.128  5.006   1.00 82.12  ? 393 ARG A N     1 
ATOM   2820  C  CA    . ARG A 1 380 ? -10.795  16.791  4.644   1.00 82.12  ? 393 ARG A CA    1 
ATOM   2821  C  C     . ARG A 1 380 ? -10.863  15.295  4.360   1.00 82.12  ? 393 ARG A C     1 
ATOM   2822  O  O     . ARG A 1 380 ? -11.784  14.610  4.800   1.00 82.12  ? 393 ARG A O     1 
ATOM   2823  C  CB    . ARG A 1 380 ? -11.226  17.583  3.407   1.00 82.12  ? 393 ARG A CB    1 
ATOM   2824  C  CG    . ARG A 1 380 ? -12.693  18.009  3.389   1.00 82.12  ? 393 ARG A CG    1 
ATOM   2825  C  CD    . ARG A 1 380 ? -13.640  16.817  3.330   1.00 82.12  ? 393 ARG A CD    1 
ATOM   2826  N  NE    . ARG A 1 380 ? -15.039  17.220  3.204   1.00 82.12  ? 393 ARG A NE    1 
ATOM   2827  C  CZ    . ARG A 1 380 ? -15.812  17.568  4.228   1.00 82.12  ? 393 ARG A CZ    1 
ATOM   2828  N  NH1   . ARG A 1 380 ? -15.321  17.571  5.460   1.00 82.12  ? 393 ARG A NH1   1 
ATOM   2829  N  NH2   . ARG A 1 380 ? -17.074  17.918  4.021   1.00 82.12  ? 393 ARG A NH2   1 
ATOM   2830  N  N     . ALA A 1 381 ? -9.872   14.796  3.628   1.00 41.17  ? 394 ALA A N     1 
ATOM   2831  C  CA    . ALA A 1 381 ? -9.804   13.381  3.282   1.00 41.17  ? 394 ALA A CA    1 
ATOM   2832  C  C     . ALA A 1 381 ? -9.539   12.511  4.507   1.00 41.17  ? 394 ALA A C     1 
ATOM   2833  O  O     . ALA A 1 381 ? -9.835   11.316  4.505   1.00 41.17  ? 394 ALA A O     1 
ATOM   2834  C  CB    . ALA A 1 381 ? -8.736   13.148  2.228   1.00 41.17  ? 394 ALA A CB    1 
ATOM   2835  N  N     . VAL A 1 382 ? -8.972   13.116  5.546   1.00 34.51  ? 395 VAL A N     1 
ATOM   2836  C  CA    . VAL A 1 382 ? -8.692   12.409  6.790   1.00 34.51  ? 395 VAL A CA    1 
ATOM   2837  C  C     . VAL A 1 382 ? -9.952   12.286  7.643   1.00 34.51  ? 395 VAL A C     1 
ATOM   2838  O  O     . VAL A 1 382 ? -10.236  11.222  8.192   1.00 34.51  ? 395 VAL A O     1 
ATOM   2839  C  CB    . VAL A 1 382 ? -7.595   13.117  7.606   1.00 34.51  ? 395 VAL A CB    1 
ATOM   2840  C  CG1   . VAL A 1 382 ? -7.323   12.366  8.899   1.00 34.51  ? 395 VAL A CG1   1 
ATOM   2841  C  CG2   . VAL A 1 382 ? -6.322   13.240  6.788   1.00 34.51  ? 395 VAL A CG2   1 
ATOM   2842  N  N     . LYS A 1 383 ? -10.707  13.378  7.746   1.00 39.08  ? 396 LYS A N     1 
ATOM   2843  C  CA    . LYS A 1 383 ? -11.911  13.398  8.573   1.00 39.08  ? 396 LYS A CA    1 
ATOM   2844  C  C     . LYS A 1 383 ? -12.997  12.489  8.007   1.00 39.08  ? 396 LYS A C     1 
ATOM   2845  O  O     . LYS A 1 383 ? -13.788  11.921  8.758   1.00 39.08  ? 396 LYS A O     1 
ATOM   2846  C  CB    . LYS A 1 383 ? -12.448  14.821  8.738   1.00 39.08  ? 396 LYS A CB    1 
ATOM   2847  C  CG    . LYS A 1 383 ? -13.298  15.015  9.991   1.00 39.08  ? 396 LYS A CG    1 
ATOM   2848  C  CD    . LYS A 1 383 ? -13.967  16.382  10.026  1.00 39.08  ? 396 LYS A CD    1 
ATOM   2849  C  CE    . LYS A 1 383 ? -15.214  16.418  9.159   1.00 39.08  ? 396 LYS A CE    1 
ATOM   2850  N  NZ    . LYS A 1 383 ? -16.271  15.501  9.671   1.00 39.08  ? 396 LYS A NZ    1 
ATOM   2851  N  N     . ASN A 1 384 ? -13.038  12.358  6.685   1.00 35.16  ? 397 ASN A N     1 
ATOM   2852  C  CA    . ASN A 1 384 ? -13.975  11.441  6.051   1.00 35.16  ? 397 ASN A CA    1 
ATOM   2853  C  C     . ASN A 1 384 ? -13.670  10.007  6.456   1.00 35.16  ? 397 ASN A C     1 
ATOM   2854  O  O     . ASN A 1 384 ? -14.562  9.263   6.858   1.00 35.16  ? 397 ASN A O     1 
ATOM   2855  C  CB    . ASN A 1 384 ? -13.933  11.579  4.528   1.00 35.16  ? 397 ASN A CB    1 
ATOM   2856  C  CG    . ASN A 1 384 ? -14.893  10.632  3.830   1.00 35.16  ? 397 ASN A CG    1 
ATOM   2857  O  OD1   . ASN A 1 384 ? -14.532  9.509   3.479   1.00 35.16  ? 397 ASN A OD1   1 
ATOM   2858  N  ND2   . ASN A 1 384 ? -16.124  11.082  3.624   1.00 35.16  ? 397 ASN A ND2   1 
ATOM   2859  N  N     . GLY A 1 385 ? -12.398  9.631   6.360   1.00 1.83   ? 398 GLY A N     1 
ATOM   2860  C  CA    . GLY A 1 385 ? -11.967  8.299   6.735   1.00 1.83   ? 398 GLY A CA    1 
ATOM   2861  C  C     . GLY A 1 385 ? -12.139  8.030   8.216   1.00 1.83   ? 398 GLY A C     1 
ATOM   2862  O  O     . GLY A 1 385 ? -12.333  6.888   8.623   1.00 1.83   ? 398 GLY A O     1 
ATOM   2863  N  N     . TYR A 1 386 ? -12.065  9.083   9.024   1.00 13.78  ? 399 TYR A N     1 
ATOM   2864  C  CA    . TYR A 1 386 ? -12.276  8.954   10.460  1.00 13.78  ? 399 TYR A CA    1 
ATOM   2865  C  C     . TYR A 1 386 ? -13.755  8.762   10.769  1.00 13.78  ? 399 TYR A C     1 
ATOM   2866  O  O     . TYR A 1 386 ? -14.136  7.818   11.463  1.00 13.78  ? 399 TYR A O     1 
ATOM   2867  C  CB    . TYR A 1 386 ? -11.740  10.183  11.198  1.00 13.78  ? 399 TYR A CB    1 
ATOM   2868  C  CG    . TYR A 1 386 ? -12.015  10.183  12.687  1.00 13.78  ? 399 TYR A CG    1 
ATOM   2869  C  CD1   . TYR A 1 386 ? -11.243  9.424   13.557  1.00 13.78  ? 399 TYR A CD1   1 
ATOM   2870  C  CD2   . TYR A 1 386 ? -13.039  10.952  13.224  1.00 13.78  ? 399 TYR A CD2   1 
ATOM   2871  C  CE1   . TYR A 1 386 ? -11.489  9.425   14.917  1.00 13.78  ? 399 TYR A CE1   1 
ATOM   2872  C  CE2   . TYR A 1 386 ? -13.292  10.958  14.581  1.00 13.78  ? 399 TYR A CE2   1 
ATOM   2873  C  CZ    . TYR A 1 386 ? -12.515  10.194  15.422  1.00 13.78  ? 399 TYR A CZ    1 
ATOM   2874  O  OH    . TYR A 1 386 ? -12.769  10.204  16.772  1.00 13.78  ? 399 TYR A OH    1 
ATOM   2875  N  N     . ASP A 1 387 ? -14.583  9.665   10.250  1.00 29.25  ? 400 ASP A N     1 
ATOM   2876  C  CA    . ASP A 1 387 ? -16.020  9.621   10.495  1.00 29.25  ? 400 ASP A CA    1 
ATOM   2877  C  C     . ASP A 1 387 ? -16.670  8.365   9.915   1.00 29.25  ? 400 ASP A C     1 
ATOM   2878  O  O     . ASP A 1 387 ? -17.571  7.792   10.522  1.00 29.25  ? 400 ASP A O     1 
ATOM   2879  C  CB    . ASP A 1 387 ? -16.701  10.869  9.927   1.00 29.25  ? 400 ASP A CB    1 
ATOM   2880  C  CG    . ASP A 1 387 ? -16.249  12.145  10.607  1.00 29.25  ? 400 ASP A CG    1 
ATOM   2881  O  OD1   . ASP A 1 387 ? -15.881  12.093  11.798  1.00 29.25  ? 400 ASP A OD1   1 
ATOM   2882  O  OD2   . ASP A 1 387 ? -16.267  13.204  9.947   1.00 29.25  ? 400 ASP A OD2   1 
ATOM   2883  N  N     . GLN A 1 388 ? -16.210  7.943   8.742   1.00 24.28  ? 401 GLN A N     1 
ATOM   2884  C  CA    . GLN A 1 388 ? -16.787  6.780   8.076   1.00 24.28  ? 401 GLN A CA    1 
ATOM   2885  C  C     . GLN A 1 388 ? -16.382  5.481   8.768   1.00 24.28  ? 401 GLN A C     1 
ATOM   2886  O  O     . GLN A 1 388 ? -17.166  4.534   8.838   1.00 24.28  ? 401 GLN A O     1 
ATOM   2887  C  CB    . GLN A 1 388 ? -16.385  6.744   6.603   1.00 24.28  ? 401 GLN A CB    1 
ATOM   2888  C  CG    . GLN A 1 388 ? -17.433  6.124   5.692   1.00 24.28  ? 401 GLN A CG    1 
ATOM   2889  C  CD    . GLN A 1 388 ? -18.542  7.090   5.324   1.00 24.28  ? 401 GLN A CD    1 
ATOM   2890  O  OE1   . GLN A 1 388 ? -18.544  8.244   5.749   1.00 24.28  ? 401 GLN A OE1   1 
ATOM   2891  N  NE2   . GLN A 1 388 ? -19.492  6.621   4.523   1.00 24.28  ? 401 GLN A NE2   1 
ATOM   2892  N  N     . THR A 1 389 ? -15.156  5.440   9.278   1.00 34.61  ? 402 THR A N     1 
ATOM   2893  C  CA    . THR A 1 389 ? -14.683  4.282   10.029  1.00 34.61  ? 402 THR A CA    1 
ATOM   2894  C  C     . THR A 1 389 ? -15.433  4.186   11.353  1.00 34.61  ? 402 THR A C     1 
ATOM   2895  O  O     . THR A 1 389 ? -15.793  3.096   11.796  1.00 34.61  ? 402 THR A O     1 
ATOM   2896  C  CB    . THR A 1 389 ? -13.171  4.355   10.297  1.00 34.61  ? 402 THR A CB    1 
ATOM   2897  O  OG1   . THR A 1 389 ? -12.470  4.527   9.058   1.00 34.61  ? 402 THR A OG1   1 
ATOM   2898  C  CG2   . THR A 1 389 ? -12.684  3.087   10.975  1.00 34.61  ? 402 THR A CG2   1 
ATOM   2899  N  N     . MET A 1 390 ? -15.668  5.337   11.977  1.00 22.48  ? 403 MET A N     1 
ATOM   2900  C  CA    . MET A 1 390 ? -16.448  5.405   13.206  1.00 22.48  ? 403 MET A CA    1 
ATOM   2901  C  C     . MET A 1 390 ? -17.897  5.013   12.948  1.00 22.48  ? 403 MET A C     1 
ATOM   2902  O  O     . MET A 1 390 ? -18.497  4.273   13.726  1.00 22.48  ? 403 MET A O     1 
ATOM   2903  C  CB    . MET A 1 390 ? -16.388  6.814   13.797  1.00 22.48  ? 403 MET A CB    1 
ATOM   2904  C  CG    . MET A 1 390 ? -15.670  6.906   15.131  1.00 22.48  ? 403 MET A CG    1 
ATOM   2905  S  SD    . MET A 1 390 ? -14.138  5.964   15.118  1.00 22.48  ? 403 MET A SD    1 
ATOM   2906  C  CE    . MET A 1 390 ? -13.452  6.410   16.710  1.00 22.48  ? 403 MET A CE    1 
ATOM   2907  N  N     . GLN A 1 391 ? -18.452  5.512   11.847  1.00 47.73  ? 404 GLN A N     1 
ATOM   2908  C  CA    . GLN A 1 391 ? -19.835  5.231   11.481  1.00 47.73  ? 404 GLN A CA    1 
ATOM   2909  C  C     . GLN A 1 391 ? -20.067  3.739   11.247  1.00 47.73  ? 404 GLN A C     1 
ATOM   2910  O  O     . GLN A 1 391 ? -21.128  3.211   11.580  1.00 47.73  ? 404 GLN A O     1 
ATOM   2911  C  CB    . GLN A 1 391 ? -20.232  6.037   10.240  1.00 47.73  ? 404 GLN A CB    1 
ATOM   2912  C  CG    . GLN A 1 391 ? -21.631  5.747   9.711   1.00 47.73  ? 404 GLN A CG    1 
ATOM   2913  C  CD    . GLN A 1 391 ? -21.999  6.619   8.527   1.00 47.73  ? 404 GLN A CD    1 
ATOM   2914  O  OE1   . GLN A 1 391 ? -22.026  7.844   8.630   1.00 47.73  ? 404 GLN A OE1   1 
ATOM   2915  N  NE2   . GLN A 1 391 ? -22.278  5.989   7.392   1.00 47.73  ? 404 GLN A NE2   1 
ATOM   2916  N  N     . LEU A 1 392 ? -19.071  3.060   10.684  1.00 12.63  ? 405 LEU A N     1 
ATOM   2917  C  CA    . LEU A 1 392 ? -19.192  1.628   10.433  1.00 12.63  ? 405 LEU A CA    1 
ATOM   2918  C  C     . LEU A 1 392 ? -19.112  0.829   11.726  1.00 12.63  ? 405 LEU A C     1 
ATOM   2919  O  O     . LEU A 1 392 ? -19.904  -0.086  11.947  1.00 12.63  ? 405 LEU A O     1 
ATOM   2920  C  CB    . LEU A 1 392 ? -18.121  1.132   9.466   1.00 12.63  ? 405 LEU A CB    1 
ATOM   2921  C  CG    . LEU A 1 392 ? -18.406  -0.307  9.031   1.00 12.63  ? 405 LEU A CG    1 
ATOM   2922  C  CD1   . LEU A 1 392 ? -19.323  -0.320  7.823   1.00 12.63  ? 405 LEU A CD1   1 
ATOM   2923  C  CD2   . LEU A 1 392 ? -17.144  -1.098  8.763   1.00 12.63  ? 405 LEU A CD2   1 
ATOM   2924  N  N     . LEU A 1 393 ? -18.147  1.171   12.573  1.00 12.16  ? 406 LEU A N     1 
ATOM   2925  C  CA    . LEU A 1 393 ? -17.975  0.491   13.851  1.00 12.16  ? 406 LEU A CA    1 
ATOM   2926  C  C     . LEU A 1 393 ? -19.219  0.649   14.726  1.00 12.16  ? 406 LEU A C     1 
ATOM   2927  O  O     . LEU A 1 393 ? -19.531  -0.224  15.538  1.00 12.16  ? 406 LEU A O     1 
ATOM   2928  C  CB    . LEU A 1 393 ? -16.727  1.006   14.576  1.00 12.16  ? 406 LEU A CB    1 
ATOM   2929  C  CG    . LEU A 1 393 ? -15.386  0.309   14.318  1.00 12.16  ? 406 LEU A CG    1 
ATOM   2930  C  CD1   . LEU A 1 393 ? -15.440  -0.592  13.096  1.00 12.16  ? 406 LEU A CD1   1 
ATOM   2931  C  CD2   . LEU A 1 393 ? -14.266  1.327   14.170  1.00 12.16  ? 406 LEU A CD2   1 
ATOM   2932  N  N     . ASP A 1 394 ? -19.935  1.756   14.540  1.00 23.13  ? 407 ASP A N     1 
ATOM   2933  C  CA    . ASP A 1 394 ? -21.182  1.999   15.256  1.00 23.13  ? 407 ASP A CA    1 
ATOM   2934  C  C     . ASP A 1 394 ? -22.324  1.127   14.731  1.00 23.13  ? 407 ASP A C     1 
ATOM   2935  O  O     . ASP A 1 394 ? -23.436  1.171   15.252  1.00 23.13  ? 407 ASP A O     1 
ATOM   2936  C  CB    . ASP A 1 394 ? -21.579  3.478   15.175  1.00 23.13  ? 407 ASP A CB    1 
ATOM   2937  C  CG    . ASP A 1 394 ? -20.670  4.376   15.990  1.00 23.13  ? 407 ASP A CG    1 
ATOM   2938  O  OD1   . ASP A 1 394 ? -19.847  3.849   16.765  1.00 23.13  ? 407 ASP A OD1   1 
ATOM   2939  O  OD2   . ASP A 1 394 ? -20.789  5.613   15.864  1.00 23.13  ? 407 ASP A OD2   1 
ATOM   2940  N  N     . SER A 1 395 ? -22.050  0.342   13.694  1.00 3.32   ? 408 SER A N     1 
ATOM   2941  C  CA    . SER A 1 395 ? -23.054  -0.557  13.136  1.00 3.32   ? 408 SER A CA    1 
ATOM   2942  C  C     . SER A 1 395 ? -22.780  -2.001  13.547  1.00 3.32   ? 408 SER A C     1 
ATOM   2943  O  O     . SER A 1 395 ? -23.450  -2.924  13.088  1.00 3.32   ? 408 SER A O     1 
ATOM   2944  C  CB    . SER A 1 395 ? -23.103  -0.445  11.611  1.00 3.32   ? 408 SER A CB    1 
ATOM   2945  O  OG    . SER A 1 395 ? -21.955  -1.013  11.015  1.00 3.32   ? 408 SER A OG    1 
ATOM   2946  N  N     . HIS A 1 396 ? -21.793  -2.187  14.416  1.00 5.93   ? 409 HIS A N     1 
ATOM   2947  C  CA    . HIS A 1 396 ? -21.470  -3.508  14.930  1.00 5.93   ? 409 HIS A CA    1 
ATOM   2948  C  C     . HIS A 1 396 ? -22.070  -3.692  16.315  1.00 5.93   ? 409 HIS A C     1 
ATOM   2949  O  O     . HIS A 1 396 ? -22.227  -4.814  16.792  1.00 5.93   ? 409 HIS A O     1 
ATOM   2950  C  CB    . HIS A 1 396 ? -19.954  -3.707  14.984  1.00 5.93   ? 409 HIS A CB    1 
ATOM   2951  C  CG    . HIS A 1 396 ? -19.295  -3.709  13.631  1.00 5.93   ? 409 HIS A CG    1 
ATOM   2952  N  ND1   . HIS A 1 396 ? -17.937  -3.619  13.483  1.00 5.93   ? 409 HIS A ND1   1 
ATOM   2953  C  CD2   . HIS A 1 396 ? -19.821  -3.797  12.393  1.00 5.93   ? 409 HIS A CD2   1 
ATOM   2954  C  CE1   . HIS A 1 396 ? -17.639  -3.647  12.181  1.00 5.93   ? 409 HIS A CE1   1 
ATOM   2955  N  NE2   . HIS A 1 396 ? -18.772  -3.754  11.510  1.00 5.93   ? 409 HIS A NE2   1 
ATOM   2956  N  N     . LYS A 1 397 ? -22.400  -2.577  16.957  1.00 34.90  ? 410 LYS A N     1 
ATOM   2957  C  CA    . LYS A 1 397 ? -23.024  -2.604  18.271  1.00 34.90  ? 410 LYS A CA    1 
ATOM   2958  C  C     . LYS A 1 397 ? -24.509  -2.926  18.164  1.00 34.90  ? 410 LYS A C     1 
ATOM   2959  O  O     . LYS A 1 397 ? -25.329  -2.052  17.883  1.00 34.90  ? 410 LYS A O     1 
ATOM   2960  C  CB    . LYS A 1 397 ? -22.813  -1.271  18.993  1.00 34.90  ? 410 LYS A CB    1 
ATOM   2961  C  CG    . LYS A 1 397 ? -22.887  -0.058  18.079  1.00 34.90  ? 410 LYS A CG    1 
ATOM   2962  C  CD    . LYS A 1 397 ? -22.545  1.231   18.812  1.00 34.90  ? 410 LYS A CD    1 
ATOM   2963  C  CE    . LYS A 1 397 ? -21.096  1.250   19.267  1.00 34.90  ? 410 LYS A CE    1 
ATOM   2964  N  NZ    . LYS A 1 397 ? -20.750  2.531   19.940  1.00 34.90  ? 410 LYS A NZ    1 
ATOM   2965  N  N     . GLN A 1 398 ? -24.848  -4.193  18.379  1.00 27.36  ? 411 GLN A N     1 
ATOM   2966  C  CA    . GLN A 1 398 ? -26.234  -4.635  18.332  1.00 27.36  ? 411 GLN A CA    1 
ATOM   2967  C  C     . GLN A 1 398 ? -26.878  -4.474  19.700  1.00 27.36  ? 411 GLN A C     1 
ATOM   2968  O  O     . GLN A 1 398 ? -26.271  -4.794  20.720  1.00 27.36  ? 411 GLN A O     1 
ATOM   2969  C  CB    . GLN A 1 398 ? -26.304  -6.097  17.899  1.00 27.36  ? 411 GLN A CB    1 
ATOM   2970  C  CG    . GLN A 1 398 ? -25.653  -6.391  16.556  1.00 27.36  ? 411 GLN A CG    1 
ATOM   2971  C  CD    . GLN A 1 398 ? -26.640  -6.361  15.409  1.00 27.36  ? 411 GLN A CD    1 
ATOM   2972  O  OE1   . GLN A 1 398 ? -27.084  -5.297  14.982  1.00 27.36  ? 411 GLN A OE1   1 
ATOM   2973  N  NE2   . GLN A 1 398 ? -26.997  -7.537  14.909  1.00 27.36  ? 411 GLN A NE2   1 
ATOM   2974  N  N     . THR A 1 399 ? -28.105  -3.966  19.716  1.00 14.21  ? 412 THR A N     1 
ATOM   2975  C  CA    . THR A 1 399 ? -28.872  -3.845  20.946  1.00 14.21  ? 412 THR A CA    1 
ATOM   2976  C  C     . THR A 1 399 ? -30.342  -4.046  20.600  1.00 14.21  ? 412 THR A C     1 
ATOM   2977  O  O     . THR A 1 399 ? -30.776  -3.695  19.505  1.00 14.21  ? 412 THR A O     1 
ATOM   2978  C  CB    . THR A 1 399 ? -28.657  -2.480  21.618  1.00 14.21  ? 412 THR A CB    1 
ATOM   2979  O  OG1   . THR A 1 399 ? -27.254  -2.232  21.765  1.00 14.21  ? 412 THR A OG1   1 
ATOM   2980  C  CG2   . THR A 1 399 ? -29.308  -2.441  22.990  1.00 14.21  ? 412 THR A CG2   1 
ATOM   2981  N  N     . PHE A 1 400 ? -31.099  -4.641  21.515  1.00 7.66   ? 413 PHE A N     1 
ATOM   2982  C  CA    . PHE A 1 400 ? -32.517  -4.882  21.283  1.00 7.66   ? 413 PHE A CA    1 
ATOM   2983  C  C     . PHE A 1 400 ? -33.319  -4.657  22.560  1.00 7.66   ? 413 PHE A C     1 
ATOM   2984  O  O     . PHE A 1 400 ? -32.754  -4.619  23.655  1.00 7.66   ? 413 PHE A O     1 
ATOM   2985  C  CB    . PHE A 1 400 ? -32.744  -6.301  20.755  1.00 7.66   ? 413 PHE A CB    1 
ATOM   2986  C  CG    . PHE A 1 400 ? -32.145  -6.549  19.399  1.00 7.66   ? 413 PHE A CG    1 
ATOM   2987  C  CD1   . PHE A 1 400 ? -32.862  -6.265  18.248  1.00 7.66   ? 413 PHE A CD1   1 
ATOM   2988  C  CD2   . PHE A 1 400 ? -30.866  -7.069  19.276  1.00 7.66   ? 413 PHE A CD2   1 
ATOM   2989  C  CE1   . PHE A 1 400 ? -32.315  -6.492  16.996  1.00 7.66   ? 413 PHE A CE1   1 
ATOM   2990  C  CE2   . PHE A 1 400 ? -30.311  -7.299  18.028  1.00 7.66   ? 413 PHE A CE2   1 
ATOM   2991  C  CZ    . PHE A 1 400 ? -31.038  -7.010  16.888  1.00 7.66   ? 413 PHE A CZ    1 
ATOM   2992  N  N     . ASP A 1 401 ? -34.632  -4.502  22.417  1.00 25.96  ? 414 ASP A N     1 
ATOM   2993  C  CA    . ASP A 1 401 ? -35.502  -4.292  23.569  1.00 25.96  ? 414 ASP A CA    1 
ATOM   2994  C  C     . ASP A 1 401 ? -35.981  -5.613  24.161  1.00 25.96  ? 414 ASP A C     1 
ATOM   2995  O  O     . ASP A 1 401 ? -36.335  -5.683  25.338  1.00 25.96  ? 414 ASP A O     1 
ATOM   2996  C  CB    . ASP A 1 401 ? -36.692  -3.405  23.199  1.00 25.96  ? 414 ASP A CB    1 
ATOM   2997  C  CG    . ASP A 1 401 ? -36.364  -1.925  23.271  1.00 25.96  ? 414 ASP A CG    1 
ATOM   2998  O  OD1   . ASP A 1 401 ? -35.621  -1.522  24.188  1.00 25.96  ? 414 ASP A OD1   1 
ATOM   2999  O  OD2   . ASP A 1 401 ? -36.850  -1.164  22.408  1.00 25.96  ? 414 ASP A OD2   1 
ATOM   3000  N  N     . HIS A 1 402 ? -35.983  -6.660  23.342  1.00 15.40  ? 415 HIS A N     1 
ATOM   3001  C  CA    . HIS A 1 402 ? -36.390  -7.985  23.797  1.00 15.40  ? 415 HIS A CA    1 
ATOM   3002  C  C     . HIS A 1 402 ? -35.441  -9.057  23.268  1.00 15.40  ? 415 HIS A C     1 
ATOM   3003  O  O     . HIS A 1 402 ? -35.086  -9.046  22.088  1.00 15.40  ? 415 HIS A O     1 
ATOM   3004  C  CB    . HIS A 1 402 ? -37.826  -8.282  23.359  1.00 15.40  ? 415 HIS A CB    1 
ATOM   3005  C  CG    . HIS A 1 402 ? -38.456  -9.428  24.090  1.00 15.40  ? 415 HIS A CG    1 
ATOM   3006  N  ND1   . HIS A 1 402 ? -38.237  -10.743 23.745  1.00 15.40  ? 415 HIS A ND1   1 
ATOM   3007  C  CD2   . HIS A 1 402 ? -39.296  -9.452  25.152  1.00 15.40  ? 415 HIS A CD2   1 
ATOM   3008  C  CE1   . HIS A 1 402 ? -38.914  -11.529 24.560  1.00 15.40  ? 415 HIS A CE1   1 
ATOM   3009  N  NE2   . HIS A 1 402 ? -39.567  -10.772 25.424  1.00 15.40  ? 415 HIS A NE2   1 
ATOM   3010  N  N     . PRO A 1 403 ? -35.034  -9.993  24.142  1.00 14.83  ? 416 PRO A N     1 
ATOM   3011  C  CA    . PRO A 1 403 ? -34.042  -11.021 23.809  1.00 14.83  ? 416 PRO A CA    1 
ATOM   3012  C  C     . PRO A 1 403 ? -34.466  -11.948 22.672  1.00 14.83  ? 416 PRO A C     1 
ATOM   3013  O  O     . PRO A 1 403 ? -33.598  -12.480 21.983  1.00 14.83  ? 416 PRO A O     1 
ATOM   3014  C  CB    . PRO A 1 403 ? -33.907  -11.815 25.113  1.00 14.83  ? 416 PRO A CB    1 
ATOM   3015  C  CG    . PRO A 1 403 ? -35.161  -11.545 25.863  1.00 14.83  ? 416 PRO A CG    1 
ATOM   3016  C  CD    . PRO A 1 403 ? -35.521  -10.135 25.525  1.00 14.83  ? 416 PRO A CD    1 
ATOM   3017  N  N     . LEU A 1 404 ? -35.769  -12.142 22.484  1.00 20.90  ? 417 LEU A N     1 
ATOM   3018  C  CA    . LEU A 1 404 ? -36.264  -13.002 21.411  1.00 20.90  ? 417 LEU A CA    1 
ATOM   3019  C  C     . LEU A 1 404 ? -36.006  -12.362 20.049  1.00 20.90  ? 417 LEU A C     1 
ATOM   3020  O  O     . LEU A 1 404 ? -35.729  -13.056 19.071  1.00 20.90  ? 417 LEU A O     1 
ATOM   3021  C  CB    . LEU A 1 404 ? -37.758  -13.281 21.589  1.00 20.90  ? 417 LEU A CB    1 
ATOM   3022  C  CG    . LEU A 1 404 ? -38.280  -14.705 21.379  1.00 20.90  ? 417 LEU A CG    1 
ATOM   3023  C  CD1   . LEU A 1 404 ? -39.801  -14.721 21.334  1.00 20.90  ? 417 LEU A CD1   1 
ATOM   3024  C  CD2   . LEU A 1 404 ? -37.706  -15.338 20.125  1.00 20.90  ? 417 LEU A CD2   1 
ATOM   3025  N  N     . MET A 1 405 ? -36.098  -11.036 19.993  1.00 18.29  ? 418 MET A N     1 
ATOM   3026  C  CA    . MET A 1 405 ? -35.848  -10.303 18.757  1.00 18.29  ? 418 MET A CA    1 
ATOM   3027  C  C     . MET A 1 405 ? -34.420  -10.534 18.281  1.00 18.29  ? 418 MET A C     1 
ATOM   3028  O  O     . MET A 1 405 ? -34.156  -10.611 17.083  1.00 18.29  ? 418 MET A O     1 
ATOM   3029  C  CB    . MET A 1 405 ? -36.094  -8.809  18.956  1.00 18.29  ? 418 MET A CB    1 
ATOM   3030  C  CG    . MET A 1 405 ? -36.124  -8.023  17.661  1.00 18.29  ? 418 MET A CG    1 
ATOM   3031  S  SD    . MET A 1 405 ? -37.442  -8.606  16.576  1.00 18.29  ? 418 MET A SD    1 
ATOM   3032  C  CE    . MET A 1 405 ? -36.950  -7.866  15.023  1.00 18.29  ? 418 MET A CE    1 
ATOM   3033  N  N     . ALA A 1 406 ? -33.502  -10.651 19.233  1.00 19.64  ? 419 ALA A N     1 
ATOM   3034  C  CA    . ALA A 1 406 ? -32.103  -10.899 18.918  1.00 19.64  ? 419 ALA A CA    1 
ATOM   3035  C  C     . ALA A 1 406 ? -31.885  -12.321 18.399  1.00 19.64  ? 419 ALA A C     1 
ATOM   3036  O  O     . ALA A 1 406 ? -31.166  -12.522 17.423  1.00 19.64  ? 419 ALA A O     1 
ATOM   3037  C  CB    . ALA A 1 406 ? -31.234  -10.629 20.129  1.00 19.64  ? 419 ALA A CB    1 
ATOM   3038  N  N     . ILE A 1 407 ? -32.504  -13.301 19.053  1.00 11.74  ? 420 ILE A N     1 
ATOM   3039  C  CA    . ILE A 1 407 ? -32.373  -14.698 18.643  1.00 11.74  ? 420 ILE A CA    1 
ATOM   3040  C  C     . ILE A 1 407 ? -33.034  -14.953 17.285  1.00 11.74  ? 420 ILE A C     1 
ATOM   3041  O  O     . ILE A 1 407 ? -32.634  -15.856 16.549  1.00 11.74  ? 420 ILE A O     1 
ATOM   3042  C  CB    . ILE A 1 407 ? -32.978  -15.661 19.687  1.00 11.74  ? 420 ILE A CB    1 
ATOM   3043  C  CG1   . ILE A 1 407 ? -32.542  -15.281 21.100  1.00 11.74  ? 420 ILE A CG1   1 
ATOM   3044  C  CG2   . ILE A 1 407 ? -32.585  -17.106 19.380  1.00 11.74  ? 420 ILE A CG2   1 
ATOM   3045  C  CD1   . ILE A 1 407 ? -31.337  -16.050 21.602  1.00 11.74  ? 420 ILE A CD1   1 
ATOM   3046  N  N     . LEU A 1 408 ? -34.048  -14.158 16.958  1.00 1.98   ? 421 LEU A N     1 
ATOM   3047  C  CA    . LEU A 1 408 ? -34.749  -14.303 15.685  1.00 1.98   ? 421 LEU A CA    1 
ATOM   3048  C  C     . LEU A 1 408 ? -34.023  -13.598 14.543  1.00 1.98   ? 421 LEU A C     1 
ATOM   3049  O  O     . LEU A 1 408 ? -33.856  -14.163 13.464  1.00 1.98   ? 421 LEU A O     1 
ATOM   3050  C  CB    . LEU A 1 408 ? -36.181  -13.773 15.791  1.00 1.98   ? 421 LEU A CB    1 
ATOM   3051  C  CG    . LEU A 1 408 ? -37.207  -14.654 16.504  1.00 1.98   ? 421 LEU A CG    1 
ATOM   3052  C  CD1   . LEU A 1 408 ? -38.538  -13.937 16.623  1.00 1.98   ? 421 LEU A CD1   1 
ATOM   3053  C  CD2   . LEU A 1 408 ? -37.375  -15.966 15.767  1.00 1.98   ? 421 LEU A CD2   1 
ATOM   3054  N  N     . TYR A 1 409 ? -33.601  -12.361 14.786  1.00 11.01  ? 422 TYR A N     1 
ATOM   3055  C  CA    . TYR A 1 409 ? -32.929  -11.563 13.764  1.00 11.01  ? 422 TYR A CA    1 
ATOM   3056  C  C     . TYR A 1 409 ? -31.525  -12.090 13.483  1.00 11.01  ? 422 TYR A C     1 
ATOM   3057  O  O     . TYR A 1 409 ? -31.151  -12.295 12.330  1.00 11.01  ? 422 TYR A O     1 
ATOM   3058  C  CB    . TYR A 1 409 ? -32.888  -10.092 14.176  1.00 11.01  ? 422 TYR A CB    1 
ATOM   3059  C  CG    . TYR A 1 409 ? -32.164  -9.193  13.203  1.00 11.01  ? 422 TYR A CG    1 
ATOM   3060  C  CD1   . TYR A 1 409 ? -32.383  -9.292  11.836  1.00 11.01  ? 422 TYR A CD1   1 
ATOM   3061  C  CD2   . TYR A 1 409 ? -31.271  -8.232  13.654  1.00 11.01  ? 422 TYR A CD2   1 
ATOM   3062  C  CE1   . TYR A 1 409 ? -31.722  -8.468  10.948  1.00 11.01  ? 422 TYR A CE1   1 
ATOM   3063  C  CE2   . TYR A 1 409 ? -30.609  -7.403  12.773  1.00 11.01  ? 422 TYR A CE2   1 
ATOM   3064  C  CZ    . TYR A 1 409 ? -30.838  -7.527  11.421  1.00 11.01  ? 422 TYR A CZ    1 
ATOM   3065  O  OH    . TYR A 1 409 ? -30.180  -6.705  10.539  1.00 11.01  ? 422 TYR A OH    1 
ATOM   3066  N  N     . ILE A 1 410 ? -30.750  -12.302 14.541  1.00 10.30  ? 423 ILE A N     1 
ATOM   3067  C  CA    . ILE A 1 410 ? -29.457  -12.959 14.416  1.00 10.30  ? 423 ILE A CA    1 
ATOM   3068  C  C     . ILE A 1 410 ? -29.704  -14.459 14.390  1.00 10.30  ? 423 ILE A C     1 
ATOM   3069  O  O     . ILE A 1 410 ? -30.514  -14.965 15.163  1.00 10.30  ? 423 ILE A O     1 
ATOM   3070  C  CB    . ILE A 1 410 ? -28.542  -12.628 15.605  1.00 10.30  ? 423 ILE A CB    1 
ATOM   3071  C  CG1   . ILE A 1 410 ? -28.528  -11.124 15.861  1.00 10.30  ? 423 ILE A CG1   1 
ATOM   3072  C  CG2   . ILE A 1 410 ? -27.134  -13.157 15.371  1.00 10.30  ? 423 ILE A CG2   1 
ATOM   3073  C  CD1   . ILE A 1 410 ? -27.766  -10.736 17.091  1.00 10.30  ? 423 ILE A CD1   1 
ATOM   3074  N  N     . GLY A 1 411 ? -29.017  -15.171 13.504  1.00 56.60  ? 424 GLY A N     1 
ATOM   3075  C  CA    . GLY A 1 411 ? -29.181  -16.610 13.417  1.00 56.60  ? 424 GLY A CA    1 
ATOM   3076  C  C     . GLY A 1 411 ? -28.838  -17.308 14.719  1.00 56.60  ? 424 GLY A C     1 
ATOM   3077  O  O     . GLY A 1 411 ? -27.902  -16.916 15.414  1.00 56.60  ? 424 GLY A O     1 
ATOM   3078  N  N     . HIS A 1 412 ? -29.597  -18.347 15.052  1.00 55.61  ? 425 HIS A N     1 
ATOM   3079  C  CA    . HIS A 1 412 ? -29.332  -19.125 16.253  1.00 55.61  ? 425 HIS A CA    1 
ATOM   3080  C  C     . HIS A 1 412 ? -28.120  -20.018 16.020  1.00 55.61  ? 425 HIS A C     1 
ATOM   3081  O  O     . HIS A 1 412 ? -27.623  -20.671 16.940  1.00 55.61  ? 425 HIS A O     1 
ATOM   3082  C  CB    . HIS A 1 412 ? -30.552  -19.960 16.640  1.00 55.61  ? 425 HIS A CB    1 
ATOM   3083  C  CG    . HIS A 1 412 ? -30.663  -21.255 15.896  1.00 55.61  ? 425 HIS A CG    1 
ATOM   3084  N  ND1   . HIS A 1 412 ? -30.328  -22.465 16.465  1.00 55.61  ? 425 HIS A ND1   1 
ATOM   3085  C  CD2   . HIS A 1 412 ? -31.070  -21.532 14.637  1.00 55.61  ? 425 HIS A CD2   1 
ATOM   3086  C  CE1   . HIS A 1 412 ? -30.525  -23.434 15.584  1.00 55.61  ? 425 HIS A CE1   1 
ATOM   3087  N  NE2   . HIS A 1 412 ? -30.976  -22.889 14.466  1.00 55.61  ? 425 HIS A NE2   1 
ATOM   3088  N  N     . ASP A 1 413 ? -27.657  -20.041 14.775  1.00 82.07  ? 426 ASP A N     1 
ATOM   3089  C  CA    . ASP A 1 413 ? -26.434  -20.735 14.407  1.00 82.07  ? 426 ASP A CA    1 
ATOM   3090  C  C     . ASP A 1 413 ? -25.251  -19.817 14.688  1.00 82.07  ? 426 ASP A C     1 
ATOM   3091  O  O     . ASP A 1 413 ? -24.103  -20.256 14.727  1.00 82.07  ? 426 ASP A O     1 
ATOM   3092  C  CB    . ASP A 1 413 ? -26.462  -21.089 12.919  1.00 82.07  ? 426 ASP A CB    1 
ATOM   3093  C  CG    . ASP A 1 413 ? -27.863  -21.058 12.338  1.00 82.07  ? 426 ASP A CG    1 
ATOM   3094  O  OD1   . ASP A 1 413 ? -28.351  -19.954 12.019  1.00 82.07  ? 426 ASP A OD1   1 
ATOM   3095  O  OD2   . ASP A 1 413 ? -28.473  -22.137 12.193  1.00 82.07  ? 426 ASP A OD2   1 
ATOM   3096  N  N     . LYS A 1 414 ? -25.549  -18.536 14.883  1.00 23.53  ? 427 LYS A N     1 
ATOM   3097  C  CA    . LYS A 1 414 ? -24.527  -17.521 15.099  1.00 23.53  ? 427 LYS A CA    1 
ATOM   3098  C  C     . LYS A 1 414 ? -24.457  -17.146 16.574  1.00 23.53  ? 427 LYS A C     1 
ATOM   3099  O  O     . LYS A 1 414 ? -23.735  -16.226 16.961  1.00 23.53  ? 427 LYS A O     1 
ATOM   3100  C  CB    . LYS A 1 414 ? -24.844  -16.278 14.269  1.00 23.53  ? 427 LYS A CB    1 
ATOM   3101  C  CG    . LYS A 1 414 ? -25.406  -16.586 12.889  1.00 23.53  ? 427 LYS A CG    1 
ATOM   3102  C  CD    . LYS A 1 414 ? -24.365  -17.235 11.998  1.00 23.53  ? 427 LYS A CD    1 
ATOM   3103  C  CE    . LYS A 1 414 ? -23.250  -16.261 11.663  1.00 23.53  ? 427 LYS A CE    1 
ATOM   3104  N  NZ    . LYS A 1 414 ? -23.786  -15.026 11.027  1.00 23.53  ? 427 LYS A NZ    1 
ATOM   3105  N  N     . LEU A 1 415 ? -25.213  -17.866 17.394  1.00 24.27  ? 428 LEU A N     1 
ATOM   3106  C  CA    . LEU A 1 415 ? -25.270  -17.595 18.823  1.00 24.27  ? 428 LEU A CA    1 
ATOM   3107  C  C     . LEU A 1 415 ? -24.841  -18.820 19.619  1.00 24.27  ? 428 LEU A C     1 
ATOM   3108  O  O     . LEU A 1 415 ? -25.049  -19.954 19.187  1.00 24.27  ? 428 LEU A O     1 
ATOM   3109  C  CB    . LEU A 1 415 ? -26.686  -17.185 19.227  1.00 24.27  ? 428 LEU A CB    1 
ATOM   3110  C  CG    . LEU A 1 415 ? -27.230  -15.894 18.616  1.00 24.27  ? 428 LEU A CG    1 
ATOM   3111  C  CD1   . LEU A 1 415 ? -28.724  -15.768 18.850  1.00 24.27  ? 428 LEU A CD1   1 
ATOM   3112  C  CD2   . LEU A 1 415 ? -26.499  -14.696 19.193  1.00 24.27  ? 428 LEU A CD2   1 
ATOM   3113  N  N     . LYS A 1 416 ? -24.236  -18.587 20.780  1.00 36.91  ? 429 LYS A N     1 
ATOM   3114  C  CA    . LYS A 1 416 ? -23.886  -19.670 21.690  1.00 36.91  ? 429 LYS A CA    1 
ATOM   3115  C  C     . LYS A 1 416 ? -25.166  -20.278 22.252  1.00 36.91  ? 429 LYS A C     1 
ATOM   3116  O  O     . LYS A 1 416 ? -25.978  -19.571 22.848  1.00 36.91  ? 429 LYS A O     1 
ATOM   3117  C  CB    . LYS A 1 416 ? -23.008  -19.139 22.824  1.00 36.91  ? 429 LYS A CB    1 
ATOM   3118  C  CG    . LYS A 1 416 ? -22.599  -20.179 23.851  1.00 36.91  ? 429 LYS A CG    1 
ATOM   3119  C  CD    . LYS A 1 416 ? -21.893  -19.524 25.026  1.00 36.91  ? 429 LYS A CD    1 
ATOM   3120  C  CE    . LYS A 1 416 ? -21.568  -20.535 26.114  1.00 36.91  ? 429 LYS A CE    1 
ATOM   3121  N  NZ    . LYS A 1 416 ? -21.030  -19.877 27.337  1.00 36.91  ? 429 LYS A NZ    1 
ATOM   3122  N  N     . ASP A 1 417 ? -25.345  -21.581 22.051  1.00 52.57  ? 430 ASP A N     1 
ATOM   3123  C  CA    . ASP A 1 417 ? -26.558  -22.269 22.487  1.00 52.57  ? 430 ASP A CA    1 
ATOM   3124  C  C     . ASP A 1 417 ? -26.745  -22.134 23.994  1.00 52.57  ? 430 ASP A C     1 
ATOM   3125  O  O     . ASP A 1 417 ? -25.955  -22.659 24.775  1.00 52.57  ? 430 ASP A O     1 
ATOM   3126  C  CB    . ASP A 1 417 ? -26.515  -23.745 22.091  1.00 52.57  ? 430 ASP A CB    1 
ATOM   3127  C  CG    . ASP A 1 417 ? -27.893  -24.384 22.069  1.00 52.57  ? 430 ASP A CG    1 
ATOM   3128  O  OD1   . ASP A 1 417 ? -28.841  -23.787 22.621  1.00 52.57  ? 430 ASP A OD1   1 
ATOM   3129  O  OD2   . ASP A 1 417 ? -28.027  -25.488 21.500  1.00 52.57  ? 430 ASP A OD2   1 
ATOM   3130  N  N     . ALA A 1 418 ? -27.796  -21.424 24.393  1.00 34.01  ? 431 ALA A N     1 
ATOM   3131  C  CA    . ALA A 1 418 ? -28.059  -21.162 25.804  1.00 34.01  ? 431 ALA A CA    1 
ATOM   3132  C  C     . ALA A 1 418 ? -28.783  -22.326 26.471  1.00 34.01  ? 431 ALA A C     1 
ATOM   3133  O  O     . ALA A 1 418 ? -28.705  -22.499 27.687  1.00 34.01  ? 431 ALA A O     1 
ATOM   3134  C  CB    . ALA A 1 418 ? -28.857  -19.880 25.962  1.00 34.01  ? 431 ALA A CB    1 
ATOM   3135  N  N     . LEU A 1 419 ? -29.495  -23.114 25.670  1.00 19.57  ? 432 LEU A N     1 
ATOM   3136  C  CA    . LEU A 1 419 ? -30.207  -24.282 26.173  1.00 19.57  ? 432 LEU A CA    1 
ATOM   3137  C  C     . LEU A 1 419 ? -29.228  -25.318 26.727  1.00 19.57  ? 432 LEU A C     1 
ATOM   3138  O  O     . LEU A 1 419 ? -29.497  -25.964 27.740  1.00 19.57  ? 432 LEU A O     1 
ATOM   3139  C  CB    . LEU A 1 419 ? -31.061  -24.906 25.067  1.00 19.57  ? 432 LEU A CB    1 
ATOM   3140  C  CG    . LEU A 1 419 ? -32.155  -24.064 24.409  1.00 19.57  ? 432 LEU A CG    1 
ATOM   3141  C  CD1   . LEU A 1 419 ? -32.820  -24.835 23.285  1.00 19.57  ? 432 LEU A CD1   1 
ATOM   3142  C  CD2   . LEU A 1 419 ? -33.188  -23.625 25.426  1.00 19.57  ? 432 LEU A CD2   1 
ATOM   3143  N  N     . ILE A 1 420 ? -28.091  -25.466 26.054  1.00 46.34  ? 433 ILE A N     1 
ATOM   3144  C  CA    . ILE A 1 420 ? -27.046  -26.387 26.490  1.00 46.34  ? 433 ILE A CA    1 
ATOM   3145  C  C     . ILE A 1 420 ? -26.325  -25.846 27.725  1.00 46.34  ? 433 ILE A C     1 
ATOM   3146  O  O     . ILE A 1 420 ? -25.985  -26.600 28.639  1.00 46.34  ? 433 ILE A O     1 
ATOM   3147  C  CB    . ILE A 1 420 ? -26.024  -26.646 25.366  1.00 46.34  ? 433 ILE A CB    1 
ATOM   3148  C  CG1   . ILE A 1 420 ? -26.732  -27.114 24.094  1.00 46.34  ? 433 ILE A CG1   1 
ATOM   3149  C  CG2   . ILE A 1 420 ? -24.988  -27.670 25.803  1.00 46.34  ? 433 ILE A CG2   1 
ATOM   3150  C  CD1   . ILE A 1 420 ? -25.792  -27.435 22.953  1.00 46.34  ? 433 ILE A CD1   1 
ATOM   3151  N  N     . ASP A 1 421 ? -26.099  -24.536 27.744  1.00 56.50  ? 434 ASP A N     1 
ATOM   3152  C  CA    . ASP A 1 421 ? -25.427  -23.882 28.863  1.00 56.50  ? 434 ASP A CA    1 
ATOM   3153  C  C     . ASP A 1 421 ? -26.274  -23.977 30.129  1.00 56.50  ? 434 ASP A C     1 
ATOM   3154  O  O     . ASP A 1 421 ? -27.461  -23.653 30.117  1.00 56.50  ? 434 ASP A O     1 
ATOM   3155  C  CB    . ASP A 1 421 ? -25.141  -22.417 28.529  1.00 56.50  ? 434 ASP A CB    1 
ATOM   3156  C  CG    . ASP A 1 421 ? -24.049  -21.819 29.398  1.00 56.50  ? 434 ASP A CG    1 
ATOM   3157  O  OD1   . ASP A 1 421 ? -23.866  -22.282 30.543  1.00 56.50  ? 434 ASP A OD1   1 
ATOM   3158  O  OD2   . ASP A 1 421 ? -23.370  -20.879 28.933  1.00 56.50  ? 434 ASP A OD2   1 
ATOM   3159  N  N     . GLU A 1 422 ? -25.656  -24.429 31.217  1.00 52.00  ? 435 GLU A N     1 
ATOM   3160  C  CA    . GLU A 1 422 ? -26.352  -24.580 32.491  1.00 52.00  ? 435 GLU A CA    1 
ATOM   3161  C  C     . GLU A 1 422 ? -26.330  -23.287 33.298  1.00 52.00  ? 435 GLU A C     1 
ATOM   3162  O  O     . GLU A 1 422 ? -27.120  -23.110 34.226  1.00 52.00  ? 435 GLU A O     1 
ATOM   3163  C  CB    . GLU A 1 422 ? -25.734  -25.714 33.313  1.00 52.00  ? 435 GLU A CB    1 
ATOM   3164  C  CG    . GLU A 1 422 ? -25.905  -27.104 32.716  1.00 52.00  ? 435 GLU A CG    1 
ATOM   3165  C  CD    . GLU A 1 422 ? -25.354  -28.196 33.616  1.00 52.00  ? 435 GLU A CD    1 
ATOM   3166  O  OE1   . GLU A 1 422 ? -25.009  -27.892 34.777  1.00 52.00  ? 435 GLU A OE1   1 
ATOM   3167  O  OE2   . GLU A 1 422 ? -25.265  -29.356 33.161  1.00 52.00  ? 435 GLU A OE2   1 
ATOM   3168  N  N     . LYS A 1 423 ? -25.419  -22.387 32.943  1.00 69.06  ? 436 LYS A N     1 
ATOM   3169  C  CA    . LYS A 1 423 ? -25.264  -21.135 33.674  1.00 69.06  ? 436 LYS A CA    1 
ATOM   3170  C  C     . LYS A 1 423 ? -25.815  -19.936 32.910  1.00 69.06  ? 436 LYS A C     1 
ATOM   3171  O  O     . LYS A 1 423 ? -25.689  -18.797 33.358  1.00 69.06  ? 436 LYS A O     1 
ATOM   3172  C  CB    . LYS A 1 423 ? -23.798  -20.900 34.037  1.00 69.06  ? 436 LYS A CB    1 
ATOM   3173  C  CG    . LYS A 1 423 ? -23.229  -21.933 34.994  1.00 69.06  ? 436 LYS A CG    1 
ATOM   3174  C  CD    . LYS A 1 423 ? -21.775  -21.642 35.318  1.00 69.06  ? 436 LYS A CD    1 
ATOM   3175  C  CE    . LYS A 1 423 ? -21.225  -22.640 36.321  1.00 69.06  ? 436 LYS A CE    1 
ATOM   3176  N  NZ    . LYS A 1 423 ? -19.784  -22.399 36.605  1.00 69.06  ? 436 LYS A NZ    1 
ATOM   3177  N  N     . SER A 1 424 ? -26.421  -20.195 31.756  1.00 31.34  ? 437 SER A N     1 
ATOM   3178  C  CA    . SER A 1 424 ? -27.078  -19.140 30.996  1.00 31.34  ? 437 SER A CA    1 
ATOM   3179  C  C     . SER A 1 424 ? -28.299  -18.653 31.765  1.00 31.34  ? 437 SER A C     1 
ATOM   3180  O  O     . SER A 1 424 ? -29.010  -19.451 32.379  1.00 31.34  ? 437 SER A O     1 
ATOM   3181  C  CB    . SER A 1 424 ? -27.490  -19.640 29.613  1.00 31.34  ? 437 SER A CB    1 
ATOM   3182  O  OG    . SER A 1 424 ? -28.379  -20.735 29.709  1.00 31.34  ? 437 SER A OG    1 
ATOM   3183  N  N     . GLU A 1 425 ? -28.526  -17.343 31.744  1.00 51.95  ? 438 GLU A N     1 
ATOM   3184  C  CA    . GLU A 1 425 ? -29.645  -16.740 32.464  1.00 51.95  ? 438 GLU A CA    1 
ATOM   3185  C  C     . GLU A 1 425 ? -30.973  -17.331 32.002  1.00 51.95  ? 438 GLU A C     1 
ATOM   3186  O  O     . GLU A 1 425 ? -31.131  -17.669 30.830  1.00 51.95  ? 438 GLU A O     1 
ATOM   3187  C  CB    . GLU A 1 425 ? -29.646  -15.222 32.270  1.00 51.95  ? 438 GLU A CB    1 
ATOM   3188  C  CG    . GLU A 1 425 ? -28.316  -14.547 32.586  1.00 51.95  ? 438 GLU A CG    1 
ATOM   3189  C  CD    . GLU A 1 425 ? -27.935  -14.644 34.051  1.00 51.95  ? 438 GLU A CD    1 
ATOM   3190  O  OE1   . GLU A 1 425 ? -26.723  -14.681 34.349  1.00 51.95  ? 438 GLU A OE1   1 
ATOM   3191  O  OE2   . GLU A 1 425 ? -28.844  -14.673 34.905  1.00 51.95  ? 438 GLU A OE2   1 
ATOM   3192  N  N     . LYS A 1 426 ? -31.917  -17.464 32.931  1.00 90.60  ? 439 LYS A N     1 
ATOM   3193  C  CA    . LYS A 1 426 ? -33.223  -18.048 32.633  1.00 90.60  ? 439 LYS A CA    1 
ATOM   3194  C  C     . LYS A 1 426 ? -33.940  -17.285 31.526  1.00 90.60  ? 439 LYS A C     1 
ATOM   3195  O  O     . LYS A 1 426 ? -34.627  -17.877 30.698  1.00 90.60  ? 439 LYS A O     1 
ATOM   3196  C  CB    . LYS A 1 426 ? -34.104  -18.079 33.886  1.00 90.60  ? 439 LYS A CB    1 
ATOM   3197  C  CG    . LYS A 1 426 ? -33.923  -19.306 34.772  1.00 90.60  ? 439 LYS A CG    1 
ATOM   3198  C  CD    . LYS A 1 426 ? -32.565  -19.322 35.457  1.00 90.60  ? 439 LYS A CD    1 
ATOM   3199  C  CE    . LYS A 1 426 ? -32.468  -20.459 36.459  1.00 90.60  ? 439 LYS A CE    1 
ATOM   3200  N  NZ    . LYS A 1 426 ? -33.533  -20.366 37.497  1.00 90.60  ? 439 LYS A NZ    1 
ATOM   3201  N  N     . GLU A 1 427 ? -33.763  -15.969 31.517  1.00 37.03  ? 440 GLU A N     1 
ATOM   3202  C  CA    . GLU A 1 427 ? -34.442  -15.099 30.568  1.00 37.03  ? 440 GLU A CA    1 
ATOM   3203  C  C     . GLU A 1 427 ? -34.004  -15.369 29.130  1.00 37.03  ? 440 GLU A C     1 
ATOM   3204  O  O     . GLU A 1 427 ? -34.811  -15.304 28.202  1.00 37.03  ? 440 GLU A O     1 
ATOM   3205  C  CB    . GLU A 1 427 ? -34.188  -13.637 30.932  1.00 37.03  ? 440 GLU A CB    1 
ATOM   3206  C  CG    . GLU A 1 427 ? -35.237  -12.674 30.416  1.00 37.03  ? 440 GLU A CG    1 
ATOM   3207  C  CD    . GLU A 1 427 ? -35.019  -11.267 30.920  1.00 37.03  ? 440 GLU A CD    1 
ATOM   3208  O  OE1   . GLU A 1 427 ? -36.009  -10.607 31.296  1.00 37.03  ? 440 GLU A OE1   1 
ATOM   3209  O  OE2   . GLU A 1 427 ? -33.856  -10.811 30.928  1.00 37.03  ? 440 GLU A OE2   1 
ATOM   3210  N  N     . ILE A 1 428 ? -32.723  -15.674 28.955  1.00 18.61  ? 441 ILE A N     1 
ATOM   3211  C  CA    . ILE A 1 428 ? -32.174  -15.980 27.639  1.00 18.61  ? 441 ILE A CA    1 
ATOM   3212  C  C     . ILE A 1 428 ? -32.436  -17.448 27.299  1.00 18.61  ? 441 ILE A C     1 
ATOM   3213  O  O     . ILE A 1 428 ? -32.748  -17.786 26.156  1.00 18.61  ? 441 ILE A O     1 
ATOM   3214  C  CB    . ILE A 1 428 ? -30.660  -15.649 27.557  1.00 18.61  ? 441 ILE A CB    1 
ATOM   3215  C  CG1   . ILE A 1 428 ? -30.437  -14.143 27.410  1.00 18.61  ? 441 ILE A CG1   1 
ATOM   3216  C  CG2   . ILE A 1 428 ? -30.008  -16.358 26.386  1.00 18.61  ? 441 ILE A CG2   1 
ATOM   3217  C  CD1   . ILE A 1 428 ? -30.586  -13.355 28.693  1.00 18.61  ? 441 ILE A CD1   1 
ATOM   3218  N  N     . PHE A 1 429 ? -32.325  -18.310 28.305  1.00 41.40  ? 442 PHE A N     1 
ATOM   3219  C  CA    . PHE A 1 429 ? -32.629  -19.729 28.146  1.00 41.40  ? 442 PHE A CA    1 
ATOM   3220  C  C     . PHE A 1 429 ? -34.084  -19.946 27.732  1.00 41.40  ? 442 PHE A C     1 
ATOM   3221  O  O     . PHE A 1 429 ? -34.379  -20.827 26.924  1.00 41.40  ? 442 PHE A O     1 
ATOM   3222  C  CB    . PHE A 1 429 ? -32.327  -20.487 29.442  1.00 41.40  ? 442 PHE A CB    1 
ATOM   3223  C  CG    . PHE A 1 429 ? -32.910  -21.873 29.489  1.00 41.40  ? 442 PHE A CG    1 
ATOM   3224  C  CD1   . PHE A 1 429 ? -32.282  -22.929 28.846  1.00 41.40  ? 442 PHE A CD1   1 
ATOM   3225  C  CD2   . PHE A 1 429 ? -34.080  -22.122 30.190  1.00 41.40  ? 442 PHE A CD2   1 
ATOM   3226  C  CE1   . PHE A 1 429 ? -32.818  -24.206 28.893  1.00 41.40  ? 442 PHE A CE1   1 
ATOM   3227  C  CE2   . PHE A 1 429 ? -34.621  -23.394 30.240  1.00 41.40  ? 442 PHE A CE2   1 
ATOM   3228  C  CZ    . PHE A 1 429 ? -33.988  -24.437 29.592  1.00 41.40  ? 442 PHE A CZ    1 
ATOM   3229  N  N     . GLU A 1 430 ? -34.987  -19.144 28.290  1.00 37.42  ? 443 GLU A N     1 
ATOM   3230  C  CA    . GLU A 1 430 ? -36.403  -19.227 27.944  1.00 37.42  ? 443 GLU A CA    1 
ATOM   3231  C  C     . GLU A 1 430 ? -36.671  -18.644 26.559  1.00 37.42  ? 443 GLU A C     1 
ATOM   3232  O  O     . GLU A 1 430 ? -37.421  -19.216 25.771  1.00 37.42  ? 443 GLU A O     1 
ATOM   3233  C  CB    . GLU A 1 430 ? -37.265  -18.508 28.990  1.00 37.42  ? 443 GLU A CB    1 
ATOM   3234  C  CG    . GLU A 1 430 ? -37.421  -19.248 30.317  1.00 37.42  ? 443 GLU A CG    1 
ATOM   3235  C  CD    . GLU A 1 430 ? -38.204  -18.447 31.344  1.00 37.42  ? 443 GLU A CD    1 
ATOM   3236  O  OE1   . GLU A 1 430 ? -38.453  -17.248 31.101  1.00 37.42  ? 443 GLU A OE1   1 
ATOM   3237  O  OE2   . GLU A 1 430 ? -38.570  -19.015 32.394  1.00 37.42  ? 443 GLU A OE2   1 
ATOM   3238  N  N     . ALA A 1 431 ? -36.054  -17.504 26.270  1.00 9.91   ? 444 ALA A N     1 
ATOM   3239  C  CA    . ALA A 1 431 ? -36.259  -16.815 25.000  1.00 9.91   ? 444 ALA A CA    1 
ATOM   3240  C  C     . ALA A 1 431 ? -35.704  -17.614 23.823  1.00 9.91   ? 444 ALA A C     1 
ATOM   3241  O  O     . ALA A 1 431 ? -36.100  -17.400 22.677  1.00 9.91   ? 444 ALA A O     1 
ATOM   3242  C  CB    . ALA A 1 431 ? -35.639  -15.431 25.042  1.00 9.91   ? 444 ALA A CB    1 
ATOM   3243  N  N     . SER A 1 432 ? -34.782  -18.527 24.111  1.00 23.60  ? 445 SER A N     1 
ATOM   3244  C  CA    . SER A 1 432 ? -34.213  -19.387 23.083  1.00 23.60  ? 445 SER A CA    1 
ATOM   3245  C  C     . SER A 1 432 ? -35.185  -20.506 22.739  1.00 23.60  ? 445 SER A C     1 
ATOM   3246  O  O     . SER A 1 432 ? -35.327  -20.883 21.578  1.00 23.60  ? 445 SER A O     1 
ATOM   3247  C  CB    . SER A 1 432 ? -32.881  -19.970 23.549  1.00 23.60  ? 445 SER A CB    1 
ATOM   3248  O  OG    . SER A 1 432 ? -31.985  -18.949 23.942  1.00 23.60  ? 445 SER A OG    1 
ATOM   3249  N  N     . ALA A 1 433 ? -35.851  -21.037 23.759  1.00 22.84  ? 446 ALA A N     1 
ATOM   3250  C  CA    . ALA A 1 433 ? -36.864  -22.065 23.555  1.00 22.84  ? 446 ALA A CA    1 
ATOM   3251  C  C     . ALA A 1 433 ? -38.060  -21.484 22.811  1.00 22.84  ? 446 ALA A C     1 
ATOM   3252  O  O     . ALA A 1 433 ? -38.675  -22.158 21.986  1.00 22.84  ? 446 ALA A O     1 
ATOM   3253  C  CB    . ALA A 1 433 ? -37.299  -22.648 24.880  1.00 22.84  ? 446 ALA A CB    1 
ATOM   3254  N  N     . HIS A 1 434 ? -38.386  -20.232 23.117  1.00 26.63  ? 447 HIS A N     1 
ATOM   3255  C  CA    . HIS A 1 434 ? -39.444  -19.522 22.415  1.00 26.63  ? 447 HIS A CA    1 
ATOM   3256  C  C     . HIS A 1 434 ? -39.075  -19.361 20.944  1.00 26.63  ? 447 HIS A C     1 
ATOM   3257  O  O     . HIS A 1 434 ? -39.945  -19.285 20.079  1.00 26.63  ? 447 HIS A O     1 
ATOM   3258  C  CB    . HIS A 1 434 ? -39.669  -18.140 23.034  1.00 26.63  ? 447 HIS A CB    1 
ATOM   3259  C  CG    . HIS A 1 434 ? -40.107  -18.178 24.465  1.00 26.63  ? 447 HIS A CG    1 
ATOM   3260  N  ND1   . HIS A 1 434 ? -40.156  -17.046 25.252  1.00 26.63  ? 447 HIS A ND1   1 
ATOM   3261  C  CD2   . HIS A 1 434 ? -40.520  -19.197 25.251  1.00 26.63  ? 447 HIS A CD2   1 
ATOM   3262  C  CE1   . HIS A 1 434 ? -40.578  -17.370 26.462  1.00 26.63  ? 447 HIS A CE1   1 
ATOM   3263  N  NE2   . HIS A 1 434 ? -40.805  -18.675 26.485  1.00 26.63  ? 447 HIS A NE2   1 
ATOM   3264  N  N     . ALA A 1 435 ? -37.775  -19.310 20.672  1.00 15.83  ? 448 ALA A N     1 
ATOM   3265  C  CA    . ALA A 1 435 ? -37.274  -19.074 19.324  1.00 15.83  ? 448 ALA A CA    1 
ATOM   3266  C  C     . ALA A 1 435 ? -37.245  -20.340 18.473  1.00 15.83  ? 448 ALA A C     1 
ATOM   3267  O  O     . ALA A 1 435 ? -37.460  -20.280 17.262  1.00 15.83  ? 448 ALA A O     1 
ATOM   3268  C  CB    . ALA A 1 435 ? -35.897  -18.450 19.382  1.00 15.83  ? 448 ALA A CB    1 
ATOM   3269  N  N     . GLN A 1 436 ? -36.965  -21.480 19.099  1.00 27.21  ? 449 GLN A N     1 
ATOM   3270  C  CA    . GLN A 1 436 ? -36.912  -22.741 18.365  1.00 27.21  ? 449 GLN A CA    1 
ATOM   3271  C  C     . GLN A 1 436 ? -38.317  -23.258 18.074  1.00 27.21  ? 449 GLN A C     1 
ATOM   3272  O  O     . GLN A 1 436 ? -38.526  -24.006 17.121  1.00 27.21  ? 449 GLN A O     1 
ATOM   3273  C  CB    . GLN A 1 436 ? -36.091  -23.800 19.113  1.00 27.21  ? 449 GLN A CB    1 
ATOM   3274  C  CG    . GLN A 1 436 ? -36.850  -24.563 20.194  1.00 27.21  ? 449 GLN A CG    1 
ATOM   3275  C  CD    . GLN A 1 436 ? -36.171  -25.869 20.572  1.00 27.21  ? 449 GLN A CD    1 
ATOM   3276  O  OE1   . GLN A 1 436 ? -36.376  -26.394 21.665  1.00 27.21  ? 449 GLN A OE1   1 
ATOM   3277  N  NE2   . GLN A 1 436 ? -35.366  -26.402 19.663  1.00 27.21  ? 449 GLN A NE2   1 
ATOM   3278  N  N     . ALA A 1 437 ? -39.276  -22.850 18.899  1.00 26.50  ? 450 ALA A N     1 
ATOM   3279  C  CA    . ALA A 1 437 ? -40.670  -23.211 18.689  1.00 26.50  ? 450 ALA A CA    1 
ATOM   3280  C  C     . ALA A 1 437 ? -41.206  -22.494 17.457  1.00 26.50  ? 450 ALA A C     1 
ATOM   3281  O  O     . ALA A 1 437 ? -41.853  -23.101 16.604  1.00 26.50  ? 450 ALA A O     1 
ATOM   3282  C  CB    . ALA A 1 437 ? -41.496  -22.862 19.909  1.00 26.50  ? 450 ALA A CB    1 
ATOM   3283  N  N     . ILE A 1 438 ? -40.936  -21.194 17.379  1.00 3.63   ? 451 ILE A N     1 
ATOM   3284  C  CA    . ILE A 1 438 ? -41.329  -20.386 16.231  1.00 3.63   ? 451 ILE A CA    1 
ATOM   3285  C  C     . ILE A 1 438 ? -40.673  -20.907 14.954  1.00 3.63   ? 451 ILE A C     1 
ATOM   3286  O  O     . ILE A 1 438 ? -41.322  -21.015 13.913  1.00 3.63   ? 451 ILE A O     1 
ATOM   3287  C  CB    . ILE A 1 438 ? -40.964  -18.902 16.437  1.00 3.63   ? 451 ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1 438 ? -41.720  -18.324 17.634  1.00 3.63   ? 451 ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1 438 ? -41.269  -18.087 15.191  1.00 3.63   ? 451 ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1 438 ? -41.373  -16.885 17.940  1.00 3.63   ? 451 ILE A CD1   1 
ATOM   3291  N  N     . LEU A 1 439 ? -39.386  -21.236 15.044  1.00 34.46  ? 452 LEU A N     1 
ATOM   3292  C  CA    . LEU A 1 439 ? -38.640  -21.767 13.906  1.00 34.46  ? 452 LEU A CA    1 
ATOM   3293  C  C     . LEU A 1 439 ? -39.224  -23.094 13.425  1.00 34.46  ? 452 LEU A C     1 
ATOM   3294  O  O     . LEU A 1 439 ? -39.278  -23.354 12.223  1.00 34.46  ? 452 LEU A O     1 
ATOM   3295  C  CB    . LEU A 1 439 ? -37.161  -21.936 14.266  1.00 34.46  ? 452 LEU A CB    1 
ATOM   3296  C  CG    . LEU A 1 439 ? -36.220  -22.424 13.165  1.00 34.46  ? 452 LEU A CG    1 
ATOM   3297  C  CD1   . LEU A 1 439 ? -36.219  -21.457 11.997  1.00 34.46  ? 452 LEU A CD1   1 
ATOM   3298  C  CD2   . LEU A 1 439 ? -34.811  -22.613 13.701  1.00 34.46  ? 452 LEU A CD2   1 
ATOM   3299  N  N     . HIS A 1 440 ? -39.655  -23.927 14.370  1.00 24.86  ? 453 HIS A N     1 
ATOM   3300  C  CA    . HIS A 1 440 ? -40.315  -25.189 14.052  1.00 24.86  ? 453 HIS A CA    1 
ATOM   3301  C  C     . HIS A 1 440 ? -41.567  -24.943 13.215  1.00 24.86  ? 453 HIS A C     1 
ATOM   3302  O  O     . HIS A 1 440 ? -41.811  -25.629 12.222  1.00 24.86  ? 453 HIS A O     1 
ATOM   3303  C  CB    . HIS A 1 440 ? -40.693  -25.934 15.335  1.00 24.86  ? 453 HIS A CB    1 
ATOM   3304  C  CG    . HIS A 1 440 ? -39.570  -26.722 15.935  1.00 24.86  ? 453 HIS A CG    1 
ATOM   3305  N  ND1   . HIS A 1 440 ? -38.598  -27.333 15.173  1.00 24.86  ? 453 HIS A ND1   1 
ATOM   3306  C  CD2   . HIS A 1 440 ? -39.270  -27.003 17.225  1.00 24.86  ? 453 HIS A CD2   1 
ATOM   3307  C  CE1   . HIS A 1 440 ? -37.746  -27.955 15.967  1.00 24.86  ? 453 HIS A CE1   1 
ATOM   3308  N  NE2   . HIS A 1 440 ? -38.130  -27.769 17.218  1.00 24.86  ? 453 HIS A NE2   1 
ATOM   3309  N  N     . LEU A 1 441 ? -42.356  -23.958 13.630  1.00 31.00  ? 454 LEU A N     1 
ATOM   3310  C  CA    . LEU A 1 441 ? -43.567  -23.582 12.916  1.00 31.00  ? 454 LEU A CA    1 
ATOM   3311  C  C     . LEU A 1 441 ? -43.227  -22.949 11.569  1.00 31.00  ? 454 LEU A C     1 
ATOM   3312  O  O     . LEU A 1 441 ? -43.852  -23.261 10.554  1.00 31.00  ? 454 LEU A O     1 
ATOM   3313  C  CB    . LEU A 1 441 ? -44.398  -22.615 13.760  1.00 31.00  ? 454 LEU A CB    1 
ATOM   3314  C  CG    . LEU A 1 441 ? -44.925  -23.167 15.086  1.00 31.00  ? 454 LEU A CG    1 
ATOM   3315  C  CD1   . LEU A 1 441 ? -45.422  -22.051 15.982  1.00 31.00  ? 454 LEU A CD1   1 
ATOM   3316  C  CD2   . LEU A 1 441 ? -46.033  -24.171 14.836  1.00 31.00  ? 454 LEU A CD2   1 
ATOM   3317  N  N     . GLN A 1 442 ? -42.233  -22.063 11.571  1.00 17.53  ? 455 GLN A N     1 
ATOM   3318  C  CA    . GLN A 1 442 ? -41.785  -21.384 10.358  1.00 17.53  ? 455 GLN A CA    1 
ATOM   3319  C  C     . GLN A 1 442 ? -41.385  -22.372 9.269   1.00 17.53  ? 455 GLN A C     1 
ATOM   3320  O  O     . GLN A 1 442 ? -41.734  -22.195 8.105   1.00 17.53  ? 455 GLN A O     1 
ATOM   3321  C  CB    . GLN A 1 442 ? -40.603  -20.459 10.662  1.00 17.53  ? 455 GLN A CB    1 
ATOM   3322  C  CG    . GLN A 1 442 ? -40.959  -19.171 11.393  1.00 17.53  ? 455 GLN A CG    1 
ATOM   3323  C  CD    . GLN A 1 442 ? -39.763  -18.258 11.571  1.00 17.53  ? 455 GLN A CD    1 
ATOM   3324  O  OE1   . GLN A 1 442 ? -38.669  -18.552 11.096  1.00 17.53  ? 455 GLN A OE1   1 
ATOM   3325  N  NE2   . GLN A 1 442 ? -39.967  -17.142 12.256  1.00 17.53  ? 455 GLN A NE2   1 
ATOM   3326  N  N     . GLU A 1 443 ? -40.648  -23.408 9.654   1.00 43.03  ? 456 GLU A N     1 
ATOM   3327  C  CA    . GLU A 1 443 ? -40.157  -24.393 8.698   1.00 43.03  ? 456 GLU A CA    1 
ATOM   3328  C  C     . GLU A 1 443 ? -41.267  -25.326 8.223   1.00 43.03  ? 456 GLU A C     1 
ATOM   3329  O  O     . GLU A 1 443 ? -41.141  -25.968 7.182   1.00 43.03  ? 456 GLU A O     1 
ATOM   3330  C  CB    . GLU A 1 443 ? -38.994  -25.193 9.294   1.00 43.03  ? 456 GLU A CB    1 
ATOM   3331  C  CG    . GLU A 1 443 ? -37.744  -24.359 9.549   1.00 43.03  ? 456 GLU A CG    1 
ATOM   3332  C  CD    . GLU A 1 443 ? -36.570  -25.183 10.043  1.00 43.03  ? 456 GLU A CD    1 
ATOM   3333  O  OE1   . GLU A 1 443 ? -36.716  -25.884 11.066  1.00 43.03  ? 456 GLU A OE1   1 
ATOM   3334  O  OE2   . GLU A 1 443 ? -35.498  -25.125 9.409   1.00 43.03  ? 456 GLU A OE2   1 
ATOM   3335  N  N     . GLN A 1 444 ? -42.352  -25.395 8.987   1.00 46.20  ? 457 GLN A N     1 
ATOM   3336  C  CA    . GLN A 1 444 ? -43.500  -26.213 8.608   1.00 46.20  ? 457 GLN A CA    1 
ATOM   3337  C  C     . GLN A 1 444 ? -44.379  -25.515 7.578   1.00 46.20  ? 457 GLN A C     1 
ATOM   3338  O  O     . GLN A 1 444 ? -44.836  -26.141 6.624   1.00 46.20  ? 457 GLN A O     1 
ATOM   3339  C  CB    . GLN A 1 444 ? -44.327  -26.597 9.835   1.00 46.20  ? 457 GLN A CB    1 
ATOM   3340  C  CG    . GLN A 1 444 ? -44.079  -28.017 10.315  1.00 46.20  ? 457 GLN A CG    1 
ATOM   3341  C  CD    . GLN A 1 444 ? -44.577  -29.061 9.335   1.00 46.20  ? 457 GLN A CD    1 
ATOM   3342  O  OE1   . GLN A 1 444 ? -45.446  -28.787 8.511   1.00 46.20  ? 457 GLN A OE1   1 
ATOM   3343  N  NE2   . GLN A 1 444 ? -44.027  -30.265 9.422   1.00 46.20  ? 457 GLN A NE2   1 
ATOM   3344  N  N     . ILE A 1 445 ? -44.616  -24.222 7.780   1.00 11.53  ? 458 ILE A N     1 
ATOM   3345  C  CA    . ILE A 1 445 ? -45.365  -23.417 6.821   1.00 11.53  ? 458 ILE A CA    1 
ATOM   3346  C  C     . ILE A 1 445 ? -44.706  -23.493 5.447   1.00 11.53  ? 458 ILE A C     1 
ATOM   3347  O  O     . ILE A 1 445 ? -45.383  -23.627 4.428   1.00 11.53  ? 458 ILE A O     1 
ATOM   3348  C  CB    . ILE A 1 445 ? -45.453  -21.944 7.258   1.00 11.53  ? 458 ILE A CB    1 
ATOM   3349  C  CG1   . ILE A 1 445 ? -45.999  -21.831 8.678   1.00 11.53  ? 458 ILE A CG1   1 
ATOM   3350  C  CG2   . ILE A 1 445 ? -46.330  -21.151 6.308   1.00 11.53  ? 458 ILE A CG2   1 
ATOM   3351  C  CD1   . ILE A 1 445 ? -46.151  -20.404 9.157   1.00 11.53  ? 458 ILE A CD1   1 
ATOM   3352  N  N     . VAL A 1 446 ? -43.380  -23.413 5.432   1.00 33.50  ? 459 VAL A N     1 
ATOM   3353  C  CA    . VAL A 1 446 ? -42.615  -23.526 4.196   1.00 33.50  ? 459 VAL A CA    1 
ATOM   3354  C  C     . VAL A 1 446 ? -42.741  -24.929 3.607   1.00 33.50  ? 459 VAL A C     1 
ATOM   3355  O  O     . VAL A 1 446 ? -42.937  -25.087 2.403   1.00 33.50  ? 459 VAL A O     1 
ATOM   3356  C  CB    . VAL A 1 446 ? -41.130  -23.192 4.422   1.00 33.50  ? 459 VAL A CB    1 
ATOM   3357  C  CG1   . VAL A 1 446 ? -40.344  -23.339 3.129   1.00 33.50  ? 459 VAL A CG1   1 
ATOM   3358  C  CG2   . VAL A 1 446 ? -40.982  -21.785 4.974   1.00 33.50  ? 459 VAL A CG2   1 
ATOM   3359  N  N     . LYS A 1 447 ? -42.634  -25.943 4.461   1.00 47.39  ? 460 LYS A N     1 
ATOM   3360  C  CA    . LYS A 1 447 ? -42.725  -27.331 4.017   1.00 47.39  ? 460 LYS A CA    1 
ATOM   3361  C  C     . LYS A 1 447 ? -44.088  -27.653 3.408   1.00 47.39  ? 460 LYS A C     1 
ATOM   3362  O  O     . LYS A 1 447 ? -44.171  -28.320 2.375   1.00 47.39  ? 460 LYS A O     1 
ATOM   3363  C  CB    . LYS A 1 447 ? -42.435  -28.295 5.171   1.00 47.39  ? 460 LYS A CB    1 
ATOM   3364  C  CG    . LYS A 1 447 ? -42.615  -29.761 4.798   1.00 47.39  ? 460 LYS A CG    1 
ATOM   3365  C  CD    . LYS A 1 447 ? -42.493  -30.683 6.003   1.00 47.39  ? 460 LYS A CD    1 
ATOM   3366  C  CE    . LYS A 1 447 ? -42.766  -32.129 5.609   1.00 47.39  ? 460 LYS A CE    1 
ATOM   3367  N  NZ    . LYS A 1 447 ? -42.628  -33.072 6.752   1.00 47.39  ? 460 LYS A NZ    1 
ATOM   3368  N  N     . GLU A 1 448 ? -45.151  -27.175 4.047   1.00 42.63  ? 461 GLU A N     1 
ATOM   3369  C  CA    . GLU A 1 448 ? -46.508  -27.475 3.601   1.00 42.63  ? 461 GLU A CA    1 
ATOM   3370  C  C     . GLU A 1 448 ? -46.920  -26.672 2.367   1.00 42.63  ? 461 GLU A C     1 
ATOM   3371  O  O     . GLU A 1 448 ? -47.635  -27.182 1.505   1.00 42.63  ? 461 GLU A O     1 
ATOM   3372  C  CB    . GLU A 1 448 ? -47.512  -27.266 4.738   1.00 42.63  ? 461 GLU A CB    1 
ATOM   3373  C  CG    . GLU A 1 448 ? -47.328  -28.219 5.911   1.00 42.63  ? 461 GLU A CG    1 
ATOM   3374  C  CD    . GLU A 1 448 ? -48.460  -28.138 6.915   1.00 42.63  ? 461 GLU A CD    1 
ATOM   3375  O  OE1   . GLU A 1 448 ? -49.396  -27.343 6.697   1.00 42.63  ? 461 GLU A OE1   1 
ATOM   3376  O  OE2   . GLU A 1 448 ? -48.415  -28.874 7.922   1.00 42.63  ? 461 GLU A OE2   1 
ATOM   3377  N  N     . MET A 1 449 ? -46.476  -25.419 2.287   1.00 39.25  ? 462 MET A N     1 
ATOM   3378  C  CA    . MET A 1 449 ? -46.795  -24.575 1.136   1.00 39.25  ? 462 MET A CA    1 
ATOM   3379  C  C     . MET A 1 449 ? -46.149  -25.107 -0.142  1.00 39.25  ? 462 MET A C     1 
ATOM   3380  O  O     . MET A 1 449 ? -46.740  -25.041 -1.219  1.00 39.25  ? 462 MET A O     1 
ATOM   3381  C  CB    . MET A 1 449 ? -46.381  -23.118 1.376   1.00 39.25  ? 462 MET A CB    1 
ATOM   3382  C  CG    . MET A 1 449 ? -47.321  -22.336 2.285   1.00 39.25  ? 462 MET A CG    1 
ATOM   3383  S  SD    . MET A 1 449 ? -46.991  -20.560 2.307   1.00 39.25  ? 462 MET A SD    1 
ATOM   3384  C  CE    . MET A 1 449 ? -45.279  -20.532 2.830   1.00 39.25  ? 462 MET A CE    1 
ATOM   3385  N  N     . ASN A 1 450 ? -44.936  -25.636 -0.017  1.00 72.97  ? 463 ASN A N     1 
ATOM   3386  C  CA    . ASN A 1 450 ? -44.243  -26.227 -1.155  1.00 72.97  ? 463 ASN A CA    1 
ATOM   3387  C  C     . ASN A 1 450 ? -44.882  -27.547 -1.576  1.00 72.97  ? 463 ASN A C     1 
ATOM   3388  O  O     . ASN A 1 450 ? -44.803  -27.940 -2.738  1.00 72.97  ? 463 ASN A O     1 
ATOM   3389  C  CB    . ASN A 1 450 ? -42.758  -26.416 -0.848  1.00 72.97  ? 463 ASN A CB    1 
ATOM   3390  C  CG    . ASN A 1 450 ? -42.044  -25.103 -0.590  1.00 72.97  ? 463 ASN A CG    1 
ATOM   3391  O  OD1   . ASN A 1 450 ? -42.664  -24.109 -0.213  1.00 72.97  ? 463 ASN A OD1   1 
ATOM   3392  N  ND2   . ASN A 1 450 ? -40.732  -25.092 -0.795  1.00 72.97  ? 463 ASN A ND2   1 
ATOM   3393  N  N     . ASP A 1 451 ? -45.511  -28.228 -0.622  1.00 57.84  ? 464 ASP A N     1 
ATOM   3394  C  CA    . ASP A 1 451 ? -46.282  -29.429 -0.924  1.00 57.84  ? 464 ASP A CA    1 
ATOM   3395  C  C     . ASP A 1 451 ? -47.587  -29.047 -1.611  1.00 57.84  ? 464 ASP A C     1 
ATOM   3396  O  O     . ASP A 1 451 ? -48.151  -29.829 -2.374  1.00 57.84  ? 464 ASP A O     1 
ATOM   3397  C  CB    . ASP A 1 451 ? -46.576  -30.224 0.350   1.00 57.84  ? 464 ASP A CB    1 
ATOM   3398  C  CG    . ASP A 1 451 ? -45.652  -31.415 0.525   1.00 57.84  ? 464 ASP A CG    1 
ATOM   3399  O  OD1   . ASP A 1 451 ? -45.176  -31.958 -0.493  1.00 57.84  ? 464 ASP A OD1   1 
ATOM   3400  O  OD2   . ASP A 1 451 ? -45.408  -31.813 1.683   1.00 57.84  ? 464 ASP A OD2   1 
ATOM   3401  N  N     . GLY A 1 452 ? -48.062  -27.836 -1.335  1.00 36.51  ? 465 GLY A N     1 
ATOM   3402  C  CA    . GLY A 1 452 ? -49.292  -27.346 -1.928  1.00 36.51  ? 465 GLY A CA    1 
ATOM   3403  C  C     . GLY A 1 452 ? -50.384  -27.113 -0.903  1.00 36.51  ? 465 GLY A C     1 
ATOM   3404  O  O     . GLY A 1 452 ? -51.462  -26.621 -1.239  1.00 36.51  ? 465 GLY A O     1 
ATOM   3405  N  N     . ASP A 1 453 ? -50.107  -27.466 0.349   1.00 46.85  ? 466 ASP A N     1 
ATOM   3406  C  CA    . ASP A 1 453 ? -51.094  -27.322 1.413   1.00 46.85  ? 466 ASP A CA    1 
ATOM   3407  C  C     . ASP A 1 453 ? -50.962  -25.985 2.136   1.00 46.85  ? 466 ASP A C     1 
ATOM   3408  O  O     . ASP A 1 453 ? -50.009  -25.761 2.880   1.00 46.85  ? 466 ASP A O     1 
ATOM   3409  C  CB    . ASP A 1 453 ? -50.982  -28.473 2.415   1.00 46.85  ? 466 ASP A CB    1 
ATOM   3410  C  CG    . ASP A 1 453 ? -52.068  -28.432 3.470   1.00 46.85  ? 466 ASP A CG    1 
ATOM   3411  O  OD1   . ASP A 1 453 ? -53.168  -27.924 3.170   1.00 46.85  ? 466 ASP A OD1   1 
ATOM   3412  O  OD2   . ASP A 1 453 ? -51.821  -28.906 4.598   1.00 46.85  ? 466 ASP A OD2   1 
ATOM   3413  N  N     . TYR A 1 454 ? -51.934  -25.107 1.913   1.00 33.34  ? 467 TYR A N     1 
ATOM   3414  C  CA    . TYR A 1 454 ? -51.950  -23.786 2.526   1.00 33.34  ? 467 TYR A CA    1 
ATOM   3415  C  C     . TYR A 1 454 ? -53.040  -23.714 3.593   1.00 33.34  ? 467 TYR A C     1 
ATOM   3416  O  O     . TYR A 1 454 ? -53.526  -22.630 3.917   1.00 33.34  ? 467 TYR A O     1 
ATOM   3417  C  CB    . TYR A 1 454 ? -52.215  -22.709 1.469   1.00 33.34  ? 467 TYR A CB    1 
ATOM   3418  C  CG    . TYR A 1 454 ? -51.180  -22.598 0.365   1.00 33.34  ? 467 TYR A CG    1 
ATOM   3419  C  CD1   . TYR A 1 454 ? -51.062  -23.577 -0.610  1.00 33.34  ? 467 TYR A CD1   1 
ATOM   3420  C  CD2   . TYR A 1 454 ? -50.346  -21.492 0.280   1.00 33.34  ? 467 TYR A CD2   1 
ATOM   3421  C  CE1   . TYR A 1 454 ? -50.129  -23.473 -1.622  1.00 33.34  ? 467 TYR A CE1   1 
ATOM   3422  C  CE2   . TYR A 1 454 ? -49.410  -21.377 -0.731  1.00 33.34  ? 467 TYR A CE2   1 
ATOM   3423  C  CZ    . TYR A 1 454 ? -49.306  -22.372 -1.678  1.00 33.34  ? 467 TYR A CZ    1 
ATOM   3424  O  OH    . TYR A 1 454 ? -48.378  -22.267 -2.687  1.00 33.34  ? 467 TYR A OH    1 
ATOM   3425  N  N     . SER A 1 455 ? -53.423  -24.867 4.135   1.00 42.59  ? 468 SER A N     1 
ATOM   3426  C  CA    . SER A 1 455 ? -54.563  -24.949 5.050   1.00 42.59  ? 468 SER A CA    1 
ATOM   3427  C  C     . SER A 1 455 ? -54.263  -24.448 6.461   1.00 42.59  ? 468 SER A C     1 
ATOM   3428  O  O     . SER A 1 455 ? -55.053  -23.704 7.042   1.00 42.59  ? 468 SER A O     1 
ATOM   3429  C  CB    . SER A 1 455 ? -55.101  -26.380 5.115   1.00 42.59  ? 468 SER A CB    1 
ATOM   3430  O  OG    . SER A 1 455 ? -54.109  -27.283 5.572   1.00 42.59  ? 468 SER A OG    1 
ATOM   3431  N  N     . SER A 1 456 ? -53.129  -24.865 7.012   1.00 58.72  ? 469 SER A N     1 
ATOM   3432  C  CA    . SER A 1 456 ? -52.780  -24.514 8.385   1.00 58.72  ? 469 SER A CA    1 
ATOM   3433  C  C     . SER A 1 456 ? -51.766  -23.374 8.475   1.00 58.72  ? 469 SER A C     1 
ATOM   3434  O  O     . SER A 1 456 ? -51.122  -23.189 9.507   1.00 58.72  ? 469 SER A O     1 
ATOM   3435  C  CB    . SER A 1 456 ? -52.273  -25.746 9.137   1.00 58.72  ? 469 SER A CB    1 
ATOM   3436  O  OG    . SER A 1 456 ? -51.529  -26.594 8.282   1.00 58.72  ? 469 SER A OG    1 
ATOM   3437  N  N     . VAL A 1 457 ? -51.637  -22.612 7.392   1.00 33.07  ? 470 VAL A N     1 
ATOM   3438  C  CA    . VAL A 1 457 ? -50.752  -21.450 7.368   1.00 33.07  ? 470 VAL A CA    1 
ATOM   3439  C  C     . VAL A 1 457 ? -51.179  -20.412 8.401   1.00 33.07  ? 470 VAL A C     1 
ATOM   3440  O  O     . VAL A 1 457 ? -50.362  -19.932 9.187   1.00 33.07  ? 470 VAL A O     1 
ATOM   3441  C  CB    . VAL A 1 457 ? -50.707  -20.804 5.972   1.00 33.07  ? 470 VAL A CB    1 
ATOM   3442  C  CG1   . VAL A 1 457 ? -50.046  -19.437 6.032   1.00 33.07  ? 470 VAL A CG1   1 
ATOM   3443  C  CG2   . VAL A 1 457 ? -49.974  -21.706 4.998   1.00 33.07  ? 470 VAL A CG2   1 
ATOM   3444  N  N     . GLN A 1 458 ? -52.464  -20.073 8.397   1.00 42.02  ? 471 GLN A N     1 
ATOM   3445  C  CA    . GLN A 1 458 ? -53.013  -19.151 9.383   1.00 42.02  ? 471 GLN A CA    1 
ATOM   3446  C  C     . GLN A 1 458 ? -52.895  -19.736 10.787  1.00 42.02  ? 471 GLN A C     1 
ATOM   3447  O  O     . GLN A 1 458 ? -52.609  -19.020 11.746  1.00 42.02  ? 471 GLN A O     1 
ATOM   3448  C  CB    . GLN A 1 458 ? -54.475  -18.828 9.062   1.00 42.02  ? 471 GLN A CB    1 
ATOM   3449  C  CG    . GLN A 1 458 ? -55.149  -17.920 10.085  1.00 42.02  ? 471 GLN A CG    1 
ATOM   3450  C  CD    . GLN A 1 458 ? -56.585  -17.589 9.728   1.00 42.02  ? 471 GLN A CD    1 
ATOM   3451  O  OE1   . GLN A 1 458 ? -57.069  -17.941 8.653   1.00 42.02  ? 471 GLN A OE1   1 
ATOM   3452  N  NE2   . GLN A 1 458 ? -57.276  -16.907 10.634  1.00 42.02  ? 471 GLN A NE2   1 
ATOM   3453  N  N     . ASN A 1 459 ? -53.108  -21.043 10.896  1.00 40.25  ? 472 ASN A N     1 
ATOM   3454  C  CA    . ASN A 1 459 ? -53.002  -21.738 12.174  1.00 40.25  ? 472 ASN A CA    1 
ATOM   3455  C  C     . ASN A 1 459 ? -51.609  -21.600 12.785  1.00 40.25  ? 472 ASN A C     1 
ATOM   3456  O  O     . ASN A 1 459 ? -51.469  -21.218 13.946  1.00 40.25  ? 472 ASN A O     1 
ATOM   3457  C  CB    . ASN A 1 459 ? -53.363  -23.217 12.006  1.00 40.25  ? 472 ASN A CB    1 
ATOM   3458  C  CG    . ASN A 1 459 ? -53.322  -23.985 13.314  1.00 40.25  ? 472 ASN A CG    1 
ATOM   3459  O  OD1   . ASN A 1 459 ? -53.487  -23.413 14.391  1.00 40.25  ? 472 ASN A OD1   1 
ATOM   3460  N  ND2   . ASN A 1 459 ? -53.103  -25.291 13.225  1.00 40.25  ? 472 ASN A ND2   1 
ATOM   3461  N  N     . TYR A 1 460 ? -50.585  -21.904 11.992  1.00 25.25  ? 473 TYR A N     1 
ATOM   3462  C  CA    . TYR A 1 460 ? -49.201  -21.833 12.452  1.00 25.25  ? 473 TYR A CA    1 
ATOM   3463  C  C     . TYR A 1 460 ? -48.784  -20.408 12.819  1.00 25.25  ? 473 TYR A C     1 
ATOM   3464  O  O     . TYR A 1 460 ? -48.080  -20.196 13.806  1.00 25.25  ? 473 TYR A O     1 
ATOM   3465  C  CB    . TYR A 1 460 ? -48.259  -22.405 11.390  1.00 25.25  ? 473 TYR A CB    1 
ATOM   3466  C  CG    . TYR A 1 460 ? -48.414  -23.893 11.162  1.00 25.25  ? 473 TYR A CG    1 
ATOM   3467  C  CD1   . TYR A 1 460 ? -48.699  -24.750 12.214  1.00 25.25  ? 473 TYR A CD1   1 
ATOM   3468  C  CD2   . TYR A 1 460 ? -48.277  -24.440 9.893   1.00 25.25  ? 473 TYR A CD2   1 
ATOM   3469  C  CE1   . TYR A 1 460 ? -48.841  -26.108 12.012  1.00 25.25  ? 473 TYR A CE1   1 
ATOM   3470  C  CE2   . TYR A 1 460 ? -48.418  -25.798 9.681   1.00 25.25  ? 473 TYR A CE2   1 
ATOM   3471  C  CZ    . TYR A 1 460 ? -48.701  -26.627 10.744  1.00 25.25  ? 473 TYR A CZ    1 
ATOM   3472  O  OH    . TYR A 1 460 ? -48.843  -27.980 10.541  1.00 25.25  ? 473 TYR A OH    1 
ATOM   3473  N  N     . LEU A 1 461 ? -49.223  -19.438 12.022  1.00 16.01  ? 474 LEU A N     1 
ATOM   3474  C  CA    . LEU A 1 461 ? -48.904  -18.035 12.270  1.00 16.01  ? 474 LEU A CA    1 
ATOM   3475  C  C     . LEU A 1 461 ? -49.570  -17.519 13.543  1.00 16.01  ? 474 LEU A C     1 
ATOM   3476  O  O     . LEU A 1 461 ? -48.987  -16.714 14.273  1.00 16.01  ? 474 LEU A O     1 
ATOM   3477  C  CB    . LEU A 1 461 ? -49.303  -17.169 11.073  1.00 16.01  ? 474 LEU A CB    1 
ATOM   3478  C  CG    . LEU A 1 461 ? -48.451  -17.323 9.813   1.00 16.01  ? 474 LEU A CG    1 
ATOM   3479  C  CD1   . LEU A 1 461 ? -49.012  -16.495 8.672   1.00 16.01  ? 474 LEU A CD1   1 
ATOM   3480  C  CD2   . LEU A 1 461 ? -47.014  -16.929 10.096  1.00 16.01  ? 474 LEU A CD2   1 
ATOM   3481  N  N     . ASP A 1 462 ? -50.789  -17.982 13.804  1.00 43.32  ? 475 ASP A N     1 
ATOM   3482  C  CA    . ASP A 1 462 ? -51.498  -17.628 15.029  1.00 43.32  ? 475 ASP A CA    1 
ATOM   3483  C  C     . ASP A 1 462 ? -50.747  -18.143 16.252  1.00 43.32  ? 475 ASP A C     1 
ATOM   3484  O  O     . ASP A 1 462 ? -50.699  -17.478 17.285  1.00 43.32  ? 475 ASP A O     1 
ATOM   3485  C  CB    . ASP A 1 462 ? -52.919  -18.193 15.015  1.00 43.32  ? 475 ASP A CB    1 
ATOM   3486  C  CG    . ASP A 1 462 ? -53.870  -17.368 14.171  1.00 43.32  ? 475 ASP A CG    1 
ATOM   3487  O  OD1   . ASP A 1 462 ? -53.418  -16.769 13.174  1.00 43.32  ? 475 ASP A OD1   1 
ATOM   3488  O  OD2   . ASP A 1 462 ? -55.071  -17.319 14.510  1.00 43.32  ? 475 ASP A OD2   1 
ATOM   3489  N  N     . GLN A 1 463 ? -50.160  -19.330 16.124  1.00 47.63  ? 476 GLN A N     1 
ATOM   3490  C  CA    . GLN A 1 463 ? -49.381  -19.923 17.205  1.00 47.63  ? 476 GLN A CA    1 
ATOM   3491  C  C     . GLN A 1 463 ? -48.071  -19.168 17.416  1.00 47.63  ? 476 GLN A C     1 
ATOM   3492  O  O     . GLN A 1 463 ? -47.614  -19.015 18.546  1.00 47.63  ? 476 GLN A O     1 
ATOM   3493  C  CB    . GLN A 1 463 ? -49.104  -21.403 16.926  1.00 47.63  ? 476 GLN A CB    1 
ATOM   3494  C  CG    . GLN A 1 463 ? -50.358  -22.257 16.779  1.00 47.63  ? 476 GLN A CG    1 
ATOM   3495  C  CD    . GLN A 1 463 ? -50.048  -23.707 16.465  1.00 47.63  ? 476 GLN A CD    1 
ATOM   3496  O  OE1   . GLN A 1 463 ? -49.053  -24.256 16.934  1.00 47.63  ? 476 GLN A OE1   1 
ATOM   3497  N  NE2   . GLN A 1 463 ? -50.899  -24.333 15.664  1.00 47.63  ? 476 GLN A NE2   1 
ATOM   3498  N  N     . ILE A 1 464 ? -47.473  -18.701 16.323  1.00 20.11  ? 477 ILE A N     1 
ATOM   3499  C  CA    . ILE A 1 464 ? -46.256  -17.895 16.395  1.00 20.11  ? 477 ILE A CA    1 
ATOM   3500  C  C     . ILE A 1 464 ? -46.508  -16.606 17.169  1.00 20.11  ? 477 ILE A C     1 
ATOM   3501  O  O     . ILE A 1 464 ? -45.805  -16.303 18.132  1.00 20.11  ? 477 ILE A O     1 
ATOM   3502  C  CB    . ILE A 1 464 ? -45.723  -17.539 14.996  1.00 20.11  ? 477 ILE A CB    1 
ATOM   3503  C  CG1   . ILE A 1 464 ? -45.193  -18.782 14.288  1.00 20.11  ? 477 ILE A CG1   1 
ATOM   3504  C  CG2   . ILE A 1 464 ? -44.622  -16.500 15.094  1.00 20.11  ? 477 ILE A CG2   1 
ATOM   3505  C  CD1   . ILE A 1 464 ? -44.648  -18.510 12.901  1.00 20.11  ? 477 ILE A CD1   1 
ATOM   3506  N  N     . GLU A 1 465 ? -47.514  -15.852 16.735  1.00 33.41  ? 478 GLU A N     1 
ATOM   3507  C  CA    . GLU A 1 465 ? -47.893  -14.609 17.394  1.00 33.41  ? 478 GLU A CA    1 
ATOM   3508  C  C     . GLU A 1 465 ? -48.254  -14.853 18.856  1.00 33.41  ? 478 GLU A C     1 
ATOM   3509  O  O     . GLU A 1 465 ? -47.950  -14.035 19.724  1.00 33.41  ? 478 GLU A O     1 
ATOM   3510  C  CB    . GLU A 1 465 ? -49.064  -13.948 16.662  1.00 33.41  ? 478 GLU A CB    1 
ATOM   3511  C  CG    . GLU A 1 465 ? -49.628  -12.724 17.372  1.00 33.41  ? 478 GLU A CG    1 
ATOM   3512  C  CD    . GLU A 1 465 ? -50.720  -12.029 16.581  1.00 33.41  ? 478 GLU A CD    1 
ATOM   3513  O  OE1   . GLU A 1 465 ? -51.000  -12.457 15.443  1.00 33.41  ? 478 GLU A OE1   1 
ATOM   3514  O  OE2   . GLU A 1 465 ? -51.295  -11.051 17.100  1.00 33.41  ? 478 GLU A OE2   1 
ATOM   3515  N  N     . ASP A 1 466 ? -48.893  -15.988 19.121  1.00 38.86  ? 479 ASP A N     1 
ATOM   3516  C  CA    . ASP A 1 466 ? -49.298  -16.341 20.476  1.00 38.86  ? 479 ASP A CA    1 
ATOM   3517  C  C     . ASP A 1 466 ? -48.083  -16.510 21.390  1.00 38.86  ? 479 ASP A C     1 
ATOM   3518  O  O     . ASP A 1 466 ? -48.125  -16.140 22.561  1.00 38.86  ? 479 ASP A O     1 
ATOM   3519  C  CB    . ASP A 1 466 ? -50.140  -17.619 20.464  1.00 38.86  ? 479 ASP A CB    1 
ATOM   3520  C  CG    . ASP A 1 466 ? -51.072  -17.717 21.658  1.00 38.86  ? 479 ASP A CG    1 
ATOM   3521  O  OD1   . ASP A 1 466 ? -51.549  -16.665 22.134  1.00 38.86  ? 479 ASP A OD1   1 
ATOM   3522  O  OD2   . ASP A 1 466 ? -51.332  -18.848 22.115  1.00 38.86  ? 479 ASP A OD2   1 
ATOM   3523  N  N     . ILE A 1 467 ? -47.002  -17.062 20.846  1.00 29.36  ? 480 ILE A N     1 
ATOM   3524  C  CA    . ILE A 1 467 ? -45.766  -17.234 21.603  1.00 29.36  ? 480 ILE A CA    1 
ATOM   3525  C  C     . ILE A 1 467 ? -45.137  -15.880 21.929  1.00 29.36  ? 480 ILE A C     1 
ATOM   3526  O  O     . ILE A 1 467 ? -44.661  -15.657 23.042  1.00 29.36  ? 480 ILE A O     1 
ATOM   3527  C  CB    . ILE A 1 467 ? -44.753  -18.117 20.844  1.00 29.36  ? 480 ILE A CB    1 
ATOM   3528  C  CG1   . ILE A 1 467 ? -45.302  -19.529 20.663  1.00 29.36  ? 480 ILE A CG1   1 
ATOM   3529  C  CG2   . ILE A 1 467 ? -43.425  -18.176 21.580  1.00 29.36  ? 480 ILE A CG2   1 
ATOM   3530  C  CD1   . ILE A 1 467 ? -44.352  -20.467 19.953  1.00 29.36  ? 480 ILE A CD1   1 
ATOM   3531  N  N     . LEU A 1 468 ? -45.149  -14.978 20.953  1.00 28.90  ? 481 LEU A N     1 
ATOM   3532  C  CA    . LEU A 1 468 ? -44.591  -13.641 21.121  1.00 28.90  ? 481 LEU A CA    1 
ATOM   3533  C  C     . LEU A 1 468 ? -45.320  -12.830 22.194  1.00 28.90  ? 481 LEU A C     1 
ATOM   3534  O  O     . LEU A 1 468 ? -44.702  -12.047 22.917  1.00 28.90  ? 481 LEU A O     1 
ATOM   3535  C  CB    . LEU A 1 468 ? -44.630  -12.879 19.793  1.00 28.90  ? 481 LEU A CB    1 
ATOM   3536  C  CG    . LEU A 1 468 ? -43.804  -13.421 18.626  1.00 28.90  ? 481 LEU A CG    1 
ATOM   3537  C  CD1   . LEU A 1 468 ? -44.068  -12.624 17.360  1.00 28.90  ? 481 LEU A CD1   1 
ATOM   3538  C  CD2   . LEU A 1 468 ? -42.329  -13.396 18.967  1.00 28.90  ? 481 LEU A CD2   1 
ATOM   3539  N  N     . THR A 1 469 ? -46.632  -13.021 22.298  1.00 33.33  ? 482 THR A N     1 
ATOM   3540  C  CA    . THR A 1 469 ? -47.457  -12.179 23.162  1.00 33.33  ? 482 THR A CA    1 
ATOM   3541  C  C     . THR A 1 469 ? -47.749  -12.784 24.536  1.00 33.33  ? 482 THR A C     1 
ATOM   3542  O  O     . THR A 1 469 ? -48.023  -12.054 25.488  1.00 33.33  ? 482 THR A O     1 
ATOM   3543  C  CB    . THR A 1 469 ? -48.787  -11.802 22.472  1.00 33.33  ? 482 THR A CB    1 
ATOM   3544  O  OG1   . THR A 1 469 ? -49.511  -10.875 23.290  1.00 33.33  ? 482 THR A OG1   1 
ATOM   3545  C  CG2   . THR A 1 469 ? -49.641  -13.036 22.240  1.00 33.33  ? 482 THR A CG2   1 
ATOM   3546  N  N     . VAL A 1 470 ? -47.689  -14.109 24.641  1.00 40.95  ? 483 VAL A N     1 
ATOM   3547  C  CA    . VAL A 1 470 ? -48.009  -14.786 25.898  1.00 40.95  ? 483 VAL A CA    1 
ATOM   3548  C  C     . VAL A 1 470 ? -46.762  -15.265 26.638  1.00 40.95  ? 483 VAL A C     1 
ATOM   3549  O  O     . VAL A 1 470 ? -46.617  -15.035 27.839  1.00 40.95  ? 483 VAL A O     1 
ATOM   3550  C  CB    . VAL A 1 470 ? -48.960  -15.981 25.680  1.00 40.95  ? 483 VAL A CB    1 
ATOM   3551  C  CG1   . VAL A 1 470 ? -49.287  -16.649 27.003  1.00 40.95  ? 483 VAL A CG1   1 
ATOM   3552  C  CG2   . VAL A 1 470 ? -50.234  -15.526 24.997  1.00 40.95  ? 483 VAL A CG2   1 
ATOM   3553  N  N     . ASP A 1 471 ? -45.867  -15.930 25.916  1.00 21.93  ? 484 ASP A N     1 
ATOM   3554  C  CA    . ASP A 1 471 ? -44.658  -16.482 26.518  1.00 21.93  ? 484 ASP A CA    1 
ATOM   3555  C  C     . ASP A 1 471 ? -43.517  -15.470 26.576  1.00 21.93  ? 484 ASP A C     1 
ATOM   3556  O  O     . ASP A 1 471 ? -42.875  -15.304 27.610  1.00 21.93  ? 484 ASP A O     1 
ATOM   3557  C  CB    . ASP A 1 471 ? -44.211  -17.734 25.767  1.00 21.93  ? 484 ASP A CB    1 
ATOM   3558  C  CG    . ASP A 1 471 ? -45.327  -18.742 25.607  1.00 21.93  ? 484 ASP A CG    1 
ATOM   3559  O  OD1   . ASP A 1 471 ? -45.750  -19.326 26.625  1.00 21.93  ? 484 ASP A OD1   1 
ATOM   3560  O  OD2   . ASP A 1 471 ? -45.779  -18.951 24.463  1.00 21.93  ? 484 ASP A OD2   1 
ATOM   3561  N  N     . ALA A 1 472 ? -43.265  -14.798 25.459  1.00 30.13  ? 485 ALA A N     1 
ATOM   3562  C  CA    . ALA A 1 472 ? -42.231  -13.774 25.407  1.00 30.13  ? 485 ALA A CA    1 
ATOM   3563  C  C     . ALA A 1 472 ? -42.664  -12.538 26.183  1.00 30.13  ? 485 ALA A C     1 
ATOM   3564  O  O     . ALA A 1 472 ? -41.826  -11.795 26.700  1.00 30.13  ? 485 ALA A O     1 
ATOM   3565  C  CB    . ALA A 1 472 ? -41.917  -13.411 23.969  1.00 30.13  ? 485 ALA A CB    1 
ATOM   3566  N  N     . LYS A 1 473 ? -43.977  -12.332 26.257  1.00 26.53  ? 486 LYS A N     1 
ATOM   3567  C  CA    . LYS A 1 473 ? -44.563  -11.175 26.928  1.00 26.53  ? 486 LYS A CA    1 
ATOM   3568  C  C     . LYS A 1 473 ? -43.996  -9.865  26.392  1.00 26.53  ? 486 LYS A C     1 
ATOM   3569  O  O     . LYS A 1 473 ? -43.566  -9.002  27.157  1.00 26.53  ? 486 LYS A O     1 
ATOM   3570  C  CB    . LYS A 1 473 ? -44.385  -11.268 28.446  1.00 26.53  ? 486 LYS A CB    1 
ATOM   3571  C  CG    . LYS A 1 473 ? -45.075  -12.477 29.071  1.00 26.53  ? 486 LYS A CG    1 
ATOM   3572  C  CD    . LYS A 1 473 ? -45.203  -12.339 30.582  1.00 26.53  ? 486 LYS A CD    1 
ATOM   3573  C  CE    . LYS A 1 473 ? -43.852  -12.402 31.273  1.00 26.53  ? 486 LYS A CE    1 
ATOM   3574  N  NZ    . LYS A 1 473 ? -43.217  -13.743 31.144  1.00 26.53  ? 486 LYS A NZ    1 
ATOM   3575  N  N     . MET A 1 474 ? -43.999  -9.729  25.069  1.00 20.51  ? 487 MET A N     1 
ATOM   3576  C  CA    . MET A 1 474 ? -43.490  -8.531  24.417  1.00 20.51  ? 487 MET A CA    1 
ATOM   3577  C  C     . MET A 1 474 ? -44.479  -7.384  24.542  1.00 20.51  ? 487 MET A C     1 
ATOM   3578  O  O     . MET A 1 474 ? -45.669  -7.603  24.778  1.00 20.51  ? 487 MET A O     1 
ATOM   3579  C  CB    . MET A 1 474 ? -43.223  -8.803  22.939  1.00 20.51  ? 487 MET A CB    1 
ATOM   3580  C  CG    . MET A 1 474 ? -42.055  -9.727  22.661  1.00 20.51  ? 487 MET A CG    1 
ATOM   3581  S  SD    . MET A 1 474 ? -41.885  -10.047 20.896  1.00 20.51  ? 487 MET A SD    1 
ATOM   3582  C  CE    . MET A 1 474 ? -40.297  -10.872 20.856  1.00 20.51  ? 487 MET A CE    1 
ATOM   3583  N  N     . ASP A 1 475 ? -43.984  -6.161  24.382  1.00 71.13  ? 488 ASP A N     1 
ATOM   3584  C  CA    . ASP A 1 475 ? -44.858  -4.999  24.293  1.00 71.13  ? 488 ASP A CA    1 
ATOM   3585  C  C     . ASP A 1 475 ? -45.661  -5.080  23.002  1.00 71.13  ? 488 ASP A C     1 
ATOM   3586  O  O     . ASP A 1 475 ? -45.265  -5.769  22.061  1.00 71.13  ? 488 ASP A O     1 
ATOM   3587  C  CB    . ASP A 1 475 ? -44.052  -3.699  24.338  1.00 71.13  ? 488 ASP A CB    1 
ATOM   3588  C  CG    . ASP A 1 475 ? -43.768  -3.238  25.756  1.00 71.13  ? 488 ASP A CG    1 
ATOM   3589  O  OD1   . ASP A 1 475 ? -43.413  -2.054  25.938  1.00 71.13  ? 488 ASP A OD1   1 
ATOM   3590  O  OD2   . ASP A 1 475 ? -43.905  -4.057  26.688  1.00 71.13  ? 488 ASP A OD2   1 
ATOM   3591  N  N     . ASP A 1 476 ? -46.786  -4.375  22.963  1.00 73.80  ? 489 ASP A N     1 
ATOM   3592  C  CA    . ASP A 1 476 ? -47.684  -4.422  21.816  1.00 73.80  ? 489 ASP A CA    1 
ATOM   3593  C  C     . ASP A 1 476 ? -47.019  -3.900  20.547  1.00 73.80  ? 489 ASP A C     1 
ATOM   3594  O  O     . ASP A 1 476 ? -47.433  -4.235  19.441  1.00 73.80  ? 489 ASP A O     1 
ATOM   3595  C  CB    . ASP A 1 476 ? -48.953  -3.615  22.101  1.00 73.80  ? 489 ASP A CB    1 
ATOM   3596  C  CG    . ASP A 1 476 ? -49.604  -3.995  23.417  1.00 73.80  ? 489 ASP A CG    1 
ATOM   3597  O  OD1   . ASP A 1 476 ? -49.291  -3.352  24.442  1.00 73.80  ? 489 ASP A OD1   1 
ATOM   3598  O  OD2   . ASP A 1 476 ? -50.428  -4.933  23.426  1.00 73.80  ? 489 ASP A OD2   1 
ATOM   3599  N  N     . ILE A 1 477 ? -45.984  -3.082  20.715  1.00 28.17  ? 490 ILE A N     1 
ATOM   3600  C  CA    . ILE A 1 477 ? -45.302  -2.453  19.588  1.00 28.17  ? 490 ILE A CA    1 
ATOM   3601  C  C     . ILE A 1 477 ? -43.994  -3.170  19.230  1.00 28.17  ? 490 ILE A C     1 
ATOM   3602  O  O     . ILE A 1 477 ? -43.567  -3.155  18.076  1.00 28.17  ? 490 ILE A O     1 
ATOM   3603  C  CB    . ILE A 1 477 ? -45.072  -0.935  19.854  1.00 28.17  ? 490 ILE A CB    1 
ATOM   3604  C  CG1   . ILE A 1 477 ? -44.392  -0.250  18.664  1.00 28.17  ? 490 ILE A CG1   1 
ATOM   3605  C  CG2   . ILE A 1 477 ? -44.303  -0.722  21.160  1.00 28.17  ? 490 ILE A CG2   1 
ATOM   3606  C  CD1   . ILE A 1 477 ? -42.902  0.006   18.849  1.00 28.17  ? 490 ILE A CD1   1 
ATOM   3607  N  N     . GLN A 1 478 ? -43.366  -3.808  20.214  1.00 75.29  ? 491 GLN A N     1 
ATOM   3608  C  CA    . GLN A 1 478 ? -42.140  -4.554  19.954  1.00 75.29  ? 491 GLN A CA    1 
ATOM   3609  C  C     . GLN A 1 478 ? -42.450  -6.003  19.587  1.00 75.29  ? 491 GLN A C     1 
ATOM   3610  O  O     . GLN A 1 478 ? -41.544  -6.799  19.338  1.00 75.29  ? 491 GLN A O     1 
ATOM   3611  C  CB    . GLN A 1 478 ? -41.175  -4.481  21.144  1.00 75.29  ? 491 GLN A CB    1 
ATOM   3612  C  CG    . GLN A 1 478 ? -41.506  -5.414  22.303  1.00 75.29  ? 491 GLN A CG    1 
ATOM   3613  C  CD    . GLN A 1 478 ? -40.632  -5.159  23.519  1.00 75.29  ? 491 GLN A CD    1 
ATOM   3614  O  OE1   . GLN A 1 478 ? -40.051  -4.084  23.663  1.00 75.29  ? 491 GLN A OE1   1 
ATOM   3615  N  NE2   . GLN A 1 478 ? -40.536  -6.149  24.400  1.00 75.29  ? 491 GLN A NE2   1 
ATOM   3616  N  N     . LYS A 1 479 ? -43.737  -6.337  19.557  1.00 45.93  ? 492 LYS A N     1 
ATOM   3617  C  CA    . LYS A 1 479 ? -44.179  -7.648  19.097  1.00 45.93  ? 492 LYS A CA    1 
ATOM   3618  C  C     . LYS A 1 479 ? -44.637  -7.542  17.645  1.00 45.93  ? 492 LYS A C     1 
ATOM   3619  O  O     . LYS A 1 479 ? -44.705  -8.542  16.929  1.00 45.93  ? 492 LYS A O     1 
ATOM   3620  C  CB    . LYS A 1 479 ? -45.298  -8.194  19.991  1.00 45.93  ? 492 LYS A CB    1 
ATOM   3621  C  CG    . LYS A 1 479 ? -46.693  -8.097  19.399  1.00 45.93  ? 492 LYS A CG    1 
ATOM   3622  C  CD    . LYS A 1 479 ? -47.185  -9.456  18.924  1.00 45.93  ? 492 LYS A CD    1 
ATOM   3623  C  CE    . LYS A 1 479 ? -48.433  -9.319  18.064  1.00 45.93  ? 492 LYS A CE    1 
ATOM   3624  N  NZ    . LYS A 1 479 ? -49.521  -8.574  18.751  1.00 45.93  ? 492 LYS A NZ    1 
ATOM   3625  N  N     . GLU A 1 480 ? -44.946  -6.320  17.217  1.00 41.54  ? 493 GLU A N     1 
ATOM   3626  C  CA    . GLU A 1 480 ? -45.269  -6.052  15.821  1.00 41.54  ? 493 GLU A CA    1 
ATOM   3627  C  C     . GLU A 1 480 ? -44.028  -6.262  14.963  1.00 41.54  ? 493 GLU A C     1 
ATOM   3628  O  O     . GLU A 1 480 ? -44.090  -6.903  13.913  1.00 41.54  ? 493 GLU A O     1 
ATOM   3629  C  CB    . GLU A 1 480 ? -45.775  -4.619  15.646  1.00 41.54  ? 493 GLU A CB    1 
ATOM   3630  C  CG    . GLU A 1 480 ? -47.094  -4.315  16.341  1.00 41.54  ? 493 GLU A CG    1 
ATOM   3631  C  CD    . GLU A 1 480 ? -48.285  -4.980  15.677  1.00 41.54  ? 493 GLU A CD    1 
ATOM   3632  O  OE1   . GLU A 1 480 ? -48.160  -5.414  14.514  1.00 41.54  ? 493 GLU A OE1   1 
ATOM   3633  O  OE2   . GLU A 1 480 ? -49.351  -5.064  16.319  1.00 41.54  ? 493 GLU A OE2   1 
ATOM   3634  N  N     . LYS A 1 481 ? -42.905  -5.715  15.422  1.00 11.93  ? 494 LYS A N     1 
ATOM   3635  C  CA    . LYS A 1 481 ? -41.625  -5.865  14.739  1.00 11.93  ? 494 LYS A CA    1 
ATOM   3636  C  C     . LYS A 1 481 ? -41.198  -7.325  14.727  1.00 11.93  ? 494 LYS A C     1 
ATOM   3637  O  O     . LYS A 1 481 ? -40.683  -7.830  13.730  1.00 11.93  ? 494 LYS A O     1 
ATOM   3638  C  CB    . LYS A 1 481 ? -40.548  -5.040  15.441  1.00 11.93  ? 494 LYS A CB    1 
ATOM   3639  C  CG    . LYS A 1 481 ? -40.850  -3.556  15.586  1.00 11.93  ? 494 LYS A CG    1 
ATOM   3640  C  CD    . LYS A 1 481 ? -39.710  -2.861  16.320  1.00 11.93  ? 494 LYS A CD    1 
ATOM   3641  C  CE    . LYS A 1 481 ? -39.951  -1.371  16.473  1.00 11.93  ? 494 LYS A CE    1 
ATOM   3642  N  NZ    . LYS A 1 481 ? -38.835  -0.716  17.212  1.00 11.93  ? 494 LYS A NZ    1 
ATOM   3643  N  N     . ALA A 1 482 ? -41.407  -7.995  15.853  1.00 1.49   ? 495 ALA A N     1 
ATOM   3644  C  CA    . ALA A 1 482 ? -41.031  -9.395  15.993  1.00 1.49   ? 495 ALA A CA    1 
ATOM   3645  C  C     . ALA A 1 482 ? -41.835  -10.284 15.052  1.00 1.49   ? 495 ALA A C     1 
ATOM   3646  O  O     . ALA A 1 482 ? -41.276  -11.147 14.378  1.00 1.49   ? 495 ALA A O     1 
ATOM   3647  C  CB    . ALA A 1 482 ? -41.208  -9.844  17.426  1.00 1.49   ? 495 ALA A CB    1 
ATOM   3648  N  N     . PHE A 1 483 ? -43.146  -10.068 15.011  1.00 33.29  ? 496 PHE A N     1 
ATOM   3649  C  CA    . PHE A 1 483 ? -44.025  -10.853 14.150  1.00 33.29  ? 496 PHE A CA    1 
ATOM   3650  C  C     . PHE A 1 483 ? -43.751  -10.563 12.678  1.00 33.29  ? 496 PHE A C     1 
ATOM   3651  O  O     . PHE A 1 483 ? -43.720  -11.477 11.858  1.00 33.29  ? 496 PHE A O     1 
ATOM   3652  C  CB    . PHE A 1 483 ? -45.493  -10.572 14.475  1.00 33.29  ? 496 PHE A CB    1 
ATOM   3653  C  CG    . PHE A 1 483 ? -46.449  -11.583 13.903  1.00 33.29  ? 496 PHE A CG    1 
ATOM   3654  C  CD1   . PHE A 1 483 ? -46.009  -12.844 13.524  1.00 33.29  ? 496 PHE A CD1   1 
ATOM   3655  C  CD2   . PHE A 1 483 ? -47.789  -11.269 13.738  1.00 33.29  ? 496 PHE A CD2   1 
ATOM   3656  C  CE1   . PHE A 1 483 ? -46.888  -13.773 12.994  1.00 33.29  ? 496 PHE A CE1   1 
ATOM   3657  C  CE2   . PHE A 1 483 ? -48.673  -12.193 13.209  1.00 33.29  ? 496 PHE A CE2   1 
ATOM   3658  C  CZ    . PHE A 1 483 ? -48.221  -13.445 12.837  1.00 33.29  ? 496 PHE A CZ    1 
ATOM   3659  N  N     . ALA A 1 484 ? -43.555  -9.289  12.349  1.00 2.17   ? 497 ALA A N     1 
ATOM   3660  C  CA    . ALA A 1 484 ? -43.264  -8.887  10.977  1.00 2.17   ? 497 ALA A CA    1 
ATOM   3661  C  C     . ALA A 1 484 ? -42.015  -9.591  10.458  1.00 2.17   ? 497 ALA A C     1 
ATOM   3662  O  O     . ALA A 1 484 ? -41.992  -10.074 9.327   1.00 2.17   ? 497 ALA A O     1 
ATOM   3663  C  CB    . ALA A 1 484 ? -43.104  -7.382  10.886  1.00 2.17   ? 497 ALA A CB    1 
ATOM   3664  N  N     . LEU A 1 485 ? -40.981  -9.639  11.294  1.00 1.91   ? 498 LEU A N     1 
ATOM   3665  C  CA    . LEU A 1 485 ? -39.740  -10.323 10.950  1.00 1.91   ? 498 LEU A CA    1 
ATOM   3666  C  C     . LEU A 1 485 ? -39.988  -11.809 10.713  1.00 1.91   ? 498 LEU A C     1 
ATOM   3667  O  O     . LEU A 1 485 ? -39.450  -12.393 9.772   1.00 1.91   ? 498 LEU A O     1 
ATOM   3668  C  CB    . LEU A 1 485 ? -38.699  -10.142 12.055  1.00 1.91   ? 498 LEU A CB    1 
ATOM   3669  C  CG    . LEU A 1 485 ? -37.343  -10.815 11.836  1.00 1.91   ? 498 LEU A CG    1 
ATOM   3670  C  CD1   . LEU A 1 485 ? -36.512  -10.036 10.837  1.00 1.91   ? 498 LEU A CD1   1 
ATOM   3671  C  CD2   . LEU A 1 485 ? -36.592  -10.972 13.142  1.00 1.91   ? 498 LEU A CD2   1 
ATOM   3672  N  N     . CYS A 1 486 ? -40.803  -12.414 11.573  1.00 8.74   ? 499 CYS A N     1 
ATOM   3673  C  CA    . CYS A 1 486 ? -41.160  -13.821 11.427  1.00 8.74   ? 499 CYS A CA    1 
ATOM   3674  C  C     . CYS A 1 486 ? -41.897  -14.071 10.115  1.00 8.74   ? 499 CYS A C     1 
ATOM   3675  O  O     . CYS A 1 486 ? -41.715  -15.108 9.482   1.00 8.74   ? 499 CYS A O     1 
ATOM   3676  C  CB    . CYS A 1 486 ? -42.019  -14.287 12.602  1.00 8.74   ? 499 CYS A CB    1 
ATOM   3677  S  SG    . CYS A 1 486 ? -41.173  -14.330 14.195  1.00 8.74   ? 499 CYS A SG    1 
ATOM   3678  N  N     . ILE A 1 487 ? -42.728  -13.115 9.713   1.00 8.36   ? 500 ILE A N     1 
ATOM   3679  C  CA    . ILE A 1 487 ? -43.464  -13.212 8.458   1.00 8.36   ? 500 ILE A CA    1 
ATOM   3680  C  C     . ILE A 1 487 ? -42.527  -13.011 7.267   1.00 8.36   ? 500 ILE A C     1 
ATOM   3681  O  O     . ILE A 1 487 ? -42.556  -13.782 6.306   1.00 8.36   ? 500 ILE A O     1 
ATOM   3682  C  CB    . ILE A 1 487 ? -44.610  -12.184 8.400   1.00 8.36   ? 500 ILE A CB    1 
ATOM   3683  C  CG1   . ILE A 1 487 ? -45.634  -12.465 9.499   1.00 8.36   ? 500 ILE A CG1   1 
ATOM   3684  C  CG2   . ILE A 1 487 ? -45.285  -12.206 7.039   1.00 8.36   ? 500 ILE A CG2   1 
ATOM   3685  C  CD1   . ILE A 1 487 ? -46.627  -11.345 9.714   1.00 8.36   ? 500 ILE A CD1   1 
ATOM   3686  N  N     . LYS A 1 488 ? -41.701  -11.970 7.343   1.00 19.20  ? 501 LYS A N     1 
ATOM   3687  C  CA    . LYS A 1 488 ? -40.721  -11.669 6.304   1.00 19.20  ? 501 LYS A CA    1 
ATOM   3688  C  C     . LYS A 1 488 ? -39.768  -12.836 6.078   1.00 19.20  ? 501 LYS A C     1 
ATOM   3689  O  O     . LYS A 1 488 ? -39.408  -13.141 4.942   1.00 19.20  ? 501 LYS A O     1 
ATOM   3690  C  CB    . LYS A 1 488 ? -39.918  -10.424 6.674   1.00 19.20  ? 501 LYS A CB    1 
ATOM   3691  C  CG    . LYS A 1 488 ? -40.682  -9.115  6.580   1.00 19.20  ? 501 LYS A CG    1 
ATOM   3692  C  CD    . LYS A 1 488 ? -39.872  -7.974  7.177   1.00 19.20  ? 501 LYS A CD    1 
ATOM   3693  C  CE    . LYS A 1 488 ? -40.515  -6.634  6.889   1.00 19.20  ? 501 LYS A CE    1 
ATOM   3694  N  NZ    . LYS A 1 488 ? -40.645  -6.401  5.426   1.00 19.20  ? 501 LYS A NZ    1 
ATOM   3695  N  N     . GLN A 1 489 ? -39.357  -13.480 7.167   1.00 24.43  ? 502 GLN A N     1 
ATOM   3696  C  CA    . GLN A 1 489 ? -38.435  -14.610 7.092   1.00 24.43  ? 502 GLN A CA    1 
ATOM   3697  C  C     . GLN A 1 489 ? -39.061  -15.812 6.389   1.00 24.43  ? 502 GLN A C     1 
ATOM   3698  O  O     . GLN A 1 489 ? -38.423  -16.442 5.550   1.00 24.43  ? 502 GLN A O     1 
ATOM   3699  C  CB    . GLN A 1 489 ? -37.927  -14.994 8.487   1.00 24.43  ? 502 GLN A CB    1 
ATOM   3700  C  CG    . GLN A 1 489 ? -36.817  -14.084 9.011   1.00 24.43  ? 502 GLN A CG    1 
ATOM   3701  C  CD    . GLN A 1 489 ? -36.451  -14.354 10.459  1.00 24.43  ? 502 GLN A CD    1 
ATOM   3702  O  OE1   . GLN A 1 489 ? -37.063  -15.189 11.123  1.00 24.43  ? 502 GLN A OE1   1 
ATOM   3703  N  NE2   . GLN A 1 489 ? -35.449  -13.641 10.956  1.00 24.43  ? 502 GLN A NE2   1 
ATOM   3704  N  N     . VAL A 1 490 ? -40.310  -16.120 6.727   1.00 14.69  ? 503 VAL A N     1 
ATOM   3705  C  CA    . VAL A 1 490 ? -41.032  -17.213 6.075   1.00 14.69  ? 503 VAL A CA    1 
ATOM   3706  C  C     . VAL A 1 490 ? -41.242  -16.915 4.593   1.00 14.69  ? 503 VAL A C     1 
ATOM   3707  O  O     . VAL A 1 490 ? -41.056  -17.785 3.742   1.00 14.69  ? 503 VAL A O     1 
ATOM   3708  C  CB    . VAL A 1 490 ? -42.386  -17.491 6.752   1.00 14.69  ? 503 VAL A CB    1 
ATOM   3709  C  CG1   . VAL A 1 490 ? -43.180  -18.519 5.963   1.00 14.69  ? 503 VAL A CG1   1 
ATOM   3710  C  CG2   . VAL A 1 490 ? -42.177  -17.971 8.175   1.00 14.69  ? 503 VAL A CG2   1 
ATOM   3711  N  N     . ASN A 1 491 ? -41.621  -15.676 4.293   1.00 16.34  ? 504 ASN A N     1 
ATOM   3712  C  CA    . ASN A 1 491 ? -41.788  -15.229 2.914   1.00 16.34  ? 504 ASN A CA    1 
ATOM   3713  C  C     . ASN A 1 491 ? -40.497  -15.398 2.116   1.00 16.34  ? 504 ASN A C     1 
ATOM   3714  O  O     . ASN A 1 491 ? -40.528  -15.693 0.922   1.00 16.34  ? 504 ASN A O     1 
ATOM   3715  C  CB    . ASN A 1 491 ? -42.249  -13.770 2.881   1.00 16.34  ? 504 ASN A CB    1 
ATOM   3716  C  CG    . ASN A 1 491 ? -42.599  -13.293 1.482   1.00 16.34  ? 504 ASN A CG    1 
ATOM   3717  O  OD1   . ASN A 1 491 ? -42.879  -14.093 0.591   1.00 16.34  ? 504 ASN A OD1   1 
ATOM   3718  N  ND2   . ASN A 1 491 ? -42.588  -11.979 1.285   1.00 16.34  ? 504 ASN A ND2   1 
ATOM   3719  N  N     . PHE A 1 492 ? -39.365  -15.219 2.790   1.00 27.23  ? 505 PHE A N     1 
ATOM   3720  C  CA    . PHE A 1 492 ? -38.056  -15.410 2.179   1.00 27.23  ? 505 PHE A CA    1 
ATOM   3721  C  C     . PHE A 1 492 ? -37.758  -16.891 1.960   1.00 27.23  ? 505 PHE A C     1 
ATOM   3722  O  O     . PHE A 1 492 ? -37.313  -17.291 0.886   1.00 27.23  ? 505 PHE A O     1 
ATOM   3723  C  CB    . PHE A 1 492 ? -36.970  -14.777 3.053   1.00 27.23  ? 505 PHE A CB    1 
ATOM   3724  C  CG    . PHE A 1 492 ? -35.570  -15.087 2.606   1.00 27.23  ? 505 PHE A CG    1 
ATOM   3725  C  CD1   . PHE A 1 492 ? -34.974  -14.355 1.591   1.00 27.23  ? 505 PHE A CD1   1 
ATOM   3726  C  CD2   . PHE A 1 492 ? -34.846  -16.106 3.208   1.00 27.23  ? 505 PHE A CD2   1 
ATOM   3727  C  CE1   . PHE A 1 492 ? -33.684  -14.640 1.178   1.00 27.23  ? 505 PHE A CE1   1 
ATOM   3728  C  CE2   . PHE A 1 492 ? -33.559  -16.396 2.799   1.00 27.23  ? 505 PHE A CE2   1 
ATOM   3729  C  CZ    . PHE A 1 492 ? -32.978  -15.661 1.784   1.00 27.23  ? 505 PHE A CZ    1 
ATOM   3730  N  N     . LEU A 1 493 ? -38.011  -17.698 2.987   1.00 20.39  ? 506 LEU A N     1 
ATOM   3731  C  CA    . LEU A 1 493 ? -37.693  -19.122 2.953   1.00 20.39  ? 506 LEU A CA    1 
ATOM   3732  C  C     . LEU A 1 493 ? -38.574  -19.911 1.986   1.00 20.39  ? 506 LEU A C     1 
ATOM   3733  O  O     . LEU A 1 493 ? -38.278  -21.063 1.670   1.00 20.39  ? 506 LEU A O     1 
ATOM   3734  C  CB    . LEU A 1 493 ? -37.803  -19.724 4.356   1.00 20.39  ? 506 LEU A CB    1 
ATOM   3735  C  CG    . LEU A 1 493 ? -36.855  -19.194 5.434   1.00 20.39  ? 506 LEU A CG    1 
ATOM   3736  C  CD1   . LEU A 1 493 ? -37.275  -19.677 6.811   1.00 20.39  ? 506 LEU A CD1   1 
ATOM   3737  C  CD2   . LEU A 1 493 ? -35.428  -19.609 5.140   1.00 20.39  ? 506 LEU A CD2   1 
ATOM   3738  N  N     . SER A 1 494 ? -39.655  -19.292 1.519   1.00 37.35  ? 507 SER A N     1 
ATOM   3739  C  CA    . SER A 1 494 ? -40.595  -19.968 0.630   1.00 37.35  ? 507 SER A CA    1 
ATOM   3740  C  C     . SER A 1 494 ? -40.533  -19.417 -0.791  1.00 37.35  ? 507 SER A C     1 
ATOM   3741  O  O     . SER A 1 494 ? -41.352  -19.779 -1.637  1.00 37.35  ? 507 SER A O     1 
ATOM   3742  C  CB    . SER A 1 494 ? -42.019  -19.851 1.172   1.00 37.35  ? 507 SER A CB    1 
ATOM   3743  O  OG    . SER A 1 494 ? -42.443  -18.501 1.204   1.00 37.35  ? 507 SER A OG    1 
ATOM   3744  N  N     . GLU A 1 495 ? -39.560  -18.545 -1.041  1.00 50.23  ? 508 GLU A N     1 
ATOM   3745  C  CA    . GLU A 1 495 ? -39.381  -17.908 -2.344  1.00 50.23  ? 508 GLU A CA    1 
ATOM   3746  C  C     . GLU A 1 495 ? -40.626  -17.155 -2.815  1.00 50.23  ? 508 GLU A C     1 
ATOM   3747  O  O     . GLU A 1 495 ? -40.934  -17.138 -4.007  1.00 50.23  ? 508 GLU A O     1 
ATOM   3748  C  CB    . GLU A 1 495 ? -38.935  -18.925 -3.402  1.00 50.23  ? 508 GLU A CB    1 
ATOM   3749  C  CG    . GLU A 1 495 ? -37.632  -19.642 -3.073  1.00 50.23  ? 508 GLU A CG    1 
ATOM   3750  C  CD    . GLU A 1 495 ? -37.181  -20.576 -4.181  1.00 50.23  ? 508 GLU A CD    1 
ATOM   3751  O  OE1   . GLU A 1 495 ? -37.525  -20.322 -5.355  1.00 50.23  ? 508 GLU A OE1   1 
ATOM   3752  O  OE2   . GLU A 1 495 ? -36.484  -21.567 -3.877  1.00 50.23  ? 508 GLU A OE2   1 
ATOM   3753  N  N     . GLY A 1 496 ? -41.343  -16.544 -1.876  1.00 46.24  ? 509 GLY A N     1 
ATOM   3754  C  CA    . GLY A 1 496 ? -42.473  -15.695 -2.213  1.00 46.24  ? 509 GLY A CA    1 
ATOM   3755  C  C     . GLY A 1 496 ? -43.834  -16.372 -2.191  1.00 46.24  ? 509 GLY A C     1 
ATOM   3756  O  O     . GLY A 1 496 ? -44.852  -15.724 -2.435  1.00 46.24  ? 509 GLY A O     1 
ATOM   3757  N  N     . LYS A 1 497 ? -43.858  -17.669 -1.891  1.00 34.29  ? 510 LYS A N     1 
ATOM   3758  C  CA    . LYS A 1 497 ? -45.099  -18.439 -1.909  1.00 34.29  ? 510 LYS A CA    1 
ATOM   3759  C  C     . LYS A 1 497 ? -46.108  -17.968 -0.865  1.00 34.29  ? 510 LYS A C     1 
ATOM   3760  O  O     . LYS A 1 497 ? -47.307  -18.215 -0.994  1.00 34.29  ? 510 LYS A O     1 
ATOM   3761  C  CB    . LYS A 1 497 ? -44.811  -19.931 -1.733  1.00 34.29  ? 510 LYS A CB    1 
ATOM   3762  C  CG    . LYS A 1 497 ? -44.199  -20.592 -2.956  1.00 34.29  ? 510 LYS A CG    1 
ATOM   3763  C  CD    . LYS A 1 497 ? -43.546  -21.918 -2.602  1.00 34.29  ? 510 LYS A CD    1 
ATOM   3764  C  CE    . LYS A 1 497 ? -42.699  -22.432 -3.755  1.00 34.29  ? 510 LYS A CE    1 
ATOM   3765  N  NZ    . LYS A 1 497 ? -41.578  -23.293 -3.285  1.00 34.29  ? 510 LYS A NZ    1 
ATOM   3766  N  N     . LEU A 1 498 ? -45.620  -17.290 0.169   1.00 28.08  ? 511 LEU A N     1 
ATOM   3767  C  CA    . LEU A 1 498 ? -46.496  -16.774 1.215   1.00 28.08  ? 511 LEU A CA    1 
ATOM   3768  C  C     . LEU A 1 498 ? -47.225  -15.510 0.765   1.00 28.08  ? 511 LEU A C     1 
ATOM   3769  O  O     . LEU A 1 498 ? -48.439  -15.398 0.926   1.00 28.08  ? 511 LEU A O     1 
ATOM   3770  C  CB    . LEU A 1 498 ? -45.712  -16.501 2.501   1.00 28.08  ? 511 LEU A CB    1 
ATOM   3771  C  CG    . LEU A 1 498 ? -46.536  -15.962 3.669   1.00 28.08  ? 511 LEU A CG    1 
ATOM   3772  C  CD1   . LEU A 1 498 ? -47.700  -16.890 3.965   1.00 28.08  ? 511 LEU A CD1   1 
ATOM   3773  C  CD2   . LEU A 1 498 ? -45.678  -15.779 4.907   1.00 28.08  ? 511 LEU A CD2   1 
ATOM   3774  N  N     . GLU A 1 499 ? -46.478  -14.566 0.200   1.00 53.81  ? 512 GLU A N     1 
ATOM   3775  C  CA    . GLU A 1 499 ? -47.039  -13.284 -0.220  1.00 53.81  ? 512 GLU A CA    1 
ATOM   3776  C  C     . GLU A 1 499 ? -48.128  -13.446 -1.277  1.00 53.81  ? 512 GLU A C     1 
ATOM   3777  O  O     . GLU A 1 499 ? -49.176  -12.805 -1.200  1.00 53.81  ? 512 GLU A O     1 
ATOM   3778  C  CB    . GLU A 1 499 ? -45.940  -12.356 -0.742  1.00 53.81  ? 512 GLU A CB    1 
ATOM   3779  C  CG    . GLU A 1 499 ? -46.442  -10.968 -1.125  1.00 53.81  ? 512 GLU A CG    1 
ATOM   3780  C  CD    . GLU A 1 499 ? -45.385  -10.120 -1.807  1.00 53.81  ? 512 GLU A CD    1 
ATOM   3781  O  OE1   . GLU A 1 499 ? -44.268  -10.626 -2.039  1.00 53.81  ? 512 GLU A OE1   1 
ATOM   3782  O  OE2   . GLU A 1 499 ? -45.676  -8.944  -2.112  1.00 53.81  ? 512 GLU A OE2   1 
ATOM   3783  N  N     . THR A 1 500 ? -47.873  -14.301 -2.263  1.00 55.13  ? 513 THR A N     1 
ATOM   3784  C  CA    . THR A 1 500 ? -48.838  -14.559 -3.327  1.00 55.13  ? 513 THR A CA    1 
ATOM   3785  C  C     . THR A 1 500 ? -50.136  -15.122 -2.759  1.00 55.13  ? 513 THR A C     1 
ATOM   3786  O  O     . THR A 1 500 ? -51.224  -14.662 -3.102  1.00 55.13  ? 513 THR A O     1 
ATOM   3787  C  CB    . THR A 1 500 ? -48.282  -15.541 -4.374  1.00 55.13  ? 513 THR A CB    1 
ATOM   3788  O  OG1   . THR A 1 500 ? -48.146  -16.841 -3.790  1.00 55.13  ? 513 THR A OG1   1 
ATOM   3789  C  CG2   . THR A 1 500 ? -46.932  -15.072 -4.885  1.00 55.13  ? 513 THR A CG2   1 
ATOM   3790  N  N     . TYR A 1 501 ? -50.010  -16.119 -1.889  1.00 53.55  ? 514 TYR A N     1 
ATOM   3791  C  CA    . TYR A 1 501 ? -51.166  -16.726 -1.238  1.00 53.55  ? 514 TYR A CA    1 
ATOM   3792  C  C     . TYR A 1 501 ? -51.900  -15.723 -0.353  1.00 53.55  ? 514 TYR A C     1 
ATOM   3793  O  O     . TYR A 1 501 ? -53.126  -15.755 -0.251  1.00 53.55  ? 514 TYR A O     1 
ATOM   3794  C  CB    . TYR A 1 501 ? -50.739  -17.942 -0.412  1.00 53.55  ? 514 TYR A CB    1 
ATOM   3795  C  CG    . TYR A 1 501 ? -51.779  -18.403 0.583   1.00 53.55  ? 514 TYR A CG    1 
ATOM   3796  C  CD1   . TYR A 1 501 ? -52.883  -19.137 0.175   1.00 53.55  ? 514 TYR A CD1   1 
ATOM   3797  C  CD2   . TYR A 1 501 ? -51.655  -18.106 1.933   1.00 53.55  ? 514 TYR A CD2   1 
ATOM   3798  C  CE1   . TYR A 1 501 ? -53.835  -19.559 1.082   1.00 53.55  ? 514 TYR A CE1   1 
ATOM   3799  C  CE2   . TYR A 1 501 ? -52.601  -18.523 2.846   1.00 53.55  ? 514 TYR A CE2   1 
ATOM   3800  C  CZ    . TYR A 1 501 ? -53.688  -19.250 2.416   1.00 53.55  ? 514 TYR A CZ    1 
ATOM   3801  O  OH    . TYR A 1 501 ? -54.631  -19.667 3.324   1.00 53.55  ? 514 TYR A OH    1 
ATOM   3802  N  N     . LEU A 1 502 ? -51.143  -14.838 0.287   1.00 48.82  ? 515 LEU A N     1 
ATOM   3803  C  CA    . LEU A 1 502 ? -51.726  -13.793 1.120   1.00 48.82  ? 515 LEU A CA    1 
ATOM   3804  C  C     . LEU A 1 502 ? -52.472  -12.766 0.274   1.00 48.82  ? 515 LEU A C     1 
ATOM   3805  O  O     . LEU A 1 502 ? -53.430  -12.146 0.737   1.00 48.82  ? 515 LEU A O     1 
ATOM   3806  C  CB    . LEU A 1 502 ? -50.644  -13.100 1.950   1.00 48.82  ? 515 LEU A CB    1 
ATOM   3807  C  CG    . LEU A 1 502 ? -50.146  -13.818 3.200   1.00 48.82  ? 515 LEU A CG    1 
ATOM   3808  C  CD1   . LEU A 1 502 ? -49.031  -13.022 3.847   1.00 48.82  ? 515 LEU A CD1   1 
ATOM   3809  C  CD2   . LEU A 1 502 ? -51.282  -14.030 4.180   1.00 48.82  ? 515 LEU A CD2   1 
ATOM   3810  N  N     . ASN A 1 503 ? -52.027  -12.589 -0.966  1.00 33.03  ? 516 ASN A N     1 
ATOM   3811  C  CA    . ASN A 1 503 ? -52.652  -11.635 -1.873  1.00 33.03  ? 516 ASN A CA    1 
ATOM   3812  C  C     . ASN A 1 503 ? -53.961  -12.147 -2.468  1.00 33.03  ? 516 ASN A C     1 
ATOM   3813  O  O     . ASN A 1 503 ? -54.837  -11.361 -2.827  1.00 33.03  ? 516 ASN A O     1 
ATOM   3814  C  CB    . ASN A 1 503 ? -51.681  -11.240 -2.989  1.00 33.03  ? 516 ASN A CB    1 
ATOM   3815  C  CG    . ASN A 1 503 ? -50.636  -10.244 -2.530  1.00 33.03  ? 516 ASN A CG    1 
ATOM   3816  O  OD1   . ASN A 1 503 ? -50.891  -9.418  -1.655  1.00 33.03  ? 516 ASN A OD1   1 
ATOM   3817  N  ND2   . ASN A 1 503 ? -49.452  -10.314 -3.125  1.00 33.03  ? 516 ASN A ND2   1 
ATOM   3818  N  N     . LYS A 1 504 ? -54.087  -13.466 -2.576  1.00 60.96  ? 517 LYS A N     1 
ATOM   3819  C  CA    . LYS A 1 504 ? -55.306  -14.075 -3.095  1.00 60.96  ? 517 LYS A CA    1 
ATOM   3820  C  C     . LYS A 1 504 ? -56.418  -14.055 -2.051  1.00 60.96  ? 517 LYS A C     1 
ATOM   3821  O  O     . LYS A 1 504 ? -57.529  -13.608 -2.330  1.00 60.96  ? 517 LYS A O     1 
ATOM   3822  C  CB    . LYS A 1 504 ? -55.045  -15.509 -3.560  1.00 60.96  ? 517 LYS A CB    1 
ATOM   3823  C  CG    . LYS A 1 504 ? -54.089  -15.620 -4.739  1.00 60.96  ? 517 LYS A CG    1 
ATOM   3824  C  CD    . LYS A 1 504 ? -53.940  -17.064 -5.194  1.00 60.96  ? 517 LYS A CD    1 
ATOM   3825  C  CE    . LYS A 1 504 ? -55.284  -17.661 -5.579  1.00 60.96  ? 517 LYS A CE    1 
ATOM   3826  N  NZ    . LYS A 1 504 ? -55.168  -19.082 -6.009  1.00 60.96  ? 517 LYS A NZ    1 
ATOM   3827  N  N     . VAL A 1 505 ? -56.106  -14.538 -0.851  1.00 36.24  ? 518 VAL A N     1 
ATOM   3828  C  CA    . VAL A 1 505 ? -57.067  -14.592 0.250   1.00 36.24  ? 518 VAL A CA    1 
ATOM   3829  C  C     . VAL A 1 505 ? -57.695  -13.228 0.534   1.00 36.24  ? 518 VAL A C     1 
ATOM   3830  O  O     . VAL A 1 505 ? -58.901  -13.123 0.756   1.00 36.24  ? 518 VAL A O     1 
ATOM   3831  C  CB    . VAL A 1 505 ? -56.412  -15.134 1.537   1.00 36.24  ? 518 VAL A CB    1 
ATOM   3832  C  CG1   . VAL A 1 505 ? -57.388  -15.087 2.701   1.00 36.24  ? 518 VAL A CG1   1 
ATOM   3833  C  CG2   . VAL A 1 505 ? -55.911  -16.551 1.319   1.00 36.24  ? 518 VAL A CG2   1 
ATOM   3834  N  N     . GLU A 1 506 ? -56.872  -12.185 0.511   1.00 46.29  ? 519 GLU A N     1 
ATOM   3835  C  CA    . GLU A 1 506 ? -57.351  -10.833 0.767   1.00 46.29  ? 519 GLU A CA    1 
ATOM   3836  C  C     . GLU A 1 506 ? -58.196  -10.315 -0.393  1.00 46.29  ? 519 GLU A C     1 
ATOM   3837  O  O     . GLU A 1 506 ? -59.171  -9.595  -0.186  1.00 46.29  ? 519 GLU A O     1 
ATOM   3838  C  CB    . GLU A 1 506 ? -56.180  -9.885  1.027   1.00 46.29  ? 519 GLU A CB    1 
ATOM   3839  C  CG    . GLU A 1 506 ? -56.601  -8.519  1.546   1.00 46.29  ? 519 GLU A CG    1 
ATOM   3840  C  CD    . GLU A 1 506 ? -55.467  -7.516  1.545   1.00 46.29  ? 519 GLU A CD    1 
ATOM   3841  O  OE1   . GLU A 1 506 ? -54.605  -7.592  0.645   1.00 46.29  ? 519 GLU A OE1   1 
ATOM   3842  O  OE2   . GLU A 1 506 ? -55.435  -6.651  2.445   1.00 46.29  ? 519 GLU A OE2   1 
ATOM   3843  N  N     . ALA A 1 507 ? -57.815  -10.682 -1.613  1.00 47.03  ? 520 ALA A N     1 
ATOM   3844  C  CA    . ALA A 1 507 ? -58.568  -10.282 -2.798  1.00 47.03  ? 520 ALA A CA    1 
ATOM   3845  C  C     . ALA A 1 507 ? -59.871  -11.067 -2.904  1.00 47.03  ? 520 ALA A C     1 
ATOM   3846  O  O     . ALA A 1 507 ? -60.868  -10.565 -3.423  1.00 47.03  ? 520 ALA A O     1 
ATOM   3847  C  CB    . ALA A 1 507 ? -57.731  -10.467 -4.051  1.00 47.03  ? 520 ALA A CB    1 
ATOM   3848  N  N     . GLU A 1 508 ? -59.855  -12.302 -2.410  1.00 57.21  ? 521 GLU A N     1 
ATOM   3849  C  CA    . GLU A 1 508 ? -61.043  -13.147 -2.410  1.00 57.21  ? 521 GLU A CA    1 
ATOM   3850  C  C     . GLU A 1 508 ? -61.952  -12.817 -1.228  1.00 57.21  ? 521 GLU A C     1 
ATOM   3851  O  O     . GLU A 1 508 ? -63.011  -13.420 -1.061  1.00 57.21  ? 521 GLU A O     1 
ATOM   3852  C  CB    . GLU A 1 508 ? -60.654  -14.628 -2.386  1.00 57.21  ? 521 GLU A CB    1 
ATOM   3853  C  CG    . GLU A 1 508 ? -59.987  -15.120 -3.664  1.00 57.21  ? 521 GLU A CG    1 
ATOM   3854  C  CD    . GLU A 1 508 ? -59.635  -16.595 -3.610  1.00 57.21  ? 521 GLU A CD    1 
ATOM   3855  O  OE1   . GLU A 1 508 ? -59.796  -17.206 -2.534  1.00 57.21  ? 521 GLU A OE1   1 
ATOM   3856  O  OE2   . GLU A 1 508 ? -59.198  -17.141 -4.645  1.00 57.21  ? 521 GLU A OE2   1 
ATOM   3857  N  N     . ALA A 1 509 ? -61.529  -11.856 -0.413  1.00 59.24  ? 522 ALA A N     1 
ATOM   3858  C  CA    . ALA A 1 509 ? -62.320  -11.414 0.729   1.00 59.24  ? 522 ALA A CA    1 
ATOM   3859  C  C     . ALA A 1 509 ? -62.892  -10.019 0.490   1.00 59.24  ? 522 ALA A C     1 
ATOM   3860  O  O     . ALA A 1 509 ? -63.856  -9.618  1.141   1.00 59.24  ? 522 ALA A O     1 
ATOM   3861  C  CB    . ALA A 1 509 ? -61.487  -11.441 1.996   1.00 59.24  ? 522 ALA A CB    1 
ATOM   3862  N  N     . LYS A 1 510 ? -62.287  -9.281  -0.436  1.00 68.37  ? 523 LYS A N     1 
ATOM   3863  C  CA    . LYS A 1 510 ? -62.812  -7.979  -0.835  1.00 68.37  ? 523 LYS A CA    1 
ATOM   3864  C  C     . LYS A 1 510 ? -63.889  -8.179  -1.894  1.00 68.37  ? 523 LYS A C     1 
ATOM   3865  O  O     . LYS A 1 510 ? -64.808  -7.371  -2.023  1.00 68.37  ? 523 LYS A O     1 
ATOM   3866  C  CB    . LYS A 1 510 ? -61.697  -7.075  -1.369  1.00 68.37  ? 523 LYS A CB    1 
ATOM   3867  C  CG    . LYS A 1 510 ? -62.140  -5.644  -1.651  1.00 68.37  ? 523 LYS A CG    1 
ATOM   3868  C  CD    . LYS A 1 510 ? -60.990  -4.786  -2.161  1.00 68.37  ? 523 LYS A CD    1 
ATOM   3869  C  CE    . LYS A 1 510 ? -60.461  -5.295  -3.492  1.00 68.37  ? 523 LYS A CE    1 
ATOM   3870  N  NZ    . LYS A 1 510 ? -59.351  -4.447  -4.012  1.00 68.37  ? 523 LYS A NZ    1 
ATOM   3871  N  N     . ALA A 1 511 ? -63.772  -9.272  -2.642  1.00 62.48  ? 524 ALA A N     1 
ATOM   3872  C  CA    . ALA A 1 511 ? -64.778  -9.644  -3.629  1.00 62.48  ? 524 ALA A CA    1 
ATOM   3873  C  C     . ALA A 1 511 ? -65.920  -10.400 -2.957  1.00 62.48  ? 524 ALA A C     1 
ATOM   3874  O  O     . ALA A 1 511 ? -66.693  -11.095 -3.615  1.00 62.48  ? 524 ALA A O     1 
ATOM   3875  C  CB    . ALA A 1 511 ? -64.157  -10.486 -4.729  1.00 62.48  ? 524 ALA A CB    1 
ATOM   3876  N  N     . ALA A 1 512 ? -66.006  -10.259 -1.639  1.00 51.71  ? 525 ALA A N     1 
ATOM   3877  C  CA    . ALA A 1 512 ? -67.084  -10.836 -0.851  1.00 51.71  ? 525 ALA A CA    1 
ATOM   3878  C  C     . ALA A 1 512 ? -67.470  -9.849  0.240   1.00 51.71  ? 525 ALA A C     1 
ATOM   3879  O  O     . ALA A 1 512 ? -68.315  -10.143 1.085   1.00 51.71  ? 525 ALA A O     1 
ATOM   3880  C  CB    . ALA A 1 512 ? -66.649  -12.155 -0.243  1.00 51.71  ? 525 ALA A CB    1 
ATOM   3881  N  N     . ALA A 1 513 ? -66.832  -8.681  0.209   1.00 61.73  ? 526 ALA A N     1 
ATOM   3882  C  CA    . ALA A 1 513 ? -67.066  -7.611  1.178   1.00 61.73  ? 526 ALA A CA    1 
ATOM   3883  C  C     . ALA A 1 513 ? -66.936  -8.077  2.626   1.00 61.73  ? 526 ALA A C     1 
ATOM   3884  O  O     . ALA A 1 513 ? -67.827  -7.847  3.441   1.00 61.73  ? 526 ALA A O     1 
ATOM   3885  C  CB    . ALA A 1 513 ? -68.423  -6.961  0.945   1.00 61.73  ? 526 ALA A CB    1 
ATOM   3886  N  N     . GLU A 1 514 ? -65.821  -8.727  2.943   1.00 74.10  ? 527 GLU A N     1 
ATOM   3887  C  CA    . GLU A 1 514 ? -65.593  -9.233  4.292   1.00 74.10  ? 527 GLU A CA    1 
ATOM   3888  C  C     . GLU A 1 514 ? -64.135  -9.090  4.720   1.00 74.10  ? 527 GLU A C     1 
ATOM   3889  O  O     . GLU A 1 514 ? -63.225  -9.292  3.915   1.00 74.10  ? 527 GLU A O     1 
ATOM   3890  C  CB    . GLU A 1 514 ? -66.048  -10.692 4.409   1.00 74.10  ? 527 GLU A CB    1 
ATOM   3891  C  CG    . GLU A 1 514 ? -65.450  -11.628 3.368   1.00 74.10  ? 527 GLU A CG    1 
ATOM   3892  C  CD    . GLU A 1 514 ? -65.979  -13.046 3.489   1.00 74.10  ? 527 GLU A CD    1 
ATOM   3893  O  OE1   . GLU A 1 514 ? -66.785  -13.305 4.407   1.00 74.10  ? 527 GLU A OE1   1 
ATOM   3894  O  OE2   . GLU A 1 514 ? -65.591  -13.901 2.666   1.00 74.10  ? 527 GLU A OE2   1 
ATOM   3895  N  N     . PRO A 1 515 ? -63.912  -8.726  5.994   1.00 54.43  ? 528 PRO A N     1 
ATOM   3896  C  CA    . PRO A 1 515 ? -62.567  -8.595  6.564   1.00 54.43  ? 528 PRO A CA    1 
ATOM   3897  C  C     . PRO A 1 515 ? -61.800  -9.911  6.503   1.00 54.43  ? 528 PRO A C     1 
ATOM   3898  O  O     . PRO A 1 515 ? -62.406  -10.978 6.603   1.00 54.43  ? 528 PRO A O     1 
ATOM   3899  C  CB    . PRO A 1 515 ? -62.844  -8.225  8.023   1.00 54.43  ? 528 PRO A CB    1 
ATOM   3900  C  CG    . PRO A 1 515 ? -64.188  -7.590  8.003   1.00 54.43  ? 528 PRO A CG    1 
ATOM   3901  C  CD    . PRO A 1 515 ? -64.957  -8.334  6.956   1.00 54.43  ? 528 PRO A CD    1 
ATOM   3902  N  N     . SER A 1 516 ? -60.482  -9.830  6.344   1.00 70.96  ? 529 SER A N     1 
ATOM   3903  C  CA    . SER A 1 516 ? -59.646  -11.025 6.252   1.00 70.96  ? 529 SER A CA    1 
ATOM   3904  C  C     . SER A 1 516 ? -58.512  -11.010 7.274   1.00 70.96  ? 529 SER A C     1 
ATOM   3905  O  O     . SER A 1 516 ? -58.215  -9.978  7.874   1.00 70.96  ? 529 SER A O     1 
ATOM   3906  C  CB    . SER A 1 516 ? -59.071  -11.170 4.842   1.00 70.96  ? 529 SER A CB    1 
ATOM   3907  O  OG    . SER A 1 516 ? -58.277  -12.337 4.733   1.00 70.96  ? 529 SER A OG    1 
ATOM   3908  N  N     . TRP A 1 517 ? -57.888  -12.168 7.462   1.00 51.42  ? 530 TRP A N     1 
ATOM   3909  C  CA    . TRP A 1 517 ? -56.742  -12.303 8.352   1.00 51.42  ? 530 TRP A CA    1 
ATOM   3910  C  C     . TRP A 1 517 ? -55.479  -11.883 7.616   1.00 51.42  ? 530 TRP A C     1 
ATOM   3911  O  O     . TRP A 1 517 ? -54.510  -11.432 8.223   1.00 51.42  ? 530 TRP A O     1 
ATOM   3912  C  CB    . TRP A 1 517 ? -56.607  -13.752 8.815   1.00 51.42  ? 530 TRP A CB    1 
ATOM   3913  C  CG    . TRP A 1 517 ? -56.390  -14.698 7.681   1.00 51.42  ? 530 TRP A CG    1 
ATOM   3914  C  CD1   . TRP A 1 517 ? -57.341  -15.216 6.854   1.00 51.42  ? 530 TRP A CD1   1 
ATOM   3915  C  CD2   . TRP A 1 517 ? -55.138  -15.232 7.238   1.00 51.42  ? 530 TRP A CD2   1 
ATOM   3916  N  NE1   . TRP A 1 517 ? -56.760  -16.043 5.925   1.00 51.42  ? 530 TRP A NE1   1 
ATOM   3917  C  CE2   . TRP A 1 517 ? -55.407  -16.071 6.140   1.00 51.42  ? 530 TRP A CE2   1 
ATOM   3918  C  CE3   . TRP A 1 517 ? -53.817  -15.085 7.666   1.00 51.42  ? 530 TRP A CE3   1 
ATOM   3919  C  CZ2   . TRP A 1 517 ? -54.402  -16.760 5.463   1.00 51.42  ? 530 TRP A CZ2   1 
ATOM   3920  C  CZ3   . TRP A 1 517 ? -52.821  -15.769 6.994   1.00 51.42  ? 530 TRP A CZ3   1 
ATOM   3921  C  CH2   . TRP A 1 517 ? -53.118  -16.595 5.905   1.00 51.42  ? 530 TRP A CH2   1 
ATOM   3922  N  N     . ALA A 1 518 ? -55.508  -12.029 6.295   1.00 36.64  ? 531 ALA A N     1 
ATOM   3923  C  CA    . ALA A 1 518 ? -54.361  -11.722 5.451   1.00 36.64  ? 531 ALA A CA    1 
ATOM   3924  C  C     . ALA A 1 518 ? -54.057  -10.227 5.408   1.00 36.64  ? 531 ALA A C     1 
ATOM   3925  O  O     . ALA A 1 518 ? -53.028  -9.813  4.876   1.00 36.64  ? 531 ALA A O     1 
ATOM   3926  C  CB    . ALA A 1 518 ? -54.586  -12.259 4.047   1.00 36.64  ? 531 ALA A CB    1 
ATOM   3927  N  N     . THR A 1 519 ? -54.957  -9.424  5.967   1.00 50.53  ? 532 THR A N     1 
ATOM   3928  C  CA    . THR A 1 519 ? -54.799  -7.973  5.986   1.00 50.53  ? 532 THR A CA    1 
ATOM   3929  C  C     . THR A 1 519 ? -53.629  -7.531  6.866   1.00 50.53  ? 532 THR A C     1 
ATOM   3930  O  O     . THR A 1 519 ? -52.783  -6.748  6.435   1.00 50.53  ? 532 THR A O     1 
ATOM   3931  C  CB    . THR A 1 519 ? -56.089  -7.277  6.460   1.00 50.53  ? 532 THR A CB    1 
ATOM   3932  O  OG1   . THR A 1 519 ? -57.156  -7.571  5.549   1.00 50.53  ? 532 THR A OG1   1 
ATOM   3933  C  CG2   . THR A 1 519 ? -55.892  -5.772  6.527   1.00 50.53  ? 532 THR A CG2   1 
ATOM   3934  N  N     . LYS A 1 520 ? -53.582  -8.035  8.096   1.00 46.86  ? 533 LYS A N     1 
ATOM   3935  C  CA    . LYS A 1 520 ? -52.535  -7.648  9.038   1.00 46.86  ? 533 LYS A CA    1 
ATOM   3936  C  C     . LYS A 1 520 ? -51.210  -8.346  8.738   1.00 46.86  ? 533 LYS A C     1 
ATOM   3937  O  O     . LYS A 1 520 ? -50.140  -7.791  8.984   1.00 46.86  ? 533 LYS A O     1 
ATOM   3938  C  CB    . LYS A 1 520 ? -52.969  -7.930  10.479  1.00 46.86  ? 533 LYS A CB    1 
ATOM   3939  C  CG    . LYS A 1 520 ? -52.081  -7.284  11.535  1.00 46.86  ? 533 LYS A CG    1 
ATOM   3940  C  CD    . LYS A 1 520 ? -52.512  -7.673  12.942  1.00 46.86  ? 533 LYS A CD    1 
ATOM   3941  C  CE    . LYS A 1 520 ? -52.422  -9.176  13.152  1.00 46.86  ? 533 LYS A CE    1 
ATOM   3942  N  NZ    . LYS A 1 520 ? -52.829  -9.579  14.529  1.00 46.86  ? 533 LYS A NZ    1 
ATOM   3943  N  N     . ILE A 1 521 ? -51.285  -9.562  8.206   1.00 33.50  ? 534 ILE A N     1 
ATOM   3944  C  CA    . ILE A 1 521 ? -50.087  -10.325 7.874   1.00 33.50  ? 534 ILE A CA    1 
ATOM   3945  C  C     . ILE A 1 521 ? -49.344  -9.674  6.706   1.00 33.50  ? 534 ILE A C     1 
ATOM   3946  O  O     . ILE A 1 521 ? -48.114  -9.652  6.678   1.00 33.50  ? 534 ILE A O     1 
ATOM   3947  C  CB    . ILE A 1 521 ? -50.423  -11.793 7.539   1.00 33.50  ? 534 ILE A CB    1 
ATOM   3948  C  CG1   . ILE A 1 521 ? -51.346  -12.388 8.604   1.00 33.50  ? 534 ILE A CG1   1 
ATOM   3949  C  CG2   . ILE A 1 521 ? -49.156  -12.621 7.413   1.00 33.50  ? 534 ILE A CG2   1 
ATOM   3950  C  CD1   . ILE A 1 521 ? -50.754  -12.382 9.998   1.00 33.50  ? 534 ILE A CD1   1 
ATOM   3951  N  N     . LEU A 1 522 ? -50.100  -9.140  5.751   1.00 30.53  ? 535 LEU A N     1 
ATOM   3952  C  CA    . LEU A 1 522 ? -49.519  -8.437  4.611   1.00 30.53  ? 535 LEU A CA    1 
ATOM   3953  C  C     . LEU A 1 522 ? -49.014  -7.048  4.996   1.00 30.53  ? 535 LEU A C     1 
ATOM   3954  O  O     . LEU A 1 522 ? -48.052  -6.550  4.413   1.00 30.53  ? 535 LEU A O     1 
ATOM   3955  C  CB    . LEU A 1 522 ? -50.526  -8.332  3.462   1.00 30.53  ? 535 LEU A CB    1 
ATOM   3956  C  CG    . LEU A 1 522 ? -50.589  -9.505  2.485   1.00 30.53  ? 535 LEU A CG    1 
ATOM   3957  C  CD1   . LEU A 1 522 ? -51.757  -9.363  1.525   1.00 30.53  ? 535 LEU A CD1   1 
ATOM   3958  C  CD2   . LEU A 1 522 ? -49.287  -9.609  1.716   1.00 30.53  ? 535 LEU A CD2   1 
ATOM   3959  N  N     . ASN A 1 523 ? -49.669  -6.424  5.971   1.00 23.15  ? 536 ASN A N     1 
ATOM   3960  C  CA    . ASN A 1 523 ? -49.229  -5.126  6.473   1.00 23.15  ? 536 ASN A CA    1 
ATOM   3961  C  C     . ASN A 1 523 ? -47.837  -5.216  7.090   1.00 23.15  ? 536 ASN A C     1 
ATOM   3962  O  O     . ASN A 1 523 ? -46.959  -4.409  6.789   1.00 23.15  ? 536 ASN A O     1 
ATOM   3963  C  CB    . ASN A 1 523 ? -50.221  -4.573  7.500   1.00 23.15  ? 536 ASN A CB    1 
ATOM   3964  C  CG    . ASN A 1 523 ? -51.488  -4.036  6.863   1.00 23.15  ? 536 ASN A CG    1 
ATOM   3965  O  OD1   . ASN A 1 523 ? -51.475  -3.567  5.726   1.00 23.15  ? 536 ASN A OD1   1 
ATOM   3966  N  ND2   . ASN A 1 523 ? -52.591  -4.098  7.598   1.00 23.15  ? 536 ASN A ND2   1 
ATOM   3967  N  N     . LEU A 1 524 ? -47.650  -6.207  7.956   1.00 28.67  ? 537 LEU A N     1 
ATOM   3968  C  CA    . LEU A 1 524 ? -46.361  -6.462  8.585   1.00 28.67  ? 537 LEU A CA    1 
ATOM   3969  C  C     . LEU A 1 524 ? -45.339  -6.926  7.552   1.00 28.67  ? 537 LEU A C     1 
ATOM   3970  O  O     . LEU A 1 524 ? -44.150  -6.630  7.661   1.00 28.67  ? 537 LEU A O     1 
ATOM   3971  C  CB    . LEU A 1 524 ? -46.513  -7.516  9.680   1.00 28.67  ? 537 LEU A CB    1 
ATOM   3972  C  CG    . LEU A 1 524 ? -47.436  -7.139  10.834  1.00 28.67  ? 537 LEU A CG    1 
ATOM   3973  C  CD1   . LEU A 1 524 ? -47.667  -8.322  11.758  1.00 28.67  ? 537 LEU A CD1   1 
ATOM   3974  C  CD2   . LEU A 1 524 ? -46.858  -5.970  11.603  1.00 28.67  ? 537 LEU A CD2   1 
ATOM   3975  N  N     . LEU A 1 525 ? -45.817  -7.652  6.547   1.00 6.62   ? 538 LEU A N     1 
ATOM   3976  C  CA    . LEU A 1 525 ? -44.966  -8.147  5.475   1.00 6.62   ? 538 LEU A CA    1 
ATOM   3977  C  C     . LEU A 1 525 ? -44.399  -6.979  4.677   1.00 6.62   ? 538 LEU A C     1 
ATOM   3978  O  O     . LEU A 1 525 ? -43.338  -7.089  4.063   1.00 6.62   ? 538 LEU A O     1 
ATOM   3979  C  CB    . LEU A 1 525 ? -45.768  -9.079  4.566   1.00 6.62   ? 538 LEU A CB    1 
ATOM   3980  C  CG    . LEU A 1 525 ? -45.068  -9.928  3.503   1.00 6.62   ? 538 LEU A CG    1 
ATOM   3981  C  CD1   . LEU A 1 525 ? -44.991  -9.195  2.176   1.00 6.62   ? 538 LEU A CD1   1 
ATOM   3982  C  CD2   . LEU A 1 525 ? -43.682  -10.346 3.969   1.00 6.62   ? 538 LEU A CD2   1 
ATOM   3983  N  N     . TRP A 1 526 ? -45.111  -5.857  4.698   1.00 30.54  ? 539 TRP A N     1 
ATOM   3984  C  CA    . TRP A 1 526 ? -44.692  -4.668  3.963   1.00 30.54  ? 539 TRP A CA    1 
ATOM   3985  C  C     . TRP A 1 526 ? -44.071  -3.603  4.860   1.00 30.54  ? 539 TRP A C     1 
ATOM   3986  O  O     . TRP A 1 526 ? -43.683  -2.537  4.388   1.00 30.54  ? 539 TRP A O     1 
ATOM   3987  C  CB    . TRP A 1 526 ? -45.868  -4.080  3.182   1.00 30.54  ? 539 TRP A CB    1 
ATOM   3988  C  CG    . TRP A 1 526 ? -46.121  -4.788  1.892   1.00 30.54  ? 539 TRP A CG    1 
ATOM   3989  C  CD1   . TRP A 1 526 ? -46.993  -5.812  1.673   1.00 30.54  ? 539 TRP A CD1   1 
ATOM   3990  C  CD2   . TRP A 1 526 ? -45.481  -4.528  0.638   1.00 30.54  ? 539 TRP A CD2   1 
ATOM   3991  N  NE1   . TRP A 1 526 ? -46.937  -6.204  0.357   1.00 30.54  ? 539 TRP A NE1   1 
ATOM   3992  C  CE2   . TRP A 1 526 ? -46.017  -5.431  -0.298  1.00 30.54  ? 539 TRP A CE2   1 
ATOM   3993  C  CE3   . TRP A 1 526 ? -44.509  -3.618  0.219   1.00 30.54  ? 539 TRP A CE3   1 
ATOM   3994  C  CZ2   . TRP A 1 526 ? -45.610  -5.448  -1.631  1.00 30.54  ? 539 TRP A CZ2   1 
ATOM   3995  C  CZ3   . TRP A 1 526 ? -44.108  -3.637  -1.101  1.00 30.54  ? 539 TRP A CZ3   1 
ATOM   3996  C  CH2   . TRP A 1 526 ? -44.657  -4.545  -2.011  1.00 30.54  ? 539 TRP A CH2   1 
ATOM   3997  N  N     . ALA A 1 527 ? -43.984  -3.897  6.153   1.00 15.62  ? 540 ALA A N     1 
ATOM   3998  C  CA    . ALA A 1 527 ? -43.357  -2.988  7.106   1.00 15.62  ? 540 ALA A CA    1 
ATOM   3999  C  C     . ALA A 1 527 ? -41.903  -2.753  6.727   1.00 15.62  ? 540 ALA A C     1 
ATOM   4000  O  O     . ALA A 1 527 ? -41.239  -3.659  6.226   1.00 15.62  ? 540 ALA A O     1 
ATOM   4001  C  CB    . ALA A 1 527 ? -43.454  -3.547  8.512   1.00 15.62  ? 540 ALA A CB    1 
ATOM   4002  N  N     . PRO A 1 528 ? -41.401  -1.531  6.956   1.00 19.32  ? 541 PRO A N     1 
ATOM   4003  C  CA    . PRO A 1 528 ? -39.992  -1.263  6.658   1.00 19.32  ? 541 PRO A CA    1 
ATOM   4004  C  C     . PRO A 1 528 ? -39.072  -2.087  7.551   1.00 19.32  ? 541 PRO A C     1 
ATOM   4005  O  O     . PRO A 1 528 ? -39.197  -2.030  8.775   1.00 19.32  ? 541 PRO A O     1 
ATOM   4006  C  CB    . PRO A 1 528 ? -39.844  0.229   6.969   1.00 19.32  ? 541 PRO A CB    1 
ATOM   4007  C  CG    . PRO A 1 528 ? -40.969  0.549   7.897   1.00 19.32  ? 541 PRO A CG    1 
ATOM   4008  C  CD    . PRO A 1 528 ? -42.096  -0.343  7.482   1.00 19.32  ? 541 PRO A CD    1 
ATOM   4009  N  N     . ILE A 1 529 ? -38.165  -2.844  6.939   1.00 8.51   ? 542 ILE A N     1 
ATOM   4010  C  CA    . ILE A 1 529 ? -37.223  -3.681  7.680   1.00 8.51   ? 542 ILE A CA    1 
ATOM   4011  C  C     . ILE A 1 529 ? -36.313  -2.816  8.550   1.00 8.51   ? 542 ILE A C     1 
ATOM   4012  O  O     . ILE A 1 529 ? -35.798  -3.269  9.572   1.00 8.51   ? 542 ILE A O     1 
ATOM   4013  C  CB    . ILE A 1 529 ? -36.380  -4.563  6.724   1.00 8.51   ? 542 ILE A CB    1 
ATOM   4014  C  CG1   . ILE A 1 529 ? -35.586  -5.615  7.496   1.00 8.51   ? 542 ILE A CG1   1 
ATOM   4015  C  CG2   . ILE A 1 529 ? -35.448  -3.712  5.876   1.00 8.51   ? 542 ILE A CG2   1 
ATOM   4016  C  CD1   . ILE A 1 529 ? -36.437  -6.705  8.091   1.00 8.51   ? 542 ILE A CD1   1 
ATOM   4017  N  N     . GLU A 1 530 ? -36.147  -1.560  8.150   1.00 47.85  ? 543 GLU A N     1 
ATOM   4018  C  CA    . GLU A 1 530 ? -35.299  -0.620  8.867   1.00 47.85  ? 543 GLU A CA    1 
ATOM   4019  C  C     . GLU A 1 530 ? -35.951  -0.198  10.182  1.00 47.85  ? 543 GLU A C     1 
ATOM   4020  O  O     . GLU A 1 530 ? -35.318  0.436   11.026  1.00 47.85  ? 543 GLU A O     1 
ATOM   4021  C  CB    . GLU A 1 530 ? -35.036  0.604   7.988   1.00 47.85  ? 543 GLU A CB    1 
ATOM   4022  C  CG    . GLU A 1 530 ? -33.753  1.357   8.298   1.00 47.85  ? 543 GLU A CG    1 
ATOM   4023  C  CD    . GLU A 1 530 ? -33.450  2.430   7.267   1.00 47.85  ? 543 GLU A CD    1 
ATOM   4024  O  OE1   . GLU A 1 530 ? -34.362  3.215   6.933   1.00 47.85  ? 543 GLU A OE1   1 
ATOM   4025  O  OE2   . GLU A 1 530 ? -32.300  2.480   6.782   1.00 47.85  ? 543 GLU A OE2   1 
ATOM   4026  N  N     . TRP A 1 531 ? -37.219  -0.562  10.346  1.00 16.32  ? 544 TRP A N     1 
ATOM   4027  C  CA    . TRP A 1 531 ? -37.983  -0.220  11.540  1.00 16.32  ? 544 TRP A CA    1 
ATOM   4028  C  C     . TRP A 1 531 ? -38.074  -1.390  12.516  1.00 16.32  ? 544 TRP A C     1 
ATOM   4029  O  O     . TRP A 1 531 ? -38.041  -1.198  13.730  1.00 16.32  ? 544 TRP A O     1 
ATOM   4030  C  CB    . TRP A 1 531 ? -39.388  0.247   11.145  1.00 16.32  ? 544 TRP A CB    1 
ATOM   4031  C  CG    . TRP A 1 531 ? -40.363  0.293   12.284  1.00 16.32  ? 544 TRP A CG    1 
ATOM   4032  C  CD1   . TRP A 1 531 ? -40.444  1.246   13.257  1.00 16.32  ? 544 TRP A CD1   1 
ATOM   4033  C  CD2   . TRP A 1 531 ? -41.404  -0.652  12.560  1.00 16.32  ? 544 TRP A CD2   1 
ATOM   4034  N  NE1   . TRP A 1 531 ? -41.466  0.946   14.127  1.00 16.32  ? 544 TRP A NE1   1 
ATOM   4035  C  CE2   . TRP A 1 531 ? -42.071  -0.214  13.719  1.00 16.32  ? 544 TRP A CE2   1 
ATOM   4036  C  CE3   . TRP A 1 531 ? -41.832  -1.828  11.939  1.00 16.32  ? 544 TRP A CE3   1 
ATOM   4037  C  CZ2   . TRP A 1 531 ? -43.146  -0.913  14.269  1.00 16.32  ? 544 TRP A CZ2   1 
ATOM   4038  C  CZ3   . TRP A 1 531 ? -42.895  -2.519  12.486  1.00 16.32  ? 544 TRP A CZ3   1 
ATOM   4039  C  CH2   . TRP A 1 531 ? -43.541  -2.061  13.638  1.00 16.32  ? 544 TRP A CH2   1 
ATOM   4040  N  N     . VAL A 1 532 ? -38.181  -2.602  11.978  1.00 25.08  ? 545 VAL A N     1 
ATOM   4041  C  CA    . VAL A 1 532 ? -38.399  -3.785  12.802  1.00 25.08  ? 545 VAL A CA    1 
ATOM   4042  C  C     . VAL A 1 532 ? -37.163  -4.184  13.609  1.00 25.08  ? 545 VAL A C     1 
ATOM   4043  O  O     . VAL A 1 532 ? -37.282  -4.749  14.695  1.00 25.08  ? 545 VAL A O     1 
ATOM   4044  C  CB    . VAL A 1 532 ? -38.906  -4.991  11.968  1.00 25.08  ? 545 VAL A CB    1 
ATOM   4045  C  CG1   . VAL A 1 532 ? -39.876  -4.528  10.896  1.00 25.08  ? 545 VAL A CG1   1 
ATOM   4046  C  CG2   . VAL A 1 532 ? -37.755  -5.741  11.331  1.00 25.08  ? 545 VAL A CG2   1 
ATOM   4047  N  N     . VAL A 1 533 ? -35.980  -3.882  13.080  1.00 0.94   ? 546 VAL A N     1 
ATOM   4048  C  CA    . VAL A 1 533 ? -34.732  -4.222  13.753  1.00 0.94   ? 546 VAL A CA    1 
ATOM   4049  C  C     . VAL A 1 533 ? -34.184  -3.011  14.493  1.00 0.94   ? 546 VAL A C     1 
ATOM   4050  O  O     . VAL A 1 533 ? -33.068  -3.034  15.013  1.00 0.94   ? 546 VAL A O     1 
ATOM   4051  C  CB    . VAL A 1 533 ? -33.672  -4.731  12.761  1.00 0.94   ? 546 VAL A CB    1 
ATOM   4052  C  CG1   . VAL A 1 533 ? -34.118  -6.032  12.126  1.00 0.94   ? 546 VAL A CG1   1 
ATOM   4053  C  CG2   . VAL A 1 533 ? -33.401  -3.686  11.695  1.00 0.94   ? 546 VAL A CG2   1 
ATOM   4054  N  N     . SER A 1 534 ? -34.986  -1.952  14.531  1.00 27.32  ? 547 SER A N     1 
ATOM   4055  C  CA    . SER A 1 534 ? -34.607  -0.712  15.196  1.00 27.32  ? 547 SER A CA    1 
ATOM   4056  C  C     . SER A 1 534 ? -34.999  -0.715  16.669  1.00 27.32  ? 547 SER A C     1 
ATOM   4057  O  O     . SER A 1 534 ? -35.649  -1.642  17.148  1.00 27.32  ? 547 SER A O     1 
ATOM   4058  C  CB    . SER A 1 534 ? -35.265  0.474   14.499  1.00 27.32  ? 547 SER A CB    1 
ATOM   4059  O  OG    . SER A 1 534 ? -35.213  1.631   15.310  1.00 27.32  ? 547 SER A OG    1 
ATOM   4060  N  N     . LEU A 1 535 ? -34.594  0.328   17.383  1.00 16.48  ? 548 LEU A N     1 
ATOM   4061  C  CA    . LEU A 1 535 ? -35.004  0.507   18.769  1.00 16.48  ? 548 LEU A CA    1 
ATOM   4062  C  C     . LEU A 1 535 ? -36.005  1.647   18.838  1.00 16.48  ? 548 LEU A C     1 
ATOM   4063  O  O     . LEU A 1 535 ? -36.261  2.207   19.905  1.00 16.48  ? 548 LEU A O     1 
ATOM   4064  C  CB    . LEU A 1 535 ? -33.804  0.785   19.679  1.00 16.48  ? 548 LEU A CB    1 
ATOM   4065  C  CG    . LEU A 1 535 ? -33.010  -0.434  20.155  1.00 16.48  ? 548 LEU A CG    1 
ATOM   4066  C  CD1   . LEU A 1 535 ? -32.275  -1.069  19.000  1.00 16.48  ? 548 LEU A CD1   1 
ATOM   4067  C  CD2   . LEU A 1 535 ? -32.036  -0.069  21.261  1.00 16.48  ? 548 LEU A CD2   1 
ATOM   4068  N  N     . PHE A 1 536 ? -36.558  1.986   17.678  1.00 24.92  ? 549 PHE A N     1 
ATOM   4069  C  CA    . PHE A 1 536 ? -37.593  3.002   17.571  1.00 24.92  ? 549 PHE A CA    1 
ATOM   4070  C  C     . PHE A 1 536 ? -38.790  2.581   18.412  1.00 24.92  ? 549 PHE A C     1 
ATOM   4071  O  O     . PHE A 1 536 ? -39.325  1.486   18.241  1.00 24.92  ? 549 PHE A O     1 
ATOM   4072  C  CB    . PHE A 1 536 ? -37.996  3.179   16.108  1.00 24.92  ? 549 PHE A CB    1 
ATOM   4073  C  CG    . PHE A 1 536 ? -38.856  4.383   15.854  1.00 24.92  ? 549 PHE A CG    1 
ATOM   4074  C  CD1   . PHE A 1 536 ? -38.336  5.662   15.982  1.00 24.92  ? 549 PHE A CD1   1 
ATOM   4075  C  CD2   . PHE A 1 536 ? -40.178  4.235   15.467  1.00 24.92  ? 549 PHE A CD2   1 
ATOM   4076  C  CE1   . PHE A 1 536 ? -39.123  6.771   15.743  1.00 24.92  ? 549 PHE A CE1   1 
ATOM   4077  C  CE2   . PHE A 1 536 ? -40.971  5.340   15.225  1.00 24.92  ? 549 PHE A CE2   1 
ATOM   4078  C  CZ    . PHE A 1 536 ? -40.442  6.609   15.364  1.00 24.92  ? 549 PHE A CZ    1 
ATOM   4079  N  N     . LYS A 1 537 ? -39.193  3.451   19.330  1.00 29.30  ? 550 LYS A N     1 
ATOM   4080  C  CA    . LYS A 1 537 ? -40.253  3.137   20.276  1.00 29.30  ? 550 LYS A CA    1 
ATOM   4081  C  C     . LYS A 1 537 ? -41.640  3.457   19.727  1.00 29.30  ? 550 LYS A C     1 
ATOM   4082  O  O     . LYS A 1 537 ? -42.635  3.347   20.443  1.00 29.30  ? 550 LYS A O     1 
ATOM   4083  C  CB    . LYS A 1 537 ? -40.032  3.897   21.583  1.00 29.30  ? 550 LYS A CB    1 
ATOM   4084  C  CG    . LYS A 1 537 ? -38.811  3.459   22.376  1.00 29.30  ? 550 LYS A CG    1 
ATOM   4085  C  CD    . LYS A 1 537 ? -38.398  4.532   23.375  1.00 29.30  ? 550 LYS A CD    1 
ATOM   4086  C  CE    . LYS A 1 537 ? -37.712  3.933   24.593  1.00 29.30  ? 550 LYS A CE    1 
ATOM   4087  N  NZ    . LYS A 1 537 ? -36.529  3.105   24.239  1.00 29.30  ? 550 LYS A NZ    1 
ATOM   4088  N  N     . GLY A 1 538 ? -41.708  3.849   18.459  1.00 21.73  ? 551 GLY A N     1 
ATOM   4089  C  CA    . GLY A 1 538 ? -42.973  4.241   17.869  1.00 21.73  ? 551 GLY A CA    1 
ATOM   4090  C  C     . GLY A 1 538 ? -43.460  3.305   16.783  1.00 21.73  ? 551 GLY A C     1 
ATOM   4091  O  O     . GLY A 1 538 ? -42.711  2.445   16.317  1.00 21.73  ? 551 GLY A O     1 
ATOM   4092  N  N     . PRO A 1 539 ? -44.726  3.474   16.369  1.00 33.65  ? 552 PRO A N     1 
ATOM   4093  C  CA    . PRO A 1 539 ? -45.349  2.672   15.313  1.00 33.65  ? 552 PRO A CA    1 
ATOM   4094  C  C     . PRO A 1 539 ? -44.734  2.994   13.962  1.00 33.65  ? 552 PRO A C     1 
ATOM   4095  O  O     . PRO A 1 539 ? -43.890  3.884   13.873  1.00 33.65  ? 552 PRO A O     1 
ATOM   4096  C  CB    . PRO A 1 539 ? -46.804  3.135   15.342  1.00 33.65  ? 552 PRO A CB    1 
ATOM   4097  C  CG    . PRO A 1 539 ? -46.741  4.526   15.867  1.00 33.65  ? 552 PRO A CG    1 
ATOM   4098  C  CD    . PRO A 1 539 ? -45.639  4.511   16.882  1.00 33.65  ? 552 PRO A CD    1 
ATOM   4099  N  N     . ALA A 1 540 ? -45.162  2.289   12.922  1.00 26.28  ? 553 ALA A N     1 
ATOM   4100  C  CA    . ALA A 1 540 ? -44.583  2.472   11.597  1.00 26.28  ? 553 ALA A CA    1 
ATOM   4101  C  C     . ALA A 1 540 ? -44.814  3.871   11.018  1.00 26.28  ? 553 ALA A C     1 
ATOM   4102  O  O     . ALA A 1 540 ? -45.548  4.048   10.045  1.00 26.28  ? 553 ALA A O     1 
ATOM   4103  C  CB    . ALA A 1 540 ? -45.079  1.405   10.649  1.00 26.28  ? 553 ALA A CB    1 
ATOM   4104  N  N     . GLN A 1 541 ? -44.188  4.855   11.652  1.00 64.16  ? 554 GLN A N     1 
ATOM   4105  C  CA    . GLN A 1 541 ? -44.037  6.191   11.101  1.00 64.16  ? 554 GLN A CA    1 
ATOM   4106  C  C     . GLN A 1 541 ? -42.550  6.473   11.241  1.00 64.16  ? 554 GLN A C     1 
ATOM   4107  O  O     . GLN A 1 541 ? -42.124  7.595   11.524  1.00 64.16  ? 554 GLN A O     1 
ATOM   4108  C  CB    . GLN A 1 541 ? -44.882  7.200   11.877  1.00 64.16  ? 554 GLN A CB    1 
ATOM   4109  C  CG    . GLN A 1 541 ? -44.649  7.195   13.376  1.00 64.16  ? 554 GLN A CG    1 
ATOM   4110  C  CD    . GLN A 1 541 ? -45.908  7.511   14.155  1.00 64.16  ? 554 GLN A CD    1 
ATOM   4111  O  OE1   . GLN A 1 541 ? -47.014  7.188   13.722  1.00 64.16  ? 554 GLN A OE1   1 
ATOM   4112  N  NE2   . GLN A 1 541 ? -45.748  8.146   15.310  1.00 64.16  ? 554 GLN A NE2   1 
ATOM   4113  N  N     . ASP A 1 542 ? -41.783  5.404   11.037  1.00 38.01  ? 555 ASP A N     1 
ATOM   4114  C  CA    . ASP A 1 542 ? -40.341  5.361   11.241  1.00 38.01  ? 555 ASP A CA    1 
ATOM   4115  C  C     . ASP A 1 542 ? -39.611  6.541   10.622  1.00 38.01  ? 555 ASP A C     1 
ATOM   4116  O  O     . ASP A 1 542 ? -38.865  7.246   11.304  1.00 38.01  ? 555 ASP A O     1 
ATOM   4117  C  CB    . ASP A 1 542 ? -39.783  4.059   10.660  1.00 38.01  ? 555 ASP A CB    1 
ATOM   4118  C  CG    . ASP A 1 542 ? -38.303  3.880   10.933  1.00 38.01  ? 555 ASP A CG    1 
ATOM   4119  O  OD1   . ASP A 1 542 ? -37.887  4.073   12.092  1.00 38.01  ? 555 ASP A OD1   1 
ATOM   4120  O  OD2   . ASP A 1 542 ? -37.560  3.549   9.988   1.00 38.01  ? 555 ASP A OD2   1 
ATOM   4121  N  N     . PHE A 1 543 ? -39.837  6.745   9.329   1.00 98.00  ? 556 PHE A N     1 
ATOM   4122  C  CA    . PHE A 1 543 ? -39.116  7.753   8.563   1.00 98.00  ? 556 PHE A CA    1 
ATOM   4123  C  C     . PHE A 1 543 ? -37.603  7.528   8.622   1.00 98.00  ? 556 PHE A C     1 
ATOM   4124  O  O     . PHE A 1 543 ? -37.149  6.395   8.783   1.00 98.00  ? 556 PHE A O     1 
ATOM   4125  C  CB    . PHE A 1 543 ? -39.515  9.165   8.997   1.00 98.00  ? 556 PHE A CB    1 
ATOM   4126  C  CG    . PHE A 1 543 ? -40.936  9.521   8.648   1.00 98.00  ? 556 PHE A CG    1 
ATOM   4127  C  CD1   . PHE A 1 543 ? -41.480  9.133   7.432   1.00 98.00  ? 556 PHE A CD1   1 
ATOM   4128  C  CD2   . PHE A 1 543 ? -41.730  10.228  9.536   1.00 98.00  ? 556 PHE A CD2   1 
ATOM   4129  C  CE1   . PHE A 1 543 ? -42.786  9.451   7.105   1.00 98.00  ? 556 PHE A CE1   1 
ATOM   4130  C  CE2   . PHE A 1 543 ? -43.037  10.549  9.215   1.00 98.00  ? 556 PHE A CE2   1 
ATOM   4131  C  CZ    . PHE A 1 543 ? -43.564  10.160  7.998   1.00 98.00  ? 556 PHE A CZ    1 
ATOM   4132  N  N     . LYS A 1 544 ? -36.821  8.593   8.490   1.00 76.85  ? 557 LYS A N     1 
ATOM   4133  C  CA    . LYS A 1 544 ? -35.387  8.428   8.295   1.00 76.85  ? 557 LYS A CA    1 
ATOM   4134  C  C     . LYS A 1 544 ? -34.599  9.642   8.770   1.00 76.85  ? 557 LYS A C     1 
ATOM   4135  O  O     . LYS A 1 544 ? -34.445  10.617  8.038   1.00 76.85  ? 557 LYS A O     1 
ATOM   4136  C  CB    . LYS A 1 544 ? -35.113  8.161   6.814   1.00 66.85  ? 557 LYS A CB    1 
ATOM   4137  C  CG    . LYS A 1 544 ? -33.690  7.769   6.464   1.00 66.85  ? 557 LYS A CG    1 
ATOM   4138  C  CD    . LYS A 1 544 ? -33.619  7.366   4.996   1.00 66.85  ? 557 LYS A CD    1 
ATOM   4139  C  CE    . LYS A 1 544 ? -32.187  7.238   4.504   1.00 66.85  ? 557 LYS A CE    1 
ATOM   4140  N  NZ    . LYS A 1 544 ? -31.433  6.168   5.207   1.00 66.85  ? 557 LYS A NZ    1 
ATOM   4141  N  N     . ILE B 2 7   ? -59.688  -33.686 7.090   1.00 57.64  ? 19  ILE B N     1 
ATOM   4142  C  CA    . ILE B 2 7   ? -58.416  -33.270 7.668   1.00 57.64  ? 19  ILE B CA    1 
ATOM   4143  C  C     . ILE B 2 7   ? -58.644  -32.464 8.944   1.00 57.64  ? 19  ILE B C     1 
ATOM   4144  O  O     . ILE B 2 7   ? -58.680  -31.234 8.916   1.00 57.64  ? 19  ILE B O     1 
ATOM   4145  C  CB    . ILE B 2 7   ? -57.589  -32.432 6.673   1.00 57.64  ? 19  ILE B CB    1 
ATOM   4146  C  CG1   . ILE B 2 7   ? -57.563  -33.105 5.298   1.00 57.64  ? 19  ILE B CG1   1 
ATOM   4147  C  CG2   . ILE B 2 7   ? -56.176  -32.221 7.195   1.00 57.64  ? 19  ILE B CG2   1 
ATOM   4148  C  CD1   . ILE B 2 7   ? -56.857  -34.445 5.281   1.00 57.64  ? 19  ILE B CD1   1 
ATOM   4149  N  N     . CYS B 2 8   ? -58.808  -33.168 10.060  1.00 87.59  ? 20  CYS B N     1 
ATOM   4150  C  CA    . CYS B 2 8   ? -58.987  -32.520 11.354  1.00 87.59  ? 20  CYS B CA    1 
ATOM   4151  C  C     . CYS B 2 8   ? -57.661  -32.488 12.110  1.00 87.59  ? 20  CYS B C     1 
ATOM   4152  O  O     . CYS B 2 8   ? -57.134  -33.528 12.506  1.00 87.59  ? 20  CYS B O     1 
ATOM   4153  C  CB    . CYS B 2 8   ? -60.057  -33.242 12.171  1.00 87.59  ? 20  CYS B CB    1 
ATOM   4154  S  SG    . CYS B 2 8   ? -61.662  -33.357 11.346  1.00 87.59  ? 20  CYS B SG    1 
ATOM   4155  N  N     . GLN B 2 9   ? -57.131  -31.285 12.309  1.00 82.99  ? 21  GLN B N     1 
ATOM   4156  C  CA    . GLN B 2 9   ? -55.786  -31.114 12.846  1.00 82.99  ? 21  GLN B CA    1 
ATOM   4157  C  C     . GLN B 2 9   ? -55.797  -30.835 14.346  1.00 82.99  ? 21  GLN B C     1 
ATOM   4158  O  O     . GLN B 2 9   ? -56.544  -29.979 14.822  1.00 82.99  ? 21  GLN B O     1 
ATOM   4159  C  CB    . GLN B 2 9   ? -55.077  -29.986 12.096  1.00 82.99  ? 21  GLN B CB    1 
ATOM   4160  C  CG    . GLN B 2 9   ? -55.436  -29.935 10.615  1.00 82.99  ? 21  GLN B CG    1 
ATOM   4161  C  CD    . GLN B 2 9   ? -54.685  -28.860 9.859   1.00 82.99  ? 21  GLN B CD    1 
ATOM   4162  O  OE1   . GLN B 2 9   ? -53.595  -28.451 10.256  1.00 82.99  ? 21  GLN B OE1   1 
ATOM   4163  N  NE2   . GLN B 2 9   ? -55.265  -28.398 8.757   1.00 82.99  ? 21  GLN B NE2   1 
ATOM   4164  N  N     . PHE B 2 10  ? -54.964  -31.561 15.087  1.00 49.93  ? 22  PHE B N     1 
ATOM   4165  C  CA    . PHE B 2 10  ? -54.920  -31.428 16.540  1.00 49.93  ? 22  PHE B CA    1 
ATOM   4166  C  C     . PHE B 2 10  ? -53.491  -31.327 17.065  1.00 49.93  ? 22  PHE B C     1 
ATOM   4167  O  O     . PHE B 2 10  ? -52.550  -31.800 16.428  1.00 49.93  ? 22  PHE B O     1 
ATOM   4168  C  CB    . PHE B 2 10  ? -55.646  -32.600 17.204  1.00 49.93  ? 22  PHE B CB    1 
ATOM   4169  C  CG    . PHE B 2 10  ? -57.084  -32.729 16.795  1.00 49.93  ? 22  PHE B CG    1 
ATOM   4170  C  CD1   . PHE B 2 10  ? -58.071  -32.009 17.449  1.00 49.93  ? 22  PHE B CD1   1 
ATOM   4171  C  CD2   . PHE B 2 10  ? -57.449  -33.565 15.753  1.00 49.93  ? 22  PHE B CD2   1 
ATOM   4172  C  CE1   . PHE B 2 10  ? -59.397  -32.123 17.073  1.00 49.93  ? 22  PHE B CE1   1 
ATOM   4173  C  CE2   . PHE B 2 10  ? -58.771  -33.684 15.372  1.00 49.93  ? 22  PHE B CE2   1 
ATOM   4174  C  CZ    . PHE B 2 10  ? -59.746  -32.961 16.033  1.00 49.93  ? 22  PHE B CZ    1 
ATOM   4175  N  N     . LYS B 2 11  ? -53.341  -30.712 18.234  1.00 43.37  ? 23  LYS B N     1 
ATOM   4176  C  CA    . LYS B 2 11  ? -52.030  -30.482 18.829  1.00 43.37  ? 23  LYS B CA    1 
ATOM   4177  C  C     . LYS B 2 11  ? -51.794  -31.410 20.017  1.00 43.37  ? 23  LYS B C     1 
ATOM   4178  O  O     . LYS B 2 11  ? -52.579  -31.426 20.965  1.00 43.37  ? 23  LYS B O     1 
ATOM   4179  C  CB    . LYS B 2 11  ? -51.912  -29.023 19.270  1.00 43.37  ? 23  LYS B CB    1 
ATOM   4180  C  CG    . LYS B 2 11  ? -50.599  -28.655 19.934  1.00 43.37  ? 23  LYS B CG    1 
ATOM   4181  C  CD    . LYS B 2 11  ? -50.610  -27.192 20.351  1.00 43.37  ? 23  LYS B CD    1 
ATOM   4182  C  CE    . LYS B 2 11  ? -49.358  -26.818 21.120  1.00 43.37  ? 23  LYS B CE    1 
ATOM   4183  N  NZ    . LYS B 2 11  ? -49.443  -25.439 21.677  1.00 43.37  ? 23  LYS B NZ    1 
ATOM   4184  N  N     . LEU B 2 12  ? -50.709  -32.179 19.963  1.00 60.88  ? 24  LEU B N     1 
ATOM   4185  C  CA    . LEU B 2 12  ? -50.395  -33.140 21.017  1.00 60.88  ? 24  LEU B CA    1 
ATOM   4186  C  C     . LEU B 2 12  ? -49.049  -32.827 21.670  1.00 60.88  ? 24  LEU B C     1 
ATOM   4187  O  O     . LEU B 2 12  ? -48.137  -32.318 21.017  1.00 60.88  ? 24  LEU B O     1 
ATOM   4188  C  CB    . LEU B 2 12  ? -50.412  -34.566 20.457  1.00 60.88  ? 24  LEU B CB    1 
ATOM   4189  C  CG    . LEU B 2 12  ? -50.285  -35.746 21.424  1.00 60.88  ? 24  LEU B CG    1 
ATOM   4190  C  CD1   . LEU B 2 12  ? -51.170  -36.900 20.983  1.00 60.88  ? 24  LEU B CD1   1 
ATOM   4191  C  CD2   . LEU B 2 12  ? -48.846  -36.208 21.515  1.00 60.88  ? 24  LEU B CD2   1 
ATOM   4192  N  N     . VAL B 2 13  ? -48.933  -33.135 22.959  1.00 40.98  ? 25  VAL B N     1 
ATOM   4193  C  CA    . VAL B 2 13  ? -47.719  -32.844 23.715  1.00 40.98  ? 25  VAL B CA    1 
ATOM   4194  C  C     . VAL B 2 13  ? -47.356  -33.972 24.682  1.00 40.98  ? 25  VAL B C     1 
ATOM   4195  O  O     . VAL B 2 13  ? -48.172  -34.378 25.508  1.00 40.98  ? 25  VAL B O     1 
ATOM   4196  C  CB    . VAL B 2 13  ? -47.853  -31.517 24.494  1.00 40.98  ? 25  VAL B CB    1 
ATOM   4197  C  CG1   . VAL B 2 13  ? -49.229  -31.408 25.123  1.00 40.98  ? 25  VAL B CG1   1 
ATOM   4198  C  CG2   . VAL B 2 13  ? -46.764  -31.397 25.546  1.00 40.98  ? 25  VAL B CG2   1 
ATOM   4199  N  N     . LEU B 2 14  ? -46.131  -34.479 24.569  1.00 50.44  ? 26  LEU B N     1 
ATOM   4200  C  CA    . LEU B 2 14  ? -45.643  -35.503 25.489  1.00 50.44  ? 26  LEU B CA    1 
ATOM   4201  C  C     . LEU B 2 14  ? -44.909  -34.878 26.674  1.00 50.44  ? 26  LEU B C     1 
ATOM   4202  O  O     . LEU B 2 14  ? -43.919  -34.167 26.499  1.00 50.44  ? 26  LEU B O     1 
ATOM   4203  C  CB    . LEU B 2 14  ? -44.731  -36.506 24.774  1.00 50.44  ? 26  LEU B CB    1 
ATOM   4204  C  CG    . LEU B 2 14  ? -45.368  -37.459 23.762  1.00 50.44  ? 26  LEU B CG    1 
ATOM   4205  C  CD1   . LEU B 2 14  ? -45.370  -36.854 22.369  1.00 50.44  ? 26  LEU B CD1   1 
ATOM   4206  C  CD2   . LEU B 2 14  ? -44.662  -38.806 23.758  1.00 50.44  ? 26  LEU B CD2   1 
ATOM   4207  N  N     . LEU B 2 15  ? -45.403  -35.146 27.878  1.00 33.49  ? 27  LEU B N     1 
ATOM   4208  C  CA    . LEU B 2 15  ? -44.783  -34.640 29.095  1.00 33.49  ? 27  LEU B CA    1 
ATOM   4209  C  C     . LEU B 2 15  ? -44.231  -35.794 29.923  1.00 33.49  ? 27  LEU B C     1 
ATOM   4210  O  O     . LEU B 2 15  ? -44.485  -36.960 29.619  1.00 33.49  ? 27  LEU B O     1 
ATOM   4211  C  CB    . LEU B 2 15  ? -45.794  -33.840 29.913  1.00 33.49  ? 27  LEU B CB    1 
ATOM   4212  C  CG    . LEU B 2 15  ? -46.311  -32.551 29.278  1.00 33.49  ? 27  LEU B CG    1 
ATOM   4213  C  CD1   . LEU B 2 15  ? -47.535  -32.043 30.016  1.00 33.49  ? 27  LEU B CD1   1 
ATOM   4214  C  CD2   . LEU B 2 15  ? -45.225  -31.490 29.263  1.00 33.49  ? 27  LEU B CD2   1 
ATOM   4215  N  N     . GLY B 2 16  ? -43.470  -35.466 30.964  1.00 61.14  ? 28  GLY B N     1 
ATOM   4216  C  CA    . GLY B 2 16  ? -42.900  -36.474 31.840  1.00 61.14  ? 28  GLY B CA    1 
ATOM   4217  C  C     . GLY B 2 16  ? -41.444  -36.212 32.172  1.00 61.14  ? 28  GLY B C     1 
ATOM   4218  O  O     . GLY B 2 16  ? -40.796  -35.381 31.537  1.00 61.14  ? 28  GLY B O     1 
ATOM   4219  N  N     . GLU B 2 17  ? -40.932  -36.927 33.171  1.00 55.22  ? 29  GLU B N     1 
ATOM   4220  C  CA    . GLU B 2 17  ? -39.537  -36.812 33.586  1.00 55.22  ? 29  GLU B CA    1 
ATOM   4221  C  C     . GLU B 2 17  ? -38.614  -37.281 32.464  1.00 55.22  ? 29  GLU B C     1 
ATOM   4222  O  O     . GLU B 2 17  ? -39.048  -37.977 31.550  1.00 55.22  ? 29  GLU B O     1 
ATOM   4223  C  CB    . GLU B 2 17  ? -39.304  -37.643 34.852  1.00 55.22  ? 29  GLU B CB    1 
ATOM   4224  C  CG    . GLU B 2 17  ? -37.974  -37.402 35.556  1.00 55.22  ? 29  GLU B CG    1 
ATOM   4225  C  CD    . GLU B 2 17  ? -37.841  -35.991 36.091  1.00 55.22  ? 29  GLU B CD    1 
ATOM   4226  O  OE1   . GLU B 2 17  ? -36.781  -35.370 35.870  1.00 55.22  ? 29  GLU B OE1   1 
ATOM   4227  O  OE2   . GLU B 2 17  ? -38.793  -35.506 36.738  1.00 55.22  ? 29  GLU B OE2   1 
ATOM   4228  N  N     . SER B 2 18  ? -37.345  -36.890 32.526  1.00 65.57  ? 30  SER B N     1 
ATOM   4229  C  CA    . SER B 2 18  ? -36.375  -37.292 31.514  1.00 65.57  ? 30  SER B CA    1 
ATOM   4230  C  C     . SER B 2 18  ? -36.072  -38.786 31.604  1.00 65.57  ? 30  SER B C     1 
ATOM   4231  O  O     . SER B 2 18  ? -36.268  -39.402 32.651  1.00 65.57  ? 30  SER B O     1 
ATOM   4232  C  CB    . SER B 2 18  ? -35.087  -36.478 31.655  1.00 65.57  ? 30  SER B CB    1 
ATOM   4233  O  OG    . SER B 2 18  ? -34.201  -36.726 30.579  1.00 65.57  ? 30  SER B OG    1 
ATOM   4234  N  N     . ALA B 2 19  ? -35.603  -39.354 30.495  1.00 82.27  ? 31  ALA B N     1 
ATOM   4235  C  CA    . ALA B 2 19  ? -35.243  -40.770 30.410  1.00 82.27  ? 31  ALA B CA    1 
ATOM   4236  C  C     . ALA B 2 19  ? -36.390  -41.724 30.745  1.00 82.27  ? 31  ALA B C     1 
ATOM   4237  O  O     . ALA B 2 19  ? -36.183  -42.742 31.406  1.00 82.27  ? 31  ALA B O     1 
ATOM   4238  C  CB    . ALA B 2 19  ? -34.021  -41.071 31.274  1.00 82.27  ? 31  ALA B CB    1 
ATOM   4239  N  N     . VAL B 2 20  ? -37.594  -41.395 30.286  1.00 36.53  ? 32  VAL B N     1 
ATOM   4240  C  CA    . VAL B 2 20  ? -38.733  -42.297 30.426  1.00 36.53  ? 32  VAL B CA    1 
ATOM   4241  C  C     . VAL B 2 20  ? -39.077  -42.955 29.089  1.00 36.53  ? 32  VAL B C     1 
ATOM   4242  O  O     . VAL B 2 20  ? -39.520  -44.103 29.052  1.00 36.53  ? 32  VAL B O     1 
ATOM   4243  C  CB    . VAL B 2 20  ? -39.980  -41.592 31.013  1.00 36.53  ? 32  VAL B CB    1 
ATOM   4244  C  CG1   . VAL B 2 20  ? -39.707  -41.120 32.428  1.00 36.53  ? 32  VAL B CG1   1 
ATOM   4245  C  CG2   . VAL B 2 20  ? -40.409  -40.431 30.134  1.00 36.53  ? 32  VAL B CG2   1 
ATOM   4246  N  N     . GLY B 2 21  ? -38.867  -42.226 27.995  1.00 88.56  ? 33  GLY B N     1 
ATOM   4247  C  CA    . GLY B 2 21  ? -39.078  -42.776 26.669  1.00 88.56  ? 33  GLY B CA    1 
ATOM   4248  C  C     . GLY B 2 21  ? -39.937  -41.940 25.738  1.00 88.56  ? 33  GLY B C     1 
ATOM   4249  O  O     . GLY B 2 21  ? -40.377  -42.429 24.698  1.00 88.56  ? 33  GLY B O     1 
ATOM   4250  N  N     . LYS B 2 22  ? -40.169  -40.682 26.104  1.00 56.43  ? 34  LYS B N     1 
ATOM   4251  C  CA    . LYS B 2 22  ? -41.012  -39.785 25.315  1.00 56.43  ? 34  LYS B CA    1 
ATOM   4252  C  C     . LYS B 2 22  ? -40.535  -39.646 23.870  1.00 56.43  ? 34  LYS B C     1 
ATOM   4253  O  O     . LYS B 2 22  ? -41.312  -39.819 22.931  1.00 56.43  ? 34  LYS B O     1 
ATOM   4254  C  CB    . LYS B 2 22  ? -41.075  -38.402 25.967  1.00 56.43  ? 34  LYS B CB    1 
ATOM   4255  C  CG    . LYS B 2 22  ? -41.701  -38.383 27.350  1.00 56.43  ? 34  LYS B CG    1 
ATOM   4256  C  CD    . LYS B 2 22  ? -41.687  -36.982 27.940  1.00 56.43  ? 34  LYS B CD    1 
ATOM   4257  C  CE    . LYS B 2 22  ? -40.269  -36.465 28.121  1.00 56.43  ? 34  LYS B CE    1 
ATOM   4258  N  NZ    . LYS B 2 22  ? -39.497  -37.279 29.100  1.00 56.43  ? 34  LYS B NZ    1 
ATOM   4259  N  N     . SER B 2 23  ? -39.253  -39.338 23.702  1.00 78.57  ? 35  SER B N     1 
ATOM   4260  C  CA    . SER B 2 23  ? -38.676  -39.120 22.380  1.00 78.57  ? 35  SER B CA    1 
ATOM   4261  C  C     . SER B 2 23  ? -38.591  -40.406 21.565  1.00 78.57  ? 35  SER B C     1 
ATOM   4262  O  O     . SER B 2 23  ? -38.527  -40.367 20.337  1.00 78.57  ? 35  SER B O     1 
ATOM   4263  C  CB    . SER B 2 23  ? -37.285  -38.491 22.497  1.00 78.57  ? 35  SER B CB    1 
ATOM   4264  O  OG    . SER B 2 23  ? -37.339  -37.240 23.161  1.00 78.57  ? 35  SER B OG    1 
ATOM   4265  N  N     . SER B 2 24  ? -38.584  -41.543 22.254  1.00 65.92  ? 36  SER B N     1 
ATOM   4266  C  CA    . SER B 2 24  ? -38.487  -42.837 21.588  1.00 65.92  ? 36  SER B CA    1 
ATOM   4267  C  C     . SER B 2 24  ? -39.861  -43.337 21.157  1.00 65.92  ? 36  SER B C     1 
ATOM   4268  O  O     . SER B 2 24  ? -39.987  -44.038 20.154  1.00 65.92  ? 36  SER B O     1 
ATOM   4269  C  CB    . SER B 2 24  ? -37.804  -43.860 22.496  1.00 65.92  ? 36  SER B CB    1 
ATOM   4270  O  OG    . SER B 2 24  ? -36.482  -43.458 22.809  1.00 65.92  ? 36  SER B OG    1 
ATOM   4271  N  N     . LEU B 2 25  ? -40.887  -42.974 21.922  1.00 56.94  ? 37  LEU B N     1 
ATOM   4272  C  CA    . LEU B 2 25  ? -42.258  -43.315 21.566  1.00 56.94  ? 37  LEU B CA    1 
ATOM   4273  C  C     . LEU B 2 25  ? -42.654  -42.617 20.270  1.00 56.94  ? 37  LEU B C     1 
ATOM   4274  O  O     . LEU B 2 25  ? -43.358  -43.185 19.437  1.00 56.94  ? 37  LEU B O     1 
ATOM   4275  C  CB    . LEU B 2 25  ? -43.224  -42.932 22.689  1.00 56.94  ? 37  LEU B CB    1 
ATOM   4276  C  CG    . LEU B 2 25  ? -43.166  -43.761 23.972  1.00 56.94  ? 37  LEU B CG    1 
ATOM   4277  C  CD1   . LEU B 2 25  ? -44.210  -43.296 24.979  1.00 56.94  ? 37  LEU B CD1   1 
ATOM   4278  C  CD2   . LEU B 2 25  ? -43.347  -45.231 23.650  1.00 56.94  ? 37  LEU B CD2   1 
ATOM   4279  N  N     . VAL B 2 26  ? -42.188  -41.382 20.109  1.00 57.35  ? 38  VAL B N     1 
ATOM   4280  C  CA    . VAL B 2 26  ? -42.453  -40.600 18.907  1.00 57.35  ? 38  VAL B CA    1 
ATOM   4281  C  C     . VAL B 2 26  ? -41.779  -41.229 17.685  1.00 57.35  ? 38  VAL B C     1 
ATOM   4282  O  O     . VAL B 2 26  ? -42.359  -41.271 16.600  1.00 57.35  ? 38  VAL B O     1 
ATOM   4283  C  CB    . VAL B 2 26  ? -41.989  -39.140 19.082  1.00 57.35  ? 38  VAL B CB    1 
ATOM   4284  C  CG1   . VAL B 2 26  ? -42.198  -38.346 17.804  1.00 57.35  ? 38  VAL B CG1   1 
ATOM   4285  C  CG2   . VAL B 2 26  ? -42.729  -38.490 20.241  1.00 57.35  ? 38  VAL B CG2   1 
ATOM   4286  N  N     . LEU B 2 27  ? -40.560  -41.729 17.871  1.00 62.53  ? 39  LEU B N     1 
ATOM   4287  C  CA    . LEU B 2 27  ? -39.841  -42.402 16.794  1.00 62.53  ? 39  LEU B CA    1 
ATOM   4288  C  C     . LEU B 2 27  ? -40.540  -43.703 16.413  1.00 62.53  ? 39  LEU B C     1 
ATOM   4289  O  O     . LEU B 2 27  ? -40.638  -44.047 15.235  1.00 62.53  ? 39  LEU B O     1 
ATOM   4290  C  CB    . LEU B 2 27  ? -38.393  -42.684 17.201  1.00 62.53  ? 39  LEU B CB    1 
ATOM   4291  C  CG    . LEU B 2 27  ? -37.484  -43.239 16.101  1.00 62.53  ? 39  LEU B CG    1 
ATOM   4292  C  CD1   . LEU B 2 27  ? -37.344  -42.232 14.973  1.00 62.53  ? 39  LEU B CD1   1 
ATOM   4293  C  CD2   . LEU B 2 27  ? -36.118  -43.623 16.651  1.00 62.53  ? 39  LEU B CD2   1 
ATOM   4294  N  N     . ARG B 2 28  ? -41.028  -44.420 17.420  1.00 89.77  ? 40  ARG B N     1 
ATOM   4295  C  CA    . ARG B 2 28  ? -41.755  -45.664 17.198  1.00 89.77  ? 40  ARG B CA    1 
ATOM   4296  C  C     . ARG B 2 28  ? -43.124  -45.405 16.568  1.00 89.77  ? 40  ARG B C     1 
ATOM   4297  O  O     . ARG B 2 28  ? -43.598  -46.191 15.747  1.00 89.77  ? 40  ARG B O     1 
ATOM   4298  C  CB    . ARG B 2 28  ? -41.912  -46.428 18.514  1.00 89.77  ? 40  ARG B CB    1 
ATOM   4299  C  CG    . ARG B 2 28  ? -42.809  -47.650 18.423  1.00 89.77  ? 40  ARG B CG    1 
ATOM   4300  C  CD    . ARG B 2 28  ? -42.202  -48.734 17.555  1.00 89.77  ? 40  ARG B CD    1 
ATOM   4301  N  NE    . ARG B 2 28  ? -41.081  -49.396 18.215  1.00 89.77  ? 40  ARG B NE    1 
ATOM   4302  C  CZ    . ARG B 2 28  ? -40.496  -50.500 17.763  1.00 89.77  ? 40  ARG B CZ    1 
ATOM   4303  N  NH1   . ARG B 2 28  ? -40.928  -51.071 16.647  1.00 89.77  ? 40  ARG B NH1   1 
ATOM   4304  N  NH2   . ARG B 2 28  ? -39.482  -51.036 18.427  1.00 89.77  ? 40  ARG B NH2   1 
ATOM   4305  N  N     . PHE B 2 29  ? -43.753  -44.298 16.949  1.00 52.11  ? 41  PHE B N     1 
ATOM   4306  C  CA    . PHE B 2 29  ? -45.070  -43.946 16.427  1.00 52.11  ? 41  PHE B CA    1 
ATOM   4307  C  C     . PHE B 2 29  ? -45.002  -43.389 15.006  1.00 52.11  ? 41  PHE B C     1 
ATOM   4308  O  O     . PHE B 2 29  ? -45.953  -43.523 14.234  1.00 52.11  ? 41  PHE B O     1 
ATOM   4309  C  CB    . PHE B 2 29  ? -45.769  -42.949 17.354  1.00 52.11  ? 41  PHE B CB    1 
ATOM   4310  C  CG    . PHE B 2 29  ? -47.073  -42.431 16.818  1.00 52.11  ? 41  PHE B CG    1 
ATOM   4311  C  CD1   . PHE B 2 29  ? -48.147  -43.285 16.623  1.00 52.11  ? 41  PHE B CD1   1 
ATOM   4312  C  CD2   . PHE B 2 29  ? -47.229  -41.087 16.519  1.00 52.11  ? 41  PHE B CD2   1 
ATOM   4313  C  CE1   . PHE B 2 29  ? -49.350  -42.810 16.130  1.00 52.11  ? 41  PHE B CE1   1 
ATOM   4314  C  CE2   . PHE B 2 29  ? -48.428  -40.604 16.028  1.00 52.11  ? 41  PHE B CE2   1 
ATOM   4315  C  CZ    . PHE B 2 29  ? -49.490  -41.467 15.834  1.00 52.11  ? 41  PHE B CZ    1 
ATOM   4316  N  N     . VAL B 2 30  ? -43.878  -42.767 14.665  1.00 45.89  ? 42  VAL B N     1 
ATOM   4317  C  CA    . VAL B 2 30  ? -43.710  -42.169 13.344  1.00 45.89  ? 42  VAL B CA    1 
ATOM   4318  C  C     . VAL B 2 30  ? -42.852  -43.034 12.424  1.00 45.89  ? 42  VAL B C     1 
ATOM   4319  O  O     . VAL B 2 30  ? -43.353  -43.614 11.461  1.00 45.89  ? 42  VAL B O     1 
ATOM   4320  C  CB    . VAL B 2 30  ? -43.105  -40.751 13.432  1.00 45.89  ? 42  VAL B CB    1 
ATOM   4321  C  CG1   . VAL B 2 30  ? -42.856  -40.185 12.041  1.00 45.89  ? 42  VAL B CG1   1 
ATOM   4322  C  CG2   . VAL B 2 30  ? -44.021  -39.833 14.219  1.00 45.89  ? 42  VAL B CG2   1 
ATOM   4323  N  N     . LYS B 2 31  ? -41.560  -43.120 12.725  1.00 78.56  ? 43  LYS B N     1 
ATOM   4324  C  CA    . LYS B 2 31  ? -40.626  -43.843 11.868  1.00 78.56  ? 43  LYS B CA    1 
ATOM   4325  C  C     . LYS B 2 31  ? -40.533  -45.326 12.217  1.00 78.56  ? 43  LYS B C     1 
ATOM   4326  O  O     . LYS B 2 31  ? -39.861  -46.091 11.524  1.00 78.56  ? 43  LYS B O     1 
ATOM   4327  C  CB    . LYS B 2 31  ? -39.241  -43.194 11.914  1.00 78.56  ? 43  LYS B CB    1 
ATOM   4328  C  CG    . LYS B 2 31  ? -39.218  -41.768 11.385  1.00 78.56  ? 43  LYS B CG    1 
ATOM   4329  C  CD    . LYS B 2 31  ? -37.812  -41.192 11.388  1.00 78.56  ? 43  LYS B CD    1 
ATOM   4330  C  CE    . LYS B 2 31  ? -37.798  -39.772 10.839  1.00 78.56  ? 43  LYS B CE    1 
ATOM   4331  N  NZ    . LYS B 2 31  ? -36.427  -39.184 10.825  1.00 78.56  ? 43  LYS B NZ    1 
ATOM   4332  N  N     . GLY B 2 32  ? -41.211  -45.724 13.289  1.00 56.75  ? 44  GLY B N     1 
ATOM   4333  C  CA    . GLY B 2 32  ? -41.266  -47.118 13.692  1.00 56.75  ? 44  GLY B CA    1 
ATOM   4334  C  C     . GLY B 2 32  ? -39.911  -47.724 14.008  1.00 56.75  ? 44  GLY B C     1 
ATOM   4335  O  O     . GLY B 2 32  ? -39.692  -48.915 13.787  1.00 56.75  ? 44  GLY B O     1 
ATOM   4336  N  N     . GLN B 2 33  ? -39.001  -46.902 14.522  1.00 74.61  ? 45  GLN B N     1 
ATOM   4337  C  CA    . GLN B 2 33  ? -37.664  -47.364 14.873  1.00 74.61  ? 45  GLN B CA    1 
ATOM   4338  C  C     . GLN B 2 33  ? -37.441  -47.266 16.375  1.00 74.61  ? 45  GLN B C     1 
ATOM   4339  O  O     . GLN B 2 33  ? -38.355  -46.918 17.124  1.00 74.61  ? 45  GLN B O     1 
ATOM   4340  C  CB    . GLN B 2 33  ? -36.604  -46.539 14.144  1.00 74.61  ? 45  GLN B CB    1 
ATOM   4341  C  CG    . GLN B 2 33  ? -36.809  -46.432 12.645  1.00 74.61  ? 45  GLN B CG    1 
ATOM   4342  C  CD    . GLN B 2 33  ? -35.734  -45.601 11.976  1.00 74.61  ? 45  GLN B CD    1 
ATOM   4343  O  OE1   . GLN B 2 33  ? -34.623  -45.474 12.490  1.00 74.61  ? 45  GLN B OE1   1 
ATOM   4344  N  NE2   . GLN B 2 33  ? -36.060  -45.025 10.825  1.00 74.61  ? 45  GLN B NE2   1 
ATOM   4345  N  N     . PHE B 2 34  ? -36.220  -47.566 16.807  1.00 85.09  ? 46  PHE B N     1 
ATOM   4346  C  CA    . PHE B 2 34  ? -35.856  -47.483 18.219  1.00 85.09  ? 46  PHE B CA    1 
ATOM   4347  C  C     . PHE B 2 34  ? -34.342  -47.494 18.406  1.00 85.09  ? 46  PHE B C     1 
ATOM   4348  O  O     . PHE B 2 34  ? -33.647  -48.353 17.862  1.00 85.09  ? 46  PHE B O     1 
ATOM   4349  C  CB    . PHE B 2 34  ? -36.490  -48.633 19.002  1.00 85.09  ? 46  PHE B CB    1 
ATOM   4350  C  CG    . PHE B 2 34  ? -36.122  -48.651 20.454  1.00 85.09  ? 46  PHE B CG    1 
ATOM   4351  C  CD1   . PHE B 2 34  ? -36.530  -47.633 21.299  1.00 85.09  ? 46  PHE B CD1   1 
ATOM   4352  C  CD2   . PHE B 2 34  ? -35.379  -49.695 20.979  1.00 85.09  ? 46  PHE B CD2   1 
ATOM   4353  C  CE1   . PHE B 2 34  ? -36.195  -47.648 22.639  1.00 85.09  ? 46  PHE B CE1   1 
ATOM   4354  C  CE2   . PHE B 2 34  ? -35.041  -49.719 22.318  1.00 85.09  ? 46  PHE B CE2   1 
ATOM   4355  C  CZ    . PHE B 2 34  ? -35.449  -48.694 23.150  1.00 85.09  ? 46  PHE B CZ    1 
ATOM   4356  N  N     . HIS B 2 35  ? -33.836  -46.533 19.174  1.00 100.95 ? 47  HIS B N     1 
ATOM   4357  C  CA    . HIS B 2 35  ? -32.408  -46.447 19.462  1.00 100.95 ? 47  HIS B CA    1 
ATOM   4358  C  C     . HIS B 2 35  ? -32.143  -46.549 20.961  1.00 100.95 ? 47  HIS B C     1 
ATOM   4359  O  O     . HIS B 2 35  ? -32.708  -45.794 21.753  1.00 100.95 ? 47  HIS B O     1 
ATOM   4360  C  CB    . HIS B 2 35  ? -31.820  -45.147 18.907  1.00 100.95 ? 47  HIS B CB    1 
ATOM   4361  C  CG    . HIS B 2 35  ? -31.701  -45.124 17.414  1.00 100.95 ? 47  HIS B CG    1 
ATOM   4362  N  ND1   . HIS B 2 35  ? -31.383  -43.983 16.710  1.00 100.95 ? 47  HIS B ND1   1 
ATOM   4363  C  CD2   . HIS B 2 35  ? -31.849  -46.105 16.493  1.00 100.95 ? 47  HIS B CD2   1 
ATOM   4364  C  CE1   . HIS B 2 35  ? -31.344  -44.260 15.419  1.00 100.95 ? 47  HIS B CE1   1 
ATOM   4365  N  NE2   . HIS B 2 35  ? -31.623  -45.544 15.261  1.00 100.95 ? 47  HIS B NE2   1 
ATOM   4366  N  N     . GLU B 2 36  ? -31.283  -47.487 21.345  1.00 106.71 ? 48  GLU B N     1 
ATOM   4367  C  CA    . GLU B 2 36  ? -30.952  -47.695 22.749  1.00 106.71 ? 48  GLU B CA    1 
ATOM   4368  C  C     . GLU B 2 36  ? -30.078  -46.559 23.273  1.00 106.71 ? 48  GLU B C     1 
ATOM   4369  O  O     . GLU B 2 36  ? -30.029  -46.304 24.476  1.00 106.71 ? 48  GLU B O     1 
ATOM   4370  C  CB    . GLU B 2 36  ? -30.245  -49.038 22.940  1.00 106.71 ? 48  GLU B CB    1 
ATOM   4371  C  CG    . GLU B 2 36  ? -30.248  -49.550 24.374  1.00 106.71 ? 48  GLU B CG    1 
ATOM   4372  C  CD    . GLU B 2 36  ? -31.642  -49.895 24.867  1.00 106.71 ? 48  GLU B CD    1 
ATOM   4373  O  OE1   . GLU B 2 36  ? -32.129  -51.000 24.551  1.00 106.71 ? 48  GLU B OE1   1 
ATOM   4374  O  OE2   . GLU B 2 36  ? -32.250  -49.060 25.568  1.00 106.71 ? 48  GLU B OE2   1 
ATOM   4375  N  N     . TYR B 2 37  ? -29.391  -45.878 22.362  1.00 150.68 ? 49  TYR B N     1 
ATOM   4376  C  CA    . TYR B 2 37  ? -28.560  -44.738 22.730  1.00 150.68 ? 49  TYR B CA    1 
ATOM   4377  C  C     . TYR B 2 37  ? -29.086  -43.442 22.122  1.00 150.68 ? 49  TYR B C     1 
ATOM   4378  O  O     . TYR B 2 37  ? -28.428  -42.833 21.279  1.00 150.68 ? 49  TYR B O     1 
ATOM   4379  C  CB    . TYR B 2 37  ? -27.108  -44.962 22.302  1.00 150.68 ? 49  TYR B CB    1 
ATOM   4380  C  CG    . TYR B 2 37  ? -26.418  -46.083 23.044  1.00 150.68 ? 49  TYR B CG    1 
ATOM   4381  C  CD1   . TYR B 2 37  ? -25.908  -47.182 22.365  1.00 150.68 ? 49  TYR B CD1   1 
ATOM   4382  C  CD2   . TYR B 2 37  ? -26.285  -46.045 24.424  1.00 150.68 ? 49  TYR B CD2   1 
ATOM   4383  C  CE1   . TYR B 2 37  ? -25.278  -48.208 23.042  1.00 150.68 ? 49  TYR B CE1   1 
ATOM   4384  C  CE2   . TYR B 2 37  ? -25.659  -47.066 25.110  1.00 150.68 ? 49  TYR B CE2   1 
ATOM   4385  C  CZ    . TYR B 2 37  ? -25.157  -48.145 24.415  1.00 150.68 ? 49  TYR B CZ    1 
ATOM   4386  O  OH    . TYR B 2 37  ? -24.532  -49.164 25.096  1.00 150.68 ? 49  TYR B OH    1 
ATOM   4387  N  N     . GLN B 2 38  ? -30.273  -43.023 22.553  1.00 83.22  ? 50  GLN B N     1 
ATOM   4388  C  CA    . GLN B 2 38  ? -30.855  -41.774 22.074  1.00 83.22  ? 50  GLN B CA    1 
ATOM   4389  C  C     . GLN B 2 38  ? -30.301  -40.575 22.830  1.00 83.22  ? 50  GLN B C     1 
ATOM   4390  O  O     . GLN B 2 38  ? -30.033  -40.654 24.029  1.00 83.22  ? 50  GLN B O     1 
ATOM   4391  C  CB    . GLN B 2 38  ? -32.380  -41.794 22.192  1.00 83.22  ? 50  GLN B CB    1 
ATOM   4392  C  CG    . GLN B 2 38  ? -33.084  -42.602 21.120  1.00 83.22  ? 50  GLN B CG    1 
ATOM   4393  C  CD    . GLN B 2 38  ? -34.457  -42.056 20.787  1.00 83.22  ? 50  GLN B CD    1 
ATOM   4394  O  OE1   . GLN B 2 38  ? -35.349  -42.798 20.378  1.00 83.22  ? 50  GLN B OE1   1 
ATOM   4395  N  NE2   . GLN B 2 38  ? -34.631  -40.750 20.951  1.00 83.22  ? 50  GLN B NE2   1 
ATOM   4396  N  N     . GLU B 2 39  ? -30.133  -39.467 22.117  1.00 83.11  ? 51  GLU B N     1 
ATOM   4397  C  CA    . GLU B 2 39  ? -29.706  -38.217 22.728  1.00 83.11  ? 51  GLU B CA    1 
ATOM   4398  C  C     . GLU B 2 39  ? -30.881  -37.612 23.484  1.00 83.11  ? 51  GLU B C     1 
ATOM   4399  O  O     . GLU B 2 39  ? -32.037  -37.907 23.181  1.00 83.11  ? 51  GLU B O     1 
ATOM   4400  C  CB    . GLU B 2 39  ? -29.220  -37.249 21.650  1.00 83.11  ? 51  GLU B CB    1 
ATOM   4401  C  CG    . GLU B 2 39  ? -28.137  -37.823 20.748  1.00 83.11  ? 51  GLU B CG    1 
ATOM   4402  C  CD    . GLU B 2 39  ? -27.999  -37.060 19.445  1.00 83.11  ? 51  GLU B CD    1 
ATOM   4403  O  OE1   . GLU B 2 39  ? -28.877  -36.224 19.148  1.00 83.11  ? 51  GLU B OE1   1 
ATOM   4404  O  OE2   . GLU B 2 39  ? -27.013  -37.299 18.718  1.00 83.11  ? 51  GLU B OE2   1 
ATOM   4405  N  N     . SER B 2 40  ? -30.590  -36.769 24.469  1.00 35.29  ? 52  SER B N     1 
ATOM   4406  C  CA    . SER B 2 40  ? -31.645  -36.137 25.253  1.00 35.29  ? 52  SER B CA    1 
ATOM   4407  C  C     . SER B 2 40  ? -32.232  -34.948 24.503  1.00 35.29  ? 52  SER B C     1 
ATOM   4408  O  O     . SER B 2 40  ? -31.513  -34.215 23.824  1.00 35.29  ? 52  SER B O     1 
ATOM   4409  C  CB    . SER B 2 40  ? -31.115  -35.692 26.615  1.00 35.29  ? 52  SER B CB    1 
ATOM   4410  O  OG    . SER B 2 40  ? -32.166  -35.228 27.443  1.00 35.29  ? 52  SER B OG    1 
ATOM   4411  N  N     . THR B 2 41  ? -33.543  -34.762 24.626  1.00 36.34  ? 53  THR B N     1 
ATOM   4412  C  CA    . THR B 2 41  ? -34.228  -33.674 23.939  1.00 36.34  ? 53  THR B CA    1 
ATOM   4413  C  C     . THR B 2 41  ? -33.840  -32.319 24.525  1.00 36.34  ? 53  THR B C     1 
ATOM   4414  O  O     . THR B 2 41  ? -33.982  -32.088 25.726  1.00 36.34  ? 53  THR B O     1 
ATOM   4415  C  CB    . THR B 2 41  ? -35.759  -33.834 24.004  1.00 36.34  ? 53  THR B CB    1 
ATOM   4416  O  OG1   . THR B 2 41  ? -36.125  -35.147 23.561  1.00 36.34  ? 53  THR B OG1   1 
ATOM   4417  C  CG2   . THR B 2 41  ? -36.445  -32.798 23.128  1.00 36.34  ? 53  THR B CG2   1 
ATOM   4418  N  N     . ILE B 2 42  ? -33.342  -31.433 23.669  1.00 33.54  ? 54  ILE B N     1 
ATOM   4419  C  CA    . ILE B 2 42  ? -33.016  -30.073 24.074  1.00 33.54  ? 54  ILE B CA    1 
ATOM   4420  C  C     . ILE B 2 42  ? -34.176  -29.151 23.716  1.00 33.54  ? 54  ILE B C     1 
ATOM   4421  O  O     . ILE B 2 42  ? -34.466  -28.937 22.539  1.00 33.54  ? 54  ILE B O     1 
ATOM   4422  C  CB    . ILE B 2 42  ? -31.734  -29.573 23.387  1.00 33.54  ? 54  ILE B CB    1 
ATOM   4423  C  CG1   . ILE B 2 42  ? -30.590  -30.566 23.588  1.00 33.54  ? 54  ILE B CG1   1 
ATOM   4424  C  CG2   . ILE B 2 42  ? -31.343  -28.216 23.925  1.00 33.54  ? 54  ILE B CG2   1 
ATOM   4425  C  CD1   . ILE B 2 42  ? -29.298  -30.153 22.911  1.00 33.54  ? 54  ILE B CD1   1 
ATOM   4426  N  N     . GLY B 2 43  ? -34.840  -28.611 24.733  1.00 31.54  ? 55  GLY B N     1 
ATOM   4427  C  CA    . GLY B 2 43  ? -36.011  -27.782 24.516  1.00 31.54  ? 55  GLY B CA    1 
ATOM   4428  C  C     . GLY B 2 43  ? -37.209  -28.613 24.100  1.00 31.54  ? 55  GLY B C     1 
ATOM   4429  O  O     . GLY B 2 43  ? -37.917  -29.159 24.948  1.00 31.54  ? 55  GLY B O     1 
ATOM   4430  N  N     . ALA B 2 44  ? -37.434  -28.710 22.792  1.00 24.09  ? 56  ALA B N     1 
ATOM   4431  C  CA    . ALA B 2 44  ? -38.532  -29.507 22.251  1.00 24.09  ? 56  ALA B CA    1 
ATOM   4432  C  C     . ALA B 2 44  ? -38.369  -29.751 20.754  1.00 24.09  ? 56  ALA B C     1 
ATOM   4433  O  O     . ALA B 2 44  ? -37.934  -28.868 20.019  1.00 24.09  ? 56  ALA B O     1 
ATOM   4434  C  CB    . ALA B 2 44  ? -39.866  -28.831 22.526  1.00 24.09  ? 56  ALA B CB    1 
ATOM   4435  N  N     . ALA B 2 45  ? -38.728  -30.952 20.309  1.00 44.11  ? 57  ALA B N     1 
ATOM   4436  C  CA    . ALA B 2 45  ? -38.694  -31.288 18.889  1.00 44.11  ? 57  ALA B CA    1 
ATOM   4437  C  C     . ALA B 2 45  ? -40.108  -31.278 18.311  1.00 44.11  ? 57  ALA B C     1 
ATOM   4438  O  O     . ALA B 2 45  ? -41.073  -31.566 19.020  1.00 44.11  ? 57  ALA B O     1 
ATOM   4439  C  CB    . ALA B 2 45  ? -38.041  -32.642 18.681  1.00 44.11  ? 57  ALA B CB    1 
ATOM   4440  N  N     . PHE B 2 46  ? -40.231  -30.952 17.027  1.00 36.49  ? 58  PHE B N     1 
ATOM   4441  C  CA    . PHE B 2 46  ? -41.546  -30.841 16.401  1.00 36.49  ? 58  PHE B CA    1 
ATOM   4442  C  C     . PHE B 2 46  ? -41.731  -31.787 15.218  1.00 36.49  ? 58  PHE B C     1 
ATOM   4443  O  O     . PHE B 2 46  ? -40.902  -31.835 14.309  1.00 36.49  ? 58  PHE B O     1 
ATOM   4444  C  CB    . PHE B 2 46  ? -41.805  -29.402 15.956  1.00 36.49  ? 58  PHE B CB    1 
ATOM   4445  C  CG    . PHE B 2 46  ? -43.179  -29.182 15.396  1.00 36.49  ? 58  PHE B CG    1 
ATOM   4446  C  CD1   . PHE B 2 46  ? -43.388  -29.139 14.028  1.00 36.49  ? 58  PHE B CD1   1 
ATOM   4447  C  CD2   . PHE B 2 46  ? -44.264  -29.022 16.239  1.00 36.49  ? 58  PHE B CD2   1 
ATOM   4448  C  CE1   . PHE B 2 46  ? -44.656  -28.939 13.515  1.00 36.49  ? 58  PHE B CE1   1 
ATOM   4449  C  CE2   . PHE B 2 46  ? -45.534  -28.820 15.732  1.00 36.49  ? 58  PHE B CE2   1 
ATOM   4450  C  CZ    . PHE B 2 46  ? -45.729  -28.779 14.368  1.00 36.49  ? 58  PHE B CZ    1 
ATOM   4451  N  N     . LEU B 2 47  ? -42.830  -32.534 15.240  1.00 42.01  ? 59  LEU B N     1 
ATOM   4452  C  CA    . LEU B 2 47  ? -43.195  -33.407 14.132  1.00 42.01  ? 59  LEU B CA    1 
ATOM   4453  C  C     . LEU B 2 47  ? -44.677  -33.300 13.800  1.00 42.01  ? 59  LEU B C     1 
ATOM   4454  O  O     . LEU B 2 47  ? -45.463  -32.732 14.561  1.00 42.01  ? 59  LEU B O     1 
ATOM   4455  C  CB    . LEU B 2 47  ? -42.849  -34.866 14.439  1.00 42.01  ? 59  LEU B CB    1 
ATOM   4456  C  CG    . LEU B 2 47  ? -41.428  -35.349 14.149  1.00 42.01  ? 59  LEU B CG    1 
ATOM   4457  C  CD1   . LEU B 2 47  ? -40.484  -35.015 15.296  1.00 42.01  ? 59  LEU B CD1   1 
ATOM   4458  C  CD2   . LEU B 2 47  ? -41.419  -36.840 13.854  1.00 42.01  ? 59  LEU B CD2   1 
ATOM   4459  N  N     . THR B 2 48  ? -45.046  -33.853 12.651  1.00 60.66  ? 60  THR B N     1 
ATOM   4460  C  CA    . THR B 2 48  ? -46.440  -33.971 12.259  1.00 60.66  ? 60  THR B CA    1 
ATOM   4461  C  C     . THR B 2 48  ? -46.665  -35.355 11.662  1.00 60.66  ? 60  THR B C     1 
ATOM   4462  O  O     . THR B 2 48  ? -46.053  -35.711 10.654  1.00 60.66  ? 60  THR B O     1 
ATOM   4463  C  CB    . THR B 2 48  ? -46.835  -32.893 11.233  1.00 60.66  ? 60  THR B CB    1 
ATOM   4464  O  OG1   . THR B 2 48  ? -47.011  -31.637 11.900  1.00 60.66  ? 60  THR B OG1   1 
ATOM   4465  C  CG2   . THR B 2 48  ? -48.131  -33.265 10.541  1.00 60.66  ? 60  THR B CG2   1 
ATOM   4466  N  N     . GLN B 2 49  ? -47.526  -36.143 12.297  1.00 53.02  ? 61  GLN B N     1 
ATOM   4467  C  CA    . GLN B 2 49  ? -47.852  -37.467 11.779  1.00 53.02  ? 61  GLN B CA    1 
ATOM   4468  C  C     . GLN B 2 49  ? -49.334  -37.575 11.444  1.00 53.02  ? 61  GLN B C     1 
ATOM   4469  O  O     . GLN B 2 49  ? -50.192  -37.158 12.222  1.00 53.02  ? 61  GLN B O     1 
ATOM   4470  C  CB    . GLN B 2 49  ? -47.435  -38.566 12.758  1.00 53.02  ? 61  GLN B CB    1 
ATOM   4471  C  CG    . GLN B 2 49  ? -47.706  -39.984 12.260  1.00 53.02  ? 61  GLN B CG    1 
ATOM   4472  C  CD    . GLN B 2 49  ? -47.053  -40.279 10.920  1.00 53.02  ? 61  GLN B CD    1 
ATOM   4473  O  OE1   . GLN B 2 49  ? -47.568  -39.901 9.867   1.00 53.02  ? 61  GLN B OE1   1 
ATOM   4474  N  NE2   . GLN B 2 49  ? -45.917  -40.965 10.953  1.00 53.02  ? 61  GLN B NE2   1 
ATOM   4475  N  N     . THR B 2 50  ? -49.623  -38.140 10.278  1.00 64.44  ? 62  THR B N     1 
ATOM   4476  C  CA    . THR B 2 50  ? -50.989  -38.212 9.782   1.00 64.44  ? 62  THR B CA    1 
ATOM   4477  C  C     . THR B 2 50  ? -51.490  -39.652 9.714   1.00 64.44  ? 62  THR B C     1 
ATOM   4478  O  O     . THR B 2 50  ? -50.989  -40.460 8.932   1.00 64.44  ? 62  THR B O     1 
ATOM   4479  C  CB    . THR B 2 50  ? -51.101  -37.565 8.393   1.00 64.44  ? 62  THR B CB    1 
ATOM   4480  O  OG1   . THR B 2 50  ? -50.455  -36.286 8.406   1.00 64.44  ? 62  THR B OG1   1 
ATOM   4481  C  CG2   . THR B 2 50  ? -52.552  -37.386 8.007   1.00 64.44  ? 62  THR B CG2   1 
ATOM   4482  N  N     . VAL B 2 51  ? -52.475  -39.966 10.548  1.00 57.69  ? 63  VAL B N     1 
ATOM   4483  C  CA    . VAL B 2 51  ? -53.126  -41.269 10.517  1.00 57.69  ? 63  VAL B CA    1 
ATOM   4484  C  C     . VAL B 2 51  ? -54.607  -41.075 10.221  1.00 57.69  ? 63  VAL B C     1 
ATOM   4485  O  O     . VAL B 2 51  ? -55.152  -39.996 10.453  1.00 57.69  ? 63  VAL B O     1 
ATOM   4486  C  CB    . VAL B 2 51  ? -52.963  -42.019 11.852  1.00 57.69  ? 63  VAL B CB    1 
ATOM   4487  C  CG1   . VAL B 2 51  ? -51.490  -42.239 12.158  1.00 57.69  ? 63  VAL B CG1   1 
ATOM   4488  C  CG2   . VAL B 2 51  ? -53.636  -41.253 12.982  1.00 57.69  ? 63  VAL B CG2   1 
ATOM   4489  N  N     . CYS B 2 52  ? -55.259  -42.109 9.699   1.00 91.53  ? 64  CYS B N     1 
ATOM   4490  C  CA    . CYS B 2 52  ? -56.690  -42.018 9.427   1.00 91.53  ? 64  CYS B CA    1 
ATOM   4491  C  C     . CYS B 2 52  ? -57.502  -43.099 10.135  1.00 91.53  ? 64  CYS B C     1 
ATOM   4492  O  O     . CYS B 2 52  ? -57.478  -44.269 9.751   1.00 91.53  ? 64  CYS B O     1 
ATOM   4493  C  CB    . CYS B 2 52  ? -56.979  -42.014 7.919   1.00 91.53  ? 64  CYS B CB    1 
ATOM   4494  S  SG    . CYS B 2 52  ? -56.360  -43.432 6.985   1.00 91.53  ? 64  CYS B SG    1 
ATOM   4495  N  N     . LEU B 2 53  ? -58.207  -42.694 11.186  1.00 67.12  ? 65  LEU B N     1 
ATOM   4496  C  CA    . LEU B 2 53  ? -59.169  -43.565 11.841  1.00 67.12  ? 65  LEU B CA    1 
ATOM   4497  C  C     . LEU B 2 53  ? -60.392  -43.639 10.940  1.00 67.12  ? 65  LEU B C     1 
ATOM   4498  O  O     . LEU B 2 53  ? -60.763  -42.642 10.324  1.00 67.12  ? 65  LEU B O     1 
ATOM   4499  C  CB    . LEU B 2 53  ? -59.542  -43.032 13.231  1.00 67.12  ? 65  LEU B CB    1 
ATOM   4500  C  CG    . LEU B 2 53  ? -60.533  -41.872 13.392  1.00 67.12  ? 65  LEU B CG    1 
ATOM   4501  C  CD1   . LEU B 2 53  ? -60.862  -41.653 14.861  1.00 67.12  ? 65  LEU B CD1   1 
ATOM   4502  C  CD2   . LEU B 2 53  ? -60.017  -40.584 12.773  1.00 67.12  ? 65  LEU B CD2   1 
ATOM   4503  N  N     . ASP B 2 54  ? -61.006  -44.818 10.861  1.00 107.99 ? 66  ASP B N     1 
ATOM   4504  C  CA    . ASP B 2 54  ? -62.103  -45.089 9.922   1.00 107.99 ? 66  ASP B CA    1 
ATOM   4505  C  C     . ASP B 2 54  ? -61.903  -44.472 8.532   1.00 107.99 ? 66  ASP B C     1 
ATOM   4506  O  O     . ASP B 2 54  ? -60.880  -44.700 7.885   1.00 107.99 ? 66  ASP B O     1 
ATOM   4507  C  CB    . ASP B 2 54  ? -63.475  -44.721 10.517  1.00 107.99 ? 66  ASP B CB    1 
ATOM   4508  C  CG    . ASP B 2 54  ? -63.556  -43.276 10.980  1.00 107.99 ? 66  ASP B CG    1 
ATOM   4509  O  OD1   . ASP B 2 54  ? -63.536  -42.372 10.119  1.00 107.99 ? 66  ASP B OD1   1 
ATOM   4510  O  OD2   . ASP B 2 54  ? -63.650  -43.046 12.203  1.00 107.99 ? 66  ASP B OD2   1 
ATOM   4511  N  N     . ASP B 2 55  ? -62.879  -43.689 8.086   1.00 95.49  ? 67  ASP B N     1 
ATOM   4512  C  CA    . ASP B 2 55  ? -62.823  -43.054 6.774   1.00 95.49  ? 67  ASP B CA    1 
ATOM   4513  C  C     . ASP B 2 55  ? -62.435  -41.577 6.858   1.00 95.49  ? 67  ASP B C     1 
ATOM   4514  O  O     . ASP B 2 55  ? -62.430  -40.872 5.849   1.00 95.49  ? 67  ASP B O     1 
ATOM   4515  C  CB    . ASP B 2 55  ? -64.169  -43.204 6.061   1.00 95.49  ? 67  ASP B CB    1 
ATOM   4516  C  CG    . ASP B 2 55  ? -65.348  -43.007 6.996   1.00 95.49  ? 67  ASP B CG    1 
ATOM   4517  O  OD1   . ASP B 2 55  ? -65.254  -43.436 8.164   1.00 95.49  ? 67  ASP B OD1   1 
ATOM   4518  O  OD2   . ASP B 2 55  ? -66.366  -42.426 6.567   1.00 95.49  ? 67  ASP B OD2   1 
ATOM   4519  N  N     . THR B 2 56  ? -62.105  -41.116 8.061   1.00 72.83  ? 68  THR B N     1 
ATOM   4520  C  CA    . THR B 2 56  ? -61.760  -39.712 8.283   1.00 72.83  ? 68  THR B CA    1 
ATOM   4521  C  C     . THR B 2 56  ? -60.290  -39.538 8.677   1.00 72.83  ? 68  THR B C     1 
ATOM   4522  O  O     . THR B 2 56  ? -59.766  -40.284 9.500   1.00 72.83  ? 68  THR B O     1 
ATOM   4523  C  CB    . THR B 2 56  ? -62.683  -39.069 9.347   1.00 72.83  ? 68  THR B CB    1 
ATOM   4524  O  OG1   . THR B 2 56  ? -63.950  -38.757 8.754   1.00 72.83  ? 68  THR B OG1   1 
ATOM   4525  C  CG2   . THR B 2 56  ? -62.075  -37.792 9.907   1.00 72.83  ? 68  THR B CG2   1 
ATOM   4526  N  N     . THR B 2 57  ? -59.631  -38.550 8.081   1.00 82.12  ? 69  THR B N     1 
ATOM   4527  C  CA    . THR B 2 57  ? -58.221  -38.292 8.348   1.00 82.12  ? 69  THR B CA    1 
ATOM   4528  C  C     . THR B 2 57  ? -58.025  -37.318 9.513   1.00 82.12  ? 69  THR B C     1 
ATOM   4529  O  O     . THR B 2 57  ? -58.731  -36.315 9.619   1.00 82.12  ? 69  THR B O     1 
ATOM   4530  C  CB    . THR B 2 57  ? -57.520  -37.736 7.093   1.00 82.12  ? 69  THR B CB    1 
ATOM   4531  O  OG1   . THR B 2 57  ? -57.650  -38.673 6.016   1.00 82.12  ? 69  THR B OG1   1 
ATOM   4532  C  CG2   . THR B 2 57  ? -56.051  -37.490 7.357   1.00 82.12  ? 69  THR B CG2   1 
ATOM   4533  N  N     . VAL B 2 58  ? -57.073  -37.626 10.392  1.00 71.50  ? 70  VAL B N     1 
ATOM   4534  C  CA    . VAL B 2 58  ? -56.676  -36.704 11.454  1.00 71.50  ? 70  VAL B CA    1 
ATOM   4535  C  C     . VAL B 2 58  ? -55.182  -36.400 11.369  1.00 71.50  ? 70  VAL B C     1 
ATOM   4536  O  O     . VAL B 2 58  ? -54.396  -37.233 10.917  1.00 71.50  ? 70  VAL B O     1 
ATOM   4537  C  CB    . VAL B 2 58  ? -57.013  -37.247 12.860  1.00 71.50  ? 70  VAL B CB    1 
ATOM   4538  C  CG1   . VAL B 2 58  ? -58.513  -37.236 13.092  1.00 71.50  ? 70  VAL B CG1   1 
ATOM   4539  C  CG2   . VAL B 2 58  ? -56.444  -38.644 13.050  1.00 71.50  ? 70  VAL B CG2   1 
ATOM   4540  N  N     . LYS B 2 59  ? -54.796  -35.204 11.801  1.00 57.05  ? 71  LYS B N     1 
ATOM   4541  C  CA    . LYS B 2 59  ? -53.394  -34.805 11.767  1.00 57.05  ? 71  LYS B CA    1 
ATOM   4542  C  C     . LYS B 2 59  ? -52.922  -34.289 13.121  1.00 57.05  ? 71  LYS B C     1 
ATOM   4543  O  O     . LYS B 2 59  ? -53.528  -33.386 13.699  1.00 57.05  ? 71  LYS B O     1 
ATOM   4544  C  CB    . LYS B 2 59  ? -53.157  -33.750 10.685  1.00 57.05  ? 71  LYS B CB    1 
ATOM   4545  C  CG    . LYS B 2 59  ? -51.705  -33.334 10.542  1.00 57.05  ? 71  LYS B CG    1 
ATOM   4546  C  CD    . LYS B 2 59  ? -51.463  -32.567 9.251   1.00 57.05  ? 71  LYS B CD    1 
ATOM   4547  C  CE    . LYS B 2 59  ? -52.302  -31.306 9.190   1.00 57.05  ? 71  LYS B CE    1 
ATOM   4548  N  NZ    . LYS B 2 59  ? -52.058  -30.430 10.369  1.00 57.05  ? 71  LYS B NZ    1 
ATOM   4549  N  N     . PHE B 2 60  ? -51.836  -34.869 13.622  1.00 58.42  ? 72  PHE B N     1 
ATOM   4550  C  CA    . PHE B 2 60  ? -51.291  -34.480 14.916  1.00 58.42  ? 72  PHE B CA    1 
ATOM   4551  C  C     . PHE B 2 60  ? -50.195  -33.428 14.788  1.00 58.42  ? 72  PHE B C     1 
ATOM   4552  O  O     . PHE B 2 60  ? -49.342  -33.504 13.903  1.00 58.42  ? 72  PHE B O     1 
ATOM   4553  C  CB    . PHE B 2 60  ? -50.744  -35.701 15.662  1.00 58.42  ? 72  PHE B CB    1 
ATOM   4554  C  CG    . PHE B 2 60  ? -51.807  -36.601 16.225  1.00 58.42  ? 72  PHE B CG    1 
ATOM   4555  C  CD1   . PHE B 2 60  ? -52.531  -36.225 17.346  1.00 58.42  ? 72  PHE B CD1   1 
ATOM   4556  C  CD2   . PHE B 2 60  ? -52.069  -37.833 15.646  1.00 58.42  ? 72  PHE B CD2   1 
ATOM   4557  C  CE1   . PHE B 2 60  ? -53.507  -37.053 17.870  1.00 58.42  ? 72  PHE B CE1   1 
ATOM   4558  C  CE2   . PHE B 2 60  ? -53.044  -38.668 16.166  1.00 58.42  ? 72  PHE B CE2   1 
ATOM   4559  C  CZ    . PHE B 2 60  ? -53.763  -38.276 17.279  1.00 58.42  ? 72  PHE B CZ    1 
ATOM   4560  N  N     . GLU B 2 61  ? -50.234  -32.441 15.677  1.00 32.30  ? 73  GLU B N     1 
ATOM   4561  C  CA    . GLU B 2 61  ? -49.145  -31.488 15.823  1.00 32.30  ? 73  GLU B CA    1 
ATOM   4562  C  C     . GLU B 2 61  ? -48.392  -31.856 17.096  1.00 32.30  ? 73  GLU B C     1 
ATOM   4563  O  O     . GLU B 2 61  ? -48.687  -31.345 18.176  1.00 32.30  ? 73  GLU B O     1 
ATOM   4564  C  CB    . GLU B 2 61  ? -49.686  -30.059 15.894  1.00 32.30  ? 73  GLU B CB    1 
ATOM   4565  C  CG    . GLU B 2 61  ? -50.459  -29.635 14.651  1.00 32.30  ? 73  GLU B CG    1 
ATOM   4566  C  CD    . GLU B 2 61  ? -51.234  -28.347 14.847  1.00 32.30  ? 73  GLU B CD    1 
ATOM   4567  O  OE1   . GLU B 2 61  ? -51.865  -27.878 13.877  1.00 32.30  ? 73  GLU B OE1   1 
ATOM   4568  O  OE2   . GLU B 2 61  ? -51.217  -27.806 15.971  1.00 32.30  ? 73  GLU B OE2   1 
ATOM   4569  N  N     . ILE B 2 62  ? -47.425  -32.758 16.959  1.00 55.85  ? 74  ILE B N     1 
ATOM   4570  C  CA    . ILE B 2 62  ? -46.760  -33.364 18.108  1.00 55.85  ? 74  ILE B CA    1 
ATOM   4571  C  C     . ILE B 2 62  ? -45.618  -32.509 18.653  1.00 55.85  ? 74  ILE B C     1 
ATOM   4572  O  O     . ILE B 2 62  ? -44.766  -32.042 17.898  1.00 55.85  ? 74  ILE B O     1 
ATOM   4573  C  CB    . ILE B 2 62  ? -46.228  -34.767 17.759  1.00 55.85  ? 74  ILE B CB    1 
ATOM   4574  C  CG1   . ILE B 2 62  ? -47.338  -35.609 17.128  1.00 55.85  ? 74  ILE B CG1   1 
ATOM   4575  C  CG2   . ILE B 2 62  ? -45.674  -35.455 18.993  1.00 55.85  ? 74  ILE B CG2   1 
ATOM   4576  C  CD1   . ILE B 2 62  ? -46.896  -36.986 16.689  1.00 55.85  ? 74  ILE B CD1   1 
ATOM   4577  N  N     . TRP B 2 63  ? -45.611  -32.311 19.968  1.00 40.61  ? 75  TRP B N     1 
ATOM   4578  C  CA    . TRP B 2 63  ? -44.549  -31.569 20.634  1.00 40.61  ? 75  TRP B CA    1 
ATOM   4579  C  C     . TRP B 2 63  ? -43.880  -32.423 21.705  1.00 40.61  ? 75  TRP B C     1 
ATOM   4580  O  O     . TRP B 2 63  ? -44.392  -32.544 22.817  1.00 40.61  ? 75  TRP B O     1 
ATOM   4581  C  CB    . TRP B 2 63  ? -45.101  -30.285 21.258  1.00 40.61  ? 75  TRP B CB    1 
ATOM   4582  C  CG    . TRP B 2 63  ? -45.376  -29.206 20.259  1.00 40.61  ? 75  TRP B CG    1 
ATOM   4583  C  CD1   . TRP B 2 63  ? -46.521  -29.027 19.540  1.00 40.61  ? 75  TRP B CD1   1 
ATOM   4584  C  CD2   . TRP B 2 63  ? -44.487  -28.156 19.865  1.00 40.61  ? 75  TRP B CD2   1 
ATOM   4585  N  NE1   . TRP B 2 63  ? -46.398  -27.930 18.722  1.00 40.61  ? 75  TRP B NE1   1 
ATOM   4586  C  CE2   . TRP B 2 63  ? -45.154  -27.375 18.905  1.00 40.61  ? 75  TRP B CE2   1 
ATOM   4587  C  CE3   . TRP B 2 63  ? -43.184  -27.798 20.232  1.00 40.61  ? 75  TRP B CE3   1 
ATOM   4588  C  CZ2   . TRP B 2 63  ? -44.569  -26.262 18.304  1.00 40.61  ? 75  TRP B CZ2   1 
ATOM   4589  C  CZ3   . TRP B 2 63  ? -42.605  -26.693 19.638  1.00 40.61  ? 75  TRP B CZ3   1 
ATOM   4590  C  CH2   . TRP B 2 63  ? -43.296  -25.938 18.685  1.00 40.61  ? 75  TRP B CH2   1 
ATOM   4591  N  N     . ASP B 2 64  ? -42.741  -33.020 21.367  1.00 56.22  ? 76  ASP B N     1 
ATOM   4592  C  CA    . ASP B 2 64  ? -41.979  -33.788 22.345  1.00 56.22  ? 76  ASP B CA    1 
ATOM   4593  C  C     . ASP B 2 64  ? -41.123  -32.857 23.192  1.00 56.22  ? 76  ASP B C     1 
ATOM   4594  O  O     . ASP B 2 64  ? -40.146  -32.290 22.709  1.00 56.22  ? 76  ASP B O     1 
ATOM   4595  C  CB    . ASP B 2 64  ? -41.091  -34.824 21.659  1.00 56.22  ? 76  ASP B CB    1 
ATOM   4596  C  CG    . ASP B 2 64  ? -40.265  -35.622 22.647  1.00 56.22  ? 76  ASP B CG    1 
ATOM   4597  O  OD1   . ASP B 2 64  ? -40.823  -36.057 23.675  1.00 56.22  ? 76  ASP B OD1   1 
ATOM   4598  O  OD2   . ASP B 2 64  ? -39.054  -35.801 22.404  1.00 56.22  ? 76  ASP B OD2   1 
ATOM   4599  N  N     . THR B 2 65  ? -41.490  -32.713 24.461  1.00 27.28  ? 77  THR B N     1 
ATOM   4600  C  CA    . THR B 2 65  ? -40.831  -31.769 25.358  1.00 27.28  ? 77  THR B CA    1 
ATOM   4601  C  C     . THR B 2 65  ? -39.593  -32.352 26.034  1.00 27.28  ? 77  THR B C     1 
ATOM   4602  O  O     . THR B 2 65  ? -39.335  -33.553 25.957  1.00 27.28  ? 77  THR B O     1 
ATOM   4603  C  CB    . THR B 2 65  ? -41.800  -31.277 26.448  1.00 27.28  ? 77  THR B CB    1 
ATOM   4604  O  OG1   . THR B 2 65  ? -42.204  -32.382 27.266  1.00 27.28  ? 77  THR B OG1   1 
ATOM   4605  C  CG2   . THR B 2 65  ? -43.030  -30.647 25.820  1.00 27.28  ? 77  THR B CG2   1 
ATOM   4606  N  N     . ALA B 2 66  ? -38.828  -31.484 26.691  1.00 32.70  ? 78  ALA B N     1 
ATOM   4607  C  CA    . ALA B 2 66  ? -37.696  -31.911 27.506  1.00 32.70  ? 78  ALA B CA    1 
ATOM   4608  C  C     . ALA B 2 66  ? -38.172  -32.159 28.931  1.00 32.70  ? 78  ALA B C     1 
ATOM   4609  O  O     . ALA B 2 66  ? -38.979  -31.395 29.462  1.00 32.70  ? 78  ALA B O     1 
ATOM   4610  C  CB    . ALA B 2 66  ? -36.604  -30.864 27.489  1.00 32.70  ? 78  ALA B CB    1 
ATOM   4611  N  N     . GLY B 2 67  ? -37.664  -33.217 29.553  1.00 55.23  ? 79  GLY B N     1 
ATOM   4612  C  CA    . GLY B 2 67  ? -38.169  -33.648 30.843  1.00 55.23  ? 79  GLY B CA    1 
ATOM   4613  C  C     . GLY B 2 67  ? -37.490  -33.062 32.067  1.00 55.23  ? 79  GLY B C     1 
ATOM   4614  O  O     . GLY B 2 67  ? -37.986  -33.218 33.184  1.00 55.23  ? 79  GLY B O     1 
ATOM   4615  N  N     . LEU B 2 68  ? -36.361  -32.390 31.865  1.00 50.44  ? 80  LEU B N     1 
ATOM   4616  C  CA    . LEU B 2 68  ? -35.589  -31.840 32.979  1.00 50.44  ? 80  LEU B CA    1 
ATOM   4617  C  C     . LEU B 2 68  ? -36.352  -30.751 33.737  1.00 50.44  ? 80  LEU B C     1 
ATOM   4618  O  O     . LEU B 2 68  ? -37.279  -30.145 33.202  1.00 50.44  ? 80  LEU B O     1 
ATOM   4619  C  CB    . LEU B 2 68  ? -34.229  -31.322 32.500  1.00 50.44  ? 80  LEU B CB    1 
ATOM   4620  C  CG    . LEU B 2 68  ? -33.145  -32.367 32.206  1.00 50.44  ? 80  LEU B CG    1 
ATOM   4621  C  CD1   . LEU B 2 68  ? -33.407  -33.120 30.908  1.00 50.44  ? 80  LEU B CD1   1 
ATOM   4622  C  CD2   . LEU B 2 68  ? -31.764  -31.729 32.179  1.00 50.44  ? 80  LEU B CD2   1 
ATOM   4623  N  N     . GLU B 2 69  ? -35.954  -30.517 34.985  1.00 64.18  ? 81  GLU B N     1 
ATOM   4624  C  CA    . GLU B 2 69  ? -36.645  -29.580 35.870  1.00 64.18  ? 81  GLU B CA    1 
ATOM   4625  C  C     . GLU B 2 69  ? -36.607  -28.140 35.358  1.00 64.18  ? 81  GLU B C     1 
ATOM   4626  O  O     . GLU B 2 69  ? -37.516  -27.352 35.621  1.00 64.18  ? 81  GLU B O     1 
ATOM   4627  C  CB    . GLU B 2 69  ? -36.053  -29.661 37.284  1.00 64.18  ? 81  GLU B CB    1 
ATOM   4628  C  CG    . GLU B 2 69  ? -36.655  -28.694 38.303  1.00 64.18  ? 81  GLU B CG    1 
ATOM   4629  C  CD    . GLU B 2 69  ? -38.085  -29.036 38.684  1.00 64.18  ? 81  GLU B CD    1 
ATOM   4630  O  OE1   . GLU B 2 69  ? -38.573  -30.118 38.294  1.00 64.18  ? 81  GLU B OE1   1 
ATOM   4631  O  OE2   . GLU B 2 69  ? -38.723  -28.221 39.383  1.00 64.18  ? 81  GLU B OE2   1 
ATOM   4632  N  N     . ARG B 2 70  ? -35.555  -27.805 34.620  1.00 40.37  ? 82  ARG B N     1 
ATOM   4633  C  CA    . ARG B 2 70  ? -35.370  -26.450 34.113  1.00 40.37  ? 82  ARG B CA    1 
ATOM   4634  C  C     . ARG B 2 70  ? -36.462  -26.070 33.113  1.00 40.37  ? 82  ARG B C     1 
ATOM   4635  O  O     . ARG B 2 70  ? -36.984  -24.955 33.143  1.00 40.37  ? 82  ARG B O     1 
ATOM   4636  C  CB    . ARG B 2 70  ? -33.990  -26.319 33.463  1.00 40.37  ? 82  ARG B CB    1 
ATOM   4637  C  CG    . ARG B 2 70  ? -33.500  -24.890 33.302  1.00 40.37  ? 82  ARG B CG    1 
ATOM   4638  C  CD    . ARG B 2 70  ? -32.111  -24.854 32.683  1.00 40.37  ? 82  ARG B CD    1 
ATOM   4639  N  NE    . ARG B 2 70  ? -31.539  -23.510 32.693  1.00 40.37  ? 82  ARG B NE    1 
ATOM   4640  C  CZ    . ARG B 2 70  ? -30.382  -23.185 32.126  1.00 40.37  ? 82  ARG B CZ    1 
ATOM   4641  N  NH1   . ARG B 2 70  ? -29.942  -21.936 32.187  1.00 40.37  ? 82  ARG B NH1   1 
ATOM   4642  N  NH2   . ARG B 2 70  ? -29.667  -24.105 31.495  1.00 40.37  ? 82  ARG B NH2   1 
ATOM   4643  N  N     . TYR B 2 71  ? -36.813  -27.013 32.243  1.00 39.99  ? 83  TYR B N     1 
ATOM   4644  C  CA    . TYR B 2 71  ? -37.770  -26.768 31.167  1.00 39.99  ? 83  TYR B CA    1 
ATOM   4645  C  C     . TYR B 2 71  ? -39.218  -26.720 31.658  1.00 39.99  ? 83  TYR B C     1 
ATOM   4646  O  O     . TYR B 2 71  ? -40.146  -26.606 30.859  1.00 39.99  ? 83  TYR B O     1 
ATOM   4647  C  CB    . TYR B 2 71  ? -37.629  -27.837 30.079  1.00 39.99  ? 83  TYR B CB    1 
ATOM   4648  C  CG    . TYR B 2 71  ? -36.242  -27.948 29.483  1.00 39.99  ? 83  TYR B CG    1 
ATOM   4649  C  CD1   . TYR B 2 71  ? -35.933  -27.341 28.275  1.00 39.99  ? 83  TYR B CD1   1 
ATOM   4650  C  CD2   . TYR B 2 71  ? -35.243  -28.667 30.126  1.00 39.99  ? 83  TYR B CD2   1 
ATOM   4651  C  CE1   . TYR B 2 71  ? -34.669  -27.441 27.727  1.00 39.99  ? 83  TYR B CE1   1 
ATOM   4652  C  CE2   . TYR B 2 71  ? -33.977  -28.772 29.587  1.00 39.99  ? 83  TYR B CE2   1 
ATOM   4653  C  CZ    . TYR B 2 71  ? -33.695  -28.158 28.387  1.00 39.99  ? 83  TYR B CZ    1 
ATOM   4654  O  OH    . TYR B 2 71  ? -32.435  -28.262 27.846  1.00 39.99  ? 83  TYR B OH    1 
ATOM   4655  N  N     . HIS B 2 72  ? -39.404  -26.808 32.971  1.00 65.80  ? 84  HIS B N     1 
ATOM   4656  C  CA    . HIS B 2 72  ? -40.737  -26.802 33.567  1.00 65.80  ? 84  HIS B CA    1 
ATOM   4657  C  C     . HIS B 2 72  ? -41.455  -25.470 33.368  1.00 65.80  ? 84  HIS B C     1 
ATOM   4658  O  O     . HIS B 2 72  ? -42.676  -25.431 33.222  1.00 65.80  ? 84  HIS B O     1 
ATOM   4659  C  CB    . HIS B 2 72  ? -40.650  -27.139 35.058  1.00 65.80  ? 84  HIS B CB    1 
ATOM   4660  C  CG    . HIS B 2 72  ? -41.928  -26.916 35.806  1.00 65.80  ? 84  HIS B CG    1 
ATOM   4661  N  ND1   . HIS B 2 72  ? -43.078  -27.626 35.542  1.00 65.80  ? 84  HIS B ND1   1 
ATOM   4662  C  CD2   . HIS B 2 72  ? -42.233  -26.063 36.811  1.00 65.80  ? 84  HIS B CD2   1 
ATOM   4663  C  CE1   . HIS B 2 72  ? -44.040  -27.218 36.352  1.00 65.80  ? 84  HIS B CE1   1 
ATOM   4664  N  NE2   . HIS B 2 72  ? -43.552  -26.270 37.132  1.00 65.80  ? 84  HIS B NE2   1 
ATOM   4665  N  N     . SER B 2 73  ? -40.691  -24.383 33.361  1.00 58.68  ? 85  SER B N     1 
ATOM   4666  C  CA    . SER B 2 73  ? -41.257  -23.046 33.211  1.00 58.68  ? 85  SER B CA    1 
ATOM   4667  C  C     . SER B 2 73  ? -41.693  -22.766 31.775  1.00 58.68  ? 85  SER B C     1 
ATOM   4668  O  O     . SER B 2 73  ? -42.436  -21.820 31.517  1.00 58.68  ? 85  SER B O     1 
ATOM   4669  C  CB    . SER B 2 73  ? -40.249  -21.991 33.668  1.00 58.68  ? 85  SER B CB    1 
ATOM   4670  O  OG    . SER B 2 73  ? -39.022  -22.126 32.975  1.00 58.68  ? 85  SER B OG    1 
ATOM   4671  N  N     . LEU B 2 74  ? -41.227  -23.593 30.846  1.00 35.82  ? 86  LEU B N     1 
ATOM   4672  C  CA    . LEU B 2 74  ? -41.551  -23.428 29.435  1.00 35.82  ? 86  LEU B CA    1 
ATOM   4673  C  C     . LEU B 2 74  ? -42.729  -24.313 29.031  1.00 35.82  ? 86  LEU B C     1 
ATOM   4674  O  O     . LEU B 2 74  ? -43.117  -24.351 27.866  1.00 35.82  ? 86  LEU B O     1 
ATOM   4675  C  CB    . LEU B 2 74  ? -40.327  -23.744 28.573  1.00 35.82  ? 86  LEU B CB    1 
ATOM   4676  C  CG    . LEU B 2 74  ? -39.133  -22.801 28.722  1.00 35.82  ? 86  LEU B CG    1 
ATOM   4677  C  CD1   . LEU B 2 74  ? -37.841  -23.501 28.347  1.00 35.82  ? 86  LEU B CD1   1 
ATOM   4678  C  CD2   . LEU B 2 74  ? -39.331  -21.567 27.865  1.00 35.82  ? 86  LEU B CD2   1 
ATOM   4679  N  N     . ALA B 2 75  ? -43.296  -25.016 30.006  1.00 32.79  ? 87  ALA B N     1 
ATOM   4680  C  CA    . ALA B 2 75  ? -44.396  -25.950 29.756  1.00 32.79  ? 87  ALA B CA    1 
ATOM   4681  C  C     . ALA B 2 75  ? -45.696  -25.342 29.198  1.00 32.79  ? 87  ALA B C     1 
ATOM   4682  O  O     . ALA B 2 75  ? -46.248  -25.876 28.233  1.00 32.79  ? 87  ALA B O     1 
ATOM   4683  C  CB    . ALA B 2 75  ? -44.680  -26.796 31.002  1.00 32.79  ? 87  ALA B CB    1 
ATOM   4684  N  N     . PRO B 2 76  ? -46.198  -24.240 29.798  1.00 16.05  ? 88  PRO B N     1 
ATOM   4685  C  CA    . PRO B 2 76  ? -47.474  -23.699 29.307  1.00 16.05  ? 88  PRO B CA    1 
ATOM   4686  C  C     . PRO B 2 76  ? -47.452  -23.283 27.835  1.00 16.05  ? 88  PRO B C     1 
ATOM   4687  O  O     . PRO B 2 76  ? -48.515  -23.188 27.224  1.00 16.05  ? 88  PRO B O     1 
ATOM   4688  C  CB    . PRO B 2 76  ? -47.693  -22.469 30.191  1.00 16.05  ? 88  PRO B CB    1 
ATOM   4689  C  CG    . PRO B 2 76  ? -46.951  -22.768 31.440  1.00 16.05  ? 88  PRO B CG    1 
ATOM   4690  C  CD    . PRO B 2 76  ? -45.728  -23.506 30.988  1.00 16.05  ? 88  PRO B CD    1 
ATOM   4691  N  N     . MET B 2 77  ? -46.269  -23.032 27.281  1.00 42.13  ? 89  MET B N     1 
ATOM   4692  C  CA    . MET B 2 77  ? -46.149  -22.729 25.859  1.00 42.13  ? 89  MET B CA    1 
ATOM   4693  C  C     . MET B 2 77  ? -46.510  -23.960 25.033  1.00 42.13  ? 89  MET B C     1 
ATOM   4694  O  O     . MET B 2 77  ? -47.055  -23.846 23.936  1.00 42.13  ? 89  MET B O     1 
ATOM   4695  C  CB    . MET B 2 77  ? -44.733  -22.254 25.516  1.00 42.13  ? 89  MET B CB    1 
ATOM   4696  C  CG    . MET B 2 77  ? -44.514  -21.943 24.037  1.00 42.13  ? 89  MET B CG    1 
ATOM   4697  S  SD    . MET B 2 77  ? -42.872  -21.300 23.646  1.00 42.13  ? 89  MET B SD    1 
ATOM   4698  C  CE    . MET B 2 77  ? -41.839  -22.698 24.081  1.00 42.13  ? 89  MET B CE    1 
ATOM   4699  N  N     . TYR B 2 78  ? -46.224  -25.138 25.578  1.00 39.73  ? 90  TYR B N     1 
ATOM   4700  C  CA    . TYR B 2 78  ? -46.407  -26.384 24.837  1.00 39.73  ? 90  TYR B CA    1 
ATOM   4701  C  C     . TYR B 2 78  ? -47.808  -26.997 24.935  1.00 39.73  ? 90  TYR B C     1 
ATOM   4702  O  O     . TYR B 2 78  ? -48.240  -27.692 24.016  1.00 39.73  ? 90  TYR B O     1 
ATOM   4703  C  CB    . TYR B 2 78  ? -45.340  -27.409 25.236  1.00 39.73  ? 90  TYR B CB    1 
ATOM   4704  C  CG    . TYR B 2 78  ? -43.937  -26.973 24.887  1.00 39.73  ? 90  TYR B CG    1 
ATOM   4705  C  CD1   . TYR B 2 78  ? -43.553  -26.807 23.565  1.00 39.73  ? 90  TYR B CD1   1 
ATOM   4706  C  CD2   . TYR B 2 78  ? -42.997  -26.727 25.877  1.00 39.73  ? 90  TYR B CD2   1 
ATOM   4707  C  CE1   . TYR B 2 78  ? -42.276  -26.406 23.239  1.00 39.73  ? 90  TYR B CE1   1 
ATOM   4708  C  CE2   . TYR B 2 78  ? -41.715  -26.326 25.559  1.00 39.73  ? 90  TYR B CE2   1 
ATOM   4709  C  CZ    . TYR B 2 78  ? -41.361  -26.168 24.238  1.00 39.73  ? 90  TYR B CZ    1 
ATOM   4710  O  OH    . TYR B 2 78  ? -40.088  -25.770 23.909  1.00 39.73  ? 90  TYR B OH    1 
ATOM   4711  N  N     . TYR B 2 79  ? -48.516  -26.746 26.034  1.00 37.15  ? 91  TYR B N     1 
ATOM   4712  C  CA    . TYR B 2 79  ? -49.853  -27.319 26.196  1.00 37.15  ? 91  TYR B CA    1 
ATOM   4713  C  C     . TYR B 2 79  ? -50.997  -26.299 26.144  1.00 37.15  ? 91  TYR B C     1 
ATOM   4714  O  O     . TYR B 2 79  ? -52.138  -26.633 26.461  1.00 37.15  ? 91  TYR B O     1 
ATOM   4715  C  CB    . TYR B 2 79  ? -49.948  -28.191 27.464  1.00 37.15  ? 91  TYR B CB    1 
ATOM   4716  C  CG    . TYR B 2 79  ? -49.788  -27.468 28.794  1.00 37.15  ? 91  TYR B CG    1 
ATOM   4717  C  CD1   . TYR B 2 79  ? -50.750  -26.572 29.247  1.00 37.15  ? 91  TYR B CD1   1 
ATOM   4718  C  CD2   . TYR B 2 79  ? -48.699  -27.722 29.617  1.00 37.15  ? 91  TYR B CD2   1 
ATOM   4719  C  CE1   . TYR B 2 79  ? -50.614  -25.925 30.458  1.00 37.15  ? 91  TYR B CE1   1 
ATOM   4720  C  CE2   . TYR B 2 79  ? -48.558  -27.082 30.835  1.00 37.15  ? 91  TYR B CE2   1 
ATOM   4721  C  CZ    . TYR B 2 79  ? -49.519  -26.185 31.249  1.00 37.15  ? 91  TYR B CZ    1 
ATOM   4722  O  OH    . TYR B 2 79  ? -49.389  -25.541 32.457  1.00 37.15  ? 91  TYR B OH    1 
ATOM   4723  N  N     . ARG B 2 80  ? -50.697  -25.067 25.740  1.00 54.97  ? 92  ARG B N     1 
ATOM   4724  C  CA    . ARG B 2 80  ? -51.706  -24.010 25.750  1.00 54.97  ? 92  ARG B CA    1 
ATOM   4725  C  C     . ARG B 2 80  ? -52.819  -24.269 24.741  1.00 54.97  ? 92  ARG B C     1 
ATOM   4726  O  O     . ARG B 2 80  ? -53.992  -24.016 25.019  1.00 54.97  ? 92  ARG B O     1 
ATOM   4727  C  CB    . ARG B 2 80  ? -51.077  -22.641 25.488  1.00 54.97  ? 92  ARG B CB    1 
ATOM   4728  C  CG    . ARG B 2 80  ? -51.815  -21.486 26.159  1.00 54.97  ? 92  ARG B CG    1 
ATOM   4729  C  CD    . ARG B 2 80  ? -51.416  -20.130 25.585  1.00 54.97  ? 92  ARG B CD    1 
ATOM   4730  N  NE    . ARG B 2 80  ? -49.969  -19.945 25.518  1.00 54.97  ? 92  ARG B NE    1 
ATOM   4731  C  CZ    . ARG B 2 80  ? -49.258  -20.027 24.398  1.00 54.97  ? 92  ARG B CZ    1 
ATOM   4732  N  NH1   . ARG B 2 80  ? -49.860  -20.291 23.247  1.00 54.97  ? 92  ARG B NH1   1 
ATOM   4733  N  NH2   . ARG B 2 80  ? -47.947  -19.847 24.425  1.00 54.97  ? 92  ARG B NH2   1 
ATOM   4734  N  N     . GLY B 2 81  ? -52.449  -24.775 23.570  1.00 52.63  ? 93  GLY B N     1 
ATOM   4735  C  CA    . GLY B 2 81  ? -53.424  -25.084 22.541  1.00 52.63  ? 93  GLY B CA    1 
ATOM   4736  C  C     . GLY B 2 81  ? -53.535  -26.573 22.285  1.00 52.63  ? 93  GLY B C     1 
ATOM   4737  O  O     . GLY B 2 81  ? -54.104  -27.000 21.282  1.00 52.63  ? 93  GLY B O     1 
ATOM   4738  N  N     . ALA B 2 82  ? -52.987  -27.366 23.198  1.00 48.30  ? 94  ALA B N     1 
ATOM   4739  C  CA    . ALA B 2 82  ? -53.032  -28.815 23.072  1.00 48.30  ? 94  ALA B CA    1 
ATOM   4740  C  C     . ALA B 2 82  ? -54.433  -29.351 23.337  1.00 48.30  ? 94  ALA B C     1 
ATOM   4741  O  O     . ALA B 2 82  ? -55.080  -28.962 24.309  1.00 48.30  ? 94  ALA B O     1 
ATOM   4742  C  CB    . ALA B 2 82  ? -52.041  -29.452 24.022  1.00 48.30  ? 94  ALA B CB    1 
ATOM   4743  N  N     . GLN B 2 83  ? -54.896  -30.242 22.465  1.00 69.71  ? 95  GLN B N     1 
ATOM   4744  C  CA    . GLN B 2 83  ? -56.168  -30.924 22.665  1.00 69.71  ? 95  GLN B CA    1 
ATOM   4745  C  C     . GLN B 2 83  ? -55.921  -32.300 23.269  1.00 69.71  ? 95  GLN B C     1 
ATOM   4746  O  O     . GLN B 2 83  ? -56.860  -33.038 23.571  1.00 69.71  ? 95  GLN B O     1 
ATOM   4747  C  CB    . GLN B 2 83  ? -56.928  -31.064 21.345  1.00 69.71  ? 95  GLN B CB    1 
ATOM   4748  C  CG    . GLN B 2 83  ? -57.321  -29.746 20.694  1.00 69.71  ? 95  GLN B CG    1 
ATOM   4749  C  CD    . GLN B 2 83  ? -56.226  -29.174 19.816  1.00 69.71  ? 95  GLN B CD    1 
ATOM   4750  O  OE1   . GLN B 2 83  ? -55.164  -29.774 19.658  1.00 69.71  ? 95  GLN B OE1   1 
ATOM   4751  N  NE2   . GLN B 2 83  ? -56.483  -28.009 19.234  1.00 69.71  ? 95  GLN B NE2   1 
ATOM   4752  N  N     . ALA B 2 84  ? -54.645  -32.636 23.439  1.00 42.33  ? 96  ALA B N     1 
ATOM   4753  C  CA    . ALA B 2 84  ? -54.249  -33.925 23.991  1.00 42.33  ? 96  ALA B CA    1 
ATOM   4754  C  C     . ALA B 2 84  ? -52.886  -33.826 24.663  1.00 42.33  ? 96  ALA B C     1 
ATOM   4755  O  O     . ALA B 2 84  ? -52.059  -32.996 24.285  1.00 42.33  ? 96  ALA B O     1 
ATOM   4756  C  CB    . ALA B 2 84  ? -54.220  -34.977 22.900  1.00 42.33  ? 96  ALA B CB    1 
ATOM   4757  N  N     . ALA B 2 85  ? -52.654  -34.681 25.655  1.00 56.15  ? 97  ALA B N     1 
ATOM   4758  C  CA    . ALA B 2 85  ? -51.376  -34.708 26.362  1.00 56.15  ? 97  ALA B CA    1 
ATOM   4759  C  C     . ALA B 2 85  ? -51.048  -36.107 26.867  1.00 56.15  ? 97  ALA B C     1 
ATOM   4760  O  O     . ALA B 2 85  ? -51.843  -36.720 27.578  1.00 56.15  ? 97  ALA B O     1 
ATOM   4761  C  CB    . ALA B 2 85  ? -51.388  -33.723 27.516  1.00 56.15  ? 97  ALA B CB    1 
ATOM   4762  N  N     . ILE B 2 86  ? -49.873  -36.606 26.497  1.00 24.54  ? 98  ILE B N     1 
ATOM   4763  C  CA    . ILE B 2 86  ? -49.411  -37.905 26.969  1.00 24.54  ? 98  ILE B CA    1 
ATOM   4764  C  C     . ILE B 2 86  ? -48.408  -37.729 28.105  1.00 24.54  ? 98  ILE B C     1 
ATOM   4765  O  O     . ILE B 2 86  ? -47.299  -37.242 27.889  1.00 24.54  ? 98  ILE B O     1 
ATOM   4766  C  CB    . ILE B 2 86  ? -48.741  -38.713 25.843  1.00 24.54  ? 98  ILE B CB    1 
ATOM   4767  C  CG1   . ILE B 2 86  ? -49.635  -38.764 24.606  1.00 24.54  ? 98  ILE B CG1   1 
ATOM   4768  C  CG2   . ILE B 2 86  ? -48.412  -40.119 26.315  1.00 24.54  ? 98  ILE B CG2   1 
ATOM   4769  C  CD1   . ILE B 2 86  ? -49.016  -39.514 23.443  1.00 24.54  ? 98  ILE B CD1   1 
ATOM   4770  N  N     . VAL B 2 87  ? -48.800  -38.120 29.313  1.00 24.49  ? 99  VAL B N     1 
ATOM   4771  C  CA    . VAL B 2 87  ? -47.893  -38.071 30.452  1.00 24.49  ? 99  VAL B CA    1 
ATOM   4772  C  C     . VAL B 2 87  ? -47.198  -39.421 30.597  1.00 24.49  ? 99  VAL B C     1 
ATOM   4773  O  O     . VAL B 2 87  ? -47.828  -40.417 30.952  1.00 24.49  ? 99  VAL B O     1 
ATOM   4774  C  CB    . VAL B 2 87  ? -48.635  -37.716 31.750  1.00 24.49  ? 99  VAL B CB    1 
ATOM   4775  C  CG1   . VAL B 2 87  ? -47.645  -37.393 32.851  1.00 24.49  ? 99  VAL B CG1   1 
ATOM   4776  C  CG2   . VAL B 2 87  ? -49.559  -36.534 31.519  1.00 24.49  ? 99  VAL B CG2   1 
ATOM   4777  N  N     . VAL B 2 88  ? -45.898  -39.448 30.316  1.00 31.28  ? 100 VAL B N     1 
ATOM   4778  C  CA    . VAL B 2 88  ? -45.139  -40.695 30.306  1.00 31.28  ? 100 VAL B CA    1 
ATOM   4779  C  C     . VAL B 2 88  ? -44.275  -40.855 31.554  1.00 31.28  ? 100 VAL B C     1 
ATOM   4780  O  O     . VAL B 2 88  ? -43.497  -39.964 31.901  1.00 31.28  ? 100 VAL B O     1 
ATOM   4781  C  CB    . VAL B 2 88  ? -44.234  -40.783 29.064  1.00 31.28  ? 100 VAL B CB    1 
ATOM   4782  C  CG1   . VAL B 2 88  ? -43.520  -42.125 29.014  1.00 31.28  ? 100 VAL B CG1   1 
ATOM   4783  C  CG2   . VAL B 2 88  ? -45.049  -40.570 27.803  1.00 31.28  ? 100 VAL B CG2   1 
ATOM   4784  N  N     . TYR B 2 89  ? -44.416  -41.995 32.225  1.00 79.74  ? 101 TYR B N     1 
ATOM   4785  C  CA    . TYR B 2 89  ? -43.558  -42.317 33.359  1.00 79.74  ? 101 TYR B CA    1 
ATOM   4786  C  C     . TYR B 2 89  ? -42.824  -43.635 33.138  1.00 79.74  ? 101 TYR B C     1 
ATOM   4787  O  O     . TYR B 2 89  ? -43.026  -44.309 32.127  1.00 79.74  ? 101 TYR B O     1 
ATOM   4788  C  CB    . TYR B 2 89  ? -44.354  -42.350 34.668  1.00 79.74  ? 101 TYR B CB    1 
ATOM   4789  C  CG    . TYR B 2 89  ? -45.270  -43.546 34.842  1.00 79.74  ? 101 TYR B CG    1 
ATOM   4790  C  CD1   . TYR B 2 89  ? -46.610  -43.478 34.487  1.00 79.74  ? 101 TYR B CD1   1 
ATOM   4791  C  CD2   . TYR B 2 89  ? -44.800  -44.735 35.390  1.00 79.74  ? 101 TYR B CD2   1 
ATOM   4792  C  CE1   . TYR B 2 89  ? -47.449  -44.562 34.655  1.00 79.74  ? 101 TYR B CE1   1 
ATOM   4793  C  CE2   . TYR B 2 89  ? -45.630  -45.821 35.558  1.00 79.74  ? 101 TYR B CE2   1 
ATOM   4794  C  CZ    . TYR B 2 89  ? -46.952  -45.730 35.190  1.00 79.74  ? 101 TYR B CZ    1 
ATOM   4795  O  OH    . TYR B 2 89  ? -47.779  -46.814 35.359  1.00 79.74  ? 101 TYR B OH    1 
ATOM   4796  N  N     . ASP B 2 90  ? -41.974  -43.995 34.094  1.00 75.89  ? 102 ASP B N     1 
ATOM   4797  C  CA    . ASP B 2 90  ? -41.199  -45.226 34.024  1.00 75.89  ? 102 ASP B CA    1 
ATOM   4798  C  C     . ASP B 2 90  ? -41.706  -46.204 35.078  1.00 75.89  ? 102 ASP B C     1 
ATOM   4799  O  O     . ASP B 2 90  ? -41.938  -45.821 36.224  1.00 75.89  ? 102 ASP B O     1 
ATOM   4800  C  CB    . ASP B 2 90  ? -39.721  -44.917 34.265  1.00 75.89  ? 102 ASP B CB    1 
ATOM   4801  C  CG    . ASP B 2 90  ? -38.812  -46.081 33.923  1.00 75.89  ? 102 ASP B CG    1 
ATOM   4802  O  OD1   . ASP B 2 90  ? -39.321  -47.190 33.660  1.00 75.89  ? 102 ASP B OD1   1 
ATOM   4803  O  OD2   . ASP B 2 90  ? -37.578  -45.886 33.926  1.00 75.89  ? 102 ASP B OD2   1 
ATOM   4804  N  N     . ILE B 2 91  ? -41.879  -47.465 34.694  1.00 88.29  ? 103 ILE B N     1 
ATOM   4805  C  CA    . ILE B 2 91  ? -42.326  -48.482 35.640  1.00 88.29  ? 103 ILE B CA    1 
ATOM   4806  C  C     . ILE B 2 91  ? -41.149  -49.037 36.434  1.00 88.29  ? 103 ILE B C     1 
ATOM   4807  O  O     . ILE B 2 91  ? -41.335  -49.773 37.401  1.00 88.29  ? 103 ILE B O     1 
ATOM   4808  C  CB    . ILE B 2 91  ? -43.071  -49.643 34.948  1.00 88.29  ? 103 ILE B CB    1 
ATOM   4809  C  CG1   . ILE B 2 91  ? -42.084  -50.627 34.320  1.00 88.29  ? 103 ILE B CG1   1 
ATOM   4810  C  CG2   . ILE B 2 91  ? -44.053  -49.112 33.915  1.00 88.29  ? 103 ILE B CG2   1 
ATOM   4811  C  CD1   . ILE B 2 91  ? -42.722  -51.929 33.887  1.00 88.29  ? 103 ILE B CD1   1 
ATOM   4812  N  N     . THR B 2 92  ? -39.938  -48.680 36.015  1.00 69.01  ? 104 THR B N     1 
ATOM   4813  C  CA    . THR B 2 92  ? -38.730  -49.076 36.730  1.00 69.01  ? 104 THR B CA    1 
ATOM   4814  C  C     . THR B 2 92  ? -38.281  -47.956 37.663  1.00 69.01  ? 104 THR B C     1 
ATOM   4815  O  O     . THR B 2 92  ? -37.182  -47.996 38.218  1.00 69.01  ? 104 THR B O     1 
ATOM   4816  C  CB    . THR B 2 92  ? -37.580  -49.419 35.761  1.00 69.01  ? 104 THR B CB    1 
ATOM   4817  O  OG1   . THR B 2 92  ? -37.055  -48.215 35.189  1.00 69.01  ? 104 THR B OG1   1 
ATOM   4818  C  CG2   . THR B 2 92  ? -38.072  -50.333 34.653  1.00 69.01  ? 104 THR B CG2   1 
ATOM   4819  N  N     . ASN B 2 93  ? -39.143  -46.958 37.827  1.00 39.03  ? 105 ASN B N     1 
ATOM   4820  C  CA    . ASN B 2 93  ? -38.866  -45.826 38.704  1.00 39.03  ? 105 ASN B CA    1 
ATOM   4821  C  C     . ASN B 2 93  ? -40.164  -45.271 39.285  1.00 39.03  ? 105 ASN B C     1 
ATOM   4822  O  O     . ASN B 2 93  ? -40.960  -44.658 38.575  1.00 39.03  ? 105 ASN B O     1 
ATOM   4823  C  CB    . ASN B 2 93  ? -38.110  -44.732 37.942  1.00 39.03  ? 105 ASN B CB    1 
ATOM   4824  C  CG    . ASN B 2 93  ? -37.506  -43.679 38.860  1.00 39.03  ? 105 ASN B CG    1 
ATOM   4825  O  OD1   . ASN B 2 93  ? -38.089  -43.311 39.879  1.00 39.03  ? 105 ASN B OD1   1 
ATOM   4826  N  ND2   . ASN B 2 93  ? -36.327  -43.189 38.495  1.00 39.03  ? 105 ASN B ND2   1 
ATOM   4827  N  N     . THR B 2 94  ? -40.366  -45.488 40.581  1.00 69.66  ? 106 THR B N     1 
ATOM   4828  C  CA    . THR B 2 94  ? -41.578  -45.048 41.266  1.00 69.66  ? 106 THR B CA    1 
ATOM   4829  C  C     . THR B 2 94  ? -41.732  -43.525 41.233  1.00 69.66  ? 106 THR B C     1 
ATOM   4830  O  O     . THR B 2 94  ? -42.845  -43.007 41.125  1.00 69.66  ? 106 THR B O     1 
ATOM   4831  C  CB    . THR B 2 94  ? -41.595  -45.537 42.730  1.00 69.66  ? 106 THR B CB    1 
ATOM   4832  O  OG1   . THR B 2 94  ? -41.357  -46.950 42.767  1.00 69.66  ? 106 THR B OG1   1 
ATOM   4833  C  CG2   . THR B 2 94  ? -42.933  -45.235 43.389  1.00 69.66  ? 106 THR B CG2   1 
ATOM   4834  N  N     . ASP B 2 95  ? -40.608  -42.818 41.313  1.00 68.05  ? 107 ASP B N     1 
ATOM   4835  C  CA    . ASP B 2 95  ? -40.615  -41.359 41.362  1.00 68.05  ? 107 ASP B CA    1 
ATOM   4836  C  C     . ASP B 2 95  ? -41.065  -40.712 40.053  1.00 68.05  ? 107 ASP B C     1 
ATOM   4837  O  O     . ASP B 2 95  ? -41.704  -39.660 40.065  1.00 68.05  ? 107 ASP B O     1 
ATOM   4838  C  CB    . ASP B 2 95  ? -39.241  -40.827 41.771  1.00 68.05  ? 107 ASP B CB    1 
ATOM   4839  C  CG    . ASP B 2 95  ? -38.908  -41.126 43.221  1.00 68.05  ? 107 ASP B CG    1 
ATOM   4840  O  OD1   . ASP B 2 95  ? -39.846  -41.262 44.034  1.00 68.05  ? 107 ASP B OD1   1 
ATOM   4841  O  OD2   . ASP B 2 95  ? -37.706  -41.221 43.548  1.00 68.05  ? 107 ASP B OD2   1 
ATOM   4842  N  N     . THR B 2 96  ? -40.722  -41.335 38.929  1.00 54.11  ? 108 THR B N     1 
ATOM   4843  C  CA    . THR B 2 96  ? -41.171  -40.854 37.626  1.00 54.11  ? 108 THR B CA    1 
ATOM   4844  C  C     . THR B 2 96  ? -42.693  -40.876 37.557  1.00 54.11  ? 108 THR B C     1 
ATOM   4845  O  O     . THR B 2 96  ? -43.317  -39.952 37.040  1.00 54.11  ? 108 THR B O     1 
ATOM   4846  C  CB    . THR B 2 96  ? -40.600  -41.699 36.474  1.00 54.11  ? 108 THR B CB    1 
ATOM   4847  O  OG1   . THR B 2 96  ? -40.933  -43.076 36.681  1.00 54.11  ? 108 THR B OG1   1 
ATOM   4848  C  CG2   . THR B 2 96  ? -39.090  -41.553 36.398  1.00 54.11  ? 108 THR B CG2   1 
ATOM   4849  N  N     . PHE B 2 97  ? -43.281  -41.943 38.088  1.00 62.64  ? 109 PHE B N     1 
ATOM   4850  C  CA    . PHE B 2 97  ? -44.730  -42.065 38.179  1.00 62.64  ? 109 PHE B CA    1 
ATOM   4851  C  C     . PHE B 2 97  ? -45.291  -41.038 39.154  1.00 62.64  ? 109 PHE B C     1 
ATOM   4852  O  O     . PHE B 2 97  ? -46.374  -40.493 38.945  1.00 62.64  ? 109 PHE B O     1 
ATOM   4853  C  CB    . PHE B 2 97  ? -45.114  -43.481 38.613  1.00 62.64  ? 109 PHE B CB    1 
ATOM   4854  C  CG    . PHE B 2 97  ? -46.574  -43.650 38.920  1.00 62.64  ? 109 PHE B CG    1 
ATOM   4855  C  CD1   . PHE B 2 97  ? -47.540  -43.330 37.978  1.00 62.64  ? 109 PHE B CD1   1 
ATOM   4856  C  CD2   . PHE B 2 97  ? -46.980  -44.143 40.149  1.00 62.64  ? 109 PHE B CD2   1 
ATOM   4857  C  CE1   . PHE B 2 97  ? -48.884  -43.488 38.263  1.00 62.64  ? 109 PHE B CE1   1 
ATOM   4858  C  CE2   . PHE B 2 97  ? -48.320  -44.306 40.439  1.00 62.64  ? 109 PHE B CE2   1 
ATOM   4859  C  CZ    . PHE B 2 97  ? -49.274  -43.977 39.495  1.00 62.64  ? 109 PHE B CZ    1 
ATOM   4860  N  N     . ALA B 2 98  ? -44.540  -40.776 40.218  1.00 51.66  ? 110 ALA B N     1 
ATOM   4861  C  CA    . ALA B 2 98  ? -44.939  -39.791 41.213  1.00 51.66  ? 110 ALA B CA    1 
ATOM   4862  C  C     . ALA B 2 98  ? -44.896  -38.382 40.634  1.00 51.66  ? 110 ALA B C     1 
ATOM   4863  O  O     . ALA B 2 98  ? -45.653  -37.507 41.053  1.00 51.66  ? 110 ALA B O     1 
ATOM   4864  C  CB    . ALA B 2 98  ? -44.048  -39.890 42.437  1.00 51.66  ? 110 ALA B CB    1 
ATOM   4865  N  N     . ARG B 2 99  ? -44.001  -38.167 39.674  1.00 79.86  ? 111 ARG B N     1 
ATOM   4866  C  CA    . ARG B 2 99  ? -43.888  -36.877 39.001  1.00 79.86  ? 111 ARG B CA    1 
ATOM   4867  C  C     . ARG B 2 99  ? -45.028  -36.702 38.006  1.00 79.86  ? 111 ARG B C     1 
ATOM   4868  O  O     . ARG B 2 99  ? -45.542  -35.600 37.820  1.00 79.86  ? 111 ARG B O     1 
ATOM   4869  C  CB    . ARG B 2 99  ? -42.544  -36.765 38.279  1.00 79.86  ? 111 ARG B CB    1 
ATOM   4870  C  CG    . ARG B 2 99  ? -42.314  -35.428 37.585  1.00 79.86  ? 111 ARG B CG    1 
ATOM   4871  C  CD    . ARG B 2 99  ? -42.272  -34.282 38.586  1.00 79.86  ? 111 ARG B CD    1 
ATOM   4872  N  NE    . ARG B 2 99  ? -41.907  -33.013 37.962  1.00 79.86  ? 111 ARG B NE    1 
ATOM   4873  C  CZ    . ARG B 2 99  ? -42.782  -32.114 37.523  1.00 79.86  ? 111 ARG B CZ    1 
ATOM   4874  N  NH1   . ARG B 2 99  ? -44.083  -32.338 37.640  1.00 79.86  ? 111 ARG B NH1   1 
ATOM   4875  N  NH2   . ARG B 2 99  ? -42.356  -30.988 36.969  1.00 79.86  ? 111 ARG B NH2   1 
ATOM   4876  N  N     . ALA B 2 100 ? -45.416  -37.805 37.371  1.00 38.29  ? 112 ALA B N     1 
ATOM   4877  C  CA    . ALA B 2 100 ? -46.509  -37.807 36.406  1.00 38.29  ? 112 ALA B CA    1 
ATOM   4878  C  C     . ALA B 2 100 ? -47.809  -37.332 37.045  1.00 38.29  ? 112 ALA B C     1 
ATOM   4879  O  O     . ALA B 2 100 ? -48.648  -36.721 36.383  1.00 38.29  ? 112 ALA B O     1 
ATOM   4880  C  CB    . ALA B 2 100 ? -46.683  -39.193 35.818  1.00 38.29  ? 112 ALA B CB    1 
ATOM   4881  N  N     . LYS B 2 101 ? -47.969  -37.623 38.333  1.00 50.20  ? 113 LYS B N     1 
ATOM   4882  C  CA    . LYS B 2 101 ? -49.137  -37.176 39.083  1.00 50.20  ? 113 LYS B CA    1 
ATOM   4883  C  C     . LYS B 2 101 ? -49.180  -35.654 39.173  1.00 50.20  ? 113 LYS B C     1 
ATOM   4884  O  O     . LYS B 2 101 ? -50.254  -35.054 39.180  1.00 50.20  ? 113 LYS B O     1 
ATOM   4885  C  CB    . LYS B 2 101 ? -49.133  -37.774 40.490  1.00 50.20  ? 113 LYS B CB    1 
ATOM   4886  C  CG    . LYS B 2 101 ? -49.172  -39.293 40.532  1.00 50.20  ? 113 LYS B CG    1 
ATOM   4887  C  CD    . LYS B 2 101 ? -49.235  -39.791 41.969  1.00 50.20  ? 113 LYS B CD    1 
ATOM   4888  C  CE    . LYS B 2 101 ? -49.237  -41.308 42.036  1.00 50.20  ? 113 LYS B CE    1 
ATOM   4889  N  NZ    . LYS B 2 101 ? -49.222  -41.800 43.443  1.00 50.20  ? 113 LYS B NZ    1 
ATOM   4890  N  N     . ASN B 2 102 ? -48.006  -35.036 39.246  1.00 57.80  ? 114 ASN B N     1 
ATOM   4891  C  CA    . ASN B 2 102 ? -47.914  -33.583 39.309  1.00 57.80  ? 114 ASN B CA    1 
ATOM   4892  C  C     . ASN B 2 102 ? -48.227  -32.933 37.966  1.00 57.80  ? 114 ASN B C     1 
ATOM   4893  O  O     . ASN B 2 102 ? -48.853  -31.877 37.915  1.00 57.80  ? 114 ASN B O     1 
ATOM   4894  C  CB    . ASN B 2 102 ? -46.535  -33.146 39.806  1.00 57.80  ? 114 ASN B CB    1 
ATOM   4895  C  CG    . ASN B 2 102 ? -46.327  -33.433 41.281  1.00 57.80  ? 114 ASN B CG    1 
ATOM   4896  O  OD1   . ASN B 2 102 ? -47.285  -33.564 42.041  1.00 57.80  ? 114 ASN B OD1   1 
ATOM   4897  N  ND2   . ASN B 2 102 ? -45.068  -33.524 41.693  1.00 57.80  ? 114 ASN B ND2   1 
ATOM   4898  N  N     . TRP B 2 103 ? -47.788  -33.567 36.883  1.00 63.29  ? 115 TRP B N     1 
ATOM   4899  C  CA    . TRP B 2 103 ? -48.071  -33.073 35.540  1.00 63.29  ? 115 TRP B CA    1 
ATOM   4900  C  C     . TRP B 2 103 ? -49.566  -33.081 35.251  1.00 63.29  ? 115 TRP B C     1 
ATOM   4901  O  O     . TRP B 2 103 ? -50.120  -32.091 34.774  1.00 63.29  ? 115 TRP B O     1 
ATOM   4902  C  CB    . TRP B 2 103 ? -47.336  -33.900 34.484  1.00 63.29  ? 115 TRP B CB    1 
ATOM   4903  C  CG    . TRP B 2 103 ? -45.896  -33.531 34.330  1.00 63.29  ? 115 TRP B CG    1 
ATOM   4904  C  CD1   . TRP B 2 103 ? -44.814  -34.341 34.522  1.00 63.29  ? 115 TRP B CD1   1 
ATOM   4905  C  CD2   . TRP B 2 103 ? -45.376  -32.251 33.956  1.00 63.29  ? 115 TRP B CD2   1 
ATOM   4906  N  NE1   . TRP B 2 103 ? -43.654  -33.644 34.286  1.00 63.29  ? 115 TRP B NE1   1 
ATOM   4907  C  CE2   . TRP B 2 103 ? -43.974  -32.353 33.937  1.00 63.29  ? 115 TRP B CE2   1 
ATOM   4908  C  CE3   . TRP B 2 103 ? -45.963  -31.023 33.633  1.00 63.29  ? 115 TRP B CE3   1 
ATOM   4909  C  CZ2   . TRP B 2 103 ? -43.148  -31.282 33.611  1.00 63.29  ? 115 TRP B CZ2   1 
ATOM   4910  C  CZ3   . TRP B 2 103 ? -45.145  -29.960 33.310  1.00 63.29  ? 115 TRP B CZ3   1 
ATOM   4911  C  CH2   . TRP B 2 103 ? -43.753  -30.094 33.300  1.00 63.29  ? 115 TRP B CH2   1 
ATOM   4912  N  N     . VAL B 2 104 ? -50.207  -34.210 35.534  1.00 78.55  ? 116 VAL B N     1 
ATOM   4913  C  CA    . VAL B 2 104 ? -51.649  -34.347 35.369  1.00 78.55  ? 116 VAL B CA    1 
ATOM   4914  C  C     . VAL B 2 104 ? -52.383  -33.289 36.185  1.00 78.55  ? 116 VAL B C     1 
ATOM   4915  O  O     . VAL B 2 104 ? -53.240  -32.575 35.665  1.00 78.55  ? 116 VAL B O     1 
ATOM   4916  C  CB    . VAL B 2 104 ? -52.130  -35.742 35.805  1.00 78.55  ? 116 VAL B CB    1 
ATOM   4917  C  CG1   . VAL B 2 104 ? -53.648  -35.802 35.831  1.00 78.55  ? 116 VAL B CG1   1 
ATOM   4918  C  CG2   . VAL B 2 104 ? -51.566  -36.808 34.883  1.00 78.55  ? 116 VAL B CG2   1 
ATOM   4919  N  N     . LYS B 2 105 ? -52.026  -33.183 37.460  1.00 50.79  ? 117 LYS B N     1 
ATOM   4920  C  CA    . LYS B 2 105 ? -52.657  -32.224 38.355  1.00 50.79  ? 117 LYS B CA    1 
ATOM   4921  C  C     . LYS B 2 105 ? -52.370  -30.790 37.918  1.00 50.79  ? 117 LYS B C     1 
ATOM   4922  O  O     . LYS B 2 105 ? -53.161  -29.886 38.179  1.00 50.79  ? 117 LYS B O     1 
ATOM   4923  C  CB    . LYS B 2 105 ? -52.200  -32.452 39.798  1.00 50.79  ? 117 LYS B CB    1 
ATOM   4924  C  CG    . LYS B 2 105 ? -53.106  -31.825 40.847  1.00 50.79  ? 117 LYS B CG    1 
ATOM   4925  C  CD    . LYS B 2 105 ? -52.695  -32.238 42.254  1.00 50.79  ? 117 LYS B CD    1 
ATOM   4926  C  CE    . LYS B 2 105 ? -53.654  -31.682 43.295  1.00 50.79  ? 117 LYS B CE    1 
ATOM   4927  N  NZ    . LYS B 2 105 ? -53.275  -32.079 44.679  1.00 50.79  ? 117 LYS B NZ    1 
ATOM   4928  N  N     . GLU B 2 106 ? -51.240  -30.586 37.247  1.00 88.58  ? 118 GLU B N     1 
ATOM   4929  C  CA    . GLU B 2 106 ? -50.912  -29.275 36.693  1.00 88.58  ? 118 GLU B CA    1 
ATOM   4930  C  C     . GLU B 2 106 ? -51.652  -29.065 35.377  1.00 88.58  ? 118 GLU B C     1 
ATOM   4931  O  O     . GLU B 2 106 ? -52.084  -27.954 35.070  1.00 88.58  ? 118 GLU B O     1 
ATOM   4932  C  CB    . GLU B 2 106 ? -49.403  -29.127 36.481  1.00 88.58  ? 118 GLU B CB    1 
ATOM   4933  C  CG    . GLU B 2 106 ? -48.978  -27.748 35.990  1.00 88.58  ? 118 GLU B CG    1 
ATOM   4934  C  CD    . GLU B 2 106 ? -47.501  -27.674 35.655  1.00 88.58  ? 118 GLU B CD    1 
ATOM   4935  O  OE1   . GLU B 2 106 ? -47.048  -26.605 35.195  1.00 88.58  ? 118 GLU B OE1   1 
ATOM   4936  O  OE2   . GLU B 2 106 ? -46.796  -28.684 35.851  1.00 88.58  ? 118 GLU B OE2   1 
ATOM   4937  N  N     . LEU B 2 107 ? -51.791  -30.139 34.603  1.00 44.69  ? 119 LEU B N     1 
ATOM   4938  C  CA    . LEU B 2 107 ? -52.564  -30.100 33.366  1.00 44.69  ? 119 LEU B CA    1 
ATOM   4939  C  C     . LEU B 2 107 ? -54.014  -29.731 33.655  1.00 44.69  ? 119 LEU B C     1 
ATOM   4940  O  O     . LEU B 2 107 ? -54.577  -28.844 33.015  1.00 44.69  ? 119 LEU B O     1 
ATOM   4941  C  CB    . LEU B 2 107 ? -52.506  -31.449 32.644  1.00 44.69  ? 119 LEU B CB    1 
ATOM   4942  C  CG    . LEU B 2 107 ? -51.320  -31.727 31.721  1.00 44.69  ? 119 LEU B CG    1 
ATOM   4943  C  CD1   . LEU B 2 107 ? -51.390  -33.141 31.173  1.00 44.69  ? 119 LEU B CD1   1 
ATOM   4944  C  CD2   . LEU B 2 107 ? -51.286  -30.722 30.585  1.00 44.69  ? 119 LEU B CD2   1 
ATOM   4945  N  N     . GLN B 2 108 ? -54.608  -30.415 34.627  1.00 70.78  ? 120 GLN B N     1 
ATOM   4946  C  CA    . GLN B 2 108 ? -55.998  -30.181 35.003  1.00 70.78  ? 120 GLN B CA    1 
ATOM   4947  C  C     . GLN B 2 108 ? -56.238  -28.739 35.444  1.00 70.78  ? 120 GLN B C     1 
ATOM   4948  O  O     . GLN B 2 108 ? -57.281  -28.155 35.150  1.00 70.78  ? 120 GLN B O     1 
ATOM   4949  C  CB    . GLN B 2 108 ? -56.420  -31.150 36.110  1.00 70.78  ? 120 GLN B CB    1 
ATOM   4950  C  CG    . GLN B 2 108 ? -56.420  -32.613 35.687  1.00 70.78  ? 120 GLN B CG    1 
ATOM   4951  C  CD    . GLN B 2 108 ? -56.868  -33.545 36.796  1.00 70.78  ? 120 GLN B CD    1 
ATOM   4952  O  OE1   . GLN B 2 108 ? -56.334  -33.515 37.905  1.00 70.78  ? 120 GLN B OE1   1 
ATOM   4953  N  NE2   . GLN B 2 108 ? -57.858  -34.379 36.502  1.00 70.78  ? 120 GLN B NE2   1 
ATOM   4954  N  N     . ARG B 2 109 ? -55.262  -28.169 36.143  1.00 88.90  ? 121 ARG B N     1 
ATOM   4955  C  CA    . ARG B 2 109 ? -55.357  -26.796 36.627  1.00 88.90  ? 121 ARG B CA    1 
ATOM   4956  C  C     . ARG B 2 109 ? -55.243  -25.767 35.504  1.00 88.90  ? 121 ARG B C     1 
ATOM   4957  O  O     . ARG B 2 109 ? -56.073  -24.865 35.392  1.00 88.90  ? 121 ARG B O     1 
ATOM   4958  C  CB    . ARG B 2 109 ? -54.264  -26.522 37.663  1.00 88.90  ? 121 ARG B CB    1 
ATOM   4959  C  CG    . ARG B 2 109 ? -54.494  -27.148 39.028  1.00 88.90  ? 121 ARG B CG    1 
ATOM   4960  C  CD    . ARG B 2 109 ? -55.031  -26.132 40.023  1.00 88.90  ? 121 ARG B CD    1 
ATOM   4961  N  NE    . ARG B 2 109 ? -54.659  -26.470 41.395  1.00 88.90  ? 121 ARG B NE    1 
ATOM   4962  C  CZ    . ARG B 2 109 ? -54.971  -25.737 42.459  1.00 88.90  ? 121 ARG B CZ    1 
ATOM   4963  N  NH1   . ARG B 2 109 ? -54.586  -26.122 43.668  1.00 88.90  ? 121 ARG B NH1   1 
ATOM   4964  N  NH2   . ARG B 2 109 ? -55.670  -24.619 42.316  1.00 88.90  ? 121 ARG B NH2   1 
ATOM   4965  N  N     . GLN B 2 110 ? -54.215  -25.912 34.672  1.00 73.55  ? 122 GLN B N     1 
ATOM   4966  C  CA    . GLN B 2 110 ? -53.815  -24.845 33.757  1.00 73.55  ? 122 GLN B CA    1 
ATOM   4967  C  C     . GLN B 2 110 ? -54.161  -25.066 32.281  1.00 73.55  ? 122 GLN B C     1 
ATOM   4968  O  O     . GLN B 2 110 ? -54.416  -24.106 31.556  1.00 73.55  ? 122 GLN B O     1 
ATOM   4969  C  CB    . GLN B 2 110 ? -52.317  -24.567 33.903  1.00 73.55  ? 122 GLN B CB    1 
ATOM   4970  C  CG    . GLN B 2 110 ? -51.976  -23.106 34.146  1.00 73.55  ? 122 GLN B CG    1 
ATOM   4971  C  CD    . GLN B 2 110 ? -52.460  -22.607 35.493  1.00 73.55  ? 122 GLN B CD    1 
ATOM   4972  O  OE1   . GLN B 2 110 ? -52.610  -23.382 36.438  1.00 73.55  ? 122 GLN B OE1   1 
ATOM   4973  N  NE2   . GLN B 2 110 ? -52.708  -21.306 35.588  1.00 73.55  ? 122 GLN B NE2   1 
ATOM   4974  N  N     . ALA B 2 111 ? -54.163  -26.316 31.829  1.00 38.15  ? 123 ALA B N     1 
ATOM   4975  C  CA    . ALA B 2 111 ? -54.431  -26.601 30.419  1.00 38.15  ? 123 ALA B CA    1 
ATOM   4976  C  C     . ALA B 2 111 ? -55.895  -26.371 30.049  1.00 38.15  ? 123 ALA B C     1 
ATOM   4977  O  O     . ALA B 2 111 ? -56.684  -25.886 30.860  1.00 38.15  ? 123 ALA B O     1 
ATOM   4978  C  CB    . ALA B 2 111 ? -54.011  -28.019 30.068  1.00 38.15  ? 123 ALA B CB    1 
ATOM   4979  N  N     . SER B 2 112 ? -56.249  -26.716 28.815  1.00 123.24 ? 124 SER B N     1 
ATOM   4980  C  CA    . SER B 2 112 ? -57.630  -26.623 28.359  1.00 123.24 ? 124 SER B CA    1 
ATOM   4981  C  C     . SER B 2 112 ? -58.480  -27.640 29.112  1.00 123.24 ? 124 SER B C     1 
ATOM   4982  O  O     . SER B 2 112 ? -58.030  -28.755 29.363  1.00 123.24 ? 124 SER B O     1 
ATOM   4983  C  CB    . SER B 2 112 ? -57.709  -26.879 26.853  1.00 123.24 ? 124 SER B CB    1 
ATOM   4984  O  OG    . SER B 2 112 ? -59.039  -26.762 26.376  1.00 123.24 ? 124 SER B OG    1 
ATOM   4985  N  N     . PRO B 2 113 ? -59.713  -27.259 29.484  1.00 81.16  ? 125 PRO B N     1 
ATOM   4986  C  CA    . PRO B 2 113 ? -60.573  -28.162 30.256  1.00 81.16  ? 125 PRO B CA    1 
ATOM   4987  C  C     . PRO B 2 113 ? -61.030  -29.362 29.434  1.00 81.16  ? 125 PRO B C     1 
ATOM   4988  O  O     . PRO B 2 113 ? -61.358  -30.406 29.997  1.00 81.16  ? 125 PRO B O     1 
ATOM   4989  C  CB    . PRO B 2 113 ? -61.772  -27.281 30.611  1.00 81.16  ? 125 PRO B CB    1 
ATOM   4990  C  CG    . PRO B 2 113 ? -61.810  -26.251 29.536  1.00 81.16  ? 125 PRO B CG    1 
ATOM   4991  C  CD    . PRO B 2 113 ? -60.373  -25.972 29.204  1.00 81.16  ? 125 PRO B CD    1 
ATOM   4992  N  N     . ASN B 2 114 ? -61.048  -29.208 28.115  1.00 77.35  ? 126 ASN B N     1 
ATOM   4993  C  CA    . ASN B 2 114 ? -61.482  -30.274 27.224  1.00 77.35  ? 126 ASN B CA    1 
ATOM   4994  C  C     . ASN B 2 114 ? -60.309  -31.021 26.597  1.00 77.35  ? 126 ASN B C     1 
ATOM   4995  O  O     . ASN B 2 114 ? -60.391  -31.474 25.456  1.00 77.35  ? 126 ASN B O     1 
ATOM   4996  C  CB    . ASN B 2 114 ? -62.390  -29.713 26.129  1.00 77.35  ? 126 ASN B CB    1 
ATOM   4997  C  CG    . ASN B 2 114 ? -63.583  -28.963 26.689  1.00 77.35  ? 126 ASN B CG    1 
ATOM   4998  O  OD1   . ASN B 2 114 ? -63.727  -27.758 26.478  1.00 77.35  ? 126 ASN B OD1   1 
ATOM   4999  N  ND2   . ASN B 2 114 ? -64.445  -29.673 27.406  1.00 77.35  ? 126 ASN B ND2   1 
ATOM   5000  N  N     . ILE B 2 115 ? -59.219  -31.150 27.347  1.00 65.20  ? 127 ILE B N     1 
ATOM   5001  C  CA    . ILE B 2 115 ? -58.030  -31.840 26.853  1.00 65.20  ? 127 ILE B CA    1 
ATOM   5002  C  C     . ILE B 2 115 ? -58.131  -33.349 27.081  1.00 65.20  ? 127 ILE B C     1 
ATOM   5003  O  O     . ILE B 2 115 ? -58.627  -33.802 28.113  1.00 65.20  ? 127 ILE B O     1 
ATOM   5004  C  CB    . ILE B 2 115 ? -56.733  -31.274 27.493  1.00 65.20  ? 127 ILE B CB    1 
ATOM   5005  C  CG1   . ILE B 2 115 ? -55.488  -31.835 26.802  1.00 65.20  ? 127 ILE B CG1   1 
ATOM   5006  C  CG2   . ILE B 2 115 ? -56.694  -31.545 28.988  1.00 65.20  ? 127 ILE B CG2   1 
ATOM   5007  C  CD1   . ILE B 2 115 ? -54.184  -31.323 27.380  1.00 65.20  ? 127 ILE B CD1   1 
ATOM   5008  N  N     . VAL B 2 116 ? -57.678  -34.124 26.101  1.00 60.26  ? 128 VAL B N     1 
ATOM   5009  C  CA    . VAL B 2 116 ? -57.690  -35.575 26.218  1.00 60.26  ? 128 VAL B CA    1 
ATOM   5010  C  C     . VAL B 2 116 ? -56.378  -36.058 26.827  1.00 60.26  ? 128 VAL B C     1 
ATOM   5011  O  O     . VAL B 2 116 ? -55.475  -36.497 26.114  1.00 60.26  ? 128 VAL B O     1 
ATOM   5012  C  CB    . VAL B 2 116 ? -57.911  -36.251 24.852  1.00 60.26  ? 128 VAL B CB    1 
ATOM   5013  C  CG1   . VAL B 2 116 ? -58.200  -37.731 25.032  1.00 60.26  ? 128 VAL B CG1   1 
ATOM   5014  C  CG2   . VAL B 2 116 ? -59.056  -35.581 24.113  1.00 60.26  ? 128 VAL B CG2   1 
ATOM   5015  N  N     . ILE B 2 117 ? -56.274  -35.964 28.149  1.00 49.32  ? 129 ILE B N     1 
ATOM   5016  C  CA    . ILE B 2 117 ? -55.074  -36.404 28.852  1.00 49.32  ? 129 ILE B CA    1 
ATOM   5017  C  C     . ILE B 2 117 ? -54.945  -37.921 28.808  1.00 49.32  ? 129 ILE B C     1 
ATOM   5018  O  O     . ILE B 2 117 ? -55.894  -38.643 29.107  1.00 49.32  ? 129 ILE B O     1 
ATOM   5019  C  CB    . ILE B 2 117 ? -55.070  -35.947 30.325  1.00 49.32  ? 129 ILE B CB    1 
ATOM   5020  C  CG1   . ILE B 2 117 ? -55.229  -34.431 30.421  1.00 49.32  ? 129 ILE B CG1   1 
ATOM   5021  C  CG2   . ILE B 2 117 ? -53.785  -36.377 31.014  1.00 49.32  ? 129 ILE B CG2   1 
ATOM   5022  C  CD1   . ILE B 2 117 ? -55.209  -33.898 31.841  1.00 49.32  ? 129 ILE B CD1   1 
ATOM   5023  N  N     . ALA B 2 118 ? -53.766  -38.397 28.427  1.00 62.13  ? 130 ALA B N     1 
ATOM   5024  C  CA    . ALA B 2 118 ? -53.475  -39.819 28.466  1.00 62.13  ? 130 ALA B CA    1 
ATOM   5025  C  C     . ALA B 2 118 ? -52.390  -40.077 29.499  1.00 62.13  ? 130 ALA B C     1 
ATOM   5026  O  O     . ALA B 2 118 ? -51.580  -39.197 29.789  1.00 62.13  ? 130 ALA B O     1 
ATOM   5027  C  CB    . ALA B 2 118 ? -53.036  -40.311 27.099  1.00 62.13  ? 130 ALA B CB    1 
ATOM   5028  N  N     . LEU B 2 119 ? -52.385  -41.280 30.063  1.00 57.83  ? 131 LEU B N     1 
ATOM   5029  C  CA    . LEU B 2 119 ? -51.317  -41.699 30.960  1.00 57.83  ? 131 LEU B CA    1 
ATOM   5030  C  C     . LEU B 2 119 ? -50.646  -42.940 30.392  1.00 57.83  ? 131 LEU B C     1 
ATOM   5031  O  O     . LEU B 2 119 ? -51.320  -43.852 29.917  1.00 57.83  ? 131 LEU B O     1 
ATOM   5032  C  CB    . LEU B 2 119 ? -51.855  -41.985 32.361  1.00 57.83  ? 131 LEU B CB    1 
ATOM   5033  C  CG    . LEU B 2 119 ? -50.841  -42.546 33.363  1.00 57.83  ? 131 LEU B CG    1 
ATOM   5034  C  CD1   . LEU B 2 119 ? -49.688  -41.580 33.559  1.00 57.83  ? 131 LEU B CD1   1 
ATOM   5035  C  CD2   . LEU B 2 119 ? -51.506  -42.857 34.691  1.00 57.83  ? 131 LEU B CD2   1 
ATOM   5036  N  N     . ALA B 2 120 ? -49.319  -42.970 30.432  1.00 57.71  ? 132 ALA B N     1 
ATOM   5037  C  CA    . ALA B 2 120 ? -48.579  -44.100 29.884  1.00 57.71  ? 132 ALA B CA    1 
ATOM   5038  C  C     . ALA B 2 120 ? -47.478  -44.572 30.821  1.00 57.71  ? 132 ALA B C     1 
ATOM   5039  O  O     . ALA B 2 120 ? -46.684  -43.772 31.315  1.00 57.71  ? 132 ALA B O     1 
ATOM   5040  C  CB    . ALA B 2 120 ? -47.997  -43.744 28.527  1.00 57.71  ? 132 ALA B CB    1 
ATOM   5041  N  N     . GLY B 2 121 ? -47.436  -45.878 31.060  1.00 36.35  ? 133 GLY B N     1 
ATOM   5042  C  CA    . GLY B 2 121 ? -46.358  -46.481 31.818  1.00 36.35  ? 133 GLY B CA    1 
ATOM   5043  C  C     . GLY B 2 121 ? -45.393  -47.157 30.866  1.00 36.35  ? 133 GLY B C     1 
ATOM   5044  O  O     . GLY B 2 121 ? -45.621  -48.289 30.440  1.00 36.35  ? 133 GLY B O     1 
ATOM   5045  N  N     . ASN B 2 122 ? -44.315  -46.457 30.527  1.00 52.59  ? 134 ASN B N     1 
ATOM   5046  C  CA    . ASN B 2 122 ? -43.364  -46.954 29.539  1.00 52.59  ? 134 ASN B CA    1 
ATOM   5047  C  C     . ASN B 2 122 ? -42.255  -47.800 30.163  1.00 52.59  ? 134 ASN B C     1 
ATOM   5048  O  O     . ASN B 2 122 ? -42.190  -47.945 31.386  1.00 52.59  ? 134 ASN B O     1 
ATOM   5049  C  CB    . ASN B 2 122 ? -42.783  -45.794 28.726  1.00 52.59  ? 134 ASN B CB    1 
ATOM   5050  C  CG    . ASN B 2 122 ? -42.247  -46.237 27.378  1.00 52.59  ? 134 ASN B CG    1 
ATOM   5051  O  OD1   . ASN B 2 122 ? -43.004  -46.657 26.504  1.00 52.59  ? 134 ASN B OD1   1 
ATOM   5052  N  ND2   . ASN B 2 122 ? -40.935  -46.141 27.203  1.00 52.59  ? 134 ASN B ND2   1 
ATOM   5053  N  N     . LYS B 2 123 ? -41.390  -48.350 29.310  1.00 57.41  ? 135 LYS B N     1 
ATOM   5054  C  CA    . LYS B 2 123 ? -40.385  -49.333 29.711  1.00 57.41  ? 135 LYS B CA    1 
ATOM   5055  C  C     . LYS B 2 123 ? -41.048  -50.562 30.324  1.00 57.41  ? 135 LYS B C     1 
ATOM   5056  O  O     . LYS B 2 123 ? -40.526  -51.165 31.261  1.00 57.41  ? 135 LYS B O     1 
ATOM   5057  C  CB    . LYS B 2 123 ? -39.346  -48.728 30.663  1.00 57.41  ? 135 LYS B CB    1 
ATOM   5058  C  CG    . LYS B 2 123 ? -38.472  -47.655 30.030  1.00 57.41  ? 135 LYS B CG    1 
ATOM   5059  C  CD    . LYS B 2 123 ? -37.374  -47.213 30.983  1.00 57.41  ? 135 LYS B CD    1 
ATOM   5060  C  CE    . LYS B 2 123 ? -36.376  -46.295 30.302  1.00 57.41  ? 135 LYS B CE    1 
ATOM   5061  N  NZ    . LYS B 2 123 ? -35.294  -45.882 31.236  1.00 57.41  ? 135 LYS B NZ    1 
ATOM   5062  N  N     . ALA B 2 124 ? -42.203  -50.928 29.775  1.00 69.80  ? 136 ALA B N     1 
ATOM   5063  C  CA    . ALA B 2 124 ? -42.976  -52.061 30.268  1.00 69.80  ? 136 ALA B CA    1 
ATOM   5064  C  C     . ALA B 2 124 ? -42.359  -53.398 29.869  1.00 69.80  ? 136 ALA B C     1 
ATOM   5065  O  O     . ALA B 2 124 ? -42.826  -54.454 30.296  1.00 69.80  ? 136 ALA B O     1 
ATOM   5066  C  CB    . ALA B 2 124 ? -44.415  -51.972 29.783  1.00 69.80  ? 136 ALA B CB    1 
ATOM   5067  N  N     . ASP B 2 125 ? -41.318  -53.351 29.044  1.00 66.99  ? 137 ASP B N     1 
ATOM   5068  C  CA    . ASP B 2 125 ? -40.601  -54.559 28.658  1.00 66.99  ? 137 ASP B CA    1 
ATOM   5069  C  C     . ASP B 2 125 ? -39.616  -54.941 29.757  1.00 66.99  ? 137 ASP B C     1 
ATOM   5070  O  O     . ASP B 2 125 ? -39.140  -56.076 29.817  1.00 66.99  ? 137 ASP B O     1 
ATOM   5071  C  CB    . ASP B 2 125 ? -39.868  -54.357 27.329  1.00 66.99  ? 137 ASP B CB    1 
ATOM   5072  C  CG    . ASP B 2 125 ? -38.391  -54.067 27.514  1.00 66.99  ? 137 ASP B CG    1 
ATOM   5073  O  OD1   . ASP B 2 125 ? -38.037  -52.898 27.769  1.00 66.99  ? 137 ASP B OD1   1 
ATOM   5074  O  OD2   . ASP B 2 125 ? -37.581  -55.011 27.399  1.00 66.99  ? 137 ASP B OD2   1 
ATOM   5075  N  N     . LEU B 2 126 ? -39.319  -53.982 30.627  1.00 41.64  ? 138 LEU B N     1 
ATOM   5076  C  CA    . LEU B 2 126 ? -38.419  -54.209 31.749  1.00 41.64  ? 138 LEU B CA    1 
ATOM   5077  C  C     . LEU B 2 126 ? -39.202  -54.657 32.981  1.00 41.64  ? 138 LEU B C     1 
ATOM   5078  O  O     . LEU B 2 126 ? -39.097  -54.049 34.046  1.00 41.64  ? 138 LEU B O     1 
ATOM   5079  C  CB    . LEU B 2 126 ? -37.632  -52.935 32.072  1.00 41.64  ? 138 LEU B CB    1 
ATOM   5080  C  CG    . LEU B 2 126 ? -36.882  -52.236 30.936  1.00 41.64  ? 138 LEU B CG    1 
ATOM   5081  C  CD1   . LEU B 2 126 ? -36.185  -50.987 31.449  1.00 41.64  ? 138 LEU B CD1   1 
ATOM   5082  C  CD2   . LEU B 2 126 ? -35.886  -53.175 30.283  1.00 41.64  ? 138 LEU B CD2   1 
ATOM   5083  N  N     . ALA B 2 127 ? -39.988  -55.720 32.831  1.00 66.45  ? 139 ALA B N     1 
ATOM   5084  C  CA    . ALA B 2 127 ? -40.761  -56.266 33.944  1.00 66.45  ? 139 ALA B CA    1 
ATOM   5085  C  C     . ALA B 2 127 ? -39.838  -56.808 35.030  1.00 66.45  ? 139 ALA B C     1 
ATOM   5086  O  O     . ALA B 2 127 ? -40.223  -56.905 36.195  1.00 66.45  ? 139 ALA B O     1 
ATOM   5087  C  CB    . ALA B 2 127 ? -41.702  -57.353 33.454  1.00 66.45  ? 139 ALA B CB    1 
ATOM   5088  N  N     . SER B 2 128 ? -38.621  -57.164 34.629  1.00 56.66  ? 140 SER B N     1 
ATOM   5089  C  CA    . SER B 2 128 ? -37.596  -57.629 35.555  1.00 56.66  ? 140 SER B CA    1 
ATOM   5090  C  C     . SER B 2 128 ? -37.324  -56.602 36.650  1.00 56.66  ? 140 SER B C     1 
ATOM   5091  O  O     . SER B 2 128 ? -37.152  -56.955 37.819  1.00 56.66  ? 140 SER B O     1 
ATOM   5092  C  CB    . SER B 2 128 ? -36.302  -57.929 34.797  1.00 56.66  ? 140 SER B CB    1 
ATOM   5093  O  OG    . SER B 2 128 ? -35.224  -58.149 35.686  1.00 56.66  ? 140 SER B OG    1 
ATOM   5094  N  N     . LYS B 2 129 ? -37.298  -55.331 36.266  1.00 79.23  ? 141 LYS B N     1 
ATOM   5095  C  CA    . LYS B 2 129 ? -36.975  -54.258 37.198  1.00 79.23  ? 141 LYS B CA    1 
ATOM   5096  C  C     . LYS B 2 129 ? -38.182  -53.370 37.481  1.00 79.23  ? 141 LYS B C     1 
ATOM   5097  O  O     . LYS B 2 129 ? -38.038  -52.260 37.996  1.00 79.23  ? 141 LYS B O     1 
ATOM   5098  C  CB    . LYS B 2 129 ? -35.816  -53.424 36.654  1.00 79.23  ? 141 LYS B CB    1 
ATOM   5099  C  CG    . LYS B 2 129 ? -34.648  -54.263 36.168  1.00 79.23  ? 141 LYS B CG    1 
ATOM   5100  C  CD    . LYS B 2 129 ? -33.440  -53.410 35.837  1.00 79.23  ? 141 LYS B CD    1 
ATOM   5101  C  CE    . LYS B 2 129 ? -32.237  -54.283 35.514  1.00 79.23  ? 141 LYS B CE    1 
ATOM   5102  N  NZ    . LYS B 2 129 ? -31.001  -53.479 35.305  1.00 79.23  ? 141 LYS B NZ    1 
ATOM   5103  N  N     . ARG B 2 130 ? -39.366  -53.871 37.139  1.00 49.23  ? 142 ARG B N     1 
ATOM   5104  C  CA    . ARG B 2 130 ? -40.620  -53.162 37.382  1.00 49.23  ? 142 ARG B CA    1 
ATOM   5105  C  C     . ARG B 2 130 ? -40.773  -52.744 38.844  1.00 49.23  ? 142 ARG B C     1 
ATOM   5106  O  O     . ARG B 2 130 ? -40.576  -53.550 39.753  1.00 49.23  ? 142 ARG B O     1 
ATOM   5107  C  CB    . ARG B 2 130 ? -41.808  -54.029 36.954  1.00 49.23  ? 142 ARG B CB    1 
ATOM   5108  C  CG    . ARG B 2 130 ? -43.116  -53.688 37.650  1.00 49.23  ? 142 ARG B CG    1 
ATOM   5109  C  CD    . ARG B 2 130 ? -44.235  -54.638 37.248  1.00 49.23  ? 142 ARG B CD    1 
ATOM   5110  N  NE    . ARG B 2 130 ? -44.892  -54.231 36.010  1.00 49.23  ? 142 ARG B NE    1 
ATOM   5111  C  CZ    . ARG B 2 130 ? -45.933  -53.407 35.959  1.00 49.23  ? 142 ARG B CZ    1 
ATOM   5112  N  NH1   . ARG B 2 130 ? -46.433  -52.899 37.075  1.00 49.23  ? 142 ARG B NH1   1 
ATOM   5113  N  NH2   . ARG B 2 130 ? -46.475  -53.087 34.792  1.00 49.23  ? 142 ARG B NH2   1 
ATOM   5114  N  N     . ALA B 2 131 ? -41.120  -51.478 39.058  1.00 49.43  ? 143 ALA B N     1 
ATOM   5115  C  CA    . ALA B 2 131 ? -41.267  -50.935 40.404  1.00 49.43  ? 143 ALA B CA    1 
ATOM   5116  C  C     . ALA B 2 131 ? -42.689  -50.454 40.674  1.00 49.43  ? 143 ALA B C     1 
ATOM   5117  O  O     . ALA B 2 131 ? -43.179  -50.541 41.800  1.00 49.43  ? 143 ALA B O     1 
ATOM   5118  C  CB    . ALA B 2 131 ? -40.276  -49.805 40.627  1.00 49.43  ? 143 ALA B CB    1 
ATOM   5119  N  N     . VAL B 2 132 ? -43.345  -49.936 39.640  1.00 67.22  ? 144 VAL B N     1 
ATOM   5120  C  CA    . VAL B 2 132 ? -44.725  -49.479 39.763  1.00 67.22  ? 144 VAL B CA    1 
ATOM   5121  C  C     . VAL B 2 132 ? -45.679  -50.629 39.456  1.00 67.22  ? 144 VAL B C     1 
ATOM   5122  O  O     . VAL B 2 132 ? -45.377  -51.484 38.623  1.00 67.22  ? 144 VAL B O     1 
ATOM   5123  C  CB    . VAL B 2 132 ? -45.015  -48.306 38.811  1.00 67.22  ? 144 VAL B CB    1 
ATOM   5124  C  CG1   . VAL B 2 132 ? -46.280  -47.578 39.234  1.00 67.22  ? 144 VAL B CG1   1 
ATOM   5125  C  CG2   . VAL B 2 132 ? -43.842  -47.347 38.791  1.00 67.22  ? 144 VAL B CG2   1 
ATOM   5126  N  N     . GLU B 2 133 ? -46.825  -50.657 40.128  1.00 97.64  ? 145 GLU B N     1 
ATOM   5127  C  CA    . GLU B 2 133 ? -47.794  -51.729 39.921  1.00 97.64  ? 145 GLU B CA    1 
ATOM   5128  C  C     . GLU B 2 133 ? -48.908  -51.309 38.962  1.00 97.64  ? 145 GLU B C     1 
ATOM   5129  O  O     . GLU B 2 133 ? -49.517  -50.252 39.128  1.00 97.64  ? 145 GLU B O     1 
ATOM   5130  C  CB    . GLU B 2 133 ? -48.381  -52.195 41.255  1.00 97.64  ? 145 GLU B CB    1 
ATOM   5131  C  CG    . GLU B 2 133 ? -48.678  -53.683 41.300  1.00 97.64  ? 145 GLU B CG    1 
ATOM   5132  C  CD    . GLU B 2 133 ? -47.450  -54.525 41.005  1.00 97.64  ? 145 GLU B CD    1 
ATOM   5133  O  OE1   . GLU B 2 133 ? -47.550  -55.454 40.176  1.00 97.64  ? 145 GLU B OE1   1 
ATOM   5134  O  OE2   . GLU B 2 133 ? -46.386  -54.259 41.602  1.00 97.64  ? 145 GLU B OE2   1 
ATOM   5135  N  N     . PHE B 2 134 ? -49.165  -52.150 37.962  1.00 81.15  ? 146 PHE B N     1 
ATOM   5136  C  CA    . PHE B 2 134 ? -50.169  -51.873 36.937  1.00 81.15  ? 146 PHE B CA    1 
ATOM   5137  C  C     . PHE B 2 134 ? -51.562  -51.671 37.527  1.00 81.15  ? 146 PHE B C     1 
ATOM   5138  O  O     . PHE B 2 134 ? -52.354  -50.883 37.012  1.00 81.15  ? 146 PHE B O     1 
ATOM   5139  C  CB    . PHE B 2 134 ? -50.185  -52.999 35.898  1.00 81.15  ? 146 PHE B CB    1 
ATOM   5140  C  CG    . PHE B 2 134 ? -51.373  -52.966 34.977  1.00 81.15  ? 146 PHE B CG    1 
ATOM   5141  C  CD1   . PHE B 2 134 ? -51.453  -52.034 33.954  1.00 81.15  ? 146 PHE B CD1   1 
ATOM   5142  C  CD2   . PHE B 2 134 ? -52.405  -53.878 35.128  1.00 81.15  ? 146 PHE B CD2   1 
ATOM   5143  C  CE1   . PHE B 2 134 ? -52.547  -52.007 33.106  1.00 81.15  ? 146 PHE B CE1   1 
ATOM   5144  C  CE2   . PHE B 2 134 ? -53.500  -53.857 34.285  1.00 81.15  ? 146 PHE B CE2   1 
ATOM   5145  C  CZ    . PHE B 2 134 ? -53.570  -52.920 33.273  1.00 81.15  ? 146 PHE B CZ    1 
ATOM   5146  N  N     . GLN B 2 135 ? -51.850  -52.383 38.610  1.00 69.22  ? 147 GLN B N     1 
ATOM   5147  C  CA    . GLN B 2 135 ? -53.135  -52.264 39.285  1.00 69.22  ? 147 GLN B CA    1 
ATOM   5148  C  C     . GLN B 2 135 ? -53.269  -50.898 39.955  1.00 69.22  ? 147 GLN B C     1 
ATOM   5149  O  O     . GLN B 2 135 ? -54.369  -50.358 40.077  1.00 69.22  ? 147 GLN B O     1 
ATOM   5150  C  CB    . GLN B 2 135 ? -53.298  -53.391 40.310  1.00 69.22  ? 147 GLN B CB    1 
ATOM   5151  C  CG    . GLN B 2 135 ? -54.663  -53.454 40.984  1.00 69.22  ? 147 GLN B CG    1 
ATOM   5152  C  CD    . GLN B 2 135 ? -54.756  -52.569 42.212  1.00 69.22  ? 147 GLN B CD    1 
ATOM   5153  O  OE1   . GLN B 2 135 ? -53.743  -52.119 42.747  1.00 69.22  ? 147 GLN B OE1   1 
ATOM   5154  N  NE2   . GLN B 2 135 ? -55.977  -52.312 42.665  1.00 69.22  ? 147 GLN B NE2   1 
ATOM   5155  N  N     . GLU B 2 136 ? -52.139  -50.342 40.384  1.00 61.57  ? 148 GLU B N     1 
ATOM   5156  C  CA    . GLU B 2 136 ? -52.123  -49.046 41.054  1.00 61.57  ? 148 GLU B CA    1 
ATOM   5157  C  C     . GLU B 2 136 ? -52.331  -47.899 40.070  1.00 61.57  ? 148 GLU B C     1 
ATOM   5158  O  O     . GLU B 2 136 ? -53.147  -47.009 40.305  1.00 61.57  ? 148 GLU B O     1 
ATOM   5159  C  CB    . GLU B 2 136 ? -50.808  -48.852 41.813  1.00 61.57  ? 148 GLU B CB    1 
ATOM   5160  C  CG    . GLU B 2 136 ? -50.673  -47.494 42.487  1.00 61.57  ? 148 GLU B CG    1 
ATOM   5161  C  CD    . GLU B 2 136 ? -49.348  -47.328 43.205  1.00 61.57  ? 148 GLU B CD    1 
ATOM   5162  O  OE1   . GLU B 2 136 ? -48.457  -48.183 43.016  1.00 61.57  ? 148 GLU B OE1   1 
ATOM   5163  O  OE2   . GLU B 2 136 ? -49.196  -46.343 43.959  1.00 61.57  ? 148 GLU B OE2   1 
ATOM   5164  N  N     . ALA B 2 137 ? -51.584  -47.924 38.971  1.00 71.27  ? 149 ALA B N     1 
ATOM   5165  C  CA    . ALA B 2 137 ? -51.680  -46.877 37.961  1.00 71.27  ? 149 ALA B CA    1 
ATOM   5166  C  C     . ALA B 2 137 ? -53.038  -46.894 37.268  1.00 71.27  ? 149 ALA B C     1 
ATOM   5167  O  O     . ALA B 2 137 ? -53.602  -45.843 36.971  1.00 71.27  ? 149 ALA B O     1 
ATOM   5168  C  CB    . ALA B 2 137 ? -50.562  -47.013 36.947  1.00 71.27  ? 149 ALA B CB    1 
ATOM   5169  N  N     . GLN B 2 138 ? -53.554  -48.093 37.012  1.00 52.60  ? 150 GLN B N     1 
ATOM   5170  C  CA    . GLN B 2 138 ? -54.882  -48.248 36.428  1.00 52.60  ? 150 GLN B CA    1 
ATOM   5171  C  C     . GLN B 2 138 ? -55.930  -47.663 37.370  1.00 52.60  ? 150 GLN B C     1 
ATOM   5172  O  O     . GLN B 2 138 ? -56.943  -47.124 36.930  1.00 52.60  ? 150 GLN B O     1 
ATOM   5173  C  CB    . GLN B 2 138 ? -55.182  -49.723 36.155  1.00 52.60  ? 150 GLN B CB    1 
ATOM   5174  C  CG    . GLN B 2 138 ? -56.452  -49.972 35.352  1.00 52.60  ? 150 GLN B CG    1 
ATOM   5175  C  CD    . GLN B 2 138 ? -56.258  -49.759 33.862  1.00 52.60  ? 150 GLN B CD    1 
ATOM   5176  O  OE1   . GLN B 2 138 ? -55.268  -50.208 33.284  1.00 52.60  ? 150 GLN B OE1   1 
ATOM   5177  N  NE2   . GLN B 2 138 ? -57.204  -49.073 33.233  1.00 52.60  ? 150 GLN B NE2   1 
ATOM   5178  N  N     . ALA B 2 139 ? -55.673  -47.767 38.669  1.00 71.85  ? 151 ALA B N     1 
ATOM   5179  C  CA    . ALA B 2 139 ? -56.566  -47.201 39.669  1.00 71.85  ? 151 ALA B CA    1 
ATOM   5180  C  C     . ALA B 2 139 ? -56.489  -45.678 39.666  1.00 71.85  ? 151 ALA B C     1 
ATOM   5181  O  O     . ALA B 2 139 ? -57.510  -45.002 39.552  1.00 71.85  ? 151 ALA B O     1 
ATOM   5182  C  CB    . ALA B 2 139 ? -56.240  -47.750 41.047  1.00 71.85  ? 151 ALA B CB    1 
ATOM   5183  N  N     . TYR B 2 140 ? -55.276  -45.145 39.791  1.00 88.09  ? 152 TYR B N     1 
ATOM   5184  C  CA    . TYR B 2 140 ? -55.067  -43.699 39.812  1.00 88.09  ? 152 TYR B CA    1 
ATOM   5185  C  C     . TYR B 2 140 ? -55.571  -43.030 38.536  1.00 88.09  ? 152 TYR B C     1 
ATOM   5186  O  O     . TYR B 2 140 ? -56.061  -41.903 38.569  1.00 88.09  ? 152 TYR B O     1 
ATOM   5187  C  CB    . TYR B 2 140 ? -53.588  -43.365 40.038  1.00 88.09  ? 152 TYR B CB    1 
ATOM   5188  C  CG    . TYR B 2 140 ? -53.273  -41.888 39.924  1.00 88.09  ? 152 TYR B CG    1 
ATOM   5189  C  CD1   . TYR B 2 140 ? -53.547  -41.016 40.970  1.00 88.09  ? 152 TYR B CD1   1 
ATOM   5190  C  CD2   . TYR B 2 140 ? -52.700  -41.367 38.771  1.00 88.09  ? 152 TYR B CD2   1 
ATOM   5191  C  CE1   . TYR B 2 140 ? -53.263  -39.667 40.870  1.00 88.09  ? 152 TYR B CE1   1 
ATOM   5192  C  CE2   . TYR B 2 140 ? -52.413  -40.020 38.661  1.00 88.09  ? 152 TYR B CE2   1 
ATOM   5193  C  CZ    . TYR B 2 140 ? -52.696  -39.175 39.712  1.00 88.09  ? 152 TYR B CZ    1 
ATOM   5194  O  OH    . TYR B 2 140 ? -52.412  -37.834 39.608  1.00 88.09  ? 152 TYR B OH    1 
ATOM   5195  N  N     . ALA B 2 141 ? -55.450  -43.730 37.414  1.00 53.69  ? 153 ALA B N     1 
ATOM   5196  C  CA    . ALA B 2 141 ? -55.935  -43.213 36.142  1.00 53.69  ? 153 ALA B CA    1 
ATOM   5197  C  C     . ALA B 2 141 ? -57.458  -43.167 36.118  1.00 53.69  ? 153 ALA B C     1 
ATOM   5198  O  O     . ALA B 2 141 ? -58.052  -42.131 35.816  1.00 53.69  ? 153 ALA B O     1 
ATOM   5199  C  CB    . ALA B 2 141 ? -55.418  -44.054 35.000  1.00 53.69  ? 153 ALA B CB    1 
ATOM   5200  N  N     . ASP B 2 142 ? -58.082  -44.299 36.437  1.00 54.78  ? 154 ASP B N     1 
ATOM   5201  C  CA    . ASP B 2 142 ? -59.537  -44.406 36.453  1.00 54.78  ? 154 ASP B CA    1 
ATOM   5202  C  C     . ASP B 2 142 ? -60.170  -43.421 37.435  1.00 54.78  ? 154 ASP B C     1 
ATOM   5203  O  O     . ASP B 2 142 ? -61.319  -43.014 37.264  1.00 54.78  ? 154 ASP B O     1 
ATOM   5204  C  CB    . ASP B 2 142 ? -59.967  -45.837 36.788  1.00 54.78  ? 154 ASP B CB    1 
ATOM   5205  C  CG    . ASP B 2 142 ? -59.668  -46.817 35.668  1.00 54.78  ? 154 ASP B CG    1 
ATOM   5206  O  OD1   . ASP B 2 142 ? -58.760  -46.542 34.858  1.00 54.78  ? 154 ASP B OD1   1 
ATOM   5207  O  OD2   . ASP B 2 142 ? -60.340  -47.868 35.603  1.00 54.78  ? 154 ASP B OD2   1 
ATOM   5208  N  N     . ASP B 2 143 ? -59.415  -43.044 38.461  1.00 69.07  ? 155 ASP B N     1 
ATOM   5209  C  CA    . ASP B 2 143 ? -59.877  -42.054 39.424  1.00 69.07  ? 155 ASP B CA    1 
ATOM   5210  C  C     . ASP B 2 143 ? -59.752  -40.645 38.854  1.00 69.07  ? 155 ASP B C     1 
ATOM   5211  O  O     . ASP B 2 143 ? -60.481  -39.737 39.253  1.00 69.07  ? 155 ASP B O     1 
ATOM   5212  C  CB    . ASP B 2 143 ? -59.082  -42.152 40.729  1.00 69.07  ? 155 ASP B CB    1 
ATOM   5213  C  CG    . ASP B 2 143 ? -59.248  -43.491 41.420  1.00 69.07  ? 155 ASP B CG    1 
ATOM   5214  O  OD1   . ASP B 2 143 ? -60.046  -44.319 40.935  1.00 69.07  ? 155 ASP B OD1   1 
ATOM   5215  O  OD2   . ASP B 2 143 ? -58.584  -43.712 42.455  1.00 69.07  ? 155 ASP B OD2   1 
ATOM   5216  N  N     . ASN B 2 144 ? -58.826  -40.469 37.917  1.00 72.30  ? 156 ASN B N     1 
ATOM   5217  C  CA    . ASN B 2 144 ? -58.526  -39.145 37.380  1.00 72.30  ? 156 ASN B CA    1 
ATOM   5218  C  C     . ASN B 2 144 ? -58.935  -38.954 35.920  1.00 72.30  ? 156 ASN B C     1 
ATOM   5219  O  O     . ASN B 2 144 ? -58.443  -38.046 35.249  1.00 72.30  ? 156 ASN B O     1 
ATOM   5220  C  CB    . ASN B 2 144 ? -57.042  -38.818 37.567  1.00 72.30  ? 156 ASN B CB    1 
ATOM   5221  C  CG    . ASN B 2 144 ? -56.647  -38.719 39.029  1.00 72.30  ? 156 ASN B CG    1 
ATOM   5222  O  OD1   . ASN B 2 144 ? -56.603  -37.630 39.600  1.00 72.30  ? 156 ASN B OD1   1 
ATOM   5223  N  ND2   . ASN B 2 144 ? -56.359  -39.859 39.643  1.00 72.30  ? 156 ASN B ND2   1 
ATOM   5224  N  N     . SER B 2 145 ? -59.830  -39.817 35.442  1.00 45.00  ? 157 SER B N     1 
ATOM   5225  C  CA    . SER B 2 145 ? -60.420  -39.703 34.106  1.00 45.00  ? 157 SER B CA    1 
ATOM   5226  C  C     . SER B 2 145 ? -59.395  -39.752 32.971  1.00 45.00  ? 157 SER B C     1 
ATOM   5227  O  O     . SER B 2 145 ? -59.552  -39.071 31.957  1.00 45.00  ? 157 SER B O     1 
ATOM   5228  C  CB    . SER B 2 145 ? -61.259  -38.424 33.997  1.00 45.00  ? 157 SER B CB    1 
ATOM   5229  O  OG    . SER B 2 145 ? -62.108  -38.269 35.120  1.00 45.00  ? 157 SER B OG    1 
ATOM   5230  N  N     . LEU B 2 146 ? -58.357  -40.566 33.137  1.00 55.75  ? 158 LEU B N     1 
ATOM   5231  C  CA    . LEU B 2 146 ? -57.275  -40.628 32.159  1.00 55.75  ? 158 LEU B CA    1 
ATOM   5232  C  C     . LEU B 2 146 ? -57.419  -41.798 31.186  1.00 55.75  ? 158 LEU B C     1 
ATOM   5233  O  O     . LEU B 2 146 ? -58.347  -42.599 31.287  1.00 55.75  ? 158 LEU B O     1 
ATOM   5234  C  CB    . LEU B 2 146 ? -55.920  -40.707 32.865  1.00 55.75  ? 158 LEU B CB    1 
ATOM   5235  C  CG    . LEU B 2 146 ? -55.610  -39.641 33.916  1.00 55.75  ? 158 LEU B CG    1 
ATOM   5236  C  CD1   . LEU B 2 146 ? -54.186  -39.791 34.427  1.00 55.75  ? 158 LEU B CD1   1 
ATOM   5237  C  CD2   . LEU B 2 146 ? -55.835  -38.248 33.359  1.00 55.75  ? 158 LEU B CD2   1 
ATOM   5238  N  N     . LEU B 2 147 ? -56.488  -41.879 30.241  1.00 39.64  ? 159 LEU B N     1 
ATOM   5239  C  CA    . LEU B 2 147 ? -56.432  -42.982 29.292  1.00 39.64  ? 159 LEU B CA    1 
ATOM   5240  C  C     . LEU B 2 147 ? -55.132  -43.745 29.520  1.00 39.64  ? 159 LEU B C     1 
ATOM   5241  O  O     . LEU B 2 147 ? -54.102  -43.415 28.932  1.00 39.64  ? 159 LEU B O     1 
ATOM   5242  C  CB    . LEU B 2 147 ? -56.483  -42.452 27.859  1.00 39.64  ? 159 LEU B CB    1 
ATOM   5243  C  CG    . LEU B 2 147 ? -57.406  -43.166 26.868  1.00 39.64  ? 159 LEU B CG    1 
ATOM   5244  C  CD1   . LEU B 2 147 ? -57.257  -42.580 25.472  1.00 39.64  ? 159 LEU B CD1   1 
ATOM   5245  C  CD2   . LEU B 2 147 ? -57.143  -44.662 26.854  1.00 39.64  ? 159 LEU B CD2   1 
ATOM   5246  N  N     . PHE B 2 148 ? -55.180  -44.763 30.375  1.00 70.19  ? 160 PHE B N     1 
ATOM   5247  C  CA    . PHE B 2 148 ? -53.968  -45.464 30.793  1.00 70.19  ? 160 PHE B CA    1 
ATOM   5248  C  C     . PHE B 2 148 ? -53.674  -46.740 30.009  1.00 70.19  ? 160 PHE B C     1 
ATOM   5249  O  O     . PHE B 2 148 ? -54.531  -47.611 29.864  1.00 70.19  ? 160 PHE B O     1 
ATOM   5250  C  CB    . PHE B 2 148 ? -54.020  -45.772 32.289  1.00 70.19  ? 160 PHE B CB    1 
ATOM   5251  C  CG    . PHE B 2 148 ? -52.891  -46.637 32.772  1.00 70.19  ? 160 PHE B CG    1 
ATOM   5252  C  CD1   . PHE B 2 148 ? -51.577  -46.206 32.676  1.00 70.19  ? 160 PHE B CD1   1 
ATOM   5253  C  CD2   . PHE B 2 148 ? -53.145  -47.875 33.337  1.00 70.19  ? 160 PHE B CD2   1 
ATOM   5254  C  CE1   . PHE B 2 148 ? -50.538  -47.001 33.123  1.00 70.19  ? 160 PHE B CE1   1 
ATOM   5255  C  CE2   . PHE B 2 148 ? -52.112  -48.673 33.788  1.00 70.19  ? 160 PHE B CE2   1 
ATOM   5256  C  CZ    . PHE B 2 148 ? -50.807  -48.236 33.678  1.00 70.19  ? 160 PHE B CZ    1 
ATOM   5257  N  N     . MET B 2 149 ? -52.447  -46.835 29.509  1.00 48.81  ? 161 MET B N     1 
ATOM   5258  C  CA    . MET B 2 149 ? -51.953  -48.048 28.874  1.00 48.81  ? 161 MET B CA    1 
ATOM   5259  C  C     . MET B 2 149 ? -50.538  -48.331 29.359  1.00 48.81  ? 161 MET B C     1 
ATOM   5260  O  O     . MET B 2 149 ? -49.950  -47.530 30.084  1.00 48.81  ? 161 MET B O     1 
ATOM   5261  C  CB    . MET B 2 149 ? -51.946  -47.908 27.352  1.00 48.81  ? 161 MET B CB    1 
ATOM   5262  C  CG    . MET B 2 149 ? -53.312  -47.926 26.694  1.00 48.81  ? 161 MET B CG    1 
ATOM   5263  S  SD    . MET B 2 149 ? -53.180  -48.182 24.912  1.00 48.81  ? 161 MET B SD    1 
ATOM   5264  C  CE    . MET B 2 149 ? -54.896  -48.042 24.415  1.00 48.81  ? 161 MET B CE    1 
ATOM   5265  N  N     . GLU B 2 150 ? -49.997  -49.474 28.956  1.00 69.17  ? 162 GLU B N     1 
ATOM   5266  C  CA    . GLU B 2 150 ? -48.591  -49.769 29.184  1.00 69.17  ? 162 GLU B CA    1 
ATOM   5267  C  C     . GLU B 2 150 ? -47.871  -49.893 27.850  1.00 69.17  ? 162 GLU B C     1 
ATOM   5268  O  O     . GLU B 2 150 ? -48.123  -50.818 27.079  1.00 69.17  ? 162 GLU B O     1 
ATOM   5269  C  CB    . GLU B 2 150 ? -48.417  -51.046 30.005  1.00 69.17  ? 162 GLU B CB    1 
ATOM   5270  C  CG    . GLU B 2 150 ? -48.626  -50.857 31.496  1.00 69.17  ? 162 GLU B CG    1 
ATOM   5271  C  CD    . GLU B 2 150 ? -48.051  -51.997 32.308  1.00 69.17  ? 162 GLU B CD    1 
ATOM   5272  O  OE1   . GLU B 2 150 ? -47.419  -52.893 31.710  1.00 69.17  ? 162 GLU B OE1   1 
ATOM   5273  O  OE2   . GLU B 2 150 ? -48.226  -51.998 33.544  1.00 69.17  ? 162 GLU B OE2   1 
ATOM   5274  N  N     . THR B 2 151 ? -46.971  -48.953 27.585  1.00 68.24  ? 163 THR B N     1 
ATOM   5275  C  CA    . THR B 2 151 ? -46.289  -48.884 26.301  1.00 68.24  ? 163 THR B CA    1 
ATOM   5276  C  C     . THR B 2 151 ? -44.868  -49.435 26.371  1.00 68.24  ? 163 THR B C     1 
ATOM   5277  O  O     . THR B 2 151 ? -44.342  -49.689 27.454  1.00 68.24  ? 163 THR B O     1 
ATOM   5278  C  CB    . THR B 2 151 ? -46.234  -47.436 25.786  1.00 68.24  ? 163 THR B CB    1 
ATOM   5279  O  OG1   . THR B 2 151 ? -45.302  -46.682 26.570  1.00 68.24  ? 163 THR B OG1   1 
ATOM   5280  C  CG2   . THR B 2 151 ? -47.607  -46.788 25.880  1.00 68.24  ? 163 THR B CG2   1 
ATOM   5281  N  N     . SER B 2 152 ? -44.258  -49.619 25.204  1.00 51.17  ? 164 SER B N     1 
ATOM   5282  C  CA    . SER B 2 152 ? -42.875  -50.076 25.111  1.00 51.17  ? 164 SER B CA    1 
ATOM   5283  C  C     . SER B 2 152 ? -42.300  -49.785 23.729  1.00 51.17  ? 164 SER B C     1 
ATOM   5284  O  O     . SER B 2 152 ? -42.602  -50.485 22.764  1.00 51.17  ? 164 SER B O     1 
ATOM   5285  C  CB    . SER B 2 152 ? -42.773  -51.572 25.410  1.00 51.17  ? 164 SER B CB    1 
ATOM   5286  O  OG    . SER B 2 152 ? -41.439  -52.029 25.266  1.00 51.17  ? 164 SER B OG    1 
ATOM   5287  N  N     . ALA B 2 153 ? -41.463  -48.756 23.639  1.00 70.60  ? 165 ALA B N     1 
ATOM   5288  C  CA    . ALA B 2 153 ? -40.846  -48.381 22.370  1.00 70.60  ? 165 ALA B CA    1 
ATOM   5289  C  C     . ALA B 2 153 ? -39.785  -49.389 21.941  1.00 70.60  ? 165 ALA B C     1 
ATOM   5290  O  O     . ALA B 2 153 ? -39.283  -49.332 20.818  1.00 70.60  ? 165 ALA B O     1 
ATOM   5291  C  CB    . ALA B 2 153 ? -40.249  -46.988 22.464  1.00 70.60  ? 165 ALA B CB    1 
ATOM   5292  N  N     . LYS B 2 154 ? -39.442  -50.303 22.843  1.00 67.74  ? 166 LYS B N     1 
ATOM   5293  C  CA    . LYS B 2 154 ? -38.465  -51.342 22.548  1.00 67.74  ? 166 LYS B CA    1 
ATOM   5294  C  C     . LYS B 2 154 ? -39.121  -52.522 21.837  1.00 67.74  ? 166 LYS B C     1 
ATOM   5295  O  O     . LYS B 2 154 ? -38.468  -53.246 21.086  1.00 67.74  ? 166 LYS B O     1 
ATOM   5296  C  CB    . LYS B 2 154 ? -37.770  -51.807 23.831  1.00 67.74  ? 166 LYS B CB    1 
ATOM   5297  C  CG    . LYS B 2 154 ? -36.595  -52.747 23.595  1.00 67.74  ? 166 LYS B CG    1 
ATOM   5298  C  CD    . LYS B 2 154 ? -35.699  -52.846 24.821  1.00 67.74  ? 166 LYS B CD    1 
ATOM   5299  C  CE    . LYS B 2 154 ? -34.455  -53.669 24.523  1.00 67.74  ? 166 LYS B CE    1 
ATOM   5300  N  NZ    . LYS B 2 154 ? -33.489  -53.666 25.657  1.00 67.74  ? 166 LYS B NZ    1 
ATOM   5301  N  N     . THR B 2 155 ? -40.417  -52.709 22.072  1.00 77.35  ? 167 THR B N     1 
ATOM   5302  C  CA    . THR B 2 155 ? -41.152  -53.812 21.459  1.00 77.35  ? 167 THR B CA    1 
ATOM   5303  C  C     . THR B 2 155 ? -42.433  -53.346 20.768  1.00 77.35  ? 167 THR B C     1 
ATOM   5304  O  O     . THR B 2 155 ? -43.322  -54.153 20.492  1.00 77.35  ? 167 THR B O     1 
ATOM   5305  C  CB    . THR B 2 155 ? -41.504  -54.902 22.490  1.00 77.35  ? 167 THR B CB    1 
ATOM   5306  O  OG1   . THR B 2 155 ? -42.230  -54.319 23.579  1.00 77.35  ? 167 THR B OG1   1 
ATOM   5307  C  CG2   . THR B 2 155 ? -40.243  -55.562 23.025  1.00 77.35  ? 167 THR B CG2   1 
ATOM   5308  N  N     . ALA B 2 156 ? -42.521  -52.042 20.505  1.00 65.62  ? 168 ALA B N     1 
ATOM   5309  C  CA    . ALA B 2 156 ? -43.671  -51.435 19.823  1.00 65.62  ? 168 ALA B CA    1 
ATOM   5310  C  C     . ALA B 2 156 ? -45.016  -51.669 20.519  1.00 65.62  ? 168 ALA B C     1 
ATOM   5311  O  O     . ALA B 2 156 ? -46.070  -51.396 19.946  1.00 65.62  ? 168 ALA B O     1 
ATOM   5312  C  CB    . ALA B 2 156 ? -43.738  -51.893 18.368  1.00 65.62  ? 168 ALA B CB    1 
ATOM   5313  N  N     . MET B 2 157 ? -44.969  -52.160 21.754  1.00 56.75  ? 169 MET B N     1 
ATOM   5314  C  CA    . MET B 2 157 ? -46.171  -52.495 22.512  1.00 56.75  ? 169 MET B CA    1 
ATOM   5315  C  C     . MET B 2 157 ? -46.997  -51.262 22.863  1.00 56.75  ? 169 MET B C     1 
ATOM   5316  O  O     . MET B 2 157 ? -46.484  -50.312 23.451  1.00 56.75  ? 169 MET B O     1 
ATOM   5317  C  CB    . MET B 2 157 ? -45.791  -53.243 23.792  1.00 56.75  ? 169 MET B CB    1 
ATOM   5318  C  CG    . MET B 2 157 ? -46.929  -53.413 24.789  1.00 56.75  ? 169 MET B CG    1 
ATOM   5319  S  SD    . MET B 2 157 ? -46.368  -54.096 26.364  1.00 56.75  ? 169 MET B SD    1 
ATOM   5320  C  CE    . MET B 2 157 ? -47.884  -54.061 27.320  1.00 56.75  ? 169 MET B CE    1 
ATOM   5321  N  N     . ASN B 2 158 ? -48.274  -51.285 22.485  1.00 76.34  ? 170 ASN B N     1 
ATOM   5322  C  CA    . ASN B 2 158 ? -49.228  -50.224 22.823  1.00 76.34  ? 170 ASN B CA    1 
ATOM   5323  C  C     . ASN B 2 158 ? -48.836  -48.803 22.407  1.00 76.34  ? 170 ASN B C     1 
ATOM   5324  O  O     . ASN B 2 158 ? -49.434  -47.836 22.875  1.00 76.34  ? 170 ASN B O     1 
ATOM   5325  C  CB    . ASN B 2 158 ? -49.569  -50.253 24.318  1.00 76.34  ? 170 ASN B CB    1 
ATOM   5326  C  CG    . ASN B 2 158 ? -50.382  -51.470 24.710  1.00 76.34  ? 170 ASN B CG    1 
ATOM   5327  O  OD1   . ASN B 2 158 ? -51.065  -52.070 23.881  1.00 76.34  ? 170 ASN B OD1   1 
ATOM   5328  N  ND2   . ASN B 2 158 ? -50.319  -51.837 25.986  1.00 76.34  ? 170 ASN B ND2   1 
ATOM   5329  N  N     . VAL B 2 159 ? -47.841  -48.674 21.534  1.00 61.10  ? 171 VAL B N     1 
ATOM   5330  C  CA    . VAL B 2 159 ? -47.416  -47.358 21.068  1.00 61.10  ? 171 VAL B CA    1 
ATOM   5331  C  C     . VAL B 2 159 ? -48.453  -46.746 20.134  1.00 61.10  ? 171 VAL B C     1 
ATOM   5332  O  O     . VAL B 2 159 ? -48.948  -45.645 20.375  1.00 61.10  ? 171 VAL B O     1 
ATOM   5333  C  CB    . VAL B 2 159 ? -46.057  -47.416 20.352  1.00 61.10  ? 171 VAL B CB    1 
ATOM   5334  C  CG1   . VAL B 2 159 ? -45.773  -46.095 19.654  1.00 61.10  ? 171 VAL B CG1   1 
ATOM   5335  C  CG2   . VAL B 2 159 ? -44.953  -47.751 21.340  1.00 61.10  ? 171 VAL B CG2   1 
ATOM   5336  N  N     . ASN B 2 160 ? -48.780  -47.468 19.068  1.00 44.34  ? 172 ASN B N     1 
ATOM   5337  C  CA    . ASN B 2 160 ? -49.785  -47.016 18.116  1.00 44.34  ? 172 ASN B CA    1 
ATOM   5338  C  C     . ASN B 2 160 ? -51.182  -47.066 18.728  1.00 44.34  ? 172 ASN B C     1 
ATOM   5339  O  O     . ASN B 2 160 ? -52.075  -46.319 18.326  1.00 44.34  ? 172 ASN B O     1 
ATOM   5340  C  CB    . ASN B 2 160 ? -49.730  -47.869 16.847  1.00 44.34  ? 172 ASN B CB    1 
ATOM   5341  C  CG    . ASN B 2 160 ? -50.458  -47.232 15.681  1.00 44.34  ? 172 ASN B CG    1 
ATOM   5342  O  OD1   . ASN B 2 160 ? -51.683  -47.298 15.589  1.00 44.34  ? 172 ASN B OD1   1 
ATOM   5343  N  ND2   . ASN B 2 160 ? -49.704  -46.616 14.778  1.00 44.34  ? 172 ASN B ND2   1 
ATOM   5344  N  N     . GLU B 2 161 ? -51.360  -47.945 19.710  1.00 50.86  ? 173 GLU B N     1 
ATOM   5345  C  CA    . GLU B 2 161 ? -52.653  -48.117 20.365  1.00 50.86  ? 173 GLU B CA    1 
ATOM   5346  C  C     . GLU B 2 161 ? -53.063  -46.911 21.211  1.00 50.86  ? 173 GLU B C     1 
ATOM   5347  O  O     . GLU B 2 161 ? -54.213  -46.479 21.159  1.00 50.86  ? 173 GLU B O     1 
ATOM   5348  C  CB    . GLU B 2 161 ? -52.670  -49.390 21.218  1.00 50.86  ? 173 GLU B CB    1 
ATOM   5349  C  CG    . GLU B 2 161 ? -52.809  -50.689 20.430  1.00 50.86  ? 173 GLU B CG    1 
ATOM   5350  C  CD    . GLU B 2 161 ? -51.478  -51.254 19.971  1.00 50.86  ? 173 GLU B CD    1 
ATOM   5351  O  OE1   . GLU B 2 161 ? -51.040  -50.922 18.850  1.00 50.86  ? 173 GLU B OE1   1 
ATOM   5352  O  OE2   . GLU B 2 161 ? -50.872  -52.038 20.731  1.00 50.86  ? 173 GLU B OE2   1 
ATOM   5353  N  N     . ILE B 2 162 ? -52.128  -46.373 21.990  1.00 41.98  ? 174 ILE B N     1 
ATOM   5354  C  CA    . ILE B 2 162 ? -52.435  -45.251 22.879  1.00 41.98  ? 174 ILE B CA    1 
ATOM   5355  C  C     . ILE B 2 162 ? -52.728  -43.955 22.117  1.00 41.98  ? 174 ILE B C     1 
ATOM   5356  O  O     . ILE B 2 162 ? -53.613  -43.190 22.501  1.00 41.98  ? 174 ILE B O     1 
ATOM   5357  C  CB    . ILE B 2 162 ? -51.327  -45.027 23.947  1.00 41.98  ? 174 ILE B CB    1 
ATOM   5358  C  CG1   . ILE B 2 162 ? -51.725  -43.911 24.916  1.00 41.98  ? 174 ILE B CG1   1 
ATOM   5359  C  CG2   . ILE B 2 162 ? -49.988  -44.716 23.298  1.00 41.98  ? 174 ILE B CG2   1 
ATOM   5360  C  CD1   . ILE B 2 162 ? -50.677  -43.608 25.968  1.00 41.98  ? 174 ILE B CD1   1 
ATOM   5361  N  N     . PHE B 2 163 ? -51.991  -43.720 21.034  1.00 56.93  ? 175 PHE B N     1 
ATOM   5362  C  CA    . PHE B 2 163 ? -52.180  -42.521 20.225  1.00 56.93  ? 175 PHE B CA    1 
ATOM   5363  C  C     . PHE B 2 163 ? -53.559  -42.497 19.581  1.00 56.93  ? 175 PHE B C     1 
ATOM   5364  O  O     . PHE B 2 163 ? -54.303  -41.528 19.724  1.00 56.93  ? 175 PHE B O     1 
ATOM   5365  C  CB    . PHE B 2 163 ? -51.107  -42.429 19.139  1.00 56.93  ? 175 PHE B CB    1 
ATOM   5366  C  CG    . PHE B 2 163 ? -49.831  -41.780 19.593  1.00 56.93  ? 175 PHE B CG    1 
ATOM   5367  C  CD1   . PHE B 2 163 ? -49.604  -40.433 19.358  1.00 56.93  ? 175 PHE B CD1   1 
ATOM   5368  C  CD2   . PHE B 2 163 ? -48.856  -42.516 20.247  1.00 56.93  ? 175 PHE B CD2   1 
ATOM   5369  C  CE1   . PHE B 2 163 ? -48.432  -39.831 19.771  1.00 56.93  ? 175 PHE B CE1   1 
ATOM   5370  C  CE2   . PHE B 2 163 ? -47.681  -41.920 20.663  1.00 56.93  ? 175 PHE B CE2   1 
ATOM   5371  C  CZ    . PHE B 2 163 ? -47.469  -40.576 20.424  1.00 56.93  ? 175 PHE B CZ    1 
ATOM   5372  N  N     . MET B 2 164 ? -53.895  -43.569 18.871  1.00 68.55  ? 176 MET B N     1 
ATOM   5373  C  CA    . MET B 2 164 ? -55.174  -43.649 18.177  1.00 68.55  ? 176 MET B CA    1 
ATOM   5374  C  C     . MET B 2 164 ? -56.349  -43.690 19.149  1.00 68.55  ? 176 MET B C     1 
ATOM   5375  O  O     . MET B 2 164 ? -57.449  -43.263 18.813  1.00 68.55  ? 176 MET B O     1 
ATOM   5376  C  CB    . MET B 2 164 ? -55.208  -44.851 17.232  1.00 68.55  ? 176 MET B CB    1 
ATOM   5377  C  CG    . MET B 2 164 ? -54.192  -44.768 16.104  1.00 68.55  ? 176 MET B CG    1 
ATOM   5378  S  SD    . MET B 2 164 ? -54.605  -45.839 14.716  1.00 68.55  ? 176 MET B SD    1 
ATOM   5379  C  CE    . MET B 2 164 ? -56.255  -45.254 14.334  1.00 68.55  ? 176 MET B CE    1 
ATOM   5380  N  N     . ALA B 2 165 ? -56.108  -44.191 20.357  1.00 32.85  ? 177 ALA B N     1 
ATOM   5381  C  CA    . ALA B 2 165 ? -57.135  -44.213 21.394  1.00 32.85  ? 177 ALA B CA    1 
ATOM   5382  C  C     . ALA B 2 165 ? -57.525  -42.795 21.797  1.00 32.85  ? 177 ALA B C     1 
ATOM   5383  O  O     . ALA B 2 165 ? -58.653  -42.547 22.222  1.00 32.85  ? 177 ALA B O     1 
ATOM   5384  C  CB    . ALA B 2 165 ? -56.656  -44.998 22.603  1.00 32.85  ? 177 ALA B CB    1 
ATOM   5385  N  N     . ILE B 2 166 ? -56.578  -41.870 21.666  1.00 65.93  ? 178 ILE B N     1 
ATOM   5386  C  CA    . ILE B 2 166 ? -56.830  -40.457 21.921  1.00 65.93  ? 178 ILE B CA    1 
ATOM   5387  C  C     . ILE B 2 166 ? -57.650  -39.868 20.779  1.00 65.93  ? 178 ILE B C     1 
ATOM   5388  O  O     . ILE B 2 166 ? -58.565  -39.075 21.002  1.00 65.93  ? 178 ILE B O     1 
ATOM   5389  C  CB    . ILE B 2 166 ? -55.514  -39.668 22.060  1.00 65.93  ? 178 ILE B CB    1 
ATOM   5390  C  CG1   . ILE B 2 166 ? -54.654  -40.251 23.184  1.00 65.93  ? 178 ILE B CG1   1 
ATOM   5391  C  CG2   . ILE B 2 166 ? -55.796  -38.199 22.313  1.00 65.93  ? 178 ILE B CG2   1 
ATOM   5392  C  CD1   . ILE B 2 166 ? -53.266  -39.648 23.274  1.00 65.93  ? 178 ILE B CD1   1 
ATOM   5393  N  N     . ALA B 2 167 ? -57.314  -40.267 19.556  1.00 64.36  ? 179 ALA B N     1 
ATOM   5394  C  CA    . ALA B 2 167 ? -58.019  -39.804 18.367  1.00 64.36  ? 179 ALA B CA    1 
ATOM   5395  C  C     . ALA B 2 167 ? -59.502  -40.159 18.420  1.00 64.36  ? 179 ALA B C     1 
ATOM   5396  O  O     . ALA B 2 167 ? -60.339  -39.429 17.891  1.00 64.36  ? 179 ALA B O     1 
ATOM   5397  C  CB    . ALA B 2 167 ? -57.381  -40.384 17.117  1.00 64.36  ? 179 ALA B CB    1 
ATOM   5398  N  N     . LYS B 2 168 ? -59.816  -41.284 19.057  1.00 66.67  ? 180 LYS B N     1 
ATOM   5399  C  CA    . LYS B 2 168 ? -61.199  -41.724 19.206  1.00 66.67  ? 180 LYS B CA    1 
ATOM   5400  C  C     . LYS B 2 168 ? -62.003  -40.717 20.019  1.00 66.67  ? 180 LYS B C     1 
ATOM   5401  O  O     . LYS B 2 168 ? -63.178  -40.477 19.740  1.00 66.67  ? 180 LYS B O     1 
ATOM   5402  C  CB    . LYS B 2 168 ? -61.266  -43.095 19.880  1.00 66.67  ? 180 LYS B CB    1 
ATOM   5403  C  CG    . LYS B 2 168 ? -60.364  -44.152 19.267  1.00 66.67  ? 180 LYS B CG    1 
ATOM   5404  C  CD    . LYS B 2 168 ? -60.550  -44.254 17.764  1.00 66.67  ? 180 LYS B CD    1 
ATOM   5405  C  CE    . LYS B 2 168 ? -59.566  -45.245 17.159  1.00 66.67  ? 180 LYS B CE    1 
ATOM   5406  N  NZ    . LYS B 2 168 ? -59.701  -46.604 17.755  1.00 66.67  ? 180 LYS B NZ    1 
ATOM   5407  N  N     . LYS B 2 169 ? -61.361  -40.132 21.026  1.00 50.69  ? 181 LYS B N     1 
ATOM   5408  C  CA    . LYS B 2 169 ? -62.013  -39.150 21.883  1.00 50.69  ? 181 LYS B CA    1 
ATOM   5409  C  C     . LYS B 2 169 ? -61.983  -37.760 21.254  1.00 50.69  ? 181 LYS B C     1 
ATOM   5410  O  O     . LYS B 2 169 ? -62.771  -36.887 21.619  1.00 50.69  ? 181 LYS B O     1 
ATOM   5411  C  CB    . LYS B 2 169 ? -61.359  -39.122 23.267  1.00 50.69  ? 181 LYS B CB    1 
ATOM   5412  C  CG    . LYS B 2 169 ? -61.199  -40.495 23.908  1.00 50.69  ? 181 LYS B CG    1 
ATOM   5413  C  CD    . LYS B 2 169 ? -60.762  -40.399 25.365  1.00 50.69  ? 181 LYS B CD    1 
ATOM   5414  C  CE    . LYS B 2 169 ? -61.954  -40.375 26.315  1.00 50.69  ? 181 LYS B CE    1 
ATOM   5415  N  NZ    . LYS B 2 169 ? -62.808  -39.164 26.159  1.00 50.69  ? 181 LYS B NZ    1 
ATOM   5416  N  N     . LEU B 2 170 ? -61.071  -37.562 20.307  1.00 68.13  ? 182 LEU B N     1 
ATOM   5417  C  CA    . LEU B 2 170 ? -60.947  -36.281 19.614  1.00 68.13  ? 182 LEU B CA    1 
ATOM   5418  C  C     . LEU B 2 170 ? -62.152  -36.006 18.720  1.00 68.13  ? 182 LEU B C     1 
ATOM   5419  O  O     . LEU B 2 170 ? -62.584  -34.861 18.581  1.00 68.13  ? 182 LEU B O     1 
ATOM   5420  C  CB    . LEU B 2 170 ? -59.659  -36.232 18.790  1.00 68.13  ? 182 LEU B CB    1 
ATOM   5421  C  CG    . LEU B 2 170 ? -58.354  -36.120 19.580  1.00 68.13  ? 182 LEU B CG    1 
ATOM   5422  C  CD1   . LEU B 2 170 ? -57.159  -36.011 18.643  1.00 68.13  ? 182 LEU B CD1   1 
ATOM   5423  C  CD2   . LEU B 2 170 ? -58.410  -34.933 20.522  1.00 68.13  ? 182 LEU B CD2   1 
ATOM   5424  N  N     . GLY C 1 4   ? -36.392  -23.494 -28.562 1.00 90.39  ? 17  GLY C N     1 
ATOM   5425  C  CA    . GLY C 1 4   ? -36.193  -23.118 -29.949 1.00 90.39  ? 17  GLY C CA    1 
ATOM   5426  C  C     . GLY C 1 4   ? -35.501  -24.203 -30.750 1.00 90.39  ? 17  GLY C C     1 
ATOM   5427  O  O     . GLY C 1 4   ? -35.377  -24.102 -31.971 1.00 90.39  ? 17  GLY C O     1 
ATOM   5428  N  N     . SER C 1 5   ? -35.050  -25.246 -30.060 1.00 85.33  ? 18  SER C N     1 
ATOM   5429  C  CA    . SER C 1 5   ? -34.356  -26.351 -30.712 1.00 85.33  ? 18  SER C CA    1 
ATOM   5430  C  C     . SER C 1 5   ? -35.332  -27.445 -31.133 1.00 85.33  ? 18  SER C C     1 
ATOM   5431  O  O     . SER C 1 5   ? -36.397  -27.599 -30.535 1.00 85.33  ? 18  SER C O     1 
ATOM   5432  C  CB    . SER C 1 5   ? -33.285  -26.931 -29.786 1.00 85.33  ? 18  SER C CB    1 
ATOM   5433  O  OG    . SER C 1 5   ? -32.411  -25.923 -29.315 1.00 85.33  ? 18  SER C OG    1 
ATOM   5434  N  N     . GLU C 1 6   ? -34.965  -28.202 -32.162 1.00 81.84  ? 19  GLU C N     1 
ATOM   5435  C  CA    . GLU C 1 6   ? -35.819  -29.271 -32.668 1.00 81.84  ? 19  GLU C CA    1 
ATOM   5436  C  C     . GLU C 1 6   ? -35.059  -30.588 -32.797 1.00 81.84  ? 19  GLU C C     1 
ATOM   5437  O  O     . GLU C 1 6   ? -33.831  -30.603 -32.868 1.00 81.84  ? 19  GLU C O     1 
ATOM   5438  C  CB    . GLU C 1 6   ? -36.417  -28.889 -34.026 1.00 81.84  ? 19  GLU C CB    1 
ATOM   5439  C  CG    . GLU C 1 6   ? -37.198  -27.583 -34.032 1.00 81.84  ? 19  GLU C CG    1 
ATOM   5440  C  CD    . GLU C 1 6   ? -38.006  -27.391 -35.302 1.00 81.84  ? 19  GLU C CD    1 
ATOM   5441  O  OE1   . GLU C 1 6   ? -38.053  -28.328 -36.127 1.00 81.84  ? 19  GLU C OE1   1 
ATOM   5442  O  OE2   . GLU C 1 6   ? -38.595  -26.305 -35.475 1.00 81.84  ? 19  GLU C OE2   1 
ATOM   5443  N  N     . ILE C 1 7   ? -35.800  -31.691 -32.825 1.00 104.89 ? 20  ILE C N     1 
ATOM   5444  C  CA    . ILE C 1 7   ? -35.215  -33.008 -33.044 1.00 104.89 ? 20  ILE C CA    1 
ATOM   5445  C  C     . ILE C 1 7   ? -35.674  -33.534 -34.399 1.00 104.89 ? 20  ILE C C     1 
ATOM   5446  O  O     . ILE C 1 7   ? -36.848  -33.415 -34.747 1.00 104.89 ? 20  ILE C O     1 
ATOM   5447  C  CB    . ILE C 1 7   ? -35.639  -34.001 -31.949 1.00 104.89 ? 20  ILE C CB    1 
ATOM   5448  C  CG1   . ILE C 1 7   ? -35.513  -33.362 -30.566 1.00 104.89 ? 20  ILE C CG1   1 
ATOM   5449  C  CG2   . ILE C 1 7   ? -34.812  -35.276 -32.035 1.00 104.89 ? 20  ILE C CG2   1 
ATOM   5450  C  CD1   . ILE C 1 7   ? -34.096  -33.002 -30.188 1.00 104.89 ? 20  ILE C CD1   1 
ATOM   5451  N  N     . SER C 1 8   ? -34.753  -34.113 -35.165 1.00 119.73 ? 21  SER C N     1 
ATOM   5452  C  CA    . SER C 1 8   ? -35.082  -34.592 -36.505 1.00 119.73 ? 21  SER C CA    1 
ATOM   5453  C  C     . SER C 1 8   ? -34.628  -36.028 -36.752 1.00 119.73 ? 21  SER C C     1 
ATOM   5454  O  O     . SER C 1 8   ? -33.586  -36.458 -36.256 1.00 119.73 ? 21  SER C O     1 
ATOM   5455  C  CB    . SER C 1 8   ? -34.480  -33.669 -37.567 1.00 119.73 ? 21  SER C CB    1 
ATOM   5456  O  OG    . SER C 1 8   ? -34.807  -34.112 -38.873 1.00 119.73 ? 21  SER C OG    1 
ATOM   5457  N  N     . LYS C 1 9   ? -35.423  -36.763 -37.524 1.00 110.58 ? 22  LYS C N     1 
ATOM   5458  C  CA    . LYS C 1 9   ? -35.058  -38.107 -37.948 1.00 110.58 ? 22  LYS C CA    1 
ATOM   5459  C  C     . LYS C 1 9   ? -34.214  -37.985 -39.211 1.00 110.58 ? 22  LYS C C     1 
ATOM   5460  O  O     . LYS C 1 9   ? -34.690  -37.495 -40.235 1.00 110.58 ? 22  LYS C O     1 
ATOM   5461  C  CB    . LYS C 1 9   ? -36.315  -38.937 -38.217 1.00 110.58 ? 22  LYS C CB    1 
ATOM   5462  C  CG    . LYS C 1 9   ? -36.141  -40.440 -38.036 1.00 110.58 ? 22  LYS C CG    1 
ATOM   5463  C  CD    . LYS C 1 9   ? -35.489  -41.092 -39.244 1.00 110.58 ? 22  LYS C CD    1 
ATOM   5464  C  CE    . LYS C 1 9   ? -35.188  -42.561 -38.988 1.00 110.58 ? 22  LYS C CE    1 
ATOM   5465  N  NZ    . LYS C 1 9   ? -34.168  -42.744 -37.919 1.00 110.58 ? 22  LYS C NZ    1 
ATOM   5466  N  N     . THR C 1 10  ? -32.961  -38.423 -39.136 1.00 106.04 ? 23  THR C N     1 
ATOM   5467  C  CA    . THR C 1 10  ? -32.017  -38.225 -40.232 1.00 106.04 ? 23  THR C CA    1 
ATOM   5468  C  C     . THR C 1 10  ? -31.588  -39.533 -40.891 1.00 106.04 ? 23  THR C C     1 
ATOM   5469  O  O     . THR C 1 10  ? -31.982  -40.618 -40.461 1.00 106.04 ? 23  THR C O     1 
ATOM   5470  C  CB    . THR C 1 10  ? -30.757  -37.483 -39.749 1.00 106.04 ? 23  THR C CB    1 
ATOM   5471  O  OG1   . THR C 1 10  ? -29.995  -38.337 -38.886 1.00 106.04 ? 23  THR C OG1   1 
ATOM   5472  C  CG2   . THR C 1 10  ? -31.140  -36.220 -38.996 1.00 106.04 ? 23  THR C CG2   1 
ATOM   5473  N  N     . GLU C 1 11  ? -30.772  -39.419 -41.937 1.00 126.32 ? 24  GLU C N     1 
ATOM   5474  C  CA    . GLU C 1 11  ? -30.227  -40.584 -42.627 1.00 126.32 ? 24  GLU C CA    1 
ATOM   5475  C  C     . GLU C 1 11  ? -29.270  -41.362 -41.729 1.00 126.32 ? 24  GLU C C     1 
ATOM   5476  O  O     . GLU C 1 11  ? -29.053  -40.994 -40.573 1.00 126.32 ? 24  GLU C O     1 
ATOM   5477  C  CB    . GLU C 1 11  ? -29.501  -40.171 -43.911 1.00 126.32 ? 24  GLU C CB    1 
ATOM   5478  C  CG    . GLU C 1 11  ? -30.404  -39.676 -45.028 1.00 126.32 ? 24  GLU C CG    1 
ATOM   5479  C  CD    . GLU C 1 11  ? -29.646  -39.440 -46.322 1.00 126.32 ? 24  GLU C CD    1 
ATOM   5480  O  OE1   . GLU C 1 11  ? -29.092  -40.413 -46.875 1.00 126.32 ? 24  GLU C OE1   1 
ATOM   5481  O  OE2   . GLU C 1 11  ? -29.598  -38.281 -46.782 1.00 126.32 ? 24  GLU C OE2   1 
ATOM   5482  N  N     . ALA C 1 12  ? -28.712  -42.442 -42.272 1.00 120.48 ? 25  ALA C N     1 
ATOM   5483  C  CA    . ALA C 1 12  ? -27.784  -43.320 -41.551 1.00 120.48 ? 25  ALA C CA    1 
ATOM   5484  C  C     . ALA C 1 12  ? -28.410  -44.030 -40.345 1.00 120.48 ? 25  ALA C C     1 
ATOM   5485  O  O     . ALA C 1 12  ? -27.767  -44.863 -39.706 1.00 120.48 ? 25  ALA C O     1 
ATOM   5486  C  CB    . ALA C 1 12  ? -26.513  -42.567 -41.145 1.00 120.48 ? 25  ALA C CB    1 
ATOM   5487  N  N     . GLY C 1 13  ? -29.663  -43.700 -40.044 1.00 169.41 ? 26  GLY C N     1 
ATOM   5488  C  CA    . GLY C 1 13  ? -30.399  -44.352 -38.976 1.00 169.41 ? 26  GLY C CA    1 
ATOM   5489  C  C     . GLY C 1 13  ? -30.213  -43.732 -37.603 1.00 169.41 ? 26  GLY C C     1 
ATOM   5490  O  O     . GLY C 1 13  ? -30.207  -44.442 -36.598 1.00 169.41 ? 26  GLY C O     1 
ATOM   5491  N  N     . GLN C 1 14  ? -30.069  -42.410 -37.553 1.00 97.13  ? 27  GLN C N     1 
ATOM   5492  C  CA    . GLN C 1 14  ? -29.845  -41.713 -36.287 1.00 97.13  ? 27  GLN C CA    1 
ATOM   5493  C  C     . GLN C 1 14  ? -30.571  -40.367 -36.206 1.00 97.13  ? 27  GLN C C     1 
ATOM   5494  O  O     . GLN C 1 14  ? -31.210  -39.937 -37.165 1.00 97.13  ? 27  GLN C O     1 
ATOM   5495  C  CB    . GLN C 1 14  ? -28.345  -41.537 -36.031 1.00 97.13  ? 27  GLN C CB    1 
ATOM   5496  C  CG    . GLN C 1 14  ? -27.633  -42.823 -35.630 1.00 97.13  ? 27  GLN C CG    1 
ATOM   5497  C  CD    . GLN C 1 14  ? -26.128  -42.721 -35.745 1.00 97.13  ? 27  GLN C CD    1 
ATOM   5498  O  OE1   . GLN C 1 14  ? -25.591  -41.670 -36.090 1.00 97.13  ? 27  GLN C OE1   1 
ATOM   5499  N  NE2   . GLN C 1 14  ? -25.437  -43.819 -35.460 1.00 97.13  ? 27  GLN C NE2   1 
ATOM   5500  N  N     . TYR C 1 15  ? -30.461  -39.710 -35.053 1.00 91.12  ? 28  TYR C N     1 
ATOM   5501  C  CA    . TYR C 1 15  ? -31.192  -38.473 -34.788 1.00 91.12  ? 28  TYR C CA    1 
ATOM   5502  C  C     . TYR C 1 15  ? -30.245  -37.390 -34.280 1.00 91.12  ? 28  TYR C C     1 
ATOM   5503  O  O     . TYR C 1 15  ? -29.444  -37.634 -33.376 1.00 91.12  ? 28  TYR C O     1 
ATOM   5504  C  CB    . TYR C 1 15  ? -32.294  -38.714 -33.750 1.00 91.12  ? 28  TYR C CB    1 
ATOM   5505  C  CG    . TYR C 1 15  ? -33.089  -39.984 -33.971 1.00 91.12  ? 28  TYR C CG    1 
ATOM   5506  C  CD1   . TYR C 1 15  ? -32.610  -41.210 -33.528 1.00 91.12  ? 28  TYR C CD1   1 
ATOM   5507  C  CD2   . TYR C 1 15  ? -34.319  -39.956 -34.611 1.00 91.12  ? 28  TYR C CD2   1 
ATOM   5508  C  CE1   . TYR C 1 15  ? -33.323  -42.370 -33.728 1.00 91.12  ? 28  TYR C CE1   1 
ATOM   5509  C  CE2   . TYR C 1 15  ? -35.045  -41.114 -34.811 1.00 91.12  ? 28  TYR C CE2   1 
ATOM   5510  C  CZ    . TYR C 1 15  ? -34.540  -42.318 -34.367 1.00 91.12  ? 28  TYR C CZ    1 
ATOM   5511  O  OH    . TYR C 1 15  ? -35.251  -43.477 -34.563 1.00 91.12  ? 28  TYR C OH    1 
ATOM   5512  N  N     . SER C 1 16  ? -30.340  -36.196 -34.856 1.00 87.26  ? 29  SER C N     1 
ATOM   5513  C  CA    . SER C 1 16  ? -29.491  -35.082 -34.443 1.00 87.26  ? 29  SER C CA    1 
ATOM   5514  C  C     . SER C 1 16  ? -30.307  -33.844 -34.080 1.00 87.26  ? 29  SER C C     1 
ATOM   5515  O  O     . SER C 1 16  ? -31.305  -33.533 -34.730 1.00 87.26  ? 29  SER C O     1 
ATOM   5516  C  CB    . SER C 1 16  ? -28.475  -34.738 -35.536 1.00 87.26  ? 29  SER C CB    1 
ATOM   5517  O  OG    . SER C 1 16  ? -27.563  -35.803 -35.743 1.00 87.26  ? 29  SER C OG    1 
ATOM   5518  N  N     . VAL C 1 17  ? -29.872  -33.144 -33.036 1.00 114.03 ? 30  VAL C N     1 
ATOM   5519  C  CA    . VAL C 1 17  ? -30.532  -31.919 -32.600 1.00 114.03 ? 30  VAL C CA    1 
ATOM   5520  C  C     . VAL C 1 17  ? -30.262  -30.782 -33.581 1.00 114.03 ? 30  VAL C C     1 
ATOM   5521  O  O     . VAL C 1 17  ? -29.308  -30.837 -34.356 1.00 114.03 ? 30  VAL C O     1 
ATOM   5522  C  CB    . VAL C 1 17  ? -30.062  -31.495 -31.194 1.00 114.03 ? 30  VAL C CB    1 
ATOM   5523  C  CG1   . VAL C 1 17  ? -30.501  -32.513 -30.157 1.00 114.03 ? 30  VAL C CG1   1 
ATOM   5524  C  CG2   . VAL C 1 17  ? -28.552  -31.326 -31.166 1.00 114.03 ? 30  VAL C CG2   1 
ATOM   5525  N  N     . SER C 1 18  ? -31.109  -29.758 -33.545 1.00 92.47  ? 31  SER C N     1 
ATOM   5526  C  CA    . SER C 1 18  ? -30.940  -28.596 -34.407 1.00 92.47  ? 31  SER C CA    1 
ATOM   5527  C  C     . SER C 1 18  ? -29.629  -27.885 -34.089 1.00 92.47  ? 31  SER C C     1 
ATOM   5528  O  O     . SER C 1 18  ? -29.262  -27.738 -32.924 1.00 92.47  ? 31  SER C O     1 
ATOM   5529  C  CB    . SER C 1 18  ? -32.110  -27.627 -34.235 1.00 92.47  ? 31  SER C CB    1 
ATOM   5530  O  OG    . SER C 1 18  ? -32.135  -27.096 -32.922 1.00 92.47  ? 31  SER C OG    1 
ATOM   5531  N  N     . ALA C 1 19  ? -28.925  -27.454 -35.131 1.00 82.57  ? 32  ALA C N     1 
ATOM   5532  C  CA    . ALA C 1 19  ? -27.648  -26.767 -34.967 1.00 82.57  ? 32  ALA C CA    1 
ATOM   5533  C  C     . ALA C 1 19  ? -27.808  -25.468 -34.182 1.00 82.57  ? 32  ALA C C     1 
ATOM   5534  O  O     . ALA C 1 19  ? -28.765  -24.725 -34.394 1.00 82.57  ? 32  ALA C O     1 
ATOM   5535  C  CB    . ALA C 1 19  ? -27.017  -26.493 -36.322 1.00 82.57  ? 32  ALA C CB    1 
ATOM   5536  N  N     . PRO C 1 20  ? -26.865  -25.194 -33.266 1.00 71.38  ? 33  PRO C N     1 
ATOM   5537  C  CA    . PRO C 1 20  ? -26.910  -23.973 -32.457 1.00 71.38  ? 33  PRO C CA    1 
ATOM   5538  C  C     . PRO C 1 20  ? -26.557  -22.734 -33.272 1.00 71.38  ? 33  PRO C C     1 
ATOM   5539  O  O     . PRO C 1 20  ? -25.626  -22.773 -34.078 1.00 71.38  ? 33  PRO C O     1 
ATOM   5540  C  CB    . PRO C 1 20  ? -25.843  -24.225 -31.390 1.00 71.38  ? 33  PRO C CB    1 
ATOM   5541  C  CG    . PRO C 1 20  ? -24.888  -25.167 -32.033 1.00 71.38  ? 33  PRO C CG    1 
ATOM   5542  C  CD    . PRO C 1 20  ? -25.722  -26.053 -32.910 1.00 71.38  ? 33  PRO C CD    1 
ATOM   5543  N  N     . GLU C 1 21  ? -27.295  -21.648 -33.059 1.00 68.29  ? 34  GLU C N     1 
ATOM   5544  C  CA    . GLU C 1 21  ? -27.071  -20.403 -33.786 1.00 68.29  ? 34  GLU C CA    1 
ATOM   5545  C  C     . GLU C 1 21  ? -26.374  -19.372 -32.902 1.00 68.29  ? 34  GLU C C     1 
ATOM   5546  O  O     . GLU C 1 21  ? -26.947  -18.893 -31.924 1.00 68.29  ? 34  GLU C O     1 
ATOM   5547  C  CB    . GLU C 1 21  ? -28.403  -19.842 -34.289 1.00 68.29  ? 34  GLU C CB    1 
ATOM   5548  C  CG    . GLU C 1 21  ? -28.289  -18.565 -35.113 1.00 68.29  ? 34  GLU C CG    1 
ATOM   5549  C  CD    . GLU C 1 21  ? -28.096  -18.836 -36.593 1.00 68.29  ? 34  GLU C CD    1 
ATOM   5550  O  OE1   . GLU C 1 21  ? -27.892  -17.867 -37.356 1.00 68.29  ? 34  GLU C OE1   1 
ATOM   5551  O  OE2   . GLU C 1 21  ? -28.153  -20.017 -36.995 1.00 68.29  ? 34  GLU C OE2   1 
ATOM   5552  N  N     . HIS C 1 22  ? -25.137  -19.032 -33.250 1.00 49.27  ? 35  HIS C N     1 
ATOM   5553  C  CA    . HIS C 1 22  ? -24.383  -18.035 -32.498 1.00 49.27  ? 35  HIS C CA    1 
ATOM   5554  C  C     . HIS C 1 22  ? -24.470  -16.670 -33.175 1.00 49.27  ? 35  HIS C C     1 
ATOM   5555  O  O     . HIS C 1 22  ? -24.345  -16.565 -34.394 1.00 49.27  ? 35  HIS C O     1 
ATOM   5556  C  CB    . HIS C 1 22  ? -22.921  -18.463 -32.352 1.00 49.27  ? 35  HIS C CB    1 
ATOM   5557  C  CG    . HIS C 1 22  ? -22.742  -19.794 -31.692 1.00 49.27  ? 35  HIS C CG    1 
ATOM   5558  N  ND1   . HIS C 1 22  ? -23.100  -20.979 -32.298 1.00 49.27  ? 35  HIS C ND1   1 
ATOM   5559  C  CD2   . HIS C 1 22  ? -22.241  -20.128 -30.479 1.00 49.27  ? 35  HIS C CD2   1 
ATOM   5560  C  CE1   . HIS C 1 22  ? -22.827  -21.985 -31.486 1.00 49.27  ? 35  HIS C CE1   1 
ATOM   5561  N  NE2   . HIS C 1 22  ? -22.304  -21.496 -30.377 1.00 49.27  ? 35  HIS C NE2   1 
ATOM   5562  N  N     . LYS C 1 23  ? -24.683  -15.628 -32.379 1.00 46.57  ? 36  LYS C N     1 
ATOM   5563  C  CA    . LYS C 1 23  ? -24.868  -14.287 -32.915 1.00 46.57  ? 36  LYS C CA    1 
ATOM   5564  C  C     . LYS C 1 23  ? -23.815  -13.320 -32.385 1.00 46.57  ? 36  LYS C C     1 
ATOM   5565  O  O     . LYS C 1 23  ? -23.900  -12.111 -32.609 1.00 46.57  ? 36  LYS C O     1 
ATOM   5566  C  CB    . LYS C 1 23  ? -26.268  -13.770 -32.579 1.00 46.57  ? 36  LYS C CB    1 
ATOM   5567  C  CG    . LYS C 1 23  ? -27.374  -14.790 -32.798 1.00 46.57  ? 36  LYS C CG    1 
ATOM   5568  C  CD    . LYS C 1 23  ? -28.538  -14.193 -33.571 1.00 46.57  ? 36  LYS C CD    1 
ATOM   5569  C  CE    . LYS C 1 23  ? -29.107  -12.975 -32.868 1.00 46.57  ? 36  LYS C CE    1 
ATOM   5570  N  NZ    . LYS C 1 23  ? -30.160  -12.309 -33.684 1.00 46.57  ? 36  LYS C NZ    1 
ATOM   5571  N  N     . GLY C 1 24  ? -22.823  -13.859 -31.683 1.00 39.98  ? 37  GLY C N     1 
ATOM   5572  C  CA    . GLY C 1 24  ? -21.776  -13.039 -31.102 1.00 39.98  ? 37  GLY C CA    1 
ATOM   5573  C  C     . GLY C 1 24  ? -20.424  -13.724 -31.043 1.00 39.98  ? 37  GLY C C     1 
ATOM   5574  O  O     . GLY C 1 24  ? -20.337  -14.951 -30.963 1.00 39.98  ? 37  GLY C O     1 
ATOM   5575  N  N     . LEU C 1 25  ? -19.366  -12.920 -31.088 1.00 10.20  ? 38  LEU C N     1 
ATOM   5576  C  CA    . LEU C 1 25  ? -18.000  -13.419 -30.964 1.00 10.20  ? 38  LEU C CA    1 
ATOM   5577  C  C     . LEU C 1 25  ? -17.184  -12.455 -30.113 1.00 10.20  ? 38  LEU C C     1 
ATOM   5578  O  O     . LEU C 1 25  ? -17.180  -11.251 -30.367 1.00 10.20  ? 38  LEU C O     1 
ATOM   5579  C  CB    . LEU C 1 25  ? -17.353  -13.582 -32.340 1.00 10.20  ? 38  LEU C CB    1 
ATOM   5580  C  CG    . LEU C 1 25  ? -15.888  -14.021 -32.353 1.00 10.20  ? 38  LEU C CG    1 
ATOM   5581  C  CD1   . LEU C 1 25  ? -15.731  -15.353 -31.652 1.00 10.20  ? 38  LEU C CD1   1 
ATOM   5582  C  CD2   . LEU C 1 25  ? -15.361  -14.104 -33.774 1.00 10.20  ? 38  LEU C CD2   1 
ATOM   5583  N  N     . VAL C 1 26  ? -16.495  -12.981 -29.105 1.00 41.09  ? 39  VAL C N     1 
ATOM   5584  C  CA    . VAL C 1 26  ? -15.725  -12.136 -28.196 1.00 41.09  ? 39  VAL C CA    1 
ATOM   5585  C  C     . VAL C 1 26  ? -14.315  -12.676 -27.954 1.00 41.09  ? 39  VAL C C     1 
ATOM   5586  O  O     . VAL C 1 26  ? -14.138  -13.831 -27.567 1.00 41.09  ? 39  VAL C O     1 
ATOM   5587  C  CB    . VAL C 1 26  ? -16.467  -11.926 -26.856 1.00 41.09  ? 39  VAL C CB    1 
ATOM   5588  C  CG1   . VAL C 1 26  ? -17.003  -13.243 -26.326 1.00 41.09  ? 39  VAL C CG1   1 
ATOM   5589  C  CG2   . VAL C 1 26  ? -15.562  -11.256 -25.837 1.00 41.09  ? 39  VAL C CG2   1 
ATOM   5590  N  N     . LEU C 1 27  ? -13.317  -11.830 -28.191 1.00 34.09  ? 40  LEU C N     1 
ATOM   5591  C  CA    . LEU C 1 27  ? -11.920  -12.220 -28.037 1.00 34.09  ? 40  LEU C CA    1 
ATOM   5592  C  C     . LEU C 1 27  ? -11.344  -11.665 -26.733 1.00 34.09  ? 40  LEU C C     1 
ATOM   5593  O  O     . LEU C 1 27  ? -11.375  -10.456 -26.498 1.00 34.09  ? 40  LEU C O     1 
ATOM   5594  C  CB    . LEU C 1 27  ? -11.106  -11.743 -29.239 1.00 34.09  ? 40  LEU C CB    1 
ATOM   5595  C  CG    . LEU C 1 27  ? -11.729  -12.087 -30.595 1.00 34.09  ? 40  LEU C CG    1 
ATOM   5596  C  CD1   . LEU C 1 27  ? -10.877  -11.583 -31.747 1.00 34.09  ? 40  LEU C CD1   1 
ATOM   5597  C  CD2   . LEU C 1 27  ? -11.959  -13.582 -30.719 1.00 34.09  ? 40  LEU C CD2   1 
ATOM   5598  N  N     . SER C 1 28  ? -10.818  -12.556 -25.894 1.00 70.12  ? 41  SER C N     1 
ATOM   5599  C  CA    . SER C 1 28  ? -10.376  -12.197 -24.546 1.00 70.12  ? 41  SER C CA    1 
ATOM   5600  C  C     . SER C 1 28  ? -9.254   -11.166 -24.525 1.00 70.12  ? 41  SER C C     1 
ATOM   5601  O  O     . SER C 1 28  ? -8.544   -10.978 -25.513 1.00 70.12  ? 41  SER C O     1 
ATOM   5602  C  CB    . SER C 1 28  ? -9.935   -13.441 -23.774 1.00 70.12  ? 41  SER C CB    1 
ATOM   5603  O  OG    . SER C 1 28  ? -8.717   -13.955 -24.283 1.00 70.12  ? 41  SER C OG    1 
ATOM   5604  N  N     . GLY C 1 29  ? -9.106   -10.500 -23.384 1.00 44.50  ? 42  GLY C N     1 
ATOM   5605  C  CA    . GLY C 1 29  ? -8.039   -9.536  -23.193 1.00 44.50  ? 42  GLY C CA    1 
ATOM   5606  C  C     . GLY C 1 29  ? -6.854   -10.157 -22.483 1.00 44.50  ? 42  GLY C C     1 
ATOM   5607  O  O     . GLY C 1 29  ? -6.845   -10.278 -21.258 1.00 44.50  ? 42  GLY C O     1 
ATOM   5608  N  N     . GLY C 1 30  ? -5.852   -10.559 -23.256 1.00 43.61  ? 43  GLY C N     1 
ATOM   5609  C  CA    . GLY C 1 30  ? -4.664   -11.173 -22.695 1.00 43.61  ? 43  GLY C CA    1 
ATOM   5610  C  C     . GLY C 1 30  ? -3.399   -10.643 -23.335 1.00 43.61  ? 43  GLY C C     1 
ATOM   5611  O  O     . GLY C 1 30  ? -3.396   -9.560  -23.920 1.00 43.61  ? 43  GLY C O     1 
ATOM   5612  N  N     . GLY C 1 31  ? -2.319   -11.408 -23.226 1.00 49.49  ? 44  GLY C N     1 
ATOM   5613  C  CA    . GLY C 1 31  ? -1.054   -11.007 -23.809 1.00 49.49  ? 44  GLY C CA    1 
ATOM   5614  C  C     . GLY C 1 31  ? -0.803   -11.662 -25.150 1.00 49.49  ? 44  GLY C C     1 
ATOM   5615  O  O     . GLY C 1 31  ? 0.313    -11.630 -25.659 1.00 49.49  ? 44  GLY C O     1 
ATOM   5616  N  N     . ALA C 1 32  ? -1.850   -12.247 -25.724 1.00 36.25  ? 45  ALA C N     1 
ATOM   5617  C  CA    . ALA C 1 32  ? -1.749   -12.949 -27.001 1.00 36.25  ? 45  ALA C CA    1 
ATOM   5618  C  C     . ALA C 1 32  ? -1.232   -12.059 -28.125 1.00 36.25  ? 45  ALA C C     1 
ATOM   5619  O  O     . ALA C 1 32  ? -1.347   -10.835 -28.065 1.00 36.25  ? 45  ALA C O     1 
ATOM   5620  C  CB    . ALA C 1 32  ? -3.095   -13.533 -27.382 1.00 36.25  ? 45  ALA C CB    1 
ATOM   5621  N  N     . LYS C 1 33  ? -0.663   -12.682 -29.151 1.00 71.92  ? 46  LYS C N     1 
ATOM   5622  C  CA    . LYS C 1 33  ? -0.242   -11.954 -30.340 1.00 71.92  ? 46  LYS C CA    1 
ATOM   5623  C  C     . LYS C 1 33  ? -1.242   -12.208 -31.464 1.00 71.92  ? 46  LYS C C     1 
ATOM   5624  O  O     . LYS C 1 33  ? -1.772   -13.312 -31.594 1.00 71.92  ? 46  LYS C O     1 
ATOM   5625  C  CB    . LYS C 1 33  ? 1.176    -12.355 -30.754 1.00 71.92  ? 46  LYS C CB    1 
ATOM   5626  C  CG    . LYS C 1 33  ? 1.950    -11.242 -31.449 1.00 71.92  ? 46  LYS C CG    1 
ATOM   5627  C  CD    . LYS C 1 33  ? 3.438    -11.321 -31.136 1.00 71.92  ? 46  LYS C CD    1 
ATOM   5628  C  CE    . LYS C 1 33  ? 4.171    -10.068 -31.596 1.00 71.92  ? 46  LYS C CE    1 
ATOM   5629  N  NZ    . LYS C 1 33  ? 5.610    -10.084 -31.212 1.00 71.92  ? 46  LYS C NZ    1 
ATOM   5630  N  N     . GLY C 1 34  ? -1.492   -11.182 -32.272 1.00 55.48  ? 47  GLY C N     1 
ATOM   5631  C  CA    . GLY C 1 34  ? -2.568   -11.200 -33.250 1.00 55.48  ? 47  GLY C CA    1 
ATOM   5632  C  C     . GLY C 1 34  ? -2.590   -12.333 -34.263 1.00 55.48  ? 47  GLY C C     1 
ATOM   5633  O  O     . GLY C 1 34  ? -3.585   -12.516 -34.964 1.00 55.48  ? 47  GLY C O     1 
ATOM   5634  N  N     . ILE C 1 35  ? -1.503   -13.093 -34.346 1.00 56.79  ? 48  ILE C N     1 
ATOM   5635  C  CA    . ILE C 1 35  ? -1.421   -14.199 -35.293 1.00 56.79  ? 48  ILE C CA    1 
ATOM   5636  C  C     . ILE C 1 35  ? -2.159   -15.420 -34.748 1.00 56.79  ? 48  ILE C C     1 
ATOM   5637  O  O     . ILE C 1 35  ? -2.449   -16.365 -35.482 1.00 56.79  ? 48  ILE C O     1 
ATOM   5638  C  CB    . ILE C 1 35  ? 0.044    -14.589 -35.590 1.00 56.79  ? 48  ILE C CB    1 
ATOM   5639  C  CG1   . ILE C 1 35  ? 0.990    -13.412 -35.329 1.00 56.79  ? 48  ILE C CG1   1 
ATOM   5640  C  CG2   . ILE C 1 35  ? 0.183    -15.112 -37.018 1.00 56.79  ? 48  ILE C CG2   1 
ATOM   5641  C  CD1   . ILE C 1 35  ? 0.923    -12.309 -36.370 1.00 56.79  ? 48  ILE C CD1   1 
ATOM   5642  N  N     . SER C 1 36  ? -2.465   -15.388 -33.455 1.00 39.24  ? 49  SER C N     1 
ATOM   5643  C  CA    . SER C 1 36  ? -3.107   -16.514 -32.786 1.00 39.24  ? 49  SER C CA    1 
ATOM   5644  C  C     . SER C 1 36  ? -4.580   -16.649 -33.161 1.00 39.24  ? 49  SER C C     1 
ATOM   5645  O  O     . SER C 1 36  ? -5.186   -17.698 -32.947 1.00 39.24  ? 49  SER C O     1 
ATOM   5646  C  CB    . SER C 1 36  ? -2.971   -16.378 -31.270 1.00 39.24  ? 49  SER C CB    1 
ATOM   5647  O  OG    . SER C 1 36  ? -1.626   -16.151 -30.893 1.00 39.24  ? 49  SER C OG    1 
ATOM   5648  N  N     . TYR C 1 37  ? -5.150   -15.586 -33.719 1.00 32.44  ? 50  TYR C N     1 
ATOM   5649  C  CA    . TYR C 1 37  ? -6.565   -15.574 -34.073 1.00 32.44  ? 50  TYR C CA    1 
ATOM   5650  C  C     . TYR C 1 37  ? -6.807   -15.878 -35.552 1.00 32.44  ? 50  TYR C C     1 
ATOM   5651  O  O     . TYR C 1 37  ? -7.952   -15.914 -36.002 1.00 32.44  ? 50  TYR C O     1 
ATOM   5652  C  CB    . TYR C 1 37  ? -7.196   -14.224 -33.725 1.00 32.44  ? 50  TYR C CB    1 
ATOM   5653  C  CG    . TYR C 1 37  ? -7.231   -13.902 -32.248 1.00 32.44  ? 50  TYR C CG    1 
ATOM   5654  C  CD1   . TYR C 1 37  ? -8.045   -14.615 -31.382 1.00 32.44  ? 50  TYR C CD1   1 
ATOM   5655  C  CD2   . TYR C 1 37  ? -6.469   -12.868 -31.727 1.00 32.44  ? 50  TYR C CD2   1 
ATOM   5656  C  CE1   . TYR C 1 37  ? -8.086   -14.320 -30.036 1.00 32.44  ? 50  TYR C CE1   1 
ATOM   5657  C  CE2   . TYR C 1 37  ? -6.503   -12.563 -30.383 1.00 32.44  ? 50  TYR C CE2   1 
ATOM   5658  C  CZ    . TYR C 1 37  ? -7.314   -13.293 -29.542 1.00 32.44  ? 50  TYR C CZ    1 
ATOM   5659  O  OH    . TYR C 1 37  ? -7.358   -12.998 -28.199 1.00 32.44  ? 50  TYR C OH    1 
ATOM   5660  N  N     . LEU C 1 38  ? -5.732   -16.092 -36.305 1.00 43.87  ? 51  LEU C N     1 
ATOM   5661  C  CA    . LEU C 1 38  ? -5.845   -16.310 -37.745 1.00 43.87  ? 51  LEU C CA    1 
ATOM   5662  C  C     . LEU C 1 38  ? -6.534   -17.635 -38.067 1.00 43.87  ? 51  LEU C C     1 
ATOM   5663  O  O     . LEU C 1 38  ? -7.467   -17.678 -38.872 1.00 43.87  ? 51  LEU C O     1 
ATOM   5664  C  CB    . LEU C 1 38  ? -4.468   -16.238 -38.411 1.00 43.87  ? 51  LEU C CB    1 
ATOM   5665  C  CG    . LEU C 1 38  ? -4.391   -16.112 -39.937 1.00 43.87  ? 51  LEU C CG    1 
ATOM   5666  C  CD1   . LEU C 1 38  ? -4.286   -17.472 -40.604 1.00 43.87  ? 51  LEU C CD1   1 
ATOM   5667  C  CD2   . LEU C 1 38  ? -5.586   -15.347 -40.486 1.00 43.87  ? 51  LEU C CD2   1 
ATOM   5668  N  N     . GLY C 1 39  ? -6.077   -18.710 -37.432 1.00 41.54  ? 52  GLY C N     1 
ATOM   5669  C  CA    . GLY C 1 39  ? -6.638   -20.030 -37.663 1.00 41.54  ? 52  GLY C CA    1 
ATOM   5670  C  C     . GLY C 1 39  ? -8.060   -20.187 -37.153 1.00 41.54  ? 52  GLY C C     1 
ATOM   5671  O  O     . GLY C 1 39  ? -8.801   -21.059 -37.609 1.00 41.54  ? 52  GLY C O     1 
ATOM   5672  N  N     . MET C 1 40  ? -8.440   -19.343 -36.199 1.00 37.19  ? 53  MET C N     1 
ATOM   5673  C  CA    . MET C 1 40  ? -9.786   -19.378 -35.644 1.00 37.19  ? 53  MET C CA    1 
ATOM   5674  C  C     . MET C 1 40  ? -10.795  -18.813 -36.643 1.00 37.19  ? 53  MET C C     1 
ATOM   5675  O  O     . MET C 1 40  ? -11.902  -19.333 -36.782 1.00 37.19  ? 53  MET C O     1 
ATOM   5676  C  CB    . MET C 1 40  ? -9.833   -18.613 -34.318 1.00 37.19  ? 53  MET C CB    1 
ATOM   5677  C  CG    . MET C 1 40  ? -11.196  -18.572 -33.653 1.00 37.19  ? 53  MET C CG    1 
ATOM   5678  S  SD    . MET C 1 40  ? -12.085  -17.042 -33.989 1.00 37.19  ? 53  MET C SD    1 
ATOM   5679  C  CE    . MET C 1 40  ? -10.913  -15.835 -33.375 1.00 37.19  ? 53  MET C CE    1 
ATOM   5680  N  N     . ILE C 1 41  ? -10.398  -17.754 -37.344 1.00 38.80  ? 54  ILE C N     1 
ATOM   5681  C  CA    . ILE C 1 41  ? -11.249  -17.127 -38.352 1.00 38.80  ? 54  ILE C CA    1 
ATOM   5682  C  C     . ILE C 1 41  ? -11.425  -18.021 -39.583 1.00 38.80  ? 54  ILE C C     1 
ATOM   5683  O  O     . ILE C 1 41  ? -12.528  -18.132 -40.124 1.00 38.80  ? 54  ILE C O     1 
ATOM   5684  C  CB    . ILE C 1 41  ? -10.700  -15.744 -38.770 1.00 38.80  ? 54  ILE C CB    1 
ATOM   5685  C  CG1   . ILE C 1 41  ? -10.728  -14.782 -37.583 1.00 38.80  ? 54  ILE C CG1   1 
ATOM   5686  C  CG2   . ILE C 1 41  ? -11.499  -15.166 -39.929 1.00 38.80  ? 54  ILE C CG2   1 
ATOM   5687  C  CD1   . ILE C 1 41  ? -10.310  -13.372 -37.931 1.00 38.80  ? 54  ILE C CD1   1 
ATOM   5688  N  N     . GLN C 1 42  ? -10.337  -18.655 -40.015 1.00 57.85  ? 55  GLN C N     1 
ATOM   5689  C  CA    . GLN C 1 42  ? -10.379  -19.593 -41.135 1.00 57.85  ? 55  GLN C CA    1 
ATOM   5690  C  C     . GLN C 1 42  ? -11.364  -20.725 -40.865 1.00 57.85  ? 55  GLN C C     1 
ATOM   5691  O  O     . GLN C 1 42  ? -12.078  -21.171 -41.762 1.00 57.85  ? 55  GLN C O     1 
ATOM   5692  C  CB    . GLN C 1 42  ? -8.992   -20.180 -41.400 1.00 57.85  ? 55  GLN C CB    1 
ATOM   5693  C  CG    . GLN C 1 42  ? -7.989   -19.211 -42.005 1.00 57.85  ? 55  GLN C CG    1 
ATOM   5694  C  CD    . GLN C 1 42  ? -6.695   -19.894 -42.406 1.00 57.85  ? 55  GLN C CD    1 
ATOM   5695  O  OE1   . GLN C 1 42  ? -6.354   -20.958 -41.889 1.00 57.85  ? 55  GLN C OE1   1 
ATOM   5696  N  NE2   . GLN C 1 42  ? -5.969   -19.288 -43.339 1.00 57.85  ? 55  GLN C NE2   1 
ATOM   5697  N  N     . ALA C 1 43  ? -11.391  -21.185 -39.620 1.00 38.64  ? 56  ALA C N     1 
ATOM   5698  C  CA    . ALA C 1 43  ? -12.281  -22.262 -39.209 1.00 38.64  ? 56  ALA C CA    1 
ATOM   5699  C  C     . ALA C 1 43  ? -13.742  -21.830 -39.273 1.00 38.64  ? 56  ALA C C     1 
ATOM   5700  O  O     . ALA C 1 43  ? -14.588  -22.548 -39.805 1.00 38.64  ? 56  ALA C O     1 
ATOM   5701  C  CB    . ALA C 1 43  ? -11.928  -22.720 -37.808 1.00 38.64  ? 56  ALA C CB    1 
ATOM   5702  N  N     . LEU C 1 44  ? -14.030  -20.653 -38.725 1.00 36.87  ? 57  LEU C N     1 
ATOM   5703  C  CA    . LEU C 1 44  ? -15.395  -20.136 -38.673 1.00 36.87  ? 57  LEU C CA    1 
ATOM   5704  C  C     . LEU C 1 44  ? -15.986  -19.896 -40.062 1.00 36.87  ? 57  LEU C C     1 
ATOM   5705  O  O     . LEU C 1 44  ? -17.169  -20.147 -40.289 1.00 36.87  ? 57  LEU C O     1 
ATOM   5706  C  CB    . LEU C 1 44  ? -15.453  -18.852 -37.844 1.00 36.87  ? 57  LEU C CB    1 
ATOM   5707  C  CG    . LEU C 1 44  ? -15.099  -18.970 -36.362 1.00 36.87  ? 57  LEU C CG    1 
ATOM   5708  C  CD1   . LEU C 1 44  ? -15.288  -17.637 -35.657 1.00 36.87  ? 57  LEU C CD1   1 
ATOM   5709  C  CD2   . LEU C 1 44  ? -15.930  -20.051 -35.695 1.00 36.87  ? 57  LEU C CD2   1 
ATOM   5710  N  N     . GLN C 1 45  ? -15.161  -19.406 -40.983 1.00 60.37  ? 58  GLN C N     1 
ATOM   5711  C  CA    . GLN C 1 45  ? -15.588  -19.209 -42.364 1.00 60.37  ? 58  GLN C CA    1 
ATOM   5712  C  C     . GLN C 1 45  ? -15.917  -20.545 -43.023 1.00 60.37  ? 58  GLN C C     1 
ATOM   5713  O  O     . GLN C 1 45  ? -16.907  -20.665 -43.745 1.00 60.37  ? 58  GLN C O     1 
ATOM   5714  C  CB    . GLN C 1 45  ? -14.508  -18.478 -43.162 1.00 60.37  ? 58  GLN C CB    1 
ATOM   5715  C  CG    . GLN C 1 45  ? -14.670  -18.577 -44.675 1.00 60.37  ? 58  GLN C CG    1 
ATOM   5716  C  CD    . GLN C 1 45  ? -15.850  -17.782 -45.209 1.00 60.37  ? 58  GLN C CD    1 
ATOM   5717  O  OE1   . GLN C 1 45  ? -16.451  -16.978 -44.498 1.00 60.37  ? 58  GLN C OE1   1 
ATOM   5718  N  NE2   . GLN C 1 45  ? -16.184  -18.006 -46.475 1.00 60.37  ? 58  GLN C NE2   1 
ATOM   5719  N  N     . GLU C 1 46  ? -15.079  -21.545 -42.765 1.00 47.07  ? 59  GLU C N     1 
ATOM   5720  C  CA    . GLU C 1 46  ? -15.292  -22.888 -43.289 1.00 47.07  ? 59  GLU C CA    1 
ATOM   5721  C  C     . GLU C 1 46  ? -16.613  -23.465 -42.792 1.00 47.07  ? 59  GLU C C     1 
ATOM   5722  O  O     . GLU C 1 46  ? -17.345  -24.105 -43.547 1.00 47.07  ? 59  GLU C O     1 
ATOM   5723  C  CB    . GLU C 1 46  ? -14.130  -23.809 -42.897 1.00 47.07  ? 59  GLU C CB    1 
ATOM   5724  C  CG    . GLU C 1 46  ? -14.359  -25.279 -43.231 1.00 47.07  ? 59  GLU C CG    1 
ATOM   5725  C  CD    . GLU C 1 46  ? -13.138  -26.140 -42.971 1.00 47.07  ? 59  GLU C CD    1 
ATOM   5726  O  OE1   . GLU C 1 46  ? -13.293  -27.375 -42.863 1.00 47.07  ? 59  GLU C OE1   1 
ATOM   5727  O  OE2   . GLU C 1 46  ? -12.025  -25.584 -42.879 1.00 47.07  ? 59  GLU C OE2   1 
ATOM   5728  N  N     . ARG C 1 47  ? -16.916  -23.227 -41.520 1.00 36.01  ? 60  ARG C N     1 
ATOM   5729  C  CA    . ARG C 1 47  ? -18.149  -23.721 -40.923 1.00 36.01  ? 60  ARG C CA    1 
ATOM   5730  C  C     . ARG C 1 47  ? -19.297  -22.737 -41.123 1.00 36.01  ? 60  ARG C C     1 
ATOM   5731  O  O     . ARG C 1 47  ? -20.437  -23.020 -40.753 1.00 36.01  ? 60  ARG C O     1 
ATOM   5732  C  CB    . ARG C 1 47  ? -17.948  -23.998 -39.433 1.00 36.01  ? 60  ARG C CB    1 
ATOM   5733  C  CG    . ARG C 1 47  ? -16.848  -25.004 -39.129 1.00 36.01  ? 60  ARG C CG    1 
ATOM   5734  C  CD    . ARG C 1 47  ? -17.145  -26.357 -39.751 1.00 36.01  ? 60  ARG C CD    1 
ATOM   5735  N  NE    . ARG C 1 47  ? -16.161  -27.369 -39.378 1.00 36.01  ? 60  ARG C NE    1 
ATOM   5736  C  CZ    . ARG C 1 47  ? -16.314  -28.226 -38.373 1.00 36.01  ? 60  ARG C CZ    1 
ATOM   5737  N  NH1   . ARG C 1 47  ? -17.416  -28.199 -37.637 1.00 36.01  ? 60  ARG C NH1   1 
ATOM   5738  N  NH2   . ARG C 1 47  ? -15.366  -29.113 -38.105 1.00 36.01  ? 60  ARG C NH2   1 
ATOM   5739  N  N     . GLY C 1 48  ? -18.992  -21.582 -41.708 1.00 26.47  ? 61  GLY C N     1 
ATOM   5740  C  CA    . GLY C 1 48  ? -19.998  -20.568 -41.969 1.00 26.47  ? 61  GLY C CA    1 
ATOM   5741  C  C     . GLY C 1 48  ? -20.590  -19.981 -40.702 1.00 26.47  ? 61  GLY C C     1 
ATOM   5742  O  O     . GLY C 1 48  ? -21.780  -19.669 -40.649 1.00 26.47  ? 61  GLY C O     1 
ATOM   5743  N  N     . LYS C 1 49  ? -19.756  -19.828 -39.679 1.00 46.61  ? 62  LYS C N     1 
ATOM   5744  C  CA    . LYS C 1 49  ? -20.209  -19.316 -38.390 1.00 46.61  ? 62  LYS C CA    1 
ATOM   5745  C  C     . LYS C 1 49  ? -20.195  -17.790 -38.345 1.00 46.61  ? 62  LYS C C     1 
ATOM   5746  O  O     . LYS C 1 49  ? -20.757  -17.187 -37.432 1.00 46.61  ? 62  LYS C O     1 
ATOM   5747  C  CB    . LYS C 1 49  ? -19.336  -19.867 -37.263 1.00 46.61  ? 62  LYS C CB    1 
ATOM   5748  C  CG    . LYS C 1 49  ? -19.239  -21.384 -37.217 1.00 46.61  ? 62  LYS C CG    1 
ATOM   5749  C  CD    . LYS C 1 49  ? -20.572  -22.041 -36.885 1.00 46.61  ? 62  LYS C CD    1 
ATOM   5750  C  CE    . LYS C 1 49  ? -21.050  -21.698 -35.482 1.00 46.61  ? 62  LYS C CE    1 
ATOM   5751  N  NZ    . LYS C 1 49  ? -21.940  -20.504 -35.462 1.00 46.61  ? 62  LYS C NZ    1 
ATOM   5752  N  N     . ILE C 1 50  ? -19.555  -17.175 -39.336 1.00 29.57  ? 63  ILE C N     1 
ATOM   5753  C  CA    . ILE C 1 50  ? -19.353  -15.727 -39.351 1.00 29.57  ? 63  ILE C CA    1 
ATOM   5754  C  C     . ILE C 1 50  ? -20.565  -14.947 -39.861 1.00 29.57  ? 63  ILE C C     1 
ATOM   5755  O  O     . ILE C 1 50  ? -20.930  -13.917 -39.293 1.00 29.57  ? 63  ILE C O     1 
ATOM   5756  C  CB    . ILE C 1 50  ? -18.105  -15.345 -40.176 1.00 29.57  ? 63  ILE C CB    1 
ATOM   5757  C  CG1   . ILE C 1 50  ? -16.859  -16.009 -39.590 1.00 29.57  ? 63  ILE C CG1   1 
ATOM   5758  C  CG2   . ILE C 1 50  ? -17.923  -13.836 -40.221 1.00 29.57  ? 63  ILE C CG2   1 
ATOM   5759  C  CD1   . ILE C 1 50  ? -15.561  -15.566 -40.229 1.00 29.57  ? 63  ILE C CD1   1 
ATOM   5760  N  N     . LYS C 1 51  ? -21.182  -15.443 -40.931 1.00 48.56  ? 64  LYS C N     1 
ATOM   5761  C  CA    . LYS C 1 51  ? -22.330  -14.781 -41.549 1.00 48.56  ? 64  LYS C CA    1 
ATOM   5762  C  C     . LYS C 1 51  ? -23.471  -14.579 -40.553 1.00 48.56  ? 64  LYS C C     1 
ATOM   5763  O  O     . LYS C 1 51  ? -24.197  -13.588 -40.618 1.00 48.56  ? 64  LYS C O     1 
ATOM   5764  C  CB    . LYS C 1 51  ? -22.830  -15.598 -42.744 1.00 48.56  ? 64  LYS C CB    1 
ATOM   5765  C  CG    . LYS C 1 51  ? -23.813  -14.866 -43.654 1.00 48.56  ? 64  LYS C CG    1 
ATOM   5766  C  CD    . LYS C 1 51  ? -24.572  -15.848 -44.540 1.00 48.56  ? 64  LYS C CD    1 
ATOM   5767  C  CE    . LYS C 1 51  ? -25.363  -15.143 -45.633 1.00 48.56  ? 64  LYS C CE    1 
ATOM   5768  N  NZ    . LYS C 1 51  ? -24.471  -14.616 -46.701 1.00 48.56  ? 64  LYS C NZ    1 
ATOM   5769  N  N     . ASN C 1 52  ? -23.611  -15.523 -39.628 1.00 49.89  ? 65  ASN C N     1 
ATOM   5770  C  CA    . ASN C 1 52  ? -24.694  -15.503 -38.651 1.00 49.89  ? 65  ASN C CA    1 
ATOM   5771  C  C     . ASN C 1 52  ? -24.482  -14.491 -37.527 1.00 49.89  ? 65  ASN C C     1 
ATOM   5772  O  O     . ASN C 1 52  ? -25.443  -14.041 -36.903 1.00 49.89  ? 65  ASN C O     1 
ATOM   5773  C  CB    . ASN C 1 52  ? -24.897  -16.899 -38.062 1.00 49.89  ? 65  ASN C CB    1 
ATOM   5774  C  CG    . ASN C 1 52  ? -25.071  -17.963 -39.129 1.00 49.89  ? 65  ASN C CG    1 
ATOM   5775  O  OD1   . ASN C 1 52  ? -24.653  -17.785 -40.272 1.00 49.89  ? 65  ASN C OD1   1 
ATOM   5776  N  ND2   . ASN C 1 52  ? -25.689  -19.079 -38.758 1.00 49.89  ? 65  ASN C ND2   1 
ATOM   5777  N  N     . LEU C 1 53  ? -23.224  -14.144 -37.270 1.00 29.68  ? 66  LEU C N     1 
ATOM   5778  C  CA    . LEU C 1 53  ? -22.883  -13.211 -36.199 1.00 29.68  ? 66  LEU C CA    1 
ATOM   5779  C  C     . LEU C 1 53  ? -23.530  -11.844 -36.410 1.00 29.68  ? 66  LEU C C     1 
ATOM   5780  O  O     . LEU C 1 53  ? -23.818  -11.448 -37.539 1.00 29.68  ? 66  LEU C O     1 
ATOM   5781  C  CB    . LEU C 1 53  ? -21.364  -13.050 -36.083 1.00 29.68  ? 66  LEU C CB    1 
ATOM   5782  C  CG    . LEU C 1 53  ? -20.511  -14.308 -35.917 1.00 29.68  ? 66  LEU C CG    1 
ATOM   5783  C  CD1   . LEU C 1 53  ? -19.053  -13.945 -35.703 1.00 29.68  ? 66  LEU C CD1   1 
ATOM   5784  C  CD2   . LEU C 1 53  ? -21.016  -15.167 -34.773 1.00 29.68  ? 66  LEU C CD2   1 
ATOM   5785  N  N     . THR C 1 54  ? -23.766  -11.134 -35.311 1.00 24.89  ? 67  THR C N     1 
ATOM   5786  C  CA    . THR C 1 54  ? -24.312  -9.785  -35.359 1.00 24.89  ? 67  THR C CA    1 
ATOM   5787  C  C     . THR C 1 54  ? -23.418  -8.851  -34.558 1.00 24.89  ? 67  THR C C     1 
ATOM   5788  O  O     . THR C 1 54  ? -23.194  -7.702  -34.939 1.00 24.89  ? 67  THR C O     1 
ATOM   5789  C  CB    . THR C 1 54  ? -25.737  -9.727  -34.777 1.00 24.89  ? 67  THR C CB    1 
ATOM   5790  O  OG1   . THR C 1 54  ? -25.705  -10.077 -33.388 1.00 24.89  ? 67  THR C OG1   1 
ATOM   5791  C  CG2   . THR C 1 54  ? -26.657  -10.682 -35.513 1.00 24.89  ? 67  THR C CG2   1 
ATOM   5792  N  N     . HIS C 1 55  ? -22.911  -9.360  -33.440 1.00 27.89  ? 68  HIS C N     1 
ATOM   5793  C  CA    . HIS C 1 55  ? -22.045  -8.583  -32.565 1.00 27.89  ? 68  HIS C CA    1 
ATOM   5794  C  C     . HIS C 1 55  ? -20.654  -9.196  -32.476 1.00 27.89  ? 68  HIS C C     1 
ATOM   5795  O  O     . HIS C 1 55  ? -20.501  -10.415 -32.548 1.00 27.89  ? 68  HIS C O     1 
ATOM   5796  C  CB    . HIS C 1 55  ? -22.657  -8.481  -31.166 1.00 27.89  ? 68  HIS C CB    1 
ATOM   5797  C  CG    . HIS C 1 55  ? -23.851  -7.586  -31.091 1.00 27.89  ? 68  HIS C CG    1 
ATOM   5798  N  ND1   . HIS C 1 55  ? -24.952  -7.740  -31.909 1.00 27.89  ? 68  HIS C ND1   1 
ATOM   5799  C  CD2   . HIS C 1 55  ? -24.121  -6.524  -30.296 1.00 27.89  ? 68  HIS C CD2   1 
ATOM   5800  C  CE1   . HIS C 1 55  ? -25.844  -6.812  -31.621 1.00 27.89  ? 68  HIS C CE1   1 
ATOM   5801  N  NE2   . HIS C 1 55  ? -25.365  -6.060  -30.645 1.00 27.89  ? 68  HIS C NE2   1 
ATOM   5802  N  N     . VAL C 1 56  ? -19.643  -8.345  -32.324 1.00 22.61  ? 69  VAL C N     1 
ATOM   5803  C  CA    . VAL C 1 56  ? -18.276  -8.818  -32.138 1.00 22.61  ? 69  VAL C CA    1 
ATOM   5804  C  C     . VAL C 1 56  ? -17.500  -7.918  -31.170 1.00 22.61  ? 69  VAL C C     1 
ATOM   5805  O  O     . VAL C 1 56  ? -17.413  -6.703  -31.360 1.00 22.61  ? 69  VAL C O     1 
ATOM   5806  C  CB    . VAL C 1 56  ? -17.528  -8.989  -33.487 1.00 22.61  ? 69  VAL C CB    1 
ATOM   5807  C  CG1   . VAL C 1 56  ? -17.508  -7.690  -34.271 1.00 22.61  ? 69  VAL C CG1   1 
ATOM   5808  C  CG2   . VAL C 1 56  ? -16.118  -9.508  -33.261 1.00 22.61  ? 69  VAL C CG2   1 
ATOM   5809  N  N     . SER C 1 57  ? -16.957  -8.525  -30.119 1.00 12.98  ? 70  SER C N     1 
ATOM   5810  C  CA    . SER C 1 57  ? -16.240  -7.784  -29.086 1.00 12.98  ? 70  SER C CA    1 
ATOM   5811  C  C     . SER C 1 57  ? -14.793  -8.253  -28.982 1.00 12.98  ? 70  SER C C     1 
ATOM   5812  O  O     . SER C 1 57  ? -14.454  -9.340  -29.449 1.00 12.98  ? 70  SER C O     1 
ATOM   5813  C  CB    . SER C 1 57  ? -16.941  -7.941  -27.737 1.00 12.98  ? 70  SER C CB    1 
ATOM   5814  O  OG    . SER C 1 57  ? -16.288  -7.193  -26.729 1.00 12.98  ? 70  SER C OG    1 
ATOM   5815  N  N     . GLY C 1 58  ? -13.941  -7.432  -28.375 1.00 17.69  ? 71  GLY C N     1 
ATOM   5816  C  CA    . GLY C 1 58  ? -12.537  -7.778  -28.241 1.00 17.69  ? 71  GLY C CA    1 
ATOM   5817  C  C     . GLY C 1 58  ? -11.713  -6.771  -27.461 1.00 17.69  ? 71  GLY C C     1 
ATOM   5818  O  O     . GLY C 1 58  ? -12.029  -5.580  -27.426 1.00 17.69  ? 71  GLY C O     1 
ATOM   5819  N  N     . ALA C 1 59  ? -10.648  -7.261  -26.831 1.00 26.90  ? 72  ALA C N     1 
ATOM   5820  C  CA    . ALA C 1 59  ? -9.713   -6.412  -26.099 1.00 26.90  ? 72  ALA C CA    1 
ATOM   5821  C  C     . ALA C 1 59  ? -8.283   -6.836  -26.416 1.00 26.90  ? 72  ALA C C     1 
ATOM   5822  O  O     . ALA C 1 59  ? -8.063   -7.923  -26.954 1.00 26.90  ? 72  ALA C O     1 
ATOM   5823  C  CB    . ALA C 1 59  ? -9.973   -6.494  -24.607 1.00 26.90  ? 72  ALA C CB    1 
ATOM   5824  N  N     . SER C 1 60  ? -7.322   -5.980  -26.079 1.00 29.13  ? 73  SER C N     1 
ATOM   5825  C  CA    . SER C 1 60  ? -5.910   -6.228  -26.375 1.00 29.13  ? 73  SER C CA    1 
ATOM   5826  C  C     . SER C 1 60  ? -5.650   -6.468  -27.862 1.00 29.13  ? 73  SER C C     1 
ATOM   5827  O  O     . SER C 1 60  ? -6.104   -5.703  -28.711 1.00 29.13  ? 73  SER C O     1 
ATOM   5828  C  CB    . SER C 1 60  ? -5.364   -7.388  -25.539 1.00 29.13  ? 73  SER C CB    1 
ATOM   5829  O  OG    . SER C 1 60  ? -5.445   -7.097  -24.156 1.00 29.13  ? 73  SER C OG    1 
ATOM   5830  N  N     . ALA C 1 61  ? -4.914   -7.531  -28.169 1.00 56.65  ? 74  ALA C N     1 
ATOM   5831  C  CA    . ALA C 1 61  ? -4.600   -7.867  -29.553 1.00 56.65  ? 74  ALA C CA    1 
ATOM   5832  C  C     . ALA C 1 61  ? -5.855   -8.262  -30.323 1.00 56.65  ? 74  ALA C C     1 
ATOM   5833  O  O     . ALA C 1 61  ? -5.918   -8.109  -31.543 1.00 56.65  ? 74  ALA C O     1 
ATOM   5834  C  CB    . ALA C 1 61  ? -3.573   -8.981  -29.606 1.00 56.65  ? 74  ALA C CB    1 
ATOM   5835  N  N     . GLY C 1 62  ? -6.850   -8.773  -29.604 1.00 24.73  ? 75  GLY C N     1 
ATOM   5836  C  CA    . GLY C 1 62  ? -8.093   -9.196  -30.218 1.00 24.73  ? 75  GLY C CA    1 
ATOM   5837  C  C     . GLY C 1 62  ? -9.031   -8.042  -30.515 1.00 24.73  ? 75  GLY C C     1 
ATOM   5838  O  O     . GLY C 1 62  ? -10.157  -8.253  -30.964 1.00 24.73  ? 75  GLY C O     1 
ATOM   5839  N  N     . ALA C 1 63  ? -8.574   -6.820  -30.263 1.00 52.14  ? 76  ALA C N     1 
ATOM   5840  C  CA    . ALA C 1 63  ? -9.359   -5.635  -30.591 1.00 52.14  ? 76  ALA C CA    1 
ATOM   5841  C  C     . ALA C 1 63  ? -9.212   -5.293  -32.072 1.00 52.14  ? 76  ALA C C     1 
ATOM   5842  O  O     . ALA C 1 63  ? -10.162  -4.837  -32.707 1.00 52.14  ? 76  ALA C O     1 
ATOM   5843  C  CB    . ALA C 1 63  ? -8.949   -4.459  -29.721 1.00 52.14  ? 76  ALA C CB    1 
ATOM   5844  N  N     . MET C 1 64  ? -8.014   -5.507  -32.614 1.00 52.28  ? 77  MET C N     1 
ATOM   5845  C  CA    . MET C 1 64  ? -7.780   -5.337  -34.044 1.00 52.28  ? 77  MET C CA    1 
ATOM   5846  C  C     . MET C 1 64  ? -8.530   -6.409  -34.822 1.00 52.28  ? 77  MET C C     1 
ATOM   5847  O  O     . MET C 1 64  ? -9.223   -6.116  -35.797 1.00 52.28  ? 77  MET C O     1 
ATOM   5848  C  CB    . MET C 1 64  ? -6.286   -5.413  -34.371 1.00 52.28  ? 77  MET C CB    1 
ATOM   5849  C  CG    . MET C 1 64  ? -5.982   -5.349  -35.864 1.00 52.28  ? 77  MET C CG    1 
ATOM   5850  S  SD    . MET C 1 64  ? -4.437   -6.154  -36.342 1.00 52.28  ? 77  MET C SD    1 
ATOM   5851  C  CE    . MET C 1 64  ? -3.234   -5.136  -35.494 1.00 52.28  ? 77  MET C CE    1 
ATOM   5852  N  N     . THR C 1 65  ? -8.384   -7.652  -34.375 1.00 29.47  ? 78  THR C N     1 
ATOM   5853  C  CA    . THR C 1 65  ? -8.998   -8.801  -35.030 1.00 29.47  ? 78  THR C CA    1 
ATOM   5854  C  C     . THR C 1 65  ? -10.523  -8.686  -35.071 1.00 29.47  ? 78  THR C C     1 
ATOM   5855  O  O     . THR C 1 65  ? -11.155  -9.075  -36.049 1.00 29.47  ? 78  THR C O     1 
ATOM   5856  C  CB    . THR C 1 65  ? -8.586   -10.116 -34.338 1.00 29.47  ? 78  THR C CB    1 
ATOM   5857  O  OG1   . THR C 1 65  ? -7.157   -10.192 -34.266 1.00 29.47  ? 78  THR C OG1   1 
ATOM   5858  C  CG2   . THR C 1 65  ? -9.111   -11.316 -35.104 1.00 29.47  ? 78  THR C CG2   1 
ATOM   5859  N  N     . ALA C 1 66  ? -11.105  -8.138  -34.012 1.00 23.48  ? 79  ALA C N     1 
ATOM   5860  C  CA    . ALA C 1 66  ? -12.548  -7.948  -33.954 1.00 23.48  ? 79  ALA C CA    1 
ATOM   5861  C  C     . ALA C 1 66  ? -12.987  -6.788  -34.843 1.00 23.48  ? 79  ALA C C     1 
ATOM   5862  O  O     . ALA C 1 66  ? -14.064  -6.823  -35.436 1.00 23.48  ? 79  ALA C O     1 
ATOM   5863  C  CB    . ALA C 1 66  ? -12.996  -7.723  -32.520 1.00 23.48  ? 79  ALA C CB    1 
ATOM   5864  N  N     . SER C 1 67  ? -12.149  -5.761  -34.931 1.00 23.62  ? 80  SER C N     1 
ATOM   5865  C  CA    . SER C 1 67  ? -12.483  -4.563  -35.692 1.00 23.62  ? 80  SER C CA    1 
ATOM   5866  C  C     . SER C 1 67  ? -12.385  -4.770  -37.203 1.00 23.62  ? 80  SER C C     1 
ATOM   5867  O  O     . SER C 1 67  ? -13.110  -4.135  -37.968 1.00 23.62  ? 80  SER C O     1 
ATOM   5868  C  CB    . SER C 1 67  ? -11.590  -3.402  -35.265 1.00 23.62  ? 80  SER C CB    1 
ATOM   5869  O  OG    . SER C 1 67  ? -10.226  -3.724  -35.450 1.00 23.62  ? 80  SER C OG    1 
ATOM   5870  N  N     . ILE C 1 68  ? -11.485  -5.650  -37.630 1.00 36.74  ? 81  ILE C N     1 
ATOM   5871  C  CA    . ILE C 1 68  ? -11.344  -5.966  -39.048 1.00 36.74  ? 81  ILE C CA    1 
ATOM   5872  C  C     . ILE C 1 68  ? -12.402  -6.980  -39.473 1.00 36.74  ? 81  ILE C C     1 
ATOM   5873  O  O     . ILE C 1 68  ? -12.581  -7.247  -40.661 1.00 36.74  ? 81  ILE C O     1 
ATOM   5874  C  CB    . ILE C 1 68  ? -9.941   -6.506  -39.377 1.00 36.74  ? 81  ILE C CB    1 
ATOM   5875  C  CG1   . ILE C 1 68  ? -9.698   -7.839  -38.670 1.00 36.74  ? 81  ILE C CG1   1 
ATOM   5876  C  CG2   . ILE C 1 68  ? -8.876   -5.493  -38.989 1.00 36.74  ? 81  ILE C CG2   1 
ATOM   5877  C  CD1   . ILE C 1 68  ? -8.319   -8.412  -38.913 1.00 36.74  ? 81  ILE C CD1   1 
ATOM   5878  N  N     . LEU C 1 69  ? -13.094  -7.545  -38.487 1.00 16.93  ? 82  LEU C N     1 
ATOM   5879  C  CA    . LEU C 1 69  ? -14.234  -8.416  -38.736 1.00 16.93  ? 82  LEU C CA    1 
ATOM   5880  C  C     . LEU C 1 69  ? -15.512  -7.587  -38.743 1.00 16.93  ? 82  LEU C C     1 
ATOM   5881  O  O     . LEU C 1 69  ? -16.433  -7.852  -39.511 1.00 16.93  ? 82  LEU C O     1 
ATOM   5882  C  CB    . LEU C 1 69  ? -14.334  -9.498  -37.659 1.00 16.93  ? 82  LEU C CB    1 
ATOM   5883  C  CG    . LEU C 1 69  ? -13.376  -10.686 -37.720 1.00 16.93  ? 82  LEU C CG    1 
ATOM   5884  C  CD1   . LEU C 1 69  ? -13.557  -11.584 -36.506 1.00 16.93  ? 82  LEU C CD1   1 
ATOM   5885  C  CD2   . LEU C 1 69  ? -13.590  -11.472 -38.998 1.00 16.93  ? 82  LEU C CD2   1 
ATOM   5886  N  N     . ALA C 1 70  ? -15.556  -6.580  -37.876 1.00 27.63  ? 83  ALA C N     1 
ATOM   5887  C  CA    . ALA C 1 70  ? -16.714  -5.703  -37.767 1.00 27.63  ? 83  ALA C CA    1 
ATOM   5888  C  C     . ALA C 1 70  ? -16.833  -4.791  -38.981 1.00 27.63  ? 83  ALA C C     1 
ATOM   5889  O  O     . ALA C 1 70  ? -17.906  -4.257  -39.263 1.00 27.63  ? 83  ALA C O     1 
ATOM   5890  C  CB    . ALA C 1 70  ? -16.630  -4.879  -36.496 1.00 27.63  ? 83  ALA C CB    1 
ATOM   5891  N  N     . VAL C 1 71  ? -15.723  -4.613  -39.690 1.00 17.10  ? 84  VAL C N     1 
ATOM   5892  C  CA    . VAL C 1 71  ? -15.684  -3.752  -40.864 1.00 17.10  ? 84  VAL C CA    1 
ATOM   5893  C  C     . VAL C 1 71  ? -16.059  -4.539  -42.120 1.00 17.10  ? 84  VAL C C     1 
ATOM   5894  O  O     . VAL C 1 71  ? -16.320  -3.960  -43.176 1.00 17.10  ? 84  VAL C O     1 
ATOM   5895  C  CB    . VAL C 1 71  ? -14.296  -3.100  -41.034 1.00 17.10  ? 84  VAL C CB    1 
ATOM   5896  C  CG1   . VAL C 1 71  ? -13.325  -4.068  -41.694 1.00 17.10  ? 84  VAL C CG1   1 
ATOM   5897  C  CG2   . VAL C 1 71  ? -14.405  -1.822  -41.839 1.00 17.10  ? 84  VAL C CG2   1 
ATOM   5898  N  N     . GLY C 1 72  ? -16.087  -5.863  -41.997 1.00 18.46  ? 85  GLY C N     1 
ATOM   5899  C  CA    . GLY C 1 72  ? -16.509  -6.720  -43.090 1.00 18.46  ? 85  GLY C CA    1 
ATOM   5900  C  C     . GLY C 1 72  ? -15.436  -7.027  -44.116 1.00 18.46  ? 85  GLY C C     1 
ATOM   5901  O  O     . GLY C 1 72  ? -15.727  -7.148  -45.307 1.00 18.46  ? 85  GLY C O     1 
ATOM   5902  N  N     . MET C 1 73  ? -14.196  -7.161  -43.657 1.00 26.35  ? 86  MET C N     1 
ATOM   5903  C  CA    . MET C 1 73  ? -13.088  -7.483  -44.549 1.00 26.35  ? 86  MET C CA    1 
ATOM   5904  C  C     . MET C 1 73  ? -13.188  -8.920  -45.058 1.00 26.35  ? 86  MET C C     1 
ATOM   5905  O  O     . MET C 1 73  ? -13.600  -9.819  -44.324 1.00 26.35  ? 86  MET C O     1 
ATOM   5906  C  CB    . MET C 1 73  ? -11.747  -7.260  -43.844 1.00 26.35  ? 86  MET C CB    1 
ATOM   5907  C  CG    . MET C 1 73  ? -10.536  -7.523  -44.727 1.00 26.35  ? 86  MET C CG    1 
ATOM   5908  S  SD    . MET C 1 73  ? -8.959   -7.148  -43.938 1.00 26.35  ? 86  MET C SD    1 
ATOM   5909  C  CE    . MET C 1 73  ? -9.177   -5.406  -43.600 1.00 26.35  ? 86  MET C CE    1 
ATOM   5910  N  N     . ASP C 1 74  ? -12.815  -9.126  -46.318 1.00 72.73  ? 87  ASP C N     1 
ATOM   5911  C  CA    . ASP C 1 74  ? -12.840  -10.450 -46.934 1.00 72.73  ? 87  ASP C CA    1 
ATOM   5912  C  C     . ASP C 1 74  ? -11.817  -11.385 -46.288 1.00 72.73  ? 87  ASP C C     1 
ATOM   5913  O  O     . ASP C 1 74  ? -10.785  -10.935 -45.792 1.00 72.73  ? 87  ASP C O     1 
ATOM   5914  C  CB    . ASP C 1 74  ? -12.572  -10.331 -48.435 1.00 72.73  ? 87  ASP C CB    1 
ATOM   5915  C  CG    . ASP C 1 74  ? -12.786  -11.636 -49.171 1.00 72.73  ? 87  ASP C CG    1 
ATOM   5916  O  OD1   . ASP C 1 74  ? -13.620  -12.447 -48.715 1.00 72.73  ? 87  ASP C OD1   1 
ATOM   5917  O  OD2   . ASP C 1 74  ? -12.124  -11.849 -50.209 1.00 72.73  ? 87  ASP C OD2   1 
ATOM   5918  N  N     . ILE C 1 75  ? -12.110  -12.684 -46.298 1.00 54.45  ? 88  ILE C N     1 
ATOM   5919  C  CA    . ILE C 1 75  ? -11.233  -13.683 -45.688 1.00 54.45  ? 88  ILE C CA    1 
ATOM   5920  C  C     . ILE C 1 75  ? -9.846   -13.711 -46.334 1.00 54.45  ? 88  ILE C C     1 
ATOM   5921  O  O     . ILE C 1 75  ? -8.842   -13.934 -45.657 1.00 54.45  ? 88  ILE C O     1 
ATOM   5922  C  CB    . ILE C 1 75  ? -11.866  -15.101 -45.718 1.00 54.45  ? 88  ILE C CB    1 
ATOM   5923  C  CG1   . ILE C 1 75  ? -10.953  -16.113 -45.020 1.00 54.45  ? 88  ILE C CG1   1 
ATOM   5924  C  CG2   . ILE C 1 75  ? -12.175  -15.534 -47.147 1.00 54.45  ? 88  ILE C CG2   1 
ATOM   5925  C  CD1   . ILE C 1 75  ? -11.356  -17.554 -45.219 1.00 54.45  ? 88  ILE C CD1   1 
ATOM   5926  N  N     . LYS C 1 76  ? -9.797   -13.473 -47.641 1.00 80.00  ? 89  LYS C N     1 
ATOM   5927  C  CA    . LYS C 1 76  ? -8.536   -13.441 -48.372 1.00 80.00  ? 89  LYS C CA    1 
ATOM   5928  C  C     . LYS C 1 76  ? -7.644   -12.318 -47.859 1.00 80.00  ? 89  LYS C C     1 
ATOM   5929  O  O     . LYS C 1 76  ? -6.444   -12.504 -47.652 1.00 80.00  ? 89  LYS C O     1 
ATOM   5930  C  CB    . LYS C 1 76  ? -8.795   -13.253 -49.868 1.00 80.00  ? 89  LYS C CB    1 
ATOM   5931  C  CG    . LYS C 1 76  ? -7.535   -13.017 -50.691 1.00 80.00  ? 89  LYS C CG    1 
ATOM   5932  C  CD    . LYS C 1 76  ? -7.868   -12.600 -52.115 1.00 80.00  ? 89  LYS C CD    1 
ATOM   5933  C  CE    . LYS C 1 76  ? -6.609   -12.293 -52.908 1.00 80.00  ? 89  LYS C CE    1 
ATOM   5934  N  NZ    . LYS C 1 76  ? -5.706   -13.472 -52.985 1.00 80.00  ? 89  LYS C NZ    1 
ATOM   5935  N  N     . ASP C 1 77  ? -8.246   -11.152 -47.647 1.00 68.48  ? 90  ASP C N     1 
ATOM   5936  C  CA    . ASP C 1 77  ? -7.515   -9.979  -47.188 1.00 68.48  ? 90  ASP C CA    1 
ATOM   5937  C  C     . ASP C 1 77  ? -7.076   -10.116 -45.731 1.00 68.48  ? 90  ASP C C     1 
ATOM   5938  O  O     . ASP C 1 77  ? -6.030   -9.600  -45.342 1.00 68.48  ? 90  ASP C O     1 
ATOM   5939  C  CB    . ASP C 1 77  ? -8.365   -8.720  -47.362 1.00 68.48  ? 90  ASP C CB    1 
ATOM   5940  C  CG    . ASP C 1 77  ? -8.873   -8.549  -48.780 1.00 68.48  ? 90  ASP C CG    1 
ATOM   5941  O  OD1   . ASP C 1 77  ? -8.214   -9.044  -49.717 1.00 68.48  ? 90  ASP C OD1   1 
ATOM   5942  O  OD2   . ASP C 1 77  ? -9.933   -7.912  -48.957 1.00 68.48  ? 90  ASP C OD2   1 
ATOM   5943  N  N     . ILE C 1 78  ? -7.881   -10.811 -44.932 1.00 53.18  ? 91  ILE C N     1 
ATOM   5944  C  CA    . ILE C 1 78  ? -7.585   -10.999 -43.513 1.00 53.18  ? 91  ILE C CA    1 
ATOM   5945  C  C     . ILE C 1 78  ? -6.293   -11.783 -43.286 1.00 53.18  ? 91  ILE C C     1 
ATOM   5946  O  O     . ILE C 1 78  ? -5.433   -11.353 -42.517 1.00 53.18  ? 91  ILE C O     1 
ATOM   5947  C  CB    . ILE C 1 78  ? -8.757   -11.679 -42.766 1.00 53.18  ? 91  ILE C CB    1 
ATOM   5948  C  CG1   . ILE C 1 78  ? -9.920   -10.702 -42.601 1.00 53.18  ? 91  ILE C CG1   1 
ATOM   5949  C  CG2   . ILE C 1 78  ? -8.312   -12.185 -41.403 1.00 53.18  ? 91  ILE C CG2   1 
ATOM   5950  C  CD1   . ILE C 1 78  ? -11.017  -11.196 -41.680 1.00 53.18  ? 91  ILE C CD1   1 
ATOM   5951  N  N     . LYS C 1 79  ? -6.160   -12.923 -43.961 1.00 64.08  ? 92  LYS C N     1 
ATOM   5952  C  CA    . LYS C 1 79  ? -4.966   -13.756 -43.843 1.00 64.08  ? 92  LYS C CA    1 
ATOM   5953  C  C     . LYS C 1 79  ? -3.707   -12.971 -44.191 1.00 64.08  ? 92  LYS C C     1 
ATOM   5954  O  O     . LYS C 1 79  ? -2.672   -13.122 -43.544 1.00 64.08  ? 92  LYS C O     1 
ATOM   5955  C  CB    . LYS C 1 79  ? -5.071   -14.992 -44.738 1.00 64.08  ? 92  LYS C CB    1 
ATOM   5956  C  CG    . LYS C 1 79  ? -3.856   -15.908 -44.661 1.00 64.08  ? 92  LYS C CG    1 
ATOM   5957  C  CD    . LYS C 1 79  ? -3.992   -17.112 -45.579 1.00 64.08  ? 92  LYS C CD    1 
ATOM   5958  C  CE    . LYS C 1 79  ? -2.809   -18.060 -45.425 1.00 64.08  ? 92  LYS C CE    1 
ATOM   5959  N  NZ    . LYS C 1 79  ? -1.515   -17.417 -45.787 1.00 64.08  ? 92  LYS C NZ    1 
ATOM   5960  N  N     . LYS C 1 80  ? -3.805   -12.125 -45.210 1.00 72.56  ? 93  LYS C N     1 
ATOM   5961  C  CA    . LYS C 1 80  ? -2.678   -11.301 -45.625 1.00 72.56  ? 93  LYS C CA    1 
ATOM   5962  C  C     . LYS C 1 80  ? -2.430   -10.176 -44.625 1.00 72.56  ? 93  LYS C C     1 
ATOM   5963  O  O     . LYS C 1 80  ? -1.284   -9.849  -44.315 1.00 72.56  ? 93  LYS C O     1 
ATOM   5964  C  CB    . LYS C 1 80  ? -2.916   -10.731 -47.024 1.00 72.56  ? 93  LYS C CB    1 
ATOM   5965  C  CG    . LYS C 1 80  ? -3.318   -11.777 -48.052 1.00 72.56  ? 93  LYS C CG    1 
ATOM   5966  C  CD    . LYS C 1 80  ? -2.898   -11.378 -49.457 1.00 72.56  ? 93  LYS C CD    1 
ATOM   5967  C  CE    . LYS C 1 80  ? -3.532   -10.068 -49.886 1.00 72.56  ? 93  LYS C CE    1 
ATOM   5968  N  NZ    . LYS C 1 80  ? -3.045   -9.649  -51.229 1.00 72.56  ? 93  LYS C NZ    1 
ATOM   5969  N  N     . LEU C 1 81  ? -3.510   -9.593  -44.116 1.00 56.54  ? 94  LEU C N     1 
ATOM   5970  C  CA    . LEU C 1 81  ? -3.411   -8.493  -43.164 1.00 56.54  ? 94  LEU C CA    1 
ATOM   5971  C  C     . LEU C 1 81  ? -2.894   -8.986  -41.813 1.00 56.54  ? 94  LEU C C     1 
ATOM   5972  O  O     . LEU C 1 81  ? -2.140   -8.289  -41.140 1.00 56.54  ? 94  LEU C O     1 
ATOM   5973  C  CB    . LEU C 1 81  ? -4.771   -7.806  -43.005 1.00 56.54  ? 94  LEU C CB    1 
ATOM   5974  C  CG    . LEU C 1 81  ? -4.809   -6.337  -42.569 1.00 56.54  ? 94  LEU C CG    1 
ATOM   5975  C  CD1   . LEU C 1 81  ? -4.646   -6.191  -41.066 1.00 56.54  ? 94  LEU C CD1   1 
ATOM   5976  C  CD2   . LEU C 1 81  ? -3.741   -5.543  -43.298 1.00 56.54  ? 94  LEU C CD2   1 
ATOM   5977  N  N     . ILE C 1 82  ? -3.301   -10.190 -41.422 1.00 47.54  ? 95  ILE C N     1 
ATOM   5978  C  CA    . ILE C 1 82  ? -2.869   -10.770 -40.152 1.00 47.54  ? 95  ILE C CA    1 
ATOM   5979  C  C     . ILE C 1 82  ? -1.407   -11.229 -40.202 1.00 47.54  ? 95  ILE C C     1 
ATOM   5980  O  O     . ILE C 1 82  ? -0.616   -10.912 -39.310 1.00 47.54  ? 95  ILE C O     1 
ATOM   5981  C  CB    . ILE C 1 82  ? -3.778   -11.944 -39.725 1.00 47.54  ? 95  ILE C CB    1 
ATOM   5982  C  CG1   . ILE C 1 82  ? -5.162   -11.435 -39.318 1.00 47.54  ? 95  ILE C CG1   1 
ATOM   5983  C  CG2   . ILE C 1 82  ? -3.152   -12.719 -38.577 1.00 47.54  ? 95  ILE C CG2   1 
ATOM   5984  C  CD1   . ILE C 1 82  ? -5.159   -10.559 -38.080 1.00 47.54  ? 95  ILE C CD1   1 
ATOM   5985  N  N     . GLU C 1 83  ? -1.056   -11.975 -41.246 1.00 58.82  ? 96  GLU C N     1 
ATOM   5986  C  CA    . GLU C 1 83  ? 0.308    -12.465 -41.418 1.00 58.82  ? 96  GLU C CA    1 
ATOM   5987  C  C     . GLU C 1 83  ? 1.292    -11.330 -41.686 1.00 58.82  ? 96  GLU C C     1 
ATOM   5988  O  O     . GLU C 1 83  ? 2.342    -11.241 -41.049 1.00 58.82  ? 96  GLU C O     1 
ATOM   5989  C  CB    . GLU C 1 83  ? 0.379    -13.478 -42.565 1.00 58.82  ? 96  GLU C CB    1 
ATOM   5990  C  CG    . GLU C 1 83  ? -0.257   -14.827 -42.271 1.00 58.82  ? 96  GLU C CG    1 
ATOM   5991  C  CD    . GLU C 1 83  ? -0.172   -15.776 -43.451 1.00 58.82  ? 96  GLU C CD    1 
ATOM   5992  O  OE1   . GLU C 1 83  ? -0.019   -15.294 -44.593 1.00 58.82  ? 96  GLU C OE1   1 
ATOM   5993  O  OE2   . GLU C 1 83  ? -0.253   -17.004 -43.238 1.00 58.82  ? 96  GLU C OE2   1 
ATOM   5994  N  N     . GLY C 1 84  ? 0.943    -10.466 -42.634 1.00 64.44  ? 97  GLY C N     1 
ATOM   5995  C  CA    . GLY C 1 84  ? 1.833    -9.408  -43.080 1.00 64.44  ? 97  GLY C CA    1 
ATOM   5996  C  C     . GLY C 1 84  ? 2.117    -8.322  -42.060 1.00 64.44  ? 97  GLY C C     1 
ATOM   5997  O  O     . GLY C 1 84  ? 3.267    -7.924  -41.877 1.00 64.44  ? 97  GLY C O     1 
ATOM   5998  N  N     . LEU C 1 85  ? 1.072    -7.835  -41.399 1.00 51.99  ? 98  LEU C N     1 
ATOM   5999  C  CA    . LEU C 1 85  ? 1.220    -6.736  -40.452 1.00 51.99  ? 98  LEU C CA    1 
ATOM   6000  C  C     . LEU C 1 85  ? 1.979    -7.160  -39.200 1.00 51.99  ? 98  LEU C C     1 
ATOM   6001  O  O     . LEU C 1 85  ? 1.376    -7.535  -38.194 1.00 51.99  ? 98  LEU C O     1 
ATOM   6002  C  CB    . LEU C 1 85  ? -0.147   -6.165  -40.069 1.00 51.99  ? 98  LEU C CB    1 
ATOM   6003  C  CG    . LEU C 1 85  ? -0.318   -4.649  -40.175 1.00 51.99  ? 98  LEU C CG    1 
ATOM   6004  C  CD1   . LEU C 1 85  ? 0.001    -4.181  -41.581 1.00 51.99  ? 98  LEU C CD1   1 
ATOM   6005  C  CD2   . LEU C 1 85  ? -1.727   -4.240  -39.784 1.00 51.99  ? 98  LEU C CD2   1 
ATOM   6006  N  N     . ASP C 1 86  ? 3.305    -7.101  -39.269 1.00 94.40  ? 99  ASP C N     1 
ATOM   6007  C  CA    . ASP C 1 86  ? 4.135    -7.351  -38.099 1.00 94.40  ? 99  ASP C CA    1 
ATOM   6008  C  C     . ASP C 1 86  ? 4.030    -6.163  -37.147 1.00 94.40  ? 99  ASP C C     1 
ATOM   6009  O  O     . ASP C 1 86  ? 4.386    -5.039  -37.501 1.00 94.40  ? 99  ASP C O     1 
ATOM   6010  C  CB    . ASP C 1 86  ? 5.590    -7.591  -38.507 1.00 94.40  ? 99  ASP C CB    1 
ATOM   6011  C  CG    . ASP C 1 86  ? 5.751    -8.800  -39.413 1.00 94.40  ? 99  ASP C CG    1 
ATOM   6012  O  OD1   . ASP C 1 86  ? 5.734    -8.627  -40.650 1.00 94.40  ? 99  ASP C OD1   1 
ATOM   6013  O  OD2   . ASP C 1 86  ? 5.897    -9.924  -38.887 1.00 94.40  ? 99  ASP C OD2   1 
ATOM   6014  N  N     . ILE C 1 87  ? 3.530    -6.423  -35.942 1.00 64.52  ? 100 ILE C N     1 
ATOM   6015  C  CA    . ILE C 1 87  ? 3.300    -5.382  -34.943 1.00 64.52  ? 100 ILE C CA    1 
ATOM   6016  C  C     . ILE C 1 87  ? 4.596    -4.657  -34.579 1.00 64.52  ? 100 ILE C C     1 
ATOM   6017  O  O     . ILE C 1 87  ? 4.579    -3.493  -34.178 1.00 64.52  ? 100 ILE C O     1 
ATOM   6018  C  CB    . ILE C 1 87  ? 2.646    -5.963  -33.664 1.00 64.52  ? 100 ILE C CB    1 
ATOM   6019  C  CG1   . ILE C 1 87  ? 1.532    -6.952  -34.023 1.00 64.52  ? 100 ILE C CG1   1 
ATOM   6020  C  CG2   . ILE C 1 87  ? 2.104    -4.852  -32.778 1.00 64.52  ? 100 ILE C CG2   1 
ATOM   6021  C  CD1   . ILE C 1 87  ? 1.960    -8.409  -34.006 1.00 64.52  ? 100 ILE C CD1   1 
ATOM   6022  N  N     . THR C 1 88  ? 5.716    -5.356  -34.738 1.00 76.20  ? 101 THR C N     1 
ATOM   6023  C  CA    . THR C 1 88  ? 7.036    -4.807  -34.447 1.00 76.20  ? 101 THR C CA    1 
ATOM   6024  C  C     . THR C 1 88  ? 7.321    -3.541  -35.254 1.00 76.20  ? 101 THR C C     1 
ATOM   6025  O  O     . THR C 1 88  ? 7.896    -2.583  -34.740 1.00 76.20  ? 101 THR C O     1 
ATOM   6026  C  CB    . THR C 1 88  ? 8.138    -5.838  -34.754 1.00 76.20  ? 101 THR C CB    1 
ATOM   6027  O  OG1   . THR C 1 88  ? 7.741    -7.128  -34.274 1.00 76.20  ? 101 THR C OG1   1 
ATOM   6028  C  CG2   . THR C 1 88  ? 9.452    -5.433  -34.103 1.00 76.20  ? 101 THR C CG2   1 
ATOM   6029  N  N     . LYS C 1 89  ? 6.907    -3.551  -36.517 1.00 85.97  ? 102 LYS C N     1 
ATOM   6030  C  CA    . LYS C 1 89  ? 7.199    -2.464  -37.446 1.00 85.97  ? 102 LYS C CA    1 
ATOM   6031  C  C     . LYS C 1 89  ? 6.585    -1.132  -37.023 1.00 85.97  ? 102 LYS C C     1 
ATOM   6032  O  O     . LYS C 1 89  ? 7.201    -0.077  -37.178 1.00 85.97  ? 102 LYS C O     1 
ATOM   6033  C  CB    . LYS C 1 89  ? 6.703    -2.828  -38.845 1.00 85.97  ? 102 LYS C CB    1 
ATOM   6034  C  CG    . LYS C 1 89  ? 7.153    -4.198  -39.330 1.00 85.97  ? 102 LYS C CG    1 
ATOM   6035  C  CD    . LYS C 1 89  ? 8.665    -4.271  -39.455 1.00 85.97  ? 102 LYS C CD    1 
ATOM   6036  C  CE    . LYS C 1 89  ? 9.187    -3.272  -40.476 1.00 85.97  ? 102 LYS C CE    1 
ATOM   6037  N  NZ    . LYS C 1 89  ? 10.670   -3.321  -40.593 1.00 85.97  ? 102 LYS C NZ    1 
ATOM   6038  N  N     . LEU C 1 90  ? 5.373    -1.188  -36.483 1.00 64.83  ? 103 LEU C N     1 
ATOM   6039  C  CA    . LEU C 1 90  ? 4.609    0.019   -36.185 1.00 64.83  ? 103 LEU C CA    1 
ATOM   6040  C  C     . LEU C 1 90  ? 4.972    0.624   -34.830 1.00 64.83  ? 103 LEU C C     1 
ATOM   6041  O  O     . LEU C 1 90  ? 4.169    1.336   -34.226 1.00 64.83  ? 103 LEU C O     1 
ATOM   6042  C  CB    . LEU C 1 90  ? 3.110    -0.280  -36.251 1.00 64.83  ? 103 LEU C CB    1 
ATOM   6043  C  CG    . LEU C 1 90  ? 2.658    -1.069  -37.482 1.00 64.83  ? 103 LEU C CG    1 
ATOM   6044  C  CD1   . LEU C 1 90  ? 1.152    -1.272  -37.487 1.00 64.83  ? 103 LEU C CD1   1 
ATOM   6045  C  CD2   . LEU C 1 90  ? 3.112    -0.382  -38.758 1.00 64.83  ? 103 LEU C CD2   1 
ATOM   6046  N  N     . LEU C 1 91  ? 6.185    0.345   -34.361 1.00 52.63  ? 104 LEU C N     1 
ATOM   6047  C  CA    . LEU C 1 91  ? 6.654    0.878   -33.087 1.00 52.63  ? 104 LEU C CA    1 
ATOM   6048  C  C     . LEU C 1 91  ? 7.372    2.213   -33.275 1.00 52.63  ? 104 LEU C C     1 
ATOM   6049  O  O     . LEU C 1 91  ? 8.586    2.257   -33.476 1.00 52.63  ? 104 LEU C O     1 
ATOM   6050  C  CB    . LEU C 1 91  ? 7.557    -0.134  -32.379 1.00 52.63  ? 104 LEU C CB    1 
ATOM   6051  C  CG    . LEU C 1 91  ? 6.837    -1.373  -31.843 1.00 52.63  ? 104 LEU C CG    1 
ATOM   6052  C  CD1   . LEU C 1 91  ? 7.827    -2.420  -31.358 1.00 52.63  ? 104 LEU C CD1   1 
ATOM   6053  C  CD2   . LEU C 1 91  ? 5.878    -0.984  -30.728 1.00 52.63  ? 104 LEU C CD2   1 
ATOM   6054  N  N     . ASP C 1 92  ? 6.603    3.296   -33.203 1.00 58.08  ? 105 ASP C N     1 
ATOM   6055  C  CA    . ASP C 1 92  ? 7.126    4.643   -33.397 1.00 58.08  ? 105 ASP C CA    1 
ATOM   6056  C  C     . ASP C 1 92  ? 7.871    5.160   -32.169 1.00 58.08  ? 105 ASP C C     1 
ATOM   6057  O  O     . ASP C 1 92  ? 7.470    6.154   -31.561 1.00 58.08  ? 105 ASP C O     1 
ATOM   6058  C  CB    . ASP C 1 92  ? 5.988    5.597   -33.764 1.00 58.08  ? 105 ASP C CB    1 
ATOM   6059  C  CG    . ASP C 1 92  ? 4.768    5.415   -32.882 1.00 58.08  ? 105 ASP C CG    1 
ATOM   6060  O  OD1   . ASP C 1 92  ? 3.962    4.504   -33.159 1.00 58.08  ? 105 ASP C OD1   1 
ATOM   6061  O  OD2   . ASP C 1 92  ? 4.612    6.182   -31.911 1.00 58.08  ? 105 ASP C OD2   1 
ATOM   6062  N  N     . ASN C 1 93  ? 8.959    4.485   -31.811 1.00 61.93  ? 106 ASN C N     1 
ATOM   6063  C  CA    . ASN C 1 93  ? 9.777    4.896   -30.678 1.00 61.93  ? 106 ASN C CA    1 
ATOM   6064  C  C     . ASN C 1 93  ? 10.489   6.215   -30.957 1.00 61.93  ? 106 ASN C C     1 
ATOM   6065  O  O     . ASN C 1 93  ? 11.476   6.249   -31.690 1.00 61.93  ? 106 ASN C O     1 
ATOM   6066  C  CB    . ASN C 1 93  ? 10.805   3.814   -30.337 1.00 61.93  ? 106 ASN C CB    1 
ATOM   6067  C  CG    . ASN C 1 93  ? 10.174   2.451   -30.121 1.00 61.93  ? 106 ASN C CG    1 
ATOM   6068  O  OD1   . ASN C 1 93  ? 10.087   1.642   -31.044 1.00 61.93  ? 106 ASN C OD1   1 
ATOM   6069  N  ND2   . ASN C 1 93  ? 9.736    2.188   -28.896 1.00 61.93  ? 106 ASN C ND2   1 
ATOM   6070  N  N     . SER C 1 94  ? 9.987    7.298   -30.372 1.00 67.74  ? 107 SER C N     1 
ATOM   6071  C  CA    . SER C 1 94  ? 10.598   8.611   -30.552 1.00 67.74  ? 107 SER C CA    1 
ATOM   6072  C  C     . SER C 1 94  ? 11.840   8.765   -29.681 1.00 67.74  ? 107 SER C C     1 
ATOM   6073  O  O     . SER C 1 94  ? 11.871   9.580   -28.758 1.00 67.74  ? 107 SER C O     1 
ATOM   6074  C  CB    . SER C 1 94  ? 9.595    9.725   -30.253 1.00 67.74  ? 107 SER C CB    1 
ATOM   6075  O  OG    . SER C 1 94  ? 8.597    9.786   -31.257 1.00 67.74  ? 107 SER C OG    1 
ATOM   6076  N  N     . GLY C 1 95  ? 12.865   7.977   -29.994 1.00 63.00  ? 108 GLY C N     1 
ATOM   6077  C  CA    . GLY C 1 95  ? 14.100   7.965   -29.233 1.00 63.00  ? 108 GLY C CA    1 
ATOM   6078  C  C     . GLY C 1 95  ? 14.595   6.548   -29.018 1.00 63.00  ? 108 GLY C C     1 
ATOM   6079  O  O     . GLY C 1 95  ? 13.826   5.592   -29.121 1.00 63.00  ? 108 GLY C O     1 
ATOM   6080  N  N     . VAL C 1 96  ? 15.885   6.409   -28.727 1.00 96.91  ? 109 VAL C N     1 
ATOM   6081  C  CA    . VAL C 1 96  ? 16.460   5.102   -28.430 1.00 96.91  ? 109 VAL C CA    1 
ATOM   6082  C  C     . VAL C 1 96  ? 16.410   4.826   -26.930 1.00 96.91  ? 109 VAL C C     1 
ATOM   6083  O  O     . VAL C 1 96  ? 16.953   5.586   -26.127 1.00 96.91  ? 109 VAL C O     1 
ATOM   6084  C  CB    . VAL C 1 96  ? 17.906   4.972   -28.957 1.00 96.91  ? 109 VAL C CB    1 
ATOM   6085  C  CG1   . VAL C 1 96  ? 17.901   4.671   -30.448 1.00 96.91  ? 109 VAL C CG1   1 
ATOM   6086  C  CG2   . VAL C 1 96  ? 18.703   6.236   -28.665 1.00 96.91  ? 109 VAL C CG2   1 
ATOM   6087  N  N     . GLY C 1 97  ? 15.747   3.737   -26.557 1.00 57.80  ? 110 GLY C N     1 
ATOM   6088  C  CA    . GLY C 1 97  ? 15.516   3.432   -25.158 1.00 57.80  ? 110 GLY C CA    1 
ATOM   6089  C  C     . GLY C 1 97  ? 14.216   4.050   -24.684 1.00 57.80  ? 110 GLY C C     1 
ATOM   6090  O  O     . GLY C 1 97  ? 14.044   4.339   -23.499 1.00 57.80  ? 110 GLY C O     1 
ATOM   6091  N  N     . PHE C 1 98  ? 13.298   4.258   -25.623 1.00 60.59  ? 111 PHE C N     1 
ATOM   6092  C  CA    . PHE C 1 98  ? 12.000   4.852   -25.326 1.00 60.59  ? 111 PHE C CA    1 
ATOM   6093  C  C     . PHE C 1 98  ? 10.884   3.925   -25.800 1.00 60.59  ? 111 PHE C C     1 
ATOM   6094  O  O     . PHE C 1 98  ? 11.152   2.859   -26.353 1.00 60.59  ? 111 PHE C O     1 
ATOM   6095  C  CB    . PHE C 1 98  ? 11.873   6.220   -26.001 1.00 60.59  ? 111 PHE C CB    1 
ATOM   6096  C  CG    . PHE C 1 98  ? 12.760   7.280   -25.407 1.00 60.59  ? 111 PHE C CG    1 
ATOM   6097  C  CD1   . PHE C 1 98  ? 14.126   7.282   -25.652 1.00 60.59  ? 111 PHE C CD1   1 
ATOM   6098  C  CD2   . PHE C 1 98  ? 12.225   8.283   -24.617 1.00 60.59  ? 111 PHE C CD2   1 
ATOM   6099  C  CE1   . PHE C 1 98  ? 14.942   8.258   -25.108 1.00 60.59  ? 111 PHE C CE1   1 
ATOM   6100  C  CE2   . PHE C 1 98  ? 13.035   9.263   -24.071 1.00 60.59  ? 111 PHE C CE2   1 
ATOM   6101  C  CZ    . PHE C 1 98  ? 14.394   9.250   -24.318 1.00 60.59  ? 111 PHE C CZ    1 
ATOM   6102  N  N     . ARG C 1 99  ? 9.637    4.330   -25.583 1.00 49.73  ? 112 ARG C N     1 
ATOM   6103  C  CA    . ARG C 1 99  ? 8.493    3.525   -25.999 1.00 49.73  ? 112 ARG C CA    1 
ATOM   6104  C  C     . ARG C 1 99  ? 7.773    4.141   -27.192 1.00 49.73  ? 112 ARG C C     1 
ATOM   6105  O  O     . ARG C 1 99  ? 8.103    5.243   -27.630 1.00 49.73  ? 112 ARG C O     1 
ATOM   6106  C  CB    . ARG C 1 99  ? 7.513    3.330   -24.840 1.00 49.73  ? 112 ARG C CB    1 
ATOM   6107  C  CG    . ARG C 1 99  ? 8.022    2.425   -23.730 1.00 49.73  ? 112 ARG C CG    1 
ATOM   6108  C  CD    . ARG C 1 99  ? 7.034    2.360   -22.578 1.00 49.73  ? 112 ARG C CD    1 
ATOM   6109  N  NE    . ARG C 1 99  ? 6.813    3.674   -21.980 1.00 49.73  ? 112 ARG C NE    1 
ATOM   6110  C  CZ    . ARG C 1 99  ? 5.917    3.926   -21.032 1.00 49.73  ? 112 ARG C CZ    1 
ATOM   6111  N  NH1   . ARG C 1 99  ? 5.148    2.953   -20.566 1.00 49.73  ? 112 ARG C NH1   1 
ATOM   6112  N  NH2   . ARG C 1 99  ? 5.788    5.154   -20.550 1.00 49.73  ? 112 ARG C NH2   1 
ATOM   6113  N  N     . ALA C 1 100 ? 6.789    3.418   -27.715 1.00 42.97  ? 113 ALA C N     1 
ATOM   6114  C  CA    . ALA C 1 100 ? 5.999    3.896   -28.842 1.00 42.97  ? 113 ALA C CA    1 
ATOM   6115  C  C     . ALA C 1 100 ? 4.924    4.871   -28.378 1.00 42.97  ? 113 ALA C C     1 
ATOM   6116  O  O     . ALA C 1 100 ? 4.267    4.640   -27.363 1.00 42.97  ? 113 ALA C O     1 
ATOM   6117  C  CB    . ALA C 1 100 ? 5.367    2.728   -29.572 1.00 42.97  ? 113 ALA C CB    1 
ATOM   6118  N  N     . ARG C 1 101 ? 4.747    5.957   -29.124 1.00 43.97  ? 114 ARG C N     1 
ATOM   6119  C  CA    . ARG C 1 101 ? 3.698    6.923   -28.825 1.00 43.97  ? 114 ARG C CA    1 
ATOM   6120  C  C     . ARG C 1 101 ? 2.345    6.314   -29.166 1.00 43.97  ? 114 ARG C C     1 
ATOM   6121  O  O     . ARG C 1 101 ? 1.340    6.603   -28.517 1.00 43.97  ? 114 ARG C O     1 
ATOM   6122  C  CB    . ARG C 1 101 ? 3.906    8.210   -29.619 1.00 43.97  ? 114 ARG C CB    1 
ATOM   6123  C  CG    . ARG C 1 101 ? 5.344    8.697   -29.657 1.00 43.97  ? 114 ARG C CG    1 
ATOM   6124  C  CD    . ARG C 1 101 ? 5.498    9.848   -30.636 1.00 43.97  ? 114 ARG C CD    1 
ATOM   6125  N  NE    . ARG C 1 101 ? 4.724    11.018  -30.233 1.00 43.97  ? 114 ARG C NE    1 
ATOM   6126  C  CZ    . ARG C 1 101 ? 5.259    12.168  -29.836 1.00 43.97  ? 114 ARG C CZ    1 
ATOM   6127  N  NH1   . ARG C 1 101 ? 6.577    12.313  -29.797 1.00 43.97  ? 114 ARG C NH1   1 
ATOM   6128  N  NH2   . ARG C 1 101 ? 4.474    13.179  -29.485 1.00 43.97  ? 114 ARG C NH2   1 
ATOM   6129  N  N     . GLY C 1 102 ? 2.327    5.470   -30.193 1.00 57.67  ? 115 GLY C N     1 
ATOM   6130  C  CA    . GLY C 1 102 ? 1.129    4.738   -30.559 1.00 57.67  ? 115 GLY C CA    1 
ATOM   6131  C  C     . GLY C 1 102 ? 0.376    5.312   -31.743 1.00 57.67  ? 115 GLY C C     1 
ATOM   6132  O  O     . GLY C 1 102 ? -0.515   4.659   -32.287 1.00 57.67  ? 115 GLY C O     1 
ATOM   6133  N  N     . ASP C 1 103 ? 0.730    6.526   -32.153 1.00 56.50  ? 116 ASP C N     1 
ATOM   6134  C  CA    . ASP C 1 103 ? -0.010   7.199   -33.215 1.00 56.50  ? 116 ASP C CA    1 
ATOM   6135  C  C     . ASP C 1 103 ? 0.381    6.760   -34.630 1.00 56.50  ? 116 ASP C C     1 
ATOM   6136  O  O     . ASP C 1 103 ? -0.124   7.305   -35.608 1.00 56.50  ? 116 ASP C O     1 
ATOM   6137  C  CB    . ASP C 1 103 ? 0.070    8.724   -33.069 1.00 56.50  ? 116 ASP C CB    1 
ATOM   6138  C  CG    . ASP C 1 103 ? 1.485    9.222   -32.861 1.00 56.50  ? 116 ASP C CG    1 
ATOM   6139  O  OD1   . ASP C 1 103 ? 2.435    8.523   -33.267 1.00 56.50  ? 116 ASP C OD1   1 
ATOM   6140  O  OD2   . ASP C 1 103 ? 1.645    10.324  -32.293 1.00 56.50  ? 116 ASP C OD2   1 
ATOM   6141  N  N     . ARG C 1 104 ? 1.274    5.782   -34.740 1.00 49.74  ? 117 ARG C N     1 
ATOM   6142  C  CA    . ARG C 1 104 ? 1.573    5.185   -36.039 1.00 49.74  ? 117 ARG C CA    1 
ATOM   6143  C  C     . ARG C 1 104 ? 0.736    3.927   -36.228 1.00 49.74  ? 117 ARG C C     1 
ATOM   6144  O  O     . ARG C 1 104 ? 0.160    3.705   -37.293 1.00 49.74  ? 117 ARG C O     1 
ATOM   6145  C  CB    . ARG C 1 104 ? 3.061    4.864   -36.183 1.00 49.74  ? 117 ARG C CB    1 
ATOM   6146  C  CG    . ARG C 1 104 ? 3.398    4.074   -37.444 1.00 49.74  ? 117 ARG C CG    1 
ATOM   6147  C  CD    . ARG C 1 104 ? 4.898    3.920   -37.624 1.00 49.74  ? 117 ARG C CD    1 
ATOM   6148  N  NE    . ARG C 1 104 ? 5.558    5.211   -37.802 1.00 49.74  ? 117 ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 1 104 ? 6.872    5.373   -37.909 1.00 49.74  ? 117 ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 1 104 ? 7.679    4.323   -37.854 1.00 49.74  ? 117 ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 1 104 ? 7.381    6.586   -38.068 1.00 49.74  ? 117 ARG C NH2   1 
ATOM   6152  N  N     . PHE C 1 105 ? 0.671    3.111   -35.181 1.00 43.84  ? 118 PHE C N     1 
ATOM   6153  C  CA    . PHE C 1 105 ? -0.190   1.939   -35.171 1.00 43.84  ? 118 PHE C CA    1 
ATOM   6154  C  C     . PHE C 1 105 ? -1.638   2.378   -35.339 1.00 43.84  ? 118 PHE C C     1 
ATOM   6155  O  O     . PHE C 1 105 ? -2.439   1.680   -35.957 1.00 43.84  ? 118 PHE C O     1 
ATOM   6156  C  CB    . PHE C 1 105 ? -0.014   1.167   -33.862 1.00 43.84  ? 118 PHE C CB    1 
ATOM   6157  C  CG    . PHE C 1 105 ? -0.906   -0.036  -33.737 1.00 43.84  ? 118 PHE C CG    1 
ATOM   6158  C  CD1   . PHE C 1 105 ? -0.634   -1.196  -34.444 1.00 43.84  ? 118 PHE C CD1   1 
ATOM   6159  C  CD2   . PHE C 1 105 ? -2.007   -0.014  -32.895 1.00 43.84  ? 118 PHE C CD2   1 
ATOM   6160  C  CE1   . PHE C 1 105 ? -1.450   -2.307  -34.327 1.00 43.84  ? 118 PHE C CE1   1 
ATOM   6161  C  CE2   . PHE C 1 105 ? -2.827   -1.120  -32.771 1.00 43.84  ? 118 PHE C CE2   1 
ATOM   6162  C  CZ    . PHE C 1 105 ? -2.547   -2.268  -33.488 1.00 43.84  ? 118 PHE C CZ    1 
ATOM   6163  N  N     . ARG C 1 106 ? -1.959   3.549   -34.796 1.00 35.92  ? 119 ARG C N     1 
ATOM   6164  C  CA    . ARG C 1 106 ? -3.299   4.113   -34.898 1.00 35.92  ? 119 ARG C CA    1 
ATOM   6165  C  C     . ARG C 1 106 ? -3.608   4.546   -36.330 1.00 35.92  ? 119 ARG C C     1 
ATOM   6166  O  O     . ARG C 1 106 ? -4.748   4.446   -36.784 1.00 35.92  ? 119 ARG C O     1 
ATOM   6167  C  CB    . ARG C 1 106 ? -3.454   5.296   -33.939 1.00 35.92  ? 119 ARG C CB    1 
ATOM   6168  C  CG    . ARG C 1 106 ? -4.888   5.766   -33.752 1.00 35.92  ? 119 ARG C CG    1 
ATOM   6169  C  CD    . ARG C 1 106 ? -5.140   7.115   -34.412 1.00 35.92  ? 119 ARG C CD    1 
ATOM   6170  N  NE    . ARG C 1 106 ? -4.623   8.235   -33.629 1.00 35.92  ? 119 ARG C NE    1 
ATOM   6171  C  CZ    . ARG C 1 106 ? -3.520   8.914   -33.931 1.00 35.92  ? 119 ARG C CZ    1 
ATOM   6172  N  NH1   . ARG C 1 106 ? -2.812   8.589   -35.002 1.00 35.92  ? 119 ARG C NH1   1 
ATOM   6173  N  NH2   . ARG C 1 106 ? -3.125   9.922   -33.164 1.00 35.92  ? 119 ARG C NH2   1 
ATOM   6174  N  N     . ASN C 1 107 ? -2.589   5.020   -37.039 1.00 35.84  ? 120 ASN C N     1 
ATOM   6175  C  CA    . ASN C 1 107 ? -2.766   5.477   -38.415 1.00 35.84  ? 120 ASN C CA    1 
ATOM   6176  C  C     . ASN C 1 107 ? -2.902   4.330   -39.416 1.00 35.84  ? 120 ASN C C     1 
ATOM   6177  O  O     . ASN C 1 107 ? -3.612   4.452   -40.413 1.00 35.84  ? 120 ASN C O     1 
ATOM   6178  C  CB    . ASN C 1 107 ? -1.627   6.414   -38.827 1.00 35.84  ? 120 ASN C CB    1 
ATOM   6179  C  CG    . ASN C 1 107 ? -1.653   7.731   -38.077 1.00 35.84  ? 120 ASN C CG    1 
ATOM   6180  O  OD1   . ASN C 1 107 ? -2.717   8.280   -37.795 1.00 35.84  ? 120 ASN C OD1   1 
ATOM   6181  N  ND2   . ASN C 1 107 ? -0.475   8.242   -37.742 1.00 35.84  ? 120 ASN C ND2   1 
ATOM   6182  N  N     . ILE C 1 108 ? -2.211   3.225   -39.150 1.00 13.44  ? 121 ILE C N     1 
ATOM   6183  C  CA    . ILE C 1 108 ? -2.337   2.025   -39.968 1.00 13.44  ? 121 ILE C CA    1 
ATOM   6184  C  C     . ILE C 1 108 ? -3.776   1.519   -39.925 1.00 13.44  ? 121 ILE C C     1 
ATOM   6185  O  O     . ILE C 1 108 ? -4.349   1.155   -40.952 1.00 13.44  ? 121 ILE C O     1 
ATOM   6186  C  CB    . ILE C 1 108 ? -1.374   0.918   -39.497 1.00 13.44  ? 121 ILE C CB    1 
ATOM   6187  C  CG1   . ILE C 1 108 ? 0.073    1.302   -39.807 1.00 13.44  ? 121 ILE C CG1   1 
ATOM   6188  C  CG2   . ILE C 1 108 ? -1.718   -0.413  -40.147 1.00 13.44  ? 121 ILE C CG2   1 
ATOM   6189  C  CD1   . ILE C 1 108 ? 0.386    1.379   -41.291 1.00 13.44  ? 121 ILE C CD1   1 
ATOM   6190  N  N     . LEU C 1 109 ? -4.356   1.518   -38.728 1.00 30.15  ? 122 LEU C N     1 
ATOM   6191  C  CA    . LEU C 1 109 ? -5.743   1.110   -38.534 1.00 30.15  ? 122 LEU C CA    1 
ATOM   6192  C  C     . LEU C 1 109 ? -6.704   1.979   -39.348 1.00 30.15  ? 122 LEU C C     1 
ATOM   6193  O  O     . LEU C 1 109 ? -7.591   1.463   -40.028 1.00 30.15  ? 122 LEU C O     1 
ATOM   6194  C  CB    . LEU C 1 109 ? -6.109   1.164   -37.050 1.00 30.15  ? 122 LEU C CB    1 
ATOM   6195  C  CG    . LEU C 1 109 ? -5.297   0.274   -36.108 1.00 30.15  ? 122 LEU C CG    1 
ATOM   6196  C  CD1   . LEU C 1 109 ? -5.623   0.579   -34.656 1.00 30.15  ? 122 LEU C CD1   1 
ATOM   6197  C  CD2   . LEU C 1 109 ? -5.539   -1.194  -36.412 1.00 30.15  ? 122 LEU C CD2   1 
ATOM   6198  N  N     . ASP C 1 110 ? -6.517   3.295   -39.281 1.00 36.09  ? 123 ASP C N     1 
ATOM   6199  C  CA    . ASP C 1 110 ? -7.354   4.237   -40.023 1.00 36.09  ? 123 ASP C CA    1 
ATOM   6200  C  C     . ASP C 1 110 ? -7.238   4.051   -41.536 1.00 36.09  ? 123 ASP C C     1 
ATOM   6201  O  O     . ASP C 1 110 ? -8.200   4.271   -42.271 1.00 36.09  ? 123 ASP C O     1 
ATOM   6202  C  CB    . ASP C 1 110 ? -7.018   5.678   -39.634 1.00 36.09  ? 123 ASP C CB    1 
ATOM   6203  C  CG    . ASP C 1 110 ? -7.938   6.222   -38.556 1.00 36.09  ? 123 ASP C CG    1 
ATOM   6204  O  OD1   . ASP C 1 110 ? -9.133   5.864   -38.556 1.00 36.09  ? 123 ASP C OD1   1 
ATOM   6205  O  OD2   . ASP C 1 110 ? -7.463   7.005   -37.707 1.00 36.09  ? 123 ASP C OD2   1 
ATOM   6206  N  N     . VAL C 1 111 ? -6.056   3.648   -41.994 1.00 33.34  ? 124 VAL C N     1 
ATOM   6207  C  CA    . VAL C 1 111 ? -5.851   3.319   -43.402 1.00 33.34  ? 124 VAL C CA    1 
ATOM   6208  C  C     . VAL C 1 111 ? -6.653   2.074   -43.771 1.00 33.34  ? 124 VAL C C     1 
ATOM   6209  O  O     . VAL C 1 111 ? -7.355   2.048   -44.782 1.00 33.34  ? 124 VAL C O     1 
ATOM   6210  C  CB    . VAL C 1 111 ? -4.361   3.083   -43.715 1.00 33.34  ? 124 VAL C CB    1 
ATOM   6211  C  CG1   . VAL C 1 111 ? -4.191   2.447   -45.082 1.00 33.34  ? 124 VAL C CG1   1 
ATOM   6212  C  CG2   . VAL C 1 111 ? -3.594   4.390   -43.640 1.00 33.34  ? 124 VAL C CG2   1 
ATOM   6213  N  N     . ILE C 1 112 ? -6.545   1.049   -42.931 1.00 16.91  ? 125 ILE C N     1 
ATOM   6214  C  CA    . ILE C 1 112 ? -7.264   -0.203  -43.125 1.00 16.91  ? 125 ILE C CA    1 
ATOM   6215  C  C     . ILE C 1 112 ? -8.778   0.009   -43.124 1.00 16.91  ? 125 ILE C C     1 
ATOM   6216  O  O     . ILE C 1 112 ? -9.493   -0.549  -43.958 1.00 16.91  ? 125 ILE C O     1 
ATOM   6217  C  CB    . ILE C 1 112 ? -6.886   -1.230  -42.040 1.00 16.91  ? 125 ILE C CB    1 
ATOM   6218  C  CG1   . ILE C 1 112 ? -5.404   -1.583  -42.130 1.00 16.91  ? 125 ILE C CG1   1 
ATOM   6219  C  CG2   . ILE C 1 112 ? -7.724   -2.485  -42.168 1.00 16.91  ? 125 ILE C CG2   1 
ATOM   6220  C  CD1   . ILE C 1 112 ? -4.938   -2.552  -41.070 1.00 16.91  ? 125 ILE C CD1   1 
ATOM   6221  N  N     . TYR C 1 113 ? -9.259   0.824   -42.191 1.00 33.93  ? 126 TYR C N     1 
ATOM   6222  C  CA    . TYR C 1 113 ? -10.689  1.076   -42.058 1.00 33.93  ? 126 TYR C CA    1 
ATOM   6223  C  C     . TYR C 1 113 ? -11.259  1.826   -43.259 1.00 33.93  ? 126 TYR C C     1 
ATOM   6224  O  O     . TYR C 1 113 ? -12.239  1.386   -43.853 1.00 33.93  ? 126 TYR C O     1 
ATOM   6225  C  CB    . TYR C 1 113 ? -10.985  1.823   -40.756 1.00 33.93  ? 126 TYR C CB    1 
ATOM   6226  C  CG    . TYR C 1 113 ? -10.615  1.034   -39.521 1.00 33.93  ? 126 TYR C CG    1 
ATOM   6227  C  CD1   . TYR C 1 113 ? -10.683  -0.352  -39.519 1.00 33.93  ? 126 TYR C CD1   1 
ATOM   6228  C  CD2   . TYR C 1 113 ? -10.189  1.670   -38.365 1.00 33.93  ? 126 TYR C CD2   1 
ATOM   6229  C  CE1   . TYR C 1 113 ? -10.342  -1.081  -38.400 1.00 33.93  ? 126 TYR C CE1   1 
ATOM   6230  C  CE2   . TYR C 1 113 ? -9.843   0.947   -37.241 1.00 33.93  ? 126 TYR C CE2   1 
ATOM   6231  C  CZ    . TYR C 1 113 ? -9.923   -0.427  -37.265 1.00 33.93  ? 126 TYR C CZ    1 
ATOM   6232  O  OH    . TYR C 1 113 ? -9.581   -1.151  -36.149 1.00 33.93  ? 126 TYR C OH    1 
ATOM   6233  N  N     . MET C 1 114 ? -10.639  2.945   -43.623 1.00 41.28  ? 127 MET C N     1 
ATOM   6234  C  CA    . MET C 1 114 ? -11.112  3.747   -44.750 1.00 41.28  ? 127 MET C CA    1 
ATOM   6235  C  C     . MET C 1 114 ? -11.058  2.975   -46.067 1.00 41.28  ? 127 MET C C     1 
ATOM   6236  O  O     . MET C 1 114 ? -11.844  3.234   -46.977 1.00 41.28  ? 127 MET C O     1 
ATOM   6237  C  CB    . MET C 1 114 ? -10.318  5.053   -44.868 1.00 41.28  ? 127 MET C CB    1 
ATOM   6238  C  CG    . MET C 1 114 ? -8.941   4.900   -45.497 1.00 41.28  ? 127 MET C CG    1 
ATOM   6239  S  SD    . MET C 1 114 ? -8.660   6.115   -46.802 1.00 41.28  ? 127 MET C SD    1 
ATOM   6240  C  CE    . MET C 1 114 ? -7.144   5.494   -47.522 1.00 41.28  ? 127 MET C CE    1 
ATOM   6241  N  N     . MET C 1 115 ? -10.133  2.023   -46.159 1.00 47.51  ? 128 MET C N     1 
ATOM   6242  C  CA    . MET C 1 115 ? -9.979   1.218   -47.364 1.00 47.51  ? 128 MET C CA    1 
ATOM   6243  C  C     . MET C 1 115 ? -11.168  0.283   -47.546 1.00 47.51  ? 128 MET C C     1 
ATOM   6244  O  O     . MET C 1 115 ? -11.842  0.313   -48.576 1.00 47.51  ? 128 MET C O     1 
ATOM   6245  C  CB    . MET C 1 115 ? -8.685   0.406   -47.309 1.00 47.51  ? 128 MET C CB    1 
ATOM   6246  C  CG    . MET C 1 115 ? -8.294   -0.221  -48.637 1.00 47.51  ? 128 MET C CG    1 
ATOM   6247  S  SD    . MET C 1 115 ? -7.674   -1.907  -48.480 1.00 47.51  ? 128 MET C SD    1 
ATOM   6248  C  CE    . MET C 1 115 ? -9.170   -2.766  -47.997 1.00 47.51  ? 128 MET C CE    1 
ATOM   6249  N  N     . GLN C 1 116 ? -11.421  -0.545  -46.539 1.00 50.41  ? 129 GLN C N     1 
ATOM   6250  C  CA    . GLN C 1 116 ? -12.511  -1.511  -46.600 1.00 50.41  ? 129 GLN C CA    1 
ATOM   6251  C  C     . GLN C 1 116 ? -13.874  -0.822  -46.578 1.00 50.41  ? 129 GLN C C     1 
ATOM   6252  O  O     . GLN C 1 116 ? -14.789  -1.224  -47.297 1.00 50.41  ? 129 GLN C O     1 
ATOM   6253  C  CB    . GLN C 1 116 ? -12.402  -2.519  -45.454 1.00 50.41  ? 129 GLN C CB    1 
ATOM   6254  C  CG    . GLN C 1 116 ? -13.295  -3.740  -45.620 1.00 50.41  ? 129 GLN C CG    1 
ATOM   6255  C  CD    . GLN C 1 116 ? -12.952  -4.544  -46.860 1.00 50.41  ? 129 GLN C CD    1 
ATOM   6256  O  OE1   . GLN C 1 116 ? -11.789  -4.643  -47.246 1.00 50.41  ? 129 GLN C OE1   1 
ATOM   6257  N  NE2   . GLN C 1 116 ? -13.967  -5.118  -47.494 1.00 50.41  ? 129 GLN C NE2   1 
ATOM   6258  N  N     . MET C 1 117 ? -14.004  0.220   -45.761 1.00 44.84  ? 130 MET C N     1 
ATOM   6259  C  CA    . MET C 1 117 ? -15.253  0.975   -45.684 1.00 44.84  ? 130 MET C CA    1 
ATOM   6260  C  C     . MET C 1 117 ? -15.565  1.691   -46.996 1.00 44.84  ? 130 MET C C     1 
ATOM   6261  O  O     . MET C 1 117 ? -16.705  2.084   -47.238 1.00 44.84  ? 130 MET C O     1 
ATOM   6262  C  CB    . MET C 1 117 ? -15.226  1.979   -44.527 1.00 44.84  ? 130 MET C CB    1 
ATOM   6263  C  CG    . MET C 1 117 ? -15.336  1.345   -43.148 1.00 44.84  ? 130 MET C CG    1 
ATOM   6264  S  SD    . MET C 1 117 ? -15.274  2.530   -41.789 1.00 44.84  ? 130 MET C SD    1 
ATOM   6265  C  CE    . MET C 1 117 ? -16.778  3.463   -42.069 1.00 44.84  ? 130 MET C CE    1 
ATOM   6266  N  N     . LYS C 1 118 ? -14.552  1.857   -47.840 1.00 52.61  ? 131 LYS C N     1 
ATOM   6267  C  CA    . LYS C 1 118 ? -14.751  2.469   -49.147 1.00 52.61  ? 131 LYS C CA    1 
ATOM   6268  C  C     . LYS C 1 118 ? -15.285  1.448   -50.145 1.00 52.61  ? 131 LYS C C     1 
ATOM   6269  O  O     . LYS C 1 118 ? -16.240  1.724   -50.869 1.00 52.61  ? 131 LYS C O     1 
ATOM   6270  C  CB    . LYS C 1 118 ? -13.453  3.079   -49.674 1.00 52.61  ? 131 LYS C CB    1 
ATOM   6271  C  CG    . LYS C 1 118 ? -13.656  3.967   -50.891 1.00 52.61  ? 131 LYS C CG    1 
ATOM   6272  C  CD    . LYS C 1 118 ? -12.343  4.462   -51.468 1.00 52.61  ? 131 LYS C CD    1 
ATOM   6273  C  CE    . LYS C 1 118 ? -12.592  5.477   -52.571 1.00 52.61  ? 131 LYS C CE    1 
ATOM   6274  N  NZ    . LYS C 1 118 ? -13.574  4.978   -53.572 1.00 52.61  ? 131 LYS C NZ    1 
ATOM   6275  N  N     . LYS C 1 119 ? -14.671  0.268   -50.170 1.00 27.79  ? 132 LYS C N     1 
ATOM   6276  C  CA    . LYS C 1 119 ? -15.059  -0.789  -51.101 1.00 27.79  ? 132 LYS C CA    1 
ATOM   6277  C  C     . LYS C 1 119 ? -16.504  -1.244  -50.891 1.00 27.79  ? 132 LYS C C     1 
ATOM   6278  O  O     . LYS C 1 119 ? -17.109  -1.843  -51.779 1.00 27.79  ? 132 LYS C O     1 
ATOM   6279  C  CB    . LYS C 1 119 ? -14.101  -1.979  -50.995 1.00 27.79  ? 132 LYS C CB    1 
ATOM   6280  C  CG    . LYS C 1 119 ? -12.646  -1.628  -51.275 1.00 27.79  ? 132 LYS C CG    1 
ATOM   6281  C  CD    . LYS C 1 119 ? -11.721  -2.830  -51.107 1.00 27.79  ? 132 LYS C CD    1 
ATOM   6282  C  CE    . LYS C 1 119 ? -12.046  -3.935  -52.100 1.00 27.79  ? 132 LYS C CE    1 
ATOM   6283  N  NZ    . LYS C 1 119 ? -11.058  -5.051  -52.049 1.00 27.79  ? 132 LYS C NZ    1 
ATOM   6284  N  N     . HIS C 1 120 ? -17.049  -0.958  -49.713 1.00 34.37  ? 133 HIS C N     1 
ATOM   6285  C  CA    . HIS C 1 120 ? -18.448  -1.239  -49.426 1.00 34.37  ? 133 HIS C CA    1 
ATOM   6286  C  C     . HIS C 1 120 ? -19.310  -0.040  -49.805 1.00 34.37  ? 133 HIS C C     1 
ATOM   6287  O  O     . HIS C 1 120 ? -20.443  -0.197  -50.259 1.00 34.37  ? 133 HIS C O     1 
ATOM   6288  C  CB    . HIS C 1 120 ? -18.641  -1.585  -47.949 1.00 34.37  ? 133 HIS C CB    1 
ATOM   6289  C  CG    . HIS C 1 120 ? -17.977  -2.861  -47.535 1.00 34.37  ? 133 HIS C CG    1 
ATOM   6290  N  ND1   . HIS C 1 120 ? -18.254  -4.072  -48.132 1.00 34.37  ? 133 HIS C ND1   1 
ATOM   6291  C  CD2   . HIS C 1 120 ? -17.056  -3.117  -46.576 1.00 34.37  ? 133 HIS C CD2   1 
ATOM   6292  C  CE1   . HIS C 1 120 ? -17.528  -5.017  -47.564 1.00 34.37  ? 133 HIS C CE1   1 
ATOM   6293  N  NE2   . HIS C 1 120 ? -16.792  -4.464  -46.616 1.00 34.37  ? 133 HIS C NE2   1 
ATOM   6294  N  N     . LEU C 1 121 ? -18.764  1.157   -49.615 1.00 36.25  ? 134 LEU C N     1 
ATOM   6295  C  CA    . LEU C 1 121 ? -19.440  2.382   -50.022 1.00 36.25  ? 134 LEU C CA    1 
ATOM   6296  C  C     . LEU C 1 121 ? -19.613  2.403   -51.538 1.00 36.25  ? 134 LEU C C     1 
ATOM   6297  O  O     . LEU C 1 121 ? -20.611  2.907   -52.055 1.00 36.25  ? 134 LEU C O     1 
ATOM   6298  C  CB    . LEU C 1 121 ? -18.643  3.611   -49.580 1.00 36.25  ? 134 LEU C CB    1 
ATOM   6299  C  CG    . LEU C 1 121 ? -19.369  4.635   -48.708 1.00 36.25  ? 134 LEU C CG    1 
ATOM   6300  C  CD1   . LEU C 1 121 ? -18.713  6.003   -48.805 1.00 36.25  ? 134 LEU C CD1   1 
ATOM   6301  C  CD2   . LEU C 1 121 ? -20.824  4.714   -49.095 1.00 36.25  ? 134 LEU C CD2   1 
ATOM   6302  N  N     . GLU C 1 122 ? -18.630  1.849   -52.241 1.00 57.11  ? 135 GLU C N     1 
ATOM   6303  C  CA    . GLU C 1 122 ? -18.648  1.795   -53.698 1.00 57.11  ? 135 GLU C CA    1 
ATOM   6304  C  C     . GLU C 1 122 ? -19.677  0.794   -54.216 1.00 57.11  ? 135 GLU C C     1 
ATOM   6305  O  O     . GLU C 1 122 ? -20.080  0.854   -55.376 1.00 57.11  ? 135 GLU C O     1 
ATOM   6306  C  CB    . GLU C 1 122 ? -17.260  1.431   -54.234 1.00 57.11  ? 135 GLU C CB    1 
ATOM   6307  C  CG    . GLU C 1 122 ? -16.178  2.469   -53.961 1.00 57.11  ? 135 GLU C CG    1 
ATOM   6308  C  CD    . GLU C 1 122 ? -14.803  2.008   -54.410 1.00 57.11  ? 135 GLU C CD    1 
ATOM   6309  O  OE1   . GLU C 1 122 ? -13.891  2.855   -54.505 1.00 57.11  ? 135 GLU C OE1   1 
ATOM   6310  O  OE2   . GLU C 1 122 ? -14.634  0.798   -54.665 1.00 57.11  ? 135 GLU C OE2   1 
ATOM   6311  N  N     . SER C 1 123 ? -20.097  -0.128  -53.354 1.00 45.37  ? 136 SER C N     1 
ATOM   6312  C  CA    . SER C 1 123 ? -21.037  -1.170  -53.752 1.00 45.37  ? 136 SER C CA    1 
ATOM   6313  C  C     . SER C 1 123 ? -22.486  -0.781  -53.469 1.00 45.37  ? 136 SER C C     1 
ATOM   6314  O  O     . SER C 1 123 ? -23.401  -1.580  -53.674 1.00 45.37  ? 136 SER C O     1 
ATOM   6315  C  CB    . SER C 1 123 ? -20.704  -2.492  -53.056 1.00 45.37  ? 136 SER C CB    1 
ATOM   6316  O  OG    . SER C 1 123 ? -20.914  -2.402  -51.658 1.00 45.37  ? 136 SER C OG    1 
ATOM   6317  N  N     . VAL C 1 124 ? -22.690  0.446   -52.998 1.00 52.51  ? 137 VAL C N     1 
ATOM   6318  C  CA    . VAL C 1 124 ? -24.035  0.950   -52.745 1.00 52.51  ? 137 VAL C CA    1 
ATOM   6319  C  C     . VAL C 1 124 ? -24.630  1.536   -54.019 1.00 52.51  ? 137 VAL C C     1 
ATOM   6320  O  O     . VAL C 1 124 ? -24.093  2.490   -54.583 1.00 52.51  ? 137 VAL C O     1 
ATOM   6321  C  CB    . VAL C 1 124 ? -24.046  2.021   -51.641 1.00 52.51  ? 137 VAL C CB    1 
ATOM   6322  C  CG1   . VAL C 1 124 ? -25.428  2.641   -51.518 1.00 52.51  ? 137 VAL C CG1   1 
ATOM   6323  C  CG2   . VAL C 1 124 ? -23.614  1.416   -50.318 1.00 52.51  ? 137 VAL C CG2   1 
ATOM   6324  N  N     . GLN C 1 125 ? -25.741  0.962   -54.468 1.00 84.29  ? 138 GLN C N     1 
ATOM   6325  C  CA    . GLN C 1 125 ? -26.359  1.378   -55.722 1.00 84.29  ? 138 GLN C CA    1 
ATOM   6326  C  C     . GLN C 1 125 ? -27.039  2.739   -55.636 1.00 84.29  ? 138 GLN C C     1 
ATOM   6327  O  O     . GLN C 1 125 ? -27.957  2.941   -54.840 1.00 84.29  ? 138 GLN C O     1 
ATOM   6328  C  CB    . GLN C 1 125 ? -27.359  0.328   -56.212 1.00 84.29  ? 138 GLN C CB    1 
ATOM   6329  C  CG    . GLN C 1 125 ? -26.714  -0.921  -56.790 1.00 84.29  ? 138 GLN C CG    1 
ATOM   6330  C  CD    . GLN C 1 125 ? -27.728  -1.884  -57.380 1.00 84.29  ? 138 GLN C CD    1 
ATOM   6331  O  OE1   . GLN C 1 125 ? -28.936  -1.661  -57.299 1.00 84.29  ? 138 GLN C OE1   1 
ATOM   6332  N  NE2   . GLN C 1 125 ? -27.238  -2.961  -57.980 1.00 84.29  ? 138 GLN C NE2   1 
ATOM   6333  N  N     . GLN C 1 126 ? -26.573  3.668   -56.464 1.00 85.73  ? 139 GLN C N     1 
ATOM   6334  C  CA    . GLN C 1 126 ? -27.230  4.956   -56.632 1.00 85.73  ? 139 GLN C CA    1 
ATOM   6335  C  C     . GLN C 1 126 ? -28.400  4.767   -57.600 1.00 85.73  ? 139 GLN C C     1 
ATOM   6336  O  O     . GLN C 1 126 ? -28.402  3.814   -58.380 1.00 85.73  ? 139 GLN C O     1 
ATOM   6337  C  CB    . GLN C 1 126 ? -26.233  5.992   -57.159 1.00 85.73  ? 139 GLN C CB    1 
ATOM   6338  C  CG    . GLN C 1 126 ? -24.994  6.153   -56.285 1.00 85.73  ? 139 GLN C CG    1 
ATOM   6339  C  CD    . GLN C 1 126 ? -24.102  7.298   -56.730 1.00 85.73  ? 139 GLN C CD    1 
ATOM   6340  O  OE1   . GLN C 1 126 ? -24.421  8.017   -57.676 1.00 85.73  ? 139 GLN C OE1   1 
ATOM   6341  N  NE2   . GLN C 1 126 ? -22.976  7.472   -56.046 1.00 85.73  ? 139 GLN C NE2   1 
ATOM   6342  N  N     . PRO C 1 127 ? -29.407  5.660   -57.560 1.00 120.18 ? 140 PRO C N     1 
ATOM   6343  C  CA    . PRO C 1 127 ? -29.578  6.879   -56.757 1.00 120.18 ? 140 PRO C CA    1 
ATOM   6344  C  C     . PRO C 1 127 ? -29.722  6.601   -55.265 1.00 120.18 ? 140 PRO C C     1 
ATOM   6345  O  O     . PRO C 1 127 ? -30.349  5.618   -54.873 1.00 120.18 ? 140 PRO C O     1 
ATOM   6346  C  CB    . PRO C 1 127 ? -30.885  7.477   -57.296 1.00 120.18 ? 140 PRO C CB    1 
ATOM   6347  C  CG    . PRO C 1 127 ? -31.103  6.820   -58.619 1.00 120.18 ? 140 PRO C CG    1 
ATOM   6348  C  CD    . PRO C 1 127 ? -30.552  5.446   -58.459 1.00 120.18 ? 140 PRO C CD    1 
ATOM   6349  N  N     . ILE C 1 128 ? -29.138  7.470   -54.448 1.00 51.11  ? 141 ILE C N     1 
ATOM   6350  C  CA    . ILE C 1 128 ? -29.187  7.320   -53.002 1.00 51.11  ? 141 ILE C CA    1 
ATOM   6351  C  C     . ILE C 1 128 ? -30.435  7.991   -52.444 1.00 51.11  ? 141 ILE C C     1 
ATOM   6352  O  O     . ILE C 1 128 ? -30.631  9.193   -52.623 1.00 51.11  ? 141 ILE C O     1 
ATOM   6353  C  CB    . ILE C 1 128 ? -27.940  7.931   -52.343 1.00 51.11  ? 141 ILE C CB    1 
ATOM   6354  C  CG1   . ILE C 1 128 ? -26.685  7.519   -53.111 1.00 51.11  ? 141 ILE C CG1   1 
ATOM   6355  C  CG2   . ILE C 1 128 ? -27.846  7.513   -50.883 1.00 51.11  ? 141 ILE C CG2   1 
ATOM   6356  C  CD1   . ILE C 1 128 ? -25.474  8.354   -52.789 1.00 51.11  ? 141 ILE C CD1   1 
ATOM   6357  N  N     . PRO C 1 129 ? -31.290  7.207   -51.770 1.00 42.52  ? 142 PRO C N     1 
ATOM   6358  C  CA    . PRO C 1 129 ? -32.505  7.733   -51.139 1.00 42.52  ? 142 PRO C CA    1 
ATOM   6359  C  C     . PRO C 1 129 ? -32.181  8.798   -50.099 1.00 42.52  ? 142 PRO C C     1 
ATOM   6360  O  O     . PRO C 1 129 ? -31.329  8.566   -49.242 1.00 42.52  ? 142 PRO C O     1 
ATOM   6361  C  CB    . PRO C 1 129 ? -33.114  6.499   -50.463 1.00 42.52  ? 142 PRO C CB    1 
ATOM   6362  C  CG    . PRO C 1 129 ? -32.002  5.500   -50.376 1.00 42.52  ? 142 PRO C CG    1 
ATOM   6363  C  CD    . PRO C 1 129 ? -31.150  5.755   -51.574 1.00 42.52  ? 142 PRO C CD    1 
ATOM   6364  N  N     . PRO C 1 130 ? -32.862  9.954   -50.173 1.00 90.34  ? 143 PRO C N     1 
ATOM   6365  C  CA    . PRO C 1 130 ? -32.626  11.121  -49.312 1.00 90.34  ? 143 PRO C CA    1 
ATOM   6366  C  C     . PRO C 1 130 ? -32.739  10.805  -47.822 1.00 90.34  ? 143 PRO C C     1 
ATOM   6367  O  O     . PRO C 1 130 ? -32.211  11.548  -46.993 1.00 90.34  ? 143 PRO C O     1 
ATOM   6368  C  CB    . PRO C 1 130 ? -33.739  12.087  -49.728 1.00 90.34  ? 143 PRO C CB    1 
ATOM   6369  C  CG    . PRO C 1 130 ? -34.067  11.699  -51.129 1.00 90.34  ? 143 PRO C CG    1 
ATOM   6370  C  CD    . PRO C 1 130 ? -33.923  10.209  -51.163 1.00 90.34  ? 143 PRO C CD    1 
ATOM   6371  N  N     . GLU C 1 131 ? -33.428  9.717   -47.493 1.00 72.73  ? 144 GLU C N     1 
ATOM   6372  C  CA    . GLU C 1 131 ? -33.535  9.252   -46.117 1.00 72.73  ? 144 GLU C CA    1 
ATOM   6373  C  C     . GLU C 1 131 ? -32.196  8.697   -45.646 1.00 72.73  ? 144 GLU C C     1 
ATOM   6374  O  O     . GLU C 1 131 ? -31.955  8.563   -44.447 1.00 72.73  ? 144 GLU C O     1 
ATOM   6375  C  CB    . GLU C 1 131 ? -34.600  8.159   -46.010 1.00 72.73  ? 144 GLU C CB    1 
ATOM   6376  C  CG    . GLU C 1 131 ? -34.273  6.911   -46.821 1.00 72.73  ? 144 GLU C CG    1 
ATOM   6377  C  CD    . GLU C 1 131 ? -35.195  5.747   -46.517 1.00 72.73  ? 144 GLU C CD    1 
ATOM   6378  O  OE1   . GLU C 1 131 ? -34.879  4.616   -46.943 1.00 72.73  ? 144 GLU C OE1   1 
ATOM   6379  O  OE2   . GLU C 1 131 ? -36.234  5.959   -45.855 1.00 72.73  ? 144 GLU C OE2   1 
ATOM   6380  N  N     . GLN C 1 132 ? -31.328  8.378   -46.601 1.00 50.03  ? 145 GLN C N     1 
ATOM   6381  C  CA    . GLN C 1 132 ? -30.059  7.732   -46.301 1.00 50.03  ? 145 GLN C CA    1 
ATOM   6382  C  C     . GLN C 1 132 ? -28.882  8.488   -46.914 1.00 50.03  ? 145 GLN C C     1 
ATOM   6383  O  O     . GLN C 1 132 ? -27.739  8.039   -46.832 1.00 50.03  ? 145 GLN C O     1 
ATOM   6384  C  CB    . GLN C 1 132 ? -30.078  6.292   -46.817 1.00 50.03  ? 145 GLN C CB    1 
ATOM   6385  C  CG    . GLN C 1 132 ? -29.341  5.307   -45.934 1.00 50.03  ? 145 GLN C CG    1 
ATOM   6386  C  CD    . GLN C 1 132 ? -29.972  5.175   -44.566 1.00 50.03  ? 145 GLN C CD    1 
ATOM   6387  O  OE1   . GLN C 1 132 ? -29.285  5.203   -43.547 1.00 50.03  ? 145 GLN C OE1   1 
ATOM   6388  N  NE2   . GLN C 1 132 ? -31.290  5.027   -44.536 1.00 50.03  ? 145 GLN C NE2   1 
ATOM   6389  N  N     . GLN C 1 133 ? -29.161  9.634   -47.526 1.00 60.51  ? 146 GLN C N     1 
ATOM   6390  C  CA    . GLN C 1 133 ? -28.118  10.401  -48.198 1.00 60.51  ? 146 GLN C CA    1 
ATOM   6391  C  C     . GLN C 1 133 ? -27.462  11.401  -47.249 1.00 60.51  ? 146 GLN C C     1 
ATOM   6392  O  O     . GLN C 1 133 ? -26.543  12.127  -47.630 1.00 60.51  ? 146 GLN C O     1 
ATOM   6393  C  CB    . GLN C 1 133 ? -28.670  11.101  -49.445 1.00 60.51  ? 146 GLN C CB    1 
ATOM   6394  C  CG    . GLN C 1 133 ? -27.615  11.404  -50.505 1.00 60.51  ? 146 GLN C CG    1 
ATOM   6395  C  CD    . GLN C 1 133 ? -28.213  11.729  -51.860 1.00 60.51  ? 146 GLN C CD    1 
ATOM   6396  O  OE1   . GLN C 1 133 ? -29.432  11.773  -52.020 1.00 60.51  ? 146 GLN C OE1   1 
ATOM   6397  N  NE2   . GLN C 1 133 ? -27.353  11.954  -52.847 1.00 60.51  ? 146 GLN C NE2   1 
ATOM   6398  N  N     . MET C 1 134 ? -27.939  11.433  -46.009 1.00 71.13  ? 147 MET C N     1 
ATOM   6399  C  CA    . MET C 1 134 ? -27.281  12.207  -44.965 1.00 71.13  ? 147 MET C CA    1 
ATOM   6400  C  C     . MET C 1 134 ? -26.153  11.354  -44.393 1.00 71.13  ? 147 MET C C     1 
ATOM   6401  O  O     . MET C 1 134 ? -25.134  11.873  -43.939 1.00 71.13  ? 147 MET C O     1 
ATOM   6402  C  CB    . MET C 1 134 ? -28.280  12.600  -43.874 1.00 71.13  ? 147 MET C CB    1 
ATOM   6403  C  CG    . MET C 1 134 ? -27.932  13.882  -43.132 1.00 71.13  ? 147 MET C CG    1 
ATOM   6404  S  SD    . MET C 1 134 ? -26.845  13.628  -41.717 1.00 71.13  ? 147 MET C SD    1 
ATOM   6405  C  CE    . MET C 1 134 ? -27.934  12.730  -40.613 1.00 71.13  ? 147 MET C CE    1 
ATOM   6406  N  N     . ASN C 1 135 ? -26.346  10.038  -44.437 1.00 53.34  ? 148 ASN C N     1 
ATOM   6407  C  CA    . ASN C 1 135 ? -25.319  9.086   -44.032 1.00 53.34  ? 148 ASN C CA    1 
ATOM   6408  C  C     . ASN C 1 135 ? -24.201  8.984   -45.063 1.00 53.34  ? 148 ASN C C     1 
ATOM   6409  O  O     . ASN C 1 135 ? -23.024  8.948   -44.712 1.00 53.34  ? 148 ASN C O     1 
ATOM   6410  C  CB    . ASN C 1 135 ? -25.928  7.701   -43.812 1.00 53.34  ? 148 ASN C CB    1 
ATOM   6411  C  CG    . ASN C 1 135 ? -26.896  7.664   -42.648 1.00 53.34  ? 148 ASN C CG    1 
ATOM   6412  O  OD1   . ASN C 1 135 ? -27.353  8.700   -42.172 1.00 53.34  ? 148 ASN C OD1   1 
ATOM   6413  N  ND2   . ASN C 1 135 ? -27.219  6.461   -42.187 1.00 53.34  ? 148 ASN C ND2   1 
ATOM   6414  N  N     . TYR C 1 136 ? -24.584  8.927   -46.336 1.00 52.73  ? 149 TYR C N     1 
ATOM   6415  C  CA    . TYR C 1 136 ? -23.631  8.791   -47.433 1.00 52.73  ? 149 TYR C CA    1 
ATOM   6416  C  C     . TYR C 1 136 ? -22.651  9.955   -47.468 1.00 52.73  ? 149 TYR C C     1 
ATOM   6417  O  O     . TYR C 1 136 ? -21.443  9.756   -47.604 1.00 52.73  ? 149 TYR C O     1 
ATOM   6418  C  CB    . TYR C 1 136 ? -24.371  8.702   -48.771 1.00 52.73  ? 149 TYR C CB    1 
ATOM   6419  C  CG    . TYR C 1 136 ? -23.482  8.369   -49.949 1.00 52.73  ? 149 TYR C CG    1 
ATOM   6420  C  CD1   . TYR C 1 136 ? -23.276  7.052   -50.333 1.00 52.73  ? 149 TYR C CD1   1 
ATOM   6421  C  CD2   . TYR C 1 136 ? -22.852  9.370   -50.679 1.00 52.73  ? 149 TYR C CD2   1 
ATOM   6422  C  CE1   . TYR C 1 136 ? -22.468  6.741   -51.408 1.00 52.73  ? 149 TYR C CE1   1 
ATOM   6423  C  CE2   . TYR C 1 136 ? -22.040  9.066   -51.755 1.00 52.73  ? 149 TYR C CE2   1 
ATOM   6424  C  CZ    . TYR C 1 136 ? -21.852  7.749   -52.114 1.00 52.73  ? 149 TYR C CZ    1 
ATOM   6425  O  OH    . TYR C 1 136 ? -21.048  7.435   -53.184 1.00 52.73  ? 149 TYR C OH    1 
ATOM   6426  N  N     . GLY C 1 137 ? -23.183  11.168  -47.351 1.00 35.56  ? 150 GLY C N     1 
ATOM   6427  C  CA    . GLY C 1 137 ? -22.371  12.370  -47.375 1.00 35.56  ? 150 GLY C CA    1 
ATOM   6428  C  C     . GLY C 1 137 ? -21.293  12.379  -46.309 1.00 35.56  ? 150 GLY C C     1 
ATOM   6429  O  O     . GLY C 1 137 ? -20.143  12.706  -46.589 1.00 35.56  ? 150 GLY C O     1 
ATOM   6430  N  N     . ILE C 1 138 ? -21.665  12.008  -45.088 1.00 32.01  ? 151 ILE C N     1 
ATOM   6431  C  CA    . ILE C 1 138 ? -20.726  11.989  -43.972 1.00 32.01  ? 151 ILE C CA    1 
ATOM   6432  C  C     . ILE C 1 138 ? -19.642  10.927  -44.161 1.00 32.01  ? 151 ILE C C     1 
ATOM   6433  O  O     . ILE C 1 138 ? -18.467  11.179  -43.899 1.00 32.01  ? 151 ILE C O     1 
ATOM   6434  C  CB    . ILE C 1 138 ? -21.449  11.773  -42.628 1.00 32.01  ? 151 ILE C CB    1 
ATOM   6435  C  CG1   . ILE C 1 138 ? -22.484  12.874  -42.396 1.00 32.01  ? 151 ILE C CG1   1 
ATOM   6436  C  CG2   . ILE C 1 138 ? -20.457  11.748  -41.479 1.00 32.01  ? 151 ILE C CG2   1 
ATOM   6437  C  CD1   . ILE C 1 138 ? -23.174  12.798  -41.050 1.00 32.01  ? 151 ILE C CD1   1 
ATOM   6438  N  N     . LEU C 1 139 ? -20.039  9.746   -44.624 1.00 33.26  ? 152 LEU C N     1 
ATOM   6439  C  CA    . LEU C 1 139 ? -19.093  8.656   -44.849 1.00 33.26  ? 152 LEU C CA    1 
ATOM   6440  C  C     . LEU C 1 139 ? -18.072  8.975   -45.942 1.00 33.26  ? 152 LEU C C     1 
ATOM   6441  O  O     . LEU C 1 139 ? -16.872  8.777   -45.754 1.00 33.26  ? 152 LEU C O     1 
ATOM   6442  C  CB    . LEU C 1 139 ? -19.829  7.357   -45.187 1.00 33.26  ? 152 LEU C CB    1 
ATOM   6443  C  CG    . LEU C 1 139 ? -20.543  6.639   -44.043 1.00 33.26  ? 152 LEU C CG    1 
ATOM   6444  C  CD1   . LEU C 1 139 ? -21.156  5.332   -44.520 1.00 33.26  ? 152 LEU C CD1   1 
ATOM   6445  C  CD2   . LEU C 1 139 ? -19.577  6.389   -42.903 1.00 33.26  ? 152 LEU C CD2   1 
ATOM   6446  N  N     . LYS C 1 140 ? -18.551  9.471   -47.080 1.00 69.88  ? 153 LYS C N     1 
ATOM   6447  C  CA    . LYS C 1 140 ? -17.680  9.725   -48.223 1.00 69.88  ? 153 LYS C CA    1 
ATOM   6448  C  C     . LYS C 1 140 ? -16.829  10.982  -48.049 1.00 69.88  ? 153 LYS C C     1 
ATOM   6449  O  O     . LYS C 1 140 ? -15.728  11.070  -48.592 1.00 69.88  ? 153 LYS C O     1 
ATOM   6450  C  CB    . LYS C 1 140 ? -18.490  9.800   -49.520 1.00 69.88  ? 153 LYS C CB    1 
ATOM   6451  C  CG    . LYS C 1 140 ? -17.656  9.574   -50.773 1.00 69.88  ? 153 LYS C CG    1 
ATOM   6452  C  CD    . LYS C 1 140 ? -18.527  9.388   -52.002 1.00 69.88  ? 153 LYS C CD    1 
ATOM   6453  C  CE    . LYS C 1 140 ? -17.955  8.315   -52.916 1.00 69.88  ? 153 LYS C CE    1 
ATOM   6454  N  NZ    . LYS C 1 140 ? -16.518  8.548   -53.224 1.00 69.88  ? 153 LYS C NZ    1 
ATOM   6455  N  N     . GLN C 1 141 ? -17.337  11.951  -47.293 1.00 72.91  ? 154 GLN C N     1 
ATOM   6456  C  CA    . GLN C 1 141 ? -16.583  13.171  -47.014 1.00 72.91  ? 154 GLN C CA    1 
ATOM   6457  C  C     . GLN C 1 141 ? -15.426  12.868  -46.063 1.00 72.91  ? 154 GLN C C     1 
ATOM   6458  O  O     . GLN C 1 141 ? -14.422  13.580  -46.045 1.00 72.91  ? 154 GLN C O     1 
ATOM   6459  C  CB    . GLN C 1 141 ? -17.491  14.253  -46.423 1.00 72.91  ? 154 GLN C CB    1 
ATOM   6460  C  CG    . GLN C 1 141 ? -16.827  15.610  -46.242 1.00 72.91  ? 154 GLN C CG    1 
ATOM   6461  C  CD    . GLN C 1 141 ? -17.704  16.596  -45.490 1.00 72.91  ? 154 GLN C CD    1 
ATOM   6462  O  OE1   . GLN C 1 141 ? -18.882  16.766  -45.806 1.00 72.91  ? 154 GLN C OE1   1 
ATOM   6463  N  NE2   . GLN C 1 141 ? -17.131  17.249  -44.483 1.00 72.91  ? 154 GLN C NE2   1 
ATOM   6464  N  N     . LYS C 1 142 ? -15.574  11.806  -45.275 1.00 40.39  ? 155 LYS C N     1 
ATOM   6465  C  CA    . LYS C 1 142 ? -14.511  11.362  -44.380 1.00 40.39  ? 155 LYS C CA    1 
ATOM   6466  C  C     . LYS C 1 142 ? -13.417  10.639  -45.153 1.00 40.39  ? 155 LYS C C     1 
ATOM   6467  O  O     . LYS C 1 142 ? -12.233  10.913  -44.971 1.00 40.39  ? 155 LYS C O     1 
ATOM   6468  C  CB    . LYS C 1 142 ? -15.063  10.450  -43.284 1.00 40.39  ? 155 LYS C CB    1 
ATOM   6469  C  CG    . LYS C 1 142 ? -15.828  11.177  -42.194 1.00 40.39  ? 155 LYS C CG    1 
ATOM   6470  C  CD    . LYS C 1 142 ? -16.257  10.222  -41.094 1.00 40.39  ? 155 LYS C CD    1 
ATOM   6471  C  CE    . LYS C 1 142 ? -17.103  10.937  -40.061 1.00 40.39  ? 155 LYS C CE    1 
ATOM   6472  N  NZ    . LYS C 1 142 ? -17.306  10.123  -38.835 1.00 40.39  ? 155 LYS C NZ    1 
ATOM   6473  N  N     . ILE C 1 143 ? -13.824  9.711   -46.013 1.00 31.09  ? 156 ILE C N     1 
ATOM   6474  C  CA    . ILE C 1 143 ? -12.884  8.976   -46.852 1.00 31.09  ? 156 ILE C CA    1 
ATOM   6475  C  C     . ILE C 1 143 ? -12.132  9.937   -47.768 1.00 31.09  ? 156 ILE C C     1 
ATOM   6476  O  O     . ILE C 1 143 ? -10.955  9.733   -48.065 1.00 31.09  ? 156 ILE C O     1 
ATOM   6477  C  CB    . ILE C 1 143 ? -13.595  7.887   -47.679 1.00 31.09  ? 156 ILE C CB    1 
ATOM   6478  C  CG1   . ILE C 1 143 ? -14.370  6.946   -46.757 1.00 31.09  ? 156 ILE C CG1   1 
ATOM   6479  C  CG2   . ILE C 1 143 ? -12.597  7.096   -48.507 1.00 31.09  ? 156 ILE C CG2   1 
ATOM   6480  C  CD1   . ILE C 1 143 ? -15.031  5.790   -47.474 1.00 31.09  ? 156 ILE C CD1   1 
ATOM   6481  N  N     . ALA C 1 144 ? -12.816  10.993  -48.198 1.00 22.94  ? 157 ALA C N     1 
ATOM   6482  C  CA    . ALA C 1 144 ? -12.186  12.049  -48.983 1.00 22.94  ? 157 ALA C CA    1 
ATOM   6483  C  C     . ALA C 1 144 ? -11.041  12.688  -48.202 1.00 22.94  ? 157 ALA C C     1 
ATOM   6484  O  O     . ALA C 1 144 ? -9.916   12.771  -48.693 1.00 22.94  ? 157 ALA C O     1 
ATOM   6485  C  CB    . ALA C 1 144 ? -13.209  13.097  -49.378 1.00 22.94  ? 157 ALA C CB    1 
ATOM   6486  N  N     . LEU C 1 145 ? -11.344  13.135  -46.985 1.00 24.82  ? 158 LEU C N     1 
ATOM   6487  C  CA    . LEU C 1 145 ? -10.358  13.734  -46.089 1.00 24.82  ? 158 LEU C CA    1 
ATOM   6488  C  C     . LEU C 1 145 ? -9.178   12.787  -45.855 1.00 24.82  ? 158 LEU C C     1 
ATOM   6489  O  O     . LEU C 1 145 ? -8.019   13.203  -45.896 1.00 24.82  ? 158 LEU C O     1 
ATOM   6490  C  CB    . LEU C 1 145 ? -11.034  14.115  -44.766 1.00 24.82  ? 158 LEU C CB    1 
ATOM   6491  C  CG    . LEU C 1 145 ? -10.314  14.819  -43.608 1.00 24.82  ? 158 LEU C CG    1 
ATOM   6492  C  CD1   . LEU C 1 145 ? -9.919   13.821  -42.537 1.00 24.82  ? 158 LEU C CD1   1 
ATOM   6493  C  CD2   . LEU C 1 145 ? -9.101   15.621  -44.059 1.00 24.82  ? 158 LEU C CD2   1 
ATOM   6494  N  N     . TYR C 1 146 ? -9.480   11.515  -45.620 1.00 37.77  ? 159 TYR C N     1 
ATOM   6495  C  CA    . TYR C 1 146 ? -8.449   10.500  -45.438 1.00 37.77  ? 159 TYR C CA    1 
ATOM   6496  C  C     . TYR C 1 146 ? -7.602   10.323  -46.697 1.00 37.77  ? 159 TYR C C     1 
ATOM   6497  O  O     . TYR C 1 146 ? -6.374   10.390  -46.641 1.00 37.77  ? 159 TYR C O     1 
ATOM   6498  C  CB    . TYR C 1 146 ? -9.085   9.164   -45.058 1.00 37.77  ? 159 TYR C CB    1 
ATOM   6499  C  CG    . TYR C 1 146 ? -9.354   8.987   -43.582 1.00 37.77  ? 159 TYR C CG    1 
ATOM   6500  C  CD1   . TYR C 1 146 ? -10.241  9.817   -42.910 1.00 37.77  ? 159 TYR C CD1   1 
ATOM   6501  C  CD2   . TYR C 1 146 ? -8.736   7.975   -42.864 1.00 37.77  ? 159 TYR C CD2   1 
ATOM   6502  C  CE1   . TYR C 1 146 ? -10.494  9.651   -41.564 1.00 37.77  ? 159 TYR C CE1   1 
ATOM   6503  C  CE2   . TYR C 1 146 ? -8.985   7.802   -41.520 1.00 37.77  ? 159 TYR C CE2   1 
ATOM   6504  C  CZ    . TYR C 1 146 ? -9.863   8.642   -40.876 1.00 37.77  ? 159 TYR C CZ    1 
ATOM   6505  O  OH    . TYR C 1 146 ? -10.110  8.469   -39.536 1.00 37.77  ? 159 TYR C OH    1 
ATOM   6506  N  N     . GLU C 1 147 ? -8.264   10.091  -47.828 1.00 42.64  ? 160 GLU C N     1 
ATOM   6507  C  CA    . GLU C 1 147 ? -7.575   9.865   -49.097 1.00 42.64  ? 160 GLU C CA    1 
ATOM   6508  C  C     . GLU C 1 147 ? -6.801   11.090  -49.582 1.00 42.64  ? 160 GLU C C     1 
ATOM   6509  O  O     . GLU C 1 147 ? -5.763   10.956  -50.229 1.00 42.64  ? 160 GLU C O     1 
ATOM   6510  C  CB    . GLU C 1 147 ? -8.558   9.401   -50.178 1.00 42.64  ? 160 GLU C CB    1 
ATOM   6511  C  CG    . GLU C 1 147 ? -8.893   7.916   -50.135 1.00 42.64  ? 160 GLU C CG    1 
ATOM   6512  C  CD    . GLU C 1 147 ? -9.781   7.482   -51.286 1.00 42.64  ? 160 GLU C CD    1 
ATOM   6513  O  OE1   . GLU C 1 147 ? -10.655  8.273   -51.697 1.00 42.64  ? 160 GLU C OE1   1 
ATOM   6514  O  OE2   . GLU C 1 147 ? -9.602   6.351   -51.783 1.00 42.64  ? 160 GLU C OE2   1 
ATOM   6515  N  N     . ASP C 1 148 ? -7.311   12.280  -49.275 1.00 64.15  ? 161 ASP C N     1 
ATOM   6516  C  CA    . ASP C 1 148 ? -6.663   13.521  -49.692 1.00 64.15  ? 161 ASP C CA    1 
ATOM   6517  C  C     . ASP C 1 148 ? -5.310   13.692  -49.002 1.00 64.15  ? 161 ASP C C     1 
ATOM   6518  O  O     . ASP C 1 148 ? -4.303   13.953  -49.659 1.00 64.15  ? 161 ASP C O     1 
ATOM   6519  C  CB    . ASP C 1 148 ? -7.566   14.724  -49.396 1.00 64.15  ? 161 ASP C CB    1 
ATOM   6520  C  CG    . ASP C 1 148 ? -7.153   15.975  -50.156 1.00 64.15  ? 161 ASP C CG    1 
ATOM   6521  O  OD1   . ASP C 1 148 ? -5.966   16.101  -50.519 1.00 64.15  ? 161 ASP C OD1   1 
ATOM   6522  O  OD2   . ASP C 1 148 ? -8.021   16.841  -50.388 1.00 64.15  ? 161 ASP C OD2   1 
ATOM   6523  N  N     . LYS C 1 149 ? -5.295   13.541  -47.680 1.00 40.08  ? 162 LYS C N     1 
ATOM   6524  C  CA    . LYS C 1 149 ? -4.072   13.693  -46.896 1.00 40.08  ? 162 LYS C CA    1 
ATOM   6525  C  C     . LYS C 1 149 ? -2.977   12.723  -47.334 1.00 40.08  ? 162 LYS C C     1 
ATOM   6526  O  O     . LYS C 1 149 ? -1.792   13.048  -47.274 1.00 40.08  ? 162 LYS C O     1 
ATOM   6527  C  CB    . LYS C 1 149 ? -4.364   13.514  -45.405 1.00 40.08  ? 162 LYS C CB    1 
ATOM   6528  C  CG    . LYS C 1 149 ? -4.361   14.805  -44.596 1.00 40.08  ? 162 LYS C CG    1 
ATOM   6529  C  CD    . LYS C 1 149 ? -5.440   15.770  -45.056 1.00 40.08  ? 162 LYS C CD    1 
ATOM   6530  C  CE    . LYS C 1 149 ? -5.498   17.000  -44.159 1.00 40.08  ? 162 LYS C CE    1 
ATOM   6531  N  NZ    . LYS C 1 149 ? -4.203   17.734  -44.122 1.00 40.08  ? 162 LYS C NZ    1 
ATOM   6532  N  N     . LEU C 1 150 ? -3.379   11.536  -47.774 1.00 35.14  ? 163 LEU C N     1 
ATOM   6533  C  CA    . LEU C 1 150 ? -2.428   10.531  -48.233 1.00 35.14  ? 163 LEU C CA    1 
ATOM   6534  C  C     . LEU C 1 150 ? -1.820   10.912  -49.581 1.00 35.14  ? 163 LEU C C     1 
ATOM   6535  O  O     . LEU C 1 150 ? -0.610   10.806  -49.778 1.00 35.14  ? 163 LEU C O     1 
ATOM   6536  C  CB    . LEU C 1 150 ? -3.092   9.157   -48.323 1.00 35.14  ? 163 LEU C CB    1 
ATOM   6537  C  CG    . LEU C 1 150 ? -3.576   8.525   -47.020 1.00 35.14  ? 163 LEU C CG    1 
ATOM   6538  C  CD1   . LEU C 1 150 ? -3.927   7.067   -47.240 1.00 35.14  ? 163 LEU C CD1   1 
ATOM   6539  C  CD2   . LEU C 1 150 ? -2.522   8.661   -45.941 1.00 35.14  ? 163 LEU C CD2   1 
ATOM   6540  N  N     . SER C 1 151 ? -2.668   11.355  -50.504 1.00 65.11  ? 164 SER C N     1 
ATOM   6541  C  CA    . SER C 1 151 ? -2.212   11.790  -51.820 1.00 65.11  ? 164 SER C CA    1 
ATOM   6542  C  C     . SER C 1 151 ? -1.360   13.051  -51.715 1.00 65.11  ? 164 SER C C     1 
ATOM   6543  O  O     . SER C 1 151 ? -0.522   13.318  -52.575 1.00 65.11  ? 164 SER C O     1 
ATOM   6544  C  CB    . SER C 1 151 ? -3.407   12.036  -52.743 1.00 65.11  ? 164 SER C CB    1 
ATOM   6545  O  OG    . SER C 1 151 ? -4.307   12.968  -52.173 1.00 65.11  ? 164 SER C OG    1 
ATOM   6546  N  N     . ARG C 1 152 ? -1.585   13.820  -50.654 1.00 50.57  ? 165 ARG C N     1 
ATOM   6547  C  CA    . ARG C 1 152 ? -0.803   15.020  -50.383 1.00 50.57  ? 165 ARG C CA    1 
ATOM   6548  C  C     . ARG C 1 152 ? 0.643    14.644  -50.076 1.00 50.57  ? 165 ARG C C     1 
ATOM   6549  O  O     . ARG C 1 152 ? 1.567    15.419  -50.326 1.00 50.57  ? 165 ARG C O     1 
ATOM   6550  C  CB    . ARG C 1 152 ? -1.399   15.780  -49.199 1.00 50.57  ? 165 ARG C CB    1 
ATOM   6551  C  CG    . ARG C 1 152 ? -1.625   17.262  -49.447 1.00 50.57  ? 165 ARG C CG    1 
ATOM   6552  C  CD    . ARG C 1 152 ? -2.936   17.508  -50.172 1.00 50.57  ? 165 ARG C CD    1 
ATOM   6553  N  NE    . ARG C 1 152 ? -3.212   18.932  -50.344 1.00 50.57  ? 165 ARG C NE    1 
ATOM   6554  C  CZ    . ARG C 1 152 ? -4.397   19.426  -50.685 1.00 50.57  ? 165 ARG C CZ    1 
ATOM   6555  N  NH1   . ARG C 1 152 ? -5.422   18.611  -50.885 1.00 50.57  ? 165 ARG C NH1   1 
ATOM   6556  N  NH2   . ARG C 1 152 ? -4.561   20.734  -50.820 1.00 50.57  ? 165 ARG C NH2   1 
ATOM   6557  N  N     . ALA C 1 153 ? 0.829    13.448  -49.526 1.00 60.73  ? 166 ALA C N     1 
ATOM   6558  C  CA    . ALA C 1 153 ? 2.157    12.948  -49.201 1.00 60.73  ? 166 ALA C CA    1 
ATOM   6559  C  C     . ALA C 1 153 ? 2.581    11.869  -50.188 1.00 60.73  ? 166 ALA C C     1 
ATOM   6560  O  O     . ALA C 1 153 ? 3.695    11.353  -50.117 1.00 60.73  ? 166 ALA C O     1 
ATOM   6561  C  CB    . ALA C 1 153 ? 2.188    12.408  -47.784 1.00 60.73  ? 166 ALA C CB    1 
ATOM   6562  N  N     . GLY C 1 154 ? 1.682    11.523  -51.102 1.00 37.57  ? 167 GLY C N     1 
ATOM   6563  C  CA    . GLY C 1 154 ? 1.981    10.536  -52.121 1.00 37.57  ? 167 GLY C CA    1 
ATOM   6564  C  C     . GLY C 1 154 ? 1.817    9.104   -51.651 1.00 37.57  ? 167 GLY C C     1 
ATOM   6565  O  O     . GLY C 1 154 ? 2.632    8.240   -51.976 1.00 37.57  ? 167 GLY C O     1 
ATOM   6566  N  N     . ILE C 1 155 ? 0.763    8.846   -50.886 1.00 62.43  ? 168 ILE C N     1 
ATOM   6567  C  CA    . ILE C 1 155 ? 0.452    7.487   -50.466 1.00 62.43  ? 168 ILE C CA    1 
ATOM   6568  C  C     . ILE C 1 155 ? -0.874   7.044   -51.074 1.00 62.43  ? 168 ILE C C     1 
ATOM   6569  O  O     . ILE C 1 155 ? -1.919   7.634   -50.806 1.00 62.43  ? 168 ILE C O     1 
ATOM   6570  C  CB    . ILE C 1 155 ? 0.390    7.361   -48.935 1.00 62.43  ? 168 ILE C CB    1 
ATOM   6571  C  CG1   . ILE C 1 155 ? 1.612    8.021   -48.299 1.00 62.43  ? 168 ILE C CG1   1 
ATOM   6572  C  CG2   . ILE C 1 155 ? 0.301    5.900   -48.521 1.00 62.43  ? 168 ILE C CG2   1 
ATOM   6573  C  CD1   . ILE C 1 155 ? 1.700    7.821   -46.809 1.00 62.43  ? 168 ILE C CD1   1 
ATOM   6574  N  N     . VAL C 1 156 ? -0.825   6.005   -51.901 1.00 78.01  ? 169 VAL C N     1 
ATOM   6575  C  CA    . VAL C 1 156 ? -2.024   5.512   -52.564 1.00 78.01  ? 169 VAL C CA    1 
ATOM   6576  C  C     . VAL C 1 156 ? -2.475   4.170   -51.989 1.00 78.01  ? 169 VAL C C     1 
ATOM   6577  O  O     . VAL C 1 156 ? -1.736   3.185   -52.025 1.00 78.01  ? 169 VAL C O     1 
ATOM   6578  C  CB    . VAL C 1 156 ? -1.827   5.416   -54.094 1.00 78.01  ? 169 VAL C CB    1 
ATOM   6579  C  CG1   . VAL C 1 156 ? -1.906   6.801   -54.724 1.00 78.01  ? 169 VAL C CG1   1 
ATOM   6580  C  CG2   . VAL C 1 156 ? -0.497   4.753   -54.427 1.00 78.01  ? 169 VAL C CG2   1 
ATOM   6581  N  N     . ILE C 1 157 ? -3.688   4.146   -51.442 1.00 38.42  ? 170 ILE C N     1 
ATOM   6582  C  CA    . ILE C 1 157 ? -4.243   2.933   -50.848 1.00 38.42  ? 170 ILE C CA    1 
ATOM   6583  C  C     . ILE C 1 157 ? -5.612   2.602   -51.435 1.00 38.42  ? 170 ILE C C     1 
ATOM   6584  O  O     . ILE C 1 157 ? -6.568   3.362   -51.273 1.00 38.42  ? 170 ILE C O     1 
ATOM   6585  C  CB    . ILE C 1 157 ? -4.379   3.051   -49.314 1.00 38.42  ? 170 ILE C CB    1 
ATOM   6586  C  CG1   . ILE C 1 157 ? -3.049   3.457   -48.675 1.00 38.42  ? 170 ILE C CG1   1 
ATOM   6587  C  CG2   . ILE C 1 157 ? -4.882   1.741   -48.722 1.00 38.42  ? 170 ILE C CG2   1 
ATOM   6588  C  CD1   . ILE C 1 157 ? -1.971   2.396   -48.759 1.00 38.42  ? 170 ILE C CD1   1 
ATOM   6589  N  N     . ASN C 1 158 ? -5.692   1.466   -52.119 1.00 67.17  ? 171 ASN C N     1 
ATOM   6590  C  CA    . ASN C 1 158 ? -6.951   0.947   -52.639 1.00 67.17  ? 171 ASN C CA    1 
ATOM   6591  C  C     . ASN C 1 158 ? -6.928   -0.578  -52.614 1.00 67.17  ? 171 ASN C C     1 
ATOM   6592  O  O     . ASN C 1 158 ? -7.893   -1.241  -52.998 1.00 67.17  ? 171 ASN C O     1 
ATOM   6593  C  CB    . ASN C 1 158 ? -7.219   1.474   -54.052 1.00 67.17  ? 171 ASN C CB    1 
ATOM   6594  C  CG    . ASN C 1 158 ? -5.943   1.768   -54.816 1.00 67.17  ? 171 ASN C CG    1 
ATOM   6595  O  OD1   . ASN C 1 158 ? -4.893   1.192   -54.536 1.00 67.17  ? 171 ASN C OD1   1 
ATOM   6596  N  ND2   . ASN C 1 158 ? -6.026   2.677   -55.782 1.00 67.17  ? 171 ASN C ND2   1 
ATOM   6597  N  N     . ASN C 1 159 ? -5.808   -1.118  -52.143 1.00 68.88  ? 172 ASN C N     1 
ATOM   6598  C  CA    . ASN C 1 159 ? -5.615   -2.557  -52.024 1.00 68.88  ? 172 ASN C CA    1 
ATOM   6599  C  C     . ASN C 1 159 ? -4.870   -2.893  -50.730 1.00 68.88  ? 172 ASN C C     1 
ATOM   6600  O  O     . ASN C 1 159 ? -4.137   -2.061  -50.198 1.00 68.88  ? 172 ASN C O     1 
ATOM   6601  C  CB    . ASN C 1 159 ? -4.861   -3.082  -53.246 1.00 68.88  ? 172 ASN C CB    1 
ATOM   6602  C  CG    . ASN C 1 159 ? -4.645   -4.579  -53.203 1.00 68.88  ? 172 ASN C CG    1 
ATOM   6603  O  OD1   . ASN C 1 159 ? -5.573   -5.361  -53.408 1.00 68.88  ? 172 ASN C OD1   1 
ATOM   6604  N  ND2   . ASN C 1 159 ? -3.412   -4.986  -52.948 1.00 68.88  ? 172 ASN C ND2   1 
ATOM   6605  N  N     . VAL C 1 160 ? -5.066   -4.107  -50.223 1.00 32.51  ? 173 VAL C N     1 
ATOM   6606  C  CA    . VAL C 1 160 ? -4.498   -4.507  -48.937 1.00 32.51  ? 173 VAL C CA    1 
ATOM   6607  C  C     . VAL C 1 160 ? -2.975   -4.628  -48.975 1.00 32.51  ? 173 VAL C C     1 
ATOM   6608  O  O     . VAL C 1 160 ? -2.302   -4.369  -47.977 1.00 32.51  ? 173 VAL C O     1 
ATOM   6609  C  CB    . VAL C 1 160 ? -5.102   -5.832  -48.451 1.00 32.51  ? 173 VAL C CB    1 
ATOM   6610  C  CG1   . VAL C 1 160 ? -4.894   -5.994  -46.955 1.00 32.51  ? 173 VAL C CG1   1 
ATOM   6611  C  CG2   . VAL C 1 160 ? -6.580   -5.876  -48.782 1.00 32.51  ? 173 VAL C CG2   1 
ATOM   6612  N  N     . ASP C 1 161 ? -2.437   -5.020  -50.126 1.00 57.83  ? 174 ASP C N     1 
ATOM   6613  C  CA    . ASP C 1 161 ? -0.991   -5.133  -50.291 1.00 57.83  ? 174 ASP C CA    1 
ATOM   6614  C  C     . ASP C 1 161 ? -0.322   -3.764  -50.196 1.00 57.83  ? 174 ASP C C     1 
ATOM   6615  O  O     . ASP C 1 161 ? 0.833    -3.660  -49.783 1.00 57.83  ? 174 ASP C O     1 
ATOM   6616  C  CB    . ASP C 1 161 ? -0.641   -5.792  -51.625 1.00 57.83  ? 174 ASP C CB    1 
ATOM   6617  C  CG    . ASP C 1 161 ? -1.340   -7.120  -51.820 1.00 57.83  ? 174 ASP C CG    1 
ATOM   6618  O  OD1   . ASP C 1 161 ? -1.857   -7.363  -52.931 1.00 57.83  ? 174 ASP C OD1   1 
ATOM   6619  O  OD2   . ASP C 1 161 ? -1.370   -7.924  -50.866 1.00 57.83  ? 174 ASP C OD2   1 
ATOM   6620  N  N     . ASP C 1 162 ? -1.050   -2.720  -50.585 1.00 78.98  ? 175 ASP C N     1 
ATOM   6621  C  CA    . ASP C 1 162 ? -0.548   -1.354  -50.476 1.00 78.98  ? 175 ASP C CA    1 
ATOM   6622  C  C     . ASP C 1 162 ? -0.302   -1.005  -49.011 1.00 78.98  ? 175 ASP C C     1 
ATOM   6623  O  O     . ASP C 1 162 ? 0.654    -0.306  -48.680 1.00 78.98  ? 175 ASP C O     1 
ATOM   6624  C  CB    . ASP C 1 162 ? -1.537   -0.362  -51.092 1.00 78.98  ? 175 ASP C CB    1 
ATOM   6625  C  CG    . ASP C 1 162 ? -1.901   -0.706  -52.523 1.00 78.98  ? 175 ASP C CG    1 
ATOM   6626  O  OD1   . ASP C 1 162 ? -1.313   -1.655  -53.081 1.00 78.98  ? 175 ASP C OD1   1 
ATOM   6627  O  OD2   . ASP C 1 162 ? -2.779   -0.022  -53.089 1.00 78.98  ? 175 ASP C OD2   1 
ATOM   6628  N  N     . ILE C 1 163 ? -1.174   -1.504  -48.140 1.00 33.35  ? 176 ILE C N     1 
ATOM   6629  C  CA    . ILE C 1 163 ? -1.036   -1.313  -46.699 1.00 33.35  ? 176 ILE C CA    1 
ATOM   6630  C  C     . ILE C 1 163 ? 0.169    -2.076  -46.149 1.00 33.35  ? 176 ILE C C     1 
ATOM   6631  O  O     . ILE C 1 163 ? 0.923    -1.553  -45.330 1.00 33.35  ? 176 ILE C O     1 
ATOM   6632  C  CB    . ILE C 1 163 ? -2.312   -1.757  -45.951 1.00 33.35  ? 176 ILE C CB    1 
ATOM   6633  C  CG1   . ILE C 1 163 ? -3.515   -0.940  -46.417 1.00 33.35  ? 176 ILE C CG1   1 
ATOM   6634  C  CG2   . ILE C 1 163 ? -2.137   -1.617  -44.450 1.00 33.35  ? 176 ILE C CG2   1 
ATOM   6635  C  CD1   . ILE C 1 163 ? -4.801   -1.275  -45.698 1.00 33.35  ? 176 ILE C CD1   1 
ATOM   6636  N  N     . ILE C 1 164 ? 0.349    -3.308  -46.615 1.00 45.72  ? 177 ILE C N     1 
ATOM   6637  C  CA    . ILE C 1 164 ? 1.427    -4.169  -46.132 1.00 45.72  ? 177 ILE C CA    1 
ATOM   6638  C  C     . ILE C 1 164 ? 2.818    -3.656  -46.508 1.00 45.72  ? 177 ILE C C     1 
ATOM   6639  O  O     . ILE C 1 164 ? 3.659    -3.432  -45.636 1.00 45.72  ? 177 ILE C O     1 
ATOM   6640  C  CB    . ILE C 1 164 ? 1.262    -5.619  -46.627 1.00 45.72  ? 177 ILE C CB    1 
ATOM   6641  C  CG1   . ILE C 1 164 ? -0.044   -6.217  -46.105 1.00 45.72  ? 177 ILE C CG1   1 
ATOM   6642  C  CG2   . ILE C 1 164 ? 2.439    -6.472  -46.187 1.00 45.72  ? 177 ILE C CG2   1 
ATOM   6643  C  CD1   . ILE C 1 164 ? -0.240   -7.671  -46.478 1.00 45.72  ? 177 ILE C CD1   1 
ATOM   6644  N  N     . ASN C 1 165 ? 3.061    -3.468  -47.802 1.00 104.19 ? 178 ASN C N     1 
ATOM   6645  C  CA    . ASN C 1 165 ? 4.370    -3.016  -48.270 1.00 104.19 ? 178 ASN C CA    1 
ATOM   6646  C  C     . ASN C 1 165 ? 4.680    -1.572  -47.873 1.00 104.19 ? 178 ASN C C     1 
ATOM   6647  O  O     . ASN C 1 165 ? 5.809    -1.107  -48.027 1.00 104.19 ? 178 ASN C O     1 
ATOM   6648  C  CB    . ASN C 1 165 ? 4.515    -3.213  -49.784 1.00 104.19 ? 178 ASN C CB    1 
ATOM   6649  C  CG    . ASN C 1 165 ? 3.750    -2.179  -50.588 1.00 104.19 ? 178 ASN C CG    1 
ATOM   6650  O  OD1   . ASN C 1 165 ? 2.730    -1.655  -50.141 1.00 104.19 ? 178 ASN C OD1   1 
ATOM   6651  N  ND2   . ASN C 1 165 ? 4.241    -1.882  -51.785 1.00 104.19 ? 178 ASN C ND2   1 
ATOM   6652  N  N     . LEU C 1 166 ? 3.668    -0.869  -47.371 1.00 48.89  ? 179 LEU C N     1 
ATOM   6653  C  CA    . LEU C 1 166 ? 3.854    0.454   -46.790 1.00 48.89  ? 179 LEU C CA    1 
ATOM   6654  C  C     . LEU C 1 166 ? 4.743    0.300   -45.563 1.00 48.89  ? 179 LEU C C     1 
ATOM   6655  O  O     . LEU C 1 166 ? 5.690    1.061   -45.361 1.00 48.89  ? 179 LEU C O     1 
ATOM   6656  C  CB    . LEU C 1 166 ? 2.500    1.038   -46.374 1.00 48.89  ? 179 LEU C CB    1 
ATOM   6657  C  CG    . LEU C 1 166 ? 2.240    2.548   -46.298 1.00 48.89  ? 179 LEU C CG    1 
ATOM   6658  C  CD1   . LEU C 1 166 ? 0.919    2.811   -45.590 1.00 48.89  ? 179 LEU C CD1   1 
ATOM   6659  C  CD2   . LEU C 1 166 ? 3.362    3.310   -45.619 1.00 48.89  ? 179 LEU C CD2   1 
ATOM   6660  N  N     . THR C 1 167 ? 4.430    -0.704  -44.752 1.00 53.34  ? 180 THR C N     1 
ATOM   6661  C  CA    . THR C 1 167 ? 5.147    -0.961  -43.510 1.00 53.34  ? 180 THR C CA    1 
ATOM   6662  C  C     . THR C 1 167 ? 6.586    -1.417  -43.748 1.00 53.34  ? 180 THR C C     1 
ATOM   6663  O  O     . THR C 1 167 ? 7.407    -1.398  -42.832 1.00 53.34  ? 180 THR C O     1 
ATOM   6664  C  CB    . THR C 1 167 ? 4.420    -2.020  -42.661 1.00 53.34  ? 180 THR C CB    1 
ATOM   6665  O  OG1   . THR C 1 167 ? 4.322    -3.242  -43.401 1.00 53.34  ? 180 THR C OG1   1 
ATOM   6666  C  CG2   . THR C 1 167 ? 3.022    -1.544  -42.297 1.00 53.34  ? 180 THR C CG2   1 
ATOM   6667  N  N     . LYS C 1 168 ? 6.885    -1.826  -44.977 1.00 73.20  ? 181 LYS C N     1 
ATOM   6668  C  CA    . LYS C 1 168 ? 8.223    -2.300  -45.321 1.00 73.20  ? 181 LYS C CA    1 
ATOM   6669  C  C     . LYS C 1 168 ? 9.159    -1.151  -45.688 1.00 73.20  ? 181 LYS C C     1 
ATOM   6670  O  O     . LYS C 1 168 ? 10.320   -1.371  -46.033 1.00 73.20  ? 181 LYS C O     1 
ATOM   6671  C  CB    . LYS C 1 168 ? 8.157    -3.307  -46.471 1.00 73.20  ? 181 LYS C CB    1 
ATOM   6672  C  CG    . LYS C 1 168 ? 7.209    -4.468  -46.227 1.00 73.20  ? 181 LYS C CG    1 
ATOM   6673  C  CD    . LYS C 1 168 ? 7.286    -5.490  -47.349 1.00 73.20  ? 181 LYS C CD    1 
ATOM   6674  C  CE    . LYS C 1 168 ? 6.287    -6.615  -47.136 1.00 73.20  ? 181 LYS C CE    1 
ATOM   6675  N  NZ    . LYS C 1 168 ? 6.466    -7.270  -45.813 1.00 73.20  ? 181 LYS C NZ    1 
ATOM   6676  N  N     . SER C 1 169 ? 8.646    0.074   -45.612 1.00 96.28  ? 182 SER C N     1 
ATOM   6677  C  CA    . SER C 1 169 ? 9.436    1.259   -45.926 1.00 96.28  ? 182 SER C CA    1 
ATOM   6678  C  C     . SER C 1 169 ? 9.185    2.367   -44.907 1.00 96.28  ? 182 SER C C     1 
ATOM   6679  O  O     . SER C 1 169 ? 8.113    2.970   -44.889 1.00 96.28  ? 182 SER C O     1 
ATOM   6680  C  CB    . SER C 1 169 ? 9.117    1.757   -47.337 1.00 96.28  ? 182 SER C CB    1 
ATOM   6681  O  OG    . SER C 1 169 ? 9.846    2.934   -47.640 1.00 96.28  ? 182 SER C OG    1 
ATOM   6682  N  N     . VAL C 1 170 ? 10.183   2.631   -44.068 1.00 42.30  ? 183 VAL C N     1 
ATOM   6683  C  CA    . VAL C 1 170 ? 10.065   3.617   -42.996 1.00 42.30  ? 183 VAL C CA    1 
ATOM   6684  C  C     . VAL C 1 170 ? 9.820    5.026   -43.534 1.00 42.30  ? 183 VAL C C     1 
ATOM   6685  O  O     . VAL C 1 170 ? 9.192    5.851   -42.872 1.00 42.30  ? 183 VAL C O     1 
ATOM   6686  C  CB    . VAL C 1 170 ? 11.329   3.632   -42.114 1.00 42.30  ? 183 VAL C CB    1 
ATOM   6687  C  CG1   . VAL C 1 170 ? 11.029   4.255   -40.759 1.00 42.30  ? 183 VAL C CG1   1 
ATOM   6688  C  CG2   . VAL C 1 170 ? 11.870   2.224   -41.938 1.00 42.30  ? 183 VAL C CG2   1 
ATOM   6689  N  N     . LYS C 1 171 ? 10.313   5.289   -44.740 1.00 129.94 ? 184 LYS C N     1 
ATOM   6690  C  CA    . LYS C 1 171 ? 10.216   6.615   -45.344 1.00 129.94 ? 184 LYS C CA    1 
ATOM   6691  C  C     . LYS C 1 171 ? 8.773    7.011   -45.659 1.00 129.94 ? 184 LYS C C     1 
ATOM   6692  O  O     . LYS C 1 171 ? 8.313    8.078   -45.251 1.00 129.94 ? 184 LYS C O     1 
ATOM   6693  C  CB    . LYS C 1 171 ? 11.078   6.700   -46.609 1.00 129.94 ? 184 LYS C CB    1 
ATOM   6694  C  CG    . LYS C 1 171 ? 12.555   6.386   -46.390 1.00 129.94 ? 184 LYS C CG    1 
ATOM   6695  C  CD    . LYS C 1 171 ? 12.858   4.910   -46.613 1.00 129.94 ? 184 LYS C CD    1 
ATOM   6696  C  CE    . LYS C 1 171 ? 14.234   4.538   -46.083 1.00 129.94 ? 184 LYS C CE    1 
ATOM   6697  N  NZ    . LYS C 1 171 ? 14.329   4.720   -44.608 1.00 129.94 ? 184 LYS C NZ    1 
ATOM   6698  N  N     . ASP C 1 172 ? 8.064    6.153   -46.386 1.00 109.05 ? 185 ASP C N     1 
ATOM   6699  C  CA    . ASP C 1 172 ? 6.666    6.409   -46.718 1.00 109.05 ? 185 ASP C CA    1 
ATOM   6700  C  C     . ASP C 1 172 ? 5.756    6.103   -45.532 1.00 109.05 ? 185 ASP C C     1 
ATOM   6701  O  O     . ASP C 1 172 ? 4.556    6.370   -45.572 1.00 109.05 ? 185 ASP C O     1 
ATOM   6702  C  CB    . ASP C 1 172 ? 6.236    5.595   -47.943 1.00 109.05 ? 185 ASP C CB    1 
ATOM   6703  C  CG    . ASP C 1 172 ? 6.770    6.167   -49.243 1.00 109.05 ? 185 ASP C CG    1 
ATOM   6704  O  OD1   . ASP C 1 172 ? 7.871    6.756   -49.232 1.00 109.05 ? 185 ASP C OD1   1 
ATOM   6705  O  OD2   . ASP C 1 172 ? 6.086    6.027   -50.279 1.00 109.05 ? 185 ASP C OD2   1 
ATOM   6706  N  N     . LEU C 1 173 ? 6.338    5.538   -44.478 1.00 64.66  ? 186 LEU C N     1 
ATOM   6707  C  CA    . LEU C 1 173 ? 5.608    5.262   -43.247 1.00 64.66  ? 186 LEU C CA    1 
ATOM   6708  C  C     . LEU C 1 173 ? 5.668    6.486   -42.338 1.00 64.66  ? 186 LEU C C     1 
ATOM   6709  O  O     . LEU C 1 173 ? 4.825    6.661   -41.458 1.00 64.66  ? 186 LEU C O     1 
ATOM   6710  C  CB    . LEU C 1 173 ? 6.198    4.039   -42.542 1.00 64.66  ? 186 LEU C CB    1 
ATOM   6711  C  CG    . LEU C 1 173 ? 5.370    3.357   -41.453 1.00 64.66  ? 186 LEU C CG    1 
ATOM   6712  C  CD1   . LEU C 1 173 ? 4.007    2.977   -41.989 1.00 64.66  ? 186 LEU C CD1   1 
ATOM   6713  C  CD2   . LEU C 1 173 ? 6.095    2.127   -40.927 1.00 64.66  ? 186 LEU C CD2   1 
ATOM   6714  N  N     . GLU C 1 174 ? 6.672    7.330   -42.563 1.00 51.71  ? 187 GLU C N     1 
ATOM   6715  C  CA    . GLU C 1 174 ? 6.811    8.588   -41.836 1.00 51.71  ? 187 GLU C CA    1 
ATOM   6716  C  C     . GLU C 1 174 ? 5.855    9.638   -42.389 1.00 51.71  ? 187 GLU C C     1 
ATOM   6717  O  O     . GLU C 1 174 ? 5.295    10.436  -41.637 1.00 51.71  ? 187 GLU C O     1 
ATOM   6718  C  CB    . GLU C 1 174 ? 8.249    9.104   -41.915 1.00 51.71  ? 187 GLU C CB    1 
ATOM   6719  C  CG    . GLU C 1 174 ? 9.229    8.411   -40.981 1.00 51.71  ? 187 GLU C CG    1 
ATOM   6720  C  CD    . GLU C 1 174 ? 10.635   8.963   -41.105 1.00 51.71  ? 187 GLU C CD    1 
ATOM   6721  O  OE1   . GLU C 1 174 ? 10.960   9.528   -42.169 1.00 51.71  ? 187 GLU C OE1   1 
ATOM   6722  O  OE2   . GLU C 1 174 ? 11.412   8.836   -40.137 1.00 51.71  ? 187 GLU C OE2   1 
ATOM   6723  N  N     . LYS C 1 175 ? 5.685    9.641   -43.708 1.00 62.54  ? 188 LYS C N     1 
ATOM   6724  C  CA    . LYS C 1 175 ? 4.749    10.548  -44.363 1.00 62.54  ? 188 LYS C CA    1 
ATOM   6725  C  C     . LYS C 1 175 ? 3.327    10.253  -43.905 1.00 62.54  ? 188 LYS C C     1 
ATOM   6726  O  O     . LYS C 1 175 ? 2.517    11.163  -43.731 1.00 62.54  ? 188 LYS C O     1 
ATOM   6727  C  CB    . LYS C 1 175 ? 4.835    10.405  -45.884 1.00 62.54  ? 188 LYS C CB    1 
ATOM   6728  C  CG    . LYS C 1 175 ? 6.121    10.928  -46.505 1.00 62.54  ? 188 LYS C CG    1 
ATOM   6729  C  CD    . LYS C 1 175 ? 6.090    10.774  -48.019 1.00 62.54  ? 188 LYS C CD    1 
ATOM   6730  C  CE    . LYS C 1 175 ? 7.245    11.508  -48.680 1.00 62.54  ? 188 LYS C CE    1 
ATOM   6731  N  NZ    . LYS C 1 175 ? 8.564    11.019  -48.199 1.00 62.54  ? 188 LYS C NZ    1 
ATOM   6732  N  N     . LEU C 1 176 ? 3.042    8.968   -43.716 1.00 55.66  ? 189 LEU C N     1 
ATOM   6733  C  CA    . LEU C 1 176 ? 1.733    8.500   -43.273 1.00 55.66  ? 189 LEU C CA    1 
ATOM   6734  C  C     . LEU C 1 176 ? 1.302    9.163   -41.972 1.00 55.66  ? 189 LEU C C     1 
ATOM   6735  O  O     . LEU C 1 176 ? 0.144    9.553   -41.816 1.00 55.66  ? 189 LEU C O     1 
ATOM   6736  C  CB    . LEU C 1 176 ? 1.754    6.982   -43.098 1.00 55.66  ? 189 LEU C CB    1 
ATOM   6737  C  CG    . LEU C 1 176 ? 0.496    6.346   -42.510 1.00 55.66  ? 189 LEU C CG    1 
ATOM   6738  C  CD1   . LEU C 1 176 ? -0.684   6.558   -43.436 1.00 55.66  ? 189 LEU C CD1   1 
ATOM   6739  C  CD2   . LEU C 1 176 ? 0.716    4.868   -42.252 1.00 55.66  ? 189 LEU C CD2   1 
ATOM   6740  N  N     . ASP C 1 177 ? 2.242    9.289   -41.041 1.00 53.85  ? 190 ASP C N     1 
ATOM   6741  C  CA    . ASP C 1 177 ? 1.967    9.925   -39.761 1.00 53.85  ? 190 ASP C CA    1 
ATOM   6742  C  C     . ASP C 1 177 ? 1.662    11.411  -39.935 1.00 53.85  ? 190 ASP C C     1 
ATOM   6743  O  O     . ASP C 1 177 ? 0.570    11.863  -39.598 1.00 53.85  ? 190 ASP C O     1 
ATOM   6744  C  CB    . ASP C 1 177 ? 3.136    9.722   -38.797 1.00 53.85  ? 190 ASP C CB    1 
ATOM   6745  C  CG    . ASP C 1 177 ? 3.290    8.277   -38.366 1.00 53.85  ? 190 ASP C CG    1 
ATOM   6746  O  OD1   . ASP C 1 177 ? 2.258    7.602   -38.172 1.00 53.85  ? 190 ASP C OD1   1 
ATOM   6747  O  OD2   . ASP C 1 177 ? 4.442    7.815   -38.225 1.00 53.85  ? 190 ASP C OD2   1 
ATOM   6748  N  N     . LYS C 1 178 ? 2.623    12.156  -40.478 1.00 65.23  ? 191 LYS C N     1 
ATOM   6749  C  CA    . LYS C 1 178 ? 2.479    13.598  -40.680 1.00 65.23  ? 191 LYS C CA    1 
ATOM   6750  C  C     . LYS C 1 178 ? 1.192    13.962  -41.420 1.00 65.23  ? 191 LYS C C     1 
ATOM   6751  O  O     . LYS C 1 178 ? 0.565    14.980  -41.128 1.00 65.23  ? 191 LYS C O     1 
ATOM   6752  C  CB    . LYS C 1 178 ? 3.692    14.160  -41.428 1.00 65.23  ? 191 LYS C CB    1 
ATOM   6753  C  CG    . LYS C 1 178 ? 3.638    15.664  -41.657 1.00 65.23  ? 191 LYS C CG    1 
ATOM   6754  C  CD    . LYS C 1 178 ? 4.868    16.166  -42.394 1.00 65.23  ? 191 LYS C CD    1 
ATOM   6755  C  CE    . LYS C 1 178 ? 4.794    17.668  -42.629 1.00 65.23  ? 191 LYS C CE    1 
ATOM   6756  N  NZ    . LYS C 1 178 ? 4.639    18.421  -41.354 1.00 65.23  ? 191 LYS C NZ    1 
ATOM   6757  N  N     . ALA C 1 179 ? 0.797    13.120  -42.368 1.00 37.28  ? 192 ALA C N     1 
ATOM   6758  C  CA    . ALA C 1 179 ? -0.450   13.322  -43.094 1.00 37.28  ? 192 ALA C CA    1 
ATOM   6759  C  C     . ALA C 1 179 ? -1.654   13.171  -42.169 1.00 37.28  ? 192 ALA C C     1 
ATOM   6760  O  O     . ALA C 1 179 ? -2.491   14.067  -42.076 1.00 37.28  ? 192 ALA C O     1 
ATOM   6761  C  CB    . ALA C 1 179 ? -0.549   12.351  -44.258 1.00 37.28  ? 192 ALA C CB    1 
ATOM   6762  N  N     . LEU C 1 180 ? -1.732   12.036  -41.480 1.00 34.03  ? 193 LEU C N     1 
ATOM   6763  C  CA    . LEU C 1 180 ? -2.895   11.720  -40.652 1.00 34.03  ? 193 LEU C CA    1 
ATOM   6764  C  C     . LEU C 1 180 ? -2.891   12.407  -39.283 1.00 34.03  ? 193 LEU C C     1 
ATOM   6765  O  O     . LEU C 1 180 ? -3.948   12.600  -38.682 1.00 34.03  ? 193 LEU C O     1 
ATOM   6766  C  CB    . LEU C 1 180 ? -3.051   10.205  -40.497 1.00 34.03  ? 193 LEU C CB    1 
ATOM   6767  C  CG    . LEU C 1 180 ? -3.317   9.440   -41.796 1.00 34.03  ? 193 LEU C CG    1 
ATOM   6768  C  CD1   . LEU C 1 180 ? -3.496   7.953   -41.538 1.00 34.03  ? 193 LEU C CD1   1 
ATOM   6769  C  CD2   . LEU C 1 180 ? -4.532   10.005  -42.513 1.00 34.03  ? 193 LEU C CD2   1 
ATOM   6770  N  N     . ASN C 1 181 ? -1.711   12.776  -38.793 1.00 59.36  ? 194 ASN C N     1 
ATOM   6771  C  CA    . ASN C 1 181 ? -1.616   13.503  -37.531 1.00 59.36  ? 194 ASN C CA    1 
ATOM   6772  C  C     . ASN C 1 181 ? -2.161   14.921  -37.658 1.00 59.36  ? 194 ASN C C     1 
ATOM   6773  O  O     . ASN C 1 181 ? -2.460   15.575  -36.659 1.00 59.36  ? 194 ASN C O     1 
ATOM   6774  C  CB    . ASN C 1 181 ? -0.175   13.535  -37.021 1.00 59.36  ? 194 ASN C CB    1 
ATOM   6775  C  CG    . ASN C 1 181 ? 0.355    12.157  -36.679 1.00 59.36  ? 194 ASN C CG    1 
ATOM   6776  O  OD1   . ASN C 1 181 ? -0.411   11.215  -36.485 1.00 59.36  ? 194 ASN C OD1   1 
ATOM   6777  N  ND2   . ASN C 1 181 ? 1.675    12.034  -36.601 1.00 59.36  ? 194 ASN C ND2   1 
ATOM   6778  N  N     . SER C 1 182 ? -2.290   15.388  -38.895 1.00 41.99  ? 195 SER C N     1 
ATOM   6779  C  CA    . SER C 1 182 ? -2.842   16.710  -39.170 1.00 41.99  ? 195 SER C CA    1 
ATOM   6780  C  C     . SER C 1 182 ? -4.366   16.704  -39.100 1.00 41.99  ? 195 SER C C     1 
ATOM   6781  O  O     . SER C 1 182 ? -5.009   17.729  -39.324 1.00 41.99  ? 195 SER C O     1 
ATOM   6782  C  CB    . SER C 1 182 ? -2.379   17.210  -40.540 1.00 41.99  ? 195 SER C CB    1 
ATOM   6783  O  OG    . SER C 1 182 ? -2.722   16.295  -41.565 1.00 41.99  ? 195 SER C OG    1 
ATOM   6784  N  N     . ILE C 1 183 ? -4.937   15.544  -38.791 1.00 40.54  ? 196 ILE C N     1 
ATOM   6785  C  CA    . ILE C 1 183 ? -6.375   15.421  -38.593 1.00 40.54  ? 196 ILE C CA    1 
ATOM   6786  C  C     . ILE C 1 183 ? -6.684   15.501  -37.103 1.00 40.54  ? 196 ILE C C     1 
ATOM   6787  O  O     . ILE C 1 183 ? -6.328   14.596  -36.348 1.00 40.54  ? 196 ILE C O     1 
ATOM   6788  C  CB    . ILE C 1 183 ? -6.913   14.095  -39.153 1.00 40.54  ? 196 ILE C CB    1 
ATOM   6789  C  CG1   . ILE C 1 183 ? -6.465   13.905  -40.602 1.00 40.54  ? 196 ILE C CG1   1 
ATOM   6790  C  CG2   . ILE C 1 183 ? -8.429   14.046  -39.052 1.00 40.54  ? 196 ILE C CG2   1 
ATOM   6791  C  CD1   . ILE C 1 183 ? -6.834   12.558  -41.184 1.00 40.54  ? 196 ILE C CD1   1 
ATOM   6792  N  N     . PRO C 1 184 ? -7.343   16.593  -36.679 1.00 37.91  ? 197 PRO C N     1 
ATOM   6793  C  CA    . PRO C 1 184 ? -7.671   16.862  -35.274 1.00 37.91  ? 197 PRO C CA    1 
ATOM   6794  C  C     . PRO C 1 184 ? -8.358   15.690  -34.580 1.00 37.91  ? 197 PRO C C     1 
ATOM   6795  O  O     . PRO C 1 184 ? -9.060   14.911  -35.223 1.00 37.91  ? 197 PRO C O     1 
ATOM   6796  C  CB    . PRO C 1 184 ? -8.638   18.042  -35.369 1.00 37.91  ? 197 PRO C CB    1 
ATOM   6797  C  CG    . PRO C 1 184 ? -8.229   18.753  -36.605 1.00 37.91  ? 197 PRO C CG    1 
ATOM   6798  C  CD    . PRO C 1 184 ? -7.801   17.678  -37.566 1.00 37.91  ? 197 PRO C CD    1 
ATOM   6799  N  N     . THR C 1 185 ? -8.143   15.573  -33.274 1.00 44.79  ? 198 THR C N     1 
ATOM   6800  C  CA    . THR C 1 185 ? -8.774   14.529  -32.481 1.00 44.79  ? 198 THR C CA    1 
ATOM   6801  C  C     . THR C 1 185 ? -10.247  14.851  -32.293 1.00 44.79  ? 198 THR C C     1 
ATOM   6802  O  O     . THR C 1 185 ? -11.089  13.957  -32.223 1.00 44.79  ? 198 THR C O     1 
ATOM   6803  C  CB    . THR C 1 185 ? -8.121   14.408  -31.094 1.00 44.79  ? 198 THR C CB    1 
ATOM   6804  O  OG1   . THR C 1 185 ? -8.171   15.677  -30.430 1.00 44.79  ? 198 THR C OG1   1 
ATOM   6805  C  CG2   . THR C 1 185 ? -6.674   13.964  -31.217 1.00 44.79  ? 198 THR C CG2   1 
ATOM   6806  N  N     . GLU C 1 186 ? -10.546  16.142  -32.212 1.00 80.44  ? 199 GLU C N     1 
ATOM   6807  C  CA    . GLU C 1 186 ? -11.906  16.606  -31.989 1.00 80.44  ? 199 GLU C CA    1 
ATOM   6808  C  C     . GLU C 1 186 ? -12.129  17.896  -32.765 1.00 80.44  ? 199 GLU C C     1 
ATOM   6809  O  O     . GLU C 1 186 ? -11.174  18.519  -33.229 1.00 80.44  ? 199 GLU C O     1 
ATOM   6810  C  CB    . GLU C 1 186 ? -12.140  16.839  -30.498 1.00 80.44  ? 199 GLU C CB    1 
ATOM   6811  C  CG    . GLU C 1 186 ? -13.557  16.561  -30.029 1.00 80.44  ? 199 GLU C CG    1 
ATOM   6812  C  CD    . GLU C 1 186 ? -13.611  16.190  -28.559 1.00 80.44  ? 199 GLU C CD    1 
ATOM   6813  O  OE1   . GLU C 1 186 ? -12.534  16.077  -27.937 1.00 80.44  ? 199 GLU C OE1   1 
ATOM   6814  O  OE2   . GLU C 1 186 ? -14.727  16.007  -28.028 1.00 80.44  ? 199 GLU C OE2   1 
ATOM   6815  N  N     . LEU C 1 187 ? -13.389  18.293  -32.908 1.00 71.27  ? 200 LEU C N     1 
ATOM   6816  C  CA    . LEU C 1 187 ? -13.718  19.515  -33.632 1.00 71.27  ? 200 LEU C CA    1 
ATOM   6817  C  C     . LEU C 1 187 ? -14.861  20.253  -32.946 1.00 71.27  ? 200 LEU C C     1 
ATOM   6818  O  O     . LEU C 1 187 ? -15.995  19.776  -32.924 1.00 71.27  ? 200 LEU C O     1 
ATOM   6819  C  CB    . LEU C 1 187 ? -14.089  19.195  -35.082 1.00 71.27  ? 200 LEU C CB    1 
ATOM   6820  C  CG    . LEU C 1 187 ? -13.409  20.029  -36.170 1.00 71.27  ? 200 LEU C CG    1 
ATOM   6821  C  CD1   . LEU C 1 187 ? -11.910  19.786  -36.180 1.00 71.27  ? 200 LEU C CD1   1 
ATOM   6822  C  CD2   . LEU C 1 187 ? -14.007  19.731  -37.536 1.00 71.27  ? 200 LEU C CD2   1 
ATOM   6823  N  N     . LYS C 1 188 ? -14.557  21.417  -32.380 1.00 99.63  ? 201 LYS C N     1 
ATOM   6824  C  CA    . LYS C 1 188 ? -15.567  22.219  -31.702 1.00 99.63  ? 201 LYS C CA    1 
ATOM   6825  C  C     . LYS C 1 188 ? -15.993  23.384  -32.587 1.00 99.63  ? 201 LYS C C     1 
ATOM   6826  O  O     . LYS C 1 188 ? -15.167  23.982  -33.277 1.00 99.63  ? 201 LYS C O     1 
ATOM   6827  C  CB    . LYS C 1 188 ? -15.039  22.724  -30.359 1.00 99.63  ? 201 LYS C CB    1 
ATOM   6828  C  CG    . LYS C 1 188 ? -14.343  21.649  -29.536 1.00 99.63  ? 201 LYS C CG    1 
ATOM   6829  C  CD    . LYS C 1 188 ? -14.685  21.759  -28.060 1.00 99.63  ? 201 LYS C CD    1 
ATOM   6830  C  CE    . LYS C 1 188 ? -16.163  21.499  -27.819 1.00 99.63  ? 201 LYS C CE    1 
ATOM   6831  N  NZ    . LYS C 1 188 ? -16.591  20.181  -28.365 1.00 99.63  ? 201 LYS C NZ    1 
ATOM   6832  N  N     . GLY C 1 189 ? -17.285  23.698  -32.567 1.00 87.41  ? 202 GLY C N     1 
ATOM   6833  C  CA    . GLY C 1 189 ? -17.834  24.734  -33.424 1.00 87.41  ? 202 GLY C CA    1 
ATOM   6834  C  C     . GLY C 1 189 ? -17.330  26.130  -33.110 1.00 87.41  ? 202 GLY C C     1 
ATOM   6835  O  O     . GLY C 1 189 ? -16.611  26.342  -32.133 1.00 87.41  ? 202 GLY C O     1 
ATOM   6836  N  N     . ALA C 1 190 ? -17.710  27.089  -33.948 1.00 122.89 ? 203 ALA C N     1 
ATOM   6837  C  CA    . ALA C 1 190 ? -17.315  28.478  -33.752 1.00 122.89 ? 203 ALA C CA    1 
ATOM   6838  C  C     . ALA C 1 190 ? -18.210  29.154  -32.718 1.00 122.89 ? 203 ALA C C     1 
ATOM   6839  O  O     . ALA C 1 190 ? -18.007  30.317  -32.372 1.00 122.89 ? 203 ALA C O     1 
ATOM   6840  C  CB    . ALA C 1 190 ? -17.354  29.235  -35.070 1.00 122.89 ? 203 ALA C CB    1 
ATOM   6841  N  N     . LYS C 1 191 ? -19.202  28.415  -32.233 1.00 98.43  ? 204 LYS C N     1 
ATOM   6842  C  CA    . LYS C 1 191 ? -20.095  28.916  -31.198 1.00 98.43  ? 204 LYS C CA    1 
ATOM   6843  C  C     . LYS C 1 191 ? -19.984  28.060  -29.942 1.00 98.43  ? 204 LYS C C     1 
ATOM   6844  O  O     . LYS C 1 191 ? -20.916  27.993  -29.141 1.00 98.43  ? 204 LYS C O     1 
ATOM   6845  C  CB    . LYS C 1 191 ? -21.540  28.939  -31.700 1.00 98.43  ? 204 LYS C CB    1 
ATOM   6846  C  CG    . LYS C 1 191 ? -22.239  30.271  -31.488 1.00 98.43  ? 204 LYS C CG    1 
ATOM   6847  C  CD    . LYS C 1 191 ? -21.442  31.406  -32.116 1.00 98.43  ? 204 LYS C CD    1 
ATOM   6848  C  CE    . LYS C 1 191 ? -22.005  32.765  -31.737 1.00 98.43  ? 204 LYS C CE    1 
ATOM   6849  N  NZ    . LYS C 1 191 ? -21.175  33.874  -32.284 1.00 98.43  ? 204 LYS C NZ    1 
ATOM   6850  N  N     . GLY C 1 192 ? -18.837  27.408  -29.778 1.00 76.95  ? 205 GLY C N     1 
ATOM   6851  C  CA    . GLY C 1 192 ? -18.597  26.552  -28.630 1.00 76.95  ? 205 GLY C CA    1 
ATOM   6852  C  C     . GLY C 1 192 ? -19.441  25.294  -28.669 1.00 76.95  ? 205 GLY C C     1 
ATOM   6853  O  O     . GLY C 1 192 ? -19.907  24.813  -27.635 1.00 76.95  ? 205 GLY C O     1 
ATOM   6854  N  N     . GLU C 1 193 ? -19.631  24.756  -29.869 1.00 114.74 ? 206 GLU C N     1 
ATOM   6855  C  CA    . GLU C 1 193 ? -20.503  23.604  -30.072 1.00 114.74 ? 206 GLU C CA    1 
ATOM   6856  C  C     . GLU C 1 193 ? -19.712  22.306  -30.195 1.00 114.74 ? 206 GLU C C     1 
ATOM   6857  O  O     . GLU C 1 193 ? -18.491  22.290  -30.038 1.00 114.74 ? 206 GLU C O     1 
ATOM   6858  C  CB    . GLU C 1 193 ? -21.352  23.811  -31.325 1.00 114.74 ? 206 GLU C CB    1 
ATOM   6859  C  CG    . GLU C 1 193 ? -22.126  25.119  -31.340 1.00 114.74 ? 206 GLU C CG    1 
ATOM   6860  C  CD    . GLU C 1 193 ? -22.563  25.519  -32.735 1.00 114.74 ? 206 GLU C CD    1 
ATOM   6861  O  OE1   . GLU C 1 193 ? -21.994  24.989  -33.712 1.00 114.74 ? 206 GLU C OE1   1 
ATOM   6862  O  OE2   . GLU C 1 193 ? -23.475  26.364  -32.854 1.00 114.74 ? 206 GLU C OE2   1 
ATOM   6863  N  N     . GLN C 1 194 ? -20.421  21.218  -30.479 1.00 117.60 ? 207 GLN C N     1 
ATOM   6864  C  CA    . GLN C 1 194 ? -19.797  19.917  -30.689 1.00 117.60 ? 207 GLN C CA    1 
ATOM   6865  C  C     . GLN C 1 194 ? -20.102  19.419  -32.097 1.00 117.60 ? 207 GLN C C     1 
ATOM   6866  O  O     . GLN C 1 194 ? -21.260  19.386  -32.510 1.00 117.60 ? 207 GLN C O     1 
ATOM   6867  C  CB    . GLN C 1 194 ? -20.298  18.911  -29.649 1.00 117.60 ? 207 GLN C CB    1 
ATOM   6868  C  CG    . GLN C 1 194 ? -19.916  17.461  -29.925 1.00 117.60 ? 207 GLN C CG    1 
ATOM   6869  C  CD    . GLN C 1 194 ? -18.468  17.145  -29.588 1.00 117.60 ? 207 GLN C CD    1 
ATOM   6870  O  OE1   . GLN C 1 194 ? -17.663  18.041  -29.335 1.00 117.60 ? 207 GLN C OE1   1 
ATOM   6871  N  NE2   . GLN C 1 194 ? -18.134  15.860  -29.577 1.00 117.60 ? 207 GLN C NE2   1 
ATOM   6872  N  N     . LEU C 1 195 ? -19.065  19.034  -32.834 1.00 80.55  ? 208 LEU C N     1 
ATOM   6873  C  CA    . LEU C 1 195 ? -19.240  18.615  -34.221 1.00 80.55  ? 208 LEU C CA    1 
ATOM   6874  C  C     . LEU C 1 195 ? -19.100  17.107  -34.402 1.00 80.55  ? 208 LEU C C     1 
ATOM   6875  O  O     . LEU C 1 195 ? -18.778  16.381  -33.461 1.00 80.55  ? 208 LEU C O     1 
ATOM   6876  C  CB    . LEU C 1 195 ? -18.251  19.345  -35.133 1.00 80.55  ? 208 LEU C CB    1 
ATOM   6877  C  CG    . LEU C 1 195 ? -18.330  20.871  -35.138 1.00 80.55  ? 208 LEU C CG    1 
ATOM   6878  C  CD1   . LEU C 1 195 ? -17.447  21.454  -36.231 1.00 80.55  ? 208 LEU C CD1   1 
ATOM   6879  C  CD2   . LEU C 1 195 ? -19.770  21.333  -35.303 1.00 80.55  ? 208 LEU C CD2   1 
ATOM   6880  N  N     . GLU C 1 196 ? -19.356  16.647  -35.622 1.00 47.91  ? 209 GLU C N     1 
ATOM   6881  C  CA    . GLU C 1 196 ? -19.194  15.245  -35.975 1.00 47.91  ? 209 GLU C CA    1 
ATOM   6882  C  C     . GLU C 1 196 ? -17.705  14.933  -36.073 1.00 47.91  ? 209 GLU C C     1 
ATOM   6883  O  O     . GLU C 1 196 ? -16.954  15.673  -36.710 1.00 47.91  ? 209 GLU C O     1 
ATOM   6884  C  CB    . GLU C 1 196 ? -19.888  14.963  -37.308 1.00 47.91  ? 209 GLU C CB    1 
ATOM   6885  C  CG    . GLU C 1 196 ? -20.750  13.711  -37.325 1.00 47.91  ? 209 GLU C CG    1 
ATOM   6886  C  CD    . GLU C 1 196 ? -19.936  12.450  -37.498 1.00 47.91  ? 209 GLU C CD    1 
ATOM   6887  O  OE1   . GLU C 1 196 ? -18.778  12.555  -37.945 1.00 47.91  ? 209 GLU C OE1   1 
ATOM   6888  O  OE2   . GLU C 1 196 ? -20.452  11.357  -37.187 1.00 47.91  ? 209 GLU C OE2   1 
ATOM   6889  N  N     . ASN C 1 197 ? -17.283  13.849  -35.427 1.00 49.88  ? 210 ASN C N     1 
ATOM   6890  C  CA    . ASN C 1 197 ? -15.879  13.449  -35.414 1.00 49.88  ? 210 ASN C CA    1 
ATOM   6891  C  C     . ASN C 1 197 ? -15.352  13.198  -36.821 1.00 49.88  ? 210 ASN C C     1 
ATOM   6892  O  O     . ASN C 1 197 ? -15.833  12.304  -37.514 1.00 49.88  ? 210 ASN C O     1 
ATOM   6893  C  CB    . ASN C 1 197 ? -15.692  12.198  -34.551 1.00 49.88  ? 210 ASN C CB    1 
ATOM   6894  C  CG    . ASN C 1 197 ? -14.233  11.808  -34.384 1.00 49.88  ? 210 ASN C CG    1 
ATOM   6895  O  OD1   . ASN C 1 197 ? -13.341  12.654  -34.418 1.00 49.88  ? 210 ASN C OD1   1 
ATOM   6896  N  ND2   . ASN C 1 197 ? -13.986  10.518  -34.198 1.00 49.88  ? 210 ASN C ND2   1 
ATOM   6897  N  N     . PRO C 1 198 ? -14.353  13.990  -37.242 1.00 47.07  ? 211 PRO C N     1 
ATOM   6898  C  CA    . PRO C 1 198 ? -13.754  13.907  -38.580 1.00 47.07  ? 211 PRO C CA    1 
ATOM   6899  C  C     . PRO C 1 198 ? -13.194  12.523  -38.909 1.00 47.07  ? 211 PRO C C     1 
ATOM   6900  O  O     . PRO C 1 198 ? -12.954  12.229  -40.081 1.00 47.07  ? 211 PRO C O     1 
ATOM   6901  C  CB    . PRO C 1 198 ? -12.617  14.938  -38.520 1.00 47.07  ? 211 PRO C CB    1 
ATOM   6902  C  CG    . PRO C 1 198 ? -12.380  15.184  -37.061 1.00 47.07  ? 211 PRO C CG    1 
ATOM   6903  C  CD    . PRO C 1 198 ? -13.722  15.041  -36.428 1.00 47.07  ? 211 PRO C CD    1 
ATOM   6904  N  N     . ARG C 1 199 ? -12.993  11.692  -37.891 1.00 25.05  ? 212 ARG C N     1 
ATOM   6905  C  CA    . ARG C 1 199 ? -12.498  10.335  -38.093 1.00 25.05  ? 212 ARG C CA    1 
ATOM   6906  C  C     . ARG C 1 199 ? -13.635  9.327   -38.200 1.00 25.05  ? 212 ARG C C     1 
ATOM   6907  O  O     . ARG C 1 199 ? -14.774  9.617   -37.837 1.00 25.05  ? 212 ARG C O     1 
ATOM   6908  C  CB    . ARG C 1 199 ? -11.556  9.928   -36.958 1.00 25.05  ? 212 ARG C CB    1 
ATOM   6909  C  CG    . ARG C 1 199 ? -10.139  10.462  -37.096 1.00 25.05  ? 212 ARG C CG    1 
ATOM   6910  C  CD    . ARG C 1 199 ? -9.188   9.765   -36.136 1.00 25.05  ? 212 ARG C CD    1 
ATOM   6911  N  NE    . ARG C 1 199 ? -7.802   9.849   -36.589 1.00 25.05  ? 212 ARG C NE    1 
ATOM   6912  C  CZ    . ARG C 1 199 ? -6.995   10.875  -36.342 1.00 25.05  ? 212 ARG C CZ    1 
ATOM   6913  N  NH1   . ARG C 1 199 ? -7.431   11.913  -35.642 1.00 25.05  ? 212 ARG C NH1   1 
ATOM   6914  N  NH2   . ARG C 1 199 ? -5.751   10.864  -36.795 1.00 25.05  ? 212 ARG C NH2   1 
ATOM   6915  N  N     . LEU C 1 200 ? -13.313  8.141   -38.706 1.00 32.26  ? 213 LEU C N     1 
ATOM   6916  C  CA    . LEU C 1 200 ? -14.274  7.054   -38.788 1.00 32.26  ? 213 LEU C CA    1 
ATOM   6917  C  C     . LEU C 1 200 ? -14.593  6.557   -37.385 1.00 32.26  ? 213 LEU C C     1 
ATOM   6918  O  O     . LEU C 1 200 ? -13.706  6.101   -36.664 1.00 32.26  ? 213 LEU C O     1 
ATOM   6919  C  CB    . LEU C 1 200 ? -13.714  5.914   -39.637 1.00 32.26  ? 213 LEU C CB    1 
ATOM   6920  C  CG    . LEU C 1 200 ? -13.322  6.283   -41.068 1.00 32.26  ? 213 LEU C CG    1 
ATOM   6921  C  CD1   . LEU C 1 200 ? -12.648  5.114   -41.764 1.00 32.26  ? 213 LEU C CD1   1 
ATOM   6922  C  CD2   . LEU C 1 200 ? -14.538  6.745   -41.853 1.00 32.26  ? 213 LEU C CD2   1 
ATOM   6923  N  N     . THR C 1 201 ? -15.862  6.649   -36.999 1.00 30.88  ? 214 THR C N     1 
ATOM   6924  C  CA    . THR C 1 201 ? -16.279  6.292   -35.648 1.00 30.88  ? 214 THR C CA    1 
ATOM   6925  C  C     . THR C 1 201 ? -16.940  4.919   -35.591 1.00 30.88  ? 214 THR C C     1 
ATOM   6926  O  O     . THR C 1 201 ? -17.146  4.275   -36.619 1.00 30.88  ? 214 THR C O     1 
ATOM   6927  C  CB    . THR C 1 201 ? -17.263  7.325   -35.077 1.00 30.88  ? 214 THR C CB    1 
ATOM   6928  O  OG1   . THR C 1 201 ? -18.582  7.058   -35.570 1.00 30.88  ? 214 THR C OG1   1 
ATOM   6929  C  CG2   . THR C 1 201 ? -16.851  8.733   -35.468 1.00 30.88  ? 214 THR C CG2   1 
ATOM   6930  N  N     . LEU C 1 202 ? -17.266  4.475   -34.381 1.00 52.48  ? 215 LEU C N     1 
ATOM   6931  C  CA    . LEU C 1 202 ? -18.016  3.240   -34.202 1.00 52.48  ? 215 LEU C CA    1 
ATOM   6932  C  C     . LEU C 1 202 ? -19.405  3.391   -34.811 1.00 52.48  ? 215 LEU C C     1 
ATOM   6933  O  O     . LEU C 1 202 ? -19.953  2.445   -35.375 1.00 52.48  ? 215 LEU C O     1 
ATOM   6934  C  CB    . LEU C 1 202 ? -18.135  2.879   -32.719 1.00 52.48  ? 215 LEU C CB    1 
ATOM   6935  C  CG    . LEU C 1 202 ? -17.013  2.064   -32.071 1.00 52.48  ? 215 LEU C CG    1 
ATOM   6936  C  CD1   . LEU C 1 202 ? -16.630  0.890   -32.956 1.00 52.48  ? 215 LEU C CD1   1 
ATOM   6937  C  CD2   . LEU C 1 202 ? -15.799  2.918   -31.753 1.00 52.48  ? 215 LEU C CD2   1 
ATOM   6938  N  N     . GLY C 1 203 ? -19.962  4.593   -34.697 1.00 35.49  ? 216 GLY C N     1 
ATOM   6939  C  CA    . GLY C 1 203 ? -21.280  4.883   -35.232 1.00 35.49  ? 216 GLY C CA    1 
ATOM   6940  C  C     . GLY C 1 203 ? -21.322  4.867   -36.749 1.00 35.49  ? 216 GLY C C     1 
ATOM   6941  O  O     . GLY C 1 203 ? -22.370  4.608   -37.342 1.00 35.49  ? 216 GLY C O     1 
ATOM   6942  N  N     . ASP C 1 204 ? -20.183  5.142   -37.378 1.00 31.25  ? 217 ASP C N     1 
ATOM   6943  C  CA    . ASP C 1 204 ? -20.100  5.145   -38.834 1.00 31.25  ? 217 ASP C CA    1 
ATOM   6944  C  C     . ASP C 1 204 ? -20.201  3.730   -39.395 1.00 31.25  ? 217 ASP C C     1 
ATOM   6945  O  O     . ASP C 1 204 ? -20.499  3.538   -40.573 1.00 31.25  ? 217 ASP C O     1 
ATOM   6946  C  CB    . ASP C 1 204 ? -18.812  5.819   -39.306 1.00 31.25  ? 217 ASP C CB    1 
ATOM   6947  C  CG    . ASP C 1 204 ? -18.769  7.295   -38.969 1.00 31.25  ? 217 ASP C CG    1 
ATOM   6948  O  OD1   . ASP C 1 204 ? -19.838  7.874   -38.690 1.00 31.25  ? 217 ASP C OD1   1 
ATOM   6949  O  OD2   . ASP C 1 204 ? -17.664  7.875   -38.991 1.00 31.25  ? 217 ASP C OD2   1 
ATOM   6950  N  N     . LEU C 1 205 ? -19.944  2.741   -38.545 1.00 28.82  ? 218 LEU C N     1 
ATOM   6951  C  CA    . LEU C 1 205 ? -20.145  1.348   -38.920 1.00 28.82  ? 218 LEU C CA    1 
ATOM   6952  C  C     . LEU C 1 205 ? -21.640  1.061   -38.998 1.00 28.82  ? 218 LEU C C     1 
ATOM   6953  O  O     . LEU C 1 205 ? -22.088  0.258   -39.815 1.00 28.82  ? 218 LEU C O     1 
ATOM   6954  C  CB    . LEU C 1 205 ? -19.461  0.414   -37.921 1.00 28.82  ? 218 LEU C CB    1 
ATOM   6955  C  CG    . LEU C 1 205 ? -18.168  -0.262  -38.382 1.00 28.82  ? 218 LEU C CG    1 
ATOM   6956  C  CD1   . LEU C 1 205 ? -17.338  0.683   -39.222 1.00 28.82  ? 218 LEU C CD1   1 
ATOM   6957  C  CD2   . LEU C 1 205 ? -17.360  -0.750  -37.191 1.00 28.82  ? 218 LEU C CD2   1 
ATOM   6958  N  N     . GLY C 1 206 ? -22.411  1.733   -38.148 1.00 55.95  ? 219 GLY C N     1 
ATOM   6959  C  CA    . GLY C 1 206 ? -23.858  1.643   -38.201 1.00 55.95  ? 219 GLY C CA    1 
ATOM   6960  C  C     . GLY C 1 206 ? -24.408  2.397   -39.399 1.00 55.95  ? 219 GLY C C     1 
ATOM   6961  O  O     . GLY C 1 206 ? -25.389  1.975   -40.009 1.00 55.95  ? 219 GLY C O     1 
ATOM   6962  N  N     . ARG C 1 207 ? -23.769  3.516   -39.731 1.00 24.93  ? 220 ARG C N     1 
ATOM   6963  C  CA    . ARG C 1 207 ? -24.150  4.318   -40.887 1.00 24.93  ? 220 ARG C CA    1 
ATOM   6964  C  C     . ARG C 1 207 ? -23.898  3.561   -42.184 1.00 24.93  ? 220 ARG C C     1 
ATOM   6965  O  O     . ARG C 1 207 ? -24.641  3.704   -43.156 1.00 24.93  ? 220 ARG C O     1 
ATOM   6966  C  CB    . ARG C 1 207 ? -23.371  5.633   -40.912 1.00 24.93  ? 220 ARG C CB    1 
ATOM   6967  C  CG    . ARG C 1 207 ? -23.842  6.684   -39.922 1.00 24.93  ? 220 ARG C CG    1 
ATOM   6968  C  CD    . ARG C 1 207 ? -23.245  8.042   -40.258 1.00 24.93  ? 220 ARG C CD    1 
ATOM   6969  N  NE    . ARG C 1 207 ? -23.918  9.136   -39.567 1.00 24.93  ? 220 ARG C NE    1 
ATOM   6970  C  CZ    . ARG C 1 207 ? -23.382  9.836   -38.573 1.00 24.93  ? 220 ARG C CZ    1 
ATOM   6971  N  NH1   . ARG C 1 207 ? -22.156  9.560   -38.152 1.00 24.93  ? 220 ARG C NH1   1 
ATOM   6972  N  NH2   . ARG C 1 207 ? -24.070  10.816  -38.003 1.00 24.93  ? 220 ARG C NH2   1 
ATOM   6973  N  N     . LEU C 1 208 ? -22.838  2.761   -42.195 1.00 29.84  ? 221 LEU C N     1 
ATOM   6974  C  CA    . LEU C 1 208 ? -22.471  1.999   -43.380 1.00 29.84  ? 221 LEU C CA    1 
ATOM   6975  C  C     . LEU C 1 208 ? -23.439  0.840   -43.585 1.00 29.84  ? 221 LEU C C     1 
ATOM   6976  O  O     . LEU C 1 208 ? -23.791  0.512   -44.716 1.00 29.84  ? 221 LEU C O     1 
ATOM   6977  C  CB    . LEU C 1 208 ? -21.030  1.493   -43.265 1.00 29.84  ? 221 LEU C CB    1 
ATOM   6978  C  CG    . LEU C 1 208 ? -20.245  1.259   -44.558 1.00 29.84  ? 221 LEU C CG    1 
ATOM   6979  C  CD1   . LEU C 1 208 ? -18.762  1.270   -44.274 1.00 29.84  ? 221 LEU C CD1   1 
ATOM   6980  C  CD2   . LEU C 1 208 ? -20.630  -0.051  -45.218 1.00 29.84  ? 221 LEU C CD2   1 
ATOM   6981  N  N     . ARG C 1 209 ? -23.876  0.229   -42.487 1.00 37.12  ? 222 ARG C N     1 
ATOM   6982  C  CA    . ARG C 1 209 ? -24.792  -0.905  -42.557 1.00 37.12  ? 222 ARG C CA    1 
ATOM   6983  C  C     . ARG C 1 209 ? -26.194  -0.480  -42.992 1.00 37.12  ? 222 ARG C C     1 
ATOM   6984  O  O     . ARG C 1 209 ? -26.862  -1.201  -43.732 1.00 37.12  ? 222 ARG C O     1 
ATOM   6985  C  CB    . ARG C 1 209 ? -24.845  -1.643  -41.218 1.00 37.12  ? 222 ARG C CB    1 
ATOM   6986  C  CG    . ARG C 1 209 ? -25.769  -2.852  -41.210 1.00 37.12  ? 222 ARG C CG    1 
ATOM   6987  C  CD    . ARG C 1 209 ? -25.665  -3.642  -39.912 1.00 37.12  ? 222 ARG C CD    1 
ATOM   6988  N  NE    . ARG C 1 209 ? -25.840  -2.802  -38.731 1.00 37.12  ? 222 ARG C NE    1 
ATOM   6989  C  CZ    . ARG C 1 209 ? -24.853  -2.447  -37.915 1.00 37.12  ? 222 ARG C CZ    1 
ATOM   6990  N  NH1   . ARG C 1 209 ? -23.616  -2.864  -38.146 1.00 37.12  ? 222 ARG C NH1   1 
ATOM   6991  N  NH2   . ARG C 1 209 ? -25.103  -1.679  -36.865 1.00 37.12  ? 222 ARG C NH2   1 
ATOM   6992  N  N     . GLU C 1 210 ? -26.633  0.691   -42.537 1.00 54.93  ? 223 GLU C N     1 
ATOM   6993  C  CA    . GLU C 1 210 ? -27.924  1.238   -42.946 1.00 54.93  ? 223 GLU C CA    1 
ATOM   6994  C  C     . GLU C 1 210 ? -27.924  1.553   -44.439 1.00 54.93  ? 223 GLU C C     1 
ATOM   6995  O  O     . GLU C 1 210 ? -28.975  1.607   -45.077 1.00 54.93  ? 223 GLU C O     1 
ATOM   6996  C  CB    . GLU C 1 210 ? -28.242  2.515   -42.166 1.00 54.93  ? 223 GLU C CB    1 
ATOM   6997  C  CG    . GLU C 1 210 ? -28.451  2.333   -40.672 1.00 54.93  ? 223 GLU C CG    1 
ATOM   6998  C  CD    . GLU C 1 210 ? -28.644  3.656   -39.949 1.00 54.93  ? 223 GLU C CD    1 
ATOM   6999  O  OE1   . GLU C 1 210 ? -29.016  4.647   -40.611 1.00 54.93  ? 223 GLU C OE1   1 
ATOM   7000  O  OE2   . GLU C 1 210 ? -28.420  3.705   -38.722 1.00 54.93  ? 223 GLU C OE2   1 
ATOM   7001  N  N     . LEU C 1 211 ? -26.731  1.761   -44.985 1.00 45.39  ? 224 LEU C N     1 
ATOM   7002  C  CA    . LEU C 1 211 ? -26.566  2.210   -46.361 1.00 45.39  ? 224 LEU C CA    1 
ATOM   7003  C  C     . LEU C 1 211 ? -26.386  1.033   -47.318 1.00 45.39  ? 224 LEU C C     1 
ATOM   7004  O  O     . LEU C 1 211 ? -26.449  1.197   -48.536 1.00 45.39  ? 224 LEU C O     1 
ATOM   7005  C  CB    . LEU C 1 211 ? -25.363  3.153   -46.442 1.00 45.39  ? 224 LEU C CB    1 
ATOM   7006  C  CG    . LEU C 1 211 ? -25.161  4.048   -47.660 1.00 45.39  ? 224 LEU C CG    1 
ATOM   7007  C  CD1   . LEU C 1 211 ? -26.399  4.873   -47.925 1.00 45.39  ? 224 LEU C CD1   1 
ATOM   7008  C  CD2   . LEU C 1 211 ? -23.970  4.956   -47.433 1.00 45.39  ? 224 LEU C CD2   1 
ATOM   7009  N  N     . LEU C 1 212 ? -26.170  -0.154  -46.759 1.00 27.45  ? 225 LEU C N     1 
ATOM   7010  C  CA    . LEU C 1 212 ? -25.939  -1.357  -47.558 1.00 27.45  ? 225 LEU C CA    1 
ATOM   7011  C  C     . LEU C 1 212 ? -27.239  -2.056  -47.959 1.00 27.45  ? 225 LEU C C     1 
ATOM   7012  O  O     . LEU C 1 212 ? -28.286  -1.818  -47.355 1.00 27.45  ? 225 LEU C O     1 
ATOM   7013  C  CB    . LEU C 1 212 ? -25.037  -2.333  -46.795 1.00 27.45  ? 225 LEU C CB    1 
ATOM   7014  C  CG    . LEU C 1 212 ? -23.559  -1.964  -46.693 1.00 27.45  ? 225 LEU C CG    1 
ATOM   7015  C  CD1   . LEU C 1 212 ? -22.757  -3.094  -46.067 1.00 27.45  ? 225 LEU C CD1   1 
ATOM   7016  C  CD2   . LEU C 1 212 ? -23.012  -1.612  -48.062 1.00 27.45  ? 225 LEU C CD2   1 
ATOM   7017  N  N     . PRO C 1 213 ? -27.177  -2.913  -48.995 1.00 55.59  ? 226 PRO C N     1 
ATOM   7018  C  CA    . PRO C 1 213 ? -28.339  -3.736  -49.344 1.00 55.59  ? 226 PRO C CA    1 
ATOM   7019  C  C     . PRO C 1 213 ? -28.698  -4.687  -48.209 1.00 55.59  ? 226 PRO C C     1 
ATOM   7020  O  O     . PRO C 1 213 ? -27.812  -5.108  -47.466 1.00 55.59  ? 226 PRO C O     1 
ATOM   7021  C  CB    . PRO C 1 213 ? -27.846  -4.542  -50.549 1.00 55.59  ? 226 PRO C CB    1 
ATOM   7022  C  CG    . PRO C 1 213 ? -26.765  -3.717  -51.141 1.00 55.59  ? 226 PRO C CG    1 
ATOM   7023  C  CD    . PRO C 1 213 ? -26.091  -3.048  -49.982 1.00 55.59  ? 226 PRO C CD    1 
ATOM   7024  N  N     . GLU C 1 214 ? -29.979  -5.030  -48.093 1.00 42.63  ? 227 GLU C N     1 
ATOM   7025  C  CA    . GLU C 1 214 ? -30.461  -5.903  -47.025 1.00 42.63  ? 227 GLU C CA    1 
ATOM   7026  C  C     . GLU C 1 214 ? -29.820  -7.288  -47.092 1.00 42.63  ? 227 GLU C C     1 
ATOM   7027  O  O     . GLU C 1 214 ? -29.832  -8.033  -46.113 1.00 42.63  ? 227 GLU C O     1 
ATOM   7028  C  CB    . GLU C 1 214 ? -31.985  -6.028  -47.091 1.00 42.63  ? 227 GLU C CB    1 
ATOM   7029  C  CG    . GLU C 1 214 ? -32.723  -4.701  -47.230 1.00 42.63  ? 227 GLU C CG    1 
ATOM   7030  C  CD    . GLU C 1 214 ? -33.306  -4.206  -45.922 1.00 42.63  ? 227 GLU C CD    1 
ATOM   7031  O  OE1   . GLU C 1 214 ? -33.327  -4.982  -44.945 1.00 42.63  ? 227 GLU C OE1   1 
ATOM   7032  O  OE2   . GLU C 1 214 ? -33.747  -3.039  -45.872 1.00 42.63  ? 227 GLU C OE2   1 
ATOM   7033  N  N     . GLU C 1 215 ? -29.268  -7.627  -48.253 1.00 63.54  ? 228 GLU C N     1 
ATOM   7034  C  CA    . GLU C 1 215 ? -28.577  -8.896  -48.443 1.00 63.54  ? 228 GLU C CA    1 
ATOM   7035  C  C     . GLU C 1 215 ? -27.148  -8.811  -47.916 1.00 63.54  ? 228 GLU C C     1 
ATOM   7036  O  O     . GLU C 1 215 ? -26.581  -9.807  -47.469 1.00 63.54  ? 228 GLU C O     1 
ATOM   7037  C  CB    . GLU C 1 215 ? -28.558  -9.275  -49.926 1.00 63.54  ? 228 GLU C CB    1 
ATOM   7038  C  CG    . GLU C 1 215 ? -27.964  -10.648 -50.220 1.00 63.54  ? 228 GLU C CG    1 
ATOM   7039  C  CD    . GLU C 1 215 ? -27.596  -10.827 -51.681 1.00 63.54  ? 228 GLU C CD    1 
ATOM   7040  O  OE1   . GLU C 1 215 ? -27.485  -9.808  -52.394 1.00 63.54  ? 228 GLU C OE1   1 
ATOM   7041  O  OE2   . GLU C 1 215 ? -27.414  -11.983 -52.115 1.00 63.54  ? 228 GLU C OE2   1 
ATOM   7042  N  N     . ASN C 1 216 ? -26.573  -7.613  -47.969 1.00 53.43  ? 229 ASN C N     1 
ATOM   7043  C  CA    . ASN C 1 216 ? -25.190  -7.406  -47.558 1.00 53.43  ? 229 ASN C CA    1 
ATOM   7044  C  C     . ASN C 1 216 ? -25.052  -6.675  -46.221 1.00 53.43  ? 229 ASN C C     1 
ATOM   7045  O  O     . ASN C 1 216 ? -23.949  -6.298  -45.829 1.00 53.43  ? 229 ASN C O     1 
ATOM   7046  C  CB    . ASN C 1 216 ? -24.413  -6.659  -48.648 1.00 53.43  ? 229 ASN C CB    1 
ATOM   7047  C  CG    . ASN C 1 216 ? -24.322  -7.442  -49.944 1.00 53.43  ? 229 ASN C CG    1 
ATOM   7048  O  OD1   . ASN C 1 216 ? -24.074  -8.647  -49.941 1.00 53.43  ? 229 ASN C OD1   1 
ATOM   7049  N  ND2   . ASN C 1 216 ? -24.527  -6.756  -51.063 1.00 53.43  ? 229 ASN C ND2   1 
ATOM   7050  N  N     . LYS C 1 217 ? -26.169  -6.483  -45.524 1.00 33.94  ? 230 LYS C N     1 
ATOM   7051  C  CA    . LYS C 1 217 ? -26.163  -5.812  -44.224 1.00 33.94  ? 230 LYS C CA    1 
ATOM   7052  C  C     . LYS C 1 217 ? -25.459  -6.636  -43.147 1.00 33.94  ? 230 LYS C C     1 
ATOM   7053  O  O     . LYS C 1 217 ? -25.186  -6.139  -42.054 1.00 33.94  ? 230 LYS C O     1 
ATOM   7054  C  CB    . LYS C 1 217 ? -27.590  -5.476  -43.774 1.00 33.94  ? 230 LYS C CB    1 
ATOM   7055  C  CG    . LYS C 1 217 ? -28.199  -4.253  -44.450 1.00 33.94  ? 230 LYS C CG    1 
ATOM   7056  C  CD    . LYS C 1 217 ? -29.538  -3.879  -43.828 1.00 33.94  ? 230 LYS C CD    1 
ATOM   7057  C  CE    . LYS C 1 217 ? -30.140  -2.654  -44.500 1.00 33.94  ? 230 LYS C CE    1 
ATOM   7058  N  NZ    . LYS C 1 217 ? -29.221  -1.488  -44.466 1.00 33.94  ? 230 LYS C NZ    1 
ATOM   7059  N  N     . HIS C 1 218 ? -25.167  -7.894  -43.461 1.00 47.27  ? 231 HIS C N     1 
ATOM   7060  C  CA    . HIS C 1 218 ? -24.518  -8.799  -42.520 1.00 47.27  ? 231 HIS C CA    1 
ATOM   7061  C  C     . HIS C 1 218 ? -23.006  -8.608  -42.521 1.00 47.27  ? 231 HIS C C     1 
ATOM   7062  O  O     . HIS C 1 218 ? -22.298  -9.200  -41.706 1.00 47.27  ? 231 HIS C O     1 
ATOM   7063  C  CB    . HIS C 1 218 ? -24.842  -10.248 -42.878 1.00 47.27  ? 231 HIS C CB    1 
ATOM   7064  C  CG    . HIS C 1 218 ? -24.131  -10.740 -44.102 1.00 47.27  ? 231 HIS C CG    1 
ATOM   7065  N  ND1   . HIS C 1 218 ? -22.855  -11.252 -44.063 1.00 47.27  ? 231 HIS C ND1   1 
ATOM   7066  C  CD2   . HIS C 1 218 ? -24.521  -10.791 -45.398 1.00 47.27  ? 231 HIS C CD2   1 
ATOM   7067  C  CE1   . HIS C 1 218 ? -22.486  -11.603 -45.285 1.00 47.27  ? 231 HIS C CE1   1 
ATOM   7068  N  NE2   . HIS C 1 218 ? -23.478  -11.333 -46.111 1.00 47.27  ? 231 HIS C NE2   1 
ATOM   7069  N  N     . LEU C 1 219 ? -22.515  -7.790  -43.446 1.00 32.37  ? 232 LEU C N     1 
ATOM   7070  C  CA    . LEU C 1 219 ? -21.080  -7.559  -43.578 1.00 32.37  ? 232 LEU C CA    1 
ATOM   7071  C  C     . LEU C 1 219 ? -20.525  -6.730  -42.424 1.00 32.37  ? 232 LEU C C     1 
ATOM   7072  O  O     . LEU C 1 219 ? -19.412  -6.969  -41.962 1.00 32.37  ? 232 LEU C O     1 
ATOM   7073  C  CB    . LEU C 1 219 ? -20.765  -6.888  -44.917 1.00 32.37  ? 232 LEU C CB    1 
ATOM   7074  C  CG    . LEU C 1 219 ? -20.964  -7.751  -46.163 1.00 32.37  ? 232 LEU C CG    1 
ATOM   7075  C  CD1   . LEU C 1 219 ? -20.724  -6.944  -47.427 1.00 32.37  ? 232 LEU C CD1   1 
ATOM   7076  C  CD2   . LEU C 1 219 ? -20.049  -8.962  -46.120 1.00 32.37  ? 232 LEU C CD2   1 
ATOM   7077  N  N     . ILE C 1 220 ? -21.305  -5.761  -41.959 1.00 39.00  ? 233 ILE C N     1 
ATOM   7078  C  CA    . ILE C 1 220 ? -20.872  -4.902  -40.864 1.00 39.00  ? 233 ILE C CA    1 
ATOM   7079  C  C     . ILE C 1 220 ? -21.408  -5.423  -39.534 1.00 39.00  ? 233 ILE C C     1 
ATOM   7080  O  O     . ILE C 1 220 ? -22.619  -5.559  -39.359 1.00 39.00  ? 233 ILE C O     1 
ATOM   7081  C  CB    . ILE C 1 220 ? -21.341  -3.452  -41.066 1.00 39.00  ? 233 ILE C CB    1 
ATOM   7082  C  CG1   . ILE C 1 220 ? -21.212  -3.044  -42.534 1.00 39.00  ? 233 ILE C CG1   1 
ATOM   7083  C  CG2   . ILE C 1 220 ? -20.553  -2.513  -40.166 1.00 39.00  ? 233 ILE C CG2   1 
ATOM   7084  C  CD1   . ILE C 1 220 ? -19.784  -3.020  -43.046 1.00 39.00  ? 233 ILE C CD1   1 
ATOM   7085  N  N     . LYS C 1 221 ? -20.507  -5.710  -38.598 1.00 15.05  ? 234 LYS C N     1 
ATOM   7086  C  CA    . LYS C 1 221 ? -20.899  -6.266  -37.308 1.00 15.05  ? 234 LYS C CA    1 
ATOM   7087  C  C     . LYS C 1 221 ? -20.804  -5.206  -36.213 1.00 15.05  ? 234 LYS C C     1 
ATOM   7088  O  O     . LYS C 1 221 ? -19.980  -4.295  -36.293 1.00 15.05  ? 234 LYS C O     1 
ATOM   7089  C  CB    . LYS C 1 221 ? -20.023  -7.469  -36.951 1.00 15.05  ? 234 LYS C CB    1 
ATOM   7090  C  CG    . LYS C 1 221 ? -19.380  -8.173  -38.144 1.00 15.05  ? 234 LYS C CG    1 
ATOM   7091  C  CD    . LYS C 1 221 ? -20.393  -8.890  -39.030 1.00 15.05  ? 234 LYS C CD    1 
ATOM   7092  C  CE    . LYS C 1 221 ? -20.904  -10.168 -38.393 1.00 15.05  ? 234 LYS C CE    1 
ATOM   7093  N  NZ    . LYS C 1 221 ? -21.693  -10.988 -39.354 1.00 15.05  ? 234 LYS C NZ    1 
ATOM   7094  N  N     . ASN C 1 222 ? -21.653  -5.324  -35.197 1.00 53.70  ? 235 ASN C N     1 
ATOM   7095  C  CA    . ASN C 1 222 ? -21.636  -4.393  -34.072 1.00 53.70  ? 235 ASN C CA    1 
ATOM   7096  C  C     . ASN C 1 222 ? -20.374  -4.580  -33.233 1.00 53.70  ? 235 ASN C C     1 
ATOM   7097  O  O     . ASN C 1 222 ? -20.220  -5.591  -32.549 1.00 53.70  ? 235 ASN C O     1 
ATOM   7098  C  CB    . ASN C 1 222 ? -22.885  -4.584  -33.209 1.00 53.70  ? 235 ASN C CB    1 
ATOM   7099  C  CG    . ASN C 1 222 ? -23.064  -3.481  -32.183 1.00 53.70  ? 235 ASN C CG    1 
ATOM   7100  O  OD1   . ASN C 1 222 ? -23.759  -2.496  -32.430 1.00 53.70  ? 235 ASN C OD1   1 
ATOM   7101  N  ND2   . ASN C 1 222 ? -22.444  -3.645  -31.021 1.00 53.70  ? 235 ASN C ND2   1 
ATOM   7102  N  N     . LEU C 1 223 ? -19.474  -3.602  -33.288 1.00 31.14  ? 236 LEU C N     1 
ATOM   7103  C  CA    . LEU C 1 223 ? -18.177  -3.718  -32.625 1.00 31.14  ? 236 LEU C CA    1 
ATOM   7104  C  C     . LEU C 1 223 ? -18.209  -3.260  -31.171 1.00 31.14  ? 236 LEU C C     1 
ATOM   7105  O  O     . LEU C 1 223 ? -18.902  -2.303  -30.823 1.00 31.14  ? 236 LEU C O     1 
ATOM   7106  C  CB    . LEU C 1 223 ? -17.108  -2.937  -33.394 1.00 31.14  ? 236 LEU C CB    1 
ATOM   7107  C  CG    . LEU C 1 223 ? -15.674  -2.991  -32.863 1.00 31.14  ? 236 LEU C CG    1 
ATOM   7108  C  CD1   . LEU C 1 223 ? -15.191  -4.425  -32.778 1.00 31.14  ? 236 LEU C CD1   1 
ATOM   7109  C  CD2   . LEU C 1 223 ? -14.742  -2.170  -33.734 1.00 31.14  ? 236 LEU C CD2   1 
ATOM   7110  N  N     . SER C 1 224 ? -17.454  -3.957  -30.327 1.00 25.61  ? 237 SER C N     1 
ATOM   7111  C  CA    . SER C 1 224 ? -17.302  -3.586  -28.928 1.00 25.61  ? 237 SER C CA    1 
ATOM   7112  C  C     . SER C 1 224 ? -15.840  -3.735  -28.519 1.00 25.61  ? 237 SER C C     1 
ATOM   7113  O  O     . SER C 1 224 ? -15.236  -4.784  -28.730 1.00 25.61  ? 237 SER C O     1 
ATOM   7114  C  CB    . SER C 1 224 ? -18.182  -4.470  -28.048 1.00 25.61  ? 237 SER C CB    1 
ATOM   7115  O  OG    . SER C 1 224 ? -19.500  -4.546  -28.560 1.00 25.61  ? 237 SER C OG    1 
ATOM   7116  N  N     . VAL C 1 225 ? -15.273  -2.683  -27.940 1.00 38.00  ? 238 VAL C N     1 
ATOM   7117  C  CA    . VAL C 1 225 ? -13.886  -2.724  -27.489 1.00 38.00  ? 238 VAL C CA    1 
ATOM   7118  C  C     . VAL C 1 225 ? -13.780  -2.388  -26.006 1.00 38.00  ? 238 VAL C C     1 
ATOM   7119  O  O     . VAL C 1 225 ? -14.533  -1.561  -25.492 1.00 38.00  ? 238 VAL C O     1 
ATOM   7120  C  CB    . VAL C 1 225 ? -12.999  -1.769  -28.303 1.00 38.00  ? 238 VAL C CB    1 
ATOM   7121  C  CG1   . VAL C 1 225 ? -12.511  -2.449  -29.567 1.00 38.00  ? 238 VAL C CG1   1 
ATOM   7122  C  CG2   . VAL C 1 225 ? -13.766  -0.506  -28.642 1.00 38.00  ? 238 VAL C CG2   1 
ATOM   7123  N  N     . VAL C 1 226 ? -12.846  -3.041  -25.320 1.00 32.60  ? 239 VAL C N     1 
ATOM   7124  C  CA    . VAL C 1 226 ? -12.637  -2.809  -23.896 1.00 32.60  ? 239 VAL C CA    1 
ATOM   7125  C  C     . VAL C 1 226 ? -11.225  -2.289  -23.645 1.00 32.60  ? 239 VAL C C     1 
ATOM   7126  O  O     . VAL C 1 226 ? -10.262  -2.791  -24.225 1.00 32.60  ? 239 VAL C O     1 
ATOM   7127  C  CB    . VAL C 1 226 ? -12.851  -4.095  -23.078 1.00 32.60  ? 239 VAL C CB    1 
ATOM   7128  C  CG1   . VAL C 1 226 ? -12.947  -3.774  -21.598 1.00 32.60  ? 239 VAL C CG1   1 
ATOM   7129  C  CG2   . VAL C 1 226 ? -14.105  -4.820  -23.542 1.00 32.60  ? 239 VAL C CG2   1 
ATOM   7130  N  N     . VAL C 1 227 ? -11.105  -1.280  -22.788 1.00 46.10  ? 240 VAL C N     1 
ATOM   7131  C  CA    . VAL C 1 227 ? -9.800   -0.730  -22.438 1.00 46.10  ? 240 VAL C CA    1 
ATOM   7132  C  C     . VAL C 1 227 ? -9.615   -0.688  -20.927 1.00 46.10  ? 240 VAL C C     1 
ATOM   7133  O  O     . VAL C 1 227 ? -10.493  -1.101  -20.171 1.00 46.10  ? 240 VAL C O     1 
ATOM   7134  C  CB    . VAL C 1 227 ? -9.606   0.691   -23.000 1.00 46.10  ? 240 VAL C CB    1 
ATOM   7135  C  CG1   . VAL C 1 227 ? -9.739   0.691   -24.512 1.00 46.10  ? 240 VAL C CG1   1 
ATOM   7136  C  CG2   . VAL C 1 227 ? -10.602  1.655   -22.372 1.00 46.10  ? 240 VAL C CG2   1 
ATOM   7137  N  N     . THR C 1 228 ? -8.463   -0.187  -20.494 1.00 55.57  ? 241 THR C N     1 
ATOM   7138  C  CA    . THR C 1 228 ? -8.198   0.013   -19.077 1.00 55.57  ? 241 THR C CA    1 
ATOM   7139  C  C     . THR C 1 228 ? -7.993   1.494   -18.800 1.00 55.57  ? 241 THR C C     1 
ATOM   7140  O  O     . THR C 1 228 ? -7.029   2.092   -19.279 1.00 55.57  ? 241 THR C O     1 
ATOM   7141  C  CB    . THR C 1 228 ? -6.940   -0.740  -18.620 1.00 55.57  ? 241 THR C CB    1 
ATOM   7142  O  OG1   . THR C 1 228 ? -7.081   -2.139  -18.898 1.00 55.57  ? 241 THR C OG1   1 
ATOM   7143  C  CG2   . THR C 1 228 ? -6.708   -0.543  -17.132 1.00 55.57  ? 241 THR C CG2   1 
ATOM   7144  N  N     . ASN C 1 229 ? -8.902   2.089   -18.036 1.00 29.04  ? 242 ASN C N     1 
ATOM   7145  C  CA    . ASN C 1 229 ? -8.735   3.475   -17.627 1.00 29.04  ? 242 ASN C CA    1 
ATOM   7146  C  C     . ASN C 1 229 ? -7.877   3.548   -16.370 1.00 29.04  ? 242 ASN C C     1 
ATOM   7147  O  O     . ASN C 1 229 ? -8.356   3.292   -15.267 1.00 29.04  ? 242 ASN C O     1 
ATOM   7148  C  CB    . ASN C 1 229 ? -10.090  4.146   -17.400 1.00 29.04  ? 242 ASN C CB    1 
ATOM   7149  C  CG    . ASN C 1 229 ? -9.981   5.653   -17.295 1.00 29.04  ? 242 ASN C CG    1 
ATOM   7150  O  OD1   . ASN C 1 229 ? -10.097  6.221   -16.213 1.00 29.04  ? 242 ASN C OD1   1 
ATOM   7151  N  ND2   . ASN C 1 229 ? -9.750   6.309   -18.425 1.00 29.04  ? 242 ASN C ND2   1 
ATOM   7152  N  N     . GLN C 1 230 ? -6.605   3.895   -16.547 1.00 38.77  ? 243 GLN C N     1 
ATOM   7153  C  CA    . GLN C 1 230 ? -5.643   3.904   -15.451 1.00 38.77  ? 243 GLN C CA    1 
ATOM   7154  C  C     . GLN C 1 230 ? -5.855   5.063   -14.478 1.00 38.77  ? 243 GLN C C     1 
ATOM   7155  O  O     . GLN C 1 230 ? -5.155   5.170   -13.471 1.00 38.77  ? 243 GLN C O     1 
ATOM   7156  C  CB    . GLN C 1 230 ? -4.214   3.923   -15.999 1.00 38.77  ? 243 GLN C CB    1 
ATOM   7157  C  CG    . GLN C 1 230 ? -3.810   2.650   -16.733 1.00 38.77  ? 243 GLN C CG    1 
ATOM   7158  C  CD    . GLN C 1 230 ? -2.418   2.733   -17.328 1.00 38.77  ? 243 GLN C CD    1 
ATOM   7159  O  OE1   . GLN C 1 230 ? -1.956   3.808   -17.707 1.00 38.77  ? 243 GLN C OE1   1 
ATOM   7160  N  NE2   . GLN C 1 230 ? -1.741   1.593   -17.413 1.00 38.77  ? 243 GLN C NE2   1 
ATOM   7161  N  N     . THR C 1 231 ? -6.818   5.927   -14.783 1.00 37.40  ? 244 THR C N     1 
ATOM   7162  C  CA    . THR C 1 231 ? -7.149   7.044   -13.905 1.00 37.40  ? 244 THR C CA    1 
ATOM   7163  C  C     . THR C 1 231 ? -8.316   6.677   -12.988 1.00 37.40  ? 244 THR C C     1 
ATOM   7164  O  O     . THR C 1 231 ? -8.290   6.960   -11.791 1.00 37.40  ? 244 THR C O     1 
ATOM   7165  C  CB    . THR C 1 231 ? -7.478   8.321   -14.705 1.00 37.40  ? 244 THR C CB    1 
ATOM   7166  O  OG1   . THR C 1 231 ? -6.341   8.705   -15.486 1.00 37.40  ? 244 THR C OG1   1 
ATOM   7167  C  CG2   . THR C 1 231 ? -7.846   9.461   -13.773 1.00 37.40  ? 244 THR C CG2   1 
ATOM   7168  N  N     . LYS C 1 232 ? -9.334   6.034   -13.551 1.00 46.78  ? 245 LYS C N     1 
ATOM   7169  C  CA    . LYS C 1 232 ? -10.484  5.611   -12.762 1.00 46.78  ? 245 LYS C CA    1 
ATOM   7170  C  C     . LYS C 1 232 ? -10.371  4.148   -12.338 1.00 46.78  ? 245 LYS C C     1 
ATOM   7171  O  O     . LYS C 1 232 ? -11.217  3.646   -11.597 1.00 46.78  ? 245 LYS C O     1 
ATOM   7172  C  CB    . LYS C 1 232 ? -11.791  5.864   -13.520 1.00 46.78  ? 245 LYS C CB    1 
ATOM   7173  C  CG    . LYS C 1 232 ? -12.029  7.331   -13.853 1.00 46.78  ? 245 LYS C CG    1 
ATOM   7174  C  CD    . LYS C 1 232 ? -13.448  7.589   -14.349 1.00 46.78  ? 245 LYS C CD    1 
ATOM   7175  C  CE    . LYS C 1 232 ? -13.715  6.923   -15.687 1.00 46.78  ? 245 LYS C CE    1 
ATOM   7176  N  NZ    . LYS C 1 232 ? -15.081  7.235   -16.195 1.00 46.78  ? 245 LYS C NZ    1 
ATOM   7177  N  N     . HIS C 1 233 ? -9.321   3.479   -12.809 1.00 43.83  ? 246 HIS C N     1 
ATOM   7178  C  CA    . HIS C 1 233 ? -9.024   2.097   -12.431 1.00 43.83  ? 246 HIS C CA    1 
ATOM   7179  C  C     . HIS C 1 233 ? -10.187  1.141   -12.689 1.00 43.83  ? 246 HIS C C     1 
ATOM   7180  O  O     . HIS C 1 233 ? -10.504  0.294   -11.854 1.00 43.83  ? 246 HIS C O     1 
ATOM   7181  C  CB    . HIS C 1 233 ? -8.579   2.028   -10.967 1.00 43.83  ? 246 HIS C CB    1 
ATOM   7182  C  CG    . HIS C 1 233 ? -7.399   2.895   -10.656 1.00 43.83  ? 246 HIS C CG    1 
ATOM   7183  N  ND1   . HIS C 1 233 ? -6.099   2.454   -10.782 1.00 43.83  ? 246 HIS C ND1   1 
ATOM   7184  C  CD2   . HIS C 1 233 ? -7.322   4.177   -10.229 1.00 43.83  ? 246 HIS C CD2   1 
ATOM   7185  C  CE1   . HIS C 1 233 ? -5.272   3.427   -10.443 1.00 43.83  ? 246 HIS C CE1   1 
ATOM   7186  N  NE2   . HIS C 1 233 ? -5.989   4.484   -10.105 1.00 43.83  ? 246 HIS C NE2   1 
ATOM   7187  N  N     . GLU C 1 234 ? -10.818  1.282   -13.850 1.00 45.25  ? 247 GLU C N     1 
ATOM   7188  C  CA    . GLU C 1 234 ? -11.936  0.422   -14.213 1.00 45.25  ? 247 GLU C CA    1 
ATOM   7189  C  C     . GLU C 1 234 ? -11.947  0.113   -15.703 1.00 45.25  ? 247 GLU C C     1 
ATOM   7190  O  O     . GLU C 1 234 ? -11.486  0.911   -16.520 1.00 45.25  ? 247 GLU C O     1 
ATOM   7191  C  CB    . GLU C 1 234 ? -13.269  1.055   -13.801 1.00 45.25  ? 247 GLU C CB    1 
ATOM   7192  C  CG    . GLU C 1 234 ? -13.564  2.398   -14.460 1.00 45.25  ? 247 GLU C CG    1 
ATOM   7193  C  CD    . GLU C 1 234 ? -14.930  2.943   -14.083 1.00 45.25  ? 247 GLU C CD    1 
ATOM   7194  O  OE1   . GLU C 1 234 ? -15.703  2.211   -13.430 1.00 45.25  ? 247 GLU C OE1   1 
ATOM   7195  O  OE2   . GLU C 1 234 ? -15.232  4.102   -14.440 1.00 45.25  ? 247 GLU C OE2   1 
ATOM   7196  N  N     . LEU C 1 235 ? -12.474  -1.057  -16.045 1.00 24.39  ? 248 LEU C N     1 
ATOM   7197  C  CA    . LEU C 1 235 ? -12.631  -1.450  -17.436 1.00 24.39  ? 248 LEU C CA    1 
ATOM   7198  C  C     . LEU C 1 235 ? -13.662  -0.561  -18.119 1.00 24.39  ? 248 LEU C C     1 
ATOM   7199  O  O     . LEU C 1 235 ? -14.842  -0.584  -17.769 1.00 24.39  ? 248 LEU C O     1 
ATOM   7200  C  CB    . LEU C 1 235 ? -13.056  -2.916  -17.528 1.00 24.39  ? 248 LEU C CB    1 
ATOM   7201  C  CG    . LEU C 1 235 ? -11.990  -3.919  -17.966 1.00 24.39  ? 248 LEU C CG    1 
ATOM   7202  C  CD1   . LEU C 1 235 ? -10.671  -3.635  -17.282 1.00 24.39  ? 248 LEU C CD1   1 
ATOM   7203  C  CD2   . LEU C 1 235 ? -12.443  -5.334  -17.669 1.00 24.39  ? 248 LEU C CD2   1 
ATOM   7204  N  N     . GLU C 1 236 ? -13.210  0.229   -19.087 1.00 43.20  ? 249 GLU C N     1 
ATOM   7205  C  CA    . GLU C 1 236 ? -14.109  1.092   -19.842 1.00 43.20  ? 249 GLU C CA    1 
ATOM   7206  C  C     . GLU C 1 236 ? -14.464  0.417   -21.159 1.00 43.20  ? 249 GLU C C     1 
ATOM   7207  O  O     . GLU C 1 236 ? -13.614  -0.206  -21.793 1.00 43.20  ? 249 GLU C O     1 
ATOM   7208  C  CB    . GLU C 1 236 ? -13.464  2.456   -20.085 1.00 43.20  ? 249 GLU C CB    1 
ATOM   7209  C  CG    . GLU C 1 236 ? -14.436  3.544   -20.514 1.00 43.20  ? 249 GLU C CG    1 
ATOM   7210  C  CD    . GLU C 1 236 ? -13.859  4.938   -20.353 1.00 43.20  ? 249 GLU C CD    1 
ATOM   7211  O  OE1   . GLU C 1 236 ? -13.785  5.671   -21.360 1.00 43.20  ? 249 GLU C OE1   1 
ATOM   7212  O  OE2   . GLU C 1 236 ? -13.489  5.305   -19.218 1.00 43.20  ? 249 GLU C OE2   1 
ATOM   7213  N  N     . ARG C 1 237 ? -15.725  0.532   -21.562 1.00 48.48  ? 250 ARG C N     1 
ATOM   7214  C  CA    . ARG C 1 237 ? -16.204  -0.152  -22.755 1.00 48.48  ? 250 ARG C CA    1 
ATOM   7215  C  C     . ARG C 1 237 ? -16.712  0.842   -23.791 1.00 48.48  ? 250 ARG C C     1 
ATOM   7216  O  O     . ARG C 1 237 ? -17.474  1.753   -23.469 1.00 48.48  ? 250 ARG C O     1 
ATOM   7217  C  CB    . ARG C 1 237 ? -17.301  -1.153  -22.380 1.00 48.48  ? 250 ARG C CB    1 
ATOM   7218  C  CG    . ARG C 1 237 ? -17.779  -2.052  -23.513 1.00 48.48  ? 250 ARG C CG    1 
ATOM   7219  C  CD    . ARG C 1 237 ? -19.009  -1.477  -24.197 1.00 48.48  ? 250 ARG C CD    1 
ATOM   7220  N  NE    . ARG C 1 237 ? -20.070  -1.158  -23.246 1.00 48.48  ? 250 ARG C NE    1 
ATOM   7221  C  CZ    . ARG C 1 237 ? -21.147  -1.910  -23.046 1.00 48.48  ? 250 ARG C CZ    1 
ATOM   7222  N  NH1   . ARG C 1 237 ? -21.314  -3.028  -23.738 1.00 48.48  ? 250 ARG C NH1   1 
ATOM   7223  N  NH2   . ARG C 1 237 ? -22.062  -1.543  -22.159 1.00 48.48  ? 250 ARG C NH2   1 
ATOM   7224  N  N     . TYR C 1 238 ? -16.281  0.662   -25.035 1.00 41.84  ? 251 TYR C N     1 
ATOM   7225  C  CA    . TYR C 1 238 ? -16.769  1.474   -26.141 1.00 41.84  ? 251 TYR C CA    1 
ATOM   7226  C  C     . TYR C 1 238 ? -17.505  0.596   -27.147 1.00 41.84  ? 251 TYR C C     1 
ATOM   7227  O  O     . TYR C 1 238 ? -17.063  -0.510  -27.456 1.00 41.84  ? 251 TYR C O     1 
ATOM   7228  C  CB    . TYR C 1 238 ? -15.616  2.208   -26.823 1.00 41.84  ? 251 TYR C CB    1 
ATOM   7229  C  CG    . TYR C 1 238 ? -14.920  3.218   -25.940 1.00 41.84  ? 251 TYR C CG    1 
ATOM   7230  C  CD1   . TYR C 1 238 ? -15.396  4.516   -25.830 1.00 41.84  ? 251 TYR C CD1   1 
ATOM   7231  C  CD2   . TYR C 1 238 ? -13.785  2.875   -25.222 1.00 41.84  ? 251 TYR C CD2   1 
ATOM   7232  C  CE1   . TYR C 1 238 ? -14.761  5.442   -25.028 1.00 41.84  ? 251 TYR C CE1   1 
ATOM   7233  C  CE2   . TYR C 1 238 ? -13.142  3.794   -24.421 1.00 41.84  ? 251 TYR C CE2   1 
ATOM   7234  C  CZ    . TYR C 1 238 ? -13.635  5.076   -24.326 1.00 41.84  ? 251 TYR C CZ    1 
ATOM   7235  O  OH    . TYR C 1 238 ? -12.996  5.993   -23.524 1.00 41.84  ? 251 TYR C OH    1 
ATOM   7236  N  N     . SER C 1 239 ? -18.630  1.089   -27.653 1.00 46.54  ? 252 SER C N     1 
ATOM   7237  C  CA    . SER C 1 239 ? -19.431  0.326   -28.603 1.00 46.54  ? 252 SER C CA    1 
ATOM   7238  C  C     . SER C 1 239 ? -20.018  1.200   -29.700 1.00 46.54  ? 252 SER C C     1 
ATOM   7239  O  O     . SER C 1 239 ? -19.840  2.417   -29.706 1.00 46.54  ? 252 SER C O     1 
ATOM   7240  C  CB    . SER C 1 239 ? -20.555  -0.419  -27.885 1.00 46.54  ? 252 SER C CB    1 
ATOM   7241  O  OG    . SER C 1 239 ? -20.053  -1.520  -27.155 1.00 46.54  ? 252 SER C OG    1 
ATOM   7242  N  N     . GLU C 1 240 ? -20.721  0.559   -30.626 1.00 46.03  ? 253 GLU C N     1 
ATOM   7243  C  CA    . GLU C 1 240 ? -21.375  1.250   -31.726 1.00 46.03  ? 253 GLU C CA    1 
ATOM   7244  C  C     . GLU C 1 240 ? -22.579  2.037   -31.222 1.00 46.03  ? 253 GLU C C     1 
ATOM   7245  O  O     . GLU C 1 240 ? -22.876  3.125   -31.719 1.00 46.03  ? 253 GLU C O     1 
ATOM   7246  C  CB    . GLU C 1 240 ? -21.816  0.235   -32.783 1.00 46.03  ? 253 GLU C CB    1 
ATOM   7247  C  CG    . GLU C 1 240 ? -22.737  0.790   -33.858 1.00 46.03  ? 253 GLU C CG    1 
ATOM   7248  C  CD    . GLU C 1 240 ? -23.265  -0.288  -34.781 1.00 46.03  ? 253 GLU C CD    1 
ATOM   7249  O  OE1   . GLU C 1 240 ? -22.578  -1.316  -34.954 1.00 46.03  ? 253 GLU C OE1   1 
ATOM   7250  O  OE2   . GLU C 1 240 ? -24.372  -0.109  -35.329 1.00 46.03  ? 253 GLU C OE2   1 
ATOM   7251  N  N     . ASP C 1 241 ? -23.260  1.488   -30.221 1.00 33.40  ? 254 ASP C N     1 
ATOM   7252  C  CA    . ASP C 1 241 ? -24.502  2.071   -29.731 1.00 33.40  ? 254 ASP C CA    1 
ATOM   7253  C  C     . ASP C 1 241 ? -24.374  2.787   -28.386 1.00 33.40  ? 254 ASP C C     1 
ATOM   7254  O  O     . ASP C 1 241 ? -25.362  3.288   -27.852 1.00 33.40  ? 254 ASP C O     1 
ATOM   7255  C  CB    . ASP C 1 241 ? -25.595  1.003   -29.663 1.00 33.40  ? 254 ASP C CB    1 
ATOM   7256  C  CG    . ASP C 1 241 ? -25.037  -0.405  -29.693 1.00 33.40  ? 254 ASP C CG    1 
ATOM   7257  O  OD1   . ASP C 1 241 ? -24.007  -0.653  -29.035 1.00 33.40  ? 254 ASP C OD1   1 
ATOM   7258  O  OD2   . ASP C 1 241 ? -25.628  -1.265  -30.381 1.00 33.40  ? 254 ASP C OD2   1 
ATOM   7259  N  N     . THR C 1 242 ? -23.161  2.838   -27.842 1.00 37.04  ? 255 THR C N     1 
ATOM   7260  C  CA    . THR C 1 242 ? -22.917  3.544   -26.586 1.00 37.04  ? 255 THR C CA    1 
ATOM   7261  C  C     . THR C 1 242 ? -21.989  4.738   -26.798 1.00 37.04  ? 255 THR C C     1 
ATOM   7262  O  O     . THR C 1 242 ? -22.204  5.812   -26.238 1.00 37.04  ? 255 THR C O     1 
ATOM   7263  C  CB    . THR C 1 242 ? -22.323  2.618   -25.511 1.00 37.04  ? 255 THR C CB    1 
ATOM   7264  O  OG1   . THR C 1 242 ? -21.035  2.155   -25.933 1.00 37.04  ? 255 THR C OG1   1 
ATOM   7265  C  CG2   . THR C 1 242 ? -23.232  1.424   -25.278 1.00 37.04  ? 255 THR C CG2   1 
ATOM   7266  N  N     . THR C 1 243 ? -20.953  4.537   -27.606 1.00 39.51  ? 256 THR C N     1 
ATOM   7267  C  CA    . THR C 1 243 ? -20.030  5.608   -27.970 1.00 39.51  ? 256 THR C CA    1 
ATOM   7268  C  C     . THR C 1 243 ? -19.818  5.644   -29.483 1.00 39.51  ? 256 THR C C     1 
ATOM   7269  O  O     . THR C 1 243 ? -18.798  5.168   -29.982 1.00 39.51  ? 256 THR C O     1 
ATOM   7270  C  CB    . THR C 1 243 ? -18.668  5.444   -27.268 1.00 39.51  ? 256 THR C CB    1 
ATOM   7271  O  OG1   . THR C 1 243 ? -18.167  4.122   -27.497 1.00 39.51  ? 256 THR C OG1   1 
ATOM   7272  C  CG2   . THR C 1 243 ? -18.806  5.670   -25.770 1.00 39.51  ? 256 THR C CG2   1 
ATOM   7273  N  N     . PRO C 1 244 ? -20.788  6.213   -30.218 1.00 56.90  ? 257 PRO C N     1 
ATOM   7274  C  CA    . PRO C 1 244 ? -20.784  6.212   -31.684 1.00 56.90  ? 257 PRO C CA    1 
ATOM   7275  C  C     . PRO C 1 244 ? -20.017  7.386   -32.283 1.00 56.90  ? 257 PRO C C     1 
ATOM   7276  O  O     . PRO C 1 244 ? -19.997  7.541   -33.503 1.00 56.90  ? 257 PRO C O     1 
ATOM   7277  C  CB    . PRO C 1 244 ? -22.266  6.346   -32.020 1.00 56.90  ? 257 PRO C CB    1 
ATOM   7278  C  CG    . PRO C 1 244 ? -22.803  7.194   -30.919 1.00 56.90  ? 257 PRO C CG    1 
ATOM   7279  C  CD    . PRO C 1 244 ? -22.010  6.839   -29.680 1.00 56.90  ? 257 PRO C CD    1 
ATOM   7280  N  N     . GLN C 1 245 ? -19.408  8.205   -31.434 1.00 21.57  ? 258 GLN C N     1 
ATOM   7281  C  CA    . GLN C 1 245 ? -18.614  9.337   -31.894 1.00 21.57  ? 258 GLN C CA    1 
ATOM   7282  C  C     . GLN C 1 245 ? -17.136  9.101   -31.615 1.00 21.57  ? 258 GLN C C     1 
ATOM   7283  O  O     . GLN C 1 245 ? -16.312  10.003  -31.766 1.00 21.57  ? 258 GLN C O     1 
ATOM   7284  C  CB    . GLN C 1 245 ? -19.076  10.627  -31.218 1.00 21.57  ? 258 GLN C CB    1 
ATOM   7285  C  CG    . GLN C 1 245 ? -20.315  11.258  -31.838 1.00 21.57  ? 258 GLN C CG    1 
ATOM   7286  C  CD    . GLN C 1 245 ? -19.998  12.044  -33.095 1.00 21.57  ? 258 GLN C CD    1 
ATOM   7287  O  OE1   . GLN C 1 245 ? -19.414  13.125  -33.032 1.00 21.57  ? 258 GLN C OE1   1 
ATOM   7288  N  NE2   . GLN C 1 245 ? -20.380  11.503  -34.245 1.00 21.57  ? 258 GLN C NE2   1 
ATOM   7289  N  N     . GLN C 1 246 ? -16.812  7.879   -31.207 1.00 55.82  ? 259 GLN C N     1 
ATOM   7290  C  CA    . GLN C 1 246 ? -15.441  7.506   -30.889 1.00 55.82  ? 259 GLN C CA    1 
ATOM   7291  C  C     . GLN C 1 246 ? -14.784  6.869   -32.106 1.00 55.82  ? 259 GLN C C     1 
ATOM   7292  O  O     . GLN C 1 246 ? -15.323  5.925   -32.678 1.00 55.82  ? 259 GLN C O     1 
ATOM   7293  C  CB    . GLN C 1 246 ? -15.433  6.514   -29.725 1.00 55.82  ? 259 GLN C CB    1 
ATOM   7294  C  CG    . GLN C 1 246 ? -14.209  6.595   -28.829 1.00 55.82  ? 259 GLN C CG    1 
ATOM   7295  C  CD    . GLN C 1 246 ? -14.236  7.796   -27.906 1.00 55.82  ? 259 GLN C CD    1 
ATOM   7296  O  OE1   . GLN C 1 246 ? -15.246  8.491   -27.801 1.00 55.82  ? 259 GLN C OE1   1 
ATOM   7297  N  NE2   . GLN C 1 246 ? -13.122  8.046   -27.230 1.00 55.82  ? 259 GLN C NE2   1 
ATOM   7298  N  N     . SER C 1 247 ? -13.624  7.387   -32.501 1.00 33.08  ? 260 SER C N     1 
ATOM   7299  C  CA    . SER C 1 247 ? -12.886  6.841   -33.638 1.00 33.08  ? 260 SER C CA    1 
ATOM   7300  C  C     . SER C 1 247 ? -12.553  5.369   -33.419 1.00 33.08  ? 260 SER C C     1 
ATOM   7301  O  O     . SER C 1 247 ? -12.259  4.955   -32.302 1.00 33.08  ? 260 SER C O     1 
ATOM   7302  C  CB    . SER C 1 247 ? -11.602  7.634   -33.872 1.00 33.08  ? 260 SER C CB    1 
ATOM   7303  O  OG    . SER C 1 247 ? -10.850  7.082   -34.937 1.00 33.08  ? 260 SER C OG    1 
ATOM   7304  N  N     . ILE C 1 248 ? -12.607  4.580   -34.488 1.00 26.38  ? 261 ILE C N     1 
ATOM   7305  C  CA    . ILE C 1 248 ? -12.345  3.149   -34.390 1.00 26.38  ? 261 ILE C CA    1 
ATOM   7306  C  C     . ILE C 1 248 ? -10.862  2.889   -34.141 1.00 26.38  ? 261 ILE C C     1 
ATOM   7307  O  O     . ILE C 1 248 ? -10.497  2.125   -33.251 1.00 26.38  ? 261 ILE C O     1 
ATOM   7308  C  CB    . ILE C 1 248 ? -12.788  2.401   -35.660 1.00 26.38  ? 261 ILE C CB    1 
ATOM   7309  C  CG1   . ILE C 1 248 ? -14.159  2.889   -36.121 1.00 26.38  ? 261 ILE C CG1   1 
ATOM   7310  C  CG2   . ILE C 1 248 ? -12.821  0.902   -35.415 1.00 26.38  ? 261 ILE C CG2   1 
ATOM   7311  C  CD1   . ILE C 1 248 ? -14.656  2.213   -37.374 1.00 26.38  ? 261 ILE C CD1   1 
ATOM   7312  N  N     . ALA C 1 249 ? -10.014  3.541   -34.927 1.00 38.38  ? 262 ALA C N     1 
ATOM   7313  C  CA    . ALA C 1 249 ? -8.572   3.358   -34.824 1.00 38.38  ? 262 ALA C CA    1 
ATOM   7314  C  C     . ALA C 1 249 ? -8.012   3.822   -33.482 1.00 38.38  ? 262 ALA C C     1 
ATOM   7315  O  O     . ALA C 1 249 ? -6.979   3.329   -33.032 1.00 38.38  ? 262 ALA C O     1 
ATOM   7316  C  CB    . ALA C 1 249 ? -7.877   4.077   -35.958 1.00 38.38  ? 262 ALA C CB    1 
ATOM   7317  N  N     . GLN C 1 250 ? -8.692   4.775   -32.851 1.00 33.27  ? 263 GLN C N     1 
ATOM   7318  C  CA    . GLN C 1 250 ? -8.235   5.341   -31.585 1.00 33.27  ? 263 GLN C CA    1 
ATOM   7319  C  C     . GLN C 1 250 ? -8.352   4.346   -30.433 1.00 33.27  ? 263 GLN C C     1 
ATOM   7320  O  O     . GLN C 1 250 ? -7.442   4.224   -29.612 1.00 33.27  ? 263 GLN C O     1 
ATOM   7321  C  CB    . GLN C 1 250 ? -9.023   6.614   -31.252 1.00 33.27  ? 263 GLN C CB    1 
ATOM   7322  C  CG    . GLN C 1 250 ? -8.524   7.357   -30.013 1.00 33.27  ? 263 GLN C CG    1 
ATOM   7323  C  CD    . GLN C 1 250 ? -9.410   8.530   -29.634 1.00 33.27  ? 263 GLN C CD    1 
ATOM   7324  O  OE1   . GLN C 1 250 ? -10.620  8.504   -29.854 1.00 33.27  ? 263 GLN C OE1   1 
ATOM   7325  N  NE2   . GLN C 1 250 ? -8.809   9.566   -29.060 1.00 33.27  ? 263 GLN C NE2   1 
ATOM   7326  N  N     . VAL C 1 251 ? -9.471   3.632   -30.379 1.00 43.57  ? 264 VAL C N     1 
ATOM   7327  C  CA    . VAL C 1 251 ? -9.749   2.737   -29.259 1.00 43.57  ? 264 VAL C CA    1 
ATOM   7328  C  C     . VAL C 1 251 ? -9.096   1.362   -29.415 1.00 43.57  ? 264 VAL C C     1 
ATOM   7329  O  O     . VAL C 1 251 ? -8.817   0.685   -28.424 1.00 43.57  ? 264 VAL C O     1 
ATOM   7330  C  CB    . VAL C 1 251 ? -11.256  2.568   -29.041 1.00 43.57  ? 264 VAL C CB    1 
ATOM   7331  C  CG1   . VAL C 1 251 ? -11.523  2.084   -27.635 1.00 43.57  ? 264 VAL C CG1   1 
ATOM   7332  C  CG2   . VAL C 1 251 ? -11.963  3.885   -29.274 1.00 43.57  ? 264 VAL C CG2   1 
ATOM   7333  N  N     . VAL C 1 252 ? -8.858   0.950   -30.656 1.00 22.27  ? 265 VAL C N     1 
ATOM   7334  C  CA    . VAL C 1 252 ? -8.158   -0.304  -30.909 1.00 22.27  ? 265 VAL C CA    1 
ATOM   7335  C  C     . VAL C 1 252 ? -6.689   -0.168  -30.513 1.00 22.27  ? 265 VAL C C     1 
ATOM   7336  O  O     . VAL C 1 252 ? -6.084   -1.105  -29.989 1.00 22.27  ? 265 VAL C O     1 
ATOM   7337  C  CB    . VAL C 1 252 ? -8.284   -0.739  -32.380 1.00 22.27  ? 265 VAL C CB    1 
ATOM   7338  C  CG1   . VAL C 1 252 ? -7.542   -2.042  -32.620 1.00 22.27  ? 265 VAL C CG1   1 
ATOM   7339  C  CG2   . VAL C 1 252 ? -9.745   -0.893  -32.761 1.00 22.27  ? 265 VAL C CG2   1 
ATOM   7340  N  N     . GLN C 1 253 ? -6.124   1.012   -30.754 1.00 40.30  ? 266 GLN C N     1 
ATOM   7341  C  CA    . GLN C 1 253 ? -4.749   1.300   -30.359 1.00 40.30  ? 266 GLN C CA    1 
ATOM   7342  C  C     . GLN C 1 253 ? -4.632   1.403   -28.839 1.00 40.30  ? 266 GLN C C     1 
ATOM   7343  O  O     . GLN C 1 253 ? -3.641   0.965   -28.259 1.00 40.30  ? 266 GLN C O     1 
ATOM   7344  C  CB    . GLN C 1 253 ? -4.249   2.581   -31.036 1.00 40.30  ? 266 GLN C CB    1 
ATOM   7345  C  CG    . GLN C 1 253 ? -2.822   2.976   -30.671 1.00 40.30  ? 266 GLN C CG    1 
ATOM   7346  C  CD    . GLN C 1 253 ? -2.768   4.049   -29.600 1.00 40.30  ? 266 GLN C CD    1 
ATOM   7347  O  OE1   . GLN C 1 253 ? -3.584   4.969   -29.588 1.00 40.30  ? 266 GLN C OE1   1 
ATOM   7348  N  NE2   . GLN C 1 253 ? -1.804   3.936   -28.692 1.00 40.30  ? 266 GLN C NE2   1 
ATOM   7349  N  N     . TRP C 1 254 ? -5.652   1.975   -28.205 1.00 11.41  ? 267 TRP C N     1 
ATOM   7350  C  CA    . TRP C 1 254 ? -5.713   2.054   -26.748 1.00 11.41  ? 267 TRP C CA    1 
ATOM   7351  C  C     . TRP C 1 254 ? -5.779   0.664   -26.131 1.00 11.41  ? 267 TRP C C     1 
ATOM   7352  O  O     . TRP C 1 254 ? -4.976   0.318   -25.265 1.00 11.41  ? 267 TRP C O     1 
ATOM   7353  C  CB    . TRP C 1 254 ? -6.934   2.860   -26.300 1.00 11.41  ? 267 TRP C CB    1 
ATOM   7354  C  CG    . TRP C 1 254 ? -6.782   4.343   -26.439 1.00 11.41  ? 267 TRP C CG    1 
ATOM   7355  C  CD1   . TRP C 1 254 ? -5.645   5.026   -26.761 1.00 11.41  ? 267 TRP C CD1   1 
ATOM   7356  C  CD2   . TRP C 1 254 ? -7.804   5.332   -26.261 1.00 11.41  ? 267 TRP C CD2   1 
ATOM   7357  N  NE1   . TRP C 1 254 ? -5.897   6.376   -26.793 1.00 11.41  ? 267 TRP C NE1   1 
ATOM   7358  C  CE2   . TRP C 1 254 ? -7.220   6.590   -26.490 1.00 11.41  ? 267 TRP C CE2   1 
ATOM   7359  C  CE3   . TRP C 1 254 ? -9.164   5.274   -25.931 1.00 11.41  ? 267 TRP C CE3   1 
ATOM   7360  C  CZ2   . TRP C 1 254 ? -7.940   7.781   -26.399 1.00 11.41  ? 267 TRP C CZ2   1 
ATOM   7361  C  CZ3   . TRP C 1 254 ? -9.879   6.456   -25.841 1.00 11.41  ? 267 TRP C CZ3   1 
ATOM   7362  C  CH2   . TRP C 1 254 ? -9.267   7.691   -26.074 1.00 11.41  ? 267 TRP C CH2   1 
ATOM   7363  N  N     . SER C 1 255 ? -6.745   -0.126  -26.591 1.00 15.73  ? 268 SER C N     1 
ATOM   7364  C  CA    . SER C 1 255 ? -6.986   -1.461  -26.061 1.00 15.73  ? 268 SER C CA    1 
ATOM   7365  C  C     . SER C 1 255 ? -5.771   -2.369  -26.209 1.00 15.73  ? 268 SER C C     1 
ATOM   7366  O  O     . SER C 1 255 ? -5.578   -3.288  -25.416 1.00 15.73  ? 268 SER C O     1 
ATOM   7367  C  CB    . SER C 1 255 ? -8.198   -2.089  -26.747 1.00 15.73  ? 268 SER C CB    1 
ATOM   7368  O  OG    . SER C 1 255 ? -8.445   -3.393  -26.260 1.00 15.73  ? 268 SER C OG    1 
ATOM   7369  N  N     . GLY C 1 256 ? -4.948   -2.104  -27.218 1.00 48.33  ? 269 GLY C N     1 
ATOM   7370  C  CA    . GLY C 1 256 ? -3.752   -2.895  -27.448 1.00 48.33  ? 269 GLY C CA    1 
ATOM   7371  C  C     . GLY C 1 256 ? -2.477   -2.220  -26.978 1.00 48.33  ? 269 GLY C C     1 
ATOM   7372  O  O     . GLY C 1 256 ? -1.379   -2.724  -27.213 1.00 48.33  ? 269 GLY C O     1 
ATOM   7373  N  N     . ALA C 1 257 ? -2.620   -1.079  -26.311 1.00 63.69  ? 270 ALA C N     1 
ATOM   7374  C  CA    . ALA C 1 257 ? -1.469   -0.341  -25.802 1.00 63.69  ? 270 ALA C CA    1 
ATOM   7375  C  C     . ALA C 1 257 ? -1.020   -0.858  -24.440 1.00 63.69  ? 270 ALA C C     1 
ATOM   7376  O  O     . ALA C 1 257 ? -1.546   -0.441  -23.408 1.00 63.69  ? 270 ALA C O     1 
ATOM   7377  C  CB    . ALA C 1 257 ? -1.783   1.141   -25.717 1.00 63.69  ? 270 ALA C CB    1 
ATOM   7378  N  N     . HIS C 1 258 ? -0.044   -1.761  -24.440 1.00 61.96  ? 271 HIS C N     1 
ATOM   7379  C  CA    . HIS C 1 258 ? 0.517    -2.276  -23.197 1.00 61.96  ? 271 HIS C CA    1 
ATOM   7380  C  C     . HIS C 1 258 ? 1.690    -1.401  -22.775 1.00 61.96  ? 271 HIS C C     1 
ATOM   7381  O  O     . HIS C 1 258 ? 2.479    -0.976  -23.618 1.00 61.96  ? 271 HIS C O     1 
ATOM   7382  C  CB    . HIS C 1 258 ? 0.973    -3.725  -23.374 1.00 61.96  ? 271 HIS C CB    1 
ATOM   7383  C  CG    . HIS C 1 258 ? 0.946    -4.526  -22.108 1.00 61.96  ? 271 HIS C CG    1 
ATOM   7384  N  ND1   . HIS C 1 258 ? -0.220   -5.012  -21.561 1.00 61.96  ? 271 HIS C ND1   1 
ATOM   7385  C  CD2   . HIS C 1 258 ? 1.943    -4.920  -21.282 1.00 61.96  ? 271 HIS C CD2   1 
ATOM   7386  C  CE1   . HIS C 1 258 ? 0.057    -5.674  -20.452 1.00 61.96  ? 271 HIS C CE1   1 
ATOM   7387  N  NE2   . HIS C 1 258 ? 1.364    -5.633  -20.259 1.00 61.96  ? 271 HIS C NE2   1 
ATOM   7388  N  N     . PRO C 1 259 ? 1.813    -1.130  -21.465 1.00 37.90  ? 272 PRO C N     1 
ATOM   7389  C  CA    . PRO C 1 259 ? 2.870    -0.251  -20.949 1.00 37.90  ? 272 PRO C CA    1 
ATOM   7390  C  C     . PRO C 1 259 ? 4.281    -0.806  -21.160 1.00 37.90  ? 272 PRO C C     1 
ATOM   7391  O  O     . PRO C 1 259 ? 5.256    -0.086  -20.947 1.00 37.90  ? 272 PRO C O     1 
ATOM   7392  C  CB    . PRO C 1 259 ? 2.549    -0.159  -19.454 1.00 37.90  ? 272 PRO C CB    1 
ATOM   7393  C  CG    . PRO C 1 259 ? 1.746    -1.380  -19.160 1.00 37.90  ? 272 PRO C CG    1 
ATOM   7394  C  CD    . PRO C 1 259 ? 0.931    -1.614  -20.390 1.00 37.90  ? 272 PRO C CD    1 
ATOM   7395  N  N     . VAL C 1 260 ? 4.381    -2.066  -21.570 1.00 35.90  ? 273 VAL C N     1 
ATOM   7396  C  CA    . VAL C 1 260 ? 5.671    -2.676  -21.868 1.00 35.90  ? 273 VAL C CA    1 
ATOM   7397  C  C     . VAL C 1 260 ? 6.182    -2.214  -23.233 1.00 35.90  ? 273 VAL C C     1 
ATOM   7398  O  O     . VAL C 1 260 ? 7.384    -2.016  -23.426 1.00 35.90  ? 273 VAL C O     1 
ATOM   7399  C  CB    . VAL C 1 260 ? 5.585    -4.217  -21.817 1.00 35.90  ? 273 VAL C CB    1 
ATOM   7400  C  CG1   . VAL C 1 260 ? 6.881    -4.853  -22.291 1.00 35.90  ? 273 VAL C CG1   1 
ATOM   7401  C  CG2   . VAL C 1 260 ? 5.254    -4.679  -20.407 1.00 35.90  ? 273 VAL C CG2   1 
ATOM   7402  N  N     . LEU C 1 261 ? 5.260    -2.025  -24.173 1.00 34.84  ? 274 LEU C N     1 
ATOM   7403  C  CA    . LEU C 1 261 ? 5.614    -1.584  -25.521 1.00 34.84  ? 274 LEU C CA    1 
ATOM   7404  C  C     . LEU C 1 261 ? 5.082    -0.188  -25.843 1.00 34.84  ? 274 LEU C C     1 
ATOM   7405  O  O     . LEU C 1 261 ? 5.750    0.595   -26.518 1.00 34.84  ? 274 LEU C O     1 
ATOM   7406  C  CB    . LEU C 1 261 ? 5.114    -2.585  -26.566 1.00 34.84  ? 274 LEU C CB    1 
ATOM   7407  C  CG    . LEU C 1 261 ? 6.140    -3.563  -27.138 1.00 34.84  ? 274 LEU C CG    1 
ATOM   7408  C  CD1   . LEU C 1 261 ? 6.834    -4.328  -26.029 1.00 34.84  ? 274 LEU C CD1   1 
ATOM   7409  C  CD2   . LEU C 1 261 ? 5.487    -4.524  -28.119 1.00 34.84  ? 274 LEU C CD2   1 
ATOM   7410  N  N     . PHE C 1 262 ? 3.883    0.120   -25.360 1.00 34.13  ? 275 PHE C N     1 
ATOM   7411  C  CA    . PHE C 1 262 ? 3.241    1.389   -25.680 1.00 34.13  ? 275 PHE C CA    1 
ATOM   7412  C  C     . PHE C 1 262 ? 3.107    2.315   -24.475 1.00 34.13  ? 275 PHE C C     1 
ATOM   7413  O  O     . PHE C 1 262 ? 2.847    1.864   -23.361 1.00 34.13  ? 275 PHE C O     1 
ATOM   7414  C  CB    . PHE C 1 262 ? 1.856    1.142   -26.285 1.00 34.13  ? 275 PHE C CB    1 
ATOM   7415  C  CG    . PHE C 1 262 ? 1.889    0.613   -27.688 1.00 34.13  ? 275 PHE C CG    1 
ATOM   7416  C  CD1   . PHE C 1 262 ? 1.894    -0.752  -27.929 1.00 34.13  ? 275 PHE C CD1   1 
ATOM   7417  C  CD2   . PHE C 1 262 ? 1.909    1.482   -28.767 1.00 34.13  ? 275 PHE C CD2   1 
ATOM   7418  C  CE1   . PHE C 1 262 ? 1.923    -1.240  -29.222 1.00 34.13  ? 275 PHE C CE1   1 
ATOM   7419  C  CE2   . PHE C 1 262 ? 1.938    1.002   -30.062 1.00 34.13  ? 275 PHE C CE2   1 
ATOM   7420  C  CZ    . PHE C 1 262 ? 1.945    -0.361  -30.289 1.00 34.13  ? 275 PHE C CZ    1 
ATOM   7421  N  N     . VAL C 1 263 ? 3.288    3.613   -24.708 1.00 41.45  ? 276 VAL C N     1 
ATOM   7422  C  CA    . VAL C 1 263 ? 2.987    4.617   -23.697 1.00 41.45  ? 276 VAL C CA    1 
ATOM   7423  C  C     . VAL C 1 263 ? 1.471    4.681   -23.535 1.00 41.45  ? 276 VAL C C     1 
ATOM   7424  O  O     . VAL C 1 263 ? 0.735    4.296   -24.444 1.00 41.45  ? 276 VAL C O     1 
ATOM   7425  C  CB    . VAL C 1 263 ? 3.530    6.011   -24.091 1.00 41.45  ? 276 VAL C CB    1 
ATOM   7426  C  CG1   . VAL C 1 263 ? 5.010    5.937   -24.412 1.00 41.45  ? 276 VAL C CG1   1 
ATOM   7427  C  CG2   . VAL C 1 263 ? 2.762    6.575   -25.270 1.00 41.45  ? 276 VAL C CG2   1 
ATOM   7428  N  N     . PRO C 1 264 ? 0.992    5.146   -22.370 1.00 30.68  ? 277 PRO C N     1 
ATOM   7429  C  CA    . PRO C 1 264 ? -0.459   5.275   -22.201 1.00 30.68  ? 277 PRO C CA    1 
ATOM   7430  C  C     . PRO C 1 264 ? -1.026   6.374   -23.090 1.00 30.68  ? 277 PRO C C     1 
ATOM   7431  O  O     . PRO C 1 264 ? -0.279   7.239   -23.550 1.00 30.68  ? 277 PRO C O     1 
ATOM   7432  C  CB    . PRO C 1 264 ? -0.606   5.663   -20.727 1.00 30.68  ? 277 PRO C CB    1 
ATOM   7433  C  CG    . PRO C 1 264 ? 0.707    6.262   -20.353 1.00 30.68  ? 277 PRO C CG    1 
ATOM   7434  C  CD    . PRO C 1 264 ? 1.726    5.502   -21.144 1.00 30.68  ? 277 PRO C CD    1 
ATOM   7435  N  N     . GLY C 1 265 ? -2.332   6.337   -23.332 1.00 29.19  ? 278 GLY C N     1 
ATOM   7436  C  CA    . GLY C 1 265 ? -2.976   7.357   -24.138 1.00 29.19  ? 278 GLY C CA    1 
ATOM   7437  C  C     . GLY C 1 265 ? -3.965   8.175   -23.332 1.00 29.19  ? 278 GLY C C     1 
ATOM   7438  O  O     . GLY C 1 265 ? -4.647   7.645   -22.456 1.00 29.19  ? 278 GLY C O     1 
ATOM   7439  N  N     . ARG C 1 266 ? -4.042   9.470   -23.623 1.00 58.65  ? 279 ARG C N     1 
ATOM   7440  C  CA    . ARG C 1 266 ? -5.003   10.342  -22.955 1.00 58.65  ? 279 ARG C CA    1 
ATOM   7441  C  C     . ARG C 1 266 ? -6.204   10.623  -23.850 1.00 58.65  ? 279 ARG C C     1 
ATOM   7442  O  O     . ARG C 1 266 ? -6.057   10.788  -25.061 1.00 58.65  ? 279 ARG C O     1 
ATOM   7443  C  CB    . ARG C 1 266 ? -4.354   11.667  -22.552 1.00 58.65  ? 279 ARG C CB    1 
ATOM   7444  C  CG    . ARG C 1 266 ? -3.222   11.547  -21.545 1.00 58.65  ? 279 ARG C CG    1 
ATOM   7445  C  CD    . ARG C 1 266 ? -2.798   12.920  -21.048 1.00 58.65  ? 279 ARG C CD    1 
ATOM   7446  N  NE    . ARG C 1 266 ? -1.554   12.873  -20.288 1.00 58.65  ? 279 ARG C NE    1 
ATOM   7447  C  CZ    . ARG C 1 266 ? -0.346   12.913  -20.839 1.00 58.65  ? 279 ARG C CZ    1 
ATOM   7448  N  NH1   . ARG C 1 266 ? -0.219   12.996  -22.156 1.00 58.65  ? 279 ARG C NH1   1 
ATOM   7449  N  NH2   . ARG C 1 266 ? 0.739    12.866  -20.076 1.00 58.65  ? 279 ARG C NH2   1 
ATOM   7450  N  N     . ASN C 1 267 ? -7.390   10.678  -23.252 1.00 31.51  ? 280 ASN C N     1 
ATOM   7451  C  CA    . ASN C 1 267 ? -8.589   11.056  -23.989 1.00 31.51  ? 280 ASN C CA    1 
ATOM   7452  C  C     . ASN C 1 267 ? -8.902   12.543  -23.838 1.00 31.51  ? 280 ASN C C     1 
ATOM   7453  O  O     . ASN C 1 267 ? -8.025   13.337  -23.494 1.00 31.51  ? 280 ASN C O     1 
ATOM   7454  C  CB    . ASN C 1 267 ? -9.793   10.200  -23.577 1.00 31.51  ? 280 ASN C CB    1 
ATOM   7455  C  CG    . ASN C 1 267 ? -10.099  10.279  -22.087 1.00 31.51  ? 280 ASN C CG    1 
ATOM   7456  O  OD1   . ASN C 1 267 ? -9.618   11.164  -21.383 1.00 31.51  ? 280 ASN C OD1   1 
ATOM   7457  N  ND2   . ASN C 1 267 ? -10.919  9.350   -21.605 1.00 31.51  ? 280 ASN C ND2   1 
ATOM   7458  N  N     . ALA C 1 268 ? -10.152  12.913  -24.091 1.00 66.74  ? 281 ALA C N     1 
ATOM   7459  C  CA    . ALA C 1 268 ? -10.574  14.305  -23.989 1.00 66.74  ? 281 ALA C CA    1 
ATOM   7460  C  C     . ALA C 1 268 ? -10.476  14.824  -22.557 1.00 66.74  ? 281 ALA C C     1 
ATOM   7461  O  O     . ALA C 1 268 ? -10.140  15.987  -22.332 1.00 66.74  ? 281 ALA C O     1 
ATOM   7462  C  CB    . ALA C 1 268 ? -11.990  14.468  -24.515 1.00 66.74  ? 281 ALA C CB    1 
ATOM   7463  N  N     . LYS C 1 269 ? -10.770  13.955  -21.595 1.00 60.77  ? 282 LYS C N     1 
ATOM   7464  C  CA    . LYS C 1 269 ? -10.769  14.335  -20.186 1.00 60.77  ? 282 LYS C CA    1 
ATOM   7465  C  C     . LYS C 1 269 ? -9.358   14.518  -19.630 1.00 60.77  ? 282 LYS C C     1 
ATOM   7466  O  O     . LYS C 1 269 ? -9.162   15.220  -18.636 1.00 60.77  ? 282 LYS C O     1 
ATOM   7467  C  CB    . LYS C 1 269 ? -11.529  13.300  -19.354 1.00 60.77  ? 282 LYS C CB    1 
ATOM   7468  C  CG    . LYS C 1 269 ? -12.983  13.109  -19.765 1.00 60.77  ? 282 LYS C CG    1 
ATOM   7469  C  CD    . LYS C 1 269 ? -13.694  12.109  -18.862 1.00 60.77  ? 282 LYS C CD    1 
ATOM   7470  C  CE    . LYS C 1 269 ? -15.144  11.915  -19.281 1.00 60.77  ? 282 LYS C CE    1 
ATOM   7471  N  NZ    . LYS C 1 269 ? -15.923  13.180  -19.204 1.00 60.77  ? 282 LYS C NZ    1 
ATOM   7472  N  N     . GLY C 1 270 ? -8.381   13.885  -20.271 1.00 61.67  ? 283 GLY C N     1 
ATOM   7473  C  CA    . GLY C 1 270 ? -7.010   13.923  -19.795 1.00 61.67  ? 283 GLY C CA    1 
ATOM   7474  C  C     . GLY C 1 270 ? -6.672   12.684  -18.988 1.00 61.67  ? 283 GLY C C     1 
ATOM   7475  O  O     . GLY C 1 270 ? -5.722   12.676  -18.204 1.00 61.67  ? 283 GLY C O     1 
ATOM   7476  N  N     . GLU C 1 271 ? -7.458   11.632  -19.188 1.00 40.86  ? 284 GLU C N     1 
ATOM   7477  C  CA    . GLU C 1 271 ? -7.295   10.392  -18.443 1.00 40.86  ? 284 GLU C CA    1 
ATOM   7478  C  C     . GLU C 1 271 ? -6.441   9.386   -19.210 1.00 40.86  ? 284 GLU C C     1 
ATOM   7479  O  O     . GLU C 1 271 ? -6.724   9.078   -20.369 1.00 40.86  ? 284 GLU C O     1 
ATOM   7480  C  CB    . GLU C 1 271 ? -8.666   9.794   -18.119 1.00 40.86  ? 284 GLU C CB    1 
ATOM   7481  C  CG    . GLU C 1 271 ? -9.548   10.706  -17.275 1.00 40.86  ? 284 GLU C CG    1 
ATOM   7482  C  CD    . GLU C 1 271 ? -11.004  10.281  -17.264 1.00 40.86  ? 284 GLU C CD    1 
ATOM   7483  O  OE1   . GLU C 1 271 ? -11.758  10.766  -16.395 1.00 40.86  ? 284 GLU C OE1   1 
ATOM   7484  O  OE2   . GLU C 1 271 ? -11.398  9.471   -18.127 1.00 40.86  ? 284 GLU C OE2   1 
ATOM   7485  N  N     . TYR C 1 272 ? -5.397   8.880   -18.558 1.00 60.84  ? 285 TYR C N     1 
ATOM   7486  C  CA    . TYR C 1 272 ? -4.511   7.886   -19.158 1.00 60.84  ? 285 TYR C CA    1 
ATOM   7487  C  C     . TYR C 1 272 ? -5.279   6.612   -19.501 1.00 60.84  ? 285 TYR C C     1 
ATOM   7488  O  O     . TYR C 1 272 ? -6.140   6.174   -18.736 1.00 60.84  ? 285 TYR C O     1 
ATOM   7489  C  CB    . TYR C 1 272 ? -3.355   7.562   -18.208 1.00 60.84  ? 285 TYR C CB    1 
ATOM   7490  C  CG    . TYR C 1 272 ? -2.435   8.733   -17.923 1.00 60.84  ? 285 TYR C CG    1 
ATOM   7491  C  CD1   . TYR C 1 272 ? -1.221   8.864   -18.583 1.00 60.84  ? 285 TYR C CD1   1 
ATOM   7492  C  CD2   . TYR C 1 272 ? -2.780   9.705   -16.992 1.00 60.84  ? 285 TYR C CD2   1 
ATOM   7493  C  CE1   . TYR C 1 272 ? -0.379   9.929   -18.326 1.00 60.84  ? 285 TYR C CE1   1 
ATOM   7494  C  CE2   . TYR C 1 272 ? -1.945   10.774  -16.732 1.00 60.84  ? 285 TYR C CE2   1 
ATOM   7495  C  CZ    . TYR C 1 272 ? -0.746   10.881  -17.400 1.00 60.84  ? 285 TYR C CZ    1 
ATOM   7496  O  OH    . TYR C 1 272 ? 0.089    11.945  -17.142 1.00 60.84  ? 285 TYR C OH    1 
ATOM   7497  N  N     . ILE C 1 273 ? -4.974   6.027   -20.657 1.00 27.80  ? 286 ILE C N     1 
ATOM   7498  C  CA    . ILE C 1 273 ? -5.640   4.805   -21.106 1.00 27.80  ? 286 ILE C CA    1 
ATOM   7499  C  C     . ILE C 1 273 ? -4.627   3.822   -21.694 1.00 27.80  ? 286 ILE C C     1 
ATOM   7500  O  O     . ILE C 1 273 ? -3.753   4.216   -22.466 1.00 27.80  ? 286 ILE C O     1 
ATOM   7501  C  CB    . ILE C 1 273 ? -6.750   5.116   -22.141 1.00 27.80  ? 286 ILE C CB    1 
ATOM   7502  C  CG1   . ILE C 1 273 ? -7.874   5.924   -21.491 1.00 27.80  ? 286 ILE C CG1   1 
ATOM   7503  C  CG2   . ILE C 1 273 ? -7.314   3.840   -22.740 1.00 27.80  ? 286 ILE C CG2   1 
ATOM   7504  C  CD1   . ILE C 1 273 ? -9.084   6.123   -22.371 1.00 27.80  ? 286 ILE C CD1   1 
ATOM   7505  N  N     . ALA C 1 274 ? -4.742   2.549   -21.321 1.00 37.45  ? 287 ALA C N     1 
ATOM   7506  C  CA    . ALA C 1 274 ? -3.822   1.520   -21.801 1.00 37.45  ? 287 ALA C CA    1 
ATOM   7507  C  C     . ALA C 1 274 ? -4.548   0.238   -22.205 1.00 37.45  ? 287 ALA C C     1 
ATOM   7508  O  O     . ALA C 1 274 ? -5.767   0.231   -22.368 1.00 37.45  ? 287 ALA C O     1 
ATOM   7509  C  CB    . ALA C 1 274 ? -2.764   1.219   -20.749 1.00 37.45  ? 287 ALA C CB    1 
ATOM   7510  N  N     . ASP C 1 275 ? -3.779   -0.840  -22.354 1.00 27.48  ? 288 ASP C N     1 
ATOM   7511  C  CA    . ASP C 1 275 ? -4.291   -2.151  -22.761 1.00 27.48  ? 288 ASP C CA    1 
ATOM   7512  C  C     . ASP C 1 275 ? -5.475   -2.603  -21.910 1.00 27.48  ? 288 ASP C C     1 
ATOM   7513  O  O     . ASP C 1 275 ? -5.443   -2.499  -20.687 1.00 27.48  ? 288 ASP C O     1 
ATOM   7514  C  CB    . ASP C 1 275 ? -3.165   -3.189  -22.681 1.00 27.48  ? 288 ASP C CB    1 
ATOM   7515  C  CG    . ASP C 1 275 ? -3.506   -4.497  -23.384 1.00 27.48  ? 288 ASP C CG    1 
ATOM   7516  O  OD1   . ASP C 1 275 ? -4.662   -4.962  -23.298 1.00 27.48  ? 288 ASP C OD1   1 
ATOM   7517  O  OD2   . ASP C 1 275 ? -2.598   -5.069  -24.021 1.00 27.48  ? 288 ASP C OD2   1 
ATOM   7518  N  N     . GLY C 1 276 ? -6.512   -3.117  -22.565 1.00 5.26   ? 289 GLY C N     1 
ATOM   7519  C  CA    . GLY C 1 276 ? -7.696   -3.583  -21.868 1.00 5.26   ? 289 GLY C CA    1 
ATOM   7520  C  C     . GLY C 1 276 ? -7.588   -5.030  -21.428 1.00 5.26   ? 289 GLY C C     1 
ATOM   7521  O  O     . GLY C 1 276 ? -8.594   -5.672  -21.117 1.00 5.26   ? 289 GLY C O     1 
ATOM   7522  N  N     . GLY C 1 277 ? -6.363   -5.544  -21.399 1.00 30.59  ? 290 GLY C N     1 
ATOM   7523  C  CA    . GLY C 1 277 ? -6.125   -6.916  -20.995 1.00 30.59  ? 290 GLY C CA    1 
ATOM   7524  C  C     . GLY C 1 277 ? -4.876   -7.086  -20.152 1.00 30.59  ? 290 GLY C C     1 
ATOM   7525  O  O     . GLY C 1 277 ? -4.233   -8.136  -20.192 1.00 30.59  ? 290 GLY C O     1 
ATOM   7526  N  N     . ILE C 1 278 ? -4.530   -6.047  -19.394 1.00 21.51  ? 291 ILE C N     1 
ATOM   7527  C  CA    . ILE C 1 278 ? -3.422   -6.117  -18.445 1.00 21.51  ? 291 ILE C CA    1 
ATOM   7528  C  C     . ILE C 1 278 ? -3.659   -7.278  -17.486 1.00 21.51  ? 291 ILE C C     1 
ATOM   7529  O  O     . ILE C 1 278 ? -2.748   -8.050  -17.185 1.00 21.51  ? 291 ILE C O     1 
ATOM   7530  C  CB    . ILE C 1 278 ? -3.258   -4.799  -17.663 1.00 21.51  ? 291 ILE C CB    1 
ATOM   7531  C  CG1   . ILE C 1 278 ? -2.753   -3.691  -18.588 1.00 21.51  ? 291 ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C 1 278 ? -2.303   -4.978  -16.500 1.00 21.51  ? 291 ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C 1 278 ? -2.435   -2.389  -17.878 1.00 21.51  ? 291 ILE C CD1   1 
ATOM   7534  N  N     . LEU C 1 279 ? -4.896   -7.394  -17.018 1.00 42.97  ? 292 LEU C N     1 
ATOM   7535  C  CA    . LEU C 1 279 ? -5.349   -8.594  -16.333 1.00 42.97  ? 292 LEU C CA    1 
ATOM   7536  C  C     . LEU C 1 279 ? -6.255   -9.355  -17.291 1.00 42.97  ? 292 LEU C C     1 
ATOM   7537  O  O     . LEU C 1 279 ? -6.954   -8.744  -18.101 1.00 42.97  ? 292 LEU C O     1 
ATOM   7538  C  CB    . LEU C 1 279 ? -6.119   -8.239  -15.062 1.00 42.97  ? 292 LEU C CB    1 
ATOM   7539  C  CG    . LEU C 1 279 ? -5.339   -7.578  -13.927 1.00 42.97  ? 292 LEU C CG    1 
ATOM   7540  C  CD1   . LEU C 1 279 ? -6.244   -7.306  -12.739 1.00 42.97  ? 292 LEU C CD1   1 
ATOM   7541  C  CD2   . LEU C 1 279 ? -4.180   -8.457  -13.519 1.00 42.97  ? 292 LEU C CD2   1 
ATOM   7542  N  N     . ASP C 1 280 ? -6.233   -10.681 -17.213 1.00 39.47  ? 293 ASP C N     1 
ATOM   7543  C  CA    . ASP C 1 280 ? -7.105   -11.492 -18.050 1.00 39.47  ? 293 ASP C CA    1 
ATOM   7544  C  C     . ASP C 1 280 ? -8.566   -11.184 -17.743 1.00 39.47  ? 293 ASP C C     1 
ATOM   7545  O  O     . ASP C 1 280 ? -8.972   -11.150 -16.581 1.00 39.47  ? 293 ASP C O     1 
ATOM   7546  C  CB    . ASP C 1 280 ? -6.818   -12.983 -17.866 1.00 39.47  ? 293 ASP C CB    1 
ATOM   7547  C  CG    . ASP C 1 280 ? -5.596   -13.442 -18.639 1.00 39.47  ? 293 ASP C CG    1 
ATOM   7548  O  OD1   . ASP C 1 280 ? -5.244   -12.783 -19.639 1.00 39.47  ? 293 ASP C OD1   1 
ATOM   7549  O  OD2   . ASP C 1 280 ? -4.994   -14.465 -18.252 1.00 39.47  ? 293 ASP C OD2   1 
ATOM   7550  N  N     . ASN C 1 281 ? -9.344   -10.945 -18.793 1.00 125.17 ? 294 ASN C N     1 
ATOM   7551  C  CA    . ASN C 1 281 ? -10.749  -10.586 -18.649 1.00 125.17 ? 294 ASN C CA    1 
ATOM   7552  C  C     . ASN C 1 281 ? -11.581  -11.066 -19.833 1.00 125.17 ? 294 ASN C C     1 
ATOM   7553  O  O     . ASN C 1 281 ? -11.149  -10.977 -20.982 1.00 125.17 ? 294 ASN C O     1 
ATOM   7554  C  CB    . ASN C 1 281 ? -10.894  -9.073  -18.477 1.00 125.17 ? 294 ASN C CB    1 
ATOM   7555  C  CG    . ASN C 1 281 ? -12.280  -8.575  -18.839 1.00 125.17 ? 294 ASN C CG    1 
ATOM   7556  O  OD1   . ASN C 1 281 ? -12.480  -7.981  -19.898 1.00 125.17 ? 294 ASN C OD1   1 
ATOM   7557  N  ND2   . ASN C 1 281 ? -13.245  -8.817  -17.960 1.00 125.17 ? 294 ASN C ND2   1 
ATOM   7558  N  N     . MET C 1 282 ? -12.772  -11.579 -19.545 1.00 62.08  ? 295 MET C N     1 
ATOM   7559  C  CA    . MET C 1 282 ? -13.669  -12.055 -20.589 1.00 62.08  ? 295 MET C CA    1 
ATOM   7560  C  C     . MET C 1 282 ? -14.871  -11.130 -20.701 1.00 62.08  ? 295 MET C C     1 
ATOM   7561  O  O     . MET C 1 282 ? -15.796  -11.214 -19.894 1.00 62.08  ? 295 MET C O     1 
ATOM   7562  C  CB    . MET C 1 282 ? -14.134  -13.481 -20.290 1.00 62.08  ? 295 MET C CB    1 
ATOM   7563  C  CG    . MET C 1 282 ? -15.021  -14.109 -21.360 1.00 62.08  ? 295 MET C CG    1 
ATOM   7564  S  SD    . MET C 1 282 ? -14.120  -15.005 -22.642 1.00 62.08  ? 295 MET C SD    1 
ATOM   7565  C  CE    . MET C 1 282 ? -13.656  -13.677 -23.750 1.00 62.08  ? 295 MET C CE    1 
ATOM   7566  N  N     . PRO C 1 283 ? -14.855  -10.234 -21.698 1.00 42.46  ? 296 PRO C N     1 
ATOM   7567  C  CA    . PRO C 1 283 ? -15.963  -9.299  -21.915 1.00 42.46  ? 296 PRO C CA    1 
ATOM   7568  C  C     . PRO C 1 283 ? -17.252  -10.028 -22.272 1.00 42.46  ? 296 PRO C C     1 
ATOM   7569  O  O     . PRO C 1 283 ? -17.213  -11.178 -22.709 1.00 42.46  ? 296 PRO C O     1 
ATOM   7570  C  CB    . PRO C 1 283 ? -15.493  -8.472  -23.115 1.00 42.46  ? 296 PRO C CB    1 
ATOM   7571  C  CG    . PRO C 1 283 ? -14.007  -8.621  -23.134 1.00 42.46  ? 296 PRO C CG    1 
ATOM   7572  C  CD    . PRO C 1 283 ? -13.748  -10.009 -22.644 1.00 42.46  ? 296 PRO C CD    1 
ATOM   7573  N  N     . GLU C 1 284 ? -18.384  -9.361  -22.079 1.00 59.87  ? 297 GLU C N     1 
ATOM   7574  C  CA    . GLU C 1 284 ? -19.670  -9.916  -22.470 1.00 59.87  ? 297 GLU C CA    1 
ATOM   7575  C  C     . GLU C 1 284 ? -20.345  -8.992  -23.474 1.00 59.87  ? 297 GLU C C     1 
ATOM   7576  O  O     . GLU C 1 284 ? -19.936  -7.843  -23.645 1.00 59.87  ? 297 GLU C O     1 
ATOM   7577  C  CB    . GLU C 1 284 ? -20.567  -10.120 -21.248 1.00 59.87  ? 297 GLU C CB    1 
ATOM   7578  C  CG    . GLU C 1 284 ? -20.027  -11.124 -20.241 1.00 59.87  ? 297 GLU C CG    1 
ATOM   7579  C  CD    . GLU C 1 284 ? -20.916  -11.268 -19.020 1.00 59.87  ? 297 GLU C CD    1 
ATOM   7580  O  OE1   . GLU C 1 284 ? -22.008  -10.663 -19.001 1.00 59.87  ? 297 GLU C OE1   1 
ATOM   7581  O  OE2   . GLU C 1 284 ? -20.519  -11.986 -18.079 1.00 59.87  ? 297 GLU C OE2   1 
ATOM   7582  N  N     . ILE C 1 285 ? -21.374  -9.498  -24.144 1.00 30.02  ? 298 ILE C N     1 
ATOM   7583  C  CA    . ILE C 1 285 ? -22.126  -8.692  -25.095 1.00 30.02  ? 298 ILE C CA    1 
ATOM   7584  C  C     . ILE C 1 285 ? -23.542  -8.459  -24.580 1.00 30.02  ? 298 ILE C C     1 
ATOM   7585  O  O     . ILE C 1 285 ? -24.339  -9.393  -24.489 1.00 30.02  ? 298 ILE C O     1 
ATOM   7586  C  CB    . ILE C 1 285 ? -22.179  -9.353  -26.481 1.00 30.02  ? 298 ILE C CB    1 
ATOM   7587  C  CG1   . ILE C 1 285 ? -20.781  -9.805  -26.907 1.00 30.02  ? 298 ILE C CG1   1 
ATOM   7588  C  CG2   . ILE C 1 285 ? -22.764  -8.395  -27.501 1.00 30.02  ? 298 ILE C CG2   1 
ATOM   7589  C  CD1   . ILE C 1 285 ? -20.748  -10.535 -28.234 1.00 30.02  ? 298 ILE C CD1   1 
ATOM   7590  N  N     . GLU C 1 286 ? -23.844  -7.210  -24.240 1.00 45.00  ? 299 GLU C N     1 
ATOM   7591  C  CA    . GLU C 1 286 ? -25.138  -6.857  -23.668 1.00 45.00  ? 299 GLU C CA    1 
ATOM   7592  C  C     . GLU C 1 286 ? -26.256  -7.079  -24.676 1.00 45.00  ? 299 GLU C C     1 
ATOM   7593  O  O     . GLU C 1 286 ? -26.188  -6.597  -25.805 1.00 45.00  ? 299 GLU C O     1 
ATOM   7594  C  CB    . GLU C 1 286 ? -25.132  -5.402  -23.198 1.00 45.00  ? 299 GLU C CB    1 
ATOM   7595  C  CG    . GLU C 1 286 ? -26.305  -5.025  -22.307 1.00 45.00  ? 299 GLU C CG    1 
ATOM   7596  C  CD    . GLU C 1 286 ? -26.152  -3.646  -21.696 1.00 45.00  ? 299 GLU C CD    1 
ATOM   7597  O  OE1   . GLU C 1 286 ? -26.606  -3.453  -20.549 1.00 45.00  ? 299 GLU C OE1   1 
ATOM   7598  O  OE2   . GLU C 1 286 ? -25.580  -2.757  -22.360 1.00 45.00  ? 299 GLU C OE2   1 
ATOM   7599  N  N     . GLY C 1 287 ? -27.283  -7.814  -24.262 1.00 33.24  ? 300 GLY C N     1 
ATOM   7600  C  CA    . GLY C 1 287 ? -28.399  -8.120  -25.138 1.00 33.24  ? 300 GLY C CA    1 
ATOM   7601  C  C     . GLY C 1 287 ? -28.311  -9.519  -25.714 1.00 33.24  ? 300 GLY C C     1 
ATOM   7602  O  O     . GLY C 1 287 ? -29.288  -10.037 -26.254 1.00 33.24  ? 300 GLY C O     1 
ATOM   7603  N  N     . LEU C 1 288 ? -27.135  -10.131 -25.604 1.00 34.06  ? 301 LEU C N     1 
ATOM   7604  C  CA    . LEU C 1 288 ? -26.939  -11.494 -26.084 1.00 34.06  ? 301 LEU C CA    1 
ATOM   7605  C  C     . LEU C 1 288 ? -26.902  -12.487 -24.927 1.00 34.06  ? 301 LEU C C     1 
ATOM   7606  O  O     . LEU C 1 288 ? -26.450  -12.159 -23.830 1.00 34.06  ? 301 LEU C O     1 
ATOM   7607  C  CB    . LEU C 1 288 ? -25.654  -11.604 -26.907 1.00 34.06  ? 301 LEU C CB    1 
ATOM   7608  C  CG    . LEU C 1 288 ? -25.646  -10.943 -28.285 1.00 34.06  ? 301 LEU C CG    1 
ATOM   7609  C  CD1   . LEU C 1 288 ? -24.361  -11.261 -29.025 1.00 34.06  ? 301 LEU C CD1   1 
ATOM   7610  C  CD2   . LEU C 1 288 ? -26.845  -11.394 -29.095 1.00 34.06  ? 301 LEU C CD2   1 
ATOM   7611  N  N     . ASP C 1 289 ? -27.384  -13.701 -25.178 1.00 46.48  ? 302 ASP C N     1 
ATOM   7612  C  CA    . ASP C 1 289 ? -27.367  -14.755 -24.170 1.00 46.48  ? 302 ASP C CA    1 
ATOM   7613  C  C     . ASP C 1 289 ? -26.057  -15.537 -24.237 1.00 46.48  ? 302 ASP C C     1 
ATOM   7614  O  O     . ASP C 1 289 ? -25.349  -15.480 -25.241 1.00 46.48  ? 302 ASP C O     1 
ATOM   7615  C  CB    . ASP C 1 289 ? -28.563  -15.691 -24.355 1.00 46.48  ? 302 ASP C CB    1 
ATOM   7616  C  CG    . ASP C 1 289 ? -29.894  -14.961 -24.285 1.00 46.48  ? 302 ASP C CG    1 
ATOM   7617  O  OD1   . ASP C 1 289 ? -29.949  -13.880 -23.662 1.00 46.48  ? 302 ASP C OD1   1 
ATOM   7618  O  OD2   . ASP C 1 289 ? -30.884  -15.471 -24.851 1.00 46.48  ? 302 ASP C OD2   1 
ATOM   7619  N  N     . ARG C 1 290 ? -25.739  -16.262 -23.168 1.00 40.91  ? 303 ARG C N     1 
ATOM   7620  C  CA    . ARG C 1 290 ? -24.484  -17.001 -23.080 1.00 40.91  ? 303 ARG C CA    1 
ATOM   7621  C  C     . ARG C 1 290 ? -24.397  -18.093 -24.142 1.00 40.91  ? 303 ARG C C     1 
ATOM   7622  O  O     . ARG C 1 290 ? -23.323  -18.372 -24.675 1.00 40.91  ? 303 ARG C O     1 
ATOM   7623  C  CB    . ARG C 1 290 ? -24.331  -17.623 -21.689 1.00 40.91  ? 303 ARG C CB    1 
ATOM   7624  C  CG    . ARG C 1 290 ? -22.944  -18.179 -21.394 1.00 40.91  ? 303 ARG C CG    1 
ATOM   7625  C  CD    . ARG C 1 290 ? -23.005  -19.346 -20.418 1.00 40.91  ? 303 ARG C CD    1 
ATOM   7626  N  NE    . ARG C 1 290 ? -23.488  -20.566 -21.058 1.00 40.91  ? 303 ARG C NE    1 
ATOM   7627  C  CZ    . ARG C 1 290 ? -22.707  -21.434 -21.694 1.00 40.91  ? 303 ARG C CZ    1 
ATOM   7628  N  NH1   . ARG C 1 290 ? -21.402  -21.217 -21.779 1.00 40.91  ? 303 ARG C NH1   1 
ATOM   7629  N  NH2   . ARG C 1 290 ? -23.229  -22.519 -22.249 1.00 40.91  ? 303 ARG C NH2   1 
ATOM   7630  N  N     . GLU C 1 291 ? -25.538  -18.701 -24.447 1.00 65.66  ? 304 GLU C N     1 
ATOM   7631  C  CA    . GLU C 1 291 ? -25.597  -19.804 -25.398 1.00 65.66  ? 304 GLU C CA    1 
ATOM   7632  C  C     . GLU C 1 291 ? -25.233  -19.368 -26.815 1.00 65.66  ? 304 GLU C C     1 
ATOM   7633  O  O     . GLU C 1 291 ? -24.675  -20.148 -27.587 1.00 65.66  ? 304 GLU C O     1 
ATOM   7634  C  CB    . GLU C 1 291 ? -26.995  -20.428 -25.402 1.00 65.66  ? 304 GLU C CB    1 
ATOM   7635  C  CG    . GLU C 1 291 ? -27.917  -19.919 -24.302 1.00 65.66  ? 304 GLU C CG    1 
ATOM   7636  C  CD    . GLU C 1 291 ? -27.614  -20.529 -22.948 1.00 65.66  ? 304 GLU C CD    1 
ATOM   7637  O  OE1   . GLU C 1 291 ? -27.553  -21.772 -22.852 1.00 65.66  ? 304 GLU C OE1   1 
ATOM   7638  O  OE2   . GLU C 1 291 ? -27.441  -19.765 -21.976 1.00 65.66  ? 304 GLU C OE2   1 
ATOM   7639  N  N     . GLU C 1 292 ? -25.551  -18.121 -27.152 1.00 54.48  ? 305 GLU C N     1 
ATOM   7640  C  CA    . GLU C 1 292 ? -25.351  -17.621 -28.510 1.00 54.48  ? 305 GLU C CA    1 
ATOM   7641  C  C     . GLU C 1 292 ? -24.141  -16.698 -28.642 1.00 54.48  ? 305 GLU C C     1 
ATOM   7642  O  O     . GLU C 1 292 ? -24.135  -15.792 -29.476 1.00 54.48  ? 305 GLU C O     1 
ATOM   7643  C  CB    . GLU C 1 292 ? -26.611  -16.902 -29.007 1.00 54.48  ? 305 GLU C CB    1 
ATOM   7644  C  CG    . GLU C 1 292 ? -27.068  -15.756 -28.114 1.00 54.48  ? 305 GLU C CG    1 
ATOM   7645  C  CD    . GLU C 1 292 ? -28.318  -15.067 -28.631 1.00 54.48  ? 305 GLU C CD    1 
ATOM   7646  O  OE1   . GLU C 1 292 ? -28.687  -14.011 -28.075 1.00 54.48  ? 305 GLU C OE1   1 
ATOM   7647  O  OE2   . GLU C 1 292 ? -28.936  -15.580 -29.587 1.00 54.48  ? 305 GLU C OE2   1 
ATOM   7648  N  N     . VAL C 1 293 ? -23.119  -16.929 -27.823 1.00 18.43  ? 306 VAL C N     1 
ATOM   7649  C  CA    . VAL C 1 293 ? -21.886  -16.150 -27.906 1.00 18.43  ? 306 VAL C CA    1 
ATOM   7650  C  C     . VAL C 1 293 ? -20.649  -17.041 -27.850 1.00 18.43  ? 306 VAL C C     1 
ATOM   7651  O  O     . VAL C 1 293 ? -20.451  -17.777 -26.885 1.00 18.43  ? 306 VAL C O     1 
ATOM   7652  C  CB    . VAL C 1 293 ? -21.793  -15.096 -26.787 1.00 18.43  ? 306 VAL C CB    1 
ATOM   7653  C  CG1   . VAL C 1 293 ? -20.431  -14.421 -26.805 1.00 18.43  ? 306 VAL C CG1   1 
ATOM   7654  C  CG2   . VAL C 1 293 ? -22.893  -14.064 -26.932 1.00 18.43  ? 306 VAL C CG2   1 
ATOM   7655  N  N     . LEU C 1 294 ? -19.820  -16.967 -28.889 1.00 35.56  ? 307 LEU C N     1 
ATOM   7656  C  CA    . LEU C 1 294 ? -18.558  -17.698 -28.917 1.00 35.56  ? 307 LEU C CA    1 
ATOM   7657  C  C     . LEU C 1 294 ? -17.478  -16.927 -28.165 1.00 35.56  ? 307 LEU C C     1 
ATOM   7658  O  O     . LEU C 1 294 ? -17.178  -15.781 -28.502 1.00 35.56  ? 307 LEU C O     1 
ATOM   7659  C  CB    . LEU C 1 294 ? -18.111  -17.951 -30.357 1.00 35.56  ? 307 LEU C CB    1 
ATOM   7660  C  CG    . LEU C 1 294 ? -18.926  -18.952 -31.179 1.00 35.56  ? 307 LEU C CG    1 
ATOM   7661  C  CD1   . LEU C 1 294 ? -18.467  -18.966 -32.627 1.00 35.56  ? 307 LEU C CD1   1 
ATOM   7662  C  CD2   . LEU C 1 294 ? -18.822  -20.342 -30.579 1.00 35.56  ? 307 LEU C CD2   1 
ATOM   7663  N  N     . CYS C 1 295 ? -16.901  -17.555 -27.145 1.00 31.78  ? 308 CYS C N     1 
ATOM   7664  C  CA    . CYS C 1 295 ? -15.837  -16.926 -26.368 1.00 31.78  ? 308 CYS C CA    1 
ATOM   7665  C  C     . CYS C 1 295 ? -14.485  -17.550 -26.696 1.00 31.78  ? 308 CYS C C     1 
ATOM   7666  O  O     . CYS C 1 295 ? -14.324  -18.769 -26.641 1.00 31.78  ? 308 CYS C O     1 
ATOM   7667  C  CB    . CYS C 1 295 ? -16.121  -17.042 -24.869 1.00 31.78  ? 308 CYS C CB    1 
ATOM   7668  S  SG    . CYS C 1 295 ? -17.601  -16.167 -24.299 1.00 31.78  ? 308 CYS C SG    1 
ATOM   7669  N  N     . VAL C 1 296 ? -13.517  -16.708 -27.043 1.00 29.26  ? 309 VAL C N     1 
ATOM   7670  C  CA    . VAL C 1 296 ? -12.179  -17.179 -27.382 1.00 29.26  ? 309 VAL C CA    1 
ATOM   7671  C  C     . VAL C 1 296 ? -11.147  -16.638 -26.397 1.00 29.26  ? 309 VAL C C     1 
ATOM   7672  O  O     . VAL C 1 296 ? -10.982  -15.423 -26.263 1.00 29.26  ? 309 VAL C O     1 
ATOM   7673  C  CB    . VAL C 1 296 ? -11.781  -16.765 -28.808 1.00 29.26  ? 309 VAL C CB    1 
ATOM   7674  C  CG1   . VAL C 1 296 ? -10.407  -17.308 -29.150 1.00 29.26  ? 309 VAL C CG1   1 
ATOM   7675  C  CG2   . VAL C 1 296 ? -12.811  -17.261 -29.808 1.00 29.26  ? 309 VAL C CG2   1 
ATOM   7676  N  N     . LYS C 1 297 ? -10.456  -17.544 -25.712 1.00 51.39  ? 310 LYS C N     1 
ATOM   7677  C  CA    . LYS C 1 297 ? -9.453   -17.162 -24.722 1.00 51.39  ? 310 LYS C CA    1 
ATOM   7678  C  C     . LYS C 1 297 ? -8.092   -17.766 -25.045 1.00 51.39  ? 310 LYS C C     1 
ATOM   7679  O  O     . LYS C 1 297 ? -7.963   -18.977 -25.221 1.00 51.39  ? 310 LYS C O     1 
ATOM   7680  C  CB    . LYS C 1 297 ? -9.892   -17.593 -23.321 1.00 51.39  ? 310 LYS C CB    1 
ATOM   7681  C  CG    . LYS C 1 297 ? -8.854   -17.350 -22.232 1.00 51.39  ? 310 LYS C CG    1 
ATOM   7682  C  CD    . LYS C 1 297 ? -9.363   -17.823 -20.877 1.00 51.39  ? 310 LYS C CD    1 
ATOM   7683  C  CE    . LYS C 1 297 ? -8.284   -17.731 -19.808 1.00 51.39  ? 310 LYS C CE    1 
ATOM   7684  N  NZ    . LYS C 1 297 ? -7.809   -16.336 -19.602 1.00 51.39  ? 310 LYS C NZ    1 
ATOM   7685  N  N     . ALA C 1 298 ? -7.077   -16.913 -25.121 1.00 49.66  ? 311 ALA C N     1 
ATOM   7686  C  CA    . ALA C 1 298 ? -5.715   -17.368 -25.356 1.00 49.66  ? 311 ALA C CA    1 
ATOM   7687  C  C     . ALA C 1 298 ? -5.017   -17.633 -24.027 1.00 49.66  ? 311 ALA C C     1 
ATOM   7688  O  O     . ALA C 1 298 ? -4.997   -16.772 -23.148 1.00 49.66  ? 311 ALA C O     1 
ATOM   7689  C  CB    . ALA C 1 298 ? -4.954   -16.340 -26.157 1.00 49.66  ? 311 ALA C CB    1 
ATOM   7690  N  N     . GLU C 1 299 ? -4.445   -18.824 -23.883 1.00 55.57  ? 312 GLU C N     1 
ATOM   7691  C  CA    . GLU C 1 299 ? -3.793   -19.213 -22.637 1.00 55.57  ? 312 GLU C CA    1 
ATOM   7692  C  C     . GLU C 1 299 ? -2.329   -19.582 -22.836 1.00 55.57  ? 312 GLU C C     1 
ATOM   7693  O  O     . GLU C 1 299 ? -1.918   -19.966 -23.929 1.00 55.57  ? 312 GLU C O     1 
ATOM   7694  C  CB    . GLU C 1 299 ? -4.529   -20.388 -21.991 1.00 55.57  ? 312 GLU C CB    1 
ATOM   7695  C  CG    . GLU C 1 299 ? -5.758   -20.001 -21.187 1.00 55.57  ? 312 GLU C CG    1 
ATOM   7696  C  CD    . GLU C 1 299 ? -6.475   -21.207 -20.615 1.00 55.57  ? 312 GLU C CD    1 
ATOM   7697  O  OE1   . GLU C 1 299 ? -7.287   -21.036 -19.683 1.00 55.57  ? 312 GLU C OE1   1 
ATOM   7698  O  OE2   . GLU C 1 299 ? -6.227   -22.328 -21.104 1.00 55.57  ? 312 GLU C OE2   1 
ATOM   7699  N  N     . ALA C 1 300 ? -1.549   -19.470 -21.766 1.00 101.42 ? 313 ALA C N     1 
ATOM   7700  C  CA    . ALA C 1 300 ? -0.155   -19.894 -21.786 1.00 101.42 ? 313 ALA C CA    1 
ATOM   7701  C  C     . ALA C 1 300 ? -0.079   -21.404 -21.971 1.00 101.42 ? 313 ALA C C     1 
ATOM   7702  O  O     . ALA C 1 300 ? -0.972   -22.130 -21.535 1.00 101.42 ? 313 ALA C O     1 
ATOM   7703  C  CB    . ALA C 1 300 ? 0.538    -19.485 -20.500 1.00 101.42 ? 313 ALA C CB    1 
ATOM   7704  N  N     . GLY C 1 301 ? 0.986    -21.868 -22.619 1.00 67.73  ? 314 GLY C N     1 
ATOM   7705  C  CA    . GLY C 1 301 ? 1.173    -23.286 -22.868 1.00 67.73  ? 314 GLY C CA    1 
ATOM   7706  C  C     . GLY C 1 301 ? 1.160    -24.103 -21.592 1.00 67.73  ? 314 GLY C C     1 
ATOM   7707  O  O     . GLY C 1 301 ? 0.575    -25.184 -21.540 1.00 67.73  ? 314 GLY C O     1 
ATOM   7708  N  N     . THR C 1 302 ? 1.805    -23.576 -20.557 1.00 87.27  ? 315 THR C N     1 
ATOM   7709  C  CA    . THR C 1 302 ? 1.827    -24.223 -19.252 1.00 87.27  ? 315 THR C CA    1 
ATOM   7710  C  C     . THR C 1 302 ? 0.431    -24.252 -18.645 1.00 87.27  ? 315 THR C C     1 
ATOM   7711  O  O     . THR C 1 302 ? 0.077    -25.184 -17.926 1.00 87.27  ? 315 THR C O     1 
ATOM   7712  C  CB    . THR C 1 302 ? 2.773    -23.496 -18.281 1.00 87.27  ? 315 THR C CB    1 
ATOM   7713  O  OG1   . THR C 1 302 ? 2.292    -22.167 -18.047 1.00 87.27  ? 315 THR C OG1   1 
ATOM   7714  C  CG2   . THR C 1 302 ? 4.178    -23.428 -18.854 1.00 87.27  ? 315 THR C CG2   1 
ATOM   7715  N  N     . ALA C 1 303 ? -0.358   -23.224 -18.940 1.00 58.69  ? 316 ALA C N     1 
ATOM   7716  C  CA    . ALA C 1 303 ? -1.716   -23.125 -18.415 1.00 58.69  ? 316 ALA C CA    1 
ATOM   7717  C  C     . ALA C 1 303 ? -2.721   -23.835 -19.317 1.00 58.69  ? 316 ALA C C     1 
ATOM   7718  O  O     . ALA C 1 303 ? -3.787   -24.248 -18.863 1.00 58.69  ? 316 ALA C O     1 
ATOM   7719  C  CB    . ALA C 1 303 ? -2.107   -21.668 -18.225 1.00 58.69  ? 316 ALA C CB    1 
ATOM   7720  N  N     . PHE C 1 304 ? -2.376   -23.967 -20.594 1.00 62.02  ? 317 PHE C N     1 
ATOM   7721  C  CA    . PHE C 1 304 ? -3.223   -24.667 -21.552 1.00 62.02  ? 317 PHE C CA    1 
ATOM   7722  C  C     . PHE C 1 304 ? -3.239   -26.162 -21.260 1.00 62.02  ? 317 PHE C C     1 
ATOM   7723  O  O     . PHE C 1 304 ? -4.302   -26.766 -21.127 1.00 62.02  ? 317 PHE C O     1 
ATOM   7724  C  CB    . PHE C 1 304 ? -2.732   -24.417 -22.980 1.00 62.02  ? 317 PHE C CB    1 
ATOM   7725  C  CG    . PHE C 1 304 ? -3.537   -25.128 -24.034 1.00 62.02  ? 317 PHE C CG    1 
ATOM   7726  C  CD1   . PHE C 1 304 ? -4.709   -24.572 -24.521 1.00 62.02  ? 317 PHE C CD1   1 
ATOM   7727  C  CD2   . PHE C 1 304 ? -3.115   -26.346 -24.547 1.00 62.02  ? 317 PHE C CD2   1 
ATOM   7728  C  CE1   . PHE C 1 304 ? -5.450   -25.220 -25.493 1.00 62.02  ? 317 PHE C CE1   1 
ATOM   7729  C  CE2   . PHE C 1 304 ? -3.851   -26.999 -25.520 1.00 62.02  ? 317 PHE C CE2   1 
ATOM   7730  C  CZ    . PHE C 1 304 ? -5.019   -26.434 -25.991 1.00 62.02  ? 317 PHE C CZ    1 
ATOM   7731  N  N     . GLU C 1 305 ? -2.051   -26.751 -21.166 1.00 77.68  ? 318 GLU C N     1 
ATOM   7732  C  CA    . GLU C 1 305 ? -1.913   -28.182 -20.925 1.00 77.68  ? 318 GLU C CA    1 
ATOM   7733  C  C     . GLU C 1 305 ? -2.406   -28.563 -19.533 1.00 77.68  ? 318 GLU C C     1 
ATOM   7734  O  O     . GLU C 1 305 ? -2.999   -29.625 -19.347 1.00 77.68  ? 318 GLU C O     1 
ATOM   7735  C  CB    . GLU C 1 305 ? -0.454   -28.611 -21.096 1.00 77.68  ? 318 GLU C CB    1 
ATOM   7736  C  CG    . GLU C 1 305 ? 0.155    -28.248 -22.444 1.00 77.68  ? 318 GLU C CG    1 
ATOM   7737  C  CD    . GLU C 1 305 ? 1.629    -28.596 -22.530 1.00 77.68  ? 318 GLU C CD    1 
ATOM   7738  O  OE1   . GLU C 1 305 ? 2.144    -29.239 -21.592 1.00 77.68  ? 318 GLU C OE1   1 
ATOM   7739  O  OE2   . GLU C 1 305 ? 2.273    -28.224 -23.533 1.00 77.68  ? 318 GLU C OE2   1 
ATOM   7740  N  N     . ASP C 1 306 ? -2.156   -27.691 -18.560 1.00 73.95  ? 319 ASP C N     1 
ATOM   7741  C  CA    . ASP C 1 306 ? -2.540   -27.945 -17.174 1.00 73.95  ? 319 ASP C CA    1 
ATOM   7742  C  C     . ASP C 1 306 ? -4.054   -28.099 -17.042 1.00 73.95  ? 319 ASP C C     1 
ATOM   7743  O  O     . ASP C 1 306 ? -4.536   -28.865 -16.211 1.00 73.95  ? 319 ASP C O     1 
ATOM   7744  C  CB    . ASP C 1 306 ? -2.044   -26.815 -16.268 1.00 73.95  ? 319 ASP C CB    1 
ATOM   7745  C  CG    . ASP C 1 306 ? -1.808   -27.267 -14.839 1.00 73.95  ? 319 ASP C CG    1 
ATOM   7746  O  OD1   . ASP C 1 306 ? -2.377   -28.303 -14.435 1.00 73.95  ? 319 ASP C OD1   1 
ATOM   7747  O  OD2   . ASP C 1 306 ? -1.051   -26.583 -14.117 1.00 73.95  ? 319 ASP C OD2   1 
ATOM   7748  N  N     . ARG C 1 307 ? -4.797   -27.372 -17.871 1.00 53.37  ? 320 ARG C N     1 
ATOM   7749  C  CA    . ARG C 1 307 ? -6.255   -27.441 -17.858 1.00 53.37  ? 320 ARG C CA    1 
ATOM   7750  C  C     . ARG C 1 307 ? -6.758   -28.709 -18.544 1.00 53.37  ? 320 ARG C C     1 
ATOM   7751  O  O     . ARG C 1 307 ? -7.713   -29.337 -18.084 1.00 53.37  ? 320 ARG C O     1 
ATOM   7752  C  CB    . ARG C 1 307 ? -6.858   -26.208 -18.534 1.00 53.37  ? 320 ARG C CB    1 
ATOM   7753  C  CG    . ARG C 1 307 ? -8.375   -26.131 -18.448 1.00 53.37  ? 320 ARG C CG    1 
ATOM   7754  C  CD    . ARG C 1 307 ? -8.952   -25.178 -19.484 1.00 53.37  ? 320 ARG C CD    1 
ATOM   7755  N  NE    . ARG C 1 307 ? -8.813   -25.699 -20.840 1.00 53.37  ? 320 ARG C NE    1 
ATOM   7756  C  CZ    . ARG C 1 307 ? -7.869   -25.320 -21.695 1.00 53.37  ? 320 ARG C CZ    1 
ATOM   7757  N  NH1   . ARG C 1 307 ? -6.982   -24.405 -21.338 1.00 53.37  ? 320 ARG C NH1   1 
ATOM   7758  N  NH2   . ARG C 1 307 ? -7.816   -25.849 -22.910 1.00 53.37  ? 320 ARG C NH2   1 
ATOM   7759  N  N     . VAL C 1 308 ? -6.109   -29.079 -19.645 1.00 82.11  ? 321 VAL C N     1 
ATOM   7760  C  CA    . VAL C 1 308 ? -6.485   -30.269 -20.407 1.00 82.11  ? 321 VAL C CA    1 
ATOM   7761  C  C     . VAL C 1 308 ? -6.127   -31.549 -19.656 1.00 82.11  ? 321 VAL C C     1 
ATOM   7762  O  O     . VAL C 1 308 ? -6.920   -32.491 -19.608 1.00 82.11  ? 321 VAL C O     1 
ATOM   7763  C  CB    . VAL C 1 308 ? -5.813   -30.287 -21.796 1.00 82.11  ? 321 VAL C CB    1 
ATOM   7764  C  CG1   . VAL C 1 308 ? -6.224   -31.525 -22.577 1.00 82.11  ? 321 VAL C CG1   1 
ATOM   7765  C  CG2   . VAL C 1 308 ? -6.168   -29.032 -22.573 1.00 82.11  ? 321 VAL C CG2   1 
ATOM   7766  N  N     . ASN C 1 309 ? -4.930   -31.575 -19.075 1.00 73.62  ? 322 ASN C N     1 
ATOM   7767  C  CA    . ASN C 1 309 ? -4.457   -32.735 -18.326 1.00 73.62  ? 322 ASN C CA    1 
ATOM   7768  C  C     . ASN C 1 309 ? -5.405   -33.147 -17.202 1.00 73.62  ? 322 ASN C C     1 
ATOM   7769  O  O     . ASN C 1 309 ? -5.590   -34.335 -16.947 1.00 73.62  ? 322 ASN C O     1 
ATOM   7770  C  CB    . ASN C 1 309 ? -3.055   -32.485 -17.765 1.00 73.62  ? 322 ASN C CB    1 
ATOM   7771  C  CG    . ASN C 1 309 ? -1.994   -32.430 -18.847 1.00 73.62  ? 322 ASN C CG    1 
ATOM   7772  O  OD1   . ASN C 1 309 ? -2.113   -33.081 -19.884 1.00 73.62  ? 322 ASN C OD1   1 
ATOM   7773  N  ND2   . ASN C 1 309 ? -0.946   -31.651 -18.608 1.00 73.62  ? 322 ASN C ND2   1 
ATOM   7774  N  N     . LYS C 1 310 ? -6.000   -32.162 -16.535 1.00 84.28  ? 323 LYS C N     1 
ATOM   7775  C  CA    . LYS C 1 310 ? -6.969   -32.437 -15.479 1.00 84.28  ? 323 LYS C CA    1 
ATOM   7776  C  C     . LYS C 1 310 ? -8.266   -32.989 -16.064 1.00 84.28  ? 323 LYS C C     1 
ATOM   7777  O  O     . LYS C 1 310 ? -8.909   -33.848 -15.465 1.00 84.28  ? 323 LYS C O     1 
ATOM   7778  C  CB    . LYS C 1 310 ? -7.260   -31.180 -14.654 1.00 84.28  ? 323 LYS C CB    1 
ATOM   7779  C  CG    . LYS C 1 310 ? -6.042   -30.580 -13.965 1.00 84.28  ? 323 LYS C CG    1 
ATOM   7780  C  CD    . LYS C 1 310 ? -6.423   -29.854 -12.679 1.00 84.28  ? 323 LYS C CD    1 
ATOM   7781  C  CE    . LYS C 1 310 ? -7.558   -28.865 -12.896 1.00 84.28  ? 323 LYS C CE    1 
ATOM   7782  N  NZ    . LYS C 1 310 ? -7.190   -27.778 -13.844 1.00 84.28  ? 323 LYS C NZ    1 
ATOM   7783  N  N     . ALA C 1 311 ? -8.640   -32.490 -17.239 1.00 81.37  ? 324 ALA C N     1 
ATOM   7784  C  CA    . ALA C 1 311 ? -9.859   -32.926 -17.912 1.00 81.37  ? 324 ALA C CA    1 
ATOM   7785  C  C     . ALA C 1 311 ? -9.785   -34.396 -18.318 1.00 81.37  ? 324 ALA C C     1 
ATOM   7786  O  O     . ALA C 1 311 ? -10.710  -35.166 -18.056 1.00 81.37  ? 324 ALA C O     1 
ATOM   7787  C  CB    . ALA C 1 311 ? -10.136  -32.053 -19.124 1.00 81.37  ? 324 ALA C CB    1 
ATOM   7788  N  N     . LYS C 1 312 ? -8.687   -34.775 -18.965 1.00 88.89  ? 325 LYS C N     1 
ATOM   7789  C  CA    . LYS C 1 312 ? -8.465   -36.163 -19.360 1.00 88.89  ? 325 LYS C CA    1 
ATOM   7790  C  C     . LYS C 1 312 ? -8.381   -37.055 -18.128 1.00 88.89  ? 325 LYS C C     1 
ATOM   7791  O  O     . LYS C 1 312 ? -8.884   -38.178 -18.125 1.00 88.89  ? 325 LYS C O     1 
ATOM   7792  C  CB    . LYS C 1 312 ? -7.184   -36.293 -20.192 1.00 88.89  ? 325 LYS C CB    1 
ATOM   7793  C  CG    . LYS C 1 312 ? -7.378   -36.145 -21.698 1.00 88.89  ? 325 LYS C CG    1 
ATOM   7794  C  CD    . LYS C 1 312 ? -7.939   -34.781 -22.066 1.00 88.89  ? 325 LYS C CD    1 
ATOM   7795  C  CE    . LYS C 1 312 ? -8.191   -34.668 -23.559 1.00 88.89  ? 325 LYS C CE    1 
ATOM   7796  N  NZ    . LYS C 1 312 ? -8.821   -33.365 -23.905 1.00 88.89  ? 325 LYS C NZ    1 
ATOM   7797  N  N     . GLN C 1 313 ? -7.742   -36.538 -17.084 1.00 85.40  ? 326 GLN C N     1 
ATOM   7798  C  CA    . GLN C 1 313 ? -7.614   -37.250 -15.819 1.00 85.40  ? 326 GLN C CA    1 
ATOM   7799  C  C     . GLN C 1 313 ? -8.971   -37.381 -15.131 1.00 85.40  ? 326 GLN C C     1 
ATOM   7800  O  O     . GLN C 1 313 ? -9.241   -38.375 -14.457 1.00 85.40  ? 326 GLN C O     1 
ATOM   7801  C  CB    . GLN C 1 313 ? -6.623   -36.526 -14.903 1.00 85.40  ? 326 GLN C CB    1 
ATOM   7802  C  CG    . GLN C 1 313 ? -6.437   -37.159 -13.534 1.00 85.40  ? 326 GLN C CG    1 
ATOM   7803  C  CD    . GLN C 1 313 ? -5.572   -36.316 -12.617 1.00 85.40  ? 326 GLN C CD    1 
ATOM   7804  O  OE1   . GLN C 1 313 ? -4.790   -35.484 -13.076 1.00 85.40  ? 326 GLN C OE1   1 
ATOM   7805  N  NE2   . GLN C 1 313 ? -5.715   -36.523 -11.313 1.00 85.40  ? 326 GLN C NE2   1 
ATOM   7806  N  N     . SER C 1 314 ? -9.820   -36.373 -15.311 1.00 75.51  ? 327 SER C N     1 
ATOM   7807  C  CA    . SER C 1 314 ? -11.157  -36.374 -14.724 1.00 75.51  ? 327 SER C CA    1 
ATOM   7808  C  C     . SER C 1 314 ? -11.991  -37.537 -15.250 1.00 75.51  ? 327 SER C C     1 
ATOM   7809  O  O     . SER C 1 314 ? -12.539  -38.322 -14.475 1.00 75.51  ? 327 SER C O     1 
ATOM   7810  C  CB    . SER C 1 314 ? -11.867  -35.048 -15.004 1.00 75.51  ? 327 SER C CB    1 
ATOM   7811  O  OG    . SER C 1 314 ? -13.189  -35.056 -14.499 1.00 75.51  ? 327 SER C OG    1 
ATOM   7812  N  N     . ALA C 1 315 ? -12.079  -37.645 -16.572 1.00 121.71 ? 328 ALA C N     1 
ATOM   7813  C  CA    . ALA C 1 315 ? -12.829  -38.721 -17.209 1.00 121.71 ? 328 ALA C CA    1 
ATOM   7814  C  C     . ALA C 1 315 ? -12.176  -40.076 -16.955 1.00 121.71 ? 328 ALA C C     1 
ATOM   7815  O  O     . ALA C 1 315 ? -12.840  -41.112 -16.993 1.00 121.71 ? 328 ALA C O     1 
ATOM   7816  C  CB    . ALA C 1 315 ? -12.958  -38.464 -18.701 1.00 121.71 ? 328 ALA C CB    1 
ATOM   7817  N  N     . MET C 1 316 ? -10.872  -40.059 -16.697 1.00 119.60 ? 329 MET C N     1 
ATOM   7818  C  CA    . MET C 1 316 ? -10.127  -41.281 -16.415 1.00 119.60 ? 329 MET C CA    1 
ATOM   7819  C  C     . MET C 1 316 ? -10.520  -41.856 -15.055 1.00 119.60 ? 329 MET C C     1 
ATOM   7820  O  O     . MET C 1 316 ? -10.429  -43.063 -14.831 1.00 119.60 ? 329 MET C O     1 
ATOM   7821  C  CB    . MET C 1 316 ? -8.620   -41.011 -16.478 1.00 119.60 ? 329 MET C CB    1 
ATOM   7822  C  CG    . MET C 1 316 ? -7.746   -42.246 -16.320 1.00 119.60 ? 329 MET C CG    1 
ATOM   7823  S  SD    . MET C 1 316 ? -6.162   -42.087 -17.170 1.00 119.60 ? 329 MET C SD    1 
ATOM   7824  C  CE    . MET C 1 316 ? -5.547   -40.558 -16.469 1.00 119.60 ? 329 MET C CE    1 
ATOM   7825  N  N     . GLU C 1 317 ? -10.971  -40.987 -14.156 1.00 75.78  ? 330 GLU C N     1 
ATOM   7826  C  CA    . GLU C 1 317 ? -11.382  -41.408 -12.820 1.00 75.78  ? 330 GLU C CA    1 
ATOM   7827  C  C     . GLU C 1 317 ? -12.832  -41.892 -12.787 1.00 75.78  ? 330 GLU C C     1 
ATOM   7828  O  O     . GLU C 1 317 ? -13.205  -42.690 -11.930 1.00 75.78  ? 330 GLU C O     1 
ATOM   7829  C  CB    . GLU C 1 317 ? -11.179  -40.274 -11.810 1.00 75.78  ? 330 GLU C CB    1 
ATOM   7830  C  CG    . GLU C 1 317 ? -9.721   -39.906 -11.566 1.00 75.78  ? 330 GLU C CG    1 
ATOM   7831  C  CD    . GLU C 1 317 ? -9.559   -38.811 -10.528 1.00 75.78  ? 330 GLU C CD    1 
ATOM   7832  O  OE1   . GLU C 1 317 ? -10.573  -38.183 -10.160 1.00 75.78  ? 330 GLU C OE1   1 
ATOM   7833  O  OE2   . GLU C 1 317 ? -8.416   -38.579 -10.080 1.00 75.78  ? 330 GLU C OE2   1 
ATOM   7834  N  N     . ALA C 1 318 ? -13.641  -41.412 -13.726 1.00 103.12 ? 331 ALA C N     1 
ATOM   7835  C  CA    . ALA C 1 318 ? -15.053  -41.782 -13.785 1.00 103.12 ? 331 ALA C CA    1 
ATOM   7836  C  C     . ALA C 1 318 ? -15.238  -43.264 -14.103 1.00 103.12 ? 331 ALA C C     1 
ATOM   7837  O  O     . ALA C 1 318 ? -16.281  -43.847 -13.805 1.00 103.12 ? 331 ALA C O     1 
ATOM   7838  C  CB    . ALA C 1 318 ? -15.784  -40.923 -14.805 1.00 103.12 ? 331 ALA C CB    1 
ATOM   7839  N  N     . ILE C 1 319 ? -14.220  -43.865 -14.712 1.00 76.90  ? 332 ILE C N     1 
ATOM   7840  C  CA    . ILE C 1 319 ? -14.250  -45.282 -15.052 1.00 76.90  ? 332 ILE C CA    1 
ATOM   7841  C  C     . ILE C 1 319 ? -13.439  -46.087 -14.034 1.00 76.90  ? 332 ILE C C     1 
ATOM   7842  O  O     . ILE C 1 319 ? -13.589  -47.304 -13.927 1.00 76.90  ? 332 ILE C O     1 
ATOM   7843  C  CB    . ILE C 1 319 ? -13.707  -45.529 -16.476 1.00 76.90  ? 332 ILE C CB    1 
ATOM   7844  C  CG1   . ILE C 1 319 ? -14.166  -44.419 -17.422 1.00 76.90  ? 332 ILE C CG1   1 
ATOM   7845  C  CG2   . ILE C 1 319 ? -14.147  -46.891 -16.997 1.00 76.90  ? 332 ILE C CG2   1 
ATOM   7846  C  CD1   . ILE C 1 319 ? -13.720  -44.611 -18.855 1.00 76.90  ? 332 ILE C CD1   1 
ATOM   7847  N  N     . SER C 1 320 ? -12.585  -45.395 -13.286 1.00 67.86  ? 333 SER C N     1 
ATOM   7848  C  CA    . SER C 1 320 ? -11.782  -46.030 -12.246 1.00 67.86  ? 333 SER C CA    1 
ATOM   7849  C  C     . SER C 1 320 ? -12.640  -46.355 -11.026 1.00 67.86  ? 333 SER C C     1 
ATOM   7850  O  O     . SER C 1 320 ? -12.437  -47.376 -10.367 1.00 67.86  ? 333 SER C O     1 
ATOM   7851  C  CB    . SER C 1 320 ? -10.610  -45.132 -11.848 1.00 67.86  ? 333 SER C CB    1 
ATOM   7852  O  OG    . SER C 1 320 ? -9.756   -45.783 -10.924 1.00 67.86  ? 333 SER C OG    1 
ATOM   7853  N  N     . TRP C 1 321 ? -13.596  -45.481 -10.730 1.00 88.36  ? 334 TRP C N     1 
ATOM   7854  C  CA    . TRP C 1 321 ? -14.548  -45.720 -9.651  1.00 88.36  ? 334 TRP C CA    1 
ATOM   7855  C  C     . TRP C 1 321 ? -15.545  -46.800 -10.046 1.00 88.36  ? 334 TRP C C     1 
ATOM   7856  O  O     . TRP C 1 321 ? -16.037  -47.543 -9.198  1.00 88.36  ? 334 TRP C O     1 
ATOM   7857  C  CB    . TRP C 1 321 ? -15.302  -44.437 -9.300  1.00 88.36  ? 334 TRP C CB    1 
ATOM   7858  C  CG    . TRP C 1 321 ? -14.496  -43.447 -8.526  1.00 88.36  ? 334 TRP C CG    1 
ATOM   7859  C  CD1   . TRP C 1 321 ? -13.809  -42.379 -9.022  1.00 88.36  ? 334 TRP C CD1   1 
ATOM   7860  C  CD2   . TRP C 1 321 ? -14.298  -43.427 -7.110  1.00 88.36  ? 334 TRP C CD2   1 
ATOM   7861  N  NE1   . TRP C 1 321 ? -13.192  -41.697 -8.003  1.00 88.36  ? 334 TRP C NE1   1 
ATOM   7862  C  CE2   . TRP C 1 321 ? -13.478  -42.322 -6.814  1.00 88.36  ? 334 TRP C CE2   1 
ATOM   7863  C  CE3   . TRP C 1 321 ? -14.734  -44.240 -6.058  1.00 88.36  ? 334 TRP C CE3   1 
ATOM   7864  C  CZ2   . TRP C 1 321 ? -13.083  -42.006 -5.518  1.00 88.36  ? 334 TRP C CZ2   1 
ATOM   7865  C  CZ3   . TRP C 1 321 ? -14.342  -43.926 -4.771  1.00 88.36  ? 334 TRP C CZ3   1 
ATOM   7866  C  CH2   . TRP C 1 321 ? -13.525  -42.819 -4.511  1.00 88.36  ? 334 TRP C CH2   1 
ATOM   7867  N  N     . PHE C 1 322 ? -15.846  -46.877 -11.337 1.00 94.98  ? 335 PHE C N     1 
ATOM   7868  C  CA    . PHE C 1 322 ? -16.794  -47.863 -11.835 1.00 94.98  ? 335 PHE C CA    1 
ATOM   7869  C  C     . PHE C 1 322 ? -16.242  -49.274 -11.665 1.00 94.98  ? 335 PHE C C     1 
ATOM   7870  O  O     . PHE C 1 322 ? -16.992  -50.215 -11.405 1.00 94.98  ? 335 PHE C O     1 
ATOM   7871  C  CB    . PHE C 1 322 ? -17.137  -47.589 -13.298 1.00 94.98  ? 335 PHE C CB    1 
ATOM   7872  C  CG    . PHE C 1 322 ? -18.218  -48.474 -13.836 1.00 94.98  ? 335 PHE C CG    1 
ATOM   7873  C  CD1   . PHE C 1 322 ? -19.512  -48.380 -13.350 1.00 94.98  ? 335 PHE C CD1   1 
ATOM   7874  C  CD2   . PHE C 1 322 ? -17.943  -49.397 -14.828 1.00 94.98  ? 335 PHE C CD2   1 
ATOM   7875  C  CE1   . PHE C 1 322 ? -20.511  -49.194 -13.843 1.00 94.98  ? 335 PHE C CE1   1 
ATOM   7876  C  CE2   . PHE C 1 322 ? -18.936  -50.213 -15.324 1.00 94.98  ? 335 PHE C CE2   1 
ATOM   7877  C  CZ    . PHE C 1 322 ? -20.223  -50.109 -14.833 1.00 94.98  ? 335 PHE C CZ    1 
ATOM   7878  N  N     . LYS C 1 323 ? -14.928  -49.412 -11.814 1.00 89.53  ? 336 LYS C N     1 
ATOM   7879  C  CA    . LYS C 1 323 ? -14.257  -50.671 -11.518 1.00 89.53  ? 336 LYS C CA    1 
ATOM   7880  C  C     . LYS C 1 323 ? -14.402  -50.987 -10.035 1.00 89.53  ? 336 LYS C C     1 
ATOM   7881  O  O     . LYS C 1 323 ? -14.713  -52.115 -9.660  1.00 89.53  ? 336 LYS C O     1 
ATOM   7882  C  CB    . LYS C 1 323 ? -12.775  -50.601 -11.897 1.00 89.53  ? 336 LYS C CB    1 
ATOM   7883  C  CG    . LYS C 1 323 ? -12.496  -50.717 -13.389 1.00 89.53  ? 336 LYS C CG    1 
ATOM   7884  C  CD    . LYS C 1 323 ? -12.703  -52.139 -13.899 1.00 89.53  ? 336 LYS C CD    1 
ATOM   7885  C  CE    . LYS C 1 323 ? -11.416  -52.959 -13.855 1.00 89.53  ? 336 LYS C CE    1 
ATOM   7886  N  NZ    . LYS C 1 323 ? -10.900  -53.175 -12.475 1.00 89.53  ? 336 LYS C NZ    1 
ATOM   7887  N  N     . ALA C 1 324 ? -14.189  -49.973 -9.200  1.00 80.22  ? 337 ALA C N     1 
ATOM   7888  C  CA    . ALA C 1 324 ? -14.273  -50.122 -7.749  1.00 80.22  ? 337 ALA C CA    1 
ATOM   7889  C  C     . ALA C 1 324 ? -15.632  -50.651 -7.296  1.00 80.22  ? 337 ALA C C     1 
ATOM   7890  O  O     . ALA C 1 324 ? -15.733  -51.320 -6.268  1.00 80.22  ? 337 ALA C O     1 
ATOM   7891  C  CB    . ALA C 1 324 ? -13.959  -48.801 -7.062  1.00 80.22  ? 337 ALA C CB    1 
ATOM   7892  N  N     . ARG C 1 325 ? -16.672  -50.344 -8.064  1.00 79.37  ? 338 ARG C N     1 
ATOM   7893  C  CA    . ARG C 1 325 ? -18.003  -50.876 -7.798  1.00 79.37  ? 338 ARG C CA    1 
ATOM   7894  C  C     . ARG C 1 325 ? -18.100  -52.314 -8.295  1.00 79.37  ? 338 ARG C C     1 
ATOM   7895  O  O     . ARG C 1 325 ? -18.645  -53.184 -7.615  1.00 79.37  ? 338 ARG C O     1 
ATOM   7896  C  CB    . ARG C 1 325 ? -19.071  -50.022 -8.481  1.00 79.37  ? 338 ARG C CB    1 
ATOM   7897  C  CG    . ARG C 1 325 ? -20.493  -50.524 -8.272  1.00 79.37  ? 338 ARG C CG    1 
ATOM   7898  C  CD    . ARG C 1 325 ? -21.186  -49.795 -7.127  1.00 79.37  ? 338 ARG C CD    1 
ATOM   7899  N  NE    . ARG C 1 325 ? -21.770  -50.713 -6.154  1.00 79.37  ? 338 ARG C NE    1 
ATOM   7900  C  CZ    . ARG C 1 325 ? -22.899  -51.388 -6.345  1.00 79.37  ? 338 ARG C CZ    1 
ATOM   7901  N  NH1   . ARG C 1 325 ? -23.357  -52.198 -5.401  1.00 79.37  ? 338 ARG C NH1   1 
ATOM   7902  N  NH2   . ARG C 1 325 ? -23.568  -51.261 -7.481  1.00 79.37  ? 338 ARG C NH2   1 
ATOM   7903  N  N     . MET C 1 326 ? -17.557  -52.556 -9.484  1.00 105.22 ? 339 MET C N     1 
ATOM   7904  C  CA    . MET C 1 326 ? -17.627  -53.871 -10.112 1.00 105.22 ? 339 MET C CA    1 
ATOM   7905  C  C     . MET C 1 326 ? -16.683  -54.889 -9.474  1.00 105.22 ? 339 MET C C     1 
ATOM   7906  O  O     . MET C 1 326 ? -16.750  -56.080 -9.778  1.00 105.22 ? 339 MET C O     1 
ATOM   7907  C  CB    . MET C 1 326 ? -17.352  -53.765 -11.613 1.00 105.22 ? 339 MET C CB    1 
ATOM   7908  C  CG    . MET C 1 326 ? -18.417  -52.999 -12.379 1.00 105.22 ? 339 MET C CG    1 
ATOM   7909  S  SD    . MET C 1 326 ? -20.055  -53.255 -11.670 1.00 105.22 ? 339 MET C SD    1 
ATOM   7910  C  CE    . MET C 1 326 ? -21.102  -52.982 -13.096 1.00 105.22 ? 339 MET C CE    1 
ATOM   7911  N  N     . ASP C 1 327 ? -15.809  -54.417 -8.591  1.00 118.30 ? 340 ASP C N     1 
ATOM   7912  C  CA    . ASP C 1 327 ? -14.870  -55.298 -7.904  1.00 118.30 ? 340 ASP C CA    1 
ATOM   7913  C  C     . ASP C 1 327 ? -15.254  -55.478 -6.437  1.00 118.30 ? 340 ASP C C     1 
ATOM   7914  O  O     . ASP C 1 327 ? -14.683  -56.312 -5.735  1.00 118.30 ? 340 ASP C O     1 
ATOM   7915  C  CB    . ASP C 1 327 ? -13.443  -54.754 -8.008  1.00 118.30 ? 340 ASP C CB    1 
ATOM   7916  C  CG    . ASP C 1 327 ? -13.015  -54.503 -9.442  1.00 118.30 ? 340 ASP C CG    1 
ATOM   7917  O  OD1   . ASP C 1 327 ? -13.576  -55.143 -10.355 1.00 118.30 ? 340 ASP C OD1   1 
ATOM   7918  O  OD2   . ASP C 1 327 ? -12.119  -53.659 -9.655  1.00 118.30 ? 340 ASP C OD2   1 
ATOM   7919  N  N     . SER C 1 328 ? -16.227  -54.694 -5.981  1.00 96.45  ? 341 SER C N     1 
ATOM   7920  C  CA    . SER C 1 328 ? -16.668  -54.745 -4.590  1.00 96.45  ? 341 SER C CA    1 
ATOM   7921  C  C     . SER C 1 328 ? -17.775  -55.775 -4.381  1.00 96.45  ? 341 SER C C     1 
ATOM   7922  O  O     . SER C 1 328 ? -18.556  -55.676 -3.435  1.00 96.45  ? 341 SER C O     1 
ATOM   7923  C  CB    . SER C 1 328 ? -17.142  -53.365 -4.128  1.00 96.45  ? 341 SER C CB    1 
ATOM   7924  O  OG    . SER C 1 328 ? -17.558  -53.395 -2.774  1.00 96.45  ? 341 SER C OG    1 
ATOM   7925  N  N     . LEU C 1 329 ? -17.834  -56.763 -5.267  1.00 86.85  ? 342 LEU C N     1 
ATOM   7926  C  CA    . LEU C 1 329 ? -18.851  -57.803 -5.187  1.00 86.85  ? 342 LEU C CA    1 
ATOM   7927  C  C     . LEU C 1 329 ? -18.442  -58.891 -4.200  1.00 86.85  ? 342 LEU C C     1 
ATOM   7928  O  O     . LEU C 1 329 ? -18.408  -60.074 -4.540  1.00 86.85  ? 342 LEU C O     1 
ATOM   7929  C  CB    . LEU C 1 329 ? -19.100  -58.408 -6.570  1.00 86.85  ? 342 LEU C CB    1 
ATOM   7930  C  CG    . LEU C 1 329 ? -19.369  -57.405 -7.694  1.00 86.85  ? 342 LEU C CG    1 
ATOM   7931  C  CD1   . LEU C 1 329 ? -19.535  -58.114 -9.030  1.00 86.85  ? 342 LEU C CD1   1 
ATOM   7932  C  CD2   . LEU C 1 329 ? -20.587  -56.549 -7.381  1.00 86.85  ? 342 LEU C CD2   1 
ATOM   7933  N  N     . SER C 1 344 ? -19.348  -34.351 -4.261  1.00 70.58  ? 357 SER C N     1 
ATOM   7934  C  CA    . SER C 1 344 ? -18.043  -34.777 -4.751  1.00 70.58  ? 357 SER C CA    1 
ATOM   7935  C  C     . SER C 1 344 ? -18.135  -36.136 -5.431  1.00 70.58  ? 357 SER C C     1 
ATOM   7936  O  O     . SER C 1 344 ? -17.626  -36.323 -6.538  1.00 70.58  ? 357 SER C O     1 
ATOM   7937  C  CB    . SER C 1 344 ? -17.032  -34.841 -3.604  1.00 70.58  ? 357 SER C CB    1 
ATOM   7938  O  OG    . SER C 1 344 ? -17.299  -35.939 -2.748  1.00 70.58  ? 357 SER C OG    1 
ATOM   7939  N  N     . VAL C 1 345 ? -18.790  -37.076 -4.755  1.00 102.24 ? 358 VAL C N     1 
ATOM   7940  C  CA    . VAL C 1 345 ? -18.930  -38.448 -5.236  1.00 102.24 ? 358 VAL C CA    1 
ATOM   7941  C  C     . VAL C 1 345 ? -19.490  -38.543 -6.655  1.00 102.24 ? 358 VAL C C     1 
ATOM   7942  O  O     . VAL C 1 345 ? -18.878  -39.156 -7.530  1.00 102.24 ? 358 VAL C O     1 
ATOM   7943  C  CB    . VAL C 1 345 ? -19.811  -39.289 -4.282  1.00 102.24 ? 358 VAL C CB    1 
ATOM   7944  C  CG1   . VAL C 1 345 ? -18.973  -39.874 -3.155  1.00 102.24 ? 358 VAL C CG1   1 
ATOM   7945  C  CG2   . VAL C 1 345 ? -20.951  -38.450 -3.724  1.00 102.24 ? 358 VAL C CG2   1 
ATOM   7946  N  N     . LEU C 1 346 ? -20.650  -37.935 -6.881  1.00 90.29  ? 359 LEU C N     1 
ATOM   7947  C  CA    . LEU C 1 346 ? -21.317  -38.023 -8.174  1.00 90.29  ? 359 LEU C CA    1 
ATOM   7948  C  C     . LEU C 1 346 ? -21.939  -36.690 -8.581  1.00 90.29  ? 359 LEU C C     1 
ATOM   7949  O  O     . LEU C 1 346 ? -22.649  -36.608 -9.583  1.00 90.29  ? 359 LEU C O     1 
ATOM   7950  C  CB    . LEU C 1 346 ? -22.386  -39.120 -8.144  1.00 90.29  ? 359 LEU C CB    1 
ATOM   7951  C  CG    . LEU C 1 346 ? -21.875  -40.555 -8.003  1.00 90.29  ? 359 LEU C CG    1 
ATOM   7952  C  CD1   . LEU C 1 346 ? -22.981  -41.490 -7.549  1.00 90.29  ? 359 LEU C CD1   1 
ATOM   7953  C  CD2   . LEU C 1 346 ? -21.279  -41.032 -9.315  1.00 90.29  ? 359 LEU C CD2   1 
ATOM   7954  N  N     . ASN C 1 347 ? -21.669  -35.648 -7.801  1.00 81.35  ? 360 ASN C N     1 
ATOM   7955  C  CA    . ASN C 1 347 ? -22.204  -34.324 -8.093  1.00 81.35  ? 360 ASN C CA    1 
ATOM   7956  C  C     . ASN C 1 347 ? -21.164  -33.395 -8.709  1.00 81.35  ? 360 ASN C C     1 
ATOM   7957  O  O     . ASN C 1 347 ? -21.157  -32.192 -8.449  1.00 81.35  ? 360 ASN C O     1 
ATOM   7958  C  CB    . ASN C 1 347 ? -22.808  -33.695 -6.836  1.00 81.35  ? 360 ASN C CB    1 
ATOM   7959  C  CG    . ASN C 1 347 ? -23.975  -34.494 -6.289  1.00 81.35  ? 360 ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 1 347 ? -25.100  -34.388 -6.778  1.00 81.35  ? 360 ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 1 347 ? -23.711  -35.301 -5.269  1.00 81.35  ? 360 ASN C ND2   1 
ATOM   7962  N  N     . ARG C 1 348 ? -20.288  -33.967 -9.528  1.00 66.61  ? 361 ARG C N     1 
ATOM   7963  C  CA    . ARG C 1 348 ? -19.276  -33.199 -10.240 1.00 66.61  ? 361 ARG C CA    1 
ATOM   7964  C  C     . ARG C 1 348 ? -19.361  -33.528 -11.727 1.00 66.61  ? 361 ARG C C     1 
ATOM   7965  O  O     . ARG C 1 348 ? -18.568  -33.041 -12.536 1.00 66.61  ? 361 ARG C O     1 
ATOM   7966  C  CB    . ARG C 1 348 ? -17.884  -33.513 -9.694  1.00 66.61  ? 361 ARG C CB    1 
ATOM   7967  C  CG    . ARG C 1 348 ? -16.835  -32.450 -9.986  1.00 66.61  ? 361 ARG C CG    1 
ATOM   7968  C  CD    . ARG C 1 348 ? -15.482  -32.870 -9.448  1.00 66.61  ? 361 ARG C CD    1 
ATOM   7969  N  NE    . ARG C 1 348 ? -15.015  -34.105 -10.067 1.00 66.61  ? 361 ARG C NE    1 
ATOM   7970  C  CZ    . ARG C 1 348 ? -14.080  -34.893 -9.549  1.00 66.61  ? 361 ARG C CZ    1 
ATOM   7971  N  NH1   . ARG C 1 348 ? -13.714  -35.999 -10.182 1.00 66.61  ? 361 ARG C NH1   1 
ATOM   7972  N  NH2   . ARG C 1 348 ? -13.513  -34.578 -8.393  1.00 66.61  ? 361 ARG C NH2   1 
ATOM   7973  N  N     . GLU C 1 349 ? -20.332  -34.367 -12.075 1.00 70.88  ? 362 GLU C N     1 
ATOM   7974  C  CA    . GLU C 1 349 ? -20.601  -34.709 -13.466 1.00 70.88  ? 362 GLU C CA    1 
ATOM   7975  C  C     . GLU C 1 349 ? -21.787  -33.898 -13.975 1.00 70.88  ? 362 GLU C C     1 
ATOM   7976  O  O     . GLU C 1 349 ? -22.733  -33.632 -13.233 1.00 70.88  ? 362 GLU C O     1 
ATOM   7977  C  CB    . GLU C 1 349 ? -20.889  -36.206 -13.610 1.00 70.88  ? 362 GLU C CB    1 
ATOM   7978  C  CG    . GLU C 1 349 ? -22.063  -36.699 -12.772 1.00 70.88  ? 362 GLU C CG    1 
ATOM   7979  C  CD    . GLU C 1 349 ? -22.360  -38.174 -12.977 1.00 70.88  ? 362 GLU C CD    1 
ATOM   7980  O  OE1   . GLU C 1 349 ? -23.337  -38.671 -12.376 1.00 70.88  ? 362 GLU C OE1   1 
ATOM   7981  O  OE2   . GLU C 1 349 ? -21.619  -38.835 -13.734 1.00 70.88  ? 362 GLU C OE2   1 
ATOM   7982  N  N     . LYS C 1 350 ? -21.732  -33.497 -15.239 1.00 59.70  ? 363 LYS C N     1 
ATOM   7983  C  CA    . LYS C 1 350 ? -22.831  -32.751 -15.834 1.00 59.70  ? 363 LYS C CA    1 
ATOM   7984  C  C     . LYS C 1 350 ? -23.859  -33.717 -16.414 1.00 59.70  ? 363 LYS C C     1 
ATOM   7985  O  O     . LYS C 1 350 ? -23.640  -34.323 -17.463 1.00 59.70  ? 363 LYS C O     1 
ATOM   7986  C  CB    . LYS C 1 350 ? -22.317  -31.775 -16.893 1.00 59.70  ? 363 LYS C CB    1 
ATOM   7987  C  CG    . LYS C 1 350 ? -21.263  -30.812 -16.362 1.00 59.70  ? 363 LYS C CG    1 
ATOM   7988  C  CD    . LYS C 1 350 ? -20.847  -29.783 -17.404 1.00 59.70  ? 363 LYS C CD    1 
ATOM   7989  C  CE    . LYS C 1 350 ? -21.989  -28.837 -17.746 1.00 59.70  ? 363 LYS C CE    1 
ATOM   7990  N  NZ    . LYS C 1 350 ? -21.574  -27.797 -18.727 1.00 59.70  ? 363 LYS C NZ    1 
ATOM   7991  N  N     . VAL C 1 351 ? -24.980  -33.855 -15.711 1.00 40.81  ? 364 VAL C N     1 
ATOM   7992  C  CA    . VAL C 1 351 ? -26.004  -34.833 -16.061 1.00 40.81  ? 364 VAL C CA    1 
ATOM   7993  C  C     . VAL C 1 351 ? -26.873  -34.362 -17.224 1.00 40.81  ? 364 VAL C C     1 
ATOM   7994  O  O     . VAL C 1 351 ? -27.360  -35.171 -18.013 1.00 40.81  ? 364 VAL C O     1 
ATOM   7995  C  CB    . VAL C 1 351 ? -26.900  -35.146 -14.857 1.00 40.81  ? 364 VAL C CB    1 
ATOM   7996  C  CG1   . VAL C 1 351 ? -27.469  -36.541 -14.981 1.00 40.81  ? 364 VAL C CG1   1 
ATOM   7997  C  CG2   . VAL C 1 351 ? -26.109  -35.023 -13.571 1.00 40.81  ? 364 VAL C CG2   1 
ATOM   7998  N  N     . TYR C 1 352 ? -27.069  -33.050 -17.317 1.00 57.45  ? 365 TYR C N     1 
ATOM   7999  C  CA    . TYR C 1 352 ? -27.793  -32.461 -18.438 1.00 57.45  ? 365 TYR C CA    1 
ATOM   8000  C  C     . TYR C 1 352 ? -26.820  -31.831 -19.429 1.00 57.45  ? 365 TYR C C     1 
ATOM   8001  O  O     . TYR C 1 352 ? -25.747  -31.366 -19.045 1.00 57.45  ? 365 TYR C O     1 
ATOM   8002  C  CB    . TYR C 1 352 ? -28.793  -31.414 -17.946 1.00 57.45  ? 365 TYR C CB    1 
ATOM   8003  C  CG    . TYR C 1 352 ? -29.969  -31.992 -17.193 1.00 57.45  ? 365 TYR C CG    1 
ATOM   8004  C  CD1   . TYR C 1 352 ? -31.064  -32.507 -17.872 1.00 57.45  ? 365 TYR C CD1   1 
ATOM   8005  C  CD2   . TYR C 1 352 ? -29.987  -32.019 -15.806 1.00 57.45  ? 365 TYR C CD2   1 
ATOM   8006  C  CE1   . TYR C 1 352 ? -32.142  -33.036 -17.191 1.00 57.45  ? 365 TYR C CE1   1 
ATOM   8007  C  CE2   . TYR C 1 352 ? -31.060  -32.546 -15.116 1.00 57.45  ? 365 TYR C CE2   1 
ATOM   8008  C  CZ    . TYR C 1 352 ? -32.136  -33.053 -15.813 1.00 57.45  ? 365 TYR C CZ    1 
ATOM   8009  O  OH    . TYR C 1 352 ? -33.209  -33.578 -15.131 1.00 57.45  ? 365 TYR C OH    1 
ATOM   8010  N  N     . TYR C 1 353 ? -27.195  -31.815 -20.704 1.00 45.65  ? 366 TYR C N     1 
ATOM   8011  C  CA    . TYR C 1 353 ? -26.345  -31.222 -21.730 1.00 45.65  ? 366 TYR C CA    1 
ATOM   8012  C  C     . TYR C 1 353 ? -26.436  -29.704 -21.736 1.00 45.65  ? 366 TYR C C     1 
ATOM   8013  O  O     . TYR C 1 353 ? -27.524  -29.140 -21.840 1.00 45.65  ? 366 TYR C O     1 
ATOM   8014  C  CB    . TYR C 1 353 ? -26.708  -31.752 -23.117 1.00 45.65  ? 366 TYR C CB    1 
ATOM   8015  C  CG    . TYR C 1 353 ? -26.058  -30.977 -24.244 1.00 45.65  ? 366 TYR C CG    1 
ATOM   8016  C  CD1   . TYR C 1 353 ? -24.713  -31.146 -24.542 1.00 45.65  ? 366 TYR C CD1   1 
ATOM   8017  C  CD2   . TYR C 1 353 ? -26.789  -30.075 -25.006 1.00 45.65  ? 366 TYR C CD2   1 
ATOM   8018  C  CE1   . TYR C 1 353 ? -24.115  -30.439 -25.568 1.00 45.65  ? 366 TYR C CE1   1 
ATOM   8019  C  CE2   . TYR C 1 353 ? -26.200  -29.365 -26.033 1.00 45.65  ? 366 TYR C CE2   1 
ATOM   8020  C  CZ    . TYR C 1 353 ? -24.864  -29.551 -26.309 1.00 45.65  ? 366 TYR C CZ    1 
ATOM   8021  O  OH    . TYR C 1 353 ? -24.276  -28.844 -27.332 1.00 45.65  ? 366 TYR C OH    1 
ATOM   8022  N  N     . ASN C 1 354 ? -25.286  -29.049 -21.630 1.00 94.75  ? 367 ASN C N     1 
ATOM   8023  C  CA    . ASN C 1 354 ? -25.214  -27.604 -21.789 1.00 94.75  ? 367 ASN C CA    1 
ATOM   8024  C  C     . ASN C 1 354 ? -24.127  -27.214 -22.785 1.00 94.75  ? 367 ASN C C     1 
ATOM   8025  O  O     . ASN C 1 354 ? -23.061  -27.828 -22.827 1.00 94.75  ? 367 ASN C O     1 
ATOM   8026  C  CB    . ASN C 1 354 ? -25.012  -26.909 -20.442 1.00 94.75  ? 367 ASN C CB    1 
ATOM   8027  C  CG    . ASN C 1 354 ? -26.290  -26.843 -19.625 1.00 94.75  ? 367 ASN C CG    1 
ATOM   8028  O  OD1   . ASN C 1 354 ? -27.389  -26.790 -20.177 1.00 94.75  ? 367 ASN C OD1   1 
ATOM   8029  N  ND2   . ASN C 1 354 ? -26.152  -26.845 -18.304 1.00 94.75  ? 367 ASN C ND2   1 
ATOM   8030  N  N     . ILE C 1 355 ? -24.413  -26.195 -23.587 1.00 50.87  ? 368 ILE C N     1 
ATOM   8031  C  CA    . ILE C 1 355 ? -23.546  -25.789 -24.690 1.00 50.87  ? 368 ILE C CA    1 
ATOM   8032  C  C     . ILE C 1 355 ? -22.167  -25.335 -24.212 1.00 50.87  ? 368 ILE C C     1 
ATOM   8033  O  O     . ILE C 1 355 ? -22.047  -24.662 -23.188 1.00 50.87  ? 368 ILE C O     1 
ATOM   8034  C  CB    . ILE C 1 355 ? -24.195  -24.659 -25.527 1.00 50.87  ? 368 ILE C CB    1 
ATOM   8035  C  CG1   . ILE C 1 355 ? -25.691  -24.919 -25.729 1.00 50.87  ? 368 ILE C CG1   1 
ATOM   8036  C  CG2   . ILE C 1 355 ? -23.500  -24.513 -26.871 1.00 50.87  ? 368 ILE C CG2   1 
ATOM   8037  C  CD1   . ILE C 1 355 ? -26.595  -24.222 -24.725 1.00 50.87  ? 368 ILE C CD1   1 
ATOM   8038  N  N     . ASP C 1 356 ? -21.133  -25.716 -24.958 1.00 46.79  ? 369 ASP C N     1 
ATOM   8039  C  CA    . ASP C 1 356 ? -19.765  -25.308 -24.656 1.00 46.79  ? 369 ASP C CA    1 
ATOM   8040  C  C     . ASP C 1 356 ? -19.258  -24.335 -25.720 1.00 46.79  ? 369 ASP C C     1 
ATOM   8041  O  O     . ASP C 1 356 ? -18.918  -24.742 -26.831 1.00 46.79  ? 369 ASP C O     1 
ATOM   8042  C  CB    . ASP C 1 356 ? -18.853  -26.533 -24.576 1.00 46.79  ? 369 ASP C CB    1 
ATOM   8043  C  CG    . ASP C 1 356 ? -17.416  -26.173 -24.260 1.00 46.79  ? 369 ASP C CG    1 
ATOM   8044  O  OD1   . ASP C 1 356 ? -17.192  -25.185 -23.530 1.00 46.79  ? 369 ASP C OD1   1 
ATOM   8045  O  OD2   . ASP C 1 356 ? -16.510  -26.883 -24.740 1.00 46.79  ? 369 ASP C OD2   1 
ATOM   8046  N  N     . ASN C 1 357 ? -19.214  -23.052 -25.374 1.00 53.08  ? 370 ASN C N     1 
ATOM   8047  C  CA    . ASN C 1 357 ? -18.827  -22.009 -26.320 1.00 53.08  ? 370 ASN C CA    1 
ATOM   8048  C  C     . ASN C 1 357 ? -17.483  -21.360 -25.993 1.00 53.08  ? 370 ASN C C     1 
ATOM   8049  O  O     . ASN C 1 357 ? -17.245  -20.208 -26.355 1.00 53.08  ? 370 ASN C O     1 
ATOM   8050  C  CB    . ASN C 1 357 ? -19.907  -20.926 -26.390 1.00 53.08  ? 370 ASN C CB    1 
ATOM   8051  C  CG    . ASN C 1 357 ? -21.214  -21.435 -26.961 1.00 53.08  ? 370 ASN C CG    1 
ATOM   8052  O  OD1   . ASN C 1 357 ? -21.227  -22.263 -27.869 1.00 53.08  ? 370 ASN C OD1   1 
ATOM   8053  N  ND2   . ASN C 1 357 ? -22.325  -20.935 -26.432 1.00 53.08  ? 370 ASN C ND2   1 
ATOM   8054  N  N     . MET C 1 358 ? -16.608  -22.098 -25.316 1.00 51.47  ? 371 MET C N     1 
ATOM   8055  C  CA    . MET C 1 358 ? -15.331  -21.539 -24.875 1.00 51.47  ? 371 MET C CA    1 
ATOM   8056  C  C     . MET C 1 358 ? -14.138  -22.084 -25.661 1.00 51.47  ? 371 MET C C     1 
ATOM   8057  O  O     . MET C 1 358 ? -13.636  -23.168 -25.369 1.00 51.47  ? 371 MET C O     1 
ATOM   8058  C  CB    . MET C 1 358 ? -15.126  -21.794 -23.382 1.00 51.47  ? 371 MET C CB    1 
ATOM   8059  C  CG    . MET C 1 358 ? -13.923  -21.085 -22.791 1.00 51.47  ? 371 MET C CG    1 
ATOM   8060  S  SD    . MET C 1 358 ? -14.120  -19.295 -22.714 1.00 51.47  ? 371 MET C SD    1 
ATOM   8061  C  CE    . MET C 1 358 ? -15.602  -19.166 -21.716 1.00 51.47  ? 371 MET C CE    1 
ATOM   8062  N  N     . ILE C 1 359 ? -13.677  -21.317 -26.645 1.00 35.95  ? 372 ILE C N     1 
ATOM   8063  C  CA    . ILE C 1 359 ? -12.534  -21.717 -27.460 1.00 35.95  ? 372 ILE C CA    1 
ATOM   8064  C  C     . ILE C 1 359 ? -11.212  -21.320 -26.803 1.00 35.95  ? 372 ILE C C     1 
ATOM   8065  O  O     . ILE C 1 359 ? -10.850  -20.143 -26.782 1.00 35.95  ? 372 ILE C O     1 
ATOM   8066  C  CB    . ILE C 1 359 ? -12.606  -21.095 -28.869 1.00 35.95  ? 372 ILE C CB    1 
ATOM   8067  C  CG1   . ILE C 1 359 ? -13.969  -21.368 -29.506 1.00 35.95  ? 372 ILE C CG1   1 
ATOM   8068  C  CG2   . ILE C 1 359 ? -11.488  -21.631 -29.748 1.00 35.95  ? 372 ILE C CG2   1 
ATOM   8069  C  CD1   . ILE C 1 359 ? -14.170  -20.680 -30.840 1.00 35.95  ? 372 ILE C CD1   1 
ATOM   8070  N  N     . TYR C 1 360 ? -10.498  -22.307 -26.270 1.00 35.32  ? 373 TYR C N     1 
ATOM   8071  C  CA    . TYR C 1 360 ? -9.207   -22.068 -25.630 1.00 35.32  ? 373 TYR C CA    1 
ATOM   8072  C  C     . TYR C 1 360 ? -8.065   -22.231 -26.627 1.00 35.32  ? 373 TYR C C     1 
ATOM   8073  O  O     . TYR C 1 360 ? -7.761   -23.343 -27.046 1.00 35.32  ? 373 TYR C O     1 
ATOM   8074  C  CB    . TYR C 1 360 ? -9.003   -23.039 -24.464 1.00 35.32  ? 373 TYR C CB    1 
ATOM   8075  C  CG    . TYR C 1 360 ? -9.825   -22.726 -23.235 1.00 35.32  ? 373 TYR C CG    1 
ATOM   8076  C  CD1   . TYR C 1 360 ? -9.812   -21.460 -22.670 1.00 35.32  ? 373 TYR C CD1   1 
ATOM   8077  C  CD2   . TYR C 1 360 ? -10.615  -23.699 -22.640 1.00 35.32  ? 373 TYR C CD2   1 
ATOM   8078  C  CE1   . TYR C 1 360 ? -10.560  -21.171 -21.547 1.00 35.32  ? 373 TYR C CE1   1 
ATOM   8079  C  CE2   . TYR C 1 360 ? -11.367  -23.419 -21.516 1.00 35.32  ? 373 TYR C CE2   1 
ATOM   8080  C  CZ    . TYR C 1 360 ? -11.334  -22.154 -20.973 1.00 35.32  ? 373 TYR C CZ    1 
ATOM   8081  O  OH    . TYR C 1 360 ? -12.083  -21.866 -19.855 1.00 35.32  ? 373 TYR C OH    1 
ATOM   8082  N  N     . ILE C 1 361 ? -7.425   -21.127 -26.999 1.00 49.79  ? 374 ILE C N     1 
ATOM   8083  C  CA    . ILE C 1 361 ? -6.309   -21.183 -27.939 1.00 49.79  ? 374 ILE C CA    1 
ATOM   8084  C  C     . ILE C 1 361 ? -4.954   -21.172 -27.232 1.00 49.79  ? 374 ILE C C     1 
ATOM   8085  O  O     . ILE C 1 361 ? -4.618   -20.219 -26.529 1.00 49.79  ? 374 ILE C O     1 
ATOM   8086  C  CB    . ILE C 1 361 ? -6.364   -20.031 -28.963 1.00 49.79  ? 374 ILE C CB    1 
ATOM   8087  C  CG1   . ILE C 1 361 ? -7.564   -20.205 -29.895 1.00 49.79  ? 374 ILE C CG1   1 
ATOM   8088  C  CG2   . ILE C 1 361 ? -5.080   -19.972 -29.773 1.00 49.79  ? 374 ILE C CG2   1 
ATOM   8089  C  CD1   . ILE C 1 361 ? -7.673   -19.139 -30.966 1.00 49.79  ? 374 ILE C CD1   1 
ATOM   8090  N  N     . ASN C 1 362 ? -4.185   -22.241 -27.419 1.00 56.79  ? 375 ASN C N     1 
ATOM   8091  C  CA    . ASN C 1 362 ? -2.828   -22.299 -26.898 1.00 56.79  ? 375 ASN C CA    1 
ATOM   8092  C  C     . ASN C 1 362 ? -1.975   -21.241 -27.581 1.00 56.79  ? 375 ASN C C     1 
ATOM   8093  O  O     . ASN C 1 362 ? -1.730   -21.313 -28.785 1.00 56.79  ? 375 ASN C O     1 
ATOM   8094  C  CB    . ASN C 1 362 ? -2.222   -23.689 -27.117 1.00 56.79  ? 375 ASN C CB    1 
ATOM   8095  C  CG    . ASN C 1 362 ? -0.916   -23.893 -26.357 1.00 56.79  ? 375 ASN C CG    1 
ATOM   8096  O  OD1   . ASN C 1 362 ? -0.238   -22.938 -25.981 1.00 56.79  ? 375 ASN C OD1   1 
ATOM   8097  N  ND2   . ASN C 1 362 ? -0.558   -25.152 -26.135 1.00 56.79  ? 375 ASN C ND2   1 
ATOM   8098  N  N     . THR C 1 363 ? -1.528   -20.260 -26.804 1.00 67.70  ? 376 THR C N     1 
ATOM   8099  C  CA    . THR C 1 363 ? -0.664   -19.202 -27.310 1.00 67.70  ? 376 THR C CA    1 
ATOM   8100  C  C     . THR C 1 363 ? 0.667    -19.755 -27.802 1.00 67.70  ? 376 THR C C     1 
ATOM   8101  O  O     . THR C 1 363 ? 1.373    -19.103 -28.572 1.00 67.70  ? 376 THR C O     1 
ATOM   8102  C  CB    . THR C 1 363 ? -0.380   -18.150 -26.228 1.00 67.70  ? 376 THR C CB    1 
ATOM   8103  O  OG1   . THR C 1 363 ? -0.269   -18.787 -24.950 1.00 67.70  ? 376 THR C OG1   1 
ATOM   8104  C  CG2   . THR C 1 363 ? -1.488   -17.120 -26.177 1.00 67.70  ? 376 THR C CG2   1 
ATOM   8105  N  N     . GLY C 1 364 ? 1.001    -20.960 -27.354 1.00 82.43  ? 377 GLY C N     1 
ATOM   8106  C  CA    . GLY C 1 364 ? 2.279    -21.562 -27.676 1.00 82.43  ? 377 GLY C CA    1 
ATOM   8107  C  C     . GLY C 1 364 ? 3.403    -20.768 -27.045 1.00 82.43  ? 377 GLY C C     1 
ATOM   8108  O  O     . GLY C 1 364 ? 3.207    -20.096 -26.033 1.00 82.43  ? 377 GLY C O     1 
ATOM   8109  N  N     . GLU C 1 365 ? 4.585    -20.844 -27.645 1.00 138.46 ? 378 GLU C N     1 
ATOM   8110  C  CA    . GLU C 1 365 ? 5.727    -20.076 -27.172 1.00 138.46 ? 378 GLU C CA    1 
ATOM   8111  C  C     . GLU C 1 365 ? 5.812    -18.747 -27.915 1.00 138.46 ? 378 GLU C C     1 
ATOM   8112  O  O     . GLU C 1 365 ? 6.704    -17.937 -27.661 1.00 138.46 ? 378 GLU C O     1 
ATOM   8113  C  CB    . GLU C 1 365 ? 7.018    -20.874 -27.348 1.00 138.46 ? 378 GLU C CB    1 
ATOM   8114  C  CG    . GLU C 1 365 ? 6.838    -22.166 -28.124 1.00 138.46 ? 378 GLU C CG    1 
ATOM   8115  C  CD    . GLU C 1 365 ? 7.747    -22.248 -29.331 1.00 138.46 ? 378 GLU C CD    1 
ATOM   8116  O  OE1   . GLU C 1 365 ? 7.321    -21.821 -30.424 1.00 138.46 ? 378 GLU C OE1   1 
ATOM   8117  O  OE2   . GLU C 1 365 ? 8.887    -22.736 -29.188 1.00 138.46 ? 378 GLU C OE2   1 
ATOM   8118  N  N     . VAL C 1 366 ? 4.872    -18.539 -28.833 1.00 82.93  ? 379 VAL C N     1 
ATOM   8119  C  CA    . VAL C 1 366 ? 4.755    -17.291 -29.579 1.00 82.93  ? 379 VAL C CA    1 
ATOM   8120  C  C     . VAL C 1 366 ? 4.627    -16.106 -28.625 1.00 82.93  ? 379 VAL C C     1 
ATOM   8121  O  O     . VAL C 1 366 ? 5.155    -15.022 -28.878 1.00 82.93  ? 379 VAL C O     1 
ATOM   8122  C  CB    . VAL C 1 366 ? 3.530    -17.329 -30.521 1.00 82.93  ? 379 VAL C CB    1 
ATOM   8123  C  CG1   . VAL C 1 366 ? 3.278    -15.969 -31.155 1.00 82.93  ? 379 VAL C CG1   1 
ATOM   8124  C  CG2   . VAL C 1 366 ? 3.715    -18.394 -31.590 1.00 82.93  ? 379 VAL C CG2   1 
ATOM   8125  N  N     . THR C 1 367 ? 3.940    -16.332 -27.512 1.00 202.87 ? 380 THR C N     1 
ATOM   8126  C  CA    . THR C 1 367 ? 3.675    -15.280 -26.541 1.00 202.87 ? 380 THR C CA    1 
ATOM   8127  C  C     . THR C 1 367 ? 4.163    -15.707 -25.146 1.00 202.87 ? 380 THR C C     1 
ATOM   8128  O  O     . THR C 1 367 ? 4.308    -16.906 -24.907 1.00 202.87 ? 380 THR C O     1 
ATOM   8129  C  CB    . THR C 1 367 ? 2.182    -14.910 -26.554 1.00 118.89 ? 380 THR C CB    1 
ATOM   8130  O  OG1   . THR C 1 367 ? 1.448    -15.941 -27.220 1.00 118.89 ? 380 THR C OG1   1 
ATOM   8131  C  CG2   . THR C 1 367 ? 1.983    -13.620 -27.318 1.00 118.89 ? 380 THR C CG2   1 
ATOM   8132  N  N     . THR C 1 368 ? 4.430    -14.773 -24.222 1.00 105.38 ? 381 THR C N     1 
ATOM   8133  C  CA    . THR C 1 368 ? 4.167    -13.330 -24.337 1.00 105.38 ? 381 THR C CA    1 
ATOM   8134  C  C     . THR C 1 368 ? 4.954    -12.609 -25.431 1.00 105.38 ? 381 THR C C     1 
ATOM   8135  O  O     . THR C 1 368 ? 5.970    -13.112 -25.912 1.00 105.38 ? 381 THR C O     1 
ATOM   8136  C  CB    . THR C 1 368 ? 4.405    -12.607 -22.993 1.00 95.38  ? 381 THR C CB    1 
ATOM   8137  O  OG1   . THR C 1 368 ? 3.994    -11.238 -23.102 1.00 95.38  ? 381 THR C OG1   1 
ATOM   8138  C  CG2   . THR C 1 368 ? 5.874    -12.663 -22.609 1.00 95.38  ? 381 THR C CG2   1 
ATOM   8139  N  N     . THR C 1 369 ? 4.459    -11.433 -25.812 1.00 139.41 ? 382 THR C N     1 
ATOM   8140  C  CA    . THR C 1 369 ? 4.948    -10.706 -26.981 1.00 139.41 ? 382 THR C CA    1 
ATOM   8141  C  C     . THR C 1 369 ? 6.460    -10.504 -27.008 1.00 139.41 ? 382 THR C C     1 
ATOM   8142  O  O     . THR C 1 369 ? 6.980    -9.509  -26.500 1.00 139.41 ? 382 THR C O     1 
ATOM   8143  C  CB    . THR C 1 369 ? 4.245    -9.337  -27.140 1.00 73.78  ? 382 THR C CB    1 
ATOM   8144  O  OG1   . THR C 1 369 ? 4.473    -8.536  -25.974 1.00 73.78  ? 382 THR C OG1   1 
ATOM   8145  C  CG2   . THR C 1 369 ? 2.747    -9.525  -27.339 1.00 73.78  ? 382 THR C CG2   1 
ATOM   8146  N  N     . ASN C 1 370 ? 7.154    -11.469 -27.603 1.00 119.83 ? 383 ASN C N     1 
ATOM   8147  C  CA    . ASN C 1 370 ? 8.586    -11.360 -27.832 1.00 119.83 ? 383 ASN C CA    1 
ATOM   8148  C  C     . ASN C 1 370 ? 8.836    -10.715 -29.192 1.00 119.83 ? 383 ASN C C     1 
ATOM   8149  O  O     . ASN C 1 370 ? 8.109    -10.981 -30.150 1.00 119.83 ? 383 ASN C O     1 
ATOM   8150  C  CB    . ASN C 1 370 ? 9.244    -12.738 -27.749 1.00 119.83 ? 383 ASN C CB    1 
ATOM   8151  C  CG    . ASN C 1 370 ? 9.032    -13.402 -26.400 1.00 119.83 ? 383 ASN C CG    1 
ATOM   8152  O  OD1   . ASN C 1 370 ? 9.084    -12.746 -25.359 1.00 119.83 ? 383 ASN C OD1   1 
ATOM   8153  N  ND2   . ASN C 1 370 ? 8.783    -14.706 -26.412 1.00 119.83 ? 383 ASN C ND2   1 
ATOM   8154  N  N     . THR C 1 371 ? 9.864    -9.870  -29.259 1.00 131.79 ? 384 THR C N     1 
ATOM   8155  C  CA    . THR C 1 371 ? 10.142   -9.028  -30.427 1.00 131.79 ? 384 THR C CA    1 
ATOM   8156  C  C     . THR C 1 371 ? 10.042   -9.748  -31.776 1.00 131.79 ? 384 THR C C     1 
ATOM   8157  O  O     . THR C 1 371 ? 9.500    -9.200  -32.737 1.00 131.79 ? 384 THR C O     1 
ATOM   8158  C  CB    . THR C 1 371 ? 11.521   -8.341  -30.305 1.00 131.79 ? 384 THR C CB    1 
ATOM   8159  O  OG1   . THR C 1 371 ? 11.585   -7.611  -29.074 1.00 131.79 ? 384 THR C OG1   1 
ATOM   8160  C  CG2   . THR C 1 371 ? 11.753   -7.383  -31.466 1.00 131.79 ? 384 THR C CG2   1 
ATOM   8161  N  N     . SER C 1 372 ? 10.547   -10.977 -31.842 1.00 115.48 ? 385 SER C N     1 
ATOM   8162  C  CA    . SER C 1 372 ? 10.469   -11.757 -33.075 1.00 115.48 ? 385 SER C CA    1 
ATOM   8163  C  C     . SER C 1 372 ? 10.514   -13.267 -32.848 1.00 115.48 ? 385 SER C C     1 
ATOM   8164  O  O     . SER C 1 372 ? 11.472   -13.788 -32.278 1.00 115.48 ? 385 SER C O     1 
ATOM   8165  C  CB    . SER C 1 372 ? 11.575   -11.344 -34.048 1.00 115.48 ? 385 SER C CB    1 
ATOM   8166  O  OG    . SER C 1 372 ? 11.345   -10.044 -34.560 1.00 115.48 ? 385 SER C OG    1 
ATOM   8167  N  N     . PRO C 1 373 ? 9.461    -13.971 -33.290 1.00 102.11 ? 386 PRO C N     1 
ATOM   8168  C  CA    . PRO C 1 373 ? 9.402    -15.435 -33.293 1.00 102.11 ? 386 PRO C CA    1 
ATOM   8169  C  C     . PRO C 1 373 ? 9.733    -16.006 -34.672 1.00 102.11 ? 386 PRO C C     1 
ATOM   8170  O  O     . PRO C 1 373 ? 9.519    -15.329 -35.678 1.00 102.11 ? 386 PRO C O     1 
ATOM   8171  C  CB    . PRO C 1 373 ? 7.937    -15.705 -32.963 1.00 102.11 ? 386 PRO C CB    1 
ATOM   8172  C  CG    . PRO C 1 373 ? 7.211    -14.567 -33.604 1.00 102.11 ? 386 PRO C CG    1 
ATOM   8173  C  CD    . PRO C 1 373 ? 8.143    -13.372 -33.567 1.00 102.11 ? 386 PRO C CD    1 
ATOM   8174  N  N     . THR C 1 374 ? 10.252   -17.230 -34.718 1.00 87.70  ? 387 THR C N     1 
ATOM   8175  C  CA    . THR C 1 374 ? 10.516   -17.894 -35.993 1.00 87.70  ? 387 THR C CA    1 
ATOM   8176  C  C     . THR C 1 374 ? 9.202    -18.264 -36.677 1.00 87.70  ? 387 THR C C     1 
ATOM   8177  O  O     . THR C 1 374 ? 8.245    -18.653 -36.012 1.00 87.70  ? 387 THR C O     1 
ATOM   8178  C  CB    . THR C 1 374 ? 11.413   -19.146 -35.821 1.00 87.70  ? 387 THR C CB    1 
ATOM   8179  O  OG1   . THR C 1 374 ? 11.247   -20.019 -36.945 1.00 87.70  ? 387 THR C OG1   1 
ATOM   8180  C  CG2   . THR C 1 374 ? 11.056   -19.897 -34.556 1.00 87.70  ? 387 THR C CG2   1 
ATOM   8181  N  N     . PRO C 1 375 ? 9.148    -18.128 -38.012 1.00 70.67  ? 388 PRO C N     1 
ATOM   8182  C  CA    . PRO C 1 375 ? 7.916    -18.392 -38.765 1.00 70.67  ? 388 PRO C CA    1 
ATOM   8183  C  C     . PRO C 1 375 ? 7.464    -19.847 -38.682 1.00 70.67  ? 388 PRO C C     1 
ATOM   8184  O  O     . PRO C 1 375 ? 6.309    -20.146 -38.986 1.00 70.67  ? 388 PRO C O     1 
ATOM   8185  C  CB    . PRO C 1 375 ? 8.305    -18.043 -40.207 1.00 70.67  ? 388 PRO C CB    1 
ATOM   8186  C  CG    . PRO C 1 375 ? 9.791    -18.161 -40.241 1.00 70.67  ? 388 PRO C CG    1 
ATOM   8187  C  CD    . PRO C 1 375 ? 10.245   -17.696 -38.893 1.00 70.67  ? 388 PRO C CD    1 
ATOM   8188  N  N     . GLU C 1 376 ? 8.361    -20.735 -38.269 1.00 94.69  ? 389 GLU C N     1 
ATOM   8189  C  CA    . GLU C 1 376 ? 8.045    -22.156 -38.183 1.00 94.69  ? 389 GLU C CA    1 
ATOM   8190  C  C     . GLU C 1 376 ? 7.185    -22.490 -36.965 1.00 94.69  ? 389 GLU C C     1 
ATOM   8191  O  O     . GLU C 1 376 ? 6.696    -23.612 -36.836 1.00 94.69  ? 389 GLU C O     1 
ATOM   8192  C  CB    . GLU C 1 376 ? 9.328    -22.992 -38.168 1.00 94.69  ? 389 GLU C CB    1 
ATOM   8193  C  CG    . GLU C 1 376 ? 10.283   -22.708 -39.321 1.00 94.69  ? 389 GLU C CG    1 
ATOM   8194  C  CD    . GLU C 1 376 ? 9.716    -23.090 -40.679 1.00 94.69  ? 389 GLU C CD    1 
ATOM   8195  O  OE1   . GLU C 1 376 ? 8.742    -23.870 -40.731 1.00 94.69  ? 389 GLU C OE1   1 
ATOM   8196  O  OE2   . GLU C 1 376 ? 10.252   -22.608 -41.699 1.00 94.69  ? 389 GLU C OE2   1 
ATOM   8197  N  N     . GLN C 1 377 ? 7.003    -21.518 -36.075 1.00 98.42  ? 390 GLN C N     1 
ATOM   8198  C  CA    . GLN C 1 377 ? 6.186    -21.720 -34.882 1.00 98.42  ? 390 GLN C CA    1 
ATOM   8199  C  C     . GLN C 1 377 ? 4.929    -20.854 -34.922 1.00 98.42  ? 390 GLN C C     1 
ATOM   8200  O  O     . GLN C 1 377 ? 3.953    -21.130 -34.224 1.00 98.42  ? 390 GLN C O     1 
ATOM   8201  C  CB    . GLN C 1 377 ? 6.995    -21.437 -33.613 1.00 98.42  ? 390 GLN C CB    1 
ATOM   8202  C  CG    . GLN C 1 377 ? 7.274    -19.964 -33.358 1.00 98.42  ? 390 GLN C CG    1 
ATOM   8203  C  CD    . GLN C 1 377 ? 8.451    -19.741 -32.430 1.00 98.42  ? 390 GLN C CD    1 
ATOM   8204  O  OE1   . GLN C 1 377 ? 8.919    -18.616 -32.261 1.00 98.42  ? 390 GLN C OE1   1 
ATOM   8205  N  NE2   . GLN C 1 377 ? 8.945    -20.817 -31.832 1.00 98.42  ? 390 GLN C NE2   1 
ATOM   8206  N  N     . ARG C 1 378 ? 4.961    -19.806 -35.740 1.00 55.76  ? 391 ARG C N     1 
ATOM   8207  C  CA    . ARG C 1 378 ? 3.793    -18.958 -35.934 1.00 55.76  ? 391 ARG C CA    1 
ATOM   8208  C  C     . ARG C 1 378 ? 2.724    -19.745 -36.676 1.00 55.76  ? 391 ARG C C     1 
ATOM   8209  O  O     . ARG C 1 378 ? 1.535    -19.636 -36.379 1.00 55.76  ? 391 ARG C O     1 
ATOM   8210  C  CB    . ARG C 1 378 ? 4.151    -17.700 -36.727 1.00 55.76  ? 391 ARG C CB    1 
ATOM   8211  C  CG    . ARG C 1 378 ? 5.296    -16.883 -36.149 1.00 55.76  ? 391 ARG C CG    1 
ATOM   8212  C  CD    . ARG C 1 378 ? 5.133    -15.412 -36.502 1.00 55.76  ? 391 ARG C CD    1 
ATOM   8213  N  NE    . ARG C 1 378 ? 4.452    -15.231 -37.781 1.00 55.76  ? 391 ARG C NE    1 
ATOM   8214  C  CZ    . ARG C 1 378 ? 4.056    -14.056 -38.260 1.00 55.76  ? 391 ARG C CZ    1 
ATOM   8215  N  NH1   . ARG C 1 378 ? 4.272    -12.947 -37.568 1.00 55.76  ? 391 ARG C NH1   1 
ATOM   8216  N  NH2   . ARG C 1 378 ? 3.441    -13.991 -39.433 1.00 55.76  ? 391 ARG C NH2   1 
ATOM   8217  N  N     . ALA C 1 379 ? 3.163    -20.543 -37.644 1.00 72.15  ? 392 ALA C N     1 
ATOM   8218  C  CA    . ALA C 1 379 ? 2.269    -21.421 -38.385 1.00 72.15  ? 392 ALA C CA    1 
ATOM   8219  C  C     . ALA C 1 379 ? 1.690    -22.480 -37.455 1.00 72.15  ? 392 ALA C C     1 
ATOM   8220  O  O     . ALA C 1 379 ? 0.561    -22.933 -37.642 1.00 72.15  ? 392 ALA C O     1 
ATOM   8221  C  CB    . ALA C 1 379 ? 3.010    -22.074 -39.537 1.00 72.15  ? 392 ALA C CB    1 
ATOM   8222  N  N     . ARG C 1 380 ? 2.474    -22.870 -36.454 1.00 82.32  ? 393 ARG C N     1 
ATOM   8223  C  CA    . ARG C 1 380 ? 2.032    -23.840 -35.460 1.00 82.32  ? 393 ARG C CA    1 
ATOM   8224  C  C     . ARG C 1 380 ? 0.931    -23.237 -34.595 1.00 82.32  ? 393 ARG C C     1 
ATOM   8225  O  O     . ARG C 1 380 ? -0.021   -23.919 -34.220 1.00 82.32  ? 393 ARG C O     1 
ATOM   8226  C  CB    . ARG C 1 380 ? 3.207    -24.276 -34.583 1.00 82.32  ? 393 ARG C CB    1 
ATOM   8227  C  CG    . ARG C 1 380 ? 3.311    -25.779 -34.372 1.00 82.32  ? 393 ARG C CG    1 
ATOM   8228  C  CD    . ARG C 1 380 ? 3.301    -26.141 -32.894 1.00 82.32  ? 393 ARG C CD    1 
ATOM   8229  N  NE    . ARG C 1 380 ? 1.966    -26.033 -32.316 1.00 82.32  ? 393 ARG C NE    1 
ATOM   8230  C  CZ    . ARG C 1 380 ? 1.066    -27.010 -32.335 1.00 82.32  ? 393 ARG C CZ    1 
ATOM   8231  N  NH1   . ARG C 1 380 ? 1.357    -28.170 -32.906 1.00 82.32  ? 393 ARG C NH1   1 
ATOM   8232  N  NH2   . ARG C 1 380 ? -0.127   -26.829 -31.786 1.00 82.32  ? 393 ARG C NH2   1 
ATOM   8233  N  N     . ALA C 1 381 ? 1.070    -21.952 -34.283 1.00 51.93  ? 394 ALA C N     1 
ATOM   8234  C  CA    . ALA C 1 381 ? 0.070    -21.236 -33.501 1.00 51.93  ? 394 ALA C CA    1 
ATOM   8235  C  C     . ALA C 1 381 ? -1.250   -21.139 -34.259 1.00 51.93  ? 394 ALA C C     1 
ATOM   8236  O  O     . ALA C 1 381 ? -2.325   -21.198 -33.663 1.00 51.93  ? 394 ALA C O     1 
ATOM   8237  C  CB    . ALA C 1 381 ? 0.576    -19.852 -33.139 1.00 51.93  ? 394 ALA C CB    1 
ATOM   8238  N  N     . VAL C 1 382 ? -1.156   -20.981 -35.576 1.00 53.49  ? 395 VAL C N     1 
ATOM   8239  C  CA    . VAL C 1 382 ? -2.334   -20.917 -36.433 1.00 53.49  ? 395 VAL C CA    1 
ATOM   8240  C  C     . VAL C 1 382 ? -3.070   -22.255 -36.445 1.00 53.49  ? 395 VAL C C     1 
ATOM   8241  O  O     . VAL C 1 382 ? -4.299   -22.297 -36.383 1.00 53.49  ? 395 VAL C O     1 
ATOM   8242  C  CB    . VAL C 1 382 ? -1.957   -20.515 -37.871 1.00 53.49  ? 395 VAL C CB    1 
ATOM   8243  C  CG1   . VAL C 1 382 ? -3.176   -20.553 -38.778 1.00 53.49  ? 395 VAL C CG1   1 
ATOM   8244  C  CG2   . VAL C 1 382 ? -1.326   -19.132 -37.886 1.00 53.49  ? 395 VAL C CG2   1 
ATOM   8245  N  N     . LYS C 1 383 ? -2.311   -23.346 -36.515 1.00 61.76  ? 396 LYS C N     1 
ATOM   8246  C  CA    . LYS C 1 383 ? -2.894   -24.684 -36.501 1.00 61.76  ? 396 LYS C CA    1 
ATOM   8247  C  C     . LYS C 1 383 ? -3.623   -24.933 -35.184 1.00 61.76  ? 396 LYS C C     1 
ATOM   8248  O  O     . LYS C 1 383 ? -4.629   -25.643 -35.147 1.00 61.76  ? 396 LYS C O     1 
ATOM   8249  C  CB    . LYS C 1 383 ? -1.820   -25.752 -36.719 1.00 61.76  ? 396 LYS C CB    1 
ATOM   8250  C  CG    . LYS C 1 383 ? -2.371   -27.106 -37.147 1.00 61.76  ? 396 LYS C CG    1 
ATOM   8251  C  CD    . LYS C 1 383 ? -1.374   -28.226 -36.895 1.00 61.76  ? 396 LYS C CD    1 
ATOM   8252  C  CE    . LYS C 1 383 ? -1.184   -28.467 -35.405 1.00 61.76  ? 396 LYS C CE    1 
ATOM   8253  N  NZ    . LYS C 1 383 ? -0.216   -29.566 -35.130 1.00 61.76  ? 396 LYS C NZ    1 
ATOM   8254  N  N     . ASN C 1 384 ? -3.110   -24.345 -34.106 1.00 94.10  ? 397 ASN C N     1 
ATOM   8255  C  CA    . ASN C 1 384 ? -3.779   -24.394 -32.812 1.00 94.10  ? 397 ASN C CA    1 
ATOM   8256  C  C     . ASN C 1 384 ? -5.141   -23.717 -32.871 1.00 94.10  ? 397 ASN C C     1 
ATOM   8257  O  O     . ASN C 1 384 ? -6.148   -24.298 -32.473 1.00 94.10  ? 397 ASN C O     1 
ATOM   8258  C  CB    . ASN C 1 384 ? -2.923   -23.731 -31.731 1.00 94.10  ? 397 ASN C CB    1 
ATOM   8259  C  CG    . ASN C 1 384 ? -2.167   -24.735 -30.885 1.00 94.10  ? 397 ASN C CG    1 
ATOM   8260  O  OD1   . ASN C 1 384 ? -0.948   -24.646 -30.736 1.00 94.10  ? 397 ASN C OD1   1 
ATOM   8261  N  ND2   . ASN C 1 384 ? -2.888   -25.699 -30.325 1.00 94.10  ? 397 ASN C ND2   1 
ATOM   8262  N  N     . GLY C 1 385 ? -5.165   -22.488 -33.377 1.00 62.93  ? 398 GLY C N     1 
ATOM   8263  C  CA    . GLY C 1 385 ? -6.400   -21.735 -33.493 1.00 62.93  ? 398 GLY C CA    1 
ATOM   8264  C  C     . GLY C 1 385 ? -7.409   -22.395 -34.412 1.00 62.93  ? 398 GLY C C     1 
ATOM   8265  O  O     . GLY C 1 385 ? -8.610   -22.157 -34.296 1.00 62.93  ? 398 GLY C O     1 
ATOM   8266  N  N     . TYR C 1 386 ? -6.921   -23.229 -35.325 1.00 58.97  ? 399 TYR C N     1 
ATOM   8267  C  CA    . TYR C 1 386 ? -7.788   -23.934 -36.263 1.00 58.97  ? 399 TYR C CA    1 
ATOM   8268  C  C     . TYR C 1 386 ? -8.316   -25.234 -35.661 1.00 58.97  ? 399 TYR C C     1 
ATOM   8269  O  O     . TYR C 1 386 ? -9.527   -25.457 -35.615 1.00 58.97  ? 399 TYR C O     1 
ATOM   8270  C  CB    . TYR C 1 386 ? -7.041   -24.223 -37.568 1.00 58.97  ? 399 TYR C CB    1 
ATOM   8271  C  CG    . TYR C 1 386 ? -7.910   -24.807 -38.662 1.00 58.97  ? 399 TYR C CG    1 
ATOM   8272  C  CD1   . TYR C 1 386 ? -8.688   -23.987 -39.466 1.00 58.97  ? 399 TYR C CD1   1 
ATOM   8273  C  CD2   . TYR C 1 386 ? -7.945   -26.175 -38.894 1.00 58.97  ? 399 TYR C CD2   1 
ATOM   8274  C  CE1   . TYR C 1 386 ? -9.482   -24.513 -40.467 1.00 58.97  ? 399 TYR C CE1   1 
ATOM   8275  C  CE2   . TYR C 1 386 ? -8.736   -26.709 -39.892 1.00 58.97  ? 399 TYR C CE2   1 
ATOM   8276  C  CZ    . TYR C 1 386 ? -9.502   -25.873 -40.675 1.00 58.97  ? 399 TYR C CZ    1 
ATOM   8277  O  OH    . TYR C 1 386 ? -10.289  -26.401 -41.669 1.00 58.97  ? 399 TYR C OH    1 
ATOM   8278  N  N     . ASP C 1 387 ? -7.402   -26.086 -35.204 1.00 55.28  ? 400 ASP C N     1 
ATOM   8279  C  CA    . ASP C 1 387 ? -7.770   -27.383 -34.643 1.00 55.28  ? 400 ASP C CA    1 
ATOM   8280  C  C     . ASP C 1 387 ? -8.614   -27.255 -33.375 1.00 55.28  ? 400 ASP C C     1 
ATOM   8281  O  O     . ASP C 1 387 ? -9.568   -28.005 -33.183 1.00 55.28  ? 400 ASP C O     1 
ATOM   8282  C  CB    . ASP C 1 387 ? -6.523   -28.226 -34.359 1.00 55.28  ? 400 ASP C CB    1 
ATOM   8283  C  CG    . ASP C 1 387 ? -5.780   -28.619 -35.621 1.00 55.28  ? 400 ASP C CG    1 
ATOM   8284  O  OD1   . ASP C 1 387 ? -6.363   -28.509 -36.719 1.00 55.28  ? 400 ASP C OD1   1 
ATOM   8285  O  OD2   . ASP C 1 387 ? -4.611   -29.050 -35.513 1.00 55.28  ? 400 ASP C OD2   1 
ATOM   8286  N  N     . GLN C 1 388 ? -8.260   -26.305 -32.516 1.00 75.68  ? 401 GLN C N     1 
ATOM   8287  C  CA    . GLN C 1 388 ? -8.971   -26.121 -31.255 1.00 75.68  ? 401 GLN C CA    1 
ATOM   8288  C  C     . GLN C 1 388 ? -10.359  -25.524 -31.472 1.00 75.68  ? 401 GLN C C     1 
ATOM   8289  O  O     . GLN C 1 388 ? -11.284  -25.788 -30.704 1.00 75.68  ? 401 GLN C O     1 
ATOM   8290  C  CB    . GLN C 1 388 ? -8.162   -25.245 -30.298 1.00 75.68  ? 401 GLN C CB    1 
ATOM   8291  C  CG    . GLN C 1 388 ? -8.130   -25.760 -28.871 1.00 75.68  ? 401 GLN C CG    1 
ATOM   8292  C  CD    . GLN C 1 388 ? -7.199   -26.940 -28.696 1.00 75.68  ? 401 GLN C CD    1 
ATOM   8293  O  OE1   . GLN C 1 388 ? -6.292   -27.153 -29.498 1.00 75.68  ? 401 GLN C OE1   1 
ATOM   8294  N  NE2   . GLN C 1 388 ? -7.419   -27.716 -27.642 1.00 75.68  ? 401 GLN C NE2   1 
ATOM   8295  N  N     . THR C 1 389 ? -10.498  -24.715 -32.518 1.00 33.36  ? 402 THR C N     1 
ATOM   8296  C  CA    . THR C 1 389 ? -11.797  -24.161 -32.884 1.00 33.36  ? 402 THR C CA    1 
ATOM   8297  C  C     . THR C 1 389 ? -12.670  -25.266 -33.466 1.00 33.36  ? 402 THR C C     1 
ATOM   8298  O  O     . THR C 1 389 ? -13.859  -25.361 -33.161 1.00 33.36  ? 402 THR C O     1 
ATOM   8299  C  CB    . THR C 1 389 ? -11.665  -23.016 -33.907 1.00 33.36  ? 402 THR C CB    1 
ATOM   8300  O  OG1   . THR C 1 389 ? -10.823  -21.987 -33.372 1.00 33.36  ? 402 THR C OG1   1 
ATOM   8301  C  CG2   . THR C 1 389 ? -13.027  -22.426 -34.232 1.00 33.36  ? 402 THR C CG2   1 
ATOM   8302  N  N     . MET C 1 390 ? -12.064  -26.101 -34.305 1.00 65.15  ? 403 MET C N     1 
ATOM   8303  C  CA    . MET C 1 390 ? -12.744  -27.254 -34.879 1.00 65.15  ? 403 MET C CA    1 
ATOM   8304  C  C     . MET C 1 390 ? -13.128  -28.245 -33.789 1.00 65.15  ? 403 MET C C     1 
ATOM   8305  O  O     . MET C 1 390 ? -14.213  -28.823 -33.817 1.00 65.15  ? 403 MET C O     1 
ATOM   8306  C  CB    . MET C 1 390 ? -11.844  -27.939 -35.907 1.00 65.15  ? 403 MET C CB    1 
ATOM   8307  C  CG    . MET C 1 390 ? -12.322  -27.814 -37.343 1.00 65.15  ? 403 MET C CG    1 
ATOM   8308  S  SD    . MET C 1 390 ? -12.823  -26.132 -37.746 1.00 65.15  ? 403 MET C SD    1 
ATOM   8309  C  CE    . MET C 1 390 ? -13.037  -26.260 -39.517 1.00 65.15  ? 403 MET C CE    1 
ATOM   8310  N  N     . GLN C 1 391 ? -12.225  -28.431 -32.830 1.00 58.75  ? 404 GLN C N     1 
ATOM   8311  C  CA    . GLN C 1 391 ? -12.431  -29.366 -31.727 1.00 58.75  ? 404 GLN C CA    1 
ATOM   8312  C  C     . GLN C 1 391 ? -13.691  -29.039 -30.926 1.00 58.75  ? 404 GLN C C     1 
ATOM   8313  O  O     . GLN C 1 391 ? -14.426  -29.938 -30.516 1.00 58.75  ? 404 GLN C O     1 
ATOM   8314  C  CB    . GLN C 1 391 ? -11.201  -29.377 -30.815 1.00 58.75  ? 404 GLN C CB    1 
ATOM   8315  C  CG    . GLN C 1 391 ? -11.329  -30.250 -29.576 1.00 58.75  ? 404 GLN C CG    1 
ATOM   8316  C  CD    . GLN C 1 391 ? -10.000  -30.450 -28.872 1.00 58.75  ? 404 GLN C CD    1 
ATOM   8317  O  OE1   . GLN C 1 391 ? -8.989   -30.749 -29.507 1.00 58.75  ? 404 GLN C OE1   1 
ATOM   8318  N  NE2   . GLN C 1 391 ? -9.995   -30.280 -27.555 1.00 58.75  ? 404 GLN C NE2   1 
ATOM   8319  N  N     . LEU C 1 392 ? -13.939  -27.750 -30.716 1.00 43.32  ? 405 LEU C N     1 
ATOM   8320  C  CA    . LEU C 1 392 ? -15.112  -27.308 -29.970 1.00 43.32  ? 405 LEU C CA    1 
ATOM   8321  C  C     . LEU C 1 392 ? -16.357  -27.222 -30.851 1.00 43.32  ? 405 LEU C C     1 
ATOM   8322  O  O     . LEU C 1 392 ? -17.467  -27.492 -30.396 1.00 43.32  ? 405 LEU C O     1 
ATOM   8323  C  CB    . LEU C 1 392 ? -14.845  -25.958 -29.299 1.00 43.32  ? 405 LEU C CB    1 
ATOM   8324  C  CG    . LEU C 1 392 ? -16.024  -25.315 -28.566 1.00 43.32  ? 405 LEU C CG    1 
ATOM   8325  C  CD1   . LEU C 1 392 ? -15.616  -24.875 -27.175 1.00 43.32  ? 405 LEU C CD1   1 
ATOM   8326  C  CD2   . LEU C 1 392 ? -16.576  -24.138 -29.354 1.00 43.32  ? 405 LEU C CD2   1 
ATOM   8327  N  N     . LEU C 1 393 ? -16.169  -26.844 -32.111 1.00 62.00  ? 406 LEU C N     1 
ATOM   8328  C  CA    . LEU C 1 393 ? -17.293  -26.673 -33.027 1.00 62.00  ? 406 LEU C CA    1 
ATOM   8329  C  C     . LEU C 1 393 ? -17.981  -27.998 -33.346 1.00 62.00  ? 406 LEU C C     1 
ATOM   8330  O  O     . LEU C 1 393 ? -19.180  -28.033 -33.624 1.00 62.00  ? 406 LEU C O     1 
ATOM   8331  C  CB    . LEU C 1 393 ? -16.844  -25.975 -34.312 1.00 62.00  ? 406 LEU C CB    1 
ATOM   8332  C  CG    . LEU C 1 393 ? -17.458  -24.597 -34.562 1.00 62.00  ? 406 LEU C CG    1 
ATOM   8333  C  CD1   . LEU C 1 393 ? -17.352  -23.737 -33.317 1.00 62.00  ? 406 LEU C CD1   1 
ATOM   8334  C  CD2   . LEU C 1 393 ? -16.789  -23.907 -35.735 1.00 62.00  ? 406 LEU C CD2   1 
ATOM   8335  N  N     . ASP C 1 394 ? -17.220  -29.087 -33.296 1.00 74.76  ? 407 ASP C N     1 
ATOM   8336  C  CA    . ASP C 1 394 ? -17.772  -30.412 -33.544 1.00 74.76  ? 407 ASP C CA    1 
ATOM   8337  C  C     . ASP C 1 394 ? -18.525  -30.935 -32.321 1.00 74.76  ? 407 ASP C C     1 
ATOM   8338  O  O     . ASP C 1 394 ? -19.264  -31.914 -32.412 1.00 74.76  ? 407 ASP C O     1 
ATOM   8339  C  CB    . ASP C 1 394 ? -16.665  -31.393 -33.939 1.00 74.76  ? 407 ASP C CB    1 
ATOM   8340  C  CG    . ASP C 1 394 ? -15.880  -30.932 -35.152 1.00 74.76  ? 407 ASP C CG    1 
ATOM   8341  O  OD1   . ASP C 1 394 ? -16.392  -30.080 -35.908 1.00 74.76  ? 407 ASP C OD1   1 
ATOM   8342  O  OD2   . ASP C 1 394 ? -14.749  -31.425 -35.350 1.00 74.76  ? 407 ASP C OD2   1 
ATOM   8343  N  N     . SER C 1 395 ? -18.336  -30.278 -31.180 1.00 69.13  ? 408 SER C N     1 
ATOM   8344  C  CA    . SER C 1 395 ? -18.988  -30.695 -29.942 1.00 69.13  ? 408 SER C CA    1 
ATOM   8345  C  C     . SER C 1 395 ? -20.463  -30.305 -29.922 1.00 69.13  ? 408 SER C C     1 
ATOM   8346  O  O     . SER C 1 395 ? -21.237  -30.817 -29.114 1.00 69.13  ? 408 SER C O     1 
ATOM   8347  C  CB    . SER C 1 395 ? -18.273  -30.101 -28.726 1.00 69.13  ? 408 SER C CB    1 
ATOM   8348  O  OG    . SER C 1 395 ? -18.353  -28.688 -28.725 1.00 69.13  ? 408 SER C OG    1 
ATOM   8349  N  N     . HIS C 1 396 ? -20.846  -29.400 -30.816 1.00 56.36  ? 409 HIS C N     1 
ATOM   8350  C  CA    . HIS C 1 396 ? -22.237  -28.986 -30.939 1.00 56.36  ? 409 HIS C CA    1 
ATOM   8351  C  C     . HIS C 1 396 ? -23.031  -30.040 -31.706 1.00 56.36  ? 409 HIS C C     1 
ATOM   8352  O  O     . HIS C 1 396 ? -24.256  -29.967 -31.799 1.00 56.36  ? 409 HIS C O     1 
ATOM   8353  C  CB    . HIS C 1 396 ? -22.333  -27.642 -31.662 1.00 56.36  ? 409 HIS C CB    1 
ATOM   8354  C  CG    . HIS C 1 396 ? -21.537  -26.546 -31.015 1.00 56.36  ? 409 HIS C CG    1 
ATOM   8355  N  ND1   . HIS C 1 396 ? -21.310  -25.339 -31.636 1.00 56.36  ? 409 HIS C ND1   1 
ATOM   8356  C  CD2   . HIS C 1 396 ? -20.927  -26.476 -29.813 1.00 56.36  ? 409 HIS C CD2   1 
ATOM   8357  C  CE1   . HIS C 1 396 ? -20.585  -24.566 -30.839 1.00 56.36  ? 409 HIS C CE1   1 
ATOM   8358  N  NE2   . HIS C 1 396 ? -20.341  -25.240 -29.725 1.00 56.36  ? 409 HIS C NE2   1 
ATOM   8359  N  N     . LYS C 1 397 ? -22.316  -31.018 -32.254 1.00 74.53  ? 410 LYS C N     1 
ATOM   8360  C  CA    . LYS C 1 397 ? -22.922  -32.074 -33.054 1.00 74.53  ? 410 LYS C CA    1 
ATOM   8361  C  C     . LYS C 1 397 ? -23.350  -33.260 -32.193 1.00 74.53  ? 410 LYS C C     1 
ATOM   8362  O  O     . LYS C 1 397 ? -22.648  -34.270 -32.123 1.00 74.53  ? 410 LYS C O     1 
ATOM   8363  C  CB    . LYS C 1 397 ? -21.941  -32.547 -34.129 1.00 74.53  ? 410 LYS C CB    1 
ATOM   8364  C  CG    . LYS C 1 397 ? -21.435  -31.440 -35.043 1.00 74.53  ? 410 LYS C CG    1 
ATOM   8365  C  CD    . LYS C 1 397 ? -22.488  -31.041 -36.062 1.00 74.53  ? 410 LYS C CD    1 
ATOM   8366  C  CE    . LYS C 1 397 ? -22.836  -32.208 -36.971 1.00 74.53  ? 410 LYS C CE    1 
ATOM   8367  N  NZ    . LYS C 1 397 ? -23.854  -31.841 -37.993 1.00 74.53  ? 410 LYS C NZ    1 
ATOM   8368  N  N     . GLN C 1 398 ? -24.502  -33.135 -31.542 1.00 70.87  ? 411 GLN C N     1 
ATOM   8369  C  CA    . GLN C 1 398 ? -25.037  -34.217 -30.721 1.00 70.87  ? 411 GLN C CA    1 
ATOM   8370  C  C     . GLN C 1 398 ? -25.928  -35.148 -31.539 1.00 70.87  ? 411 GLN C C     1 
ATOM   8371  O  O     . GLN C 1 398 ? -26.921  -34.715 -32.124 1.00 70.87  ? 411 GLN C O     1 
ATOM   8372  C  CB    . GLN C 1 398 ? -25.818  -33.654 -29.528 1.00 70.87  ? 411 GLN C CB    1 
ATOM   8373  C  CG    . GLN C 1 398 ? -24.950  -33.103 -28.400 1.00 70.87  ? 411 GLN C CG    1 
ATOM   8374  C  CD    . GLN C 1 398 ? -24.346  -34.195 -27.532 1.00 70.87  ? 411 GLN C CD    1 
ATOM   8375  O  OE1   . GLN C 1 398 ? -24.567  -35.383 -27.762 1.00 70.87  ? 411 GLN C OE1   1 
ATOM   8376  N  NE2   . GLN C 1 398 ? -23.580  -33.793 -26.525 1.00 70.87  ? 411 GLN C NE2   1 
ATOM   8377  N  N     . THR C 1 399 ? -25.567  -36.428 -31.573 1.00 97.78  ? 412 THR C N     1 
ATOM   8378  C  CA    . THR C 1 399 ? -26.324  -37.427 -32.322 1.00 97.78  ? 412 THR C CA    1 
ATOM   8379  C  C     . THR C 1 399 ? -26.386  -38.749 -31.556 1.00 97.78  ? 412 THR C C     1 
ATOM   8380  O  O     . THR C 1 399 ? -25.364  -39.244 -31.078 1.00 97.78  ? 412 THR C O     1 
ATOM   8381  C  CB    . THR C 1 399 ? -25.714  -37.663 -33.716 1.00 97.78  ? 412 THR C CB    1 
ATOM   8382  O  OG1   . THR C 1 399 ? -25.684  -36.428 -34.441 1.00 97.78  ? 412 THR C OG1   1 
ATOM   8383  C  CG2   . THR C 1 399 ? -26.531  -38.679 -34.495 1.00 97.78  ? 412 THR C CG2   1 
ATOM   8384  N  N     . PHE C 1 400 ? -27.583  -39.318 -31.442 1.00 93.92  ? 413 PHE C N     1 
ATOM   8385  C  CA    . PHE C 1 400 ? -27.781  -40.515 -30.629 1.00 93.92  ? 413 PHE C CA    1 
ATOM   8386  C  C     . PHE C 1 400 ? -28.340  -41.703 -31.412 1.00 93.92  ? 413 PHE C C     1 
ATOM   8387  O  O     . PHE C 1 400 ? -28.671  -41.586 -32.591 1.00 93.92  ? 413 PHE C O     1 
ATOM   8388  C  CB    . PHE C 1 400 ? -28.700  -40.205 -29.446 1.00 93.92  ? 413 PHE C CB    1 
ATOM   8389  C  CG    . PHE C 1 400 ? -28.235  -39.057 -28.599 1.00 93.92  ? 413 PHE C CG    1 
ATOM   8390  C  CD1   . PHE C 1 400 ? -27.267  -39.244 -27.627 1.00 93.92  ? 413 PHE C CD1   1 
ATOM   8391  C  CD2   . PHE C 1 400 ? -28.770  -37.792 -28.772 1.00 93.92  ? 413 PHE C CD2   1 
ATOM   8392  C  CE1   . PHE C 1 400 ? -26.839  -38.188 -26.844 1.00 93.92  ? 413 PHE C CE1   1 
ATOM   8393  C  CE2   . PHE C 1 400 ? -28.349  -36.731 -27.992 1.00 93.92  ? 413 PHE C CE2   1 
ATOM   8394  C  CZ    . PHE C 1 400 ? -27.381  -36.930 -27.027 1.00 93.92  ? 413 PHE C CZ    1 
ATOM   8395  N  N     . ASP C 1 401 ? -28.441  -42.847 -30.737 1.00 112.71 ? 414 ASP C N     1 
ATOM   8396  C  CA    . ASP C 1 401 ? -29.013  -44.053 -31.325 1.00 112.71 ? 414 ASP C CA    1 
ATOM   8397  C  C     . ASP C 1 401 ? -30.521  -44.101 -31.095 1.00 112.71 ? 414 ASP C C     1 
ATOM   8398  O  O     . ASP C 1 401 ? -31.263  -44.688 -31.884 1.00 112.71 ? 414 ASP C O     1 
ATOM   8399  C  CB    . ASP C 1 401 ? -28.356  -45.306 -30.740 1.00 112.71 ? 414 ASP C CB    1 
ATOM   8400  C  CG    . ASP C 1 401 ? -26.891  -45.431 -31.117 1.00 112.71 ? 414 ASP C CG    1 
ATOM   8401  O  OD1   . ASP C 1 401 ? -26.484  -44.830 -32.133 1.00 112.71 ? 414 ASP C OD1   1 
ATOM   8402  O  OD2   . ASP C 1 401 ? -26.149  -46.138 -30.401 1.00 112.71 ? 414 ASP C OD2   1 
ATOM   8403  N  N     . HIS C 1 402 ? -30.965  -43.481 -30.006 1.00 62.89  ? 415 HIS C N     1 
ATOM   8404  C  CA    . HIS C 1 402 ? -32.384  -43.424 -29.675 1.00 62.89  ? 415 HIS C CA    1 
ATOM   8405  C  C     . HIS C 1 402 ? -32.807  -41.976 -29.457 1.00 62.89  ? 415 HIS C C     1 
ATOM   8406  O  O     . HIS C 1 402 ? -32.056  -41.190 -28.880 1.00 62.89  ? 415 HIS C O     1 
ATOM   8407  C  CB    . HIS C 1 402 ? -32.672  -44.251 -28.421 1.00 62.89  ? 415 HIS C CB    1 
ATOM   8408  C  CG    . HIS C 1 402 ? -34.058  -44.817 -28.373 1.00 62.89  ? 415 HIS C CG    1 
ATOM   8409  N  ND1   . HIS C 1 402 ? -35.104  -44.177 -27.744 1.00 62.89  ? 415 HIS C ND1   1 
ATOM   8410  C  CD2   . HIS C 1 402 ? -34.569  -45.965 -28.875 1.00 62.89  ? 415 HIS C CD2   1 
ATOM   8411  C  CE1   . HIS C 1 402 ? -36.199  -44.904 -27.861 1.00 62.89  ? 415 HIS C CE1   1 
ATOM   8412  N  NE2   . HIS C 1 402 ? -35.901  -45.998 -28.545 1.00 62.89  ? 415 HIS C NE2   1 
ATOM   8413  N  N     . PRO C 1 403 ? -34.015  -41.618 -29.919 1.00 42.93  ? 416 PRO C N     1 
ATOM   8414  C  CA    . PRO C 1 403 ? -34.500  -40.242 -29.778 1.00 42.93  ? 416 PRO C CA    1 
ATOM   8415  C  C     . PRO C 1 403 ? -34.788  -39.862 -28.328 1.00 42.93  ? 416 PRO C C     1 
ATOM   8416  O  O     . PRO C 1 403 ? -34.549  -38.716 -27.953 1.00 42.93  ? 416 PRO C O     1 
ATOM   8417  C  CB    . PRO C 1 403 ? -35.797  -40.243 -30.592 1.00 42.93  ? 416 PRO C CB    1 
ATOM   8418  C  CG    . PRO C 1 403 ? -36.245  -41.661 -30.588 1.00 42.93  ? 416 PRO C CG    1 
ATOM   8419  C  CD    . PRO C 1 403 ? -34.985  -42.474 -30.623 1.00 42.93  ? 416 PRO C CD    1 
ATOM   8420  N  N     . LEU C 1 404 ? -35.293  -40.802 -27.533 1.00 91.45  ? 417 LEU C N     1 
ATOM   8421  C  CA    . LEU C 1 404 ? -35.636  -40.523 -26.139 1.00 91.45  ? 417 LEU C CA    1 
ATOM   8422  C  C     . LEU C 1 404 ? -34.402  -40.107 -25.338 1.00 91.45  ? 417 LEU C C     1 
ATOM   8423  O  O     . LEU C 1 404 ? -34.470  -39.199 -24.510 1.00 91.45  ? 417 LEU C O     1 
ATOM   8424  C  CB    . LEU C 1 404 ? -36.308  -41.735 -25.490 1.00 91.45  ? 417 LEU C CB    1 
ATOM   8425  C  CG    . LEU C 1 404 ? -37.564  -41.486 -24.648 1.00 91.45  ? 417 LEU C CG    1 
ATOM   8426  C  CD1   . LEU C 1 404 ? -37.960  -42.737 -23.880 1.00 91.45  ? 417 LEU C CD1   1 
ATOM   8427  C  CD2   . LEU C 1 404 ? -37.381  -40.316 -23.696 1.00 91.45  ? 417 LEU C CD2   1 
ATOM   8428  N  N     . MET C 1 405 ? -33.282  -40.780 -25.591 1.00 65.52  ? 418 MET C N     1 
ATOM   8429  C  CA    . MET C 1 405 ? -32.009  -40.446 -24.958 1.00 65.52  ? 418 MET C CA    1 
ATOM   8430  C  C     . MET C 1 405 ? -31.684  -38.966 -25.140 1.00 65.52  ? 418 MET C C     1 
ATOM   8431  O  O     . MET C 1 405 ? -31.194  -38.307 -24.223 1.00 65.52  ? 418 MET C O     1 
ATOM   8432  C  CB    . MET C 1 405 ? -30.891  -41.313 -25.538 1.00 65.52  ? 418 MET C CB    1 
ATOM   8433  C  CG    . MET C 1 405 ? -29.487  -40.880 -25.154 1.00 65.52  ? 418 MET C CG    1 
ATOM   8434  S  SD    . MET C 1 405 ? -29.170  -40.947 -23.382 1.00 65.52  ? 418 MET C SD    1 
ATOM   8435  C  CE    . MET C 1 405 ? -29.397  -42.694 -23.062 1.00 65.52  ? 418 MET C CE    1 
ATOM   8436  N  N     . ALA C 1 406 ? -31.975  -38.448 -26.329 1.00 57.87  ? 419 ALA C N     1 
ATOM   8437  C  CA    . ALA C 1 406 ? -31.798  -37.030 -26.611 1.00 57.87  ? 419 ALA C CA    1 
ATOM   8438  C  C     . ALA C 1 406 ? -32.740  -36.184 -25.759 1.00 57.87  ? 419 ALA C C     1 
ATOM   8439  O  O     . ALA C 1 406 ? -32.326  -35.193 -25.162 1.00 57.87  ? 419 ALA C O     1 
ATOM   8440  C  CB    . ALA C 1 406 ? -32.022  -36.752 -28.089 1.00 57.87  ? 419 ALA C CB    1 
ATOM   8441  N  N     . ILE C 1 407 ? -34.007  -36.586 -25.701 1.00 38.47  ? 420 ILE C N     1 
ATOM   8442  C  CA    . ILE C 1 407 ? -35.018  -35.851 -24.944 1.00 38.47  ? 420 ILE C CA    1 
ATOM   8443  C  C     . ILE C 1 407 ? -34.801  -35.988 -23.434 1.00 38.47  ? 420 ILE C C     1 
ATOM   8444  O  O     . ILE C 1 407 ? -35.395  -35.258 -22.642 1.00 38.47  ? 420 ILE C O     1 
ATOM   8445  C  CB    . ILE C 1 407 ? -36.449  -36.318 -25.304 1.00 38.47  ? 420 ILE C CB    1 
ATOM   8446  C  CG1   . ILE C 1 407 ? -36.570  -36.605 -26.801 1.00 38.47  ? 420 ILE C CG1   1 
ATOM   8447  C  CG2   . ILE C 1 407 ? -37.482  -35.278 -24.893 1.00 38.47  ? 420 ILE C CG2   1 
ATOM   8448  C  CD1   . ILE C 1 407 ? -36.490  -35.369 -27.670 1.00 38.47  ? 420 ILE C CD1   1 
ATOM   8449  N  N     . LEU C 1 408 ? -33.951  -36.928 -23.035 1.00 43.47  ? 421 LEU C N     1 
ATOM   8450  C  CA    . LEU C 1 408 ? -33.635  -37.112 -21.624 1.00 43.47  ? 421 LEU C CA    1 
ATOM   8451  C  C     . LEU C 1 408 ? -32.385  -36.331 -21.233 1.00 43.47  ? 421 LEU C C     1 
ATOM   8452  O  O     . LEU C 1 408 ? -32.204  -35.974 -20.070 1.00 43.47  ? 421 LEU C O     1 
ATOM   8453  C  CB    . LEU C 1 408 ? -33.438  -38.595 -21.302 1.00 43.47  ? 421 LEU C CB    1 
ATOM   8454  C  CG    . LEU C 1 408 ? -34.659  -39.514 -21.324 1.00 43.47  ? 421 LEU C CG    1 
ATOM   8455  C  CD1   . LEU C 1 408 ? -34.248  -40.956 -21.081 1.00 43.47  ? 421 LEU C CD1   1 
ATOM   8456  C  CD2   . LEU C 1 408 ? -35.679  -39.072 -20.292 1.00 43.47  ? 421 LEU C CD2   1 
ATOM   8457  N  N     . TYR C 1 409 ? -31.531  -36.061 -22.215 1.00 34.29  ? 422 TYR C N     1 
ATOM   8458  C  CA    . TYR C 1 409 ? -30.222  -35.468 -21.962 1.00 34.29  ? 422 TYR C CA    1 
ATOM   8459  C  C     . TYR C 1 409 ? -30.198  -33.956 -22.189 1.00 34.29  ? 422 TYR C C     1 
ATOM   8460  O  O     . TYR C 1 409 ? -29.452  -33.234 -21.527 1.00 34.29  ? 422 TYR C O     1 
ATOM   8461  C  CB    . TYR C 1 409 ? -29.166  -36.158 -22.830 1.00 34.29  ? 422 TYR C CB    1 
ATOM   8462  C  CG    . TYR C 1 409 ? -27.745  -35.719 -22.565 1.00 34.29  ? 422 TYR C CG    1 
ATOM   8463  C  CD1   . TYR C 1 409 ? -27.250  -35.642 -21.271 1.00 34.29  ? 422 TYR C CD1   1 
ATOM   8464  C  CD2   . TYR C 1 409 ? -26.891  -35.403 -23.611 1.00 34.29  ? 422 TYR C CD2   1 
ATOM   8465  C  CE1   . TYR C 1 409 ? -25.951  -35.246 -21.027 1.00 34.29  ? 422 TYR C CE1   1 
ATOM   8466  C  CE2   . TYR C 1 409 ? -25.590  -35.011 -23.376 1.00 34.29  ? 422 TYR C CE2   1 
ATOM   8467  C  CZ    . TYR C 1 409 ? -25.126  -34.933 -22.083 1.00 34.29  ? 422 TYR C CZ    1 
ATOM   8468  O  OH    . TYR C 1 409 ? -23.831  -34.541 -21.841 1.00 34.29  ? 422 TYR C OH    1 
ATOM   8469  N  N     . ILE C 1 410 ? -31.014  -33.483 -23.125 1.00 55.28  ? 423 ILE C N     1 
ATOM   8470  C  CA    . ILE C 1 410 ? -31.078  -32.054 -23.443 1.00 55.28  ? 423 ILE C CA    1 
ATOM   8471  C  C     . ILE C 1 410 ? -31.711  -31.133 -22.372 1.00 55.28  ? 423 ILE C C     1 
ATOM   8472  O  O     . ILE C 1 410 ? -31.082  -30.145 -21.988 1.00 55.28  ? 423 ILE C O     1 
ATOM   8473  C  CB    . ILE C 1 410 ? -31.708  -31.790 -24.839 1.00 55.28  ? 423 ILE C CB    1 
ATOM   8474  C  CG1   . ILE C 1 410 ? -30.917  -32.510 -25.933 1.00 55.28  ? 423 ILE C CG1   1 
ATOM   8475  C  CG2   . ILE C 1 410 ? -31.780  -30.298 -25.122 1.00 55.28  ? 423 ILE C CG2   1 
ATOM   8476  C  CD1   . ILE C 1 410 ? -29.449  -32.155 -25.968 1.00 55.28  ? 423 ILE C CD1   1 
ATOM   8477  N  N     . GLY C 1 411 ? -32.918  -31.425 -21.873 1.00 71.80  ? 424 GLY C N     1 
ATOM   8478  C  CA    . GLY C 1 411 ? -33.694  -32.614 -22.184 1.00 71.80  ? 424 GLY C CA    1 
ATOM   8479  C  C     . GLY C 1 411 ? -35.083  -32.329 -22.722 1.00 71.80  ? 424 GLY C C     1 
ATOM   8480  O  O     . GLY C 1 411 ? -35.229  -31.729 -23.784 1.00 71.80  ? 424 GLY C O     1 
ATOM   8481  N  N     . HIS C 1 412 ? -36.102  -32.778 -21.992 1.00 92.99  ? 425 HIS C N     1 
ATOM   8482  C  CA    . HIS C 1 412 ? -37.495  -32.603 -22.400 1.00 92.99  ? 425 HIS C CA    1 
ATOM   8483  C  C     . HIS C 1 412 ? -37.838  -31.124 -22.507 1.00 92.99  ? 425 HIS C C     1 
ATOM   8484  O  O     . HIS C 1 412 ? -38.506  -30.694 -23.447 1.00 92.99  ? 425 HIS C O     1 
ATOM   8485  C  CB    . HIS C 1 412 ? -38.431  -33.303 -21.408 1.00 92.99  ? 425 HIS C CB    1 
ATOM   8486  C  CG    . HIS C 1 412 ? -39.872  -33.288 -21.816 1.00 92.99  ? 425 HIS C CG    1 
ATOM   8487  N  ND1   . HIS C 1 412 ? -40.293  -33.639 -23.082 1.00 92.99  ? 425 HIS C ND1   1 
ATOM   8488  C  CD2   . HIS C 1 412 ? -40.992  -32.975 -21.122 1.00 92.99  ? 425 HIS C CD2   1 
ATOM   8489  C  CE1   . HIS C 1 412 ? -41.608  -33.536 -23.150 1.00 92.99  ? 425 HIS C CE1   1 
ATOM   8490  N  NE2   . HIS C 1 412 ? -42.057  -33.135 -21.974 1.00 92.99  ? 425 HIS C NE2   1 
ATOM   8491  N  N     . ASP C 1 413 ? -37.368  -30.350 -21.535 1.00 97.73  ? 426 ASP C N     1 
ATOM   8492  C  CA    . ASP C 1 413 ? -37.493  -28.901 -21.577 1.00 97.73  ? 426 ASP C CA    1 
ATOM   8493  C  C     . ASP C 1 413 ? -36.405  -28.365 -22.500 1.00 97.73  ? 426 ASP C C     1 
ATOM   8494  O  O     . ASP C 1 413 ? -35.597  -29.135 -23.020 1.00 97.73  ? 426 ASP C O     1 
ATOM   8495  C  CB    . ASP C 1 413 ? -37.342  -28.322 -20.169 1.00 97.73  ? 426 ASP C CB    1 
ATOM   8496  C  CG    . ASP C 1 413 ? -37.871  -26.905 -20.057 1.00 97.73  ? 426 ASP C CG    1 
ATOM   8497  O  OD1   . ASP C 1 413 ? -39.107  -26.734 -19.987 1.00 97.73  ? 426 ASP C OD1   1 
ATOM   8498  O  OD2   . ASP C 1 413 ? -37.051  -25.964 -20.028 1.00 97.73  ? 426 ASP C OD2   1 
ATOM   8499  N  N     . LYS C 1 414 ? -36.401  -27.053 -22.721 1.00 74.38  ? 427 LYS C N     1 
ATOM   8500  C  CA    . LYS C 1 414 ? -35.412  -26.392 -23.580 1.00 74.38  ? 427 LYS C CA    1 
ATOM   8501  C  C     . LYS C 1 414 ? -35.469  -26.829 -25.048 1.00 74.38  ? 427 LYS C C     1 
ATOM   8502  O  O     . LYS C 1 414 ? -34.699  -26.342 -25.877 1.00 74.38  ? 427 LYS C O     1 
ATOM   8503  C  CB    . LYS C 1 414 ? -33.993  -26.560 -23.026 1.00 74.38  ? 427 LYS C CB    1 
ATOM   8504  C  CG    . LYS C 1 414 ? -33.831  -26.121 -21.578 1.00 74.38  ? 427 LYS C CG    1 
ATOM   8505  C  CD    . LYS C 1 414 ? -32.365  -26.016 -21.176 1.00 74.38  ? 427 LYS C CD    1 
ATOM   8506  C  CE    . LYS C 1 414 ? -31.739  -24.701 -21.633 1.00 74.38  ? 427 LYS C CE    1 
ATOM   8507  N  NZ    . LYS C 1 414 ? -31.496  -24.627 -23.102 1.00 74.38  ? 427 LYS C NZ    1 
ATOM   8508  N  N     . LEU C 1 415 ? -36.375  -27.749 -25.360 1.00 83.12  ? 428 LEU C N     1 
ATOM   8509  C  CA    . LEU C 1 415 ? -36.622  -28.166 -26.735 1.00 83.12  ? 428 LEU C CA    1 
ATOM   8510  C  C     . LEU C 1 415 ? -38.012  -27.702 -27.138 1.00 83.12  ? 428 LEU C C     1 
ATOM   8511  O  O     . LEU C 1 415 ? -38.801  -27.289 -26.289 1.00 83.12  ? 428 LEU C O     1 
ATOM   8512  C  CB    . LEU C 1 415 ? -36.537  -29.688 -26.864 1.00 83.12  ? 428 LEU C CB    1 
ATOM   8513  C  CG    . LEU C 1 415 ? -35.161  -30.354 -26.878 1.00 83.12  ? 428 LEU C CG    1 
ATOM   8514  C  CD1   . LEU C 1 415 ? -35.301  -31.865 -26.939 1.00 83.12  ? 428 LEU C CD1   1 
ATOM   8515  C  CD2   . LEU C 1 415 ? -34.347  -29.859 -28.053 1.00 83.12  ? 428 LEU C CD2   1 
ATOM   8516  N  N     . LYS C 1 416 ? -38.317  -27.763 -28.430 1.00 107.64 ? 429 LYS C N     1 
ATOM   8517  C  CA    . LYS C 1 416 ? -39.679  -27.496 -28.868 1.00 107.64 ? 429 LYS C CA    1 
ATOM   8518  C  C     . LYS C 1 416 ? -40.545  -28.683 -28.467 1.00 107.64 ? 429 LYS C C     1 
ATOM   8519  O  O     . LYS C 1 416 ? -40.143  -29.837 -28.625 1.00 107.64 ? 429 LYS C O     1 
ATOM   8520  C  CB    . LYS C 1 416 ? -39.755  -27.240 -30.379 1.00 107.64 ? 429 LYS C CB    1 
ATOM   8521  C  CG    . LYS C 1 416 ? -39.499  -28.457 -31.259 1.00 107.64 ? 429 LYS C CG    1 
ATOM   8522  C  CD    . LYS C 1 416 ? -40.388  -28.437 -32.496 1.00 107.64 ? 429 LYS C CD    1 
ATOM   8523  C  CE    . LYS C 1 416 ? -40.108  -29.624 -33.407 1.00 107.64 ? 429 LYS C CE    1 
ATOM   8524  N  NZ    . LYS C 1 416 ? -40.306  -30.930 -32.721 1.00 107.64 ? 429 LYS C NZ    1 
ATOM   8525  N  N     . ASP C 1 417 ? -41.720  -28.405 -27.916 1.00 105.37 ? 430 ASP C N     1 
ATOM   8526  C  CA    . ASP C 1 417 ? -42.615  -29.481 -27.520 1.00 105.37 ? 430 ASP C CA    1 
ATOM   8527  C  C     . ASP C 1 417 ? -43.262  -30.077 -28.762 1.00 105.37 ? 430 ASP C C     1 
ATOM   8528  O  O     . ASP C 1 417 ? -44.195  -29.507 -29.326 1.00 105.37 ? 430 ASP C O     1 
ATOM   8529  C  CB    . ASP C 1 417 ? -43.672  -28.988 -26.531 1.00 105.37 ? 430 ASP C CB    1 
ATOM   8530  C  CG    . ASP C 1 417 ? -43.842  -29.924 -25.348 1.00 105.37 ? 430 ASP C CG    1 
ATOM   8531  O  OD1   . ASP C 1 417 ? -42.941  -30.759 -25.117 1.00 105.37 ? 430 ASP C OD1   1 
ATOM   8532  O  OD2   . ASP C 1 417 ? -44.869  -29.821 -24.645 1.00 105.37 ? 430 ASP C OD2   1 
ATOM   8533  N  N     . ALA C 1 418 ? -42.747  -31.225 -29.190 1.00 87.60  ? 431 ALA C N     1 
ATOM   8534  C  CA    . ALA C 1 418 ? -43.220  -31.882 -30.401 1.00 87.60  ? 431 ALA C CA    1 
ATOM   8535  C  C     . ALA C 1 418 ? -44.650  -32.388 -30.242 1.00 87.60  ? 431 ALA C C     1 
ATOM   8536  O  O     . ALA C 1 418 ? -45.330  -32.671 -31.229 1.00 87.60  ? 431 ALA C O     1 
ATOM   8537  C  CB    . ALA C 1 418 ? -42.294  -33.020 -30.774 1.00 87.60  ? 431 ALA C CB    1 
ATOM   8538  N  N     . LEU C 1 419 ? -45.092  -32.505 -28.994 1.00 80.21  ? 432 LEU C N     1 
ATOM   8539  C  CA    . LEU C 1 419 ? -46.446  -32.949 -28.689 1.00 80.21  ? 432 LEU C CA    1 
ATOM   8540  C  C     . LEU C 1 419 ? -47.489  -32.008 -29.290 1.00 80.21  ? 432 LEU C C     1 
ATOM   8541  O  O     . LEU C 1 419 ? -48.507  -32.452 -29.819 1.00 80.21  ? 432 LEU C O     1 
ATOM   8542  C  CB    . LEU C 1 419 ? -46.639  -33.064 -27.176 1.00 80.21  ? 432 LEU C CB    1 
ATOM   8543  C  CG    . LEU C 1 419 ? -45.717  -34.042 -26.443 1.00 80.21  ? 432 LEU C CG    1 
ATOM   8544  C  CD1   . LEU C 1 419 ? -46.063  -34.121 -24.963 1.00 80.21  ? 432 LEU C CD1   1 
ATOM   8545  C  CD2   . LEU C 1 419 ? -45.780  -35.418 -27.083 1.00 80.21  ? 432 LEU C CD2   1 
ATOM   8546  N  N     . ILE C 1 420 ? -47.226  -30.707 -29.206 1.00 66.44  ? 433 ILE C N     1 
ATOM   8547  C  CA    . ILE C 1 420 ? -48.082  -29.709 -29.837 1.00 66.44  ? 433 ILE C CA    1 
ATOM   8548  C  C     . ILE C 1 420 ? -47.929  -29.769 -31.356 1.00 66.44  ? 433 ILE C C     1 
ATOM   8549  O  O     . ILE C 1 420 ? -48.913  -29.716 -32.095 1.00 66.44  ? 433 ILE C O     1 
ATOM   8550  C  CB    . ILE C 1 420 ? -47.760  -28.277 -29.341 1.00 66.44  ? 433 ILE C CB    1 
ATOM   8551  C  CG1   . ILE C 1 420 ? -48.332  -28.039 -27.942 1.00 66.44  ? 433 ILE C CG1   1 
ATOM   8552  C  CG2   . ILE C 1 420 ? -48.313  -27.231 -30.297 1.00 66.44  ? 433 ILE C CG2   1 
ATOM   8553  C  CD1   . ILE C 1 420 ? -47.424  -28.481 -26.817 1.00 66.44  ? 433 ILE C CD1   1 
ATOM   8554  N  N     . ASP C 1 421 ? -46.686  -29.901 -31.809 1.00 101.40 ? 434 ASP C N     1 
ATOM   8555  C  CA    . ASP C 1 421 ? -46.358  -29.857 -33.234 1.00 101.40 ? 434 ASP C CA    1 
ATOM   8556  C  C     . ASP C 1 421 ? -46.931  -31.028 -34.034 1.00 101.40 ? 434 ASP C C     1 
ATOM   8557  O  O     . ASP C 1 421 ? -46.559  -32.180 -33.816 1.00 101.40 ? 434 ASP C O     1 
ATOM   8558  C  CB    . ASP C 1 421 ? -44.839  -29.796 -33.418 1.00 101.40 ? 434 ASP C CB    1 
ATOM   8559  C  CG    . ASP C 1 421 ? -44.426  -29.764 -34.876 1.00 101.40 ? 434 ASP C CG    1 
ATOM   8560  O  OD1   . ASP C 1 421 ? -44.204  -30.846 -35.457 1.00 101.40 ? 434 ASP C OD1   1 
ATOM   8561  O  OD2   . ASP C 1 421 ? -44.318  -28.655 -35.441 1.00 101.40 ? 434 ASP C OD2   1 
ATOM   8562  N  N     . GLU C 1 422 ? -47.829  -30.720 -34.966 1.00 101.23 ? 435 GLU C N     1 
ATOM   8563  C  CA    . GLU C 1 422 ? -48.396  -31.730 -35.854 1.00 101.23 ? 435 GLU C CA    1 
ATOM   8564  C  C     . GLU C 1 422 ? -47.596  -31.828 -37.151 1.00 101.23 ? 435 GLU C C     1 
ATOM   8565  O  O     . GLU C 1 422 ? -47.893  -32.658 -38.012 1.00 101.23 ? 435 GLU C O     1 
ATOM   8566  C  CB    . GLU C 1 422 ? -49.861  -31.419 -36.170 1.00 101.23 ? 435 GLU C CB    1 
ATOM   8567  C  CG    . GLU C 1 422 ? -50.736  -31.216 -34.947 1.00 101.23 ? 435 GLU C CG    1 
ATOM   8568  C  CD    . GLU C 1 422 ? -51.263  -29.798 -34.843 1.00 101.23 ? 435 GLU C CD    1 
ATOM   8569  O  OE1   . GLU C 1 422 ? -51.002  -29.139 -33.816 1.00 101.23 ? 435 GLU C OE1   1 
ATOM   8570  O  OE2   . GLU C 1 422 ? -51.942  -29.344 -35.787 1.00 101.23 ? 435 GLU C OE2   1 
ATOM   8571  N  N     . LYS C 1 423 ? -46.589  -30.971 -37.287 1.00 112.46 ? 436 LYS C N     1 
ATOM   8572  C  CA    . LYS C 1 423 ? -45.696  -31.015 -38.440 1.00 112.46 ? 436 LYS C CA    1 
ATOM   8573  C  C     . LYS C 1 423 ? -44.912  -32.320 -38.450 1.00 112.46 ? 436 LYS C C     1 
ATOM   8574  O  O     . LYS C 1 423 ? -44.613  -32.870 -39.510 1.00 112.46 ? 436 LYS C O     1 
ATOM   8575  C  CB    . LYS C 1 423 ? -44.720  -29.835 -38.416 1.00 112.46 ? 436 LYS C CB    1 
ATOM   8576  C  CG    . LYS C 1 423 ? -45.327  -28.476 -38.746 1.00 112.46 ? 436 LYS C CG    1 
ATOM   8577  C  CD    . LYS C 1 423 ? -45.485  -28.280 -40.248 1.00 112.46 ? 436 LYS C CD    1 
ATOM   8578  C  CE    . LYS C 1 423 ? -46.903  -28.577 -40.709 1.00 112.46 ? 436 LYS C CE    1 
ATOM   8579  N  NZ    . LYS C 1 423 ? -47.043  -28.455 -42.185 1.00 112.46 ? 436 LYS C NZ    1 
ATOM   8580  N  N     . SER C 1 424 ? -44.586  -32.809 -37.257 1.00 76.35  ? 437 SER C N     1 
ATOM   8581  C  CA    . SER C 1 424 ? -43.754  -33.993 -37.089 1.00 76.35  ? 437 SER C CA    1 
ATOM   8582  C  C     . SER C 1 424 ? -43.778  -34.386 -35.618 1.00 76.35  ? 437 SER C C     1 
ATOM   8583  O  O     . SER C 1 424 ? -43.958  -33.517 -34.766 1.00 76.35  ? 437 SER C O     1 
ATOM   8584  C  CB    . SER C 1 424 ? -42.313  -33.679 -37.501 1.00 76.35  ? 437 SER C CB    1 
ATOM   8585  O  OG    . SER C 1 424 ? -42.207  -33.435 -38.892 1.00 76.35  ? 437 SER C OG    1 
ATOM   8586  N  N     . GLU C 1 425 ? -43.619  -35.668 -35.284 1.00 89.24  ? 438 GLU C N     1 
ATOM   8587  C  CA    . GLU C 1 425 ? -43.568  -36.809 -36.198 1.00 89.24  ? 438 GLU C CA    1 
ATOM   8588  C  C     . GLU C 1 425 ? -43.963  -37.973 -35.306 1.00 89.24  ? 438 GLU C C     1 
ATOM   8589  O  O     . GLU C 1 425 ? -43.641  -37.953 -34.120 1.00 89.24  ? 438 GLU C O     1 
ATOM   8590  C  CB    . GLU C 1 425 ? -42.148  -37.044 -36.716 1.00 89.24  ? 438 GLU C CB    1 
ATOM   8591  C  CG    . GLU C 1 425 ? -42.003  -38.204 -37.699 1.00 89.24  ? 438 GLU C CG    1 
ATOM   8592  C  CD    . GLU C 1 425 ? -42.073  -37.762 -39.151 1.00 89.24  ? 438 GLU C CD    1 
ATOM   8593  O  OE1   . GLU C 1 425 ? -42.864  -36.848 -39.463 1.00 89.24  ? 438 GLU C OE1   1 
ATOM   8594  O  OE2   . GLU C 1 425 ? -41.330  -38.329 -39.981 1.00 89.24  ? 438 GLU C OE2   1 
ATOM   8595  N  N     . LYS C 1 426 ? -44.647  -38.975 -35.855 1.00 101.70 ? 439 LYS C N     1 
ATOM   8596  C  CA    . LYS C 1 426 ? -45.135  -40.108 -35.060 1.00 101.70 ? 439 LYS C CA    1 
ATOM   8597  C  C     . LYS C 1 426 ? -44.092  -40.681 -34.100 1.00 101.70 ? 439 LYS C C     1 
ATOM   8598  O  O     . LYS C 1 426 ? -44.347  -40.814 -32.904 1.00 101.70 ? 439 LYS C O     1 
ATOM   8599  C  CB    . LYS C 1 426 ? -45.672  -41.218 -35.968 1.00 101.70 ? 439 LYS C CB    1 
ATOM   8600  C  CG    . LYS C 1 426 ? -45.849  -42.561 -35.269 1.00 101.70 ? 439 LYS C CG    1 
ATOM   8601  C  CD    . LYS C 1 426 ? -47.278  -43.064 -35.378 1.00 101.70 ? 439 LYS C CD    1 
ATOM   8602  C  CE    . LYS C 1 426 ? -47.315  -44.543 -35.732 1.00 101.70 ? 439 LYS C CE    1 
ATOM   8603  N  NZ    . LYS C 1 426 ? -46.790  -44.791 -37.105 1.00 101.70 ? 439 LYS C NZ    1 
ATOM   8604  N  N     . GLU C 1 427 ? -42.914  -40.998 -34.628 1.00 82.54  ? 440 GLU C N     1 
ATOM   8605  C  CA    . GLU C 1 427 ? -41.841  -41.581 -33.829 1.00 82.54  ? 440 GLU C CA    1 
ATOM   8606  C  C     . GLU C 1 427 ? -41.351  -40.643 -32.726 1.00 82.54  ? 440 GLU C C     1 
ATOM   8607  O  O     . GLU C 1 427 ? -41.196  -41.051 -31.575 1.00 82.54  ? 440 GLU C O     1 
ATOM   8608  C  CB    . GLU C 1 427 ? -40.675  -41.991 -34.728 1.00 82.54  ? 440 GLU C CB    1 
ATOM   8609  C  CG    . GLU C 1 427 ? -39.459  -42.479 -33.968 1.00 82.54  ? 440 GLU C CG    1 
ATOM   8610  C  CD    . GLU C 1 427 ? -38.418  -43.103 -34.871 1.00 82.54  ? 440 GLU C CD    1 
ATOM   8611  O  OE1   . GLU C 1 427 ? -38.657  -43.188 -36.094 1.00 82.54  ? 440 GLU C OE1   1 
ATOM   8612  O  OE2   . GLU C 1 427 ? -37.362  -43.516 -34.353 1.00 82.54  ? 440 GLU C OE2   1 
ATOM   8613  N  N     . ILE C 1 428 ? -41.107  -39.388 -33.087 1.00 72.27  ? 441 ILE C N     1 
ATOM   8614  C  CA    . ILE C 1 428 ? -40.666  -38.384 -32.124 1.00 72.27  ? 441 ILE C CA    1 
ATOM   8615  C  C     . ILE C 1 428 ? -41.791  -38.033 -31.145 1.00 72.27  ? 441 ILE C C     1 
ATOM   8616  O  O     . ILE C 1 428 ? -41.543  -37.806 -29.960 1.00 72.27  ? 441 ILE C O     1 
ATOM   8617  C  CB    . ILE C 1 428 ? -40.118  -37.119 -32.838 1.00 72.27  ? 441 ILE C CB    1 
ATOM   8618  C  CG1   . ILE C 1 428 ? -38.591  -37.071 -32.753 1.00 72.27  ? 441 ILE C CG1   1 
ATOM   8619  C  CG2   . ILE C 1 428 ? -40.693  -35.850 -32.243 1.00 72.27  ? 441 ILE C CG2   1 
ATOM   8620  C  CD1   . ILE C 1 428 ? -37.903  -38.228 -33.429 1.00 72.27  ? 441 ILE C CD1   1 
ATOM   8621  N  N     . PHE C 1 429 ? -43.025  -38.014 -31.645 1.00 67.77  ? 442 PHE C N     1 
ATOM   8622  C  CA    . PHE C 1 429 ? -44.194  -37.694 -30.828 1.00 67.77  ? 442 PHE C CA    1 
ATOM   8623  C  C     . PHE C 1 429 ? -44.340  -38.642 -29.641 1.00 67.77  ? 442 PHE C C     1 
ATOM   8624  O  O     . PHE C 1 429 ? -44.725  -38.224 -28.549 1.00 67.77  ? 442 PHE C O     1 
ATOM   8625  C  CB    . PHE C 1 429 ? -45.460  -37.722 -31.688 1.00 67.77  ? 442 PHE C CB    1 
ATOM   8626  C  CG    . PHE C 1 429 ? -46.733  -37.592 -30.908 1.00 67.77  ? 442 PHE C CG    1 
ATOM   8627  C  CD1   . PHE C 1 429 ? -47.184  -36.350 -30.491 1.00 67.77  ? 442 PHE C CD1   1 
ATOM   8628  C  CD2   . PHE C 1 429 ? -47.492  -38.712 -30.609 1.00 67.77  ? 442 PHE C CD2   1 
ATOM   8629  C  CE1   . PHE C 1 429 ? -48.362  -36.229 -29.780 1.00 67.77  ? 442 PHE C CE1   1 
ATOM   8630  C  CE2   . PHE C 1 429 ? -48.669  -38.598 -29.899 1.00 67.77  ? 442 PHE C CE2   1 
ATOM   8631  C  CZ    . PHE C 1 429 ? -49.104  -37.356 -29.484 1.00 67.77  ? 442 PHE C CZ    1 
ATOM   8632  N  N     . GLU C 1 430 ? -44.032  -39.916 -29.863 1.00 76.58  ? 443 GLU C N     1 
ATOM   8633  C  CA    . GLU C 1 430 ? -44.086  -40.913 -28.802 1.00 76.58  ? 443 GLU C CA    1 
ATOM   8634  C  C     . GLU C 1 430 ? -42.983  -40.661 -27.783 1.00 76.58  ? 443 GLU C C     1 
ATOM   8635  O  O     . GLU C 1 430 ? -43.235  -40.589 -26.582 1.00 76.58  ? 443 GLU C O     1 
ATOM   8636  C  CB    . GLU C 1 430 ? -43.932  -42.319 -29.382 1.00 76.58  ? 443 GLU C CB    1 
ATOM   8637  C  CG    . GLU C 1 430 ? -44.957  -42.686 -30.441 1.00 76.58  ? 443 GLU C CG    1 
ATOM   8638  C  CD    . GLU C 1 430 ? -44.570  -43.937 -31.207 1.00 76.58  ? 443 GLU C CD    1 
ATOM   8639  O  OE1   . GLU C 1 430 ? -43.605  -44.611 -30.793 1.00 76.58  ? 443 GLU C OE1   1 
ATOM   8640  O  OE2   . GLU C 1 430 ? -45.227  -44.242 -32.225 1.00 76.58  ? 443 GLU C OE2   1 
ATOM   8641  N  N     . ALA C 1 431 ? -41.757  -40.528 -28.278 1.00 61.35  ? 444 ALA C N     1 
ATOM   8642  C  CA    . ALA C 1 431 ? -40.594  -40.305 -27.427 1.00 61.35  ? 444 ALA C CA    1 
ATOM   8643  C  C     . ALA C 1 431 ? -40.694  -38.990 -26.659 1.00 61.35  ? 444 ALA C C     1 
ATOM   8644  O  O     . ALA C 1 431 ? -40.164  -38.864 -25.556 1.00 61.35  ? 444 ALA C O     1 
ATOM   8645  C  CB    . ALA C 1 431 ? -39.321  -40.341 -28.255 1.00 61.35  ? 444 ALA C CB    1 
ATOM   8646  N  N     . SER C 1 432 ? -41.374  -38.012 -27.248 1.00 81.43  ? 445 SER C N     1 
ATOM   8647  C  CA    . SER C 1 432 ? -41.580  -36.726 -26.595 1.00 81.43  ? 445 SER C CA    1 
ATOM   8648  C  C     . SER C 1 432 ? -42.726  -36.817 -25.591 1.00 81.43  ? 445 SER C C     1 
ATOM   8649  O  O     . SER C 1 432 ? -43.022  -35.857 -24.881 1.00 81.43  ? 445 SER C O     1 
ATOM   8650  C  CB    . SER C 1 432 ? -41.861  -35.638 -27.632 1.00 81.43  ? 445 SER C CB    1 
ATOM   8651  O  OG    . SER C 1 432 ? -41.931  -34.360 -27.030 1.00 81.43  ? 445 SER C OG    1 
ATOM   8652  N  N     . ALA C 1 433 ? -43.367  -37.981 -25.541 1.00 65.08  ? 446 ALA C N     1 
ATOM   8653  C  CA    . ALA C 1 433 ? -44.448  -38.228 -24.594 1.00 65.08  ? 446 ALA C CA    1 
ATOM   8654  C  C     . ALA C 1 433 ? -44.001  -39.212 -23.519 1.00 65.08  ? 446 ALA C C     1 
ATOM   8655  O  O     . ALA C 1 433 ? -44.555  -39.241 -22.421 1.00 65.08  ? 446 ALA C O     1 
ATOM   8656  C  CB    . ALA C 1 433 ? -45.674  -38.749 -25.314 1.00 65.08  ? 446 ALA C CB    1 
ATOM   8657  N  N     . HIS C 1 434 ? -43.002  -40.026 -23.848 1.00 67.50  ? 447 HIS C N     1 
ATOM   8658  C  CA    . HIS C 1 434 ? -42.415  -40.937 -22.877 1.00 67.50  ? 447 HIS C CA    1 
ATOM   8659  C  C     . HIS C 1 434 ? -41.580  -40.141 -21.882 1.00 67.50  ? 447 HIS C C     1 
ATOM   8660  O  O     . HIS C 1 434 ? -41.477  -40.501 -20.710 1.00 67.50  ? 447 HIS C O     1 
ATOM   8661  C  CB    . HIS C 1 434 ? -41.532  -41.972 -23.575 1.00 67.50  ? 447 HIS C CB    1 
ATOM   8662  C  CG    . HIS C 1 434 ? -42.237  -42.758 -24.635 1.00 67.50  ? 447 HIS C CG    1 
ATOM   8663  N  ND1   . HIS C 1 434 ? -41.578  -43.304 -25.718 1.00 67.50  ? 447 HIS C ND1   1 
ATOM   8664  C  CD2   . HIS C 1 434 ? -43.540  -43.099 -24.780 1.00 67.50  ? 447 HIS C CD2   1 
ATOM   8665  C  CE1   . HIS C 1 434 ? -42.443  -43.942 -26.482 1.00 67.50  ? 447 HIS C CE1   1 
ATOM   8666  N  NE2   . HIS C 1 434 ? -43.642  -43.834 -25.937 1.00 67.50  ? 447 HIS C NE2   1 
ATOM   8667  N  N     . ALA C 1 435 ? -40.987  -39.054 -22.363 1.00 50.54  ? 448 ALA C N     1 
ATOM   8668  C  CA    . ALA C 1 435 ? -40.121  -38.213 -21.546 1.00 50.54  ? 448 ALA C CA    1 
ATOM   8669  C  C     . ALA C 1 435 ? -40.889  -37.492 -20.444 1.00 50.54  ? 448 ALA C C     1 
ATOM   8670  O  O     . ALA C 1 435 ? -40.422  -37.415 -19.309 1.00 50.54  ? 448 ALA C O     1 
ATOM   8671  C  CB    . ALA C 1 435 ? -39.383  -37.213 -22.416 1.00 50.54  ? 448 ALA C CB    1 
ATOM   8672  N  N     . GLN C 1 436 ? -42.062  -36.960 -20.781 1.00 35.62  ? 449 GLN C N     1 
ATOM   8673  C  CA    . GLN C 1 436 ? -42.881  -36.256 -19.798 1.00 35.62  ? 449 GLN C CA    1 
ATOM   8674  C  C     . GLN C 1 436 ? -43.432  -37.224 -18.758 1.00 35.62  ? 449 GLN C C     1 
ATOM   8675  O  O     . GLN C 1 436 ? -43.795  -36.822 -17.654 1.00 35.62  ? 449 GLN C O     1 
ATOM   8676  C  CB    . GLN C 1 436 ? -44.028  -35.494 -20.467 1.00 35.62  ? 449 GLN C CB    1 
ATOM   8677  C  CG    . GLN C 1 436 ? -45.249  -36.345 -20.785 1.00 35.62  ? 449 GLN C CG    1 
ATOM   8678  C  CD    . GLN C 1 436 ? -46.543  -35.558 -20.709 1.00 35.62  ? 449 GLN C CD    1 
ATOM   8679  O  OE1   . GLN C 1 436 ? -47.625  -36.101 -20.922 1.00 35.62  ? 449 GLN C OE1   1 
ATOM   8680  N  NE2   . GLN C 1 436 ? -46.438  -34.273 -20.398 1.00 35.62  ? 449 GLN C NE2   1 
ATOM   8681  N  N     . ALA C 1 437 ? -43.494  -38.502 -19.118 1.00 54.81  ? 450 ALA C N     1 
ATOM   8682  C  CA    . ALA C 1 437 ? -43.930  -39.535 -18.190 1.00 54.81  ? 450 ALA C CA    1 
ATOM   8683  C  C     . ALA C 1 437 ? -42.814  -39.841 -17.199 1.00 54.81  ? 450 ALA C C     1 
ATOM   8684  O  O     . ALA C 1 437 ? -43.032  -39.855 -15.988 1.00 54.81  ? 450 ALA C O     1 
ATOM   8685  C  CB    . ALA C 1 437 ? -44.334  -40.787 -18.944 1.00 54.81  ? 450 ALA C CB    1 
ATOM   8686  N  N     . ILE C 1 438 ? -41.619  -40.088 -17.727 1.00 23.07  ? 451 ILE C N     1 
ATOM   8687  C  CA    . ILE C 1 438 ? -40.448  -40.351 -16.900 1.00 23.07  ? 451 ILE C CA    1 
ATOM   8688  C  C     . ILE C 1 438 ? -40.117  -39.143 -16.025 1.00 23.07  ? 451 ILE C C     1 
ATOM   8689  O  O     . ILE C 1 438 ? -39.822  -39.291 -14.839 1.00 23.07  ? 451 ILE C O     1 
ATOM   8690  C  CB    . ILE C 1 438 ? -39.222  -40.718 -17.758 1.00 23.07  ? 451 ILE C CB    1 
ATOM   8691  C  CG1   . ILE C 1 438 ? -39.518  -41.938 -18.627 1.00 23.07  ? 451 ILE C CG1   1 
ATOM   8692  C  CG2   . ILE C 1 438 ? -38.012  -40.988 -16.881 1.00 23.07  ? 451 ILE C CG2   1 
ATOM   8693  C  CD1   . ILE C 1 438 ? -38.350  -42.379 -19.478 1.00 23.07  ? 451 ILE C CD1   1 
ATOM   8694  N  N     . LEU C 1 439 ? -40.174  -37.951 -16.614 1.00 38.98  ? 452 LEU C N     1 
ATOM   8695  C  CA    . LEU C 1 439 ? -39.899  -36.717 -15.882 1.00 38.98  ? 452 LEU C CA    1 
ATOM   8696  C  C     . LEU C 1 439 ? -40.911  -36.494 -14.760 1.00 38.98  ? 452 LEU C C     1 
ATOM   8697  O  O     . LEU C 1 439 ? -40.571  -35.950 -13.711 1.00 38.98  ? 452 LEU C O     1 
ATOM   8698  C  CB    . LEU C 1 439 ? -39.871  -35.513 -16.828 1.00 38.98  ? 452 LEU C CB    1 
ATOM   8699  C  CG    . LEU C 1 439 ? -39.531  -34.150 -16.220 1.00 38.98  ? 452 LEU C CG    1 
ATOM   8700  C  CD1   . LEU C 1 439 ? -38.269  -34.234 -15.378 1.00 38.98  ? 452 LEU C CD1   1 
ATOM   8701  C  CD2   . LEU C 1 439 ? -39.375  -33.095 -17.306 1.00 38.98  ? 452 LEU C CD2   1 
ATOM   8702  N  N     . HIS C 1 440 ? -42.151  -36.919 -14.982 1.00 33.71  ? 453 HIS C N     1 
ATOM   8703  C  CA    . HIS C 1 440 ? -43.177  -36.853 -13.946 1.00 33.71  ? 453 HIS C CA    1 
ATOM   8704  C  C     . HIS C 1 440 ? -42.807  -37.742 -12.761 1.00 33.71  ? 453 HIS C C     1 
ATOM   8705  O  O     . HIS C 1 440 ? -42.995  -37.364 -11.605 1.00 33.71  ? 453 HIS C O     1 
ATOM   8706  C  CB    . HIS C 1 440 ? -44.538  -37.269 -14.508 1.00 33.71  ? 453 HIS C CB    1 
ATOM   8707  C  CG    . HIS C 1 440 ? -45.355  -36.125 -15.036 1.00 33.71  ? 453 HIS C CG    1 
ATOM   8708  N  ND1   . HIS C 1 440 ? -46.060  -36.200 -16.211 1.00 33.71  ? 453 HIS C ND1   1 
ATOM   8709  C  CD2   . HIS C 1 440 ? -45.583  -34.892 -14.531 1.00 33.71  ? 453 HIS C CD2   1 
ATOM   8710  C  CE1   . HIS C 1 440 ? -46.688  -35.056 -16.422 1.00 33.71  ? 453 HIS C CE1   1 
ATOM   8711  N  NE2   . HIS C 1 440 ? -46.414  -34.243 -15.412 1.00 33.71  ? 453 HIS C NE2   1 
ATOM   8712  N  N     . LEU C 1 441 ? -42.280  -38.925 -13.060 1.00 34.48  ? 454 LEU C N     1 
ATOM   8713  C  CA    . LEU C 1 441 ? -41.854  -39.859 -12.026 1.00 34.48  ? 454 LEU C CA    1 
ATOM   8714  C  C     . LEU C 1 441 ? -40.585  -39.374 -11.331 1.00 34.48  ? 454 LEU C C     1 
ATOM   8715  O  O     . LEU C 1 441 ? -40.480  -39.438 -10.105 1.00 34.48  ? 454 LEU C O     1 
ATOM   8716  C  CB    . LEU C 1 441 ? -41.633  -41.251 -12.620 1.00 34.48  ? 454 LEU C CB    1 
ATOM   8717  C  CG    . LEU C 1 441 ? -42.876  -41.934 -13.190 1.00 34.48  ? 454 LEU C CG    1 
ATOM   8718  C  CD1   . LEU C 1 441 ? -42.527  -43.271 -13.822 1.00 34.48  ? 454 LEU C CD1   1 
ATOM   8719  C  CD2   . LEU C 1 441 ? -43.923  -42.114 -12.105 1.00 34.48  ? 454 LEU C CD2   1 
ATOM   8720  N  N     . GLN C 1 442 ? -39.629  -38.891 -12.122 1.00 34.64  ? 455 GLN C N     1 
ATOM   8721  C  CA    . GLN C 1 442 ? -38.372  -38.363 -11.597 1.00 34.64  ? 455 GLN C CA    1 
ATOM   8722  C  C     . GLN C 1 442 ? -38.610  -37.278 -10.553 1.00 34.64  ? 455 GLN C C     1 
ATOM   8723  O  O     . GLN C 1 442 ? -38.002  -37.288 -9.485  1.00 34.64  ? 455 GLN C O     1 
ATOM   8724  C  CB    . GLN C 1 442 ? -37.511  -37.804 -12.733 1.00 34.64  ? 455 GLN C CB    1 
ATOM   8725  C  CG    . GLN C 1 442 ? -36.919  -38.855 -13.662 1.00 34.64  ? 455 GLN C CG    1 
ATOM   8726  C  CD    . GLN C 1 442 ? -36.038  -38.253 -14.739 1.00 34.64  ? 455 GLN C CD    1 
ATOM   8727  O  OE1   . GLN C 1 442 ? -36.361  -37.214 -15.313 1.00 34.64  ? 455 GLN C OE1   1 
ATOM   8728  N  NE2   . GLN C 1 442 ? -34.916  -38.903 -15.016 1.00 34.64  ? 455 GLN C NE2   1 
ATOM   8729  N  N     . GLU C 1 443 ? -39.502  -36.346 -10.872 1.00 54.41  ? 456 GLU C N     1 
ATOM   8730  C  CA    . GLU C 1 443 ? -39.832  -35.251 -9.969  1.00 54.41  ? 456 GLU C CA    1 
ATOM   8731  C  C     . GLU C 1 443 ? -40.573  -35.750 -8.731  1.00 54.41  ? 456 GLU C C     1 
ATOM   8732  O  O     . GLU C 1 443 ? -40.518  -35.126 -7.671  1.00 54.41  ? 456 GLU C O     1 
ATOM   8733  C  CB    . GLU C 1 443 ? -40.665  -34.195 -10.697 1.00 54.41  ? 456 GLU C CB    1 
ATOM   8734  C  CG    . GLU C 1 443 ? -39.919  -33.478 -11.816 1.00 54.41  ? 456 GLU C CG    1 
ATOM   8735  C  CD    . GLU C 1 443 ? -40.842  -32.689 -12.729 1.00 54.41  ? 456 GLU C CD    1 
ATOM   8736  O  OE1   . GLU C 1 443 ? -42.075  -32.766 -12.547 1.00 54.41  ? 456 GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C 1 443 ? -40.330  -31.994 -13.631 1.00 54.41  ? 456 GLU C OE2   1 
ATOM   8738  N  N     . GLN C 1 444 ? -41.266  -36.878 -8.871  1.00 47.22  ? 457 GLN C N     1 
ATOM   8739  C  CA    . GLN C 1 444 ? -42.014  -37.468 -7.762  1.00 47.22  ? 457 GLN C CA    1 
ATOM   8740  C  C     . GLN C 1 444 ? -41.107  -38.196 -6.776  1.00 47.22  ? 457 GLN C C     1 
ATOM   8741  O  O     . GLN C 1 444 ? -41.309  -38.115 -5.566  1.00 47.22  ? 457 GLN C O     1 
ATOM   8742  C  CB    . GLN C 1 444 ? -43.096  -38.415 -8.283  1.00 47.22  ? 457 GLN C CB    1 
ATOM   8743  C  CG    . GLN C 1 444 ? -44.490  -37.809 -8.291  1.00 47.22  ? 457 GLN C CG    1 
ATOM   8744  C  CD    . GLN C 1 444 ? -45.077  -37.674 -6.900  1.00 47.22  ? 457 GLN C CD    1 
ATOM   8745  O  OE1   . GLN C 1 444 ? -44.592  -38.284 -5.948  1.00 47.22  ? 457 GLN C OE1   1 
ATOM   8746  N  NE2   . GLN C 1 444 ? -46.128  -36.873 -6.775  1.00 47.22  ? 457 GLN C NE2   1 
ATOM   8747  N  N     . ILE C 1 445 ? -40.118  -38.913 -7.303  1.00 33.80  ? 458 ILE C N     1 
ATOM   8748  C  CA    . ILE C 1 445 ? -39.123  -39.585 -6.473  1.00 33.80  ? 458 ILE C CA    1 
ATOM   8749  C  C     . ILE C 1 445 ? -38.418  -38.567 -5.582  1.00 33.80  ? 458 ILE C C     1 
ATOM   8750  O  O     . ILE C 1 445 ? -38.249  -38.783 -4.382  1.00 33.80  ? 458 ILE C O     1 
ATOM   8751  C  CB    . ILE C 1 445 ? -38.066  -40.311 -7.327  1.00 33.80  ? 458 ILE C CB    1 
ATOM   8752  C  CG1   . ILE C 1 445 ? -38.721  -41.317 -8.271  1.00 33.80  ? 458 ILE C CG1   1 
ATOM   8753  C  CG2   . ILE C 1 445 ? -37.054  -41.017 -6.443  1.00 33.80  ? 458 ILE C CG2   1 
ATOM   8754  C  CD1   . ILE C 1 445 ? -37.738  -42.028 -9.179  1.00 33.80  ? 458 ILE C CD1   1 
ATOM   8755  N  N     . VAL C 1 446 ? -38.016  -37.455 -6.188  1.00 51.93  ? 459 VAL C N     1 
ATOM   8756  C  CA    . VAL C 1 446 ? -37.352  -36.373 -5.474  1.00 51.93  ? 459 VAL C CA    1 
ATOM   8757  C  C     . VAL C 1 446 ? -38.272  -35.748 -4.430  1.00 51.93  ? 459 VAL C C     1 
ATOM   8758  O  O     . VAL C 1 446 ? -37.862  -35.507 -3.296  1.00 51.93  ? 459 VAL C O     1 
ATOM   8759  C  CB    . VAL C 1 446 ? -36.876  -35.279 -6.445  1.00 51.93  ? 459 VAL C CB    1 
ATOM   8760  C  CG1   . VAL C 1 446 ? -36.227  -34.134 -5.686  1.00 51.93  ? 459 VAL C CG1   1 
ATOM   8761  C  CG2   . VAL C 1 446 ? -35.910  -35.860 -7.462  1.00 51.93  ? 459 VAL C CG2   1 
ATOM   8762  N  N     . LYS C 1 447 ? -39.517  -35.493 -4.822  1.00 59.29  ? 460 LYS C N     1 
ATOM   8763  C  CA    . LYS C 1 447 ? -40.498  -34.859 -3.943  1.00 59.29  ? 460 LYS C CA    1 
ATOM   8764  C  C     . LYS C 1 447 ? -40.711  -35.625 -2.640  1.00 59.29  ? 460 LYS C C     1 
ATOM   8765  O  O     . LYS C 1 447 ? -40.688  -35.040 -1.556  1.00 59.29  ? 460 LYS C O     1 
ATOM   8766  C  CB    . LYS C 1 447 ? -41.837  -34.691 -4.666  1.00 59.29  ? 460 LYS C CB    1 
ATOM   8767  C  CG    . LYS C 1 447 ? -42.955  -34.163 -3.778  1.00 59.29  ? 460 LYS C CG    1 
ATOM   8768  C  CD    . LYS C 1 447 ? -44.228  -33.911 -4.570  1.00 59.29  ? 460 LYS C CD    1 
ATOM   8769  C  CE    . LYS C 1 447 ? -45.310  -33.304 -3.691  1.00 59.29  ? 460 LYS C CE    1 
ATOM   8770  N  NZ    . LYS C 1 447 ? -46.531  -32.943 -4.466  1.00 59.29  ? 460 LYS C NZ    1 
ATOM   8771  N  N     . GLU C 1 448 ? -40.918  -36.933 -2.750  1.00 58.05  ? 461 GLU C N     1 
ATOM   8772  C  CA    . GLU C 1 448 ? -41.183  -37.766 -1.584  1.00 58.05  ? 461 GLU C CA    1 
ATOM   8773  C  C     . GLU C 1 448 ? -39.960  -37.902 -0.679  1.00 58.05  ? 461 GLU C C     1 
ATOM   8774  O  O     . GLU C 1 448 ? -40.084  -37.883 0.546   1.00 58.05  ? 461 GLU C O     1 
ATOM   8775  C  CB    . GLU C 1 448 ? -41.686  -39.145 -2.013  1.00 58.05  ? 461 GLU C CB    1 
ATOM   8776  C  CG    . GLU C 1 448 ? -43.038  -39.125 -2.709  1.00 58.05  ? 461 GLU C CG    1 
ATOM   8777  C  CD    . GLU C 1 448 ? -43.575  -40.517 -2.977  1.00 58.05  ? 461 GLU C CD    1 
ATOM   8778  O  OE1   . GLU C 1 448 ? -42.854  -41.498 -2.700  1.00 58.05  ? 461 GLU C OE1   1 
ATOM   8779  O  OE2   . GLU C 1 448 ? -44.721  -40.629 -3.461  1.00 58.05  ? 461 GLU C OE2   1 
ATOM   8780  N  N     . MET C 1 449 ? -38.783  -38.040 -1.284  1.00 54.63  ? 462 MET C N     1 
ATOM   8781  C  CA    . MET C 1 449 ? -37.542  -38.144 -0.521  1.00 54.63  ? 462 MET C CA    1 
ATOM   8782  C  C     . MET C 1 449 ? -37.248  -36.846 0.226   1.00 54.63  ? 462 MET C C     1 
ATOM   8783  O  O     . MET C 1 449 ? -36.647  -36.861 1.299   1.00 54.63  ? 462 MET C O     1 
ATOM   8784  C  CB    . MET C 1 449 ? -36.367  -38.516 -1.428  1.00 54.63  ? 462 MET C CB    1 
ATOM   8785  C  CG    . MET C 1 449 ? -36.432  -39.931 -1.982  1.00 54.63  ? 462 MET C CG    1 
ATOM   8786  S  SD    . MET C 1 449 ? -34.925  -40.430 -2.841  1.00 54.63  ? 462 MET C SD    1 
ATOM   8787  C  CE    . MET C 1 449 ? -34.849  -39.201 -4.141  1.00 54.63  ? 462 MET C CE    1 
ATOM   8788  N  N     . ASN C 1 450 ? -37.677  -35.727 -0.349  1.00 56.59  ? 463 ASN C N     1 
ATOM   8789  C  CA    . ASN C 1 450 ? -37.570  -34.435 0.317   1.00 56.59  ? 463 ASN C CA    1 
ATOM   8790  C  C     . ASN C 1 450 ? -38.585  -34.320 1.449   1.00 56.59  ? 463 ASN C C     1 
ATOM   8791  O  O     . ASN C 1 450 ? -38.443  -33.487 2.343   1.00 56.59  ? 463 ASN C O     1 
ATOM   8792  C  CB    . ASN C 1 450 ? -37.764  -33.292 -0.682  1.00 56.59  ? 463 ASN C CB    1 
ATOM   8793  C  CG    . ASN C 1 450 ? -36.624  -33.182 -1.677  1.00 56.59  ? 463 ASN C CG    1 
ATOM   8794  O  OD1   . ASN C 1 450 ? -35.809  -34.094 -1.809  1.00 56.59  ? 463 ASN C OD1   1 
ATOM   8795  N  ND2   . ASN C 1 450 ? -36.566  -32.062 -2.387  1.00 56.59  ? 463 ASN C ND2   1 
ATOM   8796  N  N     . ASP C 1 451 ? -39.614  -35.161 1.398   1.00 53.95  ? 464 ASP C N     1 
ATOM   8797  C  CA    . ASP C 1 451 ? -40.626  -35.202 2.444   1.00 53.95  ? 464 ASP C CA    1 
ATOM   8798  C  C     . ASP C 1 451 ? -40.287  -36.301 3.445   1.00 53.95  ? 464 ASP C C     1 
ATOM   8799  O  O     . ASP C 1 451 ? -40.844  -36.348 4.541   1.00 53.95  ? 464 ASP C O     1 
ATOM   8800  C  CB    . ASP C 1 451 ? -42.011  -35.454 1.845   1.00 53.95  ? 464 ASP C CB    1 
ATOM   8801  C  CG    . ASP C 1 451 ? -43.087  -34.584 2.469   1.00 53.95  ? 464 ASP C CG    1 
ATOM   8802  O  OD1   . ASP C 1 451 ? -42.839  -33.377 2.662   1.00 53.95  ? 464 ASP C OD1   1 
ATOM   8803  O  OD2   . ASP C 1 451 ? -44.181  -35.109 2.765   1.00 53.95  ? 464 ASP C OD2   1 
ATOM   8804  N  N     . GLY C 1 452 ? -39.374  -37.187 3.059   1.00 37.39  ? 465 GLY C N     1 
ATOM   8805  C  CA    . GLY C 1 452 ? -38.925  -38.249 3.941   1.00 37.39  ? 465 GLY C CA    1 
ATOM   8806  C  C     . GLY C 1 452 ? -39.402  -39.638 3.558   1.00 37.39  ? 465 GLY C C     1 
ATOM   8807  O  O     . GLY C 1 452 ? -38.925  -40.632 4.106   1.00 37.39  ? 465 GLY C O     1 
ATOM   8808  N  N     . ASP C 1 453 ? -40.339  -39.711 2.618   1.00 62.79  ? 466 ASP C N     1 
ATOM   8809  C  CA    . ASP C 1 453 ? -40.930  -40.989 2.223   1.00 62.79  ? 466 ASP C CA    1 
ATOM   8810  C  C     . ASP C 1 453 ? -40.163  -41.650 1.078   1.00 62.79  ? 466 ASP C C     1 
ATOM   8811  O  O     . ASP C 1 453 ? -40.341  -41.295 -0.085  1.00 62.79  ? 466 ASP C O     1 
ATOM   8812  C  CB    . ASP C 1 453 ? -42.399  -40.796 1.838   1.00 62.79  ? 466 ASP C CB    1 
ATOM   8813  C  CG    . ASP C 1 453 ? -43.086  -42.097 1.482   1.00 62.79  ? 466 ASP C CG    1 
ATOM   8814  O  OD1   . ASP C 1 453 ? -42.663  -43.154 1.991   1.00 62.79  ? 466 ASP C OD1   1 
ATOM   8815  O  OD2   . ASP C 1 453 ? -44.056  -42.061 0.696   1.00 62.79  ? 466 ASP C OD2   1 
ATOM   8816  N  N     . TYR C 1 454 ? -39.318  -42.619 1.419   1.00 65.85  ? 467 TYR C N     1 
ATOM   8817  C  CA    . TYR C 1 454 ? -38.510  -43.328 0.433   1.00 65.85  ? 467 TYR C CA    1 
ATOM   8818  C  C     . TYR C 1 454 ? -39.158  -44.653 0.031   1.00 65.85  ? 467 TYR C C     1 
ATOM   8819  O  O     . TYR C 1 454 ? -38.532  -45.476 -0.638  1.00 65.85  ? 467 TYR C O     1 
ATOM   8820  C  CB    . TYR C 1 454 ? -37.110  -43.609 0.990   1.00 65.85  ? 467 TYR C CB    1 
ATOM   8821  C  CG    . TYR C 1 454 ? -36.253  -42.386 1.255   1.00 65.85  ? 467 TYR C CG    1 
ATOM   8822  C  CD1   . TYR C 1 454 ? -36.541  -41.523 2.304   1.00 65.85  ? 467 TYR C CD1   1 
ATOM   8823  C  CD2   . TYR C 1 454 ? -35.135  -42.116 0.477   1.00 65.85  ? 467 TYR C CD2   1 
ATOM   8824  C  CE1   . TYR C 1 454 ? -35.757  -40.414 2.556   1.00 65.85  ? 467 TYR C CE1   1 
ATOM   8825  C  CE2   . TYR C 1 454 ? -34.342  -41.010 0.723   1.00 65.85  ? 467 TYR C CE2   1 
ATOM   8826  C  CZ    . TYR C 1 454 ? -34.658  -40.163 1.763   1.00 65.85  ? 467 TYR C CZ    1 
ATOM   8827  O  OH    . TYR C 1 454 ? -33.874  -39.060 2.013   1.00 65.85  ? 467 TYR C OH    1 
ATOM   8828  N  N     . SER C 1 455 ? -40.407  -44.855 0.441   1.00 63.43  ? 468 SER C N     1 
ATOM   8829  C  CA    . SER C 1 455 ? -41.095  -46.129 0.235   1.00 63.43  ? 468 SER C CA    1 
ATOM   8830  C  C     . SER C 1 455 ? -41.288  -46.481 -1.238  1.00 63.43  ? 468 SER C C     1 
ATOM   8831  O  O     . SER C 1 455 ? -40.948  -47.582 -1.671  1.00 63.43  ? 468 SER C O     1 
ATOM   8832  C  CB    . SER C 1 455 ? -42.451  -46.130 0.946   1.00 63.43  ? 468 SER C CB    1 
ATOM   8833  O  OG    . SER C 1 455 ? -43.326  -45.170 0.382   1.00 63.43  ? 468 SER C OG    1 
ATOM   8834  N  N     . SER C 1 456 ? -41.835  -45.543 -2.003  1.00 83.52  ? 469 SER C N     1 
ATOM   8835  C  CA    . SER C 1 456 ? -42.156  -45.792 -3.403  1.00 83.52  ? 469 SER C CA    1 
ATOM   8836  C  C     . SER C 1 456 ? -41.007  -45.460 -4.353  1.00 83.52  ? 469 SER C C     1 
ATOM   8837  O  O     . SER C 1 456 ? -41.207  -45.370 -5.565  1.00 83.52  ? 469 SER C O     1 
ATOM   8838  C  CB    . SER C 1 456 ? -43.414  -45.021 -3.806  1.00 83.52  ? 469 SER C CB    1 
ATOM   8839  O  OG    . SER C 1 456 ? -43.296  -43.648 -3.480  1.00 83.52  ? 469 SER C OG    1 
ATOM   8840  N  N     . VAL C 1 457 ? -39.810  -45.278 -3.802  1.00 42.00  ? 470 VAL C N     1 
ATOM   8841  C  CA    . VAL C 1 457 ? -38.620  -45.036 -4.615  1.00 42.00  ? 470 VAL C CA    1 
ATOM   8842  C  C     . VAL C 1 457 ? -38.362  -46.209 -5.556  1.00 42.00  ? 470 VAL C C     1 
ATOM   8843  O  O     . VAL C 1 457 ? -38.166  -46.023 -6.757  1.00 42.00  ? 470 VAL C O     1 
ATOM   8844  C  CB    . VAL C 1 457 ? -37.375  -44.795 -3.741  1.00 42.00  ? 470 VAL C CB    1 
ATOM   8845  C  CG1   . VAL C 1 457 ? -36.104  -44.943 -4.563  1.00 42.00  ? 470 VAL C CG1   1 
ATOM   8846  C  CG2   . VAL C 1 457 ? -37.437  -43.422 -3.094  1.00 42.00  ? 470 VAL C CG2   1 
ATOM   8847  N  N     . GLN C 1 458 ? -38.373  -47.417 -5.000  1.00 49.42  ? 471 GLN C N     1 
ATOM   8848  C  CA    . GLN C 1 458 ? -38.195  -48.628 -5.791  1.00 49.42  ? 471 GLN C CA    1 
ATOM   8849  C  C     . GLN C 1 458 ? -39.346  -48.805 -6.778  1.00 49.42  ? 471 GLN C C     1 
ATOM   8850  O  O     . GLN C 1 458 ? -39.149  -49.286 -7.894  1.00 49.42  ? 471 GLN C O     1 
ATOM   8851  C  CB    . GLN C 1 458 ? -38.081  -49.854 -4.882  1.00 49.42  ? 471 GLN C CB    1 
ATOM   8852  C  CG    . GLN C 1 458 ? -37.968  -51.176 -5.634  1.00 49.42  ? 471 GLN C CG    1 
ATOM   8853  C  CD    . GLN C 1 458 ? -37.926  -52.380 -4.712  1.00 49.42  ? 471 GLN C CD    1 
ATOM   8854  O  OE1   . GLN C 1 458 ? -37.596  -52.263 -3.533  1.00 49.42  ? 471 GLN C OE1   1 
ATOM   8855  N  NE2   . GLN C 1 458 ? -38.266  -53.546 -5.248  1.00 49.42  ? 471 GLN C NE2   1 
ATOM   8856  N  N     . ASN C 1 459 ? -40.544  -48.408 -6.362  1.00 48.77  ? 472 ASN C N     1 
ATOM   8857  C  CA    . ASN C 1 459 ? -41.725  -48.502 -7.213  1.00 48.77  ? 472 ASN C CA    1 
ATOM   8858  C  C     . ASN C 1 459 ? -41.568  -47.694 -8.499  1.00 48.77  ? 472 ASN C C     1 
ATOM   8859  O  O     . ASN C 1 459 ? -41.703  -48.232 -9.598  1.00 48.77  ? 472 ASN C O     1 
ATOM   8860  C  CB    . ASN C 1 459 ? -42.970  -48.043 -6.450  1.00 48.77  ? 472 ASN C CB    1 
ATOM   8861  C  CG    . ASN C 1 459 ? -44.254  -48.275 -7.227  1.00 48.77  ? 472 ASN C CG    1 
ATOM   8862  O  OD1   . ASN C 1 459 ? -44.319  -49.146 -8.094  1.00 48.77  ? 472 ASN C OD1   1 
ATOM   8863  N  ND2   . ASN C 1 459 ? -45.283  -47.495 -6.916  1.00 48.77  ? 472 ASN C ND2   1 
ATOM   8864  N  N     . TYR C 1 460 ? -41.269  -46.406 -8.350  1.00 58.25  ? 473 TYR C N     1 
ATOM   8865  C  CA    . TYR C 1 460 ? -41.141  -45.498 -9.488  1.00 58.25  ? 473 TYR C CA    1 
ATOM   8866  C  C     . TYR C 1 460 ? -39.992  -45.883 -10.419 1.00 58.25  ? 473 TYR C C     1 
ATOM   8867  O  O     . TYR C 1 460 ? -40.111  -45.768 -11.639 1.00 58.25  ? 473 TYR C O     1 
ATOM   8868  C  CB    . TYR C 1 460 ? -40.964  -44.058 -9.002  1.00 58.25  ? 473 TYR C CB    1 
ATOM   8869  C  CG    . TYR C 1 460 ? -42.107  -43.550 -8.153  1.00 58.25  ? 473 TYR C CG    1 
ATOM   8870  C  CD1   . TYR C 1 460 ? -43.404  -43.995 -8.362  1.00 58.25  ? 473 TYR C CD1   1 
ATOM   8871  C  CD2   . TYR C 1 460 ? -41.887  -42.629 -7.138  1.00 58.25  ? 473 TYR C CD2   1 
ATOM   8872  C  CE1   . TYR C 1 460 ? -44.450  -43.535 -7.588  1.00 58.25  ? 473 TYR C CE1   1 
ATOM   8873  C  CE2   . TYR C 1 460 ? -42.927  -42.163 -6.359  1.00 58.25  ? 473 TYR C CE2   1 
ATOM   8874  C  CZ    . TYR C 1 460 ? -44.207  -42.620 -6.588  1.00 58.25  ? 473 TYR C CZ    1 
ATOM   8875  O  OH    . TYR C 1 460 ? -45.247  -42.161 -5.815  1.00 58.25  ? 473 TYR C OH    1 
ATOM   8876  N  N     . LEU C 1 461 ? -38.883  -46.334 -9.839  1.00 50.11  ? 474 LEU C N     1 
ATOM   8877  C  CA    . LEU C 1 461 ? -37.735  -46.774 -10.625 1.00 50.11  ? 474 LEU C CA    1 
ATOM   8878  C  C     . LEU C 1 461 ? -38.105  -47.959 -11.512 1.00 50.11  ? 474 LEU C C     1 
ATOM   8879  O  O     . LEU C 1 461 ? -37.623  -48.078 -12.640 1.00 50.11  ? 474 LEU C O     1 
ATOM   8880  C  CB    . LEU C 1 461 ? -36.557  -47.136 -9.716  1.00 50.11  ? 474 LEU C CB    1 
ATOM   8881  C  CG    . LEU C 1 461 ? -35.810  -45.973 -9.060  1.00 50.11  ? 474 LEU C CG    1 
ATOM   8882  C  CD1   . LEU C 1 461 ? -34.595  -46.471 -8.295  1.00 50.11  ? 474 LEU C CD1   1 
ATOM   8883  C  CD2   . LEU C 1 461 ? -35.399  -44.948 -10.104 1.00 50.11  ? 474 LEU C CD2   1 
ATOM   8884  N  N     . ASP C 1 462 ? -38.967  -48.830 -10.997 1.00 88.63  ? 475 ASP C N     1 
ATOM   8885  C  CA    . ASP C 1 462 ? -39.454  -49.972 -11.760 1.00 88.63  ? 475 ASP C CA    1 
ATOM   8886  C  C     . ASP C 1 462 ? -40.405  -49.518 -12.865 1.00 88.63  ? 475 ASP C C     1 
ATOM   8887  O  O     . ASP C 1 462 ? -40.419  -50.089 -13.955 1.00 88.63  ? 475 ASP C O     1 
ATOM   8888  C  CB    . ASP C 1 462 ? -40.152  -50.975 -10.838 1.00 88.63  ? 475 ASP C CB    1 
ATOM   8889  C  CG    . ASP C 1 462 ? -39.190  -51.668 -9.893  1.00 88.63  ? 475 ASP C CG    1 
ATOM   8890  O  OD1   . ASP C 1 462 ? -38.069  -51.152 -9.699  1.00 88.63  ? 475 ASP C OD1   1 
ATOM   8891  O  OD2   . ASP C 1 462 ? -39.555  -52.727 -9.341  1.00 88.63  ? 475 ASP C OD2   1 
ATOM   8892  N  N     . GLN C 1 463 ? -41.195  -48.486 -12.577 1.00 48.93  ? 476 GLN C N     1 
ATOM   8893  C  CA    . GLN C 1 463 ? -42.142  -47.948 -13.550 1.00 48.93  ? 476 GLN C CA    1 
ATOM   8894  C  C     . GLN C 1 463 ? -41.424  -47.238 -14.695 1.00 48.93  ? 476 GLN C C     1 
ATOM   8895  O  O     . GLN C 1 463 ? -41.907  -47.222 -15.826 1.00 48.93  ? 476 GLN C O     1 
ATOM   8896  C  CB    . GLN C 1 463 ? -43.134  -46.994 -12.877 1.00 48.93  ? 476 GLN C CB    1 
ATOM   8897  C  CG    . GLN C 1 463 ? -43.959  -47.621 -11.761 1.00 48.93  ? 476 GLN C CG    1 
ATOM   8898  C  CD    . GLN C 1 463 ? -45.066  -46.708 -11.266 1.00 48.93  ? 476 GLN C CD    1 
ATOM   8899  O  OE1   . GLN C 1 463 ? -45.542  -45.841 -11.997 1.00 48.93  ? 476 GLN C OE1   1 
ATOM   8900  N  NE2   . GLN C 1 463 ? -45.481  -46.901 -10.020 1.00 48.93  ? 476 GLN C NE2   1 
ATOM   8901  N  N     . ILE C 1 464 ? -40.272  -46.648 -14.393 1.00 60.01  ? 477 ILE C N     1 
ATOM   8902  C  CA    . ILE C 1 464 ? -39.463  -45.974 -15.404 1.00 60.01  ? 477 ILE C CA    1 
ATOM   8903  C  C     . ILE C 1 464 ? -38.876  -46.976 -16.397 1.00 60.01  ? 477 ILE C C     1 
ATOM   8904  O  O     . ILE C 1 464 ? -38.953  -46.780 -17.610 1.00 60.01  ? 477 ILE C O     1 
ATOM   8905  C  CB    . ILE C 1 464 ? -38.323  -45.153 -14.765 1.00 60.01  ? 477 ILE C CB    1 
ATOM   8906  C  CG1   . ILE C 1 464 ? -38.876  -43.885 -14.111 1.00 60.01  ? 477 ILE C CG1   1 
ATOM   8907  C  CG2   . ILE C 1 464 ? -37.272  -44.790 -15.801 1.00 60.01  ? 477 ILE C CG2   1 
ATOM   8908  C  CD1   . ILE C 1 464 ? -37.807  -42.970 -13.546 1.00 60.01  ? 477 ILE C CD1   1 
ATOM   8909  N  N     . GLU C 1 465 ? -38.299  -48.051 -15.869 1.00 64.46  ? 478 GLU C N     1 
ATOM   8910  C  CA    . GLU C 1 465 ? -37.681  -49.086 -16.692 1.00 64.46  ? 478 GLU C CA    1 
ATOM   8911  C  C     . GLU C 1 465 ? -38.696  -49.721 -17.640 1.00 64.46  ? 478 GLU C C     1 
ATOM   8912  O  O     . GLU C 1 465 ? -38.341  -50.176 -18.728 1.00 64.46  ? 478 GLU C O     1 
ATOM   8913  C  CB    . GLU C 1 465 ? -37.032  -50.152 -15.804 1.00 64.46  ? 478 GLU C CB    1 
ATOM   8914  C  CG    . GLU C 1 465 ? -36.098  -51.104 -16.537 1.00 64.46  ? 478 GLU C CG    1 
ATOM   8915  C  CD    . GLU C 1 465 ? -35.365  -52.045 -15.597 1.00 64.46  ? 478 GLU C CD    1 
ATOM   8916  O  OE1   . GLU C 1 465 ? -35.780  -52.164 -14.426 1.00 64.46  ? 478 GLU C OE1   1 
ATOM   8917  O  OE2   . GLU C 1 465 ? -34.371  -52.663 -16.031 1.00 64.46  ? 478 GLU C OE2   1 
ATOM   8918  N  N     . ASP C 1 466 ? -39.959  -49.743 -17.221 1.00 68.27  ? 479 ASP C N     1 
ATOM   8919  C  CA    . ASP C 1 466 ? -41.050  -50.239 -18.056 1.00 68.27  ? 479 ASP C CA    1 
ATOM   8920  C  C     . ASP C 1 466 ? -41.171  -49.434 -19.348 1.00 68.27  ? 479 ASP C C     1 
ATOM   8921  O  O     . ASP C 1 466 ? -41.293  -50.001 -20.432 1.00 68.27  ? 479 ASP C O     1 
ATOM   8922  C  CB    . ASP C 1 466 ? -42.374  -50.185 -17.289 1.00 68.27  ? 479 ASP C CB    1 
ATOM   8923  C  CG    . ASP C 1 466 ? -42.839  -51.551 -16.822 1.00 68.27  ? 479 ASP C CG    1 
ATOM   8924  O  OD1   . ASP C 1 466 ? -41.983  -52.413 -16.537 1.00 68.27  ? 479 ASP C OD1   1 
ATOM   8925  O  OD2   . ASP C 1 466 ? -44.067  -51.759 -16.741 1.00 68.27  ? 479 ASP C OD2   1 
ATOM   8926  N  N     . ILE C 1 467 ? -41.139  -48.112 -19.220 1.00 59.47  ? 480 ILE C N     1 
ATOM   8927  C  CA    . ILE C 1 467 ? -41.228  -47.218 -20.369 1.00 59.47  ? 480 ILE C CA    1 
ATOM   8928  C  C     . ILE C 1 467 ? -40.035  -47.413 -21.304 1.00 59.47  ? 480 ILE C C     1 
ATOM   8929  O  O     . ILE C 1 467 ? -40.164  -47.316 -22.524 1.00 59.47  ? 480 ILE C O     1 
ATOM   8930  C  CB    . ILE C 1 467 ? -41.299  -45.740 -19.921 1.00 59.47  ? 480 ILE C CB    1 
ATOM   8931  C  CG1   . ILE C 1 467 ? -42.421  -45.541 -18.902 1.00 59.47  ? 480 ILE C CG1   1 
ATOM   8932  C  CG2   . ILE C 1 467 ? -41.499  -44.817 -21.113 1.00 59.47  ? 480 ILE C CG2   1 
ATOM   8933  C  CD1   . ILE C 1 467 ? -42.558  -44.114 -18.413 1.00 59.47  ? 480 ILE C CD1   1 
ATOM   8934  N  N     . LEU C 1 468 ? -38.879  -47.710 -20.720 1.00 64.67  ? 481 LEU C N     1 
ATOM   8935  C  CA    . LEU C 1 468 ? -37.635  -47.814 -21.474 1.00 64.67  ? 481 LEU C CA    1 
ATOM   8936  C  C     . LEU C 1 468 ? -37.507  -49.100 -22.290 1.00 64.67  ? 481 LEU C C     1 
ATOM   8937  O  O     . LEU C 1 468 ? -36.666  -49.185 -23.183 1.00 64.67  ? 481 LEU C O     1 
ATOM   8938  C  CB    . LEU C 1 468 ? -36.432  -47.679 -20.535 1.00 64.67  ? 481 LEU C CB    1 
ATOM   8939  C  CG    . LEU C 1 468 ? -36.316  -46.365 -19.764 1.00 64.67  ? 481 LEU C CG    1 
ATOM   8940  C  CD1   . LEU C 1 468 ? -35.038  -46.331 -18.944 1.00 64.67  ? 481 LEU C CD1   1 
ATOM   8941  C  CD2   . LEU C 1 468 ? -36.371  -45.189 -20.717 1.00 64.67  ? 481 LEU C CD2   1 
ATOM   8942  N  N     . THR C 1 469 ? -38.331  -50.100 -21.989 1.00 65.76  ? 482 THR C N     1 
ATOM   8943  C  CA    . THR C 1 469 ? -38.217  -51.388 -22.673 1.00 65.76  ? 482 THR C CA    1 
ATOM   8944  C  C     . THR C 1 469 ? -39.527  -51.891 -23.282 1.00 65.76  ? 482 THR C C     1 
ATOM   8945  O  O     . THR C 1 469 ? -39.516  -52.796 -24.115 1.00 65.76  ? 482 THR C O     1 
ATOM   8946  C  CB    . THR C 1 469 ? -37.631  -52.476 -21.746 1.00 65.76  ? 482 THR C CB    1 
ATOM   8947  O  OG1   . THR C 1 469 ? -37.429  -53.684 -22.491 1.00 65.76  ? 482 THR C OG1   1 
ATOM   8948  C  CG2   . THR C 1 469 ? -38.570  -52.755 -20.586 1.00 65.76  ? 482 THR C CG2   1 
ATOM   8949  N  N     . VAL C 1 470 ? -40.648  -51.308 -22.870 1.00 64.49  ? 483 VAL C N     1 
ATOM   8950  C  CA    . VAL C 1 470 ? -41.948  -51.703 -23.409 1.00 64.49  ? 483 VAL C CA    1 
ATOM   8951  C  C     . VAL C 1 470 ? -42.530  -50.620 -24.312 1.00 64.49  ? 483 VAL C C     1 
ATOM   8952  O  O     . VAL C 1 470 ? -42.725  -50.836 -25.509 1.00 64.49  ? 483 VAL C O     1 
ATOM   8953  C  CB    . VAL C 1 470 ? -42.955  -52.035 -22.292 1.00 64.49  ? 483 VAL C CB    1 
ATOM   8954  C  CG1   . VAL C 1 470 ? -44.307  -52.397 -22.886 1.00 64.49  ? 483 VAL C CG1   1 
ATOM   8955  C  CG2   . VAL C 1 470 ? -42.434  -53.169 -21.427 1.00 64.49  ? 483 VAL C CG2   1 
ATOM   8956  N  N     . ASP C 1 471 ? -42.806  -49.457 -23.731 1.00 74.37  ? 484 ASP C N     1 
ATOM   8957  C  CA    . ASP C 1 471 ? -43.355  -48.333 -24.479 1.00 74.37  ? 484 ASP C CA    1 
ATOM   8958  C  C     . ASP C 1 471 ? -42.366  -47.836 -25.528 1.00 74.37  ? 484 ASP C C     1 
ATOM   8959  O  O     . ASP C 1 471 ? -42.619  -47.932 -26.729 1.00 74.37  ? 484 ASP C O     1 
ATOM   8960  C  CB    . ASP C 1 471 ? -43.733  -47.201 -23.524 1.00 74.37  ? 484 ASP C CB    1 
ATOM   8961  C  CG    . ASP C 1 471 ? -44.785  -47.620 -22.516 1.00 74.37  ? 484 ASP C CG    1 
ATOM   8962  O  OD1   . ASP C 1 471 ? -45.163  -46.783 -21.674 1.00 74.37  ? 484 ASP C OD1   1 
ATOM   8963  O  OD2   . ASP C 1 471 ? -45.236  -48.783 -22.571 1.00 74.37  ? 484 ASP C OD2   1 
ATOM   8964  N  N     . ALA C 1 472 ? -41.240  -47.302 -25.068 1.00 66.05  ? 485 ALA C N     1 
ATOM   8965  C  CA    . ALA C 1 472 ? -40.156  -46.920 -25.964 1.00 66.05  ? 485 ALA C CA    1 
ATOM   8966  C  C     . ALA C 1 472 ? -39.227  -48.109 -26.161 1.00 66.05  ? 485 ALA C C     1 
ATOM   8967  O  O     . ALA C 1 472 ? -38.319  -48.336 -25.361 1.00 66.05  ? 485 ALA C O     1 
ATOM   8968  C  CB    . ALA C 1 472 ? -39.391  -45.742 -25.401 1.00 66.05  ? 485 ALA C CB    1 
ATOM   8969  N  N     . LYS C 1 473 ? -39.461  -48.865 -27.229 1.00 86.84  ? 486 LYS C N     1 
ATOM   8970  C  CA    . LYS C 1 473 ? -38.701  -50.081 -27.496 1.00 86.84  ? 486 LYS C CA    1 
ATOM   8971  C  C     . LYS C 1 473 ? -37.223  -49.782 -27.706 1.00 86.84  ? 486 LYS C C     1 
ATOM   8972  O  O     . LYS C 1 473 ? -36.811  -49.369 -28.790 1.00 86.84  ? 486 LYS C O     1 
ATOM   8973  C  CB    . LYS C 1 473 ? -39.250  -50.811 -28.725 1.00 86.84  ? 486 LYS C CB    1 
ATOM   8974  C  CG    . LYS C 1 473 ? -40.747  -50.661 -28.939 1.00 86.84  ? 486 LYS C CG    1 
ATOM   8975  C  CD    . LYS C 1 473 ? -41.056  -49.515 -29.893 1.00 86.84  ? 486 LYS C CD    1 
ATOM   8976  C  CE    . LYS C 1 473 ? -42.550  -49.365 -30.108 1.00 86.84  ? 486 LYS C CE    1 
ATOM   8977  N  NZ    . LYS C 1 473 ? -43.153  -50.605 -30.666 1.00 86.84  ? 486 LYS C NZ    1 
ATOM   8978  N  N     . MET C 1 474 ? -36.428  -49.993 -26.663 1.00 69.89  ? 487 MET C N     1 
ATOM   8979  C  CA    . MET C 1 474 ? -34.989  -49.794 -26.752 1.00 69.89  ? 487 MET C CA    1 
ATOM   8980  C  C     . MET C 1 474 ? -34.272  -51.135 -26.798 1.00 69.89  ? 487 MET C C     1 
ATOM   8981  O  O     . MET C 1 474 ? -34.746  -52.119 -26.229 1.00 69.89  ? 487 MET C O     1 
ATOM   8982  C  CB    . MET C 1 474 ? -34.482  -48.979 -25.560 1.00 69.89  ? 487 MET C CB    1 
ATOM   8983  C  CG    . MET C 1 474 ? -35.048  -47.570 -25.470 1.00 69.89  ? 487 MET C CG    1 
ATOM   8984  S  SD    . MET C 1 474 ? -34.459  -46.691 -24.008 1.00 69.89  ? 487 MET C SD    1 
ATOM   8985  C  CE    . MET C 1 474 ? -35.227  -45.091 -24.241 1.00 69.89  ? 487 MET C CE    1 
ATOM   8986  N  N     . ASP C 1 475 ? -33.134  -51.171 -27.484 1.00 84.10  ? 488 ASP C N     1 
ATOM   8987  C  CA    . ASP C 1 475 ? -32.269  -52.343 -27.473 1.00 84.10  ? 488 ASP C CA    1 
ATOM   8988  C  C     . ASP C 1 475 ? -31.770  -52.557 -26.048 1.00 84.10  ? 488 ASP C C     1 
ATOM   8989  O  O     . ASP C 1 475 ? -31.731  -51.616 -25.253 1.00 84.10  ? 488 ASP C O     1 
ATOM   8990  C  CB    . ASP C 1 475 ? -31.091  -52.140 -28.430 1.00 84.10  ? 488 ASP C CB    1 
ATOM   8991  C  CG    . ASP C 1 475 ? -30.387  -53.440 -28.785 1.00 84.10  ? 488 ASP C CG    1 
ATOM   8992  O  OD1   . ASP C 1 475 ? -30.251  -54.316 -27.904 1.00 84.10  ? 488 ASP C OD1   1 
ATOM   8993  O  OD2   . ASP C 1 475 ? -29.969  -53.584 -29.953 1.00 84.10  ? 488 ASP C OD2   1 
ATOM   8994  N  N     . ASP C 1 476 ? -31.395  -53.793 -25.730 1.00 65.55  ? 489 ASP C N     1 
ATOM   8995  C  CA    . ASP C 1 476 ? -30.949  -54.151 -24.385 1.00 65.55  ? 489 ASP C CA    1 
ATOM   8996  C  C     . ASP C 1 476 ? -29.797  -53.282 -23.881 1.00 65.55  ? 489 ASP C C     1 
ATOM   8997  O  O     . ASP C 1 476 ? -29.652  -53.066 -22.677 1.00 65.55  ? 489 ASP C O     1 
ATOM   8998  C  CB    . ASP C 1 476 ? -30.550  -55.629 -24.329 1.00 65.55  ? 489 ASP C CB    1 
ATOM   8999  C  CG    . ASP C 1 476 ? -31.739  -56.550 -24.125 1.00 65.55  ? 489 ASP C CG    1 
ATOM   9000  O  OD1   . ASP C 1 476 ? -32.889  -56.093 -24.289 1.00 65.55  ? 489 ASP C OD1   1 
ATOM   9001  O  OD2   . ASP C 1 476 ? -31.519  -57.736 -23.801 1.00 65.55  ? 489 ASP C OD2   1 
ATOM   9002  N  N     . ILE C 1 477 ? -28.987  -52.780 -24.807 1.00 108.63 ? 490 ILE C N     1 
ATOM   9003  C  CA    . ILE C 1 477 ? -27.838  -51.956 -24.447 1.00 108.63 ? 490 ILE C CA    1 
ATOM   9004  C  C     . ILE C 1 477 ? -28.228  -50.492 -24.231 1.00 108.63 ? 490 ILE C C     1 
ATOM   9005  O  O     . ILE C 1 477 ? -27.661  -49.817 -23.372 1.00 108.63 ? 490 ILE C O     1 
ATOM   9006  C  CB    . ILE C 1 477 ? -26.692  -52.084 -25.492 1.00 108.63 ? 490 ILE C CB    1 
ATOM   9007  C  CG1   . ILE C 1 477 ? -25.419  -51.375 -25.008 1.00 108.63 ? 490 ILE C CG1   1 
ATOM   9008  C  CG2   . ILE C 1 477 ? -27.141  -51.591 -26.868 1.00 108.63 ? 490 ILE C CG2   1 
ATOM   9009  C  CD1   . ILE C 1 477 ? -25.210  -49.980 -25.577 1.00 108.63 ? 490 ILE C CD1   1 
ATOM   9010  N  N     . GLN C 1 478 ? -29.203  -50.008 -24.995 1.00 78.21  ? 491 GLN C N     1 
ATOM   9011  C  CA    . GLN C 1 478 ? -29.605  -48.608 -24.898 1.00 78.21  ? 491 GLN C CA    1 
ATOM   9012  C  C     . GLN C 1 478 ? -30.759  -48.396 -23.920 1.00 78.21  ? 491 GLN C C     1 
ATOM   9013  O  O     . GLN C 1 478 ? -31.387  -47.338 -23.912 1.00 78.21  ? 491 GLN C O     1 
ATOM   9014  C  CB    . GLN C 1 478 ? -29.947  -48.030 -26.277 1.00 78.21  ? 491 GLN C CB    1 
ATOM   9015  C  CG    . GLN C 1 478 ? -31.084  -48.732 -26.997 1.00 78.21  ? 491 GLN C CG    1 
ATOM   9016  C  CD    . GLN C 1 478 ? -31.388  -48.116 -28.351 1.00 78.21  ? 491 GLN C CD    1 
ATOM   9017  O  OE1   . GLN C 1 478 ? -32.153  -48.670 -29.140 1.00 78.21  ? 491 GLN C OE1   1 
ATOM   9018  N  NE2   . GLN C 1 478 ? -30.791  -46.963 -28.625 1.00 78.21  ? 491 GLN C NE2   1 
ATOM   9019  N  N     . LYS C 1 479 ? -31.030  -49.404 -23.097 1.00 79.77  ? 492 LYS C N     1 
ATOM   9020  C  CA    . LYS C 1 479 ? -32.021  -49.271 -22.036 1.00 79.77  ? 492 LYS C CA    1 
ATOM   9021  C  C     . LYS C 1 479 ? -31.314  -49.106 -20.693 1.00 79.77  ? 492 LYS C C     1 
ATOM   9022  O  O     . LYS C 1 479 ? -31.896  -48.601 -19.733 1.00 79.77  ? 492 LYS C O     1 
ATOM   9023  C  CB    . LYS C 1 479 ? -32.969  -50.475 -22.004 1.00 79.77  ? 492 LYS C CB    1 
ATOM   9024  C  CG    . LYS C 1 479 ? -32.411  -51.704 -21.300 1.00 79.77  ? 492 LYS C CG    1 
ATOM   9025  C  CD    . LYS C 1 479 ? -33.466  -52.795 -21.177 1.00 79.77  ? 492 LYS C CD    1 
ATOM   9026  C  CE    . LYS C 1 479 ? -32.996  -53.920 -20.266 1.00 79.77  ? 492 LYS C CE    1 
ATOM   9027  N  NZ    . LYS C 1 479 ? -31.749  -54.563 -20.760 1.00 79.77  ? 492 LYS C NZ    1 
ATOM   9028  N  N     . GLU C 1 480 ? -30.056  -49.536 -20.638 1.00 72.97  ? 493 GLU C N     1 
ATOM   9029  C  CA    . GLU C 1 480 ? -29.232  -49.348 -19.450 1.00 72.97  ? 493 GLU C CA    1 
ATOM   9030  C  C     . GLU C 1 480 ? -28.719  -47.917 -19.382 1.00 72.97  ? 493 GLU C C     1 
ATOM   9031  O  O     . GLU C 1 480 ? -28.693  -47.307 -18.314 1.00 72.97  ? 493 GLU C O     1 
ATOM   9032  C  CB    . GLU C 1 480 ? -28.052  -50.323 -19.437 1.00 72.97  ? 493 GLU C CB    1 
ATOM   9033  C  CG    . GLU C 1 480 ? -28.345  -51.663 -18.778 1.00 72.97  ? 493 GLU C CG    1 
ATOM   9034  C  CD    . GLU C 1 480 ? -27.115  -52.272 -18.132 1.00 72.97  ? 493 GLU C CD    1 
ATOM   9035  O  OE1   . GLU C 1 480 ? -26.002  -51.758 -18.368 1.00 72.97  ? 493 GLU C OE1   1 
ATOM   9036  O  OE2   . GLU C 1 480 ? -27.261  -53.258 -17.381 1.00 72.97  ? 493 GLU C OE2   1 
ATOM   9037  N  N     . LYS C 1 481 ? -28.306  -47.391 -20.531 1.00 80.77  ? 494 LYS C N     1 
ATOM   9038  C  CA    . LYS C 1 481 ? -27.826  -46.017 -20.627 1.00 80.77  ? 494 LYS C CA    1 
ATOM   9039  C  C     . LYS C 1 481 ? -28.933  -45.037 -20.260 1.00 80.77  ? 494 LYS C C     1 
ATOM   9040  O  O     . LYS C 1 481 ? -28.696  -44.041 -19.578 1.00 80.77  ? 494 LYS C O     1 
ATOM   9041  C  CB    . LYS C 1 481 ? -27.330  -45.730 -22.045 1.00 80.77  ? 494 LYS C CB    1 
ATOM   9042  C  CG    . LYS C 1 481 ? -26.155  -46.587 -22.485 1.00 80.77  ? 494 LYS C CG    1 
ATOM   9043  C  CD    . LYS C 1 481 ? -26.027  -46.605 -24.002 1.00 80.77  ? 494 LYS C CD    1 
ATOM   9044  C  CE    . LYS C 1 481 ? -25.981  -45.199 -24.582 1.00 80.77  ? 494 LYS C CE    1 
ATOM   9045  N  NZ    . LYS C 1 481 ? -25.936  -45.213 -26.071 1.00 80.77  ? 494 LYS C NZ    1 
ATOM   9046  N  N     . ALA C 1 482 ? -30.145  -45.330 -20.716 1.00 92.81  ? 495 ALA C N     1 
ATOM   9047  C  CA    . ALA C 1 482 ? -31.299  -44.489 -20.427 1.00 92.81  ? 495 ALA C CA    1 
ATOM   9048  C  C     . ALA C 1 482 ? -31.672  -44.547 -18.948 1.00 92.81  ? 495 ALA C C     1 
ATOM   9049  O  O     . ALA C 1 482 ? -31.954  -43.518 -18.336 1.00 92.81  ? 495 ALA C O     1 
ATOM   9050  C  CB    . ALA C 1 482 ? -32.480  -44.895 -21.291 1.00 92.81  ? 495 ALA C CB    1 
ATOM   9051  N  N     . PHE C 1 483 ? -31.673  -45.751 -18.382 1.00 63.72  ? 496 PHE C N     1 
ATOM   9052  C  CA    . PHE C 1 483 ? -32.003  -45.931 -16.974 1.00 63.72  ? 496 PHE C CA    1 
ATOM   9053  C  C     . PHE C 1 483 ? -30.953  -45.265 -16.092 1.00 63.72  ? 496 PHE C C     1 
ATOM   9054  O  O     . PHE C 1 483 ? -31.290  -44.571 -15.135 1.00 63.72  ? 496 PHE C O     1 
ATOM   9055  C  CB    . PHE C 1 483 ? -32.118  -47.417 -16.628 1.00 63.72  ? 496 PHE C CB    1 
ATOM   9056  C  CG    . PHE C 1 483 ? -32.946  -47.693 -15.402 1.00 63.72  ? 496 PHE C CG    1 
ATOM   9057  C  CD1   . PHE C 1 483 ? -33.816  -46.735 -14.904 1.00 63.72  ? 496 PHE C CD1   1 
ATOM   9058  C  CD2   . PHE C 1 483 ? -32.847  -48.908 -14.742 1.00 63.72  ? 496 PHE C CD2   1 
ATOM   9059  C  CE1   . PHE C 1 483 ? -34.577  -46.986 -13.777 1.00 63.72  ? 496 PHE C CE1   1 
ATOM   9060  C  CE2   . PHE C 1 483 ? -33.603  -49.165 -13.612 1.00 63.72  ? 496 PHE C CE2   1 
ATOM   9061  C  CZ    . PHE C 1 483 ? -34.469  -48.202 -13.130 1.00 63.72  ? 496 PHE C CZ    1 
ATOM   9062  N  N     . ALA C 1 484 ? -29.684  -45.478 -16.427 1.00 36.96  ? 497 ALA C N     1 
ATOM   9063  C  CA    . ALA C 1 484 ? -28.580  -44.866 -15.695 1.00 36.96  ? 497 ALA C CA    1 
ATOM   9064  C  C     . ALA C 1 484 ? -28.700  -43.347 -15.704 1.00 36.96  ? 497 ALA C C     1 
ATOM   9065  O  O     . ALA C 1 484 ? -28.546  -42.699 -14.669 1.00 36.96  ? 497 ALA C O     1 
ATOM   9066  C  CB    . ALA C 1 484 ? -27.249  -45.295 -16.284 1.00 36.96  ? 497 ALA C CB    1 
ATOM   9067  N  N     . LEU C 1 485 ? -28.972  -42.788 -16.879 1.00 51.80  ? 498 LEU C N     1 
ATOM   9068  C  CA    . LEU C 1 485 ? -29.165  -41.350 -17.025 1.00 51.80  ? 498 LEU C CA    1 
ATOM   9069  C  C     . LEU C 1 485 ? -30.318  -40.854 -16.157 1.00 51.80  ? 498 LEU C C     1 
ATOM   9070  O  O     . LEU C 1 485 ? -30.217  -39.805 -15.522 1.00 51.80  ? 498 LEU C O     1 
ATOM   9071  C  CB    . LEU C 1 485 ? -29.415  -40.990 -18.491 1.00 51.80  ? 498 LEU C CB    1 
ATOM   9072  C  CG    . LEU C 1 485 ? -29.848  -39.555 -18.794 1.00 51.80  ? 498 LEU C CG    1 
ATOM   9073  C  CD1   . LEU C 1 485 ? -28.804  -38.561 -18.324 1.00 51.80  ? 498 LEU C CD1   1 
ATOM   9074  C  CD2   . LEU C 1 485 ? -30.109  -39.384 -20.276 1.00 51.80  ? 498 LEU C CD2   1 
ATOM   9075  N  N     . CYS C 1 486 ? -31.409  -41.615 -16.129 1.00 46.89  ? 499 CYS C N     1 
ATOM   9076  C  CA    . CYS C 1 486 ? -32.570  -41.258 -15.319 1.00 46.89  ? 499 CYS C CA    1 
ATOM   9077  C  C     . CYS C 1 486 ? -32.248  -41.281 -13.827 1.00 46.89  ? 499 CYS C C     1 
ATOM   9078  O  O     . CYS C 1 486 ? -32.673  -40.400 -13.082 1.00 46.89  ? 499 CYS C O     1 
ATOM   9079  C  CB    . CYS C 1 486 ? -33.749  -42.184 -15.620 1.00 46.89  ? 499 CYS C CB    1 
ATOM   9080  S  SG    . CYS C 1 486 ? -34.485  -41.960 -17.253 1.00 46.89  ? 499 CYS C SG    1 
ATOM   9081  N  N     . ILE C 1 487 ? -31.498  -42.293 -13.399 1.00 48.46  ? 500 ILE C N     1 
ATOM   9082  C  CA    . ILE C 1 487 ? -31.072  -42.401 -12.008 1.00 48.46  ? 500 ILE C CA    1 
ATOM   9083  C  C     . ILE C 1 487 ? -30.134  -41.252 -11.644 1.00 48.46  ? 500 ILE C C     1 
ATOM   9084  O  O     . ILE C 1 487 ? -30.276  -40.632 -10.588 1.00 48.46  ? 500 ILE C O     1 
ATOM   9085  C  CB    . ILE C 1 487 ? -30.365  -43.745 -11.736 1.00 48.46  ? 500 ILE C CB    1 
ATOM   9086  C  CG1   . ILE C 1 487 ? -31.318  -44.914 -11.982 1.00 48.46  ? 500 ILE C CG1   1 
ATOM   9087  C  CG2   . ILE C 1 487 ? -29.838  -43.797 -10.313 1.00 48.46  ? 500 ILE C CG2   1 
ATOM   9088  C  CD1   . ILE C 1 487 ? -30.660  -46.274 -11.870 1.00 48.46  ? 500 ILE C CD1   1 
ATOM   9089  N  N     . LYS C 1 488 ? -29.180  -40.976 -12.529 1.00 32.36  ? 501 LYS C N     1 
ATOM   9090  C  CA    . LYS C 1 488 ? -28.224  -39.890 -12.338 1.00 32.36  ? 501 LYS C CA    1 
ATOM   9091  C  C     . LYS C 1 488 ? -28.920  -38.537 -12.222 1.00 32.36  ? 501 LYS C C     1 
ATOM   9092  O  O     . LYS C 1 488 ? -28.549  -37.712 -11.389 1.00 32.36  ? 501 LYS C O     1 
ATOM   9093  C  CB    . LYS C 1 488 ? -27.215  -39.862 -13.487 1.00 32.36  ? 501 LYS C CB    1 
ATOM   9094  C  CG    . LYS C 1 488 ? -26.177  -40.973 -13.445 1.00 32.36  ? 501 LYS C CG    1 
ATOM   9095  C  CD    . LYS C 1 488 ? -25.361  -41.007 -14.729 1.00 32.36  ? 501 LYS C CD    1 
ATOM   9096  C  CE    . LYS C 1 488 ? -24.159  -41.925 -14.598 1.00 32.36  ? 501 LYS C CE    1 
ATOM   9097  N  NZ    . LYS C 1 488 ? -23.214  -41.446 -13.552 1.00 32.36  ? 501 LYS C NZ    1 
ATOM   9098  N  N     . GLN C 1 489 ? -29.927  -38.315 -13.063 1.00 48.40  ? 502 GLN C N     1 
ATOM   9099  C  CA    . GLN C 1 489 ? -30.691  -37.071 -13.029 1.00 48.40  ? 502 GLN C CA    1 
ATOM   9100  C  C     . GLN C 1 489 ? -31.446  -36.913 -11.711 1.00 48.40  ? 502 GLN C C     1 
ATOM   9101  O  O     . GLN C 1 489 ? -31.335  -35.883 -11.050 1.00 48.40  ? 502 GLN C O     1 
ATOM   9102  C  CB    . GLN C 1 489 ? -31.658  -36.988 -14.215 1.00 48.40  ? 502 GLN C CB    1 
ATOM   9103  C  CG    . GLN C 1 489 ? -30.977  -36.709 -15.550 1.00 48.40  ? 502 GLN C CG    1 
ATOM   9104  C  CD    . GLN C 1 489 ? -31.956  -36.571 -16.699 1.00 48.40  ? 502 GLN C CD    1 
ATOM   9105  O  OE1   . GLN C 1 489 ? -33.152  -36.812 -16.544 1.00 48.40  ? 502 GLN C OE1   1 
ATOM   9106  N  NE2   . GLN C 1 489 ? -31.449  -36.178 -17.861 1.00 48.40  ? 502 GLN C NE2   1 
ATOM   9107  N  N     . VAL C 1 490 ? -32.208  -37.939 -11.340 1.00 39.03  ? 503 VAL C N     1 
ATOM   9108  C  CA    . VAL C 1 490 ? -32.946  -37.949 -10.077 1.00 39.03  ? 503 VAL C CA    1 
ATOM   9109  C  C     . VAL C 1 490 ? -32.029  -37.660 -8.893  1.00 39.03  ? 503 VAL C C     1 
ATOM   9110  O  O     . VAL C 1 490 ? -32.334  -36.816 -8.050  1.00 39.03  ? 503 VAL C O     1 
ATOM   9111  C  CB    . VAL C 1 490 ? -33.654  -39.299 -9.847  1.00 39.03  ? 503 VAL C CB    1 
ATOM   9112  C  CG1   . VAL C 1 490 ? -34.131  -39.415 -8.410  1.00 39.03  ? 503 VAL C CG1   1 
ATOM   9113  C  CG2   . VAL C 1 490 ? -34.817  -39.461 -10.808 1.00 39.03  ? 503 VAL C CG2   1 
ATOM   9114  N  N     . ASN C 1 491 ? -30.902  -38.363 -8.847  1.00 30.46  ? 504 ASN C N     1 
ATOM   9115  C  CA    . ASN C 1 491 ? -29.913  -38.174 -7.792  1.00 30.46  ? 504 ASN C CA    1 
ATOM   9116  C  C     . ASN C 1 491 ? -29.425  -36.728 -7.722  1.00 30.46  ? 504 ASN C C     1 
ATOM   9117  O  O     . ASN C 1 491 ? -29.230  -36.181 -6.637  1.00 30.46  ? 504 ASN C O     1 
ATOM   9118  C  CB    . ASN C 1 491 ? -28.734  -39.126 -7.999  1.00 30.46  ? 504 ASN C CB    1 
ATOM   9119  C  CG    . ASN C 1 491 ? -27.764  -39.118 -6.834  1.00 30.46  ? 504 ASN C CG    1 
ATOM   9120  O  OD1   . ASN C 1 491 ? -28.133  -38.798 -5.707  1.00 30.46  ? 504 ASN C OD1   1 
ATOM   9121  N  ND2   . ASN C 1 491 ? -26.513  -39.473 -7.104  1.00 30.46  ? 504 ASN C ND2   1 
ATOM   9122  N  N     . PHE C 1 492 ? -29.236  -36.115 -8.885  1.00 43.00  ? 505 PHE C N     1 
ATOM   9123  C  CA    . PHE C 1 492 ? -28.836  -34.716 -8.959  1.00 43.00  ? 505 PHE C CA    1 
ATOM   9124  C  C     . PHE C 1 492 ? -29.965  -33.806 -8.489  1.00 43.00  ? 505 PHE C C     1 
ATOM   9125  O  O     . PHE C 1 492 ? -29.733  -32.846 -7.755  1.00 43.00  ? 505 PHE C O     1 
ATOM   9126  C  CB    . PHE C 1 492 ? -28.424  -34.353 -10.389 1.00 43.00  ? 505 PHE C CB    1 
ATOM   9127  C  CG    . PHE C 1 492 ? -28.116  -32.894 -10.582 1.00 43.00  ? 505 PHE C CG    1 
ATOM   9128  C  CD1   . PHE C 1 492 ? -26.853  -32.396 -10.301 1.00 43.00  ? 505 PHE C CD1   1 
ATOM   9129  C  CD2   . PHE C 1 492 ? -29.088  -32.021 -11.049 1.00 43.00  ? 505 PHE C CD2   1 
ATOM   9130  C  CE1   . PHE C 1 492 ? -26.568  -31.054 -10.477 1.00 43.00  ? 505 PHE C CE1   1 
ATOM   9131  C  CE2   . PHE C 1 492 ? -28.809  -30.680 -11.225 1.00 43.00  ? 505 PHE C CE2   1 
ATOM   9132  C  CZ    . PHE C 1 492 ? -27.548  -30.196 -10.939 1.00 43.00  ? 505 PHE C CZ    1 
ATOM   9133  N  N     . LEU C 1 493 ? -31.186  -34.112 -8.919  1.00 39.11  ? 506 LEU C N     1 
ATOM   9134  C  CA    . LEU C 1 493 ? -32.350  -33.302 -8.575  1.00 39.11  ? 506 LEU C CA    1 
ATOM   9135  C  C     . LEU C 1 493 ? -32.695  -33.413 -7.094  1.00 39.11  ? 506 LEU C C     1 
ATOM   9136  O  O     . LEU C 1 493 ? -33.366  -32.544 -6.539  1.00 39.11  ? 506 LEU C O     1 
ATOM   9137  C  CB    . LEU C 1 493 ? -33.557  -33.703 -9.426  1.00 39.11  ? 506 LEU C CB    1 
ATOM   9138  C  CG    . LEU C 1 493 ? -33.430  -33.536 -10.941 1.00 39.11  ? 506 LEU C CG    1 
ATOM   9139  C  CD1   . LEU C 1 493 ? -34.675  -34.045 -11.652 1.00 39.11  ? 506 LEU C CD1   1 
ATOM   9140  C  CD2   . LEU C 1 493 ? -33.159  -32.087 -11.307 1.00 39.11  ? 506 LEU C CD2   1 
ATOM   9141  N  N     . SER C 1 494 ? -32.234  -34.486 -6.460  1.00 59.16  ? 507 SER C N     1 
ATOM   9142  C  CA    . SER C 1 494 ? -32.490  -34.706 -5.043  1.00 59.16  ? 507 SER C CA    1 
ATOM   9143  C  C     . SER C 1 494 ? -31.272  -34.345 -4.198  1.00 59.16  ? 507 SER C C     1 
ATOM   9144  O  O     . SER C 1 494 ? -31.263  -34.565 -2.987  1.00 59.16  ? 507 SER C O     1 
ATOM   9145  C  CB    . SER C 1 494 ? -32.893  -36.159 -4.793  1.00 59.16  ? 507 SER C CB    1 
ATOM   9146  O  OG    . SER C 1 494 ? -31.906  -37.053 -5.273  1.00 59.16  ? 507 SER C OG    1 
ATOM   9147  N  N     . GLU C 1 495 ? -30.253  -33.790 -4.850  1.00 46.65  ? 508 GLU C N     1 
ATOM   9148  C  CA    . GLU C 1 495 ? -29.017  -33.372 -4.187  1.00 46.65  ? 508 GLU C CA    1 
ATOM   9149  C  C     . GLU C 1 495 ? -28.350  -34.486 -3.376  1.00 46.65  ? 508 GLU C C     1 
ATOM   9150  O  O     . GLU C 1 495 ? -27.874  -34.252 -2.266  1.00 46.65  ? 508 GLU C O     1 
ATOM   9151  C  CB    . GLU C 1 495 ? -29.252  -32.133 -3.314  1.00 46.65  ? 508 GLU C CB    1 
ATOM   9152  C  CG    . GLU C 1 495 ? -29.643  -30.883 -4.097  1.00 46.65  ? 508 GLU C CG    1 
ATOM   9153  C  CD    . GLU C 1 495 ? -29.879  -29.679 -3.203  1.00 46.65  ? 508 GLU C CD    1 
ATOM   9154  O  OE1   . GLU C 1 495 ? -29.509  -29.737 -2.012  1.00 46.65  ? 508 GLU C OE1   1 
ATOM   9155  O  OE2   . GLU C 1 495 ? -30.435  -28.674 -3.693  1.00 46.65  ? 508 GLU C OE2   1 
ATOM   9156  N  N     . GLY C 1 496 ? -28.325  -35.693 -3.932  1.00 53.62  ? 509 GLY C N     1 
ATOM   9157  C  CA    . GLY C 1 496 ? -27.613  -36.798 -3.314  1.00 53.62  ? 509 GLY C CA    1 
ATOM   9158  C  C     . GLY C 1 496 ? -28.439  -37.660 -2.376  1.00 53.62  ? 509 GLY C C     1 
ATOM   9159  O  O     . GLY C 1 496 ? -27.940  -38.657 -1.851  1.00 53.62  ? 509 GLY C O     1 
ATOM   9160  N  N     . LYS C 1 497 ? -29.698  -37.286 -2.166  1.00 39.52  ? 510 LYS C N     1 
ATOM   9161  C  CA    . LYS C 1 497 ? -30.564  -38.004 -1.233  1.00 39.52  ? 510 LYS C CA    1 
ATOM   9162  C  C     . LYS C 1 497 ? -30.820  -39.452 -1.649  1.00 39.52  ? 510 LYS C C     1 
ATOM   9163  O  O     . LYS C 1 497 ? -30.991  -40.326 -0.800  1.00 39.52  ? 510 LYS C O     1 
ATOM   9164  C  CB    . LYS C 1 497 ? -31.891  -37.265 -1.046  1.00 39.52  ? 510 LYS C CB    1 
ATOM   9165  C  CG    . LYS C 1 497 ? -31.790  -36.002 -0.206  1.00 39.52  ? 510 LYS C CG    1 
ATOM   9166  C  CD    . LYS C 1 497 ? -33.139  -35.312 -0.090  1.00 39.52  ? 510 LYS C CD    1 
ATOM   9167  C  CE    . LYS C 1 497 ? -33.035  -34.033 0.724   1.00 39.52  ? 510 LYS C CE    1 
ATOM   9168  N  NZ    . LYS C 1 497 ? -34.347  -33.340 0.860   1.00 39.52  ? 510 LYS C NZ    1 
ATOM   9169  N  N     . LEU C 1 498 ? -30.850  -39.700 -2.954  1.00 43.50  ? 511 LEU C N     1 
ATOM   9170  C  CA    . LEU C 1 498 ? -31.060  -41.050 -3.465  1.00 43.50  ? 511 LEU C CA    1 
ATOM   9171  C  C     . LEU C 1 498 ? -29.842  -41.931 -3.202  1.00 43.50  ? 511 LEU C C     1 
ATOM   9172  O  O     . LEU C 1 498 ? -29.971  -43.136 -2.985  1.00 43.50  ? 511 LEU C O     1 
ATOM   9173  C  CB    . LEU C 1 498 ? -31.381  -41.019 -4.962  1.00 43.50  ? 511 LEU C CB    1 
ATOM   9174  C  CG    . LEU C 1 498 ? -31.642  -42.367 -5.635  1.00 43.50  ? 511 LEU C CG    1 
ATOM   9175  C  CD1   . LEU C 1 498 ? -32.826  -43.060 -4.988  1.00 43.50  ? 511 LEU C CD1   1 
ATOM   9176  C  CD2   . LEU C 1 498 ? -31.872  -42.198 -7.127  1.00 43.50  ? 511 LEU C CD2   1 
ATOM   9177  N  N     . GLU C 1 499 ? -28.661  -41.322 -3.217  1.00 72.36  ? 512 GLU C N     1 
ATOM   9178  C  CA    . GLU C 1 499 ? -27.416  -42.048 -2.992  1.00 72.36  ? 512 GLU C CA    1 
ATOM   9179  C  C     . GLU C 1 499 ? -27.324  -42.567 -1.560  1.00 72.36  ? 512 GLU C C     1 
ATOM   9180  O  O     . GLU C 1 499 ? -26.888  -43.694 -1.327  1.00 72.36  ? 512 GLU C O     1 
ATOM   9181  C  CB    . GLU C 1 499 ? -26.212  -41.158 -3.302  1.00 72.36  ? 512 GLU C CB    1 
ATOM   9182  C  CG    . GLU C 1 499 ? -24.869  -41.862 -3.168  1.00 72.36  ? 512 GLU C CG    1 
ATOM   9183  C  CD    . GLU C 1 499 ? -23.699  -40.899 -3.202  1.00 72.36  ? 512 GLU C CD    1 
ATOM   9184  O  OE1   . GLU C 1 499 ? -23.939  -39.674 -3.244  1.00 72.36  ? 512 GLU C OE1   1 
ATOM   9185  O  OE2   . GLU C 1 499 ? -22.541  -41.366 -3.183  1.00 72.36  ? 512 GLU C OE2   1 
ATOM   9186  N  N     . THR C 1 500 ? -27.732  -41.736 -0.606  1.00 65.63  ? 513 THR C N     1 
ATOM   9187  C  CA    . THR C 1 500 ? -27.731  -42.118 0.801   1.00 65.63  ? 513 THR C CA    1 
ATOM   9188  C  C     . THR C 1 500 ? -28.646  -43.313 1.043   1.00 65.63  ? 513 THR C C     1 
ATOM   9189  O  O     . THR C 1 500 ? -28.293  -44.243 1.767   1.00 65.63  ? 513 THR C O     1 
ATOM   9190  C  CB    . THR C 1 500 ? -28.192  -40.956 1.699   1.00 65.63  ? 513 THR C CB    1 
ATOM   9191  O  OG1   . THR C 1 500 ? -29.560  -40.641 1.413   1.00 65.63  ? 513 THR C OG1   1 
ATOM   9192  C  CG2   . THR C 1 500 ? -27.331  -39.725 1.468   1.00 65.63  ? 513 THR C CG2   1 
ATOM   9193  N  N     . TYR C 1 501 ? -29.822  -43.277 0.427   1.00 63.06  ? 514 TYR C N     1 
ATOM   9194  C  CA    . TYR C 1 501 ? -30.809  -44.341 0.567   1.00 63.06  ? 514 TYR C CA    1 
ATOM   9195  C  C     . TYR C 1 501 ? -30.329  -45.658 -0.036  1.00 63.06  ? 514 TYR C C     1 
ATOM   9196  O  O     . TYR C 1 501 ? -30.484  -46.718 0.569   1.00 63.06  ? 514 TYR C O     1 
ATOM   9197  C  CB    . TYR C 1 501 ? -32.130  -43.921 -0.085  1.00 63.06  ? 514 TYR C CB    1 
ATOM   9198  C  CG    . TYR C 1 501 ? -33.149  -45.034 -0.189  1.00 63.06  ? 514 TYR C CG    1 
ATOM   9199  C  CD1   . TYR C 1 501 ? -33.989  -45.333 0.874   1.00 63.06  ? 514 TYR C CD1   1 
ATOM   9200  C  CD2   . TYR C 1 501 ? -33.274  -45.780 -1.353  1.00 63.06  ? 514 TYR C CD2   1 
ATOM   9201  C  CE1   . TYR C 1 501 ? -34.920  -46.348 0.783   1.00 63.06  ? 514 TYR C CE1   1 
ATOM   9202  C  CE2   . TYR C 1 501 ? -34.201  -46.796 -1.451  1.00 63.06  ? 514 TYR C CE2   1 
ATOM   9203  C  CZ    . TYR C 1 501 ? -35.022  -47.076 -0.382  1.00 63.06  ? 514 TYR C CZ    1 
ATOM   9204  O  OH    . TYR C 1 501 ? -35.948  -48.087 -0.479  1.00 63.06  ? 514 TYR C OH    1 
ATOM   9205  N  N     . LEU C 1 502 ? -29.754  -45.583 -1.233  1.00 69.75  ? 515 LEU C N     1 
ATOM   9206  C  CA    . LEU C 1 502 ? -29.349  -46.777 -1.972  1.00 69.75  ? 515 LEU C CA    1 
ATOM   9207  C  C     . LEU C 1 502 ? -28.275  -47.597 -1.260  1.00 69.75  ? 515 LEU C C     1 
ATOM   9208  O  O     . LEU C 1 502 ? -28.320  -48.828 -1.268  1.00 69.75  ? 515 LEU C O     1 
ATOM   9209  C  CB    . LEU C 1 502 ? -28.887  -46.405 -3.382  1.00 69.75  ? 515 LEU C CB    1 
ATOM   9210  C  CG    . LEU C 1 502 ? -29.991  -46.097 -4.390  1.00 69.75  ? 515 LEU C CG    1 
ATOM   9211  C  CD1   . LEU C 1 502 ? -29.395  -45.681 -5.721  1.00 69.75  ? 515 LEU C CD1   1 
ATOM   9212  C  CD2   . LEU C 1 502 ? -30.898  -47.302 -4.563  1.00 69.75  ? 515 LEU C CD2   1 
ATOM   9213  N  N     . ASN C 1 503 ? -27.311  -46.915 -0.649  1.00 60.34  ? 516 ASN C N     1 
ATOM   9214  C  CA    . ASN C 1 503 ? -26.263  -47.595 0.102   1.00 60.34  ? 516 ASN C CA    1 
ATOM   9215  C  C     . ASN C 1 503 ? -26.815  -48.273 1.350   1.00 60.34  ? 516 ASN C C     1 
ATOM   9216  O  O     . ASN C 1 503 ? -26.468  -49.414 1.651   1.00 60.34  ? 516 ASN C O     1 
ATOM   9217  C  CB    . ASN C 1 503 ? -25.152  -46.617 0.489   1.00 60.34  ? 516 ASN C CB    1 
ATOM   9218  C  CG    . ASN C 1 503 ? -24.387  -46.096 -0.711  1.00 60.34  ? 516 ASN C CG    1 
ATOM   9219  O  OD1   . ASN C 1 503 ? -24.381  -46.713 -1.775  1.00 60.34  ? 516 ASN C OD1   1 
ATOM   9220  N  ND2   . ASN C 1 503 ? -23.729  -44.955 -0.541  1.00 60.34  ? 516 ASN C ND2   1 
ATOM   9221  N  N     . LYS C 1 504 ? -27.674  -47.555 2.069   1.00 59.18  ? 517 LYS C N     1 
ATOM   9222  C  CA    . LYS C 1 504 ? -28.297  -48.061 3.289   1.00 59.18  ? 517 LYS C CA    1 
ATOM   9223  C  C     . LYS C 1 504 ? -29.031  -49.376 3.046   1.00 59.18  ? 517 LYS C C     1 
ATOM   9224  O  O     . LYS C 1 504 ? -28.852  -50.340 3.789   1.00 59.18  ? 517 LYS C O     1 
ATOM   9225  C  CB    . LYS C 1 504 ? -29.263  -47.023 3.864   1.00 59.18  ? 517 LYS C CB    1 
ATOM   9226  C  CG    . LYS C 1 504 ? -30.042  -47.501 5.079   1.00 59.18  ? 517 LYS C CG    1 
ATOM   9227  C  CD    . LYS C 1 504 ? -31.050  -46.460 5.537   1.00 59.18  ? 517 LYS C CD    1 
ATOM   9228  C  CE    . LYS C 1 504 ? -31.830  -46.944 6.749   1.00 59.18  ? 517 LYS C CE    1 
ATOM   9229  N  NZ    . LYS C 1 504 ? -32.815  -45.933 7.226   1.00 59.18  ? 517 LYS C NZ    1 
ATOM   9230  N  N     . VAL C 1 505 ? -29.853  -49.405 2.001   1.00 68.60  ? 518 VAL C N     1 
ATOM   9231  C  CA    . VAL C 1 505 ? -30.589  -50.606 1.622   1.00 68.60  ? 518 VAL C CA    1 
ATOM   9232  C  C     . VAL C 1 505 ? -29.651  -51.784 1.375   1.00 68.60  ? 518 VAL C C     1 
ATOM   9233  O  O     . VAL C 1 505 ? -29.858  -52.879 1.900   1.00 68.60  ? 518 VAL C O     1 
ATOM   9234  C  CB    . VAL C 1 505 ? -31.434  -50.363 0.355   1.00 68.60  ? 518 VAL C CB    1 
ATOM   9235  C  CG1   . VAL C 1 505 ? -31.923  -51.681 -0.227  1.00 68.60  ? 518 VAL C CG1   1 
ATOM   9236  C  CG2   . VAL C 1 505 ? -32.602  -49.440 0.664   1.00 68.60  ? 518 VAL C CG2   1 
ATOM   9237  N  N     . GLU C 1 506 ? -28.612  -51.543 0.581   1.00 70.56  ? 519 GLU C N     1 
ATOM   9238  C  CA    . GLU C 1 506 ? -27.669  -52.588 0.201   1.00 70.56  ? 519 GLU C CA    1 
ATOM   9239  C  C     . GLU C 1 506 ? -26.807  -53.029 1.383   1.00 70.56  ? 519 GLU C C     1 
ATOM   9240  O  O     . GLU C 1 506 ? -26.393  -54.184 1.460   1.00 70.56  ? 519 GLU C O     1 
ATOM   9241  C  CB    . GLU C 1 506 ? -26.783  -52.103 -0.949  1.00 70.56  ? 519 GLU C CB    1 
ATOM   9242  C  CG    . GLU C 1 506 ? -26.160  -53.216 -1.776  1.00 70.56  ? 519 GLU C CG    1 
ATOM   9243  C  CD    . GLU C 1 506 ? -25.260  -52.687 -2.874  1.00 70.56  ? 519 GLU C CD    1 
ATOM   9244  O  OE1   . GLU C 1 506 ? -24.549  -51.691 -2.629  1.00 70.56  ? 519 GLU C OE1   1 
ATOM   9245  O  OE2   . GLU C 1 506 ? -25.265  -53.262 -3.981  1.00 70.56  ? 519 GLU C OE2   1 
ATOM   9246  N  N     . ALA C 1 507 ? -26.542  -52.105 2.302   1.00 64.46  ? 520 ALA C N     1 
ATOM   9247  C  CA    . ALA C 1 507 ? -25.749  -52.412 3.489   1.00 64.46  ? 520 ALA C CA    1 
ATOM   9248  C  C     . ALA C 1 507 ? -26.505  -53.340 4.435   1.00 64.46  ? 520 ALA C C     1 
ATOM   9249  O  O     . ALA C 1 507 ? -25.912  -54.214 5.068   1.00 64.46  ? 520 ALA C O     1 
ATOM   9250  C  CB    . ALA C 1 507 ? -25.347  -51.136 4.205   1.00 64.46  ? 520 ALA C CB    1 
ATOM   9251  N  N     . GLU C 1 508 ? -27.816  -53.139 4.531   1.00 63.05  ? 521 GLU C N     1 
ATOM   9252  C  CA    . GLU C 1 508 ? -28.666  -53.999 5.345   1.00 63.05  ? 521 GLU C CA    1 
ATOM   9253  C  C     . GLU C 1 508 ? -28.824  -55.357 4.675   1.00 63.05  ? 521 GLU C C     1 
ATOM   9254  O  O     . GLU C 1 508 ? -29.126  -56.354 5.329   1.00 63.05  ? 521 GLU C O     1 
ATOM   9255  C  CB    . GLU C 1 508 ? -30.039  -53.359 5.552   1.00 63.05  ? 521 GLU C CB    1 
ATOM   9256  C  CG    . GLU C 1 508 ? -30.005  -52.001 6.234   1.00 63.05  ? 521 GLU C CG    1 
ATOM   9257  C  CD    . GLU C 1 508 ? -31.373  -51.350 6.303   1.00 63.05  ? 521 GLU C CD    1 
ATOM   9258  O  OE1   . GLU C 1 508 ? -32.381  -52.052 6.083   1.00 63.05  ? 521 GLU C OE1   1 
ATOM   9259  O  OE2   . GLU C 1 508 ? -31.438  -50.133 6.575   1.00 63.05  ? 521 GLU C OE2   1 
ATOM   9260  N  N     . ALA C 1 509 ? -28.622  -55.384 3.362   1.00 77.41  ? 522 ALA C N     1 
ATOM   9261  C  CA    . ALA C 1 509 ? -28.714  -56.616 2.590   1.00 77.41  ? 522 ALA C CA    1 
ATOM   9262  C  C     . ALA C 1 509 ? -27.398  -57.385 2.648   1.00 77.41  ? 522 ALA C C     1 
ATOM   9263  O  O     . ALA C 1 509 ? -27.361  -58.591 2.405   1.00 77.41  ? 522 ALA C O     1 
ATOM   9264  C  CB    . ALA C 1 509 ? -29.088  -56.311 1.154   1.00 77.41  ? 522 ALA C CB    1 
ATOM   9265  N  N     . LYS C 1 510 ? -26.320  -56.673 2.963   1.00 108.20 ? 523 LYS C N     1 
ATOM   9266  C  CA    . LYS C 1 510 ? -25.010  -57.289 3.132   1.00 108.20 ? 523 LYS C CA    1 
ATOM   9267  C  C     . LYS C 1 510 ? -24.981  -58.150 4.388   1.00 108.20 ? 523 LYS C C     1 
ATOM   9268  O  O     . LYS C 1 510 ? -24.627  -59.328 4.338   1.00 108.20 ? 523 LYS C O     1 
ATOM   9269  C  CB    . LYS C 1 510 ? -23.920  -56.218 3.219   1.00 108.20 ? 523 LYS C CB    1 
ATOM   9270  C  CG    . LYS C 1 510 ? -23.502  -55.624 1.883   1.00 108.20 ? 523 LYS C CG    1 
ATOM   9271  C  CD    . LYS C 1 510 ? -22.426  -54.551 2.048   1.00 108.20 ? 523 LYS C CD    1 
ATOM   9272  C  CE    . LYS C 1 510 ? -21.161  -55.095 2.704   1.00 108.20 ? 523 LYS C CE    1 
ATOM   9273  N  NZ    . LYS C 1 510 ? -21.171  -54.960 4.189   1.00 108.20 ? 523 LYS C NZ    1 
ATOM   9274  N  N     . ALA C 1 511 ? -25.354  -57.551 5.514   1.00 60.68  ? 524 ALA C N     1 
ATOM   9275  C  CA    . ALA C 1 511 ? -25.369  -58.248 6.795   1.00 60.68  ? 524 ALA C CA    1 
ATOM   9276  C  C     . ALA C 1 511 ? -26.396  -59.375 6.806   1.00 60.68  ? 524 ALA C C     1 
ATOM   9277  O  O     . ALA C 1 511 ? -26.144  -60.451 7.346   1.00 60.68  ? 524 ALA C O     1 
ATOM   9278  C  CB    . ALA C 1 511 ? -25.643  -57.269 7.925   1.00 60.68  ? 524 ALA C CB    1 
ATOM   9279  N  N     . ALA C 1 512 ? -27.553  -59.123 6.203   1.00 55.73  ? 525 ALA C N     1 
ATOM   9280  C  CA    . ALA C 1 512 ? -28.622  -60.114 6.150   1.00 55.73  ? 525 ALA C CA    1 
ATOM   9281  C  C     . ALA C 1 512 ? -28.329  -61.221 5.139   1.00 55.73  ? 525 ALA C C     1 
ATOM   9282  O  O     . ALA C 1 512 ? -29.099  -62.175 5.018   1.00 55.73  ? 525 ALA C O     1 
ATOM   9283  C  CB    . ALA C 1 512 ? -29.948  -59.446 5.836   1.00 55.73  ? 525 ALA C CB    1 
ATOM   9284  N  N     . ALA C 1 513 ? -27.219  -61.078 4.417   1.00 86.19  ? 526 ALA C N     1 
ATOM   9285  C  CA    . ALA C 1 513 ? -26.770  -62.063 3.433   1.00 86.19  ? 526 ALA C CA    1 
ATOM   9286  C  C     . ALA C 1 513 ? -27.841  -62.402 2.399   1.00 86.19  ? 526 ALA C C     1 
ATOM   9287  O  O     . ALA C 1 513 ? -28.033  -63.566 2.046   1.00 86.19  ? 526 ALA C O     1 
ATOM   9288  C  CB    . ALA C 1 513 ? -26.272  -63.326 4.126   1.00 86.19  ? 526 ALA C CB    1 
ATOM   9289  N  N     . GLU C 1 514 ? -28.533  -61.375 1.917   1.00 112.73 ? 527 GLU C N     1 
ATOM   9290  C  CA    . GLU C 1 514 ? -29.577  -61.554 0.915   1.00 112.73 ? 527 GLU C CA    1 
ATOM   9291  C  C     . GLU C 1 514 ? -29.454  -60.508 -0.190  1.00 112.73 ? 527 GLU C C     1 
ATOM   9292  O  O     . GLU C 1 514 ? -29.136  -59.350 0.082   1.00 112.73 ? 527 GLU C O     1 
ATOM   9293  C  CB    . GLU C 1 514 ? -30.962  -61.488 1.566   1.00 112.73 ? 527 GLU C CB    1 
ATOM   9294  C  CG    . GLU C 1 514 ? -31.196  -60.245 2.413   1.00 112.73 ? 527 GLU C CG    1 
ATOM   9295  C  CD    . GLU C 1 514 ? -32.569  -60.226 3.059   1.00 112.73 ? 527 GLU C CD    1 
ATOM   9296  O  OE1   . GLU C 1 514 ? -33.360  -61.159 2.806   1.00 112.73 ? 527 GLU C OE1   1 
ATOM   9297  O  OE2   . GLU C 1 514 ? -32.857  -59.277 3.818   1.00 112.73 ? 527 GLU C OE2   1 
ATOM   9298  N  N     . PRO C 1 515 ? -29.692  -60.920 -1.446  1.00 99.18  ? 528 PRO C N     1 
ATOM   9299  C  CA    . PRO C 1 515 ? -29.632  -60.017 -2.600  1.00 99.18  ? 528 PRO C CA    1 
ATOM   9300  C  C     . PRO C 1 515 ? -30.597  -58.849 -2.454  1.00 99.18  ? 528 PRO C C     1 
ATOM   9301  O  O     . PRO C 1 515 ? -31.630  -58.985 -1.797  1.00 99.18  ? 528 PRO C O     1 
ATOM   9302  C  CB    . PRO C 1 515 ? -30.077  -60.908 -3.762  1.00 99.18  ? 528 PRO C CB    1 
ATOM   9303  C  CG    . PRO C 1 515 ? -29.731  -62.285 -3.333  1.00 99.18  ? 528 PRO C CG    1 
ATOM   9304  C  CD    . PRO C 1 515 ? -29.966  -62.310 -1.851  1.00 99.18  ? 528 PRO C CD    1 
ATOM   9305  N  N     . SER C 1 516 ? -30.261  -57.715 -3.060  1.00 102.50 ? 529 SER C N     1 
ATOM   9306  C  CA    . SER C 1 516 ? -31.118  -56.538 -3.000  1.00 102.50 ? 529 SER C CA    1 
ATOM   9307  C  C     . SER C 1 516 ? -31.324  -55.930 -4.381  1.00 102.50 ? 529 SER C C     1 
ATOM   9308  O  O     . SER C 1 516 ? -30.537  -56.158 -5.298  1.00 102.50 ? 529 SER C O     1 
ATOM   9309  C  CB    . SER C 1 516 ? -30.531  -55.491 -2.054  1.00 102.50 ? 529 SER C CB    1 
ATOM   9310  O  OG    . SER C 1 516 ? -31.367  -54.349 -1.980  1.00 102.50 ? 529 SER C OG    1 
ATOM   9311  N  N     . TRP C 1 517 ? -32.393  -55.155 -4.513  1.00 74.63  ? 530 TRP C N     1 
ATOM   9312  C  CA    . TRP C 1 517 ? -32.710  -54.464 -5.753  1.00 74.63  ? 530 TRP C CA    1 
ATOM   9313  C  C     . TRP C 1 517 ? -31.778  -53.275 -5.947  1.00 74.63  ? 530 TRP C C     1 
ATOM   9314  O  O     . TRP C 1 517 ? -31.584  -52.800 -7.065  1.00 74.63  ? 530 TRP C O     1 
ATOM   9315  C  CB    . TRP C 1 517 ? -34.154  -53.975 -5.711  1.00 74.63  ? 530 TRP C CB    1 
ATOM   9316  C  CG    . TRP C 1 517 ? -34.408  -53.044 -4.574  1.00 74.63  ? 530 TRP C CG    1 
ATOM   9317  C  CD1   . TRP C 1 517 ? -34.626  -53.382 -3.270  1.00 74.63  ? 530 TRP C CD1   1 
ATOM   9318  C  CD2   . TRP C 1 517 ? -34.462  -51.618 -4.632  1.00 74.63  ? 530 TRP C CD2   1 
ATOM   9319  N  NE1   . TRP C 1 517 ? -34.815  -52.252 -2.513  1.00 74.63  ? 530 TRP C NE1   1 
ATOM   9320  C  CE2   . TRP C 1 517 ? -34.719  -51.150 -3.330  1.00 74.63  ? 530 TRP C CE2   1 
ATOM   9321  C  CE3   . TRP C 1 517 ? -34.320  -50.682 -5.663  1.00 74.63  ? 530 TRP C CE3   1 
ATOM   9322  C  CZ2   . TRP C 1 517 ? -34.838  -49.799 -3.027  1.00 74.63  ? 530 TRP C CZ2   1 
ATOM   9323  C  CZ3   . TRP C 1 517 ? -34.438  -49.340 -5.363  1.00 74.63  ? 530 TRP C CZ3   1 
ATOM   9324  C  CH2   . TRP C 1 517 ? -34.694  -48.911 -4.058  1.00 74.63  ? 530 TRP C CH2   1 
ATOM   9325  N  N     . ALA C 1 518 ? -31.204  -52.801 -4.845  1.00 87.75  ? 531 ALA C N     1 
ATOM   9326  C  CA    . ALA C 1 518 ? -30.297  -51.659 -4.873  1.00 87.75  ? 531 ALA C CA    1 
ATOM   9327  C  C     . ALA C 1 518 ? -28.934  -52.041 -5.439  1.00 87.75  ? 531 ALA C C     1 
ATOM   9328  O  O     . ALA C 1 518 ? -28.048  -51.197 -5.563  1.00 87.75  ? 531 ALA C O     1 
ATOM   9329  C  CB    . ALA C 1 518 ? -30.149  -51.068 -3.482  1.00 87.75  ? 531 ALA C CB    1 
ATOM   9330  N  N     . THR C 1 519 ? -28.770  -53.318 -5.772  1.00 93.43  ? 532 THR C N     1 
ATOM   9331  C  CA    . THR C 1 519 ? -27.543  -53.799 -6.392  1.00 93.43  ? 532 THR C CA    1 
ATOM   9332  C  C     . THR C 1 519 ? -27.415  -53.246 -7.808  1.00 93.43  ? 532 THR C C     1 
ATOM   9333  O  O     . THR C 1 519 ? -26.400  -52.648 -8.162  1.00 93.43  ? 532 THR C O     1 
ATOM   9334  C  CB    . THR C 1 519 ? -27.514  -55.337 -6.455  1.00 93.43  ? 532 THR C CB    1 
ATOM   9335  O  OG1   . THR C 1 519 ? -27.820  -55.881 -5.165  1.00 93.43  ? 532 THR C OG1   1 
ATOM   9336  C  CG2   . THR C 1 519 ? -26.145  -55.831 -6.903  1.00 93.43  ? 532 THR C CG2   1 
ATOM   9337  N  N     . LYS C 1 520 ? -28.457  -53.445 -8.610  1.00 79.16  ? 533 LYS C N     1 
ATOM   9338  C  CA    . LYS C 1 520 ? -28.448  -53.028 -10.007 1.00 79.16  ? 533 LYS C CA    1 
ATOM   9339  C  C     . LYS C 1 520 ? -28.591  -51.514 -10.159 1.00 79.16  ? 533 LYS C C     1 
ATOM   9340  O  O     . LYS C 1 520 ? -28.007  -50.919 -11.064 1.00 79.16  ? 533 LYS C O     1 
ATOM   9341  C  CB    . LYS C 1 520 ? -29.559  -53.737 -10.785 1.00 79.16  ? 533 LYS C CB    1 
ATOM   9342  C  CG    . LYS C 1 520 ? -29.479  -53.550 -12.291 1.00 79.16  ? 533 LYS C CG    1 
ATOM   9343  C  CD    . LYS C 1 520 ? -30.815  -53.833 -12.956 1.00 79.16  ? 533 LYS C CD    1 
ATOM   9344  C  CE    . LYS C 1 520 ? -31.874  -52.847 -12.490 1.00 79.16  ? 533 LYS C CE    1 
ATOM   9345  N  NZ    . LYS C 1 520 ? -33.167  -53.031 -13.203 1.00 79.16  ? 533 LYS C NZ    1 
ATOM   9346  N  N     . ILE C 1 521 ? -29.371  -50.898 -9.277  1.00 88.56  ? 534 ILE C N     1 
ATOM   9347  C  CA    . ILE C 1 521 ? -29.591  -49.455 -9.327  1.00 88.56  ? 534 ILE C CA    1 
ATOM   9348  C  C     . ILE C 1 521 ? -28.287  -48.697 -9.070  1.00 88.56  ? 534 ILE C C     1 
ATOM   9349  O  O     . ILE C 1 521 ? -28.002  -47.693 -9.724  1.00 88.56  ? 534 ILE C O     1 
ATOM   9350  C  CB    . ILE C 1 521 ? -30.675  -49.010 -8.320  1.00 88.56  ? 534 ILE C CB    1 
ATOM   9351  C  CG1   . ILE C 1 521 ? -31.985  -49.757 -8.577  1.00 88.56  ? 534 ILE C CG1   1 
ATOM   9352  C  CG2   . ILE C 1 521 ? -30.909  -47.513 -8.410  1.00 88.56  ? 534 ILE C CG2   1 
ATOM   9353  C  CD1   . ILE C 1 521 ? -32.604  -49.460 -9.929  1.00 88.56  ? 534 ILE C CD1   1 
ATOM   9354  N  N     . LEU C 1 522 ? -27.494  -49.192 -8.125  1.00 70.52  ? 535 LEU C N     1 
ATOM   9355  C  CA    . LEU C 1 522 ? -26.198  -48.595 -7.823  1.00 70.52  ? 535 LEU C CA    1 
ATOM   9356  C  C     . LEU C 1 522 ? -25.169  -48.896 -8.911  1.00 70.52  ? 535 LEU C C     1 
ATOM   9357  O  O     . LEU C 1 522 ? -24.196  -48.160 -9.077  1.00 70.52  ? 535 LEU C O     1 
ATOM   9358  C  CB    . LEU C 1 522 ? -25.688  -49.060 -6.457  1.00 70.52  ? 535 LEU C CB    1 
ATOM   9359  C  CG    . LEU C 1 522 ? -26.228  -48.298 -5.247  1.00 70.52  ? 535 LEU C CG    1 
ATOM   9360  C  CD1   . LEU C 1 522 ? -25.692  -48.874 -3.946  1.00 70.52  ? 535 LEU C CD1   1 
ATOM   9361  C  CD2   . LEU C 1 522 ? -25.870  -46.829 -5.367  1.00 70.52  ? 535 LEU C CD2   1 
ATOM   9362  N  N     . ASN C 1 523 ? -25.390  -49.980 -9.651  1.00 90.25  ? 536 ASN C N     1 
ATOM   9363  C  CA    . ASN C 1 523 ? -24.522  -50.338 -10.769 1.00 90.25  ? 536 ASN C CA    1 
ATOM   9364  C  C     . ASN C 1 523 ? -24.625  -49.337 -11.917 1.00 90.25  ? 536 ASN C C     1 
ATOM   9365  O  O     . ASN C 1 523 ? -23.734  -49.251 -12.759 1.00 90.25  ? 536 ASN C O     1 
ATOM   9366  C  CB    . ASN C 1 523 ? -24.854  -51.744 -11.281 1.00 90.25  ? 536 ASN C CB    1 
ATOM   9367  C  CG    . ASN C 1 523 ? -24.272  -52.842 -10.409 1.00 90.25  ? 536 ASN C CG    1 
ATOM   9368  O  OD1   . ASN C 1 523 ? -23.805  -52.592 -9.300  1.00 90.25  ? 536 ASN C OD1   1 
ATOM   9369  N  ND2   . ASN C 1 523 ? -24.302  -54.071 -10.912 1.00 90.25  ? 536 ASN C ND2   1 
ATOM   9370  N  N     . LEU C 1 524 ? -25.720  -48.584 -11.944 1.00 54.20  ? 537 LEU C N     1 
ATOM   9371  C  CA    . LEU C 1 524 ? -25.973  -47.635 -13.021 1.00 54.20  ? 537 LEU C CA    1 
ATOM   9372  C  C     . LEU C 1 524 ? -25.637  -46.202 -12.613 1.00 54.20  ? 537 LEU C C     1 
ATOM   9373  O  O     . LEU C 1 524 ? -25.354  -45.359 -13.463 1.00 54.20  ? 537 LEU C O     1 
ATOM   9374  C  CB    . LEU C 1 524 ? -27.428  -47.727 -13.480 1.00 54.20  ? 537 LEU C CB    1 
ATOM   9375  C  CG    . LEU C 1 524 ? -27.897  -49.124 -13.882 1.00 54.20  ? 537 LEU C CG    1 
ATOM   9376  C  CD1   . LEU C 1 524 ? -29.340  -49.102 -14.357 1.00 54.20  ? 537 LEU C CD1   1 
ATOM   9377  C  CD2   . LEU C 1 524 ? -26.990  -49.703 -14.952 1.00 54.20  ? 537 LEU C CD2   1 
ATOM   9378  N  N     . LEU C 1 525 ? -25.671  -45.931 -11.312 1.00 59.18  ? 538 LEU C N     1 
ATOM   9379  C  CA    . LEU C 1 525 ? -25.354  -44.601 -10.805 1.00 59.18  ? 538 LEU C CA    1 
ATOM   9380  C  C     . LEU C 1 525 ? -23.873  -44.303 -11.001 1.00 59.18  ? 538 LEU C C     1 
ATOM   9381  O  O     . LEU C 1 525 ? -23.497  -43.203 -11.407 1.00 59.18  ? 538 LEU C O     1 
ATOM   9382  C  CB    . LEU C 1 525 ? -25.713  -44.484 -9.323  1.00 59.18  ? 538 LEU C CB    1 
ATOM   9383  C  CG    . LEU C 1 525 ? -26.471  -43.232 -8.871  1.00 59.18  ? 538 LEU C CG    1 
ATOM   9384  C  CD1   . LEU C 1 525 ? -26.404  -43.071 -7.358  1.00 59.18  ? 538 LEU C CD1   1 
ATOM   9385  C  CD2   . LEU C 1 525 ? -25.958  -41.984 -9.569  1.00 59.18  ? 538 LEU C CD2   1 
ATOM   9386  N  N     . TRP C 1 526 ? -23.035  -45.294 -10.715 1.00 83.61  ? 539 TRP C N     1 
ATOM   9387  C  CA    . TRP C 1 526 ? -21.589  -45.134 -10.822 1.00 83.61  ? 539 TRP C CA    1 
ATOM   9388  C  C     . TRP C 1 526 ? -21.079  -45.389 -12.236 1.00 83.61  ? 539 TRP C C     1 
ATOM   9389  O  O     . TRP C 1 526 ? -19.876  -45.346 -12.487 1.00 83.61  ? 539 TRP C O     1 
ATOM   9390  C  CB    . TRP C 1 526 ? -20.876  -46.048 -9.825  1.00 83.61  ? 539 TRP C CB    1 
ATOM   9391  C  CG    . TRP C 1 526 ? -21.085  -45.635 -8.406  1.00 83.61  ? 539 TRP C CG    1 
ATOM   9392  C  CD1   . TRP C 1 526 ? -22.025  -46.115 -7.540  1.00 83.61  ? 539 TRP C CD1   1 
ATOM   9393  C  CD2   . TRP C 1 526 ? -20.347  -44.648 -7.685  1.00 83.61  ? 539 TRP C CD2   1 
ATOM   9394  N  NE1   . TRP C 1 526 ? -21.912  -45.490 -6.323  1.00 83.61  ? 539 TRP C NE1   1 
ATOM   9395  C  CE2   . TRP C 1 526 ? -20.881  -44.576 -6.387  1.00 83.61  ? 539 TRP C CE2   1 
ATOM   9396  C  CE3   . TRP C 1 526 ? -19.274  -43.809 -8.010  1.00 83.61  ? 539 TRP C CE3   1 
ATOM   9397  C  CZ2   . TRP C 1 526 ? -20.393  -43.712 -5.414  1.00 83.61  ? 539 TRP C CZ2   1 
ATOM   9398  C  CZ3   . TRP C 1 526 ? -18.785  -42.949 -7.047  1.00 83.61  ? 539 TRP C CZ3   1 
ATOM   9399  C  CH2   . TRP C 1 526 ? -19.343  -42.906 -5.766  1.00 83.61  ? 539 TRP C CH2   1 
ATOM   9400  N  N     . ALA C 1 527 ? -22.003  -45.654 -13.154 1.00 98.94  ? 540 ALA C N     1 
ATOM   9401  C  CA    . ALA C 1 527 ? -21.659  -45.826 -14.558 1.00 98.94  ? 540 ALA C CA    1 
ATOM   9402  C  C     . ALA C 1 527 ? -21.021  -44.552 -15.092 1.00 98.94  ? 540 ALA C C     1 
ATOM   9403  O  O     . ALA C 1 527 ? -21.352  -43.456 -14.642 1.00 98.94  ? 540 ALA C O     1 
ATOM   9404  C  CB    . ALA C 1 527 ? -22.896  -46.175 -15.364 1.00 98.94  ? 540 ALA C CB    1 
ATOM   9405  N  N     . PRO C 1 528 ? -20.089  -44.692 -16.047 1.00 83.99  ? 541 PRO C N     1 
ATOM   9406  C  CA    . PRO C 1 528 ? -19.464  -43.514 -16.656 1.00 83.99  ? 541 PRO C CA    1 
ATOM   9407  C  C     . PRO C 1 528 ? -20.497  -42.652 -17.375 1.00 83.99  ? 541 PRO C C     1 
ATOM   9408  O  O     . PRO C 1 528 ? -21.240  -43.165 -18.212 1.00 83.99  ? 541 PRO C O     1 
ATOM   9409  C  CB    . PRO C 1 528 ? -18.490  -44.123 -17.669 1.00 83.99  ? 541 PRO C CB    1 
ATOM   9410  C  CG    . PRO C 1 528 ? -18.224  -45.504 -17.167 1.00 83.99  ? 541 PRO C CG    1 
ATOM   9411  C  CD    . PRO C 1 528 ? -19.514  -45.949 -16.554 1.00 83.99  ? 541 PRO C CD    1 
ATOM   9412  N  N     . ILE C 1 529 ? -20.544  -41.365 -17.045 1.00 49.74  ? 542 ILE C N     1 
ATOM   9413  C  CA    . ILE C 1 529 ? -21.486  -40.443 -17.673 1.00 49.74  ? 542 ILE C CA    1 
ATOM   9414  C  C     . ILE C 1 529 ? -21.216  -40.336 -19.172 1.00 49.74  ? 542 ILE C C     1 
ATOM   9415  O  O     . ILE C 1 529 ? -22.141  -40.187 -19.973 1.00 49.74  ? 542 ILE C O     1 
ATOM   9416  C  CB    . ILE C 1 529 ? -21.444  -39.045 -17.007 1.00 49.74  ? 542 ILE C CB    1 
ATOM   9417  C  CG1   . ILE C 1 529 ? -22.369  -38.061 -17.728 1.00 49.74  ? 542 ILE C CG1   1 
ATOM   9418  C  CG2   . ILE C 1 529 ? -20.021  -38.508 -16.966 1.00 49.74  ? 542 ILE C CG2   1 
ATOM   9419  C  CD1   . ILE C 1 529 ? -23.831  -38.448 -17.689 1.00 49.74  ? 542 ILE C CD1   1 
ATOM   9420  N  N     . GLU C 1 530 ? -19.943  -40.436 -19.545 1.00 88.87  ? 543 GLU C N     1 
ATOM   9421  C  CA    . GLU C 1 530 ? -19.551  -40.412 -20.947 1.00 88.87  ? 543 GLU C CA    1 
ATOM   9422  C  C     . GLU C 1 530 ? -20.182  -41.590 -21.678 1.00 88.87  ? 543 GLU C C     1 
ATOM   9423  O  O     . GLU C 1 530 ? -20.610  -41.465 -22.822 1.00 88.87  ? 543 GLU C O     1 
ATOM   9424  C  CB    . GLU C 1 530 ? -18.028  -40.481 -21.076 1.00 88.87  ? 543 GLU C CB    1 
ATOM   9425  C  CG    . GLU C 1 530 ? -17.262  -39.864 -19.911 1.00 88.87  ? 543 GLU C CG    1 
ATOM   9426  C  CD    . GLU C 1 530 ? -17.329  -38.349 -19.888 1.00 88.87  ? 543 GLU C CD    1 
ATOM   9427  O  OE1   . GLU C 1 530 ? -17.857  -37.753 -20.851 1.00 88.87  ? 543 GLU C OE1   1 
ATOM   9428  O  OE2   . GLU C 1 530 ? -16.847  -37.748 -18.904 1.00 88.87  ? 543 GLU C OE2   1 
ATOM   9429  N  N     . TRP C 1 531 ? -20.248  -42.727 -20.992 1.00 117.50 ? 544 TRP C N     1 
ATOM   9430  C  CA    . TRP C 1 531 ? -20.767  -43.963 -21.566 1.00 117.50 ? 544 TRP C CA    1 
ATOM   9431  C  C     . TRP C 1 531 ? -22.268  -43.916 -21.852 1.00 117.50 ? 544 TRP C C     1 
ATOM   9432  O  O     . TRP C 1 531 ? -22.725  -44.438 -22.868 1.00 117.50 ? 544 TRP C O     1 
ATOM   9433  C  CB    . TRP C 1 531 ? -20.444  -45.145 -20.649 1.00 117.50 ? 544 TRP C CB    1 
ATOM   9434  C  CG    . TRP C 1 531 ? -21.088  -46.428 -21.071 1.00 117.50 ? 544 TRP C CG    1 
ATOM   9435  C  CD1   . TRP C 1 531 ? -20.644  -47.293 -22.027 1.00 117.50 ? 544 TRP C CD1   1 
ATOM   9436  C  CD2   . TRP C 1 531 ? -22.295  -46.994 -20.548 1.00 117.50 ? 544 TRP C CD2   1 
ATOM   9437  N  NE1   . TRP C 1 531 ? -21.502  -48.361 -22.134 1.00 117.50 ? 544 TRP C NE1   1 
ATOM   9438  C  CE2   . TRP C 1 531 ? -22.527  -48.201 -21.233 1.00 117.50 ? 544 TRP C CE2   1 
ATOM   9439  C  CE3   . TRP C 1 531 ? -23.207  -46.596 -19.564 1.00 117.50 ? 544 TRP C CE3   1 
ATOM   9440  C  CZ2   . TRP C 1 531 ? -23.627  -49.013 -20.971 1.00 117.50 ? 544 TRP C CZ2   1 
ATOM   9441  C  CZ3   . TRP C 1 531 ? -24.299  -47.401 -19.304 1.00 117.50 ? 544 TRP C CZ3   1 
ATOM   9442  C  CH2   . TRP C 1 531 ? -24.501  -48.595 -20.003 1.00 117.50 ? 544 TRP C CH2   1 
ATOM   9443  N  N     . VAL C 1 532 ? -23.031  -43.293 -20.957 1.00 64.03  ? 545 VAL C N     1 
ATOM   9444  C  CA    . VAL C 1 532 ? -24.484  -43.248 -21.102 1.00 64.03  ? 545 VAL C CA    1 
ATOM   9445  C  C     . VAL C 1 532 ? -24.914  -42.322 -22.238 1.00 64.03  ? 545 VAL C C     1 
ATOM   9446  O  O     . VAL C 1 532 ? -26.031  -42.427 -22.745 1.00 64.03  ? 545 VAL C O     1 
ATOM   9447  C  CB    . VAL C 1 532 ? -25.189  -42.821 -19.793 1.00 64.03  ? 545 VAL C CB    1 
ATOM   9448  C  CG1   . VAL C 1 532 ? -24.566  -43.519 -18.597 1.00 64.03  ? 545 VAL C CG1   1 
ATOM   9449  C  CG2   . VAL C 1 532 ? -25.133  -41.314 -19.613 1.00 64.03  ? 545 VAL C CG2   1 
ATOM   9450  N  N     . VAL C 1 533 ? -24.024  -41.414 -22.628 1.00 51.64  ? 546 VAL C N     1 
ATOM   9451  C  CA    . VAL C 1 533 ? -24.290  -40.507 -23.738 1.00 51.64  ? 546 VAL C CA    1 
ATOM   9452  C  C     . VAL C 1 533 ? -23.389  -40.850 -24.918 1.00 51.64  ? 546 VAL C C     1 
ATOM   9453  O  O     . VAL C 1 533 ? -23.410  -40.177 -25.949 1.00 51.64  ? 546 VAL C O     1 
ATOM   9454  C  CB    . VAL C 1 533 ? -24.070  -39.036 -23.342 1.00 51.64  ? 546 VAL C CB    1 
ATOM   9455  C  CG1   . VAL C 1 533 ? -25.009  -38.642 -22.218 1.00 51.64  ? 546 VAL C CG1   1 
ATOM   9456  C  CG2   . VAL C 1 533 ? -22.626  -38.808 -22.935 1.00 51.64  ? 546 VAL C CG2   1 
ATOM   9457  N  N     . SER C 1 534 ? -22.592  -41.900 -24.751 1.00 76.39  ? 547 SER C N     1 
ATOM   9458  C  CA    . SER C 1 534 ? -21.710  -42.369 -25.811 1.00 76.39  ? 547 SER C CA    1 
ATOM   9459  C  C     . SER C 1 534 ? -22.508  -43.043 -26.913 1.00 76.39  ? 547 SER C C     1 
ATOM   9460  O  O     . SER C 1 534 ? -23.620  -43.521 -26.687 1.00 76.39  ? 547 SER C O     1 
ATOM   9461  C  CB    . SER C 1 534 ? -20.685  -43.356 -25.255 1.00 76.39  ? 547 SER C CB    1 
ATOM   9462  O  OG    . SER C 1 534 ? -19.869  -43.882 -26.284 1.00 76.39  ? 547 SER C OG    1 
ATOM   9463  N  N     . LEU C 1 535 ? -21.932  -43.081 -28.109 1.00 100.39 ? 548 LEU C N     1 
ATOM   9464  C  CA    . LEU C 1 535 ? -22.530  -43.807 -29.217 1.00 100.39 ? 548 LEU C CA    1 
ATOM   9465  C  C     . LEU C 1 535 ? -21.935  -45.210 -29.257 1.00 100.39 ? 548 LEU C C     1 
ATOM   9466  O  O     . LEU C 1 535 ? -21.871  -45.845 -30.309 1.00 100.39 ? 548 LEU C O     1 
ATOM   9467  C  CB    . LEU C 1 535 ? -22.284  -43.071 -30.534 1.00 100.39 ? 548 LEU C CB    1 
ATOM   9468  C  CG    . LEU C 1 535 ? -23.504  -42.911 -31.439 1.00 100.39 ? 548 LEU C CG    1 
ATOM   9469  C  CD1   . LEU C 1 535 ? -24.713  -42.500 -30.621 1.00 100.39 ? 548 LEU C CD1   1 
ATOM   9470  C  CD2   . LEU C 1 535 ? -23.232  -41.888 -32.530 1.00 100.39 ? 548 LEU C CD2   1 
ATOM   9471  N  N     . PHE C 1 536 ? -21.499  -45.680 -28.092 1.00 90.77  ? 549 PHE C N     1 
ATOM   9472  C  CA    . PHE C 1 536 ? -20.893  -46.996 -27.957 1.00 90.77  ? 549 PHE C CA    1 
ATOM   9473  C  C     . PHE C 1 536 ? -21.952  -48.081 -28.098 1.00 90.77  ? 549 PHE C C     1 
ATOM   9474  O  O     . PHE C 1 536 ? -23.116  -47.877 -27.751 1.00 90.77  ? 549 PHE C O     1 
ATOM   9475  C  CB    . PHE C 1 536 ? -20.188  -47.115 -26.605 1.00 90.77  ? 549 PHE C CB    1 
ATOM   9476  C  CG    . PHE C 1 536 ? -19.093  -48.144 -26.577 1.00 90.77  ? 549 PHE C CG    1 
ATOM   9477  C  CD1   . PHE C 1 536 ? -17.899  -47.920 -27.245 1.00 90.77  ? 549 PHE C CD1   1 
ATOM   9478  C  CD2   . PHE C 1 536 ? -19.248  -49.324 -25.869 1.00 90.77  ? 549 PHE C CD2   1 
ATOM   9479  C  CE1   . PHE C 1 536 ? -16.886  -48.860 -27.218 1.00 90.77  ? 549 PHE C CE1   1 
ATOM   9480  C  CE2   . PHE C 1 536 ? -18.237  -50.268 -25.837 1.00 90.77  ? 549 PHE C CE2   1 
ATOM   9481  C  CZ    . PHE C 1 536 ? -17.055  -50.035 -26.513 1.00 90.77  ? 549 PHE C CZ    1 
ATOM   9482  N  N     . LYS C 1 537 ? -21.540  -49.235 -28.611 1.00 108.70 ? 550 LYS C N     1 
ATOM   9483  C  CA    . LYS C 1 537 ? -22.457  -50.338 -28.861 1.00 108.70 ? 550 LYS C CA    1 
ATOM   9484  C  C     . LYS C 1 537 ? -22.324  -51.404 -27.782 1.00 108.70 ? 550 LYS C C     1 
ATOM   9485  O  O     . LYS C 1 537 ? -23.309  -52.019 -27.378 1.00 108.70 ? 550 LYS C O     1 
ATOM   9486  C  CB    . LYS C 1 537 ? -22.195  -50.963 -30.234 1.00 108.70 ? 550 LYS C CB    1 
ATOM   9487  C  CG    . LYS C 1 537 ? -22.144  -49.981 -31.400 1.00 108.70 ? 550 LYS C CG    1 
ATOM   9488  C  CD    . LYS C 1 537 ? -20.738  -49.431 -31.622 1.00 108.70 ? 550 LYS C CD    1 
ATOM   9489  C  CE    . LYS C 1 537 ? -19.700  -50.543 -31.645 1.00 108.70 ? 550 LYS C CE    1 
ATOM   9490  N  NZ    . LYS C 1 537 ? -19.960  -51.534 -32.725 1.00 108.70 ? 550 LYS C NZ    1 
ATOM   9491  N  N     . GLY C 1 538 ? -21.097  -51.621 -27.320 1.00 93.38  ? 551 GLY C N     1 
ATOM   9492  C  CA    . GLY C 1 538 ? -20.831  -52.618 -26.301 1.00 93.38  ? 551 GLY C CA    1 
ATOM   9493  C  C     . GLY C 1 538 ? -21.334  -52.212 -24.929 1.00 93.38  ? 551 GLY C C     1 
ATOM   9494  O  O     . GLY C 1 538 ? -21.932  -51.147 -24.774 1.00 93.38  ? 551 GLY C O     1 
ATOM   9495  N  N     . PRO C 1 539 ? -21.096  -53.066 -23.922 1.00 94.90  ? 552 PRO C N     1 
ATOM   9496  C  CA    . PRO C 1 539 ? -21.520  -52.816 -22.541 1.00 94.90  ? 552 PRO C CA    1 
ATOM   9497  C  C     . PRO C 1 539 ? -20.663  -51.752 -21.867 1.00 94.90  ? 552 PRO C C     1 
ATOM   9498  O  O     . PRO C 1 539 ? -19.924  -51.034 -22.542 1.00 94.90  ? 552 PRO C O     1 
ATOM   9499  C  CB    . PRO C 1 539 ? -21.294  -54.168 -21.851 1.00 94.90  ? 552 PRO C CB    1 
ATOM   9500  C  CG    . PRO C 1 539 ? -21.115  -55.163 -22.957 1.00 94.90  ? 552 PRO C CG    1 
ATOM   9501  C  CD    . PRO C 1 539 ? -20.490  -54.397 -24.073 1.00 94.90  ? 552 PRO C CD    1 
ATOM   9502  N  N     . ALA C 1 540 ? -20.756  -51.664 -20.544 1.00 61.69  ? 553 ALA C N     1 
ATOM   9503  C  CA    . ALA C 1 540 ? -19.991  -50.684 -19.780 1.00 61.69  ? 553 ALA C CA    1 
ATOM   9504  C  C     . ALA C 1 540 ? -18.492  -50.973 -19.829 1.00 61.69  ? 553 ALA C C     1 
ATOM   9505  O  O     . ALA C 1 540 ? -17.879  -51.325 -18.821 1.00 61.69  ? 553 ALA C O     1 
ATOM   9506  C  CB    . ALA C 1 540 ? -20.481  -50.635 -18.347 1.00 61.69  ? 553 ALA C CB    1 
ATOM   9507  N  N     . GLN C 1 541 ? -17.918  -50.819 -21.016 1.00 106.74 ? 554 GLN C N     1 
ATOM   9508  C  CA    . GLN C 1 541 ? -16.489  -50.996 -21.231 1.00 106.74 ? 554 GLN C CA    1 
ATOM   9509  C  C     . GLN C 1 541 ? -16.033  -49.974 -22.266 1.00 106.74 ? 554 GLN C C     1 
ATOM   9510  O  O     . GLN C 1 541 ? -15.485  -50.321 -23.312 1.00 106.74 ? 554 GLN C O     1 
ATOM   9511  C  CB    . GLN C 1 541 ? -16.188  -52.424 -21.691 1.00 106.74 ? 554 GLN C CB    1 
ATOM   9512  C  CG    . GLN C 1 541 ? -17.137  -52.956 -22.756 1.00 106.74 ? 554 GLN C CG    1 
ATOM   9513  C  CD    . GLN C 1 541 ? -16.938  -54.434 -23.029 1.00 106.74 ? 554 GLN C CD    1 
ATOM   9514  O  OE1   . GLN C 1 541 ? -16.567  -55.196 -22.137 1.00 106.74 ? 554 GLN C OE1   1 
ATOM   9515  N  NE2   . GLN C 1 541 ? -17.181  -54.845 -24.267 1.00 106.74 ? 554 GLN C NE2   1 
ATOM   9516  N  N     . ASP C 1 542 ? -16.270  -48.705 -21.950 1.00 89.23  ? 555 ASP C N     1 
ATOM   9517  C  CA    . ASP C 1 542 ? -16.069  -47.613 -22.893 1.00 89.23  ? 555 ASP C CA    1 
ATOM   9518  C  C     . ASP C 1 542 ? -14.599  -47.268 -23.113 1.00 89.23  ? 555 ASP C C     1 
ATOM   9519  O  O     . ASP C 1 542 ? -13.781  -47.351 -22.196 1.00 89.23  ? 555 ASP C O     1 
ATOM   9520  C  CB    . ASP C 1 542 ? -16.832  -46.372 -22.420 1.00 89.23  ? 555 ASP C CB    1 
ATOM   9521  C  CG    . ASP C 1 542 ? -16.717  -45.209 -23.386 1.00 89.23  ? 555 ASP C CG    1 
ATOM   9522  O  OD1   . ASP C 1 542 ? -16.745  -44.050 -22.923 1.00 89.23  ? 555 ASP C OD1   1 
ATOM   9523  O  OD2   . ASP C 1 542 ? -16.602  -45.453 -24.605 1.00 89.23  ? 555 ASP C OD2   1 
ATOM   9524  N  N     . PHE C 1 543 ? -14.277  -46.887 -24.345 1.00 158.56 ? 556 PHE C N     1 
ATOM   9525  C  CA    . PHE C 1 543 ? -12.955  -46.375 -24.682 1.00 158.56 ? 556 PHE C CA    1 
ATOM   9526  C  C     . PHE C 1 543 ? -12.926  -44.853 -24.543 1.00 158.56 ? 556 PHE C C     1 
ATOM   9527  O  O     . PHE C 1 543 ? -13.969  -44.202 -24.601 1.00 158.56 ? 556 PHE C O     1 
ATOM   9528  C  CB    . PHE C 1 543 ? -12.524  -46.823 -26.089 1.00 158.56 ? 556 PHE C CB    1 
ATOM   9529  C  CG    . PHE C 1 543 ? -13.287  -46.168 -27.221 1.00 158.56 ? 556 PHE C CG    1 
ATOM   9530  C  CD1   . PHE C 1 543 ? -14.646  -45.902 -27.126 1.00 158.56 ? 556 PHE C CD1   1 
ATOM   9531  C  CD2   . PHE C 1 543 ? -12.632  -45.831 -28.395 1.00 158.56 ? 556 PHE C CD2   1 
ATOM   9532  C  CE1   . PHE C 1 543 ? -15.329  -45.305 -28.170 1.00 158.56 ? 556 PHE C CE1   1 
ATOM   9533  C  CE2   . PHE C 1 543 ? -13.311  -45.235 -29.442 1.00 158.56 ? 556 PHE C CE2   1 
ATOM   9534  C  CZ    . PHE C 1 543 ? -14.660  -44.972 -29.329 1.00 158.56 ? 556 PHE C CZ    1 
ATOM   9535  N  N     . LYS C 1 544 ? -11.735  -44.294 -24.348 1.00 80.74  ? 557 LYS C N     1 
ATOM   9536  C  CA    . LYS C 1 544 ? -11.589  -42.856 -24.129 1.00 80.74  ? 557 LYS C CA    1 
ATOM   9537  C  C     . LYS C 1 544 ? -12.096  -42.040 -25.314 1.00 80.74  ? 557 LYS C C     1 
ATOM   9538  O  O     . LYS C 1 544 ? -12.146  -40.812 -25.259 1.00 80.74  ? 557 LYS C O     1 
ATOM   9539  C  CB    . LYS C 1 544 ? -10.129  -42.501 -23.840 1.00 80.74  ? 557 LYS C CB    1 
ATOM   9540  C  CG    . LYS C 1 544 ? -9.534   -43.221 -22.644 1.00 80.74  ? 557 LYS C CG    1 
ATOM   9541  C  CD    . LYS C 1 544 ? -8.113   -42.751 -22.381 1.00 80.74  ? 557 LYS C CD    1 
ATOM   9542  C  CE    . LYS C 1 544 ? -7.451   -43.569 -21.284 1.00 80.74  ? 557 LYS C CE    1 
ATOM   9543  N  NZ    . LYS C 1 544 ? -8.201   -43.499 -20.000 1.00 80.74  ? 557 LYS C NZ    1 
ATOM   9544  N  N     . ILE D 2 7   ? -50.231  -48.772 3.638   1.00 106.73 ? 19  ILE D N     1 
ATOM   9545  C  CA    . ILE D 2 7   ? -49.758  -47.857 2.607   1.00 106.73 ? 19  ILE D CA    1 
ATOM   9546  C  C     . ILE D 2 7   ? -49.651  -48.571 1.264   1.00 106.73 ? 19  ILE D C     1 
ATOM   9547  O  O     . ILE D 2 7   ? -48.553  -48.787 0.749   1.00 106.73 ? 19  ILE D O     1 
ATOM   9548  C  CB    . ILE D 2 7   ? -48.388  -47.253 2.974   1.00 106.73 ? 19  ILE D CB    1 
ATOM   9549  C  CG1   . ILE D 2 7   ? -48.323  -46.947 4.473   1.00 106.73 ? 19  ILE D CG1   1 
ATOM   9550  C  CG2   . ILE D 2 7   ? -48.117  -45.998 2.157   1.00 106.73 ? 19  ILE D CG2   1 
ATOM   9551  C  CD1   . ILE D 2 7   ? -46.976  -46.436 4.936   1.00 106.73 ? 19  ILE D CD1   1 
ATOM   9552  N  N     . CYS D 2 8   ? -50.797  -48.946 0.704   1.00 98.01  ? 20  CYS D N     1 
ATOM   9553  C  CA    . CYS D 2 8   ? -50.831  -49.569 -0.614  1.00 98.01  ? 20  CYS D CA    1 
ATOM   9554  C  C     . CYS D 2 8   ? -51.072  -48.521 -1.696  1.00 98.01  ? 20  CYS D C     1 
ATOM   9555  O  O     . CYS D 2 8   ? -51.876  -47.605 -1.519  1.00 98.01  ? 20  CYS D O     1 
ATOM   9556  C  CB    . CYS D 2 8   ? -51.903  -50.658 -0.674  1.00 98.01  ? 20  CYS D CB    1 
ATOM   9557  S  SG    . CYS D 2 8   ? -51.550  -52.106 0.350   1.00 98.01  ? 20  CYS D SG    1 
ATOM   9558  N  N     . GLN D 2 9   ? -50.368  -48.659 -2.815  1.00 77.73  ? 21  GLN D N     1 
ATOM   9559  C  CA    . GLN D 2 9   ? -50.451  -47.682 -3.893  1.00 77.73  ? 21  GLN D CA    1 
ATOM   9560  C  C     . GLN D 2 9   ? -51.060  -48.282 -5.157  1.00 77.73  ? 21  GLN D C     1 
ATOM   9561  O  O     . GLN D 2 9   ? -50.555  -49.268 -5.695  1.00 77.73  ? 21  GLN D O     1 
ATOM   9562  C  CB    . GLN D 2 9   ? -49.066  -47.103 -4.192  1.00 77.73  ? 21  GLN D CB    1 
ATOM   9563  C  CG    . GLN D 2 9   ? -48.396  -46.457 -2.988  1.00 77.73  ? 21  GLN D CG    1 
ATOM   9564  C  CD    . GLN D 2 9   ? -47.019  -45.910 -3.306  1.00 77.73  ? 21  GLN D CD    1 
ATOM   9565  O  OE1   . GLN D 2 9   ? -46.468  -46.168 -4.376  1.00 77.73  ? 21  GLN D OE1   1 
ATOM   9566  N  NE2   . GLN D 2 9   ? -46.456  -45.149 -2.375  1.00 77.73  ? 21  GLN D NE2   1 
ATOM   9567  N  N     . PHE D 2 10  ? -52.146  -47.678 -5.627  1.00 107.79 ? 22  PHE D N     1 
ATOM   9568  C  CA    . PHE D 2 10  ? -52.821  -48.152 -6.828  1.00 107.79 ? 22  PHE D CA    1 
ATOM   9569  C  C     . PHE D 2 10  ? -52.722  -47.121 -7.946  1.00 107.79 ? 22  PHE D C     1 
ATOM   9570  O  O     . PHE D 2 10  ? -52.865  -45.921 -7.712  1.00 107.79 ? 22  PHE D O     1 
ATOM   9571  C  CB    . PHE D 2 10  ? -54.285  -48.471 -6.525  1.00 107.79 ? 22  PHE D CB    1 
ATOM   9572  C  CG    . PHE D 2 10  ? -54.472  -49.391 -5.352  1.00 107.79 ? 22  PHE D CG    1 
ATOM   9573  C  CD1   . PHE D 2 10  ? -54.416  -50.765 -5.516  1.00 107.79 ? 22  PHE D CD1   1 
ATOM   9574  C  CD2   . PHE D 2 10  ? -54.699  -48.880 -4.084  1.00 107.79 ? 22  PHE D CD2   1 
ATOM   9575  C  CE1   . PHE D 2 10  ? -54.583  -51.613 -4.438  1.00 107.79 ? 22  PHE D CE1   1 
ATOM   9576  C  CE2   . PHE D 2 10  ? -54.869  -49.723 -3.002  1.00 107.79 ? 22  PHE D CE2   1 
ATOM   9577  C  CZ    . PHE D 2 10  ? -54.810  -51.091 -3.180  1.00 107.79 ? 22  PHE D CZ    1 
ATOM   9578  N  N     . LYS D 2 11  ? -52.473  -47.596 -9.161  1.00 37.26  ? 23  LYS D N     1 
ATOM   9579  C  CA    . LYS D 2 11  ? -52.340  -46.718 -10.317 1.00 37.26  ? 23  LYS D CA    1 
ATOM   9580  C  C     . LYS D 2 11  ? -53.703  -46.436 -10.948 1.00 37.26  ? 23  LYS D C     1 
ATOM   9581  O  O     . LYS D 2 11  ? -54.420  -47.359 -11.335 1.00 37.26  ? 23  LYS D O     1 
ATOM   9582  C  CB    . LYS D 2 11  ? -51.397  -47.344 -11.344 1.00 37.26  ? 23  LYS D CB    1 
ATOM   9583  C  CG    . LYS D 2 11  ? -51.095  -46.465 -12.545 1.00 37.26  ? 23  LYS D CG    1 
ATOM   9584  C  CD    . LYS D 2 11  ? -50.172  -47.180 -13.518 1.00 37.26  ? 23  LYS D CD    1 
ATOM   9585  C  CE    . LYS D 2 11  ? -49.829  -46.304 -14.707 1.00 37.26  ? 23  LYS D CE    1 
ATOM   9586  N  NZ    . LYS D 2 11  ? -49.012  -47.035 -15.711 1.00 37.26  ? 23  LYS D NZ    1 
ATOM   9587  N  N     . LEU D 2 12  ? -54.057  -45.157 -11.046 1.00 42.63  ? 24  LEU D N     1 
ATOM   9588  C  CA    . LEU D 2 12  ? -55.348  -44.759 -11.597 1.00 42.63  ? 24  LEU D CA    1 
ATOM   9589  C  C     . LEU D 2 12  ? -55.157  -43.985 -12.898 1.00 42.63  ? 24  LEU D C     1 
ATOM   9590  O  O     . LEU D 2 12  ? -54.229  -43.186 -13.023 1.00 42.63  ? 24  LEU D O     1 
ATOM   9591  C  CB    . LEU D 2 12  ? -56.125  -43.922 -10.578 1.00 42.63  ? 24  LEU D CB    1 
ATOM   9592  C  CG    . LEU D 2 12  ? -57.652  -43.882 -10.661 1.00 42.63  ? 24  LEU D CG    1 
ATOM   9593  C  CD1   . LEU D 2 12  ? -58.243  -43.514 -9.311  1.00 42.63  ? 24  LEU D CD1   1 
ATOM   9594  C  CD2   . LEU D 2 12  ? -58.119  -42.899 -11.712 1.00 42.63  ? 24  LEU D CD2   1 
ATOM   9595  N  N     . VAL D 2 13  ? -56.038  -44.228 -13.864 1.00 47.43  ? 25  VAL D N     1 
ATOM   9596  C  CA    . VAL D 2 13  ? -55.958  -43.569 -15.164 1.00 47.43  ? 25  VAL D CA    1 
ATOM   9597  C  C     . VAL D 2 13  ? -57.321  -43.007 -15.574 1.00 47.43  ? 25  VAL D C     1 
ATOM   9598  O  O     . VAL D 2 13  ? -58.352  -43.637 -15.344 1.00 47.43  ? 25  VAL D O     1 
ATOM   9599  C  CB    . VAL D 2 13  ? -55.413  -44.534 -16.249 1.00 47.43  ? 25  VAL D CB    1 
ATOM   9600  C  CG1   . VAL D 2 13  ? -56.230  -45.816 -16.292 1.00 47.43  ? 25  VAL D CG1   1 
ATOM   9601  C  CG2   . VAL D 2 13  ? -55.382  -43.866 -17.615 1.00 47.43  ? 25  VAL D CG2   1 
ATOM   9602  N  N     . LEU D 2 14  ? -57.323  -41.813 -16.160 1.00 49.60  ? 26  LEU D N     1 
ATOM   9603  C  CA    . LEU D 2 14  ? -58.562  -41.197 -16.624 1.00 49.60  ? 26  LEU D CA    1 
ATOM   9604  C  C     . LEU D 2 14  ? -58.582  -41.068 -18.145 1.00 49.60  ? 26  LEU D C     1 
ATOM   9605  O  O     . LEU D 2 14  ? -57.777  -40.341 -18.728 1.00 49.60  ? 26  LEU D O     1 
ATOM   9606  C  CB    . LEU D 2 14  ? -58.781  -39.828 -15.972 1.00 49.60  ? 26  LEU D CB    1 
ATOM   9607  C  CG    . LEU D 2 14  ? -59.077  -39.805 -14.471 1.00 49.60  ? 26  LEU D CG    1 
ATOM   9608  C  CD1   . LEU D 2 14  ? -57.794  -39.832 -13.664 1.00 49.60  ? 26  LEU D CD1   1 
ATOM   9609  C  CD2   . LEU D 2 14  ? -59.920  -38.596 -14.091 1.00 49.60  ? 26  LEU D CD2   1 
ATOM   9610  N  N     . LEU D 2 15  ? -59.504  -41.784 -18.781 1.00 37.92  ? 27  LEU D N     1 
ATOM   9611  C  CA    . LEU D 2 15  ? -59.647  -41.743 -20.231 1.00 37.92  ? 27  LEU D CA    1 
ATOM   9612  C  C     . LEU D 2 15  ? -60.998  -41.160 -20.629 1.00 37.92  ? 27  LEU D C     1 
ATOM   9613  O  O     . LEU D 2 15  ? -61.940  -41.151 -19.834 1.00 37.92  ? 27  LEU D O     1 
ATOM   9614  C  CB    . LEU D 2 15  ? -59.477  -43.140 -20.825 1.00 37.92  ? 27  LEU D CB    1 
ATOM   9615  C  CG    . LEU D 2 15  ? -58.065  -43.721 -20.769 1.00 37.92  ? 27  LEU D CG    1 
ATOM   9616  C  CD1   . LEU D 2 15  ? -58.070  -45.204 -21.084 1.00 37.92  ? 27  LEU D CD1   1 
ATOM   9617  C  CD2   . LEU D 2 15  ? -57.153  -42.982 -21.731 1.00 37.92  ? 27  LEU D CD2   1 
ATOM   9618  N  N     . GLY D 2 16  ? -61.085  -40.672 -21.862 1.00 61.95  ? 28  GLY D N     1 
ATOM   9619  C  CA    . GLY D 2 16  ? -62.310  -40.082 -22.368 1.00 61.95  ? 28  GLY D CA    1 
ATOM   9620  C  C     . GLY D 2 16  ? -62.039  -39.083 -23.476 1.00 61.95  ? 28  GLY D C     1 
ATOM   9621  O  O     . GLY D 2 16  ? -60.897  -38.908 -23.901 1.00 61.95  ? 28  GLY D O     1 
ATOM   9622  N  N     . GLU D 2 17  ? -63.095  -38.427 -23.946 1.00 96.06  ? 29  GLU D N     1 
ATOM   9623  C  CA    . GLU D 2 17  ? -62.971  -37.417 -24.989 1.00 96.06  ? 29  GLU D CA    1 
ATOM   9624  C  C     . GLU D 2 17  ? -62.639  -36.067 -24.358 1.00 96.06  ? 29  GLU D C     1 
ATOM   9625  O  O     . GLU D 2 17  ? -62.864  -35.864 -23.167 1.00 96.06  ? 29  GLU D O     1 
ATOM   9626  C  CB    . GLU D 2 17  ? -64.271  -37.341 -25.801 1.00 96.06  ? 29  GLU D CB    1 
ATOM   9627  C  CG    . GLU D 2 17  ? -64.236  -36.405 -27.003 1.00 96.06  ? 29  GLU D CG    1 
ATOM   9628  C  CD    . GLU D 2 17  ? -63.050  -36.658 -27.914 1.00 96.06  ? 29  GLU D CD    1 
ATOM   9629  O  OE1   . GLU D 2 17  ? -62.465  -35.673 -28.410 1.00 96.06  ? 29  GLU D OE1   1 
ATOM   9630  O  OE2   . GLU D 2 17  ? -62.705  -37.837 -28.140 1.00 96.06  ? 29  GLU D OE2   1 
ATOM   9631  N  N     . SER D 2 18  ? -62.084  -35.157 -25.153 1.00 67.22  ? 30  SER D N     1 
ATOM   9632  C  CA    . SER D 2 18  ? -61.736  -33.824 -24.675 1.00 67.22  ? 30  SER D CA    1 
ATOM   9633  C  C     . SER D 2 18  ? -62.963  -33.056 -24.195 1.00 67.22  ? 30  SER D C     1 
ATOM   9634  O  O     . SER D 2 18  ? -64.086  -33.336 -24.615 1.00 67.22  ? 30  SER D O     1 
ATOM   9635  C  CB    . SER D 2 18  ? -61.031  -33.032 -25.777 1.00 67.22  ? 30  SER D CB    1 
ATOM   9636  O  OG    . SER D 2 18  ? -60.662  -31.742 -25.326 1.00 67.22  ? 30  SER D OG    1 
ATOM   9637  N  N     . ALA D 2 19  ? -62.732  -32.096 -23.304 1.00 88.50  ? 31  ALA D N     1 
ATOM   9638  C  CA    . ALA D 2 19  ? -63.772  -31.190 -22.819 1.00 88.50  ? 31  ALA D CA    1 
ATOM   9639  C  C     . ALA D 2 19  ? -64.949  -31.879 -22.127 1.00 88.50  ? 31  ALA D C     1 
ATOM   9640  O  O     . ALA D 2 19  ? -66.068  -31.366 -22.144 1.00 88.50  ? 31  ALA D O     1 
ATOM   9641  C  CB    . ALA D 2 19  ? -64.266  -30.284 -23.947 1.00 88.50  ? 31  ALA D CB    1 
ATOM   9642  N  N     . VAL D 2 20  ? -64.699  -33.035 -21.519 1.00 52.46  ? 32  VAL D N     1 
ATOM   9643  C  CA    . VAL D 2 20  ? -65.721  -33.691 -20.712 1.00 52.46  ? 32  VAL D CA    1 
ATOM   9644  C  C     . VAL D 2 20  ? -65.516  -33.354 -19.239 1.00 52.46  ? 32  VAL D C     1 
ATOM   9645  O  O     . VAL D 2 20  ? -66.431  -33.490 -18.429 1.00 52.46  ? 32  VAL D O     1 
ATOM   9646  C  CB    . VAL D 2 20  ? -65.738  -35.222 -20.905 1.00 52.46  ? 32  VAL D CB    1 
ATOM   9647  C  CG1   . VAL D 2 20  ? -65.977  -35.573 -22.363 1.00 52.46  ? 32  VAL D CG1   1 
ATOM   9648  C  CG2   . VAL D 2 20  ? -64.446  -35.838 -20.409 1.00 52.46  ? 32  VAL D CG2   1 
ATOM   9649  N  N     . GLY D 2 21  ? -64.309  -32.909 -18.901 1.00 72.12  ? 33  GLY D N     1 
ATOM   9650  C  CA    . GLY D 2 21  ? -64.014  -32.464 -17.552 1.00 72.12  ? 33  GLY D CA    1 
ATOM   9651  C  C     . GLY D 2 21  ? -63.051  -33.354 -16.792 1.00 72.12  ? 33  GLY D C     1 
ATOM   9652  O  O     . GLY D 2 21  ? -63.039  -33.346 -15.562 1.00 72.12  ? 33  GLY D O     1 
ATOM   9653  N  N     . LYS D 2 22  ? -62.238  -34.115 -17.521 1.00 76.98  ? 34  LYS D N     1 
ATOM   9654  C  CA    . LYS D 2 22  ? -61.274  -35.024 -16.906 1.00 76.98  ? 34  LYS D CA    1 
ATOM   9655  C  C     . LYS D 2 22  ? -60.294  -34.298 -15.984 1.00 76.98  ? 34  LYS D C     1 
ATOM   9656  O  O     . LYS D 2 22  ? -60.081  -34.711 -14.845 1.00 76.98  ? 34  LYS D O     1 
ATOM   9657  C  CB    . LYS D 2 22  ? -60.501  -35.798 -17.977 1.00 76.98  ? 34  LYS D CB    1 
ATOM   9658  C  CG    . LYS D 2 22  ? -61.354  -36.735 -18.815 1.00 76.98  ? 34  LYS D CG    1 
ATOM   9659  C  CD    . LYS D 2 22  ? -60.503  -37.543 -19.783 1.00 76.98  ? 34  LYS D CD    1 
ATOM   9660  C  CE    . LYS D 2 22  ? -59.642  -36.641 -20.652 1.00 76.98  ? 34  LYS D CE    1 
ATOM   9661  N  NZ    . LYS D 2 22  ? -60.456  -35.662 -21.424 1.00 76.98  ? 34  LYS D NZ    1 
ATOM   9662  N  N     . SER D 2 23  ? -59.706  -33.215 -16.483 1.00 41.47  ? 35  SER D N     1 
ATOM   9663  C  CA    . SER D 2 23  ? -58.725  -32.449 -15.721 1.00 41.47  ? 35  SER D CA    1 
ATOM   9664  C  C     . SER D 2 23  ? -59.354  -31.730 -14.531 1.00 41.47  ? 35  SER D C     1 
ATOM   9665  O  O     . SER D 2 23  ? -58.771  -31.680 -13.448 1.00 41.47  ? 35  SER D O     1 
ATOM   9666  C  CB    . SER D 2 23  ? -58.009  -31.445 -16.624 1.00 41.47  ? 35  SER D CB    1 
ATOM   9667  O  OG    . SER D 2 23  ? -57.275  -32.106 -17.637 1.00 41.47  ? 35  SER D OG    1 
ATOM   9668  N  N     . SER D 2 24  ? -60.543  -31.173 -14.738 1.00 68.59  ? 36  SER D N     1 
ATOM   9669  C  CA    . SER D 2 24  ? -61.254  -30.471 -13.675 1.00 68.59  ? 36  SER D CA    1 
ATOM   9670  C  C     . SER D 2 24  ? -61.675  -31.424 -12.560 1.00 68.59  ? 36  SER D C     1 
ATOM   9671  O  O     . SER D 2 24  ? -61.706  -31.042 -11.390 1.00 68.59  ? 36  SER D O     1 
ATOM   9672  C  CB    . SER D 2 24  ? -62.470  -29.729 -14.234 1.00 68.59  ? 36  SER D CB    1 
ATOM   9673  O  OG    . SER D 2 24  ? -62.074  -28.637 -15.043 1.00 68.59  ? 36  SER D OG    1 
ATOM   9674  N  N     . LEU D 2 25  ? -61.996  -32.661 -12.931 1.00 50.80  ? 37  LEU D N     1 
ATOM   9675  C  CA    . LEU D 2 25  ? -62.351  -33.694 -11.960 1.00 50.80  ? 37  LEU D CA    1 
ATOM   9676  C  C     . LEU D 2 25  ? -61.229  -33.919 -10.952 1.00 50.80  ? 37  LEU D C     1 
ATOM   9677  O  O     . LEU D 2 25  ? -61.445  -33.845 -9.742  1.00 50.80  ? 37  LEU D O     1 
ATOM   9678  C  CB    . LEU D 2 25  ? -62.684  -35.012 -12.667 1.00 50.80  ? 37  LEU D CB    1 
ATOM   9679  C  CG    . LEU D 2 25  ? -64.094  -35.188 -13.236 1.00 50.80  ? 37  LEU D CG    1 
ATOM   9680  C  CD1   . LEU D 2 25  ? -64.246  -36.553 -13.891 1.00 50.80  ? 37  LEU D CD1   1 
ATOM   9681  C  CD2   . LEU D 2 25  ? -65.138  -34.996 -12.151 1.00 50.80  ? 37  LEU D CD2   1 
ATOM   9682  N  N     . VAL D 2 26  ? -60.032  -34.190 -11.463 1.00 30.55  ? 38  VAL D N     1 
ATOM   9683  C  CA    . VAL D 2 26  ? -58.859  -34.410 -10.625 1.00 30.55  ? 38  VAL D CA    1 
ATOM   9684  C  C     . VAL D 2 26  ? -58.544  -33.162 -9.800  1.00 30.55  ? 38  VAL D C     1 
ATOM   9685  O  O     . VAL D 2 26  ? -58.007  -33.253 -8.695  1.00 30.55  ? 38  VAL D O     1 
ATOM   9686  C  CB    . VAL D 2 26  ? -57.634  -34.793 -11.475 1.00 30.55  ? 38  VAL D CB    1 
ATOM   9687  C  CG1   . VAL D 2 26  ? -56.519  -35.327 -10.595 1.00 30.55  ? 38  VAL D CG1   1 
ATOM   9688  C  CG2   . VAL D 2 26  ? -58.018  -35.828 -12.517 1.00 30.55  ? 38  VAL D CG2   1 
ATOM   9689  N  N     . LEU D 2 27  ? -58.889  -31.996 -10.342 1.00 49.86  ? 39  LEU D N     1 
ATOM   9690  C  CA    . LEU D 2 27  ? -58.688  -30.733 -9.639  1.00 49.86  ? 39  LEU D CA    1 
ATOM   9691  C  C     . LEU D 2 27  ? -59.665  -30.601 -8.475  1.00 49.86  ? 39  LEU D C     1 
ATOM   9692  O  O     . LEU D 2 27  ? -59.289  -30.176 -7.382  1.00 49.86  ? 39  LEU D O     1 
ATOM   9693  C  CB    . LEU D 2 27  ? -58.852  -29.549 -10.595 1.00 49.86  ? 39  LEU D CB    1 
ATOM   9694  C  CG    . LEU D 2 27  ? -58.478  -28.181 -10.024 1.00 49.86  ? 39  LEU D CG    1 
ATOM   9695  C  CD1   . LEU D 2 27  ? -56.987  -28.117 -9.760  1.00 49.86  ? 39  LEU D CD1   1 
ATOM   9696  C  CD2   . LEU D 2 27  ? -58.907  -27.052 -10.946 1.00 49.86  ? 39  LEU D CD2   1 
ATOM   9697  N  N     . ARG D 2 28  ? -60.920  -30.963 -8.720  1.00 54.34  ? 40  ARG D N     1 
ATOM   9698  C  CA    . ARG D 2 28  ? -61.945  -30.953 -7.683  1.00 54.34  ? 40  ARG D CA    1 
ATOM   9699  C  C     . ARG D 2 28  ? -61.611  -31.963 -6.589  1.00 54.34  ? 40  ARG D C     1 
ATOM   9700  O  O     . ARG D 2 28  ? -61.854  -31.721 -5.406  1.00 54.34  ? 40  ARG D O     1 
ATOM   9701  C  CB    . ARG D 2 28  ? -63.314  -31.271 -8.289  1.00 54.34  ? 40  ARG D CB    1 
ATOM   9702  C  CG    . ARG D 2 28  ? -64.418  -31.458 -7.264  1.00 54.34  ? 40  ARG D CG    1 
ATOM   9703  C  CD    . ARG D 2 28  ? -64.637  -30.193 -6.457  1.00 54.34  ? 40  ARG D CD    1 
ATOM   9704  N  NE    . ARG D 2 28  ? -65.333  -29.168 -7.227  1.00 54.34  ? 40  ARG D NE    1 
ATOM   9705  C  CZ    . ARG D 2 28  ? -65.596  -27.946 -6.776  1.00 54.34  ? 40  ARG D CZ    1 
ATOM   9706  N  NH1   . ARG D 2 28  ? -65.215  -27.593 -5.558  1.00 54.34  ? 40  ARG D NH1   1 
ATOM   9707  N  NH2   . ARG D 2 28  ? -66.237  -27.076 -7.544  1.00 54.34  ? 40  ARG D NH2   1 
ATOM   9708  N  N     . PHE D 2 29  ? -61.044  -33.093 -6.995  1.00 40.14  ? 41  PHE D N     1 
ATOM   9709  C  CA    . PHE D 2 29  ? -60.705  -34.166 -6.069  1.00 40.14  ? 41  PHE D CA    1 
ATOM   9710  C  C     . PHE D 2 29  ? -59.529  -33.802 -5.165  1.00 40.14  ? 41  PHE D C     1 
ATOM   9711  O  O     . PHE D 2 29  ? -59.624  -33.898 -3.942  1.00 40.14  ? 41  PHE D O     1 
ATOM   9712  C  CB    . PHE D 2 29  ? -60.405  -35.450 -6.847  1.00 40.14  ? 41  PHE D CB    1 
ATOM   9713  C  CG    . PHE D 2 29  ? -59.915  -36.583 -5.992  1.00 40.14  ? 41  PHE D CG    1 
ATOM   9714  C  CD1   . PHE D 2 29  ? -60.612  -36.971 -4.857  1.00 40.14  ? 41  PHE D CD1   1 
ATOM   9715  C  CD2   . PHE D 2 29  ? -58.767  -37.276 -6.338  1.00 40.14  ? 41  PHE D CD2   1 
ATOM   9716  C  CE1   . PHE D 2 29  ? -60.160  -38.020 -4.075  1.00 40.14  ? 41  PHE D CE1   1 
ATOM   9717  C  CE2   . PHE D 2 29  ? -58.311  -38.326 -5.563  1.00 40.14  ? 41  PHE D CE2   1 
ATOM   9718  C  CZ    . PHE D 2 29  ? -59.009  -38.698 -4.430  1.00 40.14  ? 41  PHE D CZ    1 
ATOM   9719  N  N     . VAL D 2 30  ? -58.427  -33.378 -5.775  1.00 63.37  ? 42  VAL D N     1 
ATOM   9720  C  CA    . VAL D 2 30  ? -57.195  -33.107 -5.040  1.00 63.37  ? 42  VAL D CA    1 
ATOM   9721  C  C     . VAL D 2 30  ? -57.185  -31.742 -4.350  1.00 63.37  ? 42  VAL D C     1 
ATOM   9722  O  O     . VAL D 2 30  ? -56.951  -31.651 -3.145  1.00 63.37  ? 42  VAL D O     1 
ATOM   9723  C  CB    . VAL D 2 30  ? -55.962  -33.222 -5.957  1.00 63.37  ? 42  VAL D CB    1 
ATOM   9724  C  CG1   . VAL D 2 30  ? -54.701  -32.815 -5.213  1.00 63.37  ? 42  VAL D CG1   1 
ATOM   9725  C  CG2   . VAL D 2 30  ? -55.832  -34.638 -6.494  1.00 63.37  ? 42  VAL D CG2   1 
ATOM   9726  N  N     . LYS D 2 31  ? -57.436  -30.686 -5.117  1.00 75.19  ? 43  LYS D N     1 
ATOM   9727  C  CA    . LYS D 2 31  ? -57.336  -29.325 -4.598  1.00 75.19  ? 43  LYS D CA    1 
ATOM   9728  C  C     . LYS D 2 31  ? -58.683  -28.736 -4.182  1.00 75.19  ? 43  LYS D C     1 
ATOM   9729  O  O     . LYS D 2 31  ? -58.734  -27.765 -3.427  1.00 75.19  ? 43  LYS D O     1 
ATOM   9730  C  CB    . LYS D 2 31  ? -56.659  -28.411 -5.622  1.00 75.19  ? 43  LYS D CB    1 
ATOM   9731  C  CG    . LYS D 2 31  ? -55.230  -28.810 -5.961  1.00 75.19  ? 43  LYS D CG    1 
ATOM   9732  C  CD    . LYS D 2 31  ? -54.628  -27.888 -7.012  1.00 75.19  ? 43  LYS D CD    1 
ATOM   9733  C  CE    . LYS D 2 31  ? -53.226  -28.333 -7.405  1.00 75.19  ? 43  LYS D CE    1 
ATOM   9734  N  NZ    . LYS D 2 31  ? -52.665  -27.513 -8.519  1.00 75.19  ? 43  LYS D NZ    1 
ATOM   9735  N  N     . GLY D 2 32  ? -59.769  -29.322 -4.673  1.00 62.02  ? 44  GLY D N     1 
ATOM   9736  C  CA    . GLY D 2 32  ? -61.096  -28.816 -4.373  1.00 62.02  ? 44  GLY D CA    1 
ATOM   9737  C  C     . GLY D 2 32  ? -61.387  -27.542 -5.139  1.00 62.02  ? 44  GLY D C     1 
ATOM   9738  O  O     . GLY D 2 32  ? -62.194  -26.716 -4.712  1.00 62.02  ? 44  GLY D O     1 
ATOM   9739  N  N     . GLN D 2 33  ? -60.725  -27.386 -6.281  1.00 74.54  ? 45  GLN D N     1 
ATOM   9740  C  CA    . GLN D 2 33  ? -60.868  -26.187 -7.095  1.00 74.54  ? 45  GLN D CA    1 
ATOM   9741  C  C     . GLN D 2 33  ? -61.589  -26.486 -8.405  1.00 74.54  ? 45  GLN D C     1 
ATOM   9742  O  O     . GLN D 2 33  ? -61.519  -27.601 -8.924  1.00 74.54  ? 45  GLN D O     1 
ATOM   9743  C  CB    . GLN D 2 33  ? -59.493  -25.583 -7.386  1.00 74.54  ? 45  GLN D CB    1 
ATOM   9744  C  CG    . GLN D 2 33  ? -58.677  -25.264 -6.142  1.00 74.54  ? 45  GLN D CG    1 
ATOM   9745  C  CD    . GLN D 2 33  ? -57.244  -24.894 -6.465  1.00 74.54  ? 45  GLN D CD    1 
ATOM   9746  O  OE1   . GLN D 2 33  ? -56.787  -25.063 -7.595  1.00 74.54  ? 45  GLN D OE1   1 
ATOM   9747  N  NE2   . GLN D 2 33  ? -56.526  -24.385 -5.471  1.00 74.54  ? 45  GLN D NE2   1 
ATOM   9748  N  N     . PHE D 2 34  ? -62.283  -25.484 -8.934  1.00 59.33  ? 46  PHE D N     1 
ATOM   9749  C  CA    . PHE D 2 34  ? -62.939  -25.604 -10.231 1.00 59.33  ? 46  PHE D CA    1 
ATOM   9750  C  C     . PHE D 2 34  ? -62.708  -24.348 -11.061 1.00 59.33  ? 46  PHE D C     1 
ATOM   9751  O  O     . PHE D 2 34  ? -62.820  -23.231 -10.557 1.00 59.33  ? 46  PHE D O     1 
ATOM   9752  C  CB    . PHE D 2 34  ? -64.437  -25.856 -10.063 1.00 59.33  ? 46  PHE D CB    1 
ATOM   9753  C  CG    . PHE D 2 34  ? -65.193  -25.893 -11.361 1.00 59.33  ? 46  PHE D CG    1 
ATOM   9754  C  CD1   . PHE D 2 34  ? -65.152  -27.018 -12.169 1.00 59.33  ? 46  PHE D CD1   1 
ATOM   9755  C  CD2   . PHE D 2 34  ? -65.951  -24.807 -11.769 1.00 59.33  ? 46  PHE D CD2   1 
ATOM   9756  C  CE1   . PHE D 2 34  ? -65.847  -27.057 -13.363 1.00 59.33  ? 46  PHE D CE1   1 
ATOM   9757  C  CE2   . PHE D 2 34  ? -66.649  -24.839 -12.961 1.00 59.33  ? 46  PHE D CE2   1 
ATOM   9758  C  CZ    . PHE D 2 34  ? -66.598  -25.966 -13.759 1.00 59.33  ? 46  PHE D CZ    1 
ATOM   9759  N  N     . HIS D 2 35  ? -62.385  -24.538 -12.335 1.00 71.52  ? 47  HIS D N     1 
ATOM   9760  C  CA    . HIS D 2 35  ? -62.140  -23.420 -13.233 1.00 71.52  ? 47  HIS D CA    1 
ATOM   9761  C  C     . HIS D 2 35  ? -63.079  -23.469 -14.434 1.00 71.52  ? 47  HIS D C     1 
ATOM   9762  O  O     . HIS D 2 35  ? -63.259  -24.521 -15.048 1.00 71.52  ? 47  HIS D O     1 
ATOM   9763  C  CB    . HIS D 2 35  ? -60.680  -23.418 -13.694 1.00 71.52  ? 47  HIS D CB    1 
ATOM   9764  C  CG    . HIS D 2 35  ? -59.696  -23.213 -12.582 1.00 71.52  ? 47  HIS D CG    1 
ATOM   9765  N  ND1   . HIS D 2 35  ? -58.486  -23.869 -12.530 1.00 71.52  ? 47  HIS D ND1   1 
ATOM   9766  C  CD2   . HIS D 2 35  ? -59.743  -22.422 -11.485 1.00 71.52  ? 47  HIS D CD2   1 
ATOM   9767  C  CE1   . HIS D 2 35  ? -57.829  -23.494 -11.446 1.00 71.52  ? 47  HIS D CE1   1 
ATOM   9768  N  NE2   . HIS D 2 35  ? -58.572  -22.614 -10.794 1.00 71.52  ? 47  HIS D NE2   1 
ATOM   9769  N  N     . GLU D 2 36  ? -63.682  -22.329 -14.757 1.00 75.51  ? 48  GLU D N     1 
ATOM   9770  C  CA    . GLU D 2 36  ? -64.595  -22.249 -15.890 1.00 75.51  ? 48  GLU D CA    1 
ATOM   9771  C  C     . GLU D 2 36  ? -63.833  -22.469 -17.191 1.00 75.51  ? 48  GLU D C     1 
ATOM   9772  O  O     . GLU D 2 36  ? -64.328  -23.128 -18.105 1.00 75.51  ? 48  GLU D O     1 
ATOM   9773  C  CB    . GLU D 2 36  ? -65.317  -20.902 -15.915 1.00 75.51  ? 48  GLU D CB    1 
ATOM   9774  C  CG    . GLU D 2 36  ? -66.597  -20.907 -16.735 1.00 75.51  ? 48  GLU D CG    1 
ATOM   9775  C  CD    . GLU D 2 36  ? -67.706  -21.705 -16.076 1.00 75.51  ? 48  GLU D CD    1 
ATOM   9776  O  OE1   . GLU D 2 36  ? -68.066  -21.383 -14.925 1.00 75.51  ? 48  GLU D OE1   1 
ATOM   9777  O  OE2   . GLU D 2 36  ? -68.212  -22.656 -16.706 1.00 75.51  ? 48  GLU D OE2   1 
ATOM   9778  N  N     . TYR D 2 37  ? -62.629  -21.911 -17.273 1.00 68.17  ? 49  TYR D N     1 
ATOM   9779  C  CA    . TYR D 2 37  ? -61.736  -22.217 -18.383 1.00 68.17  ? 49  TYR D CA    1 
ATOM   9780  C  C     . TYR D 2 37  ? -60.566  -23.085 -17.937 1.00 68.17  ? 49  TYR D C     1 
ATOM   9781  O  O     . TYR D 2 37  ? -59.947  -22.832 -16.904 1.00 68.17  ? 49  TYR D O     1 
ATOM   9782  C  CB    . TYR D 2 37  ? -61.198  -20.952 -19.057 1.00 68.17  ? 49  TYR D CB    1 
ATOM   9783  C  CG    . TYR D 2 37  ? -60.106  -21.261 -20.059 1.00 68.17  ? 49  TYR D CG    1 
ATOM   9784  C  CD1   . TYR D 2 37  ? -60.415  -21.746 -21.321 1.00 68.17  ? 49  TYR D CD1   1 
ATOM   9785  C  CD2   . TYR D 2 37  ? -58.765  -21.092 -19.734 1.00 68.17  ? 49  TYR D CD2   1 
ATOM   9786  C  CE1   . TYR D 2 37  ? -59.424  -22.044 -22.235 1.00 68.17  ? 49  TYR D CE1   1 
ATOM   9787  C  CE2   . TYR D 2 37  ? -57.767  -21.389 -20.642 1.00 68.17  ? 49  TYR D CE2   1 
ATOM   9788  C  CZ    . TYR D 2 37  ? -58.104  -21.864 -21.891 1.00 68.17  ? 49  TYR D CZ    1 
ATOM   9789  O  OH    . TYR D 2 37  ? -57.115  -22.161 -22.797 1.00 68.17  ? 49  TYR D OH    1 
ATOM   9790  N  N     . GLN D 2 38  ? -60.269  -24.105 -18.732 1.00 57.36  ? 50  GLN D N     1 
ATOM   9791  C  CA    . GLN D 2 38  ? -59.088  -24.929 -18.533 1.00 57.36  ? 50  GLN D CA    1 
ATOM   9792  C  C     . GLN D 2 38  ? -58.504  -25.295 -19.888 1.00 57.36  ? 50  GLN D C     1 
ATOM   9793  O  O     . GLN D 2 38  ? -59.198  -25.860 -20.732 1.00 57.36  ? 50  GLN D O     1 
ATOM   9794  C  CB    . GLN D 2 38  ? -59.430  -26.201 -17.757 1.00 57.36  ? 50  GLN D CB    1 
ATOM   9795  C  CG    . GLN D 2 38  ? -59.675  -25.994 -16.273 1.00 57.36  ? 50  GLN D CG    1 
ATOM   9796  C  CD    . GLN D 2 38  ? -58.789  -26.872 -15.412 1.00 57.36  ? 50  GLN D CD    1 
ATOM   9797  O  OE1   . GLN D 2 38  ? -57.693  -27.255 -15.819 1.00 57.36  ? 50  GLN D OE1   1 
ATOM   9798  N  NE2   . GLN D 2 38  ? -59.262  -27.198 -14.216 1.00 57.36  ? 50  GLN D NE2   1 
ATOM   9799  N  N     . GLU D 2 39  ? -57.234  -24.965 -20.098 1.00 65.30  ? 51  GLU D N     1 
ATOM   9800  C  CA    . GLU D 2 39  ? -56.559  -25.322 -21.340 1.00 65.30  ? 51  GLU D CA    1 
ATOM   9801  C  C     . GLU D 2 39  ? -56.454  -26.837 -21.465 1.00 65.30  ? 51  GLU D C     1 
ATOM   9802  O  O     . GLU D 2 39  ? -56.400  -27.546 -20.461 1.00 65.30  ? 51  GLU D O     1 
ATOM   9803  C  CB    . GLU D 2 39  ? -55.173  -24.676 -21.414 1.00 65.30  ? 51  GLU D CB    1 
ATOM   9804  C  CG    . GLU D 2 39  ? -54.289  -24.935 -20.199 1.00 65.30  ? 51  GLU D CG    1 
ATOM   9805  C  CD    . GLU D 2 39  ? -52.893  -24.357 -20.360 1.00 65.30  ? 51  GLU D CD    1 
ATOM   9806  O  OE1   . GLU D 2 39  ? -52.629  -23.724 -21.403 1.00 65.30  ? 51  GLU D OE1   1 
ATOM   9807  O  OE2   . GLU D 2 39  ? -52.062  -24.538 -19.447 1.00 65.30  ? 51  GLU D OE2   1 
ATOM   9808  N  N     . SER D 2 40  ? -56.437  -27.326 -22.701 1.00 24.90  ? 52  SER D N     1 
ATOM   9809  C  CA    . SER D 2 40  ? -56.389  -28.761 -22.963 1.00 24.90  ? 52  SER D CA    1 
ATOM   9810  C  C     . SER D 2 40  ? -55.127  -29.398 -22.396 1.00 24.90  ? 52  SER D C     1 
ATOM   9811  O  O     . SER D 2 40  ? -54.150  -28.708 -22.109 1.00 24.90  ? 52  SER D O     1 
ATOM   9812  C  CB    . SER D 2 40  ? -56.482  -29.036 -24.462 1.00 24.90  ? 52  SER D CB    1 
ATOM   9813  O  OG    . SER D 2 40  ? -56.351  -30.421 -24.732 1.00 24.90  ? 52  SER D OG    1 
ATOM   9814  N  N     . THR D 2 41  ? -55.154  -30.717 -22.238 1.00 59.77  ? 53  THR D N     1 
ATOM   9815  C  CA    . THR D 2 41  ? -54.038  -31.440 -21.639 1.00 59.77  ? 53  THR D CA    1 
ATOM   9816  C  C     . THR D 2 41  ? -53.090  -31.966 -22.713 1.00 59.77  ? 53  THR D C     1 
ATOM   9817  O  O     . THR D 2 41  ? -53.524  -32.376 -23.788 1.00 59.77  ? 53  THR D O     1 
ATOM   9818  C  CB    . THR D 2 41  ? -54.526  -32.615 -20.768 1.00 59.77  ? 53  THR D CB    1 
ATOM   9819  O  OG1   . THR D 2 41  ? -55.742  -32.251 -20.103 1.00 59.77  ? 53  THR D OG1   1 
ATOM   9820  C  CG2   . THR D 2 41  ? -53.479  -32.984 -19.731 1.00 59.77  ? 53  THR D CG2   1 
ATOM   9821  N  N     . ILE D 2 42  ? -51.795  -31.948 -22.414 1.00 48.11  ? 54  ILE D N     1 
ATOM   9822  C  CA    . ILE D 2 42  ? -50.784  -32.413 -23.353 1.00 48.11  ? 54  ILE D CA    1 
ATOM   9823  C  C     . ILE D 2 42  ? -50.172  -33.717 -22.853 1.00 48.11  ? 54  ILE D C     1 
ATOM   9824  O  O     . ILE D 2 42  ? -49.577  -33.754 -21.776 1.00 48.11  ? 54  ILE D O     1 
ATOM   9825  C  CB    . ILE D 2 42  ? -49.666  -31.369 -23.537 1.00 48.11  ? 54  ILE D CB    1 
ATOM   9826  C  CG1   . ILE D 2 42  ? -50.253  -29.960 -23.651 1.00 48.11  ? 54  ILE D CG1   1 
ATOM   9827  C  CG2   . ILE D 2 42  ? -48.830  -31.695 -24.760 1.00 48.11  ? 54  ILE D CG2   1 
ATOM   9828  C  CD1   . ILE D 2 42  ? -50.962  -29.693 -24.962 1.00 48.11  ? 54  ILE D CD1   1 
ATOM   9829  N  N     . GLY D 2 43  ? -50.319  -34.783 -23.637 1.00 73.15  ? 55  GLY D N     1 
ATOM   9830  C  CA    . GLY D 2 43  ? -49.826  -36.093 -23.248 1.00 73.15  ? 55  GLY D CA    1 
ATOM   9831  C  C     . GLY D 2 43  ? -50.516  -36.614 -22.001 1.00 73.15  ? 55  GLY D C     1 
ATOM   9832  O  O     . GLY D 2 43  ? -51.495  -37.358 -22.087 1.00 73.15  ? 55  GLY D O     1 
ATOM   9833  N  N     . ALA D 2 44  ? -50.004  -36.218 -20.839 1.00 43.06  ? 56  ALA D N     1 
ATOM   9834  C  CA    . ALA D 2 44  ? -50.593  -36.614 -19.564 1.00 43.06  ? 56  ALA D CA    1 
ATOM   9835  C  C     . ALA D 2 44  ? -50.182  -35.682 -18.427 1.00 43.06  ? 56  ALA D C     1 
ATOM   9836  O  O     . ALA D 2 44  ? -49.114  -35.071 -18.465 1.00 43.06  ? 56  ALA D O     1 
ATOM   9837  C  CB    . ALA D 2 44  ? -50.218  -38.050 -19.229 1.00 43.06  ? 56  ALA D CB    1 
ATOM   9838  N  N     . ALA D 2 45  ? -51.040  -35.581 -17.416 1.00 34.59  ? 57  ALA D N     1 
ATOM   9839  C  CA    . ALA D 2 45  ? -50.729  -34.834 -16.202 1.00 34.59  ? 57  ALA D CA    1 
ATOM   9840  C  C     . ALA D 2 45  ? -50.739  -35.796 -15.019 1.00 34.59  ? 57  ALA D C     1 
ATOM   9841  O  O     . ALA D 2 45  ? -51.711  -36.525 -14.820 1.00 34.59  ? 57  ALA D O     1 
ATOM   9842  C  CB    . ALA D 2 45  ? -51.737  -33.719 -15.991 1.00 34.59  ? 57  ALA D CB    1 
ATOM   9843  N  N     . PHE D 2 46  ? -49.665  -35.799 -14.235 1.00 51.62  ? 58  PHE D N     1 
ATOM   9844  C  CA    . PHE D 2 46  ? -49.507  -36.790 -13.173 1.00 51.62  ? 58  PHE D CA    1 
ATOM   9845  C  C     . PHE D 2 46  ? -49.567  -36.198 -11.766 1.00 51.62  ? 58  PHE D C     1 
ATOM   9846  O  O     . PHE D 2 46  ? -48.690  -35.433 -11.363 1.00 51.62  ? 58  PHE D O     1 
ATOM   9847  C  CB    . PHE D 2 46  ? -48.199  -37.555 -13.369 1.00 51.62  ? 58  PHE D CB    1 
ATOM   9848  C  CG    . PHE D 2 46  ? -47.900  -38.539 -12.278 1.00 51.62  ? 58  PHE D CG    1 
ATOM   9849  C  CD1   . PHE D 2 46  ? -46.694  -38.491 -11.602 1.00 51.62  ? 58  PHE D CD1   1 
ATOM   9850  C  CD2   . PHE D 2 46  ? -48.821  -39.512 -11.929 1.00 51.62  ? 58  PHE D CD2   1 
ATOM   9851  C  CE1   . PHE D 2 46  ? -46.409  -39.398 -10.602 1.00 51.62  ? 58  PHE D CE1   1 
ATOM   9852  C  CE2   . PHE D 2 46  ? -48.544  -40.422 -10.924 1.00 51.62  ? 58  PHE D CE2   1 
ATOM   9853  C  CZ    . PHE D 2 46  ? -47.335  -40.362 -10.260 1.00 51.62  ? 58  PHE D CZ    1 
ATOM   9854  N  N     . LEU D 2 47  ? -50.605  -36.571 -11.023 1.00 65.21  ? 59  LEU D N     1 
ATOM   9855  C  CA    . LEU D 2 47  ? -50.772  -36.121 -9.645  1.00 65.21  ? 59  LEU D CA    1 
ATOM   9856  C  C     . LEU D 2 47  ? -50.716  -37.286 -8.663  1.00 65.21  ? 59  LEU D C     1 
ATOM   9857  O  O     . LEU D 2 47  ? -50.349  -38.406 -9.025  1.00 65.21  ? 59  LEU D O     1 
ATOM   9858  C  CB    . LEU D 2 47  ? -52.093  -35.368 -9.474  1.00 65.21  ? 59  LEU D CB    1 
ATOM   9859  C  CG    . LEU D 2 47  ? -52.106  -33.869 -9.779  1.00 65.21  ? 59  LEU D CG    1 
ATOM   9860  C  CD1   . LEU D 2 47  ? -51.972  -33.599 -11.271 1.00 65.21  ? 59  LEU D CD1   1 
ATOM   9861  C  CD2   . LEU D 2 47  ? -53.365  -33.220 -9.220  1.00 65.21  ? 59  LEU D CD2   1 
ATOM   9862  N  N     . THR D 2 48  ? -51.089  -37.005 -7.419  1.00 50.76  ? 60  THR D N     1 
ATOM   9863  C  CA    . THR D 2 48  ? -51.113  -38.003 -6.358  1.00 50.76  ? 60  THR D CA    1 
ATOM   9864  C  C     . THR D 2 48  ? -51.923  -37.481 -5.175  1.00 50.76  ? 60  THR D C     1 
ATOM   9865  O  O     . THR D 2 48  ? -51.634  -36.410 -4.640  1.00 50.76  ? 60  THR D O     1 
ATOM   9866  C  CB    . THR D 2 48  ? -49.690  -38.358 -5.880  1.00 50.76  ? 60  THR D CB    1 
ATOM   9867  O  OG1   . THR D 2 48  ? -49.040  -39.174 -6.862  1.00 50.76  ? 60  THR D OG1   1 
ATOM   9868  C  CG2   . THR D 2 48  ? -49.739  -39.114 -4.565  1.00 50.76  ? 60  THR D CG2   1 
ATOM   9869  N  N     . GLN D 2 49  ? -52.944  -38.235 -4.774  1.00 50.87  ? 61  GLN D N     1 
ATOM   9870  C  CA    . GLN D 2 49  ? -53.749  -37.869 -3.614  1.00 50.87  ? 61  GLN D CA    1 
ATOM   9871  C  C     . GLN D 2 49  ? -53.870  -39.035 -2.639  1.00 50.87  ? 61  GLN D C     1 
ATOM   9872  O  O     . GLN D 2 49  ? -54.014  -40.188 -3.047  1.00 50.87  ? 61  GLN D O     1 
ATOM   9873  C  CB    . GLN D 2 49  ? -55.134  -37.376 -4.044  1.00 50.87  ? 61  GLN D CB    1 
ATOM   9874  C  CG    . GLN D 2 49  ? -56.070  -37.005 -2.893  1.00 50.87  ? 61  GLN D CG    1 
ATOM   9875  C  CD    . GLN D 2 49  ? -55.592  -35.807 -2.089  1.00 50.87  ? 61  GLN D CD    1 
ATOM   9876  O  OE1   . GLN D 2 49  ? -54.660  -35.106 -2.484  1.00 50.87  ? 61  GLN D OE1   1 
ATOM   9877  N  NE2   . GLN D 2 49  ? -56.237  -35.566 -0.954  1.00 50.87  ? 61  GLN D NE2   1 
ATOM   9878  N  N     . THR D 2 50  ? -53.799  -38.726 -1.349  1.00 81.83  ? 62  THR D N     1 
ATOM   9879  C  CA    . THR D 2 50  ? -53.898  -39.739 -0.307  1.00 81.83  ? 62  THR D CA    1 
ATOM   9880  C  C     . THR D 2 50  ? -55.278  -39.715 0.343   1.00 81.83  ? 62  THR D C     1 
ATOM   9881  O  O     . THR D 2 50  ? -55.736  -38.673 0.810   1.00 81.83  ? 62  THR D O     1 
ATOM   9882  C  CB    . THR D 2 50  ? -52.822  -39.532 0.776   1.00 81.83  ? 62  THR D CB    1 
ATOM   9883  O  OG1   . THR D 2 50  ? -51.519  -39.662 0.195   1.00 81.83  ? 62  THR D OG1   1 
ATOM   9884  C  CG2   . THR D 2 50  ? -52.975  -40.556 1.883   1.00 81.83  ? 62  THR D CG2   1 
ATOM   9885  N  N     . VAL D 2 51  ? -55.942  -40.868 0.354   1.00 67.22  ? 63  VAL D N     1 
ATOM   9886  C  CA    . VAL D 2 51  ? -57.214  -41.023 1.054   1.00 67.22  ? 63  VAL D CA    1 
ATOM   9887  C  C     . VAL D 2 51  ? -57.224  -42.342 1.818   1.00 67.22  ? 63  VAL D C     1 
ATOM   9888  O  O     . VAL D 2 51  ? -56.649  -43.331 1.365   1.00 67.22  ? 63  VAL D O     1 
ATOM   9889  C  CB    . VAL D 2 51  ? -58.416  -40.979 0.089   1.00 67.22  ? 63  VAL D CB    1 
ATOM   9890  C  CG1   . VAL D 2 51  ? -58.671  -39.558 -0.387  1.00 67.22  ? 63  VAL D CG1   1 
ATOM   9891  C  CG2   . VAL D 2 51  ? -58.194  -41.916 -1.089  1.00 67.22  ? 63  VAL D CG2   1 
ATOM   9892  N  N     . CYS D 2 52  ? -57.867  -42.358 2.981   1.00 133.40 ? 64  CYS D N     1 
ATOM   9893  C  CA    . CYS D 2 52  ? -57.929  -43.578 3.779   1.00 133.40 ? 64  CYS D CA    1 
ATOM   9894  C  C     . CYS D 2 52  ? -59.361  -44.040 4.038   1.00 133.40 ? 64  CYS D C     1 
ATOM   9895  O  O     . CYS D 2 52  ? -60.231  -43.245 4.392   1.00 133.40 ? 64  CYS D O     1 
ATOM   9896  C  CB    . CYS D 2 52  ? -57.163  -43.418 5.100   1.00 133.40 ? 64  CYS D CB    1 
ATOM   9897  S  SG    . CYS D 2 52  ? -57.869  -42.259 6.292   1.00 133.40 ? 64  CYS D SG    1 
ATOM   9898  N  N     . LEU D 2 53  ? -59.593  -45.335 3.848   1.00 65.82  ? 65  LEU D N     1 
ATOM   9899  C  CA    . LEU D 2 53  ? -60.901  -45.926 4.099   1.00 65.82  ? 65  LEU D CA    1 
ATOM   9900  C  C     . LEU D 2 53  ? -60.817  -46.984 5.201   1.00 65.82  ? 65  LEU D C     1 
ATOM   9901  O  O     . LEU D 2 53  ? -60.002  -47.905 5.130   1.00 65.82  ? 65  LEU D O     1 
ATOM   9902  C  CB    . LEU D 2 53  ? -61.503  -46.512 2.810   1.00 65.82  ? 65  LEU D CB    1 
ATOM   9903  C  CG    . LEU D 2 53  ? -61.051  -47.874 2.263   1.00 65.82  ? 65  LEU D CG    1 
ATOM   9904  C  CD1   . LEU D 2 53  ? -61.913  -48.292 1.084   1.00 65.82  ? 65  LEU D CD1   1 
ATOM   9905  C  CD2   . LEU D 2 53  ? -59.582  -47.876 1.871   1.00 65.82  ? 65  LEU D CD2   1 
ATOM   9906  N  N     . ASP D 2 54  ? -61.650  -46.825 6.227   1.00 107.91 ? 66  ASP D N     1 
ATOM   9907  C  CA    . ASP D 2 54  ? -61.732  -47.766 7.346   1.00 107.91 ? 66  ASP D CA    1 
ATOM   9908  C  C     . ASP D 2 54  ? -60.372  -48.139 7.944   1.00 107.91 ? 66  ASP D C     1 
ATOM   9909  O  O     . ASP D 2 54  ? -59.890  -49.257 7.752   1.00 107.91 ? 66  ASP D O     1 
ATOM   9910  C  CB    . ASP D 2 54  ? -62.499  -49.027 6.936   1.00 107.91 ? 66  ASP D CB    1 
ATOM   9911  C  CG    . ASP D 2 54  ? -62.881  -49.888 8.125   1.00 107.91 ? 66  ASP D CG    1 
ATOM   9912  O  OD1   . ASP D 2 54  ? -63.102  -51.103 7.936   1.00 107.91 ? 66  ASP D OD1   1 
ATOM   9913  O  OD2   . ASP D 2 54  ? -62.961  -49.349 9.249   1.00 107.91 ? 66  ASP D OD2   1 
ATOM   9914  N  N     . ASP D 2 55  ? -59.761  -47.194 8.655   1.00 76.88  ? 67  ASP D N     1 
ATOM   9915  C  CA    . ASP D 2 55  ? -58.463  -47.396 9.307   1.00 76.88  ? 67  ASP D CA    1 
ATOM   9916  C  C     . ASP D 2 55  ? -57.341  -47.839 8.363   1.00 76.88  ? 67  ASP D C     1 
ATOM   9917  O  O     . ASP D 2 55  ? -56.286  -48.281 8.816   1.00 76.88  ? 67  ASP D O     1 
ATOM   9918  C  CB    . ASP D 2 55  ? -58.577  -48.385 10.474  1.00 76.88  ? 67  ASP D CB    1 
ATOM   9919  C  CG    . ASP D 2 55  ? -59.303  -47.801 11.672  1.00 76.88  ? 67  ASP D CG    1 
ATOM   9920  O  OD1   . ASP D 2 55  ? -60.352  -47.162 11.478  1.00 76.88  ? 67  ASP D OD1   1 
ATOM   9921  O  OD2   . ASP D 2 55  ? -58.821  -47.984 12.809  1.00 76.88  ? 67  ASP D OD2   1 
ATOM   9922  N  N     . THR D 2 56  ? -57.564  -47.715 7.058   1.00 80.93  ? 68  THR D N     1 
ATOM   9923  C  CA    . THR D 2 56  ? -56.586  -48.164 6.073   1.00 80.93  ? 68  THR D CA    1 
ATOM   9924  C  C     . THR D 2 56  ? -56.341  -47.104 5.004   1.00 80.93  ? 68  THR D C     1 
ATOM   9925  O  O     . THR D 2 56  ? -57.276  -46.638 4.355   1.00 80.93  ? 68  THR D O     1 
ATOM   9926  C  CB    . THR D 2 56  ? -57.030  -49.474 5.402   1.00 80.93  ? 68  THR D CB    1 
ATOM   9927  O  OG1   . THR D 2 56  ? -57.171  -50.495 6.397   1.00 80.93  ? 68  THR D OG1   1 
ATOM   9928  C  CG2   . THR D 2 56  ? -56.010  -49.917 4.368   1.00 80.93  ? 68  THR D CG2   1 
ATOM   9929  N  N     . THR D 2 57  ? -55.077  -46.735 4.822   1.00 76.52  ? 69  THR D N     1 
ATOM   9930  C  CA    . THR D 2 57  ? -54.706  -45.671 3.895   1.00 76.52  ? 69  THR D CA    1 
ATOM   9931  C  C     . THR D 2 57  ? -54.312  -46.204 2.520   1.00 76.52  ? 69  THR D C     1 
ATOM   9932  O  O     . THR D 2 57  ? -53.492  -47.115 2.412   1.00 76.52  ? 69  THR D O     1 
ATOM   9933  C  CB    . THR D 2 57  ? -53.546  -44.826 4.459   1.00 76.52  ? 69  THR D CB    1 
ATOM   9934  O  OG1   . THR D 2 57  ? -53.985  -44.130 5.632   1.00 76.52  ? 69  THR D OG1   1 
ATOM   9935  C  CG2   . THR D 2 57  ? -53.065  -43.817 3.433   1.00 76.52  ? 69  THR D CG2   1 
ATOM   9936  N  N     . VAL D 2 58  ? -54.904  -45.635 1.473   1.00 71.77  ? 70  VAL D N     1 
ATOM   9937  C  CA    . VAL D 2 58  ? -54.510  -45.961 0.106   1.00 71.77  ? 70  VAL D CA    1 
ATOM   9938  C  C     . VAL D 2 58  ? -54.005  -44.716 -0.621  1.00 71.77  ? 70  VAL D C     1 
ATOM   9939  O  O     . VAL D 2 58  ? -54.492  -43.609 -0.392  1.00 71.77  ? 70  VAL D O     1 
ATOM   9940  C  CB    . VAL D 2 58  ? -55.656  -46.627 -0.693  1.00 71.77  ? 70  VAL D CB    1 
ATOM   9941  C  CG1   . VAL D 2 58  ? -56.027  -47.964 -0.072  1.00 71.77  ? 70  VAL D CG1   1 
ATOM   9942  C  CG2   . VAL D 2 58  ? -56.870  -45.714 -0.771  1.00 71.77  ? 70  VAL D CG2   1 
ATOM   9943  N  N     . LYS D 2 59  ? -53.018  -44.907 -1.489  1.00 70.81  ? 71  LYS D N     1 
ATOM   9944  C  CA    . LYS D 2 59  ? -52.389  -43.797 -2.194  1.00 70.81  ? 71  LYS D CA    1 
ATOM   9945  C  C     . LYS D 2 59  ? -52.598  -43.925 -3.698  1.00 70.81  ? 71  LYS D C     1 
ATOM   9946  O  O     . LYS D 2 59  ? -52.171  -44.904 -4.310  1.00 70.81  ? 71  LYS D O     1 
ATOM   9947  C  CB    . LYS D 2 59  ? -50.896  -43.756 -1.870  1.00 70.81  ? 71  LYS D CB    1 
ATOM   9948  C  CG    . LYS D 2 59  ? -50.139  -42.593 -2.481  1.00 70.81  ? 71  LYS D CG    1 
ATOM   9949  C  CD    . LYS D 2 59  ? -48.673  -42.660 -2.081  1.00 70.81  ? 71  LYS D CD    1 
ATOM   9950  C  CE    . LYS D 2 59  ? -47.874  -41.505 -2.653  1.00 70.81  ? 71  LYS D CE    1 
ATOM   9951  N  NZ    . LYS D 2 59  ? -46.439  -41.605 -2.273  1.00 70.81  ? 71  LYS D NZ    1 
ATOM   9952  N  N     . PHE D 2 60  ? -53.257  -42.933 -4.289  1.00 61.38  ? 72  PHE D N     1 
ATOM   9953  C  CA    . PHE D 2 60  ? -53.572  -42.966 -5.713  1.00 61.38  ? 72  PHE D CA    1 
ATOM   9954  C  C     . PHE D 2 60  ? -52.467  -42.361 -6.574  1.00 61.38  ? 72  PHE D C     1 
ATOM   9955  O  O     . PHE D 2 60  ? -51.975  -41.268 -6.296  1.00 61.38  ? 72  PHE D O     1 
ATOM   9956  C  CB    . PHE D 2 60  ? -54.896  -42.246 -5.987  1.00 61.38  ? 72  PHE D CB    1 
ATOM   9957  C  CG    . PHE D 2 60  ? -56.114  -43.068 -5.672  1.00 61.38  ? 72  PHE D CG    1 
ATOM   9958  C  CD1   . PHE D 2 60  ? -56.084  -44.449 -5.782  1.00 61.38  ? 72  PHE D CD1   1 
ATOM   9959  C  CD2   . PHE D 2 60  ? -57.292  -42.457 -5.270  1.00 61.38  ? 72  PHE D CD2   1 
ATOM   9960  C  CE1   . PHE D 2 60  ? -57.206  -45.208 -5.495  1.00 61.38  ? 72  PHE D CE1   1 
ATOM   9961  C  CE2   . PHE D 2 60  ? -58.416  -43.209 -4.981  1.00 61.38  ? 72  PHE D CE2   1 
ATOM   9962  C  CZ    . PHE D 2 60  ? -58.372  -44.585 -5.093  1.00 61.38  ? 72  PHE D CZ    1 
ATOM   9963  N  N     . GLU D 2 61  ? -52.080  -43.087 -7.618  1.00 36.01  ? 73  GLU D N     1 
ATOM   9964  C  CA    . GLU D 2 61  ? -51.161  -42.567 -8.619  1.00 36.01  ? 73  GLU D CA    1 
ATOM   9965  C  C     . GLU D 2 61  ? -51.974  -42.160 -9.842  1.00 36.01  ? 73  GLU D C     1 
ATOM   9966  O  O     . GLU D 2 61  ? -52.091  -42.918 -10.805 1.00 36.01  ? 73  GLU D O     1 
ATOM   9967  C  CB    . GLU D 2 61  ? -50.108  -43.614 -8.989  1.00 36.01  ? 73  GLU D CB    1 
ATOM   9968  C  CG    . GLU D 2 61  ? -49.273  -44.093 -7.808  1.00 36.01  ? 73  GLU D CG    1 
ATOM   9969  C  CD    . GLU D 2 61  ? -48.194  -45.081 -8.208  1.00 36.01  ? 73  GLU D CD    1 
ATOM   9970  O  OE1   . GLU D 2 61  ? -47.493  -45.591 -7.308  1.00 36.01  ? 73  GLU D OE1   1 
ATOM   9971  O  OE2   . GLU D 2 61  ? -48.042  -45.348 -9.418  1.00 36.01  ? 73  GLU D OE2   1 
ATOM   9972  N  N     . ILE D 2 62  ? -52.540  -40.959 -9.786  1.00 53.84  ? 74  ILE D N     1 
ATOM   9973  C  CA    . ILE D 2 62  ? -53.474  -40.484 -10.803 1.00 53.84  ? 74  ILE D CA    1 
ATOM   9974  C  C     . ILE D 2 62  ? -52.786  -40.030 -12.090 1.00 53.84  ? 74  ILE D C     1 
ATOM   9975  O  O     . ILE D 2 62  ? -51.897  -39.182 -12.064 1.00 53.84  ? 74  ILE D O     1 
ATOM   9976  C  CB    . ILE D 2 62  ? -54.343  -39.334 -10.254 1.00 53.84  ? 74  ILE D CB    1 
ATOM   9977  C  CG1   . ILE D 2 62  ? -55.176  -39.821 -9.068  1.00 53.84  ? 74  ILE D CG1   1 
ATOM   9978  C  CG2   . ILE D 2 62  ? -55.242  -38.771 -11.341 1.00 53.84  ? 74  ILE D CG2   1 
ATOM   9979  C  CD1   . ILE D 2 62  ? -56.071  -38.760 -8.464  1.00 53.84  ? 74  ILE D CD1   1 
ATOM   9980  N  N     . TRP D 2 63  ? -53.212  -40.598 -13.214 1.00 49.13  ? 75  TRP D N     1 
ATOM   9981  C  CA    . TRP D 2 63  ? -52.690  -40.209 -14.516 1.00 49.13  ? 75  TRP D CA    1 
ATOM   9982  C  C     . TRP D 2 63  ? -53.790  -39.624 -15.397 1.00 49.13  ? 75  TRP D C     1 
ATOM   9983  O  O     . TRP D 2 63  ? -54.503  -40.357 -16.084 1.00 49.13  ? 75  TRP D O     1 
ATOM   9984  C  CB    . TRP D 2 63  ? -52.033  -41.403 -15.210 1.00 49.13  ? 75  TRP D CB    1 
ATOM   9985  C  CG    . TRP D 2 63  ? -50.757  -41.842 -14.562 1.00 49.13  ? 75  TRP D CG    1 
ATOM   9986  C  CD1   . TRP D 2 63  ? -50.622  -42.711 -13.518 1.00 49.13  ? 75  TRP D CD1   1 
ATOM   9987  C  CD2   . TRP D 2 63  ? -49.428  -41.435 -14.915 1.00 49.13  ? 75  TRP D CD2   1 
ATOM   9988  N  NE1   . TRP D 2 63  ? -49.294  -42.868 -13.199 1.00 49.13  ? 75  TRP D NE1   1 
ATOM   9989  C  CE2   . TRP D 2 63  ? -48.542  -42.094 -14.045 1.00 49.13  ? 75  TRP D CE2   1 
ATOM   9990  C  CE3   . TRP D 2 63  ? -48.908  -40.573 -15.885 1.00 49.13  ? 75  TRP D CE3   1 
ATOM   9991  C  CZ2   . TRP D 2 63  ? -47.160  -41.918 -14.112 1.00 49.13  ? 75  TRP D CZ2   1 
ATOM   9992  C  CZ3   . TRP D 2 63  ? -47.537  -40.401 -15.951 1.00 49.13  ? 75  TRP D CZ3   1 
ATOM   9993  C  CH2   . TRP D 2 63  ? -46.679  -41.069 -15.072 1.00 49.13  ? 75  TRP D CH2   1 
ATOM   9994  N  N     . ASP D 2 64  ? -53.928  -38.301 -15.367 1.00 47.81  ? 76  ASP D N     1 
ATOM   9995  C  CA    . ASP D 2 64  ? -54.897  -37.610 -16.212 1.00 47.81  ? 76  ASP D CA    1 
ATOM   9996  C  C     . ASP D 2 64  ? -54.367  -37.505 -17.638 1.00 47.81  ? 76  ASP D C     1 
ATOM   9997  O  O     . ASP D 2 64  ? -53.340  -36.875 -17.878 1.00 47.81  ? 76  ASP D O     1 
ATOM   9998  C  CB    . ASP D 2 64  ? -55.192  -36.218 -15.651 1.00 47.81  ? 76  ASP D CB    1 
ATOM   9999  C  CG    . ASP D 2 64  ? -56.093  -35.399 -16.556 1.00 47.81  ? 76  ASP D CG    1 
ATOM   10000 O  OD1   . ASP D 2 64  ? -56.917  -35.990 -17.283 1.00 47.81  ? 76  ASP D OD1   1 
ATOM   10001 O  OD2   . ASP D 2 64  ? -55.977  -34.155 -16.537 1.00 47.81  ? 76  ASP D OD2   1 
ATOM   10002 N  N     . THR D 2 65  ? -55.075  -38.122 -18.579 1.00 36.54  ? 77  THR D N     1 
ATOM   10003 C  CA    . THR D 2 65  ? -54.632  -38.179 -19.969 1.00 36.54  ? 77  THR D CA    1 
ATOM   10004 C  C     . THR D 2 65  ? -55.233  -37.062 -20.817 1.00 36.54  ? 77  THR D C     1 
ATOM   10005 O  O     . THR D 2 65  ? -56.028  -36.259 -20.333 1.00 36.54  ? 77  THR D O     1 
ATOM   10006 C  CB    . THR D 2 65  ? -54.976  -39.535 -20.613 1.00 36.54  ? 77  THR D CB    1 
ATOM   10007 O  OG1   . THR D 2 65  ? -56.397  -39.718 -20.624 1.00 36.54  ? 77  THR D OG1   1 
ATOM   10008 C  CG2   . THR D 2 65  ? -54.335  -40.669 -19.838 1.00 36.54  ? 77  THR D CG2   1 
ATOM   10009 N  N     . ALA D 2 66  ? -54.840  -37.021 -22.086 1.00 65.01  ? 78  ALA D N     1 
ATOM   10010 C  CA    . ALA D 2 66  ? -55.380  -36.051 -23.032 1.00 65.01  ? 78  ALA D CA    1 
ATOM   10011 C  C     . ALA D 2 66  ? -56.500  -36.684 -23.849 1.00 65.01  ? 78  ALA D C     1 
ATOM   10012 O  O     . ALA D 2 66  ? -56.360  -37.803 -24.344 1.00 65.01  ? 78  ALA D O     1 
ATOM   10013 C  CB    . ALA D 2 66  ? -54.285  -35.540 -23.945 1.00 65.01  ? 78  ALA D CB    1 
ATOM   10014 N  N     . GLY D 2 67  ? -57.607  -35.964 -23.994 1.00 107.02 ? 79  GLY D N     1 
ATOM   10015 C  CA    . GLY D 2 67  ? -58.782  -36.506 -24.653 1.00 107.02 ? 79  GLY D CA    1 
ATOM   10016 C  C     . GLY D 2 67  ? -58.851  -36.275 -26.151 1.00 107.02 ? 79  GLY D C     1 
ATOM   10017 O  O     . GLY D 2 67  ? -59.900  -35.901 -26.674 1.00 107.02 ? 79  GLY D O     1 
ATOM   10018 N  N     . LEU D 2 68  ? -57.742  -36.508 -26.847 1.00 86.97  ? 80  LEU D N     1 
ATOM   10019 C  CA    . LEU D 2 68  ? -57.708  -36.338 -28.297 1.00 86.97  ? 80  LEU D CA    1 
ATOM   10020 C  C     . LEU D 2 68  ? -57.263  -37.617 -29.007 1.00 86.97  ? 80  LEU D C     1 
ATOM   10021 O  O     . LEU D 2 68  ? -56.524  -38.424 -28.443 1.00 86.97  ? 80  LEU D O     1 
ATOM   10022 C  CB    . LEU D 2 68  ? -56.810  -35.161 -28.682 1.00 86.97  ? 80  LEU D CB    1 
ATOM   10023 C  CG    . LEU D 2 68  ? -57.252  -33.794 -28.154 1.00 86.97  ? 80  LEU D CG    1 
ATOM   10024 C  CD1   . LEU D 2 68  ? -56.299  -32.694 -28.598 1.00 86.97  ? 80  LEU D CD1   1 
ATOM   10025 C  CD2   . LEU D 2 68  ? -58.670  -33.488 -28.602 1.00 86.97  ? 80  LEU D CD2   1 
ATOM   10026 N  N     . GLU D 2 69  ? -57.719  -37.794 -30.244 1.00 115.49 ? 81  GLU D N     1 
ATOM   10027 C  CA    . GLU D 2 69  ? -57.424  -39.001 -31.012 1.00 115.49 ? 81  GLU D CA    1 
ATOM   10028 C  C     . GLU D 2 69  ? -55.940  -39.103 -31.365 1.00 115.49 ? 81  GLU D C     1 
ATOM   10029 O  O     . GLU D 2 69  ? -55.426  -40.193 -31.618 1.00 115.49 ? 81  GLU D O     1 
ATOM   10030 C  CB    . GLU D 2 69  ? -58.280  -39.053 -32.280 1.00 115.49 ? 81  GLU D CB    1 
ATOM   10031 C  CG    . GLU D 2 69  ? -58.247  -40.391 -33.003 1.00 115.49 ? 81  GLU D CG    1 
ATOM   10032 C  CD    . GLU D 2 69  ? -58.761  -41.533 -32.145 1.00 115.49 ? 81  GLU D CD    1 
ATOM   10033 O  OE1   . GLU D 2 69  ? -59.741  -41.326 -31.398 1.00 115.49 ? 81  GLU D OE1   1 
ATOM   10034 O  OE2   . GLU D 2 69  ? -58.183  -42.637 -32.217 1.00 115.49 ? 81  GLU D OE2   1 
ATOM   10035 N  N     . ARG D 2 70  ? -55.260  -37.961 -31.382 1.00 101.74 ? 82  ARG D N     1 
ATOM   10036 C  CA    . ARG D 2 70  ? -53.820  -37.930 -31.611 1.00 101.74 ? 82  ARG D CA    1 
ATOM   10037 C  C     . ARG D 2 70  ? -53.091  -38.714 -30.527 1.00 101.74 ? 82  ARG D C     1 
ATOM   10038 O  O     . ARG D 2 70  ? -52.094  -39.384 -30.794 1.00 101.74 ? 82  ARG D O     1 
ATOM   10039 C  CB    . ARG D 2 70  ? -53.313  -36.487 -31.643 1.00 101.74 ? 82  ARG D CB    1 
ATOM   10040 C  CG    . ARG D 2 70  ? -53.150  -35.914 -33.042 1.00 101.74 ? 82  ARG D CG    1 
ATOM   10041 C  CD    . ARG D 2 70  ? -51.874  -36.415 -33.706 1.00 101.74 ? 82  ARG D CD    1 
ATOM   10042 N  NE    . ARG D 2 70  ? -50.684  -35.740 -33.193 1.00 101.74 ? 82  ARG D NE    1 
ATOM   10043 C  CZ    . ARG D 2 70  ? -49.464  -35.887 -33.700 1.00 101.74 ? 82  ARG D CZ    1 
ATOM   10044 N  NH1   . ARG D 2 70  ? -49.267  -36.687 -34.739 1.00 101.74 ? 82  ARG D NH1   1 
ATOM   10045 N  NH2   . ARG D 2 70  ? -48.439  -35.231 -33.172 1.00 101.74 ? 82  ARG D NH2   1 
ATOM   10046 N  N     . TYR D 2 71  ? -53.608  -38.634 -29.306 1.00 88.32  ? 83  TYR D N     1 
ATOM   10047 C  CA    . TYR D 2 71  ? -52.980  -39.283 -28.162 1.00 88.32  ? 83  TYR D CA    1 
ATOM   10048 C  C     . TYR D 2 71  ? -53.546  -40.679 -27.912 1.00 88.32  ? 83  TYR D C     1 
ATOM   10049 O  O     . TYR D 2 71  ? -53.310  -41.269 -26.859 1.00 88.32  ? 83  TYR D O     1 
ATOM   10050 C  CB    . TYR D 2 71  ? -53.137  -38.414 -26.912 1.00 88.32  ? 83  TYR D CB    1 
ATOM   10051 C  CG    . TYR D 2 71  ? -52.659  -36.991 -27.098 1.00 88.32  ? 83  TYR D CG    1 
ATOM   10052 C  CD1   . TYR D 2 71  ? -51.311  -36.675 -27.001 1.00 88.32  ? 83  TYR D CD1   1 
ATOM   10053 C  CD2   . TYR D 2 71  ? -53.554  -35.966 -27.372 1.00 88.32  ? 83  TYR D CD2   1 
ATOM   10054 C  CE1   . TYR D 2 71  ? -50.867  -35.377 -27.173 1.00 88.32  ? 83  TYR D CE1   1 
ATOM   10055 C  CE2   . TYR D 2 71  ? -53.119  -34.664 -27.543 1.00 88.32  ? 83  TYR D CE2   1 
ATOM   10056 C  CZ    . TYR D 2 71  ? -51.775  -34.376 -27.443 1.00 88.32  ? 83  TYR D CZ    1 
ATOM   10057 O  OH    . TYR D 2 71  ? -51.337  -33.083 -27.614 1.00 88.32  ? 83  TYR D OH    1 
ATOM   10058 N  N     . HIS D 2 72  ? -54.291  -41.201 -28.881 1.00 117.42 ? 84  HIS D N     1 
ATOM   10059 C  CA    . HIS D 2 72  ? -54.874  -42.535 -28.765 1.00 117.42 ? 84  HIS D CA    1 
ATOM   10060 C  C     . HIS D 2 72  ? -53.801  -43.616 -28.740 1.00 117.42 ? 84  HIS D C     1 
ATOM   10061 O  O     . HIS D 2 72  ? -53.921  -44.604 -28.018 1.00 117.42 ? 84  HIS D O     1 
ATOM   10062 C  CB    . HIS D 2 72  ? -55.845  -42.803 -29.916 1.00 117.42 ? 84  HIS D CB    1 
ATOM   10063 C  CG    . HIS D 2 72  ? -56.249  -44.238 -30.046 1.00 117.42 ? 84  HIS D CG    1 
ATOM   10064 N  ND1   . HIS D 2 72  ? -57.167  -44.834 -29.206 1.00 117.42 ? 84  HIS D ND1   1 
ATOM   10065 C  CD2   . HIS D 2 72  ? -55.859  -45.200 -30.916 1.00 117.42 ? 84  HIS D CD2   1 
ATOM   10066 C  CE1   . HIS D 2 72  ? -57.324  -46.098 -29.555 1.00 117.42 ? 84  HIS D CE1   1 
ATOM   10067 N  NE2   . HIS D 2 72  ? -56.542  -46.346 -30.590 1.00 117.42 ? 84  HIS D NE2   1 
ATOM   10068 N  N     . SER D 2 73  ? -52.756  -43.423 -29.536 1.00 58.82  ? 85  SER D N     1 
ATOM   10069 C  CA    . SER D 2 73  ? -51.670  -44.391 -29.624 1.00 58.82  ? 85  SER D CA    1 
ATOM   10070 C  C     . SER D 2 73  ? -50.862  -44.465 -28.330 1.00 58.82  ? 85  SER D C     1 
ATOM   10071 O  O     . SER D 2 73  ? -50.236  -45.484 -28.038 1.00 58.82  ? 85  SER D O     1 
ATOM   10072 C  CB    . SER D 2 73  ? -50.750  -44.050 -30.798 1.00 58.82  ? 85  SER D CB    1 
ATOM   10073 O  OG    . SER D 2 73  ? -50.311  -42.705 -30.725 1.00 58.82  ? 85  SER D OG    1 
ATOM   10074 N  N     . LEU D 2 74  ? -50.884  -43.384 -27.556 1.00 77.19  ? 86  LEU D N     1 
ATOM   10075 C  CA    . LEU D 2 74  ? -50.116  -43.304 -26.318 1.00 77.19  ? 86  LEU D CA    1 
ATOM   10076 C  C     . LEU D 2 74  ? -50.831  -43.982 -25.153 1.00 77.19  ? 86  LEU D C     1 
ATOM   10077 O  O     . LEU D 2 74  ? -50.242  -44.191 -24.096 1.00 77.19  ? 86  LEU D O     1 
ATOM   10078 C  CB    . LEU D 2 74  ? -49.838  -41.844 -25.960 1.00 77.19  ? 86  LEU D CB    1 
ATOM   10079 C  CG    . LEU D 2 74  ? -49.083  -41.005 -26.989 1.00 77.19  ? 86  LEU D CG    1 
ATOM   10080 C  CD1   . LEU D 2 74  ? -48.989  -39.564 -26.525 1.00 77.19  ? 86  LEU D CD1   1 
ATOM   10081 C  CD2   . LEU D 2 74  ? -47.701  -41.584 -27.232 1.00 77.19  ? 86  LEU D CD2   1 
ATOM   10082 N  N     . ALA D 2 75  ? -52.101  -44.320 -25.358 1.00 55.08  ? 87  ALA D N     1 
ATOM   10083 C  CA    . ALA D 2 75  ? -52.946  -44.892 -24.305 1.00 55.08  ? 87  ALA D CA    1 
ATOM   10084 C  C     . ALA D 2 75  ? -52.366  -46.065 -23.489 1.00 55.08  ? 87  ALA D C     1 
ATOM   10085 O  O     . ALA D 2 75  ? -52.433  -46.036 -22.260 1.00 55.08  ? 87  ALA D O     1 
ATOM   10086 C  CB    . ALA D 2 75  ? -54.333  -45.246 -24.858 1.00 55.08  ? 87  ALA D CB    1 
ATOM   10087 N  N     . PRO D 2 76  ? -51.804  -47.097 -24.157 1.00 58.73  ? 88  PRO D N     1 
ATOM   10088 C  CA    . PRO D 2 76  ? -51.315  -48.251 -23.389 1.00 58.73  ? 88  PRO D CA    1 
ATOM   10089 C  C     . PRO D 2 76  ? -50.256  -47.897 -22.344 1.00 58.73  ? 88  PRO D C     1 
ATOM   10090 O  O     . PRO D 2 76  ? -50.107  -48.623 -21.363 1.00 58.73  ? 88  PRO D O     1 
ATOM   10091 C  CB    . PRO D 2 76  ? -50.702  -49.151 -24.465 1.00 58.73  ? 88  PRO D CB    1 
ATOM   10092 C  CG    . PRO D 2 76  ? -51.421  -48.789 -25.710 1.00 58.73  ? 88  PRO D CG    1 
ATOM   10093 C  CD    . PRO D 2 76  ? -51.651  -47.314 -25.608 1.00 58.73  ? 88  PRO D CD    1 
ATOM   10094 N  N     . MET D 2 77  ? -49.536  -46.799 -22.557 1.00 67.29  ? 89  MET D N     1 
ATOM   10095 C  CA    . MET D 2 77  ? -48.537  -46.329 -21.602 1.00 67.29  ? 89  MET D CA    1 
ATOM   10096 C  C     . MET D 2 77  ? -49.157  -46.023 -20.239 1.00 67.29  ? 89  MET D C     1 
ATOM   10097 O  O     . MET D 2 77  ? -48.548  -46.264 -19.196 1.00 67.29  ? 89  MET D O     1 
ATOM   10098 C  CB    . MET D 2 77  ? -47.827  -45.087 -22.152 1.00 67.29  ? 89  MET D CB    1 
ATOM   10099 C  CG    . MET D 2 77  ? -46.999  -44.320 -21.130 1.00 67.29  ? 89  MET D CG    1 
ATOM   10100 S  SD    . MET D 2 77  ? -45.693  -43.321 -21.876 1.00 67.29  ? 89  MET D SD    1 
ATOM   10101 C  CE    . MET D 2 77  ? -46.650  -42.171 -22.861 1.00 67.29  ? 89  MET D CE    1 
ATOM   10102 N  N     . TYR D 2 78  ? -50.383  -45.514 -20.260 1.00 70.24  ? 90  TYR D N     1 
ATOM   10103 C  CA    . TYR D 2 78  ? -51.028  -45.011 -19.053 1.00 70.24  ? 90  TYR D CA    1 
ATOM   10104 C  C     . TYR D 2 78  ? -51.876  -46.055 -18.322 1.00 70.24  ? 90  TYR D C     1 
ATOM   10105 O  O     . TYR D 2 78  ? -51.937  -46.053 -17.093 1.00 70.24  ? 90  TYR D O     1 
ATOM   10106 C  CB    . TYR D 2 78  ? -51.868  -43.779 -19.393 1.00 70.24  ? 90  TYR D CB    1 
ATOM   10107 C  CG    . TYR D 2 78  ? -51.094  -42.721 -20.148 1.00 70.24  ? 90  TYR D CG    1 
ATOM   10108 C  CD1   . TYR D 2 78  ? -49.876  -42.252 -19.674 1.00 70.24  ? 90  TYR D CD1   1 
ATOM   10109 C  CD2   . TYR D 2 78  ? -51.571  -42.206 -21.346 1.00 70.24  ? 90  TYR D CD2   1 
ATOM   10110 C  CE1   . TYR D 2 78  ? -49.163  -41.290 -20.364 1.00 70.24  ? 90  TYR D CE1   1 
ATOM   10111 C  CE2   . TYR D 2 78  ? -50.864  -41.245 -22.043 1.00 70.24  ? 90  TYR D CE2   1 
ATOM   10112 C  CZ    . TYR D 2 78  ? -49.661  -40.791 -21.547 1.00 70.24  ? 90  TYR D CZ    1 
ATOM   10113 O  OH    . TYR D 2 78  ? -48.954  -39.835 -22.236 1.00 70.24  ? 90  TYR D OH    1 
ATOM   10114 N  N     . TYR D 2 79  ? -52.529  -46.942 -19.069 1.00 69.74  ? 91  TYR D N     1 
ATOM   10115 C  CA    . TYR D 2 79  ? -53.391  -47.947 -18.448 1.00 69.74  ? 91  TYR D CA    1 
ATOM   10116 C  C     . TYR D 2 79  ? -52.734  -49.322 -18.322 1.00 69.74  ? 91  TYR D C     1 
ATOM   10117 O  O     . TYR D 2 79  ? -53.404  -50.299 -17.989 1.00 69.74  ? 91  TYR D O     1 
ATOM   10118 C  CB    . TYR D 2 79  ? -54.746  -48.055 -19.172 1.00 69.74  ? 91  TYR D CB    1 
ATOM   10119 C  CG    . TYR D 2 79  ? -54.694  -48.594 -20.592 1.00 69.74  ? 91  TYR D CG    1 
ATOM   10120 C  CD1   . TYR D 2 79  ? -54.495  -49.948 -20.842 1.00 69.74  ? 91  TYR D CD1   1 
ATOM   10121 C  CD2   . TYR D 2 79  ? -54.884  -47.755 -21.681 1.00 69.74  ? 91  TYR D CD2   1 
ATOM   10122 C  CE1   . TYR D 2 79  ? -54.454  -50.442 -22.130 1.00 69.74  ? 91  TYR D CE1   1 
ATOM   10123 C  CE2   . TYR D 2 79  ? -54.849  -48.243 -22.974 1.00 69.74  ? 91  TYR D CE2   1 
ATOM   10124 C  CZ    . TYR D 2 79  ? -54.633  -49.587 -23.192 1.00 69.74  ? 91  TYR D CZ    1 
ATOM   10125 O  OH    . TYR D 2 79  ? -54.596  -50.079 -24.476 1.00 69.74  ? 91  TYR D OH    1 
ATOM   10126 N  N     . ARG D 2 80  ? -51.431  -49.393 -18.584 1.00 76.94  ? 92  ARG D N     1 
ATOM   10127 C  CA    . ARG D 2 80  ? -50.707  -50.663 -18.555 1.00 76.94  ? 92  ARG D CA    1 
ATOM   10128 C  C     . ARG D 2 80  ? -50.822  -51.370 -17.207 1.00 76.94  ? 92  ARG D C     1 
ATOM   10129 O  O     . ARG D 2 80  ? -51.625  -52.290 -17.045 1.00 76.94  ? 92  ARG D O     1 
ATOM   10130 C  CB    . ARG D 2 80  ? -49.233  -50.458 -18.907 1.00 76.94  ? 92  ARG D CB    1 
ATOM   10131 C  CG    . ARG D 2 80  ? -48.765  -51.249 -20.125 1.00 76.94  ? 92  ARG D CG    1 
ATOM   10132 C  CD    . ARG D 2 80  ? -47.423  -51.927 -19.879 1.00 76.94  ? 92  ARG D CD    1 
ATOM   10133 N  NE    . ARG D 2 80  ? -47.564  -53.144 -19.083 1.00 76.94  ? 92  ARG D NE    1 
ATOM   10134 C  CZ    . ARG D 2 80  ? -47.417  -53.201 -17.763 1.00 76.94  ? 92  ARG D CZ    1 
ATOM   10135 N  NH1   . ARG D 2 80  ? -47.116  -52.107 -17.077 1.00 76.94  ? 92  ARG D NH1   1 
ATOM   10136 N  NH2   . ARG D 2 80  ? -47.566  -54.354 -17.127 1.00 76.94  ? 92  ARG D NH2   1 
ATOM   10137 N  N     . GLY D 2 81  ? -50.015  -50.940 -16.243 1.00 39.50  ? 93  GLY D N     1 
ATOM   10138 C  CA    . GLY D 2 81  ? -50.055  -51.514 -14.911 1.00 39.50  ? 93  GLY D CA    1 
ATOM   10139 C  C     . GLY D 2 81  ? -51.005  -50.769 -13.994 1.00 39.50  ? 93  GLY D C     1 
ATOM   10140 O  O     . GLY D 2 81  ? -50.700  -50.543 -12.824 1.00 39.50  ? 93  GLY D O     1 
ATOM   10141 N  N     . ALA D 2 82  ? -52.161  -50.388 -14.527 1.00 71.55  ? 94  ALA D N     1 
ATOM   10142 C  CA    . ALA D 2 82  ? -53.154  -49.647 -13.757 1.00 71.55  ? 94  ALA D CA    1 
ATOM   10143 C  C     . ALA D 2 82  ? -54.121  -50.576 -13.026 1.00 71.55  ? 94  ALA D C     1 
ATOM   10144 O  O     . ALA D 2 82  ? -54.727  -51.458 -13.633 1.00 71.55  ? 94  ALA D O     1 
ATOM   10145 C  CB    . ALA D 2 82  ? -53.919  -48.697 -14.661 1.00 71.55  ? 94  ALA D CB    1 
ATOM   10146 N  N     . GLN D 2 83  ? -54.264  -50.364 -11.721 1.00 61.32  ? 95  GLN D N     1 
ATOM   10147 C  CA    . GLN D 2 83  ? -55.190  -51.146 -10.911 1.00 61.32  ? 95  GLN D CA    1 
ATOM   10148 C  C     . GLN D 2 83  ? -56.620  -50.659 -11.098 1.00 61.32  ? 95  GLN D C     1 
ATOM   10149 O  O     . GLN D 2 83  ? -57.575  -51.381 -10.806 1.00 61.32  ? 95  GLN D O     1 
ATOM   10150 C  CB    . GLN D 2 83  ? -54.817  -51.066 -9.429  1.00 61.32  ? 95  GLN D CB    1 
ATOM   10151 C  CG    . GLN D 2 83  ? -53.672  -51.974 -9.001  1.00 61.32  ? 95  GLN D CG    1 
ATOM   10152 C  CD    . GLN D 2 83  ? -52.340  -51.567 -9.596  1.00 61.32  ? 95  GLN D CD    1 
ATOM   10153 O  OE1   . GLN D 2 83  ? -52.034  -51.896 -10.741 1.00 61.32  ? 95  GLN D OE1   1 
ATOM   10154 N  NE2   . GLN D 2 83  ? -51.539  -50.847 -8.819  1.00 61.32  ? 95  GLN D NE2   1 
ATOM   10155 N  N     . ALA D 2 84  ? -56.762  -49.430 -11.582 1.00 52.16  ? 96  ALA D N     1 
ATOM   10156 C  CA    . ALA D 2 84  ? -58.076  -48.821 -11.746 1.00 52.16  ? 96  ALA D CA    1 
ATOM   10157 C  C     . ALA D 2 84  ? -58.125  -47.899 -12.958 1.00 52.16  ? 96  ALA D C     1 
ATOM   10158 O  O     . ALA D 2 84  ? -57.091  -47.541 -13.520 1.00 52.16  ? 96  ALA D O     1 
ATOM