data_4LT6
# 
_entry.id   4LT6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4LT6         
RCSB  RCSB081054   
WWPDB D_1000081054 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4LT6 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, Q.'    1 
'Nausch, L.'  2 
'Martin, G.'  3 
'Keller, W.'  4 
'Doublie, S.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human poly(a) polymerase gamma reveals a conserved catalytic core for canonical poly(a) polymerases.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            426 
_citation.page_first                43 
_citation.page_last                 50 
_citation.year                      2014 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24076191 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2013.09.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, Q.'     1 
primary 'Nausch, L.W.' 2 
primary 'Martin, G.'   3 
primary 'Keller, W.'   4 
primary 'Doublie, S.'  5 
# 
_cell.entry_id           4LT6 
_cell.length_a           68.870 
_cell.length_b           89.920 
_cell.length_c           201.630 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4LT6 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly(A) polymerase gamma'          59289.688 2  2.7.7.19 ? 'UNP residues 1-508' ? 
2 non-polymer syn "3'-DEOXYADENOSINE-5'-TRIPHOSPHATE" 491.182   2  ?        ? ?                    ? 
3 non-polymer syn 'CALCIUM ION'                       40.078    2  ?        ? ?                    ? 
4 water       nat water                               18.015    53 ?        ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;PAP-gamma, Neo-poly(A) polymerase, Neo-PAP, Polynucleotide adenylyltransferase gamma, SRP RNA 3'-adenylating enzyme
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHMKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEW
ISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVP
VIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRG
IYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPI
ITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVE
SKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNIN
MLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHMKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEW
ISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVP
VIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRG
IYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPI
ITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVE
SKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNIN
MLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   LYS n 
1 9   GLU n 
1 10  MET n 
1 11  SER n 
1 12  ALA n 
1 13  ASN n 
1 14  THR n 
1 15  VAL n 
1 16  LEU n 
1 17  ASP n 
1 18  SER n 
1 19  GLN n 
1 20  ARG n 
1 21  GLN n 
1 22  GLN n 
1 23  LYS n 
1 24  HIS n 
1 25  TYR n 
1 26  GLY n 
1 27  ILE n 
1 28  THR n 
1 29  SER n 
1 30  PRO n 
1 31  ILE n 
1 32  SER n 
1 33  LEU n 
1 34  ALA n 
1 35  SER n 
1 36  PRO n 
1 37  LYS n 
1 38  GLU n 
1 39  ILE n 
1 40  ASP n 
1 41  HIS n 
1 42  ILE n 
1 43  TYR n 
1 44  THR n 
1 45  GLN n 
1 46  LYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ASP n 
1 50  ALA n 
1 51  MET n 
1 52  LYS n 
1 53  PRO n 
1 54  PHE n 
1 55  GLY n 
1 56  VAL n 
1 57  PHE n 
1 58  GLU n 
1 59  ASP n 
1 60  GLU n 
1 61  GLU n 
1 62  GLU n 
1 63  LEU n 
1 64  ASN n 
1 65  HIS n 
1 66  ARG n 
1 67  LEU n 
1 68  VAL n 
1 69  VAL n 
1 70  LEU n 
1 71  GLY n 
1 72  LYS n 
1 73  LEU n 
1 74  ASN n 
1 75  ASN n 
1 76  LEU n 
1 77  VAL n 
1 78  LYS n 
1 79  GLU n 
1 80  TRP n 
1 81  ILE n 
1 82  SER n 
1 83  ASP n 
1 84  VAL n 
1 85  SER n 
1 86  GLU n 
1 87  SER n 
1 88  LYS n 
1 89  ASN n 
1 90  LEU n 
1 91  PRO n 
1 92  PRO n 
1 93  SER n 
1 94  VAL n 
1 95  VAL n 
1 96  ALA n 
1 97  THR n 
1 98  VAL n 
1 99  GLY n 
1 100 GLY n 
1 101 LYS n 
1 102 ILE n 
1 103 PHE n 
1 104 THR n 
1 105 PHE n 
1 106 GLY n 
1 107 SER n 
1 108 TYR n 
1 109 ARG n 
1 110 LEU n 
1 111 GLY n 
1 112 VAL n 
1 113 HIS n 
1 114 THR n 
1 115 LYS n 
1 116 GLY n 
1 117 ALA n 
1 118 ASP n 
1 119 ILE n 
1 120 ASP n 
1 121 ALA n 
1 122 LEU n 
1 123 CYS n 
1 124 VAL n 
1 125 ALA n 
1 126 PRO n 
1 127 ARG n 
1 128 HIS n 
1 129 VAL n 
1 130 GLU n 
1 131 ARG n 
1 132 SER n 
1 133 ASP n 
1 134 PHE n 
1 135 PHE n 
1 136 GLN n 
1 137 SER n 
1 138 PHE n 
1 139 PHE n 
1 140 GLU n 
1 141 LYS n 
1 142 LEU n 
1 143 LYS n 
1 144 HIS n 
1 145 GLN n 
1 146 ASP n 
1 147 GLY n 
1 148 ILE n 
1 149 ARG n 
1 150 ASN n 
1 151 LEU n 
1 152 ARG n 
1 153 ALA n 
1 154 VAL n 
1 155 GLU n 
1 156 ASP n 
1 157 ALA n 
1 158 PHE n 
1 159 VAL n 
1 160 PRO n 
1 161 VAL n 
1 162 ILE n 
1 163 LYS n 
1 164 PHE n 
1 165 GLU n 
1 166 PHE n 
1 167 ASP n 
1 168 GLY n 
1 169 ILE n 
1 170 GLU n 
1 171 ILE n 
1 172 ASP n 
1 173 LEU n 
1 174 VAL n 
1 175 PHE n 
1 176 ALA n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 ILE n 
1 181 GLN n 
1 182 THR n 
1 183 ILE n 
1 184 SER n 
1 185 ASP n 
1 186 ASN n 
1 187 LEU n 
1 188 ASP n 
1 189 LEU n 
1 190 ARG n 
1 191 ASP n 
1 192 ASP n 
1 193 SER n 
1 194 ARG n 
1 195 LEU n 
1 196 ARG n 
1 197 SER n 
1 198 LEU n 
1 199 ASP n 
1 200 ILE n 
1 201 ARG n 
1 202 CYS n 
1 203 ILE n 
1 204 ARG n 
1 205 SER n 
1 206 LEU n 
1 207 ASN n 
1 208 GLY n 
1 209 CYS n 
1 210 ARG n 
1 211 VAL n 
1 212 THR n 
1 213 ASP n 
1 214 GLU n 
1 215 ILE n 
1 216 LEU n 
1 217 HIS n 
1 218 LEU n 
1 219 VAL n 
1 220 PRO n 
1 221 ASN n 
1 222 LYS n 
1 223 GLU n 
1 224 THR n 
1 225 PHE n 
1 226 ARG n 
1 227 LEU n 
1 228 THR n 
1 229 LEU n 
1 230 ARG n 
1 231 ALA n 
1 232 VAL n 
1 233 LYS n 
1 234 LEU n 
1 235 TRP n 
1 236 ALA n 
1 237 LYS n 
1 238 ARG n 
1 239 ARG n 
1 240 GLY n 
1 241 ILE n 
1 242 TYR n 
1 243 SER n 
1 244 ASN n 
1 245 MET n 
1 246 LEU n 
1 247 GLY n 
1 248 PHE n 
1 249 LEU n 
1 250 GLY n 
1 251 GLY n 
1 252 VAL n 
1 253 SER n 
1 254 TRP n 
1 255 ALA n 
1 256 MET n 
1 257 LEU n 
1 258 VAL n 
1 259 ALA n 
1 260 ARG n 
1 261 THR n 
1 262 CYS n 
1 263 GLN n 
1 264 LEU n 
1 265 TYR n 
1 266 PRO n 
1 267 ASN n 
1 268 ALA n 
1 269 ALA n 
1 270 ALA n 
1 271 SER n 
1 272 THR n 
1 273 LEU n 
1 274 VAL n 
1 275 HIS n 
1 276 LYS n 
1 277 PHE n 
1 278 PHE n 
1 279 LEU n 
1 280 VAL n 
1 281 PHE n 
1 282 SER n 
1 283 LYS n 
1 284 TRP n 
1 285 GLU n 
1 286 TRP n 
1 287 PRO n 
1 288 ASN n 
1 289 PRO n 
1 290 VAL n 
1 291 LEU n 
1 292 LEU n 
1 293 LYS n 
1 294 GLN n 
1 295 PRO n 
1 296 GLU n 
1 297 GLU n 
1 298 SER n 
1 299 ASN n 
1 300 LEU n 
1 301 ASN n 
1 302 LEU n 
1 303 PRO n 
1 304 VAL n 
1 305 TRP n 
1 306 ASP n 
1 307 PRO n 
1 308 ARG n 
1 309 VAL n 
1 310 ASN n 
1 311 PRO n 
1 312 SER n 
1 313 ASP n 
1 314 ARG n 
1 315 TYR n 
1 316 HIS n 
1 317 LEU n 
1 318 MET n 
1 319 PRO n 
1 320 ILE n 
1 321 ILE n 
1 322 THR n 
1 323 PRO n 
1 324 ALA n 
1 325 TYR n 
1 326 PRO n 
1 327 GLN n 
1 328 GLN n 
1 329 ASN n 
1 330 SER n 
1 331 THR n 
1 332 TYR n 
1 333 ASN n 
1 334 VAL n 
1 335 SER n 
1 336 THR n 
1 337 SER n 
1 338 THR n 
1 339 ARG n 
1 340 THR n 
1 341 VAL n 
1 342 MET n 
1 343 VAL n 
1 344 GLU n 
1 345 GLU n 
1 346 PHE n 
1 347 LYS n 
1 348 GLN n 
1 349 GLY n 
1 350 LEU n 
1 351 ALA n 
1 352 VAL n 
1 353 THR n 
1 354 ASP n 
1 355 GLU n 
1 356 ILE n 
1 357 LEU n 
1 358 GLN n 
1 359 GLY n 
1 360 LYS n 
1 361 SER n 
1 362 ASP n 
1 363 TRP n 
1 364 SER n 
1 365 LYS n 
1 366 LEU n 
1 367 LEU n 
1 368 GLU n 
1 369 PRO n 
1 370 PRO n 
1 371 ASN n 
1 372 PHE n 
1 373 PHE n 
1 374 GLN n 
1 375 LYS n 
1 376 TYR n 
1 377 ARG n 
1 378 HIS n 
1 379 TYR n 
1 380 ILE n 
1 381 VAL n 
1 382 LEU n 
1 383 THR n 
1 384 ALA n 
1 385 SER n 
1 386 ALA n 
1 387 SER n 
1 388 THR n 
1 389 GLU n 
1 390 GLU n 
1 391 ASN n 
1 392 HIS n 
1 393 LEU n 
1 394 GLU n 
1 395 TRP n 
1 396 VAL n 
1 397 GLY n 
1 398 LEU n 
1 399 VAL n 
1 400 GLU n 
1 401 SER n 
1 402 LYS n 
1 403 ILE n 
1 404 ARG n 
1 405 VAL n 
1 406 LEU n 
1 407 VAL n 
1 408 GLY n 
1 409 ASN n 
1 410 LEU n 
1 411 GLU n 
1 412 ARG n 
1 413 ASN n 
1 414 GLU n 
1 415 PHE n 
1 416 ILE n 
1 417 THR n 
1 418 LEU n 
1 419 ALA n 
1 420 HIS n 
1 421 VAL n 
1 422 ASN n 
1 423 PRO n 
1 424 GLN n 
1 425 SER n 
1 426 PHE n 
1 427 PRO n 
1 428 GLY n 
1 429 ASN n 
1 430 LYS n 
1 431 GLU n 
1 432 HIS n 
1 433 HIS n 
1 434 LYS n 
1 435 ASP n 
1 436 ASN n 
1 437 ASN n 
1 438 TYR n 
1 439 VAL n 
1 440 SER n 
1 441 MET n 
1 442 TRP n 
1 443 PHE n 
1 444 LEU n 
1 445 GLY n 
1 446 ILE n 
1 447 ILE n 
1 448 PHE n 
1 449 ARG n 
1 450 ARG n 
1 451 VAL n 
1 452 GLU n 
1 453 ASN n 
1 454 ALA n 
1 455 GLU n 
1 456 SER n 
1 457 VAL n 
1 458 ASN n 
1 459 ILE n 
1 460 ASP n 
1 461 LEU n 
1 462 THR n 
1 463 TYR n 
1 464 ASP n 
1 465 ILE n 
1 466 GLN n 
1 467 SER n 
1 468 PHE n 
1 469 THR n 
1 470 ASP n 
1 471 THR n 
1 472 VAL n 
1 473 TYR n 
1 474 ARG n 
1 475 GLN n 
1 476 ALA n 
1 477 ASN n 
1 478 ASN n 
1 479 ILE n 
1 480 ASN n 
1 481 MET n 
1 482 LEU n 
1 483 LYS n 
1 484 GLU n 
1 485 GLY n 
1 486 MET n 
1 487 LYS n 
1 488 ILE n 
1 489 GLU n 
1 490 ALA n 
1 491 THR n 
1 492 HIS n 
1 493 VAL n 
1 494 LYS n 
1 495 LYS n 
1 496 LYS n 
1 497 GLN n 
1 498 LEU n 
1 499 HIS n 
1 500 HIS n 
1 501 TYR n 
1 502 LEU n 
1 503 PRO n 
1 504 ALA n 
1 505 GLU n 
1 506 ILE n 
1 507 LEU n 
1 508 GLN n 
1 509 LYS n 
1 510 LYS n 
1 511 LYS n 
1 512 LYS n 
1 513 GLN n 
1 514 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PAPOLG, PAP2, PAPG' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PAPOG_HUMAN 
_struct_ref.pdbx_db_accession          Q9BWT3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSE
SKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEF
DGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNML
GFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYP
QQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVL
VGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGM
KIEATHVKKKQLHHYLPAEILQKKKKQS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4LT6 A 7 ? 514 ? Q9BWT3 1 ? 508 ? 1 508 
2 1 4LT6 B 7 ? 514 ? Q9BWT3 1 ? 508 ? 1 508 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4LT6 HIS A 1 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -5 1  
1 4LT6 HIS A 2 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -4 2  
1 4LT6 HIS A 3 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -3 3  
1 4LT6 HIS A 4 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -2 4  
1 4LT6 HIS A 5 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -1 5  
1 4LT6 HIS A 6 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' 0  6  
2 4LT6 HIS B 1 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -5 7  
2 4LT6 HIS B 2 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -4 8  
2 4LT6 HIS B 3 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -3 9  
2 4LT6 HIS B 4 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -2 10 
2 4LT6 HIS B 5 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' -1 11 
2 4LT6 HIS B 6 ? UNP Q9BWT3 ? ? 'EXPRESSION TAG' 0  12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3AT non-polymer         . "3'-DEOXYADENOSINE-5'-TRIPHOSPHATE" 'CORDYCEPIN TRIPHOSPHATE' 'C10 H16 N5 O12 P3' 491.182 
ALA 'L-peptide linking' y ALANINE                             ?                         'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                            ?                         'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ?                         'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ?                         'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                       ?                         'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                            ?                         'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ?                         'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ?                         'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                             ?                         'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                           ?                         'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                               ?                         'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ?                         'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                             ?                         'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                              ?                         'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                          ?                         'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ?                         'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                             ?                         'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                              ?                         'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                           ?                         'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ?                         'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                            ?                         'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                              ?                         'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4LT6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   53.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20%(W/V) PEG 8000, 50mM Tris-HCl, 100mM (NH4)2SO4, 5mM CaCl2, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2003-03-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Xenocs mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4LT6 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.79 
_reflns.number_obs                   31418 
_reflns.number_all                   32026 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1 2.79 2.97  89.5 ? ? ? ? ? ? ? ? ? ? 
1 2 2.97 3.20  99.4 ? ? ? ? ? ? ? ? ? ? 
1 3 3.2  3.52  100  ? ? ? ? ? ? ? ? ? ? 
1 4 3.52 4.03  100  ? ? ? ? ? ? ? ? ? ? 
1 5 4.03 5.06  100  ? ? ? ? ? ? ? ? ? ? 
1 6 5.06 20.00 99.7 ? ? ? ? ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4LT6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     29444 
_refine.ls_number_reflns_all                     32026 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.884 
_refine.ls_d_res_high                            2.79 
_refine.ls_percent_reflns_obs                    95.66 
_refine.ls_R_factor_obs                          0.1962 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1930 
_refine.ls_R_factor_R_free                       0.2574 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.84 
_refine.ls_number_reflns_R_free                  2784 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            6.8225 
_refine.aniso_B[2][2]                            -0.1153 
_refine.aniso_B[3][3]                            -6.7072 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1Q78' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.pdbx_overall_phase_error                 27.40 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7529 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             53 
_refine_hist.number_atoms_total               7644 
_refine_hist.d_res_high                       2.79 
_refine_hist.d_res_low                        19.884 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 7777  'X-RAY DIFFRACTION' ? 
f_angle_d          1.250  ? ? 10564 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.905 ? ? 2914  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.085  ? ? 1175  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 1336  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.79   2.8360  1861 0.3150 64.00  0.3748 . . 68  . . . . 
'X-RAY DIFFRACTION' . 2.8360 2.8875  2326 0.2805 81.00  0.3774 . . 113 . . . . 
'X-RAY DIFFRACTION' . 2.8875 2.9428  2463 0.2847 88.00  0.3360 . . 127 . . . . 
'X-RAY DIFFRACTION' . 2.9428 3.0027  2676 0.2809 92.00  0.3249 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.0027 3.0678  2709 0.2534 95.00  0.3135 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.0678 3.1388  2824 0.2627 98.00  0.3335 . . 131 . . . . 
'X-RAY DIFFRACTION' . 3.1388 3.2170  2829 0.2621 99.00  0.3071 . . 173 . . . . 
'X-RAY DIFFRACTION' . 3.2170 3.3036  2815 0.2594 99.00  0.3952 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.3036 3.4004  2831 0.2417 100.00 0.3622 . . 163 . . . . 
'X-RAY DIFFRACTION' . 3.4004 3.5096  2831 0.2258 100.00 0.2726 . . 159 . . . . 
'X-RAY DIFFRACTION' . 3.5096 3.6343  2894 0.2117 100.00 0.2667 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.6343 3.7788  2878 0.1813 100.00 0.2693 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.7788 3.9495  2854 0.1650 100.00 0.2258 . . 133 . . . . 
'X-RAY DIFFRACTION' . 3.9495 4.1560  2840 0.1606 100.00 0.2004 . . 153 . . . . 
'X-RAY DIFFRACTION' . 4.1560 4.4137  2880 0.1539 100.00 0.2458 . . 120 . . . . 
'X-RAY DIFFRACTION' . 4.4137 4.7502  2858 0.1483 100.00 0.2125 . . 163 . . . . 
'X-RAY DIFFRACTION' . 4.7502 5.2203  2858 0.1485 100.00 0.2217 . . 152 . . . . 
'X-RAY DIFFRACTION' . 5.2203 5.9579  2852 0.1616 100.00 0.2075 . . 167 . . . . 
'X-RAY DIFFRACTION' . 5.9579 7.4404  2871 0.1704 100.00 0.2120 . . 138 . . . . 
'X-RAY DIFFRACTION' . 7.4404 19.8847 2825 0.1491 99.00  0.1826 . . 138 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4LT6 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4LT6 
_struct.title                     'Crystal Structure of human poly(A) polymerase gamma' 
_struct.pdbx_descriptor           'Poly(A) polymerase gamma (E.C.2.7.7.19)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4LT6 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Poly(A) polymerase, PAP, polymerase, polyadenylation, 3' processing, mRNA processing, Nucleus, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 37  ? LYS A 52  ? LYS A 31  LYS A 46  1 ? 16 
HELX_P HELX_P2  2  PRO A 53  ? GLY A 55  ? PRO A 47  GLY A 49  5 ? 3  
HELX_P HELX_P3  3  ASP A 59  ? SER A 85  ? ASP A 53  SER A 79  1 ? 27 
HELX_P HELX_P4  4  PRO A 91  ? ALA A 96  ? PRO A 85  ALA A 90  1 ? 6  
HELX_P HELX_P5  5  GLY A 106 ? GLY A 111 ? GLY A 100 GLY A 105 1 ? 6  
HELX_P HELX_P6  6  GLU A 130 ? GLN A 145 ? GLU A 124 GLN A 139 1 ? 16 
HELX_P HELX_P7  7  ASP A 191 ? ARG A 196 ? ASP A 185 ARG A 190 5 ? 6  
HELX_P HELX_P8  8  ASP A 199 ? LEU A 218 ? ASP A 193 LEU A 212 1 ? 20 
HELX_P HELX_P9  9  ASN A 221 ? ARG A 239 ? ASN A 215 ARG A 233 1 ? 19 
HELX_P HELX_P10 10 GLY A 250 ? TYR A 265 ? GLY A 244 TYR A 259 1 ? 16 
HELX_P HELX_P11 11 ALA A 269 ? TRP A 284 ? ALA A 263 TRP A 278 1 ? 16 
HELX_P HELX_P12 12 SER A 312 ? HIS A 316 ? SER A 306 HIS A 310 5 ? 5  
HELX_P HELX_P13 13 SER A 335 ? LEU A 357 ? SER A 329 LEU A 351 1 ? 23 
HELX_P HELX_P14 14 ASP A 362 ? GLU A 368 ? ASP A 356 GLU A 362 1 ? 7  
HELX_P HELX_P15 15 THR A 388 ? SER A 401 ? THR A 382 SER A 395 1 ? 14 
HELX_P HELX_P16 16 LYS A 402 ? ASN A 413 ? LYS A 396 ASN A 407 1 ? 12 
HELX_P HELX_P17 17 LEU A 461 ? ILE A 479 ? LEU A 455 ILE A 473 1 ? 19 
HELX_P HELX_P18 18 GLN A 497 ? TYR A 501 ? GLN A 491 TYR A 495 5 ? 5  
HELX_P HELX_P19 19 LYS B 37  ? LYS B 52  ? LYS B 31  LYS B 46  1 ? 16 
HELX_P HELX_P20 20 PRO B 53  ? GLY B 55  ? PRO B 47  GLY B 49  5 ? 3  
HELX_P HELX_P21 21 ASP B 59  ? ASN B 89  ? ASP B 53  ASN B 83  1 ? 31 
HELX_P HELX_P22 22 GLY B 106 ? GLY B 111 ? GLY B 100 GLY B 105 1 ? 6  
HELX_P HELX_P23 23 GLU B 130 ? GLN B 136 ? GLU B 124 GLN B 130 1 ? 7  
HELX_P HELX_P24 24 PHE B 138 ? HIS B 144 ? PHE B 132 HIS B 138 1 ? 7  
HELX_P HELX_P25 25 ASP B 191 ? ARG B 196 ? ASP B 185 ARG B 190 5 ? 6  
HELX_P HELX_P26 26 ASP B 199 ? LEU B 218 ? ASP B 193 LEU B 212 1 ? 20 
HELX_P HELX_P27 27 ASN B 221 ? ARG B 239 ? ASN B 215 ARG B 233 1 ? 19 
HELX_P HELX_P28 28 GLY B 250 ? TYR B 265 ? GLY B 244 TYR B 259 1 ? 16 
HELX_P HELX_P29 29 ALA B 269 ? SER B 282 ? ALA B 263 SER B 276 1 ? 14 
HELX_P HELX_P30 30 ASN B 310 ? HIS B 316 ? ASN B 304 HIS B 310 5 ? 7  
HELX_P HELX_P31 31 SER B 335 ? GLN B 358 ? SER B 329 GLN B 352 1 ? 24 
HELX_P HELX_P32 32 ASP B 362 ? LEU B 367 ? ASP B 356 LEU B 361 1 ? 6  
HELX_P HELX_P33 33 ASN B 371 ? LYS B 375 ? ASN B 365 LYS B 369 5 ? 5  
HELX_P HELX_P34 34 THR B 388 ? SER B 401 ? THR B 382 SER B 395 1 ? 14 
HELX_P HELX_P35 35 LYS B 402 ? ASN B 413 ? LYS B 396 ASN B 407 1 ? 12 
HELX_P HELX_P36 36 LEU B 461 ? ILE B 479 ? LEU B 455 ILE B 473 1 ? 19 
HELX_P HELX_P37 37 LYS B 496 ? TYR B 501 ? LYS B 490 TYR B 495 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E 3AT .   O1G ? ? ? 1_555 F CA . CA ? ? B 3AT 601 B CA 602 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc2  metalc ? ? C 3AT .   O2G ? ? ? 1_555 D CA . CA ? ? A 3AT 601 A CA 602 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc3  metalc ? ? A ASP 120 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 114 A CA 602 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc4  metalc ? ? E 3AT .   O1B ? ? ? 1_555 F CA . CA ? ? B 3AT 601 B CA 602 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc5  metalc ? ? A ASP 118 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 112 A CA 602 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc6  metalc ? ? C 3AT .   O1B ? ? ? 1_555 D CA . CA ? ? A 3AT 601 A CA 602 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc7  metalc ? ? B ASP 120 OD2 ? ? ? 1_555 F CA . CA ? ? B ASP 114 B CA 602 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc8  metalc ? ? B ASP 118 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 112 B CA 602 1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc9  metalc ? ? E 3AT .   O1A ? ? ? 1_555 F CA . CA ? ? B 3AT 601 B CA 602 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc10 metalc ? ? C 3AT .   O1A ? ? ? 1_555 D CA . CA ? ? A 3AT 601 A CA 602 1_555 ? ? ? ? ? ? ? 2.885 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 286 A . ? TRP 280 A PRO 287 A ? PRO 281 A 1 0.74  
2 TYR 325 A . ? TYR 319 A PRO 326 A ? PRO 320 A 1 -1.97 
3 TRP 286 B . ? TRP 280 B PRO 287 B ? PRO 281 B 1 0.93  
4 TYR 325 B . ? TYR 319 B PRO 326 B ? PRO 320 B 1 -3.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 101 ? PHE A 105 ? LYS A 95  PHE A 99  
A 2 ILE A 119 ? ALA A 125 ? ILE A 113 ALA A 119 
A 3 ILE A 169 ? ARG A 177 ? ILE A 163 ARG A 171 
A 4 VAL A 161 ? PHE A 166 ? VAL A 155 PHE A 160 
A 5 ILE A 148 ? VAL A 154 ? ILE A 142 VAL A 148 
B 1 ILE A 416 ? PHE A 426 ? ILE A 410 PHE A 420 
B 2 TYR A 438 ? PHE A 448 ? TYR A 432 PHE A 442 
B 3 HIS A 378 ? ALA A 386 ? HIS A 372 ALA A 380 
B 4 LYS A 487 ? LYS A 494 ? LYS A 481 LYS A 488 
C 1 LYS B 101 ? PHE B 105 ? LYS B 95  PHE B 99  
C 2 ILE B 119 ? ALA B 125 ? ILE B 113 ALA B 119 
C 3 ILE B 169 ? ARG B 177 ? ILE B 163 ARG B 171 
C 4 VAL B 161 ? PHE B 166 ? VAL B 155 PHE B 160 
C 5 ARG B 152 ? VAL B 154 ? ARG B 146 VAL B 148 
D 1 ILE B 416 ? VAL B 421 ? ILE B 410 VAL B 415 
D 2 TYR B 438 ? PHE B 448 ? TYR B 432 PHE B 442 
D 3 HIS B 378 ? ALA B 386 ? HIS B 372 ALA B 380 
D 4 LYS B 487 ? LYS B 494 ? LYS B 481 LYS B 488 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 103 ? N PHE A 97  O LEU A 122 ? O LEU A 116 
A 2 3 N CYS A 123 ? N CYS A 117 O VAL A 174 ? O VAL A 168 
A 3 4 O ILE A 171 ? O ILE A 165 N PHE A 164 ? N PHE A 158 
A 4 5 O GLU A 165 ? O GLU A 159 N ARG A 149 ? N ARG A 143 
B 1 2 N THR A 417 ? N THR A 411 O ILE A 447 ? O ILE A 441 
B 2 3 O SER A 440 ? O SER A 434 N ALA A 384 ? N ALA A 378 
B 3 4 N SER A 385 ? N SER A 379 O LYS A 487 ? O LYS A 481 
C 1 2 N PHE B 103 ? N PHE B 97  O LEU B 122 ? O LEU B 116 
C 2 3 N CYS B 123 ? N CYS B 117 O VAL B 174 ? O VAL B 168 
C 3 4 O ILE B 171 ? O ILE B 165 N PHE B 164 ? N PHE B 158 
C 4 5 O VAL B 161 ? O VAL B 155 N VAL B 154 ? N VAL B 148 
D 1 2 N HIS B 420 ? N HIS B 414 O GLY B 445 ? O GLY B 439 
D 2 3 O SER B 440 ? O SER B 434 N ALA B 384 ? N ALA B 378 
D 3 4 N VAL B 381 ? N VAL B 375 O THR B 491 ? O THR B 485 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 3AT A 601' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 602'  
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 3AT B 601' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA B 602'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 PHE A 105 ? PHE A 99  . ? 1_555 ? 
2  AC1 17 GLY A 106 ? GLY A 100 . ? 1_555 ? 
3  AC1 17 SER A 107 ? SER A 101 . ? 1_555 ? 
4  AC1 17 ASP A 118 ? ASP A 112 . ? 1_555 ? 
5  AC1 17 ASP A 120 ? ASP A 114 . ? 1_555 ? 
6  AC1 17 ASN A 207 ? ASN A 201 . ? 1_555 ? 
7  AC1 17 VAL A 211 ? VAL A 205 . ? 1_555 ? 
8  AC1 17 LYS A 233 ? LYS A 227 . ? 1_555 ? 
9  AC1 17 TYR A 242 ? TYR A 236 . ? 1_555 ? 
10 AC1 17 VAL A 252 ? VAL A 246 . ? 1_555 ? 
11 AC1 17 THR A 322 ? THR A 316 . ? 1_555 ? 
12 AC1 17 SER A 330 ? SER A 324 . ? 1_555 ? 
13 AC1 17 CA  D .   ? CA  A 602 . ? 1_555 ? 
14 AC1 17 HOH G .   ? HOH A 714 . ? 1_555 ? 
15 AC1 17 HOH G .   ? HOH A 715 . ? 1_555 ? 
16 AC1 17 HOH G .   ? HOH A 726 . ? 1_555 ? 
17 AC1 17 HOH G .   ? HOH A 727 . ? 1_555 ? 
18 AC2 3  ASP A 118 ? ASP A 112 . ? 1_555 ? 
19 AC2 3  ASP A 120 ? ASP A 114 . ? 1_555 ? 
20 AC2 3  3AT C .   ? 3AT A 601 . ? 1_555 ? 
21 AC3 14 PHE B 105 ? PHE B 99  . ? 1_555 ? 
22 AC3 14 GLY B 106 ? GLY B 100 . ? 1_555 ? 
23 AC3 14 SER B 107 ? SER B 101 . ? 1_555 ? 
24 AC3 14 ASP B 120 ? ASP B 114 . ? 1_555 ? 
25 AC3 14 ASN B 207 ? ASN B 201 . ? 1_555 ? 
26 AC3 14 LYS B 233 ? LYS B 227 . ? 1_555 ? 
27 AC3 14 TYR B 242 ? TYR B 236 . ? 1_555 ? 
28 AC3 14 VAL B 252 ? VAL B 246 . ? 1_555 ? 
29 AC3 14 THR B 322 ? THR B 316 . ? 1_555 ? 
30 AC3 14 SER B 330 ? SER B 324 . ? 1_555 ? 
31 AC3 14 CA  F .   ? CA  B 602 . ? 1_555 ? 
32 AC3 14 HOH H .   ? HOH B 723 . ? 1_555 ? 
33 AC3 14 HOH H .   ? HOH B 724 . ? 1_555 ? 
34 AC3 14 HOH H .   ? HOH B 726 . ? 1_555 ? 
35 AC4 3  ASP B 118 ? ASP B 112 . ? 1_555 ? 
36 AC4 3  ASP B 120 ? ASP B 114 . ? 1_555 ? 
37 AC4 3  3AT E .   ? 3AT B 601 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4LT6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4LT6 
_atom_sites.fract_transf_matrix[1][1]   0.014520 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011121 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004960 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 23  ? 15.252  7.627   -23.419 1.00 41.14  ? 17  LYS A N     1 
ATOM   2    C  CA    . LYS A 1 23  ? 14.471  7.302   -22.219 1.00 47.92  ? 17  LYS A CA    1 
ATOM   3    C  C     . LYS A 1 23  ? 13.149  6.539   -22.498 1.00 43.44  ? 17  LYS A C     1 
ATOM   4    O  O     . LYS A 1 23  ? 13.079  5.325   -22.322 1.00 36.91  ? 17  LYS A O     1 
ATOM   5    C  CB    . LYS A 1 23  ? 14.211  8.565   -21.393 1.00 41.41  ? 17  LYS A CB    1 
ATOM   6    C  CG    . LYS A 1 23  ? 13.508  8.278   -20.081 1.00 53.56  ? 17  LYS A CG    1 
ATOM   7    C  CD    . LYS A 1 23  ? 14.168  7.109   -19.339 1.00 49.42  ? 17  LYS A CD    1 
ATOM   8    C  CE    . LYS A 1 23  ? 13.369  6.734   -18.092 1.00 52.37  ? 17  LYS A CE    1 
ATOM   9    N  NZ    . LYS A 1 23  ? 13.994  5.615   -17.348 1.00 48.82  ? 17  LYS A NZ    1 
ATOM   10   N  N     . HIS A 1 24  ? 12.103  7.260   -22.897 1.00 43.89  ? 18  HIS A N     1 
ATOM   11   C  CA    . HIS A 1 24  ? 10.894  6.654   -23.464 1.00 30.85  ? 18  HIS A CA    1 
ATOM   12   C  C     . HIS A 1 24  ? 11.122  6.529   -24.972 1.00 27.04  ? 18  HIS A C     1 
ATOM   13   O  O     . HIS A 1 24  ? 12.260  6.589   -25.419 1.00 29.65  ? 18  HIS A O     1 
ATOM   14   C  CB    . HIS A 1 24  ? 9.702   7.553   -23.196 1.00 27.83  ? 18  HIS A CB    1 
ATOM   15   C  CG    . HIS A 1 24  ? 9.903   8.963   -23.670 1.00 37.67  ? 18  HIS A CG    1 
ATOM   16   N  ND1   . HIS A 1 24  ? 10.587  9.906   -22.932 1.00 37.39  ? 18  HIS A ND1   1 
ATOM   17   C  CD2   . HIS A 1 24  ? 9.525   9.583   -24.816 1.00 33.59  ? 18  HIS A CD2   1 
ATOM   18   C  CE1   . HIS A 1 24  ? 10.609  11.048  -23.598 1.00 38.96  ? 18  HIS A CE1   1 
ATOM   19   N  NE2   . HIS A 1 24  ? 9.972   10.880  -24.744 1.00 30.12  ? 18  HIS A NE2   1 
ATOM   20   N  N     . TYR A 1 25  ? 10.070  6.395   -25.772 1.00 27.46  ? 19  TYR A N     1 
ATOM   21   C  CA    . TYR A 1 25  ? 10.291  6.206   -27.212 1.00 26.40  ? 19  TYR A CA    1 
ATOM   22   C  C     . TYR A 1 25  ? 10.102  7.373   -28.200 1.00 28.77  ? 19  TYR A C     1 
ATOM   23   O  O     . TYR A 1 25  ? 11.073  7.800   -28.826 1.00 42.04  ? 19  TYR A O     1 
ATOM   24   C  CB    . TYR A 1 25  ? 9.609   4.938   -27.720 1.00 28.66  ? 19  TYR A CB    1 
ATOM   25   C  CG    . TYR A 1 25  ? 10.432  3.694   -27.447 1.00 35.27  ? 19  TYR A CG    1 
ATOM   26   C  CD1   . TYR A 1 25  ? 11.366  3.227   -28.376 1.00 33.81  ? 19  TYR A CD1   1 
ATOM   27   C  CD2   . TYR A 1 25  ? 10.299  3.003   -26.248 1.00 29.77  ? 19  TYR A CD2   1 
ATOM   28   C  CE1   . TYR A 1 25  ? 12.127  2.085   -28.116 1.00 35.73  ? 19  TYR A CE1   1 
ATOM   29   C  CE2   . TYR A 1 25  ? 11.048  1.871   -25.986 1.00 32.62  ? 19  TYR A CE2   1 
ATOM   30   C  CZ    . TYR A 1 25  ? 11.954  1.412   -26.918 1.00 39.13  ? 19  TYR A CZ    1 
ATOM   31   O  OH    . TYR A 1 25  ? 12.687  0.280   -26.632 1.00 45.44  ? 19  TYR A OH    1 
ATOM   32   N  N     . GLY A 1 26  ? 8.884   7.875   -28.374 1.00 22.55  ? 20  GLY A N     1 
ATOM   33   C  CA    . GLY A 1 26  ? 8.636   8.853   -29.432 1.00 23.31  ? 20  GLY A CA    1 
ATOM   34   C  C     . GLY A 1 26  ? 9.251   10.240  -29.272 1.00 19.33  ? 20  GLY A C     1 
ATOM   35   O  O     . GLY A 1 26  ? 10.113  10.445  -28.432 1.00 17.77  ? 20  GLY A O     1 
ATOM   36   N  N     . ILE A 1 27  ? 8.805   11.199  -30.084 1.00 19.20  ? 21  ILE A N     1 
ATOM   37   C  CA    . ILE A 1 27  ? 9.250   12.583  -29.935 1.00 17.24  ? 21  ILE A CA    1 
ATOM   38   C  C     . ILE A 1 27  ? 8.658   13.256  -28.708 1.00 22.82  ? 21  ILE A C     1 
ATOM   39   O  O     . ILE A 1 27  ? 9.104   14.329  -28.319 1.00 28.11  ? 21  ILE A O     1 
ATOM   40   C  CB    . ILE A 1 27  ? 8.854   13.485  -31.119 1.00 16.88  ? 21  ILE A CB    1 
ATOM   41   C  CG1   . ILE A 1 27  ? 7.389   13.288  -31.476 1.00 14.99  ? 21  ILE A CG1   1 
ATOM   42   C  CG2   . ILE A 1 27  ? 9.753   13.275  -32.306 1.00 17.93  ? 21  ILE A CG2   1 
ATOM   43   C  CD1   . ILE A 1 27  ? 6.990   14.027  -32.719 1.00 17.64  ? 21  ILE A CD1   1 
ATOM   44   N  N     . THR A 1 28  ? 7.627   12.665  -28.121 1.00 19.12  ? 22  THR A N     1 
ATOM   45   C  CA    . THR A 1 28  ? 6.997   13.284  -26.970 1.00 17.13  ? 22  THR A CA    1 
ATOM   46   C  C     . THR A 1 28  ? 7.050   12.300  -25.837 1.00 20.38  ? 22  THR A C     1 
ATOM   47   O  O     . THR A 1 28  ? 7.152   11.100  -26.059 1.00 25.36  ? 22  THR A O     1 
ATOM   48   C  CB    . THR A 1 28  ? 5.525   13.623  -27.232 1.00 17.00  ? 22  THR A CB    1 
ATOM   49   O  OG1   . THR A 1 28  ? 4.737   12.440  -27.084 1.00 21.97  ? 22  THR A OG1   1 
ATOM   50   C  CG2   . THR A 1 28  ? 5.337   14.169  -28.627 1.00 14.97  ? 22  THR A CG2   1 
ATOM   51   N  N     . SER A 1 29  ? 6.994   12.795  -24.615 1.00 19.59  ? 23  SER A N     1 
ATOM   52   C  CA    . SER A 1 29  ? 6.894   11.888  -23.500 1.00 23.64  ? 23  SER A CA    1 
ATOM   53   C  C     . SER A 1 29  ? 5.492   11.319  -23.609 1.00 20.98  ? 23  SER A C     1 
ATOM   54   O  O     . SER A 1 29  ? 4.609   11.967  -24.160 1.00 22.03  ? 23  SER A O     1 
ATOM   55   C  CB    . SER A 1 29  ? 7.141   12.604  -22.164 1.00 31.49  ? 23  SER A CB    1 
ATOM   56   O  OG    . SER A 1 29  ? 6.074   13.464  -21.817 1.00 35.52  ? 23  SER A OG    1 
ATOM   57   N  N     . PRO A 1 30  ? 5.295   10.085  -23.140 1.00 21.29  ? 24  PRO A N     1 
ATOM   58   C  CA    . PRO A 1 30  ? 4.009   9.409   -23.338 1.00 22.23  ? 24  PRO A CA    1 
ATOM   59   C  C     . PRO A 1 30  ? 2.832   9.969   -22.537 1.00 17.56  ? 24  PRO A C     1 
ATOM   60   O  O     . PRO A 1 30  ? 3.002   10.663  -21.546 1.00 18.93  ? 24  PRO A O     1 
ATOM   61   C  CB    . PRO A 1 30  ? 4.308   7.957   -22.941 1.00 19.05  ? 24  PRO A CB    1 
ATOM   62   C  CG    . PRO A 1 30  ? 5.553   8.021   -22.144 1.00 26.21  ? 24  PRO A CG    1 
ATOM   63   C  CD    . PRO A 1 30  ? 6.339   9.156   -22.685 1.00 24.34  ? 24  PRO A CD    1 
ATOM   64   N  N     . ILE A 1 31  ? 1.632   9.645   -23.001 1.00 18.91  ? 25  ILE A N     1 
ATOM   65   C  CA    . ILE A 1 31  ? 0.394   10.122  -22.403 1.00 19.63  ? 25  ILE A CA    1 
ATOM   66   C  C     . ILE A 1 31  ? 0.108   9.457   -21.052 1.00 19.36  ? 25  ILE A C     1 
ATOM   67   O  O     . ILE A 1 31  ? -0.384  10.109  -20.137 1.00 29.96  ? 25  ILE A O     1 
ATOM   68   C  CB    . ILE A 1 31  ? -0.796  9.930   -23.388 1.00 14.51  ? 25  ILE A CB    1 
ATOM   69   C  CG1   . ILE A 1 31  ? -0.766  11.010  -24.470 1.00 13.90  ? 25  ILE A CG1   1 
ATOM   70   C  CG2   . ILE A 1 31  ? -2.128  9.957   -22.672 1.00 13.82  ? 25  ILE A CG2   1 
ATOM   71   C  CD1   . ILE A 1 31  ? -1.747  10.773  -25.599 1.00 13.24  ? 25  ILE A CD1   1 
ATOM   72   N  N     . SER A 1 32  ? 0.426   8.173   -20.919 1.00 13.06  ? 26  SER A N     1 
ATOM   73   C  CA    . SER A 1 32  ? 0.119   7.443   -19.689 1.00 15.00  ? 26  SER A CA    1 
ATOM   74   C  C     . SER A 1 32  ? 0.906   6.158   -19.570 1.00 11.40  ? 26  SER A C     1 
ATOM   75   O  O     . SER A 1 32  ? 1.114   5.460   -20.556 1.00 18.39  ? 26  SER A O     1 
ATOM   76   C  CB    . SER A 1 32  ? -1.369  7.098   -19.615 1.00 21.72  ? 26  SER A CB    1 
ATOM   77   O  OG    . SER A 1 32  ? -1.621  6.113   -18.618 1.00 17.43  ? 26  SER A OG    1 
ATOM   78   N  N     . LEU A 1 33  ? 1.317   5.827   -18.356 1.00 9.09   ? 27  LEU A N     1 
ATOM   79   C  CA    . LEU A 1 33  ? 2.063   4.600   -18.134 1.00 9.29   ? 27  LEU A CA    1 
ATOM   80   C  C     . LEU A 1 33  ? 1.207   3.493   -17.533 1.00 9.87   ? 27  LEU A C     1 
ATOM   81   O  O     . LEU A 1 33  ? 1.738   2.516   -17.020 1.00 10.39  ? 27  LEU A O     1 
ATOM   82   C  CB    . LEU A 1 33  ? 3.261   4.865   -17.242 1.00 9.15   ? 27  LEU A CB    1 
ATOM   83   C  CG    . LEU A 1 33  ? 4.323   5.783   -17.825 1.00 6.36   ? 27  LEU A CG    1 
ATOM   84   C  CD1   . LEU A 1 33  ? 5.537   5.763   -16.936 1.00 8.29   ? 27  LEU A CD1   1 
ATOM   85   C  CD2   . LEU A 1 33  ? 4.682   5.291   -19.183 1.00 7.29   ? 27  LEU A CD2   1 
ATOM   86   N  N     . ALA A 1 34  ? -0.112  3.644   -17.622 1.00 9.41   ? 28  ALA A N     1 
ATOM   87   C  CA    . ALA A 1 34  ? -1.054  2.683   -17.052 1.00 10.06  ? 28  ALA A CA    1 
ATOM   88   C  C     . ALA A 1 34  ? -0.882  1.259   -17.599 1.00 13.84  ? 28  ALA A C     1 
ATOM   89   O  O     . ALA A 1 34  ? -0.841  1.046   -18.817 1.00 14.38  ? 28  ALA A O     1 
ATOM   90   C  CB    . ALA A 1 34  ? -2.484  3.163   -17.272 1.00 7.57   ? 28  ALA A CB    1 
ATOM   91   N  N     . SER A 1 35  ? -0.808  0.288   -16.689 1.00 10.77  ? 29  SER A N     1 
ATOM   92   C  CA    . SER A 1 35  ? -0.705  -1.124  -17.047 1.00 9.35   ? 29  SER A CA    1 
ATOM   93   C  C     . SER A 1 35  ? -2.057  -1.823  -16.885 1.00 10.28  ? 29  SER A C     1 
ATOM   94   O  O     . SER A 1 35  ? -2.881  -1.378  -16.108 1.00 13.18  ? 29  SER A O     1 
ATOM   95   C  CB    . SER A 1 35  ? 0.339   -1.792  -16.168 1.00 10.35  ? 29  SER A CB    1 
ATOM   96   O  OG    . SER A 1 35  ? 1.575   -1.112  -16.259 1.00 15.94  ? 29  SER A OG    1 
ATOM   97   N  N     . PRO A 1 36  ? -2.290  -2.924  -17.620 1.00 13.78  ? 30  PRO A N     1 
ATOM   98   C  CA    . PRO A 1 36  ? -3.612  -3.573  -17.611 1.00 14.67  ? 30  PRO A CA    1 
ATOM   99   C  C     . PRO A 1 36  ? -3.932  -4.401  -16.355 1.00 14.07  ? 30  PRO A C     1 
ATOM   100  O  O     . PRO A 1 36  ? -3.027  -4.901  -15.675 1.00 14.81  ? 30  PRO A O     1 
ATOM   101  C  CB    . PRO A 1 36  ? -3.533  -4.503  -18.823 1.00 11.70  ? 30  PRO A CB    1 
ATOM   102  C  CG    . PRO A 1 36  ? -2.091  -4.856  -18.899 1.00 9.14   ? 30  PRO A CG    1 
ATOM   103  C  CD    . PRO A 1 36  ? -1.370  -3.589  -18.561 1.00 9.77   ? 30  PRO A CD    1 
ATOM   104  N  N     . LYS A 1 37  ? -5.224  -4.541  -16.069 1.00 11.54  ? 31  LYS A N     1 
ATOM   105  C  CA    . LYS A 1 37  ? -5.703  -5.387  -14.981 1.00 11.11  ? 31  LYS A CA    1 
ATOM   106  C  C     . LYS A 1 37  ? -6.368  -6.630  -15.574 1.00 12.80  ? 31  LYS A C     1 
ATOM   107  O  O     . LYS A 1 37  ? -6.410  -6.785  -16.793 1.00 14.53  ? 31  LYS A O     1 
ATOM   108  C  CB    . LYS A 1 37  ? -6.699  -4.630  -14.094 1.00 11.86  ? 31  LYS A CB    1 
ATOM   109  C  CG    . LYS A 1 37  ? -6.132  -3.446  -13.294 1.00 12.39  ? 31  LYS A CG    1 
ATOM   110  C  CD    . LYS A 1 37  ? -5.189  -3.849  -12.156 1.00 12.36  ? 31  LYS A CD    1 
ATOM   111  C  CE    . LYS A 1 37  ? -5.941  -4.379  -10.964 1.00 13.75  ? 31  LYS A CE    1 
ATOM   112  N  NZ    . LYS A 1 37  ? -4.982  -4.722  -9.881  1.00 23.65  ? 31  LYS A NZ    1 
ATOM   113  N  N     . GLU A 1 38  ? -6.891  -7.509  -14.722 1.00 9.24   ? 32  GLU A N     1 
ATOM   114  C  CA    . GLU A 1 38  ? -7.443  -8.779  -15.180 1.00 8.17   ? 32  GLU A CA    1 
ATOM   115  C  C     . GLU A 1 38  ? -8.446  -8.648  -16.336 1.00 9.88   ? 32  GLU A C     1 
ATOM   116  O  O     . GLU A 1 38  ? -8.491  -9.474  -17.242 1.00 12.59  ? 32  GLU A O     1 
ATOM   117  C  CB    . GLU A 1 38  ? -8.081  -9.536  -14.012 1.00 9.07   ? 32  GLU A CB    1 
ATOM   118  C  CG    . GLU A 1 38  ? -7.118  -10.318 -13.143 1.00 9.14   ? 32  GLU A CG    1 
ATOM   119  C  CD    . GLU A 1 38  ? -6.354  -9.444  -12.171 1.00 11.10  ? 32  GLU A CD    1 
ATOM   120  O  OE1   . GLU A 1 38  ? -5.476  -9.987  -11.463 1.00 10.29  ? 32  GLU A OE1   1 
ATOM   121  O  OE2   . GLU A 1 38  ? -6.632  -8.223  -12.110 1.00 9.07   ? 32  GLU A OE2   1 
ATOM   122  N  N     . ILE A 1 39  ? -9.259  -7.607  -16.327 1.00 10.52  ? 33  ILE A N     1 
ATOM   123  C  CA    . ILE A 1 39  ? -10.319 -7.562  -17.317 1.00 11.71  ? 33  ILE A CA    1 
ATOM   124  C  C     . ILE A 1 39  ? -9.788  -7.106  -18.673 1.00 13.60  ? 33  ILE A C     1 
ATOM   125  O  O     . ILE A 1 39  ? -10.250 -7.565  -19.715 1.00 12.51  ? 33  ILE A O     1 
ATOM   126  C  CB    . ILE A 1 39  ? -11.537 -6.735  -16.860 1.00 9.11   ? 33  ILE A CB    1 
ATOM   127  C  CG1   . ILE A 1 39  ? -12.716 -7.009  -17.801 1.00 8.69   ? 33  ILE A CG1   1 
ATOM   128  C  CG2   . ILE A 1 39  ? -11.176 -5.264  -16.741 1.00 6.43   ? 33  ILE A CG2   1 
ATOM   129  C  CD1   . ILE A 1 39  ? -13.940 -6.236  -17.490 1.00 14.08  ? 33  ILE A CD1   1 
ATOM   130  N  N     . ASP A 1 40  ? -8.800  -6.221  -18.651 1.00 13.42  ? 34  ASP A N     1 
ATOM   131  C  CA    . ASP A 1 40  ? -8.116  -5.831  -19.868 1.00 10.33  ? 34  ASP A CA    1 
ATOM   132  C  C     . ASP A 1 40  ? -7.536  -7.069  -20.554 1.00 11.44  ? 34  ASP A C     1 
ATOM   133  O  O     . ASP A 1 40  ? -7.555  -7.172  -21.777 1.00 13.16  ? 34  ASP A O     1 
ATOM   134  C  CB    . ASP A 1 40  ? -7.029  -4.825  -19.542 1.00 10.01  ? 34  ASP A CB    1 
ATOM   135  C  CG    . ASP A 1 40  ? -7.566  -3.625  -18.799 1.00 13.94  ? 34  ASP A CG    1 
ATOM   136  O  OD1   . ASP A 1 40  ? -8.525  -3.011  -19.307 1.00 12.84  ? 34  ASP A OD1   1 
ATOM   137  O  OD2   . ASP A 1 40  ? -7.045  -3.302  -17.705 1.00 21.84  ? 34  ASP A OD2   1 
ATOM   138  N  N     . HIS A 1 41  ? -7.045  -8.026  -19.779 1.00 9.06   ? 35  HIS A N     1 
ATOM   139  C  CA    . HIS A 1 41  ? -6.604  -9.262  -20.388 1.00 8.75   ? 35  HIS A CA    1 
ATOM   140  C  C     . HIS A 1 41  ? -7.785  -10.004 -20.965 1.00 10.58  ? 35  HIS A C     1 
ATOM   141  O  O     . HIS A 1 41  ? -7.651  -10.687 -21.976 1.00 12.29  ? 35  HIS A O     1 
ATOM   142  C  CB    . HIS A 1 41  ? -5.842  -10.130 -19.397 1.00 11.02  ? 35  HIS A CB    1 
ATOM   143  C  CG    . HIS A 1 41  ? -4.563  -9.511  -18.955 1.00 11.94  ? 35  HIS A CG    1 
ATOM   144  N  ND1   . HIS A 1 41  ? -3.592  -9.110  -19.847 1.00 13.62  ? 35  HIS A ND1   1 
ATOM   145  C  CD2   . HIS A 1 41  ? -4.110  -9.175  -17.726 1.00 11.79  ? 35  HIS A CD2   1 
ATOM   146  C  CE1   . HIS A 1 41  ? -2.586  -8.569  -19.184 1.00 15.39  ? 35  HIS A CE1   1 
ATOM   147  N  NE2   . HIS A 1 41  ? -2.873  -8.598  -17.895 1.00 13.39  ? 35  HIS A NE2   1 
ATOM   148  N  N     . ILE A 1 42  ? -8.945  -9.867  -20.336 1.00 8.76   ? 36  ILE A N     1 
ATOM   149  C  CA    . ILE A 1 42  ? -10.124 -10.548 -20.836 1.00 8.66   ? 36  ILE A CA    1 
ATOM   150  C  C     . ILE A 1 42  ? -10.555 -9.969  -22.187 1.00 12.15  ? 36  ILE A C     1 
ATOM   151  O  O     . ILE A 1 42  ? -10.908 -10.709 -23.112 1.00 10.85  ? 36  ILE A O     1 
ATOM   152  C  CB    . ILE A 1 42  ? -11.273 -10.472 -19.827 1.00 9.78   ? 36  ILE A CB    1 
ATOM   153  C  CG1   . ILE A 1 42  ? -10.921 -11.298 -18.596 1.00 11.10  ? 36  ILE A CG1   1 
ATOM   154  C  CG2   . ILE A 1 42  ? -12.570 -10.959 -20.448 1.00 8.76   ? 36  ILE A CG2   1 
ATOM   155  C  CD1   . ILE A 1 42  ? -12.095 -11.649 -17.740 1.00 8.96   ? 36  ILE A CD1   1 
ATOM   156  N  N     . TYR A 1 43  ? -10.514 -8.641  -22.297 1.00 13.24  ? 37  TYR A N     1 
ATOM   157  C  CA    . TYR A 1 43  ? -10.865 -7.937  -23.529 1.00 8.42   ? 37  TYR A CA    1 
ATOM   158  C  C     . TYR A 1 43  ? -9.901  -8.245  -24.668 1.00 8.74   ? 37  TYR A C     1 
ATOM   159  O  O     . TYR A 1 43  ? -10.303 -8.327  -25.832 1.00 8.35   ? 37  TYR A O     1 
ATOM   160  C  CB    . TYR A 1 43  ? -10.870 -6.445  -23.281 1.00 7.15   ? 37  TYR A CB    1 
ATOM   161  C  CG    . TYR A 1 43  ? -12.008 -6.009  -22.427 1.00 10.44  ? 37  TYR A CG    1 
ATOM   162  C  CD1   . TYR A 1 43  ? -13.250 -6.627  -22.534 1.00 9.35   ? 37  TYR A CD1   1 
ATOM   163  C  CD2   . TYR A 1 43  ? -11.846 -4.983  -21.498 1.00 10.93  ? 37  TYR A CD2   1 
ATOM   164  C  CE1   . TYR A 1 43  ? -14.309 -6.224  -21.743 1.00 12.41  ? 37  TYR A CE1   1 
ATOM   165  C  CE2   . TYR A 1 43  ? -12.892 -4.577  -20.695 1.00 12.72  ? 37  TYR A CE2   1 
ATOM   166  C  CZ    . TYR A 1 43  ? -14.125 -5.195  -20.817 1.00 16.53  ? 37  TYR A CZ    1 
ATOM   167  O  OH    . TYR A 1 43  ? -15.171 -4.779  -20.008 1.00 20.03  ? 37  TYR A OH    1 
ATOM   168  N  N     . THR A 1 44  ? -8.629  -8.407  -24.331 1.00 6.74   ? 38  THR A N     1 
ATOM   169  C  CA    . THR A 1 44  ? -7.649  -8.775  -25.324 1.00 6.68   ? 38  THR A CA    1 
ATOM   170  C  C     . THR A 1 44  ? -7.953  -10.163 -25.868 1.00 11.28  ? 38  THR A C     1 
ATOM   171  O  O     . THR A 1 44  ? -7.931  -10.370 -27.085 1.00 14.59  ? 38  THR A O     1 
ATOM   172  C  CB    . THR A 1 44  ? -6.236  -8.715  -24.770 1.00 7.17   ? 38  THR A CB    1 
ATOM   173  O  OG1   . THR A 1 44  ? -5.967  -7.381  -24.325 1.00 7.45   ? 38  THR A OG1   1 
ATOM   174  C  CG2   . THR A 1 44  ? -5.241  -9.083  -25.844 1.00 4.58   ? 38  THR A CG2   1 
ATOM   175  N  N     . GLN A 1 45  ? -8.267  -11.114 -24.990 1.00 8.72   ? 39  GLN A N     1 
ATOM   176  C  CA    . GLN A 1 45  ? -8.589  -12.456 -25.467 1.00 7.49   ? 39  GLN A CA    1 
ATOM   177  C  C     . GLN A 1 45  ? -9.820  -12.456 -26.379 1.00 9.06   ? 39  GLN A C     1 
ATOM   178  O  O     . GLN A 1 45  ? -9.817  -13.093 -27.418 1.00 9.98   ? 39  GLN A O     1 
ATOM   179  C  CB    . GLN A 1 45  ? -8.760  -13.437 -24.319 1.00 6.90   ? 39  GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 45  ? -8.922  -14.866 -24.789 1.00 7.37   ? 39  GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 45  ? -7.661  -15.412 -25.400 1.00 6.46   ? 39  GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 45  ? -6.556  -15.166 -24.911 1.00 5.08   ? 39  GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 45  ? -7.810  -16.145 -26.489 1.00 8.26   ? 39  GLN A NE2   1 
ATOM   184  N  N     . LYS A 1 46  ? -10.855 -11.716 -25.997 1.00 10.07  ? 40  LYS A N     1 
ATOM   185  C  CA    . LYS A 1 46  ? -12.027 -11.533 -26.842 1.00 9.91   ? 40  LYS A CA    1 
ATOM   186  C  C     . LYS A 1 46  ? -11.643 -10.938 -28.208 1.00 12.62  ? 40  LYS A C     1 
ATOM   187  O  O     . LYS A 1 46  ? -12.241 -11.290 -29.249 1.00 9.91   ? 40  LYS A O     1 
ATOM   188  C  CB    . LYS A 1 46  ? -13.043 -10.632 -26.141 1.00 8.62   ? 40  LYS A CB    1 
ATOM   189  C  CG    . LYS A 1 46  ? -13.596 -11.187 -24.831 1.00 12.64  ? 40  LYS A CG    1 
ATOM   190  C  CD    . LYS A 1 46  ? -14.839 -12.062 -25.063 1.00 23.25  ? 40  LYS A CD    1 
ATOM   191  C  CE    . LYS A 1 46  ? -15.578 -12.400 -23.753 1.00 31.53  ? 40  LYS A CE    1 
ATOM   192  N  NZ    . LYS A 1 46  ? -16.203 -11.209 -23.057 1.00 17.62  ? 40  LYS A NZ    1 
ATOM   193  N  N     . LEU A 1 47  ? -10.646 -10.047 -28.203 1.00 9.30   ? 41  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 47  ? -10.168 -9.420  -29.440 1.00 9.02   ? 41  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 47  ? -9.556  -10.473 -30.348 1.00 9.59   ? 41  LEU A C     1 
ATOM   196  O  O     . LEU A 1 47  ? -9.873  -10.557 -31.530 1.00 8.57   ? 41  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 47  ? -9.116  -8.352  -29.150 1.00 7.03   ? 41  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 47  ? -9.007  -7.112  -30.049 1.00 7.08   ? 41  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 47  ? -7.547  -6.671  -30.159 1.00 6.81   ? 41  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 47  ? -9.647  -7.277  -31.427 1.00 6.18   ? 41  LEU A CD2   1 
ATOM   201  N  N     . ILE A 1 48  ? -8.668  -11.277 -29.785 1.00 9.72   ? 42  ILE A N     1 
ATOM   202  C  CA    . ILE A 1 48  ? -8.070  -12.348 -30.549 1.00 10.12  ? 42  ILE A CA    1 
ATOM   203  C  C     . ILE A 1 48  ? -9.154  -13.279 -31.080 1.00 10.53  ? 42  ILE A C     1 
ATOM   204  O  O     . ILE A 1 48  ? -9.081  -13.737 -32.216 1.00 11.85  ? 42  ILE A O     1 
ATOM   205  C  CB    . ILE A 1 48  ? -7.057  -13.134 -29.717 1.00 7.38   ? 42  ILE A CB    1 
ATOM   206  C  CG1   . ILE A 1 48  ? -5.969  -12.195 -29.214 1.00 7.05   ? 42  ILE A CG1   1 
ATOM   207  C  CG2   . ILE A 1 48  ? -6.432  -14.192 -30.559 1.00 10.49  ? 42  ILE A CG2   1 
ATOM   208  C  CD1   . ILE A 1 48  ? -4.772  -12.877 -28.700 1.00 2.64   ? 42  ILE A CD1   1 
ATOM   209  N  N     . ASP A 1 49  ? -10.176 -13.522 -30.268 1.00 8.68   ? 43  ASP A N     1 
ATOM   210  C  CA    . ASP A 1 49  ? -11.196 -14.490 -30.624 1.00 7.63   ? 43  ASP A CA    1 
ATOM   211  C  C     . ASP A 1 49  ? -12.116 -13.944 -31.690 1.00 8.37   ? 43  ASP A C     1 
ATOM   212  O  O     . ASP A 1 49  ? -12.550 -14.681 -32.564 1.00 11.56  ? 43  ASP A O     1 
ATOM   213  C  CB    . ASP A 1 49  ? -11.984 -14.949 -29.398 1.00 8.39   ? 43  ASP A CB    1 
ATOM   214  C  CG    . ASP A 1 49  ? -11.111 -15.672 -28.371 1.00 11.00  ? 43  ASP A CG    1 
ATOM   215  O  OD1   . ASP A 1 49  ? -10.004 -16.137 -28.728 1.00 9.47   ? 43  ASP A OD1   1 
ATOM   216  O  OD2   . ASP A 1 49  ? -11.532 -15.768 -27.201 1.00 10.89  ? 43  ASP A OD2   1 
ATOM   217  N  N     . ALA A 1 50  ? -12.405 -12.652 -31.637 1.00 9.72   ? 44  ALA A N     1 
ATOM   218  C  CA    . ALA A 1 50  ? -13.178 -12.029 -32.706 1.00 6.81   ? 44  ALA A CA    1 
ATOM   219  C  C     . ALA A 1 50  ? -12.400 -12.053 -34.010 1.00 8.39   ? 44  ALA A C     1 
ATOM   220  O  O     . ALA A 1 50  ? -12.987 -12.158 -35.074 1.00 10.49  ? 44  ALA A O     1 
ATOM   221  C  CB    . ALA A 1 50  ? -13.525 -10.627 -32.353 1.00 6.49   ? 44  ALA A CB    1 
ATOM   222  N  N     . MET A 1 51  ? -11.077 -11.969 -33.921 1.00 8.72   ? 45  MET A N     1 
ATOM   223  C  CA    . MET A 1 51  ? -10.231 -11.831 -35.098 1.00 8.17   ? 45  MET A CA    1 
ATOM   224  C  C     . MET A 1 51  ? -9.983  -13.130 -35.870 1.00 12.54  ? 45  MET A C     1 
ATOM   225  O  O     . MET A 1 51  ? -9.928  -13.103 -37.105 1.00 14.26  ? 45  MET A O     1 
ATOM   226  C  CB    . MET A 1 51  ? -8.890  -11.210 -34.723 1.00 9.56   ? 45  MET A CB    1 
ATOM   227  C  CG    . MET A 1 51  ? -8.847  -9.682  -34.706 1.00 11.40  ? 45  MET A CG    1 
ATOM   228  S  SD    . MET A 1 51  ? -7.148  -9.120  -34.376 1.00 14.87  ? 45  MET A SD    1 
ATOM   229  C  CE    . MET A 1 51  ? -7.040  -9.415  -32.623 1.00 12.17  ? 45  MET A CE    1 
ATOM   230  N  N     . LYS A 1 52  ? -9.819  -14.249 -35.154 1.00 12.38  ? 46  LYS A N     1 
ATOM   231  C  CA    . LYS A 1 52  ? -9.531  -15.555 -35.776 1.00 8.65   ? 46  LYS A CA    1 
ATOM   232  C  C     . LYS A 1 52  ? -10.402 -15.904 -36.990 1.00 9.61   ? 46  LYS A C     1 
ATOM   233  O  O     . LYS A 1 52  ? -9.877  -16.305 -38.038 1.00 9.32   ? 46  LYS A O     1 
ATOM   234  C  CB    . LYS A 1 52  ? -9.576  -16.708 -34.755 1.00 11.02  ? 46  LYS A CB    1 
ATOM   235  C  CG    . LYS A 1 52  ? -8.430  -16.739 -33.738 1.00 18.17  ? 46  LYS A CG    1 
ATOM   236  C  CD    . LYS A 1 52  ? -8.009  -18.178 -33.417 1.00 30.99  ? 46  LYS A CD    1 
ATOM   237  C  CE    . LYS A 1 52  ? -7.266  -18.282 -32.071 1.00 40.94  ? 46  LYS A CE    1 
ATOM   238  N  NZ    . LYS A 1 52  ? -8.182  -18.240 -30.872 1.00 19.88  ? 46  LYS A NZ    1 
ATOM   239  N  N     . PRO A 1 53  ? -11.733 -15.751 -36.869 1.00 9.89   ? 47  PRO A N     1 
ATOM   240  C  CA    . PRO A 1 53  ? -12.547 -16.172 -38.014 1.00 9.25   ? 47  PRO A CA    1 
ATOM   241  C  C     . PRO A 1 53  ? -12.286 -15.417 -39.319 1.00 9.50   ? 47  PRO A C     1 
ATOM   242  O  O     . PRO A 1 53  ? -12.715 -15.897 -40.374 1.00 10.56  ? 47  PRO A O     1 
ATOM   243  C  CB    . PRO A 1 53  ? -13.993 -15.949 -37.529 1.00 6.45   ? 47  PRO A CB    1 
ATOM   244  C  CG    . PRO A 1 53  ? -13.886 -15.096 -36.337 1.00 9.23   ? 47  PRO A CG    1 
ATOM   245  C  CD    . PRO A 1 53  ? -12.573 -15.398 -35.710 1.00 8.48   ? 47  PRO A CD    1 
ATOM   246  N  N     . PHE A 1 54  ? -11.604 -14.277 -39.257 1.00 9.45   ? 48  PHE A N     1 
ATOM   247  C  CA    . PHE A 1 54  ? -11.371 -13.468 -40.455 1.00 10.54  ? 48  PHE A CA    1 
ATOM   248  C  C     . PHE A 1 54  ? -10.088 -13.844 -41.215 1.00 9.63   ? 48  PHE A C     1 
ATOM   249  O  O     . PHE A 1 54  ? -9.763  -13.236 -42.236 1.00 8.64   ? 48  PHE A O     1 
ATOM   250  C  CB    . PHE A 1 54  ? -11.381 -11.973 -40.115 1.00 9.51   ? 48  PHE A CB    1 
ATOM   251  C  CG    . PHE A 1 54  ? -12.736 -11.444 -39.748 1.00 11.14  ? 48  PHE A CG    1 
ATOM   252  C  CD1   . PHE A 1 54  ? -13.685 -11.186 -40.729 1.00 11.54  ? 48  PHE A CD1   1 
ATOM   253  C  CD2   . PHE A 1 54  ? -13.065 -11.195 -38.422 1.00 9.91   ? 48  PHE A CD2   1 
ATOM   254  C  CE1   . PHE A 1 54  ? -14.941 -10.691 -40.392 1.00 10.86  ? 48  PHE A CE1   1 
ATOM   255  C  CE2   . PHE A 1 54  ? -14.318 -10.695 -38.078 1.00 7.93   ? 48  PHE A CE2   1 
ATOM   256  C  CZ    . PHE A 1 54  ? -15.255 -10.446 -39.062 1.00 10.02  ? 48  PHE A CZ    1 
ATOM   257  N  N     . GLY A 1 55  ? -9.367  -14.840 -40.718 1.00 7.23   ? 49  GLY A N     1 
ATOM   258  C  CA    . GLY A 1 55  ? -8.196  -15.332 -41.408 1.00 8.46   ? 49  GLY A CA    1 
ATOM   259  C  C     . GLY A 1 55  ? -6.921  -14.571 -41.102 1.00 10.60  ? 49  GLY A C     1 
ATOM   260  O  O     . GLY A 1 55  ? -5.900  -14.748 -41.753 1.00 12.47  ? 49  GLY A O     1 
ATOM   261  N  N     . VAL A 1 56  ? -6.968  -13.734 -40.084 1.00 13.52  ? 50  VAL A N     1 
ATOM   262  C  CA    . VAL A 1 56  ? -5.835  -12.884 -39.749 1.00 10.29  ? 50  VAL A CA    1 
ATOM   263  C  C     . VAL A 1 56  ? -4.559  -13.628 -39.340 1.00 11.27  ? 50  VAL A C     1 
ATOM   264  O  O     . VAL A 1 56  ? -3.459  -13.138 -39.581 1.00 14.26  ? 50  VAL A O     1 
ATOM   265  C  CB    . VAL A 1 56  ? -6.237  -11.917 -38.642 1.00 9.81   ? 50  VAL A CB    1 
ATOM   266  C  CG1   . VAL A 1 56  ? -5.128  -10.931 -38.389 1.00 18.87  ? 50  VAL A CG1   1 
ATOM   267  C  CG2   . VAL A 1 56  ? -7.505  -11.197 -39.055 1.00 9.62   ? 50  VAL A CG2   1 
ATOM   268  N  N     . PHE A 1 57  ? -4.704  -14.796 -38.712 1.00 16.77  ? 51  PHE A N     1 
ATOM   269  C  CA    . PHE A 1 57  ? -3.554  -15.532 -38.171 1.00 14.54  ? 51  PHE A CA    1 
ATOM   270  C  C     . PHE A 1 57  ? -3.256  -16.749 -39.009 1.00 16.97  ? 51  PHE A C     1 
ATOM   271  O  O     . PHE A 1 57  ? -4.122  -17.594 -39.220 1.00 16.37  ? 51  PHE A O     1 
ATOM   272  C  CB    . PHE A 1 57  ? -3.803  -16.026 -36.747 1.00 12.08  ? 51  PHE A CB    1 
ATOM   273  C  CG    . PHE A 1 57  ? -4.099  -14.945 -35.757 1.00 9.12   ? 51  PHE A CG    1 
ATOM   274  C  CD1   . PHE A 1 57  ? -3.070  -14.216 -35.179 1.00 10.66  ? 51  PHE A CD1   1 
ATOM   275  C  CD2   . PHE A 1 57  ? -5.399  -14.684 -35.377 1.00 7.89   ? 51  PHE A CD2   1 
ATOM   276  C  CE1   . PHE A 1 57  ? -3.328  -13.230 -34.246 1.00 7.28   ? 51  PHE A CE1   1 
ATOM   277  C  CE2   . PHE A 1 57  ? -5.668  -13.703 -34.455 1.00 13.96  ? 51  PHE A CE2   1 
ATOM   278  C  CZ    . PHE A 1 57  ? -4.624  -12.970 -33.883 1.00 12.08  ? 51  PHE A CZ    1 
ATOM   279  N  N     . GLU A 1 58  ? -2.018  -16.856 -39.459 1.00 14.41  ? 52  GLU A N     1 
ATOM   280  C  CA    . GLU A 1 58  ? -1.630  -17.979 -40.274 1.00 14.92  ? 52  GLU A CA    1 
ATOM   281  C  C     . GLU A 1 58  ? -1.243  -19.192 -39.423 1.00 17.06  ? 52  GLU A C     1 
ATOM   282  O  O     . GLU A 1 58  ? -0.853  -19.037 -38.267 1.00 18.06  ? 52  GLU A O     1 
ATOM   283  C  CB    . GLU A 1 58  ? -0.458  -17.562 -41.137 1.00 14.66  ? 52  GLU A CB    1 
ATOM   284  C  CG    . GLU A 1 58  ? -0.751  -17.497 -42.605 1.00 13.68  ? 52  GLU A CG    1 
ATOM   285  C  CD    . GLU A 1 58  ? 0.505   -17.221 -43.359 1.00 16.64  ? 52  GLU A CD    1 
ATOM   286  O  OE1   . GLU A 1 58  ? 0.520   -17.344 -44.607 1.00 18.28  ? 52  GLU A OE1   1 
ATOM   287  O  OE2   . GLU A 1 58  ? 1.488   -16.876 -42.667 1.00 16.16  ? 52  GLU A OE2   1 
ATOM   288  N  N     . ASP A 1 59  ? -1.338  -20.382 -40.024 1.00 17.18  ? 53  ASP A N     1 
ATOM   289  C  CA    . ASP A 1 59  ? -0.977  -21.663 -39.411 1.00 14.56  ? 53  ASP A CA    1 
ATOM   290  C  C     . ASP A 1 59  ? 0.513   -21.945 -39.351 1.00 21.71  ? 53  ASP A C     1 
ATOM   291  O  O     . ASP A 1 59  ? 1.293   -21.427 -40.146 1.00 22.03  ? 53  ASP A O     1 
ATOM   292  C  CB    . ASP A 1 59  ? -1.549  -22.796 -40.246 1.00 19.53  ? 53  ASP A CB    1 
ATOM   293  C  CG    . ASP A 1 59  ? -3.031  -22.916 -40.115 1.00 35.15  ? 53  ASP A CG    1 
ATOM   294  O  OD1   . ASP A 1 59  ? -3.577  -22.376 -39.118 1.00 38.19  ? 53  ASP A OD1   1 
ATOM   295  O  OD2   . ASP A 1 59  ? -3.644  -23.557 -41.004 1.00 30.11  ? 53  ASP A OD2   1 
ATOM   296  N  N     . GLU A 1 60  ? 0.892   -22.823 -38.430 1.00 26.29  ? 54  GLU A N     1 
ATOM   297  C  CA    . GLU A 1 60  ? 2.204   -23.461 -38.439 1.00 26.14  ? 54  GLU A CA    1 
ATOM   298  C  C     . GLU A 1 60  ? 2.583   -23.931 -39.857 1.00 19.46  ? 54  GLU A C     1 
ATOM   299  O  O     . GLU A 1 60  ? 3.700   -23.714 -40.317 1.00 18.96  ? 54  GLU A O     1 
ATOM   300  C  CB    . GLU A 1 60  ? 2.199   -24.638 -37.445 1.00 27.63  ? 54  GLU A CB    1 
ATOM   301  C  CG    . GLU A 1 60  ? 3.486   -25.459 -37.332 1.00 38.54  ? 54  GLU A CG    1 
ATOM   302  C  CD    . GLU A 1 60  ? 4.654   -24.700 -36.696 1.00 58.00  ? 54  GLU A CD    1 
ATOM   303  O  OE1   . GLU A 1 60  ? 5.702   -25.343 -36.448 1.00 66.74  ? 54  GLU A OE1   1 
ATOM   304  O  OE2   . GLU A 1 60  ? 4.536   -23.473 -36.451 1.00 55.48  ? 54  GLU A OE2   1 
ATOM   305  N  N     . GLU A 1 61  ? 1.650   -24.552 -40.562 1.00 16.06  ? 55  GLU A N     1 
ATOM   306  C  CA    . GLU A 1 61  ? 1.966   -25.020 -41.901 1.00 22.33  ? 55  GLU A CA    1 
ATOM   307  C  C     . GLU A 1 61  ? 2.345   -23.859 -42.789 1.00 16.42  ? 55  GLU A C     1 
ATOM   308  O  O     . GLU A 1 61  ? 3.460   -23.805 -43.288 1.00 14.35  ? 55  GLU A O     1 
ATOM   309  C  CB    . GLU A 1 61  ? 0.805   -25.791 -42.507 1.00 27.31  ? 55  GLU A CB    1 
ATOM   310  C  CG    . GLU A 1 61  ? 0.648   -27.179 -41.938 1.00 33.74  ? 55  GLU A CG    1 
ATOM   311  C  CD    . GLU A 1 61  ? -0.253  -28.035 -42.790 1.00 46.15  ? 55  GLU A CD    1 
ATOM   312  O  OE1   . GLU A 1 61  ? -0.716  -27.543 -43.848 0.50 30.94  ? 55  GLU A OE1   1 
ATOM   313  O  OE2   . GLU A 1 61  ? -0.498  -29.204 -42.408 0.50 45.38  ? 55  GLU A OE2   1 
ATOM   314  N  N     . GLU A 1 62  ? 1.410   -22.930 -42.952 1.00 16.50  ? 56  GLU A N     1 
ATOM   315  C  CA    . GLU A 1 62  ? 1.618   -21.709 -43.724 1.00 15.49  ? 56  GLU A CA    1 
ATOM   316  C  C     . GLU A 1 62  ? 2.907   -20.916 -43.380 1.00 14.73  ? 56  GLU A C     1 
ATOM   317  O  O     . GLU A 1 62  ? 3.669   -20.537 -44.279 1.00 15.36  ? 56  GLU A O     1 
ATOM   318  C  CB    . GLU A 1 62  ? 0.373   -20.817 -43.622 1.00 14.38  ? 56  GLU A CB    1 
ATOM   319  C  CG    . GLU A 1 62  ? -0.882  -21.441 -44.235 1.00 15.91  ? 56  GLU A CG    1 
ATOM   320  C  CD    . GLU A 1 62  ? -2.188  -20.805 -43.723 1.00 22.77  ? 56  GLU A CD    1 
ATOM   321  O  OE1   . GLU A 1 62  ? -3.187  -20.779 -44.486 1.00 20.25  ? 56  GLU A OE1   1 
ATOM   322  O  OE2   . GLU A 1 62  ? -2.227  -20.345 -42.554 1.00 18.50  ? 56  GLU A OE2   1 
ATOM   323  N  N     . LEU A 1 63  ? 3.165   -20.665 -42.103 1.00 12.37  ? 57  LEU A N     1 
ATOM   324  C  CA    . LEU A 1 63  ? 4.333   -19.865 -41.732 1.00 11.25  ? 57  LEU A CA    1 
ATOM   325  C  C     . LEU A 1 63  ? 5.571   -20.588 -42.198 1.00 13.30  ? 57  LEU A C     1 
ATOM   326  O  O     . LEU A 1 63  ? 6.511   -19.990 -42.719 1.00 13.16  ? 57  LEU A O     1 
ATOM   327  C  CB    . LEU A 1 63  ? 4.402   -19.657 -40.215 1.00 10.64  ? 57  LEU A CB    1 
ATOM   328  C  CG    . LEU A 1 63  ? 3.209   -18.909 -39.615 1.00 12.68  ? 57  LEU A CG    1 
ATOM   329  C  CD1   . LEU A 1 63  ? 3.252   -18.944 -38.127 1.00 18.20  ? 57  LEU A CD1   1 
ATOM   330  C  CD2   . LEU A 1 63  ? 3.145   -17.468 -40.103 1.00 13.83  ? 57  LEU A CD2   1 
ATOM   331  N  N     . ASN A 1 64  ? 5.545   -21.899 -42.008 1.00 13.73  ? 58  ASN A N     1 
ATOM   332  C  CA    . ASN A 1 64  ? 6.660   -22.748 -42.347 1.00 12.49  ? 58  ASN A CA    1 
ATOM   333  C  C     . ASN A 1 64  ? 6.884   -22.761 -43.850 1.00 11.80  ? 58  ASN A C     1 
ATOM   334  O  O     . ASN A 1 64  ? 8.018   -22.736 -44.315 1.00 9.45   ? 58  ASN A O     1 
ATOM   335  C  CB    . ASN A 1 64  ? 6.402   -24.155 -41.826 1.00 12.97  ? 58  ASN A CB    1 
ATOM   336  C  CG    . ASN A 1 64  ? 6.783   -24.313 -40.378 1.00 19.51  ? 58  ASN A CG    1 
ATOM   337  O  OD1   . ASN A 1 64  ? 7.293   -23.382 -39.755 1.00 24.96  ? 58  ASN A OD1   1 
ATOM   338  N  ND2   . ASN A 1 64  ? 6.544   -25.498 -39.828 1.00 22.41  ? 58  ASN A ND2   1 
ATOM   339  N  N     . HIS A 1 65  ? 5.797   -22.799 -44.607 1.00 10.34  ? 59  HIS A N     1 
ATOM   340  C  CA    . HIS A 1 65  ? 5.906   -22.813 -46.047 1.00 11.04  ? 59  HIS A CA    1 
ATOM   341  C  C     . HIS A 1 65  ? 6.650   -21.567 -46.513 1.00 15.00  ? 59  HIS A C     1 
ATOM   342  O  O     . HIS A 1 65  ? 7.599   -21.658 -47.304 1.00 14.09  ? 59  HIS A O     1 
ATOM   343  C  CB    . HIS A 1 65  ? 4.537   -22.890 -46.695 1.00 9.56   ? 59  HIS A CB    1 
ATOM   344  C  CG    . HIS A 1 65  ? 4.595   -23.120 -48.169 1.00 17.84  ? 59  HIS A CG    1 
ATOM   345  N  ND1   . HIS A 1 65  ? 5.275   -24.182 -48.726 1.00 21.36  ? 59  HIS A ND1   1 
ATOM   346  C  CD2   . HIS A 1 65  ? 4.074   -22.420 -49.204 1.00 20.11  ? 59  HIS A CD2   1 
ATOM   347  C  CE1   . HIS A 1 65  ? 5.157   -24.133 -50.042 1.00 17.79  ? 59  HIS A CE1   1 
ATOM   348  N  NE2   . HIS A 1 65  ? 4.440   -23.071 -50.359 1.00 14.15  ? 59  HIS A NE2   1 
ATOM   349  N  N     . ARG A 1 66  ? 6.229   -20.412 -45.998 1.00 14.30  ? 60  ARG A N     1 
ATOM   350  C  CA    . ARG A 1 66  ? 6.915   -19.150 -46.263 1.00 11.88  ? 60  ARG A CA    1 
ATOM   351  C  C     . ARG A 1 66  ? 8.389   -19.266 -45.914 1.00 10.23  ? 60  ARG A C     1 
ATOM   352  O  O     . ARG A 1 66  ? 9.240   -18.829 -46.678 1.00 10.76  ? 60  ARG A O     1 
ATOM   353  C  CB    . ARG A 1 66  ? 6.268   -17.998 -45.483 1.00 10.17  ? 60  ARG A CB    1 
ATOM   354  C  CG    . ARG A 1 66  ? 4.864   -17.649 -45.963 1.00 11.65  ? 60  ARG A CG    1 
ATOM   355  C  CD    . ARG A 1 66  ? 4.262   -16.542 -45.126 1.00 11.89  ? 60  ARG A CD    1 
ATOM   356  N  NE    . ARG A 1 66  ? 2.852   -16.275 -45.428 1.00 12.06  ? 60  ARG A NE    1 
ATOM   357  C  CZ    . ARG A 1 66  ? 2.428   -15.487 -46.414 1.00 11.46  ? 60  ARG A CZ    1 
ATOM   358  N  NH1   . ARG A 1 66  ? 3.301   -14.905 -47.220 1.00 10.06  ? 60  ARG A NH1   1 
ATOM   359  N  NH2   . ARG A 1 66  ? 1.130   -15.294 -46.605 1.00 8.95   ? 60  ARG A NH2   1 
ATOM   360  N  N     . LEU A 1 67  ? 8.673   -19.876 -44.764 1.00 11.43  ? 61  LEU A N     1 
ATOM   361  C  CA    . LEU A 1 67  ? 10.038  -20.115 -44.304 1.00 9.23   ? 61  LEU A CA    1 
ATOM   362  C  C     . LEU A 1 67  ? 10.844  -20.950 -45.297 1.00 11.68  ? 61  LEU A C     1 
ATOM   363  O  O     . LEU A 1 67  ? 12.007  -20.660 -45.565 1.00 12.46  ? 61  LEU A O     1 
ATOM   364  C  CB    . LEU A 1 67  ? 10.013  -20.810 -42.952 1.00 9.42   ? 61  LEU A CB    1 
ATOM   365  C  CG    . LEU A 1 67  ? 10.401  -20.066 -41.681 1.00 11.76  ? 61  LEU A CG    1 
ATOM   366  C  CD1   . LEU A 1 67  ? 10.058  -18.597 -41.779 1.00 13.98  ? 61  LEU A CD1   1 
ATOM   367  C  CD2   . LEU A 1 67  ? 9.686   -20.698 -40.496 1.00 13.06  ? 61  LEU A CD2   1 
ATOM   368  N  N     . VAL A 1 68  ? 10.218  -21.985 -45.850 1.00 14.40  ? 62  VAL A N     1 
ATOM   369  C  CA    . VAL A 1 68  ? 10.886  -22.865 -46.801 1.00 10.61  ? 62  VAL A CA    1 
ATOM   370  C  C     . VAL A 1 68  ? 11.128  -22.138 -48.108 1.00 11.71  ? 62  VAL A C     1 
ATOM   371  O  O     . VAL A 1 68  ? 12.246  -22.145 -48.622 1.00 15.72  ? 62  VAL A O     1 
ATOM   372  C  CB    . VAL A 1 68  ? 10.075  -24.154 -47.054 1.00 10.85  ? 62  VAL A CB    1 
ATOM   373  C  CG1   . VAL A 1 68  ? 10.618  -24.912 -48.245 1.00 12.70  ? 62  VAL A CG1   1 
ATOM   374  C  CG2   . VAL A 1 68  ? 10.101  -25.042 -45.828 1.00 13.30  ? 62  VAL A CG2   1 
ATOM   375  N  N     . VAL A 1 69  ? 10.087  -21.511 -48.645 1.00 8.95   ? 63  VAL A N     1 
ATOM   376  C  CA    . VAL A 1 69  ? 10.229  -20.724 -49.870 1.00 10.98  ? 63  VAL A CA    1 
ATOM   377  C  C     . VAL A 1 69  ? 11.315  -19.653 -49.764 1.00 12.61  ? 63  VAL A C     1 
ATOM   378  O  O     . VAL A 1 69  ? 12.180  -19.538 -50.633 1.00 13.22  ? 63  VAL A O     1 
ATOM   379  C  CB    . VAL A 1 69  ? 8.928   -20.020 -50.248 1.00 8.46   ? 63  VAL A CB    1 
ATOM   380  C  CG1   . VAL A 1 69  ? 9.150   -19.151 -51.443 1.00 9.04   ? 63  VAL A CG1   1 
ATOM   381  C  CG2   . VAL A 1 69  ? 7.848   -21.022 -50.532 1.00 11.35  ? 63  VAL A CG2   1 
ATOM   382  N  N     . LEU A 1 70  ? 11.271  -18.869 -48.697 1.00 10.77  ? 64  LEU A N     1 
ATOM   383  C  CA    . LEU A 1 70  ? 12.263  -17.820 -48.507 1.00 13.98  ? 64  LEU A CA    1 
ATOM   384  C  C     . LEU A 1 70  ? 13.676  -18.384 -48.401 1.00 14.27  ? 64  LEU A C     1 
ATOM   385  O  O     . LEU A 1 70  ? 14.632  -17.746 -48.828 1.00 16.47  ? 64  LEU A O     1 
ATOM   386  C  CB    . LEU A 1 70  ? 11.926  -16.973 -47.278 1.00 13.58  ? 64  LEU A CB    1 
ATOM   387  C  CG    . LEU A 1 70  ? 10.892  -15.882 -47.529 1.00 11.76  ? 64  LEU A CG    1 
ATOM   388  C  CD1   . LEU A 1 70  ? 10.428  -15.303 -46.214 1.00 8.83   ? 64  LEU A CD1   1 
ATOM   389  C  CD2   . LEU A 1 70  ? 11.504  -14.813 -48.410 1.00 8.62   ? 64  LEU A CD2   1 
ATOM   390  N  N     . GLY A 1 71  ? 13.807  -19.573 -47.824 1.00 10.13  ? 65  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 71  ? 15.101  -20.225 -47.752 1.00 13.44  ? 65  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 71  ? 15.704  -20.454 -49.134 1.00 24.22  ? 65  GLY A C     1 
ATOM   393  O  O     . GLY A 1 71  ? 16.892  -20.184 -49.350 1.00 23.27  ? 65  GLY A O     1 
ATOM   394  N  N     . LYS A 1 72  ? 14.884  -20.944 -50.068 1.00 17.37  ? 66  LYS A N     1 
ATOM   395  C  CA    . LYS A 1 72  ? 15.329  -21.199 -51.430 1.00 16.77  ? 66  LYS A CA    1 
ATOM   396  C  C     . LYS A 1 72  ? 15.753  -19.898 -52.072 1.00 21.19  ? 66  LYS A C     1 
ATOM   397  O  O     . LYS A 1 72  ? 16.861  -19.798 -52.605 1.00 24.98  ? 66  LYS A O     1 
ATOM   398  C  CB    . LYS A 1 72  ? 14.215  -21.808 -52.285 1.00 14.22  ? 66  LYS A CB    1 
ATOM   399  C  CG    . LYS A 1 72  ? 13.793  -23.215 -51.933 1.00 15.03  ? 66  LYS A CG    1 
ATOM   400  C  CD    . LYS A 1 72  ? 12.312  -23.378 -52.244 1.00 17.78  ? 66  LYS A CD    1 
ATOM   401  C  CE    . LYS A 1 72  ? 11.999  -24.631 -53.054 1.00 23.71  ? 66  LYS A CE    1 
ATOM   402  N  NZ    . LYS A 1 72  ? 10.732  -24.453 -53.845 1.00 15.77  ? 66  LYS A NZ    1 
ATOM   403  N  N     . LEU A 1 73  ? 14.857  -18.913 -52.030 1.00 18.70  ? 67  LEU A N     1 
ATOM   404  C  CA    . LEU A 1 73  ? 15.090  -17.618 -52.670 1.00 20.61  ? 67  LEU A CA    1 
ATOM   405  C  C     . LEU A 1 73  ? 16.436  -17.077 -52.234 1.00 24.49  ? 67  LEU A C     1 
ATOM   406  O  O     . LEU A 1 73  ? 17.252  -16.643 -53.051 1.00 24.77  ? 67  LEU A O     1 
ATOM   407  C  CB    . LEU A 1 73  ? 14.011  -16.614 -52.272 1.00 14.07  ? 67  LEU A CB    1 
ATOM   408  C  CG    . LEU A 1 73  ? 13.383  -15.803 -53.394 1.00 12.66  ? 67  LEU A CG    1 
ATOM   409  C  CD1   . LEU A 1 73  ? 12.650  -14.585 -52.849 1.00 11.70  ? 67  LEU A CD1   1 
ATOM   410  C  CD2   . LEU A 1 73  ? 14.426  -15.410 -54.398 1.00 15.40  ? 67  LEU A CD2   1 
ATOM   411  N  N     . ASN A 1 74  ? 16.661  -17.126 -50.928 1.00 23.83  ? 68  ASN A N     1 
ATOM   412  C  CA    . ASN A 1 74  ? 17.893  -16.650 -50.362 1.00 21.63  ? 68  ASN A CA    1 
ATOM   413  C  C     . ASN A 1 74  ? 19.059  -17.390 -50.983 1.00 27.65  ? 68  ASN A C     1 
ATOM   414  O  O     . ASN A 1 74  ? 19.987  -16.764 -51.503 1.00 26.71  ? 68  ASN A O     1 
ATOM   415  C  CB    . ASN A 1 74  ? 17.887  -16.849 -48.863 1.00 20.24  ? 68  ASN A CB    1 
ATOM   416  C  CG    . ASN A 1 74  ? 19.047  -16.172 -48.208 1.00 25.92  ? 68  ASN A CG    1 
ATOM   417  O  OD1   . ASN A 1 74  ? 19.217  -14.964 -48.343 1.00 25.57  ? 68  ASN A OD1   1 
ATOM   418  N  ND2   . ASN A 1 74  ? 19.865  -16.940 -47.503 1.00 29.05  ? 68  ASN A ND2   1 
ATOM   419  N  N     . ASN A 1 75  ? 18.982  -18.723 -50.946 1.00 30.11  ? 69  ASN A N     1 
ATOM   420  C  CA    . ASN A 1 75  ? 19.999  -19.597 -51.545 1.00 31.28  ? 69  ASN A CA    1 
ATOM   421  C  C     . ASN A 1 75  ? 20.216  -19.351 -53.048 1.00 28.34  ? 69  ASN A C     1 
ATOM   422  O  O     . ASN A 1 75  ? 21.336  -19.455 -53.535 1.00 32.06  ? 69  ASN A O     1 
ATOM   423  C  CB    . ASN A 1 75  ? 19.696  -21.087 -51.284 1.00 31.06  ? 69  ASN A CB    1 
ATOM   424  C  CG    . ASN A 1 75  ? 20.197  -21.580 -49.913 1.00 38.99  ? 69  ASN A CG    1 
ATOM   425  O  OD1   . ASN A 1 75  ? 21.067  -20.965 -49.288 1.00 37.07  ? 69  ASN A OD1   1 
ATOM   426  N  ND2   . ASN A 1 75  ? 19.651  -22.711 -49.457 1.00 31.33  ? 69  ASN A ND2   1 
ATOM   427  N  N     . LEU A 1 76  ? 19.155  -19.036 -53.781 1.00 22.53  ? 70  LEU A N     1 
ATOM   428  C  CA    . LEU A 1 76  ? 19.302  -18.661 -55.181 1.00 26.77  ? 70  LEU A CA    1 
ATOM   429  C  C     . LEU A 1 76  ? 20.128  -17.395 -55.307 1.00 28.75  ? 70  LEU A C     1 
ATOM   430  O  O     . LEU A 1 76  ? 21.018  -17.286 -56.149 1.00 28.25  ? 70  LEU A O     1 
ATOM   431  C  CB    . LEU A 1 76  ? 17.942  -18.388 -55.792 1.00 23.40  ? 70  LEU A CB    1 
ATOM   432  C  CG    . LEU A 1 76  ? 17.001  -19.566 -55.836 1.00 25.22  ? 70  LEU A CG    1 
ATOM   433  C  CD1   . LEU A 1 76  ? 15.855  -19.191 -56.726 1.00 26.18  ? 70  LEU A CD1   1 
ATOM   434  C  CD2   . LEU A 1 76  ? 17.740  -20.774 -56.366 1.00 30.45  ? 70  LEU A CD2   1 
ATOM   435  N  N     . VAL A 1 77  ? 19.795  -16.432 -54.459 1.00 30.48  ? 71  VAL A N     1 
ATOM   436  C  CA    . VAL A 1 77  ? 20.459  -15.142 -54.439 1.00 34.73  ? 71  VAL A CA    1 
ATOM   437  C  C     . VAL A 1 77  ? 21.922  -15.284 -54.035 1.00 30.17  ? 71  VAL A C     1 
ATOM   438  O  O     . VAL A 1 77  ? 22.786  -14.622 -54.589 1.00 35.22  ? 71  VAL A O     1 
ATOM   439  C  CB    . VAL A 1 77  ? 19.707  -14.157 -53.517 1.00 27.19  ? 71  VAL A CB    1 
ATOM   440  C  CG1   . VAL A 1 77  ? 20.651  -13.129 -52.908 1.00 22.72  ? 71  VAL A CG1   1 
ATOM   441  C  CG2   . VAL A 1 77  ? 18.580  -13.497 -54.289 1.00 17.77  ? 71  VAL A CG2   1 
ATOM   442  N  N     . LYS A 1 78  ? 22.202  -16.160 -53.084 1.00 21.43  ? 72  LYS A N     1 
ATOM   443  C  CA    . LYS A 1 78  ? 23.578  -16.438 -52.735 1.00 23.93  ? 72  LYS A CA    1 
ATOM   444  C  C     . LYS A 1 78  ? 24.272  -17.178 -53.873 1.00 36.42  ? 72  LYS A C     1 
ATOM   445  O  O     . LYS A 1 78  ? 25.482  -17.037 -54.071 1.00 39.93  ? 72  LYS A O     1 
ATOM   446  C  CB    . LYS A 1 78  ? 23.655  -17.240 -51.440 1.00 28.11  ? 72  LYS A CB    1 
ATOM   447  C  CG    . LYS A 1 78  ? 23.601  -16.380 -50.194 1.00 30.89  ? 72  LYS A CG    1 
ATOM   448  C  CD    . LYS A 1 78  ? 23.482  -17.217 -48.946 1.00 28.98  ? 72  LYS A CD    1 
ATOM   449  C  CE    . LYS A 1 78  ? 23.597  -16.357 -47.692 1.00 44.75  ? 72  LYS A CE    1 
ATOM   450  N  NZ    . LYS A 1 78  ? 25.005  -15.998 -47.343 1.00 47.77  ? 72  LYS A NZ    1 
ATOM   451  N  N     . GLU A 1 79  ? 23.498  -17.956 -54.625 1.00 37.66  ? 73  GLU A N     1 
ATOM   452  C  CA    . GLU A 1 79  ? 24.030  -18.732 -55.738 1.00 35.02  ? 73  GLU A CA    1 
ATOM   453  C  C     . GLU A 1 79  ? 24.350  -17.781 -56.872 1.00 38.08  ? 73  GLU A C     1 
ATOM   454  O  O     . GLU A 1 79  ? 25.473  -17.733 -57.360 1.00 42.73  ? 73  GLU A O     1 
ATOM   455  C  CB    . GLU A 1 79  ? 23.008  -19.770 -56.216 1.00 37.47  ? 73  GLU A CB    1 
ATOM   456  C  CG    . GLU A 1 79  ? 23.601  -21.095 -56.713 1.00 38.93  ? 73  GLU A CG    1 
ATOM   457  C  CD    . GLU A 1 79  ? 22.799  -21.698 -57.860 1.00 41.79  ? 73  GLU A CD    1 
ATOM   458  O  OE1   . GLU A 1 79  ? 21.712  -22.263 -57.610 1.00 40.81  ? 73  GLU A OE1   1 
ATOM   459  O  OE2   . GLU A 1 79  ? 23.253  -21.597 -59.022 1.00 52.78  ? 73  GLU A OE2   1 
ATOM   460  N  N     . TRP A 1 80  ? 23.350  -17.014 -57.279 1.00 34.64  ? 74  TRP A N     1 
ATOM   461  C  CA    . TRP A 1 80  ? 23.483  -16.097 -58.402 1.00 36.61  ? 74  TRP A CA    1 
ATOM   462  C  C     . TRP A 1 80  ? 24.532  -15.006 -58.220 1.00 42.56  ? 74  TRP A C     1 
ATOM   463  O  O     . TRP A 1 80  ? 25.161  -14.588 -59.185 1.00 49.38  ? 74  TRP A O     1 
ATOM   464  C  CB    . TRP A 1 80  ? 22.134  -15.466 -58.687 1.00 37.10  ? 74  TRP A CB    1 
ATOM   465  C  CG    . TRP A 1 80  ? 22.183  -14.207 -59.464 1.00 38.48  ? 74  TRP A CG    1 
ATOM   466  C  CD1   . TRP A 1 80  ? 22.356  -14.080 -60.806 1.00 43.33  ? 74  TRP A CD1   1 
ATOM   467  C  CD2   . TRP A 1 80  ? 22.006  -12.887 -58.955 1.00 38.36  ? 74  TRP A CD2   1 
ATOM   468  N  NE1   . TRP A 1 80  ? 22.314  -12.758 -61.166 1.00 43.24  ? 74  TRP A NE1   1 
ATOM   469  C  CE2   . TRP A 1 80  ? 22.098  -12.004 -60.046 1.00 41.43  ? 74  TRP A CE2   1 
ATOM   470  C  CE3   . TRP A 1 80  ? 21.785  -12.364 -57.680 1.00 42.11  ? 74  TRP A CE3   1 
ATOM   471  C  CZ2   . TRP A 1 80  ? 21.971  -10.625 -59.904 1.00 47.33  ? 74  TRP A CZ2   1 
ATOM   472  C  CZ3   . TRP A 1 80  ? 21.664  -10.994 -57.538 1.00 41.36  ? 74  TRP A CZ3   1 
ATOM   473  C  CH2   . TRP A 1 80  ? 21.753  -10.140 -58.643 1.00 45.67  ? 74  TRP A CH2   1 
ATOM   474  N  N     . ILE A 1 81  ? 24.717  -14.537 -56.992 1.00 41.95  ? 75  ILE A N     1 
ATOM   475  C  CA    . ILE A 1 81  ? 25.732  -13.522 -56.708 1.00 44.35  ? 75  ILE A CA    1 
ATOM   476  C  C     . ILE A 1 81  ? 27.129  -14.139 -56.797 1.00 50.58  ? 75  ILE A C     1 
ATOM   477  O  O     . ILE A 1 81  ? 28.130  -13.441 -56.966 1.00 59.13  ? 75  ILE A O     1 
ATOM   478  C  CB    . ILE A 1 81  ? 25.494  -12.865 -55.332 1.00 46.69  ? 75  ILE A CB    1 
ATOM   479  C  CG1   . ILE A 1 81  ? 24.245  -12.001 -55.379 1.00 44.67  ? 75  ILE A CG1   1 
ATOM   480  C  CG2   . ILE A 1 81  ? 26.631  -11.964 -54.931 1.00 47.06  ? 75  ILE A CG2   1 
ATOM   481  C  CD1   . ILE A 1 81  ? 23.738  -11.654 -54.018 1.00 38.50  ? 75  ILE A CD1   1 
ATOM   482  N  N     . SER A 1 82  ? 27.192  -15.461 -56.711 1.00 53.68  ? 76  SER A N     1 
ATOM   483  C  CA    . SER A 1 82  ? 28.453  -16.170 -56.908 1.00 54.52  ? 76  SER A CA    1 
ATOM   484  C  C     . SER A 1 82  ? 28.741  -16.377 -58.401 1.00 49.20  ? 76  SER A C     1 
ATOM   485  O  O     . SER A 1 82  ? 29.875  -16.227 -58.847 1.00 43.72  ? 76  SER A O     1 
ATOM   486  C  CB    . SER A 1 82  ? 28.424  -17.512 -56.177 1.00 45.11  ? 76  SER A CB    1 
ATOM   487  O  OG    . SER A 1 82  ? 29.721  -18.053 -56.056 1.00 43.03  ? 76  SER A OG    1 
ATOM   488  N  N     . ASP A 1 83  ? 27.700  -16.720 -59.159 1.00 49.39  ? 77  ASP A N     1 
ATOM   489  C  CA    . ASP A 1 83  ? 27.810  -16.917 -60.600 1.00 46.13  ? 77  ASP A CA    1 
ATOM   490  C  C     . ASP A 1 83  ? 28.350  -15.661 -61.279 1.00 53.09  ? 77  ASP A C     1 
ATOM   491  O  O     . ASP A 1 83  ? 29.351  -15.714 -61.986 1.00 66.58  ? 77  ASP A O     1 
ATOM   492  C  CB    . ASP A 1 83  ? 26.449  -17.291 -61.216 1.00 50.08  ? 77  ASP A CB    1 
ATOM   493  C  CG    . ASP A 1 83  ? 25.909  -18.633 -60.714 1.00 49.86  ? 77  ASP A CG    1 
ATOM   494  O  OD1   . ASP A 1 83  ? 26.663  -19.383 -60.053 1.00 43.74  ? 77  ASP A OD1   1 
ATOM   495  O  OD2   . ASP A 1 83  ? 24.725  -18.940 -60.994 1.00 47.61  ? 77  ASP A OD2   1 
ATOM   496  N  N     . VAL A 1 84  ? 27.672  -14.536 -61.063 1.00 55.81  ? 78  VAL A N     1 
ATOM   497  C  CA    . VAL A 1 84  ? 28.072  -13.242 -61.616 1.00 51.34  ? 78  VAL A CA    1 
ATOM   498  C  C     . VAL A 1 84  ? 29.494  -12.873 -61.194 1.00 51.82  ? 78  VAL A C     1 
ATOM   499  O  O     . VAL A 1 84  ? 30.254  -12.299 -61.970 1.00 52.11  ? 78  VAL A O     1 
ATOM   500  C  CB    . VAL A 1 84  ? 27.069  -12.132 -61.193 1.00 49.81  ? 78  VAL A CB    1 
ATOM   501  C  CG1   . VAL A 1 84  ? 27.716  -10.752 -61.192 1.00 44.47  ? 78  VAL A CG1   1 
ATOM   502  C  CG2   . VAL A 1 84  ? 25.833  -12.158 -62.088 1.00 46.29  ? 78  VAL A CG2   1 
ATOM   503  N  N     . SER A 1 85  ? 29.854  -13.242 -59.970 1.00 51.56  ? 79  SER A N     1 
ATOM   504  C  CA    . SER A 1 85  ? 31.189  -12.993 -59.427 1.00 57.39  ? 79  SER A CA    1 
ATOM   505  C  C     . SER A 1 85  ? 32.300  -13.810 -60.103 1.00 68.80  ? 79  SER A C     1 
ATOM   506  O  O     . SER A 1 85  ? 33.474  -13.682 -59.750 1.00 70.98  ? 79  SER A O     1 
ATOM   507  C  CB    . SER A 1 85  ? 31.196  -13.260 -57.917 1.00 57.86  ? 79  SER A CB    1 
ATOM   508  O  OG    . SER A 1 85  ? 32.511  -13.427 -57.420 1.00 59.56  ? 79  SER A OG    1 
ATOM   509  N  N     . GLU A 1 86  ? 31.930  -14.653 -61.063 1.00 69.20  ? 80  GLU A N     1 
ATOM   510  C  CA    . GLU A 1 86  ? 32.902  -15.457 -61.796 1.00 65.29  ? 80  GLU A CA    1 
ATOM   511  C  C     . GLU A 1 86  ? 32.952  -15.067 -63.261 1.00 61.55  ? 80  GLU A C     1 
ATOM   512  O  O     . GLU A 1 86  ? 33.847  -15.483 -63.992 1.00 66.44  ? 80  GLU A O     1 
ATOM   513  C  CB    . GLU A 1 86  ? 32.594  -16.945 -61.660 1.00 64.31  ? 80  GLU A CB    1 
ATOM   514  C  CG    . GLU A 1 86  ? 33.052  -17.544 -60.346 1.00 68.88  ? 80  GLU A CG    1 
ATOM   515  C  CD    . GLU A 1 86  ? 32.717  -19.015 -60.253 1.00 81.88  ? 80  GLU A CD    1 
ATOM   516  O  OE1   . GLU A 1 86  ? 31.993  -19.510 -61.150 1.00 66.07  ? 80  GLU A OE1   1 
ATOM   517  O  OE2   . GLU A 1 86  ? 33.176  -19.672 -59.291 1.00 81.31  ? 80  GLU A OE2   1 
ATOM   518  N  N     . SER A 1 87  ? 31.977  -14.270 -63.683 1.00 65.32  ? 81  SER A N     1 
ATOM   519  C  CA    . SER A 1 87  ? 31.996  -13.653 -65.004 1.00 74.87  ? 81  SER A CA    1 
ATOM   520  C  C     . SER A 1 87  ? 32.921  -12.442 -64.951 1.00 77.86  ? 81  SER A C     1 
ATOM   521  O  O     . SER A 1 87  ? 33.254  -11.841 -65.979 1.00 68.75  ? 81  SER A O     1 
ATOM   522  C  CB    . SER A 1 87  ? 30.590  -13.213 -65.401 1.00 66.95  ? 81  SER A CB    1 
ATOM   523  O  OG    . SER A 1 87  ? 29.631  -14.157 -64.961 1.00 69.44  ? 81  SER A OG    1 
ATOM   524  N  N     . LYS A 1 88  ? 33.324  -12.089 -63.733 1.00 77.01  ? 82  LYS A N     1 
ATOM   525  C  CA    . LYS A 1 88  ? 34.226  -10.969 -63.507 1.00 80.05  ? 82  LYS A CA    1 
ATOM   526  C  C     . LYS A 1 88  ? 35.572  -11.479 -62.959 1.00 82.50  ? 82  LYS A C     1 
ATOM   527  O  O     . LYS A 1 88  ? 36.462  -10.691 -62.625 1.00 91.69  ? 82  LYS A O     1 
ATOM   528  C  CB    . LYS A 1 88  ? 33.589  -9.928  -62.565 1.00 79.46  ? 82  LYS A CB    1 
ATOM   529  C  CG    . LYS A 1 88  ? 32.062  -9.696  -62.739 1.00 70.45  ? 82  LYS A CG    1 
ATOM   530  C  CD    . LYS A 1 88  ? 31.664  -9.126  -64.110 1.00 68.16  ? 82  LYS A CD    1 
ATOM   531  C  CE    . LYS A 1 88  ? 30.142  -8.914  -64.241 1.00 51.77  ? 82  LYS A CE    1 
ATOM   532  N  NZ    . LYS A 1 88  ? 29.602  -7.680  -63.577 1.00 39.34  ? 82  LYS A NZ    1 
ATOM   533  N  N     . ASN A 1 89  ? 35.703  -12.802 -62.865 1.00 74.52  ? 83  ASN A N     1 
ATOM   534  C  CA    . ASN A 1 89  ? 36.984  -13.457 -62.574 1.00 80.48  ? 83  ASN A CA    1 
ATOM   535  C  C     . ASN A 1 89  ? 37.742  -12.974 -61.331 1.00 73.33  ? 83  ASN A C     1 
ATOM   536  O  O     . ASN A 1 89  ? 38.924  -12.652 -61.411 1.00 81.60  ? 83  ASN A O     1 
ATOM   537  C  CB    . ASN A 1 89  ? 37.915  -13.374 -63.797 1.00 86.65  ? 83  ASN A CB    1 
ATOM   538  C  CG    . ASN A 1 89  ? 37.482  -14.291 -64.938 1.00 80.52  ? 83  ASN A CG    1 
ATOM   539  O  OD1   . ASN A 1 89  ? 37.846  -15.470 -64.975 1.00 73.44  ? 83  ASN A OD1   1 
ATOM   540  N  ND2   . ASN A 1 89  ? 36.715  -13.746 -65.881 1.00 74.31  ? 83  ASN A ND2   1 
ATOM   541  N  N     . LEU A 1 90  ? 37.077  -12.935 -60.184 1.00 74.41  ? 84  LEU A N     1 
ATOM   542  C  CA    . LEU A 1 90  ? 37.748  -12.530 -58.951 1.00 84.36  ? 84  LEU A CA    1 
ATOM   543  C  C     . LEU A 1 90  ? 38.439  -13.749 -58.337 1.00 79.23  ? 84  LEU A C     1 
ATOM   544  O  O     . LEU A 1 90  ? 38.076  -14.878 -58.652 1.00 76.54  ? 84  LEU A O     1 
ATOM   545  C  CB    . LEU A 1 90  ? 36.747  -11.913 -57.966 1.00 84.76  ? 84  LEU A CB    1 
ATOM   546  C  CG    . LEU A 1 90  ? 35.749  -10.864 -58.476 1.00 81.53  ? 84  LEU A CG    1 
ATOM   547  C  CD1   . LEU A 1 90  ? 35.068  -10.197 -57.296 1.00 75.17  ? 84  LEU A CD1   1 
ATOM   548  C  CD2   . LEU A 1 90  ? 36.383  -9.821  -59.392 1.00 76.35  ? 84  LEU A CD2   1 
ATOM   549  N  N     . PRO A 1 91  ? 39.448  -13.527 -57.475 1.00 82.61  ? 85  PRO A N     1 
ATOM   550  C  CA    . PRO A 1 91  ? 40.164  -14.638 -56.827 1.00 88.30  ? 85  PRO A CA    1 
ATOM   551  C  C     . PRO A 1 91  ? 39.240  -15.566 -56.047 1.00 88.67  ? 85  PRO A C     1 
ATOM   552  O  O     . PRO A 1 91  ? 38.506  -15.090 -55.192 1.00 87.68  ? 85  PRO A O     1 
ATOM   553  C  CB    . PRO A 1 91  ? 41.125  -13.930 -55.860 1.00 82.54  ? 85  PRO A CB    1 
ATOM   554  C  CG    . PRO A 1 91  ? 40.629  -12.522 -55.760 1.00 83.70  ? 85  PRO A CG    1 
ATOM   555  C  CD    . PRO A 1 91  ? 40.016  -12.225 -57.092 1.00 86.15  ? 85  PRO A CD    1 
ATOM   556  N  N     . PRO A 1 92  ? 39.286  -16.879 -56.336 1.00 93.60  ? 86  PRO A N     1 
ATOM   557  C  CA    . PRO A 1 92  ? 38.395  -17.883 -55.733 1.00 98.75  ? 86  PRO A CA    1 
ATOM   558  C  C     . PRO A 1 92  ? 38.339  -17.916 -54.189 1.00 95.58  ? 86  PRO A C     1 
ATOM   559  O  O     . PRO A 1 92  ? 37.463  -18.595 -53.644 1.00 91.57  ? 86  PRO A O     1 
ATOM   560  C  CB    . PRO A 1 92  ? 38.936  -19.202 -56.296 1.00 95.93  ? 86  PRO A CB    1 
ATOM   561  C  CG    . PRO A 1 92  ? 39.512  -18.818 -57.624 1.00 77.08  ? 86  PRO A CG    1 
ATOM   562  C  CD    . PRO A 1 92  ? 40.138  -17.470 -57.386 1.00 88.24  ? 86  PRO A CD    1 
ATOM   563  N  N     . SER A 1 93  ? 39.237  -17.206 -53.504 1.00 95.28  ? 87  SER A N     1 
ATOM   564  C  CA    . SER A 1 93  ? 39.162  -17.073 -52.044 1.00 99.50  ? 87  SER A CA    1 
ATOM   565  C  C     . SER A 1 93  ? 38.386  -15.808 -51.666 1.00 100.78 ? 87  SER A C     1 
ATOM   566  O  O     . SER A 1 93  ? 38.311  -15.422 -50.489 1.00 90.36  ? 87  SER A O     1 
ATOM   567  C  CB    . SER A 1 93  ? 40.560  -17.056 -51.414 1.00 102.86 ? 87  SER A CB    1 
ATOM   568  O  OG    . SER A 1 93  ? 41.277  -15.880 -51.757 1.00 103.40 ? 87  SER A OG    1 
ATOM   569  N  N     . VAL A 1 94  ? 37.815  -15.175 -52.690 1.00 98.42  ? 88  VAL A N     1 
ATOM   570  C  CA    . VAL A 1 94  ? 37.000  -13.972 -52.551 1.00 89.75  ? 88  VAL A CA    1 
ATOM   571  C  C     . VAL A 1 94  ? 35.561  -14.251 -52.999 1.00 82.27  ? 88  VAL A C     1 
ATOM   572  O  O     . VAL A 1 94  ? 34.612  -13.794 -52.366 1.00 75.21  ? 88  VAL A O     1 
ATOM   573  C  CB    . VAL A 1 94  ? 37.607  -12.790 -53.357 1.00 86.73  ? 88  VAL A CB    1 
ATOM   574  C  CG1   . VAL A 1 94  ? 36.563  -11.721 -53.667 1.00 82.21  ? 88  VAL A CG1   1 
ATOM   575  C  CG2   . VAL A 1 94  ? 38.804  -12.205 -52.621 1.00 82.08  ? 88  VAL A CG2   1 
ATOM   576  N  N     . VAL A 1 95  ? 35.403  -15.014 -54.081 1.00 85.26  ? 89  VAL A N     1 
ATOM   577  C  CA    . VAL A 1 95  ? 34.075  -15.412 -54.550 1.00 79.11  ? 89  VAL A CA    1 
ATOM   578  C  C     . VAL A 1 95  ? 33.375  -16.244 -53.480 1.00 79.39  ? 89  VAL A C     1 
ATOM   579  O  O     . VAL A 1 95  ? 32.160  -16.156 -53.307 1.00 80.50  ? 89  VAL A O     1 
ATOM   580  C  CB    . VAL A 1 95  ? 34.133  -16.198 -55.873 1.00 76.09  ? 89  VAL A CB    1 
ATOM   581  C  CG1   . VAL A 1 95  ? 32.729  -16.468 -56.392 1.00 60.79  ? 89  VAL A CG1   1 
ATOM   582  C  CG2   . VAL A 1 95  ? 34.936  -15.428 -56.907 1.00 75.31  ? 89  VAL A CG2   1 
ATOM   583  N  N     . ALA A 1 96  ? 34.150  -17.040 -52.750 1.00 78.99  ? 90  ALA A N     1 
ATOM   584  C  CA    . ALA A 1 96  ? 33.636  -17.716 -51.564 1.00 78.23  ? 90  ALA A CA    1 
ATOM   585  C  C     . ALA A 1 96  ? 33.208  -16.698 -50.505 1.00 71.58  ? 90  ALA A C     1 
ATOM   586  O  O     . ALA A 1 96  ? 32.155  -16.834 -49.883 1.00 65.93  ? 90  ALA A O     1 
ATOM   587  C  CB    . ALA A 1 96  ? 34.684  -18.655 -50.997 1.00 83.00  ? 90  ALA A CB    1 
ATOM   588  N  N     . THR A 1 97  ? 34.034  -15.675 -50.314 1.00 76.61  ? 91  THR A N     1 
ATOM   589  C  CA    . THR A 1 97  ? 33.777  -14.629 -49.326 1.00 76.02  ? 91  THR A CA    1 
ATOM   590  C  C     . THR A 1 97  ? 32.577  -13.748 -49.708 1.00 65.95  ? 91  THR A C     1 
ATOM   591  O  O     . THR A 1 97  ? 31.886  -13.219 -48.837 1.00 50.74  ? 91  THR A O     1 
ATOM   592  C  CB    . THR A 1 97  ? 35.027  -13.744 -49.134 1.00 79.56  ? 91  THR A CB    1 
ATOM   593  O  OG1   . THR A 1 97  ? 36.209  -14.556 -49.203 1.00 80.54  ? 91  THR A OG1   1 
ATOM   594  C  CG2   . THR A 1 97  ? 34.977  -13.015 -47.796 1.00 69.95  ? 91  THR A CG2   1 
ATOM   595  N  N     . VAL A 1 98  ? 32.352  -13.592 -51.014 1.00 73.70  ? 92  VAL A N     1 
ATOM   596  C  CA    . VAL A 1 98  ? 31.191  -12.877 -51.553 1.00 64.78  ? 92  VAL A CA    1 
ATOM   597  C  C     . VAL A 1 98  ? 29.902  -13.417 -50.943 1.00 74.38  ? 92  VAL A C     1 
ATOM   598  O  O     . VAL A 1 98  ? 29.638  -14.626 -50.990 1.00 77.74  ? 92  VAL A O     1 
ATOM   599  C  CB    . VAL A 1 98  ? 31.129  -12.989 -53.106 1.00 64.09  ? 92  VAL A CB    1 
ATOM   600  C  CG1   . VAL A 1 98  ? 29.695  -13.067 -53.610 1.00 62.29  ? 92  VAL A CG1   1 
ATOM   601  C  CG2   . VAL A 1 98  ? 31.855  -11.830 -53.762 1.00 63.40  ? 92  VAL A CG2   1 
ATOM   602  N  N     . GLY A 1 99  ? 29.108  -12.522 -50.358 1.00 61.39  ? 93  GLY A N     1 
ATOM   603  C  CA    . GLY A 1 99  ? 27.899  -12.927 -49.660 1.00 54.02  ? 93  GLY A CA    1 
ATOM   604  C  C     . GLY A 1 99  ? 26.636  -12.901 -50.502 1.00 51.36  ? 93  GLY A C     1 
ATOM   605  O  O     . GLY A 1 99  ? 26.536  -13.556 -51.545 1.00 43.94  ? 93  GLY A O     1 
ATOM   606  N  N     . GLY A 1 100 ? 25.662  -12.128 -50.039 1.00 48.42  ? 94  GLY A N     1 
ATOM   607  C  CA    . GLY A 1 100 ? 24.367  -12.061 -50.682 1.00 36.02  ? 94  GLY A CA    1 
ATOM   608  C  C     . GLY A 1 100 ? 23.300  -12.430 -49.678 1.00 35.24  ? 94  GLY A C     1 
ATOM   609  O  O     . GLY A 1 100 ? 23.436  -13.408 -48.937 1.00 35.94  ? 94  GLY A O     1 
ATOM   610  N  N     . LYS A 1 101 ? 22.235  -11.646 -49.631 1.00 26.71  ? 95  LYS A N     1 
ATOM   611  C  CA    . LYS A 1 101 ? 21.239  -11.862 -48.597 1.00 26.14  ? 95  LYS A CA    1 
ATOM   612  C  C     . LYS A 1 101 ? 19.895  -11.362 -49.060 1.00 24.66  ? 95  LYS A C     1 
ATOM   613  O  O     . LYS A 1 101 ? 19.818  -10.468 -49.900 1.00 26.75  ? 95  LYS A O     1 
ATOM   614  C  CB    . LYS A 1 101 ? 21.647  -11.163 -47.296 1.00 24.47  ? 95  LYS A CB    1 
ATOM   615  C  CG    . LYS A 1 101 ? 20.722  -11.432 -46.142 1.00 24.41  ? 95  LYS A CG    1 
ATOM   616  C  CD    . LYS A 1 101 ? 21.175  -10.732 -44.886 1.00 36.82  ? 95  LYS A CD    1 
ATOM   617  C  CE    . LYS A 1 101 ? 20.260  -11.077 -43.716 1.00 46.53  ? 95  LYS A CE    1 
ATOM   618  N  NZ    . LYS A 1 101 ? 20.593  -10.305 -42.474 1.00 57.26  ? 95  LYS A NZ    1 
ATOM   619  N  N     . ILE A 1 102 ? 18.842  -11.972 -48.525 1.00 25.90  ? 96  ILE A N     1 
ATOM   620  C  CA    . ILE A 1 102 ? 17.479  -11.537 -48.761 1.00 21.80  ? 96  ILE A CA    1 
ATOM   621  C  C     . ILE A 1 102 ? 16.938  -11.008 -47.460 1.00 18.76  ? 96  ILE A C     1 
ATOM   622  O  O     . ILE A 1 102 ? 17.138  -11.626 -46.417 1.00 24.26  ? 96  ILE A O     1 
ATOM   623  C  CB    . ILE A 1 102 ? 16.604  -12.698 -49.258 1.00 19.21  ? 96  ILE A CB    1 
ATOM   624  C  CG1   . ILE A 1 102 ? 16.649  -12.730 -50.774 1.00 16.09  ? 96  ILE A CG1   1 
ATOM   625  C  CG2   . ILE A 1 102 ? 15.159  -12.555 -48.791 1.00 12.56  ? 96  ILE A CG2   1 
ATOM   626  C  CD1   . ILE A 1 102 ? 15.471  -13.387 -51.376 1.00 18.45  ? 96  ILE A CD1   1 
ATOM   627  N  N     . PHE A 1 103 ? 16.294  -9.846  -47.522 1.00 18.65  ? 97  PHE A N     1 
ATOM   628  C  CA    . PHE A 1 103 ? 15.596  -9.268  -46.373 1.00 17.88  ? 97  PHE A CA    1 
ATOM   629  C  C     . PHE A 1 103 ? 14.125  -9.176  -46.700 1.00 11.80  ? 97  PHE A C     1 
ATOM   630  O  O     . PHE A 1 103 ? 13.765  -8.988  -47.848 1.00 15.63  ? 97  PHE A O     1 
ATOM   631  C  CB    . PHE A 1 103 ? 16.073  -7.847  -46.113 1.00 19.63  ? 97  PHE A CB    1 
ATOM   632  C  CG    . PHE A 1 103 ? 17.479  -7.740  -45.604 1.00 22.61  ? 97  PHE A CG    1 
ATOM   633  C  CD1   . PHE A 1 103 ? 18.545  -7.657  -46.486 1.00 21.56  ? 97  PHE A CD1   1 
ATOM   634  C  CD2   . PHE A 1 103 ? 17.730  -7.668  -44.244 1.00 28.80  ? 97  PHE A CD2   1 
ATOM   635  C  CE1   . PHE A 1 103 ? 19.839  -7.535  -46.019 1.00 27.34  ? 97  PHE A CE1   1 
ATOM   636  C  CE2   . PHE A 1 103 ? 19.021  -7.546  -43.769 1.00 33.82  ? 97  PHE A CE2   1 
ATOM   637  C  CZ    . PHE A 1 103 ? 20.078  -7.479  -44.657 1.00 34.48  ? 97  PHE A CZ    1 
ATOM   638  N  N     . THR A 1 104 ? 13.265  -9.288  -45.699 1.00 16.19  ? 98  THR A N     1 
ATOM   639  C  CA    . THR A 1 104 ? 11.841  -9.024  -45.922 1.00 14.82  ? 98  THR A CA    1 
ATOM   640  C  C     . THR A 1 104 ? 11.450  -7.697  -45.288 1.00 11.35  ? 98  THR A C     1 
ATOM   641  O  O     . THR A 1 104 ? 12.142  -7.190  -44.407 1.00 13.87  ? 98  THR A O     1 
ATOM   642  C  CB    . THR A 1 104 ? 10.926  -10.165 -45.395 1.00 13.86  ? 98  THR A CB    1 
ATOM   643  O  OG1   . THR A 1 104 ? 11.319  -10.538 -44.065 1.00 14.84  ? 98  THR A OG1   1 
ATOM   644  C  CG2   . THR A 1 104 ? 11.023  -11.382 -46.298 1.00 9.38   ? 98  THR A CG2   1 
ATOM   645  N  N     . PHE A 1 105 ? 10.360  -7.119  -45.761 1.00 7.97   ? 99  PHE A N     1 
ATOM   646  C  CA    . PHE A 1 105 ? 9.805   -5.941  -45.124 1.00 10.41  ? 99  PHE A CA    1 
ATOM   647  C  C     . PHE A 1 105 ? 8.301   -5.985  -45.271 1.00 11.05  ? 99  PHE A C     1 
ATOM   648  O  O     . PHE A 1 105 ? 7.760   -6.984  -45.733 1.00 13.07  ? 99  PHE A O     1 
ATOM   649  C  CB    . PHE A 1 105 ? 10.436  -4.629  -45.630 1.00 10.98  ? 99  PHE A CB    1 
ATOM   650  C  CG    . PHE A 1 105 ? 10.368  -4.441  -47.111 1.00 14.86  ? 99  PHE A CG    1 
ATOM   651  C  CD1   . PHE A 1 105 ? 11.224  -5.134  -47.958 1.00 16.33  ? 99  PHE A CD1   1 
ATOM   652  C  CD2   . PHE A 1 105 ? 9.462   -3.550  -47.667 1.00 16.33  ? 99  PHE A CD2   1 
ATOM   653  C  CE1   . PHE A 1 105 ? 11.155  -4.958  -49.328 1.00 14.75  ? 99  PHE A CE1   1 
ATOM   654  C  CE2   . PHE A 1 105 ? 9.394   -3.367  -49.026 1.00 14.46  ? 99  PHE A CE2   1 
ATOM   655  C  CZ    . PHE A 1 105 ? 10.244  -4.073  -49.861 1.00 14.26  ? 99  PHE A CZ    1 
ATOM   656  N  N     . GLY A 1 106 ? 7.617   -4.935  -44.847 1.00 10.74  ? 100 GLY A N     1 
ATOM   657  C  CA    . GLY A 1 106 ? 6.168   -4.932  -44.902 1.00 11.35  ? 100 GLY A CA    1 
ATOM   658  C  C     . GLY A 1 106 ? 5.529   -5.905  -43.926 1.00 11.76  ? 100 GLY A C     1 
ATOM   659  O  O     . GLY A 1 106 ? 6.179   -6.373  -42.986 1.00 12.63  ? 100 GLY A O     1 
ATOM   660  N  N     . SER A 1 107 ? 4.244   -6.171  -44.154 1.00 12.82  ? 101 SER A N     1 
ATOM   661  C  CA    . SER A 1 107 ? 3.430   -7.123  -43.397 1.00 11.09  ? 101 SER A CA    1 
ATOM   662  C  C     . SER A 1 107 ? 4.201   -8.302  -42.807 1.00 14.07  ? 101 SER A C     1 
ATOM   663  O  O     . SER A 1 107 ? 4.235   -8.501  -41.584 1.00 9.87   ? 101 SER A O     1 
ATOM   664  C  CB    . SER A 1 107 ? 2.336   -7.691  -44.305 1.00 12.60  ? 101 SER A CB    1 
ATOM   665  O  OG    . SER A 1 107 ? 1.199   -6.849  -44.350 1.00 18.46  ? 101 SER A OG    1 
ATOM   666  N  N     . TYR A 1 108 ? 4.807   -9.091  -43.690 1.00 12.87  ? 102 TYR A N     1 
ATOM   667  C  CA    . TYR A 1 108 ? 5.427   -10.325 -43.264 1.00 10.13  ? 102 TYR A CA    1 
ATOM   668  C  C     . TYR A 1 108 ? 6.516   -10.069 -42.219 1.00 12.17  ? 102 TYR A C     1 
ATOM   669  O  O     . TYR A 1 108 ? 6.549   -10.731 -41.187 1.00 13.74  ? 102 TYR A O     1 
ATOM   670  C  CB    . TYR A 1 108 ? 5.941   -11.150 -44.454 1.00 9.34   ? 102 TYR A CB    1 
ATOM   671  C  CG    . TYR A 1 108 ? 6.659   -12.400 -44.002 1.00 9.55   ? 102 TYR A CG    1 
ATOM   672  C  CD1   . TYR A 1 108 ? 5.954   -13.512 -43.542 1.00 7.66   ? 102 TYR A CD1   1 
ATOM   673  C  CD2   . TYR A 1 108 ? 8.042   -12.454 -43.992 1.00 9.89   ? 102 TYR A CD2   1 
ATOM   674  C  CE1   . TYR A 1 108 ? 6.613   -14.648 -43.104 1.00 6.63   ? 102 TYR A CE1   1 
ATOM   675  C  CE2   . TYR A 1 108 ? 8.705   -13.578 -43.548 1.00 13.78  ? 102 TYR A CE2   1 
ATOM   676  C  CZ    . TYR A 1 108 ? 7.992   -14.670 -43.106 1.00 10.20  ? 102 TYR A CZ    1 
ATOM   677  O  OH    . TYR A 1 108 ? 8.694   -15.771 -42.664 1.00 13.74  ? 102 TYR A OH    1 
ATOM   678  N  N     . ARG A 1 109 ? 7.383   -9.096  -42.470 1.00 12.40  ? 103 ARG A N     1 
ATOM   679  C  CA    . ARG A 1 109 ? 8.465   -8.794  -41.539 1.00 13.69  ? 103 ARG A CA    1 
ATOM   680  C  C     . ARG A 1 109 ? 7.940   -8.201  -40.241 1.00 12.28  ? 103 ARG A C     1 
ATOM   681  O  O     . ARG A 1 109 ? 8.520   -8.404  -39.169 1.00 13.45  ? 103 ARG A O     1 
ATOM   682  C  CB    . ARG A 1 109 ? 9.480   -7.847  -42.177 1.00 15.08  ? 103 ARG A CB    1 
ATOM   683  C  CG    . ARG A 1 109 ? 10.302  -7.056  -41.187 1.00 17.08  ? 103 ARG A CG    1 
ATOM   684  C  CD    . ARG A 1 109 ? 11.766  -7.391  -41.244 1.00 25.51  ? 103 ARG A CD    1 
ATOM   685  N  NE    . ARG A 1 109 ? 12.076  -8.591  -40.477 1.00 37.03  ? 103 ARG A NE    1 
ATOM   686  C  CZ    . ARG A 1 109 ? 12.717  -8.599  -39.311 1.00 40.51  ? 103 ARG A CZ    1 
ATOM   687  N  NH1   . ARG A 1 109 ? 13.127  -7.460  -38.754 1.00 35.42  ? 103 ARG A NH1   1 
ATOM   688  N  NH2   . ARG A 1 109 ? 12.957  -9.756  -38.712 1.00 39.24  ? 103 ARG A NH2   1 
ATOM   689  N  N     . LEU A 1 110 ? 6.843   -7.463  -40.339 1.00 9.66   ? 104 LEU A N     1 
ATOM   690  C  CA    . LEU A 1 110 ? 6.211   -6.928  -39.146 1.00 10.69  ? 104 LEU A CA    1 
ATOM   691  C  C     . LEU A 1 110 ? 5.556   -8.054  -38.357 1.00 11.50  ? 104 LEU A C     1 
ATOM   692  O  O     . LEU A 1 110 ? 5.249   -7.895  -37.187 1.00 14.60  ? 104 LEU A O     1 
ATOM   693  C  CB    . LEU A 1 110 ? 5.195   -5.843  -39.507 1.00 12.65  ? 104 LEU A CB    1 
ATOM   694  C  CG    . LEU A 1 110 ? 5.836   -4.518  -39.955 1.00 14.02  ? 104 LEU A CG    1 
ATOM   695  C  CD1   . LEU A 1 110 ? 4.803   -3.547  -40.494 1.00 9.65   ? 104 LEU A CD1   1 
ATOM   696  C  CD2   . LEU A 1 110 ? 6.609   -3.877  -38.815 1.00 8.57   ? 104 LEU A CD2   1 
ATOM   697  N  N     . GLY A 1 111 ? 5.357   -9.198  -39.002 1.00 10.90  ? 105 GLY A N     1 
ATOM   698  C  CA    . GLY A 1 111 ? 4.805   -10.365 -38.341 1.00 8.28   ? 105 GLY A CA    1 
ATOM   699  C  C     . GLY A 1 111 ? 3.327   -10.216 -38.073 1.00 9.56   ? 105 GLY A C     1 
ATOM   700  O  O     . GLY A 1 111 ? 2.822   -10.656 -37.034 1.00 7.32   ? 105 GLY A O     1 
ATOM   701  N  N     . VAL A 1 112 ? 2.634   -9.595  -39.025 1.00 9.96   ? 106 VAL A N     1 
ATOM   702  C  CA    . VAL A 1 112 ? 1.236   -9.244  -38.857 1.00 6.77   ? 106 VAL A CA    1 
ATOM   703  C  C     . VAL A 1 112 ? 0.486   -9.501  -40.128 1.00 7.21   ? 106 VAL A C     1 
ATOM   704  O  O     . VAL A 1 112 ? -0.666  -9.131  -40.250 1.00 9.40   ? 106 VAL A O     1 
ATOM   705  C  CB    . VAL A 1 112 ? 1.086   -7.768  -38.533 1.00 7.82   ? 106 VAL A CB    1 
ATOM   706  C  CG1   . VAL A 1 112 ? 1.839   -7.418  -37.248 1.00 9.11   ? 106 VAL A CG1   1 
ATOM   707  C  CG2   . VAL A 1 112 ? 1.618   -6.950  -39.662 1.00 10.82  ? 106 VAL A CG2   1 
ATOM   708  N  N     . HIS A 1 113 ? 1.150   -10.143 -41.082 1.00 12.08  ? 107 HIS A N     1 
ATOM   709  C  CA    . HIS A 1 113 ? 0.551   -10.495 -42.375 1.00 10.05  ? 107 HIS A CA    1 
ATOM   710  C  C     . HIS A 1 113 ? -0.598  -11.482 -42.191 1.00 10.58  ? 107 HIS A C     1 
ATOM   711  O  O     . HIS A 1 113 ? -0.650  -12.214 -41.196 1.00 9.23   ? 107 HIS A O     1 
ATOM   712  C  CB    . HIS A 1 113 ? 1.606   -11.144 -43.250 1.00 7.29   ? 107 HIS A CB    1 
ATOM   713  C  CG    . HIS A 1 113 ? 2.120   -12.429 -42.687 1.00 9.82   ? 107 HIS A CG    1 
ATOM   714  N  ND1   . HIS A 1 113 ? 3.050   -12.476 -41.669 1.00 9.64   ? 107 HIS A ND1   1 
ATOM   715  C  CD2   . HIS A 1 113 ? 1.811   -13.716 -42.976 1.00 9.01   ? 107 HIS A CD2   1 
ATOM   716  C  CE1   . HIS A 1 113 ? 3.305   -13.737 -41.370 1.00 10.87  ? 107 HIS A CE1   1 
ATOM   717  N  NE2   . HIS A 1 113 ? 2.560   -14.509 -42.143 1.00 7.84   ? 107 HIS A NE2   1 
ATOM   718  N  N     . THR A 1 114 ? -1.513  -11.520 -43.152 1.00 11.71  ? 108 THR A N     1 
ATOM   719  C  CA    . THR A 1 114 ? -2.677  -12.399 -43.030 1.00 12.02  ? 108 THR A CA    1 
ATOM   720  C  C     . THR A 1 114 ? -2.599  -13.608 -43.967 1.00 15.31  ? 108 THR A C     1 
ATOM   721  O  O     . THR A 1 114 ? -1.648  -13.751 -44.740 1.00 15.44  ? 108 THR A O     1 
ATOM   722  C  CB    . THR A 1 114 ? -3.989  -11.647 -43.288 1.00 8.83   ? 108 THR A CB    1 
ATOM   723  O  OG1   . THR A 1 114 ? -4.068  -11.288 -44.665 1.00 13.23  ? 108 THR A OG1   1 
ATOM   724  C  CG2   . THR A 1 114 ? -4.044  -10.390 -42.467 1.00 13.06  ? 108 THR A CG2   1 
ATOM   725  N  N     . LYS A 1 115 ? -3.594  -14.484 -43.879 1.00 12.25  ? 109 LYS A N     1 
ATOM   726  C  CA    . LYS A 1 115 ? -3.666  -15.622 -44.770 1.00 11.80  ? 109 LYS A CA    1 
ATOM   727  C  C     . LYS A 1 115 ? -3.667  -15.093 -46.203 1.00 15.89  ? 109 LYS A C     1 
ATOM   728  O  O     . LYS A 1 115 ? -4.390  -14.153 -46.506 1.00 23.20  ? 109 LYS A O     1 
ATOM   729  C  CB    . LYS A 1 115 ? -4.913  -16.456 -44.462 1.00 9.50   ? 109 LYS A CB    1 
ATOM   730  C  CG    . LYS A 1 115 ? -4.696  -17.398 -43.300 1.00 16.05  ? 109 LYS A CG    1 
ATOM   731  C  CD    . LYS A 1 115 ? -5.900  -18.265 -42.928 1.00 13.26  ? 109 LYS A CD    1 
ATOM   732  C  CE    . LYS A 1 115 ? -5.423  -19.405 -42.010 1.00 13.33  ? 109 LYS A CE    1 
ATOM   733  N  NZ    . LYS A 1 115 ? -6.496  -19.962 -41.144 1.00 13.73  ? 109 LYS A NZ    1 
ATOM   734  N  N     . GLY A 1 116 ? -2.810  -15.647 -47.055 1.00 12.63  ? 110 GLY A N     1 
ATOM   735  C  CA    . GLY A 1 116 ? -2.737  -15.240 -48.448 1.00 13.02  ? 110 GLY A CA    1 
ATOM   736  C  C     . GLY A 1 116 ? -1.942  -13.979 -48.747 1.00 12.28  ? 110 GLY A C     1 
ATOM   737  O  O     . GLY A 1 116 ? -2.094  -13.371 -49.805 1.00 16.31  ? 110 GLY A O     1 
ATOM   738  N  N     . ALA A 1 117 ? -1.086  -13.574 -47.826 1.00 8.80   ? 111 ALA A N     1 
ATOM   739  C  CA    . ALA A 1 117 ? -0.400  -12.310 -47.983 1.00 10.11  ? 111 ALA A CA    1 
ATOM   740  C  C     . ALA A 1 117 ? 0.805   -12.467 -48.879 1.00 12.64  ? 111 ALA A C     1 
ATOM   741  O  O     . ALA A 1 117 ? 1.516   -13.467 -48.793 1.00 14.66  ? 111 ALA A O     1 
ATOM   742  C  CB    . ALA A 1 117 ? 0.036   -11.791 -46.629 1.00 12.79  ? 111 ALA A CB    1 
ATOM   743  N  N     . ASP A 1 118 ? 1.060   -11.478 -49.728 1.00 13.06  ? 112 ASP A N     1 
ATOM   744  C  CA    . ASP A 1 118 ? 2.317   -11.480 -50.453 1.00 11.34  ? 112 ASP A CA    1 
ATOM   745  C  C     . ASP A 1 118 ? 3.477   -11.223 -49.506 1.00 14.42  ? 112 ASP A C     1 
ATOM   746  O  O     . ASP A 1 118 ? 3.279   -10.832 -48.353 1.00 16.15  ? 112 ASP A O     1 
ATOM   747  C  CB    . ASP A 1 118 ? 2.310   -10.498 -51.623 1.00 16.76  ? 112 ASP A CB    1 
ATOM   748  C  CG    . ASP A 1 118 ? 2.133   -9.050  -51.199 1.00 26.22  ? 112 ASP A CG    1 
ATOM   749  O  OD1   . ASP A 1 118 ? 2.486   -8.704  -50.052 1.00 23.56  ? 112 ASP A OD1   1 
ATOM   750  O  OD2   . ASP A 1 118 ? 1.655   -8.244  -52.041 1.00 31.75  ? 112 ASP A OD2   1 
ATOM   751  N  N     . ILE A 1 119 ? 4.688   -11.451 -49.992 1.00 13.32  ? 113 ILE A N     1 
ATOM   752  C  CA    . ILE A 1 119 ? 5.878   -11.149 -49.223 1.00 11.78  ? 113 ILE A CA    1 
ATOM   753  C  C     . ILE A 1 119 ? 6.739   -10.121 -49.934 1.00 15.38  ? 113 ILE A C     1 
ATOM   754  O  O     . ILE A 1 119 ? 7.128   -10.329 -51.080 1.00 18.58  ? 113 ILE A O     1 
ATOM   755  C  CB    . ILE A 1 119 ? 6.715   -12.388 -49.034 1.00 11.10  ? 113 ILE A CB    1 
ATOM   756  C  CG1   . ILE A 1 119 ? 5.946   -13.399 -48.194 1.00 13.66  ? 113 ILE A CG1   1 
ATOM   757  C  CG2   . ILE A 1 119 ? 8.044   -12.033 -48.390 1.00 11.06  ? 113 ILE A CG2   1 
ATOM   758  C  CD1   . ILE A 1 119 ? 6.806   -14.500 -47.620 1.00 12.22  ? 113 ILE A CD1   1 
ATOM   759  N  N     . ASP A 1 120 ? 7.046   -9.015  -49.266 1.00 13.73  ? 114 ASP A N     1 
ATOM   760  C  CA    . ASP A 1 120 ? 7.912   -8.014  -49.875 1.00 15.93  ? 114 ASP A CA    1 
ATOM   761  C  C     . ASP A 1 120 ? 9.356   -8.292  -49.508 1.00 14.19  ? 114 ASP A C     1 
ATOM   762  O  O     . ASP A 1 120 ? 9.715   -8.290  -48.343 1.00 17.89  ? 114 ASP A O     1 
ATOM   763  C  CB    . ASP A 1 120 ? 7.499   -6.605  -49.454 1.00 16.09  ? 114 ASP A CB    1 
ATOM   764  C  CG    . ASP A 1 120 ? 6.091   -6.248  -49.913 1.00 21.35  ? 114 ASP A CG    1 
ATOM   765  O  OD1   . ASP A 1 120 ? 5.862   -6.044  -51.135 1.00 17.61  ? 114 ASP A OD1   1 
ATOM   766  O  OD2   . ASP A 1 120 ? 5.209   -6.162  -49.035 1.00 21.26  ? 114 ASP A OD2   1 
ATOM   767  N  N     . ALA A 1 121 ? 10.200  -8.546  -50.492 1.00 14.56  ? 115 ALA A N     1 
ATOM   768  C  CA    . ALA A 1 121 ? 11.561  -8.921  -50.157 1.00 12.92  ? 115 ALA A CA    1 
ATOM   769  C  C     . ALA A 1 121 ? 12.612  -8.064  -50.851 1.00 12.63  ? 115 ALA A C     1 
ATOM   770  O  O     . ALA A 1 121 ? 12.366  -7.497  -51.914 1.00 15.07  ? 115 ALA A O     1 
ATOM   771  C  CB    . ALA A 1 121 ? 11.773  -10.384 -50.447 1.00 11.85  ? 115 ALA A CB    1 
ATOM   772  N  N     . LEU A 1 122 ? 13.785  -7.990  -50.240 1.00 9.64   ? 116 LEU A N     1 
ATOM   773  C  CA    . LEU A 1 122 ? 14.881  -7.172  -50.736 1.00 13.10  ? 116 LEU A CA    1 
ATOM   774  C  C     . LEU A 1 122 ? 16.141  -7.998  -50.950 1.00 17.94  ? 116 LEU A C     1 
ATOM   775  O  O     . LEU A 1 122 ? 16.609  -8.687  -50.050 1.00 17.45  ? 116 LEU A O     1 
ATOM   776  C  CB    . LEU A 1 122 ? 15.201  -6.045  -49.757 1.00 15.87  ? 116 LEU A CB    1 
ATOM   777  C  CG    . LEU A 1 122 ? 16.543  -5.347  -49.977 1.00 16.78  ? 116 LEU A CG    1 
ATOM   778  C  CD1   . LEU A 1 122 ? 16.435  -4.359  -51.124 1.00 17.28  ? 116 LEU A CD1   1 
ATOM   779  C  CD2   . LEU A 1 122 ? 17.023  -4.659  -48.721 1.00 12.68  ? 116 LEU A CD2   1 
ATOM   780  N  N     . CYS A 1 123 ? 16.694  -7.917  -52.153 1.00 28.86  ? 117 CYS A N     1 
ATOM   781  C  CA    . CYS A 1 123 ? 17.931  -8.606  -52.467 1.00 21.17  ? 117 CYS A CA    1 
ATOM   782  C  C     . CYS A 1 123 ? 19.109  -7.654  -52.357 1.00 22.00  ? 117 CYS A C     1 
ATOM   783  O  O     . CYS A 1 123 ? 19.135  -6.618  -53.023 1.00 29.29  ? 117 CYS A O     1 
ATOM   784  C  CB    . CYS A 1 123 ? 17.870  -9.143  -53.886 1.00 19.45  ? 117 CYS A CB    1 
ATOM   785  S  SG    . CYS A 1 123 ? 19.441  -9.848  -54.353 1.00 26.34  ? 117 CYS A SG    1 
ATOM   786  N  N     . VAL A 1 124 ? 20.090  -8.002  -51.537 1.00 14.81  ? 118 VAL A N     1 
ATOM   787  C  CA    . VAL A 1 124 ? 21.221  -7.115  -51.325 1.00 21.38  ? 118 VAL A CA    1 
ATOM   788  C  C     . VAL A 1 124 ? 22.521  -7.736  -51.785 1.00 25.67  ? 118 VAL A C     1 
ATOM   789  O  O     . VAL A 1 124 ? 22.968  -8.733  -51.226 1.00 31.99  ? 118 VAL A O     1 
ATOM   790  C  CB    . VAL A 1 124 ? 21.350  -6.705  -49.847 1.00 27.54  ? 118 VAL A CB    1 
ATOM   791  C  CG1   . VAL A 1 124 ? 22.686  -6.007  -49.584 1.00 25.64  ? 118 VAL A CG1   1 
ATOM   792  C  CG2   . VAL A 1 124 ? 20.198  -5.808  -49.457 1.00 21.18  ? 118 VAL A CG2   1 
ATOM   793  N  N     . ALA A 1 125 ? 23.132  -7.117  -52.791 1.00 30.46  ? 119 ALA A N     1 
ATOM   794  C  CA    . ALA A 1 125 ? 24.327  -7.649  -53.443 1.00 36.97  ? 119 ALA A CA    1 
ATOM   795  C  C     . ALA A 1 125 ? 25.552  -6.786  -53.156 1.00 37.99  ? 119 ALA A C     1 
ATOM   796  O  O     . ALA A 1 125 ? 25.410  -5.669  -52.656 1.00 34.27  ? 119 ALA A O     1 
ATOM   797  C  CB    . ALA A 1 125 ? 24.090  -7.750  -54.949 1.00 34.65  ? 119 ALA A CB    1 
ATOM   798  N  N     . PRO A 1 126 ? 26.761  -7.310  -53.449 1.00 42.35  ? 120 PRO A N     1 
ATOM   799  C  CA    . PRO A 1 126 ? 28.008  -6.535  -53.332 1.00 50.11  ? 120 PRO A CA    1 
ATOM   800  C  C     . PRO A 1 126 ? 28.434  -5.747  -54.601 1.00 50.51  ? 120 PRO A C     1 
ATOM   801  O  O     . PRO A 1 126 ? 27.759  -5.846  -55.638 1.00 44.73  ? 120 PRO A O     1 
ATOM   802  C  CB    . PRO A 1 126 ? 29.056  -7.611  -52.983 1.00 47.76  ? 120 PRO A CB    1 
ATOM   803  C  CG    . PRO A 1 126 ? 28.280  -8.845  -52.626 1.00 40.08  ? 120 PRO A CG    1 
ATOM   804  C  CD    . PRO A 1 126 ? 27.039  -8.754  -53.451 1.00 42.15  ? 120 PRO A CD    1 
ATOM   805  N  N     . ARG A 1 127 ? 29.533  -4.984  -54.480 1.00 44.19  ? 121 ARG A N     1 
ATOM   806  C  CA    . ARG A 1 127 ? 30.117  -4.123  -55.534 1.00 49.63  ? 121 ARG A CA    1 
ATOM   807  C  C     . ARG A 1 127 ? 29.877  -4.526  -56.988 1.00 48.98  ? 121 ARG A C     1 
ATOM   808  O  O     . ARG A 1 127 ? 29.435  -3.722  -57.812 1.00 42.02  ? 121 ARG A O     1 
ATOM   809  C  CB    . ARG A 1 127 ? 31.645  -4.060  -55.388 1.00 52.13  ? 121 ARG A CB    1 
ATOM   810  C  CG    . ARG A 1 127 ? 32.232  -3.333  -54.192 1.00 46.13  ? 121 ARG A CG    1 
ATOM   811  C  CD    . ARG A 1 127 ? 33.724  -3.162  -54.439 1.00 44.62  ? 121 ARG A CD    1 
ATOM   812  N  NE    . ARG A 1 127 ? 34.582  -3.127  -53.254 1.00 47.54  ? 121 ARG A NE    1 
ATOM   813  C  CZ    . ARG A 1 127 ? 35.505  -4.047  -52.967 1.00 44.68  ? 121 ARG A CZ    1 
ATOM   814  N  NH1   . ARG A 1 127 ? 35.685  -5.086  -53.775 1.00 42.78  ? 121 ARG A NH1   1 
ATOM   815  N  NH2   . ARG A 1 127 ? 36.250  -3.931  -51.874 1.00 37.98  ? 121 ARG A NH2   1 
ATOM   816  N  N     . HIS A 1 128 ? 30.222  -5.771  -57.296 1.00 47.49  ? 122 HIS A N     1 
ATOM   817  C  CA    . HIS A 1 128 ? 30.316  -6.234  -58.671 1.00 44.31  ? 122 HIS A CA    1 
ATOM   818  C  C     . HIS A 1 128 ? 28.987  -6.574  -59.333 1.00 44.52  ? 122 HIS A C     1 
ATOM   819  O  O     . HIS A 1 128 ? 28.962  -7.046  -60.465 1.00 50.80  ? 122 HIS A O     1 
ATOM   820  C  CB    . HIS A 1 128 ? 31.248  -7.438  -58.744 1.00 49.63  ? 122 HIS A CB    1 
ATOM   821  C  CG    . HIS A 1 128 ? 30.857  -8.566  -57.839 1.00 56.81  ? 122 HIS A CG    1 
ATOM   822  N  ND1   . HIS A 1 128 ? 29.767  -9.374  -58.083 1.00 53.53  ? 122 HIS A ND1   1 
ATOM   823  C  CD2   . HIS A 1 128 ? 31.424  -9.033  -56.699 1.00 58.59  ? 122 HIS A CD2   1 
ATOM   824  C  CE1   . HIS A 1 128 ? 29.676  -10.287 -57.130 1.00 57.77  ? 122 HIS A CE1   1 
ATOM   825  N  NE2   . HIS A 1 128 ? 30.670  -10.104 -56.279 1.00 58.70  ? 122 HIS A NE2   1 
ATOM   826  N  N     . VAL A 1 129 ? 27.882  -6.334  -58.641 1.00 48.18  ? 123 VAL A N     1 
ATOM   827  C  CA    . VAL A 1 129 ? 26.582  -6.679  -59.196 1.00 45.58  ? 123 VAL A CA    1 
ATOM   828  C  C     . VAL A 1 129 ? 25.803  -5.420  -59.510 1.00 47.26  ? 123 VAL A C     1 
ATOM   829  O  O     . VAL A 1 129 ? 25.536  -4.613  -58.625 1.00 56.76  ? 123 VAL A O     1 
ATOM   830  C  CB    . VAL A 1 129 ? 25.759  -7.529  -58.225 1.00 42.95  ? 123 VAL A CB    1 
ATOM   831  C  CG1   . VAL A 1 129 ? 24.585  -8.140  -58.953 1.00 36.02  ? 123 VAL A CG1   1 
ATOM   832  C  CG2   . VAL A 1 129 ? 26.623  -8.613  -57.591 1.00 42.99  ? 123 VAL A CG2   1 
ATOM   833  N  N     . GLU A 1 130 ? 25.436  -5.250  -60.770 1.00 36.75  ? 124 GLU A N     1 
ATOM   834  C  CA    . GLU A 1 130 ? 24.802  -4.016  -61.192 1.00 44.76  ? 124 GLU A CA    1 
ATOM   835  C  C     . GLU A 1 130 ? 23.303  -4.225  -61.251 1.00 41.58  ? 124 GLU A C     1 
ATOM   836  O  O     . GLU A 1 130 ? 22.835  -5.335  -61.511 1.00 38.44  ? 124 GLU A O     1 
ATOM   837  C  CB    . GLU A 1 130 ? 25.337  -3.593  -62.570 1.00 57.87  ? 124 GLU A CB    1 
ATOM   838  C  CG    . GLU A 1 130 ? 25.069  -2.130  -62.963 1.00 61.18  ? 124 GLU A CG    1 
ATOM   839  C  CD    . GLU A 1 130 ? 26.243  -1.208  -62.648 1.00 73.06  ? 124 GLU A CD    1 
ATOM   840  O  OE1   . GLU A 1 130 ? 26.031  0.024   -62.540 1.00 61.97  ? 124 GLU A OE1   1 
ATOM   841  O  OE2   . GLU A 1 130 ? 27.380  -1.718  -62.511 1.00 70.95  ? 124 GLU A OE2   1 
ATOM   842  N  N     . ARG A 1 131 ? 22.553  -3.152  -61.024 1.00 39.15  ? 125 ARG A N     1 
ATOM   843  C  CA    . ARG A 1 131 ? 21.098  -3.187  -61.144 1.00 42.41  ? 125 ARG A CA    1 
ATOM   844  C  C     . ARG A 1 131 ? 20.668  -3.789  -62.484 1.00 47.61  ? 125 ARG A C     1 
ATOM   845  O  O     . ARG A 1 131 ? 19.587  -4.361  -62.608 1.00 43.29  ? 125 ARG A O     1 
ATOM   846  C  CB    . ARG A 1 131 ? 20.518  -1.779  -60.985 1.00 31.28  ? 125 ARG A CB    1 
ATOM   847  C  CG    . ARG A 1 131 ? 21.140  -0.998  -59.840 1.00 38.05  ? 125 ARG A CG    1 
ATOM   848  C  CD    . ARG A 1 131 ? 20.218  0.099   -59.330 1.00 42.56  ? 125 ARG A CD    1 
ATOM   849  N  NE    . ARG A 1 131 ? 19.101  -0.435  -58.549 1.00 48.55  ? 125 ARG A NE    1 
ATOM   850  C  CZ    . ARG A 1 131 ? 17.893  -0.704  -59.051 1.00 50.83  ? 125 ARG A CZ    1 
ATOM   851  N  NH1   . ARG A 1 131 ? 17.627  -0.491  -60.345 1.00 34.42  ? 125 ARG A NH1   1 
ATOM   852  N  NH2   . ARG A 1 131 ? 16.945  -1.188  -58.253 1.00 44.26  ? 125 ARG A NH2   1 
ATOM   853  N  N     . SER A 1 132 ? 21.534  -3.650  -63.482 1.00 52.65  ? 126 SER A N     1 
ATOM   854  C  CA    . SER A 1 132 ? 21.310  -4.209  -64.803 1.00 50.71  ? 126 SER A CA    1 
ATOM   855  C  C     . SER A 1 132 ? 21.285  -5.735  -64.768 1.00 54.12  ? 126 SER A C     1 
ATOM   856  O  O     . SER A 1 132 ? 20.510  -6.360  -65.495 1.00 48.72  ? 126 SER A O     1 
ATOM   857  C  CB    . SER A 1 132 ? 22.418  -3.738  -65.740 1.00 56.24  ? 126 SER A CB    1 
ATOM   858  O  OG    . SER A 1 132 ? 23.693  -3.988  -65.168 1.00 47.87  ? 126 SER A OG    1 
ATOM   859  N  N     . ASP A 1 133 ? 22.133  -6.325  -63.920 1.00 51.22  ? 127 ASP A N     1 
ATOM   860  C  CA    . ASP A 1 133 ? 22.265  -7.785  -63.810 1.00 50.02  ? 127 ASP A CA    1 
ATOM   861  C  C     . ASP A 1 133 ? 20.999  -8.477  -63.261 1.00 53.71  ? 127 ASP A C     1 
ATOM   862  O  O     . ASP A 1 133 ? 20.523  -9.473  -63.811 1.00 42.82  ? 127 ASP A O     1 
ATOM   863  C  CB    . ASP A 1 133 ? 23.470  -8.141  -62.927 1.00 43.75  ? 127 ASP A CB    1 
ATOM   864  C  CG    . ASP A 1 133 ? 24.794  -7.692  -63.526 1.00 51.49  ? 127 ASP A CG    1 
ATOM   865  O  OD1   . ASP A 1 133 ? 24.776  -6.987  -64.557 1.00 57.08  ? 127 ASP A OD1   1 
ATOM   866  O  OD2   . ASP A 1 133 ? 25.857  -8.037  -62.957 1.00 47.18  ? 127 ASP A OD2   1 
ATOM   867  N  N     . PHE A 1 134 ? 20.475  -7.941  -62.163 1.00 54.20  ? 128 PHE A N     1 
ATOM   868  C  CA    . PHE A 1 134 ? 19.284  -8.473  -61.507 1.00 44.78  ? 128 PHE A CA    1 
ATOM   869  C  C     . PHE A 1 134 ? 18.110  -8.617  -62.489 1.00 39.15  ? 128 PHE A C     1 
ATOM   870  O  O     . PHE A 1 134 ? 17.402  -9.624  -62.471 1.00 38.21  ? 128 PHE A O     1 
ATOM   871  C  CB    . PHE A 1 134 ? 18.938  -7.586  -60.286 1.00 42.04  ? 128 PHE A CB    1 
ATOM   872  C  CG    . PHE A 1 134 ? 17.592  -7.871  -59.648 1.00 37.67  ? 128 PHE A CG    1 
ATOM   873  C  CD1   . PHE A 1 134 ? 17.444  -8.889  -58.715 1.00 38.70  ? 128 PHE A CD1   1 
ATOM   874  C  CD2   . PHE A 1 134 ? 16.489  -7.087  -59.954 1.00 32.69  ? 128 PHE A CD2   1 
ATOM   875  C  CE1   . PHE A 1 134 ? 16.214  -9.141  -58.128 1.00 30.38  ? 128 PHE A CE1   1 
ATOM   876  C  CE2   . PHE A 1 134 ? 15.269  -7.326  -59.369 1.00 30.66  ? 128 PHE A CE2   1 
ATOM   877  C  CZ    . PHE A 1 134 ? 15.126  -8.360  -58.461 1.00 30.17  ? 128 PHE A CZ    1 
ATOM   878  N  N     . PHE A 1 135 ? 17.931  -7.638  -63.369 1.00 30.31  ? 129 PHE A N     1 
ATOM   879  C  CA    . PHE A 1 135 ? 16.777  -7.643  -64.259 1.00 33.97  ? 129 PHE A CA    1 
ATOM   880  C  C     . PHE A 1 135 ? 16.935  -8.483  -65.525 1.00 48.62  ? 129 PHE A C     1 
ATOM   881  O  O     . PHE A 1 135 ? 15.942  -8.733  -66.219 1.00 48.68  ? 129 PHE A O     1 
ATOM   882  C  CB    . PHE A 1 135 ? 16.395  -6.228  -64.653 1.00 41.02  ? 129 PHE A CB    1 
ATOM   883  C  CG    . PHE A 1 135 ? 15.648  -5.485  -63.594 1.00 48.38  ? 129 PHE A CG    1 
ATOM   884  C  CD1   . PHE A 1 135 ? 16.327  -4.723  -62.651 1.00 41.68  ? 129 PHE A CD1   1 
ATOM   885  C  CD2   . PHE A 1 135 ? 14.262  -5.527  -63.551 1.00 48.76  ? 129 PHE A CD2   1 
ATOM   886  C  CE1   . PHE A 1 135 ? 15.640  -4.022  -61.682 1.00 38.23  ? 129 PHE A CE1   1 
ATOM   887  C  CE2   . PHE A 1 135 ? 13.566  -4.835  -62.574 1.00 45.93  ? 129 PHE A CE2   1 
ATOM   888  C  CZ    . PHE A 1 135 ? 14.258  -4.076  -61.642 1.00 41.50  ? 129 PHE A CZ    1 
ATOM   889  N  N     . GLN A 1 136 ? 18.165  -8.897  -65.845 1.00 50.46  ? 130 GLN A N     1 
ATOM   890  C  CA    . GLN A 1 136 ? 18.375  -9.836  -66.961 1.00 46.93  ? 130 GLN A CA    1 
ATOM   891  C  C     . GLN A 1 136 ? 18.791  -11.268 -66.545 1.00 46.65  ? 130 GLN A C     1 
ATOM   892  O  O     . GLN A 1 136 ? 18.065  -12.220 -66.843 1.00 49.66  ? 130 GLN A O     1 
ATOM   893  C  CB    . GLN A 1 136 ? 19.266  -9.256  -68.091 1.00 51.75  ? 130 GLN A CB    1 
ATOM   894  C  CG    . GLN A 1 136 ? 20.617  -8.655  -67.676 1.00 55.58  ? 130 GLN A CG    1 
ATOM   895  C  CD    . GLN A 1 136 ? 21.754  -9.673  -67.628 1.00 58.27  ? 130 GLN A CD    1 
ATOM   896  O  OE1   . GLN A 1 136 ? 22.519  -9.722  -66.656 1.00 47.64  ? 130 GLN A OE1   1 
ATOM   897  N  NE2   . GLN A 1 136 ? 21.879  -10.481 -68.684 1.00 56.63  ? 130 GLN A NE2   1 
ATOM   898  N  N     . SER A 1 137 ? 19.918  -11.427 -65.846 1.00 41.24  ? 131 SER A N     1 
ATOM   899  C  CA    . SER A 1 137 ? 20.436  -12.769 -65.522 1.00 37.65  ? 131 SER A CA    1 
ATOM   900  C  C     . SER A 1 137 ? 19.735  -13.502 -64.354 1.00 47.32  ? 131 SER A C     1 
ATOM   901  O  O     . SER A 1 137 ? 19.309  -14.652 -64.507 1.00 46.91  ? 131 SER A O     1 
ATOM   902  C  CB    . SER A 1 137 ? 21.957  -12.747 -65.320 1.00 38.23  ? 131 SER A CB    1 
ATOM   903  O  OG    . SER A 1 137 ? 22.333  -12.073 -64.135 1.00 49.51  ? 131 SER A OG    1 
ATOM   904  N  N     . PHE A 1 138 ? 19.631  -12.849 -63.196 1.00 47.17  ? 132 PHE A N     1 
ATOM   905  C  CA    . PHE A 1 138 ? 18.850  -13.394 -62.091 1.00 36.80  ? 132 PHE A CA    1 
ATOM   906  C  C     . PHE A 1 138 ? 17.397  -13.550 -62.520 1.00 35.19  ? 132 PHE A C     1 
ATOM   907  O  O     . PHE A 1 138 ? 16.730  -14.491 -62.108 1.00 36.10  ? 132 PHE A O     1 
ATOM   908  C  CB    . PHE A 1 138 ? 18.932  -12.503 -60.850 1.00 44.37  ? 132 PHE A CB    1 
ATOM   909  C  CG    . PHE A 1 138 ? 18.260  -13.088 -59.629 1.00 37.39  ? 132 PHE A CG    1 
ATOM   910  C  CD1   . PHE A 1 138 ? 18.958  -13.920 -58.767 1.00 35.45  ? 132 PHE A CD1   1 
ATOM   911  C  CD2   . PHE A 1 138 ? 16.934  -12.806 -59.346 1.00 27.61  ? 132 PHE A CD2   1 
ATOM   912  C  CE1   . PHE A 1 138 ? 18.349  -14.462 -57.647 1.00 29.77  ? 132 PHE A CE1   1 
ATOM   913  C  CE2   . PHE A 1 138 ? 16.321  -13.347 -58.236 1.00 28.17  ? 132 PHE A CE2   1 
ATOM   914  C  CZ    . PHE A 1 138 ? 17.031  -14.174 -57.384 1.00 24.94  ? 132 PHE A CZ    1 
ATOM   915  N  N     . PHE A 1 139 ? 16.905  -12.631 -63.344 1.00 31.70  ? 133 PHE A N     1 
ATOM   916  C  CA    . PHE A 1 139 ? 15.584  -12.807 -63.925 1.00 30.31  ? 133 PHE A CA    1 
ATOM   917  C  C     . PHE A 1 139 ? 15.559  -14.103 -64.742 1.00 38.18  ? 133 PHE A C     1 
ATOM   918  O  O     . PHE A 1 139 ? 14.536  -14.786 -64.808 1.00 38.03  ? 133 PHE A O     1 
ATOM   919  C  CB    . PHE A 1 139 ? 15.162  -11.609 -64.789 1.00 25.07  ? 133 PHE A CB    1 
ATOM   920  C  CG    . PHE A 1 139 ? 13.736  -11.687 -65.266 1.00 26.97  ? 133 PHE A CG    1 
ATOM   921  C  CD1   . PHE A 1 139 ? 13.395  -12.449 -66.377 1.00 30.03  ? 133 PHE A CD1   1 
ATOM   922  C  CD2   . PHE A 1 139 ? 12.726  -11.023 -64.587 1.00 30.55  ? 133 PHE A CD2   1 
ATOM   923  C  CE1   . PHE A 1 139 ? 12.080  -12.540 -66.802 1.00 24.85  ? 133 PHE A CE1   1 
ATOM   924  C  CE2   . PHE A 1 139 ? 11.402  -11.106 -65.008 1.00 27.12  ? 133 PHE A CE2   1 
ATOM   925  C  CZ    . PHE A 1 139 ? 11.083  -11.863 -66.122 1.00 29.31  ? 133 PHE A CZ    1 
ATOM   926  N  N     . GLU A 1 140 ? 16.680  -14.450 -65.367 1.00 38.23  ? 134 GLU A N     1 
ATOM   927  C  CA    . GLU A 1 140 ? 16.721  -15.702 -66.114 1.00 46.55  ? 134 GLU A CA    1 
ATOM   928  C  C     . GLU A 1 140 ? 16.792  -16.876 -65.147 1.00 42.70  ? 134 GLU A C     1 
ATOM   929  O  O     . GLU A 1 140 ? 16.234  -17.941 -65.417 1.00 45.59  ? 134 GLU A O     1 
ATOM   930  C  CB    . GLU A 1 140 ? 17.868  -15.740 -67.138 1.00 46.59  ? 134 GLU A CB    1 
ATOM   931  C  CG    . GLU A 1 140 ? 17.557  -15.004 -68.451 1.00 42.65  ? 134 GLU A CG    1 
ATOM   932  C  CD    . GLU A 1 140 ? 16.249  -15.457 -69.096 1.00 53.13  ? 134 GLU A CD    1 
ATOM   933  O  OE1   . GLU A 1 140 ? 16.113  -16.668 -69.385 1.00 54.50  ? 134 GLU A OE1   1 
ATOM   934  O  OE2   . GLU A 1 140 ? 15.352  -14.604 -69.312 1.00 53.53  ? 134 GLU A OE2   1 
ATOM   935  N  N     . LYS A 1 141 ? 17.452  -16.668 -64.011 1.00 35.20  ? 135 LYS A N     1 
ATOM   936  C  CA    . LYS A 1 141 ? 17.554  -17.718 -63.003 1.00 33.63  ? 135 LYS A CA    1 
ATOM   937  C  C     . LYS A 1 141 ? 16.183  -18.139 -62.464 1.00 35.56  ? 135 LYS A C     1 
ATOM   938  O  O     . LYS A 1 141 ? 15.891  -19.328 -62.347 1.00 36.92  ? 135 LYS A O     1 
ATOM   939  C  CB    . LYS A 1 141 ? 18.486  -17.308 -61.858 1.00 28.88  ? 135 LYS A CB    1 
ATOM   940  C  CG    . LYS A 1 141 ? 18.954  -18.499 -61.015 1.00 30.99  ? 135 LYS A CG    1 
ATOM   941  C  CD    . LYS A 1 141 ? 20.224  -18.212 -60.236 1.00 28.94  ? 135 LYS A CD    1 
ATOM   942  C  CE    . LYS A 1 141 ? 21.149  -19.414 -60.275 1.00 39.43  ? 135 LYS A CE    1 
ATOM   943  N  NZ    . LYS A 1 141 ? 20.412  -20.674 -59.954 1.00 47.43  ? 135 LYS A NZ    1 
ATOM   944  N  N     . LEU A 1 142 ? 15.338  -17.167 -62.146 1.00 31.75  ? 136 LEU A N     1 
ATOM   945  C  CA    . LEU A 1 142 ? 14.034  -17.480 -61.585 1.00 30.29  ? 136 LEU A CA    1 
ATOM   946  C  C     . LEU A 1 142 ? 13.194  -18.259 -62.584 1.00 33.51  ? 136 LEU A C     1 
ATOM   947  O  O     . LEU A 1 142 ? 12.577  -19.257 -62.216 1.00 37.72  ? 136 LEU A O     1 
ATOM   948  C  CB    . LEU A 1 142 ? 13.295  -16.213 -61.135 1.00 32.65  ? 136 LEU A CB    1 
ATOM   949  C  CG    . LEU A 1 142 ? 13.951  -15.324 -60.073 1.00 23.21  ? 136 LEU A CG    1 
ATOM   950  C  CD1   . LEU A 1 142 ? 13.072  -14.139 -59.794 1.00 23.15  ? 136 LEU A CD1   1 
ATOM   951  C  CD2   . LEU A 1 142 ? 14.231  -16.082 -58.798 1.00 23.16  ? 136 LEU A CD2   1 
ATOM   952  N  N     . LYS A 1 143 ? 13.194  -17.815 -63.840 1.00 31.75  ? 137 LYS A N     1 
ATOM   953  C  CA    . LYS A 1 143 ? 12.387  -18.434 -64.891 1.00 34.74  ? 137 LYS A CA    1 
ATOM   954  C  C     . LYS A 1 143 ? 12.551  -19.946 -64.902 1.00 38.81  ? 137 LYS A C     1 
ATOM   955  O  O     . LYS A 1 143 ? 11.592  -20.685 -65.141 1.00 39.54  ? 137 LYS A O     1 
ATOM   956  C  CB    . LYS A 1 143 ? 12.748  -17.861 -66.267 1.00 36.67  ? 137 LYS A CB    1 
ATOM   957  C  CG    . LYS A 1 143 ? 11.634  -18.008 -67.319 1.00 43.94  ? 137 LYS A CG    1 
ATOM   958  C  CD    . LYS A 1 143 ? 11.962  -17.279 -68.636 1.00 52.96  ? 137 LYS A CD    1 
ATOM   959  C  CE    . LYS A 1 143 ? 13.131  -17.946 -69.373 1.00 64.60  ? 137 LYS A CE    1 
ATOM   960  N  NZ    . LYS A 1 143 ? 13.435  -17.340 -70.706 1.00 57.18  ? 137 LYS A NZ    1 
ATOM   961  N  N     . HIS A 1 144 ? 13.762  -20.396 -64.594 1.00 32.05  ? 138 HIS A N     1 
ATOM   962  C  CA    . HIS A 1 144 ? 14.085  -21.816 -64.627 1.00 42.32  ? 138 HIS A CA    1 
ATOM   963  C  C     . HIS A 1 144 ? 13.731  -22.618 -63.367 1.00 42.36  ? 138 HIS A C     1 
ATOM   964  O  O     . HIS A 1 144 ? 13.458  -23.818 -63.463 1.00 40.77  ? 138 HIS A O     1 
ATOM   965  C  CB    . HIS A 1 144 ? 15.557  -22.014 -65.009 1.00 48.68  ? 138 HIS A CB    1 
ATOM   966  C  CG    . HIS A 1 144 ? 15.843  -21.701 -66.446 1.00 64.62  ? 138 HIS A CG    1 
ATOM   967  N  ND1   . HIS A 1 144 ? 17.109  -21.415 -66.913 1.00 72.17  ? 138 HIS A ND1   1 
ATOM   968  C  CD2   . HIS A 1 144 ? 15.020  -21.628 -67.522 1.00 60.07  ? 138 HIS A CD2   1 
ATOM   969  C  CE1   . HIS A 1 144 ? 17.052  -21.178 -68.212 1.00 76.71  ? 138 HIS A CE1   1 
ATOM   970  N  NE2   . HIS A 1 144 ? 15.796  -21.299 -68.605 1.00 73.89  ? 138 HIS A NE2   1 
ATOM   971  N  N     . GLN A 1 145 ? 13.727  -21.968 -62.201 1.00 41.95  ? 139 GLN A N     1 
ATOM   972  C  CA    . GLN A 1 145 ? 13.461  -22.667 -60.940 1.00 37.19  ? 139 GLN A CA    1 
ATOM   973  C  C     . GLN A 1 145 ? 12.091  -23.332 -60.933 1.00 36.17  ? 139 GLN A C     1 
ATOM   974  O  O     . GLN A 1 145 ? 11.148  -22.845 -61.570 1.00 27.35  ? 139 GLN A O     1 
ATOM   975  C  CB    . GLN A 1 145 ? 13.631  -21.747 -59.724 1.00 30.00  ? 139 GLN A CB    1 
ATOM   976  C  CG    . GLN A 1 145 ? 15.090  -21.537 -59.306 1.00 38.14  ? 139 GLN A CG    1 
ATOM   977  C  CD    . GLN A 1 145 ? 15.706  -22.750 -58.596 1.00 50.57  ? 139 GLN A CD    1 
ATOM   978  O  OE1   . GLN A 1 145 ? 15.011  -23.496 -57.889 1.00 47.63  ? 139 GLN A OE1   1 
ATOM   979  N  NE2   . GLN A 1 145 ? 17.023  -22.945 -58.779 1.00 35.10  ? 139 GLN A NE2   1 
ATOM   980  N  N     . ASP A 1 146 ? 12.008  -24.444 -60.201 1.00 35.93  ? 140 ASP A N     1 
ATOM   981  C  CA    . ASP A 1 146 ? 10.854  -25.340 -60.221 1.00 30.18  ? 140 ASP A CA    1 
ATOM   982  C  C     . ASP A 1 146 ? 9.486   -24.671 -60.031 1.00 32.31  ? 140 ASP A C     1 
ATOM   983  O  O     . ASP A 1 146 ? 8.685   -24.616 -60.969 1.00 45.60  ? 140 ASP A O     1 
ATOM   984  C  CB    . ASP A 1 146 ? 11.026  -26.471 -59.204 1.00 23.46  ? 140 ASP A CB    1 
ATOM   985  C  CG    . ASP A 1 146 ? 11.580  -27.757 -59.825 1.00 27.96  ? 140 ASP A CG    1 
ATOM   986  O  OD1   . ASP A 1 146 ? 11.478  -27.937 -61.065 1.00 22.36  ? 140 ASP A OD1   1 
ATOM   987  O  OD2   . ASP A 1 146 ? 12.106  -28.602 -59.051 1.00 23.38  ? 140 ASP A OD2   1 
ATOM   988  N  N     . GLY A 1 147 ? 9.201   -24.171 -58.836 1.00 17.75  ? 141 GLY A N     1 
ATOM   989  C  CA    . GLY A 1 147 ? 7.844   -23.718 -58.562 1.00 21.76  ? 141 GLY A CA    1 
ATOM   990  C  C     . GLY A 1 147 ? 7.493   -22.275 -58.896 1.00 21.87  ? 141 GLY A C     1 
ATOM   991  O  O     . GLY A 1 147 ? 6.489   -21.755 -58.420 1.00 18.86  ? 141 GLY A O     1 
ATOM   992  N  N     . ILE A 1 148 ? 8.309   -21.615 -59.713 1.00 26.26  ? 142 ILE A N     1 
ATOM   993  C  CA    . ILE A 1 148 ? 8.090   -20.201 -59.992 1.00 16.16  ? 142 ILE A CA    1 
ATOM   994  C  C     . ILE A 1 148 ? 7.171   -19.971 -61.176 1.00 21.68  ? 142 ILE A C     1 
ATOM   995  O  O     . ILE A 1 148 ? 7.412   -20.472 -62.265 1.00 28.56  ? 142 ILE A O     1 
ATOM   996  C  CB    . ILE A 1 148 ? 9.394   -19.468 -60.185 1.00 12.40  ? 142 ILE A CB    1 
ATOM   997  C  CG1   . ILE A 1 148 ? 10.150  -19.459 -58.856 1.00 19.67  ? 142 ILE A CG1   1 
ATOM   998  C  CG2   . ILE A 1 148 ? 9.120   -18.054 -60.630 1.00 17.77  ? 142 ILE A CG2   1 
ATOM   999  C  CD1   . ILE A 1 148 ? 11.489  -18.762 -58.868 1.00 23.26  ? 142 ILE A CD1   1 
ATOM   1000 N  N     . ARG A 1 149 ? 6.096   -19.231 -60.941 1.00 21.41  ? 143 ARG A N     1 
ATOM   1001 C  CA    . ARG A 1 149 ? 5.125   -18.929 -61.972 1.00 21.26  ? 143 ARG A CA    1 
ATOM   1002 C  C     . ARG A 1 149 ? 4.899   -17.426 -61.983 1.00 31.48  ? 143 ARG A C     1 
ATOM   1003 O  O     . ARG A 1 149 ? 5.319   -16.727 -61.056 1.00 28.48  ? 143 ARG A O     1 
ATOM   1004 C  CB    . ARG A 1 149 ? 3.799   -19.631 -61.683 1.00 19.94  ? 143 ARG A CB    1 
ATOM   1005 C  CG    . ARG A 1 149 ? 3.914   -21.114 -61.433 1.00 24.26  ? 143 ARG A CG    1 
ATOM   1006 C  CD    . ARG A 1 149 ? 4.577   -21.814 -62.600 1.00 32.94  ? 143 ARG A CD    1 
ATOM   1007 N  NE    . ARG A 1 149 ? 3.817   -21.590 -63.820 1.00 38.38  ? 143 ARG A NE    1 
ATOM   1008 C  CZ    . ARG A 1 149 ? 2.927   -22.448 -64.297 1.00 31.77  ? 143 ARG A CZ    1 
ATOM   1009 N  NH1   . ARG A 1 149 ? 2.719   -23.594 -63.661 1.00 25.37  ? 143 ARG A NH1   1 
ATOM   1010 N  NH2   . ARG A 1 149 ? 2.261   -22.166 -65.410 1.00 33.73  ? 143 ARG A NH2   1 
ATOM   1011 N  N     . ASN A 1 150 ? 4.241   -16.937 -63.033 1.00 35.79  ? 144 ASN A N     1 
ATOM   1012 C  CA    . ASN A 1 150 ? 3.847   -15.536 -63.117 1.00 30.40  ? 144 ASN A CA    1 
ATOM   1013 C  C     . ASN A 1 150 ? 5.017   -14.545 -63.091 1.00 28.41  ? 144 ASN A C     1 
ATOM   1014 O  O     . ASN A 1 150 ? 4.869   -13.427 -62.602 1.00 32.60  ? 144 ASN A O     1 
ATOM   1015 C  CB    . ASN A 1 150 ? 2.866   -15.208 -61.990 1.00 31.85  ? 144 ASN A CB    1 
ATOM   1016 C  CG    . ASN A 1 150 ? 1.572   -14.610 -62.495 1.00 42.44  ? 144 ASN A CG    1 
ATOM   1017 O  OD1   . ASN A 1 150 ? 1.457   -13.392 -62.656 1.00 48.26  ? 144 ASN A OD1   1 
ATOM   1018 N  ND2   . ASN A 1 150 ? 0.579   -15.464 -62.736 1.00 43.30  ? 144 ASN A ND2   1 
ATOM   1019 N  N     . LEU A 1 151 ? 6.172   -14.950 -63.610 1.00 24.93  ? 145 LEU A N     1 
ATOM   1020 C  CA    . LEU A 1 151 ? 7.341   -14.070 -63.636 1.00 25.54  ? 145 LEU A CA    1 
ATOM   1021 C  C     . LEU A 1 151 ? 7.068   -12.846 -64.476 1.00 28.32  ? 145 LEU A C     1 
ATOM   1022 O  O     . LEU A 1 151 ? 6.444   -12.944 -65.528 1.00 37.59  ? 145 LEU A O     1 
ATOM   1023 C  CB    . LEU A 1 151 ? 8.561   -14.785 -64.208 1.00 21.23  ? 145 LEU A CB    1 
ATOM   1024 C  CG    . LEU A 1 151 ? 9.757   -14.842 -63.270 1.00 25.17  ? 145 LEU A CG    1 
ATOM   1025 C  CD1   . LEU A 1 151 ? 11.017  -15.122 -64.054 1.00 29.34  ? 145 LEU A CD1   1 
ATOM   1026 C  CD2   . LEU A 1 151 ? 9.885   -13.557 -62.473 1.00 23.22  ? 145 LEU A CD2   1 
ATOM   1027 N  N     . ARG A 1 152 ? 7.539   -11.697 -64.005 1.00 31.19  ? 146 ARG A N     1 
ATOM   1028 C  CA    . ARG A 1 152 ? 7.413   -10.427 -64.727 1.00 32.69  ? 146 ARG A CA    1 
ATOM   1029 C  C     . ARG A 1 152 ? 8.242   -9.321  -64.069 1.00 39.34  ? 146 ARG A C     1 
ATOM   1030 O  O     . ARG A 1 152 ? 8.253   -9.176  -62.842 1.00 40.45  ? 146 ARG A O     1 
ATOM   1031 C  CB    . ARG A 1 152 ? 5.947   -9.980  -64.855 1.00 23.88  ? 146 ARG A CB    1 
ATOM   1032 C  CG    . ARG A 1 152 ? 5.271   -9.632  -63.554 1.00 30.23  ? 146 ARG A CG    1 
ATOM   1033 C  CD    . ARG A 1 152 ? 3.932   -10.322 -63.429 1.00 32.58  ? 146 ARG A CD    1 
ATOM   1034 N  NE    . ARG A 1 152 ? 3.684   -10.771 -62.063 1.00 33.95  ? 146 ARG A NE    1 
ATOM   1035 C  CZ    . ARG A 1 152 ? 2.813   -10.205 -61.237 1.00 40.17  ? 146 ARG A CZ    1 
ATOM   1036 N  NH1   . ARG A 1 152 ? 2.094   -9.160  -61.643 1.00 35.79  ? 146 ARG A NH1   1 
ATOM   1037 N  NH2   . ARG A 1 152 ? 2.660   -10.691 -60.008 1.00 41.69  ? 146 ARG A NH2   1 
ATOM   1038 N  N     . ALA A 1 153 ? 8.953   -8.556  -64.890 1.00 45.39  ? 147 ALA A N     1 
ATOM   1039 C  CA    . ALA A 1 153 ? 9.674   -7.387  -64.413 1.00 34.67  ? 147 ALA A CA    1 
ATOM   1040 C  C     . ALA A 1 153 ? 8.804   -6.141  -64.576 1.00 37.40  ? 147 ALA A C     1 
ATOM   1041 O  O     . ALA A 1 153 ? 7.969   -6.062  -65.485 1.00 38.57  ? 147 ALA A O     1 
ATOM   1042 C  CB    . ALA A 1 153 ? 10.994  -7.230  -65.169 1.00 40.38  ? 147 ALA A CB    1 
ATOM   1043 N  N     . VAL A 1 154 ? 8.976   -5.189  -63.666 1.00 38.79  ? 148 VAL A N     1 
ATOM   1044 C  CA    . VAL A 1 154 ? 8.429   -3.848  -63.819 1.00 40.20  ? 148 VAL A CA    1 
ATOM   1045 C  C     . VAL A 1 154 ? 9.504   -2.879  -63.331 1.00 46.64  ? 148 VAL A C     1 
ATOM   1046 O  O     . VAL A 1 154 ? 9.488   -2.480  -62.168 1.00 50.75  ? 148 VAL A O     1 
ATOM   1047 C  CB    . VAL A 1 154 ? 7.133   -3.645  -62.994 1.00 33.52  ? 148 VAL A CB    1 
ATOM   1048 C  CG1   . VAL A 1 154 ? 6.556   -2.276  -63.239 1.00 43.38  ? 148 VAL A CG1   1 
ATOM   1049 C  CG2   . VAL A 1 154 ? 6.093   -4.677  -63.354 1.00 34.21  ? 148 VAL A CG2   1 
ATOM   1050 N  N     . GLU A 1 155 ? 10.460  -2.528  -64.196 1.00 46.92  ? 149 GLU A N     1 
ATOM   1051 C  CA    . GLU A 1 155 ? 11.548  -1.634  -63.780 1.00 42.26  ? 149 GLU A CA    1 
ATOM   1052 C  C     . GLU A 1 155 ? 11.305  -0.166  -64.084 1.00 40.59  ? 149 GLU A C     1 
ATOM   1053 O  O     . GLU A 1 155 ? 12.037  0.692   -63.607 1.00 44.62  ? 149 GLU A O     1 
ATOM   1054 C  CB    . GLU A 1 155 ? 12.917  -2.068  -64.318 1.00 41.31  ? 149 GLU A CB    1 
ATOM   1055 C  CG    . GLU A 1 155 ? 12.928  -2.729  -65.683 1.00 52.11  ? 149 GLU A CG    1 
ATOM   1056 C  CD    . GLU A 1 155 ? 14.343  -3.058  -66.135 1.00 52.40  ? 149 GLU A CD    1 
ATOM   1057 O  OE1   . GLU A 1 155 ? 15.278  -2.373  -65.662 1.00 40.33  ? 149 GLU A OE1   1 
ATOM   1058 O  OE2   . GLU A 1 155 ? 14.522  -3.998  -66.945 1.00 53.58  ? 149 GLU A OE2   1 
ATOM   1059 N  N     . ASP A 1 156 ? 10.290  0.125   -64.883 1.00 43.82  ? 150 ASP A N     1 
ATOM   1060 C  CA    . ASP A 1 156 ? 9.881   1.505   -65.057 1.00 47.88  ? 150 ASP A CA    1 
ATOM   1061 C  C     . ASP A 1 156 ? 9.338   2.023   -63.718 1.00 55.44  ? 150 ASP A C     1 
ATOM   1062 O  O     . ASP A 1 156 ? 9.535   3.194   -63.374 1.00 53.79  ? 150 ASP A O     1 
ATOM   1063 C  CB    . ASP A 1 156 ? 8.839   1.648   -66.180 1.00 41.65  ? 150 ASP A CB    1 
ATOM   1064 C  CG    . ASP A 1 156 ? 7.529   0.928   -65.870 1.00 47.20  ? 150 ASP A CG    1 
ATOM   1065 O  OD1   . ASP A 1 156 ? 6.718   1.468   -65.084 1.00 47.38  ? 150 ASP A OD1   1 
ATOM   1066 O  OD2   . ASP A 1 156 ? 7.303   -0.174  -66.418 1.00 40.30  ? 150 ASP A OD2   1 
ATOM   1067 N  N     . ALA A 1 157 ? 8.691   1.134   -62.955 1.00 49.08  ? 151 ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 157 ? 7.995   1.509   -61.713 1.00 51.53  ? 151 ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 157 ? 8.846   2.280   -60.706 1.00 43.57  ? 151 ALA A C     1 
ATOM   1070 O  O     . ALA A 1 157 ? 10.079  2.300   -60.792 1.00 44.83  ? 151 ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 157 ? 7.366   0.291   -61.047 1.00 41.27  ? 151 ALA A CB    1 
ATOM   1072 N  N     . PHE A 1 158 ? 8.171   2.910   -59.751 1.00 37.95  ? 152 PHE A N     1 
ATOM   1073 C  CA    . PHE A 1 158 ? 8.835   3.796   -58.803 1.00 39.02  ? 152 PHE A CA    1 
ATOM   1074 C  C     . PHE A 1 158 ? 9.982   3.115   -58.066 1.00 34.76  ? 152 PHE A C     1 
ATOM   1075 O  O     . PHE A 1 158 ? 11.103  3.609   -58.066 1.00 33.32  ? 152 PHE A O     1 
ATOM   1076 C  CB    . PHE A 1 158 ? 7.834   4.389   -57.816 1.00 39.95  ? 152 PHE A CB    1 
ATOM   1077 C  CG    . PHE A 1 158 ? 8.422   5.446   -56.935 1.00 46.68  ? 152 PHE A CG    1 
ATOM   1078 C  CD1   . PHE A 1 158 ? 8.836   6.654   -57.472 1.00 47.59  ? 152 PHE A CD1   1 
ATOM   1079 C  CD2   . PHE A 1 158 ? 8.572   5.233   -55.578 1.00 43.84  ? 152 PHE A CD2   1 
ATOM   1080 C  CE1   . PHE A 1 158 ? 9.384   7.625   -56.679 1.00 39.32  ? 152 PHE A CE1   1 
ATOM   1081 C  CE2   . PHE A 1 158 ? 9.117   6.203   -54.779 1.00 46.27  ? 152 PHE A CE2   1 
ATOM   1082 C  CZ    . PHE A 1 158 ? 9.520   7.405   -55.332 1.00 51.70  ? 152 PHE A CZ    1 
ATOM   1083 N  N     . VAL A 1 159 ? 9.694   1.984   -57.433 1.00 40.42  ? 153 VAL A N     1 
ATOM   1084 C  CA    . VAL A 1 159 ? 10.745  1.114   -56.912 1.00 40.78  ? 153 VAL A CA    1 
ATOM   1085 C  C     . VAL A 1 159 ? 10.865  -0.093  -57.854 1.00 37.31  ? 153 VAL A C     1 
ATOM   1086 O  O     . VAL A 1 159 ? 9.926   -0.879  -57.998 1.00 37.65  ? 153 VAL A O     1 
ATOM   1087 C  CB    . VAL A 1 159 ? 10.466  0.646   -55.448 1.00 28.90  ? 153 VAL A CB    1 
ATOM   1088 C  CG1   . VAL A 1 159 ? 11.769  0.342   -54.728 1.00 26.03  ? 153 VAL A CG1   1 
ATOM   1089 C  CG2   . VAL A 1 159 ? 9.685   1.697   -54.678 1.00 19.47  ? 153 VAL A CG2   1 
ATOM   1090 N  N     . PRO A 1 160 ? 12.013  -0.230  -58.521 1.00 32.46  ? 154 PRO A N     1 
ATOM   1091 C  CA    . PRO A 1 160 ? 12.188  -1.313  -59.495 1.00 44.91  ? 154 PRO A CA    1 
ATOM   1092 C  C     . PRO A 1 160 ? 12.035  -2.691  -58.845 1.00 48.91  ? 154 PRO A C     1 
ATOM   1093 O  O     . PRO A 1 160 ? 12.818  -3.027  -57.945 1.00 43.55  ? 154 PRO A O     1 
ATOM   1094 C  CB    . PRO A 1 160 ? 13.631  -1.118  -59.983 1.00 48.27  ? 154 PRO A CB    1 
ATOM   1095 C  CG    . PRO A 1 160 ? 13.999  0.276   -59.589 1.00 41.74  ? 154 PRO A CG    1 
ATOM   1096 C  CD    . PRO A 1 160 ? 13.232  0.571   -58.348 1.00 32.06  ? 154 PRO A CD    1 
ATOM   1097 N  N     . VAL A 1 161 ? 11.054  -3.469  -59.308 1.00 39.96  ? 155 VAL A N     1 
ATOM   1098 C  CA    . VAL A 1 161 ? 10.708  -4.759  -58.703 1.00 36.28  ? 155 VAL A CA    1 
ATOM   1099 C  C     . VAL A 1 161 ? 10.672  -5.904  -59.722 1.00 34.92  ? 155 VAL A C     1 
ATOM   1100 O  O     . VAL A 1 161 ? 10.368  -5.692  -60.893 1.00 39.20  ? 155 VAL A O     1 
ATOM   1101 C  CB    . VAL A 1 161 ? 9.304   -4.677  -58.026 1.00 38.56  ? 155 VAL A CB    1 
ATOM   1102 C  CG1   . VAL A 1 161 ? 8.242   -4.285  -59.040 1.00 35.39  ? 155 VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A 1 161 ? 8.922   -5.992  -57.327 1.00 28.13  ? 155 VAL A CG2   1 
ATOM   1104 N  N     . ILE A 1 162 ? 11.000  -7.114  -59.276 1.00 33.97  ? 156 ILE A N     1 
ATOM   1105 C  CA    . ILE A 1 162 ? 10.601  -8.326  -59.988 1.00 31.29  ? 156 ILE A CA    1 
ATOM   1106 C  C     . ILE A 1 162 ? 9.506   -9.043  -59.190 1.00 27.35  ? 156 ILE A C     1 
ATOM   1107 O  O     . ILE A 1 162 ? 9.709   -9.382  -58.025 1.00 27.99  ? 156 ILE A O     1 
ATOM   1108 C  CB    . ILE A 1 162 ? 11.775  -9.284  -60.198 1.00 26.59  ? 156 ILE A CB    1 
ATOM   1109 C  CG1   . ILE A 1 162 ? 12.815  -8.654  -61.119 1.00 27.94  ? 156 ILE A CG1   1 
ATOM   1110 C  CG2   . ILE A 1 162 ? 11.279  -10.584 -60.786 1.00 21.61  ? 156 ILE A CG2   1 
ATOM   1111 C  CD1   . ILE A 1 162 ? 13.956  -9.575  -61.461 1.00 26.45  ? 156 ILE A CD1   1 
ATOM   1112 N  N     . LYS A 1 163 ? 8.348   -9.251  -59.810 1.00 22.94  ? 157 LYS A N     1 
ATOM   1113 C  CA    . LYS A 1 163 ? 7.229   -9.915  -59.158 1.00 23.31  ? 157 LYS A CA    1 
ATOM   1114 C  C     . LYS A 1 163 ? 7.104   -11.342 -59.655 1.00 29.43  ? 157 LYS A C     1 
ATOM   1115 O  O     . LYS A 1 163 ? 7.276   -11.602 -60.846 1.00 29.93  ? 157 LYS A O     1 
ATOM   1116 C  CB    . LYS A 1 163 ? 5.912   -9.211  -59.483 1.00 28.14  ? 157 LYS A CB    1 
ATOM   1117 C  CG    . LYS A 1 163 ? 5.704   -7.857  -58.856 1.00 27.95  ? 157 LYS A CG    1 
ATOM   1118 C  CD    . LYS A 1 163 ? 4.301   -7.364  -59.172 1.00 25.78  ? 157 LYS A CD    1 
ATOM   1119 C  CE    . LYS A 1 163 ? 4.160   -5.867  -58.936 1.00 34.39  ? 157 LYS A CE    1 
ATOM   1120 N  NZ    . LYS A 1 163 ? 4.207   -5.497  -57.489 1.00 41.32  ? 157 LYS A NZ    1 
ATOM   1121 N  N     . PHE A 1 164 ? 6.778   -12.263 -58.752 1.00 27.24  ? 158 PHE A N     1 
ATOM   1122 C  CA    . PHE A 1 164 ? 6.480   -13.637 -59.139 1.00 22.02  ? 158 PHE A CA    1 
ATOM   1123 C  C     . PHE A 1 164 ? 5.738   -14.361 -58.053 1.00 19.33  ? 158 PHE A C     1 
ATOM   1124 O  O     . PHE A 1 164 ? 5.492   -13.810 -56.992 1.00 27.37  ? 158 PHE A O     1 
ATOM   1125 C  CB    . PHE A 1 164 ? 7.751   -14.402 -59.469 1.00 17.34  ? 158 PHE A CB    1 
ATOM   1126 C  CG    . PHE A 1 164 ? 8.767   -14.409 -58.369 1.00 17.47  ? 158 PHE A CG    1 
ATOM   1127 C  CD1   . PHE A 1 164 ? 9.676   -13.376 -58.241 1.00 17.48  ? 158 PHE A CD1   1 
ATOM   1128 C  CD2   . PHE A 1 164 ? 8.853   -15.474 -57.493 1.00 15.73  ? 158 PHE A CD2   1 
ATOM   1129 C  CE1   . PHE A 1 164 ? 10.636  -13.394 -57.248 1.00 13.98  ? 158 PHE A CE1   1 
ATOM   1130 C  CE2   . PHE A 1 164 ? 9.809   -15.491 -56.508 1.00 15.16  ? 158 PHE A CE2   1 
ATOM   1131 C  CZ    . PHE A 1 164 ? 10.700  -14.444 -56.383 1.00 12.42  ? 158 PHE A CZ    1 
ATOM   1132 N  N     . GLU A 1 165 ? 5.359   -15.597 -58.325 1.00 19.72  ? 159 GLU A N     1 
ATOM   1133 C  CA    . GLU A 1 165 ? 4.855   -16.457 -57.276 1.00 16.01  ? 159 GLU A CA    1 
ATOM   1134 C  C     . GLU A 1 165 ? 5.820   -17.611 -57.152 1.00 18.56  ? 159 GLU A C     1 
ATOM   1135 O  O     . GLU A 1 165 ? 6.257   -18.184 -58.149 1.00 19.30  ? 159 GLU A O     1 
ATOM   1136 C  CB    . GLU A 1 165 ? 3.484   -17.000 -57.617 1.00 18.04  ? 159 GLU A CB    1 
ATOM   1137 C  CG    . GLU A 1 165 ? 2.483   -15.971 -58.042 1.00 26.95  ? 159 GLU A CG    1 
ATOM   1138 C  CD    . GLU A 1 165 ? 1.150   -16.612 -58.373 1.00 43.97  ? 159 GLU A CD    1 
ATOM   1139 O  OE1   . GLU A 1 165 ? 0.960   -17.802 -57.994 1.00 32.97  ? 159 GLU A OE1   1 
ATOM   1140 O  OE2   . GLU A 1 165 ? 0.305   -15.932 -59.009 1.00 41.26  ? 159 GLU A OE2   1 
ATOM   1141 N  N     . PHE A 1 166 ? 6.158   -17.954 -55.922 1.00 15.77  ? 160 PHE A N     1 
ATOM   1142 C  CA    . PHE A 1 166 ? 7.085   -19.037 -55.682 1.00 15.09  ? 160 PHE A CA    1 
ATOM   1143 C  C     . PHE A 1 166 ? 6.352   -20.033 -54.807 1.00 14.36  ? 160 PHE A C     1 
ATOM   1144 O  O     . PHE A 1 166 ? 6.078   -19.763 -53.649 1.00 15.80  ? 160 PHE A O     1 
ATOM   1145 C  CB    . PHE A 1 166 ? 8.327   -18.501 -54.980 1.00 10.02  ? 160 PHE A CB    1 
ATOM   1146 C  CG    . PHE A 1 166 ? 9.523   -19.387 -55.082 1.00 10.18  ? 160 PHE A CG    1 
ATOM   1147 C  CD1   . PHE A 1 166 ? 9.447   -20.620 -55.696 1.00 14.65  ? 160 PHE A CD1   1 
ATOM   1148 C  CD2   . PHE A 1 166 ? 10.736  -18.980 -54.559 1.00 11.30  ? 160 PHE A CD2   1 
ATOM   1149 C  CE1   . PHE A 1 166 ? 10.562  -21.432 -55.781 1.00 13.67  ? 160 PHE A CE1   1 
ATOM   1150 C  CE2   . PHE A 1 166 ? 11.846  -19.792 -54.635 1.00 11.56  ? 160 PHE A CE2   1 
ATOM   1151 C  CZ    . PHE A 1 166 ? 11.760  -21.015 -55.244 1.00 9.91   ? 160 PHE A CZ    1 
ATOM   1152 N  N     . ASP A 1 167 ? 6.008   -21.176 -55.379 1.00 15.16  ? 161 ASP A N     1 
ATOM   1153 C  CA    . ASP A 1 167 ? 5.262   -22.190 -54.656 1.00 12.70  ? 161 ASP A CA    1 
ATOM   1154 C  C     . ASP A 1 167 ? 4.015   -21.581 -54.049 1.00 11.53  ? 161 ASP A C     1 
ATOM   1155 O  O     . ASP A 1 167 ? 3.611   -21.949 -52.955 1.00 11.56  ? 161 ASP A O     1 
ATOM   1156 C  CB    . ASP A 1 167 ? 6.123   -22.849 -53.579 1.00 11.61  ? 161 ASP A CB    1 
ATOM   1157 C  CG    . ASP A 1 167 ? 7.243   -23.712 -54.158 1.00 14.60  ? 161 ASP A CG    1 
ATOM   1158 O  OD1   . ASP A 1 167 ? 7.104   -24.223 -55.297 1.00 13.53  ? 161 ASP A OD1   1 
ATOM   1159 O  OD2   . ASP A 1 167 ? 8.262   -23.888 -53.454 1.00 13.70  ? 161 ASP A OD2   1 
ATOM   1160 N  N     . GLY A 1 168 ? 3.432   -20.619 -54.759 1.00 11.69  ? 162 GLY A N     1 
ATOM   1161 C  CA    . GLY A 1 168 ? 2.155   -20.042 -54.374 1.00 13.52  ? 162 GLY A CA    1 
ATOM   1162 C  C     . GLY A 1 168 ? 2.213   -18.831 -53.461 1.00 15.63  ? 162 GLY A C     1 
ATOM   1163 O  O     . GLY A 1 168 ? 1.186   -18.307 -53.039 1.00 19.71  ? 162 GLY A O     1 
ATOM   1164 N  N     . ILE A 1 169 ? 3.422   -18.394 -53.146 1.00 13.33  ? 163 ILE A N     1 
ATOM   1165 C  CA    . ILE A 1 169 ? 3.622   -17.180 -52.390 1.00 13.38  ? 163 ILE A CA    1 
ATOM   1166 C  C     . ILE A 1 169 ? 3.869   -16.038 -53.372 1.00 15.80  ? 163 ILE A C     1 
ATOM   1167 O  O     . ILE A 1 169 ? 4.810   -16.081 -54.160 1.00 15.65  ? 163 ILE A O     1 
ATOM   1168 C  CB    . ILE A 1 169 ? 4.844   -17.327 -51.458 1.00 14.19  ? 163 ILE A CB    1 
ATOM   1169 C  CG1   . ILE A 1 169 ? 4.615   -18.466 -50.476 1.00 12.64  ? 163 ILE A CG1   1 
ATOM   1170 C  CG2   . ILE A 1 169 ? 5.123   -16.028 -50.705 1.00 13.62  ? 163 ILE A CG2   1 
ATOM   1171 C  CD1   . ILE A 1 169 ? 3.356   -18.291 -49.690 1.00 15.49  ? 163 ILE A CD1   1 
ATOM   1172 N  N     . GLU A 1 170 ? 3.020   -15.022 -53.352 1.00 15.95  ? 164 GLU A N     1 
ATOM   1173 C  CA    . GLU A 1 170 ? 3.293   -13.861 -54.174 1.00 16.88  ? 164 GLU A CA    1 
ATOM   1174 C  C     . GLU A 1 170 ? 4.521   -13.220 -53.585 1.00 16.60  ? 164 GLU A C     1 
ATOM   1175 O  O     . GLU A 1 170 ? 4.577   -12.971 -52.392 1.00 20.83  ? 164 GLU A O     1 
ATOM   1176 C  CB    . GLU A 1 170 ? 2.142   -12.867 -54.128 1.00 18.03  ? 164 GLU A CB    1 
ATOM   1177 C  CG    . GLU A 1 170 ? 0.945   -13.212 -54.985 1.00 29.20  ? 164 GLU A CG    1 
ATOM   1178 C  CD    . GLU A 1 170 ? -0.216  -12.256 -54.740 1.00 52.87  ? 164 GLU A CD    1 
ATOM   1179 O  OE1   . GLU A 1 170 ? -1.358  -12.741 -54.568 1.00 56.88  ? 164 GLU A OE1   1 
ATOM   1180 O  OE2   . GLU A 1 170 ? 0.015   -11.021 -54.706 1.00 52.77  ? 164 GLU A OE2   1 
ATOM   1181 N  N     . ILE A 1 171 ? 5.519   -12.961 -54.407 1.00 16.36  ? 165 ILE A N     1 
ATOM   1182 C  CA    . ILE A 1 171 ? 6.703   -12.295 -53.911 1.00 15.76  ? 165 ILE A CA    1 
ATOM   1183 C  C     . ILE A 1 171 ? 6.983   -11.045 -54.740 1.00 20.48  ? 165 ILE A C     1 
ATOM   1184 O  O     . ILE A 1 171 ? 6.848   -11.060 -55.960 1.00 22.23  ? 165 ILE A O     1 
ATOM   1185 C  CB    . ILE A 1 171 ? 7.887   -13.259 -53.883 1.00 14.79  ? 165 ILE A CB    1 
ATOM   1186 C  CG1   . ILE A 1 171 ? 7.634   -14.324 -52.818 1.00 13.35  ? 165 ILE A CG1   1 
ATOM   1187 C  CG2   . ILE A 1 171 ? 9.177   -12.523 -53.606 1.00 14.71  ? 165 ILE A CG2   1 
ATOM   1188 C  CD1   . ILE A 1 171 ? 8.797   -15.252 -52.568 1.00 10.78  ? 165 ILE A CD1   1 
ATOM   1189 N  N     . ASP A 1 172 ? 7.311   -9.950  -54.059 1.00 22.62  ? 166 ASP A N     1 
ATOM   1190 C  CA    . ASP A 1 172 ? 7.704   -8.707  -54.715 1.00 17.48  ? 166 ASP A CA    1 
ATOM   1191 C  C     . ASP A 1 172 ? 9.148   -8.426  -54.372 1.00 19.34  ? 166 ASP A C     1 
ATOM   1192 O  O     . ASP A 1 172 ? 9.451   -7.826  -53.336 1.00 21.58  ? 166 ASP A O     1 
ATOM   1193 C  CB    . ASP A 1 172 ? 6.807   -7.560  -54.276 1.00 15.35  ? 166 ASP A CB    1 
ATOM   1194 C  CG    . ASP A 1 172 ? 5.484   -7.553  -55.016 1.00 25.74  ? 166 ASP A CG    1 
ATOM   1195 O  OD1   . ASP A 1 172 ? 4.997   -8.641  -55.404 1.00 22.42  ? 166 ASP A OD1   1 
ATOM   1196 O  OD2   . ASP A 1 172 ? 4.932   -6.455  -55.231 1.00 33.84  ? 166 ASP A OD2   1 
ATOM   1197 N  N     . LEU A 1 173 ? 10.041  -8.898  -55.235 1.00 19.59  ? 167 LEU A N     1 
ATOM   1198 C  CA    . LEU A 1 173 ? 11.466  -8.873  -54.949 1.00 20.48  ? 167 LEU A CA    1 
ATOM   1199 C  C     . LEU A 1 173 ? 12.124  -7.611  -55.499 1.00 25.18  ? 167 LEU A C     1 
ATOM   1200 O  O     . LEU A 1 173 ? 11.963  -7.271  -56.669 1.00 28.43  ? 167 LEU A O     1 
ATOM   1201 C  CB    . LEU A 1 173 ? 12.142  -10.111 -55.514 1.00 12.78  ? 167 LEU A CB    1 
ATOM   1202 C  CG    . LEU A 1 173 ? 13.639  -10.139 -55.231 1.00 20.65  ? 167 LEU A CG    1 
ATOM   1203 C  CD1   . LEU A 1 173 ? 13.905  -10.023 -53.725 1.00 15.82  ? 167 LEU A CD1   1 
ATOM   1204 C  CD2   . LEU A 1 173 ? 14.306  -11.391 -55.841 1.00 17.47  ? 167 LEU A CD2   1 
ATOM   1205 N  N     . VAL A 1 174 ? 12.868  -6.925  -54.643 1.00 17.97  ? 168 VAL A N     1 
ATOM   1206 C  CA    . VAL A 1 174 ? 13.407  -5.621  -54.973 1.00 17.17  ? 168 VAL A CA    1 
ATOM   1207 C  C     . VAL A 1 174 ? 14.913  -5.669  -54.751 1.00 21.66  ? 168 VAL A C     1 
ATOM   1208 O  O     . VAL A 1 174 ? 15.414  -6.447  -53.930 1.00 19.81  ? 168 VAL A O     1 
ATOM   1209 C  CB    . VAL A 1 174 ? 12.710  -4.519  -54.134 1.00 18.00  ? 168 VAL A CB    1 
ATOM   1210 C  CG1   . VAL A 1 174 ? 13.625  -3.976  -53.072 1.00 18.17  ? 168 VAL A CG1   1 
ATOM   1211 C  CG2   . VAL A 1 174 ? 12.194  -3.407  -55.018 1.00 21.57  ? 168 VAL A CG2   1 
ATOM   1212 N  N     . PHE A 1 175 ? 15.653  -4.872  -55.505 1.00 24.39  ? 169 PHE A N     1 
ATOM   1213 C  CA    . PHE A 1 175 ? 17.092  -5.066  -55.526 1.00 24.66  ? 169 PHE A CA    1 
ATOM   1214 C  C     . PHE A 1 175 ? 17.841  -3.831  -55.104 1.00 23.87  ? 169 PHE A C     1 
ATOM   1215 O  O     . PHE A 1 175 ? 17.418  -2.720  -55.399 1.00 23.94  ? 169 PHE A O     1 
ATOM   1216 C  CB    . PHE A 1 175 ? 17.558  -5.499  -56.922 1.00 28.99  ? 169 PHE A CB    1 
ATOM   1217 C  CG    . PHE A 1 175 ? 19.038  -5.741  -57.009 1.00 32.18  ? 169 PHE A CG    1 
ATOM   1218 C  CD1   . PHE A 1 175 ? 19.571  -6.976  -56.666 1.00 32.55  ? 169 PHE A CD1   1 
ATOM   1219 C  CD2   . PHE A 1 175 ? 19.901  -4.730  -57.408 1.00 29.92  ? 169 PHE A CD2   1 
ATOM   1220 C  CE1   . PHE A 1 175 ? 20.934  -7.199  -56.722 1.00 32.99  ? 169 PHE A CE1   1 
ATOM   1221 C  CE2   . PHE A 1 175 ? 21.261  -4.946  -57.466 1.00 32.79  ? 169 PHE A CE2   1 
ATOM   1222 C  CZ    . PHE A 1 175 ? 21.781  -6.184  -57.122 1.00 36.07  ? 169 PHE A CZ    1 
ATOM   1223 N  N     . ALA A 1 176 ? 18.963  -4.039  -54.423 1.00 22.90  ? 170 ALA A N     1 
ATOM   1224 C  CA    . ALA A 1 176 ? 19.872  -2.954  -54.091 1.00 25.78  ? 170 ALA A CA    1 
ATOM   1225 C  C     . ALA A 1 176 ? 21.319  -3.399  -54.266 1.00 36.18  ? 170 ALA A C     1 
ATOM   1226 O  O     . ALA A 1 176 ? 21.667  -4.542  -53.964 1.00 34.01  ? 170 ALA A O     1 
ATOM   1227 C  CB    . ALA A 1 176 ? 19.641  -2.476  -52.676 1.00 20.07  ? 170 ALA A CB    1 
ATOM   1228 N  N     . ARG A 1 177 ? 22.154  -2.484  -54.756 1.00 38.92  ? 171 ARG A N     1 
ATOM   1229 C  CA    . ARG A 1 177 ? 23.583  -2.717  -54.907 1.00 33.69  ? 171 ARG A CA    1 
ATOM   1230 C  C     . ARG A 1 177 ? 24.318  -1.804  -53.952 1.00 33.18  ? 171 ARG A C     1 
ATOM   1231 O  O     . ARG A 1 177 ? 24.223  -0.584  -54.086 1.00 36.28  ? 171 ARG A O     1 
ATOM   1232 C  CB    . ARG A 1 177 ? 24.020  -2.400  -56.344 1.00 46.75  ? 171 ARG A CB    1 
ATOM   1233 C  CG    . ARG A 1 177 ? 25.516  -2.095  -56.503 1.00 61.19  ? 171 ARG A CG    1 
ATOM   1234 C  CD    . ARG A 1 177 ? 25.868  -1.456  -57.864 1.00 55.79  ? 171 ARG A CD    1 
ATOM   1235 N  NE    . ARG A 1 177 ? 27.155  -0.759  -57.802 1.00 50.21  ? 171 ARG A NE    1 
ATOM   1236 C  CZ    . ARG A 1 177 ? 28.083  -0.791  -58.754 1.00 62.93  ? 171 ARG A CZ    1 
ATOM   1237 N  NH1   . ARG A 1 177 ? 27.876  -1.490  -59.864 1.00 63.52  ? 171 ARG A NH1   1 
ATOM   1238 N  NH2   . ARG A 1 177 ? 29.222  -0.121  -58.596 1.00 69.06  ? 171 ARG A NH2   1 
ATOM   1239 N  N     . LEU A 1 178 ? 25.032  -2.387  -52.988 1.00 30.35  ? 172 LEU A N     1 
ATOM   1240 C  CA    . LEU A 1 178 ? 25.849  -1.609  -52.051 1.00 34.91  ? 172 LEU A CA    1 
ATOM   1241 C  C     . LEU A 1 178 ? 27.277  -1.526  -52.543 1.00 49.42  ? 172 LEU A C     1 
ATOM   1242 O  O     . LEU A 1 178 ? 27.723  -2.365  -53.327 1.00 53.10  ? 172 LEU A O     1 
ATOM   1243 C  CB    . LEU A 1 178 ? 25.867  -2.236  -50.660 1.00 31.32  ? 172 LEU A CB    1 
ATOM   1244 C  CG    . LEU A 1 178 ? 24.570  -2.201  -49.859 1.00 34.29  ? 172 LEU A CG    1 
ATOM   1245 C  CD1   . LEU A 1 178 ? 24.743  -2.915  -48.528 1.00 26.18  ? 172 LEU A CD1   1 
ATOM   1246 C  CD2   . LEU A 1 178 ? 24.102  -0.767  -49.669 1.00 31.99  ? 172 LEU A CD2   1 
ATOM   1247 N  N     . ALA A 1 179 ? 28.001  -0.519  -52.073 1.00 51.72  ? 173 ALA A N     1 
ATOM   1248 C  CA    . ALA A 1 179 ? 29.411  -0.395  -52.416 1.00 47.63  ? 173 ALA A CA    1 
ATOM   1249 C  C     . ALA A 1 179 ? 30.291  -1.006  -51.328 1.00 55.34  ? 173 ALA A C     1 
ATOM   1250 O  O     . ALA A 1 179 ? 31.078  -0.302  -50.693 1.00 52.15  ? 173 ALA A O     1 
ATOM   1251 C  CB    . ALA A 1 179 ? 29.780  1.057   -52.646 1.00 44.20  ? 173 ALA A CB    1 
ATOM   1252 N  N     . ILE A 1 180 ? 30.139  -2.310  -51.102 1.00 47.46  ? 174 ILE A N     1 
ATOM   1253 C  CA    . ILE A 1 180 ? 31.056  -3.053  -50.245 1.00 42.77  ? 174 ILE A CA    1 
ATOM   1254 C  C     . ILE A 1 180 ? 31.450  -4.323  -50.957 1.00 41.84  ? 174 ILE A C     1 
ATOM   1255 O  O     . ILE A 1 180 ? 30.837  -4.683  -51.956 1.00 47.70  ? 174 ILE A O     1 
ATOM   1256 C  CB    . ILE A 1 180 ? 30.450  -3.415  -48.875 1.00 47.04  ? 174 ILE A CB    1 
ATOM   1257 C  CG1   . ILE A 1 180 ? 28.947  -3.663  -48.998 1.00 46.76  ? 174 ILE A CG1   1 
ATOM   1258 C  CG2   . ILE A 1 180 ? 30.741  -2.326  -47.855 1.00 40.85  ? 174 ILE A CG2   1 
ATOM   1259 C  CD1   . ILE A 1 180 ? 28.301  -4.074  -47.694 1.00 51.88  ? 174 ILE A CD1   1 
ATOM   1260 N  N     . GLN A 1 181 ? 32.468  -5.001  -50.438 1.00 43.02  ? 175 GLN A N     1 
ATOM   1261 C  CA    . GLN A 1 181 ? 33.011  -6.200  -51.076 1.00 52.13  ? 175 GLN A CA    1 
ATOM   1262 C  C     . GLN A 1 181 ? 32.146  -7.429  -50.812 1.00 50.11  ? 175 GLN A C     1 
ATOM   1263 O  O     . GLN A 1 181 ? 31.820  -8.175  -51.733 1.00 40.84  ? 175 GLN A O     1 
ATOM   1264 C  CB    . GLN A 1 181 ? 34.449  -6.447  -50.599 1.00 59.85  ? 175 GLN A CB    1 
ATOM   1265 C  CG    . GLN A 1 181 ? 35.075  -7.751  -51.092 1.00 66.42  ? 175 GLN A CG    1 
ATOM   1266 C  CD    . GLN A 1 181 ? 36.530  -7.587  -51.517 1.00 76.39  ? 175 GLN A CD    1 
ATOM   1267 O  OE1   . GLN A 1 181 ? 36.839  -6.815  -52.430 1.00 76.38  ? 175 GLN A OE1   1 
ATOM   1268 N  NE2   . GLN A 1 181 ? 37.429  -8.314  -50.856 1.00 72.54  ? 175 GLN A NE2   1 
ATOM   1269 N  N     . THR A 1 182 ? 31.783  -7.621  -49.545 1.00 53.22  ? 176 THR A N     1 
ATOM   1270 C  CA    . THR A 1 182 ? 31.024  -8.786  -49.102 1.00 56.92  ? 176 THR A CA    1 
ATOM   1271 C  C     . THR A 1 182 ? 29.638  -8.385  -48.601 1.00 57.42  ? 176 THR A C     1 
ATOM   1272 O  O     . THR A 1 182 ? 29.317  -7.203  -48.514 1.00 60.54  ? 176 THR A O     1 
ATOM   1273 C  CB    . THR A 1 182 ? 31.745  -9.526  -47.946 1.00 48.70  ? 176 THR A CB    1 
ATOM   1274 O  OG1   . THR A 1 182 ? 31.453  -8.880  -46.701 1.00 37.53  ? 176 THR A OG1   1 
ATOM   1275 C  CG2   . THR A 1 182 ? 33.250  -9.547  -48.166 1.00 49.86  ? 176 THR A CG2   1 
ATOM   1276 N  N     . ILE A 1 183 ? 28.817  -9.378  -48.274 1.00 60.91  ? 177 ILE A N     1 
ATOM   1277 C  CA    . ILE A 1 183 ? 27.548  -9.135  -47.599 1.00 55.94  ? 177 ILE A CA    1 
ATOM   1278 C  C     . ILE A 1 183 ? 27.462  -10.006 -46.345 1.00 51.75  ? 177 ILE A C     1 
ATOM   1279 O  O     . ILE A 1 183 ? 26.982  -11.141 -46.389 1.00 51.80  ? 177 ILE A O     1 
ATOM   1280 C  CB    . ILE A 1 183 ? 26.343  -9.370  -48.528 1.00 48.64  ? 177 ILE A CB    1 
ATOM   1281 C  CG1   . ILE A 1 183 ? 26.370  -8.371  -49.676 1.00 43.02  ? 177 ILE A CG1   1 
ATOM   1282 C  CG2   . ILE A 1 183 ? 25.041  -9.187  -47.779 1.00 49.24  ? 177 ILE A CG2   1 
ATOM   1283 C  CD1   . ILE A 1 183 ? 26.216  -6.948  -49.221 1.00 39.71  ? 177 ILE A CD1   1 
ATOM   1284 N  N     . SER A 1 184 ? 27.975  -9.461  -45.242 1.00 54.57  ? 178 SER A N     1 
ATOM   1285 C  CA    . SER A 1 184 ? 27.917  -10.093 -43.925 1.00 63.82  ? 178 SER A CA    1 
ATOM   1286 C  C     . SER A 1 184 ? 26.509  -10.598 -43.625 1.00 57.36  ? 178 SER A C     1 
ATOM   1287 O  O     . SER A 1 184 ? 25.567  -9.814  -43.558 1.00 57.43  ? 178 SER A O     1 
ATOM   1288 C  CB    . SER A 1 184 ? 28.367  -9.099  -42.839 1.00 61.59  ? 178 SER A CB    1 
ATOM   1289 O  OG    . SER A 1 184 ? 27.873  -9.457  -41.556 1.00 55.46  ? 178 SER A OG    1 
ATOM   1290 N  N     . ASP A 1 185 ? 26.370  -11.907 -43.444 1.00 58.35  ? 179 ASP A N     1 
ATOM   1291 C  CA    . ASP A 1 185 ? 25.057  -12.503 -43.230 1.00 56.40  ? 179 ASP A CA    1 
ATOM   1292 C  C     . ASP A 1 185 ? 24.289  -11.840 -42.085 1.00 50.82  ? 179 ASP A C     1 
ATOM   1293 O  O     . ASP A 1 185 ? 23.073  -11.955 -42.013 1.00 50.25  ? 179 ASP A O     1 
ATOM   1294 C  CB    . ASP A 1 185 ? 25.156  -14.023 -43.048 1.00 58.97  ? 179 ASP A CB    1 
ATOM   1295 C  CG    . ASP A 1 185 ? 24.706  -14.793 -44.290 1.00 55.55  ? 179 ASP A CG    1 
ATOM   1296 O  OD1   . ASP A 1 185 ? 24.735  -14.227 -45.409 1.00 53.11  ? 179 ASP A OD1   1 
ATOM   1297 O  OD2   . ASP A 1 185 ? 24.314  -15.968 -44.145 1.00 48.63  ? 179 ASP A OD2   1 
ATOM   1298 N  N     . ASN A 1 186 ? 24.994  -11.132 -41.207 1.00 53.70  ? 180 ASN A N     1 
ATOM   1299 C  CA    . ASN A 1 186 ? 24.321  -10.225 -40.273 1.00 64.41  ? 180 ASN A CA    1 
ATOM   1300 C  C     . ASN A 1 186 ? 24.568  -8.740  -40.590 1.00 58.75  ? 180 ASN A C     1 
ATOM   1301 O  O     . ASN A 1 186 ? 25.105  -7.986  -39.782 1.00 54.80  ? 180 ASN A O     1 
ATOM   1302 C  CB    . ASN A 1 186 ? 24.558  -10.595 -38.783 1.00 72.92  ? 180 ASN A CB    1 
ATOM   1303 C  CG    . ASN A 1 186 ? 25.964  -10.258 -38.277 1.00 71.10  ? 180 ASN A CG    1 
ATOM   1304 O  OD1   . ASN A 1 186 ? 26.874  -9.935  -39.053 1.00 64.24  ? 180 ASN A OD1   1 
ATOM   1305 N  ND2   . ASN A 1 186 ? 26.142  -10.344 -36.955 1.00 57.46  ? 180 ASN A ND2   1 
ATOM   1306 N  N     . LEU A 1 187 ? 24.158  -8.339  -41.791 1.00 60.89  ? 181 LEU A N     1 
ATOM   1307 C  CA    . LEU A 1 187 ? 24.228  -6.944  -42.213 1.00 51.52  ? 181 LEU A CA    1 
ATOM   1308 C  C     . LEU A 1 187 ? 23.248  -6.110  -41.418 1.00 50.28  ? 181 LEU A C     1 
ATOM   1309 O  O     . LEU A 1 187 ? 22.345  -6.638  -40.771 1.00 54.78  ? 181 LEU A O     1 
ATOM   1310 C  CB    . LEU A 1 187 ? 23.886  -6.807  -43.693 1.00 39.38  ? 181 LEU A CB    1 
ATOM   1311 C  CG    . LEU A 1 187 ? 24.878  -6.041  -44.564 1.00 42.94  ? 181 LEU A CG    1 
ATOM   1312 C  CD1   . LEU A 1 187 ? 24.170  -5.478  -45.789 1.00 34.88  ? 181 LEU A CD1   1 
ATOM   1313 C  CD2   . LEU A 1 187 ? 25.606  -4.951  -43.780 1.00 47.37  ? 181 LEU A CD2   1 
ATOM   1314 N  N     . ASP A 1 188 ? 23.421  -4.797  -41.486 1.00 51.75  ? 182 ASP A N     1 
ATOM   1315 C  CA    . ASP A 1 188 ? 22.557  -3.885  -40.766 1.00 50.66  ? 182 ASP A CA    1 
ATOM   1316 C  C     . ASP A 1 188 ? 22.288  -2.637  -41.594 1.00 49.64  ? 182 ASP A C     1 
ATOM   1317 O  O     . ASP A 1 188 ? 23.133  -1.742  -41.687 1.00 49.07  ? 182 ASP A O     1 
ATOM   1318 C  CB    . ASP A 1 188 ? 23.191  -3.511  -39.436 1.00 58.63  ? 182 ASP A CB    1 
ATOM   1319 C  CG    . ASP A 1 188 ? 22.193  -2.953  -38.471 1.00 64.61  ? 182 ASP A CG    1 
ATOM   1320 O  OD1   . ASP A 1 188 ? 20.990  -3.254  -38.649 1.00 60.03  ? 182 ASP A OD1   1 
ATOM   1321 O  OD2   . ASP A 1 188 ? 22.605  -2.219  -37.545 1.00 74.52  ? 182 ASP A OD2   1 
ATOM   1322 N  N     . LEU A 1 189 ? 21.097  -2.584  -42.182 1.00 40.39  ? 183 LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 189 ? 20.749  -1.539  -43.131 1.00 34.12  ? 183 LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 189 ? 20.417  -0.205  -42.478 1.00 36.75  ? 183 LEU A C     1 
ATOM   1325 O  O     . LEU A 1 189 ? 20.232  0.800   -43.168 1.00 28.52  ? 183 LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 189 ? 19.562  -1.984  -43.976 1.00 21.73  ? 183 LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 189 ? 19.773  -3.223  -44.828 1.00 18.47  ? 183 LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 189 ? 18.518  -3.520  -45.608 1.00 21.45  ? 183 LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 189 ? 20.924  -2.994  -45.759 1.00 20.67  ? 183 LEU A CD2   1 
ATOM   1330 N  N     . ARG A 1 190 ? 20.329  -0.183  -41.154 1.00 43.11  ? 184 ARG A N     1 
ATOM   1331 C  CA    . ARG A 1 190 ? 19.859  1.031   -40.500 1.00 47.96  ? 184 ARG A CA    1 
ATOM   1332 C  C     . ARG A 1 190 ? 20.867  2.173   -40.561 1.00 41.06  ? 184 ARG A C     1 
ATOM   1333 O  O     . ARG A 1 190 ? 20.532  3.315   -40.262 1.00 45.35  ? 184 ARG A O     1 
ATOM   1334 C  CB    . ARG A 1 190 ? 19.385  0.770   -39.067 1.00 44.73  ? 184 ARG A CB    1 
ATOM   1335 C  CG    . ARG A 1 190 ? 20.272  -0.130  -38.242 1.00 53.06  ? 184 ARG A CG    1 
ATOM   1336 C  CD    . ARG A 1 190 ? 19.813  -0.161  -36.780 1.00 58.67  ? 184 ARG A CD    1 
ATOM   1337 N  NE    . ARG A 1 190 ? 18.360  -0.030  -36.660 1.00 64.25  ? 184 ARG A NE    1 
ATOM   1338 C  CZ    . ARG A 1 190 ? 17.734  1.061   -36.219 1.00 58.65  ? 184 ARG A CZ    1 
ATOM   1339 N  NH1   . ARG A 1 190 ? 18.430  2.132   -35.840 1.00 45.12  ? 184 ARG A NH1   1 
ATOM   1340 N  NH2   . ARG A 1 190 ? 16.406  1.076   -36.157 1.00 44.72  ? 184 ARG A NH2   1 
ATOM   1341 N  N     . ASP A 1 191 ? 22.090  1.865   -40.975 1.00 43.78  ? 185 ASP A N     1 
ATOM   1342 C  CA    . ASP A 1 191 ? 23.144  2.871   -41.064 1.00 42.72  ? 185 ASP A CA    1 
ATOM   1343 C  C     . ASP A 1 191 ? 22.935  3.856   -42.210 1.00 47.02  ? 185 ASP A C     1 
ATOM   1344 O  O     . ASP A 1 191 ? 22.694  3.453   -43.351 1.00 47.35  ? 185 ASP A O     1 
ATOM   1345 C  CB    . ASP A 1 191 ? 24.500  2.201   -41.225 1.00 50.69  ? 185 ASP A CB    1 
ATOM   1346 C  CG    . ASP A 1 191 ? 25.623  3.200   -41.281 1.00 59.17  ? 185 ASP A CG    1 
ATOM   1347 O  OD1   . ASP A 1 191 ? 25.448  4.330   -40.755 1.00 46.95  ? 185 ASP A OD1   1 
ATOM   1348 O  OD2   . ASP A 1 191 ? 26.677  2.848   -41.851 1.00 60.83  ? 185 ASP A OD2   1 
ATOM   1349 N  N     . ASP A 1 192 ? 23.052  5.146   -41.901 1.00 46.41  ? 186 ASP A N     1 
ATOM   1350 C  CA    . ASP A 1 192 ? 22.818  6.203   -42.886 1.00 41.45  ? 186 ASP A CA    1 
ATOM   1351 C  C     . ASP A 1 192 ? 24.031  6.388   -43.790 1.00 44.23  ? 186 ASP A C     1 
ATOM   1352 O  O     . ASP A 1 192 ? 23.932  6.938   -44.892 1.00 39.79  ? 186 ASP A O     1 
ATOM   1353 C  CB    . ASP A 1 192 ? 22.470  7.525   -42.194 1.00 37.08  ? 186 ASP A CB    1 
ATOM   1354 C  CG    . ASP A 1 192 ? 20.976  7.701   -41.965 1.00 39.76  ? 186 ASP A CG    1 
ATOM   1355 O  OD1   . ASP A 1 192 ? 20.237  6.694   -41.894 1.00 35.76  ? 186 ASP A OD1   1 
ATOM   1356 O  OD2   . ASP A 1 192 ? 20.543  8.868   -41.847 1.00 46.85  ? 186 ASP A OD2   1 
ATOM   1357 N  N     . SER A 1 193 ? 25.180  5.917   -43.321 1.00 43.30  ? 187 SER A N     1 
ATOM   1358 C  CA    . SER A 1 193 ? 26.405  6.032   -44.093 1.00 50.09  ? 187 SER A CA    1 
ATOM   1359 C  C     . SER A 1 193 ? 26.310  5.226   -45.382 1.00 48.83  ? 187 SER A C     1 
ATOM   1360 O  O     . SER A 1 193 ? 26.968  5.542   -46.372 1.00 58.95  ? 187 SER A O     1 
ATOM   1361 C  CB    . SER A 1 193 ? 27.600  5.555   -43.272 1.00 54.33  ? 187 SER A CB    1 
ATOM   1362 O  OG    . SER A 1 193 ? 27.705  4.144   -43.314 1.00 45.06  ? 187 SER A OG    1 
ATOM   1363 N  N     . ARG A 1 194 ? 25.483  4.186   -45.364 1.00 47.08  ? 188 ARG A N     1 
ATOM   1364 C  CA    . ARG A 1 194 ? 25.332  3.318   -46.523 1.00 47.97  ? 188 ARG A CA    1 
ATOM   1365 C  C     . ARG A 1 194 ? 24.842  4.105   -47.723 1.00 44.26  ? 188 ARG A C     1 
ATOM   1366 O  O     . ARG A 1 194 ? 25.282  3.863   -48.840 1.00 46.97  ? 188 ARG A O     1 
ATOM   1367 C  CB    . ARG A 1 194 ? 24.355  2.174   -46.238 1.00 48.72  ? 188 ARG A CB    1 
ATOM   1368 C  CG    . ARG A 1 194 ? 24.535  1.512   -44.891 1.00 55.20  ? 188 ARG A CG    1 
ATOM   1369 C  CD    . ARG A 1 194 ? 24.373  0.008   -45.003 1.00 61.56  ? 188 ARG A CD    1 
ATOM   1370 N  NE    . ARG A 1 194 ? 25.628  -0.665  -45.337 1.00 65.91  ? 188 ARG A NE    1 
ATOM   1371 C  CZ    . ARG A 1 194 ? 26.397  -1.292  -44.449 1.00 62.28  ? 188 ARG A CZ    1 
ATOM   1372 N  NH1   . ARG A 1 194 ? 26.036  -1.331  -43.170 1.00 54.87  ? 188 ARG A NH1   1 
ATOM   1373 N  NH2   . ARG A 1 194 ? 27.524  -1.881  -44.840 1.00 59.57  ? 188 ARG A NH2   1 
ATOM   1374 N  N     . LEU A 1 195 ? 23.942  5.054   -47.484 1.00 44.35  ? 189 LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 195 ? 23.286  5.778   -48.572 1.00 43.01  ? 189 LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 195 ? 24.250  6.643   -49.376 1.00 47.43  ? 189 LEU A C     1 
ATOM   1377 O  O     . LEU A 1 195 ? 24.010  6.917   -50.559 1.00 41.86  ? 189 LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 195 ? 22.135  6.637   -48.046 1.00 40.12  ? 189 LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 195 ? 20.958  5.938   -47.365 1.00 31.91  ? 189 LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 195 ? 19.725  6.764   -47.586 1.00 32.17  ? 189 LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 195 ? 20.749  4.544   -47.895 1.00 29.64  ? 189 LEU A CD2   1 
ATOM   1382 N  N     . ARG A 1 196 ? 25.333  7.064   -48.723 1.00 52.11  ? 190 ARG A N     1 
ATOM   1383 C  CA    . ARG A 1 196 ? 26.370  7.890   -49.340 1.00 52.40  ? 190 ARG A CA    1 
ATOM   1384 C  C     . ARG A 1 196 ? 26.802  7.370   -50.711 1.00 48.19  ? 190 ARG A C     1 
ATOM   1385 O  O     . ARG A 1 196 ? 27.210  6.213   -50.852 1.00 49.23  ? 190 ARG A O     1 
ATOM   1386 C  CB    . ARG A 1 196 ? 27.579  7.983   -48.408 1.00 52.67  ? 190 ARG A CB    1 
ATOM   1387 C  CG    . ARG A 1 196 ? 28.777  8.711   -48.992 1.00 64.22  ? 190 ARG A CG    1 
ATOM   1388 C  CD    . ARG A 1 196 ? 29.767  9.094   -47.901 1.00 69.22  ? 190 ARG A CD    1 
ATOM   1389 N  NE    . ARG A 1 196 ? 29.160  9.990   -46.915 1.00 81.44  ? 190 ARG A NE    1 
ATOM   1390 C  CZ    . ARG A 1 196 ? 28.730  9.610   -45.711 1.00 80.36  ? 190 ARG A CZ    1 
ATOM   1391 N  NH1   . ARG A 1 196 ? 28.845  8.341   -45.331 1.00 70.86  ? 190 ARG A NH1   1 
ATOM   1392 N  NH2   . ARG A 1 196 ? 28.190  10.500  -44.884 1.00 67.26  ? 190 ARG A NH2   1 
ATOM   1393 N  N     . SER A 1 197 ? 26.692  8.229   -51.718 1.00 47.35  ? 191 SER A N     1 
ATOM   1394 C  CA    . SER A 1 197 ? 27.121  7.888   -53.070 1.00 55.54  ? 191 SER A CA    1 
ATOM   1395 C  C     . SER A 1 197 ? 26.389  6.656   -53.595 1.00 46.18  ? 191 SER A C     1 
ATOM   1396 O  O     . SER A 1 197 ? 27.026  5.699   -54.029 1.00 50.76  ? 191 SER A O     1 
ATOM   1397 C  CB    . SER A 1 197 ? 28.643  7.634   -53.122 1.00 66.34  ? 191 SER A CB    1 
ATOM   1398 O  OG    . SER A 1 197 ? 29.413  8.738   -52.661 1.00 59.80  ? 191 SER A OG    1 
ATOM   1399 N  N     . LEU A 1 198 ? 25.062  6.667   -53.538 1.00 43.76  ? 192 LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 198 ? 24.277  5.580   -54.113 1.00 32.87  ? 192 LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 198 ? 23.269  6.114   -55.097 1.00 29.49  ? 192 LEU A C     1 
ATOM   1402 O  O     . LEU A 1 198 ? 22.717  7.197   -54.911 1.00 30.69  ? 192 LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 198 ? 23.520  4.801   -53.045 1.00 38.97  ? 192 LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 198 ? 24.255  3.963   -52.004 1.00 42.96  ? 192 LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 198 ? 23.300  2.902   -51.492 1.00 43.46  ? 192 LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 198 ? 25.512  3.325   -52.555 1.00 46.92  ? 192 LEU A CD2   1 
ATOM   1407 N  N     . ASP A 1 199 ? 23.033  5.326   -56.138 1.00 29.51  ? 193 ASP A N     1 
ATOM   1408 C  CA    . ASP A 1 199 ? 22.045  5.615   -57.166 1.00 24.96  ? 193 ASP A CA    1 
ATOM   1409 C  C     . ASP A 1 199 ? 20.673  5.765   -56.517 1.00 29.78  ? 193 ASP A C     1 
ATOM   1410 O  O     . ASP A 1 199 ? 20.253  4.891   -55.773 1.00 30.64  ? 193 ASP A O     1 
ATOM   1411 C  CB    . ASP A 1 199 ? 22.043  4.440   -58.150 1.00 28.11  ? 193 ASP A CB    1 
ATOM   1412 C  CG    . ASP A 1 199 ? 21.195  4.689   -59.393 1.00 32.36  ? 193 ASP A CG    1 
ATOM   1413 O  OD1   . ASP A 1 199 ? 20.129  5.317   -59.284 1.00 33.90  ? 193 ASP A OD1   1 
ATOM   1414 O  OD2   . ASP A 1 199 ? 21.595  4.232   -60.490 1.00 33.47  ? 193 ASP A OD2   1 
ATOM   1415 N  N     . ILE A 1 200 ? 19.972  6.858   -56.806 1.00 30.15  ? 194 ILE A N     1 
ATOM   1416 C  CA    . ILE A 1 200 ? 18.625  7.069   -56.267 1.00 39.90  ? 194 ILE A CA    1 
ATOM   1417 C  C     . ILE A 1 200 ? 17.747  5.824   -56.383 1.00 42.23  ? 194 ILE A C     1 
ATOM   1418 O  O     . ILE A 1 200 ? 16.884  5.578   -55.533 1.00 44.12  ? 194 ILE A O     1 
ATOM   1419 C  CB    . ILE A 1 200 ? 17.886  8.245   -56.945 1.00 43.84  ? 194 ILE A CB    1 
ATOM   1420 C  CG1   . ILE A 1 200 ? 18.108  8.222   -58.462 1.00 45.99  ? 194 ILE A CG1   1 
ATOM   1421 C  CG2   . ILE A 1 200 ? 18.316  9.577   -56.328 1.00 54.19  ? 194 ILE A CG2   1 
ATOM   1422 C  CD1   . ILE A 1 200 ? 17.153  9.115   -59.252 1.00 54.38  ? 194 ILE A CD1   1 
ATOM   1423 N  N     . ARG A 1 201 ? 17.978  5.045   -57.434 1.00 36.33  ? 195 ARG A N     1 
ATOM   1424 C  CA    . ARG A 1 201 ? 17.311  3.761   -57.606 1.00 38.96  ? 195 ARG A CA    1 
ATOM   1425 C  C     . ARG A 1 201 ? 17.666  2.810   -56.439 1.00 35.69  ? 195 ARG A C     1 
ATOM   1426 O  O     . ARG A 1 201 ? 16.793  2.163   -55.854 1.00 32.33  ? 195 ARG A O     1 
ATOM   1427 C  CB    . ARG A 1 201 ? 17.692  3.145   -58.966 1.00 36.38  ? 195 ARG A CB    1 
ATOM   1428 C  CG    . ARG A 1 201 ? 17.235  3.942   -60.193 1.00 31.69  ? 195 ARG A CG    1 
ATOM   1429 C  CD    . ARG A 1 201 ? 18.298  3.960   -61.300 1.00 36.36  ? 195 ARG A CD    1 
ATOM   1430 N  NE    . ARG A 1 201 ? 18.099  2.970   -62.364 1.00 38.55  ? 195 ARG A NE    1 
ATOM   1431 C  CZ    . ARG A 1 201 ? 19.062  2.182   -62.844 1.00 31.88  ? 195 ARG A CZ    1 
ATOM   1432 N  NH1   . ARG A 1 201 ? 20.290  2.254   -62.343 1.00 22.15  ? 195 ARG A NH1   1 
ATOM   1433 N  NH2   . ARG A 1 201 ? 18.801  1.323   -63.824 1.00 31.68  ? 195 ARG A NH2   1 
ATOM   1434 N  N     . CYS A 1 202 ? 18.949  2.737   -56.102 1.00 30.73  ? 196 CYS A N     1 
ATOM   1435 C  CA    . CYS A 1 202 ? 19.394  1.881   -55.016 1.00 30.80  ? 196 CYS A CA    1 
ATOM   1436 C  C     . CYS A 1 202 ? 18.856  2.368   -53.658 1.00 32.77  ? 196 CYS A C     1 
ATOM   1437 O  O     . CYS A 1 202 ? 18.583  1.571   -52.764 1.00 32.28  ? 196 CYS A O     1 
ATOM   1438 C  CB    . CYS A 1 202 ? 20.927  1.787   -55.006 1.00 30.87  ? 196 CYS A CB    1 
ATOM   1439 S  SG    . CYS A 1 202 ? 21.603  0.674   -56.257 1.00 32.61  ? 196 CYS A SG    1 
ATOM   1440 N  N     . ILE A 1 203 ? 18.687  3.678   -53.514 1.00 37.02  ? 197 ILE A N     1 
ATOM   1441 C  CA    . ILE A 1 203 ? 18.271  4.253   -52.241 1.00 31.47  ? 197 ILE A CA    1 
ATOM   1442 C  C     . ILE A 1 203 ? 16.807  3.980   -51.985 1.00 29.78  ? 197 ILE A C     1 
ATOM   1443 O  O     . ILE A 1 203 ? 16.424  3.630   -50.865 1.00 32.11  ? 197 ILE A O     1 
ATOM   1444 C  CB    . ILE A 1 203 ? 18.527  5.770   -52.184 1.00 31.63  ? 197 ILE A CB    1 
ATOM   1445 C  CG1   . ILE A 1 203 ? 20.029  6.043   -52.198 1.00 35.10  ? 197 ILE A CG1   1 
ATOM   1446 C  CG2   . ILE A 1 203 ? 17.914  6.377   -50.928 1.00 23.56  ? 197 ILE A CG2   1 
ATOM   1447 C  CD1   . ILE A 1 203 ? 20.391  7.385   -52.789 1.00 44.78  ? 197 ILE A CD1   1 
ATOM   1448 N  N     . ARG A 1 204 ? 15.987  4.133   -53.019 1.00 24.24  ? 198 ARG A N     1 
ATOM   1449 C  CA    . ARG A 1 204 ? 14.558  3.890   -52.873 1.00 29.71  ? 198 ARG A CA    1 
ATOM   1450 C  C     . ARG A 1 204 ? 14.318  2.424   -52.587 1.00 24.90  ? 198 ARG A C     1 
ATOM   1451 O  O     . ARG A 1 204 ? 13.307  2.049   -51.988 1.00 23.18  ? 198 ARG A O     1 
ATOM   1452 C  CB    . ARG A 1 204 ? 13.793  4.278   -54.138 1.00 36.21  ? 198 ARG A CB    1 
ATOM   1453 C  CG    . ARG A 1 204 ? 13.846  5.740   -54.491 1.00 34.92  ? 198 ARG A CG    1 
ATOM   1454 C  CD    . ARG A 1 204 ? 12.574  6.174   -55.198 1.00 40.15  ? 198 ARG A CD    1 
ATOM   1455 N  NE    . ARG A 1 204 ? 12.833  7.261   -56.135 1.00 54.40  ? 198 ARG A NE    1 
ATOM   1456 C  CZ    . ARG A 1 204 ? 12.676  7.163   -57.453 1.00 63.69  ? 198 ARG A CZ    1 
ATOM   1457 N  NH1   . ARG A 1 204 ? 12.229  6.036   -57.992 1.00 53.87  ? 198 ARG A NH1   1 
ATOM   1458 N  NH2   . ARG A 1 204 ? 12.954  8.199   -58.232 1.00 76.43  ? 198 ARG A NH2   1 
ATOM   1459 N  N     . SER A 1 205 ? 15.255  1.601   -53.041 1.00 27.86  ? 199 SER A N     1 
ATOM   1460 C  CA    . SER A 1 205 ? 15.175  0.159   -52.850 1.00 28.11  ? 199 SER A CA    1 
ATOM   1461 C  C     . SER A 1 205 ? 15.536  -0.258  -51.425 1.00 19.52  ? 199 SER A C     1 
ATOM   1462 O  O     . SER A 1 205 ? 14.967  -1.201  -50.892 1.00 25.20  ? 199 SER A O     1 
ATOM   1463 C  CB    . SER A 1 205 ? 16.057  -0.565  -53.865 1.00 25.16  ? 199 SER A CB    1 
ATOM   1464 O  OG    . SER A 1 205 ? 15.477  -0.549  -55.163 1.00 26.15  ? 199 SER A OG    1 
ATOM   1465 N  N     . LEU A 1 206 ? 16.470  0.445   -50.804 1.00 15.74  ? 200 LEU A N     1 
ATOM   1466 C  CA    . LEU A 1 206 ? 16.773  0.194   -49.403 1.00 21.53  ? 200 LEU A CA    1 
ATOM   1467 C  C     . LEU A 1 206 ? 15.665  0.677   -48.446 1.00 22.67  ? 200 LEU A C     1 
ATOM   1468 O  O     . LEU A 1 206 ? 15.594  0.249   -47.289 1.00 16.34  ? 200 LEU A O     1 
ATOM   1469 C  CB    . LEU A 1 206 ? 18.097  0.855   -49.025 1.00 24.03  ? 200 LEU A CB    1 
ATOM   1470 C  CG    . LEU A 1 206 ? 19.384  0.199   -49.522 1.00 28.44  ? 200 LEU A CG    1 
ATOM   1471 C  CD1   . LEU A 1 206 ? 20.620  0.922   -48.957 1.00 19.70  ? 200 LEU A CD1   1 
ATOM   1472 C  CD2   . LEU A 1 206 ? 19.393  -1.280  -49.153 1.00 22.55  ? 200 LEU A CD2   1 
ATOM   1473 N  N     . ASN A 1 207 ? 14.807  1.569   -48.938 1.00 20.94  ? 201 ASN A N     1 
ATOM   1474 C  CA    . ASN A 1 207 ? 13.860  2.285   -48.090 1.00 14.70  ? 201 ASN A CA    1 
ATOM   1475 C  C     . ASN A 1 207 ? 12.865  1.386   -47.382 1.00 16.57  ? 201 ASN A C     1 
ATOM   1476 O  O     . ASN A 1 207 ? 12.595  1.573   -46.189 1.00 14.54  ? 201 ASN A O     1 
ATOM   1477 C  CB    . ASN A 1 207 ? 13.107  3.328   -48.902 1.00 18.90  ? 201 ASN A CB    1 
ATOM   1478 C  CG    . ASN A 1 207 ? 12.389  4.326   -48.031 1.00 16.75  ? 201 ASN A CG    1 
ATOM   1479 O  OD1   . ASN A 1 207 ? 12.969  4.870   -47.082 1.00 14.21  ? 201 ASN A OD1   1 
ATOM   1480 N  ND2   . ASN A 1 207 ? 11.111  4.569   -48.334 1.00 13.87  ? 201 ASN A ND2   1 
ATOM   1481 N  N     . GLY A 1 208 ? 12.324  0.421   -48.127 1.00 18.12  ? 202 GLY A N     1 
ATOM   1482 C  CA    . GLY A 1 208 ? 11.417  -0.589  -47.593 1.00 19.32  ? 202 GLY A CA    1 
ATOM   1483 C  C     . GLY A 1 208 ? 11.884  -1.255  -46.303 1.00 17.31  ? 202 GLY A C     1 
ATOM   1484 O  O     . GLY A 1 208 ? 11.253  -1.128  -45.253 1.00 15.98  ? 202 GLY A O     1 
ATOM   1485 N  N     . CYS A 1 209 ? 12.998  -1.964  -46.368 1.00 13.67  ? 203 CYS A N     1 
ATOM   1486 C  CA    . CYS A 1 209 ? 13.567  -2.494  -45.151 1.00 15.77  ? 203 CYS A CA    1 
ATOM   1487 C  C     . CYS A 1 209 ? 13.791  -1.411  -44.127 1.00 17.42  ? 203 CYS A C     1 
ATOM   1488 O  O     . CYS A 1 209 ? 13.337  -1.532  -42.999 1.00 20.21  ? 203 CYS A O     1 
ATOM   1489 C  CB    . CYS A 1 209 ? 14.877  -3.209  -45.426 1.00 16.55  ? 203 CYS A CB    1 
ATOM   1490 S  SG    . CYS A 1 209 ? 14.555  -4.737  -46.232 1.00 27.21  ? 203 CYS A SG    1 
ATOM   1491 N  N     . ARG A 1 210 ? 14.481  -0.347  -44.519 1.00 18.99  ? 204 ARG A N     1 
ATOM   1492 C  CA    . ARG A 1 210 ? 14.872  0.660   -43.551 1.00 15.55  ? 204 ARG A CA    1 
ATOM   1493 C  C     . ARG A 1 210 ? 13.675  1.141   -42.720 1.00 14.69  ? 204 ARG A C     1 
ATOM   1494 O  O     . ARG A 1 210 ? 13.753  1.215   -41.497 1.00 12.32  ? 204 ARG A O     1 
ATOM   1495 C  CB    . ARG A 1 210 ? 15.638  1.790   -44.224 1.00 10.75  ? 204 ARG A CB    1 
ATOM   1496 C  CG    . ARG A 1 210 ? 16.976  1.330   -44.758 1.00 14.18  ? 204 ARG A CG    1 
ATOM   1497 C  CD    . ARG A 1 210 ? 17.825  2.489   -45.279 1.00 19.73  ? 204 ARG A CD    1 
ATOM   1498 N  NE    . ARG A 1 210 ? 18.723  3.012   -44.250 1.00 25.28  ? 204 ARG A NE    1 
ATOM   1499 C  CZ    . ARG A 1 210 ? 18.892  4.302   -43.981 1.00 21.55  ? 204 ARG A CZ    1 
ATOM   1500 N  NH1   . ARG A 1 210 ? 18.233  5.227   -44.662 1.00 19.22  ? 204 ARG A NH1   1 
ATOM   1501 N  NH2   . ARG A 1 210 ? 19.726  4.666   -43.027 1.00 27.87  ? 204 ARG A NH2   1 
ATOM   1502 N  N     . VAL A 1 211 ? 12.550  1.386   -43.379 1.00 15.76  ? 205 VAL A N     1 
ATOM   1503 C  CA    . VAL A 1 211 ? 11.365  1.872   -42.683 1.00 13.61  ? 205 VAL A CA    1 
ATOM   1504 C  C     . VAL A 1 211 ? 10.822  0.810   -41.771 1.00 14.02  ? 205 VAL A C     1 
ATOM   1505 O  O     . VAL A 1 211 ? 10.597  1.052   -40.578 1.00 16.54  ? 205 VAL A O     1 
ATOM   1506 C  CB    . VAL A 1 211 ? 10.246  2.256   -43.658 1.00 16.17  ? 205 VAL A CB    1 
ATOM   1507 C  CG1   . VAL A 1 211 ? 8.934   2.477   -42.907 1.00 10.89  ? 205 VAL A CG1   1 
ATOM   1508 C  CG2   . VAL A 1 211 ? 10.639  3.482   -44.459 1.00 12.58  ? 205 VAL A CG2   1 
ATOM   1509 N  N     . THR A 1 212 ? 10.600  -0.369  -42.343 1.00 14.31  ? 206 THR A N     1 
ATOM   1510 C  CA    . THR A 1 212 ? 10.055  -1.490  -41.586 1.00 13.16  ? 206 THR A CA    1 
ATOM   1511 C  C     . THR A 1 212 ? 10.889  -1.758  -40.327 1.00 11.39  ? 206 THR A C     1 
ATOM   1512 O  O     . THR A 1 212 ? 10.365  -1.755  -39.237 1.00 13.39  ? 206 THR A O     1 
ATOM   1513 C  CB    . THR A 1 212 ? 9.906   -2.752  -42.460 1.00 10.77  ? 206 THR A CB    1 
ATOM   1514 O  OG1   . THR A 1 212 ? 8.934   -2.515  -43.487 1.00 10.43  ? 206 THR A OG1   1 
ATOM   1515 C  CG2   . THR A 1 212 ? 9.413   -3.867  -41.634 1.00 13.52  ? 206 THR A CG2   1 
ATOM   1516 N  N     . ASP A 1 213 ? 12.195  -1.921  -40.479 1.00 13.85  ? 207 ASP A N     1 
ATOM   1517 C  CA    . ASP A 1 213 ? 13.072  -2.129  -39.342 1.00 13.53  ? 207 ASP A CA    1 
ATOM   1518 C  C     . ASP A 1 213 ? 13.076  -0.950  -38.366 1.00 16.88  ? 207 ASP A C     1 
ATOM   1519 O  O     . ASP A 1 213 ? 13.273  -1.132  -37.172 1.00 18.58  ? 207 ASP A O     1 
ATOM   1520 C  CB    . ASP A 1 213 ? 14.493  -2.455  -39.808 1.00 15.15  ? 207 ASP A CB    1 
ATOM   1521 C  CG    . ASP A 1 213 ? 14.615  -3.859  -40.379 1.00 30.52  ? 207 ASP A CG    1 
ATOM   1522 O  OD1   . ASP A 1 213 ? 13.884  -4.209  -41.336 1.00 29.76  ? 207 ASP A OD1   1 
ATOM   1523 O  OD2   . ASP A 1 213 ? 15.440  -4.630  -39.853 1.00 46.30  ? 207 ASP A OD2   1 
ATOM   1524 N  N     . GLU A 1 214 ? 12.867  0.259   -38.863 1.00 15.72  ? 208 GLU A N     1 
ATOM   1525 C  CA    . GLU A 1 214 ? 12.866  1.417   -37.978 1.00 17.99  ? 208 GLU A CA    1 
ATOM   1526 C  C     . GLU A 1 214 ? 11.656  1.346   -37.061 1.00 19.77  ? 208 GLU A C     1 
ATOM   1527 O  O     . GLU A 1 214 ? 11.758  1.608   -35.860 1.00 18.91  ? 208 GLU A O     1 
ATOM   1528 C  CB    . GLU A 1 214 ? 12.834  2.740   -38.764 1.00 17.98  ? 208 GLU A CB    1 
ATOM   1529 C  CG    . GLU A 1 214 ? 14.187  3.374   -39.048 1.00 18.15  ? 208 GLU A CG    1 
ATOM   1530 C  CD    . GLU A 1 214 ? 14.859  3.913   -37.807 1.00 25.75  ? 208 GLU A CD    1 
ATOM   1531 O  OE1   . GLU A 1 214 ? 14.165  4.088   -36.793 1.00 29.21  ? 208 GLU A OE1   1 
ATOM   1532 O  OE2   . GLU A 1 214 ? 16.084  4.158   -37.834 1.00 33.22  ? 208 GLU A OE2   1 
ATOM   1533 N  N     . ILE A 1 215 ? 10.506  1.002   -37.635 1.00 13.94  ? 209 ILE A N     1 
ATOM   1534 C  CA    . ILE A 1 215 ? 9.279   0.973   -36.867 1.00 11.64  ? 209 ILE A CA    1 
ATOM   1535 C  C     . ILE A 1 215 ? 9.415   -0.026  -35.727 1.00 18.94  ? 209 ILE A C     1 
ATOM   1536 O  O     . ILE A 1 215 ? 9.136   0.294   -34.566 1.00 18.14  ? 209 ILE A O     1 
ATOM   1537 C  CB    . ILE A 1 215 ? 8.108   0.588   -37.731 1.00 8.51   ? 209 ILE A CB    1 
ATOM   1538 C  CG1   . ILE A 1 215 ? 7.966   1.593   -38.867 1.00 8.62   ? 209 ILE A CG1   1 
ATOM   1539 C  CG2   . ILE A 1 215 ? 6.859   0.525   -36.899 1.00 7.10   ? 209 ILE A CG2   1 
ATOM   1540 C  CD1   . ILE A 1 215 ? 6.856   1.282   -39.797 1.00 6.86   ? 209 ILE A CD1   1 
ATOM   1541 N  N     . LEU A 1 216 ? 9.884   -1.225  -36.044 1.00 13.90  ? 210 LEU A N     1 
ATOM   1542 C  CA    . LEU A 1 216 ? 10.018  -2.247  -35.025 1.00 15.10  ? 210 LEU A CA    1 
ATOM   1543 C  C     . LEU A 1 216 ? 10.894  -1.779  -33.867 1.00 19.36  ? 210 LEU A C     1 
ATOM   1544 O  O     . LEU A 1 216 ? 10.683  -2.185  -32.724 1.00 23.13  ? 210 LEU A O     1 
ATOM   1545 C  CB    . LEU A 1 216 ? 10.557  -3.539  -35.634 1.00 20.94  ? 210 LEU A CB    1 
ATOM   1546 C  CG    . LEU A 1 216 ? 9.605   -4.292  -36.571 1.00 15.49  ? 210 LEU A CG    1 
ATOM   1547 C  CD1   . LEU A 1 216 ? 10.278  -5.489  -37.233 1.00 15.21  ? 210 LEU A CD1   1 
ATOM   1548 C  CD2   . LEU A 1 216 ? 8.379   -4.733  -35.805 1.00 17.02  ? 210 LEU A CD2   1 
ATOM   1549 N  N     . HIS A 1 217 ? 11.851  -0.899  -34.155 1.00 19.33  ? 211 HIS A N     1 
ATOM   1550 C  CA    . HIS A 1 217 ? 12.796  -0.437  -33.134 1.00 20.69  ? 211 HIS A CA    1 
ATOM   1551 C  C     . HIS A 1 217 ? 12.262  0.732   -32.329 1.00 21.51  ? 211 HIS A C     1 
ATOM   1552 O  O     . HIS A 1 217 ? 12.771  1.027   -31.250 1.00 24.28  ? 211 HIS A O     1 
ATOM   1553 C  CB    . HIS A 1 217 ? 14.143  -0.049  -33.748 1.00 18.40  ? 211 HIS A CB    1 
ATOM   1554 C  CG    . HIS A 1 217 ? 14.881  -1.201  -34.358 1.00 46.50  ? 211 HIS A CG    1 
ATOM   1555 N  ND1   . HIS A 1 217 ? 14.275  -2.119  -35.194 1.00 48.97  ? 211 HIS A ND1   1 
ATOM   1556 C  CD2   . HIS A 1 217 ? 16.177  -1.582  -34.260 1.00 48.72  ? 211 HIS A CD2   1 
ATOM   1557 C  CE1   . HIS A 1 217 ? 15.166  -3.014  -35.584 1.00 41.81  ? 211 HIS A CE1   1 
ATOM   1558 N  NE2   . HIS A 1 217 ? 16.328  -2.708  -35.032 1.00 54.22  ? 211 HIS A NE2   1 
ATOM   1559 N  N     . LEU A 1 218 ? 11.240  1.397   -32.856 1.00 18.89  ? 212 LEU A N     1 
ATOM   1560 C  CA    . LEU A 1 218 ? 10.711  2.602   -32.228 1.00 17.70  ? 212 LEU A CA    1 
ATOM   1561 C  C     . LEU A 1 218 ? 9.478   2.311   -31.375 1.00 17.27  ? 212 LEU A C     1 
ATOM   1562 O  O     . LEU A 1 218 ? 8.831   3.223   -30.861 1.00 18.94  ? 212 LEU A O     1 
ATOM   1563 C  CB    . LEU A 1 218 ? 10.377  3.632   -33.298 1.00 15.99  ? 212 LEU A CB    1 
ATOM   1564 C  CG    . LEU A 1 218 ? 11.576  4.153   -34.086 1.00 12.76  ? 212 LEU A CG    1 
ATOM   1565 C  CD1   . LEU A 1 218 ? 11.110  4.924   -35.291 1.00 14.90  ? 212 LEU A CD1   1 
ATOM   1566 C  CD2   . LEU A 1 218 ? 12.445  5.017   -33.220 1.00 9.84   ? 212 LEU A CD2   1 
ATOM   1567 N  N     . VAL A 1 219 ? 9.189   1.025   -31.219 1.00 16.58  ? 213 VAL A N     1 
ATOM   1568 C  CA    . VAL A 1 219 ? 8.018   0.528   -30.522 1.00 9.98   ? 213 VAL A CA    1 
ATOM   1569 C  C     . VAL A 1 219 ? 8.460   -0.080  -29.170 1.00 17.41  ? 213 VAL A C     1 
ATOM   1570 O  O     . VAL A 1 219 ? 9.451   -0.814  -29.096 1.00 24.21  ? 213 VAL A O     1 
ATOM   1571 C  CB    . VAL A 1 219 ? 7.292   -0.467  -31.459 1.00 11.57  ? 213 VAL A CB    1 
ATOM   1572 C  CG1   . VAL A 1 219 ? 7.213   -1.857  -30.884 1.00 14.17  ? 213 VAL A CG1   1 
ATOM   1573 C  CG2   . VAL A 1 219 ? 5.933   0.056   -31.863 1.00 9.69   ? 213 VAL A CG2   1 
ATOM   1574 N  N     . PRO A 1 220 ? 7.776   0.275   -28.075 1.00 18.10  ? 214 PRO A N     1 
ATOM   1575 C  CA    . PRO A 1 220 ? 8.280   -0.210  -26.787 1.00 13.37  ? 214 PRO A CA    1 
ATOM   1576 C  C     . PRO A 1 220 ? 7.999   -1.687  -26.525 1.00 12.96  ? 214 PRO A C     1 
ATOM   1577 O  O     . PRO A 1 220 ? 8.755   -2.324  -25.800 1.00 13.55  ? 214 PRO A O     1 
ATOM   1578 C  CB    . PRO A 1 220 ? 7.534   0.655   -25.775 1.00 10.29  ? 214 PRO A CB    1 
ATOM   1579 C  CG    . PRO A 1 220 ? 6.338   1.142   -26.466 1.00 10.48  ? 214 PRO A CG    1 
ATOM   1580 C  CD    . PRO A 1 220 ? 6.697   1.265   -27.910 1.00 15.25  ? 214 PRO A CD    1 
ATOM   1581 N  N     . ASN A 1 221 ? 6.933   -2.227  -27.106 1.00 14.58  ? 215 ASN A N     1 
ATOM   1582 C  CA    . ASN A 1 221 ? 6.599   -3.637  -26.917 1.00 12.18  ? 215 ASN A CA    1 
ATOM   1583 C  C     . ASN A 1 221 ? 6.178   -4.201  -28.250 1.00 11.07  ? 215 ASN A C     1 
ATOM   1584 O  O     . ASN A 1 221 ? 5.179   -3.748  -28.823 1.00 12.38  ? 215 ASN A O     1 
ATOM   1585 C  CB    . ASN A 1 221 ? 5.454   -3.788  -25.907 1.00 10.22  ? 215 ASN A CB    1 
ATOM   1586 C  CG    . ASN A 1 221 ? 5.159   -5.240  -25.543 1.00 7.97   ? 215 ASN A CG    1 
ATOM   1587 O  OD1   . ASN A 1 221 ? 5.186   -6.130  -26.386 1.00 8.54   ? 215 ASN A OD1   1 
ATOM   1588 N  ND2   . ASN A 1 221 ? 4.845   -5.471  -24.274 1.00 9.51   ? 215 ASN A ND2   1 
ATOM   1589 N  N     . LYS A 1 222 ? 6.920   -5.189  -28.743 1.00 8.29   ? 216 LYS A N     1 
ATOM   1590 C  CA    . LYS A 1 222 ? 6.629   -5.739  -30.064 1.00 9.66   ? 216 LYS A CA    1 
ATOM   1591 C  C     . LYS A 1 222 ? 5.399   -6.650  -30.072 1.00 8.96   ? 216 LYS A C     1 
ATOM   1592 O  O     . LYS A 1 222 ? 4.666   -6.706  -31.068 1.00 6.94   ? 216 LYS A O     1 
ATOM   1593 C  CB    . LYS A 1 222 ? 7.853   -6.450  -30.658 1.00 11.63  ? 216 LYS A CB    1 
ATOM   1594 C  CG    . LYS A 1 222 ? 9.088   -5.552  -30.833 1.00 12.84  ? 216 LYS A CG    1 
ATOM   1595 C  CD    . LYS A 1 222 ? 10.208  -6.300  -31.559 1.00 23.71  ? 216 LYS A CD    1 
ATOM   1596 C  CE    . LYS A 1 222 ? 11.480  -5.480  -31.709 1.00 25.95  ? 216 LYS A CE    1 
ATOM   1597 N  NZ    . LYS A 1 222 ? 12.176  -5.264  -30.404 1.00 36.26  ? 216 LYS A NZ    1 
ATOM   1598 N  N     . GLU A 1 223 ? 5.160   -7.360  -28.969 1.00 8.26   ? 217 GLU A N     1 
ATOM   1599 C  CA    . GLU A 1 223 ? 4.015   -8.269  -28.928 1.00 6.38   ? 217 GLU A CA    1 
ATOM   1600 C  C     . GLU A 1 223 ? 2.714   -7.485  -29.013 1.00 5.35   ? 217 GLU A C     1 
ATOM   1601 O  O     . GLU A 1 223 ? 1.850   -7.803  -29.815 1.00 4.61   ? 217 GLU A O     1 
ATOM   1602 C  CB    . GLU A 1 223 ? 4.059   -9.170  -27.696 1.00 4.64   ? 217 GLU A CB    1 
ATOM   1603 C  CG    . GLU A 1 223 ? 3.006   -10.268 -27.663 0.50 2.62   ? 217 GLU A CG    1 
ATOM   1604 C  CD    . GLU A 1 223 ? 3.258   -11.265 -26.552 0.50 3.48   ? 217 GLU A CD    1 
ATOM   1605 O  OE1   . GLU A 1 223 ? 2.387   -12.118 -26.300 0.50 0.56   ? 217 GLU A OE1   1 
ATOM   1606 O  OE2   . GLU A 1 223 ? 4.336   -11.193 -25.922 0.50 4.10   ? 217 GLU A OE2   1 
ATOM   1607 N  N     . THR A 1 224 ? 2.603   -6.431  -28.215 1.00 5.73   ? 218 THR A N     1 
ATOM   1608 C  CA    . THR A 1 224 ? 1.387   -5.618  -28.196 1.00 7.33   ? 218 THR A CA    1 
ATOM   1609 C  C     . THR A 1 224 ? 1.215   -4.775  -29.467 1.00 7.56   ? 218 THR A C     1 
ATOM   1610 O  O     . THR A 1 224 ? 0.090   -4.527  -29.918 1.00 7.70   ? 218 THR A O     1 
ATOM   1611 C  CB    . THR A 1 224 ? 1.292   -4.721  -26.915 1.00 6.71   ? 218 THR A CB    1 
ATOM   1612 O  OG1   . THR A 1 224 ? 2.297   -3.701  -26.942 1.00 5.74   ? 218 THR A OG1   1 
ATOM   1613 C  CG2   . THR A 1 224 ? 1.459   -5.561  -25.654 1.00 5.11   ? 218 THR A CG2   1 
ATOM   1614 N  N     . PHE A 1 225 ? 2.331   -4.329  -30.035 1.00 7.81   ? 219 PHE A N     1 
ATOM   1615 C  CA    . PHE A 1 225 ? 2.318   -3.644  -31.323 1.00 6.73   ? 219 PHE A CA    1 
ATOM   1616 C  C     . PHE A 1 225 ? 1.698   -4.528  -32.428 1.00 6.97   ? 219 PHE A C     1 
ATOM   1617 O  O     . PHE A 1 225 ? 0.738   -4.123  -33.102 1.00 6.13   ? 219 PHE A O     1 
ATOM   1618 C  CB    . PHE A 1 225 ? 3.742   -3.220  -31.697 1.00 7.47   ? 219 PHE A CB    1 
ATOM   1619 C  CG    . PHE A 1 225 ? 3.875   -2.755  -33.106 1.00 6.07   ? 219 PHE A CG    1 
ATOM   1620 C  CD1   . PHE A 1 225 ? 3.222   -1.611  -33.535 1.00 7.94   ? 219 PHE A CD1   1 
ATOM   1621 C  CD2   . PHE A 1 225 ? 4.640   -3.459  -34.010 1.00 6.28   ? 219 PHE A CD2   1 
ATOM   1622 C  CE1   . PHE A 1 225 ? 3.329   -1.185  -34.849 1.00 7.66   ? 219 PHE A CE1   1 
ATOM   1623 C  CE2   . PHE A 1 225 ? 4.757   -3.037  -35.317 1.00 5.15   ? 219 PHE A CE2   1 
ATOM   1624 C  CZ    . PHE A 1 225 ? 4.095   -1.897  -35.738 1.00 5.26   ? 219 PHE A CZ    1 
ATOM   1625 N  N     . ARG A 1 226 ? 2.228   -5.744  -32.586 1.00 6.12   ? 220 ARG A N     1 
ATOM   1626 C  CA    . ARG A 1 226 ? 1.717   -6.666  -33.586 1.00 4.20   ? 220 ARG A CA    1 
ATOM   1627 C  C     . ARG A 1 226 ? 0.238   -6.907  -33.420 1.00 5.40   ? 220 ARG A C     1 
ATOM   1628 O  O     . ARG A 1 226 ? -0.526  -6.669  -34.347 1.00 8.60   ? 220 ARG A O     1 
ATOM   1629 C  CB    . ARG A 1 226 ? 2.471   -7.988  -33.580 1.00 6.28   ? 220 ARG A CB    1 
ATOM   1630 C  CG    . ARG A 1 226 ? 3.868   -7.892  -34.175 1.00 10.76  ? 220 ARG A CG    1 
ATOM   1631 C  CD    . ARG A 1 226 ? 4.566   -9.242  -34.330 1.00 8.69   ? 220 ARG A CD    1 
ATOM   1632 N  NE    . ARG A 1 226 ? 6.020   -9.083  -34.333 1.00 8.21   ? 220 ARG A NE    1 
ATOM   1633 C  CZ    . ARG A 1 226 ? 6.786   -9.239  -33.257 1.00 12.90  ? 220 ARG A CZ    1 
ATOM   1634 N  NH1   . ARG A 1 226 ? 6.246   -9.566  -32.091 1.00 12.36  ? 220 ARG A NH1   1 
ATOM   1635 N  NH2   . ARG A 1 226 ? 8.094   -9.076  -33.347 1.00 19.88  ? 220 ARG A NH2   1 
ATOM   1636 N  N     . LEU A 1 227 ? -0.179  -7.356  -32.243 1.00 6.07   ? 221 LEU A N     1 
ATOM   1637 C  CA    . LEU A 1 227 ? -1.594  -7.646  -32.014 1.00 5.94   ? 221 LEU A CA    1 
ATOM   1638 C  C     . LEU A 1 227 ? -2.490  -6.436  -32.351 1.00 7.09   ? 221 LEU A C     1 
ATOM   1639 O  O     . LEU A 1 227 ? -3.495  -6.557  -33.078 1.00 6.55   ? 221 LEU A O     1 
ATOM   1640 C  CB    . LEU A 1 227 ? -1.819  -8.130  -30.588 1.00 2.48   ? 221 LEU A CB    1 
ATOM   1641 C  CG    . LEU A 1 227 ? -3.218  -8.673  -30.333 1.00 3.82   ? 221 LEU A CG    1 
ATOM   1642 C  CD1   . LEU A 1 227 ? -3.618  -9.638  -31.442 1.00 4.74   ? 221 LEU A CD1   1 
ATOM   1643 C  CD2   . LEU A 1 227 ? -3.259  -9.352  -28.975 1.00 2.97   ? 221 LEU A CD2   1 
ATOM   1644 N  N     . THR A 1 228 ? -2.091  -5.265  -31.871 1.00 4.64   ? 222 THR A N     1 
ATOM   1645 C  CA    . THR A 1 228 ? -2.834  -4.064  -32.169 1.00 5.11   ? 222 THR A CA    1 
ATOM   1646 C  C     . THR A 1 228 ? -2.860  -3.823  -33.680 1.00 6.39   ? 222 THR A C     1 
ATOM   1647 O  O     . THR A 1 228 ? -3.929  -3.565  -34.250 1.00 5.41   ? 222 THR A O     1 
ATOM   1648 C  CB    . THR A 1 228 ? -2.264  -2.849  -31.418 1.00 5.74   ? 222 THR A CB    1 
ATOM   1649 O  OG1   . THR A 1 228 ? -2.125  -3.166  -30.021 1.00 5.90   ? 222 THR A OG1   1 
ATOM   1650 C  CG2   . THR A 1 228 ? -3.180  -1.653  -31.581 1.00 3.11   ? 222 THR A CG2   1 
ATOM   1651 N  N     . LEU A 1 229 ? -1.696  -3.935  -34.330 1.00 6.54   ? 223 LEU A N     1 
ATOM   1652 C  CA    . LEU A 1 229 ? -1.627  -3.783  -35.797 1.00 7.59   ? 223 LEU A CA    1 
ATOM   1653 C  C     . LEU A 1 229 ? -2.563  -4.732  -36.547 1.00 7.35   ? 223 LEU A C     1 
ATOM   1654 O  O     . LEU A 1 229 ? -3.294  -4.300  -37.447 1.00 7.51   ? 223 LEU A O     1 
ATOM   1655 C  CB    . LEU A 1 229 ? -0.210  -3.973  -36.333 1.00 6.19   ? 223 LEU A CB    1 
ATOM   1656 C  CG    . LEU A 1 229 ? 0.251   -2.937  -37.372 1.00 7.72   ? 223 LEU A CG    1 
ATOM   1657 C  CD1   . LEU A 1 229 ? 1.110   -3.593  -38.422 1.00 13.78  ? 223 LEU A CD1   1 
ATOM   1658 C  CD2   . LEU A 1 229 ? -0.895  -2.166  -38.020 1.00 5.24   ? 223 LEU A CD2   1 
ATOM   1659 N  N     . ARG A 1 230 ? -2.537  -6.012  -36.179 1.00 5.12   ? 224 ARG A N     1 
ATOM   1660 C  CA    . ARG A 1 230 ? -3.452  -6.970  -36.776 1.00 7.61   ? 224 ARG A CA    1 
ATOM   1661 C  C     . ARG A 1 230 ? -4.902  -6.501  -36.645 1.00 7.77   ? 224 ARG A C     1 
ATOM   1662 O  O     . ARG A 1 230 ? -5.646  -6.501  -37.627 1.00 7.45   ? 224 ARG A O     1 
ATOM   1663 C  CB    . ARG A 1 230 ? -3.275  -8.351  -36.158 1.00 8.57   ? 224 ARG A CB    1 
ATOM   1664 C  CG    . ARG A 1 230 ? -1.925  -8.951  -36.407 1.00 7.89   ? 224 ARG A CG    1 
ATOM   1665 C  CD    . ARG A 1 230 ? -1.763  -10.270 -35.687 1.00 6.94   ? 224 ARG A CD    1 
ATOM   1666 N  NE    . ARG A 1 230 ? -1.237  -11.284 -36.586 1.00 9.10   ? 224 ARG A NE    1 
ATOM   1667 C  CZ    . ARG A 1 230 ? -0.331  -12.186 -36.245 1.00 9.46   ? 224 ARG A CZ    1 
ATOM   1668 N  NH1   . ARG A 1 230 ? 0.157   -12.216 -35.013 1.00 11.90  ? 224 ARG A NH1   1 
ATOM   1669 N  NH2   . ARG A 1 230 ? 0.080   -13.062 -37.139 1.00 14.23  ? 224 ARG A NH2   1 
ATOM   1670 N  N     . ALA A 1 231 ? -5.288  -6.079  -35.442 1.00 5.80   ? 225 ALA A N     1 
ATOM   1671 C  CA    . ALA A 1 231 ? -6.648  -5.615  -35.208 1.00 5.32   ? 225 ALA A CA    1 
ATOM   1672 C  C     . ALA A 1 231 ? -6.980  -4.401  -36.068 1.00 5.55   ? 225 ALA A C     1 
ATOM   1673 O  O     . ALA A 1 231 ? -7.975  -4.377  -36.774 1.00 4.99   ? 225 ALA A O     1 
ATOM   1674 C  CB    . ALA A 1 231 ? -6.839  -5.288  -33.752 1.00 5.85   ? 225 ALA A CB    1 
ATOM   1675 N  N     . VAL A 1 232 ? -6.124  -3.391  -36.011 1.00 8.04   ? 226 VAL A N     1 
ATOM   1676 C  CA    . VAL A 1 232 ? -6.380  -2.142  -36.718 1.00 7.22   ? 226 VAL A CA    1 
ATOM   1677 C  C     . VAL A 1 232 ? -6.470  -2.373  -38.213 1.00 8.11   ? 226 VAL A C     1 
ATOM   1678 O  O     . VAL A 1 232 ? -7.366  -1.846  -38.875 1.00 9.39   ? 226 VAL A O     1 
ATOM   1679 C  CB    . VAL A 1 232 ? -5.315  -1.075  -36.380 1.00 6.67   ? 226 VAL A CB    1 
ATOM   1680 C  CG1   . VAL A 1 232 ? -5.578  0.209   -37.141 1.00 4.53   ? 226 VAL A CG1   1 
ATOM   1681 C  CG2   . VAL A 1 232 ? -5.316  -0.811  -34.874 1.00 4.92   ? 226 VAL A CG2   1 
ATOM   1682 N  N     . LYS A 1 233 ? -5.564  -3.179  -38.752 1.00 6.68   ? 227 LYS A N     1 
ATOM   1683 C  CA    . LYS A 1 233 ? -5.614  -3.440  -40.176 1.00 6.11   ? 227 LYS A CA    1 
ATOM   1684 C  C     . LYS A 1 233 ? -6.912  -4.157  -40.545 1.00 8.41   ? 227 LYS A C     1 
ATOM   1685 O  O     . LYS A 1 233 ? -7.545  -3.815  -41.535 1.00 9.34   ? 227 LYS A O     1 
ATOM   1686 C  CB    . LYS A 1 233 ? -4.379  -4.207  -40.646 1.00 6.79   ? 227 LYS A CB    1 
ATOM   1687 C  CG    . LYS A 1 233 ? -3.137  -3.339  -40.707 1.00 6.70   ? 227 LYS A CG    1 
ATOM   1688 C  CD    . LYS A 1 233 ? -1.902  -4.116  -41.120 1.00 9.33   ? 227 LYS A CD    1 
ATOM   1689 C  CE    . LYS A 1 233 ? -1.897  -4.387  -42.630 1.00 16.09  ? 227 LYS A CE    1 
ATOM   1690 N  NZ    . LYS A 1 233 ? -0.725  -5.202  -43.103 1.00 12.91  ? 227 LYS A NZ    1 
ATOM   1691 N  N     . LEU A 1 234 ? -7.323  -5.138  -39.741 1.00 9.66   ? 228 LEU A N     1 
ATOM   1692 C  CA    . LEU A 1 234 ? -8.603  -5.813  -39.970 1.00 8.20   ? 228 LEU A CA    1 
ATOM   1693 C  C     . LEU A 1 234 ? -9.752  -4.791  -39.953 1.00 9.23   ? 228 LEU A C     1 
ATOM   1694 O  O     . LEU A 1 234 ? -10.641 -4.813  -40.808 1.00 7.55   ? 228 LEU A O     1 
ATOM   1695 C  CB    . LEU A 1 234 ? -8.849  -6.860  -38.894 1.00 5.05   ? 228 LEU A CB    1 
ATOM   1696 C  CG    . LEU A 1 234 ? -9.660  -8.107  -39.264 1.00 8.09   ? 228 LEU A CG    1 
ATOM   1697 C  CD1   . LEU A 1 234 ? -10.299 -8.710  -38.028 1.00 8.24   ? 228 LEU A CD1   1 
ATOM   1698 C  CD2   . LEU A 1 234 ? -10.707 -7.895  -40.341 1.00 7.78   ? 228 LEU A CD2   1 
ATOM   1699 N  N     . TRP A 1 235 ? -9.724  -3.906  -38.961 1.00 7.19   ? 229 TRP A N     1 
ATOM   1700 C  CA    . TRP A 1 235 ? -10.725 -2.877  -38.847 1.00 5.18   ? 229 TRP A CA    1 
ATOM   1701 C  C     . TRP A 1 235 ? -10.766 -2.050  -40.136 1.00 8.78   ? 229 TRP A C     1 
ATOM   1702 O  O     . TRP A 1 235 ? -11.830 -1.899  -40.745 1.00 10.36  ? 229 TRP A O     1 
ATOM   1703 C  CB    . TRP A 1 235 ? -10.455 -1.999  -37.629 1.00 4.77   ? 229 TRP A CB    1 
ATOM   1704 C  CG    . TRP A 1 235 ? -11.243 -0.742  -37.673 1.00 6.65   ? 229 TRP A CG    1 
ATOM   1705 C  CD1   . TRP A 1 235 ? -12.582 -0.614  -37.494 1.00 6.22   ? 229 TRP A CD1   1 
ATOM   1706 C  CD2   . TRP A 1 235 ? -10.748 0.576   -37.954 1.00 8.25   ? 229 TRP A CD2   1 
ATOM   1707 N  NE1   . TRP A 1 235 ? -12.956 0.696   -37.634 1.00 7.84   ? 229 TRP A NE1   1 
ATOM   1708 C  CE2   . TRP A 1 235 ? -11.847 1.448   -37.916 1.00 7.12   ? 229 TRP A CE2   1 
ATOM   1709 C  CE3   . TRP A 1 235 ? -9.480  1.100   -38.240 1.00 6.95   ? 229 TRP A CE3   1 
ATOM   1710 C  CZ2   . TRP A 1 235 ? -11.720 2.807   -38.147 1.00 6.30   ? 229 TRP A CZ2   1 
ATOM   1711 C  CZ3   . TRP A 1 235 ? -9.359  2.450   -38.465 1.00 4.87   ? 229 TRP A CZ3   1 
ATOM   1712 C  CH2   . TRP A 1 235 ? -10.467 3.287   -38.413 1.00 6.38   ? 229 TRP A CH2   1 
ATOM   1713 N  N     . ALA A 1 236 ? -9.610  -1.540  -40.562 1.00 7.83   ? 230 ALA A N     1 
ATOM   1714 C  CA    . ALA A 1 236 ? -9.527  -0.733  -41.776 1.00 6.34   ? 230 ALA A CA    1 
ATOM   1715 C  C     . ALA A 1 236 ? -10.106 -1.460  -42.992 1.00 7.72   ? 230 ALA A C     1 
ATOM   1716 O  O     . ALA A 1 236 ? -10.899 -0.888  -43.731 1.00 8.31   ? 230 ALA A O     1 
ATOM   1717 C  CB    . ALA A 1 236 ? -8.108  -0.332  -42.036 1.00 6.43   ? 230 ALA A CB    1 
ATOM   1718 N  N     . LYS A 1 237 ? -9.722  -2.720  -43.185 1.00 6.74   ? 231 LYS A N     1 
ATOM   1719 C  CA    . LYS A 1 237 ? -10.203 -3.492  -44.323 1.00 8.03   ? 231 LYS A CA    1 
ATOM   1720 C  C     . LYS A 1 237 ? -11.711 -3.640  -44.239 1.00 8.30   ? 231 LYS A C     1 
ATOM   1721 O  O     . LYS A 1 237 ? -12.424 -3.303  -45.178 1.00 8.45   ? 231 LYS A O     1 
ATOM   1722 C  CB    . LYS A 1 237 ? -9.536  -4.882  -44.411 1.00 8.60   ? 231 LYS A CB    1 
ATOM   1723 C  CG    . LYS A 1 237 ? -8.018  -4.868  -44.645 1.00 11.06  ? 231 LYS A CG    1 
ATOM   1724 C  CD    . LYS A 1 237 ? -7.488  -6.243  -45.069 1.00 14.00  ? 231 LYS A CD    1 
ATOM   1725 C  CE    . LYS A 1 237 ? -5.967  -6.260  -45.382 1.00 11.07  ? 231 LYS A CE    1 
ATOM   1726 N  NZ    . LYS A 1 237 ? -5.097  -6.387  -44.152 1.00 15.40  ? 231 LYS A NZ    1 
ATOM   1727 N  N     . ARG A 1 238 ? -12.185 -4.135  -43.100 1.00 9.08   ? 232 ARG A N     1 
ATOM   1728 C  CA    . ARG A 1 238 ? -13.602 -4.394  -42.899 1.00 8.77   ? 232 ARG A CA    1 
ATOM   1729 C  C     . ARG A 1 238 ? -14.367 -3.094  -43.063 1.00 10.54  ? 232 ARG A C     1 
ATOM   1730 O  O     . ARG A 1 238 ? -15.513 -3.072  -43.507 1.00 12.34  ? 232 ARG A O     1 
ATOM   1731 C  CB    . ARG A 1 238 ? -13.865 -5.009  -41.511 1.00 7.69   ? 232 ARG A CB    1 
ATOM   1732 C  CG    . ARG A 1 238 ? -13.850 -6.561  -41.442 1.00 9.40   ? 232 ARG A CG    1 
ATOM   1733 C  CD    . ARG A 1 238 ? -14.481 -7.159  -42.679 1.00 13.90  ? 232 ARG A CD    1 
ATOM   1734 N  NE    . ARG A 1 238 ? -15.479 -8.225  -42.509 1.00 19.70  ? 232 ARG A NE    1 
ATOM   1735 C  CZ    . ARG A 1 238 ? -16.637 -8.112  -41.856 1.00 20.00  ? 232 ARG A CZ    1 
ATOM   1736 N  NH1   . ARG A 1 238 ? -16.952 -6.990  -41.229 1.00 15.58  ? 232 ARG A NH1   1 
ATOM   1737 N  NH2   . ARG A 1 238 ? -17.476 -9.143  -41.802 1.00 25.52  ? 232 ARG A NH2   1 
ATOM   1738 N  N     . ARG A 1 239 ? -13.716 -1.995  -42.729 1.00 8.31   ? 233 ARG A N     1 
ATOM   1739 C  CA    . ARG A 1 239 ? -14.424 -0.746  -42.692 1.00 8.50   ? 233 ARG A CA    1 
ATOM   1740 C  C     . ARG A 1 239 ? -14.303 0.033   -44.004 1.00 12.73  ? 233 ARG A C     1 
ATOM   1741 O  O     . ARG A 1 239 ? -14.879 1.114   -44.156 1.00 13.46  ? 233 ARG A O     1 
ATOM   1742 C  CB    . ARG A 1 239 ? -13.942 0.078   -41.515 1.00 7.72   ? 233 ARG A CB    1 
ATOM   1743 C  CG    . ARG A 1 239 ? -15.065 0.697   -40.778 1.00 9.25   ? 233 ARG A CG    1 
ATOM   1744 C  CD    . ARG A 1 239 ? -15.741 -0.309  -39.913 1.00 10.18  ? 233 ARG A CD    1 
ATOM   1745 N  NE    . ARG A 1 239 ? -17.205 -0.249  -39.918 1.00 9.53   ? 233 ARG A NE    1 
ATOM   1746 C  CZ    . ARG A 1 239 ? -17.940 0.828   -39.659 1.00 11.44  ? 233 ARG A CZ    1 
ATOM   1747 N  NH1   . ARG A 1 239 ? -17.378 2.006   -39.403 1.00 10.08  ? 233 ARG A NH1   1 
ATOM   1748 N  NH2   . ARG A 1 239 ? -19.261 0.724   -39.662 1.00 14.60  ? 233 ARG A NH2   1 
ATOM   1749 N  N     . GLY A 1 240 ? -13.560 -0.513  -44.959 1.00 10.23  ? 234 GLY A N     1 
ATOM   1750 C  CA    . GLY A 1 240 ? -13.467 0.103   -46.275 1.00 10.14  ? 234 GLY A CA    1 
ATOM   1751 C  C     . GLY A 1 240 ? -12.557 1.319   -46.384 1.00 11.30  ? 234 GLY A C     1 
ATOM   1752 O  O     . GLY A 1 240 ? -12.790 2.212   -47.198 1.00 13.74  ? 234 GLY A O     1 
ATOM   1753 N  N     . ILE A 1 241 ? -11.516 1.360   -45.563 1.00 9.38   ? 235 ILE A N     1 
ATOM   1754 C  CA    . ILE A 1 241 ? -10.527 2.413   -45.668 1.00 8.47   ? 235 ILE A CA    1 
ATOM   1755 C  C     . ILE A 1 241 ? -9.096  1.856   -45.770 1.00 10.39  ? 235 ILE A C     1 
ATOM   1756 O  O     . ILE A 1 241 ? -8.134  2.543   -45.436 1.00 8.56   ? 235 ILE A O     1 
ATOM   1757 C  CB    . ILE A 1 241 ? -10.636 3.390   -44.500 1.00 6.58   ? 235 ILE A CB    1 
ATOM   1758 C  CG1   . ILE A 1 241 ? -10.333 2.666   -43.195 1.00 6.62   ? 235 ILE A CG1   1 
ATOM   1759 C  CG2   . ILE A 1 241 ? -12.013 4.001   -44.473 1.00 5.19   ? 235 ILE A CG2   1 
ATOM   1760 C  CD1   . ILE A 1 241 ? -10.359 3.550   -41.995 1.00 5.35   ? 235 ILE A CD1   1 
ATOM   1761 N  N     . TYR A 1 242 ? -8.957  0.619   -46.247 1.00 10.32  ? 236 TYR A N     1 
ATOM   1762 C  CA    . TYR A 1 242 ? -7.636  0.057   -46.522 1.00 8.45   ? 236 TYR A CA    1 
ATOM   1763 C  C     . TYR A 1 242 ? -7.378  0.032   -48.027 1.00 13.67  ? 236 TYR A C     1 
ATOM   1764 O  O     . TYR A 1 242 ? -7.890  -0.848  -48.725 1.00 16.55  ? 236 TYR A O     1 
ATOM   1765 C  CB    . TYR A 1 242 ? -7.544  -1.359  -45.968 1.00 9.52   ? 236 TYR A CB    1 
ATOM   1766 C  CG    . TYR A 1 242 ? -6.133  -1.909  -45.860 1.00 11.67  ? 236 TYR A CG    1 
ATOM   1767 C  CD1   . TYR A 1 242 ? -5.444  -2.299  -46.987 1.00 8.57   ? 236 TYR A CD1   1 
ATOM   1768 C  CD2   . TYR A 1 242 ? -5.502  -2.061  -44.617 1.00 9.16   ? 236 TYR A CD2   1 
ATOM   1769 C  CE1   . TYR A 1 242 ? -4.167  -2.804  -46.905 1.00 10.24  ? 236 TYR A CE1   1 
ATOM   1770 C  CE2   . TYR A 1 242 ? -4.218  -2.571  -44.522 1.00 8.13   ? 236 TYR A CE2   1 
ATOM   1771 C  CZ    . TYR A 1 242 ? -3.556  -2.945  -45.684 1.00 12.90  ? 236 TYR A CZ    1 
ATOM   1772 O  OH    . TYR A 1 242 ? -2.276  -3.465  -45.664 1.00 13.84  ? 236 TYR A OH    1 
ATOM   1773 N  N     . SER A 1 243 ? -6.604  1.004   -48.514 1.00 10.66  ? 237 SER A N     1 
ATOM   1774 C  CA    . SER A 1 243 ? -6.145  1.070   -49.915 1.00 10.50  ? 237 SER A CA    1 
ATOM   1775 C  C     . SER A 1 243 ? -5.355  2.354   -50.159 1.00 8.77   ? 237 SER A C     1 
ATOM   1776 O  O     . SER A 1 243 ? -5.925  3.452   -50.209 1.00 7.60   ? 237 SER A O     1 
ATOM   1777 C  CB    . SER A 1 243 ? -7.314  0.995   -50.924 1.00 13.68  ? 237 SER A CB    1 
ATOM   1778 O  OG    . SER A 1 243 ? -6.876  1.174   -52.269 1.00 8.54   ? 237 SER A OG    1 
ATOM   1779 N  N     . ASN A 1 244 ? -4.044  2.230   -50.305 1.00 5.84   ? 238 ASN A N     1 
ATOM   1780 C  CA    . ASN A 1 244 ? -3.271  3.414   -50.616 1.00 7.32   ? 238 ASN A CA    1 
ATOM   1781 C  C     . ASN A 1 244 ? -3.602  3.963   -51.991 1.00 9.83   ? 238 ASN A C     1 
ATOM   1782 O  O     . ASN A 1 244 ? -3.578  5.167   -52.217 1.00 11.59  ? 238 ASN A O     1 
ATOM   1783 C  CB    . ASN A 1 244 ? -1.784  3.144   -50.547 1.00 6.06   ? 238 ASN A CB    1 
ATOM   1784 C  CG    . ASN A 1 244 ? -0.988  4.266   -51.141 1.00 6.25   ? 238 ASN A CG    1 
ATOM   1785 O  OD1   . ASN A 1 244 ? -0.769  5.283   -50.501 1.00 9.75   ? 238 ASN A OD1   1 
ATOM   1786 N  ND2   . ASN A 1 244 ? -0.580  4.109   -52.384 1.00 7.53   ? 238 ASN A ND2   1 
ATOM   1787 N  N     . MET A 1 245 ? -3.902  3.059   -52.910 1.00 11.56  ? 239 MET A N     1 
ATOM   1788 C  CA    . MET A 1 245 ? -4.145  3.405   -54.295 1.00 10.63  ? 239 MET A CA    1 
ATOM   1789 C  C     . MET A 1 245 ? -5.325  4.334   -54.425 1.00 12.32  ? 239 MET A C     1 
ATOM   1790 O  O     . MET A 1 245 ? -5.237  5.401   -55.035 1.00 17.54  ? 239 MET A O     1 
ATOM   1791 C  CB    . MET A 1 245 ? -4.437  2.131   -55.071 1.00 18.40  ? 239 MET A CB    1 
ATOM   1792 C  CG    . MET A 1 245 ? -4.922  2.340   -56.478 1.00 22.99  ? 239 MET A CG    1 
ATOM   1793 S  SD    . MET A 1 245 ? -3.864  1.433   -57.604 1.00 43.01  ? 239 MET A SD    1 
ATOM   1794 C  CE    . MET A 1 245 ? -2.290  2.286   -57.357 1.00 15.65  ? 239 MET A CE    1 
ATOM   1795 N  N     . LEU A 1 246 ? -6.432  3.912   -53.836 1.00 13.78  ? 240 LEU A N     1 
ATOM   1796 C  CA    . LEU A 1 246 ? -7.700  4.600   -53.975 1.00 11.55  ? 240 LEU A CA    1 
ATOM   1797 C  C     . LEU A 1 246 ? -7.864  5.739   -52.972 1.00 12.97  ? 240 LEU A C     1 
ATOM   1798 O  O     . LEU A 1 246 ? -8.975  6.250   -52.783 1.00 14.78  ? 240 LEU A O     1 
ATOM   1799 C  CB    . LEU A 1 246 ? -8.835  3.594   -53.847 1.00 10.16  ? 240 LEU A CB    1 
ATOM   1800 C  CG    . LEU A 1 246 ? -8.839  2.617   -55.019 1.00 12.39  ? 240 LEU A CG    1 
ATOM   1801 C  CD1   . LEU A 1 246 ? -9.449  1.277   -54.653 1.00 18.58  ? 240 LEU A CD1   1 
ATOM   1802 C  CD2   . LEU A 1 246 ? -9.614  3.227   -56.137 1.00 17.25  ? 240 LEU A CD2   1 
ATOM   1803 N  N     . GLY A 1 247 ? -6.764  6.132   -52.330 1.00 8.96   ? 241 GLY A N     1 
ATOM   1804 C  CA    . GLY A 1 247 ? -6.729  7.388   -51.598 1.00 9.72   ? 241 GLY A CA    1 
ATOM   1805 C  C     . GLY A 1 247 ? -6.876  7.272   -50.100 1.00 9.58   ? 241 GLY A C     1 
ATOM   1806 O  O     . GLY A 1 247 ? -6.912  8.279   -49.379 1.00 8.99   ? 241 GLY A O     1 
ATOM   1807 N  N     . PHE A 1 248 ? -6.961  6.031   -49.637 1.00 10.12  ? 242 PHE A N     1 
ATOM   1808 C  CA    . PHE A 1 248 ? -7.027  5.742   -48.218 1.00 8.18   ? 242 PHE A CA    1 
ATOM   1809 C  C     . PHE A 1 248 ? -5.627  5.436   -47.735 1.00 8.63   ? 242 PHE A C     1 
ATOM   1810 O  O     . PHE A 1 248 ? -4.667  5.991   -48.260 1.00 13.19  ? 242 PHE A O     1 
ATOM   1811 C  CB    . PHE A 1 248 ? -8.007  4.600   -47.962 1.00 8.37   ? 242 PHE A CB    1 
ATOM   1812 C  CG    . PHE A 1 248 ? -9.419  4.957   -48.315 1.00 8.02   ? 242 PHE A CG    1 
ATOM   1813 C  CD1   . PHE A 1 248 ? -10.178 5.739   -47.462 1.00 7.86   ? 242 PHE A CD1   1 
ATOM   1814 C  CD2   . PHE A 1 248 ? -9.962  4.574   -49.521 1.00 5.78   ? 242 PHE A CD2   1 
ATOM   1815 C  CE1   . PHE A 1 248 ? -11.473 6.098   -47.786 1.00 7.47   ? 242 PHE A CE1   1 
ATOM   1816 C  CE2   . PHE A 1 248 ? -11.247 4.923   -49.854 1.00 7.01   ? 242 PHE A CE2   1 
ATOM   1817 C  CZ    . PHE A 1 248 ? -12.010 5.688   -48.982 1.00 10.05  ? 242 PHE A CZ    1 
ATOM   1818 N  N     . LEU A 1 249 ? -5.491  4.568   -46.747 1.00 7.45   ? 243 LEU A N     1 
ATOM   1819 C  CA    . LEU A 1 249 ? -4.180  4.259   -46.207 1.00 6.40   ? 243 LEU A CA    1 
ATOM   1820 C  C     . LEU A 1 249 ? -3.803  2.806   -46.480 1.00 7.29   ? 243 LEU A C     1 
ATOM   1821 O  O     . LEU A 1 249 ? -4.666  1.926   -46.496 1.00 8.04   ? 243 LEU A O     1 
ATOM   1822 C  CB    . LEU A 1 249 ? -4.174  4.507   -44.704 1.00 7.50   ? 243 LEU A CB    1 
ATOM   1823 C  CG    . LEU A 1 249 ? -3.673  5.847   -44.172 1.00 11.39  ? 243 LEU A CG    1 
ATOM   1824 C  CD1   . LEU A 1 249 ? -4.299  7.025   -44.895 1.00 9.14   ? 243 LEU A CD1   1 
ATOM   1825 C  CD2   . LEU A 1 249 ? -3.947  5.920   -42.665 1.00 9.83   ? 243 LEU A CD2   1 
ATOM   1826 N  N     . GLY A 1 250 ? -2.517  2.548   -46.684 1.00 5.67   ? 244 GLY A N     1 
ATOM   1827 C  CA    . GLY A 1 250 ? -2.053  1.182   -46.779 1.00 4.69   ? 244 GLY A CA    1 
ATOM   1828 C  C     . GLY A 1 250 ? -1.257  0.749   -45.570 1.00 6.59   ? 244 GLY A C     1 
ATOM   1829 O  O     . GLY A 1 250 ? -1.112  1.486   -44.591 1.00 7.16   ? 244 GLY A O     1 
ATOM   1830 N  N     . GLY A 1 251 ? -0.730  -0.463  -45.661 1.00 9.47   ? 245 GLY A N     1 
ATOM   1831 C  CA    . GLY A 1 251 ? 0.034   -1.090  -44.603 1.00 7.56   ? 245 GLY A CA    1 
ATOM   1832 C  C     . GLY A 1 251 ? 1.024   -0.235  -43.841 1.00 8.77   ? 245 GLY A C     1 
ATOM   1833 O  O     . GLY A 1 251 ? 0.973   -0.220  -42.624 1.00 14.44  ? 245 GLY A O     1 
ATOM   1834 N  N     . VAL A 1 252 ? 1.927   0.467   -44.518 1.00 9.05   ? 246 VAL A N     1 
ATOM   1835 C  CA    . VAL A 1 252 ? 2.966   1.225   -43.807 1.00 7.62   ? 246 VAL A CA    1 
ATOM   1836 C  C     . VAL A 1 252 ? 2.369   2.379   -43.021 1.00 8.16   ? 246 VAL A C     1 
ATOM   1837 O  O     . VAL A 1 252 ? 2.842   2.722   -41.938 1.00 7.94   ? 246 VAL A O     1 
ATOM   1838 C  CB    . VAL A 1 252 ? 4.053   1.781   -44.741 1.00 7.64   ? 246 VAL A CB    1 
ATOM   1839 C  CG1   . VAL A 1 252 ? 5.320   2.011   -43.963 1.00 7.43   ? 246 VAL A CG1   1 
ATOM   1840 C  CG2   . VAL A 1 252 ? 4.336   0.806   -45.824 1.00 16.39  ? 246 VAL A CG2   1 
ATOM   1841 N  N     . SER A 1 253 ? 1.321   2.975   -43.567 1.00 6.78   ? 247 SER A N     1 
ATOM   1842 C  CA    . SER A 1 253 ? 0.643   4.045   -42.869 1.00 6.27   ? 247 SER A CA    1 
ATOM   1843 C  C     . SER A 1 253 ? -0.021  3.544   -41.586 1.00 10.22  ? 247 SER A C     1 
ATOM   1844 O  O     . SER A 1 253 ? 0.176   4.137   -40.513 1.00 11.62  ? 247 SER A O     1 
ATOM   1845 C  CB    . SER A 1 253 ? -0.366  4.716   -43.793 1.00 7.68   ? 247 SER A CB    1 
ATOM   1846 O  OG    . SER A 1 253 ? 0.308   5.360   -44.865 1.00 8.60   ? 247 SER A OG    1 
ATOM   1847 N  N     . TRP A 1 254 ? -0.799  2.460   -41.676 1.00 8.07   ? 248 TRP A N     1 
ATOM   1848 C  CA    . TRP A 1 254 ? -1.440  1.926   -40.480 1.00 5.15   ? 248 TRP A CA    1 
ATOM   1849 C  C     . TRP A 1 254 ? -0.379  1.449   -39.512 1.00 7.32   ? 248 TRP A C     1 
ATOM   1850 O  O     . TRP A 1 254 ? -0.539  1.573   -38.307 1.00 9.95   ? 248 TRP A O     1 
ATOM   1851 C  CB    . TRP A 1 254 ? -2.401  0.791   -40.797 1.00 5.17   ? 248 TRP A CB    1 
ATOM   1852 C  CG    . TRP A 1 254 ? -3.539  1.185   -41.687 1.00 8.30   ? 248 TRP A CG    1 
ATOM   1853 C  CD1   . TRP A 1 254 ? -3.763  0.763   -42.971 1.00 7.11   ? 248 TRP A CD1   1 
ATOM   1854 C  CD2   . TRP A 1 254 ? -4.616  2.076   -41.370 1.00 6.75   ? 248 TRP A CD2   1 
ATOM   1855 N  NE1   . TRP A 1 254 ? -4.912  1.335   -43.466 1.00 5.65   ? 248 TRP A NE1   1 
ATOM   1856 C  CE2   . TRP A 1 254 ? -5.453  2.146   -42.506 1.00 6.29   ? 248 TRP A CE2   1 
ATOM   1857 C  CE3   . TRP A 1 254 ? -4.949  2.827   -40.245 1.00 5.06   ? 248 TRP A CE3   1 
ATOM   1858 C  CZ2   . TRP A 1 254 ? -6.602  2.930   -42.541 1.00 5.24   ? 248 TRP A CZ2   1 
ATOM   1859 C  CZ3   . TRP A 1 254 ? -6.085  3.608   -40.289 1.00 6.12   ? 248 TRP A CZ3   1 
ATOM   1860 C  CH2   . TRP A 1 254 ? -6.897  3.654   -41.430 1.00 4.53   ? 248 TRP A CH2   1 
ATOM   1861 N  N     . ALA A 1 255 ? 0.713   0.911   -40.035 1.00 5.90   ? 249 ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 255 ? 1.781   0.440   -39.182 1.00 5.79   ? 249 ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 255 ? 2.329   1.611   -38.389 1.00 7.92   ? 249 ALA A C     1 
ATOM   1864 O  O     . ALA A 1 255 ? 2.587   1.510   -37.188 1.00 9.82   ? 249 ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 255 ? 2.869   -0.200  -39.998 1.00 6.31   ? 249 ALA A CB    1 
ATOM   1866 N  N     . MET A 1 256 ? 2.486   2.744   -39.049 1.00 8.17   ? 250 MET A N     1 
ATOM   1867 C  CA    . MET A 1 256 ? 3.041   3.899   -38.367 1.00 8.72   ? 250 MET A CA    1 
ATOM   1868 C  C     . MET A 1 256 ? 2.094   4.531   -37.329 1.00 9.33   ? 250 MET A C     1 
ATOM   1869 O  O     . MET A 1 256 ? 2.531   4.927   -36.235 1.00 7.69   ? 250 MET A O     1 
ATOM   1870 C  CB    . MET A 1 256 ? 3.551   4.909   -39.383 1.00 7.20   ? 250 MET A CB    1 
ATOM   1871 C  CG    . MET A 1 256 ? 4.818   4.428   -40.064 1.00 8.54   ? 250 MET A CG    1 
ATOM   1872 S  SD    . MET A 1 256 ? 5.698   5.738   -40.940 1.00 17.21  ? 250 MET A SD    1 
ATOM   1873 C  CE    . MET A 1 256 ? 4.861   5.702   -42.533 1.00 6.84   ? 250 MET A CE    1 
ATOM   1874 N  N     . LEU A 1 257 ? 0.806   4.608   -37.656 1.00 8.69   ? 251 LEU A N     1 
ATOM   1875 C  CA    . LEU A 1 257 ? -0.169  5.136   -36.701 1.00 8.70   ? 251 LEU A CA    1 
ATOM   1876 C  C     . LEU A 1 257 ? -0.252  4.276   -35.438 1.00 9.94   ? 251 LEU A C     1 
ATOM   1877 O  O     . LEU A 1 257 ? -0.213  4.799   -34.318 1.00 10.58  ? 251 LEU A O     1 
ATOM   1878 C  CB    . LEU A 1 257 ? -1.535  5.282   -37.352 1.00 8.07   ? 251 LEU A CB    1 
ATOM   1879 C  CG    . LEU A 1 257 ? -1.567  6.292   -38.507 1.00 10.70  ? 251 LEU A CG    1 
ATOM   1880 C  CD1   . LEU A 1 257 ? -2.946  6.315   -39.129 1.00 12.64  ? 251 LEU A CD1   1 
ATOM   1881 C  CD2   . LEU A 1 257 ? -1.145  7.714   -38.078 1.00 6.24   ? 251 LEU A CD2   1 
ATOM   1882 N  N     . VAL A 1 258 ? -0.329  2.958   -35.622 1.00 9.00   ? 252 VAL A N     1 
ATOM   1883 C  CA    . VAL A 1 258 ? -0.327  2.038   -34.495 1.00 8.19   ? 252 VAL A CA    1 
ATOM   1884 C  C     . VAL A 1 258 ? 0.986   2.137   -33.715 1.00 9.21   ? 252 VAL A C     1 
ATOM   1885 O  O     . VAL A 1 258 ? 1.001   2.002   -32.494 1.00 12.59  ? 252 VAL A O     1 
ATOM   1886 C  CB    . VAL A 1 258 ? -0.588  0.575   -34.924 1.00 6.23   ? 252 VAL A CB    1 
ATOM   1887 C  CG1   . VAL A 1 258 ? -0.339  -0.374  -33.768 1.00 5.61   ? 252 VAL A CG1   1 
ATOM   1888 C  CG2   . VAL A 1 258 ? -2.000  0.406   -35.413 1.00 4.53   ? 252 VAL A CG2   1 
ATOM   1889 N  N     . ALA A 1 259 ? 2.089   2.393   -34.398 1.00 6.79   ? 253 ALA A N     1 
ATOM   1890 C  CA    . ALA A 1 259 ? 3.336   2.522   -33.668 1.00 6.65   ? 253 ALA A CA    1 
ATOM   1891 C  C     . ALA A 1 259 ? 3.326   3.809   -32.862 1.00 7.87   ? 253 ALA A C     1 
ATOM   1892 O  O     . ALA A 1 259 ? 3.772   3.827   -31.722 1.00 9.49   ? 253 ALA A O     1 
ATOM   1893 C  CB    . ALA A 1 259 ? 4.531   2.467   -34.595 1.00 7.45   ? 253 ALA A CB    1 
ATOM   1894 N  N     . ARG A 1 260 ? 2.810   4.892   -33.430 1.00 9.21   ? 254 ARG A N     1 
ATOM   1895 C  CA    . ARG A 1 260 ? 2.754   6.131   -32.657 1.00 10.80  ? 254 ARG A CA    1 
ATOM   1896 C  C     . ARG A 1 260 ? 1.898   5.920   -31.406 1.00 11.06  ? 254 ARG A C     1 
ATOM   1897 O  O     . ARG A 1 260 ? 2.313   6.308   -30.308 1.00 9.04   ? 254 ARG A O     1 
ATOM   1898 C  CB    . ARG A 1 260 ? 2.244   7.313   -33.485 1.00 9.59   ? 254 ARG A CB    1 
ATOM   1899 C  CG    . ARG A 1 260 ? 2.204   8.640   -32.729 1.00 8.71   ? 254 ARG A CG    1 
ATOM   1900 C  CD    . ARG A 1 260 ? 3.518   9.414   -32.744 1.00 7.37   ? 254 ARG A CD    1 
ATOM   1901 N  NE    . ARG A 1 260 ? 4.173   9.422   -31.438 1.00 17.69  ? 254 ARG A NE    1 
ATOM   1902 C  CZ    . ARG A 1 260 ? 4.003   10.356  -30.500 1.00 13.88  ? 254 ARG A CZ    1 
ATOM   1903 N  NH1   . ARG A 1 260 ? 3.196   11.379  -30.705 1.00 12.54  ? 254 ARG A NH1   1 
ATOM   1904 N  NH2   . ARG A 1 260 ? 4.649   10.271  -29.350 1.00 13.39  ? 254 ARG A NH2   1 
ATOM   1905 N  N     . THR A 1 261 ? 0.736   5.275   -31.566 1.00 6.79   ? 255 THR A N     1 
ATOM   1906 C  CA    . THR A 1 261 ? -0.131  4.973   -30.425 1.00 6.45   ? 255 THR A CA    1 
ATOM   1907 C  C     . THR A 1 261 ? 0.549   4.131   -29.365 1.00 7.77   ? 255 THR A C     1 
ATOM   1908 O  O     . THR A 1 261 ? 0.386   4.366   -28.167 1.00 7.50   ? 255 THR A O     1 
ATOM   1909 C  CB    . THR A 1 261 ? -1.345  4.199   -30.834 1.00 6.85   ? 255 THR A CB    1 
ATOM   1910 O  OG1   . THR A 1 261 ? -1.972  4.860   -31.933 1.00 6.84   ? 255 THR A OG1   1 
ATOM   1911 C  CG2   . THR A 1 261 ? -2.315  4.075   -29.644 1.00 4.88   ? 255 THR A CG2   1 
ATOM   1912 N  N     . CYS A 1 262 ? 1.318   3.147   -29.811 1.00 7.39   ? 256 CYS A N     1 
ATOM   1913 C  CA    . CYS A 1 262 ? 2.089   2.332   -28.893 1.00 7.94   ? 256 CYS A CA    1 
ATOM   1914 C  C     . CYS A 1 262 ? 3.100   3.115   -28.055 1.00 10.00  ? 256 CYS A C     1 
ATOM   1915 O  O     . CYS A 1 262 ? 3.406   2.714   -26.949 1.00 10.58  ? 256 CYS A O     1 
ATOM   1916 C  CB    . CYS A 1 262 ? 2.793   1.226   -29.645 1.00 5.67   ? 256 CYS A CB    1 
ATOM   1917 S  SG    . CYS A 1 262 ? 1.652   -0.033  -30.191 1.00 11.35  ? 256 CYS A SG    1 
ATOM   1918 N  N     . GLN A 1 263 ? 3.623   4.220   -28.576 1.00 11.21  ? 257 GLN A N     1 
ATOM   1919 C  CA    . GLN A 1 263 ? 4.665   4.943   -27.864 1.00 9.00   ? 257 GLN A CA    1 
ATOM   1920 C  C     . GLN A 1 263 ? 4.054   5.755   -26.763 1.00 10.55  ? 257 GLN A C     1 
ATOM   1921 O  O     . GLN A 1 263 ? 4.714   6.058   -25.774 1.00 15.11  ? 257 GLN A O     1 
ATOM   1922 C  CB    . GLN A 1 263 ? 5.423   5.878   -28.794 1.00 11.82  ? 257 GLN A CB    1 
ATOM   1923 C  CG    . GLN A 1 263 ? 6.162   5.190   -29.909 1.00 11.27  ? 257 GLN A CG    1 
ATOM   1924 C  CD    . GLN A 1 263 ? 6.721   6.177   -30.907 1.00 15.57  ? 257 GLN A CD    1 
ATOM   1925 O  OE1   . GLN A 1 263 ? 6.160   7.263   -31.111 1.00 15.59  ? 257 GLN A OE1   1 
ATOM   1926 N  NE2   . GLN A 1 263 ? 7.844   5.815   -31.532 1.00 14.68  ? 257 GLN A NE2   1 
ATOM   1927 N  N     . LEU A 1 264 ? 2.785   6.107   -26.947 1.00 12.14  ? 258 LEU A N     1 
ATOM   1928 C  CA    . LEU A 1 264 ? 2.076   7.013   -26.053 1.00 10.06  ? 258 LEU A CA    1 
ATOM   1929 C  C     . LEU A 1 264 ? 1.535   6.241   -24.860 1.00 15.01  ? 258 LEU A C     1 
ATOM   1930 O  O     . LEU A 1 264 ? 1.333   6.784   -23.769 1.00 15.18  ? 258 LEU A O     1 
ATOM   1931 C  CB    . LEU A 1 264 ? 0.945   7.680   -26.818 1.00 8.64   ? 258 LEU A CB    1 
ATOM   1932 C  CG    . LEU A 1 264 ? 1.551   8.683   -27.783 1.00 9.10   ? 258 LEU A CG    1 
ATOM   1933 C  CD1   . LEU A 1 264 ? 0.580   9.228   -28.807 1.00 5.55   ? 258 LEU A CD1   1 
ATOM   1934 C  CD2   . LEU A 1 264 ? 2.098   9.757   -26.918 1.00 11.21  ? 258 LEU A CD2   1 
ATOM   1935 N  N     . TYR A 1 265 ? 1.329   4.952   -25.077 1.00 11.33  ? 259 TYR A N     1 
ATOM   1936 C  CA    . TYR A 1 265 ? 0.820   4.080   -24.048 1.00 8.36   ? 259 TYR A CA    1 
ATOM   1937 C  C     . TYR A 1 265 ? 1.713   2.855   -23.959 1.00 8.16   ? 259 TYR A C     1 
ATOM   1938 O  O     . TYR A 1 265 ? 1.288   1.751   -24.249 1.00 8.73   ? 259 TYR A O     1 
ATOM   1939 C  CB    . TYR A 1 265 ? -0.615  3.688   -24.410 1.00 9.92   ? 259 TYR A CB    1 
ATOM   1940 C  CG    . TYR A 1 265 ? -1.534  4.890   -24.522 1.00 10.11  ? 259 TYR A CG    1 
ATOM   1941 C  CD1   . TYR A 1 265 ? -2.193  5.389   -23.397 1.00 15.44  ? 259 TYR A CD1   1 
ATOM   1942 C  CD2   . TYR A 1 265 ? -1.725  5.540   -25.728 1.00 6.65   ? 259 TYR A CD2   1 
ATOM   1943 C  CE1   . TYR A 1 265 ? -3.031  6.486   -23.478 1.00 13.81  ? 259 TYR A CE1   1 
ATOM   1944 C  CE2   . TYR A 1 265 ? -2.554  6.644   -25.816 1.00 9.05   ? 259 TYR A CE2   1 
ATOM   1945 C  CZ    . TYR A 1 265 ? -3.201  7.109   -24.687 1.00 12.22  ? 259 TYR A CZ    1 
ATOM   1946 O  OH    . TYR A 1 265 ? -4.021  8.197   -24.749 1.00 14.73  ? 259 TYR A OH    1 
ATOM   1947 N  N     . PRO A 1 266 ? 2.969   3.045   -23.553 1.00 10.06  ? 260 PRO A N     1 
ATOM   1948 C  CA    . PRO A 1 266 ? 3.951   1.954   -23.628 1.00 8.03   ? 260 PRO A CA    1 
ATOM   1949 C  C     . PRO A 1 266 ? 3.577   0.687   -22.878 1.00 11.13  ? 260 PRO A C     1 
ATOM   1950 O  O     . PRO A 1 266 ? 4.213   -0.340  -23.079 1.00 17.92  ? 260 PRO A O     1 
ATOM   1951 C  CB    . PRO A 1 266 ? 5.210   2.565   -22.996 1.00 9.03   ? 260 PRO A CB    1 
ATOM   1952 C  CG    . PRO A 1 266 ? 4.758   3.782   -22.288 1.00 11.64  ? 260 PRO A CG    1 
ATOM   1953 C  CD    . PRO A 1 266 ? 3.552   4.281   -23.005 1.00 10.72  ? 260 PRO A CD    1 
ATOM   1954 N  N     . ASN A 1 267 ? 2.566   0.731   -22.026 1.00 12.59  ? 261 ASN A N     1 
ATOM   1955 C  CA    . ASN A 1 267 ? 2.282   -0.433  -21.196 1.00 10.33  ? 261 ASN A CA    1 
ATOM   1956 C  C     . ASN A 1 267 ? 0.946   -1.141  -21.450 1.00 9.50   ? 261 ASN A C     1 
ATOM   1957 O  O     . ASN A 1 267 ? 0.699   -2.213  -20.898 1.00 13.55  ? 261 ASN A O     1 
ATOM   1958 C  CB    . ASN A 1 267 ? 2.411   -0.062  -19.714 1.00 11.62  ? 261 ASN A CB    1 
ATOM   1959 C  CG    . ASN A 1 267 ? 3.837   0.257   -19.318 1.00 12.12  ? 261 ASN A CG    1 
ATOM   1960 O  OD1   . ASN A 1 267 ? 4.782   -0.252  -19.922 1.00 12.22  ? 261 ASN A OD1   1 
ATOM   1961 N  ND2   . ASN A 1 267 ? 4.003   1.102   -18.292 1.00 9.77   ? 261 ASN A ND2   1 
ATOM   1962 N  N     . ALA A 1 268 ? 0.093   -0.560  -22.282 1.00 5.63   ? 262 ALA A N     1 
ATOM   1963 C  CA    . ALA A 1 268 ? -1.268  -1.065  -22.430 1.00 5.30   ? 262 ALA A CA    1 
ATOM   1964 C  C     . ALA A 1 268 ? -1.361  -2.478  -23.000 1.00 7.58   ? 262 ALA A C     1 
ATOM   1965 O  O     . ALA A 1 268 ? -0.400  -3.031  -23.532 1.00 8.39   ? 262 ALA A O     1 
ATOM   1966 C  CB    . ALA A 1 268 ? -2.106  -0.117  -23.261 1.00 3.68   ? 262 ALA A CB    1 
ATOM   1967 N  N     . ALA A 1 269 ? -2.540  -3.060  -22.855 1.00 7.26   ? 263 ALA A N     1 
ATOM   1968 C  CA    . ALA A 1 269 ? -2.886  -4.262  -23.570 1.00 5.93   ? 263 ALA A CA    1 
ATOM   1969 C  C     . ALA A 1 269 ? -3.330  -3.843  -24.972 1.00 6.01   ? 263 ALA A C     1 
ATOM   1970 O  O     . ALA A 1 269 ? -3.634  -2.674  -25.217 1.00 5.92   ? 263 ALA A O     1 
ATOM   1971 C  CB    . ALA A 1 269 ? -4.004  -4.994  -22.845 1.00 6.13   ? 263 ALA A CB    1 
ATOM   1972 N  N     . ALA A 1 270 ? -3.355  -4.802  -25.889 1.00 6.90   ? 264 ALA A N     1 
ATOM   1973 C  CA    . ALA A 1 270 ? -3.794  -4.541  -27.243 1.00 6.34   ? 264 ALA A CA    1 
ATOM   1974 C  C     . ALA A 1 270 ? -5.194  -3.945  -27.205 1.00 6.16   ? 264 ALA A C     1 
ATOM   1975 O  O     . ALA A 1 270 ? -5.478  -2.951  -27.891 1.00 5.92   ? 264 ALA A O     1 
ATOM   1976 C  CB    . ALA A 1 270 ? -3.769  -5.800  -28.048 1.00 4.21   ? 264 ALA A CB    1 
ATOM   1977 N  N     . SER A 1 271 ? -6.050  -4.539  -26.377 1.00 5.30   ? 265 SER A N     1 
ATOM   1978 C  CA    . SER A 1 271 ? -7.419  -4.068  -26.211 1.00 5.54   ? 265 SER A CA    1 
ATOM   1979 C  C     . SER A 1 271 ? -7.425  -2.576  -25.918 1.00 6.45   ? 265 SER A C     1 
ATOM   1980 O  O     . SER A 1 271 ? -8.112  -1.808  -26.569 1.00 8.26   ? 265 SER A O     1 
ATOM   1981 C  CB    . SER A 1 271 ? -8.078  -4.818  -25.074 1.00 5.28   ? 265 SER A CB    1 
ATOM   1982 O  OG    . SER A 1 271 ? -7.142  -4.999  -24.025 1.00 7.63   ? 265 SER A OG    1 
ATOM   1983 N  N     . THR A 1 272 ? -6.625  -2.161  -24.952 1.00 5.08   ? 266 THR A N     1 
ATOM   1984 C  CA    . THR A 1 272 ? -6.528  -0.753  -24.639 1.00 5.89   ? 266 THR A CA    1 
ATOM   1985 C  C     . THR A 1 272 ? -5.919  0.024   -25.827 1.00 5.96   ? 266 THR A C     1 
ATOM   1986 O  O     . THR A 1 272 ? -6.366  1.123   -26.167 1.00 6.33   ? 266 THR A O     1 
ATOM   1987 C  CB    . THR A 1 272 ? -5.697  -0.548  -23.339 1.00 5.19   ? 266 THR A CB    1 
ATOM   1988 O  OG1   . THR A 1 272 ? -6.358  -1.184  -22.240 1.00 5.77   ? 266 THR A OG1   1 
ATOM   1989 C  CG2   . THR A 1 272 ? -5.520  0.911   -23.039 1.00 3.22   ? 266 THR A CG2   1 
ATOM   1990 N  N     . LEU A 1 273 ? -4.905  -0.563  -26.457 1.00 5.18   ? 267 LEU A N     1 
ATOM   1991 C  CA    . LEU A 1 273 ? -4.195  0.097   -27.542 1.00 5.50   ? 267 LEU A CA    1 
ATOM   1992 C  C     . LEU A 1 273 ? -5.101  0.348   -28.752 1.00 6.47   ? 267 LEU A C     1 
ATOM   1993 O  O     . LEU A 1 273 ? -4.992  1.395   -29.389 1.00 6.89   ? 267 LEU A O     1 
ATOM   1994 C  CB    . LEU A 1 273 ? -2.942  -0.693  -27.938 1.00 5.22   ? 267 LEU A CB    1 
ATOM   1995 C  CG    . LEU A 1 273 ? -1.780  -0.594  -26.953 1.00 5.63   ? 267 LEU A CG    1 
ATOM   1996 C  CD1   . LEU A 1 273 ? -0.783  -1.695  -27.177 1.00 6.91   ? 267 LEU A CD1   1 
ATOM   1997 C  CD2   . LEU A 1 273 ? -1.095  0.742   -27.087 1.00 5.17   ? 267 LEU A CD2   1 
ATOM   1998 N  N     . VAL A 1 274 ? -5.983  -0.601  -29.067 1.00 5.07   ? 268 VAL A N     1 
ATOM   1999 C  CA    . VAL A 1 274 ? -6.981  -0.392  -30.115 1.00 4.73   ? 268 VAL A CA    1 
ATOM   2000 C  C     . VAL A 1 274 ? -7.917  0.745   -29.716 1.00 6.64   ? 268 VAL A C     1 
ATOM   2001 O  O     . VAL A 1 274 ? -8.294  1.576   -30.531 1.00 8.28   ? 268 VAL A O     1 
ATOM   2002 C  CB    . VAL A 1 274 ? -7.817  -1.656  -30.365 1.00 4.04   ? 268 VAL A CB    1 
ATOM   2003 C  CG1   . VAL A 1 274 ? -8.972  -1.374  -31.322 1.00 2.95   ? 268 VAL A CG1   1 
ATOM   2004 C  CG2   . VAL A 1 274 ? -6.938  -2.778  -30.889 1.00 5.06   ? 268 VAL A CG2   1 
ATOM   2005 N  N     . HIS A 1 275 ? -8.293  0.795   -28.452 1.00 6.38   ? 269 HIS A N     1 
ATOM   2006 C  CA    . HIS A 1 275 ? -9.141  1.880   -28.027 1.00 7.59   ? 269 HIS A CA    1 
ATOM   2007 C  C     . HIS A 1 275 ? -8.409  3.211   -28.136 1.00 6.67   ? 269 HIS A C     1 
ATOM   2008 O  O     . HIS A 1 275 ? -8.927  4.165   -28.705 1.00 6.42   ? 269 HIS A O     1 
ATOM   2009 C  CB    . HIS A 1 275 ? -9.638  1.674   -26.596 1.00 8.72   ? 269 HIS A CB    1 
ATOM   2010 C  CG    . HIS A 1 275 ? -10.298 2.889   -26.030 1.00 10.72  ? 269 HIS A CG    1 
ATOM   2011 N  ND1   . HIS A 1 275 ? -11.503 3.364   -26.501 1.00 8.76   ? 269 HIS A ND1   1 
ATOM   2012 C  CD2   . HIS A 1 275 ? -9.890  3.765   -25.081 1.00 9.89   ? 269 HIS A CD2   1 
ATOM   2013 C  CE1   . HIS A 1 275 ? -11.819 4.468   -25.849 1.00 10.44  ? 269 HIS A CE1   1 
ATOM   2014 N  NE2   . HIS A 1 275 ? -10.856 4.734   -24.983 1.00 8.66   ? 269 HIS A NE2   1 
ATOM   2015 N  N     . LYS A 1 276 ? -7.202  3.265   -27.587 1.00 6.15   ? 270 LYS A N     1 
ATOM   2016 C  CA    . LYS A 1 276 ? -6.470  4.519   -27.485 1.00 6.02   ? 270 LYS A CA    1 
ATOM   2017 C  C     . LYS A 1 276 ? -6.137  5.037   -28.856 1.00 7.55   ? 270 LYS A C     1 
ATOM   2018 O  O     . LYS A 1 276 ? -6.131  6.241   -29.087 1.00 7.77   ? 270 LYS A O     1 
ATOM   2019 C  CB    . LYS A 1 276 ? -5.187  4.331   -26.694 1.00 6.35   ? 270 LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1 276 ? -5.418  4.094   -25.226 1.00 11.41  ? 270 LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1 276 ? -6.154  5.263   -24.581 1.00 12.14  ? 270 LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1 276 ? -6.391  5.007   -23.102 1.00 9.85   ? 270 LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1 276 ? -7.013  6.190   -22.452 1.00 20.95  ? 270 LYS A NZ    1 
ATOM   2024 N  N     . PHE A 1 277 ? -5.843  4.104   -29.754 1.00 8.71   ? 271 PHE A N     1 
ATOM   2025 C  CA    . PHE A 1 277 ? -5.633  4.396   -31.164 1.00 6.97   ? 271 PHE A CA    1 
ATOM   2026 C  C     . PHE A 1 277 ? -6.740  5.294   -31.657 1.00 7.76   ? 271 PHE A C     1 
ATOM   2027 O  O     . PHE A 1 277 ? -6.468  6.369   -32.181 1.00 9.80   ? 271 PHE A O     1 
ATOM   2028 C  CB    . PHE A 1 277 ? -5.624  3.106   -31.977 1.00 5.72   ? 271 PHE A CB    1 
ATOM   2029 C  CG    . PHE A 1 277 ? -5.603  3.322   -33.449 1.00 5.97   ? 271 PHE A CG    1 
ATOM   2030 C  CD1   . PHE A 1 277 ? -4.409  3.551   -34.107 1.00 7.56   ? 271 PHE A CD1   1 
ATOM   2031 C  CD2   . PHE A 1 277 ? -6.778  3.288   -34.187 1.00 9.00   ? 271 PHE A CD2   1 
ATOM   2032 C  CE1   . PHE A 1 277 ? -4.379  3.743   -35.482 1.00 8.42   ? 271 PHE A CE1   1 
ATOM   2033 C  CE2   . PHE A 1 277 ? -6.766  3.493   -35.555 1.00 8.11   ? 271 PHE A CE2   1 
ATOM   2034 C  CZ    . PHE A 1 277 ? -5.563  3.713   -36.207 1.00 9.88   ? 271 PHE A CZ    1 
ATOM   2035 N  N     . PHE A 1 278 ? -7.986  4.870   -31.472 1.00 5.73   ? 272 PHE A N     1 
ATOM   2036 C  CA    . PHE A 1 278 ? -9.105  5.659   -31.951 1.00 6.85   ? 272 PHE A CA    1 
ATOM   2037 C  C     . PHE A 1 278 ? -9.210  6.992   -31.214 1.00 8.78   ? 272 PHE A C     1 
ATOM   2038 O  O     . PHE A 1 278 ? -9.503  8.015   -31.830 1.00 11.86  ? 272 PHE A O     1 
ATOM   2039 C  CB    . PHE A 1 278 ? -10.415 4.890   -31.853 1.00 9.58   ? 272 PHE A CB    1 
ATOM   2040 C  CG    . PHE A 1 278 ? -10.483 3.679   -32.740 1.00 9.27   ? 272 PHE A CG    1 
ATOM   2041 C  CD1   . PHE A 1 278 ? -10.322 3.794   -34.104 1.00 9.21   ? 272 PHE A CD1   1 
ATOM   2042 C  CD2   . PHE A 1 278 ? -10.736 2.424   -32.205 1.00 9.20   ? 272 PHE A CD2   1 
ATOM   2043 C  CE1   . PHE A 1 278 ? -10.396 2.681   -34.922 1.00 9.35   ? 272 PHE A CE1   1 
ATOM   2044 C  CE2   . PHE A 1 278 ? -10.807 1.311   -33.014 1.00 8.52   ? 272 PHE A CE2   1 
ATOM   2045 C  CZ    . PHE A 1 278 ? -10.640 1.442   -34.377 1.00 9.10   ? 272 PHE A CZ    1 
ATOM   2046 N  N     . LEU A 1 279 ? -8.962  6.980   -29.908 1.00 6.61   ? 273 LEU A N     1 
ATOM   2047 C  CA    . LEU A 1 279 ? -8.966  8.201   -29.107 1.00 8.08   ? 273 LEU A CA    1 
ATOM   2048 C  C     . LEU A 1 279 ? -8.007  9.195   -29.723 1.00 10.59  ? 273 LEU A C     1 
ATOM   2049 O  O     . LEU A 1 279 ? -8.386  10.301  -30.111 1.00 11.43  ? 273 LEU A O     1 
ATOM   2050 C  CB    . LEU A 1 279 ? -8.473  7.913   -27.687 1.00 8.29   ? 273 LEU A CB    1 
ATOM   2051 C  CG    . LEU A 1 279 ? -9.118  8.561   -26.455 1.00 6.19   ? 273 LEU A CG    1 
ATOM   2052 C  CD1   . LEU A 1 279 ? -8.087  8.792   -25.381 1.00 5.38   ? 273 LEU A CD1   1 
ATOM   2053 C  CD2   . LEU A 1 279 ? -9.832  9.831   -26.799 1.00 13.21  ? 273 LEU A CD2   1 
ATOM   2054 N  N     . VAL A 1 280 ? -6.753  8.773   -29.802 1.00 9.64   ? 274 VAL A N     1 
ATOM   2055 C  CA    . VAL A 1 280 ? -5.681  9.596   -30.329 1.00 8.61   ? 274 VAL A CA    1 
ATOM   2056 C  C     . VAL A 1 280 ? -5.984  10.134  -31.716 1.00 8.76   ? 274 VAL A C     1 
ATOM   2057 O  O     . VAL A 1 280 ? -5.967  11.338  -31.925 1.00 9.68   ? 274 VAL A O     1 
ATOM   2058 C  CB    . VAL A 1 280 ? -4.369  8.816   -30.385 1.00 7.28   ? 274 VAL A CB    1 
ATOM   2059 C  CG1   . VAL A 1 280 ? -3.318  9.615   -31.122 1.00 6.53   ? 274 VAL A CG1   1 
ATOM   2060 C  CG2   . VAL A 1 280 ? -3.911  8.471   -28.990 1.00 6.48   ? 274 VAL A CG2   1 
ATOM   2061 N  N     . PHE A 1 281 ? -6.274  9.258   -32.665 1.00 7.86   ? 275 PHE A N     1 
ATOM   2062 C  CA    . PHE A 1 281 ? -6.383  9.722   -34.043 1.00 8.88   ? 275 PHE A CA    1 
ATOM   2063 C  C     . PHE A 1 281 ? -7.751  10.224  -34.454 1.00 10.82  ? 275 PHE A C     1 
ATOM   2064 O  O     . PHE A 1 281 ? -8.061  10.288  -35.634 1.00 16.36  ? 275 PHE A O     1 
ATOM   2065 C  CB    . PHE A 1 281 ? -5.834  8.691   -35.023 1.00 7.97   ? 275 PHE A CB    1 
ATOM   2066 C  CG    . PHE A 1 281 ? -4.357  8.516   -34.902 1.00 9.47   ? 275 PHE A CG    1 
ATOM   2067 C  CD1   . PHE A 1 281 ? -3.502  9.530   -35.281 1.00 8.55   ? 275 PHE A CD1   1 
ATOM   2068 C  CD2   . PHE A 1 281 ? -3.821  7.370   -34.357 1.00 7.57   ? 275 PHE A CD2   1 
ATOM   2069 C  CE1   . PHE A 1 281 ? -2.148  9.388   -35.143 1.00 8.76   ? 275 PHE A CE1   1 
ATOM   2070 C  CE2   . PHE A 1 281 ? -2.464  7.223   -34.226 1.00 6.41   ? 275 PHE A CE2   1 
ATOM   2071 C  CZ    . PHE A 1 281 ? -1.627  8.227   -34.608 1.00 6.81   ? 275 PHE A CZ    1 
ATOM   2072 N  N     . SER A 1 282 ? -8.563  10.601  -33.479 1.00 11.55  ? 276 SER A N     1 
ATOM   2073 C  CA    . SER A 1 282 ? -9.805  11.290  -33.781 1.00 10.60  ? 276 SER A CA    1 
ATOM   2074 C  C     . SER A 1 282 ? -9.734  12.685  -33.178 1.00 10.86  ? 276 SER A C     1 
ATOM   2075 O  O     . SER A 1 282 ? -10.445 13.591  -33.598 1.00 17.42  ? 276 SER A O     1 
ATOM   2076 C  CB    . SER A 1 282 ? -11.013 10.502  -33.266 1.00 12.34  ? 276 SER A CB    1 
ATOM   2077 O  OG    . SER A 1 282 ? -10.894 10.269  -31.888 1.00 8.97   ? 276 SER A OG    1 
ATOM   2078 N  N     . LYS A 1 283 ? -8.868  12.850  -32.185 1.00 11.71  ? 277 LYS A N     1 
ATOM   2079 C  CA    . LYS A 1 283 ? -8.518  14.168  -31.675 1.00 7.40   ? 277 LYS A CA    1 
ATOM   2080 C  C     . LYS A 1 283 ? -7.550  14.812  -32.645 1.00 8.37   ? 277 LYS A C     1 
ATOM   2081 O  O     . LYS A 1 283 ? -7.439  16.013  -32.678 1.00 15.52  ? 277 LYS A O     1 
ATOM   2082 C  CB    . LYS A 1 283 ? -7.739  14.067  -30.355 1.00 9.80   ? 277 LYS A CB    1 
ATOM   2083 C  CG    . LYS A 1 283 ? -8.462  13.687  -29.088 1.00 9.89   ? 277 LYS A CG    1 
ATOM   2084 C  CD    . LYS A 1 283 ? -7.429  13.481  -27.960 1.00 6.58   ? 277 LYS A CD    1 
ATOM   2085 C  CE    . LYS A 1 283 ? -8.051  13.604  -26.562 1.00 16.53  ? 277 LYS A CE    1 
ATOM   2086 N  NZ    . LYS A 1 283 ? -9.482  13.091  -26.448 1.00 14.38  ? 277 LYS A NZ    1 
ATOM   2087 N  N     . TRP A 1 284 ? -6.802  14.006  -33.391 1.00 10.01  ? 278 TRP A N     1 
ATOM   2088 C  CA    . TRP A 1 284 ? -5.585  14.491  -34.057 1.00 11.52  ? 278 TRP A CA    1 
ATOM   2089 C  C     . TRP A 1 284 ? -5.804  15.675  -35.010 1.00 13.88  ? 278 TRP A C     1 
ATOM   2090 O  O     . TRP A 1 284 ? -6.636  15.626  -35.922 1.00 11.30  ? 278 TRP A O     1 
ATOM   2091 C  CB    . TRP A 1 284 ? -4.845  13.341  -34.756 1.00 9.33   ? 278 TRP A CB    1 
ATOM   2092 C  CG    . TRP A 1 284 ? -3.456  13.696  -35.279 1.00 9.81   ? 278 TRP A CG    1 
ATOM   2093 C  CD1   . TRP A 1 284 ? -3.156  14.332  -36.461 1.00 10.11  ? 278 TRP A CD1   1 
ATOM   2094 C  CD2   . TRP A 1 284 ? -2.197  13.395  -34.663 1.00 7.36   ? 278 TRP A CD2   1 
ATOM   2095 N  NE1   . TRP A 1 284 ? -1.798  14.455  -36.604 1.00 7.50   ? 278 TRP A NE1   1 
ATOM   2096 C  CE2   . TRP A 1 284 ? -1.184  13.886  -35.518 1.00 8.08   ? 278 TRP A CE2   1 
ATOM   2097 C  CE3   . TRP A 1 284 ? -1.826  12.756  -33.475 1.00 6.12   ? 278 TRP A CE3   1 
ATOM   2098 C  CZ2   . TRP A 1 284 ? 0.173   13.770  -35.213 1.00 6.06   ? 278 TRP A CZ2   1 
ATOM   2099 C  CZ3   . TRP A 1 284 ? -0.483  12.641  -33.176 1.00 5.83   ? 278 TRP A CZ3   1 
ATOM   2100 C  CH2   . TRP A 1 284 ? 0.501   13.152  -34.040 1.00 6.08   ? 278 TRP A CH2   1 
ATOM   2101 N  N     . GLU A 1 285 ? -5.049  16.742  -34.788 1.00 12.13  ? 279 GLU A N     1 
ATOM   2102 C  CA    . GLU A 1 285 ? -5.285  17.961  -35.526 1.00 12.40  ? 279 GLU A CA    1 
ATOM   2103 C  C     . GLU A 1 285 ? -4.502  17.959  -36.833 1.00 16.36  ? 279 GLU A C     1 
ATOM   2104 O  O     . GLU A 1 285 ? -3.318  18.313  -36.868 1.00 18.99  ? 279 GLU A O     1 
ATOM   2105 C  CB    . GLU A 1 285 ? -4.946  19.173  -34.657 1.00 19.62  ? 279 GLU A CB    1 
ATOM   2106 C  CG    . GLU A 1 285 ? -5.727  20.421  -35.040 1.00 36.46  ? 279 GLU A CG    1 
ATOM   2107 C  CD    . GLU A 1 285 ? -5.833  21.417  -33.907 1.00 42.69  ? 279 GLU A CD    1 
ATOM   2108 O  OE1   . GLU A 1 285 ? -6.097  20.975  -32.767 1.00 52.13  ? 279 GLU A OE1   1 
ATOM   2109 O  OE2   . GLU A 1 285 ? -5.659  22.633  -34.158 1.00 40.92  ? 279 GLU A OE2   1 
ATOM   2110 N  N     . TRP A 1 286 ? -5.157  17.538  -37.913 1.00 17.45  ? 280 TRP A N     1 
ATOM   2111 C  CA    . TRP A 1 286 ? -4.503  17.517  -39.222 1.00 14.54  ? 280 TRP A CA    1 
ATOM   2112 C  C     . TRP A 1 286 ? -4.300  18.942  -39.745 1.00 18.38  ? 280 TRP A C     1 
ATOM   2113 O  O     . TRP A 1 286 ? -5.133  19.823  -39.488 1.00 29.06  ? 280 TRP A O     1 
ATOM   2114 C  CB    . TRP A 1 286 ? -5.325  16.704  -40.222 1.00 13.15  ? 280 TRP A CB    1 
ATOM   2115 C  CG    . TRP A 1 286 ? -5.587  15.303  -39.790 1.00 10.36  ? 280 TRP A CG    1 
ATOM   2116 C  CD1   . TRP A 1 286 ? -6.792  14.759  -39.489 1.00 9.38   ? 280 TRP A CD1   1 
ATOM   2117 C  CD2   . TRP A 1 286 ? -4.621  14.256  -39.625 1.00 12.23  ? 280 TRP A CD2   1 
ATOM   2118 N  NE1   . TRP A 1 286 ? -6.645  13.439  -39.140 1.00 10.11  ? 280 TRP A NE1   1 
ATOM   2119 C  CE2   . TRP A 1 286 ? -5.317  13.109  -39.210 1.00 12.31  ? 280 TRP A CE2   1 
ATOM   2120 C  CE3   . TRP A 1 286 ? -3.232  14.180  -39.786 1.00 14.75  ? 280 TRP A CE3   1 
ATOM   2121 C  CZ2   . TRP A 1 286 ? -4.672  11.895  -38.946 1.00 13.69  ? 280 TRP A CZ2   1 
ATOM   2122 C  CZ3   . TRP A 1 286 ? -2.592  12.976  -39.518 1.00 11.65  ? 280 TRP A CZ3   1 
ATOM   2123 C  CH2   . TRP A 1 286 ? -3.314  11.850  -39.109 1.00 10.44  ? 280 TRP A CH2   1 
ATOM   2124 N  N     . PRO A 1 287 ? -3.206  19.175  -40.489 1.00 13.03  ? 281 PRO A N     1 
ATOM   2125 C  CA    . PRO A 1 287 ? -2.170  18.216  -40.883 1.00 14.81  ? 281 PRO A CA    1 
ATOM   2126 C  C     . PRO A 1 287 ? -0.904  18.229  -40.040 1.00 12.48  ? 281 PRO A C     1 
ATOM   2127 O  O     . PRO A 1 287 ? 0.188   18.190  -40.606 1.00 11.81  ? 281 PRO A O     1 
ATOM   2128 C  CB    . PRO A 1 287 ? -1.808  18.679  -42.290 1.00 12.74  ? 281 PRO A CB    1 
ATOM   2129 C  CG    . PRO A 1 287 ? -1.956  20.132  -42.227 1.00 10.78  ? 281 PRO A CG    1 
ATOM   2130 C  CD    . PRO A 1 287 ? -3.140  20.390  -41.316 1.00 16.92  ? 281 PRO A CD    1 
ATOM   2131 N  N     . ASN A 1 288 ? -1.030  18.289  -38.725 1.00 11.62  ? 282 ASN A N     1 
ATOM   2132 C  CA    . ASN A 1 288 ? 0.117   17.980  -37.895 1.00 11.28  ? 282 ASN A CA    1 
ATOM   2133 C  C     . ASN A 1 288 ? 0.668   16.627  -38.324 1.00 8.27   ? 282 ASN A C     1 
ATOM   2134 O  O     . ASN A 1 288 ? -0.064  15.651  -38.411 1.00 9.49   ? 282 ASN A O     1 
ATOM   2135 C  CB    . ASN A 1 288 ? -0.299  17.905  -36.429 1.00 10.94  ? 282 ASN A CB    1 
ATOM   2136 C  CG    . ASN A 1 288 ? -0.506  19.254  -35.817 1.00 13.35  ? 282 ASN A CG    1 
ATOM   2137 O  OD1   . ASN A 1 288 ? -0.089  20.268  -36.370 1.00 20.58  ? 282 ASN A OD1   1 
ATOM   2138 N  ND2   . ASN A 1 288 ? -1.135  19.283  -34.653 1.00 18.94  ? 282 ASN A ND2   1 
ATOM   2139 N  N     . PRO A 1 289 ? 1.957   16.554  -38.602 1.00 6.12   ? 283 PRO A N     1 
ATOM   2140 C  CA    . PRO A 1 289 ? 2.435   15.266  -39.111 1.00 9.59   ? 283 PRO A CA    1 
ATOM   2141 C  C     . PRO A 1 289 ? 2.594   14.212  -38.005 1.00 9.51   ? 283 PRO A C     1 
ATOM   2142 O  O     . PRO A 1 289 ? 2.903   14.580  -36.875 1.00 10.74  ? 283 PRO A O     1 
ATOM   2143 C  CB    . PRO A 1 289 ? 3.797   15.632  -39.700 1.00 10.97  ? 283 PRO A CB    1 
ATOM   2144 C  CG    . PRO A 1 289 ? 4.257   16.785  -38.852 1.00 5.94   ? 283 PRO A CG    1 
ATOM   2145 C  CD    . PRO A 1 289 ? 3.014   17.573  -38.566 1.00 6.20   ? 283 PRO A CD    1 
ATOM   2146 N  N     . VAL A 1 290 ? 2.390   12.931  -38.320 1.00 8.28   ? 284 VAL A N     1 
ATOM   2147 C  CA    . VAL A 1 290 ? 2.690   11.858  -37.375 1.00 6.51   ? 284 VAL A CA    1 
ATOM   2148 C  C     . VAL A 1 290 ? 4.143   11.417  -37.515 1.00 7.82   ? 284 VAL A C     1 
ATOM   2149 O  O     . VAL A 1 290 ? 4.550   10.827  -38.523 1.00 6.99   ? 284 VAL A O     1 
ATOM   2150 C  CB    . VAL A 1 290 ? 1.756   10.651  -37.537 1.00 6.04   ? 284 VAL A CB    1 
ATOM   2151 C  CG1   . VAL A 1 290 ? 2.081   9.574   -36.508 1.00 3.77   ? 284 VAL A CG1   1 
ATOM   2152 C  CG2   . VAL A 1 290 ? 0.324   11.080  -37.392 1.00 6.59   ? 284 VAL A CG2   1 
ATOM   2153 N  N     . LEU A 1 291 ? 4.923   11.711  -36.486 1.00 6.33   ? 285 LEU A N     1 
ATOM   2154 C  CA    . LEU A 1 291 ? 6.335   11.383  -36.479 1.00 9.07   ? 285 LEU A CA    1 
ATOM   2155 C  C     . LEU A 1 291 ? 6.609   10.326  -35.424 1.00 12.37  ? 285 LEU A C     1 
ATOM   2156 O  O     . LEU A 1 291 ? 6.027   10.386  -34.337 1.00 18.80  ? 285 LEU A O     1 
ATOM   2157 C  CB    . LEU A 1 291 ? 7.142   12.642  -36.170 1.00 12.98  ? 285 LEU A CB    1 
ATOM   2158 C  CG    . LEU A 1 291 ? 6.862   13.822  -37.113 1.00 9.86   ? 285 LEU A CG    1 
ATOM   2159 C  CD1   . LEU A 1 291 ? 7.142   15.145  -36.429 1.00 4.88   ? 285 LEU A CD1   1 
ATOM   2160 C  CD2   . LEU A 1 291 ? 7.681   13.700  -38.388 1.00 8.15   ? 285 LEU A CD2   1 
ATOM   2161 N  N     . LEU A 1 292 ? 7.478   9.362   -35.736 1.00 10.35  ? 286 LEU A N     1 
ATOM   2162 C  CA    . LEU A 1 292 ? 7.852   8.315   -34.780 1.00 9.84   ? 286 LEU A CA    1 
ATOM   2163 C  C     . LEU A 1 292 ? 9.177   8.606   -34.059 1.00 15.11  ? 286 LEU A C     1 
ATOM   2164 O  O     . LEU A 1 292 ? 9.445   8.076   -32.978 1.00 17.08  ? 286 LEU A O     1 
ATOM   2165 C  CB    . LEU A 1 292 ? 7.916   6.962   -35.469 1.00 7.54   ? 286 LEU A CB    1 
ATOM   2166 C  CG    . LEU A 1 292 ? 6.584   6.497   -36.061 1.00 11.83  ? 286 LEU A CG    1 
ATOM   2167 C  CD1   . LEU A 1 292 ? 6.769   5.273   -36.961 1.00 11.15  ? 286 LEU A CD1   1 
ATOM   2168 C  CD2   . LEU A 1 292 ? 5.574   6.204   -34.970 1.00 10.68  ? 286 LEU A CD2   1 
ATOM   2169 N  N     . LYS A 1 293 ? 10.007  9.449   -34.658 1.00 14.67  ? 287 LYS A N     1 
ATOM   2170 C  CA    . LYS A 1 293 ? 11.262  9.846   -34.035 1.00 18.38  ? 287 LYS A CA    1 
ATOM   2171 C  C     . LYS A 1 293 ? 11.607  11.287  -34.401 1.00 26.21  ? 287 LYS A C     1 
ATOM   2172 O  O     . LYS A 1 293 ? 11.043  11.858  -35.350 1.00 20.04  ? 287 LYS A O     1 
ATOM   2173 C  CB    . LYS A 1 293 ? 12.404  8.904   -34.432 1.00 11.76  ? 287 LYS A CB    1 
ATOM   2174 C  CG    . LYS A 1 293 ? 12.877  9.090   -35.841 1.00 21.63  ? 287 LYS A CG    1 
ATOM   2175 C  CD    . LYS A 1 293 ? 13.918  8.054   -36.252 1.00 33.05  ? 287 LYS A CD    1 
ATOM   2176 C  CE    . LYS A 1 293 ? 15.278  8.304   -35.630 1.00 33.74  ? 287 LYS A CE    1 
ATOM   2177 N  NZ    . LYS A 1 293 ? 16.289  7.393   -36.234 1.00 33.28  ? 287 LYS A NZ    1 
ATOM   2178 N  N     . GLN A 1 294 ? 12.520  11.877  -33.631 1.00 26.36  ? 288 GLN A N     1 
ATOM   2179 C  CA    . GLN A 1 294 ? 12.983  13.224  -33.906 1.00 28.21  ? 288 GLN A CA    1 
ATOM   2180 C  C     . GLN A 1 294 ? 13.877  13.135  -35.107 1.00 27.81  ? 288 GLN A C     1 
ATOM   2181 O  O     . GLN A 1 294 ? 14.893  12.438  -35.053 1.00 29.39  ? 288 GLN A O     1 
ATOM   2182 C  CB    . GLN A 1 294 ? 13.777  13.777  -32.723 1.00 33.13  ? 288 GLN A CB    1 
ATOM   2183 C  CG    . GLN A 1 294 ? 13.327  15.170  -32.293 1.00 41.64  ? 288 GLN A CG    1 
ATOM   2184 C  CD    . GLN A 1 294 ? 12.927  16.044  -33.476 1.00 46.37  ? 288 GLN A CD    1 
ATOM   2185 O  OE1   . GLN A 1 294 ? 13.772  16.444  -34.280 1.00 51.58  ? 288 GLN A OE1   1 
ATOM   2186 N  NE2   . GLN A 1 294 ? 11.631  16.332  -33.594 1.00 37.06  ? 288 GLN A NE2   1 
ATOM   2187 N  N     . PRO A 1 295 ? 13.506  13.818  -36.207 1.00 33.45  ? 289 PRO A N     1 
ATOM   2188 C  CA    . PRO A 1 295 ? 14.355  13.731  -37.400 1.00 34.11  ? 289 PRO A CA    1 
ATOM   2189 C  C     . PRO A 1 295 ? 15.712  14.342  -37.124 1.00 39.58  ? 289 PRO A C     1 
ATOM   2190 O  O     . PRO A 1 295 ? 15.798  15.409  -36.511 1.00 40.77  ? 289 PRO A O     1 
ATOM   2191 C  CB    . PRO A 1 295 ? 13.606  14.572  -38.446 1.00 22.30  ? 289 PRO A CB    1 
ATOM   2192 C  CG    . PRO A 1 295 ? 12.218  14.676  -37.966 1.00 25.71  ? 289 PRO A CG    1 
ATOM   2193 C  CD    . PRO A 1 295 ? 12.312  14.643  -36.446 1.00 36.49  ? 289 PRO A CD    1 
ATOM   2194 N  N     . GLU A 1 296 ? 16.764  13.648  -37.535 1.00 44.49  ? 290 GLU A N     1 
ATOM   2195 C  CA    . GLU A 1 296 ? 18.087  14.238  -37.549 1.00 49.01  ? 290 GLU A CA    1 
ATOM   2196 C  C     . GLU A 1 296 ? 18.363  14.746  -38.955 1.00 46.23  ? 290 GLU A C     1 
ATOM   2197 O  O     . GLU A 1 296 ? 17.734  14.306  -39.918 1.00 36.87  ? 290 GLU A O     1 
ATOM   2198 C  CB    . GLU A 1 296 ? 19.142  13.208  -37.178 1.00 52.62  ? 290 GLU A CB    1 
ATOM   2199 C  CG    . GLU A 1 296 ? 19.065  12.685  -35.767 1.00 48.80  ? 290 GLU A CG    1 
ATOM   2200 C  CD    . GLU A 1 296 ? 20.328  11.939  -35.400 1.00 58.85  ? 290 GLU A CD    1 
ATOM   2201 O  OE1   . GLU A 1 296 ? 21.416  12.403  -35.806 1.00 57.37  ? 290 GLU A OE1   1 
ATOM   2202 O  OE2   . GLU A 1 296 ? 20.241  10.889  -34.727 1.00 63.52  ? 290 GLU A OE2   1 
ATOM   2203 N  N     . GLU A 1 297 ? 19.294  15.679  -39.079 1.00 53.42  ? 291 GLU A N     1 
ATOM   2204 C  CA    . GLU A 1 297 ? 19.764  16.043  -40.405 1.00 58.74  ? 291 GLU A CA    1 
ATOM   2205 C  C     . GLU A 1 297 ? 21.142  15.440  -40.612 1.00 50.58  ? 291 GLU A C     1 
ATOM   2206 O  O     . GLU A 1 297 ? 21.860  15.141  -39.652 1.00 47.33  ? 291 GLU A O     1 
ATOM   2207 C  CB    . GLU A 1 297 ? 19.756  17.561  -40.635 1.00 59.20  ? 291 GLU A CB    1 
ATOM   2208 C  CG    . GLU A 1 297 ? 20.708  18.363  -39.758 1.00 64.01  ? 291 GLU A CG    1 
ATOM   2209 C  CD    . GLU A 1 297 ? 20.642  19.856  -40.055 1.00 70.62  ? 291 GLU A CD    1 
ATOM   2210 O  OE1   . GLU A 1 297 ? 19.584  20.476  -39.790 1.00 59.71  ? 291 GLU A OE1   1 
ATOM   2211 O  OE2   . GLU A 1 297 ? 21.647  20.402  -40.564 1.00 68.14  ? 291 GLU A OE2   1 
ATOM   2212 N  N     . SER A 1 298 ? 21.484  15.229  -41.874 1.00 45.72  ? 292 SER A N     1 
ATOM   2213 C  CA    . SER A 1 298 ? 22.772  14.666  -42.222 1.00 53.67  ? 292 SER A CA    1 
ATOM   2214 C  C     . SER A 1 298 ? 23.450  15.585  -43.211 1.00 45.15  ? 292 SER A C     1 
ATOM   2215 O  O     . SER A 1 298 ? 22.898  16.604  -43.618 1.00 45.52  ? 292 SER A O     1 
ATOM   2216 C  CB    . SER A 1 298 ? 22.602  13.273  -42.831 1.00 49.84  ? 292 SER A CB    1 
ATOM   2217 O  OG    . SER A 1 298 ? 21.653  13.301  -43.885 1.00 42.44  ? 292 SER A OG    1 
ATOM   2218 N  N     . ASN A 1 299 ? 24.660  15.221  -43.588 1.00 43.58  ? 293 ASN A N     1 
ATOM   2219 C  CA    . ASN A 1 299 ? 25.353  15.916  -44.646 1.00 44.03  ? 293 ASN A CA    1 
ATOM   2220 C  C     . ASN A 1 299 ? 24.824  15.453  -46.006 1.00 45.06  ? 293 ASN A C     1 
ATOM   2221 O  O     . ASN A 1 299 ? 25.215  15.971  -47.044 1.00 46.55  ? 293 ASN A O     1 
ATOM   2222 C  CB    . ASN A 1 299 ? 26.871  15.692  -44.513 1.00 63.28  ? 293 ASN A CB    1 
ATOM   2223 C  CG    . ASN A 1 299 ? 27.239  14.238  -44.154 1.00 62.22  ? 293 ASN A CG    1 
ATOM   2224 O  OD1   . ASN A 1 299 ? 26.663  13.290  -44.689 1.00 62.41  ? 293 ASN A OD1   1 
ATOM   2225 N  ND2   . ASN A 1 299 ? 28.207  14.070  -43.247 1.00 46.30  ? 293 ASN A ND2   1 
ATOM   2226 N  N     . LEU A 1 300 ? 23.901  14.496  -45.981 1.00 48.06  ? 294 LEU A N     1 
ATOM   2227 C  CA    . LEU A 1 300 ? 23.487  13.769  -47.182 1.00 46.28  ? 294 LEU A CA    1 
ATOM   2228 C  C     . LEU A 1 300 ? 22.670  14.573  -48.198 1.00 47.50  ? 294 LEU A C     1 
ATOM   2229 O  O     . LEU A 1 300 ? 22.682  14.262  -49.398 1.00 40.50  ? 294 LEU A O     1 
ATOM   2230 C  CB    . LEU A 1 300 ? 22.734  12.492  -46.799 1.00 42.25  ? 294 LEU A CB    1 
ATOM   2231 C  CG    . LEU A 1 300 ? 23.572  11.238  -46.549 1.00 41.94  ? 294 LEU A CG    1 
ATOM   2232 C  CD1   . LEU A 1 300 ? 22.696  10.073  -46.075 1.00 37.62  ? 294 LEU A CD1   1 
ATOM   2233 C  CD2   . LEU A 1 300 ? 24.343  10.866  -47.803 1.00 39.06  ? 294 LEU A CD2   1 
ATOM   2234 N  N     . ASN A 1 301 ? 21.939  15.574  -47.719 1.00 41.11  ? 295 ASN A N     1 
ATOM   2235 C  CA    . ASN A 1 301 ? 21.261  16.514  -48.608 1.00 44.14  ? 295 ASN A CA    1 
ATOM   2236 C  C     . ASN A 1 301 ? 20.331  15.892  -49.652 1.00 33.52  ? 295 ASN A C     1 
ATOM   2237 O  O     . ASN A 1 301 ? 20.429  16.227  -50.829 1.00 35.47  ? 295 ASN A O     1 
ATOM   2238 C  CB    . ASN A 1 301 ? 22.307  17.365  -49.336 1.00 52.77  ? 295 ASN A CB    1 
ATOM   2239 C  CG    . ASN A 1 301 ? 21.945  18.833  -49.375 1.00 65.31  ? 295 ASN A CG    1 
ATOM   2240 O  OD1   . ASN A 1 301 ? 21.535  19.411  -48.365 1.00 69.53  ? 295 ASN A OD1   1 
ATOM   2241 N  ND2   . ASN A 1 301 ? 22.092  19.449  -50.547 1.00 72.87  ? 295 ASN A ND2   1 
ATOM   2242 N  N     . LEU A 1 302 ? 19.433  15.003  -49.229 1.00 36.86  ? 296 LEU A N     1 
ATOM   2243 C  CA    . LEU A 1 302 ? 18.446  14.388  -50.138 1.00 31.01  ? 296 LEU A CA    1 
ATOM   2244 C  C     . LEU A 1 302 ? 17.080  15.055  -49.992 1.00 23.47  ? 296 LEU A C     1 
ATOM   2245 O  O     . LEU A 1 302 ? 16.807  15.651  -48.952 1.00 31.25  ? 296 LEU A O     1 
ATOM   2246 C  CB    . LEU A 1 302 ? 18.319  12.888  -49.853 1.00 24.60  ? 296 LEU A CB    1 
ATOM   2247 C  CG    . LEU A 1 302 ? 19.513  12.031  -50.259 1.00 25.70  ? 296 LEU A CG    1 
ATOM   2248 C  CD1   . LEU A 1 302 ? 19.282  10.585  -49.922 1.00 18.48  ? 296 LEU A CD1   1 
ATOM   2249 C  CD2   . LEU A 1 302 ? 19.771  12.188  -51.743 1.00 28.75  ? 296 LEU A CD2   1 
ATOM   2250 N  N     . PRO A 1 303 ? 16.223  14.974  -51.029 1.00 19.62  ? 297 PRO A N     1 
ATOM   2251 C  CA    . PRO A 1 303 ? 14.842  15.471  -50.912 1.00 24.62  ? 297 PRO A CA    1 
ATOM   2252 C  C     . PRO A 1 303 ? 14.130  14.883  -49.692 1.00 25.92  ? 297 PRO A C     1 
ATOM   2253 O  O     . PRO A 1 303 ? 14.275  13.696  -49.409 1.00 25.90  ? 297 PRO A O     1 
ATOM   2254 C  CB    . PRO A 1 303 ? 14.177  14.962  -52.195 1.00 21.82  ? 297 PRO A CB    1 
ATOM   2255 C  CG    . PRO A 1 303 ? 15.272  14.887  -53.169 1.00 21.01  ? 297 PRO A CG    1 
ATOM   2256 C  CD    . PRO A 1 303 ? 16.501  14.472  -52.384 1.00 26.93  ? 297 PRO A CD    1 
ATOM   2257 N  N     . VAL A 1 304 ? 13.385  15.706  -48.965 1.00 26.64  ? 298 VAL A N     1 
ATOM   2258 C  CA    . VAL A 1 304 ? 12.773  15.271  -47.713 1.00 19.17  ? 298 VAL A CA    1 
ATOM   2259 C  C     . VAL A 1 304 ? 11.454  15.990  -47.555 1.00 20.37  ? 298 VAL A C     1 
ATOM   2260 O  O     . VAL A 1 304 ? 11.336  17.134  -47.980 1.00 26.65  ? 298 VAL A O     1 
ATOM   2261 C  CB    . VAL A 1 304 ? 13.673  15.636  -46.527 1.00 19.54  ? 298 VAL A CB    1 
ATOM   2262 C  CG1   . VAL A 1 304 ? 12.910  15.590  -45.231 1.00 27.46  ? 298 VAL A CG1   1 
ATOM   2263 C  CG2   . VAL A 1 304 ? 14.860  14.714  -46.461 1.00 27.88  ? 298 VAL A CG2   1 
ATOM   2264 N  N     . TRP A 1 305 ? 10.455  15.331  -46.974 1.00 21.49  ? 299 TRP A N     1 
ATOM   2265 C  CA    . TRP A 1 305 ? 9.213   16.024  -46.650 1.00 21.38  ? 299 TRP A CA    1 
ATOM   2266 C  C     . TRP A 1 305 ? 9.504   17.105  -45.647 1.00 22.87  ? 299 TRP A C     1 
ATOM   2267 O  O     . TRP A 1 305 ? 10.092  16.836  -44.600 1.00 22.23  ? 299 TRP A O     1 
ATOM   2268 C  CB    . TRP A 1 305 ? 8.187   15.088  -46.039 1.00 15.81  ? 299 TRP A CB    1 
ATOM   2269 C  CG    . TRP A 1 305 ? 6.853   15.724  -45.875 1.00 11.09  ? 299 TRP A CG    1 
ATOM   2270 C  CD1   . TRP A 1 305 ? 5.908   15.880  -46.838 1.00 14.06  ? 299 TRP A CD1   1 
ATOM   2271 C  CD2   . TRP A 1 305 ? 6.296   16.271  -44.676 1.00 11.65  ? 299 TRP A CD2   1 
ATOM   2272 N  NE1   . TRP A 1 305 ? 4.799   16.492  -46.320 1.00 13.85  ? 299 TRP A NE1   1 
ATOM   2273 C  CE2   . TRP A 1 305 ? 5.010   16.740  -44.990 1.00 12.32  ? 299 TRP A CE2   1 
ATOM   2274 C  CE3   . TRP A 1 305 ? 6.753   16.395  -43.362 1.00 14.44  ? 299 TRP A CE3   1 
ATOM   2275 C  CZ2   . TRP A 1 305 ? 4.178   17.340  -44.044 1.00 14.33  ? 299 TRP A CZ2   1 
ATOM   2276 C  CZ3   . TRP A 1 305 ? 5.917   16.988  -42.413 1.00 13.14  ? 299 TRP A CZ3   1 
ATOM   2277 C  CH2   . TRP A 1 305 ? 4.648   17.450  -42.760 1.00 11.97  ? 299 TRP A CH2   1 
ATOM   2278 N  N     . ASP A 1 306 ? 9.091   18.326  -45.977 1.00 27.97  ? 300 ASP A N     1 
ATOM   2279 C  CA    . ASP A 1 306 ? 9.282   19.487  -45.114 1.00 30.45  ? 300 ASP A CA    1 
ATOM   2280 C  C     . ASP A 1 306 ? 8.495   20.653  -45.668 1.00 28.69  ? 300 ASP A C     1 
ATOM   2281 O  O     . ASP A 1 306 ? 8.916   21.282  -46.624 1.00 31.12  ? 300 ASP A O     1 
ATOM   2282 C  CB    . ASP A 1 306 ? 10.758  19.875  -45.040 1.00 35.51  ? 300 ASP A CB    1 
ATOM   2283 C  CG    . ASP A 1 306 ? 11.045  20.873  -43.934 1.00 40.45  ? 300 ASP A CG    1 
ATOM   2284 O  OD1   . ASP A 1 306 ? 10.085  21.505  -43.451 1.00 39.23  ? 300 ASP A OD1   1 
ATOM   2285 O  OD2   . ASP A 1 306 ? 12.228  21.017  -43.543 1.00 43.44  ? 300 ASP A OD2   1 
ATOM   2286 N  N     . PRO A 1 307 ? 7.343   20.948  -45.061 1.00 31.82  ? 301 PRO A N     1 
ATOM   2287 C  CA    . PRO A 1 307 ? 6.484   22.033  -45.551 1.00 31.88  ? 301 PRO A CA    1 
ATOM   2288 C  C     . PRO A 1 307 ? 7.118   23.394  -45.320 1.00 29.32  ? 301 PRO A C     1 
ATOM   2289 O  O     . PRO A 1 307 ? 6.674   24.370  -45.908 1.00 32.10  ? 301 PRO A O     1 
ATOM   2290 C  CB    . PRO A 1 307 ? 5.216   21.882  -44.705 1.00 28.90  ? 301 PRO A CB    1 
ATOM   2291 C  CG    . PRO A 1 307 ? 5.650   21.116  -43.490 1.00 16.87  ? 301 PRO A CG    1 
ATOM   2292 C  CD    . PRO A 1 307 ? 6.742   20.214  -43.934 1.00 19.06  ? 301 PRO A CD    1 
ATOM   2293 N  N     . ARG A 1 308 ? 8.156   23.426  -44.486 1.00 34.81  ? 302 ARG A N     1 
ATOM   2294 C  CA    . ARG A 1 308 ? 8.857   24.648  -44.095 1.00 33.43  ? 302 ARG A CA    1 
ATOM   2295 C  C     . ARG A 1 308 ? 9.904   25.046  -45.125 1.00 37.18  ? 302 ARG A C     1 
ATOM   2296 O  O     . ARG A 1 308 ? 10.659  25.992  -44.915 1.00 44.82  ? 302 ARG A O     1 
ATOM   2297 C  CB    . ARG A 1 308 ? 9.551   24.433  -42.753 1.00 30.28  ? 302 ARG A CB    1 
ATOM   2298 C  CG    . ARG A 1 308 ? 9.723   25.674  -41.928 1.00 59.13  ? 302 ARG A CG    1 
ATOM   2299 C  CD    . ARG A 1 308 ? 10.763  25.458  -40.838 1.00 76.13  ? 302 ARG A CD    1 
ATOM   2300 N  NE    . ARG A 1 308 ? 12.045  26.070  -41.187 1.00 80.69  ? 302 ARG A NE    1 
ATOM   2301 C  CZ    . ARG A 1 308 ? 12.449  27.263  -40.755 1.00 72.23  ? 302 ARG A CZ    1 
ATOM   2302 N  NH1   . ARG A 1 308 ? 11.677  27.981  -39.945 1.00 57.64  ? 302 ARG A NH1   1 
ATOM   2303 N  NH2   . ARG A 1 308 ? 13.631  27.737  -41.126 1.00 68.45  ? 302 ARG A NH2   1 
ATOM   2304 N  N     . VAL A 1 309 ? 9.961   24.296  -46.221 1.00 32.46  ? 303 VAL A N     1 
ATOM   2305 C  CA    . VAL A 1 309 ? 10.862  24.581  -47.330 1.00 27.05  ? 303 VAL A CA    1 
ATOM   2306 C  C     . VAL A 1 309 ? 10.242  24.121  -48.654 1.00 34.52  ? 303 VAL A C     1 
ATOM   2307 O  O     . VAL A 1 309 ? 10.812  24.339  -49.716 1.00 40.43  ? 303 VAL A O     1 
ATOM   2308 C  CB    . VAL A 1 309 ? 12.282  23.934  -47.146 1.00 31.53  ? 303 VAL A CB    1 
ATOM   2309 C  CG1   . VAL A 1 309 ? 13.153  24.749  -46.193 1.00 45.23  ? 303 VAL A CG1   1 
ATOM   2310 C  CG2   . VAL A 1 309 ? 12.189  22.508  -46.668 1.00 27.09  ? 303 VAL A CG2   1 
ATOM   2311 N  N     . ASN A 1 310 ? 9.072   23.491  -48.584 1.00 31.38  ? 304 ASN A N     1 
ATOM   2312 C  CA    . ASN A 1 310 ? 8.392   22.976  -49.771 1.00 30.63  ? 304 ASN A CA    1 
ATOM   2313 C  C     . ASN A 1 310 ? 6.908   23.288  -49.768 1.00 34.42  ? 304 ASN A C     1 
ATOM   2314 O  O     . ASN A 1 310 ? 6.133   22.684  -49.028 1.00 35.87  ? 304 ASN A O     1 
ATOM   2315 C  CB    . ASN A 1 310 ? 8.576   21.473  -49.882 1.00 32.50  ? 304 ASN A CB    1 
ATOM   2316 C  CG    . ASN A 1 310 ? 9.877   21.099  -50.517 1.00 42.60  ? 304 ASN A CG    1 
ATOM   2317 O  OD1   . ASN A 1 310 ? 10.245  21.644  -51.566 1.00 55.11  ? 304 ASN A OD1   1 
ATOM   2318 N  ND2   . ASN A 1 310 ? 10.596  20.164  -49.892 1.00 31.58  ? 304 ASN A ND2   1 
ATOM   2319 N  N     . PRO A 1 311 ? 6.500   24.255  -50.582 1.00 35.45  ? 305 PRO A N     1 
ATOM   2320 C  CA    . PRO A 1 311 ? 5.087   24.619  -50.524 1.00 34.86  ? 305 PRO A CA    1 
ATOM   2321 C  C     . PRO A 1 311 ? 4.190   23.482  -50.975 1.00 32.96  ? 305 PRO A C     1 
ATOM   2322 O  O     . PRO A 1 311 ? 3.004   23.471  -50.639 1.00 30.92  ? 305 PRO A O     1 
ATOM   2323 C  CB    . PRO A 1 311 ? 5.010   25.812  -51.478 1.00 31.56  ? 305 PRO A CB    1 
ATOM   2324 C  CG    . PRO A 1 311 ? 6.346   26.462  -51.311 1.00 29.38  ? 305 PRO A CG    1 
ATOM   2325 C  CD    . PRO A 1 311 ? 7.315   25.308  -51.211 1.00 35.38  ? 305 PRO A CD    1 
ATOM   2326 N  N     . SER A 1 312 ? 4.754   22.539  -51.725 1.00 36.64  ? 306 SER A N     1 
ATOM   2327 C  CA    . SER A 1 312 ? 3.990   21.391  -52.201 1.00 35.43  ? 306 SER A CA    1 
ATOM   2328 C  C     . SER A 1 312 ? 3.606   20.513  -50.992 1.00 31.32  ? 306 SER A C     1 
ATOM   2329 O  O     . SER A 1 312 ? 2.512   19.947  -50.927 1.00 26.11  ? 306 SER A O     1 
ATOM   2330 C  CB    . SER A 1 312 ? 4.792   20.611  -53.263 1.00 20.33  ? 306 SER A CB    1 
ATOM   2331 O  OG    . SER A 1 312 ? 5.083   19.274  -52.848 1.00 29.17  ? 306 SER A OG    1 
ATOM   2332 N  N     . ASP A 1 313 ? 4.507   20.435  -50.023 1.00 22.42  ? 307 ASP A N     1 
ATOM   2333 C  CA    . ASP A 1 313 ? 4.267   19.638  -48.836 1.00 22.61  ? 307 ASP A CA    1 
ATOM   2334 C  C     . ASP A 1 313 ? 3.189   20.224  -47.933 1.00 20.78  ? 307 ASP A C     1 
ATOM   2335 O  O     . ASP A 1 313 ? 2.500   19.493  -47.229 1.00 24.88  ? 307 ASP A O     1 
ATOM   2336 C  CB    . ASP A 1 313 ? 5.563   19.462  -48.054 1.00 21.68  ? 307 ASP A CB    1 
ATOM   2337 C  CG    . ASP A 1 313 ? 6.595   18.675  -48.823 1.00 23.03  ? 307 ASP A CG    1 
ATOM   2338 O  OD1   . ASP A 1 313 ? 6.273   18.215  -49.947 1.00 20.81  ? 307 ASP A OD1   1 
ATOM   2339 O  OD2   . ASP A 1 313 ? 7.718   18.509  -48.290 1.00 21.56  ? 307 ASP A OD2   1 
ATOM   2340 N  N     . ARG A 1 314 ? 3.038   21.539  -47.949 1.00 19.84  ? 308 ARG A N     1 
ATOM   2341 C  CA    . ARG A 1 314 ? 2.016   22.181  -47.144 1.00 13.86  ? 308 ARG A CA    1 
ATOM   2342 C  C     . ARG A 1 314 ? 0.631   21.642  -47.443 1.00 11.75  ? 308 ARG A C     1 
ATOM   2343 O  O     . ARG A 1 314 ? -0.262  21.699  -46.606 1.00 11.98  ? 308 ARG A O     1 
ATOM   2344 C  CB    . ARG A 1 314 ? 2.032   23.686  -47.379 1.00 23.25  ? 308 ARG A CB    1 
ATOM   2345 C  CG    . ARG A 1 314 ? 3.161   24.409  -46.687 1.00 29.94  ? 308 ARG A CG    1 
ATOM   2346 C  CD    . ARG A 1 314 ? 2.734   25.815  -46.310 1.00 31.47  ? 308 ARG A CD    1 
ATOM   2347 N  NE    . ARG A 1 314 ? 2.893   26.757  -47.411 1.00 43.73  ? 308 ARG A NE    1 
ATOM   2348 C  CZ    . ARG A 1 314 ? 4.053   27.326  -47.738 1.00 54.80  ? 308 ARG A CZ    1 
ATOM   2349 N  NH1   . ARG A 1 314 ? 5.161   27.035  -47.050 1.00 36.14  ? 308 ARG A NH1   1 
ATOM   2350 N  NH2   . ARG A 1 314 ? 4.107   28.183  -48.754 1.00 49.60  ? 308 ARG A NH2   1 
ATOM   2351 N  N     . TYR A 1 315 ? 0.445   21.105  -48.637 1.00 14.45  ? 309 TYR A N     1 
ATOM   2352 C  CA    . TYR A 1 315 ? -0.893  20.745  -49.076 1.00 13.42  ? 309 TYR A CA    1 
ATOM   2353 C  C     . TYR A 1 315 ? -1.255  19.301  -48.771 1.00 12.23  ? 309 TYR A C     1 
ATOM   2354 O  O     . TYR A 1 315 ? -2.416  18.910  -48.936 1.00 13.04  ? 309 TYR A O     1 
ATOM   2355 C  CB    . TYR A 1 315 ? -1.081  21.027  -50.566 1.00 17.95  ? 309 TYR A CB    1 
ATOM   2356 C  CG    . TYR A 1 315 ? -0.734  22.436  -50.996 1.00 20.60  ? 309 TYR A CG    1 
ATOM   2357 C  CD1   . TYR A 1 315 ? -0.980  23.526  -50.170 1.00 20.96  ? 309 TYR A CD1   1 
ATOM   2358 C  CD2   . TYR A 1 315 ? -0.147  22.668  -52.223 1.00 23.52  ? 309 TYR A CD2   1 
ATOM   2359 C  CE1   . TYR A 1 315 ? -0.650  24.808  -50.566 1.00 25.19  ? 309 TYR A CE1   1 
ATOM   2360 C  CE2   . TYR A 1 315 ? 0.180   23.935  -52.627 1.00 31.22  ? 309 TYR A CE2   1 
ATOM   2361 C  CZ    . TYR A 1 315 ? -0.073  25.008  -51.805 1.00 31.40  ? 309 TYR A CZ    1 
ATOM   2362 O  OH    . TYR A 1 315 ? 0.266   26.272  -52.240 1.00 22.99  ? 309 TYR A OH    1 
ATOM   2363 N  N     . HIS A 1 316 ? -0.278  18.508  -48.341 1.00 8.52   ? 310 HIS A N     1 
ATOM   2364 C  CA    . HIS A 1 316 ? -0.581  17.154  -47.911 1.00 11.22  ? 310 HIS A CA    1 
ATOM   2365 C  C     . HIS A 1 316 ? -1.541  17.204  -46.725 1.00 13.86  ? 310 HIS A C     1 
ATOM   2366 O  O     . HIS A 1 316 ? -1.310  17.920  -45.746 1.00 11.56  ? 310 HIS A O     1 
ATOM   2367 C  CB    . HIS A 1 316 ? 0.683   16.390  -47.544 1.00 13.41  ? 310 HIS A CB    1 
ATOM   2368 C  CG    . HIS A 1 316 ? 1.625   16.198  -48.686 1.00 15.59  ? 310 HIS A CG    1 
ATOM   2369 N  ND1   . HIS A 1 316 ? 2.939   15.819  -48.511 1.00 17.40  ? 310 HIS A ND1   1 
ATOM   2370 C  CD2   . HIS A 1 316 ? 1.444   16.326  -50.022 1.00 14.95  ? 310 HIS A CD2   1 
ATOM   2371 C  CE1   . HIS A 1 316 ? 3.526   15.727  -49.691 1.00 21.10  ? 310 HIS A CE1   1 
ATOM   2372 N  NE2   . HIS A 1 316 ? 2.639   16.029  -50.624 1.00 16.82  ? 310 HIS A NE2   1 
ATOM   2373 N  N     . LEU A 1 317 ? -2.615  16.428  -46.821 1.00 12.03  ? 311 LEU A N     1 
ATOM   2374 C  CA    . LEU A 1 317 ? -3.729  16.556  -45.901 1.00 8.85   ? 311 LEU A CA    1 
ATOM   2375 C  C     . LEU A 1 317 ? -3.616  15.746  -44.601 1.00 11.36  ? 311 LEU A C     1 
ATOM   2376 O  O     . LEU A 1 317 ? -4.267  16.068  -43.588 1.00 13.49  ? 311 LEU A O     1 
ATOM   2377 C  CB    . LEU A 1 317 ? -5.016  16.213  -46.640 1.00 7.99   ? 311 LEU A CB    1 
ATOM   2378 C  CG    . LEU A 1 317 ? -5.274  17.070  -47.887 1.00 12.09  ? 311 LEU A CG    1 
ATOM   2379 C  CD1   . LEU A 1 317 ? -6.431  16.514  -48.677 1.00 11.69  ? 311 LEU A CD1   1 
ATOM   2380 C  CD2   . LEU A 1 317 ? -5.565  18.508  -47.516 1.00 10.05  ? 311 LEU A CD2   1 
ATOM   2381 N  N     . MET A 1 318 ? -2.791  14.708  -44.624 1.00 8.47   ? 312 MET A N     1 
ATOM   2382 C  CA    . MET A 1 318 ? -2.746  13.758  -43.525 1.00 8.84   ? 312 MET A CA    1 
ATOM   2383 C  C     . MET A 1 318 ? -1.363  13.158  -43.364 1.00 10.35  ? 312 MET A C     1 
ATOM   2384 O  O     . MET A 1 318 ? -1.219  11.943  -43.342 1.00 8.78   ? 312 MET A O     1 
ATOM   2385 C  CB    . MET A 1 318 ? -3.735  12.643  -43.806 1.00 9.55   ? 312 MET A CB    1 
ATOM   2386 C  CG    . MET A 1 318 ? -4.352  11.987  -42.599 1.00 8.45   ? 312 MET A CG    1 
ATOM   2387 S  SD    . MET A 1 318 ? -5.678  10.910  -43.199 1.00 10.47  ? 312 MET A SD    1 
ATOM   2388 C  CE    . MET A 1 318 ? -5.904  9.798   -41.809 1.00 9.53   ? 312 MET A CE    1 
ATOM   2389 N  N     . PRO A 1 319 ? -0.340  14.016  -43.211 1.00 15.96  ? 313 PRO A N     1 
ATOM   2390 C  CA    . PRO A 1 319 ? 1.065   13.574  -43.169 1.00 15.80  ? 313 PRO A CA    1 
ATOM   2391 C  C     . PRO A 1 319 ? 1.359   12.457  -42.151 1.00 13.30  ? 313 PRO A C     1 
ATOM   2392 O  O     . PRO A 1 319 ? 1.206   12.634  -40.940 1.00 12.65  ? 313 PRO A O     1 
ATOM   2393 C  CB    . PRO A 1 319 ? 1.825   14.850  -42.766 1.00 14.15  ? 313 PRO A CB    1 
ATOM   2394 C  CG    . PRO A 1 319 ? 0.875   15.983  -43.053 1.00 12.75  ? 313 PRO A CG    1 
ATOM   2395 C  CD    . PRO A 1 319 ? -0.485  15.441  -42.845 1.00 12.21  ? 313 PRO A CD    1 
ATOM   2396 N  N     . ILE A 1 320 ? 1.788   11.310  -42.655 1.00 12.43  ? 314 ILE A N     1 
ATOM   2397 C  CA    . ILE A 1 320 ? 2.275   10.231  -41.803 1.00 12.38  ? 314 ILE A CA    1 
ATOM   2398 C  C     . ILE A 1 320 ? 3.690   9.906   -42.287 1.00 12.44  ? 314 ILE A C     1 
ATOM   2399 O  O     . ILE A 1 320 ? 3.878   9.237   -43.306 1.00 12.43  ? 314 ILE A O     1 
ATOM   2400 C  CB    . ILE A 1 320 ? 1.354   8.984   -41.868 1.00 9.51   ? 314 ILE A CB    1 
ATOM   2401 C  CG1   . ILE A 1 320 ? -0.109  9.391   -41.700 1.00 8.68   ? 314 ILE A CG1   1 
ATOM   2402 C  CG2   . ILE A 1 320 ? 1.733   7.999   -40.808 1.00 8.69   ? 314 ILE A CG2   1 
ATOM   2403 C  CD1   . ILE A 1 320 ? -1.070  8.248   -41.694 1.00 7.83   ? 314 ILE A CD1   1 
ATOM   2404 N  N     . ILE A 1 321 ? 4.678   10.389  -41.547 1.00 9.79   ? 315 ILE A N     1 
ATOM   2405 C  CA    . ILE A 1 321 ? 6.036   10.483  -42.057 1.00 10.30  ? 315 ILE A CA    1 
ATOM   2406 C  C     . ILE A 1 321 ? 6.953   9.332   -41.699 1.00 11.70  ? 315 ILE A C     1 
ATOM   2407 O  O     . ILE A 1 321 ? 7.208   9.048   -40.534 1.00 18.99  ? 315 ILE A O     1 
ATOM   2408 C  CB    . ILE A 1 321 ? 6.710   11.788  -41.601 1.00 13.51  ? 315 ILE A CB    1 
ATOM   2409 C  CG1   . ILE A 1 321 ? 5.865   12.987  -42.011 1.00 13.55  ? 315 ILE A CG1   1 
ATOM   2410 C  CG2   . ILE A 1 321 ? 8.093   11.901  -42.181 1.00 11.63  ? 315 ILE A CG2   1 
ATOM   2411 C  CD1   . ILE A 1 321 ? 5.511   12.986  -43.449 1.00 12.40  ? 315 ILE A CD1   1 
ATOM   2412 N  N     . THR A 1 322 ? 7.473   8.706   -42.741 1.00 14.56  ? 316 THR A N     1 
ATOM   2413 C  CA    . THR A 1 322 ? 8.444   7.640   -42.657 1.00 13.10  ? 316 THR A CA    1 
ATOM   2414 C  C     . THR A 1 322 ? 9.659   8.059   -41.844 1.00 14.65  ? 316 THR A C     1 
ATOM   2415 O  O     . THR A 1 322 ? 10.189  9.138   -42.043 1.00 19.21  ? 316 THR A O     1 
ATOM   2416 C  CB    . THR A 1 322 ? 8.826   7.264   -44.085 1.00 15.55  ? 316 THR A CB    1 
ATOM   2417 O  OG1   . THR A 1 322 ? 7.987   6.178   -44.504 1.00 12.64  ? 316 THR A OG1   1 
ATOM   2418 C  CG2   . THR A 1 322 ? 10.327  6.901   -44.223 1.00 20.03  ? 316 THR A CG2   1 
ATOM   2419 N  N     . PRO A 1 323 ? 10.094  7.212   -40.908 1.00 12.65  ? 317 PRO A N     1 
ATOM   2420 C  CA    . PRO A 1 323 ? 11.159  7.575   -39.958 1.00 15.34  ? 317 PRO A CA    1 
ATOM   2421 C  C     . PRO A 1 323 ? 12.611  7.345   -40.423 1.00 19.46  ? 317 PRO A C     1 
ATOM   2422 O  O     . PRO A 1 323 ? 13.531  7.923   -39.830 1.00 18.15  ? 317 PRO A O     1 
ATOM   2423 C  CB    . PRO A 1 323 ? 10.853  6.693   -38.745 1.00 14.25  ? 317 PRO A CB    1 
ATOM   2424 C  CG    . PRO A 1 323 ? 10.211  5.485   -39.330 1.00 16.12  ? 317 PRO A CG    1 
ATOM   2425 C  CD    . PRO A 1 323 ? 9.426   5.954   -40.544 1.00 14.40  ? 317 PRO A CD    1 
ATOM   2426 N  N     . ALA A 1 324 ? 12.822  6.506   -41.438 1.00 21.26  ? 318 ALA A N     1 
ATOM   2427 C  CA    . ALA A 1 324 ? 14.173  6.276   -41.967 1.00 20.06  ? 318 ALA A CA    1 
ATOM   2428 C  C     . ALA A 1 324 ? 14.549  7.401   -42.897 1.00 15.61  ? 318 ALA A C     1 
ATOM   2429 O  O     . ALA A 1 324 ? 13.715  7.840   -43.682 1.00 17.88  ? 318 ALA A O     1 
ATOM   2430 C  CB    . ALA A 1 324 ? 14.252  4.953   -42.711 1.00 13.11  ? 318 ALA A CB    1 
ATOM   2431 N  N     . TYR A 1 325 ? 15.794  7.864   -42.812 1.00 17.19  ? 319 TYR A N     1 
ATOM   2432 C  CA    . TYR A 1 325 ? 16.272  8.896   -43.725 1.00 21.40  ? 319 TYR A CA    1 
ATOM   2433 C  C     . TYR A 1 325 ? 16.378  8.326   -45.135 1.00 16.35  ? 319 TYR A C     1 
ATOM   2434 O  O     . TYR A 1 325 ? 16.875  7.219   -45.313 1.00 17.14  ? 319 TYR A O     1 
ATOM   2435 C  CB    . TYR A 1 325 ? 17.628  9.471   -43.286 1.00 23.05  ? 319 TYR A CB    1 
ATOM   2436 C  CG    . TYR A 1 325 ? 18.096  10.599  -44.197 1.00 32.73  ? 319 TYR A CG    1 
ATOM   2437 C  CD1   . TYR A 1 325 ? 17.731  11.919  -43.952 1.00 31.84  ? 319 TYR A CD1   1 
ATOM   2438 C  CD2   . TYR A 1 325 ? 18.873  10.340  -45.317 1.00 31.04  ? 319 TYR A CD2   1 
ATOM   2439 C  CE1   . TYR A 1 325 ? 18.135  12.945  -44.785 1.00 25.05  ? 319 TYR A CE1   1 
ATOM   2440 C  CE2   . TYR A 1 325 ? 19.281  11.362  -46.157 1.00 36.09  ? 319 TYR A CE2   1 
ATOM   2441 C  CZ    . TYR A 1 325 ? 18.908  12.661  -45.885 1.00 35.54  ? 319 TYR A CZ    1 
ATOM   2442 O  OH    . TYR A 1 325 ? 19.313  13.673  -46.727 1.00 37.96  ? 319 TYR A OH    1 
ATOM   2443 N  N     . PRO A 1 326 ? 15.900  9.073   -46.141 1.00 15.00  ? 320 PRO A N     1 
ATOM   2444 C  CA    . PRO A 1 326 ? 15.239  10.378  -46.062 1.00 21.05  ? 320 PRO A CA    1 
ATOM   2445 C  C     . PRO A 1 326 ? 13.716  10.298  -45.871 1.00 18.53  ? 320 PRO A C     1 
ATOM   2446 O  O     . PRO A 1 326 ? 13.000  9.721   -46.695 1.00 15.56  ? 320 PRO A O     1 
ATOM   2447 C  CB    . PRO A 1 326 ? 15.558  10.999  -47.424 1.00 22.26  ? 320 PRO A CB    1 
ATOM   2448 C  CG    . PRO A 1 326 ? 15.584  9.832   -48.351 1.00 22.75  ? 320 PRO A CG    1 
ATOM   2449 C  CD    . PRO A 1 326 ? 16.125  8.666   -47.540 1.00 23.86  ? 320 PRO A CD    1 
ATOM   2450 N  N     . GLN A 1 327 ? 13.239  10.914  -44.794 1.00 15.23  ? 321 GLN A N     1 
ATOM   2451 C  CA    . GLN A 1 327 ? 11.833  10.887  -44.411 1.00 15.56  ? 321 GLN A CA    1 
ATOM   2452 C  C     . GLN A 1 327 ? 10.871  11.470  -45.451 1.00 21.49  ? 321 GLN A C     1 
ATOM   2453 O  O     . GLN A 1 327 ? 11.004  12.626  -45.868 1.00 27.20  ? 321 GLN A O     1 
ATOM   2454 C  CB    . GLN A 1 327 ? 11.643  11.613  -43.074 1.00 18.66  ? 321 GLN A CB    1 
ATOM   2455 C  CG    . GLN A 1 327 ? 12.766  12.579  -42.697 1.00 28.42  ? 321 GLN A CG    1 
ATOM   2456 C  CD    . GLN A 1 327 ? 13.950  11.894  -42.015 1.00 23.58  ? 321 GLN A CD    1 
ATOM   2457 O  OE1   . GLN A 1 327 ? 13.781  10.952  -41.247 1.00 26.21  ? 321 GLN A OE1   1 
ATOM   2458 N  NE2   . GLN A 1 327 ? 15.147  12.372  -42.299 1.00 23.10  ? 321 GLN A NE2   1 
ATOM   2459 N  N     . GLN A 1 328 ? 9.883   10.669  -45.841 1.00 16.01  ? 322 GLN A N     1 
ATOM   2460 C  CA    . GLN A 1 328 ? 8.843   11.101  -46.768 1.00 13.75  ? 322 GLN A CA    1 
ATOM   2461 C  C     . GLN A 1 328 ? 7.448   10.874  -46.188 1.00 15.24  ? 322 GLN A C     1 
ATOM   2462 O  O     . GLN A 1 328 ? 7.269   10.078  -45.268 1.00 19.02  ? 322 GLN A O     1 
ATOM   2463 C  CB    . GLN A 1 328 ? 8.961   10.296  -48.047 1.00 19.08  ? 322 GLN A CB    1 
ATOM   2464 C  CG    . GLN A 1 328 ? 10.315  10.374  -48.663 1.00 17.35  ? 322 GLN A CG    1 
ATOM   2465 C  CD    . GLN A 1 328 ? 10.524  11.703  -49.299 1.00 21.43  ? 322 GLN A CD    1 
ATOM   2466 O  OE1   . GLN A 1 328 ? 9.569   12.446  -49.524 1.00 28.13  ? 322 GLN A OE1   1 
ATOM   2467 N  NE2   . GLN A 1 328 ? 11.771  12.030  -49.591 1.00 28.59  ? 322 GLN A NE2   1 
ATOM   2468 N  N     . ASN A 1 329 ? 6.457   11.565  -46.726 1.00 12.41  ? 323 ASN A N     1 
ATOM   2469 C  CA    . ASN A 1 329 ? 5.080   11.272  -46.381 1.00 9.22   ? 323 ASN A CA    1 
ATOM   2470 C  C     . ASN A 1 329 ? 4.615   10.039  -47.139 1.00 12.54  ? 323 ASN A C     1 
ATOM   2471 O  O     . ASN A 1 329 ? 4.984   9.826   -48.290 1.00 8.98   ? 323 ASN A O     1 
ATOM   2472 C  CB    . ASN A 1 329 ? 4.179   12.455  -46.713 1.00 10.44  ? 323 ASN A CB    1 
ATOM   2473 C  CG    . ASN A 1 329 ? 2.755   12.268  -46.217 1.00 14.59  ? 323 ASN A CG    1 
ATOM   2474 O  OD1   . ASN A 1 329 ? 2.499   11.479  -45.300 1.00 14.49  ? 323 ASN A OD1   1 
ATOM   2475 N  ND2   . ASN A 1 329 ? 1.819   13.008  -46.812 1.00 12.90  ? 323 ASN A ND2   1 
ATOM   2476 N  N     . SER A 1 330 ? 3.797   9.225   -46.486 1.00 14.59  ? 324 SER A N     1 
ATOM   2477 C  CA    . SER A 1 330 ? 3.319   8.002   -47.090 1.00 8.78   ? 324 SER A CA    1 
ATOM   2478 C  C     . SER A 1 330 ? 1.885   8.133   -47.549 1.00 9.83   ? 324 SER A C     1 
ATOM   2479 O  O     . SER A 1 330 ? 1.358   7.205   -48.116 1.00 11.73  ? 324 SER A O     1 
ATOM   2480 C  CB    . SER A 1 330 ? 3.390   6.883   -46.078 1.00 7.27   ? 324 SER A CB    1 
ATOM   2481 O  OG    . SER A 1 330 ? 2.657   7.255   -44.928 1.00 10.82  ? 324 SER A OG    1 
ATOM   2482 N  N     . THR A 1 331 ? 1.239   9.266   -47.304 1.00 10.12  ? 325 THR A N     1 
ATOM   2483 C  CA    . THR A 1 331 ? -0.178  9.380   -47.636 1.00 10.56  ? 325 THR A CA    1 
ATOM   2484 C  C     . THR A 1 331 ? -0.490  10.483  -48.633 1.00 11.83  ? 325 THR A C     1 
ATOM   2485 O  O     . THR A 1 331 ? -1.568  11.088  -48.586 1.00 8.88   ? 325 THR A O     1 
ATOM   2486 C  CB    . THR A 1 331 ? -0.994  9.665   -46.423 1.00 10.97  ? 325 THR A CB    1 
ATOM   2487 O  OG1   . THR A 1 331 ? -0.507  10.879  -45.843 1.00 14.20  ? 325 THR A OG1   1 
ATOM   2488 C  CG2   . THR A 1 331 ? -0.864  8.522   -45.437 1.00 12.28  ? 325 THR A CG2   1 
ATOM   2489 N  N     . TYR A 1 332 ? 0.446   10.719  -49.543 1.00 13.13  ? 326 TYR A N     1 
ATOM   2490 C  CA    . TYR A 1 332 ? 0.243   11.673  -50.612 1.00 12.80  ? 326 TYR A CA    1 
ATOM   2491 C  C     . TYR A 1 332 ? -1.080  11.440  -51.349 1.00 14.64  ? 326 TYR A C     1 
ATOM   2492 O  O     . TYR A 1 332 ? -1.707  12.393  -51.810 1.00 14.82  ? 326 TYR A O     1 
ATOM   2493 C  CB    . TYR A 1 332 ? 1.419   11.633  -51.585 1.00 13.38  ? 326 TYR A CB    1 
ATOM   2494 C  CG    . TYR A 1 332 ? 1.191   12.452  -52.837 1.00 24.36  ? 326 TYR A CG    1 
ATOM   2495 C  CD1   . TYR A 1 332 ? 0.493   11.923  -53.934 1.00 29.44  ? 326 TYR A CD1   1 
ATOM   2496 C  CD2   . TYR A 1 332 ? 1.675   13.753  -52.937 1.00 27.25  ? 326 TYR A CD2   1 
ATOM   2497 C  CE1   . TYR A 1 332 ? 0.275   12.680  -55.086 1.00 26.26  ? 326 TYR A CE1   1 
ATOM   2498 C  CE2   . TYR A 1 332 ? 1.467   14.510  -54.087 1.00 28.39  ? 326 TYR A CE2   1 
ATOM   2499 C  CZ    . TYR A 1 332 ? 0.771   13.966  -55.150 1.00 27.39  ? 326 TYR A CZ    1 
ATOM   2500 O  OH    . TYR A 1 332 ? 0.568   14.713  -56.275 1.00 34.59  ? 326 TYR A OH    1 
ATOM   2501 N  N     . ASN A 1 333 ? -1.509  10.186  -51.464 1.00 9.78   ? 327 ASN A N     1 
ATOM   2502 C  CA    . ASN A 1 333 ? -2.719  9.900   -52.228 1.00 10.25  ? 327 ASN A CA    1 
ATOM   2503 C  C     . ASN A 1 333 ? -4.013  10.392  -51.584 1.00 10.21  ? 327 ASN A C     1 
ATOM   2504 O  O     . ASN A 1 333 ? -5.060  10.383  -52.224 1.00 10.11  ? 327 ASN A O     1 
ATOM   2505 C  CB    . ASN A 1 333 ? -2.842  8.406   -52.525 1.00 9.47   ? 327 ASN A CB    1 
ATOM   2506 C  CG    . ASN A 1 333 ? -2.050  7.979   -53.741 1.00 14.16  ? 327 ASN A CG    1 
ATOM   2507 O  OD1   . ASN A 1 333 ? -1.535  8.810   -54.502 1.00 20.01  ? 327 ASN A OD1   1 
ATOM   2508 N  ND2   . ASN A 1 333 ? -1.954  6.676   -53.941 1.00 10.89  ? 327 ASN A ND2   1 
ATOM   2509 N  N     . VAL A 1 334 ? -3.947  10.811  -50.323 1.00 8.38   ? 328 VAL A N     1 
ATOM   2510 C  CA    . VAL A 1 334 ? -5.155  11.144  -49.581 1.00 8.96   ? 328 VAL A CA    1 
ATOM   2511 C  C     . VAL A 1 334 ? -5.776  12.453  -50.051 1.00 12.25  ? 328 VAL A C     1 
ATOM   2512 O  O     . VAL A 1 334 ? -5.201  13.521  -49.850 1.00 12.92  ? 328 VAL A O     1 
ATOM   2513 C  CB    . VAL A 1 334 ? -4.886  11.280  -48.068 1.00 11.56  ? 328 VAL A CB    1 
ATOM   2514 C  CG1   . VAL A 1 334 ? -6.134  11.751  -47.360 1.00 8.67   ? 328 VAL A CG1   1 
ATOM   2515 C  CG2   . VAL A 1 334 ? -4.412  9.967   -47.473 1.00 11.75  ? 328 VAL A CG2   1 
ATOM   2516 N  N     . SER A 1 335 ? -6.947  12.365  -50.679 1.00 11.50  ? 329 SER A N     1 
ATOM   2517 C  CA    . SER A 1 335 ? -7.749  13.544  -51.001 1.00 10.01  ? 329 SER A CA    1 
ATOM   2518 C  C     . SER A 1 335 ? -8.512  14.014  -49.761 1.00 13.44  ? 329 SER A C     1 
ATOM   2519 O  O     . SER A 1 335 ? -8.399  13.415  -48.690 1.00 13.26  ? 329 SER A O     1 
ATOM   2520 C  CB    . SER A 1 335 ? -8.730  13.241  -52.135 1.00 6.62   ? 329 SER A CB    1 
ATOM   2521 O  OG    . SER A 1 335 ? -9.811  12.454  -51.703 1.00 4.95   ? 329 SER A OG    1 
ATOM   2522 N  N     . THR A 1 336 ? -9.295  15.076  -49.901 1.00 12.57  ? 330 THR A N     1 
ATOM   2523 C  CA    . THR A 1 336 ? -10.016 15.604  -48.754 1.00 11.68  ? 330 THR A CA    1 
ATOM   2524 C  C     . THR A 1 336 ? -11.171 14.683  -48.366 1.00 12.70  ? 330 THR A C     1 
ATOM   2525 O  O     . THR A 1 336 ? -11.422 14.456  -47.181 1.00 11.35  ? 330 THR A O     1 
ATOM   2526 C  CB    . THR A 1 336 ? -10.499 17.068  -48.983 1.00 14.69  ? 330 THR A CB    1 
ATOM   2527 O  OG1   . THR A 1 336 ? -11.838 17.087  -49.490 1.00 18.35  ? 330 THR A OG1   1 
ATOM   2528 C  CG2   . THR A 1 336 ? -9.588  17.774  -49.979 1.00 28.05  ? 330 THR A CG2   1 
ATOM   2529 N  N     . SER A 1 337 ? -11.872 14.151  -49.360 1.00 11.14  ? 331 SER A N     1 
ATOM   2530 C  CA    . SER A 1 337 ? -12.995 13.266  -49.071 1.00 13.20  ? 331 SER A CA    1 
ATOM   2531 C  C     . SER A 1 337 ? -12.530 12.056  -48.251 1.00 15.98  ? 331 SER A C     1 
ATOM   2532 O  O     . SER A 1 337 ? -13.139 11.718  -47.233 1.00 15.09  ? 331 SER A O     1 
ATOM   2533 C  CB    . SER A 1 337 ? -13.693 12.789  -50.359 1.00 14.40  ? 331 SER A CB    1 
ATOM   2534 O  OG    . SER A 1 337 ? -14.647 13.717  -50.837 1.00 14.43  ? 331 SER A OG    1 
ATOM   2535 N  N     . THR A 1 338 ? -11.457 11.398  -48.692 1.00 11.69  ? 332 THR A N     1 
ATOM   2536 C  CA    . THR A 1 338 ? -10.984 10.240  -47.965 1.00 11.25  ? 332 THR A CA    1 
ATOM   2537 C  C     . THR A 1 338 ? -10.514 10.636  -46.559 1.00 13.23  ? 332 THR A C     1 
ATOM   2538 O  O     . THR A 1 338 ? -10.680 9.870   -45.613 1.00 14.03  ? 332 THR A O     1 
ATOM   2539 C  CB    . THR A 1 338 ? -9.902  9.424   -48.738 1.00 9.57   ? 332 THR A CB    1 
ATOM   2540 O  OG1   . THR A 1 338 ? -8.717  10.208  -48.927 1.00 8.27   ? 332 THR A OG1   1 
ATOM   2541 C  CG2   . THR A 1 338 ? -10.433 8.983   -50.064 1.00 6.72   ? 332 THR A CG2   1 
ATOM   2542 N  N     . ARG A 1 339 ? -9.950  11.830  -46.406 1.00 11.43  ? 333 ARG A N     1 
ATOM   2543 C  CA    . ARG A 1 339 ? -9.529  12.251  -45.081 1.00 8.77   ? 333 ARG A CA    1 
ATOM   2544 C  C     . ARG A 1 339 ? -10.760 12.408  -44.222 1.00 10.44  ? 333 ARG A C     1 
ATOM   2545 O  O     . ARG A 1 339 ? -10.792 11.952  -43.092 1.00 12.97  ? 333 ARG A O     1 
ATOM   2546 C  CB    . ARG A 1 339 ? -8.764  13.558  -45.138 1.00 10.23  ? 333 ARG A CB    1 
ATOM   2547 C  CG    . ARG A 1 339 ? -8.021  13.888  -43.865 1.00 7.77   ? 333 ARG A CG    1 
ATOM   2548 C  CD    . ARG A 1 339 ? -8.432  15.259  -43.416 1.00 11.84  ? 333 ARG A CD    1 
ATOM   2549 N  NE    . ARG A 1 339 ? -7.426  16.307  -43.610 1.00 12.45  ? 333 ARG A NE    1 
ATOM   2550 C  CZ    . ARG A 1 339 ? -7.693  17.504  -44.135 1.00 12.57  ? 333 ARG A CZ    1 
ATOM   2551 N  NH1   . ARG A 1 339 ? -8.922  17.789  -44.553 1.00 9.08   ? 333 ARG A NH1   1 
ATOM   2552 N  NH2   . ARG A 1 339 ? -6.731  18.414  -44.259 1.00 12.39  ? 333 ARG A NH2   1 
ATOM   2553 N  N     . THR A 1 340 ? -11.791 13.027  -44.782 1.00 11.61  ? 334 THR A N     1 
ATOM   2554 C  CA    . THR A 1 340 ? -13.052 13.229  -44.079 1.00 11.97  ? 334 THR A CA    1 
ATOM   2555 C  C     . THR A 1 340 ? -13.746 11.902  -43.729 1.00 14.87  ? 334 THR A C     1 
ATOM   2556 O  O     . THR A 1 340 ? -14.216 11.741  -42.610 1.00 22.11  ? 334 THR A O     1 
ATOM   2557 C  CB    . THR A 1 340 ? -14.012 14.151  -44.883 1.00 14.76  ? 334 THR A CB    1 
ATOM   2558 O  OG1   . THR A 1 340 ? -13.552 15.507  -44.822 1.00 17.34  ? 334 THR A OG1   1 
ATOM   2559 C  CG2   . THR A 1 340 ? -15.419 14.086  -44.331 1.00 11.07  ? 334 THR A CG2   1 
ATOM   2560 N  N     . VAL A 1 341 ? -13.805 10.956  -44.667 1.00 13.52  ? 335 VAL A N     1 
ATOM   2561 C  CA    . VAL A 1 341 ? -14.403 9.642   -44.403 1.00 13.44  ? 335 VAL A CA    1 
ATOM   2562 C  C     . VAL A 1 341 ? -13.657 8.913   -43.276 1.00 12.82  ? 335 VAL A C     1 
ATOM   2563 O  O     . VAL A 1 341 ? -14.271 8.313   -42.394 1.00 12.43  ? 335 VAL A O     1 
ATOM   2564 C  CB    . VAL A 1 341 ? -14.453 8.751   -45.693 1.00 12.56  ? 335 VAL A CB    1 
ATOM   2565 C  CG1   . VAL A 1 341 ? -14.319 7.265   -45.366 1.00 5.89   ? 335 VAL A CG1   1 
ATOM   2566 C  CG2   . VAL A 1 341 ? -15.728 9.006   -46.482 1.00 12.31  ? 335 VAL A CG2   1 
ATOM   2567 N  N     . MET A 1 342 ? -12.333 8.984   -43.298 1.00 9.30   ? 336 MET A N     1 
ATOM   2568 C  CA    . MET A 1 342 ? -11.537 8.269   -42.323 1.00 9.29   ? 336 MET A CA    1 
ATOM   2569 C  C     . MET A 1 342 ? -11.670 8.875   -40.944 1.00 12.30  ? 336 MET A C     1 
ATOM   2570 O  O     . MET A 1 342 ? -11.663 8.167   -39.943 1.00 14.98  ? 336 MET A O     1 
ATOM   2571 C  CB    . MET A 1 342 ? -10.070 8.275   -42.724 1.00 10.09  ? 336 MET A CB    1 
ATOM   2572 C  CG    . MET A 1 342 ? -9.679  7.197   -43.711 1.00 7.22   ? 336 MET A CG    1 
ATOM   2573 S  SD    . MET A 1 342 ? -8.021  7.521   -44.340 1.00 10.32  ? 336 MET A SD    1 
ATOM   2574 C  CE    . MET A 1 342 ? -7.586  5.879   -44.801 1.00 11.95  ? 336 MET A CE    1 
ATOM   2575 N  N     . VAL A 1 343 ? -11.758 10.192  -40.881 1.00 12.09  ? 337 VAL A N     1 
ATOM   2576 C  CA    . VAL A 1 343 ? -11.890 10.839  -39.593 1.00 12.96  ? 337 VAL A CA    1 
ATOM   2577 C  C     . VAL A 1 343 ? -13.191 10.379  -38.914 1.00 15.94  ? 337 VAL A C     1 
ATOM   2578 O  O     . VAL A 1 343 ? -13.222 10.101  -37.711 1.00 14.91  ? 337 VAL A O     1 
ATOM   2579 C  CB    . VAL A 1 343 ? -11.812 12.365  -39.727 1.00 12.09  ? 337 VAL A CB    1 
ATOM   2580 C  CG1   . VAL A 1 343 ? -12.460 13.045  -38.529 1.00 13.93  ? 337 VAL A CG1   1 
ATOM   2581 C  CG2   . VAL A 1 343 ? -10.366 12.796  -39.886 1.00 9.48   ? 337 VAL A CG2   1 
ATOM   2582 N  N     . GLU A 1 344 ? -14.253 10.256  -39.700 1.00 14.24  ? 338 GLU A N     1 
ATOM   2583 C  CA    . GLU A 1 344 ? -15.503 9.742   -39.171 1.00 15.10  ? 338 GLU A CA    1 
ATOM   2584 C  C     . GLU A 1 344 ? -15.348 8.302   -38.649 1.00 13.37  ? 338 GLU A C     1 
ATOM   2585 O  O     . GLU A 1 344 ? -15.944 7.947   -37.632 1.00 14.09  ? 338 GLU A O     1 
ATOM   2586 C  CB    . GLU A 1 344 ? -16.628 9.859   -40.214 1.00 14.83  ? 338 GLU A CB    1 
ATOM   2587 C  CG    . GLU A 1 344 ? -17.505 11.100  -40.025 1.00 28.15  ? 338 GLU A CG    1 
ATOM   2588 C  CD    . GLU A 1 344 ? -17.725 11.924  -41.303 1.00 42.46  ? 338 GLU A CD    1 
ATOM   2589 O  OE1   . GLU A 1 344 ? -17.953 11.325  -42.395 1.00 36.29  ? 338 GLU A OE1   1 
ATOM   2590 O  OE2   . GLU A 1 344 ? -17.675 13.182  -41.194 1.00 28.77  ? 338 GLU A OE2   1 
ATOM   2591 N  N     . GLU A 1 345 ? -14.537 7.491   -39.333 1.00 12.19  ? 339 GLU A N     1 
ATOM   2592 C  CA    . GLU A 1 345 ? -14.339 6.087   -38.957 1.00 10.44  ? 339 GLU A CA    1 
ATOM   2593 C  C     . GLU A 1 345 ? -13.560 6.009   -37.673 1.00 10.15  ? 339 GLU A C     1 
ATOM   2594 O  O     . GLU A 1 345 ? -13.787 5.142   -36.837 1.00 9.71   ? 339 GLU A O     1 
ATOM   2595 C  CB    . GLU A 1 345 ? -13.590 5.301   -40.039 1.00 7.31   ? 339 GLU A CB    1 
ATOM   2596 C  CG    . GLU A 1 345 ? -14.397 5.007   -41.274 1.00 6.86   ? 339 GLU A CG    1 
ATOM   2597 C  CD    . GLU A 1 345 ? -15.699 4.320   -40.960 1.00 9.20   ? 339 GLU A CD    1 
ATOM   2598 O  OE1   . GLU A 1 345 ? -15.753 3.535   -39.997 1.00 7.80   ? 339 GLU A OE1   1 
ATOM   2599 O  OE2   . GLU A 1 345 ? -16.684 4.566   -41.680 1.00 16.22  ? 339 GLU A OE2   1 
ATOM   2600 N  N     . PHE A 1 346 ? -12.618 6.919   -37.540 1.00 9.02   ? 340 PHE A N     1 
ATOM   2601 C  CA    . PHE A 1 346 ? -11.833 7.007   -36.348 1.00 9.31   ? 340 PHE A CA    1 
ATOM   2602 C  C     . PHE A 1 346 ? -12.768 7.240   -35.184 1.00 14.74  ? 340 PHE A C     1 
ATOM   2603 O  O     . PHE A 1 346 ? -12.680 6.586   -34.144 1.00 17.53  ? 340 PHE A O     1 
ATOM   2604 C  CB    . PHE A 1 346 ? -10.887 8.179   -36.477 1.00 10.78  ? 340 PHE A CB    1 
ATOM   2605 C  CG    . PHE A 1 346 ? -9.632  7.843   -37.175 1.00 10.00  ? 340 PHE A CG    1 
ATOM   2606 C  CD1   . PHE A 1 346 ? -9.014  6.635   -36.942 1.00 11.20  ? 340 PHE A CD1   1 
ATOM   2607 C  CD2   . PHE A 1 346 ? -9.068  8.721   -38.067 1.00 8.87   ? 340 PHE A CD2   1 
ATOM   2608 C  CE1   . PHE A 1 346 ? -7.848  6.311   -37.575 1.00 11.62  ? 340 PHE A CE1   1 
ATOM   2609 C  CE2   . PHE A 1 346 ? -7.906  8.408   -38.698 1.00 9.73   ? 340 PHE A CE2   1 
ATOM   2610 C  CZ    . PHE A 1 346 ? -7.294  7.194   -38.458 1.00 11.64  ? 340 PHE A CZ    1 
ATOM   2611 N  N     . LYS A 1 347 ? -13.675 8.183   -35.359 1.00 14.65  ? 341 LYS A N     1 
ATOM   2612 C  CA    . LYS A 1 347 ? -14.584 8.517   -34.286 1.00 14.40  ? 341 LYS A CA    1 
ATOM   2613 C  C     . LYS A 1 347 ? -15.565 7.362   -33.995 1.00 13.98  ? 341 LYS A C     1 
ATOM   2614 O  O     . LYS A 1 347 ? -15.860 7.065   -32.835 1.00 12.65  ? 341 LYS A O     1 
ATOM   2615 C  CB    . LYS A 1 347 ? -15.278 9.845   -34.588 1.00 11.04  ? 341 LYS A CB    1 
ATOM   2616 C  CG    . LYS A 1 347 ? -14.307 11.043  -34.599 1.00 12.54  ? 341 LYS A CG    1 
ATOM   2617 C  CD    . LYS A 1 347 ? -14.987 12.315  -35.116 1.00 12.95  ? 341 LYS A CD    1 
ATOM   2618 C  CE    . LYS A 1 347 ? -14.035 13.490  -35.276 1.00 15.68  ? 341 LYS A CE    1 
ATOM   2619 N  NZ    . LYS A 1 347 ? -14.702 14.634  -35.995 1.00 13.66  ? 341 LYS A NZ    1 
ATOM   2620 N  N     . GLN A 1 348 ? -16.043 6.693   -35.040 1.00 14.21  ? 342 GLN A N     1 
ATOM   2621 C  CA    . GLN A 1 348 ? -16.873 5.504   -34.850 1.00 15.25  ? 342 GLN A CA    1 
ATOM   2622 C  C     . GLN A 1 348 ? -16.134 4.429   -34.036 1.00 16.21  ? 342 GLN A C     1 
ATOM   2623 O  O     . GLN A 1 348 ? -16.736 3.735   -33.227 1.00 16.39  ? 342 GLN A O     1 
ATOM   2624 C  CB    . GLN A 1 348 ? -17.325 4.929   -36.192 1.00 10.09  ? 342 GLN A CB    1 
ATOM   2625 C  CG    . GLN A 1 348 ? -18.807 5.036   -36.424 1.00 14.07  ? 342 GLN A CG    1 
ATOM   2626 C  CD    . GLN A 1 348 ? -19.607 4.309   -35.357 1.00 24.10  ? 342 GLN A CD    1 
ATOM   2627 O  OE1   . GLN A 1 348 ? -20.511 4.875   -34.746 1.00 36.54  ? 342 GLN A OE1   1 
ATOM   2628 N  NE2   . GLN A 1 348 ? -19.277 3.048   -35.128 1.00 18.18  ? 342 GLN A NE2   1 
ATOM   2629 N  N     . GLY A 1 349 ? -14.828 4.296   -34.249 1.00 13.98  ? 343 GLY A N     1 
ATOM   2630 C  CA    . GLY A 1 349 ? -14.051 3.310   -33.530 1.00 10.91  ? 343 GLY A CA    1 
ATOM   2631 C  C     . GLY A 1 349 ? -14.014 3.698   -32.075 1.00 10.64  ? 343 GLY A C     1 
ATOM   2632 O  O     . GLY A 1 349 ? -14.175 2.883   -31.173 1.00 11.93  ? 343 GLY A O     1 
ATOM   2633 N  N     . LEU A 1 350 ? -13.820 4.980   -31.844 1.00 12.61  ? 344 LEU A N     1 
ATOM   2634 C  CA    . LEU A 1 350 ? -13.783 5.480   -30.488 1.00 12.62  ? 344 LEU A CA    1 
ATOM   2635 C  C     . LEU A 1 350 ? -15.104 5.178   -29.760 1.00 11.30  ? 344 LEU A C     1 
ATOM   2636 O  O     . LEU A 1 350 ? -15.091 4.757   -28.616 1.00 9.83   ? 344 LEU A O     1 
ATOM   2637 C  CB    . LEU A 1 350 ? -13.476 6.975   -30.497 1.00 10.02  ? 344 LEU A CB    1 
ATOM   2638 C  CG    . LEU A 1 350 ? -13.467 7.568   -29.101 1.00 11.13  ? 344 LEU A CG    1 
ATOM   2639 C  CD1   . LEU A 1 350 ? -12.393 6.876   -28.271 1.00 11.30  ? 344 LEU A CD1   1 
ATOM   2640 C  CD2   . LEU A 1 350 ? -13.241 9.043   -29.178 1.00 8.17   ? 344 LEU A CD2   1 
ATOM   2641 N  N     . ALA A 1 351 ? -16.233 5.367   -30.442 1.00 9.39   ? 345 ALA A N     1 
ATOM   2642 C  CA    . ALA A 1 351 ? -17.537 5.129   -29.842 1.00 8.87   ? 345 ALA A CA    1 
ATOM   2643 C  C     . ALA A 1 351 ? -17.755 3.649   -29.506 1.00 14.67  ? 345 ALA A C     1 
ATOM   2644 O  O     . ALA A 1 351 ? -18.155 3.293   -28.387 1.00 14.35  ? 345 ALA A O     1 
ATOM   2645 C  CB    . ALA A 1 351 ? -18.635 5.628   -30.743 1.00 6.25   ? 345 ALA A CB    1 
ATOM   2646 N  N     . VAL A 1 352 ? -17.495 2.782   -30.471 1.00 11.58  ? 346 VAL A N     1 
ATOM   2647 C  CA    . VAL A 1 352 ? -17.692 1.372   -30.233 1.00 10.61  ? 346 VAL A CA    1 
ATOM   2648 C  C     . VAL A 1 352 ? -16.721 0.867   -29.171 1.00 11.90  ? 346 VAL A C     1 
ATOM   2649 O  O     . VAL A 1 352 ? -17.116 0.118   -28.284 1.00 14.12  ? 346 VAL A O     1 
ATOM   2650 C  CB    . VAL A 1 352 ? -17.583 0.574   -31.521 1.00 9.96   ? 346 VAL A CB    1 
ATOM   2651 C  CG1   . VAL A 1 352 ? -18.085 -0.833  -31.314 1.00 10.57  ? 346 VAL A CG1   1 
ATOM   2652 C  CG2   . VAL A 1 352 ? -18.421 1.232   -32.560 1.00 13.46  ? 346 VAL A CG2   1 
ATOM   2653 N  N     . THR A 1 353 ? -15.466 1.295   -29.217 1.00 10.12  ? 347 THR A N     1 
ATOM   2654 C  CA    . THR A 1 353 ? -14.527 0.812   -28.207 1.00 11.24  ? 347 THR A CA    1 
ATOM   2655 C  C     . THR A 1 353 ? -14.779 1.366   -26.805 1.00 13.70  ? 347 THR A C     1 
ATOM   2656 O  O     . THR A 1 353 ? -14.299 0.788   -25.832 1.00 15.37  ? 347 THR A O     1 
ATOM   2657 C  CB    . THR A 1 353 ? -13.069 1.070   -28.570 1.00 10.19  ? 347 THR A CB    1 
ATOM   2658 O  OG1   . THR A 1 353 ? -12.898 2.461   -28.859 1.00 12.69  ? 347 THR A OG1   1 
ATOM   2659 C  CG2   . THR A 1 353 ? -12.648 0.199   -29.760 1.00 6.78   ? 347 THR A CG2   1 
ATOM   2660 N  N     . ASP A 1 354 ? -15.502 2.483   -26.699 1.00 11.63  ? 348 ASP A N     1 
ATOM   2661 C  CA    . ASP A 1 354 ? -15.929 2.983   -25.398 1.00 9.69   ? 348 ASP A CA    1 
ATOM   2662 C  C     . ASP A 1 354 ? -16.858 1.933   -24.810 1.00 15.26  ? 348 ASP A C     1 
ATOM   2663 O  O     . ASP A 1 354 ? -16.810 1.630   -23.608 1.00 12.23  ? 348 ASP A O     1 
ATOM   2664 C  CB    . ASP A 1 354 ? -16.698 4.301   -25.524 1.00 11.05  ? 348 ASP A CB    1 
ATOM   2665 C  CG    . ASP A 1 354 ? -15.791 5.534   -25.529 1.00 14.84  ? 348 ASP A CG    1 
ATOM   2666 O  OD1   . ASP A 1 354 ? -14.668 5.468   -24.966 1.00 14.08  ? 348 ASP A OD1   1 
ATOM   2667 O  OD2   . ASP A 1 354 ? -16.219 6.580   -26.089 1.00 14.40  ? 348 ASP A OD2   1 
ATOM   2668 N  N     . GLU A 1 355 ? -17.708 1.375   -25.674 1.00 15.55  ? 349 GLU A N     1 
ATOM   2669 C  CA    . GLU A 1 355 ? -18.687 0.385   -25.248 1.00 11.38  ? 349 GLU A CA    1 
ATOM   2670 C  C     . GLU A 1 355 ? -17.962 -0.904  -24.953 1.00 12.23  ? 349 GLU A C     1 
ATOM   2671 O  O     . GLU A 1 355 ? -18.207 -1.531  -23.941 1.00 18.02  ? 349 GLU A O     1 
ATOM   2672 C  CB    . GLU A 1 355 ? -19.776 0.174   -26.304 1.00 10.40  ? 349 GLU A CB    1 
ATOM   2673 C  CG    . GLU A 1 355 ? -20.712 1.370   -26.510 1.00 12.15  ? 349 GLU A CG    1 
ATOM   2674 C  CD    . GLU A 1 355 ? -21.524 1.284   -27.805 1.00 17.59  ? 349 GLU A CD    1 
ATOM   2675 O  OE1   . GLU A 1 355 ? -22.184 2.284   -28.177 1.00 21.94  ? 349 GLU A OE1   1 
ATOM   2676 O  OE2   . GLU A 1 355 ? -21.495 0.219   -28.458 1.00 14.99  ? 349 GLU A OE2   1 
ATOM   2677 N  N     . ILE A 1 356 ? -17.041 -1.288  -25.819 1.00 11.93  ? 350 ILE A N     1 
ATOM   2678 C  CA    . ILE A 1 356 ? -16.418 -2.592  -25.683 1.00 13.04  ? 350 ILE A CA    1 
ATOM   2679 C  C     . ILE A 1 356 ? -15.649 -2.708  -24.375 1.00 12.67  ? 350 ILE A C     1 
ATOM   2680 O  O     . ILE A 1 356 ? -15.838 -3.677  -23.646 1.00 13.67  ? 350 ILE A O     1 
ATOM   2681 C  CB    . ILE A 1 356 ? -15.558 -2.950  -26.916 1.00 12.34  ? 350 ILE A CB    1 
ATOM   2682 C  CG1   . ILE A 1 356 ? -16.449 -3.006  -28.148 1.00 10.83  ? 350 ILE A CG1   1 
ATOM   2683 C  CG2   . ILE A 1 356 ? -14.893 -4.301  -26.760 1.00 8.50   ? 350 ILE A CG2   1 
ATOM   2684 C  CD1   . ILE A 1 356 ? -15.693 -3.007  -29.427 1.00 10.78  ? 350 ILE A CD1   1 
ATOM   2685 N  N     . LEU A 1 357 ? -14.831 -1.711  -24.042 1.00 11.95  ? 351 LEU A N     1 
ATOM   2686 C  CA    . LEU A 1 357 ? -14.033 -1.779  -22.810 1.00 10.56  ? 351 LEU A CA    1 
ATOM   2687 C  C     . LEU A 1 357 ? -14.870 -1.617  -21.539 1.00 11.96  ? 351 LEU A C     1 
ATOM   2688 O  O     . LEU A 1 357 ? -14.331 -1.492  -20.450 1.00 13.69  ? 351 LEU A O     1 
ATOM   2689 C  CB    . LEU A 1 357 ? -12.900 -0.749  -22.810 1.00 9.03   ? 351 LEU A CB    1 
ATOM   2690 C  CG    . LEU A 1 357 ? -11.817 -0.809  -23.888 1.00 10.68  ? 351 LEU A CG    1 
ATOM   2691 C  CD1   . LEU A 1 357 ? -10.674 0.153   -23.561 1.00 7.06   ? 351 LEU A CD1   1 
ATOM   2692 C  CD2   . LEU A 1 357 ? -11.302 -2.230  -24.069 1.00 11.07  ? 351 LEU A CD2   1 
ATOM   2693 N  N     . GLN A 1 358 ? -16.187 -1.612  -21.678 1.00 14.05  ? 352 GLN A N     1 
ATOM   2694 C  CA    . GLN A 1 358 ? -17.072 -1.540  -20.525 1.00 12.65  ? 352 GLN A CA    1 
ATOM   2695 C  C     . GLN A 1 358 ? -17.933 -2.793  -20.432 1.00 17.81  ? 352 GLN A C     1 
ATOM   2696 O  O     . GLN A 1 358 ? -18.698 -2.967  -19.478 1.00 28.41  ? 352 GLN A O     1 
ATOM   2697 C  CB    . GLN A 1 358 ? -17.954 -0.292  -20.597 1.00 12.82  ? 352 GLN A CB    1 
ATOM   2698 C  CG    . GLN A 1 358 ? -17.294 0.952   -20.034 1.00 12.91  ? 352 GLN A CG    1 
ATOM   2699 C  CD    . GLN A 1 358 ? -18.091 2.211   -20.304 1.00 12.78  ? 352 GLN A CD    1 
ATOM   2700 O  OE1   . GLN A 1 358 ? -19.320 2.190   -20.298 1.00 12.71  ? 352 GLN A OE1   1 
ATOM   2701 N  NE2   . GLN A 1 358 ? -17.391 3.320   -20.547 1.00 10.29  ? 352 GLN A NE2   1 
ATOM   2702 N  N     . GLY A 1 359 ? -17.808 -3.662  -21.426 1.00 12.16  ? 353 GLY A N     1 
ATOM   2703 C  CA    . GLY A 1 359 ? -18.534 -4.906  -21.422 1.00 11.17  ? 353 GLY A CA    1 
ATOM   2704 C  C     . GLY A 1 359 ? -19.903 -4.769  -22.043 1.00 17.58  ? 353 GLY A C     1 
ATOM   2705 O  O     . GLY A 1 359 ? -20.692 -5.718  -22.038 1.00 22.09  ? 353 GLY A O     1 
ATOM   2706 N  N     . LYS A 1 360 ? -20.189 -3.595  -22.596 1.00 18.77  ? 354 LYS A N     1 
ATOM   2707 C  CA    . LYS A 1 360 ? -21.517 -3.323  -23.152 1.00 19.01  ? 354 LYS A CA    1 
ATOM   2708 C  C     . LYS A 1 360 ? -21.661 -3.689  -24.626 1.00 18.64  ? 354 LYS A C     1 
ATOM   2709 O  O     . LYS A 1 360 ? -22.777 -3.769  -25.141 1.00 21.08  ? 354 LYS A O     1 
ATOM   2710 C  CB    . LYS A 1 360 ? -21.904 -1.870  -22.909 1.00 18.55  ? 354 LYS A CB    1 
ATOM   2711 C  CG    . LYS A 1 360 ? -21.909 -1.514  -21.430 1.00 24.02  ? 354 LYS A CG    1 
ATOM   2712 C  CD    . LYS A 1 360 ? -22.930 -2.357  -20.663 1.00 29.58  ? 354 LYS A CD    1 
ATOM   2713 C  CE    . LYS A 1 360 ? -22.643 -2.363  -19.168 1.00 29.04  ? 354 LYS A CE    1 
ATOM   2714 N  NZ    . LYS A 1 360 ? -22.383 -0.981  -18.668 1.00 42.84  ? 354 LYS A NZ    1 
ATOM   2715 N  N     . SER A 1 361 ? -20.533 -3.927  -25.293 1.00 18.88  ? 355 SER A N     1 
ATOM   2716 C  CA    . SER A 1 361 ? -20.527 -4.348  -26.698 1.00 16.42  ? 355 SER A CA    1 
ATOM   2717 C  C     . SER A 1 361 ? -19.375 -5.299  -27.000 1.00 14.76  ? 355 SER A C     1 
ATOM   2718 O  O     . SER A 1 361 ? -18.351 -5.301  -26.311 1.00 14.06  ? 355 SER A O     1 
ATOM   2719 C  CB    . SER A 1 361 ? -20.426 -3.140  -27.626 1.00 14.24  ? 355 SER A CB    1 
ATOM   2720 O  OG    . SER A 1 361 ? -21.661 -2.475  -27.742 1.00 16.40  ? 355 SER A OG    1 
ATOM   2721 N  N     . ASP A 1 362 ? -19.545 -6.086  -28.054 1.00 12.41  ? 356 ASP A N     1 
ATOM   2722 C  CA    . ASP A 1 362 ? -18.555 -7.079  -28.445 1.00 12.63  ? 356 ASP A CA    1 
ATOM   2723 C  C     . ASP A 1 362 ? -17.659 -6.545  -29.543 1.00 14.80  ? 356 ASP A C     1 
ATOM   2724 O  O     . ASP A 1 362 ? -18.017 -5.598  -30.250 1.00 17.32  ? 356 ASP A O     1 
ATOM   2725 C  CB    . ASP A 1 362 ? -19.243 -8.359  -28.935 1.00 19.77  ? 356 ASP A CB    1 
ATOM   2726 C  CG    . ASP A 1 362 ? -19.536 -9.329  -27.814 1.00 23.99  ? 356 ASP A CG    1 
ATOM   2727 O  OD1   . ASP A 1 362 ? -18.625 -9.555  -26.985 1.00 26.02  ? 356 ASP A OD1   1 
ATOM   2728 O  OD2   . ASP A 1 362 ? -20.673 -9.848  -27.764 1.00 20.39  ? 356 ASP A OD2   1 
ATOM   2729 N  N     . TRP A 1 363 ? -16.499 -7.172  -29.704 1.00 13.01  ? 357 TRP A N     1 
ATOM   2730 C  CA    . TRP A 1 363 ? -15.547 -6.736  -30.708 1.00 8.21   ? 357 TRP A CA    1 
ATOM   2731 C  C     . TRP A 1 363 ? -16.132 -6.815  -32.101 1.00 9.98   ? 357 TRP A C     1 
ATOM   2732 O  O     . TRP A 1 363 ? -15.747 -6.059  -32.978 1.00 13.26  ? 357 TRP A O     1 
ATOM   2733 C  CB    . TRP A 1 363 ? -14.268 -7.549  -30.619 1.00 8.21   ? 357 TRP A CB    1 
ATOM   2734 C  CG    . TRP A 1 363 ? -13.397 -7.154  -29.473 1.00 7.52   ? 357 TRP A CG    1 
ATOM   2735 C  CD1   . TRP A 1 363 ? -13.159 -7.869  -28.337 1.00 7.19   ? 357 TRP A CD1   1 
ATOM   2736 C  CD2   . TRP A 1 363 ? -12.645 -5.943  -29.352 1.00 6.81   ? 357 TRP A CD2   1 
ATOM   2737 N  NE1   . TRP A 1 363 ? -12.307 -7.174  -27.512 1.00 7.10   ? 357 TRP A NE1   1 
ATOM   2738 C  CE2   . TRP A 1 363 ? -11.979 -5.987  -28.115 1.00 7.07   ? 357 TRP A CE2   1 
ATOM   2739 C  CE3   . TRP A 1 363 ? -12.467 -4.827  -30.172 1.00 6.45   ? 357 TRP A CE3   1 
ATOM   2740 C  CZ2   . TRP A 1 363 ? -11.144 -4.961  -27.685 1.00 6.73   ? 357 TRP A CZ2   1 
ATOM   2741 C  CZ3   . TRP A 1 363 ? -11.649 -3.807  -29.738 1.00 4.63   ? 357 TRP A CZ3   1 
ATOM   2742 C  CH2   . TRP A 1 363 ? -10.997 -3.881  -28.511 1.00 5.11   ? 357 TRP A CH2   1 
ATOM   2743 N  N     . SER A 1 364 ? -17.079 -7.713  -32.308 1.00 10.82  ? 358 SER A N     1 
ATOM   2744 C  CA    . SER A 1 364 ? -17.682 -7.842  -33.626 1.00 10.68  ? 358 SER A CA    1 
ATOM   2745 C  C     . SER A 1 364 ? -18.327 -6.528  -34.086 1.00 12.14  ? 358 SER A C     1 
ATOM   2746 O  O     . SER A 1 364 ? -18.398 -6.245  -35.289 1.00 12.39  ? 358 SER A O     1 
ATOM   2747 C  CB    . SER A 1 364 ? -18.703 -8.989  -33.653 1.00 6.97   ? 358 SER A CB    1 
ATOM   2748 O  OG    . SER A 1 364 ? -19.878 -8.664  -32.933 1.00 6.69   ? 358 SER A OG    1 
ATOM   2749 N  N     . LYS A 1 365 ? -18.787 -5.723  -33.132 1.00 10.12  ? 359 LYS A N     1 
ATOM   2750 C  CA    . LYS A 1 365 ? -19.484 -4.493  -33.484 1.00 13.65  ? 359 LYS A CA    1 
ATOM   2751 C  C     . LYS A 1 365 ? -18.517 -3.500  -34.104 1.00 13.60  ? 359 LYS A C     1 
ATOM   2752 O  O     . LYS A 1 365 ? -18.891 -2.716  -34.966 1.00 18.89  ? 359 LYS A O     1 
ATOM   2753 C  CB    . LYS A 1 365 ? -20.190 -3.874  -32.275 1.00 15.23  ? 359 LYS A CB    1 
ATOM   2754 C  CG    . LYS A 1 365 ? -21.032 -2.633  -32.603 1.00 19.82  ? 359 LYS A CG    1 
ATOM   2755 C  CD    . LYS A 1 365 ? -21.832 -2.161  -31.384 1.00 20.18  ? 359 LYS A CD    1 
ATOM   2756 C  CE    . LYS A 1 365 ? -22.285 -0.719  -31.511 1.00 15.62  ? 359 LYS A CE    1 
ATOM   2757 N  NZ    . LYS A 1 365 ? -23.120 -0.303  -30.358 1.00 15.07  ? 359 LYS A NZ    1 
ATOM   2758 N  N     . LEU A 1 366 ? -17.271 -3.544  -33.660 1.00 9.86   ? 360 LEU A N     1 
ATOM   2759 C  CA    . LEU A 1 366 ? -16.224 -2.739  -34.249 1.00 7.87   ? 360 LEU A CA    1 
ATOM   2760 C  C     . LEU A 1 366 ? -16.020 -3.185  -35.690 1.00 10.23  ? 360 LEU A C     1 
ATOM   2761 O  O     . LEU A 1 366 ? -15.720 -2.390  -36.571 1.00 12.44  ? 360 LEU A O     1 
ATOM   2762 C  CB    . LEU A 1 366 ? -14.936 -2.962  -33.478 1.00 8.80   ? 360 LEU A CB    1 
ATOM   2763 C  CG    . LEU A 1 366 ? -13.863 -1.887  -33.428 1.00 8.12   ? 360 LEU A CG    1 
ATOM   2764 C  CD1   . LEU A 1 366 ? -12.490 -2.488  -33.700 1.00 5.52   ? 360 LEU A CD1   1 
ATOM   2765 C  CD2   . LEU A 1 366 ? -14.189 -0.736  -34.369 1.00 11.31  ? 360 LEU A CD2   1 
ATOM   2766 N  N     . LEU A 1 367 ? -16.206 -4.467  -35.937 1.00 10.43  ? 361 LEU A N     1 
ATOM   2767 C  CA    . LEU A 1 367 ? -15.805 -5.025  -37.212 1.00 9.84   ? 361 LEU A CA    1 
ATOM   2768 C  C     . LEU A 1 367 ? -16.927 -5.071  -38.264 1.00 10.45  ? 361 LEU A C     1 
ATOM   2769 O  O     . LEU A 1 367 ? -16.676 -5.441  -39.406 1.00 8.67   ? 361 LEU A O     1 
ATOM   2770 C  CB    . LEU A 1 367 ? -15.166 -6.402  -36.994 1.00 8.96   ? 361 LEU A CB    1 
ATOM   2771 C  CG    . LEU A 1 367 ? -13.668 -6.484  -36.648 1.00 8.31   ? 361 LEU A CG    1 
ATOM   2772 C  CD1   . LEU A 1 367 ? -13.084 -5.169  -36.156 1.00 8.24   ? 361 LEU A CD1   1 
ATOM   2773 C  CD2   . LEU A 1 367 ? -13.394 -7.589  -35.648 1.00 5.21   ? 361 LEU A CD2   1 
ATOM   2774 N  N     . GLU A 1 368 ? -18.147 -4.688  -37.885 1.00 11.31  ? 362 GLU A N     1 
ATOM   2775 C  CA    . GLU A 1 368 ? -19.265 -4.632  -38.834 1.00 10.80  ? 362 GLU A CA    1 
ATOM   2776 C  C     . GLU A 1 368 ? -18.911 -3.776  -40.018 1.00 10.43  ? 362 GLU A C     1 
ATOM   2777 O  O     . GLU A 1 368 ? -18.371 -2.688  -39.854 1.00 11.19  ? 362 GLU A O     1 
ATOM   2778 C  CB    . GLU A 1 368 ? -20.471 -3.915  -38.248 1.00 16.03  ? 362 GLU A CB    1 
ATOM   2779 C  CG    . GLU A 1 368 ? -21.162 -4.489  -37.065 1.00 22.90  ? 362 GLU A CG    1 
ATOM   2780 C  CD    . GLU A 1 368 ? -22.153 -3.479  -36.542 1.00 33.25  ? 362 GLU A CD    1 
ATOM   2781 O  OE1   . GLU A 1 368 ? -21.873 -2.265  -36.718 1.00 26.12  ? 362 GLU A OE1   1 
ATOM   2782 O  OE2   . GLU A 1 368 ? -23.202 -3.886  -35.991 1.00 48.62  ? 362 GLU A OE2   1 
ATOM   2783 N  N     . PRO A 1 369 ? -19.293 -4.214  -41.216 1.00 13.48  ? 363 PRO A N     1 
ATOM   2784 C  CA    . PRO A 1 369 ? -19.045 -3.362  -42.382 1.00 14.75  ? 363 PRO A CA    1 
ATOM   2785 C  C     . PRO A 1 369 ? -19.890 -2.115  -42.231 1.00 12.57  ? 363 PRO A C     1 
ATOM   2786 O  O     . PRO A 1 369 ? -20.897 -2.190  -41.546 1.00 11.27  ? 363 PRO A O     1 
ATOM   2787 C  CB    . PRO A 1 369 ? -19.537 -4.215  -43.548 1.00 15.41  ? 363 PRO A CB    1 
ATOM   2788 C  CG    . PRO A 1 369 ? -20.554 -5.135  -42.924 1.00 16.25  ? 363 PRO A CG    1 
ATOM   2789 C  CD    . PRO A 1 369 ? -20.082 -5.411  -41.544 1.00 12.10  ? 363 PRO A CD    1 
ATOM   2790 N  N     . PRO A 1 370 ? -19.464 -0.985  -42.817 1.00 14.26  ? 364 PRO A N     1 
ATOM   2791 C  CA    . PRO A 1 370 ? -20.228 0.263   -42.720 1.00 14.46  ? 364 PRO A CA    1 
ATOM   2792 C  C     . PRO A 1 370 ? -21.403 0.272   -43.689 1.00 20.50  ? 364 PRO A C     1 
ATOM   2793 O  O     . PRO A 1 370 ? -21.378 -0.449  -44.682 1.00 32.37  ? 364 PRO A O     1 
ATOM   2794 C  CB    . PRO A 1 370 ? -19.197 1.313   -43.119 1.00 18.44  ? 364 PRO A CB    1 
ATOM   2795 C  CG    . PRO A 1 370 ? -18.262 0.587   -44.038 1.00 12.05  ? 364 PRO A CG    1 
ATOM   2796 C  CD    . PRO A 1 370 ? -18.154 -0.784  -43.467 1.00 12.97  ? 364 PRO A CD    1 
ATOM   2797 N  N     . ASN A 1 371 ? -22.424 1.071   -43.426 1.00 21.11  ? 365 ASN A N     1 
ATOM   2798 C  CA    . ASN A 1 371 ? -23.562 1.091   -44.338 1.00 34.06  ? 365 ASN A CA    1 
ATOM   2799 C  C     . ASN A 1 371 ? -23.330 1.906   -45.623 1.00 31.75  ? 365 ASN A C     1 
ATOM   2800 O  O     . ASN A 1 371 ? -24.076 2.840   -45.934 1.00 32.20  ? 365 ASN A O     1 
ATOM   2801 C  CB    . ASN A 1 371 ? -24.835 1.519   -43.600 1.00 47.94  ? 365 ASN A CB    1 
ATOM   2802 C  CG    . ASN A 1 371 ? -25.427 0.386   -42.767 1.00 55.47  ? 365 ASN A CG    1 
ATOM   2803 O  OD1   . ASN A 1 371 ? -25.324 -0.791  -43.140 1.00 45.46  ? 365 ASN A OD1   1 
ATOM   2804 N  ND2   . ASN A 1 371 ? -26.040 0.732   -41.632 1.00 44.58  ? 365 ASN A ND2   1 
ATOM   2805 N  N     . PHE A 1 372 ? -22.295 1.532   -46.371 1.00 26.02  ? 366 PHE A N     1 
ATOM   2806 C  CA    . PHE A 1 372 ? -21.919 2.257   -47.575 1.00 21.85  ? 366 PHE A CA    1 
ATOM   2807 C  C     . PHE A 1 372 ? -23.034 2.320   -48.604 1.00 25.84  ? 366 PHE A C     1 
ATOM   2808 O  O     . PHE A 1 372 ? -23.271 3.367   -49.197 1.00 31.67  ? 366 PHE A O     1 
ATOM   2809 C  CB    . PHE A 1 372 ? -20.678 1.655   -48.218 1.00 20.89  ? 366 PHE A CB    1 
ATOM   2810 C  CG    . PHE A 1 372 ? -20.267 2.346   -49.489 1.00 24.42  ? 366 PHE A CG    1 
ATOM   2811 C  CD1   . PHE A 1 372 ? -19.499 3.502   -49.445 1.00 17.18  ? 366 PHE A CD1   1 
ATOM   2812 C  CD2   . PHE A 1 372 ? -20.657 1.842   -50.735 1.00 23.10  ? 366 PHE A CD2   1 
ATOM   2813 C  CE1   . PHE A 1 372 ? -19.123 4.136   -50.623 1.00 19.36  ? 366 PHE A CE1   1 
ATOM   2814 C  CE2   . PHE A 1 372 ? -20.288 2.475   -51.915 1.00 18.08  ? 366 PHE A CE2   1 
ATOM   2815 C  CZ    . PHE A 1 372 ? -19.520 3.620   -51.865 1.00 16.02  ? 366 PHE A CZ    1 
ATOM   2816 N  N     . PHE A 1 373 ? -23.719 1.208   -48.825 1.00 24.19  ? 367 PHE A N     1 
ATOM   2817 C  CA    . PHE A 1 373 ? -24.752 1.178   -49.843 1.00 19.78  ? 367 PHE A CA    1 
ATOM   2818 C  C     . PHE A 1 373 ? -26.102 1.705   -49.380 1.00 25.55  ? 367 PHE A C     1 
ATOM   2819 O  O     . PHE A 1 373 ? -27.122 1.427   -50.002 1.00 30.31  ? 367 PHE A O     1 
ATOM   2820 C  CB    . PHE A 1 373 ? -24.879 -0.221  -50.404 1.00 21.46  ? 367 PHE A CB    1 
ATOM   2821 C  CG    . PHE A 1 373 ? -23.616 -0.718  -51.014 1.00 30.36  ? 367 PHE A CG    1 
ATOM   2822 C  CD1   . PHE A 1 373 ? -23.248 -0.316  -52.288 1.00 20.10  ? 367 PHE A CD1   1 
ATOM   2823 C  CD2   . PHE A 1 373 ? -22.772 -1.561  -50.304 1.00 30.12  ? 367 PHE A CD2   1 
ATOM   2824 C  CE1   . PHE A 1 373 ? -22.080 -0.760  -52.854 1.00 18.00  ? 367 PHE A CE1   1 
ATOM   2825 C  CE2   . PHE A 1 373 ? -21.595 -2.011  -50.863 1.00 25.77  ? 367 PHE A CE2   1 
ATOM   2826 C  CZ    . PHE A 1 373 ? -21.249 -1.607  -52.143 1.00 25.81  ? 367 PHE A CZ    1 
ATOM   2827 N  N     . GLN A 1 374 ? -26.112 2.469   -48.292 1.00 29.72  ? 368 GLN A N     1 
ATOM   2828 C  CA    . GLN A 1 374 ? -27.331 3.167   -47.885 1.00 33.67  ? 368 GLN A CA    1 
ATOM   2829 C  C     . GLN A 1 374 ? -27.094 4.581   -47.392 1.00 29.21  ? 368 GLN A C     1 
ATOM   2830 O  O     . GLN A 1 374 ? -28.042 5.348   -47.260 1.00 34.27  ? 368 GLN A O     1 
ATOM   2831 C  CB    . GLN A 1 374 ? -28.101 2.397   -46.812 1.00 35.13  ? 368 GLN A CB    1 
ATOM   2832 C  CG    . GLN A 1 374 ? -28.909 1.234   -47.349 1.00 42.78  ? 368 GLN A CG    1 
ATOM   2833 C  CD    . GLN A 1 374 ? -28.242 -0.089  -47.062 1.00 45.43  ? 368 GLN A CD    1 
ATOM   2834 O  OE1   . GLN A 1 374 ? -27.356 -0.176  -46.201 1.00 40.90  ? 368 GLN A OE1   1 
ATOM   2835 N  NE2   . GLN A 1 374 ? -28.656 -1.131  -47.781 1.00 43.07  ? 368 GLN A NE2   1 
ATOM   2836 N  N     . LYS A 1 375 ? -25.850 4.946   -47.112 1.00 23.72  ? 369 LYS A N     1 
ATOM   2837 C  CA    . LYS A 1 375 ? -25.657 6.216   -46.431 1.00 24.89  ? 369 LYS A CA    1 
ATOM   2838 C  C     . LYS A 1 375 ? -25.639 7.382   -47.388 1.00 19.70  ? 369 LYS A C     1 
ATOM   2839 O  O     . LYS A 1 375 ? -25.487 8.514   -46.961 1.00 30.14  ? 369 LYS A O     1 
ATOM   2840 C  CB    . LYS A 1 375 ? -24.433 6.208   -45.498 1.00 21.79  ? 369 LYS A CB    1 
ATOM   2841 C  CG    . LYS A 1 375 ? -23.118 5.862   -46.158 1.00 29.69  ? 369 LYS A CG    1 
ATOM   2842 C  CD    . LYS A 1 375 ? -21.989 5.662   -45.134 1.00 33.51  ? 369 LYS A CD    1 
ATOM   2843 C  CE    . LYS A 1 375 ? -21.994 6.735   -44.044 1.00 37.20  ? 369 LYS A CE    1 
ATOM   2844 N  NZ    . LYS A 1 375 ? -22.481 6.184   -42.738 1.00 45.99  ? 369 LYS A NZ    1 
ATOM   2845 N  N     . TYR A 1 376 ? -25.832 7.109   -48.675 1.00 22.60  ? 370 TYR A N     1 
ATOM   2846 C  CA    . TYR A 1 376 ? -25.718 8.140   -49.717 1.00 22.69  ? 370 TYR A CA    1 
ATOM   2847 C  C     . TYR A 1 376 ? -26.927 8.205   -50.642 1.00 24.20  ? 370 TYR A C     1 
ATOM   2848 O  O     . TYR A 1 376 ? -27.526 7.184   -50.977 1.00 22.56  ? 370 TYR A O     1 
ATOM   2849 C  CB    . TYR A 1 376 ? -24.449 7.931   -50.549 1.00 16.91  ? 370 TYR A CB    1 
ATOM   2850 C  CG    . TYR A 1 376 ? -23.194 8.041   -49.735 1.00 18.25  ? 370 TYR A CG    1 
ATOM   2851 C  CD1   . TYR A 1 376 ? -23.009 9.096   -48.847 1.00 15.45  ? 370 TYR A CD1   1 
ATOM   2852 C  CD2   . TYR A 1 376 ? -22.211 7.076   -49.823 1.00 16.75  ? 370 TYR A CD2   1 
ATOM   2853 C  CE1   . TYR A 1 376 ? -21.876 9.188   -48.083 1.00 14.46  ? 370 TYR A CE1   1 
ATOM   2854 C  CE2   . TYR A 1 376 ? -21.073 7.160   -49.074 1.00 17.50  ? 370 TYR A CE2   1 
ATOM   2855 C  CZ    . TYR A 1 376 ? -20.906 8.213   -48.202 1.00 21.86  ? 370 TYR A CZ    1 
ATOM   2856 O  OH    . TYR A 1 376 ? -19.754 8.280   -47.449 1.00 26.19  ? 370 TYR A OH    1 
ATOM   2857 N  N     . ARG A 1 377 ? -27.273 9.419   -51.060 1.00 27.96  ? 371 ARG A N     1 
ATOM   2858 C  CA    . ARG A 1 377 ? -28.437 9.622   -51.911 1.00 25.95  ? 371 ARG A CA    1 
ATOM   2859 C  C     . ARG A 1 377 ? -28.100 9.280   -53.349 1.00 22.60  ? 371 ARG A C     1 
ATOM   2860 O  O     . ARG A 1 377 ? -28.961 8.840   -54.103 1.00 28.48  ? 371 ARG A O     1 
ATOM   2861 C  CB    . ARG A 1 377 ? -28.991 11.056  -51.783 1.00 28.30  ? 371 ARG A CB    1 
ATOM   2862 C  CG    . ARG A 1 377 ? -29.857 11.307  -50.532 1.00 30.02  ? 371 ARG A CG    1 
ATOM   2863 C  CD    . ARG A 1 377 ? -30.807 10.123  -50.296 1.00 45.62  ? 371 ARG A CD    1 
ATOM   2864 N  NE    . ARG A 1 377 ? -32.243 10.429  -50.335 1.00 59.47  ? 371 ARG A NE    1 
ATOM   2865 C  CZ    . ARG A 1 377 ? -32.895 11.030  -51.335 1.00 57.14  ? 371 ARG A CZ    1 
ATOM   2866 N  NH1   . ARG A 1 377 ? -32.265 11.458  -52.431 1.00 48.67  ? 371 ARG A NH1   1 
ATOM   2867 N  NH2   . ARG A 1 377 ? -34.204 11.220  -51.226 1.00 47.90  ? 371 ARG A NH2   1 
ATOM   2868 N  N     . HIS A 1 378 ? -26.840 9.467   -53.726 1.00 22.25  ? 372 HIS A N     1 
ATOM   2869 C  CA    . HIS A 1 378 ? -26.419 9.189   -55.099 1.00 22.80  ? 372 HIS A CA    1 
ATOM   2870 C  C     . HIS A 1 378 ? -25.124 8.387   -55.167 1.00 20.00  ? 372 HIS A C     1 
ATOM   2871 O  O     . HIS A 1 378 ? -24.275 8.469   -54.281 1.00 19.33  ? 372 HIS A O     1 
ATOM   2872 C  CB    . HIS A 1 378 ? -26.213 10.485  -55.885 1.00 25.23  ? 372 HIS A CB    1 
ATOM   2873 C  CG    . HIS A 1 378 ? -27.268 11.516  -55.651 1.00 21.03  ? 372 HIS A CG    1 
ATOM   2874 N  ND1   . HIS A 1 378 ? -28.286 11.752  -56.547 1.00 22.96  ? 372 HIS A ND1   1 
ATOM   2875 C  CD2   . HIS A 1 378 ? -27.451 12.387  -54.631 1.00 19.82  ? 372 HIS A CD2   1 
ATOM   2876 C  CE1   . HIS A 1 378 ? -29.061 12.716  -56.080 1.00 28.13  ? 372 HIS A CE1   1 
ATOM   2877 N  NE2   . HIS A 1 378 ? -28.574 13.121  -54.921 1.00 23.75  ? 372 HIS A NE2   1 
ATOM   2878 N  N     . TYR A 1 379 ? -24.971 7.634   -56.248 1.00 17.57  ? 373 TYR A N     1 
ATOM   2879 C  CA    . TYR A 1 379 ? -23.787 6.842   -56.446 1.00 14.46  ? 373 TYR A CA    1 
ATOM   2880 C  C     . TYR A 1 379 ? -23.279 6.986   -57.847 1.00 18.50  ? 373 TYR A C     1 
ATOM   2881 O  O     . TYR A 1 379 ? -23.971 7.467   -58.735 1.00 17.84  ? 373 TYR A O     1 
ATOM   2882 C  CB    . TYR A 1 379 ? -24.068 5.366   -56.184 1.00 15.23  ? 373 TYR A CB    1 
ATOM   2883 C  CG    . TYR A 1 379 ? -24.349 5.080   -54.742 1.00 19.98  ? 373 TYR A CG    1 
ATOM   2884 C  CD1   . TYR A 1 379 ? -25.606 5.312   -54.209 1.00 17.14  ? 373 TYR A CD1   1 
ATOM   2885 C  CD2   . TYR A 1 379 ? -23.355 4.591   -53.904 1.00 19.03  ? 373 TYR A CD2   1 
ATOM   2886 C  CE1   . TYR A 1 379 ? -25.873 5.072   -52.893 1.00 21.21  ? 373 TYR A CE1   1 
ATOM   2887 C  CE2   . TYR A 1 379 ? -23.615 4.344   -52.572 1.00 20.46  ? 373 TYR A CE2   1 
ATOM   2888 C  CZ    . TYR A 1 379 ? -24.880 4.589   -52.074 1.00 22.23  ? 373 TYR A CZ    1 
ATOM   2889 O  OH    . TYR A 1 379 ? -25.171 4.357   -50.753 1.00 22.20  ? 373 TYR A OH    1 
ATOM   2890 N  N     . ILE A 1 380 ? -22.049 6.548   -58.036 1.00 20.00  ? 374 ILE A N     1 
ATOM   2891 C  CA    . ILE A 1 380 ? -21.550 6.297   -59.358 1.00 16.95  ? 374 ILE A CA    1 
ATOM   2892 C  C     . ILE A 1 380 ? -21.118 4.841   -59.429 1.00 19.26  ? 374 ILE A C     1 
ATOM   2893 O  O     . ILE A 1 380 ? -20.329 4.375   -58.600 1.00 19.11  ? 374 ILE A O     1 
ATOM   2894 C  CB    . ILE A 1 380 ? -20.389 7.215   -59.666 1.00 20.32  ? 374 ILE A CB    1 
ATOM   2895 C  CG1   . ILE A 1 380 ? -20.874 8.656   -59.631 1.00 15.76  ? 374 ILE A CG1   1 
ATOM   2896 C  CG2   . ILE A 1 380 ? -19.801 6.895   -61.043 1.00 22.51  ? 374 ILE A CG2   1 
ATOM   2897 C  CD1   . ILE A 1 380 ? -19.809 9.620   -59.979 1.00 19.42  ? 374 ILE A CD1   1 
ATOM   2898 N  N     . VAL A 1 381 ? -21.663 4.115   -60.400 1.00 19.02  ? 375 VAL A N     1 
ATOM   2899 C  CA    . VAL A 1 381 ? -21.188 2.774   -60.692 1.00 18.83  ? 375 VAL A CA    1 
ATOM   2900 C  C     . VAL A 1 381 ? -20.134 2.849   -61.764 1.00 19.78  ? 375 VAL A C     1 
ATOM   2901 O  O     . VAL A 1 381 ? -20.411 3.258   -62.887 1.00 25.23  ? 375 VAL A O     1 
ATOM   2902 C  CB    . VAL A 1 381 ? -22.281 1.874   -61.229 1.00 19.38  ? 375 VAL A CB    1 
ATOM   2903 C  CG1   . VAL A 1 381 ? -21.747 0.454   -61.371 1.00 15.55  ? 375 VAL A CG1   1 
ATOM   2904 C  CG2   . VAL A 1 381 ? -23.482 1.928   -60.317 1.00 23.84  ? 375 VAL A CG2   1 
ATOM   2905 N  N     . LEU A 1 382 ? -18.927 2.448   -61.401 1.00 18.53  ? 376 LEU A N     1 
ATOM   2906 C  CA    . LEU A 1 382 ? -17.782 2.452   -62.291 1.00 20.41  ? 376 LEU A CA    1 
ATOM   2907 C  C     . LEU A 1 382 ? -17.587 1.033   -62.810 1.00 23.46  ? 376 LEU A C     1 
ATOM   2908 O  O     . LEU A 1 382 ? -16.974 0.205   -62.127 1.00 25.40  ? 376 LEU A O     1 
ATOM   2909 C  CB    . LEU A 1 382 ? -16.549 2.848   -61.487 1.00 17.97  ? 376 LEU A CB    1 
ATOM   2910 C  CG    . LEU A 1 382 ? -15.595 3.939   -61.954 1.00 20.21  ? 376 LEU A CG    1 
ATOM   2911 C  CD1   . LEU A 1 382 ? -14.200 3.500   -61.608 1.00 20.87  ? 376 LEU A CD1   1 
ATOM   2912 C  CD2   . LEU A 1 382 ? -15.708 4.199   -63.426 1.00 22.87  ? 376 LEU A CD2   1 
ATOM   2913 N  N     . THR A 1 383 ? -18.107 0.735   -63.999 1.00 24.97  ? 377 THR A N     1 
ATOM   2914 C  CA    . THR A 1 383 ? -18.019 -0.627  -64.530 1.00 26.21  ? 377 THR A CA    1 
ATOM   2915 C  C     . THR A 1 383 ? -16.885 -0.721  -65.529 1.00 27.49  ? 377 THR A C     1 
ATOM   2916 O  O     . THR A 1 383 ? -16.743 0.147   -66.388 1.00 30.35  ? 377 THR A O     1 
ATOM   2917 C  CB    . THR A 1 383 ? -19.320 -1.082  -65.220 1.00 26.64  ? 377 THR A CB    1 
ATOM   2918 O  OG1   . THR A 1 383 ? -20.446 -0.835  -64.371 1.00 33.43  ? 377 THR A OG1   1 
ATOM   2919 C  CG2   . THR A 1 383 ? -19.260 -2.545  -65.517 1.00 18.06  ? 377 THR A CG2   1 
ATOM   2920 N  N     . ALA A 1 384 ? -16.076 -1.770  -65.403 1.00 22.45  ? 378 ALA A N     1 
ATOM   2921 C  CA    . ALA A 1 384 ? -14.923 -1.976  -66.271 1.00 26.40  ? 378 ALA A CA    1 
ATOM   2922 C  C     . ALA A 1 384 ? -14.983 -3.368  -66.859 1.00 38.12  ? 378 ALA A C     1 
ATOM   2923 O  O     . ALA A 1 384 ? -15.149 -4.344  -66.129 1.00 37.04  ? 378 ALA A O     1 
ATOM   2924 C  CB    . ALA A 1 384 ? -13.641 -1.806  -65.495 1.00 27.88  ? 378 ALA A CB    1 
ATOM   2925 N  N     . SER A 1 385 ? -14.833 -3.470  -68.176 1.00 41.08  ? 379 SER A N     1 
ATOM   2926 C  CA    . SER A 1 385 ? -15.024 -4.754  -68.833 1.00 34.73  ? 379 SER A CA    1 
ATOM   2927 C  C     . SER A 1 385 ? -13.877 -5.166  -69.745 1.00 33.12  ? 379 SER A C     1 
ATOM   2928 O  O     . SER A 1 385 ? -13.210 -4.317  -70.326 1.00 29.25  ? 379 SER A O     1 
ATOM   2929 C  CB    . SER A 1 385 ? -16.334 -4.740  -69.605 1.00 28.60  ? 379 SER A CB    1 
ATOM   2930 O  OG    . SER A 1 385 ? -17.163 -5.800  -69.160 1.00 40.91  ? 379 SER A OG    1 
ATOM   2931 N  N     . ALA A 1 386 ? -13.637 -6.472  -69.853 1.00 36.48  ? 380 ALA A N     1 
ATOM   2932 C  CA    . ALA A 1 386 ? -12.717 -6.985  -70.873 1.00 45.72  ? 380 ALA A CA    1 
ATOM   2933 C  C     . ALA A 1 386 ? -13.170 -8.308  -71.505 1.00 59.23  ? 380 ALA A C     1 
ATOM   2934 O  O     . ALA A 1 386 ? -14.076 -8.982  -71.005 1.00 58.63  ? 380 ALA A O     1 
ATOM   2935 C  CB    . ALA A 1 386 ? -11.306 -7.103  -70.337 1.00 39.27  ? 380 ALA A CB    1 
ATOM   2936 N  N     . SER A 1 387 ? -12.525 -8.664  -72.613 1.00 66.55  ? 381 SER A N     1 
ATOM   2937 C  CA    . SER A 1 387 ? -12.872 -9.857  -73.384 1.00 62.74  ? 381 SER A CA    1 
ATOM   2938 C  C     . SER A 1 387 ? -12.313 -11.129 -72.756 1.00 65.12  ? 381 SER A C     1 
ATOM   2939 O  O     . SER A 1 387 ? -13.068 -12.048 -72.441 1.00 72.46  ? 381 SER A O     1 
ATOM   2940 C  CB    . SER A 1 387 ? -12.383 -9.710  -74.829 1.00 62.60  ? 381 SER A CB    1 
ATOM   2941 O  OG    . SER A 1 387 ? -11.263 -8.835  -74.908 1.00 65.84  ? 381 SER A OG    1 
ATOM   2942 N  N     . THR A 1 388 ? -10.995 -11.169 -72.567 1.00 64.11  ? 382 THR A N     1 
ATOM   2943 C  CA    . THR A 1 388 ? -10.322 -12.339 -72.002 1.00 64.29  ? 382 THR A CA    1 
ATOM   2944 C  C     . THR A 1 388 ? -9.798  -12.081 -70.587 1.00 57.94  ? 382 THR A C     1 
ATOM   2945 O  O     . THR A 1 388 ? -9.791  -10.947 -70.118 1.00 55.40  ? 382 THR A O     1 
ATOM   2946 C  CB    . THR A 1 388 ? -9.154  -12.789 -72.896 1.00 65.35  ? 382 THR A CB    1 
ATOM   2947 O  OG1   . THR A 1 388 ? -8.016  -11.948 -72.669 1.00 61.67  ? 382 THR A OG1   1 
ATOM   2948 C  CG2   . THR A 1 388 ? -9.552  -12.711 -74.358 1.00 59.52  ? 382 THR A CG2   1 
ATOM   2949 N  N     . GLU A 1 389 ? -9.358  -13.139 -69.914 1.00 59.21  ? 383 GLU A N     1 
ATOM   2950 C  CA    . GLU A 1 389 ? -8.876  -13.022 -68.540 1.00 56.63  ? 383 GLU A CA    1 
ATOM   2951 C  C     . GLU A 1 389 ? -7.646  -12.135 -68.417 1.00 59.07  ? 383 GLU A C     1 
ATOM   2952 O  O     . GLU A 1 389 ? -7.649  -11.180 -67.640 1.00 59.82  ? 383 GLU A O     1 
ATOM   2953 C  CB    . GLU A 1 389 ? -8.577  -14.393 -67.949 1.00 61.73  ? 383 GLU A CB    1 
ATOM   2954 C  CG    . GLU A 1 389 ? -9.709  -14.969 -67.135 1.00 64.43  ? 383 GLU A CG    1 
ATOM   2955 C  CD    . GLU A 1 389 ? -9.219  -15.633 -65.865 1.00 71.95  ? 383 GLU A CD    1 
ATOM   2956 O  OE1   . GLU A 1 389 ? -8.458  -14.985 -65.114 1.00 63.74  ? 383 GLU A OE1   1 
ATOM   2957 O  OE2   . GLU A 1 389 ? -9.589  -16.802 -65.621 1.00 68.11  ? 383 GLU A OE2   1 
ATOM   2958 N  N     . GLU A 1 390 ? -6.596  -12.455 -69.173 1.00 61.74  ? 384 GLU A N     1 
ATOM   2959 C  CA    . GLU A 1 390 ? -5.383  -11.640 -69.187 1.00 56.93  ? 384 GLU A CA    1 
ATOM   2960 C  C     . GLU A 1 390 ? -5.745  -10.224 -69.604 1.00 58.68  ? 384 GLU A C     1 
ATOM   2961 O  O     . GLU A 1 390 ? -5.139  -9.256  -69.148 1.00 57.97  ? 384 GLU A O     1 
ATOM   2962 C  CB    . GLU A 1 390 ? -4.324  -12.197 -70.152 1.00 64.11  ? 384 GLU A CB    1 
ATOM   2963 C  CG    . GLU A 1 390 ? -4.453  -13.677 -70.492 1.00 77.47  ? 384 GLU A CG    1 
ATOM   2964 C  CD    . GLU A 1 390 ? -5.278  -13.928 -71.749 1.00 76.35  ? 384 GLU A CD    1 
ATOM   2965 O  OE1   . GLU A 1 390 ? -5.184  -13.114 -72.699 1.00 61.24  ? 384 GLU A OE1   1 
ATOM   2966 O  OE2   . GLU A 1 390 ? -6.023  -14.938 -71.781 1.00 70.84  ? 384 GLU A OE2   1 
ATOM   2967 N  N     . ASN A 1 391 ? -6.738  -10.112 -70.481 1.00 57.02  ? 385 ASN A N     1 
ATOM   2968 C  CA    . ASN A 1 391 ? -7.226  -8.813  -70.896 1.00 52.27  ? 385 ASN A CA    1 
ATOM   2969 C  C     . ASN A 1 391 ? -7.860  -8.095  -69.718 1.00 47.16  ? 385 ASN A C     1 
ATOM   2970 O  O     . ASN A 1 391 ? -7.676  -6.896  -69.542 1.00 49.40  ? 385 ASN A O     1 
ATOM   2971 C  CB    . ASN A 1 391 ? -8.237  -8.949  -72.037 1.00 59.84  ? 385 ASN A CB    1 
ATOM   2972 C  CG    . ASN A 1 391 ? -7.617  -8.723  -73.405 1.00 57.38  ? 385 ASN A CG    1 
ATOM   2973 O  OD1   . ASN A 1 391 ? -6.430  -8.978  -73.618 1.00 50.54  ? 385 ASN A OD1   1 
ATOM   2974 N  ND2   . ASN A 1 391 ? -8.426  -8.229  -74.344 1.00 54.81  ? 385 ASN A ND2   1 
ATOM   2975 N  N     . HIS A 1 392 ? -8.603  -8.830  -68.903 1.00 43.11  ? 386 HIS A N     1 
ATOM   2976 C  CA    . HIS A 1 392 ? -9.284  -8.209  -67.784 1.00 42.48  ? 386 HIS A CA    1 
ATOM   2977 C  C     . HIS A 1 392 ? -8.303  -7.695  -66.748 1.00 46.46  ? 386 HIS A C     1 
ATOM   2978 O  O     . HIS A 1 392 ? -8.169  -6.489  -66.571 1.00 43.82  ? 386 HIS A O     1 
ATOM   2979 C  CB    . HIS A 1 392 ? -10.264 -9.168  -67.134 1.00 46.37  ? 386 HIS A CB    1 
ATOM   2980 C  CG    . HIS A 1 392 ? -11.186 -8.507  -66.160 1.00 54.21  ? 386 HIS A CG    1 
ATOM   2981 N  ND1   . HIS A 1 392 ? -11.953 -7.410  -66.494 1.00 46.51  ? 386 HIS A ND1   1 
ATOM   2982 C  CD2   . HIS A 1 392 ? -11.466 -8.785  -64.863 1.00 48.65  ? 386 HIS A CD2   1 
ATOM   2983 C  CE1   . HIS A 1 392 ? -12.674 -7.046  -65.447 1.00 45.81  ? 386 HIS A CE1   1 
ATOM   2984 N  NE2   . HIS A 1 392 ? -12.397 -7.863  -64.445 1.00 47.84  ? 386 HIS A NE2   1 
ATOM   2985 N  N     . LEU A 1 393 ? -7.621  -8.620  -66.078 1.00 50.31  ? 387 LEU A N     1 
ATOM   2986 C  CA    . LEU A 1 393 ? -6.647  -8.296  -65.033 1.00 43.36  ? 387 LEU A CA    1 
ATOM   2987 C  C     . LEU A 1 393 ? -5.827  -7.035  -65.322 1.00 39.80  ? 387 LEU A C     1 
ATOM   2988 O  O     . LEU A 1 393 ? -5.632  -6.212  -64.434 1.00 39.50  ? 387 LEU A O     1 
ATOM   2989 C  CB    . LEU A 1 393 ? -5.710  -9.484  -64.800 1.00 34.72  ? 387 LEU A CB    1 
ATOM   2990 C  CG    . LEU A 1 393 ? -5.051  -9.648  -63.428 1.00 39.31  ? 387 LEU A CG    1 
ATOM   2991 C  CD1   . LEU A 1 393 ? -4.535  -11.063 -63.302 1.00 46.84  ? 387 LEU A CD1   1 
ATOM   2992 C  CD2   . LEU A 1 393 ? -3.914  -8.655  -63.173 1.00 42.27  ? 387 LEU A CD2   1 
ATOM   2993 N  N     . GLU A 1 394 ? -5.370  -6.884  -66.564 1.00 37.79  ? 388 GLU A N     1 
ATOM   2994 C  CA    . GLU A 1 394 ? -4.500  -5.772  -66.934 1.00 37.65  ? 388 GLU A CA    1 
ATOM   2995 C  C     . GLU A 1 394 ? -5.282  -4.469  -66.916 1.00 35.10  ? 388 GLU A C     1 
ATOM   2996 O  O     . GLU A 1 394 ? -4.875  -3.495  -66.284 1.00 33.37  ? 388 GLU A O     1 
ATOM   2997 C  CB    . GLU A 1 394 ? -3.884  -5.998  -68.327 1.00 41.70  ? 388 GLU A CB    1 
ATOM   2998 C  CG    . GLU A 1 394 ? -2.741  -5.027  -68.680 1.00 51.67  ? 388 GLU A CG    1 
ATOM   2999 C  CD    . GLU A 1 394 ? -2.413  -4.967  -70.178 1.00 58.29  ? 388 GLU A CD    1 
ATOM   3000 O  OE1   . GLU A 1 394 ? -1.465  -4.235  -70.552 1.00 47.17  ? 388 GLU A OE1   1 
ATOM   3001 O  OE2   . GLU A 1 394 ? -3.105  -5.636  -70.982 1.00 64.14  ? 388 GLU A OE2   1 
ATOM   3002 N  N     . TRP A 1 395 ? -6.407  -4.477  -67.623 1.00 37.32  ? 389 TRP A N     1 
ATOM   3003 C  CA    . TRP A 1 395 ? -7.302  -3.327  -67.774 1.00 35.11  ? 389 TRP A CA    1 
ATOM   3004 C  C     . TRP A 1 395 ? -7.810  -2.839  -66.407 1.00 33.11  ? 389 TRP A C     1 
ATOM   3005 O  O     . TRP A 1 395 ? -7.698  -1.651  -66.074 1.00 28.10  ? 389 TRP A O     1 
ATOM   3006 C  CB    . TRP A 1 395 ? -8.458  -3.733  -68.713 1.00 29.33  ? 389 TRP A CB    1 
ATOM   3007 C  CG    . TRP A 1 395 ? -9.572  -2.731  -68.961 1.00 26.13  ? 389 TRP A CG    1 
ATOM   3008 C  CD1   . TRP A 1 395 ? -10.915 -2.946  -68.798 1.00 31.70  ? 389 TRP A CD1   1 
ATOM   3009 C  CD2   . TRP A 1 395 ? -9.442  -1.394  -69.454 1.00 23.31  ? 389 TRP A CD2   1 
ATOM   3010 N  NE1   . TRP A 1 395 ? -11.627 -1.821  -69.146 1.00 25.63  ? 389 TRP A NE1   1 
ATOM   3011 C  CE2   . TRP A 1 395 ? -10.747 -0.853  -69.545 1.00 21.65  ? 389 TRP A CE2   1 
ATOM   3012 C  CE3   . TRP A 1 395 ? -8.351  -0.592  -69.808 1.00 21.38  ? 389 TRP A CE3   1 
ATOM   3013 C  CZ2   . TRP A 1 395 ? -10.986 0.447   -69.971 1.00 20.06  ? 389 TRP A CZ2   1 
ATOM   3014 C  CZ3   . TRP A 1 395 ? -8.590  0.694   -70.235 1.00 20.93  ? 389 TRP A CZ3   1 
ATOM   3015 C  CH2   . TRP A 1 395 ? -9.898  1.206   -70.312 1.00 21.65  ? 389 TRP A CH2   1 
ATOM   3016 N  N     . VAL A 1 396 ? -8.343  -3.775  -65.620 1.00 32.36  ? 390 VAL A N     1 
ATOM   3017 C  CA    . VAL A 1 396 ? -8.790  -3.511  -64.260 1.00 26.30  ? 390 VAL A CA    1 
ATOM   3018 C  C     . VAL A 1 396 ? -7.679  -2.823  -63.485 1.00 23.31  ? 390 VAL A C     1 
ATOM   3019 O  O     . VAL A 1 396 ? -7.933  -1.930  -62.691 1.00 21.85  ? 390 VAL A O     1 
ATOM   3020 C  CB    . VAL A 1 396 ? -9.232  -4.818  -63.560 1.00 27.75  ? 390 VAL A CB    1 
ATOM   3021 C  CG1   . VAL A 1 396 ? -8.830  -4.830  -62.097 1.00 26.52  ? 390 VAL A CG1   1 
ATOM   3022 C  CG2   . VAL A 1 396 ? -10.720 -4.999  -63.698 1.00 23.90  ? 390 VAL A CG2   1 
ATOM   3023 N  N     . GLY A 1 397 ? -6.445  -3.232  -63.756 1.00 25.73  ? 391 GLY A N     1 
ATOM   3024 C  CA    . GLY A 1 397 ? -5.279  -2.605  -63.181 1.00 17.58  ? 391 GLY A CA    1 
ATOM   3025 C  C     . GLY A 1 397 ? -5.298  -1.144  -63.531 1.00 20.14  ? 391 GLY A C     1 
ATOM   3026 O  O     . GLY A 1 397 ? -5.311  -0.294  -62.647 1.00 23.67  ? 391 GLY A O     1 
ATOM   3027 N  N     . LEU A 1 398 ? -5.351  -0.862  -64.828 1.00 23.96  ? 392 LEU A N     1 
ATOM   3028 C  CA    . LEU A 1 398 ? -5.252  0.501   -65.347 1.00 21.38  ? 392 LEU A CA    1 
ATOM   3029 C  C     . LEU A 1 398 ? -6.345  1.413   -64.803 1.00 20.77  ? 392 LEU A C     1 
ATOM   3030 O  O     . LEU A 1 398 ? -6.064  2.487   -64.272 1.00 16.38  ? 392 LEU A O     1 
ATOM   3031 C  CB    . LEU A 1 398 ? -5.273  0.496   -66.882 1.00 17.35  ? 392 LEU A CB    1 
ATOM   3032 C  CG    . LEU A 1 398 ? -5.398  1.869   -67.549 1.00 19.37  ? 392 LEU A CG    1 
ATOM   3033 C  CD1   . LEU A 1 398 ? -4.253  2.772   -67.166 1.00 22.56  ? 392 LEU A CD1   1 
ATOM   3034 C  CD2   . LEU A 1 398 ? -5.462  1.734   -69.042 1.00 31.99  ? 392 LEU A CD2   1 
ATOM   3035 N  N     . VAL A 1 399 ? -7.589  0.975   -64.965 1.00 19.80  ? 393 VAL A N     1 
ATOM   3036 C  CA    . VAL A 1 399 ? -8.743  1.671   -64.423 1.00 18.35  ? 393 VAL A CA    1 
ATOM   3037 C  C     . VAL A 1 399 ? -8.554  2.007   -62.953 1.00 22.48  ? 393 VAL A C     1 
ATOM   3038 O  O     . VAL A 1 399 ? -8.565  3.167   -62.571 1.00 21.10  ? 393 VAL A O     1 
ATOM   3039 C  CB    . VAL A 1 399 ? -9.985  0.787   -64.516 1.00 23.87  ? 393 VAL A CB    1 
ATOM   3040 C  CG1   . VAL A 1 399 ? -11.172 1.474   -63.870 1.00 20.16  ? 393 VAL A CG1   1 
ATOM   3041 C  CG2   . VAL A 1 399 ? -10.273 0.424   -65.967 1.00 26.34  ? 393 VAL A CG2   1 
ATOM   3042 N  N     . GLU A 1 400 ? -8.364  0.976   -62.137 1.00 23.36  ? 394 GLU A N     1 
ATOM   3043 C  CA    . GLU A 1 400 ? -8.284  1.138   -60.698 1.00 21.97  ? 394 GLU A CA    1 
ATOM   3044 C  C     . GLU A 1 400 ? -7.259  2.185   -60.332 1.00 23.37  ? 394 GLU A C     1 
ATOM   3045 O  O     . GLU A 1 400 ? -7.462  2.943   -59.388 1.00 29.02  ? 394 GLU A O     1 
ATOM   3046 C  CB    . GLU A 1 400 ? -7.934  -0.183  -60.010 1.00 28.32  ? 394 GLU A CB    1 
ATOM   3047 C  CG    . GLU A 1 400 ? -8.294  -0.199  -58.529 1.00 38.75  ? 394 GLU A CG    1 
ATOM   3048 C  CD    . GLU A 1 400 ? -7.335  -1.018  -57.666 1.00 45.58  ? 394 GLU A CD    1 
ATOM   3049 O  OE1   . GLU A 1 400 ? -6.109  -0.766  -57.725 1.00 38.43  ? 394 GLU A OE1   1 
ATOM   3050 O  OE2   . GLU A 1 400 ? -7.818  -1.898  -56.912 1.00 49.76  ? 394 GLU A OE2   1 
ATOM   3051 N  N     . SER A 1 401 ? -6.169  2.246   -61.089 1.00 18.17  ? 395 SER A N     1 
ATOM   3052 C  CA    . SER A 1 401 ? -5.124  3.224   -60.815 1.00 16.49  ? 395 SER A CA    1 
ATOM   3053 C  C     . SER A 1 401 ? -5.531  4.638   -61.229 1.00 19.87  ? 395 SER A C     1 
ATOM   3054 O  O     . SER A 1 401 ? -4.794  5.590   -60.983 1.00 21.01  ? 395 SER A O     1 
ATOM   3055 C  CB    . SER A 1 401 ? -3.809  2.832   -61.495 1.00 17.91  ? 395 SER A CB    1 
ATOM   3056 O  OG    . SER A 1 401 ? -3.810  3.139   -62.882 1.00 20.05  ? 395 SER A OG    1 
ATOM   3057 N  N     . LYS A 1 402 ? -6.706  4.776   -61.844 1.00 17.48  ? 396 LYS A N     1 
ATOM   3058 C  CA    . LYS A 1 402 ? -7.166  6.072   -62.346 1.00 17.10  ? 396 LYS A CA    1 
ATOM   3059 C  C     . LYS A 1 402 ? -8.421  6.584   -61.632 1.00 17.68  ? 396 LYS A C     1 
ATOM   3060 O  O     . LYS A 1 402 ? -8.840  7.710   -61.857 1.00 18.49  ? 396 LYS A O     1 
ATOM   3061 C  CB    . LYS A 1 402 ? -7.429  5.999   -63.859 1.00 19.80  ? 396 LYS A CB    1 
ATOM   3062 C  CG    . LYS A 1 402 ? -6.206  5.662   -64.710 1.00 22.65  ? 396 LYS A CG    1 
ATOM   3063 C  CD    . LYS A 1 402 ? -5.348  6.902   -65.006 1.00 40.91  ? 396 LYS A CD    1 
ATOM   3064 C  CE    . LYS A 1 402 ? -4.060  6.556   -65.773 1.00 42.87  ? 396 LYS A CE    1 
ATOM   3065 N  NZ    . LYS A 1 402 ? -2.922  6.136   -64.880 1.00 39.98  ? 396 LYS A NZ    1 
ATOM   3066 N  N     . ILE A 1 403 ? -9.016  5.753   -60.781 1.00 20.99  ? 397 ILE A N     1 
ATOM   3067 C  CA    . ILE A 1 403 ? -10.241 6.097   -60.063 1.00 14.80  ? 397 ILE A CA    1 
ATOM   3068 C  C     . ILE A 1 403 ? -10.052 7.354   -59.229 1.00 17.88  ? 397 ILE A C     1 
ATOM   3069 O  O     . ILE A 1 403 ? -10.951 8.198   -59.130 1.00 18.32  ? 397 ILE A O     1 
ATOM   3070 C  CB    . ILE A 1 403 ? -10.673 4.942   -59.140 1.00 16.99  ? 397 ILE A CB    1 
ATOM   3071 C  CG1   . ILE A 1 403 ? -11.165 3.765   -59.982 1.00 20.24  ? 397 ILE A CG1   1 
ATOM   3072 C  CG2   . ILE A 1 403 ? -11.756 5.388   -58.163 1.00 10.31  ? 397 ILE A CG2   1 
ATOM   3073 C  CD1   . ILE A 1 403 ? -11.537 2.539   -59.192 1.00 20.74  ? 397 ILE A CD1   1 
ATOM   3074 N  N     . ARG A 1 404 ? -8.862  7.497   -58.656 1.00 17.28  ? 398 ARG A N     1 
ATOM   3075 C  CA    . ARG A 1 404 ? -8.556  8.645   -57.808 1.00 12.52  ? 398 ARG A CA    1 
ATOM   3076 C  C     . ARG A 1 404 ? -8.696  9.947   -58.577 1.00 17.47  ? 398 ARG A C     1 
ATOM   3077 O  O     . ARG A 1 404 ? -8.748  11.017  -57.985 1.00 22.80  ? 398 ARG A O     1 
ATOM   3078 C  CB    . ARG A 1 404 ? -7.143  8.525   -57.262 1.00 12.09  ? 398 ARG A CB    1 
ATOM   3079 C  CG    . ARG A 1 404 ? -6.982  9.024   -55.868 1.00 14.22  ? 398 ARG A CG    1 
ATOM   3080 C  CD    . ARG A 1 404 ? -5.641  8.612   -55.308 1.00 14.67  ? 398 ARG A CD    1 
ATOM   3081 N  NE    . ARG A 1 404 ? -4.547  9.257   -56.021 1.00 22.86  ? 398 ARG A NE    1 
ATOM   3082 C  CZ    . ARG A 1 404 ? -3.755  8.641   -56.897 1.00 26.08  ? 398 ARG A CZ    1 
ATOM   3083 N  NH1   . ARG A 1 404 ? -3.927  7.346   -57.169 1.00 26.54  ? 398 ARG A NH1   1 
ATOM   3084 N  NH2   . ARG A 1 404 ? -2.782  9.320   -57.493 1.00 16.93  ? 398 ARG A NH2   1 
ATOM   3085 N  N     . VAL A 1 405 ? -8.758  9.850   -59.900 1.00 16.52  ? 399 VAL A N     1 
ATOM   3086 C  CA    . VAL A 1 405 ? -8.873  11.018  -60.751 1.00 16.45  ? 399 VAL A CA    1 
ATOM   3087 C  C     . VAL A 1 405 ? -10.323 11.471  -60.842 1.00 19.97  ? 399 VAL A C     1 
ATOM   3088 O  O     . VAL A 1 405 ? -10.602 12.670  -60.717 1.00 22.41  ? 399 VAL A O     1 
ATOM   3089 C  CB    . VAL A 1 405 ? -8.268  10.754  -62.158 1.00 20.56  ? 399 VAL A CB    1 
ATOM   3090 C  CG1   . VAL A 1 405 ? -8.832  11.722  -63.210 1.00 19.11  ? 399 VAL A CG1   1 
ATOM   3091 C  CG2   . VAL A 1 405 ? -6.748  10.821  -62.096 1.00 13.81  ? 399 VAL A CG2   1 
ATOM   3092 N  N     . LEU A 1 406 ? -11.230 10.514  -61.058 1.00 16.49  ? 400 LEU A N     1 
ATOM   3093 C  CA    . LEU A 1 406 ? -12.670 10.778  -61.069 1.00 15.16  ? 400 LEU A CA    1 
ATOM   3094 C  C     . LEU A 1 406 ? -13.038 11.453  -59.764 1.00 20.69  ? 400 LEU A C     1 
ATOM   3095 O  O     . LEU A 1 406 ? -13.720 12.485  -59.760 1.00 20.73  ? 400 LEU A O     1 
ATOM   3096 C  CB    . LEU A 1 406 ? -13.450 9.471   -61.184 1.00 14.67  ? 400 LEU A CB    1 
ATOM   3097 C  CG    . LEU A 1 406 ? -14.968 9.376   -61.446 1.00 15.71  ? 400 LEU A CG    1 
ATOM   3098 C  CD1   . LEU A 1 406 ? -15.632 8.480   -60.416 1.00 17.97  ? 400 LEU A CD1   1 
ATOM   3099 C  CD2   . LEU A 1 406 ? -15.706 10.698  -61.543 1.00 11.84  ? 400 LEU A CD2   1 
ATOM   3100 N  N     . VAL A 1 407 ? -12.579 10.865  -58.660 1.00 15.04  ? 401 VAL A N     1 
ATOM   3101 C  CA    . VAL A 1 407 ? -12.786 11.451  -57.346 1.00 17.83  ? 401 VAL A CA    1 
ATOM   3102 C  C     . VAL A 1 407 ? -12.332 12.902  -57.376 1.00 16.96  ? 401 VAL A C     1 
ATOM   3103 O  O     . VAL A 1 407 ? -13.064 13.797  -56.965 1.00 14.12  ? 401 VAL A O     1 
ATOM   3104 C  CB    . VAL A 1 407 ? -12.007 10.699  -56.254 1.00 14.00  ? 401 VAL A CB    1 
ATOM   3105 C  CG1   . VAL A 1 407 ? -12.018 11.490  -54.968 1.00 8.64   ? 401 VAL A CG1   1 
ATOM   3106 C  CG2   . VAL A 1 407 ? -12.577 9.307   -56.054 1.00 9.05   ? 401 VAL A CG2   1 
ATOM   3107 N  N     . GLY A 1 408 ? -11.130 13.116  -57.904 1.00 19.85  ? 402 GLY A N     1 
ATOM   3108 C  CA    . GLY A 1 408 ? -10.551 14.442  -58.023 1.00 19.14  ? 402 GLY A CA    1 
ATOM   3109 C  C     . GLY A 1 408 ? -11.464 15.394  -58.764 1.00 21.07  ? 402 GLY A C     1 
ATOM   3110 O  O     . GLY A 1 408 ? -11.729 16.503  -58.296 1.00 18.55  ? 402 GLY A O     1 
ATOM   3111 N  N     . ASN A 1 409 ? -11.950 14.953  -59.921 1.00 21.05  ? 403 ASN A N     1 
ATOM   3112 C  CA    . ASN A 1 409 ? -12.881 15.748  -60.706 1.00 21.29  ? 403 ASN A CA    1 
ATOM   3113 C  C     . ASN A 1 409 ? -14.093 16.103  -59.859 1.00 22.94  ? 403 ASN A C     1 
ATOM   3114 O  O     . ASN A 1 409 ? -14.498 17.267  -59.770 1.00 22.36  ? 403 ASN A O     1 
ATOM   3115 C  CB    . ASN A 1 409 ? -13.318 14.990  -61.964 1.00 24.30  ? 403 ASN A CB    1 
ATOM   3116 C  CG    . ASN A 1 409 ? -12.170 14.764  -62.943 1.00 33.59  ? 403 ASN A CG    1 
ATOM   3117 O  OD1   . ASN A 1 409 ? -11.009 15.099  -62.654 1.00 29.76  ? 403 ASN A OD1   1 
ATOM   3118 N  ND2   . ASN A 1 409 ? -12.488 14.188  -64.111 1.00 27.50  ? 403 ASN A ND2   1 
ATOM   3119 N  N     . LEU A 1 410 ? -14.648 15.090  -59.208 1.00 21.94  ? 404 LEU A N     1 
ATOM   3120 C  CA    . LEU A 1 410 ? -15.840 15.278  -58.403 1.00 19.49  ? 404 LEU A CA    1 
ATOM   3121 C  C     . LEU A 1 410 ? -15.613 16.233  -57.233 1.00 22.29  ? 404 LEU A C     1 
ATOM   3122 O  O     . LEU A 1 410 ? -16.515 16.963  -56.836 1.00 25.92  ? 404 LEU A O     1 
ATOM   3123 C  CB    . LEU A 1 410 ? -16.342 13.939  -57.901 1.00 14.69  ? 404 LEU A CB    1 
ATOM   3124 C  CG    . LEU A 1 410 ? -16.924 13.027  -58.970 1.00 14.28  ? 404 LEU A CG    1 
ATOM   3125 C  CD1   . LEU A 1 410 ? -16.996 11.653  -58.381 1.00 16.34  ? 404 LEU A CD1   1 
ATOM   3126 C  CD2   . LEU A 1 410 ? -18.304 13.503  -59.438 1.00 9.57   ? 404 LEU A CD2   1 
ATOM   3127 N  N     . GLU A 1 411 ? -14.409 16.243  -56.684 1.00 19.74  ? 405 GLU A N     1 
ATOM   3128 C  CA    . GLU A 1 411 ? -14.138 17.115  -55.555 1.00 17.72  ? 405 GLU A CA    1 
ATOM   3129 C  C     . GLU A 1 411 ? -14.075 18.578  -55.983 1.00 20.43  ? 405 GLU A C     1 
ATOM   3130 O  O     . GLU A 1 411 ? -14.425 19.470  -55.204 1.00 21.39  ? 405 GLU A O     1 
ATOM   3131 C  CB    . GLU A 1 411 ? -12.862 16.682  -54.827 1.00 16.73  ? 405 GLU A CB    1 
ATOM   3132 C  CG    . GLU A 1 411 ? -13.024 15.365  -54.074 1.00 14.93  ? 405 GLU A CG    1 
ATOM   3133 C  CD    . GLU A 1 411 ? -11.811 15.007  -53.228 1.00 19.75  ? 405 GLU A CD    1 
ATOM   3134 O  OE1   . GLU A 1 411 ? -10.717 15.571  -53.473 1.00 21.25  ? 405 GLU A OE1   1 
ATOM   3135 O  OE2   . GLU A 1 411 ? -11.953 14.163  -52.314 1.00 16.92  ? 405 GLU A OE2   1 
ATOM   3136 N  N     . ARG A 1 412 ? -13.645 18.815  -57.225 1.00 22.97  ? 406 ARG A N     1 
ATOM   3137 C  CA    . ARG A 1 412 ? -13.555 20.170  -57.778 1.00 15.28  ? 406 ARG A CA    1 
ATOM   3138 C  C     . ARG A 1 412 ? -14.903 20.669  -58.259 1.00 16.96  ? 406 ARG A C     1 
ATOM   3139 O  O     . ARG A 1 412 ? -15.048 21.837  -58.618 1.00 18.96  ? 406 ARG A O     1 
ATOM   3140 C  CB    . ARG A 1 412 ? -12.534 20.236  -58.912 1.00 14.49  ? 406 ARG A CB    1 
ATOM   3141 C  CG    . ARG A 1 412 ? -11.113 20.432  -58.407 1.00 20.70  ? 406 ARG A CG    1 
ATOM   3142 C  CD    . ARG A 1 412 ? -10.043 20.375  -59.515 1.00 23.43  ? 406 ARG A CD    1 
ATOM   3143 N  NE    . ARG A 1 412 ? -9.607  19.012  -59.818 1.00 25.42  ? 406 ARG A NE    1 
ATOM   3144 C  CZ    . ARG A 1 412 ? -9.984  18.342  -60.901 1.00 25.63  ? 406 ARG A CZ    1 
ATOM   3145 N  NH1   . ARG A 1 412 ? -10.797 18.918  -61.780 1.00 26.70  ? 406 ARG A NH1   1 
ATOM   3146 N  NH2   . ARG A 1 412 ? -9.551  17.103  -61.103 1.00 23.88  ? 406 ARG A NH2   1 
ATOM   3147 N  N     . ASN A 1 413 ? -15.890 19.777  -58.267 1.00 18.91  ? 407 ASN A N     1 
ATOM   3148 C  CA    . ASN A 1 413 ? -17.260 20.157  -58.578 1.00 14.35  ? 407 ASN A CA    1 
ATOM   3149 C  C     . ASN A 1 413 ? -17.838 21.082  -57.509 1.00 16.46  ? 407 ASN A C     1 
ATOM   3150 O  O     . ASN A 1 413 ? -17.702 20.853  -56.317 1.00 22.27  ? 407 ASN A O     1 
ATOM   3151 C  CB    . ASN A 1 413 ? -18.120 18.918  -58.753 1.00 12.99  ? 407 ASN A CB    1 
ATOM   3152 C  CG    . ASN A 1 413 ? -19.517 19.235  -59.239 1.00 16.83  ? 407 ASN A CG    1 
ATOM   3153 O  OD1   . ASN A 1 413 ? -20.194 20.120  -58.713 1.00 13.88  ? 407 ASN A OD1   1 
ATOM   3154 N  ND2   . ASN A 1 413 ? -19.967 18.492  -60.244 1.00 17.57  ? 407 ASN A ND2   1 
ATOM   3155 N  N     . GLU A 1 414 ? -18.487 22.136  -57.961 1.00 18.19  ? 408 GLU A N     1 
ATOM   3156 C  CA    . GLU A 1 414 ? -19.046 23.157  -57.096 1.00 22.47  ? 408 GLU A CA    1 
ATOM   3157 C  C     . GLU A 1 414 ? -20.115 22.633  -56.137 1.00 27.60  ? 408 GLU A C     1 
ATOM   3158 O  O     . GLU A 1 414 ? -20.231 23.107  -54.994 1.00 28.46  ? 408 GLU A O     1 
ATOM   3159 C  CB    . GLU A 1 414 ? -19.655 24.241  -57.975 1.00 29.97  ? 408 GLU A CB    1 
ATOM   3160 C  CG    . GLU A 1 414 ? -20.221 25.412  -57.225 1.00 49.87  ? 408 GLU A CG    1 
ATOM   3161 C  CD    . GLU A 1 414 ? -21.079 26.282  -58.109 1.00 53.53  ? 408 GLU A CD    1 
ATOM   3162 O  OE1   . GLU A 1 414 ? -21.148 25.982  -59.334 1.00 29.73  ? 408 GLU A OE1   1 
ATOM   3163 O  OE2   . GLU A 1 414 ? -21.677 27.249  -57.567 1.00 55.47  ? 408 GLU A OE2   1 
ATOM   3164 N  N     . PHE A 1 415 ? -20.893 21.661  -56.606 1.00 26.38  ? 409 PHE A N     1 
ATOM   3165 C  CA    . PHE A 1 415 ? -22.055 21.178  -55.858 1.00 25.04  ? 409 PHE A CA    1 
ATOM   3166 C  C     . PHE A 1 415 ? -21.752 19.988  -54.975 1.00 25.20  ? 409 PHE A C     1 
ATOM   3167 O  O     . PHE A 1 415 ? -22.576 19.608  -54.152 1.00 27.17  ? 409 PHE A O     1 
ATOM   3168 C  CB    . PHE A 1 415 ? -23.210 20.836  -56.803 1.00 22.50  ? 409 PHE A CB    1 
ATOM   3169 C  CG    . PHE A 1 415 ? -23.690 22.011  -57.590 1.00 34.70  ? 409 PHE A CG    1 
ATOM   3170 C  CD1   . PHE A 1 415 ? -24.457 23.001  -56.981 1.00 36.00  ? 409 PHE A CD1   1 
ATOM   3171 C  CD2   . PHE A 1 415 ? -23.346 22.155  -58.923 1.00 28.95  ? 409 PHE A CD2   1 
ATOM   3172 C  CE1   . PHE A 1 415 ? -24.885 24.108  -57.688 1.00 30.31  ? 409 PHE A CE1   1 
ATOM   3173 C  CE2   . PHE A 1 415 ? -23.774 23.259  -59.638 1.00 38.24  ? 409 PHE A CE2   1 
ATOM   3174 C  CZ    . PHE A 1 415 ? -24.546 24.238  -59.019 1.00 36.13  ? 409 PHE A CZ    1 
ATOM   3175 N  N     . ILE A 1 416 ? -20.568 19.408  -55.130 1.00 21.01  ? 410 ILE A N     1 
ATOM   3176 C  CA    . ILE A 1 416 ? -20.261 18.185  -54.417 1.00 14.84  ? 410 ILE A CA    1 
ATOM   3177 C  C     . ILE A 1 416 ? -19.479 18.403  -53.136 1.00 15.00  ? 410 ILE A C     1 
ATOM   3178 O  O     . ILE A 1 416 ? -18.502 19.152  -53.075 1.00 14.58  ? 410 ILE A O     1 
ATOM   3179 C  CB    . ILE A 1 416 ? -19.605 17.155  -55.335 1.00 16.69  ? 410 ILE A CB    1 
ATOM   3180 C  CG1   . ILE A 1 416 ? -20.603 16.755  -56.420 1.00 18.45  ? 410 ILE A CG1   1 
ATOM   3181 C  CG2   . ILE A 1 416 ? -19.167 15.929  -54.558 1.00 14.38  ? 410 ILE A CG2   1 
ATOM   3182 C  CD1   . ILE A 1 416 ? -20.156 15.595  -57.256 1.00 17.76  ? 410 ILE A CD1   1 
ATOM   3183 N  N     . THR A 1 417 ? -19.947 17.712  -52.109 1.00 21.70  ? 411 THR A N     1 
ATOM   3184 C  CA    . THR A 1 417 ? -19.479 17.866  -50.748 1.00 15.21  ? 411 THR A CA    1 
ATOM   3185 C  C     . THR A 1 417 ? -18.593 16.700  -50.367 1.00 15.03  ? 411 THR A C     1 
ATOM   3186 O  O     . THR A 1 417 ? -17.625 16.854  -49.629 1.00 16.94  ? 411 THR A O     1 
ATOM   3187 C  CB    . THR A 1 417 ? -20.688 17.988  -49.845 1.00 15.31  ? 411 THR A CB    1 
ATOM   3188 O  OG1   . THR A 1 417 ? -20.981 19.382  -49.692 1.00 24.70  ? 411 THR A OG1   1 
ATOM   3189 C  CG2   . THR A 1 417 ? -20.471 17.343  -48.495 1.00 20.76  ? 411 THR A CG2   1 
ATOM   3190 N  N     . LEU A 1 418 ? -18.891 15.539  -50.933 1.00 18.40  ? 412 LEU A N     1 
ATOM   3191 C  CA    . LEU A 1 418 ? -18.119 14.343  -50.654 1.00 14.76  ? 412 LEU A CA    1 
ATOM   3192 C  C     . LEU A 1 418 ? -18.170 13.370  -51.835 1.00 14.72  ? 412 LEU A C     1 
ATOM   3193 O  O     . LEU A 1 418 ? -19.239 13.061  -52.356 1.00 14.23  ? 412 LEU A O     1 
ATOM   3194 C  CB    . LEU A 1 418 ? -18.679 13.664  -49.398 1.00 14.22  ? 412 LEU A CB    1 
ATOM   3195 C  CG    . LEU A 1 418 ? -17.930 12.475  -48.793 1.00 11.93  ? 412 LEU A CG    1 
ATOM   3196 C  CD1   . LEU A 1 418 ? -16.780 12.954  -47.929 1.00 11.99  ? 412 LEU A CD1   1 
ATOM   3197 C  CD2   . LEU A 1 418 ? -18.869 11.605  -47.993 1.00 11.24  ? 412 LEU A CD2   1 
ATOM   3198 N  N     . ALA A 1 419 ? -17.007 12.885  -52.247 1.00 14.52  ? 413 ALA A N     1 
ATOM   3199 C  CA    . ALA A 1 419 ? -16.936 11.779  -53.183 1.00 12.77  ? 413 ALA A CA    1 
ATOM   3200 C  C     . ALA A 1 419 ? -16.242 10.603  -52.498 1.00 15.88  ? 413 ALA A C     1 
ATOM   3201 O  O     . ALA A 1 419 ? -15.027 10.619  -52.287 1.00 16.74  ? 413 ALA A O     1 
ATOM   3202 C  CB    . ALA A 1 419 ? -16.195 12.184  -54.438 1.00 12.64  ? 413 ALA A CB    1 
ATOM   3203 N  N     . HIS A 1 420 ? -17.030 9.583   -52.170 1.00 16.95  ? 414 HIS A N     1 
ATOM   3204 C  CA    . HIS A 1 420 ? -16.589 8.451   -51.356 1.00 12.31  ? 414 HIS A CA    1 
ATOM   3205 C  C     . HIS A 1 420 ? -16.422 7.176   -52.166 1.00 13.03  ? 414 HIS A C     1 
ATOM   3206 O  O     . HIS A 1 420 ? -17.402 6.508   -52.505 1.00 13.92  ? 414 HIS A O     1 
ATOM   3207 C  CB    . HIS A 1 420 ? -17.623 8.202   -50.257 1.00 14.91  ? 414 HIS A CB    1 
ATOM   3208 C  CG    . HIS A 1 420 ? -17.218 7.160   -49.262 1.00 16.22  ? 414 HIS A CG    1 
ATOM   3209 N  ND1   . HIS A 1 420 ? -18.109 6.604   -48.371 1.00 13.48  ? 414 HIS A ND1   1 
ATOM   3210 C  CD2   . HIS A 1 420 ? -16.020 6.581   -49.010 1.00 14.76  ? 414 HIS A CD2   1 
ATOM   3211 C  CE1   . HIS A 1 420 ? -17.480 5.719   -47.620 1.00 16.00  ? 414 HIS A CE1   1 
ATOM   3212 N  NE2   . HIS A 1 420 ? -16.210 5.689   -47.986 1.00 16.51  ? 414 HIS A NE2   1 
ATOM   3213 N  N     . VAL A 1 421 ? -15.193 6.808   -52.481 1.00 11.82  ? 415 VAL A N     1 
ATOM   3214 C  CA    . VAL A 1 421 ? -15.049 5.540   -53.177 1.00 14.19  ? 415 VAL A CA    1 
ATOM   3215 C  C     . VAL A 1 421 ? -14.971 4.380   -52.195 1.00 11.42  ? 415 VAL A C     1 
ATOM   3216 O  O     . VAL A 1 421 ? -14.300 4.459   -51.179 1.00 13.61  ? 415 VAL A O     1 
ATOM   3217 C  CB    . VAL A 1 421 ? -13.873 5.514   -54.207 1.00 13.15  ? 415 VAL A CB    1 
ATOM   3218 C  CG1   . VAL A 1 421 ? -12.530 5.312   -53.529 1.00 8.13   ? 415 VAL A CG1   1 
ATOM   3219 C  CG2   . VAL A 1 421 ? -14.106 4.416   -55.220 1.00 14.68  ? 415 VAL A CG2   1 
ATOM   3220 N  N     . ASN A 1 422 ? -15.700 3.319   -52.504 1.00 13.62  ? 416 ASN A N     1 
ATOM   3221 C  CA    . ASN A 1 422 ? -15.583 2.045   -51.824 1.00 11.55  ? 416 ASN A CA    1 
ATOM   3222 C  C     . ASN A 1 422 ? -14.505 1.232   -52.527 1.00 14.18  ? 416 ASN A C     1 
ATOM   3223 O  O     . ASN A 1 422 ? -14.708 0.774   -53.645 1.00 18.04  ? 416 ASN A O     1 
ATOM   3224 C  CB    . ASN A 1 422 ? -16.929 1.337   -51.909 1.00 13.28  ? 416 ASN A CB    1 
ATOM   3225 C  CG    . ASN A 1 422 ? -16.908 -0.053  -51.333 1.00 20.66  ? 416 ASN A CG    1 
ATOM   3226 O  OD1   . ASN A 1 422 ? -15.850 -0.612  -51.037 1.00 22.33  ? 416 ASN A OD1   1 
ATOM   3227 N  ND2   . ASN A 1 422 ? -18.098 -0.632  -51.170 1.00 20.21  ? 416 ASN A ND2   1 
ATOM   3228 N  N     . PRO A 1 423 ? -13.356 1.035   -51.867 1.00 14.50  ? 417 PRO A N     1 
ATOM   3229 C  CA    . PRO A 1 423 ? -12.157 0.389   -52.434 1.00 13.87  ? 417 PRO A CA    1 
ATOM   3230 C  C     . PRO A 1 423 ? -12.255 -1.129  -52.651 1.00 15.82  ? 417 PRO A C     1 
ATOM   3231 O  O     . PRO A 1 423 ? -11.250 -1.816  -52.859 1.00 14.49  ? 417 PRO A O     1 
ATOM   3232 C  CB    . PRO A 1 423 ? -11.083 0.699   -51.398 1.00 8.45   ? 417 PRO A CB    1 
ATOM   3233 C  CG    . PRO A 1 423 ? -11.850 0.842   -50.130 1.00 13.45  ? 417 PRO A CG    1 
ATOM   3234 C  CD    . PRO A 1 423 ? -13.127 1.509   -50.494 1.00 11.24  ? 417 PRO A CD    1 
ATOM   3235 N  N     . GLN A 1 424 ? -13.467 -1.652  -52.595 1.00 18.96  ? 418 GLN A N     1 
ATOM   3236 C  CA    . GLN A 1 424 ? -13.688 -3.061  -52.857 1.00 23.97  ? 418 GLN A CA    1 
ATOM   3237 C  C     . GLN A 1 424 ? -14.356 -3.128  -54.213 1.00 26.60  ? 418 GLN A C     1 
ATOM   3238 O  O     . GLN A 1 424 ? -15.401 -2.506  -54.422 1.00 26.70  ? 418 GLN A O     1 
ATOM   3239 C  CB    . GLN A 1 424 ? -14.586 -3.678  -51.772 1.00 24.97  ? 418 GLN A CB    1 
ATOM   3240 C  CG    . GLN A 1 424 ? -14.874 -5.177  -51.912 1.00 30.84  ? 418 GLN A CG    1 
ATOM   3241 C  CD    . GLN A 1 424 ? -15.636 -5.748  -50.706 1.00 48.91  ? 418 GLN A CD    1 
ATOM   3242 O  OE1   . GLN A 1 424 ? -16.143 -5.002  -49.855 1.00 45.06  ? 418 GLN A OE1   1 
ATOM   3243 N  NE2   . GLN A 1 424 ? -15.713 -7.077  -50.629 1.00 50.19  ? 418 GLN A NE2   1 
ATOM   3244 N  N     . SER A 1 425 ? -13.741 -3.845  -55.148 1.00 22.39  ? 419 SER A N     1 
ATOM   3245 C  CA    . SER A 1 425 ? -14.378 -4.070  -56.431 1.00 21.32  ? 419 SER A CA    1 
ATOM   3246 C  C     . SER A 1 425 ? -15.236 -5.302  -56.273 1.00 27.68  ? 419 SER A C     1 
ATOM   3247 O  O     . SER A 1 425 ? -15.029 -6.109  -55.363 1.00 30.00  ? 419 SER A O     1 
ATOM   3248 C  CB    . SER A 1 425 ? -13.343 -4.294  -57.517 1.00 20.46  ? 419 SER A CB    1 
ATOM   3249 O  OG    . SER A 1 425 ? -12.593 -5.451  -57.230 1.00 22.01  ? 419 SER A OG    1 
ATOM   3250 N  N     . PHE A 1 426 ? -16.219 -5.439  -57.145 1.00 27.40  ? 420 PHE A N     1 
ATOM   3251 C  CA    . PHE A 1 426 ? -17.067 -6.612  -57.128 1.00 28.56  ? 420 PHE A CA    1 
ATOM   3252 C  C     . PHE A 1 426 ? -17.147 -7.153  -58.542 1.00 39.41  ? 420 PHE A C     1 
ATOM   3253 O  O     . PHE A 1 426 ? -16.776 -6.467  -59.493 1.00 43.30  ? 420 PHE A O     1 
ATOM   3254 C  CB    . PHE A 1 426 ? -18.453 -6.249  -56.624 1.00 24.95  ? 420 PHE A CB    1 
ATOM   3255 C  CG    . PHE A 1 426 ? -18.461 -5.694  -55.237 1.00 32.32  ? 420 PHE A CG    1 
ATOM   3256 C  CD1   . PHE A 1 426 ? -18.584 -6.535  -54.141 1.00 37.88  ? 420 PHE A CD1   1 
ATOM   3257 C  CD2   . PHE A 1 426 ? -18.345 -4.329  -55.020 1.00 29.29  ? 420 PHE A CD2   1 
ATOM   3258 C  CE1   . PHE A 1 426 ? -18.595 -6.027  -52.855 1.00 32.10  ? 420 PHE A CE1   1 
ATOM   3259 C  CE2   . PHE A 1 426 ? -18.354 -3.811  -53.731 1.00 27.22  ? 420 PHE A CE2   1 
ATOM   3260 C  CZ    . PHE A 1 426 ? -18.481 -4.660  -52.650 1.00 31.37  ? 420 PHE A CZ    1 
ATOM   3261 N  N     . PRO A 1 427 ? -17.588 -8.404  -58.688 1.00 37.88  ? 421 PRO A N     1 
ATOM   3262 C  CA    . PRO A 1 427 ? -17.865 -8.941  -60.025 1.00 37.10  ? 421 PRO A CA    1 
ATOM   3263 C  C     . PRO A 1 427 ? -19.323 -8.698  -60.413 1.00 45.82  ? 421 PRO A C     1 
ATOM   3264 O  O     . PRO A 1 427 ? -20.071 -8.142  -59.606 1.00 45.60  ? 421 PRO A O     1 
ATOM   3265 C  CB    . PRO A 1 427 ? -17.600 -10.438 -59.859 1.00 38.27  ? 421 PRO A CB    1 
ATOM   3266 C  CG    . PRO A 1 427 ? -16.883 -10.575 -58.522 1.00 41.13  ? 421 PRO A CG    1 
ATOM   3267 C  CD    . PRO A 1 427 ? -17.406 -9.469  -57.693 1.00 33.52  ? 421 PRO A CD    1 
ATOM   3268 N  N     . GLY A 1 428 ? -19.716 -9.104  -61.620 1.00 49.87  ? 422 GLY A N     1 
ATOM   3269 C  CA    . GLY A 1 428 ? -21.083 -8.914  -62.088 1.00 54.82  ? 422 GLY A CA    1 
ATOM   3270 C  C     . GLY A 1 428 ? -21.968 -10.145 -61.953 1.00 51.56  ? 422 GLY A C     1 
ATOM   3271 O  O     . GLY A 1 428 ? -23.195 -10.056 -62.042 1.00 42.98  ? 422 GLY A O     1 
ATOM   3272 N  N     . ASN A 1 437 ? -17.311 -13.395 -70.811 1.00 67.16  ? 431 ASN A N     1 
ATOM   3273 C  CA    . ASN A 1 437 ? -17.180 -11.972 -70.493 1.00 71.67  ? 431 ASN A CA    1 
ATOM   3274 C  C     . ASN A 1 437 ? -16.700 -11.696 -69.054 1.00 70.21  ? 431 ASN A C     1 
ATOM   3275 O  O     . ASN A 1 437 ? -17.178 -12.308 -68.092 1.00 71.02  ? 431 ASN A O     1 
ATOM   3276 C  CB    . ASN A 1 437 ? -18.503 -11.249 -70.767 1.00 68.12  ? 431 ASN A CB    1 
ATOM   3277 C  CG    . ASN A 1 437 ? -18.338 -9.744  -70.864 1.00 63.78  ? 431 ASN A CG    1 
ATOM   3278 O  OD1   . ASN A 1 437 ? -17.221 -9.235  -70.925 1.00 62.08  ? 431 ASN A OD1   1 
ATOM   3279 N  ND2   . ASN A 1 437 ? -19.456 -9.024  -70.888 1.00 67.15  ? 431 ASN A ND2   1 
ATOM   3280 N  N     . TYR A 1 438 ? -15.754 -10.771 -68.910 1.00 61.64  ? 432 TYR A N     1 
ATOM   3281 C  CA    . TYR A 1 438 ? -15.204 -10.441 -67.595 1.00 53.24  ? 432 TYR A CA    1 
ATOM   3282 C  C     . TYR A 1 438 ? -15.435 -8.983  -67.197 1.00 46.46  ? 432 TYR A C     1 
ATOM   3283 O  O     . TYR A 1 438 ? -15.216 -8.056  -67.982 1.00 44.25  ? 432 TYR A O     1 
ATOM   3284 C  CB    . TYR A 1 438 ? -13.718 -10.788 -67.538 1.00 51.73  ? 432 TYR A CB    1 
ATOM   3285 C  CG    . TYR A 1 438 ? -13.450 -12.231 -67.882 1.00 67.86  ? 432 TYR A CG    1 
ATOM   3286 C  CD1   . TYR A 1 438 ? -14.228 -13.254 -67.336 1.00 68.16  ? 432 TYR A CD1   1 
ATOM   3287 C  CD2   . TYR A 1 438 ? -12.441 -12.575 -68.769 1.00 60.65  ? 432 TYR A CD2   1 
ATOM   3288 C  CE1   . TYR A 1 438 ? -13.991 -14.577 -67.658 1.00 61.75  ? 432 TYR A CE1   1 
ATOM   3289 C  CE2   . TYR A 1 438 ? -12.203 -13.890 -69.097 1.00 61.21  ? 432 TYR A CE2   1 
ATOM   3290 C  CZ    . TYR A 1 438 ? -12.970 -14.885 -68.538 1.00 64.26  ? 432 TYR A CZ    1 
ATOM   3291 O  OH    . TYR A 1 438 ? -12.714 -16.191 -68.875 1.00 70.77  ? 432 TYR A OH    1 
ATOM   3292 N  N     . VAL A 1 439 ? -15.873 -8.791  -65.961 1.00 45.43  ? 433 VAL A N     1 
ATOM   3293 C  CA    . VAL A 1 439 ? -16.226 -7.464  -65.486 1.00 45.25  ? 433 VAL A CA    1 
ATOM   3294 C  C     . VAL A 1 439 ? -15.798 -7.211  -64.036 1.00 40.81  ? 433 VAL A C     1 
ATOM   3295 O  O     . VAL A 1 439 ? -15.518 -8.136  -63.273 1.00 35.07  ? 433 VAL A O     1 
ATOM   3296 C  CB    . VAL A 1 439 ? -17.750 -7.210  -65.628 1.00 39.12  ? 433 VAL A CB    1 
ATOM   3297 C  CG1   . VAL A 1 439 ? -18.482 -7.533  -64.331 1.00 38.29  ? 433 VAL A CG1   1 
ATOM   3298 C  CG2   . VAL A 1 439 ? -18.008 -5.781  -66.031 1.00 30.92  ? 433 VAL A CG2   1 
ATOM   3299 N  N     . SER A 1 440 ? -15.741 -5.934  -63.680 1.00 41.67  ? 434 SER A N     1 
ATOM   3300 C  CA    . SER A 1 440 ? -15.558 -5.513  -62.301 1.00 36.72  ? 434 SER A CA    1 
ATOM   3301 C  C     . SER A 1 440 ? -16.233 -4.154  -62.113 1.00 31.29  ? 434 SER A C     1 
ATOM   3302 O  O     . SER A 1 440 ? -16.304 -3.351  -63.043 1.00 33.16  ? 434 SER A O     1 
ATOM   3303 C  CB    . SER A 1 440 ? -14.072 -5.439  -61.963 1.00 31.41  ? 434 SER A CB    1 
ATOM   3304 O  OG    . SER A 1 440 ? -13.455 -6.689  -62.194 1.00 32.95  ? 434 SER A OG    1 
ATOM   3305 N  N     . MET A 1 441 ? -16.752 -3.895  -60.922 1.00 33.73  ? 435 MET A N     1 
ATOM   3306 C  CA    . MET A 1 441 ? -17.330 -2.585  -60.657 1.00 29.61  ? 435 MET A CA    1 
ATOM   3307 C  C     . MET A 1 441 ? -16.884 -1.987  -59.331 1.00 23.41  ? 435 MET A C     1 
ATOM   3308 O  O     . MET A 1 441 ? -16.566 -2.699  -58.371 1.00 20.38  ? 435 MET A O     1 
ATOM   3309 C  CB    . MET A 1 441 ? -18.860 -2.629  -60.761 1.00 32.21  ? 435 MET A CB    1 
ATOM   3310 C  CG    . MET A 1 441 ? -19.449 -4.023  -60.622 1.00 35.75  ? 435 MET A CG    1 
ATOM   3311 S  SD    . MET A 1 441 ? -21.086 -4.224  -61.369 1.00 38.28  ? 435 MET A SD    1 
ATOM   3312 C  CE    . MET A 1 441 ? -22.105 -3.165  -60.357 1.00 28.15  ? 435 MET A CE    1 
ATOM   3313 N  N     . TRP A 1 442 ? -16.837 -0.664  -59.309 1.00 20.03  ? 436 TRP A N     1 
ATOM   3314 C  CA    . TRP A 1 442 ? -16.600 0.072   -58.086 1.00 15.76  ? 436 TRP A CA    1 
ATOM   3315 C  C     . TRP A 1 442 ? -17.765 1.013   -57.883 1.00 16.77  ? 436 TRP A C     1 
ATOM   3316 O  O     . TRP A 1 442 ? -18.486 1.311   -58.819 1.00 23.50  ? 436 TRP A O     1 
ATOM   3317 C  CB    . TRP A 1 442 ? -15.316 0.869   -58.189 1.00 13.32  ? 436 TRP A CB    1 
ATOM   3318 C  CG    . TRP A 1 442 ? -14.088 0.045   -58.342 1.00 14.68  ? 436 TRP A CG    1 
ATOM   3319 C  CD1   . TRP A 1 442 ? -13.265 -0.371  -57.357 1.00 19.70  ? 436 TRP A CD1   1 
ATOM   3320 C  CD2   . TRP A 1 442 ? -13.532 -0.444  -59.560 1.00 18.57  ? 436 TRP A CD2   1 
ATOM   3321 N  NE1   . TRP A 1 442 ? -12.219 -1.099  -57.874 1.00 19.94  ? 436 TRP A NE1   1 
ATOM   3322 C  CE2   . TRP A 1 442 ? -12.361 -1.153  -59.230 1.00 19.94  ? 436 TRP A CE2   1 
ATOM   3323 C  CE3   . TRP A 1 442 ? -13.904 -0.345  -60.899 1.00 22.03  ? 436 TRP A CE3   1 
ATOM   3324 C  CZ2   . TRP A 1 442 ? -11.565 -1.759  -60.184 1.00 21.77  ? 436 TRP A CZ2   1 
ATOM   3325 C  CZ3   . TRP A 1 442 ? -13.113 -0.943  -61.843 1.00 23.05  ? 436 TRP A CZ3   1 
ATOM   3326 C  CH2   . TRP A 1 442 ? -11.954 -1.644  -61.483 1.00 24.04  ? 436 TRP A CH2   1 
ATOM   3327 N  N     . PHE A 1 443 ? -17.965 1.478   -56.660 1.00 19.76  ? 437 PHE A N     1 
ATOM   3328 C  CA    . PHE A 1 443 ? -19.087 2.357   -56.376 1.00 14.30  ? 437 PHE A CA    1 
ATOM   3329 C  C     . PHE A 1 443 ? -18.557 3.576   -55.678 1.00 22.45  ? 437 PHE A C     1 
ATOM   3330 O  O     . PHE A 1 443 ? -17.719 3.466   -54.773 1.00 22.25  ? 437 PHE A O     1 
ATOM   3331 C  CB    . PHE A 1 443 ? -20.117 1.662   -55.487 1.00 14.63  ? 437 PHE A CB    1 
ATOM   3332 C  CG    . PHE A 1 443 ? -20.734 0.451   -56.116 1.00 17.51  ? 437 PHE A CG    1 
ATOM   3333 C  CD1   . PHE A 1 443 ? -20.021 -0.730  -56.228 1.00 16.15  ? 437 PHE A CD1   1 
ATOM   3334 C  CD2   . PHE A 1 443 ? -22.024 0.493   -56.607 1.00 15.37  ? 437 PHE A CD2   1 
ATOM   3335 C  CE1   . PHE A 1 443 ? -20.580 -1.828  -56.817 1.00 17.41  ? 437 PHE A CE1   1 
ATOM   3336 C  CE2   . PHE A 1 443 ? -22.585 -0.614  -57.189 1.00 16.40  ? 437 PHE A CE2   1 
ATOM   3337 C  CZ    . PHE A 1 443 ? -21.866 -1.773  -57.289 1.00 17.13  ? 437 PHE A CZ    1 
ATOM   3338 N  N     . LEU A 1 444 ? -19.012 4.743   -56.123 1.00 23.05  ? 438 LEU A N     1 
ATOM   3339 C  CA    . LEU A 1 444 ? -18.737 5.973   -55.406 1.00 15.89  ? 438 LEU A CA    1 
ATOM   3340 C  C     . LEU A 1 444 ? -20.043 6.431   -54.823 1.00 18.91  ? 438 LEU A C     1 
ATOM   3341 O  O     . LEU A 1 444 ? -21.091 6.256   -55.434 1.00 19.09  ? 438 LEU A O     1 
ATOM   3342 C  CB    . LEU A 1 444 ? -18.182 7.043   -56.333 1.00 16.66  ? 438 LEU A CB    1 
ATOM   3343 C  CG    . LEU A 1 444 ? -16.668 7.060   -56.525 1.00 17.53  ? 438 LEU A CG    1 
ATOM   3344 C  CD1   . LEU A 1 444 ? -16.244 6.173   -57.664 1.00 13.36  ? 438 LEU A CD1   1 
ATOM   3345 C  CD2   . LEU A 1 444 ? -16.210 8.471   -56.769 1.00 20.00  ? 438 LEU A CD2   1 
ATOM   3346 N  N     . GLY A 1 445 ? -19.987 6.989   -53.625 1.00 17.78  ? 439 GLY A N     1 
ATOM   3347 C  CA    . GLY A 1 445 ? -21.160 7.582   -53.021 1.00 15.38  ? 439 GLY A CA    1 
ATOM   3348 C  C     . GLY A 1 445 ? -20.959 9.075   -53.034 1.00 18.37  ? 439 GLY A C     1 
ATOM   3349 O  O     . GLY A 1 445 ? -19.832 9.553   -52.898 1.00 20.10  ? 439 GLY A O     1 
ATOM   3350 N  N     . ILE A 1 446 ? -22.032 9.830   -53.226 1.00 17.98  ? 440 ILE A N     1 
ATOM   3351 C  CA    . ILE A 1 446 ? -21.868 11.260  -53.396 1.00 15.80  ? 440 ILE A CA    1 
ATOM   3352 C  C     . ILE A 1 446 ? -22.812 12.038  -52.505 1.00 17.75  ? 440 ILE A C     1 
ATOM   3353 O  O     . ILE A 1 446 ? -23.929 11.613  -52.242 1.00 22.50  ? 440 ILE A O     1 
ATOM   3354 C  CB    . ILE A 1 446 ? -22.030 11.664  -54.870 1.00 15.42  ? 440 ILE A CB    1 
ATOM   3355 C  CG1   . ILE A 1 446 ? -21.107 10.815  -55.735 1.00 12.42  ? 440 ILE A CG1   1 
ATOM   3356 C  CG2   . ILE A 1 446 ? -21.713 13.133  -55.071 1.00 13.20  ? 440 ILE A CG2   1 
ATOM   3357 C  CD1   . ILE A 1 446 ? -21.109 11.215  -57.144 1.00 18.10  ? 440 ILE A CD1   1 
ATOM   3358 N  N     . ILE A 1 447 ? -22.327 13.165  -52.007 1.00 16.13  ? 441 ILE A N     1 
ATOM   3359 C  CA    . ILE A 1 447 ? -23.157 14.097  -51.288 1.00 17.07  ? 441 ILE A CA    1 
ATOM   3360 C  C     . ILE A 1 447 ? -23.148 15.432  -52.044 1.00 19.98  ? 441 ILE A C     1 
ATOM   3361 O  O     . ILE A 1 447 ? -22.076 15.978  -52.329 1.00 15.14  ? 441 ILE A O     1 
ATOM   3362 C  CB    . ILE A 1 447 ? -22.621 14.310  -49.859 1.00 17.15  ? 441 ILE A CB    1 
ATOM   3363 C  CG1   . ILE A 1 447 ? -22.562 12.986  -49.105 1.00 16.73  ? 441 ILE A CG1   1 
ATOM   3364 C  CG2   . ILE A 1 447 ? -23.464 15.315  -49.096 1.00 10.68  ? 441 ILE A CG2   1 
ATOM   3365 C  CD1   . ILE A 1 447 ? -22.101 13.136  -47.659 1.00 12.04  ? 441 ILE A CD1   1 
ATOM   3366 N  N     . PHE A 1 448 ? -24.342 15.932  -52.375 1.00 18.01  ? 442 PHE A N     1 
ATOM   3367 C  CA    . PHE A 1 448 ? -24.522 17.290  -52.882 1.00 13.76  ? 442 PHE A CA    1 
ATOM   3368 C  C     . PHE A 1 448 ? -24.854 18.298  -51.783 1.00 19.39  ? 442 PHE A C     1 
ATOM   3369 O  O     . PHE A 1 448 ? -25.086 17.929  -50.636 1.00 29.00  ? 442 PHE A O     1 
ATOM   3370 C  CB    . PHE A 1 448 ? -25.630 17.329  -53.913 1.00 15.16  ? 442 PHE A CB    1 
ATOM   3371 C  CG    . PHE A 1 448 ? -25.344 16.525  -55.120 1.00 18.15  ? 442 PHE A CG    1 
ATOM   3372 C  CD1   . PHE A 1 448 ? -24.301 16.878  -55.966 1.00 20.49  ? 442 PHE A CD1   1 
ATOM   3373 C  CD2   . PHE A 1 448 ? -26.118 15.419  -55.428 1.00 14.68  ? 442 PHE A CD2   1 
ATOM   3374 C  CE1   . PHE A 1 448 ? -24.027 16.129  -57.096 1.00 18.98  ? 442 PHE A CE1   1 
ATOM   3375 C  CE2   . PHE A 1 448 ? -25.854 14.675  -56.550 1.00 14.54  ? 442 PHE A CE2   1 
ATOM   3376 C  CZ    . PHE A 1 448 ? -24.806 15.028  -57.388 1.00 15.48  ? 442 PHE A CZ    1 
ATOM   3377 N  N     . ARG A 1 449 ? -24.907 19.572  -52.153 1.00 17.52  ? 443 ARG A N     1 
ATOM   3378 C  CA    . ARG A 1 449 ? -25.041 20.653  -51.196 1.00 16.95  ? 443 ARG A CA    1 
ATOM   3379 C  C     . ARG A 1 449 ? -26.496 21.038  -50.979 1.00 19.66  ? 443 ARG A C     1 
ATOM   3380 O  O     . ARG A 1 449 ? -27.373 20.608  -51.722 1.00 25.48  ? 443 ARG A O     1 
ATOM   3381 C  CB    . ARG A 1 449 ? -24.238 21.856  -51.681 1.00 24.01  ? 443 ARG A CB    1 
ATOM   3382 C  CG    . ARG A 1 449 ? -24.831 23.195  -51.289 1.00 36.98  ? 443 ARG A CG    1 
ATOM   3383 C  CD    . ARG A 1 449 ? -25.060 24.084  -52.512 1.00 36.15  ? 443 ARG A CD    1 
ATOM   3384 N  NE    . ARG A 1 449 ? -23.821 24.371  -53.238 1.00 37.60  ? 443 ARG A NE    1 
ATOM   3385 C  CZ    . ARG A 1 449 ? -23.717 25.246  -54.237 1.00 39.28  ? 443 ARG A CZ    1 
ATOM   3386 N  NH1   . ARG A 1 449 ? -22.545 25.438  -54.830 1.00 39.67  ? 443 ARG A NH1   1 
ATOM   3387 N  NH2   . ARG A 1 449 ? -24.781 25.938  -54.639 1.00 36.71  ? 443 ARG A NH2   1 
ATOM   3388 N  N     . ASP A 1 460 ? -26.601 17.056  -62.243 1.00 31.01  ? 454 ASP A N     1 
ATOM   3389 C  CA    . ASP A 1 460 ? -26.278 16.418  -63.528 1.00 49.09  ? 454 ASP A CA    1 
ATOM   3390 C  C     . ASP A 1 460 ? -24.751 16.312  -63.767 1.00 52.23  ? 454 ASP A C     1 
ATOM   3391 O  O     . ASP A 1 460 ? -24.129 17.228  -64.327 1.00 39.43  ? 454 ASP A O     1 
ATOM   3392 C  CB    . ASP A 1 460 ? -26.965 17.179  -64.677 1.00 55.33  ? 454 ASP A CB    1 
ATOM   3393 C  CG    . ASP A 1 460 ? -26.780 16.510  -66.052 1.00 56.77  ? 454 ASP A CG    1 
ATOM   3394 O  OD1   . ASP A 1 460 ? -25.629 16.470  -66.553 1.00 46.72  ? 454 ASP A OD1   1 
ATOM   3395 O  OD2   . ASP A 1 460 ? -27.796 16.062  -66.649 1.00 44.73  ? 454 ASP A OD2   1 
ATOM   3396 N  N     . LEU A 1 461 ? -24.152 15.189  -63.364 1.00 42.44  ? 455 LEU A N     1 
ATOM   3397 C  CA    . LEU A 1 461 ? -22.691 15.054  -63.412 1.00 40.20  ? 455 LEU A CA    1 
ATOM   3398 C  C     . LEU A 1 461 ? -22.181 14.098  -64.479 1.00 37.19  ? 455 LEU A C     1 
ATOM   3399 O  O     . LEU A 1 461 ? -21.227 13.356  -64.260 1.00 34.19  ? 455 LEU A O     1 
ATOM   3400 C  CB    . LEU A 1 461 ? -22.119 14.666  -62.042 1.00 27.88  ? 455 LEU A CB    1 
ATOM   3401 C  CG    . LEU A 1 461 ? -23.006 13.873  -61.089 1.00 25.21  ? 455 LEU A CG    1 
ATOM   3402 C  CD1   . LEU A 1 461 ? -23.187 12.462  -61.562 1.00 31.66  ? 455 LEU A CD1   1 
ATOM   3403 C  CD2   . LEU A 1 461 ? -22.416 13.885  -59.708 1.00 26.37  ? 455 LEU A CD2   1 
ATOM   3404 N  N     . THR A 1 462 ? -22.808 14.141  -65.643 1.00 42.17  ? 456 THR A N     1 
ATOM   3405 C  CA    . THR A 1 462 ? -22.438 13.258  -66.738 1.00 49.30  ? 456 THR A CA    1 
ATOM   3406 C  C     . THR A 1 462 ? -21.132 13.686  -67.424 1.00 45.19  ? 456 THR A C     1 
ATOM   3407 O  O     . THR A 1 462 ? -20.478 12.894  -68.101 1.00 40.16  ? 456 THR A O     1 
ATOM   3408 C  CB    . THR A 1 462 ? -23.571 13.205  -67.755 1.00 52.53  ? 456 THR A CB    1 
ATOM   3409 O  OG1   . THR A 1 462 ? -23.620 14.444  -68.472 1.00 51.52  ? 456 THR A OG1   1 
ATOM   3410 C  CG2   . THR A 1 462 ? -24.897 12.989  -67.026 1.00 43.28  ? 456 THR A CG2   1 
ATOM   3411 N  N     . TYR A 1 463 ? -20.749 14.939  -67.220 1.00 46.94  ? 457 TYR A N     1 
ATOM   3412 C  CA    . TYR A 1 463 ? -19.556 15.480  -67.848 1.00 47.00  ? 457 TYR A CA    1 
ATOM   3413 C  C     . TYR A 1 463 ? -18.368 15.576  -66.899 1.00 42.42  ? 457 TYR A C     1 
ATOM   3414 O  O     . TYR A 1 463 ? -17.265 15.923  -67.318 1.00 47.41  ? 457 TYR A O     1 
ATOM   3415 C  CB    . TYR A 1 463 ? -19.848 16.851  -68.468 1.00 66.19  ? 457 TYR A CB    1 
ATOM   3416 C  CG    . TYR A 1 463 ? -20.640 16.775  -69.755 1.00 63.25  ? 457 TYR A CG    1 
ATOM   3417 C  CD1   . TYR A 1 463 ? -20.016 16.469  -70.960 1.00 66.41  ? 457 TYR A CD1   1 
ATOM   3418 C  CD2   . TYR A 1 463 ? -22.010 17.002  -69.764 1.00 61.23  ? 457 TYR A CD2   1 
ATOM   3419 C  CE1   . TYR A 1 463 ? -20.734 16.389  -72.135 1.00 72.69  ? 457 TYR A CE1   1 
ATOM   3420 C  CE2   . TYR A 1 463 ? -22.737 16.925  -70.933 1.00 66.08  ? 457 TYR A CE2   1 
ATOM   3421 C  CZ    . TYR A 1 463 ? -22.096 16.617  -72.118 1.00 79.25  ? 457 TYR A CZ    1 
ATOM   3422 O  OH    . TYR A 1 463 ? -22.821 16.540  -73.290 1.00 88.39  ? 457 TYR A OH    1 
ATOM   3423 N  N     . ASP A 1 464 ? -18.586 15.302  -65.620 1.00 38.29  ? 458 ASP A N     1 
ATOM   3424 C  CA    . ASP A 1 464 ? -17.456 15.094  -64.729 1.00 36.98  ? 458 ASP A CA    1 
ATOM   3425 C  C     . ASP A 1 464 ? -17.027 13.666  -65.013 1.00 35.24  ? 458 ASP A C     1 
ATOM   3426 O  O     . ASP A 1 464 ? -15.866 13.296  -64.829 1.00 30.67  ? 458 ASP A O     1 
ATOM   3427 C  CB    . ASP A 1 464 ? -17.855 15.243  -63.256 1.00 30.40  ? 458 ASP A CB    1 
ATOM   3428 C  CG    . ASP A 1 464 ? -17.749 16.672  -62.752 1.00 33.36  ? 458 ASP A CG    1 
ATOM   3429 O  OD1   . ASP A 1 464 ? -16.617 17.139  -62.511 1.00 41.24  ? 458 ASP A OD1   1 
ATOM   3430 O  OD2   . ASP A 1 464 ? -18.797 17.325  -62.573 1.00 34.07  ? 458 ASP A OD2   1 
ATOM   3431 N  N     . ILE A 1 465 ? -17.999 12.882  -65.479 1.00 35.54  ? 459 ILE A N     1 
ATOM   3432 C  CA    . ILE A 1 465 ? -17.843 11.458  -65.732 1.00 33.85  ? 459 ILE A CA    1 
ATOM   3433 C  C     . ILE A 1 465 ? -17.203 11.225  -67.078 1.00 37.82  ? 459 ILE A C     1 
ATOM   3434 O  O     . ILE A 1 465 ? -16.264 10.431  -67.192 1.00 31.49  ? 459 ILE A O     1 
ATOM   3435 C  CB    . ILE A 1 465 ? -19.207 10.763  -65.776 1.00 38.43  ? 459 ILE A CB    1 
ATOM   3436 C  CG1   . ILE A 1 465 ? -19.746 10.522  -64.370 1.00 29.25  ? 459 ILE A CG1   1 
ATOM   3437 C  CG2   . ILE A 1 465 ? -19.116 9.445   -66.533 1.00 35.53  ? 459 ILE A CG2   1 
ATOM   3438 C  CD1   . ILE A 1 465 ? -21.149 9.955   -64.385 1.00 26.71  ? 459 ILE A CD1   1 
ATOM   3439 N  N     . GLN A 1 466 ? -17.742 11.904  -68.094 1.00 44.32  ? 460 GLN A N     1 
ATOM   3440 C  CA    . GLN A 1 466 ? -17.226 11.819  -69.456 1.00 38.78  ? 460 GLN A CA    1 
ATOM   3441 C  C     . GLN A 1 466 ? -15.738 12.068  -69.442 1.00 28.23  ? 460 GLN A C     1 
ATOM   3442 O  O     . GLN A 1 466 ? -14.963 11.163  -69.714 1.00 27.15  ? 460 GLN A O     1 
ATOM   3443 C  CB    . GLN A 1 466 ? -17.908 12.835  -70.381 1.00 49.11  ? 460 GLN A CB    1 
ATOM   3444 C  CG    . GLN A 1 466 ? -17.756 12.523  -71.884 1.00 42.14  ? 460 GLN A CG    1 
ATOM   3445 C  CD    . GLN A 1 466 ? -18.413 11.194  -72.284 1.00 55.40  ? 460 GLN A CD    1 
ATOM   3446 O  OE1   . GLN A 1 466 ? -19.204 10.617  -71.522 1.00 58.31  ? 460 GLN A OE1   1 
ATOM   3447 N  NE2   . GLN A 1 466 ? -18.082 10.704  -73.480 1.00 42.15  ? 460 GLN A NE2   1 
ATOM   3448 N  N     . SER A 1 467 ? -15.346 13.289  -69.091 1.00 27.16  ? 461 SER A N     1 
ATOM   3449 C  CA    . SER A 1 467 ? -13.929 13.641  -68.931 1.00 34.46  ? 461 SER A CA    1 
ATOM   3450 C  C     . SER A 1 467 ? -13.096 12.578  -68.193 1.00 37.05  ? 461 SER A C     1 
ATOM   3451 O  O     . SER A 1 467 ? -11.881 12.503  -68.372 1.00 38.98  ? 461 SER A O     1 
ATOM   3452 C  CB    . SER A 1 467 ? -13.771 15.010  -68.244 1.00 30.38  ? 461 SER A CB    1 
ATOM   3453 O  OG    . SER A 1 467 ? -12.655 15.029  -67.361 1.00 30.16  ? 461 SER A OG    1 
ATOM   3454 N  N     . PHE A 1 468 ? -13.740 11.758  -67.367 1.00 32.50  ? 462 PHE A N     1 
ATOM   3455 C  CA    . PHE A 1 468 ? -13.007 10.706  -66.690 1.00 27.61  ? 462 PHE A CA    1 
ATOM   3456 C  C     . PHE A 1 468 ? -12.840 9.507   -67.611 1.00 25.60  ? 462 PHE A C     1 
ATOM   3457 O  O     . PHE A 1 468 ? -11.714 9.131   -67.928 1.00 24.23  ? 462 PHE A O     1 
ATOM   3458 C  CB    . PHE A 1 468 ? -13.656 10.297  -65.366 1.00 20.94  ? 462 PHE A CB    1 
ATOM   3459 C  CG    . PHE A 1 468 ? -13.125 9.008   -64.837 1.00 15.77  ? 462 PHE A CG    1 
ATOM   3460 C  CD1   . PHE A 1 468 ? -11.810 8.910   -64.438 1.00 13.46  ? 462 PHE A CD1   1 
ATOM   3461 C  CD2   . PHE A 1 468 ? -13.918 7.880   -64.797 1.00 17.29  ? 462 PHE A CD2   1 
ATOM   3462 C  CE1   . PHE A 1 468 ? -11.307 7.720   -63.993 1.00 17.38  ? 462 PHE A CE1   1 
ATOM   3463 C  CE2   . PHE A 1 468 ? -13.415 6.684   -64.340 1.00 19.19  ? 462 PHE A CE2   1 
ATOM   3464 C  CZ    . PHE A 1 468 ? -12.110 6.602   -63.944 1.00 17.08  ? 462 PHE A CZ    1 
ATOM   3465 N  N     . THR A 1 469 ? -13.959 8.908   -68.023 1.00 27.25  ? 463 THR A N     1 
ATOM   3466 C  CA    . THR A 1 469 ? -13.945 7.811   -68.999 1.00 25.35  ? 463 THR A CA    1 
ATOM   3467 C  C     . THR A 1 469 ? -13.101 8.172   -70.225 1.00 30.77  ? 463 THR A C     1 
ATOM   3468 O  O     . THR A 1 469 ? -12.264 7.383   -70.664 1.00 30.04  ? 463 THR A O     1 
ATOM   3469 C  CB    . THR A 1 469 ? -15.376 7.365   -69.432 1.00 25.51  ? 463 THR A CB    1 
ATOM   3470 O  OG1   . THR A 1 469 ? -16.183 8.501   -69.772 1.00 30.60  ? 463 THR A OG1   1 
ATOM   3471 C  CG2   . THR A 1 469 ? -16.058 6.619   -68.307 1.00 36.57  ? 463 THR A CG2   1 
ATOM   3472 N  N     . ASP A 1 470 ? -13.297 9.376   -70.752 1.00 28.44  ? 464 ASP A N     1 
ATOM   3473 C  CA    . ASP A 1 470 ? -12.452 9.866   -71.827 1.00 28.53  ? 464 ASP A CA    1 
ATOM   3474 C  C     . ASP A 1 470 ? -10.992 9.791   -71.412 1.00 31.13  ? 464 ASP A C     1 
ATOM   3475 O  O     . ASP A 1 470 ? -10.187 9.199   -72.117 1.00 45.72  ? 464 ASP A O     1 
ATOM   3476 C  CB    . ASP A 1 470 ? -12.813 11.303  -72.230 1.00 34.04  ? 464 ASP A CB    1 
ATOM   3477 C  CG    . ASP A 1 470 ? -14.225 11.423  -72.795 1.00 33.96  ? 464 ASP A CG    1 
ATOM   3478 O  OD1   . ASP A 1 470 ? -14.838 10.379  -73.151 1.00 25.97  ? 464 ASP A OD1   1 
ATOM   3479 O  OD2   . ASP A 1 470 ? -14.715 12.574  -72.875 1.00 35.40  ? 464 ASP A OD2   1 
ATOM   3480 N  N     . THR A 1 471 ? -10.652 10.363  -70.261 1.00 32.46  ? 465 THR A N     1 
ATOM   3481 C  CA    . THR A 1 471 ? -9.259  10.382  -69.800 1.00 35.23  ? 465 THR A CA    1 
ATOM   3482 C  C     . THR A 1 471 ? -8.619  8.992   -69.708 1.00 32.68  ? 465 THR A C     1 
ATOM   3483 O  O     . THR A 1 471 ? -7.415  8.843   -69.896 1.00 34.75  ? 465 THR A O     1 
ATOM   3484 C  CB    . THR A 1 471 ? -9.130  11.081  -68.436 1.00 35.43  ? 465 THR A CB    1 
ATOM   3485 O  OG1   . THR A 1 471 ? -9.816  12.337  -68.483 1.00 40.14  ? 465 THR A OG1   1 
ATOM   3486 C  CG2   . THR A 1 471 ? -7.668  11.328  -68.081 1.00 41.72  ? 465 THR A CG2   1 
ATOM   3487 N  N     . VAL A 1 472 ? -9.428  7.978   -69.435 1.00 28.06  ? 466 VAL A N     1 
ATOM   3488 C  CA    . VAL A 1 472 ? -8.894  6.647   -69.196 1.00 30.53  ? 466 VAL A CA    1 
ATOM   3489 C  C     . VAL A 1 472 ? -8.457  5.990   -70.498 1.00 32.18  ? 466 VAL A C     1 
ATOM   3490 O  O     . VAL A 1 472 ? -7.314  5.550   -70.617 1.00 36.64  ? 466 VAL A O     1 
ATOM   3491 C  CB    . VAL A 1 472 ? -9.909  5.763   -68.447 1.00 32.97  ? 466 VAL A CB    1 
ATOM   3492 C  CG1   . VAL A 1 472 ? -9.326  4.369   -68.143 1.00 18.06  ? 466 VAL A CG1   1 
ATOM   3493 C  CG2   . VAL A 1 472 ? -10.351 6.465   -67.179 1.00 26.75  ? 466 VAL A CG2   1 
ATOM   3494 N  N     . TYR A 1 473 ? -9.365  5.925   -71.469 1.00 34.02  ? 467 TYR A N     1 
ATOM   3495 C  CA    . TYR A 1 473 ? -9.032  5.441   -72.811 1.00 32.45  ? 467 TYR A CA    1 
ATOM   3496 C  C     . TYR A 1 473 ? -7.863  6.248   -73.403 1.00 37.83  ? 467 TYR A C     1 
ATOM   3497 O  O     . TYR A 1 473 ? -6.913  5.689   -73.953 1.00 37.82  ? 467 TYR A O     1 
ATOM   3498 C  CB    . TYR A 1 473 ? -10.233 5.584   -73.741 1.00 24.87  ? 467 TYR A CB    1 
ATOM   3499 C  CG    . TYR A 1 473 ? -11.445 4.712   -73.448 1.00 23.28  ? 467 TYR A CG    1 
ATOM   3500 C  CD1   . TYR A 1 473 ? -11.338 3.329   -73.373 1.00 21.65  ? 467 TYR A CD1   1 
ATOM   3501 C  CD2   . TYR A 1 473 ? -12.709 5.277   -73.312 1.00 15.80  ? 467 TYR A CD2   1 
ATOM   3502 C  CE1   . TYR A 1 473 ? -12.455 2.540   -73.137 1.00 19.30  ? 467 TYR A CE1   1 
ATOM   3503 C  CE2   . TYR A 1 473 ? -13.820 4.500   -73.071 1.00 13.80  ? 467 TYR A CE2   1 
ATOM   3504 C  CZ    . TYR A 1 473 ? -13.693 3.135   -72.989 1.00 18.66  ? 467 TYR A CZ    1 
ATOM   3505 O  OH    . TYR A 1 473 ? -14.809 2.360   -72.760 1.00 27.04  ? 467 TYR A OH    1 
ATOM   3506 N  N     . ARG A 1 474 ? -7.949  7.569   -73.275 1.00 34.25  ? 468 ARG A N     1 
ATOM   3507 C  CA    . ARG A 1 474 ? -6.939  8.478   -73.800 1.00 39.15  ? 468 ARG A CA    1 
ATOM   3508 C  C     . ARG A 1 474 ? -5.543  8.125   -73.299 1.00 40.09  ? 468 ARG A C     1 
ATOM   3509 O  O     . ARG A 1 474 ? -4.582  8.156   -74.065 1.00 49.58  ? 468 ARG A O     1 
ATOM   3510 C  CB    . ARG A 1 474 ? -7.301  9.928   -73.446 1.00 42.07  ? 468 ARG A CB    1 
ATOM   3511 C  CG    . ARG A 1 474 ? -6.369  11.006  -73.996 1.00 53.72  ? 468 ARG A CG    1 
ATOM   3512 C  CD    . ARG A 1 474 ? -5.176  11.283  -73.078 1.00 54.86  ? 468 ARG A CD    1 
ATOM   3513 N  NE    . ARG A 1 474 ? -4.940  12.708  -72.863 1.00 60.45  ? 468 ARG A NE    1 
ATOM   3514 C  CZ    . ARG A 1 474 ? -5.459  13.402  -71.855 1.00 71.83  ? 468 ARG A CZ    1 
ATOM   3515 N  NH1   . ARG A 1 474 ? -6.249  12.802  -70.971 1.00 63.62  ? 468 ARG A NH1   1 
ATOM   3516 N  NH2   . ARG A 1 474 ? -5.192  14.694  -71.729 1.00 79.74  ? 468 ARG A NH2   1 
ATOM   3517 N  N     . GLN A 1 475 ? -5.425  7.807   -72.015 1.00 41.58  ? 469 GLN A N     1 
ATOM   3518 C  CA    . GLN A 1 475 ? -4.121  7.477   -71.447 1.00 42.22  ? 469 GLN A CA    1 
ATOM   3519 C  C     . GLN A 1 475 ? -3.788  6.025   -71.729 1.00 36.77  ? 469 GLN A C     1 
ATOM   3520 O  O     . GLN A 1 475 ? -2.621  5.657   -71.822 1.00 36.84  ? 469 GLN A O     1 
ATOM   3521 C  CB    . GLN A 1 475 ? -4.061  7.767   -69.947 1.00 42.59  ? 469 GLN A CB    1 
ATOM   3522 C  CG    . GLN A 1 475 ? -4.081  9.246   -69.584 1.00 41.49  ? 469 GLN A CG    1 
ATOM   3523 C  CD    . GLN A 1 475 ? -3.826  9.486   -68.100 1.00 56.82  ? 469 GLN A CD    1 
ATOM   3524 O  OE1   . GLN A 1 475 ? -2.934  8.879   -67.496 1.00 57.60  ? 469 GLN A OE1   1 
ATOM   3525 N  NE2   . GLN A 1 475 ? -4.613  10.374  -67.504 1.00 57.59  ? 469 GLN A NE2   1 
ATOM   3526 N  N     . ALA A 1 476 ? -4.817  5.203   -71.880 1.00 35.33  ? 470 ALA A N     1 
ATOM   3527 C  CA    . ALA A 1 476 ? -4.612  3.832   -72.329 1.00 44.26  ? 470 ALA A CA    1 
ATOM   3528 C  C     . ALA A 1 476 ? -3.968  3.827   -73.729 1.00 48.85  ? 470 ALA A C     1 
ATOM   3529 O  O     . ALA A 1 476 ? -3.086  3.011   -74.016 1.00 48.49  ? 470 ALA A O     1 
ATOM   3530 C  CB    . ALA A 1 476 ? -5.929  3.058   -72.320 1.00 34.34  ? 470 ALA A CB    1 
ATOM   3531 N  N     . ASN A 1 477 ? -4.396  4.754   -74.587 1.00 46.88  ? 471 ASN A N     1 
ATOM   3532 C  CA    . ASN A 1 477 ? -3.797  4.911   -75.913 1.00 39.72  ? 471 ASN A CA    1 
ATOM   3533 C  C     . ASN A 1 477 ? -2.359  5.396   -75.853 1.00 39.44  ? 471 ASN A C     1 
ATOM   3534 O  O     . ASN A 1 477 ? -1.492  4.851   -76.527 1.00 45.68  ? 471 ASN A O     1 
ATOM   3535 C  CB    . ASN A 1 477 ? -4.626  5.841   -76.794 1.00 44.33  ? 471 ASN A CB    1 
ATOM   3536 C  CG    . ASN A 1 477 ? -5.904  5.192   -77.274 1.00 48.84  ? 471 ASN A CG    1 
ATOM   3537 O  OD1   . ASN A 1 477 ? -5.976  3.970   -77.406 1.00 43.47  ? 471 ASN A OD1   1 
ATOM   3538 N  ND2   . ASN A 1 477 ? -6.929  6.005   -77.524 1.00 48.78  ? 471 ASN A ND2   1 
ATOM   3539 N  N     . ASN A 1 478 ? -2.101  6.415   -75.044 1.00 43.73  ? 472 ASN A N     1 
ATOM   3540 C  CA    . ASN A 1 478 ? -0.727  6.859   -74.821 1.00 47.37  ? 472 ASN A CA    1 
ATOM   3541 C  C     . ASN A 1 478 ? 0.267   5.729   -74.535 1.00 46.21  ? 472 ASN A C     1 
ATOM   3542 O  O     . ASN A 1 478 ? 1.404   5.808   -74.982 1.00 49.96  ? 472 ASN A O     1 
ATOM   3543 C  CB    . ASN A 1 478 ? -0.647  7.935   -73.735 1.00 42.47  ? 472 ASN A CB    1 
ATOM   3544 C  CG    . ASN A 1 478 ? -1.128  9.278   -74.222 1.00 47.04  ? 472 ASN A CG    1 
ATOM   3545 O  OD1   . ASN A 1 478 ? -1.408  9.448   -75.409 1.00 50.82  ? 472 ASN A OD1   1 
ATOM   3546 N  ND2   . ASN A 1 478 ? -1.219  10.248  -73.315 1.00 47.80  ? 472 ASN A ND2   1 
ATOM   3547 N  N     . ILE A 1 479 ? -0.142  4.681   -73.815 1.00 45.69  ? 473 ILE A N     1 
ATOM   3548 C  CA    . ILE A 1 479 ? 0.763   3.540   -73.624 1.00 48.63  ? 473 ILE A CA    1 
ATOM   3549 C  C     . ILE A 1 479 ? 0.525   2.378   -74.583 1.00 47.18  ? 473 ILE A C     1 
ATOM   3550 O  O     . ILE A 1 479 ? 1.035   1.282   -74.349 1.00 47.76  ? 473 ILE A O     1 
ATOM   3551 C  CB    . ILE A 1 479 ? 0.788   2.969   -72.179 1.00 47.00  ? 473 ILE A CB    1 
ATOM   3552 C  CG1   . ILE A 1 479 ? -0.381  3.471   -71.348 1.00 36.99  ? 473 ILE A CG1   1 
ATOM   3553 C  CG2   . ILE A 1 479 ? 2.122   3.267   -71.495 1.00 48.26  ? 473 ILE A CG2   1 
ATOM   3554 C  CD1   . ILE A 1 479 ? -0.631  2.609   -70.136 1.00 26.67  ? 473 ILE A CD1   1 
ATOM   3555 N  N     . ASN A 1 480 ? -0.223  2.623   -75.658 1.00 45.83  ? 474 ASN A N     1 
ATOM   3556 C  CA    . ASN A 1 480 ? -0.485  1.598   -76.668 1.00 46.29  ? 474 ASN A CA    1 
ATOM   3557 C  C     . ASN A 1 480 ? -1.001  0.334   -76.017 1.00 55.80  ? 474 ASN A C     1 
ATOM   3558 O  O     . ASN A 1 480 ? -0.559  -0.777  -76.319 1.00 54.09  ? 474 ASN A O     1 
ATOM   3559 C  CB    . ASN A 1 480 ? 0.771   1.298   -77.479 1.00 44.61  ? 474 ASN A CB    1 
ATOM   3560 C  CG    . ASN A 1 480 ? 0.819   2.077   -78.774 1.00 62.52  ? 474 ASN A CG    1 
ATOM   3561 O  OD1   . ASN A 1 480 ? 0.485   1.551   -79.844 1.00 62.60  ? 474 ASN A OD1   1 
ATOM   3562 N  ND2   . ASN A 1 480 ? 1.218   3.346   -78.686 1.00 50.76  ? 474 ASN A ND2   1 
ATOM   3563 N  N     . MET A 1 481 ? -1.940  0.530   -75.104 1.00 57.81  ? 475 MET A N     1 
ATOM   3564 C  CA    . MET A 1 481 ? -2.351  -0.512  -74.185 1.00 50.41  ? 475 MET A CA    1 
ATOM   3565 C  C     . MET A 1 481 ? -3.756  -1.005  -74.519 1.00 51.76  ? 475 MET A C     1 
ATOM   3566 O  O     . MET A 1 481 ? -4.018  -2.214  -74.497 1.00 48.58  ? 475 MET A O     1 
ATOM   3567 C  CB    . MET A 1 481 ? -2.263  0.031   -72.750 1.00 46.86  ? 475 MET A CB    1 
ATOM   3568 C  CG    . MET A 1 481 ? -2.632  -0.949  -71.667 1.00 46.01  ? 475 MET A CG    1 
ATOM   3569 S  SD    . MET A 1 481 ? -4.381  -0.837  -71.271 1.00 46.57  ? 475 MET A SD    1 
ATOM   3570 C  CE    . MET A 1 481 ? -4.561  -2.280  -70.227 1.00 47.26  ? 475 MET A CE    1 
ATOM   3571 N  N     . LEU A 1 482 ? -4.642  -0.061  -74.847 1.00 50.77  ? 476 LEU A N     1 
ATOM   3572 C  CA    . LEU A 1 482 ? -6.063  -0.346  -75.082 1.00 49.37  ? 476 LEU A CA    1 
ATOM   3573 C  C     . LEU A 1 482 ? -6.288  -1.329  -76.221 1.00 45.28  ? 476 LEU A C     1 
ATOM   3574 O  O     . LEU A 1 482 ? -6.064  -1.012  -77.385 1.00 51.71  ? 476 LEU A O     1 
ATOM   3575 C  CB    . LEU A 1 482 ? -6.854  0.952   -75.311 1.00 50.09  ? 476 LEU A CB    1 
ATOM   3576 C  CG    . LEU A 1 482 ? -8.371  0.958   -75.569 1.00 42.61  ? 476 LEU A CG    1 
ATOM   3577 C  CD1   . LEU A 1 482 ? -8.686  0.994   -77.060 1.00 56.43  ? 476 LEU A CD1   1 
ATOM   3578 C  CD2   . LEU A 1 482 ? -9.092  -0.202  -74.901 1.00 40.82  ? 476 LEU A CD2   1 
ATOM   3579 N  N     . LYS A 1 483 ? -6.740  -2.523  -75.856 1.00 47.35  ? 477 LYS A N     1 
ATOM   3580 C  CA    . LYS A 1 483 ? -7.051  -3.581  -76.803 1.00 53.52  ? 477 LYS A CA    1 
ATOM   3581 C  C     . LYS A 1 483 ? -8.568  -3.672  -76.956 1.00 52.47  ? 477 LYS A C     1 
ATOM   3582 O  O     . LYS A 1 483 ? -9.307  -3.309  -76.042 1.00 44.42  ? 477 LYS A O     1 
ATOM   3583 C  CB    . LYS A 1 483 ? -6.468  -4.905  -76.298 1.00 54.10  ? 477 LYS A CB    1 
ATOM   3584 C  CG    . LYS A 1 483 ? -4.987  -4.797  -75.928 1.00 56.10  ? 477 LYS A CG    1 
ATOM   3585 C  CD    . LYS A 1 483 ? -4.449  -6.054  -75.257 1.00 64.18  ? 477 LYS A CD    1 
ATOM   3586 C  CE    . LYS A 1 483 ? -3.111  -5.776  -74.580 1.00 64.66  ? 477 LYS A CE    1 
ATOM   3587 N  NZ    . LYS A 1 483 ? -3.248  -4.770  -73.479 1.00 54.75  ? 477 LYS A NZ    1 
ATOM   3588 N  N     . GLU A 1 484 ? -9.034  -4.127  -78.115 1.00 57.99  ? 478 GLU A N     1 
ATOM   3589 C  CA    . GLU A 1 484 ? -10.469 -4.212  -78.349 1.00 58.16  ? 478 GLU A CA    1 
ATOM   3590 C  C     . GLU A 1 484 ? -11.089 -5.122  -77.306 1.00 51.81  ? 478 GLU A C     1 
ATOM   3591 O  O     . GLU A 1 484 ? -10.452 -6.075  -76.849 1.00 54.94  ? 478 GLU A O     1 
ATOM   3592 C  CB    . GLU A 1 484 ? -10.781 -4.730  -79.757 1.00 61.40  ? 478 GLU A CB    1 
ATOM   3593 C  CG    . GLU A 1 484 ? -11.479 -6.090  -79.777 1.00 60.61  ? 478 GLU A CG    1 
ATOM   3594 C  CD    . GLU A 1 484 ? -12.604 -6.159  -80.789 1.00 63.52  ? 478 GLU A CD    1 
ATOM   3595 O  OE1   . GLU A 1 484 ? -13.598 -6.879  -80.540 1.00 58.69  ? 478 GLU A OE1   1 
ATOM   3596 O  OE2   . GLU A 1 484 ? -12.490 -5.494  -81.838 1.00 75.46  ? 478 GLU A OE2   1 
ATOM   3597 N  N     . GLY A 1 485 ? -12.323 -4.810  -76.921 1.00 51.50  ? 479 GLY A N     1 
ATOM   3598 C  CA    . GLY A 1 485 ? -13.048 -5.613  -75.951 1.00 53.81  ? 479 GLY A CA    1 
ATOM   3599 C  C     . GLY A 1 485 ? -12.945 -5.070  -74.536 1.00 50.29  ? 479 GLY A C     1 
ATOM   3600 O  O     . GLY A 1 485 ? -13.582 -5.581  -73.616 1.00 39.87  ? 479 GLY A O     1 
ATOM   3601 N  N     . MET A 1 486 ? -12.137 -4.027  -74.366 1.00 48.88  ? 480 MET A N     1 
ATOM   3602 C  CA    . MET A 1 486 ? -11.927 -3.419  -73.060 1.00 32.37  ? 480 MET A CA    1 
ATOM   3603 C  C     . MET A 1 486 ? -12.751 -2.153  -72.906 1.00 32.30  ? 480 MET A C     1 
ATOM   3604 O  O     . MET A 1 486 ? -12.325 -1.078  -73.313 1.00 35.68  ? 480 MET A O     1 
ATOM   3605 C  CB    . MET A 1 486 ? -10.445 -3.107  -72.840 1.00 29.90  ? 480 MET A CB    1 
ATOM   3606 C  CG    . MET A 1 486 ? -9.562  -4.337  -72.933 1.00 45.42  ? 480 MET A CG    1 
ATOM   3607 S  SD    . MET A 1 486 ? -7.915  -4.157  -72.233 1.00 44.00  ? 480 MET A SD    1 
ATOM   3608 C  CE    . MET A 1 486 ? -7.509  -2.482  -72.703 1.00 29.89  ? 480 MET A CE    1 
ATOM   3609 N  N     . LYS A 1 487 ? -13.926 -2.280  -72.303 1.00 29.96  ? 481 LYS A N     1 
ATOM   3610 C  CA    . LYS A 1 487 ? -14.771 -1.128  -72.050 1.00 26.31  ? 481 LYS A CA    1 
ATOM   3611 C  C     . LYS A 1 487 ? -14.632 -0.583  -70.609 1.00 37.31  ? 481 LYS A C     1 
ATOM   3612 O  O     . LYS A 1 487 ? -14.346 -1.334  -69.660 1.00 32.81  ? 481 LYS A O     1 
ATOM   3613 C  CB    . LYS A 1 487 ? -16.220 -1.504  -72.344 1.00 25.89  ? 481 LYS A CB    1 
ATOM   3614 C  CG    . LYS A 1 487 ? -17.174 -0.326  -72.363 1.00 38.26  ? 481 LYS A CG    1 
ATOM   3615 C  CD    . LYS A 1 487 ? -18.557 -0.719  -72.885 1.00 42.93  ? 481 LYS A CD    1 
ATOM   3616 C  CE    . LYS A 1 487 ? -19.394 0.526   -73.165 1.00 48.97  ? 481 LYS A CE    1 
ATOM   3617 N  NZ    . LYS A 1 487 ? -18.612 1.567   -73.914 1.00 35.68  ? 481 LYS A NZ    1 
ATOM   3618 N  N     . ILE A 1 488 ? -14.809 0.730   -70.455 1.00 35.27  ? 482 ILE A N     1 
ATOM   3619 C  CA    . ILE A 1 488 ? -15.056 1.322   -69.140 1.00 26.24  ? 482 ILE A CA    1 
ATOM   3620 C  C     . ILE A 1 488 ? -16.249 2.282   -69.177 1.00 30.57  ? 482 ILE A C     1 
ATOM   3621 O  O     . ILE A 1 488 ? -16.349 3.152   -70.045 1.00 23.79  ? 482 ILE A O     1 
ATOM   3622 C  CB    . ILE A 1 488 ? -13.823 2.017   -68.531 1.00 23.68  ? 482 ILE A CB    1 
ATOM   3623 C  CG1   . ILE A 1 488 ? -14.097 2.334   -67.054 1.00 25.30  ? 482 ILE A CG1   1 
ATOM   3624 C  CG2   . ILE A 1 488 ? -13.446 3.262   -69.317 1.00 21.14  ? 482 ILE A CG2   1 
ATOM   3625 C  CD1   . ILE A 1 488 ? -13.145 3.311   -66.451 1.00 24.97  ? 482 ILE A CD1   1 
ATOM   3626 N  N     . GLU A 1 489 ? -17.155 2.109   -68.217 1.00 39.31  ? 483 GLU A N     1 
ATOM   3627 C  CA    . GLU A 1 489 ? -18.425 2.825   -68.209 1.00 32.67  ? 483 GLU A CA    1 
ATOM   3628 C  C     . GLU A 1 489 ? -18.797 3.290   -66.805 1.00 28.33  ? 483 GLU A C     1 
ATOM   3629 O  O     . GLU A 1 489 ? -18.639 2.543   -65.837 1.00 31.30  ? 483 GLU A O     1 
ATOM   3630 C  CB    . GLU A 1 489 ? -19.512 1.912   -68.766 1.00 34.52  ? 483 GLU A CB    1 
ATOM   3631 C  CG    . GLU A 1 489 ? -20.869 2.549   -68.913 1.00 38.46  ? 483 GLU A CG    1 
ATOM   3632 C  CD    . GLU A 1 489 ? -21.885 1.567   -69.441 1.00 52.61  ? 483 GLU A CD    1 
ATOM   3633 O  OE1   . GLU A 1 489 ? -21.472 0.477   -69.902 1.00 50.60  ? 483 GLU A OE1   1 
ATOM   3634 O  OE2   . GLU A 1 489 ? -23.093 1.884   -69.390 1.00 62.57  ? 483 GLU A OE2   1 
ATOM   3635 N  N     . ALA A 1 490 ? -19.300 4.518   -66.705 1.00 22.11  ? 484 ALA A N     1 
ATOM   3636 C  CA    . ALA A 1 490 ? -19.644 5.111   -65.415 1.00 23.62  ? 484 ALA A CA    1 
ATOM   3637 C  C     . ALA A 1 490 ? -21.027 5.782   -65.405 1.00 25.15  ? 484 ALA A C     1 
ATOM   3638 O  O     . ALA A 1 490 ? -21.196 6.865   -65.961 1.00 26.91  ? 484 ALA A O     1 
ATOM   3639 C  CB    . ALA A 1 490 ? -18.566 6.113   -65.005 1.00 19.23  ? 484 ALA A CB    1 
ATOM   3640 N  N     . THR A 1 491 ? -22.016 5.166   -64.762 1.00 21.27  ? 485 THR A N     1 
ATOM   3641 C  CA    . THR A 1 491 ? -23.340 5.779   -64.737 1.00 21.10  ? 485 THR A CA    1 
ATOM   3642 C  C     . THR A 1 491 ? -23.758 6.254   -63.362 1.00 20.31  ? 485 THR A C     1 
ATOM   3643 O  O     . THR A 1 491 ? -23.585 5.555   -62.377 1.00 22.52  ? 485 THR A O     1 
ATOM   3644 C  CB    . THR A 1 491 ? -24.428 4.866   -65.324 1.00 21.47  ? 485 THR A CB    1 
ATOM   3645 O  OG1   . THR A 1 491 ? -24.286 3.554   -64.785 1.00 30.27  ? 485 THR A OG1   1 
ATOM   3646 C  CG2   . THR A 1 491 ? -24.295 4.782   -66.829 1.00 35.76  ? 485 THR A CG2   1 
ATOM   3647 N  N     . HIS A 1 492 ? -24.294 7.469   -63.321 1.00 24.36  ? 486 HIS A N     1 
ATOM   3648 C  CA    . HIS A 1 492 ? -24.849 8.062   -62.108 1.00 22.15  ? 486 HIS A CA    1 
ATOM   3649 C  C     . HIS A 1 492 ? -26.142 7.357   -61.800 1.00 22.79  ? 486 HIS A C     1 
ATOM   3650 O  O     . HIS A 1 492 ? -26.981 7.190   -62.675 1.00 30.26  ? 486 HIS A O     1 
ATOM   3651 C  CB    . HIS A 1 492 ? -25.134 9.550   -62.329 1.00 18.40  ? 486 HIS A CB    1 
ATOM   3652 C  CG    . HIS A 1 492 ? -25.782 10.236  -61.165 1.00 25.09  ? 486 HIS A CG    1 
ATOM   3653 N  ND1   . HIS A 1 492 ? -26.444 11.439  -61.291 1.00 34.43  ? 486 HIS A ND1   1 
ATOM   3654 C  CD2   . HIS A 1 492 ? -25.853 9.907   -59.852 1.00 26.31  ? 486 HIS A CD2   1 
ATOM   3655 C  CE1   . HIS A 1 492 ? -26.905 11.815  -60.110 1.00 28.50  ? 486 HIS A CE1   1 
ATOM   3656 N  NE2   . HIS A 1 492 ? -26.563 10.901  -59.219 1.00 24.69  ? 486 HIS A NE2   1 
ATOM   3657 N  N     . VAL A 1 493 ? -26.301 6.936   -60.554 1.00 22.71  ? 487 VAL A N     1 
ATOM   3658 C  CA    . VAL A 1 493 ? -27.486 6.216   -60.138 1.00 19.76  ? 487 VAL A CA    1 
ATOM   3659 C  C     . VAL A 1 493 ? -27.993 6.788   -58.830 1.00 25.95  ? 487 VAL A C     1 
ATOM   3660 O  O     . VAL A 1 493 ? -27.212 6.967   -57.902 1.00 26.55  ? 487 VAL A O     1 
ATOM   3661 C  CB    . VAL A 1 493 ? -27.141 4.756   -59.879 1.00 21.49  ? 487 VAL A CB    1 
ATOM   3662 C  CG1   . VAL A 1 493 ? -28.395 3.953   -59.638 1.00 25.86  ? 487 VAL A CG1   1 
ATOM   3663 C  CG2   . VAL A 1 493 ? -26.340 4.185   -61.038 1.00 29.33  ? 487 VAL A CG2   1 
ATOM   3664 N  N     . LYS A 1 494 ? -29.290 7.072   -58.746 1.00 28.26  ? 488 LYS A N     1 
ATOM   3665 C  CA    . LYS A 1 494 ? -29.899 7.431   -57.469 1.00 28.93  ? 488 LYS A CA    1 
ATOM   3666 C  C     . LYS A 1 494 ? -29.917 6.212   -56.533 1.00 36.25  ? 488 LYS A C     1 
ATOM   3667 O  O     . LYS A 1 494 ? -29.714 5.081   -56.982 1.00 36.80  ? 488 LYS A O     1 
ATOM   3668 C  CB    . LYS A 1 494 ? -31.322 7.950   -57.680 1.00 38.82  ? 488 LYS A CB    1 
ATOM   3669 C  CG    . LYS A 1 494 ? -31.427 9.289   -58.404 1.00 39.76  ? 488 LYS A CG    1 
ATOM   3670 C  CD    . LYS A 1 494 ? -32.817 9.910   -58.208 1.00 52.28  ? 488 LYS A CD    1 
ATOM   3671 C  CE    . LYS A 1 494 ? -32.938 11.300  -58.847 1.00 58.71  ? 488 LYS A CE    1 
ATOM   3672 N  NZ    . LYS A 1 494 ? -32.981 11.281  -60.345 1.00 40.38  ? 488 LYS A NZ    1 
ATOM   3673 N  N     . LYS A 1 495 ? -30.160 6.429   -55.239 1.00 38.57  ? 489 LYS A N     1 
ATOM   3674 C  CA    . LYS A 1 495 ? -30.199 5.317   -54.283 1.00 35.57  ? 489 LYS A CA    1 
ATOM   3675 C  C     . LYS A 1 495 ? -31.310 4.335   -54.615 1.00 39.02  ? 489 LYS A C     1 
ATOM   3676 O  O     . LYS A 1 495 ? -31.132 3.117   -54.557 1.00 35.85  ? 489 LYS A O     1 
ATOM   3677 C  CB    . LYS A 1 495 ? -30.406 5.802   -52.848 1.00 33.10  ? 489 LYS A CB    1 
ATOM   3678 C  CG    . LYS A 1 495 ? -30.503 4.636   -51.866 1.00 40.30  ? 489 LYS A CG    1 
ATOM   3679 C  CD    . LYS A 1 495 ? -31.108 5.022   -50.533 1.00 45.88  ? 489 LYS A CD    1 
ATOM   3680 C  CE    . LYS A 1 495 ? -30.089 5.656   -49.618 1.00 40.33  ? 489 LYS A CE    1 
ATOM   3681 N  NZ    . LYS A 1 495 ? -30.651 5.865   -48.253 1.00 36.84  ? 489 LYS A NZ    1 
ATOM   3682 N  N     . LYS A 1 496 ? -32.463 4.884   -54.967 1.00 43.73  ? 490 LYS A N     1 
ATOM   3683 C  CA    . LYS A 1 496 ? -33.649 4.083   -55.217 1.00 44.29  ? 490 LYS A CA    1 
ATOM   3684 C  C     . LYS A 1 496 ? -33.368 3.072   -56.317 1.00 38.47  ? 490 LYS A C     1 
ATOM   3685 O  O     . LYS A 1 496 ? -33.904 1.968   -56.318 1.00 39.58  ? 490 LYS A O     1 
ATOM   3686 C  CB    . LYS A 1 496 ? -34.830 5.000   -55.566 1.00 49.94  ? 490 LYS A CB    1 
ATOM   3687 C  CG    . LYS A 1 496 ? -34.920 6.280   -54.672 1.00 72.98  ? 490 LYS A CG    1 
ATOM   3688 C  CD    . LYS A 1 496 ? -34.991 5.979   -53.145 1.00 61.39  ? 490 LYS A CD    1 
ATOM   3689 C  CE    . LYS A 1 496 ? -34.978 7.252   -52.285 1.00 47.81  ? 490 LYS A CE    1 
ATOM   3690 N  NZ    . LYS A 1 496 ? -36.292 7.974   -52.247 1.00 49.17  ? 490 LYS A NZ    1 
ATOM   3691 N  N     . GLN A 1 497 ? -32.468 3.444   -57.218 1.00 41.57  ? 491 GLN A N     1 
ATOM   3692 C  CA    . GLN A 1 497 ? -32.149 2.636   -58.383 1.00 40.76  ? 491 GLN A CA    1 
ATOM   3693 C  C     . GLN A 1 497 ? -30.927 1.741   -58.186 1.00 36.70  ? 491 GLN A C     1 
ATOM   3694 O  O     . GLN A 1 497 ? -30.551 1.009   -59.097 1.00 33.41  ? 491 GLN A O     1 
ATOM   3695 C  CB    . GLN A 1 497 ? -31.949 3.551   -59.601 1.00 38.76  ? 491 GLN A CB    1 
ATOM   3696 C  CG    . GLN A 1 497 ? -33.088 3.514   -60.615 1.00 44.24  ? 491 GLN A CG    1 
ATOM   3697 C  CD    . GLN A 1 497 ? -34.458 3.423   -59.960 1.00 51.73  ? 491 GLN A CD    1 
ATOM   3698 O  OE1   . GLN A 1 497 ? -34.829 4.275   -59.151 1.00 43.37  ? 491 GLN A OE1   1 
ATOM   3699 N  NE2   . GLN A 1 497 ? -35.214 2.375   -60.302 1.00 57.52  ? 491 GLN A NE2   1 
ATOM   3700 N  N     . LEU A 1 498 ? -30.321 1.791   -56.999 1.00 36.56  ? 492 LEU A N     1 
ATOM   3701 C  CA    . LEU A 1 498 ? -29.057 1.085   -56.736 1.00 34.55  ? 492 LEU A CA    1 
ATOM   3702 C  C     . LEU A 1 498 ? -29.147 -0.430  -56.896 1.00 37.08  ? 492 LEU A C     1 
ATOM   3703 O  O     . LEU A 1 498 ? -28.232 -1.063  -57.418 1.00 38.24  ? 492 LEU A O     1 
ATOM   3704 C  CB    . LEU A 1 498 ? -28.549 1.388   -55.323 1.00 34.09  ? 492 LEU A CB    1 
ATOM   3705 C  CG    . LEU A 1 498 ? -27.098 1.824   -55.054 1.00 27.40  ? 492 LEU A CG    1 
ATOM   3706 C  CD1   . LEU A 1 498 ? -26.681 1.423   -53.641 1.00 22.56  ? 492 LEU A CD1   1 
ATOM   3707 C  CD2   . LEU A 1 498 ? -26.092 1.315   -56.080 1.00 19.82  ? 492 LEU A CD2   1 
ATOM   3708 N  N     . HIS A 1 499 ? -30.250 -1.005  -56.437 1.00 39.90  ? 493 HIS A N     1 
ATOM   3709 C  CA    . HIS A 1 499 ? -30.403 -2.455  -56.398 1.00 37.24  ? 493 HIS A CA    1 
ATOM   3710 C  C     . HIS A 1 499 ? -30.237 -3.157  -57.744 1.00 43.20  ? 493 HIS A C     1 
ATOM   3711 O  O     . HIS A 1 499 ? -29.986 -4.359  -57.783 1.00 52.15  ? 493 HIS A O     1 
ATOM   3712 C  CB    . HIS A 1 499 ? -31.754 -2.821  -55.798 1.00 40.23  ? 493 HIS A CB    1 
ATOM   3713 C  CG    . HIS A 1 499 ? -32.927 -2.334  -56.592 1.00 45.36  ? 493 HIS A CG    1 
ATOM   3714 N  ND1   . HIS A 1 499 ? -33.537 -3.096  -57.565 1.00 43.75  ? 493 HIS A ND1   1 
ATOM   3715 C  CD2   . HIS A 1 499 ? -33.622 -1.171  -56.535 1.00 42.35  ? 493 HIS A CD2   1 
ATOM   3716 C  CE1   . HIS A 1 499 ? -34.552 -2.424  -58.077 1.00 42.34  ? 493 HIS A CE1   1 
ATOM   3717 N  NE2   . HIS A 1 499 ? -34.626 -1.254  -57.468 1.00 44.34  ? 493 HIS A NE2   1 
ATOM   3718 N  N     . HIS A 1 500 ? -30.392 -2.421  -58.840 1.00 41.50  ? 494 HIS A N     1 
ATOM   3719 C  CA    . HIS A 1 500 ? -30.181 -2.984  -60.175 1.00 43.09  ? 494 HIS A CA    1 
ATOM   3720 C  C     . HIS A 1 500 ? -28.713 -3.316  -60.402 1.00 43.09  ? 494 HIS A C     1 
ATOM   3721 O  O     . HIS A 1 500 ? -28.381 -4.110  -61.279 1.00 47.48  ? 494 HIS A O     1 
ATOM   3722 C  CB    . HIS A 1 500 ? -30.629 -2.012  -61.274 1.00 40.65  ? 494 HIS A CB    1 
ATOM   3723 C  CG    . HIS A 1 500 ? -32.112 -1.837  -61.369 1.00 41.64  ? 494 HIS A CG    1 
ATOM   3724 N  ND1   . HIS A 1 500 ? -33.006 -2.820  -61.007 1.00 45.67  ? 494 HIS A ND1   1 
ATOM   3725 C  CD2   . HIS A 1 500 ? -32.858 -0.786  -61.789 1.00 40.31  ? 494 HIS A CD2   1 
ATOM   3726 C  CE1   . HIS A 1 500 ? -34.239 -2.384  -61.200 1.00 46.53  ? 494 HIS A CE1   1 
ATOM   3727 N  NE2   . HIS A 1 500 ? -34.176 -1.151  -61.669 1.00 47.41  ? 494 HIS A NE2   1 
ATOM   3728 N  N     . TYR A 1 501 ? -27.837 -2.695  -59.618 1.00 40.68  ? 495 TYR A N     1 
ATOM   3729 C  CA    . TYR A 1 501 ? -26.402 -2.844  -59.817 1.00 39.68  ? 495 TYR A CA    1 
ATOM   3730 C  C     . TYR A 1 501 ? -25.767 -3.607  -58.683 1.00 41.90  ? 495 TYR A C     1 
ATOM   3731 O  O     . TYR A 1 501 ? -24.712 -4.207  -58.847 1.00 42.65  ? 495 TYR A O     1 
ATOM   3732 C  CB    . TYR A 1 501 ? -25.741 -1.478  -59.923 1.00 38.73  ? 495 TYR A CB    1 
ATOM   3733 C  CG    . TYR A 1 501 ? -26.265 -0.641  -61.064 1.00 40.70  ? 495 TYR A CG    1 
ATOM   3734 C  CD1   . TYR A 1 501 ? -25.753 -0.788  -62.342 1.00 35.26  ? 495 TYR A CD1   1 
ATOM   3735 C  CD2   . TYR A 1 501 ? -27.270 0.296   -60.862 1.00 36.30  ? 495 TYR A CD2   1 
ATOM   3736 C  CE1   . TYR A 1 501 ? -26.225 -0.024  -63.391 1.00 42.39  ? 495 TYR A CE1   1 
ATOM   3737 C  CE2   . TYR A 1 501 ? -27.747 1.064   -61.902 1.00 35.39  ? 495 TYR A CE2   1 
ATOM   3738 C  CZ    . TYR A 1 501 ? -27.220 0.902   -63.167 1.00 39.40  ? 495 TYR A CZ    1 
ATOM   3739 O  OH    . TYR A 1 501 ? -27.686 1.661   -64.217 1.00 36.49  ? 495 TYR A OH    1 
ATOM   3740 N  N     . LEU A 1 502 ? -26.418 -3.568  -57.528 1.00 45.71  ? 496 LEU A N     1 
ATOM   3741 C  CA    . LEU A 1 502 ? -25.910 -4.212  -56.333 1.00 46.74  ? 496 LEU A CA    1 
ATOM   3742 C  C     . LEU A 1 502 ? -25.703 -5.702  -56.566 1.00 56.48  ? 496 LEU A C     1 
ATOM   3743 O  O     . LEU A 1 502 ? -26.607 -6.395  -57.027 1.00 64.48  ? 496 LEU A O     1 
ATOM   3744 C  CB    . LEU A 1 502 ? -26.867 -3.969  -55.171 1.00 56.17  ? 496 LEU A CB    1 
ATOM   3745 C  CG    . LEU A 1 502 ? -26.197 -3.477  -53.887 1.00 56.61  ? 496 LEU A CG    1 
ATOM   3746 C  CD1   . LEU A 1 502 ? -25.048 -2.537  -54.221 1.00 41.84  ? 496 LEU A CD1   1 
ATOM   3747 C  CD2   . LEU A 1 502 ? -27.222 -2.802  -52.971 1.00 43.10  ? 496 LEU A CD2   1 
ATOM   3748 N  N     . PRO A 1 503 ? -24.497 -6.197  -56.252 1.00 65.86  ? 497 PRO A N     1 
ATOM   3749 C  CA    . PRO A 1 503 ? -24.072 -7.548  -56.622 1.00 64.21  ? 497 PRO A CA    1 
ATOM   3750 C  C     . PRO A 1 503 ? -23.937 -8.504  -55.437 1.00 80.28  ? 497 PRO A C     1 
ATOM   3751 O  O     . PRO A 1 503 ? -23.109 -8.260  -54.555 1.00 88.72  ? 497 PRO A O     1 
ATOM   3752 C  CB    . PRO A 1 503 ? -22.681 -7.291  -57.196 1.00 60.28  ? 497 PRO A CB    1 
ATOM   3753 C  CG    . PRO A 1 503 ? -22.173 -6.022  -56.406 1.00 56.40  ? 497 PRO A CG    1 
ATOM   3754 C  CD    . PRO A 1 503 ? -23.374 -5.424  -55.691 1.00 59.58  ? 497 PRO A CD    1 
ATOM   3755 N  N     . ALA A 1 504 ? -24.733 -9.571  -55.408 1.00 76.17  ? 498 ALA A N     1 
ATOM   3756 C  CA    . ALA A 1 504 ? -24.509 -10.688 -54.474 1.00 83.12  ? 498 ALA A CA    1 
ATOM   3757 C  C     . ALA A 1 504 ? -24.410 -10.346 -52.968 1.00 82.98  ? 498 ALA A C     1 
ATOM   3758 O  O     . ALA A 1 504 ? -24.782 -11.158 -52.118 1.00 80.96  ? 498 ALA A O     1 
ATOM   3759 C  CB    . ALA A 1 504 ? -23.286 -11.503 -54.920 1.00 72.26  ? 498 ALA A CB    1 
ATOM   3760 N  N     . GLU A 1 505 ? -23.891 -9.160  -52.653 1.00 84.92  ? 499 GLU A N     1 
ATOM   3761 C  CA    . GLU A 1 505 ? -23.794 -8.651  -51.284 1.00 82.47  ? 499 GLU A CA    1 
ATOM   3762 C  C     . GLU A 1 505 ? -25.168 -8.185  -50.754 1.00 84.40  ? 499 GLU A C     1 
ATOM   3763 O  O     . GLU A 1 505 ? -25.351 -7.960  -49.547 1.00 76.42  ? 499 GLU A O     1 
ATOM   3764 C  CB    . GLU A 1 505 ? -22.719 -7.549  -51.226 1.00 85.34  ? 499 GLU A CB    1 
ATOM   3765 C  CG    . GLU A 1 505 ? -23.005 -6.336  -50.347 1.00 79.78  ? 499 GLU A CG    1 
ATOM   3766 C  CD    . GLU A 1 505 ? -23.906 -5.328  -51.022 1.00 62.97  ? 499 GLU A CD    1 
ATOM   3767 O  OE1   . GLU A 1 505 ? -24.920 -4.937  -50.407 1.00 57.87  ? 499 GLU A OE1   1 
ATOM   3768 O  OE2   . GLU A 1 505 ? -23.603 -4.935  -52.167 1.00 63.79  ? 499 GLU A OE2   1 
ATOM   3769 N  N     . ILE A 1 506 ? -26.130 -8.071  -51.673 1.00 82.85  ? 500 ILE A N     1 
ATOM   3770 C  CA    . ILE A 1 506 ? -27.542 -7.868  -51.343 1.00 76.56  ? 500 ILE A CA    1 
ATOM   3771 C  C     . ILE A 1 506 ? -28.062 -8.962  -50.404 1.00 77.35  ? 500 ILE A C     1 
ATOM   3772 O  O     . ILE A 1 506 ? -28.869 -9.798  -50.806 1.00 75.87  ? 500 ILE A O     1 
ATOM   3773 C  CB    . ILE A 1 506 ? -28.412 -7.871  -52.623 1.00 70.26  ? 500 ILE A CB    1 
ATOM   3774 C  CG1   . ILE A 1 506 ? -27.610 -8.403  -53.817 1.00 65.05  ? 500 ILE A CG1   1 
ATOM   3775 C  CG2   . ILE A 1 506 ? -28.934 -6.479  -52.920 1.00 70.69  ? 500 ILE A CG2   1 
ATOM   3776 C  CD1   . ILE A 1 506 ? -28.329 -8.301  -55.142 1.00 48.41  ? 500 ILE A CD1   1 
ATOM   3777 N  N     . LEU A 1 507 ? -27.600 -8.950  -49.156 1.00 78.40  ? 501 LEU A N     1 
ATOM   3778 C  CA    . LEU A 1 507 ? -27.900 -10.019 -48.207 1.00 74.03  ? 501 LEU A CA    1 
ATOM   3779 C  C     . LEU A 1 507 ? -27.924 -9.501  -46.771 1.00 63.91  ? 501 LEU A C     1 
ATOM   3780 O  O     . LEU A 1 507 ? -26.874 -9.243  -46.181 1.00 60.39  ? 501 LEU A O     1 
ATOM   3781 C  CB    . LEU A 1 507 ? -26.874 -11.151 -48.346 1.00 71.68  ? 501 LEU A CB    1 
ATOM   3782 C  CG    . LEU A 1 507 ? -27.003 -12.063 -49.572 1.00 72.00  ? 501 LEU A CG    1 
ATOM   3783 C  CD1   . LEU A 1 507 ? -25.787 -12.967 -49.739 1.00 63.73  ? 501 LEU A CD1   1 
ATOM   3784 C  CD2   . LEU A 1 507 ? -28.280 -12.888 -49.473 1.00 82.78  ? 501 LEU A CD2   1 
ATOM   3785 N  N     . HIS B 1 24  ? -28.257 -35.603 -0.460  1.00 42.94  ? 18  HIS B N     1 
ATOM   3786 C  CA    . HIS B 1 24  ? -27.932 -34.200 -0.174  1.00 44.42  ? 18  HIS B CA    1 
ATOM   3787 C  C     . HIS B 1 24  ? -27.874 -33.312 -1.430  1.00 42.69  ? 18  HIS B C     1 
ATOM   3788 O  O     . HIS B 1 24  ? -28.188 -33.771 -2.533  1.00 44.78  ? 18  HIS B O     1 
ATOM   3789 C  CB    . HIS B 1 24  ? -26.652 -34.073 0.676   1.00 45.30  ? 18  HIS B CB    1 
ATOM   3790 C  CG    . HIS B 1 24  ? -25.396 -34.524 -0.014  1.00 46.02  ? 18  HIS B CG    1 
ATOM   3791 N  ND1   . HIS B 1 24  ? -24.893 -35.803 0.110   1.00 55.47  ? 18  HIS B ND1   1 
ATOM   3792 C  CD2   . HIS B 1 24  ? -24.521 -33.853 -0.804  1.00 40.24  ? 18  HIS B CD2   1 
ATOM   3793 C  CE1   . HIS B 1 24  ? -23.775 -35.907 -0.591  1.00 41.78  ? 18  HIS B CE1   1 
ATOM   3794 N  NE2   . HIS B 1 24  ? -23.527 -34.739 -1.154  1.00 42.36  ? 18  HIS B NE2   1 
ATOM   3795 N  N     . TYR B 1 25  ? -27.465 -32.051 -1.262  1.00 37.68  ? 19  TYR B N     1 
ATOM   3796 C  CA    . TYR B 1 25  ? -27.661 -31.037 -2.306  1.00 26.08  ? 19  TYR B CA    1 
ATOM   3797 C  C     . TYR B 1 25  ? -26.448 -30.505 -3.069  1.00 32.93  ? 19  TYR B C     1 
ATOM   3798 O  O     . TYR B 1 25  ? -26.459 -30.465 -4.311  1.00 39.82  ? 19  TYR B O     1 
ATOM   3799 C  CB    . TYR B 1 25  ? -28.418 -29.858 -1.747  1.00 24.68  ? 19  TYR B CB    1 
ATOM   3800 C  CG    . TYR B 1 25  ? -29.875 -30.137 -1.521  1.00 27.84  ? 19  TYR B CG    1 
ATOM   3801 C  CD1   . TYR B 1 25  ? -30.817 -29.940 -2.536  1.00 25.85  ? 19  TYR B CD1   1 
ATOM   3802 C  CD2   . TYR B 1 25  ? -30.316 -30.588 -0.287  1.00 26.04  ? 19  TYR B CD2   1 
ATOM   3803 C  CE1   . TYR B 1 25  ? -32.165 -30.189 -2.313  1.00 26.96  ? 19  TYR B CE1   1 
ATOM   3804 C  CE2   . TYR B 1 25  ? -31.647 -30.849 -0.058  1.00 28.79  ? 19  TYR B CE2   1 
ATOM   3805 C  CZ    . TYR B 1 25  ? -32.571 -30.642 -1.056  1.00 31.89  ? 19  TYR B CZ    1 
ATOM   3806 O  OH    . TYR B 1 25  ? -33.894 -30.913 -0.769  1.00 38.38  ? 19  TYR B OH    1 
ATOM   3807 N  N     . GLY B 1 26  ? -25.418 -30.068 -2.356  1.00 23.01  ? 20  GLY B N     1 
ATOM   3808 C  CA    . GLY B 1 26  ? -24.250 -29.502 -3.032  1.00 28.43  ? 20  GLY B CA    1 
ATOM   3809 C  C     . GLY B 1 26  ? -23.378 -30.447 -3.851  1.00 17.12  ? 20  GLY B C     1 
ATOM   3810 O  O     . GLY B 1 26  ? -23.757 -31.576 -4.108  1.00 20.99  ? 20  GLY B O     1 
ATOM   3811 N  N     . ILE B 1 27  ? -22.206 -29.979 -4.274  1.00 20.93  ? 21  ILE B N     1 
ATOM   3812 C  CA    . ILE B 1 27  ? -21.231 -30.855 -4.927  1.00 19.82  ? 21  ILE B CA    1 
ATOM   3813 C  C     . ILE B 1 27  ? -20.213 -31.412 -3.933  1.00 21.16  ? 21  ILE B C     1 
ATOM   3814 O  O     . ILE B 1 27  ? -19.191 -31.989 -4.324  1.00 23.92  ? 21  ILE B O     1 
ATOM   3815 C  CB    . ILE B 1 27  ? -20.465 -30.159 -6.072  1.00 18.95  ? 21  ILE B CB    1 
ATOM   3816 C  CG1   . ILE B 1 27  ? -19.741 -28.920 -5.558  1.00 23.04  ? 21  ILE B CG1   1 
ATOM   3817 C  CG2   . ILE B 1 27  ? -21.389 -29.807 -7.202  1.00 20.41  ? 21  ILE B CG2   1 
ATOM   3818 C  CD1   . ILE B 1 27  ? -19.064 -28.136 -6.657  1.00 25.71  ? 21  ILE B CD1   1 
ATOM   3819 N  N     . THR B 1 28  ? -20.485 -31.211 -2.648  1.00 19.36  ? 22  THR B N     1 
ATOM   3820 C  CA    . THR B 1 28  ? -19.726 -31.856 -1.585  1.00 18.79  ? 22  THR B CA    1 
ATOM   3821 C  C     . THR B 1 28  ? -20.709 -32.301 -0.515  1.00 20.68  ? 22  THR B C     1 
ATOM   3822 O  O     . THR B 1 28  ? -21.895 -31.973 -0.585  1.00 21.49  ? 22  THR B O     1 
ATOM   3823 C  CB    . THR B 1 28  ? -18.702 -30.904 -0.926  1.00 17.06  ? 22  THR B CB    1 
ATOM   3824 O  OG1   . THR B 1 28  ? -19.388 -29.888 -0.180  1.00 20.26  ? 22  THR B OG1   1 
ATOM   3825 C  CG2   . THR B 1 28  ? -17.813 -30.261 -1.953  1.00 13.36  ? 22  THR B CG2   1 
ATOM   3826 N  N     . SER B 1 29  ? -20.216 -33.043 0.476   1.00 22.34  ? 23  SER B N     1 
ATOM   3827 C  CA    . SER B 1 29  ? -21.013 -33.385 1.649   1.00 16.07  ? 23  SER B CA    1 
ATOM   3828 C  C     . SER B 1 29  ? -21.205 -32.133 2.470   1.00 12.73  ? 23  SER B C     1 
ATOM   3829 O  O     . SER B 1 29  ? -20.434 -31.185 2.353   1.00 15.57  ? 23  SER B O     1 
ATOM   3830 C  CB    . SER B 1 29  ? -20.307 -34.440 2.501   1.00 12.55  ? 23  SER B CB    1 
ATOM   3831 O  OG    . SER B 1 29  ? -20.439 -35.738 1.960   1.00 18.48  ? 23  SER B OG    1 
ATOM   3832 N  N     . PRO B 1 30  ? -22.249 -32.109 3.293   1.00 11.99  ? 24  PRO B N     1 
ATOM   3833 C  CA    . PRO B 1 30  ? -22.363 -31.045 4.292   1.00 14.00  ? 24  PRO B CA    1 
ATOM   3834 C  C     . PRO B 1 30  ? -21.200 -31.109 5.282   1.00 14.24  ? 24  PRO B C     1 
ATOM   3835 O  O     . PRO B 1 30  ? -20.640 -32.172 5.516   1.00 17.55  ? 24  PRO B O     1 
ATOM   3836 C  CB    . PRO B 1 30  ? -23.675 -31.378 4.999   1.00 15.69  ? 24  PRO B CB    1 
ATOM   3837 C  CG    . PRO B 1 30  ? -24.465 -32.137 3.983   1.00 14.04  ? 24  PRO B CG    1 
ATOM   3838 C  CD    . PRO B 1 30  ? -23.468 -32.928 3.199   1.00 15.13  ? 24  PRO B CD    1 
ATOM   3839 N  N     . ILE B 1 31  ? -20.828 -29.983 5.860   1.00 10.33  ? 25  ILE B N     1 
ATOM   3840 C  CA    . ILE B 1 31  ? -19.735 -29.992 6.811   1.00 13.70  ? 25  ILE B CA    1 
ATOM   3841 C  C     . ILE B 1 31  ? -20.199 -30.456 8.191   1.00 18.96  ? 25  ILE B C     1 
ATOM   3842 O  O     . ILE B 1 31  ? -19.542 -31.272 8.838   1.00 19.42  ? 25  ILE B O     1 
ATOM   3843 C  CB    . ILE B 1 31  ? -19.049 -28.624 6.867   1.00 13.60  ? 25  ILE B CB    1 
ATOM   3844 C  CG1   . ILE B 1 31  ? -18.204 -28.447 5.601   1.00 16.62  ? 25  ILE B CG1   1 
ATOM   3845 C  CG2   . ILE B 1 31  ? -18.184 -28.508 8.100   1.00 8.07   ? 25  ILE B CG2   1 
ATOM   3846 C  CD1   . ILE B 1 31  ? -18.314 -27.087 4.960   1.00 12.32  ? 25  ILE B CD1   1 
ATOM   3847 N  N     . SER B 1 32  ? -21.340 -29.941 8.635   1.00 19.94  ? 26  SER B N     1 
ATOM   3848 C  CA    . SER B 1 32  ? -21.953 -30.405 9.868   1.00 17.12  ? 26  SER B CA    1 
ATOM   3849 C  C     . SER B 1 32  ? -23.432 -30.635 9.661   1.00 24.70  ? 26  SER B C     1 
ATOM   3850 O  O     . SER B 1 32  ? -24.108 -29.819 9.036   1.00 20.99  ? 26  SER B O     1 
ATOM   3851 C  CB    . SER B 1 32  ? -21.765 -29.401 10.987  1.00 21.82  ? 26  SER B CB    1 
ATOM   3852 O  OG    . SER B 1 32  ? -22.606 -29.718 12.088  1.00 24.37  ? 26  SER B OG    1 
ATOM   3853 N  N     . LEU B 1 33  ? -23.927 -31.753 10.189  1.00 30.61  ? 27  LEU B N     1 
ATOM   3854 C  CA    . LEU B 1 33  ? -25.335 -32.106 10.077  1.00 21.75  ? 27  LEU B CA    1 
ATOM   3855 C  C     . LEU B 1 33  ? -26.095 -31.629 11.305  1.00 22.42  ? 27  LEU B C     1 
ATOM   3856 O  O     . LEU B 1 33  ? -27.298 -31.867 11.420  1.00 28.25  ? 27  LEU B O     1 
ATOM   3857 C  CB    . LEU B 1 33  ? -25.496 -33.614 9.912   1.00 17.53  ? 27  LEU B CB    1 
ATOM   3858 C  CG    . LEU B 1 33  ? -25.265 -34.229 8.529   1.00 18.32  ? 27  LEU B CG    1 
ATOM   3859 C  CD1   . LEU B 1 33  ? -25.205 -35.738 8.635   1.00 17.85  ? 27  LEU B CD1   1 
ATOM   3860 C  CD2   . LEU B 1 33  ? -26.369 -33.845 7.577   1.00 20.48  ? 27  LEU B CD2   1 
ATOM   3861 N  N     . ALA B 1 34  ? -25.393 -30.937 12.203  1.00 15.88  ? 28  ALA B N     1 
ATOM   3862 C  CA    . ALA B 1 34  ? -25.965 -30.434 13.464  1.00 25.09  ? 28  ALA B CA    1 
ATOM   3863 C  C     . ALA B 1 34  ? -27.329 -29.714 13.387  1.00 28.66  ? 28  ALA B C     1 
ATOM   3864 O  O     . ALA B 1 34  ? -27.502 -28.756 12.625  1.00 24.79  ? 28  ALA B O     1 
ATOM   3865 C  CB    . ALA B 1 34  ? -24.955 -29.538 14.174  1.00 22.82  ? 28  ALA B CB    1 
ATOM   3866 N  N     . SER B 1 35  ? -28.278 -30.176 14.203  1.00 29.29  ? 29  SER B N     1 
ATOM   3867 C  CA    . SER B 1 35  ? -29.572 -29.516 14.374  1.00 21.73  ? 29  SER B CA    1 
ATOM   3868 C  C     . SER B 1 35  ? -29.415 -28.419 15.404  1.00 23.93  ? 29  SER B C     1 
ATOM   3869 O  O     . SER B 1 35  ? -28.507 -28.483 16.245  1.00 29.36  ? 29  SER B O     1 
ATOM   3870 C  CB    . SER B 1 35  ? -30.617 -30.510 14.868  1.00 25.84  ? 29  SER B CB    1 
ATOM   3871 O  OG    . SER B 1 35  ? -30.386 -31.803 14.337  1.00 44.17  ? 29  SER B OG    1 
ATOM   3872 N  N     . PRO B 1 36  ? -30.301 -27.408 15.357  1.00 25.91  ? 30  PRO B N     1 
ATOM   3873 C  CA    . PRO B 1 36  ? -30.149 -26.274 16.280  1.00 26.43  ? 30  PRO B CA    1 
ATOM   3874 C  C     . PRO B 1 36  ? -30.487 -26.655 17.707  1.00 31.34  ? 30  PRO B C     1 
ATOM   3875 O  O     . PRO B 1 36  ? -31.372 -27.481 17.943  1.00 32.77  ? 30  PRO B O     1 
ATOM   3876 C  CB    . PRO B 1 36  ? -31.167 -25.250 15.760  1.00 27.13  ? 30  PRO B CB    1 
ATOM   3877 C  CG    . PRO B 1 36  ? -32.176 -26.046 14.990  1.00 19.54  ? 30  PRO B CG    1 
ATOM   3878 C  CD    . PRO B 1 36  ? -31.437 -27.230 14.429  1.00 21.68  ? 30  PRO B CD    1 
ATOM   3879 N  N     . LYS B 1 37  ? -29.774 -26.064 18.656  1.00 39.05  ? 31  LYS B N     1 
ATOM   3880 C  CA    . LYS B 1 37  ? -30.129 -26.228 20.058  1.00 38.82  ? 31  LYS B CA    1 
ATOM   3881 C  C     . LYS B 1 37  ? -31.145 -25.132 20.381  1.00 35.80  ? 31  LYS B C     1 
ATOM   3882 O  O     . LYS B 1 37  ? -31.409 -24.285 19.532  1.00 37.26  ? 31  LYS B O     1 
ATOM   3883 C  CB    . LYS B 1 37  ? -28.881 -26.185 20.953  1.00 41.35  ? 31  LYS B CB    1 
ATOM   3884 C  CG    . LYS B 1 37  ? -27.853 -27.311 20.664  1.00 38.20  ? 31  LYS B CG    1 
ATOM   3885 C  CD    . LYS B 1 37  ? -28.522 -28.702 20.529  1.00 45.13  ? 31  LYS B CD    1 
ATOM   3886 C  CE    . LYS B 1 37  ? -27.624 -29.751 19.843  1.00 38.10  ? 31  LYS B CE    1 
ATOM   3887 N  NZ    . LYS B 1 37  ? -26.487 -30.234 20.694  1.00 29.45  ? 31  LYS B NZ    1 
ATOM   3888 N  N     . GLU B 1 38  ? -31.731 -25.153 21.578  1.00 46.49  ? 32  GLU B N     1 
ATOM   3889 C  CA    . GLU B 1 38  ? -32.842 -24.244 21.889  1.00 40.36  ? 32  GLU B CA    1 
ATOM   3890 C  C     . GLU B 1 38  ? -32.402 -22.782 21.916  1.00 33.16  ? 32  GLU B C     1 
ATOM   3891 O  O     . GLU B 1 38  ? -33.158 -21.892 21.521  1.00 32.58  ? 32  GLU B O     1 
ATOM   3892 C  CB    . GLU B 1 38  ? -33.550 -24.635 23.199  1.00 38.96  ? 32  GLU B CB    1 
ATOM   3893 C  CG    . GLU B 1 38  ? -35.041 -24.259 23.245  1.00 50.97  ? 32  GLU B CG    1 
ATOM   3894 C  CD    . GLU B 1 38  ? -35.930 -25.137 22.341  1.00 54.10  ? 32  GLU B CD    1 
ATOM   3895 O  OE1   . GLU B 1 38  ? -36.553 -24.586 21.400  1.00 39.54  ? 32  GLU B OE1   1 
ATOM   3896 O  OE2   . GLU B 1 38  ? -36.020 -26.368 22.582  1.00 36.39  ? 32  GLU B OE2   1 
ATOM   3897 N  N     . ILE B 1 39  ? -31.173 -22.536 22.362  1.00 33.36  ? 33  ILE B N     1 
ATOM   3898 C  CA    . ILE B 1 39  ? -30.667 -21.167 22.418  1.00 33.51  ? 33  ILE B CA    1 
ATOM   3899 C  C     . ILE B 1 39  ? -30.434 -20.593 21.018  1.00 27.96  ? 33  ILE B C     1 
ATOM   3900 O  O     . ILE B 1 39  ? -30.543 -19.389 20.803  1.00 26.94  ? 33  ILE B O     1 
ATOM   3901 C  CB    . ILE B 1 39  ? -29.383 -21.041 23.279  1.00 25.42  ? 33  ILE B CB    1 
ATOM   3902 C  CG1   . ILE B 1 39  ? -29.227 -19.599 23.786  1.00 25.28  ? 33  ILE B CG1   1 
ATOM   3903 C  CG2   . ILE B 1 39  ? -28.158 -21.499 22.497  1.00 22.86  ? 33  ILE B CG2   1 
ATOM   3904 C  CD1   . ILE B 1 39  ? -28.198 -19.409 24.905  1.00 24.70  ? 33  ILE B CD1   1 
ATOM   3905 N  N     . ASP B 1 40  ? -30.122 -21.462 20.068  1.00 30.13  ? 34  ASP B N     1 
ATOM   3906 C  CA    . ASP B 1 40  ? -29.939 -21.038 18.693  1.00 26.49  ? 34  ASP B CA    1 
ATOM   3907 C  C     . ASP B 1 40  ? -31.223 -20.397 18.197  1.00 25.45  ? 34  ASP B C     1 
ATOM   3908 O  O     . ASP B 1 40  ? -31.196 -19.349 17.561  1.00 25.41  ? 34  ASP B O     1 
ATOM   3909 C  CB    . ASP B 1 40  ? -29.545 -22.228 17.821  1.00 24.13  ? 34  ASP B CB    1 
ATOM   3910 C  CG    . ASP B 1 40  ? -28.113 -22.668 18.057  1.00 26.40  ? 34  ASP B CG    1 
ATOM   3911 O  OD1   . ASP B 1 40  ? -27.222 -21.789 18.138  1.00 23.04  ? 34  ASP B OD1   1 
ATOM   3912 O  OD2   . ASP B 1 40  ? -27.881 -23.890 18.171  1.00 27.35  ? 34  ASP B OD2   1 
ATOM   3913 N  N     . HIS B 1 41  ? -32.352 -21.012 18.530  1.00 30.98  ? 35  HIS B N     1 
ATOM   3914 C  CA    . HIS B 1 41  ? -33.653 -20.474 18.149  1.00 26.71  ? 35  HIS B CA    1 
ATOM   3915 C  C     . HIS B 1 41  ? -33.910 -19.100 18.739  1.00 22.69  ? 35  HIS B C     1 
ATOM   3916 O  O     . HIS B 1 41  ? -34.578 -18.277 18.130  1.00 26.60  ? 35  HIS B O     1 
ATOM   3917 C  CB    . HIS B 1 41  ? -34.764 -21.436 18.537  1.00 20.51  ? 35  HIS B CB    1 
ATOM   3918 C  CG    . HIS B 1 41  ? -34.915 -22.568 17.582  1.00 25.20  ? 35  HIS B CG    1 
ATOM   3919 N  ND1   . HIS B 1 41  ? -35.376 -22.391 16.296  1.00 39.83  ? 35  HIS B ND1   1 
ATOM   3920 C  CD2   . HIS B 1 41  ? -34.637 -23.885 17.706  1.00 29.15  ? 35  HIS B CD2   1 
ATOM   3921 C  CE1   . HIS B 1 41  ? -35.396 -23.556 15.674  1.00 36.23  ? 35  HIS B CE1   1 
ATOM   3922 N  NE2   . HIS B 1 41  ? -34.948 -24.478 16.505  1.00 37.24  ? 35  HIS B NE2   1 
ATOM   3923 N  N     . ILE B 1 42  ? -33.377 -18.851 19.926  1.00 28.78  ? 36  ILE B N     1 
ATOM   3924 C  CA    . ILE B 1 42  ? -33.515 -17.538 20.540  1.00 30.25  ? 36  ILE B CA    1 
ATOM   3925 C  C     . ILE B 1 42  ? -32.654 -16.506 19.801  1.00 27.53  ? 36  ILE B C     1 
ATOM   3926 O  O     . ILE B 1 42  ? -33.063 -15.351 19.639  1.00 25.73  ? 36  ILE B O     1 
ATOM   3927 C  CB    . ILE B 1 42  ? -33.227 -17.584 22.064  1.00 25.79  ? 36  ILE B CB    1 
ATOM   3928 C  CG1   . ILE B 1 42  ? -34.340 -18.366 22.766  1.00 34.61  ? 36  ILE B CG1   1 
ATOM   3929 C  CG2   . ILE B 1 42  ? -33.112 -16.186 22.652  1.00 16.82  ? 36  ILE B CG2   1 
ATOM   3930 C  CD1   . ILE B 1 42  ? -34.289 -18.314 24.287  1.00 45.88  ? 36  ILE B CD1   1 
ATOM   3931 N  N     . TYR B 1 43  ? -31.484 -16.927 19.321  1.00 22.54  ? 37  TYR B N     1 
ATOM   3932 C  CA    . TYR B 1 43  ? -30.625 -16.016 18.565  1.00 21.69  ? 37  TYR B CA    1 
ATOM   3933 C  C     . TYR B 1 43  ? -31.246 -15.630 17.218  1.00 20.18  ? 37  TYR B C     1 
ATOM   3934 O  O     . TYR B 1 43  ? -31.167 -14.479 16.789  1.00 19.57  ? 37  TYR B O     1 
ATOM   3935 C  CB    . TYR B 1 43  ? -29.225 -16.591 18.375  1.00 17.64  ? 37  TYR B CB    1 
ATOM   3936 C  CG    . TYR B 1 43  ? -28.327 -16.451 19.584  1.00 20.71  ? 37  TYR B CG    1 
ATOM   3937 C  CD1   . TYR B 1 43  ? -28.014 -15.201 20.111  1.00 20.82  ? 37  TYR B CD1   1 
ATOM   3938 C  CD2   . TYR B 1 43  ? -27.776 -17.571 20.192  1.00 24.88  ? 37  TYR B CD2   1 
ATOM   3939 C  CE1   . TYR B 1 43  ? -27.183 -15.083 21.221  1.00 21.60  ? 37  TYR B CE1   1 
ATOM   3940 C  CE2   . TYR B 1 43  ? -26.947 -17.460 21.294  1.00 19.22  ? 37  TYR B CE2   1 
ATOM   3941 C  CZ    . TYR B 1 43  ? -26.655 -16.224 21.800  1.00 21.15  ? 37  TYR B CZ    1 
ATOM   3942 O  OH    . TYR B 1 43  ? -25.828 -16.144 22.890  1.00 26.27  ? 37  TYR B OH    1 
ATOM   3943 N  N     . THR B 1 44  ? -31.877 -16.591 16.562  1.00 18.06  ? 38  THR B N     1 
ATOM   3944 C  CA    . THR B 1 44  ? -32.585 -16.312 15.322  1.00 19.08  ? 38  THR B CA    1 
ATOM   3945 C  C     . THR B 1 44  ? -33.700 -15.270 15.530  1.00 27.29  ? 38  THR B C     1 
ATOM   3946 O  O     . THR B 1 44  ? -33.932 -14.404 14.667  1.00 23.86  ? 38  THR B O     1 
ATOM   3947 C  CB    . THR B 1 44  ? -33.137 -17.607 14.714  1.00 13.80  ? 38  THR B CB    1 
ATOM   3948 O  OG1   . THR B 1 44  ? -32.041 -18.488 14.461  1.00 13.18  ? 38  THR B OG1   1 
ATOM   3949 C  CG2   . THR B 1 44  ? -33.880 -17.333 13.419  1.00 9.58   ? 38  THR B CG2   1 
ATOM   3950 N  N     . GLN B 1 45  ? -34.373 -15.337 16.680  1.00 28.85  ? 39  GLN B N     1 
ATOM   3951 C  CA    . GLN B 1 45  ? -35.444 -14.386 16.972  1.00 25.14  ? 39  GLN B CA    1 
ATOM   3952 C  C     . GLN B 1 45  ? -34.852 -13.000 17.185  1.00 25.43  ? 39  GLN B C     1 
ATOM   3953 O  O     . GLN B 1 45  ? -35.416 -12.002 16.744  1.00 27.34  ? 39  GLN B O     1 
ATOM   3954 C  CB    . GLN B 1 45  ? -36.287 -14.825 18.174  1.00 16.49  ? 39  GLN B CB    1 
ATOM   3955 C  CG    . GLN B 1 45  ? -37.562 -13.995 18.385  1.00 16.62  ? 39  GLN B CG    1 
ATOM   3956 C  CD    . GLN B 1 45  ? -38.489 -13.982 17.167  1.00 32.11  ? 39  GLN B CD    1 
ATOM   3957 O  OE1   . GLN B 1 45  ? -38.652 -12.942 16.517  1.00 30.94  ? 39  GLN B OE1   1 
ATOM   3958 N  NE2   . GLN B 1 45  ? -39.109 -15.131 16.860  1.00 25.52  ? 39  GLN B NE2   1 
ATOM   3959 N  N     . LYS B 1 46  ? -33.693 -12.951 17.831  1.00 23.39  ? 40  LYS B N     1 
ATOM   3960 C  CA    . LYS B 1 46  ? -33.010 -11.690 18.055  1.00 23.05  ? 40  LYS B CA    1 
ATOM   3961 C  C     . LYS B 1 46  ? -32.468 -11.092 16.752  1.00 25.22  ? 40  LYS B C     1 
ATOM   3962 O  O     . LYS B 1 46  ? -32.160 -9.896  16.685  1.00 24.48  ? 40  LYS B O     1 
ATOM   3963 C  CB    . LYS B 1 46  ? -31.908 -11.858 19.104  1.00 23.31  ? 40  LYS B CB    1 
ATOM   3964 C  CG    . LYS B 1 46  ? -32.426 -11.710 20.537  1.00 34.67  ? 40  LYS B CG    1 
ATOM   3965 C  CD    . LYS B 1 46  ? -31.308 -11.586 21.568  1.00 38.64  ? 40  LYS B CD    1 
ATOM   3966 C  CE    . LYS B 1 46  ? -31.839 -11.063 22.895  1.00 43.48  ? 40  LYS B CE    1 
ATOM   3967 N  NZ    . LYS B 1 46  ? -30.814 -11.106 23.979  1.00 50.63  ? 40  LYS B NZ    1 
ATOM   3968 N  N     . LEU B 1 47  ? -32.372 -11.925 15.718  1.00 22.54  ? 41  LEU B N     1 
ATOM   3969 C  CA    . LEU B 1 47  ? -31.865 -11.485 14.421  1.00 20.83  ? 41  LEU B CA    1 
ATOM   3970 C  C     . LEU B 1 47  ? -32.984 -10.789 13.677  1.00 23.24  ? 41  LEU B C     1 
ATOM   3971 O  O     . LEU B 1 47  ? -32.795 -9.728  13.073  1.00 22.41  ? 41  LEU B O     1 
ATOM   3972 C  CB    . LEU B 1 47  ? -31.398 -12.683 13.598  1.00 18.84  ? 41  LEU B CB    1 
ATOM   3973 C  CG    . LEU B 1 47  ? -30.265 -12.495 12.580  1.00 19.53  ? 41  LEU B CG    1 
ATOM   3974 C  CD1   . LEU B 1 47  ? -30.275 -13.643 11.564  1.00 12.91  ? 41  LEU B CD1   1 
ATOM   3975 C  CD2   . LEU B 1 47  ? -30.292 -11.138 11.880  1.00 16.68  ? 41  LEU B CD2   1 
ATOM   3976 N  N     . ILE B 1 48  ? -34.150 -11.420 13.713  1.00 21.69  ? 42  ILE B N     1 
ATOM   3977 C  CA    . ILE B 1 48  ? -35.345 -10.871 13.107  1.00 17.00  ? 42  ILE B CA    1 
ATOM   3978 C  C     . ILE B 1 48  ? -35.668 -9.487  13.675  1.00 22.80  ? 42  ILE B C     1 
ATOM   3979 O  O     . ILE B 1 48  ? -35.991 -8.541  12.946  1.00 23.58  ? 42  ILE B O     1 
ATOM   3980 C  CB    . ILE B 1 48  ? -36.511 -11.814 13.340  1.00 16.18  ? 42  ILE B CB    1 
ATOM   3981 C  CG1   . ILE B 1 48  ? -36.188 -13.185 12.731  1.00 11.12  ? 42  ILE B CG1   1 
ATOM   3982 C  CG2   . ILE B 1 48  ? -37.785 -11.208 12.805  1.00 17.42  ? 42  ILE B CG2   1 
ATOM   3983 C  CD1   . ILE B 1 48  ? -37.388 -14.053 12.509  1.00 6.93   ? 42  ILE B CD1   1 
ATOM   3984 N  N     . ASP B 1 49  ? -35.551 -9.355  14.986  1.00 23.32  ? 43  ASP B N     1 
ATOM   3985 C  CA    . ASP B 1 49  ? -35.877 -8.092  15.618  1.00 23.60  ? 43  ASP B CA    1 
ATOM   3986 C  C     . ASP B 1 49  ? -34.900 -7.002  15.193  1.00 19.16  ? 43  ASP B C     1 
ATOM   3987 O  O     . ASP B 1 49  ? -35.303 -5.877  14.916  1.00 19.95  ? 43  ASP B O     1 
ATOM   3988 C  CB    . ASP B 1 49  ? -35.914 -8.263  17.136  1.00 26.16  ? 43  ASP B CB    1 
ATOM   3989 C  CG    . ASP B 1 49  ? -36.984 -9.250  17.580  1.00 32.40  ? 43  ASP B CG    1 
ATOM   3990 O  OD1   . ASP B 1 49  ? -38.045 -9.334  16.901  1.00 36.04  ? 43  ASP B OD1   1 
ATOM   3991 O  OD2   . ASP B 1 49  ? -36.755 -9.943  18.597  1.00 27.88  ? 43  ASP B OD2   1 
ATOM   3992 N  N     . ALA B 1 50  ? -33.620 -7.344  15.135  1.00 14.97  ? 44  ALA B N     1 
ATOM   3993 C  CA    . ALA B 1 50  ? -32.597 -6.383  14.772  1.00 14.60  ? 44  ALA B CA    1 
ATOM   3994 C  C     . ALA B 1 50  ? -32.824 -5.934  13.334  1.00 20.43  ? 44  ALA B C     1 
ATOM   3995 O  O     . ALA B 1 50  ? -32.565 -4.784  12.965  1.00 16.89  ? 44  ALA B O     1 
ATOM   3996 C  CB    . ALA B 1 50  ? -31.221 -7.002  14.924  1.00 16.10  ? 44  ALA B CB    1 
ATOM   3997 N  N     . MET B 1 51  ? -33.328 -6.850  12.522  1.00 18.38  ? 45  MET B N     1 
ATOM   3998 C  CA    . MET B 1 51  ? -33.552 -6.544  11.130  1.00 16.89  ? 45  MET B CA    1 
ATOM   3999 C  C     . MET B 1 51  ? -34.818 -5.720  10.921  1.00 20.70  ? 45  MET B C     1 
ATOM   4000 O  O     . MET B 1 51  ? -34.859 -4.878  10.020  1.00 18.42  ? 45  MET B O     1 
ATOM   4001 C  CB    . MET B 1 51  ? -33.611 -7.826  10.313  1.00 19.27  ? 45  MET B CB    1 
ATOM   4002 C  CG    . MET B 1 51  ? -32.281 -8.539  10.207  1.00 19.88  ? 45  MET B CG    1 
ATOM   4003 S  SD    . MET B 1 51  ? -32.300 -9.783  8.909   1.00 20.56  ? 45  MET B SD    1 
ATOM   4004 C  CE    . MET B 1 51  ? -33.322 -11.066 9.612   1.00 14.27  ? 45  MET B CE    1 
ATOM   4005 N  N     . LYS B 1 52  ? -35.837 -5.950  11.752  1.00 18.93  ? 46  LYS B N     1 
ATOM   4006 C  CA    . LYS B 1 52  ? -37.141 -5.296  11.561  1.00 19.00  ? 46  LYS B CA    1 
ATOM   4007 C  C     . LYS B 1 52  ? -37.121 -3.784  11.268  1.00 18.44  ? 46  LYS B C     1 
ATOM   4008 O  O     . LYS B 1 52  ? -37.709 -3.358  10.265  1.00 17.20  ? 46  LYS B O     1 
ATOM   4009 C  CB    . LYS B 1 52  ? -38.138 -5.637  12.682  1.00 19.88  ? 46  LYS B CB    1 
ATOM   4010 C  CG    . LYS B 1 52  ? -39.137 -6.745  12.318  1.00 20.76  ? 46  LYS B CG    1 
ATOM   4011 C  CD    . LYS B 1 52  ? -39.987 -7.171  13.524  1.00 46.06  ? 46  LYS B CD    1 
ATOM   4012 C  CE    . LYS B 1 52  ? -40.746 -8.492  13.293  1.00 40.29  ? 46  LYS B CE    1 
ATOM   4013 N  NZ    . LYS B 1 52  ? -41.130 -9.131  14.595  1.00 30.14  ? 46  LYS B NZ    1 
ATOM   4014 N  N     . PRO B 1 53  ? -36.422 -2.974  12.099  1.00 18.41  ? 47  PRO B N     1 
ATOM   4015 C  CA    . PRO B 1 53  ? -36.478 -1.516  11.894  1.00 17.25  ? 47  PRO B CA    1 
ATOM   4016 C  C     . PRO B 1 53  ? -35.814 -1.029  10.595  1.00 15.92  ? 47  PRO B C     1 
ATOM   4017 O  O     . PRO B 1 53  ? -35.752 0.171   10.334  1.00 14.26  ? 47  PRO B O     1 
ATOM   4018 C  CB    . PRO B 1 53  ? -35.722 -0.967  13.108  1.00 10.21  ? 47  PRO B CB    1 
ATOM   4019 C  CG    . PRO B 1 53  ? -34.792 -2.034  13.479  1.00 13.05  ? 47  PRO B CG    1 
ATOM   4020 C  CD    . PRO B 1 53  ? -35.527 -3.316  13.218  1.00 15.74  ? 47  PRO B CD    1 
ATOM   4021 N  N     . PHE B 1 54  ? -35.332 -1.955  9.780   1.00 19.06  ? 48  PHE B N     1 
ATOM   4022 C  CA    . PHE B 1 54  ? -34.647 -1.578  8.562   1.00 11.74  ? 48  PHE B CA    1 
ATOM   4023 C  C     . PHE B 1 54  ? -35.545 -1.686  7.348   1.00 12.75  ? 48  PHE B C     1 
ATOM   4024 O  O     . PHE B 1 54  ? -35.108 -1.415  6.243   1.00 23.80  ? 48  PHE B O     1 
ATOM   4025 C  CB    . PHE B 1 54  ? -33.407 -2.432  8.374   1.00 11.35  ? 48  PHE B CB    1 
ATOM   4026 C  CG    . PHE B 1 54  ? -32.243 -1.995  9.202   1.00 12.03  ? 48  PHE B CG    1 
ATOM   4027 C  CD1   . PHE B 1 54  ? -31.612 -0.786  8.950   1.00 15.59  ? 48  PHE B CD1   1 
ATOM   4028 C  CD2   . PHE B 1 54  ? -31.759 -2.793  10.212  1.00 11.34  ? 48  PHE B CD2   1 
ATOM   4029 C  CE1   . PHE B 1 54  ? -30.519 -0.379  9.701   1.00 10.77  ? 48  PHE B CE1   1 
ATOM   4030 C  CE2   . PHE B 1 54  ? -30.680 -2.390  10.968  1.00 10.77  ? 48  PHE B CE2   1 
ATOM   4031 C  CZ    . PHE B 1 54  ? -30.063 -1.182  10.713  1.00 10.40  ? 48  PHE B CZ    1 
ATOM   4032 N  N     . GLY B 1 55  ? -36.800 -2.070  7.539   1.00 12.18  ? 49  GLY B N     1 
ATOM   4033 C  CA    . GLY B 1 55  ? -37.735 -2.128  6.427   1.00 13.42  ? 49  GLY B CA    1 
ATOM   4034 C  C     . GLY B 1 55  ? -37.523 -3.386  5.613   1.00 20.78  ? 49  GLY B C     1 
ATOM   4035 O  O     . GLY B 1 55  ? -37.766 -3.445  4.406   1.00 22.48  ? 49  GLY B O     1 
ATOM   4036 N  N     . VAL B 1 56  ? -37.071 -4.422  6.295   1.00 18.44  ? 50  VAL B N     1 
ATOM   4037 C  CA    . VAL B 1 56  ? -36.575 -5.603  5.626   1.00 12.99  ? 50  VAL B CA    1 
ATOM   4038 C  C     . VAL B 1 56  ? -37.711 -6.592  5.317   1.00 18.78  ? 50  VAL B C     1 
ATOM   4039 O  O     . VAL B 1 56  ? -37.585 -7.460  4.432   1.00 18.03  ? 50  VAL B O     1 
ATOM   4040 C  CB    . VAL B 1 56  ? -35.445 -6.185  6.480   1.00 13.39  ? 50  VAL B CB    1 
ATOM   4041 C  CG1   . VAL B 1 56  ? -35.601 -7.682  6.724   1.00 15.65  ? 50  VAL B CG1   1 
ATOM   4042 C  CG2   . VAL B 1 56  ? -34.114 -5.816  5.871   1.00 10.15  ? 50  VAL B CG2   1 
ATOM   4043 N  N     . PHE B 1 57  ? -38.835 -6.411  6.021   1.00 25.75  ? 51  PHE B N     1 
ATOM   4044 C  CA    . PHE B 1 57  ? -40.025 -7.267  5.909   1.00 18.95  ? 51  PHE B CA    1 
ATOM   4045 C  C     . PHE B 1 57  ? -41.252 -6.449  5.548   1.00 18.24  ? 51  PHE B C     1 
ATOM   4046 O  O     . PHE B 1 57  ? -41.421 -5.335  6.050   1.00 20.07  ? 51  PHE B O     1 
ATOM   4047 C  CB    . PHE B 1 57  ? -40.326 -7.925  7.248   1.00 13.25  ? 51  PHE B CB    1 
ATOM   4048 C  CG    . PHE B 1 57  ? -39.284 -8.895  7.710   1.00 11.80  ? 51  PHE B CG    1 
ATOM   4049 C  CD1   . PHE B 1 57  ? -39.191 -10.150 7.145   1.00 8.73   ? 51  PHE B CD1   1 
ATOM   4050 C  CD2   . PHE B 1 57  ? -38.436 -8.573  8.760   1.00 16.78  ? 51  PHE B CD2   1 
ATOM   4051 C  CE1   . PHE B 1 57  ? -38.247 -11.059 7.598   1.00 11.62  ? 51  PHE B CE1   1 
ATOM   4052 C  CE2   . PHE B 1 57  ? -37.493 -9.479  9.224   1.00 15.28  ? 51  PHE B CE2   1 
ATOM   4053 C  CZ    . PHE B 1 57  ? -37.400 -10.729 8.642   1.00 13.61  ? 51  PHE B CZ    1 
ATOM   4054 N  N     . GLU B 1 58  ? -42.125 -7.011  4.717   1.00 19.03  ? 52  GLU B N     1 
ATOM   4055 C  CA    . GLU B 1 58  ? -43.320 -6.292  4.263   1.00 20.06  ? 52  GLU B CA    1 
ATOM   4056 C  C     . GLU B 1 58  ? -44.597 -6.665  5.024   1.00 18.02  ? 52  GLU B C     1 
ATOM   4057 O  O     . GLU B 1 58  ? -44.735 -7.792  5.490   1.00 18.90  ? 52  GLU B O     1 
ATOM   4058 C  CB    . GLU B 1 58  ? -43.523 -6.465  2.747   1.00 19.42  ? 52  GLU B CB    1 
ATOM   4059 C  CG    . GLU B 1 58  ? -42.769 -5.440  1.870   1.00 20.41  ? 52  GLU B CG    1 
ATOM   4060 C  CD    . GLU B 1 58  ? -43.338 -5.308  0.442   1.00 20.76  ? 52  GLU B CD    1 
ATOM   4061 O  OE1   . GLU B 1 58  ? -43.347 -4.179  -0.111  1.00 17.88  ? 52  GLU B OE1   1 
ATOM   4062 O  OE2   . GLU B 1 58  ? -43.767 -6.337  -0.128  1.00 17.55  ? 52  GLU B OE2   1 
ATOM   4063 N  N     . ASP B 1 59  ? -45.512 -5.701  5.144   1.00 22.92  ? 53  ASP B N     1 
ATOM   4064 C  CA    . ASP B 1 59  ? -46.842 -5.894  5.737   1.00 19.48  ? 53  ASP B CA    1 
ATOM   4065 C  C     . ASP B 1 59  ? -47.580 -6.996  5.033   1.00 20.31  ? 53  ASP B C     1 
ATOM   4066 O  O     . ASP B 1 59  ? -47.325 -7.274  3.870   1.00 20.82  ? 53  ASP B O     1 
ATOM   4067 C  CB    . ASP B 1 59  ? -47.731 -4.673  5.471   1.00 21.49  ? 53  ASP B CB    1 
ATOM   4068 C  CG    . ASP B 1 59  ? -47.361 -3.468  6.287   1.00 28.61  ? 53  ASP B CG    1 
ATOM   4069 O  OD1   . ASP B 1 59  ? -46.817 -3.635  7.396   1.00 27.45  ? 53  ASP B OD1   1 
ATOM   4070 O  OD2   . ASP B 1 59  ? -47.644 -2.340  5.813   1.00 29.58  ? 53  ASP B OD2   1 
ATOM   4071 N  N     . GLU B 1 60  ? -48.570 -7.560  5.704   1.00 22.31  ? 54  GLU B N     1 
ATOM   4072 C  CA    . GLU B 1 60  ? -49.604 -8.277  4.976   1.00 25.05  ? 54  GLU B CA    1 
ATOM   4073 C  C     . GLU B 1 60  ? -50.236 -7.347  3.932   1.00 22.52  ? 54  GLU B C     1 
ATOM   4074 O  O     . GLU B 1 60  ? -50.472 -7.760  2.807   1.00 23.68  ? 54  GLU B O     1 
ATOM   4075 C  CB    . GLU B 1 60  ? -50.662 -8.868  5.920   1.00 27.46  ? 54  GLU B CB    1 
ATOM   4076 C  CG    . GLU B 1 60  ? -50.138 -9.999  6.811   1.00 32.35  ? 54  GLU B CG    1 
ATOM   4077 C  CD    . GLU B 1 60  ? -49.169 -10.941 6.073   1.00 53.90  ? 54  GLU B CD    1 
ATOM   4078 O  OE1   . GLU B 1 60  ? -49.546 -11.493 5.001   1.00 48.36  ? 54  GLU B OE1   1 
ATOM   4079 O  OE2   . GLU B 1 60  ? -48.023 -11.119 6.563   1.00 51.49  ? 54  GLU B OE2   1 
ATOM   4080 N  N     . GLU B 1 61  ? -50.489 -6.091  4.296   1.00 23.59  ? 55  GLU B N     1 
ATOM   4081 C  CA    . GLU B 1 61  ? -51.010 -5.114  3.339   1.00 30.23  ? 55  GLU B CA    1 
ATOM   4082 C  C     . GLU B 1 61  ? -50.103 -5.002  2.118   1.00 27.24  ? 55  GLU B C     1 
ATOM   4083 O  O     . GLU B 1 61  ? -50.567 -4.980  0.978   1.00 23.23  ? 55  GLU B O     1 
ATOM   4084 C  CB    . GLU B 1 61  ? -51.138 -3.720  3.966   1.00 30.56  ? 55  GLU B CB    1 
ATOM   4085 C  CG    . GLU B 1 61  ? -52.280 -3.539  4.951   1.00 38.15  ? 55  GLU B CG    1 
ATOM   4086 C  CD    . GLU B 1 61  ? -52.703 -2.077  5.083   0.50 36.48  ? 55  GLU B CD    1 
ATOM   4087 O  OE1   . GLU B 1 61  ? -52.371 -1.275  4.177   0.50 28.49  ? 55  GLU B OE1   1 
ATOM   4088 O  OE2   . GLU B 1 61  ? -53.369 -1.735  6.088   0.50 30.95  ? 55  GLU B OE2   1 
ATOM   4089 N  N     . GLU B 1 62  ? -48.804 -4.928  2.370   1.00 23.53  ? 56  GLU B N     1 
ATOM   4090 C  CA    . GLU B 1 62  ? -47.855 -4.664  1.310   1.00 19.85  ? 56  GLU B CA    1 
ATOM   4091 C  C     . GLU B 1 62  ? -47.745 -5.845  0.354   1.00 19.70  ? 56  GLU B C     1 
ATOM   4092 O  O     . GLU B 1 62  ? -47.782 -5.675  -0.864  1.00 20.42  ? 56  GLU B O     1 
ATOM   4093 C  CB    . GLU B 1 62  ? -46.500 -4.279  1.902   1.00 19.45  ? 56  GLU B CB    1 
ATOM   4094 C  CG    . GLU B 1 62  ? -46.481 -2.864  2.446   1.00 21.16  ? 56  GLU B CG    1 
ATOM   4095 C  CD    . GLU B 1 62  ? -45.200 -2.521  3.180   1.00 27.98  ? 56  GLU B CD    1 
ATOM   4096 O  OE1   . GLU B 1 62  ? -44.789 -3.315  4.055   1.00 22.07  ? 56  GLU B OE1   1 
ATOM   4097 O  OE2   . GLU B 1 62  ? -44.608 -1.456  2.882   1.00 29.57  ? 56  GLU B OE2   1 
ATOM   4098 N  N     . LEU B 1 63  ? -47.620 -7.042  0.910   1.00 22.22  ? 57  LEU B N     1 
ATOM   4099 C  CA    . LEU B 1 63  ? -47.554 -8.259  0.113   1.00 16.16  ? 57  LEU B CA    1 
ATOM   4100 C  C     . LEU B 1 63  ? -48.822 -8.430  -0.693  1.00 18.24  ? 57  LEU B C     1 
ATOM   4101 O  O     . LEU B 1 63  ? -48.773 -8.821  -1.856  1.00 18.53  ? 57  LEU B O     1 
ATOM   4102 C  CB    . LEU B 1 63  ? -47.390 -9.459  1.027   1.00 17.97  ? 57  LEU B CB    1 
ATOM   4103 C  CG    . LEU B 1 63  ? -46.084 -9.481  1.799   1.00 17.79  ? 57  LEU B CG    1 
ATOM   4104 C  CD1   . LEU B 1 63  ? -46.184 -10.432 2.986   1.00 15.68  ? 57  LEU B CD1   1 
ATOM   4105 C  CD2   . LEU B 1 63  ? -44.985 -9.880  0.840   1.00 19.41  ? 57  LEU B CD2   1 
ATOM   4106 N  N     . ASN B 1 64  ? -49.958 -8.134  -0.062  1.00 25.17  ? 58  ASN B N     1 
ATOM   4107 C  CA    . ASN B 1 64  ? -51.268 -8.289  -0.695  1.00 23.03  ? 58  ASN B CA    1 
ATOM   4108 C  C     . ASN B 1 64  ? -51.426 -7.391  -1.903  1.00 17.15  ? 58  ASN B C     1 
ATOM   4109 O  O     . ASN B 1 64  ? -51.938 -7.812  -2.934  1.00 17.31  ? 58  ASN B O     1 
ATOM   4110 C  CB    . ASN B 1 64  ? -52.408 -8.037  0.296   1.00 19.08  ? 58  ASN B CB    1 
ATOM   4111 C  CG    . ASN B 1 64  ? -52.631 -9.209  1.254   1.00 23.28  ? 58  ASN B CG    1 
ATOM   4112 O  OD1   . ASN B 1 64  ? -52.372 -10.366 0.926   1.00 16.52  ? 58  ASN B OD1   1 
ATOM   4113 N  ND2   . ASN B 1 64  ? -53.122 -8.903  2.448   1.00 34.79  ? 58  ASN B ND2   1 
ATOM   4114 N  N     . HIS B 1 65  ? -50.986 -6.150  -1.770  1.00 18.02  ? 59  HIS B N     1 
ATOM   4115 C  CA    . HIS B 1 65  ? -51.073 -5.215  -2.875  1.00 18.16  ? 59  HIS B CA    1 
ATOM   4116 C  C     . HIS B 1 65  ? -50.356 -5.787  -4.099  1.00 19.28  ? 59  HIS B C     1 
ATOM   4117 O  O     . HIS B 1 65  ? -50.927 -5.856  -5.188  1.00 16.48  ? 59  HIS B O     1 
ATOM   4118 C  CB    . HIS B 1 65  ? -50.493 -3.855  -2.482  1.00 17.56  ? 59  HIS B CB    1 
ATOM   4119 C  CG    . HIS B 1 65  ? -50.631 -2.822  -3.552  1.00 25.10  ? 59  HIS B CG    1 
ATOM   4120 N  ND1   . HIS B 1 65  ? -51.767 -2.710  -4.326  1.00 23.32  ? 59  HIS B ND1   1 
ATOM   4121 C  CD2   . HIS B 1 65  ? -49.775 -1.874  -3.996  1.00 24.95  ? 59  HIS B CD2   1 
ATOM   4122 C  CE1   . HIS B 1 65  ? -51.603 -1.733  -5.199  1.00 24.71  ? 59  HIS B CE1   1 
ATOM   4123 N  NE2   . HIS B 1 65  ? -50.405 -1.210  -5.021  1.00 25.26  ? 59  HIS B NE2   1 
ATOM   4124 N  N     . ARG B 1 66  ? -49.116 -6.222  -3.902  1.00 15.71  ? 60  ARG B N     1 
ATOM   4125 C  CA    . ARG B 1 66  ? -48.349 -6.827  -4.969  1.00 11.83  ? 60  ARG B CA    1 
ATOM   4126 C  C     . ARG B 1 66  ? -49.134 -7.958  -5.591  1.00 14.32  ? 60  ARG B C     1 
ATOM   4127 O  O     . ARG B 1 66  ? -49.161 -8.098  -6.808  1.00 17.98  ? 60  ARG B O     1 
ATOM   4128 C  CB    . ARG B 1 66  ? -47.014 -7.348  -4.448  1.00 11.60  ? 60  ARG B CB    1 
ATOM   4129 C  CG    . ARG B 1 66  ? -46.024 -6.260  -4.079  1.00 13.03  ? 60  ARG B CG    1 
ATOM   4130 C  CD    . ARG B 1 66  ? -44.743 -6.842  -3.502  1.00 11.53  ? 60  ARG B CD    1 
ATOM   4131 N  NE    . ARG B 1 66  ? -43.871 -5.828  -2.909  1.00 14.67  ? 60  ARG B NE    1 
ATOM   4132 C  CZ    . ARG B 1 66  ? -42.901 -5.188  -3.559  1.00 14.34  ? 60  ARG B CZ    1 
ATOM   4133 N  NH1   . ARG B 1 66  ? -42.669 -5.433  -4.842  1.00 12.06  ? 60  ARG B NH1   1 
ATOM   4134 N  NH2   . ARG B 1 66  ? -42.159 -4.295  -2.923  1.00 11.91  ? 60  ARG B NH2   1 
ATOM   4135 N  N     . LEU B 1 67  ? -49.784 -8.763  -4.760  1.00 15.59  ? 61  LEU B N     1 
ATOM   4136 C  CA    . LEU B 1 67  ? -50.535 -9.904  -5.268  1.00 15.35  ? 61  LEU B CA    1 
ATOM   4137 C  C     . LEU B 1 67  ? -51.610 -9.412  -6.230  1.00 15.53  ? 61  LEU B C     1 
ATOM   4138 O  O     . LEU B 1 67  ? -51.824 -9.980  -7.297  1.00 16.59  ? 61  LEU B O     1 
ATOM   4139 C  CB    . LEU B 1 67  ? -51.143 -10.713 -4.119  1.00 16.36  ? 61  LEU B CB    1 
ATOM   4140 C  CG    . LEU B 1 67  ? -50.352 -11.925 -3.602  1.00 17.08  ? 61  LEU B CG    1 
ATOM   4141 C  CD1   . LEU B 1 67  ? -50.236 -12.989 -4.680  1.00 15.22  ? 61  LEU B CD1   1 
ATOM   4142 C  CD2   . LEU B 1 67  ? -48.959 -11.531 -3.137  1.00 20.95  ? 61  LEU B CD2   1 
ATOM   4143 N  N     . VAL B 1 68  ? -52.248 -8.317  -5.851  1.00 17.06  ? 62  VAL B N     1 
ATOM   4144 C  CA    . VAL B 1 68  ? -53.292 -7.703  -6.650  1.00 16.81  ? 62  VAL B CA    1 
ATOM   4145 C  C     . VAL B 1 68  ? -52.725 -7.193  -7.954  1.00 17.81  ? 62  VAL B C     1 
ATOM   4146 O  O     . VAL B 1 68  ? -53.286 -7.434  -9.017  1.00 20.77  ? 62  VAL B O     1 
ATOM   4147 C  CB    . VAL B 1 68  ? -53.900 -6.517  -5.909  1.00 11.90  ? 62  VAL B CB    1 
ATOM   4148 C  CG1   . VAL B 1 68  ? -54.695 -5.676  -6.846  1.00 7.45   ? 62  VAL B CG1   1 
ATOM   4149 C  CG2   . VAL B 1 68  ? -54.737 -7.010  -4.765  1.00 11.82  ? 62  VAL B CG2   1 
ATOM   4150 N  N     . VAL B 1 69  ? -51.608 -6.481  -7.865  1.00 18.56  ? 63  VAL B N     1 
ATOM   4151 C  CA    . VAL B 1 69  ? -50.953 -5.940  -9.049  1.00 16.49  ? 63  VAL B CA    1 
ATOM   4152 C  C     . VAL B 1 69  ? -50.544 -7.051  -10.015 1.00 18.36  ? 63  VAL B C     1 
ATOM   4153 O  O     . VAL B 1 69  ? -50.867 -6.994  -11.204 1.00 16.21  ? 63  VAL B O     1 
ATOM   4154 C  CB    . VAL B 1 69  ? -49.759 -5.068  -8.661  1.00 11.99  ? 63  VAL B CB    1 
ATOM   4155 C  CG1   . VAL B 1 69  ? -48.849 -4.827  -9.848  1.00 17.34  ? 63  VAL B CG1   1 
ATOM   4156 C  CG2   . VAL B 1 69  ? -50.265 -3.765  -8.111  1.00 18.69  ? 63  VAL B CG2   1 
ATOM   4157 N  N     . LEU B 1 70  ? -49.857 -8.065  -9.493  1.00 16.30  ? 64  LEU B N     1 
ATOM   4158 C  CA    . LEU B 1 70  ? -49.490 -9.225  -10.288 1.00 14.03  ? 64  LEU B CA    1 
ATOM   4159 C  C     . LEU B 1 70  ? -50.720 -9.910  -10.867 1.00 18.75  ? 64  LEU B C     1 
ATOM   4160 O  O     . LEU B 1 70  ? -50.676 -10.438 -11.977 1.00 20.29  ? 64  LEU B O     1 
ATOM   4161 C  CB    . LEU B 1 70  ? -48.669 -10.206 -9.466  1.00 13.73  ? 64  LEU B CB    1 
ATOM   4162 C  CG    . LEU B 1 70  ? -47.181 -9.866  -9.415  1.00 16.97  ? 64  LEU B CG    1 
ATOM   4163 C  CD1   . LEU B 1 70  ? -46.407 -10.966 -8.708  1.00 9.81   ? 64  LEU B CD1   1 
ATOM   4164 C  CD2   . LEU B 1 70  ? -46.631 -9.588  -10.821 1.00 8.40   ? 64  LEU B CD2   1 
ATOM   4165 N  N     . GLY B 1 71  ? -51.818 -9.897  -10.121 1.00 19.42  ? 65  GLY B N     1 
ATOM   4166 C  CA    . GLY B 1 71  ? -53.077 -10.387 -10.648 1.00 17.64  ? 65  GLY B CA    1 
ATOM   4167 C  C     . GLY B 1 71  ? -53.414 -9.694  -11.959 1.00 21.17  ? 65  GLY B C     1 
ATOM   4168 O  O     . GLY B 1 71  ? -53.565 -10.350 -12.977 1.00 25.27  ? 65  GLY B O     1 
ATOM   4169 N  N     . LYS B 1 72  ? -53.493 -8.366  -11.930 1.00 21.59  ? 66  LYS B N     1 
ATOM   4170 C  CA    . LYS B 1 72  ? -53.885 -7.556  -13.085 1.00 20.94  ? 66  LYS B CA    1 
ATOM   4171 C  C     . LYS B 1 72  ? -52.939 -7.696  -14.280 1.00 22.91  ? 66  LYS B C     1 
ATOM   4172 O  O     . LYS B 1 72  ? -53.380 -7.812  -15.424 1.00 24.14  ? 66  LYS B O     1 
ATOM   4173 C  CB    . LYS B 1 72  ? -53.982 -6.081  -12.668 1.00 24.71  ? 66  LYS B CB    1 
ATOM   4174 C  CG    . LYS B 1 72  ? -55.199 -5.741  -11.810 1.00 19.73  ? 66  LYS B CG    1 
ATOM   4175 C  CD    . LYS B 1 72  ? -54.969 -4.490  -10.976 1.00 19.64  ? 66  LYS B CD    1 
ATOM   4176 C  CE    . LYS B 1 72  ? -55.822 -3.318  -11.458 1.00 28.84  ? 66  LYS B CE    1 
ATOM   4177 N  NZ    . LYS B 1 72  ? -55.718 -2.116  -10.562 1.00 18.22  ? 66  LYS B NZ    1 
ATOM   4178 N  N     . LEU B 1 73  ? -51.641 -7.672  -14.004 1.00 20.53  ? 67  LEU B N     1 
ATOM   4179 C  CA    . LEU B 1 73  ? -50.625 -7.832  -15.029 1.00 18.19  ? 67  LEU B CA    1 
ATOM   4180 C  C     . LEU B 1 73  ? -50.837 -9.147  -15.762 1.00 23.83  ? 67  LEU B C     1 
ATOM   4181 O  O     . LEU B 1 73  ? -50.815 -9.193  -16.981 1.00 27.00  ? 67  LEU B O     1 
ATOM   4182 C  CB    . LEU B 1 73  ? -49.244 -7.840  -14.387 1.00 16.25  ? 67  LEU B CB    1 
ATOM   4183 C  CG    . LEU B 1 73  ? -48.063 -7.262  -15.165 1.00 20.70  ? 67  LEU B CG    1 
ATOM   4184 C  CD1   . LEU B 1 73  ? -46.848 -8.154  -14.998 1.00 20.50  ? 67  LEU B CD1   1 
ATOM   4185 C  CD2   . LEU B 1 73  ? -48.390 -7.041  -16.636 1.00 18.03  ? 67  LEU B CD2   1 
ATOM   4186 N  N     . ASN B 1 74  ? -51.037 -10.218 -15.003 1.00 28.98  ? 68  ASN B N     1 
ATOM   4187 C  CA    . ASN B 1 74  ? -51.257 -11.542 -15.570 1.00 25.84  ? 68  ASN B CA    1 
ATOM   4188 C  C     . ASN B 1 74  ? -52.501 -11.535 -16.446 1.00 27.16  ? 68  ASN B C     1 
ATOM   4189 O  O     . ASN B 1 74  ? -52.554 -12.204 -17.473 1.00 32.12  ? 68  ASN B O     1 
ATOM   4190 C  CB    . ASN B 1 74  ? -51.407 -12.577 -14.452 1.00 21.80  ? 68  ASN B CB    1 
ATOM   4191 C  CG    . ASN B 1 74  ? -50.826 -13.928 -14.821 1.00 36.07  ? 68  ASN B CG    1 
ATOM   4192 O  OD1   . ASN B 1 74  ? -49.835 -14.373 -14.231 1.00 44.64  ? 68  ASN B OD1   1 
ATOM   4193 N  ND2   . ASN B 1 74  ? -51.449 -14.600 -15.786 1.00 32.79  ? 68  ASN B ND2   1 
ATOM   4194 N  N     . ASN B 1 75  ? -53.499 -10.760 -16.044 1.00 26.18  ? 69  ASN B N     1 
ATOM   4195 C  CA    . ASN B 1 75  ? -54.750 -10.701 -16.787 1.00 30.84  ? 69  ASN B CA    1 
ATOM   4196 C  C     . ASN B 1 75  ? -54.625 -9.883  -18.071 1.00 31.98  ? 69  ASN B C     1 
ATOM   4197 O  O     . ASN B 1 75  ? -55.249 -10.221 -19.069 1.00 32.22  ? 69  ASN B O     1 
ATOM   4198 C  CB    . ASN B 1 75  ? -55.921 -10.236 -15.895 1.00 30.41  ? 69  ASN B CB    1 
ATOM   4199 C  CG    . ASN B 1 75  ? -56.810 -9.188  -16.569 1.00 36.47  ? 69  ASN B CG    1 
ATOM   4200 O  OD1   . ASN B 1 75  ? -57.613 -9.505  -17.451 1.00 29.31  ? 69  ASN B OD1   1 
ATOM   4201 N  ND2   . ASN B 1 75  ? -56.684 -7.934  -16.130 1.00 41.21  ? 69  ASN B ND2   1 
ATOM   4202 N  N     . LEU B 1 76  ? -53.809 -8.830  -18.058 1.00 26.83  ? 70  LEU B N     1 
ATOM   4203 C  CA    . LEU B 1 76  ? -53.566 -8.065  -19.283 1.00 32.36  ? 70  LEU B CA    1 
ATOM   4204 C  C     . LEU B 1 76  ? -52.891 -8.933  -20.348 1.00 32.66  ? 70  LEU B C     1 
ATOM   4205 O  O     . LEU B 1 76  ? -53.277 -8.916  -21.517 1.00 39.75  ? 70  LEU B O     1 
ATOM   4206 C  CB    . LEU B 1 76  ? -52.700 -6.824  -19.021 1.00 33.25  ? 70  LEU B CB    1 
ATOM   4207 C  CG    . LEU B 1 76  ? -53.157 -5.696  -18.089 1.00 31.49  ? 70  LEU B CG    1 
ATOM   4208 C  CD1   . LEU B 1 76  ? -52.103 -4.604  -18.064 1.00 28.69  ? 70  LEU B CD1   1 
ATOM   4209 C  CD2   . LEU B 1 76  ? -54.499 -5.120  -18.493 1.00 33.10  ? 70  LEU B CD2   1 
ATOM   4210 N  N     . VAL B 1 77  ? -51.875 -9.681  -19.935 1.00 28.65  ? 71  VAL B N     1 
ATOM   4211 C  CA    . VAL B 1 77  ? -51.144 -10.554 -20.838 1.00 29.59  ? 71  VAL B CA    1 
ATOM   4212 C  C     . VAL B 1 77  ? -52.070 -11.562 -21.525 1.00 34.04  ? 71  VAL B C     1 
ATOM   4213 O  O     . VAL B 1 77  ? -52.082 -11.657 -22.746 1.00 39.03  ? 71  VAL B O     1 
ATOM   4214 C  CB    . VAL B 1 77  ? -49.999 -11.279 -20.099 1.00 30.12  ? 71  VAL B CB    1 
ATOM   4215 C  CG1   . VAL B 1 77  ? -49.478 -12.441 -20.916 1.00 34.85  ? 71  VAL B CG1   1 
ATOM   4216 C  CG2   . VAL B 1 77  ? -48.879 -10.310 -19.779 1.00 24.56  ? 71  VAL B CG2   1 
ATOM   4217 N  N     . LYS B 1 78  ? -52.854 -12.302 -20.747 1.00 33.60  ? 72  LYS B N     1 
ATOM   4218 C  CA    . LYS B 1 78  ? -53.820 -13.242 -21.315 1.00 41.88  ? 72  LYS B CA    1 
ATOM   4219 C  C     . LYS B 1 78  ? -54.770 -12.534 -22.300 1.00 47.22  ? 72  LYS B C     1 
ATOM   4220 O  O     . LYS B 1 78  ? -55.130 -13.089 -23.344 1.00 46.14  ? 72  LYS B O     1 
ATOM   4221 C  CB    . LYS B 1 78  ? -54.618 -13.945 -20.201 1.00 51.40  ? 72  LYS B CB    1 
ATOM   4222 C  CG    . LYS B 1 78  ? -53.951 -15.193 -19.588 1.00 59.55  ? 72  LYS B CG    1 
ATOM   4223 C  CD    . LYS B 1 78  ? -54.787 -15.780 -18.432 1.00 54.84  ? 72  LYS B CD    1 
ATOM   4224 C  CE    . LYS B 1 78  ? -54.360 -17.213 -18.072 1.00 59.18  ? 72  LYS B CE    1 
ATOM   4225 N  NZ    . LYS B 1 78  ? -55.094 -17.787 -16.889 1.00 54.98  ? 72  LYS B NZ    1 
ATOM   4226 N  N     . GLU B 1 79  ? -55.149 -11.302 -21.952 1.00 41.85  ? 73  GLU B N     1 
ATOM   4227 C  CA    . GLU B 1 79  ? -56.036 -10.457 -22.750 1.00 33.93  ? 73  GLU B CA    1 
ATOM   4228 C  C     . GLU B 1 79  ? -55.320 -10.011 -24.017 1.00 40.81  ? 73  GLU B C     1 
ATOM   4229 O  O     . GLU B 1 79  ? -55.900 -10.003 -25.102 1.00 50.58  ? 73  GLU B O     1 
ATOM   4230 C  CB    . GLU B 1 79  ? -56.459 -9.238  -21.923 1.00 32.78  ? 73  GLU B CB    1 
ATOM   4231 C  CG    . GLU B 1 79  ? -57.500 -8.318  -22.533 1.00 38.40  ? 73  GLU B CG    1 
ATOM   4232 C  CD    . GLU B 1 79  ? -57.488 -6.915  -21.907 1.00 44.97  ? 73  GLU B CD    1 
ATOM   4233 O  OE1   . GLU B 1 79  ? -57.930 -6.756  -20.741 1.00 29.15  ? 73  GLU B OE1   1 
ATOM   4234 O  OE2   . GLU B 1 79  ? -57.032 -5.968  -22.588 1.00 43.49  ? 73  GLU B OE2   1 
ATOM   4235 N  N     . TRP B 1 80  ? -54.054 -9.649  -23.883 1.00 31.13  ? 74  TRP B N     1 
ATOM   4236 C  CA    . TRP B 1 80  ? -53.245 -9.305  -25.043 1.00 38.55  ? 74  TRP B CA    1 
ATOM   4237 C  C     . TRP B 1 80  ? -52.990 -10.497 -25.961 1.00 45.34  ? 74  TRP B C     1 
ATOM   4238 O  O     . TRP B 1 80  ? -53.518 -10.554 -27.059 1.00 44.60  ? 74  TRP B O     1 
ATOM   4239 C  CB    . TRP B 1 80  ? -51.923 -8.725  -24.588 1.00 40.24  ? 74  TRP B CB    1 
ATOM   4240 C  CG    . TRP B 1 80  ? -50.883 -8.663  -25.643 1.00 39.46  ? 74  TRP B CG    1 
ATOM   4241 C  CD1   . TRP B 1 80  ? -50.939 -7.961  -26.799 1.00 44.10  ? 74  TRP B CD1   1 
ATOM   4242 C  CD2   . TRP B 1 80  ? -49.601 -9.297  -25.616 1.00 42.02  ? 74  TRP B CD2   1 
ATOM   4243 N  NE1   . TRP B 1 80  ? -49.773 -8.119  -27.504 1.00 51.99  ? 74  TRP B NE1   1 
ATOM   4244 C  CE2   . TRP B 1 80  ? -48.932 -8.936  -26.796 1.00 44.37  ? 74  TRP B CE2   1 
ATOM   4245 C  CE3   . TRP B 1 80  ? -48.952 -10.135 -24.706 1.00 44.07  ? 74  TRP B CE3   1 
ATOM   4246 C  CZ2   . TRP B 1 80  ? -47.649 -9.385  -27.097 1.00 45.91  ? 74  TRP B CZ2   1 
ATOM   4247 C  CZ3   . TRP B 1 80  ? -47.675 -10.582 -25.007 1.00 44.95  ? 74  TRP B CZ3   1 
ATOM   4248 C  CH2   . TRP B 1 80  ? -47.038 -10.204 -26.189 1.00 46.50  ? 74  TRP B CH2   1 
ATOM   4249 N  N     . ILE B 1 81  ? -52.179 -11.446 -25.500 1.00 46.38  ? 75  ILE B N     1 
ATOM   4250 C  CA    . ILE B 1 81  ? -51.876 -12.680 -26.226 1.00 46.51  ? 75  ILE B CA    1 
ATOM   4251 C  C     . ILE B 1 81  ? -53.058 -13.222 -27.034 1.00 50.14  ? 75  ILE B C     1 
ATOM   4252 O  O     . ILE B 1 81  ? -52.885 -13.837 -28.088 1.00 56.63  ? 75  ILE B O     1 
ATOM   4253 C  CB    . ILE B 1 81  ? -51.350 -13.757 -25.250 1.00 46.07  ? 75  ILE B CB    1 
ATOM   4254 C  CG1   . ILE B 1 81  ? -49.865 -13.543 -24.996 1.00 41.82  ? 75  ILE B CG1   1 
ATOM   4255 C  CG2   . ILE B 1 81  ? -51.571 -15.169 -25.774 1.00 46.53  ? 75  ILE B CG2   1 
ATOM   4256 C  CD1   . ILE B 1 81  ? -49.287 -14.574 -24.071 1.00 48.51  ? 75  ILE B CD1   1 
ATOM   4257 N  N     . SER B 1 82  ? -54.264 -12.956 -26.554 1.00 43.80  ? 76  SER B N     1 
ATOM   4258 C  CA    . SER B 1 82  ? -55.457 -13.324 -27.286 1.00 44.70  ? 76  SER B CA    1 
ATOM   4259 C  C     . SER B 1 82  ? -55.798 -12.328 -28.412 1.00 61.10  ? 76  SER B C     1 
ATOM   4260 O  O     . SER B 1 82  ? -56.500 -12.691 -29.359 1.00 58.56  ? 76  SER B O     1 
ATOM   4261 C  CB    . SER B 1 82  ? -56.628 -13.475 -26.330 1.00 38.50  ? 76  SER B CB    1 
ATOM   4262 O  OG    . SER B 1 82  ? -57.740 -14.002 -27.006 1.00 39.85  ? 76  SER B OG    1 
ATOM   4263 N  N     . ASP B 1 83  ? -55.316 -11.084 -28.311 1.00 54.24  ? 77  ASP B N     1 
ATOM   4264 C  CA    . ASP B 1 83  ? -55.481 -10.110 -29.398 1.00 47.96  ? 77  ASP B CA    1 
ATOM   4265 C  C     . ASP B 1 83  ? -54.665 -10.538 -30.600 1.00 55.30  ? 77  ASP B C     1 
ATOM   4266 O  O     . ASP B 1 83  ? -55.061 -10.319 -31.743 1.00 65.77  ? 77  ASP B O     1 
ATOM   4267 C  CB    . ASP B 1 83  ? -55.014 -8.707  -28.994 1.00 47.43  ? 77  ASP B CB    1 
ATOM   4268 C  CG    . ASP B 1 83  ? -56.045 -7.947  -28.192 1.00 52.04  ? 77  ASP B CG    1 
ATOM   4269 O  OD1   . ASP B 1 83  ? -57.235 -8.338  -28.228 1.00 50.12  ? 77  ASP B OD1   1 
ATOM   4270 O  OD2   . ASP B 1 83  ? -55.656 -6.946  -27.538 1.00 41.73  ? 77  ASP B OD2   1 
ATOM   4271 N  N     . VAL B 1 84  ? -53.503 -11.123 -30.347 1.00 47.96  ? 78  VAL B N     1 
ATOM   4272 C  CA    . VAL B 1 84  ? -52.661 -11.551 -31.444 1.00 53.39  ? 78  VAL B CA    1 
ATOM   4273 C  C     . VAL B 1 84  ? -53.216 -12.862 -31.992 1.00 57.37  ? 78  VAL B C     1 
ATOM   4274 O  O     . VAL B 1 84  ? -52.952 -13.223 -33.136 1.00 64.32  ? 78  VAL B O     1 
ATOM   4275 C  CB    . VAL B 1 84  ? -51.184 -11.680 -31.020 1.00 52.00  ? 78  VAL B CB    1 
ATOM   4276 C  CG1   . VAL B 1 84  ? -50.306 -11.958 -32.221 1.00 52.79  ? 78  VAL B CG1   1 
ATOM   4277 C  CG2   . VAL B 1 84  ? -50.722 -10.405 -30.343 1.00 44.99  ? 78  VAL B CG2   1 
ATOM   4278 N  N     . SER B 1 85  ? -54.013 -13.558 -31.184 1.00 50.66  ? 79  SER B N     1 
ATOM   4279 C  CA    . SER B 1 85  ? -54.668 -14.793 -31.629 1.00 62.75  ? 79  SER B CA    1 
ATOM   4280 C  C     . SER B 1 85  ? -55.685 -14.563 -32.756 1.00 68.76  ? 79  SER B C     1 
ATOM   4281 O  O     . SER B 1 85  ? -55.590 -15.186 -33.819 1.00 74.25  ? 79  SER B O     1 
ATOM   4282 C  CB    . SER B 1 85  ? -55.340 -15.515 -30.459 1.00 65.39  ? 79  SER B CB    1 
ATOM   4283 O  OG    . SER B 1 85  ? -54.486 -16.495 -29.903 1.00 66.87  ? 79  SER B OG    1 
ATOM   4284 N  N     . GLU B 1 86  ? -56.663 -13.689 -32.509 1.00 71.19  ? 80  GLU B N     1 
ATOM   4285 C  CA    . GLU B 1 86  ? -57.602 -13.248 -33.545 1.00 67.80  ? 80  GLU B CA    1 
ATOM   4286 C  C     . GLU B 1 86  ? -56.820 -12.675 -34.735 1.00 68.24  ? 80  GLU B C     1 
ATOM   4287 O  O     . GLU B 1 86  ? -57.099 -13.004 -35.890 1.00 65.71  ? 80  GLU B O     1 
ATOM   4288 C  CB    . GLU B 1 86  ? -58.572 -12.182 -32.997 1.00 62.04  ? 80  GLU B CB    1 
ATOM   4289 C  CG    . GLU B 1 86  ? -59.423 -12.595 -31.780 1.00 61.72  ? 80  GLU B CG    1 
ATOM   4290 C  CD    . GLU B 1 86  ? -59.962 -11.389 -30.975 1.00 66.22  ? 80  GLU B CD    1 
ATOM   4291 O  OE1   . GLU B 1 86  ? -59.249 -10.365 -30.854 1.00 58.16  ? 80  GLU B OE1   1 
ATOM   4292 O  OE2   . GLU B 1 86  ? -61.100 -11.464 -30.452 1.00 62.90  ? 80  GLU B OE2   1 
ATOM   4293 N  N     . SER B 1 87  ? -55.824 -11.841 -34.427 1.00 61.14  ? 81  SER B N     1 
ATOM   4294 C  CA    . SER B 1 87  ? -55.036 -11.099 -35.415 1.00 59.51  ? 81  SER B CA    1 
ATOM   4295 C  C     . SER B 1 87  ? -54.214 -11.948 -36.412 1.00 63.34  ? 81  SER B C     1 
ATOM   4296 O  O     . SER B 1 87  ? -53.926 -11.510 -37.530 1.00 61.99  ? 81  SER B O     1 
ATOM   4297 C  CB    . SER B 1 87  ? -54.131 -10.091 -34.695 1.00 55.51  ? 81  SER B CB    1 
ATOM   4298 O  OG    . SER B 1 87  ? -53.214 -9.489  -35.590 1.00 61.85  ? 81  SER B OG    1 
ATOM   4299 N  N     . LYS B 1 88  ? -53.822 -13.150 -36.008 1.00 67.10  ? 82  LYS B N     1 
ATOM   4300 C  CA    . LYS B 1 88  ? -53.137 -14.052 -36.922 1.00 67.42  ? 82  LYS B CA    1 
ATOM   4301 C  C     . LYS B 1 88  ? -54.190 -14.789 -37.728 1.00 75.71  ? 82  LYS B C     1 
ATOM   4302 O  O     . LYS B 1 88  ? -53.932 -15.233 -38.850 1.00 73.10  ? 82  LYS B O     1 
ATOM   4303 C  CB    . LYS B 1 88  ? -52.278 -15.054 -36.154 1.00 53.45  ? 82  LYS B CB    1 
ATOM   4304 C  CG    . LYS B 1 88  ? -51.020 -14.468 -35.544 1.00 54.47  ? 82  LYS B CG    1 
ATOM   4305 C  CD    . LYS B 1 88  ? -49.915 -14.279 -36.578 1.00 64.08  ? 82  LYS B CD    1 
ATOM   4306 C  CE    . LYS B 1 88  ? -48.553 -13.997 -35.920 1.00 62.40  ? 82  LYS B CE    1 
ATOM   4307 N  NZ    . LYS B 1 88  ? -48.455 -12.666 -35.221 1.00 48.63  ? 82  LYS B NZ    1 
ATOM   4308 N  N     . ASN B 1 89  ? -55.379 -14.892 -37.133 1.00 69.62  ? 83  ASN B N     1 
ATOM   4309 C  CA    . ASN B 1 89  ? -56.504 -15.662 -37.669 1.00 77.99  ? 83  ASN B CA    1 
ATOM   4310 C  C     . ASN B 1 89  ? -56.337 -17.175 -37.513 1.00 78.90  ? 83  ASN B C     1 
ATOM   4311 O  O     . ASN B 1 89  ? -55.794 -17.858 -38.383 1.00 78.89  ? 83  ASN B O     1 
ATOM   4312 C  CB    . ASN B 1 89  ? -56.844 -15.277 -39.122 1.00 71.12  ? 83  ASN B CB    1 
ATOM   4313 C  CG    . ASN B 1 89  ? -57.734 -14.042 -39.210 1.00 78.08  ? 83  ASN B CG    1 
ATOM   4314 O  OD1   . ASN B 1 89  ? -58.965 -14.151 -39.218 1.00 68.86  ? 83  ASN B OD1   1 
ATOM   4315 N  ND2   . ASN B 1 89  ? -57.114 -12.860 -39.278 1.00 65.89  ? 83  ASN B ND2   1 
ATOM   4316 N  N     . LEU B 1 90  ? -56.802 -17.682 -36.378 1.00 66.39  ? 84  LEU B N     1 
ATOM   4317 C  CA    . LEU B 1 90  ? -56.839 -19.112 -36.123 1.00 71.85  ? 84  LEU B CA    1 
ATOM   4318 C  C     . LEU B 1 90  ? -58.251 -19.433 -35.632 1.00 83.35  ? 84  LEU B C     1 
ATOM   4319 O  O     . LEU B 1 90  ? -58.936 -18.543 -35.117 1.00 71.54  ? 84  LEU B O     1 
ATOM   4320 C  CB    . LEU B 1 90  ? -55.811 -19.475 -35.055 1.00 80.72  ? 84  LEU B CB    1 
ATOM   4321 C  CG    . LEU B 1 90  ? -54.613 -18.539 -34.865 1.00 79.89  ? 84  LEU B CG    1 
ATOM   4322 C  CD1   . LEU B 1 90  ? -53.893 -18.899 -33.567 1.00 62.68  ? 84  LEU B CD1   1 
ATOM   4323 C  CD2   . LEU B 1 90  ? -53.655 -18.576 -36.061 1.00 69.33  ? 84  LEU B CD2   1 
ATOM   4324 N  N     . PRO B 1 91  ? -58.697 -20.698 -35.789 1.00 90.56  ? 85  PRO B N     1 
ATOM   4325 C  CA    . PRO B 1 91  ? -60.069 -21.097 -35.420 1.00 92.51  ? 85  PRO B CA    1 
ATOM   4326 C  C     . PRO B 1 91  ? -60.451 -20.773 -33.968 1.00 91.32  ? 85  PRO B C     1 
ATOM   4327 O  O     . PRO B 1 91  ? -59.621 -20.943 -33.070 1.00 87.33  ? 85  PRO B O     1 
ATOM   4328 C  CB    . PRO B 1 91  ? -60.074 -22.618 -35.659 1.00 80.13  ? 85  PRO B CB    1 
ATOM   4329 C  CG    . PRO B 1 91  ? -58.627 -23.010 -35.755 1.00 79.46  ? 85  PRO B CG    1 
ATOM   4330 C  CD    . PRO B 1 91  ? -57.935 -21.828 -36.348 1.00 75.76  ? 85  PRO B CD    1 
ATOM   4331 N  N     . PRO B 1 92  ? -61.705 -20.325 -33.738 1.00 95.53  ? 86  PRO B N     1 
ATOM   4332 C  CA    . PRO B 1 92  ? -62.159 -19.863 -32.416 1.00 91.61  ? 86  PRO B CA    1 
ATOM   4333 C  C     . PRO B 1 92  ? -62.285 -20.992 -31.393 1.00 92.25  ? 86  PRO B C     1 
ATOM   4334 O  O     . PRO B 1 92  ? -63.219 -21.005 -30.592 1.00 89.43  ? 86  PRO B O     1 
ATOM   4335 C  CB    . PRO B 1 92  ? -63.534 -19.251 -32.709 1.00 80.93  ? 86  PRO B CB    1 
ATOM   4336 C  CG    . PRO B 1 92  ? -64.017 -19.983 -33.913 1.00 87.81  ? 86  PRO B CG    1 
ATOM   4337 C  CD    . PRO B 1 92  ? -62.789 -20.276 -34.739 1.00 89.55  ? 86  PRO B CD    1 
ATOM   4338 N  N     . SER B 1 93  ? -61.341 -21.925 -31.431 1.00 91.59  ? 87  SER B N     1 
ATOM   4339 C  CA    . SER B 1 93  ? -61.267 -23.014 -30.469 1.00 91.98  ? 87  SER B CA    1 
ATOM   4340 C  C     . SER B 1 93  ? -59.827 -23.113 -29.979 1.00 91.04  ? 87  SER B C     1 
ATOM   4341 O  O     . SER B 1 93  ? -59.547 -23.666 -28.915 1.00 81.50  ? 87  SER B O     1 
ATOM   4342 C  CB    . SER B 1 93  ? -61.715 -24.330 -31.113 1.00 96.79  ? 87  SER B CB    1 
ATOM   4343 O  OG    . SER B 1 93  ? -61.066 -24.547 -32.357 1.00 97.95  ? 87  SER B OG    1 
ATOM   4344 N  N     . VAL B 1 94  ? -58.915 -22.560 -30.771 1.00 95.32  ? 88  VAL B N     1 
ATOM   4345 C  CA    . VAL B 1 94  ? -57.510 -22.500 -30.402 1.00 93.63  ? 88  VAL B CA    1 
ATOM   4346 C  C     . VAL B 1 94  ? -57.204 -21.142 -29.770 1.00 87.34  ? 88  VAL B C     1 
ATOM   4347 O  O     . VAL B 1 94  ? -56.439 -21.053 -28.810 1.00 82.78  ? 88  VAL B O     1 
ATOM   4348 C  CB    . VAL B 1 94  ? -56.603 -22.722 -31.621 1.00 89.39  ? 88  VAL B CB    1 
ATOM   4349 C  CG1   . VAL B 1 94  ? -55.184 -23.000 -31.170 1.00 83.67  ? 88  VAL B CG1   1 
ATOM   4350 C  CG2   . VAL B 1 94  ? -57.130 -23.875 -32.470 1.00 91.23  ? 88  VAL B CG2   1 
ATOM   4351 N  N     . VAL B 1 95  ? -57.818 -20.095 -30.316 1.00 81.82  ? 89  VAL B N     1 
ATOM   4352 C  CA    . VAL B 1 95  ? -57.699 -18.736 -29.790 1.00 82.16  ? 89  VAL B CA    1 
ATOM   4353 C  C     . VAL B 1 95  ? -57.969 -18.653 -28.282 1.00 79.36  ? 89  VAL B C     1 
ATOM   4354 O  O     . VAL B 1 95  ? -57.195 -18.054 -27.533 1.00 76.11  ? 89  VAL B O     1 
ATOM   4355 C  CB    . VAL B 1 95  ? -58.662 -17.780 -30.534 1.00 85.88  ? 89  VAL B CB    1 
ATOM   4356 C  CG1   . VAL B 1 95  ? -58.668 -16.398 -29.896 1.00 78.04  ? 89  VAL B CG1   1 
ATOM   4357 C  CG2   . VAL B 1 95  ? -58.283 -17.691 -31.998 1.00 83.54  ? 89  VAL B CG2   1 
ATOM   4358 N  N     . ALA B 1 96  ? -59.060 -19.265 -27.837 1.00 80.79  ? 90  ALA B N     1 
ATOM   4359 C  CA    . ALA B 1 96  ? -59.439 -19.203 -26.430 1.00 82.20  ? 90  ALA B CA    1 
ATOM   4360 C  C     . ALA B 1 96  ? -58.905 -20.377 -25.607 1.00 79.52  ? 90  ALA B C     1 
ATOM   4361 O  O     . ALA B 1 96  ? -59.450 -20.694 -24.548 1.00 68.51  ? 90  ALA B O     1 
ATOM   4362 C  CB    . ALA B 1 96  ? -60.951 -19.096 -26.289 1.00 87.19  ? 90  ALA B CB    1 
ATOM   4363 N  N     . THR B 1 97  ? -57.855 -21.028 -26.106 1.00 82.11  ? 91  THR B N     1 
ATOM   4364 C  CA    . THR B 1 97  ? -57.109 -22.007 -25.309 1.00 87.48  ? 91  THR B CA    1 
ATOM   4365 C  C     . THR B 1 97  ? -55.643 -21.582 -25.246 1.00 73.85  ? 91  THR B C     1 
ATOM   4366 O  O     . THR B 1 97  ? -54.908 -21.961 -24.327 1.00 66.56  ? 91  THR B O     1 
ATOM   4367 C  CB    . THR B 1 97  ? -57.246 -23.468 -25.839 1.00 88.58  ? 91  THR B CB    1 
ATOM   4368 O  OG1   . THR B 1 97  ? -56.902 -24.403 -24.800 1.00 68.72  ? 91  THR B OG1   1 
ATOM   4369 C  CG2   . THR B 1 97  ? -56.360 -23.704 -27.065 1.00 76.06  ? 91  THR B CG2   1 
ATOM   4370 N  N     . VAL B 1 98  ? -55.234 -20.787 -26.233 1.00 70.79  ? 92  VAL B N     1 
ATOM   4371 C  CA    . VAL B 1 98  ? -53.929 -20.141 -26.212 1.00 69.47  ? 92  VAL B CA    1 
ATOM   4372 C  C     . VAL B 1 98  ? -53.864 -19.293 -24.961 1.00 71.44  ? 92  VAL B C     1 
ATOM   4373 O  O     . VAL B 1 98  ? -54.677 -18.384 -24.780 1.00 70.10  ? 92  VAL B O     1 
ATOM   4374 C  CB    . VAL B 1 98  ? -53.700 -19.274 -27.460 1.00 59.15  ? 92  VAL B CB    1 
ATOM   4375 C  CG1   . VAL B 1 98  ? -52.610 -18.255 -27.221 1.00 51.21  ? 92  VAL B CG1   1 
ATOM   4376 C  CG2   . VAL B 1 98  ? -53.352 -20.156 -28.642 1.00 70.08  ? 92  VAL B CG2   1 
ATOM   4377 N  N     . GLY B 1 99  ? -52.907 -19.610 -24.092 1.00 65.41  ? 93  GLY B N     1 
ATOM   4378 C  CA    . GLY B 1 99  ? -52.883 -19.052 -22.755 1.00 62.52  ? 93  GLY B CA    1 
ATOM   4379 C  C     . GLY B 1 99  ? -51.956 -17.875 -22.553 1.00 56.15  ? 93  GLY B C     1 
ATOM   4380 O  O     . GLY B 1 99  ? -52.293 -16.730 -22.861 1.00 53.49  ? 93  GLY B O     1 
ATOM   4381 N  N     . GLY B 1 100 ? -50.778 -18.165 -22.020 1.00 54.42  ? 94  GLY B N     1 
ATOM   4382 C  CA    . GLY B 1 100 ? -49.868 -17.124 -21.593 1.00 50.47  ? 94  GLY B CA    1 
ATOM   4383 C  C     . GLY B 1 100 ? -49.808 -17.097 -20.081 1.00 44.60  ? 94  GLY B C     1 
ATOM   4384 O  O     . GLY B 1 100 ? -50.760 -17.507 -19.407 1.00 39.74  ? 94  GLY B O     1 
ATOM   4385 N  N     . LYS B 1 101 ? -48.689 -16.612 -19.553 1.00 36.65  ? 95  LYS B N     1 
ATOM   4386 C  CA    . LYS B 1 101 ? -48.456 -16.602 -18.122 1.00 33.08  ? 95  LYS B CA    1 
ATOM   4387 C  C     . LYS B 1 101 ? -47.304 -15.674 -17.757 1.00 33.18  ? 95  LYS B C     1 
ATOM   4388 O  O     . LYS B 1 101 ? -46.360 -15.503 -18.530 1.00 32.97  ? 95  LYS B O     1 
ATOM   4389 C  CB    . LYS B 1 101 ? -48.147 -18.019 -17.641 1.00 45.28  ? 95  LYS B CB    1 
ATOM   4390 C  CG    . LYS B 1 101 ? -48.019 -18.145 -16.136 1.00 51.13  ? 95  LYS B CG    1 
ATOM   4391 C  CD    . LYS B 1 101 ? -47.307 -19.425 -15.739 1.00 48.20  ? 95  LYS B CD    1 
ATOM   4392 C  CE    . LYS B 1 101 ? -46.611 -19.248 -14.393 1.00 46.64  ? 95  LYS B CE    1 
ATOM   4393 N  NZ    . LYS B 1 101 ? -45.976 -20.509 -13.911 1.00 44.00  ? 95  LYS B NZ    1 
ATOM   4394 N  N     . ILE B 1 102 ? -47.404 -15.066 -16.578 1.00 33.61  ? 96  ILE B N     1 
ATOM   4395 C  CA    . ILE B 1 102 ? -46.329 -14.269 -15.996 1.00 30.36  ? 96  ILE B CA    1 
ATOM   4396 C  C     . ILE B 1 102 ? -45.604 -15.080 -14.916 1.00 31.28  ? 96  ILE B C     1 
ATOM   4397 O  O     . ILE B 1 102 ? -46.246 -15.722 -14.082 1.00 31.58  ? 96  ILE B O     1 
ATOM   4398 C  CB    . ILE B 1 102 ? -46.897 -13.010 -15.337 1.00 26.77  ? 96  ILE B CB    1 
ATOM   4399 C  CG1   . ILE B 1 102 ? -47.570 -12.128 -16.374 1.00 27.22  ? 96  ILE B CG1   1 
ATOM   4400 C  CG2   . ILE B 1 102 ? -45.803 -12.225 -14.655 1.00 25.90  ? 96  ILE B CG2   1 
ATOM   4401 C  CD1   . ILE B 1 102 ? -46.587 -11.290 -17.144 1.00 29.73  ? 96  ILE B CD1   1 
ATOM   4402 N  N     . PHE B 1 103 ? -44.273 -15.061 -14.939 1.00 28.93  ? 97  PHE B N     1 
ATOM   4403 C  CA    . PHE B 1 103 ? -43.466 -15.677 -13.883 1.00 28.32  ? 97  PHE B CA    1 
ATOM   4404 C  C     . PHE B 1 103 ? -42.671 -14.586 -13.159 1.00 22.21  ? 97  PHE B C     1 
ATOM   4405 O  O     . PHE B 1 103 ? -42.131 -13.687 -13.803 1.00 20.93  ? 97  PHE B O     1 
ATOM   4406 C  CB    . PHE B 1 103 ? -42.456 -16.668 -14.462 1.00 24.08  ? 97  PHE B CB    1 
ATOM   4407 C  CG    . PHE B 1 103 ? -43.057 -17.836 -15.191 1.00 30.15  ? 97  PHE B CG    1 
ATOM   4408 C  CD1   . PHE B 1 103 ? -43.684 -17.673 -16.415 1.00 37.61  ? 97  PHE B CD1   1 
ATOM   4409 C  CD2   . PHE B 1 103 ? -42.920 -19.117 -14.690 1.00 39.83  ? 97  PHE B CD2   1 
ATOM   4410 C  CE1   . PHE B 1 103 ? -44.211 -18.763 -17.098 1.00 35.92  ? 97  PHE B CE1   1 
ATOM   4411 C  CE2   . PHE B 1 103 ? -43.430 -20.212 -15.379 1.00 47.65  ? 97  PHE B CE2   1 
ATOM   4412 C  CZ    . PHE B 1 103 ? -44.080 -20.032 -16.581 1.00 34.73  ? 97  PHE B CZ    1 
ATOM   4413 N  N     . THR B 1 104 ? -42.583 -14.654 -11.834 1.00 16.77  ? 98  THR B N     1 
ATOM   4414 C  CA    . THR B 1 104 ? -41.685 -13.741 -11.131 1.00 13.91  ? 98  THR B CA    1 
ATOM   4415 C  C     . THR B 1 104 ? -40.343 -14.416 -10.951 1.00 11.61  ? 98  THR B C     1 
ATOM   4416 O  O     . THR B 1 104 ? -40.245 -15.634 -10.945 1.00 12.45  ? 98  THR B O     1 
ATOM   4417 C  CB    . THR B 1 104 ? -42.218 -13.273 -9.750  1.00 11.40  ? 98  THR B CB    1 
ATOM   4418 O  OG1   . THR B 1 104 ? -42.459 -14.402 -8.907  1.00 13.72  ? 98  THR B OG1   1 
ATOM   4419 C  CG2   . THR B 1 104 ? -43.496 -12.510 -9.902  1.00 10.97  ? 98  THR B CG2   1 
ATOM   4420 N  N     . PHE B 1 105 ? -39.303 -13.615 -10.835 1.00 12.21  ? 99  PHE B N     1 
ATOM   4421 C  CA    . PHE B 1 105 ? -37.989 -14.137 -10.534 1.00 13.96  ? 99  PHE B CA    1 
ATOM   4422 C  C     . PHE B 1 105 ? -37.287 -13.075 -9.715  1.00 16.46  ? 99  PHE B C     1 
ATOM   4423 O  O     . PHE B 1 105 ? -37.855 -12.013 -9.483  1.00 21.03  ? 99  PHE B O     1 
ATOM   4424 C  CB    . PHE B 1 105 ? -37.223 -14.526 -11.808 1.00 18.25  ? 99  PHE B CB    1 
ATOM   4425 C  CG    . PHE B 1 105 ? -36.870 -13.370 -12.712 1.00 15.41  ? 99  PHE B CG    1 
ATOM   4426 C  CD1   . PHE B 1 105 ? -37.769 -12.910 -13.658 1.00 20.29  ? 99  PHE B CD1   1 
ATOM   4427 C  CD2   . PHE B 1 105 ? -35.622 -12.789 -12.657 1.00 13.74  ? 99  PHE B CD2   1 
ATOM   4428 C  CE1   . PHE B 1 105 ? -37.435 -11.855 -14.512 1.00 20.93  ? 99  PHE B CE1   1 
ATOM   4429 C  CE2   . PHE B 1 105 ? -35.291 -11.749 -13.498 1.00 18.19  ? 99  PHE B CE2   1 
ATOM   4430 C  CZ    . PHE B 1 105 ? -36.200 -11.279 -14.431 1.00 15.22  ? 99  PHE B CZ    1 
ATOM   4431 N  N     . GLY B 1 106 ? -36.075 -13.346 -9.253  1.00 15.29  ? 100 GLY B N     1 
ATOM   4432 C  CA    . GLY B 1 106 ? -35.388 -12.375 -8.424  1.00 15.52  ? 100 GLY B CA    1 
ATOM   4433 C  C     . GLY B 1 106 ? -35.963 -12.308 -7.017  1.00 18.14  ? 100 GLY B C     1 
ATOM   4434 O  O     . GLY B 1 106 ? -36.563 -13.269 -6.529  1.00 16.77  ? 100 GLY B O     1 
ATOM   4435 N  N     . SER B 1 107 ? -35.786 -11.161 -6.370  1.00 19.65  ? 101 SER B N     1 
ATOM   4436 C  CA    . SER B 1 107 ? -36.075 -11.004 -4.946  1.00 10.81  ? 101 SER B CA    1 
ATOM   4437 C  C     . SER B 1 107 ? -37.471 -11.387 -4.552  1.00 10.84  ? 101 SER B C     1 
ATOM   4438 O  O     . SER B 1 107 ? -37.656 -12.132 -3.606  1.00 11.91  ? 101 SER B O     1 
ATOM   4439 C  CB    . SER B 1 107 ? -35.842 -9.570  -4.524  1.00 15.29  ? 101 SER B CB    1 
ATOM   4440 O  OG    . SER B 1 107 ? -34.456 -9.318  -4.394  1.00 24.59  ? 101 SER B OG    1 
ATOM   4441 N  N     . TYR B 1 108 ? -38.461 -10.854 -5.255  1.00 15.30  ? 102 TYR B N     1 
ATOM   4442 C  CA    . TYR B 1 108 ? -39.835 -11.206 -4.958  1.00 9.86   ? 102 TYR B CA    1 
ATOM   4443 C  C     . TYR B 1 108 ? -39.993 -12.720 -5.022  1.00 10.71  ? 102 TYR B C     1 
ATOM   4444 O  O     . TYR B 1 108 ? -40.371 -13.331 -4.022  1.00 13.72  ? 102 TYR B O     1 
ATOM   4445 C  CB    . TYR B 1 108 ? -40.810 -10.488 -5.879  1.00 8.80   ? 102 TYR B CB    1 
ATOM   4446 C  CG    . TYR B 1 108 ? -42.257 -10.763 -5.567  1.00 9.90   ? 102 TYR B CG    1 
ATOM   4447 C  CD1   . TYR B 1 108 ? -42.954 -9.998  -4.636  1.00 9.85   ? 102 TYR B CD1   1 
ATOM   4448 C  CD2   . TYR B 1 108 ? -42.929 -11.784 -6.206  1.00 9.18   ? 102 TYR B CD2   1 
ATOM   4449 C  CE1   . TYR B 1 108 ? -44.275 -10.258 -4.359  1.00 8.75   ? 102 TYR B CE1   1 
ATOM   4450 C  CE2   . TYR B 1 108 ? -44.249 -12.052 -5.936  1.00 8.97   ? 102 TYR B CE2   1 
ATOM   4451 C  CZ    . TYR B 1 108 ? -44.920 -11.291 -5.021  1.00 12.16  ? 102 TYR B CZ    1 
ATOM   4452 O  OH    . TYR B 1 108 ? -46.241 -11.596 -4.768  1.00 21.89  ? 102 TYR B OH    1 
ATOM   4453 N  N     . ARG B 1 109 ? -39.652 -13.336 -6.153  1.00 10.22  ? 103 ARG B N     1 
ATOM   4454 C  CA    . ARG B 1 109 ? -39.810 -14.797 -6.296  1.00 14.17  ? 103 ARG B CA    1 
ATOM   4455 C  C     . ARG B 1 109 ? -39.149 -15.604 -5.171  1.00 13.42  ? 103 ARG B C     1 
ATOM   4456 O  O     . ARG B 1 109 ? -39.711 -16.587 -4.697  1.00 14.44  ? 103 ARG B O     1 
ATOM   4457 C  CB    . ARG B 1 109 ? -39.308 -15.295 -7.654  1.00 12.92  ? 103 ARG B CB    1 
ATOM   4458 C  CG    . ARG B 1 109 ? -39.464 -16.806 -7.900  1.00 13.66  ? 103 ARG B CG    1 
ATOM   4459 C  CD    . ARG B 1 109 ? -40.918 -17.263 -8.033  1.00 15.57  ? 103 ARG B CD    1 
ATOM   4460 N  NE    . ARG B 1 109 ? -41.194 -18.384 -7.139  1.00 22.94  ? 103 ARG B NE    1 
ATOM   4461 C  CZ    . ARG B 1 109 ? -41.086 -19.664 -7.479  1.00 25.91  ? 103 ARG B CZ    1 
ATOM   4462 N  NH1   . ARG B 1 109 ? -40.730 -19.982 -8.714  1.00 30.84  ? 103 ARG B NH1   1 
ATOM   4463 N  NH2   . ARG B 1 109 ? -41.339 -20.624 -6.587  1.00 21.59  ? 103 ARG B NH2   1 
ATOM   4464 N  N     . LEU B 1 110 ? -37.961 -15.180 -4.755  1.00 11.80  ? 104 LEU B N     1 
ATOM   4465 C  CA    . LEU B 1 110 ? -37.250 -15.829 -3.665  1.00 12.49  ? 104 LEU B CA    1 
ATOM   4466 C  C     . LEU B 1 110 ? -37.935 -15.580 -2.320  1.00 11.14  ? 104 LEU B C     1 
ATOM   4467 O  O     . LEU B 1 110 ? -37.800 -16.370 -1.394  1.00 9.82   ? 104 LEU B O     1 
ATOM   4468 C  CB    . LEU B 1 110 ? -35.792 -15.355 -3.608  1.00 12.66  ? 104 LEU B CB    1 
ATOM   4469 C  CG    . LEU B 1 110 ? -34.877 -15.767 -4.763  1.00 12.85  ? 104 LEU B CG    1 
ATOM   4470 C  CD1   . LEU B 1 110 ? -33.598 -14.966 -4.729  1.00 12.46  ? 104 LEU B CD1   1 
ATOM   4471 C  CD2   . LEU B 1 110 ? -34.563 -17.242 -4.690  1.00 10.19  ? 104 LEU B CD2   1 
ATOM   4472 N  N     . GLY B 1 111 ? -38.662 -14.477 -2.215  1.00 11.28  ? 105 GLY B N     1 
ATOM   4473 C  CA    . GLY B 1 111 ? -39.352 -14.145 -0.979  1.00 12.48  ? 105 GLY B CA    1 
ATOM   4474 C  C     . GLY B 1 111 ? -38.504 -13.483 0.094   1.00 11.81  ? 105 GLY B C     1 
ATOM   4475 O  O     . GLY B 1 111 ? -38.733 -13.700 1.288   1.00 10.66  ? 105 GLY B O     1 
ATOM   4476 N  N     . VAL B 1 112 ? -37.548 -12.659 -0.337  1.00 10.25  ? 106 VAL B N     1 
ATOM   4477 C  CA    . VAL B 1 112 ? -36.589 -12.014 0.543   1.00 7.90   ? 106 VAL B CA    1 
ATOM   4478 C  C     . VAL B 1 112 ? -36.527 -10.531 0.228   1.00 9.87   ? 106 VAL B C     1 
ATOM   4479 O  O     . VAL B 1 112 ? -35.767 -9.780  0.847   1.00 11.40  ? 106 VAL B O     1 
ATOM   4480 C  CB    . VAL B 1 112 ? -35.212 -12.583 0.301   1.00 9.45   ? 106 VAL B CB    1 
ATOM   4481 C  CG1   . VAL B 1 112 ? -35.162 -14.021 0.762   1.00 11.18  ? 106 VAL B CG1   1 
ATOM   4482 C  CG2   . VAL B 1 112 ? -34.911 -12.502 -1.183  1.00 11.42  ? 106 VAL B CG2   1 
ATOM   4483 N  N     . HIS B 1 113 ? -37.330 -10.111 -0.741  1.00 7.88   ? 107 HIS B N     1 
ATOM   4484 C  CA    . HIS B 1 113 ? -37.431 -8.706  -1.100  1.00 7.87   ? 107 HIS B CA    1 
ATOM   4485 C  C     . HIS B 1 113 ? -37.764 -7.817  0.093   1.00 8.93   ? 107 HIS B C     1 
ATOM   4486 O  O     . HIS B 1 113 ? -38.349 -8.275  1.072   1.00 9.68   ? 107 HIS B O     1 
ATOM   4487 C  CB    . HIS B 1 113 ? -38.489 -8.533  -2.171  1.00 7.36   ? 107 HIS B CB    1 
ATOM   4488 C  CG    . HIS B 1 113 ? -39.887 -8.646  -1.660  1.00 9.95   ? 107 HIS B CG    1 
ATOM   4489 N  ND1   . HIS B 1 113 ? -40.522 -9.856  -1.487  1.00 9.98   ? 107 HIS B ND1   1 
ATOM   4490 C  CD2   . HIS B 1 113 ? -40.779 -7.695  -1.295  1.00 12.75  ? 107 HIS B CD2   1 
ATOM   4491 C  CE1   . HIS B 1 113 ? -41.745 -9.643  -1.033  1.00 12.96  ? 107 HIS B CE1   1 
ATOM   4492 N  NE2   . HIS B 1 113 ? -41.925 -8.341  -0.903  1.00 12.37  ? 107 HIS B NE2   1 
ATOM   4493 N  N     . THR B 1 114 ? -37.386 -6.545  0.012   1.00 9.39   ? 108 THR B N     1 
ATOM   4494 C  CA    . THR B 1 114 ? -37.641 -5.604  1.104   1.00 11.99  ? 108 THR B CA    1 
ATOM   4495 C  C     . THR B 1 114 ? -38.760 -4.613  0.773   1.00 14.33  ? 108 THR B C     1 
ATOM   4496 O  O     . THR B 1 114 ? -39.275 -4.613  -0.338  1.00 11.84  ? 108 THR B O     1 
ATOM   4497 C  CB    . THR B 1 114 ? -36.382 -4.812  1.483   1.00 10.70  ? 108 THR B CB    1 
ATOM   4498 O  OG1   . THR B 1 114 ? -36.035 -3.928  0.417   1.00 11.09  ? 108 THR B OG1   1 
ATOM   4499 C  CG2   . THR B 1 114 ? -35.219 -5.746  1.750   1.00 16.20  ? 108 THR B CG2   1 
ATOM   4500 N  N     . LYS B 1 115 ? -39.147 -3.786  1.744   1.00 14.51  ? 109 LYS B N     1 
ATOM   4501 C  CA    . LYS B 1 115 ? -40.150 -2.758  1.496   1.00 15.22  ? 109 LYS B CA    1 
ATOM   4502 C  C     . LYS B 1 115 ? -39.647 -1.832  0.394   1.00 15.78  ? 109 LYS B C     1 
ATOM   4503 O  O     . LYS B 1 115 ? -38.490 -1.416  0.411   1.00 13.17  ? 109 LYS B O     1 
ATOM   4504 C  CB    . LYS B 1 115 ? -40.472 -1.982  2.778   1.00 17.20  ? 109 LYS B CB    1 
ATOM   4505 C  CG    . LYS B 1 115 ? -41.105 -2.869  3.854   1.00 26.30  ? 109 LYS B CG    1 
ATOM   4506 C  CD    . LYS B 1 115 ? -41.257 -2.189  5.226   1.00 26.39  ? 109 LYS B CD    1 
ATOM   4507 C  CE    . LYS B 1 115 ? -42.501 -1.326  5.285   1.00 30.10  ? 109 LYS B CE    1 
ATOM   4508 N  NZ    . LYS B 1 115 ? -43.308 -1.625  6.503   1.00 30.50  ? 109 LYS B NZ    1 
ATOM   4509 N  N     . GLY B 1 116 ? -40.509 -1.550  -0.582  1.00 14.39  ? 110 GLY B N     1 
ATOM   4510 C  CA    . GLY B 1 116 ? -40.124 -0.767  -1.743  1.00 10.32  ? 110 GLY B CA    1 
ATOM   4511 C  C     . GLY B 1 116 ? -39.449 -1.515  -2.891  1.00 12.21  ? 110 GLY B C     1 
ATOM   4512 O  O     . GLY B 1 116 ? -39.228 -0.946  -3.951  1.00 18.24  ? 110 GLY B O     1 
ATOM   4513 N  N     . ALA B 1 117 ? -39.113 -2.780  -2.690  1.00 12.27  ? 111 ALA B N     1 
ATOM   4514 C  CA    . ALA B 1 117 ? -38.484 -3.580  -3.727  1.00 12.54  ? 111 ALA B CA    1 
ATOM   4515 C  C     . ALA B 1 117 ? -39.331 -3.627  -4.983  1.00 19.30  ? 111 ALA B C     1 
ATOM   4516 O  O     . ALA B 1 117 ? -40.543 -3.435  -4.921  1.00 20.07  ? 111 ALA B O     1 
ATOM   4517 C  CB    . ALA B 1 117 ? -38.250 -4.977  -3.221  1.00 12.89  ? 111 ALA B CB    1 
ATOM   4518 N  N     . ASP B 1 118 ? -38.690 -3.875  -6.125  1.00 21.72  ? 112 ASP B N     1 
ATOM   4519 C  CA    . ASP B 1 118 ? -39.429 -4.054  -7.373  1.00 20.18  ? 112 ASP B CA    1 
ATOM   4520 C  C     . ASP B 1 118 ? -39.673 -5.531  -7.675  1.00 22.32  ? 112 ASP B C     1 
ATOM   4521 O  O     . ASP B 1 118 ? -39.132 -6.406  -7.008  1.00 21.63  ? 112 ASP B O     1 
ATOM   4522 C  CB    . ASP B 1 118 ? -38.739 -3.345  -8.549  1.00 23.46  ? 112 ASP B CB    1 
ATOM   4523 C  CG    . ASP B 1 118 ? -37.304 -3.813  -8.791  1.00 31.81  ? 112 ASP B CG    1 
ATOM   4524 O  OD1   . ASP B 1 118 ? -36.995 -5.005  -8.591  1.00 31.04  ? 112 ASP B OD1   1 
ATOM   4525 O  OD2   . ASP B 1 118 ? -36.478 -2.972  -9.216  1.00 41.70  ? 112 ASP B OD2   1 
ATOM   4526 N  N     . ILE B 1 119 ? -40.486 -5.816  -8.680  1.00 19.33  ? 113 ILE B N     1 
ATOM   4527 C  CA    . ILE B 1 119 ? -40.696 -7.197  -9.068  1.00 17.19  ? 113 ILE B CA    1 
ATOM   4528 C  C     . ILE B 1 119 ? -40.074 -7.471  -10.426 1.00 26.01  ? 113 ILE B C     1 
ATOM   4529 O  O     . ILE B 1 119 ? -40.391 -6.799  -11.411 1.00 24.96  ? 113 ILE B O     1 
ATOM   4530 C  CB    . ILE B 1 119 ? -42.174 -7.528  -9.172  1.00 14.30  ? 113 ILE B CB    1 
ATOM   4531 C  CG1   . ILE B 1 119 ? -42.876 -7.257  -7.840  1.00 14.14  ? 113 ILE B CG1   1 
ATOM   4532 C  CG2   . ILE B 1 119 ? -42.343 -8.960  -9.637  1.00 11.86  ? 113 ILE B CG2   1 
ATOM   4533 C  CD1   . ILE B 1 119 ? -44.394 -7.328  -7.899  1.00 8.33   ? 113 ILE B CD1   1 
ATOM   4534 N  N     . ASP B 1 120 ? -39.186 -8.459  -10.479 1.00 27.69  ? 114 ASP B N     1 
ATOM   4535 C  CA    . ASP B 1 120 ? -38.643 -8.923  -11.749 1.00 21.15  ? 114 ASP B CA    1 
ATOM   4536 C  C     . ASP B 1 120 ? -39.596 -9.921  -12.357 1.00 17.67  ? 114 ASP B C     1 
ATOM   4537 O  O     . ASP B 1 120 ? -39.806 -10.999 -11.801 1.00 16.26  ? 114 ASP B O     1 
ATOM   4538 C  CB    . ASP B 1 120 ? -37.282 -9.566  -11.545 1.00 17.37  ? 114 ASP B CB    1 
ATOM   4539 C  CG    . ASP B 1 120 ? -36.221 -8.555  -11.249 1.00 22.32  ? 114 ASP B CG    1 
ATOM   4540 O  OD1   . ASP B 1 120 ? -35.866 -7.793  -12.171 1.00 29.24  ? 114 ASP B OD1   1 
ATOM   4541 O  OD2   . ASP B 1 120 ? -35.748 -8.512  -10.097 1.00 29.68  ? 114 ASP B OD2   1 
ATOM   4542 N  N     . ALA B 1 121 ? -40.178 -9.563  -13.495 1.00 19.38  ? 115 ALA B N     1 
ATOM   4543 C  CA    . ALA B 1 121 ? -41.229 -10.388 -14.074 1.00 22.27  ? 115 ALA B CA    1 
ATOM   4544 C  C     . ALA B 1 121 ? -40.905 -10.823 -15.489 1.00 21.51  ? 115 ALA B C     1 
ATOM   4545 O  O     . ALA B 1 121 ? -40.348 -10.058 -16.267 1.00 25.78  ? 115 ALA B O     1 
ATOM   4546 C  CB    . ALA B 1 121 ? -42.560 -9.650  -14.038 1.00 22.30  ? 115 ALA B CB    1 
ATOM   4547 N  N     . LEU B 1 122 ? -41.262 -12.060 -15.809 1.00 20.18  ? 116 LEU B N     1 
ATOM   4548 C  CA    . LEU B 1 122 ? -41.069 -12.603 -17.144 1.00 21.78  ? 116 LEU B CA    1 
ATOM   4549 C  C     . LEU B 1 122 ? -42.405 -12.998 -17.744 1.00 29.43  ? 116 LEU B C     1 
ATOM   4550 O  O     . LEU B 1 122 ? -43.124 -13.842 -17.194 1.00 28.83  ? 116 LEU B O     1 
ATOM   4551 C  CB    . LEU B 1 122 ? -40.167 -13.831 -17.107 1.00 23.95  ? 116 LEU B CB    1 
ATOM   4552 C  CG    . LEU B 1 122 ? -40.227 -14.710 -18.357 1.00 25.11  ? 116 LEU B CG    1 
ATOM   4553 C  CD1   . LEU B 1 122 ? -39.484 -14.048 -19.501 1.00 26.46  ? 116 LEU B CD1   1 
ATOM   4554 C  CD2   . LEU B 1 122 ? -39.679 -16.103 -18.089 1.00 22.72  ? 116 LEU B CD2   1 
ATOM   4555 N  N     . CYS B 1 123 ? -42.741 -12.381 -18.872 1.00 31.63  ? 117 CYS B N     1 
ATOM   4556 C  CA    . CYS B 1 123 ? -43.933 -12.763 -19.609 1.00 27.14  ? 117 CYS B CA    1 
ATOM   4557 C  C     . CYS B 1 123 ? -43.558 -13.793 -20.650 1.00 25.94  ? 117 CYS B C     1 
ATOM   4558 O  O     . CYS B 1 123 ? -42.551 -13.654 -21.332 1.00 27.11  ? 117 CYS B O     1 
ATOM   4559 C  CB    . CYS B 1 123 ? -44.564 -11.560 -20.296 1.00 26.32  ? 117 CYS B CB    1 
ATOM   4560 S  SG    . CYS B 1 123 ? -45.899 -12.048 -21.397 1.00 24.79  ? 117 CYS B SG    1 
ATOM   4561 N  N     . VAL B 1 124 ? -44.379 -14.822 -20.780 1.00 25.14  ? 118 VAL B N     1 
ATOM   4562 C  CA    . VAL B 1 124 ? -44.054 -15.922 -21.667 1.00 29.05  ? 118 VAL B CA    1 
ATOM   4563 C  C     . VAL B 1 124 ? -45.174 -16.172 -22.665 1.00 35.93  ? 118 VAL B C     1 
ATOM   4564 O  O     . VAL B 1 124 ? -46.305 -16.480 -22.281 1.00 36.66  ? 118 VAL B O     1 
ATOM   4565 C  CB    . VAL B 1 124 ? -43.758 -17.195 -20.859 1.00 32.72  ? 118 VAL B CB    1 
ATOM   4566 C  CG1   . VAL B 1 124 ? -43.937 -18.430 -21.718 1.00 40.74  ? 118 VAL B CG1   1 
ATOM   4567 C  CG2   . VAL B 1 124 ? -42.354 -17.128 -20.282 1.00 25.90  ? 118 VAL B CG2   1 
ATOM   4568 N  N     . ALA B 1 125 ? -44.852 -16.039 -23.948 1.00 36.74  ? 119 ALA B N     1 
ATOM   4569 C  CA    . ALA B 1 125 ? -45.862 -16.134 -25.000 1.00 40.65  ? 119 ALA B CA    1 
ATOM   4570 C  C     . ALA B 1 125 ? -45.731 -17.398 -25.869 1.00 44.18  ? 119 ALA B C     1 
ATOM   4571 O  O     . ALA B 1 125 ? -44.643 -17.960 -26.005 1.00 40.33  ? 119 ALA B O     1 
ATOM   4572 C  CB    . ALA B 1 125 ? -45.834 -14.882 -25.860 1.00 35.59  ? 119 ALA B CB    1 
ATOM   4573 N  N     . PRO B 1 126 ? -46.856 -17.852 -26.447 1.00 40.85  ? 120 PRO B N     1 
ATOM   4574 C  CA    . PRO B 1 126 ? -46.899 -19.004 -27.348 1.00 42.99  ? 120 PRO B CA    1 
ATOM   4575 C  C     . PRO B 1 126 ? -46.211 -18.719 -28.674 1.00 43.67  ? 120 PRO B C     1 
ATOM   4576 O  O     . PRO B 1 126 ? -45.780 -17.589 -28.887 1.00 39.21  ? 120 PRO B O     1 
ATOM   4577 C  CB    . PRO B 1 126 ? -48.394 -19.199 -27.586 1.00 48.49  ? 120 PRO B CB    1 
ATOM   4578 C  CG    . PRO B 1 126 ? -49.055 -18.556 -26.431 1.00 47.62  ? 120 PRO B CG    1 
ATOM   4579 C  CD    . PRO B 1 126 ? -48.210 -17.372 -26.126 1.00 46.21  ? 120 PRO B CD    1 
ATOM   4580 N  N     . ARG B 1 127 ? -46.151 -19.726 -29.551 1.00 50.63  ? 121 ARG B N     1 
ATOM   4581 C  CA    . ARG B 1 127 ? -45.326 -19.701 -30.766 1.00 49.59  ? 121 ARG B CA    1 
ATOM   4582 C  C     . ARG B 1 127 ? -45.537 -18.483 -31.643 1.00 43.58  ? 121 ARG B C     1 
ATOM   4583 O  O     . ARG B 1 127 ? -44.626 -18.057 -32.340 1.00 43.55  ? 121 ARG B O     1 
ATOM   4584 C  CB    . ARG B 1 127 ? -45.554 -20.963 -31.604 1.00 51.88  ? 121 ARG B CB    1 
ATOM   4585 C  CG    . ARG B 1 127 ? -47.007 -21.193 -32.000 1.00 58.67  ? 121 ARG B CG    1 
ATOM   4586 C  CD    . ARG B 1 127 ? -47.172 -21.522 -33.492 1.00 68.06  ? 121 ARG B CD    1 
ATOM   4587 N  NE    . ARG B 1 127 ? -47.143 -22.958 -33.773 1.00 76.36  ? 121 ARG B NE    1 
ATOM   4588 C  CZ    . ARG B 1 127 ? -48.157 -23.788 -33.534 1.00 71.40  ? 121 ARG B CZ    1 
ATOM   4589 N  NH1   . ARG B 1 127 ? -49.280 -23.329 -32.997 1.00 69.67  ? 121 ARG B NH1   1 
ATOM   4590 N  NH2   . ARG B 1 127 ? -48.047 -25.080 -33.820 1.00 62.97  ? 121 ARG B NH2   1 
ATOM   4591 N  N     . HIS B 1 128 ? -46.737 -17.921 -31.573 1.00 45.32  ? 122 HIS B N     1 
ATOM   4592 C  CA    . HIS B 1 128 ? -47.206 -16.909 -32.512 1.00 46.13  ? 122 HIS B CA    1 
ATOM   4593 C  C     . HIS B 1 128 ? -47.245 -15.494 -31.948 1.00 49.19  ? 122 HIS B C     1 
ATOM   4594 O  O     . HIS B 1 128 ? -48.194 -14.752 -32.188 1.00 51.65  ? 122 HIS B O     1 
ATOM   4595 C  CB    . HIS B 1 128 ? -48.611 -17.289 -32.935 1.00 51.73  ? 122 HIS B CB    1 
ATOM   4596 C  CG    . HIS B 1 128 ? -49.415 -17.862 -31.818 1.00 48.12  ? 122 HIS B CG    1 
ATOM   4597 N  ND1   . HIS B 1 128 ? -50.032 -17.076 -30.869 1.00 57.08  ? 122 HIS B ND1   1 
ATOM   4598 C  CD2   . HIS B 1 128 ? -49.663 -19.145 -31.466 1.00 58.17  ? 122 HIS B CD2   1 
ATOM   4599 C  CE1   . HIS B 1 128 ? -50.650 -17.852 -29.997 1.00 66.83  ? 122 HIS B CE1   1 
ATOM   4600 N  NE2   . HIS B 1 128 ? -50.441 -19.112 -30.335 1.00 66.70  ? 122 HIS B NE2   1 
ATOM   4601 N  N     . VAL B 1 129 ? -46.230 -15.124 -31.180 1.00 48.04  ? 123 VAL B N     1 
ATOM   4602 C  CA    . VAL B 1 129 ? -46.078 -13.747 -30.755 1.00 44.47  ? 123 VAL B CA    1 
ATOM   4603 C  C     . VAL B 1 129 ? -44.614 -13.457 -30.880 1.00 48.56  ? 123 VAL B C     1 
ATOM   4604 O  O     . VAL B 1 129 ? -43.804 -14.241 -30.414 1.00 55.61  ? 123 VAL B O     1 
ATOM   4605 C  CB    . VAL B 1 129 ? -46.442 -13.545 -29.288 1.00 46.97  ? 123 VAL B CB    1 
ATOM   4606 C  CG1   . VAL B 1 129 ? -46.219 -12.093 -28.911 1.00 41.15  ? 123 VAL B CG1   1 
ATOM   4607 C  CG2   . VAL B 1 129 ? -47.879 -13.968 -29.015 1.00 45.93  ? 123 VAL B CG2   1 
ATOM   4608 N  N     . GLU B 1 130 ? -44.256 -12.351 -31.513 1.00 49.41  ? 124 GLU B N     1 
ATOM   4609 C  CA    . GLU B 1 130 ? -42.844 -12.051 -31.684 1.00 53.92  ? 124 GLU B CA    1 
ATOM   4610 C  C     . GLU B 1 130 ? -42.363 -11.102 -30.614 1.00 46.06  ? 124 GLU B C     1 
ATOM   4611 O  O     . GLU B 1 130 ? -43.155 -10.399 -30.001 1.00 45.82  ? 124 GLU B O     1 
ATOM   4612 C  CB    . GLU B 1 130 ? -42.567 -11.466 -33.071 1.00 64.47  ? 124 GLU B CB    1 
ATOM   4613 C  CG    . GLU B 1 130 ? -41.632 -12.318 -33.922 1.00 69.74  ? 124 GLU B CG    1 
ATOM   4614 C  CD    . GLU B 1 130 ? -42.175 -13.726 -34.176 1.00 69.74  ? 124 GLU B CD    1 
ATOM   4615 O  OE1   . GLU B 1 130 ? -42.776 -13.941 -35.251 1.00 70.79  ? 124 GLU B OE1   1 
ATOM   4616 O  OE2   . GLU B 1 130 ? -41.991 -14.618 -33.314 1.00 57.93  ? 124 GLU B OE2   1 
ATOM   4617 N  N     . ARG B 1 131 ? -41.052 -11.064 -30.409 1.00 53.01  ? 125 ARG B N     1 
ATOM   4618 C  CA    . ARG B 1 131 ? -40.468 -10.142 -29.448 1.00 46.86  ? 125 ARG B CA    1 
ATOM   4619 C  C     . ARG B 1 131 ? -40.815 -8.722  -29.858 1.00 50.37  ? 125 ARG B C     1 
ATOM   4620 O  O     . ARG B 1 131 ? -40.676 -7.797  -29.068 1.00 56.37  ? 125 ARG B O     1 
ATOM   4621 C  CB    . ARG B 1 131 ? -38.946 -10.325 -29.346 1.00 47.16  ? 125 ARG B CB    1 
ATOM   4622 C  CG    . ARG B 1 131 ? -38.502 -11.789 -29.205 1.00 52.29  ? 125 ARG B CG    1 
ATOM   4623 C  CD    . ARG B 1 131 ? -37.111 -11.936 -28.579 1.00 50.51  ? 125 ARG B CD    1 
ATOM   4624 N  NE    . ARG B 1 131 ? -37.151 -11.893 -27.118 1.00 42.29  ? 125 ARG B NE    1 
ATOM   4625 C  CZ    . ARG B 1 131 ? -36.941 -10.792 -26.396 1.00 46.80  ? 125 ARG B CZ    1 
ATOM   4626 N  NH1   . ARG B 1 131 ? -36.664 -9.636  -26.995 1.00 46.36  ? 125 ARG B NH1   1 
ATOM   4627 N  NH2   . ARG B 1 131 ? -37.000 -10.846 -25.070 1.00 48.61  ? 125 ARG B NH2   1 
ATOM   4628 N  N     . SER B 1 132 ? -41.272 -8.566  -31.099 1.00 52.49  ? 126 SER B N     1 
ATOM   4629 C  CA    . SER B 1 132 ? -41.743 -7.283  -31.607 1.00 58.23  ? 126 SER B CA    1 
ATOM   4630 C  C     . SER B 1 132 ? -43.157 -6.953  -31.107 1.00 55.21  ? 126 SER B C     1 
ATOM   4631 O  O     . SER B 1 132 ? -43.415 -5.844  -30.627 1.00 51.27  ? 126 SER B O     1 
ATOM   4632 C  CB    . SER B 1 132 ? -41.734 -7.293  -33.130 1.00 52.77  ? 126 SER B CB    1 
ATOM   4633 O  OG    . SER B 1 132 ? -42.831 -8.043  -33.622 1.00 58.29  ? 126 SER B OG    1 
ATOM   4634 N  N     . ASP B 1 133 ? -44.069 -7.916  -31.225 1.00 53.83  ? 127 ASP B N     1 
ATOM   4635 C  CA    . ASP B 1 133 ? -45.447 -7.731  -30.771 1.00 49.27  ? 127 ASP B CA    1 
ATOM   4636 C  C     . ASP B 1 133 ? -45.494 -7.348  -29.290 1.00 48.59  ? 127 ASP B C     1 
ATOM   4637 O  O     . ASP B 1 133 ? -46.441 -6.714  -28.835 1.00 50.55  ? 127 ASP B O     1 
ATOM   4638 C  CB    . ASP B 1 133 ? -46.291 -8.995  -31.015 1.00 48.60  ? 127 ASP B CB    1 
ATOM   4639 C  CG    . ASP B 1 133 ? -46.386 -9.372  -32.486 1.00 57.10  ? 127 ASP B CG    1 
ATOM   4640 O  OD1   . ASP B 1 133 ? -46.055 -8.519  -33.340 1.00 67.99  ? 127 ASP B OD1   1 
ATOM   4641 O  OD2   . ASP B 1 133 ? -46.799 -10.517 -32.790 1.00 51.53  ? 127 ASP B OD2   1 
ATOM   4642 N  N     . PHE B 1 134 ? -44.467 -7.739  -28.541 1.00 46.96  ? 128 PHE B N     1 
ATOM   4643 C  CA    . PHE B 1 134 ? -44.382 -7.406  -27.126 1.00 43.36  ? 128 PHE B CA    1 
ATOM   4644 C  C     . PHE B 1 134 ? -43.967 -5.955  -26.950 1.00 44.48  ? 128 PHE B C     1 
ATOM   4645 O  O     . PHE B 1 134 ? -44.404 -5.294  -26.008 1.00 44.68  ? 128 PHE B O     1 
ATOM   4646 C  CB    . PHE B 1 134 ? -43.391 -8.338  -26.433 1.00 43.75  ? 128 PHE B CB    1 
ATOM   4647 C  CG    . PHE B 1 134 ? -43.028 -7.938  -25.018 1.00 44.05  ? 128 PHE B CG    1 
ATOM   4648 C  CD1   . PHE B 1 134 ? -43.875 -8.219  -23.962 1.00 38.73  ? 128 PHE B CD1   1 
ATOM   4649 C  CD2   . PHE B 1 134 ? -41.808 -7.329  -24.743 1.00 44.27  ? 128 PHE B CD2   1 
ATOM   4650 C  CE1   . PHE B 1 134 ? -43.521 -7.883  -22.667 1.00 35.80  ? 128 PHE B CE1   1 
ATOM   4651 C  CE2   . PHE B 1 134 ? -41.452 -6.991  -23.448 1.00 36.55  ? 128 PHE B CE2   1 
ATOM   4652 C  CZ    . PHE B 1 134 ? -42.307 -7.267  -22.413 1.00 33.42  ? 128 PHE B CZ    1 
ATOM   4653 N  N     . PHE B 1 135 ? -43.138 -5.455  -27.865 1.00 44.47  ? 129 PHE B N     1 
ATOM   4654 C  CA    . PHE B 1 135 ? -42.640 -4.082  -27.765 1.00 47.66  ? 129 PHE B CA    1 
ATOM   4655 C  C     . PHE B 1 135 ? -43.487 -3.021  -28.470 1.00 49.18  ? 129 PHE B C     1 
ATOM   4656 O  O     . PHE B 1 135 ? -43.274 -1.820  -28.277 1.00 50.13  ? 129 PHE B O     1 
ATOM   4657 C  CB    . PHE B 1 135 ? -41.180 -3.996  -28.193 1.00 42.71  ? 129 PHE B CB    1 
ATOM   4658 C  CG    . PHE B 1 135 ? -40.238 -4.470  -27.146 1.00 40.62  ? 129 PHE B CG    1 
ATOM   4659 C  CD1   . PHE B 1 135 ? -39.893 -3.645  -26.095 1.00 35.81  ? 129 PHE B CD1   1 
ATOM   4660 C  CD2   . PHE B 1 135 ? -39.720 -5.754  -27.192 1.00 42.69  ? 129 PHE B CD2   1 
ATOM   4661 C  CE1   . PHE B 1 135 ? -39.030 -4.086  -25.114 1.00 41.41  ? 129 PHE B CE1   1 
ATOM   4662 C  CE2   . PHE B 1 135 ? -38.858 -6.203  -26.222 1.00 41.30  ? 129 PHE B CE2   1 
ATOM   4663 C  CZ    . PHE B 1 135 ? -38.511 -5.370  -25.177 1.00 42.03  ? 129 PHE B CZ    1 
ATOM   4664 N  N     . GLN B 1 136 ? -44.443 -3.456  -29.280 1.00 47.69  ? 130 GLN B N     1 
ATOM   4665 C  CA    . GLN B 1 136 ? -45.459 -2.532  -29.759 1.00 52.67  ? 130 GLN B CA    1 
ATOM   4666 C  C     . GLN B 1 136 ? -46.811 -2.809  -29.107 1.00 42.12  ? 130 GLN B C     1 
ATOM   4667 O  O     . GLN B 1 136 ? -47.172 -2.146  -28.144 1.00 40.97  ? 130 GLN B O     1 
ATOM   4668 C  CB    . GLN B 1 136 ? -45.545 -2.482  -31.298 1.00 57.07  ? 130 GLN B CB    1 
ATOM   4669 C  CG    . GLN B 1 136 ? -45.558 -3.822  -32.021 1.00 57.83  ? 130 GLN B CG    1 
ATOM   4670 C  CD    . GLN B 1 136 ? -45.623 -3.652  -33.537 1.00 79.97  ? 130 GLN B CD    1 
ATOM   4671 O  OE1   . GLN B 1 136 ? -45.917 -2.562  -34.036 1.00 84.28  ? 130 GLN B OE1   1 
ATOM   4672 N  NE2   . GLN B 1 136 ? -45.343 -4.730  -34.276 1.00 65.70  ? 130 GLN B NE2   1 
ATOM   4673 N  N     . SER B 1 137 ? -47.532 -3.806  -29.610 1.00 43.90  ? 131 SER B N     1 
ATOM   4674 C  CA    . SER B 1 137 ? -48.924 -4.027  -29.220 1.00 46.52  ? 131 SER B CA    1 
ATOM   4675 C  C     . SER B 1 137 ? -49.170 -4.318  -27.739 1.00 49.46  ? 131 SER B C     1 
ATOM   4676 O  O     . SER B 1 137 ? -50.252 -4.013  -27.232 1.00 49.69  ? 131 SER B O     1 
ATOM   4677 C  CB    . SER B 1 137 ? -49.607 -5.084  -30.105 1.00 50.44  ? 131 SER B CB    1 
ATOM   4678 O  OG    . SER B 1 137 ? -48.803 -6.237  -30.280 1.00 58.69  ? 131 SER B OG    1 
ATOM   4679 N  N     . PHE B 1 138 ? -48.199 -4.899  -27.038 1.00 45.12  ? 132 PHE B N     1 
ATOM   4680 C  CA    . PHE B 1 138 ? -48.359 -5.011  -25.593 1.00 41.37  ? 132 PHE B CA    1 
ATOM   4681 C  C     . PHE B 1 138 ? -47.982 -3.698  -24.903 1.00 40.33  ? 132 PHE B C     1 
ATOM   4682 O  O     . PHE B 1 138 ? -48.646 -3.280  -23.954 1.00 41.41  ? 132 PHE B O     1 
ATOM   4683 C  CB    . PHE B 1 138 ? -47.616 -6.203  -24.979 1.00 38.31  ? 132 PHE B CB    1 
ATOM   4684 C  CG    . PHE B 1 138 ? -47.939 -6.417  -23.515 1.00 39.18  ? 132 PHE B CG    1 
ATOM   4685 C  CD1   . PHE B 1 138 ? -49.128 -7.020  -23.133 1.00 36.57  ? 132 PHE B CD1   1 
ATOM   4686 C  CD2   . PHE B 1 138 ? -47.075 -5.983  -22.519 1.00 38.96  ? 132 PHE B CD2   1 
ATOM   4687 C  CE1   . PHE B 1 138 ? -49.439 -7.206  -21.784 1.00 31.27  ? 132 PHE B CE1   1 
ATOM   4688 C  CE2   . PHE B 1 138 ? -47.385 -6.169  -21.170 1.00 30.47  ? 132 PHE B CE2   1 
ATOM   4689 C  CZ    . PHE B 1 138 ? -48.563 -6.782  -20.809 1.00 23.73  ? 132 PHE B CZ    1 
ATOM   4690 N  N     . PHE B 1 139 ? -46.937 -3.037  -25.388 1.00 35.94  ? 133 PHE B N     1 
ATOM   4691 C  CA    . PHE B 1 139 ? -46.551 -1.743  -24.834 1.00 38.72  ? 133 PHE B CA    1 
ATOM   4692 C  C     . PHE B 1 139 ? -47.712 -0.768  -24.952 1.00 44.18  ? 133 PHE B C     1 
ATOM   4693 O  O     . PHE B 1 139 ? -47.932 0.068   -24.075 1.00 48.14  ? 133 PHE B O     1 
ATOM   4694 C  CB    . PHE B 1 139 ? -45.340 -1.190  -25.575 1.00 39.33  ? 133 PHE B CB    1 
ATOM   4695 C  CG    . PHE B 1 139 ? -44.792 0.082   -24.992 1.00 32.09  ? 133 PHE B CG    1 
ATOM   4696 C  CD1   . PHE B 1 139 ? -45.262 1.309   -25.404 1.00 32.45  ? 133 PHE B CD1   1 
ATOM   4697 C  CD2   . PHE B 1 139 ? -43.781 0.047   -24.051 1.00 40.99  ? 133 PHE B CD2   1 
ATOM   4698 C  CE1   . PHE B 1 139 ? -44.742 2.474   -24.882 1.00 40.42  ? 133 PHE B CE1   1 
ATOM   4699 C  CE2   . PHE B 1 139 ? -43.255 1.218   -23.520 1.00 41.23  ? 133 PHE B CE2   1 
ATOM   4700 C  CZ    . PHE B 1 139 ? -43.735 2.428   -23.939 1.00 39.82  ? 133 PHE B CZ    1 
ATOM   4701 N  N     . GLU B 1 140 ? -48.456 -0.889  -26.046 1.00 45.51  ? 134 GLU B N     1 
ATOM   4702 C  CA    . GLU B 1 140 ? -49.603 -0.028  -26.284 1.00 46.13  ? 134 GLU B CA    1 
ATOM   4703 C  C     . GLU B 1 140 ? -50.781 -0.386  -25.391 1.00 44.31  ? 134 GLU B C     1 
ATOM   4704 O  O     . GLU B 1 140 ? -51.662 0.444   -25.186 1.00 46.91  ? 134 GLU B O     1 
ATOM   4705 C  CB    . GLU B 1 140 ? -50.022 -0.042  -27.763 1.00 51.53  ? 134 GLU B CB    1 
ATOM   4706 C  CG    . GLU B 1 140 ? -49.269 0.967   -28.646 1.00 55.75  ? 134 GLU B CG    1 
ATOM   4707 C  CD    . GLU B 1 140 ? -49.686 2.414   -28.387 1.00 66.50  ? 134 GLU B CD    1 
ATOM   4708 O  OE1   . GLU B 1 140 ? -50.886 2.737   -28.562 1.00 60.66  ? 134 GLU B OE1   1 
ATOM   4709 O  OE2   . GLU B 1 140 ? -48.813 3.228   -28.005 1.00 64.86  ? 134 GLU B OE2   1 
ATOM   4710 N  N     . LYS B 1 141 ? -50.815 -1.606  -24.858 1.00 40.06  ? 135 LYS B N     1 
ATOM   4711 C  CA    . LYS B 1 141 ? -51.873 -1.931  -23.906 1.00 35.15  ? 135 LYS B CA    1 
ATOM   4712 C  C     . LYS B 1 141 ? -51.508 -1.408  -22.532 1.00 34.92  ? 135 LYS B C     1 
ATOM   4713 O  O     . LYS B 1 141 ? -52.381 -1.045  -21.750 1.00 38.71  ? 135 LYS B O     1 
ATOM   4714 C  CB    . LYS B 1 141 ? -52.205 -3.423  -23.858 1.00 33.46  ? 135 LYS B CB    1 
ATOM   4715 C  CG    . LYS B 1 141 ? -53.439 -3.734  -22.992 1.00 34.50  ? 135 LYS B CG    1 
ATOM   4716 C  CD    . LYS B 1 141 ? -54.221 -4.962  -23.475 1.00 42.90  ? 135 LYS B CD    1 
ATOM   4717 C  CE    . LYS B 1 141 ? -54.958 -4.725  -24.816 1.00 52.83  ? 135 LYS B CE    1 
ATOM   4718 N  NZ    . LYS B 1 141 ? -56.296 -4.045  -24.709 1.00 52.29  ? 135 LYS B NZ    1 
ATOM   4719 N  N     . LEU B 1 142 ? -50.212 -1.346  -22.252 1.00 31.92  ? 136 LEU B N     1 
ATOM   4720 C  CA    . LEU B 1 142 ? -49.739 -0.806  -20.989 1.00 33.88  ? 136 LEU B CA    1 
ATOM   4721 C  C     . LEU B 1 142 ? -49.925 0.708   -20.960 1.00 39.80  ? 136 LEU B C     1 
ATOM   4722 O  O     . LEU B 1 142 ? -50.178 1.306   -19.902 1.00 40.08  ? 136 LEU B O     1 
ATOM   4723 C  CB    . LEU B 1 142 ? -48.274 -1.188  -20.754 1.00 37.10  ? 136 LEU B CB    1 
ATOM   4724 C  CG    . LEU B 1 142 ? -47.990 -2.655  -20.403 1.00 26.64  ? 136 LEU B CG    1 
ATOM   4725 C  CD1   . LEU B 1 142 ? -46.509 -2.890  -20.272 1.00 27.05  ? 136 LEU B CD1   1 
ATOM   4726 C  CD2   . LEU B 1 142 ? -48.690 -3.040  -19.132 1.00 25.15  ? 136 LEU B CD2   1 
ATOM   4727 N  N     . LYS B 1 143 ? -49.813 1.320   -22.135 1.00 41.33  ? 137 LYS B N     1 
ATOM   4728 C  CA    . LYS B 1 143 ? -50.006 2.758   -22.279 1.00 49.10  ? 137 LYS B CA    1 
ATOM   4729 C  C     . LYS B 1 143 ? -51.400 3.190   -21.805 1.00 43.67  ? 137 LYS B C     1 
ATOM   4730 O  O     . LYS B 1 143 ? -51.552 4.227   -21.151 1.00 45.13  ? 137 LYS B O     1 
ATOM   4731 C  CB    . LYS B 1 143 ? -49.747 3.181   -23.732 1.00 46.83  ? 137 LYS B CB    1 
ATOM   4732 C  CG    . LYS B 1 143 ? -50.168 4.615   -24.077 1.00 58.68  ? 137 LYS B CG    1 
ATOM   4733 C  CD    . LYS B 1 143 ? -49.895 4.924   -25.558 1.00 72.41  ? 137 LYS B CD    1 
ATOM   4734 C  CE    . LYS B 1 143 ? -50.950 5.849   -26.187 1.00 72.39  ? 137 LYS B CE    1 
ATOM   4735 N  NZ    . LYS B 1 143 ? -50.880 5.869   -27.689 1.00 51.20  ? 137 LYS B NZ    1 
ATOM   4736 N  N     . HIS B 1 144 ? -52.399 2.363   -22.105 1.00 40.73  ? 138 HIS B N     1 
ATOM   4737 C  CA    . HIS B 1 144 ? -53.800 2.685   -21.827 1.00 48.23  ? 138 HIS B CA    1 
ATOM   4738 C  C     . HIS B 1 144 ? -54.349 2.039   -20.558 1.00 47.70  ? 138 HIS B C     1 
ATOM   4739 O  O     . HIS B 1 144 ? -55.551 1.776   -20.469 1.00 51.92  ? 138 HIS B O     1 
ATOM   4740 C  CB    . HIS B 1 144 ? -54.706 2.252   -22.991 1.00 46.95  ? 138 HIS B CB    1 
ATOM   4741 C  CG    . HIS B 1 144 ? -54.284 2.775   -24.328 1.00 45.23  ? 138 HIS B CG    1 
ATOM   4742 N  ND1   . HIS B 1 144 ? -53.159 2.326   -24.985 1.00 47.49  ? 138 HIS B ND1   1 
ATOM   4743 C  CD2   . HIS B 1 144 ? -54.849 3.697   -25.140 1.00 39.60  ? 138 HIS B CD2   1 
ATOM   4744 C  CE1   . HIS B 1 144 ? -53.044 2.954   -26.140 1.00 47.49  ? 138 HIS B CE1   1 
ATOM   4745 N  NE2   . HIS B 1 144 ? -54.057 3.792   -26.259 1.00 51.32  ? 138 HIS B NE2   1 
ATOM   4746 N  N     . GLN B 1 145 ? -53.493 1.761   -19.584 1.00 46.66  ? 139 GLN B N     1 
ATOM   4747 C  CA    . GLN B 1 145 ? -53.990 1.195   -18.338 1.00 46.11  ? 139 GLN B CA    1 
ATOM   4748 C  C     . GLN B 1 145 ? -53.915 2.226   -17.225 1.00 52.27  ? 139 GLN B C     1 
ATOM   4749 O  O     . GLN B 1 145 ? -52.992 3.048   -17.195 1.00 48.67  ? 139 GLN B O     1 
ATOM   4750 C  CB    . GLN B 1 145 ? -53.249 -0.090  -17.972 1.00 44.69  ? 139 GLN B CB    1 
ATOM   4751 C  CG    . GLN B 1 145 ? -53.807 -1.343  -18.645 1.00 51.04  ? 139 GLN B CG    1 
ATOM   4752 C  CD    . GLN B 1 145 ? -55.129 -1.826  -18.035 1.00 63.84  ? 139 GLN B CD    1 
ATOM   4753 O  OE1   . GLN B 1 145 ? -55.194 -2.192  -16.848 1.00 39.98  ? 139 GLN B OE1   1 
ATOM   4754 N  NE2   . GLN B 1 145 ? -56.186 -1.842  -18.855 1.00 59.89  ? 139 GLN B NE2   1 
ATOM   4755 N  N     . ASP B 1 146 ? -54.899 2.184   -16.328 1.00 46.66  ? 140 ASP B N     1 
ATOM   4756 C  CA    . ASP B 1 146 ? -55.040 3.187   -15.275 1.00 48.71  ? 140 ASP B CA    1 
ATOM   4757 C  C     . ASP B 1 146 ? -53.808 3.381   -14.403 1.00 54.72  ? 140 ASP B C     1 
ATOM   4758 O  O     . ASP B 1 146 ? -53.232 4.470   -14.358 1.00 55.65  ? 140 ASP B O     1 
ATOM   4759 C  CB    . ASP B 1 146 ? -56.239 2.875   -14.389 1.00 45.45  ? 140 ASP B CB    1 
ATOM   4760 C  CG    . ASP B 1 146 ? -57.499 3.552   -14.872 1.00 69.68  ? 140 ASP B CG    1 
ATOM   4761 O  OD1   . ASP B 1 146 ? -57.399 4.686   -15.408 1.00 67.89  ? 140 ASP B OD1   1 
ATOM   4762 O  OD2   . ASP B 1 146 ? -58.585 2.949   -14.718 1.00 75.13  ? 140 ASP B OD2   1 
ATOM   4763 N  N     . GLY B 1 147 ? -53.406 2.324   -13.712 1.00 44.75  ? 141 GLY B N     1 
ATOM   4764 C  CA    . GLY B 1 147 ? -52.372 2.448   -12.709 1.00 34.93  ? 141 GLY B CA    1 
ATOM   4765 C  C     . GLY B 1 147 ? -50.962 2.694   -13.200 1.00 31.01  ? 141 GLY B C     1 
ATOM   4766 O  O     . GLY B 1 147 ? -50.084 2.929   -12.379 1.00 34.54  ? 141 GLY B O     1 
ATOM   4767 N  N     . ILE B 1 148 ? -50.736 2.658   -14.515 1.00 34.80  ? 142 ILE B N     1 
ATOM   4768 C  CA    . ILE B 1 148 ? -49.368 2.659   -15.066 1.00 33.64  ? 142 ILE B CA    1 
ATOM   4769 C  C     . ILE B 1 148 ? -48.654 4.009   -15.034 1.00 36.72  ? 142 ILE B C     1 
ATOM   4770 O  O     . ILE B 1 148 ? -49.246 5.036   -15.349 1.00 41.39  ? 142 ILE B O     1 
ATOM   4771 C  CB    . ILE B 1 148 ? -49.342 2.137   -16.502 1.00 36.36  ? 142 ILE B CB    1 
ATOM   4772 C  CG1   . ILE B 1 148 ? -50.209 0.890   -16.613 1.00 45.45  ? 142 ILE B CG1   1 
ATOM   4773 C  CG2   . ILE B 1 148 ? -47.923 1.801   -16.917 1.00 31.60  ? 142 ILE B CG2   1 
ATOM   4774 C  CD1   . ILE B 1 148 ? -49.686 -0.288  -15.809 1.00 35.02  ? 142 ILE B CD1   1 
ATOM   4775 N  N     . ARG B 1 149 ? -47.379 3.996   -14.649 1.00 33.83  ? 143 ARG B N     1 
ATOM   4776 C  CA    . ARG B 1 149 ? -46.564 5.206   -14.590 1.00 35.09  ? 143 ARG B CA    1 
ATOM   4777 C  C     . ARG B 1 149 ? -45.124 4.910   -15.020 1.00 42.06  ? 143 ARG B C     1 
ATOM   4778 O  O     . ARG B 1 149 ? -44.650 3.777   -14.899 1.00 40.22  ? 143 ARG B O     1 
ATOM   4779 C  CB    . ARG B 1 149 ? -46.553 5.786   -13.177 1.00 39.07  ? 143 ARG B CB    1 
ATOM   4780 C  CG    . ARG B 1 149 ? -47.890 6.262   -12.651 1.00 38.85  ? 143 ARG B CG    1 
ATOM   4781 C  CD    . ARG B 1 149 ? -48.281 7.595   -13.247 1.00 62.00  ? 143 ARG B CD    1 
ATOM   4782 N  NE    . ARG B 1 149 ? -49.407 8.211   -12.544 1.00 70.98  ? 143 ARG B NE    1 
ATOM   4783 C  CZ    . ARG B 1 149 ? -49.292 9.202   -11.663 1.00 74.64  ? 143 ARG B CZ    1 
ATOM   4784 N  NH1   . ARG B 1 149 ? -48.094 9.696   -11.370 1.00 77.84  ? 143 ARG B NH1   1 
ATOM   4785 N  NH2   . ARG B 1 149 ? -50.374 9.704   -11.079 1.00 65.58  ? 143 ARG B NH2   1 
ATOM   4786 N  N     . ASN B 1 150 ? -44.434 5.939   -15.505 1.00 46.70  ? 144 ASN B N     1 
ATOM   4787 C  CA    . ASN B 1 150 ? -43.052 5.816   -15.961 1.00 42.82  ? 144 ASN B CA    1 
ATOM   4788 C  C     . ASN B 1 150 ? -42.882 4.667   -16.930 1.00 42.18  ? 144 ASN B C     1 
ATOM   4789 O  O     . ASN B 1 150 ? -41.936 3.895   -16.821 1.00 46.52  ? 144 ASN B O     1 
ATOM   4790 C  CB    . ASN B 1 150 ? -42.098 5.624   -14.781 1.00 46.91  ? 144 ASN B CB    1 
ATOM   4791 C  CG    . ASN B 1 150 ? -42.243 6.707   -13.730 1.00 59.35  ? 144 ASN B CG    1 
ATOM   4792 O  OD1   . ASN B 1 150 ? -42.822 7.770   -13.984 1.00 59.08  ? 144 ASN B OD1   1 
ATOM   4793 N  ND2   . ASN B 1 150 ? -41.708 6.445   -12.537 1.00 53.19  ? 144 ASN B ND2   1 
ATOM   4794 N  N     . LEU B 1 151 ? -43.812 4.552   -17.871 1.00 46.21  ? 145 LEU B N     1 
ATOM   4795 C  CA    . LEU B 1 151 ? -43.837 3.426   -18.797 1.00 40.32  ? 145 LEU B CA    1 
ATOM   4796 C  C     . LEU B 1 151 ? -42.794 3.590   -19.880 1.00 40.94  ? 145 LEU B C     1 
ATOM   4797 O  O     . LEU B 1 151 ? -43.112 4.071   -20.959 1.00 45.22  ? 145 LEU B O     1 
ATOM   4798 C  CB    . LEU B 1 151 ? -45.212 3.317   -19.453 1.00 32.25  ? 145 LEU B CB    1 
ATOM   4799 C  CG    . LEU B 1 151 ? -45.702 1.973   -20.005 1.00 35.52  ? 145 LEU B CG    1 
ATOM   4800 C  CD1   . LEU B 1 151 ? -46.140 2.123   -21.450 1.00 36.46  ? 145 LEU B CD1   1 
ATOM   4801 C  CD2   . LEU B 1 151 ? -44.672 0.859   -19.855 1.00 37.23  ? 145 LEU B CD2   1 
ATOM   4802 N  N     . ARG B 1 152 ? -41.558 3.183   -19.609 1.00 42.17  ? 146 ARG B N     1 
ATOM   4803 C  CA    . ARG B 1 152 ? -40.529 3.251   -20.643 1.00 47.98  ? 146 ARG B CA    1 
ATOM   4804 C  C     . ARG B 1 152 ? -39.956 1.892   -21.044 1.00 41.74  ? 146 ARG B C     1 
ATOM   4805 O  O     . ARG B 1 152 ? -39.588 1.076   -20.203 1.00 36.56  ? 146 ARG B O     1 
ATOM   4806 C  CB    . ARG B 1 152 ? -39.413 4.238   -20.275 1.00 49.93  ? 146 ARG B CB    1 
ATOM   4807 C  CG    . ARG B 1 152 ? -38.566 3.835   -19.092 1.00 55.33  ? 146 ARG B CG    1 
ATOM   4808 C  CD    . ARG B 1 152 ? -38.920 4.637   -17.853 1.00 55.35  ? 146 ARG B CD    1 
ATOM   4809 N  NE    . ARG B 1 152 ? -38.908 3.795   -16.659 1.00 53.57  ? 146 ARG B NE    1 
ATOM   4810 C  CZ    . ARG B 1 152 ? -37.817 3.494   -15.965 1.00 52.50  ? 146 ARG B CZ    1 
ATOM   4811 N  NH1   . ARG B 1 152 ? -36.633 3.975   -16.336 1.00 45.54  ? 146 ARG B NH1   1 
ATOM   4812 N  NH2   . ARG B 1 152 ? -37.915 2.713   -14.895 1.00 49.75  ? 146 ARG B NH2   1 
ATOM   4813 N  N     . ALA B 1 153 ? -39.902 1.658   -22.348 1.00 44.40  ? 147 ALA B N     1 
ATOM   4814 C  CA    . ALA B 1 153 ? -39.334 0.431   -22.874 1.00 38.91  ? 147 ALA B CA    1 
ATOM   4815 C  C     . ALA B 1 153 ? -37.843 0.617   -23.071 1.00 43.97  ? 147 ALA B C     1 
ATOM   4816 O  O     . ALA B 1 153 ? -37.346 1.745   -23.059 1.00 55.64  ? 147 ALA B O     1 
ATOM   4817 C  CB    . ALA B 1 153 ? -39.988 0.067   -24.176 1.00 29.86  ? 147 ALA B CB    1 
ATOM   4818 N  N     . VAL B 1 154 ? -37.140 -0.500  -23.234 1.00 40.33  ? 148 VAL B N     1 
ATOM   4819 C  CA    . VAL B 1 154 ? -35.707 -0.541  -23.501 1.00 41.76  ? 148 VAL B CA    1 
ATOM   4820 C  C     . VAL B 1 154 ? -35.443 -1.901  -24.139 1.00 41.85  ? 148 VAL B C     1 
ATOM   4821 O  O     . VAL B 1 154 ? -35.493 -2.905  -23.442 1.00 49.53  ? 148 VAL B O     1 
ATOM   4822 C  CB    . VAL B 1 154 ? -34.868 -0.528  -22.191 1.00 27.36  ? 148 VAL B CB    1 
ATOM   4823 C  CG1   . VAL B 1 154 ? -33.408 -0.650  -22.499 1.00 28.05  ? 148 VAL B CG1   1 
ATOM   4824 C  CG2   . VAL B 1 154 ? -35.112 0.709   -21.353 1.00 36.74  ? 148 VAL B CG2   1 
ATOM   4825 N  N     . GLU B 1 155 ? -35.184 -1.983  -25.440 1.00 39.94  ? 149 GLU B N     1 
ATOM   4826 C  CA    . GLU B 1 155 ? -34.741 -3.283  -25.958 1.00 48.48  ? 149 GLU B CA    1 
ATOM   4827 C  C     . GLU B 1 155 ? -33.259 -3.357  -26.330 1.00 56.25  ? 149 GLU B C     1 
ATOM   4828 O  O     . GLU B 1 155 ? -32.705 -4.443  -26.507 1.00 50.57  ? 149 GLU B O     1 
ATOM   4829 C  CB    . GLU B 1 155 ? -35.652 -3.867  -27.047 1.00 41.38  ? 149 GLU B CB    1 
ATOM   4830 C  CG    . GLU B 1 155 ? -36.066 -2.960  -28.169 1.00 39.65  ? 149 GLU B CG    1 
ATOM   4831 C  CD    . GLU B 1 155 ? -37.038 -3.666  -29.106 1.00 49.09  ? 149 GLU B CD    1 
ATOM   4832 O  OE1   . GLU B 1 155 ? -36.857 -4.884  -29.343 1.00 50.83  ? 149 GLU B OE1   1 
ATOM   4833 O  OE2   . GLU B 1 155 ? -37.993 -3.019  -29.588 1.00 48.51  ? 149 GLU B OE2   1 
ATOM   4834 N  N     . ASP B 1 156 ? -32.609 -2.204  -26.409 1.00 60.44  ? 150 ASP B N     1 
ATOM   4835 C  CA    . ASP B 1 156 ? -31.167 -2.186  -26.588 1.00 63.27  ? 150 ASP B CA    1 
ATOM   4836 C  C     . ASP B 1 156 ? -30.473 -2.329  -25.237 1.00 66.43  ? 150 ASP B C     1 
ATOM   4837 O  O     . ASP B 1 156 ? -29.595 -1.533  -24.893 1.00 68.01  ? 150 ASP B O     1 
ATOM   4838 C  CB    . ASP B 1 156 ? -30.715 -0.910  -27.303 1.00 71.13  ? 150 ASP B CB    1 
ATOM   4839 C  CG    . ASP B 1 156 ? -31.279 -0.800  -28.714 1.00 81.70  ? 150 ASP B CG    1 
ATOM   4840 O  OD1   . ASP B 1 156 ? -31.917 -1.778  -29.176 1.00 66.18  ? 150 ASP B OD1   1 
ATOM   4841 O  OD2   . ASP B 1 156 ? -31.075 0.258   -29.359 1.00 76.10  ? 150 ASP B OD2   1 
ATOM   4842 N  N     . ALA B 1 157 ? -30.896 -3.333  -24.469 1.00 54.40  ? 151 ALA B N     1 
ATOM   4843 C  CA    . ALA B 1 157 ? -30.231 -3.695  -23.220 1.00 55.46  ? 151 ALA B CA    1 
ATOM   4844 C  C     . ALA B 1 157 ? -30.047 -5.207  -23.161 1.00 56.75  ? 151 ALA B C     1 
ATOM   4845 O  O     . ALA B 1 157 ? -30.622 -5.934  -23.982 1.00 51.61  ? 151 ALA B O     1 
ATOM   4846 C  CB    . ALA B 1 157 ? -31.011 -3.203  -22.021 1.00 54.12  ? 151 ALA B CB    1 
ATOM   4847 N  N     . PHE B 1 158 ? -29.250 -5.668  -22.195 1.00 56.79  ? 152 PHE B N     1 
ATOM   4848 C  CA    . PHE B 1 158 ? -28.819 -7.068  -22.138 1.00 60.90  ? 152 PHE B CA    1 
ATOM   4849 C  C     . PHE B 1 158 ? -30.007 -8.011  -22.228 1.00 63.18  ? 152 PHE B C     1 
ATOM   4850 O  O     . PHE B 1 158 ? -30.045 -8.917  -23.068 1.00 62.10  ? 152 PHE B O     1 
ATOM   4851 C  CB    . PHE B 1 158 ? -28.024 -7.360  -20.860 1.00 54.78  ? 152 PHE B CB    1 
ATOM   4852 C  CG    . PHE B 1 158 ? -27.238 -8.647  -20.921 1.00 71.62  ? 152 PHE B CG    1 
ATOM   4853 C  CD1   . PHE B 1 158 ? -26.714 -9.101  -22.127 1.00 65.68  ? 152 PHE B CD1   1 
ATOM   4854 C  CD2   . PHE B 1 158 ? -27.035 -9.413  -19.778 1.00 70.75  ? 152 PHE B CD2   1 
ATOM   4855 C  CE1   . PHE B 1 158 ? -25.992 -10.283 -22.187 1.00 63.35  ? 152 PHE B CE1   1 
ATOM   4856 C  CE2   . PHE B 1 158 ? -26.315 -10.600 -19.835 1.00 65.17  ? 152 PHE B CE2   1 
ATOM   4857 C  CZ    . PHE B 1 158 ? -25.797 -11.035 -21.043 1.00 61.09  ? 152 PHE B CZ    1 
ATOM   4858 N  N     . VAL B 1 159 ? -30.979 -7.783  -21.355 1.00 55.12  ? 153 VAL B N     1 
ATOM   4859 C  CA    . VAL B 1 159 ? -32.243 -8.487  -21.430 1.00 45.28  ? 153 VAL B CA    1 
ATOM   4860 C  C     . VAL B 1 159 ? -33.328 -7.457  -21.687 1.00 37.39  ? 153 VAL B C     1 
ATOM   4861 O  O     . VAL B 1 159 ? -33.655 -6.679  -20.798 1.00 42.10  ? 153 VAL B O     1 
ATOM   4862 C  CB    . VAL B 1 159 ? -32.543 -9.238  -20.128 1.00 37.75  ? 153 VAL B CB    1 
ATOM   4863 C  CG1   . VAL B 1 159 ? -33.578 -10.309 -20.382 1.00 32.96  ? 153 VAL B CG1   1 
ATOM   4864 C  CG2   . VAL B 1 159 ? -31.268 -9.852  -19.564 1.00 34.26  ? 153 VAL B CG2   1 
ATOM   4865 N  N     . PRO B 1 160 ? -33.852 -7.421  -22.920 1.00 35.48  ? 154 PRO B N     1 
ATOM   4866 C  CA    . PRO B 1 160 ? -34.927 -6.511  -23.311 1.00 38.35  ? 154 PRO B CA    1 
ATOM   4867 C  C     . PRO B 1 160 ? -35.998 -6.431  -22.226 1.00 39.44  ? 154 PRO B C     1 
ATOM   4868 O  O     . PRO B 1 160 ? -36.417 -7.467  -21.712 1.00 41.30  ? 154 PRO B O     1 
ATOM   4869 C  CB    . PRO B 1 160 ? -35.477 -7.171  -24.572 1.00 42.82  ? 154 PRO B CB    1 
ATOM   4870 C  CG    . PRO B 1 160 ? -34.284 -7.800  -25.193 1.00 40.51  ? 154 PRO B CG    1 
ATOM   4871 C  CD    . PRO B 1 160 ? -33.390 -8.237  -24.057 1.00 36.76  ? 154 PRO B CD    1 
ATOM   4872 N  N     . VAL B 1 161 ? -36.414 -5.220  -21.872 1.00 31.82  ? 155 VAL B N     1 
ATOM   4873 C  CA    . VAL B 1 161 ? -37.264 -5.032  -20.712 1.00 34.41  ? 155 VAL B CA    1 
ATOM   4874 C  C     . VAL B 1 161 ? -38.162 -3.803  -20.817 1.00 37.40  ? 155 VAL B C     1 
ATOM   4875 O  O     . VAL B 1 161 ? -37.743 -2.749  -21.276 1.00 43.24  ? 155 VAL B O     1 
ATOM   4876 C  CB    . VAL B 1 161 ? -36.400 -4.910  -19.433 1.00 45.12  ? 155 VAL B CB    1 
ATOM   4877 C  CG1   . VAL B 1 161 ? -35.427 -3.731  -19.556 1.00 38.26  ? 155 VAL B CG1   1 
ATOM   4878 C  CG2   . VAL B 1 161 ? -37.274 -4.804  -18.167 1.00 31.55  ? 155 VAL B CG2   1 
ATOM   4879 N  N     . ILE B 1 162 ? -39.407 -3.946  -20.388 1.00 36.15  ? 156 ILE B N     1 
ATOM   4880 C  CA    . ILE B 1 162 ? -40.289 -2.806  -20.258 1.00 33.02  ? 156 ILE B CA    1 
ATOM   4881 C  C     . ILE B 1 162 ? -40.372 -2.451  -18.793 1.00 33.40  ? 156 ILE B C     1 
ATOM   4882 O  O     . ILE B 1 162 ? -40.910 -3.215  -18.007 1.00 32.89  ? 156 ILE B O     1 
ATOM   4883 C  CB    . ILE B 1 162 ? -41.697 -3.146  -20.721 1.00 33.78  ? 156 ILE B CB    1 
ATOM   4884 C  CG1   . ILE B 1 162 ? -41.669 -3.630  -22.166 1.00 35.34  ? 156 ILE B CG1   1 
ATOM   4885 C  CG2   . ILE B 1 162 ? -42.601 -1.944  -20.562 1.00 32.32  ? 156 ILE B CG2   1 
ATOM   4886 C  CD1   . ILE B 1 162 ? -43.032 -3.846  -22.746 1.00 41.66  ? 156 ILE B CD1   1 
ATOM   4887 N  N     . LYS B 1 163 ? -39.826 -1.302  -18.420 1.00 36.99  ? 157 LYS B N     1 
ATOM   4888 C  CA    . LYS B 1 163 ? -39.954 -0.810  -17.058 1.00 33.69  ? 157 LYS B CA    1 
ATOM   4889 C  C     . LYS B 1 163 ? -41.281 -0.069  -16.921 1.00 36.15  ? 157 LYS B C     1 
ATOM   4890 O  O     . LYS B 1 163 ? -41.767 0.492   -17.907 1.00 40.94  ? 157 LYS B O     1 
ATOM   4891 C  CB    . LYS B 1 163 ? -38.796 0.133   -16.729 1.00 36.28  ? 157 LYS B CB    1 
ATOM   4892 C  CG    . LYS B 1 163 ? -37.651 -0.500  -15.938 1.00 42.85  ? 157 LYS B CG    1 
ATOM   4893 C  CD    . LYS B 1 163 ? -36.698 -1.314  -16.804 1.00 43.54  ? 157 LYS B CD    1 
ATOM   4894 C  CE    . LYS B 1 163 ? -35.583 -1.949  -15.959 1.00 44.37  ? 157 LYS B CE    1 
ATOM   4895 N  NZ    . LYS B 1 163 ? -34.960 -0.975  -15.010 1.00 38.45  ? 157 LYS B NZ    1 
ATOM   4896 N  N     . PHE B 1 164 ? -41.866 -0.089  -15.719 1.00 31.56  ? 158 PHE B N     1 
ATOM   4897 C  CA    . PHE B 1 164 ? -43.042 0.741   -15.380 1.00 34.24  ? 158 PHE B CA    1 
ATOM   4898 C  C     . PHE B 1 164 ? -43.485 0.617   -13.916 1.00 32.50  ? 158 PHE B C     1 
ATOM   4899 O  O     . PHE B 1 164 ? -43.035 -0.270  -13.191 1.00 33.97  ? 158 PHE B O     1 
ATOM   4900 C  CB    . PHE B 1 164 ? -44.230 0.451   -16.298 1.00 34.51  ? 158 PHE B CB    1 
ATOM   4901 C  CG    . PHE B 1 164 ? -44.675 -0.975  -16.280 1.00 32.43  ? 158 PHE B CG    1 
ATOM   4902 C  CD1   . PHE B 1 164 ? -44.017 -1.927  -17.038 1.00 29.97  ? 158 PHE B CD1   1 
ATOM   4903 C  CD2   . PHE B 1 164 ? -45.756 -1.362  -15.513 1.00 23.55  ? 158 PHE B CD2   1 
ATOM   4904 C  CE1   . PHE B 1 164 ? -44.425 -3.244  -17.025 1.00 26.84  ? 158 PHE B CE1   1 
ATOM   4905 C  CE2   . PHE B 1 164 ? -46.164 -2.666  -15.497 1.00 24.20  ? 158 PHE B CE2   1 
ATOM   4906 C  CZ    . PHE B 1 164 ? -45.497 -3.616  -16.258 1.00 24.98  ? 158 PHE B CZ    1 
ATOM   4907 N  N     . GLU B 1 165 ? -44.375 1.511   -13.494 1.00 32.21  ? 159 GLU B N     1 
ATOM   4908 C  CA    . GLU B 1 165 ? -44.835 1.562   -12.107 1.00 31.30  ? 159 GLU B CA    1 
ATOM   4909 C  C     . GLU B 1 165 ? -46.344 1.326   -12.012 1.00 31.49  ? 159 GLU B C     1 
ATOM   4910 O  O     . GLU B 1 165 ? -47.131 2.269   -12.043 1.00 34.55  ? 159 GLU B O     1 
ATOM   4911 C  CB    . GLU B 1 165 ? -44.466 2.914   -11.482 1.00 40.55  ? 159 GLU B CB    1 
ATOM   4912 C  CG    . GLU B 1 165 ? -45.001 3.151   -10.061 1.00 43.68  ? 159 GLU B CG    1 
ATOM   4913 C  CD    . GLU B 1 165 ? -44.285 4.291   -9.334  1.00 49.28  ? 159 GLU B CD    1 
ATOM   4914 O  OE1   . GLU B 1 165 ? -44.509 4.460   -8.109  1.00 42.07  ? 159 GLU B OE1   1 
ATOM   4915 O  OE2   . GLU B 1 165 ? -43.492 5.010   -9.988  1.00 58.05  ? 159 GLU B OE2   1 
ATOM   4916 N  N     . PHE B 1 166 ? -46.737 0.061   -11.899 1.00 27.03  ? 160 PHE B N     1 
ATOM   4917 C  CA    . PHE B 1 166 ? -48.141 -0.322  -11.795 1.00 25.93  ? 160 PHE B CA    1 
ATOM   4918 C  C     . PHE B 1 166 ? -48.609 -0.135  -10.359 1.00 24.36  ? 160 PHE B C     1 
ATOM   4919 O  O     . PHE B 1 166 ? -48.072 -0.758  -9.451  1.00 23.88  ? 160 PHE B O     1 
ATOM   4920 C  CB    . PHE B 1 166 ? -48.307 -1.788  -12.200 1.00 25.09  ? 160 PHE B CB    1 
ATOM   4921 C  CG    . PHE B 1 166 ? -49.672 -2.134  -12.747 1.00 30.16  ? 160 PHE B CG    1 
ATOM   4922 C  CD1   . PHE B 1 166 ? -50.717 -1.224  -12.703 1.00 29.15  ? 160 PHE B CD1   1 
ATOM   4923 C  CD2   . PHE B 1 166 ? -49.909 -3.388  -13.303 1.00 26.55  ? 160 PHE B CD2   1 
ATOM   4924 C  CE1   . PHE B 1 166 ? -51.969 -1.557  -13.210 1.00 25.70  ? 160 PHE B CE1   1 
ATOM   4925 C  CE2   . PHE B 1 166 ? -51.162 -3.726  -13.806 1.00 23.52  ? 160 PHE B CE2   1 
ATOM   4926 C  CZ    . PHE B 1 166 ? -52.190 -2.811  -13.756 1.00 20.56  ? 160 PHE B CZ    1 
ATOM   4927 N  N     . ASP B 1 167 ? -49.598 0.732   -10.162 1.00 23.68  ? 161 ASP B N     1 
ATOM   4928 C  CA    . ASP B 1 167 ? -50.173 0.984   -8.844  1.00 21.17  ? 161 ASP B CA    1 
ATOM   4929 C  C     . ASP B 1 167 ? -49.130 1.158   -7.746  1.00 21.05  ? 161 ASP B C     1 
ATOM   4930 O  O     . ASP B 1 167 ? -49.346 0.739   -6.618  1.00 19.88  ? 161 ASP B O     1 
ATOM   4931 C  CB    . ASP B 1 167 ? -51.132 -0.141  -8.447  1.00 23.03  ? 161 ASP B CB    1 
ATOM   4932 C  CG    . ASP B 1 167 ? -52.429 -0.104  -9.220  1.00 25.22  ? 161 ASP B CG    1 
ATOM   4933 O  OD1   . ASP B 1 167 ? -52.815 1.008   -9.649  1.00 26.09  ? 161 ASP B OD1   1 
ATOM   4934 O  OD2   . ASP B 1 167 ? -53.063 -1.181  -9.385  1.00 18.87  ? 161 ASP B OD2   1 
ATOM   4935 N  N     . GLY B 1 168 ? -47.993 1.753   -8.078  1.00 21.15  ? 162 GLY B N     1 
ATOM   4936 C  CA    . GLY B 1 168 ? -46.989 2.062   -7.077  1.00 20.19  ? 162 GLY B CA    1 
ATOM   4937 C  C     . GLY B 1 168 ? -45.911 1.005   -7.008  1.00 23.01  ? 162 GLY B C     1 
ATOM   4938 O  O     . GLY B 1 168 ? -44.801 1.255   -6.504  1.00 17.13  ? 162 GLY B O     1 
ATOM   4939 N  N     . ILE B 1 169 ? -46.255 -0.177  -7.514  1.00 17.66  ? 163 ILE B N     1 
ATOM   4940 C  CA    . ILE B 1 169 ? -45.336 -1.300  -7.579  1.00 17.83  ? 163 ILE B CA    1 
ATOM   4941 C  C     . ILE B 1 169 ? -44.484 -1.199  -8.842  1.00 23.36  ? 163 ILE B C     1 
ATOM   4942 O  O     . ILE B 1 169 ? -45.006 -1.156  -9.950  1.00 26.75  ? 163 ILE B O     1 
ATOM   4943 C  CB    . ILE B 1 169 ? -46.093 -2.643  -7.610  1.00 17.24  ? 163 ILE B CB    1 
ATOM   4944 C  CG1   . ILE B 1 169 ? -46.896 -2.878  -6.316  1.00 14.84  ? 163 ILE B CG1   1 
ATOM   4945 C  CG2   . ILE B 1 169 ? -45.143 -3.780  -7.919  1.00 14.37  ? 163 ILE B CG2   1 
ATOM   4946 C  CD1   . ILE B 1 169 ? -46.273 -2.334  -5.085  1.00 12.61  ? 163 ILE B CD1   1 
ATOM   4947 N  N     . GLU B 1 170 ? -43.169 -1.155  -8.668  1.00 24.59  ? 164 GLU B N     1 
ATOM   4948 C  CA    . GLU B 1 170 ? -42.228 -1.087  -9.781  1.00 23.44  ? 164 GLU B CA    1 
ATOM   4949 C  C     . GLU B 1 170 ? -42.082 -2.461  -10.405 1.00 24.04  ? 164 GLU B C     1 
ATOM   4950 O  O     . GLU B 1 170 ? -41.846 -3.443  -9.701  1.00 21.28  ? 164 GLU B O     1 
ATOM   4951 C  CB    . GLU B 1 170 ? -40.870 -0.694  -9.245  1.00 26.03  ? 164 GLU B CB    1 
ATOM   4952 C  CG    . GLU B 1 170 ? -40.203 0.479   -9.873  1.00 31.15  ? 164 GLU B CG    1 
ATOM   4953 C  CD    . GLU B 1 170 ? -38.979 0.877   -9.063  1.00 41.87  ? 164 GLU B CD    1 
ATOM   4954 O  OE1   . GLU B 1 170 ? -39.146 1.497   -7.980  1.00 23.40  ? 164 GLU B OE1   1 
ATOM   4955 O  OE2   . GLU B 1 170 ? -37.854 0.531   -9.493  1.00 59.57  ? 164 GLU B OE2   1 
ATOM   4956 N  N     . ILE B 1 171 ? -42.190 -2.531  -11.726 1.00 27.63  ? 165 ILE B N     1 
ATOM   4957 C  CA    . ILE B 1 171 ? -42.058 -3.797  -12.434 1.00 22.88  ? 165 ILE B CA    1 
ATOM   4958 C  C     . ILE B 1 171 ? -41.051 -3.666  -13.573 1.00 27.86  ? 165 ILE B C     1 
ATOM   4959 O  O     . ILE B 1 171 ? -41.093 -2.706  -14.335 1.00 34.22  ? 165 ILE B O     1 
ATOM   4960 C  CB    . ILE B 1 171 ? -43.414 -4.255  -12.986 1.00 19.09  ? 165 ILE B CB    1 
ATOM   4961 C  CG1   . ILE B 1 171 ? -44.405 -4.441  -11.843 1.00 16.40  ? 165 ILE B CG1   1 
ATOM   4962 C  CG2   . ILE B 1 171 ? -43.271 -5.532  -13.762 1.00 21.32  ? 165 ILE B CG2   1 
ATOM   4963 C  CD1   . ILE B 1 171 ? -45.734 -4.982  -12.265 1.00 15.74  ? 165 ILE B CD1   1 
ATOM   4964 N  N     . ASP B 1 172 ? -40.122 -4.616  -13.642 1.00 28.89  ? 166 ASP B N     1 
ATOM   4965 C  CA    . ASP B 1 172 ? -39.204 -4.767  -14.763 1.00 24.07  ? 166 ASP B CA    1 
ATOM   4966 C  C     . ASP B 1 172 ? -39.646 -6.030  -15.503 1.00 27.43  ? 166 ASP B C     1 
ATOM   4967 O  O     . ASP B 1 172 ? -39.406 -7.159  -15.055 1.00 24.07  ? 166 ASP B O     1 
ATOM   4968 C  CB    . ASP B 1 172 ? -37.754 -4.904  -14.283 1.00 25.21  ? 166 ASP B CB    1 
ATOM   4969 C  CG    . ASP B 1 172 ? -37.234 -3.645  -13.579 1.00 35.36  ? 166 ASP B CG    1 
ATOM   4970 O  OD1   . ASP B 1 172 ? -37.988 -2.649  -13.474 1.00 32.02  ? 166 ASP B OD1   1 
ATOM   4971 O  OD2   . ASP B 1 172 ? -36.060 -3.648  -13.136 1.00 31.74  ? 166 ASP B OD2   1 
ATOM   4972 N  N     . LEU B 1 173 ? -40.316 -5.826  -16.630 1.00 29.56  ? 167 LEU B N     1 
ATOM   4973 C  CA    . LEU B 1 173 ? -40.983 -6.907  -17.341 1.00 26.72  ? 167 LEU B CA    1 
ATOM   4974 C  C     . LEU B 1 173 ? -40.144 -7.392  -18.503 1.00 26.23  ? 167 LEU B C     1 
ATOM   4975 O  O     . LEU B 1 173 ? -39.677 -6.605  -19.312 1.00 33.95  ? 167 LEU B O     1 
ATOM   4976 C  CB    . LEU B 1 173 ? -42.344 -6.431  -17.852 1.00 23.92  ? 167 LEU B CB    1 
ATOM   4977 C  CG    . LEU B 1 173 ? -43.276 -7.453  -18.502 1.00 25.57  ? 167 LEU B CG    1 
ATOM   4978 C  CD1   . LEU B 1 173 ? -43.712 -8.525  -17.513 1.00 19.97  ? 167 LEU B CD1   1 
ATOM   4979 C  CD2   . LEU B 1 173 ? -44.483 -6.736  -19.086 1.00 26.16  ? 167 LEU B CD2   1 
ATOM   4980 N  N     . VAL B 1 174 ? -39.982 -8.699  -18.597 1.00 20.85  ? 168 VAL B N     1 
ATOM   4981 C  CA    . VAL B 1 174 ? -39.114 -9.277  -19.601 1.00 24.37  ? 168 VAL B CA    1 
ATOM   4982 C  C     . VAL B 1 174 ? -39.841 -10.352 -20.433 1.00 31.47  ? 168 VAL B C     1 
ATOM   4983 O  O     . VAL B 1 174 ? -40.699 -11.079 -19.920 1.00 25.19  ? 168 VAL B O     1 
ATOM   4984 C  CB    . VAL B 1 174 ? -37.832 -9.792  -18.932 1.00 23.50  ? 168 VAL B CB    1 
ATOM   4985 C  CG1   . VAL B 1 174 ? -37.248 -10.953 -19.681 1.00 31.81  ? 168 VAL B CG1   1 
ATOM   4986 C  CG2   . VAL B 1 174 ? -36.832 -8.663  -18.818 1.00 27.62  ? 168 VAL B CG2   1 
ATOM   4987 N  N     . PHE B 1 175 ? -39.517 -10.432 -21.725 1.00 39.18  ? 169 PHE B N     1 
ATOM   4988 C  CA    . PHE B 1 175 ? -40.304 -11.255 -22.643 1.00 34.75  ? 169 PHE B CA    1 
ATOM   4989 C  C     . PHE B 1 175 ? -39.592 -12.468 -23.213 1.00 26.41  ? 169 PHE B C     1 
ATOM   4990 O  O     . PHE B 1 175 ? -38.401 -12.430 -23.471 1.00 29.56  ? 169 PHE B O     1 
ATOM   4991 C  CB    . PHE B 1 175 ? -40.817 -10.422 -23.809 1.00 30.39  ? 169 PHE B CB    1 
ATOM   4992 C  CG    . PHE B 1 175 ? -41.602 -11.218 -24.785 1.00 33.52  ? 169 PHE B CG    1 
ATOM   4993 C  CD1   . PHE B 1 175 ? -42.912 -11.552 -24.513 1.00 37.41  ? 169 PHE B CD1   1 
ATOM   4994 C  CD2   . PHE B 1 175 ? -41.025 -11.682 -25.946 1.00 34.61  ? 169 PHE B CD2   1 
ATOM   4995 C  CE1   . PHE B 1 175 ? -43.640 -12.307 -25.401 1.00 35.86  ? 169 PHE B CE1   1 
ATOM   4996 C  CE2   . PHE B 1 175 ? -41.744 -12.444 -26.822 1.00 32.49  ? 169 PHE B CE2   1 
ATOM   4997 C  CZ    . PHE B 1 175 ? -43.056 -12.754 -26.551 1.00 32.78  ? 169 PHE B CZ    1 
ATOM   4998 N  N     . ALA B 1 176 ? -40.350 -13.531 -23.451 1.00 22.62  ? 170 ALA B N     1 
ATOM   4999 C  CA    . ALA B 1 176 ? -39.810 -14.720 -24.089 1.00 30.02  ? 170 ALA B CA    1 
ATOM   5000 C  C     . ALA B 1 176 ? -40.838 -15.410 -24.982 1.00 39.56  ? 170 ALA B C     1 
ATOM   5001 O  O     . ALA B 1 176 ? -42.012 -15.530 -24.614 1.00 38.19  ? 170 ALA B O     1 
ATOM   5002 C  CB    . ALA B 1 176 ? -39.280 -15.688 -23.053 1.00 20.87  ? 170 ALA B CB    1 
ATOM   5003 N  N     . ARG B 1 177 ? -40.383 -15.867 -26.150 1.00 41.07  ? 171 ARG B N     1 
ATOM   5004 C  CA    . ARG B 1 177 ? -41.225 -16.608 -27.083 1.00 35.24  ? 171 ARG B CA    1 
ATOM   5005 C  C     . ARG B 1 177 ? -40.954 -18.098 -26.964 1.00 32.47  ? 171 ARG B C     1 
ATOM   5006 O  O     . ARG B 1 177 ? -39.828 -18.502 -26.731 1.00 38.98  ? 171 ARG B O     1 
ATOM   5007 C  CB    . ARG B 1 177 ? -40.940 -16.159 -28.511 1.00 44.70  ? 171 ARG B CB    1 
ATOM   5008 C  CG    . ARG B 1 177 ? -42.030 -16.533 -29.487 1.00 48.71  ? 171 ARG B CG    1 
ATOM   5009 C  CD    . ARG B 1 177 ? -41.512 -16.641 -30.911 1.00 49.74  ? 171 ARG B CD    1 
ATOM   5010 N  NE    . ARG B 1 177 ? -41.495 -18.035 -31.342 1.00 57.57  ? 171 ARG B NE    1 
ATOM   5011 C  CZ    . ARG B 1 177 ? -41.206 -18.439 -32.574 1.00 67.21  ? 171 ARG B CZ    1 
ATOM   5012 N  NH1   . ARG B 1 177 ? -40.908 -17.546 -33.510 1.00 77.01  ? 171 ARG B NH1   1 
ATOM   5013 N  NH2   . ARG B 1 177 ? -41.214 -19.736 -32.869 1.00 57.23  ? 171 ARG B NH2   1 
ATOM   5014 N  N     . LEU B 1 178 ? -41.980 -18.919 -27.136 1.00 35.08  ? 172 LEU B N     1 
ATOM   5015 C  CA    . LEU B 1 178 ? -41.815 -20.362 -26.997 1.00 43.70  ? 172 LEU B CA    1 
ATOM   5016 C  C     . LEU B 1 178 ? -42.557 -21.134 -28.085 1.00 55.82  ? 172 LEU B C     1 
ATOM   5017 O  O     . LEU B 1 178 ? -43.741 -20.900 -28.317 1.00 61.13  ? 172 LEU B O     1 
ATOM   5018 C  CB    . LEU B 1 178 ? -42.302 -20.818 -25.620 1.00 47.02  ? 172 LEU B CB    1 
ATOM   5019 C  CG    . LEU B 1 178 ? -41.229 -21.174 -24.591 1.00 45.14  ? 172 LEU B CG    1 
ATOM   5020 C  CD1   . LEU B 1 178 ? -41.862 -21.557 -23.265 1.00 29.64  ? 172 LEU B CD1   1 
ATOM   5021 C  CD2   . LEU B 1 178 ? -40.346 -22.301 -25.123 1.00 53.48  ? 172 LEU B CD2   1 
ATOM   5022 N  N     . ALA B 1 179 ? -41.872 -22.070 -28.737 1.00 59.35  ? 173 ALA B N     1 
ATOM   5023 C  CA    . ALA B 1 179 ? -42.478 -22.855 -29.814 1.00 48.30  ? 173 ALA B CA    1 
ATOM   5024 C  C     . ALA B 1 179 ? -43.539 -23.809 -29.289 1.00 51.14  ? 173 ALA B C     1 
ATOM   5025 O  O     . ALA B 1 179 ? -43.338 -25.021 -29.279 1.00 56.70  ? 173 ALA B O     1 
ATOM   5026 C  CB    . ALA B 1 179 ? -41.415 -23.627 -30.558 1.00 41.35  ? 173 ALA B CB    1 
ATOM   5027 N  N     . ILE B 1 180 ? -44.661 -23.261 -28.839 1.00 49.05  ? 174 ILE B N     1 
ATOM   5028 C  CA    . ILE B 1 180 ? -45.768 -24.068 -28.334 1.00 60.39  ? 174 ILE B CA    1 
ATOM   5029 C  C     . ILE B 1 180 ? -47.078 -23.397 -28.734 1.00 61.33  ? 174 ILE B C     1 
ATOM   5030 O  O     . ILE B 1 180 ? -47.122 -22.179 -28.920 1.00 58.70  ? 174 ILE B O     1 
ATOM   5031 C  CB    . ILE B 1 180 ? -45.719 -24.231 -26.787 1.00 59.51  ? 174 ILE B CB    1 
ATOM   5032 C  CG1   . ILE B 1 180 ? -44.430 -24.910 -26.337 1.00 55.77  ? 174 ILE B CG1   1 
ATOM   5033 C  CG2   . ILE B 1 180 ? -46.894 -25.055 -26.278 1.00 62.70  ? 174 ILE B CG2   1 
ATOM   5034 C  CD1   . ILE B 1 180 ? -44.484 -25.393 -24.901 1.00 67.39  ? 174 ILE B CD1   1 
ATOM   5035 N  N     . GLN B 1 181 ? -48.134 -24.191 -28.896 1.00 65.10  ? 175 GLN B N     1 
ATOM   5036 C  CA    . GLN B 1 181 ? -49.456 -23.657 -29.182 1.00 60.60  ? 175 GLN B CA    1 
ATOM   5037 C  C     . GLN B 1 181 ? -49.894 -22.770 -28.040 1.00 55.17  ? 175 GLN B C     1 
ATOM   5038 O  O     . GLN B 1 181 ? -50.143 -21.591 -28.234 1.00 58.62  ? 175 GLN B O     1 
ATOM   5039 C  CB    . GLN B 1 181 ? -50.472 -24.784 -29.360 1.00 67.74  ? 175 GLN B CB    1 
ATOM   5040 C  CG    . GLN B 1 181 ? -50.463 -25.436 -30.732 1.00 74.69  ? 175 GLN B CG    1 
ATOM   5041 C  CD    . GLN B 1 181 ? -51.647 -25.024 -31.585 1.00 76.35  ? 175 GLN B CD    1 
ATOM   5042 O  OE1   . GLN B 1 181 ? -52.166 -23.918 -31.442 1.00 73.50  ? 175 GLN B OE1   1 
ATOM   5043 N  NE2   . GLN B 1 181 ? -52.086 -25.918 -32.474 1.00 63.75  ? 175 GLN B NE2   1 
ATOM   5044 N  N     . THR B 1 182 ? -49.988 -23.351 -26.847 1.00 55.43  ? 176 THR B N     1 
ATOM   5045 C  CA    . THR B 1 182 ? -50.512 -22.652 -25.677 1.00 53.53  ? 176 THR B CA    1 
ATOM   5046 C  C     . THR B 1 182 ? -49.573 -22.764 -24.472 1.00 55.83  ? 176 THR B C     1 
ATOM   5047 O  O     . THR B 1 182 ? -49.012 -23.833 -24.190 1.00 44.03  ? 176 THR B O     1 
ATOM   5048 C  CB    . THR B 1 182 ? -51.912 -23.181 -25.269 1.00 51.16  ? 176 THR B CB    1 
ATOM   5049 O  OG1   . THR B 1 182 ? -51.774 -24.402 -24.532 1.00 50.72  ? 176 THR B OG1   1 
ATOM   5050 C  CG2   . THR B 1 182 ? -52.775 -23.444 -26.493 1.00 59.37  ? 176 THR B CG2   1 
ATOM   5051 N  N     . ILE B 1 183 ? -49.409 -21.647 -23.766 1.00 56.95  ? 177 ILE B N     1 
ATOM   5052 C  CA    . ILE B 1 183 ? -48.602 -21.607 -22.554 1.00 47.52  ? 177 ILE B CA    1 
ATOM   5053 C  C     . ILE B 1 183 ? -49.420 -22.119 -21.376 1.00 45.57  ? 177 ILE B C     1 
ATOM   5054 O  O     . ILE B 1 183 ? -50.390 -21.488 -20.966 1.00 49.56  ? 177 ILE B O     1 
ATOM   5055 C  CB    . ILE B 1 183 ? -48.129 -20.184 -22.233 1.00 48.38  ? 177 ILE B CB    1 
ATOM   5056 C  CG1   . ILE B 1 183 ? -47.386 -19.573 -23.417 1.00 44.54  ? 177 ILE B CG1   1 
ATOM   5057 C  CG2   . ILE B 1 183 ? -47.235 -20.193 -21.017 1.00 55.32  ? 177 ILE B CG2   1 
ATOM   5058 C  CD1   . ILE B 1 183 ? -46.234 -20.403 -23.901 1.00 49.67  ? 177 ILE B CD1   1 
ATOM   5059 N  N     . SER B 1 184 ? -49.012 -23.261 -20.833 1.00 52.87  ? 178 SER B N     1 
ATOM   5060 C  CA    . SER B 1 184 ? -49.766 -23.955 -19.788 1.00 57.09  ? 178 SER B CA    1 
ATOM   5061 C  C     . SER B 1 184 ? -49.915 -23.165 -18.482 1.00 54.58  ? 178 SER B C     1 
ATOM   5062 O  O     . SER B 1 184 ? -49.516 -22.001 -18.385 1.00 54.54  ? 178 SER B O     1 
ATOM   5063 C  CB    . SER B 1 184 ? -49.131 -25.326 -19.508 1.00 54.45  ? 178 SER B CB    1 
ATOM   5064 O  OG    . SER B 1 184 ? -49.702 -25.931 -18.362 1.00 49.77  ? 178 SER B OG    1 
ATOM   5065 N  N     . ASP B 1 185 ? -50.506 -23.804 -17.477 1.00 57.35  ? 179 ASP B N     1 
ATOM   5066 C  CA    . ASP B 1 185 ? -50.633 -23.176 -16.171 1.00 54.95  ? 179 ASP B CA    1 
ATOM   5067 C  C     . ASP B 1 185 ? -49.354 -23.408 -15.399 1.00 49.17  ? 179 ASP B C     1 
ATOM   5068 O  O     . ASP B 1 185 ? -48.837 -22.511 -14.736 1.00 42.30  ? 179 ASP B O     1 
ATOM   5069 C  CB    . ASP B 1 185 ? -51.795 -23.771 -15.389 1.00 46.07  ? 179 ASP B CB    1 
ATOM   5070 C  CG    . ASP B 1 185 ? -52.237 -22.870 -14.265 1.00 41.66  ? 179 ASP B CG    1 
ATOM   5071 O  OD1   . ASP B 1 185 ? -51.455 -21.949 -13.928 1.00 42.46  ? 179 ASP B OD1   1 
ATOM   5072 O  OD2   . ASP B 1 185 ? -53.360 -23.068 -13.739 1.00 32.38  ? 179 ASP B OD2   1 
ATOM   5073 N  N     . ASN B 1 186 ? -48.872 -24.640 -15.474 1.00 43.78  ? 180 ASN B N     1 
ATOM   5074 C  CA    . ASN B 1 186 ? -47.586 -24.983 -14.910 1.00 48.44  ? 180 ASN B CA    1 
ATOM   5075 C  C     . ASN B 1 186 ? -46.618 -25.325 -16.037 1.00 53.31  ? 180 ASN B C     1 
ATOM   5076 O  O     . ASN B 1 186 ? -46.128 -26.458 -16.167 1.00 43.24  ? 180 ASN B O     1 
ATOM   5077 C  CB    . ASN B 1 186 ? -47.703 -26.124 -13.899 1.00 44.31  ? 180 ASN B CB    1 
ATOM   5078 C  CG    . ASN B 1 186 ? -48.190 -27.409 -14.531 1.00 49.07  ? 180 ASN B CG    1 
ATOM   5079 O  OD1   . ASN B 1 186 ? -49.021 -27.390 -15.443 1.00 47.73  ? 180 ASN B OD1   1 
ATOM   5080 N  ND2   . ASN B 1 186 ? -47.652 -28.533 -14.073 1.00 43.10  ? 180 ASN B ND2   1 
ATOM   5081 N  N     . LEU B 1 187 ? -46.370 -24.327 -16.874 1.00 51.90  ? 181 LEU B N     1 
ATOM   5082 C  CA    . LEU B 1 187 ? -45.227 -24.376 -17.763 1.00 50.27  ? 181 LEU B CA    1 
ATOM   5083 C  C     . LEU B 1 187 ? -43.981 -24.429 -16.869 1.00 54.83  ? 181 LEU B C     1 
ATOM   5084 O  O     . LEU B 1 187 ? -43.756 -23.540 -16.039 1.00 52.07  ? 181 LEU B O     1 
ATOM   5085 C  CB    . LEU B 1 187 ? -45.206 -23.128 -18.638 1.00 39.86  ? 181 LEU B CB    1 
ATOM   5086 C  CG    . LEU B 1 187 ? -44.457 -23.135 -19.971 1.00 47.00  ? 181 LEU B CG    1 
ATOM   5087 C  CD1   . LEU B 1 187 ? -44.134 -21.706 -20.343 1.00 41.01  ? 181 LEU B CD1   1 
ATOM   5088 C  CD2   . LEU B 1 187 ? -43.189 -23.996 -19.981 1.00 45.05  ? 181 LEU B CD2   1 
ATOM   5089 N  N     . ASP B 1 188 ? -43.183 -25.478 -17.019 1.00 46.95  ? 182 ASP B N     1 
ATOM   5090 C  CA    . ASP B 1 188 ? -41.931 -25.557 -16.285 1.00 44.49  ? 182 ASP B CA    1 
ATOM   5091 C  C     . ASP B 1 188 ? -40.790 -25.125 -17.195 1.00 44.38  ? 182 ASP B C     1 
ATOM   5092 O  O     . ASP B 1 188 ? -40.499 -25.789 -18.194 1.00 46.41  ? 182 ASP B O     1 
ATOM   5093 C  CB    . ASP B 1 188 ? -41.709 -26.974 -15.779 1.00 47.68  ? 182 ASP B CB    1 
ATOM   5094 C  CG    . ASP B 1 188 ? -40.255 -27.273 -15.509 1.00 55.39  ? 182 ASP B CG    1 
ATOM   5095 O  OD1   . ASP B 1 188 ? -39.781 -26.973 -14.386 1.00 56.69  ? 182 ASP B OD1   1 
ATOM   5096 O  OD2   . ASP B 1 188 ? -39.592 -27.816 -16.423 1.00 52.32  ? 182 ASP B OD2   1 
ATOM   5097 N  N     . LEU B 1 189 ? -40.152 -24.008 -16.859 1.00 32.78  ? 183 LEU B N     1 
ATOM   5098 C  CA    . LEU B 1 189 ? -39.109 -23.455 -17.719 1.00 35.01  ? 183 LEU B CA    1 
ATOM   5099 C  C     . LEU B 1 189 ? -37.757 -24.080 -17.447 1.00 32.53  ? 183 LEU B C     1 
ATOM   5100 O  O     . LEU B 1 189 ? -36.738 -23.577 -17.908 1.00 27.77  ? 183 LEU B O     1 
ATOM   5101 C  CB    . LEU B 1 189 ? -38.970 -21.949 -17.520 1.00 27.02  ? 183 LEU B CB    1 
ATOM   5102 C  CG    . LEU B 1 189 ? -40.239 -21.133 -17.344 1.00 31.82  ? 183 LEU B CG    1 
ATOM   5103 C  CD1   . LEU B 1 189 ? -39.851 -19.690 -17.115 1.00 33.71  ? 183 LEU B CD1   1 
ATOM   5104 C  CD2   . LEU B 1 189 ? -41.121 -21.271 -18.554 1.00 31.44  ? 183 LEU B CD2   1 
ATOM   5105 N  N     . ARG B 1 190 ? -37.740 -25.168 -16.692 1.00 39.65  ? 184 ARG B N     1 
ATOM   5106 C  CA    . ARG B 1 190 ? -36.474 -25.716 -16.233 1.00 45.12  ? 184 ARG B CA    1 
ATOM   5107 C  C     . ARG B 1 190 ? -35.893 -26.711 -17.221 1.00 35.02  ? 184 ARG B C     1 
ATOM   5108 O  O     . ARG B 1 190 ? -34.682 -26.791 -17.389 1.00 37.04  ? 184 ARG B O     1 
ATOM   5109 C  CB    . ARG B 1 190 ? -36.623 -26.352 -14.850 1.00 49.04  ? 184 ARG B CB    1 
ATOM   5110 C  CG    . ARG B 1 190 ? -35.422 -26.111 -13.958 1.00 58.45  ? 184 ARG B CG    1 
ATOM   5111 C  CD    . ARG B 1 190 ? -35.005 -27.379 -13.237 1.00 61.15  ? 184 ARG B CD    1 
ATOM   5112 N  NE    . ARG B 1 190 ? -36.009 -27.814 -12.272 1.00 70.34  ? 184 ARG B NE    1 
ATOM   5113 C  CZ    . ARG B 1 190 ? -35.761 -28.665 -11.284 1.00 63.93  ? 184 ARG B CZ    1 
ATOM   5114 N  NH1   . ARG B 1 190 ? -34.539 -29.161 -11.130 1.00 50.87  ? 184 ARG B NH1   1 
ATOM   5115 N  NH2   . ARG B 1 190 ? -36.731 -29.013 -10.447 1.00 64.21  ? 184 ARG B NH2   1 
ATOM   5116 N  N     . ASP B 1 191 ? -36.766 -27.470 -17.864 1.00 38.78  ? 185 ASP B N     1 
ATOM   5117 C  CA    . ASP B 1 191 ? -36.355 -28.426 -18.877 1.00 52.76  ? 185 ASP B CA    1 
ATOM   5118 C  C     . ASP B 1 191 ? -35.448 -27.739 -19.899 1.00 51.89  ? 185 ASP B C     1 
ATOM   5119 O  O     . ASP B 1 191 ? -35.849 -26.741 -20.491 1.00 49.80  ? 185 ASP B O     1 
ATOM   5120 C  CB    . ASP B 1 191 ? -37.598 -28.978 -19.574 1.00 54.40  ? 185 ASP B CB    1 
ATOM   5121 C  CG    . ASP B 1 191 ? -37.303 -30.207 -20.394 1.00 68.27  ? 185 ASP B CG    1 
ATOM   5122 O  OD1   . ASP B 1 191 ? -36.379 -30.959 -20.007 1.00 71.04  ? 185 ASP B OD1   1 
ATOM   5123 O  OD2   . ASP B 1 191 ? -37.988 -30.418 -21.422 1.00 72.95  ? 185 ASP B OD2   1 
ATOM   5124 N  N     . ASP B 1 192 ? -34.229 -28.250 -20.091 1.00 45.65  ? 186 ASP B N     1 
ATOM   5125 C  CA    . ASP B 1 192 ? -33.289 -27.643 -21.049 1.00 47.28  ? 186 ASP B CA    1 
ATOM   5126 C  C     . ASP B 1 192 ? -33.747 -27.730 -22.510 1.00 51.80  ? 186 ASP B C     1 
ATOM   5127 O  O     . ASP B 1 192 ? -33.226 -27.021 -23.375 1.00 47.30  ? 186 ASP B O     1 
ATOM   5128 C  CB    . ASP B 1 192 ? -31.890 -28.244 -20.921 1.00 47.46  ? 186 ASP B CB    1 
ATOM   5129 C  CG    . ASP B 1 192 ? -31.079 -27.603 -19.820 1.00 40.47  ? 186 ASP B CG    1 
ATOM   5130 O  OD1   . ASP B 1 192 ? -31.648 -26.825 -19.033 1.00 33.40  ? 186 ASP B OD1   1 
ATOM   5131 O  OD2   . ASP B 1 192 ? -29.866 -27.891 -19.733 1.00 42.75  ? 186 ASP B OD2   1 
ATOM   5132 N  N     . SER B 1 193 ? -34.717 -28.597 -22.781 1.00 52.51  ? 187 SER B N     1 
ATOM   5133 C  CA    . SER B 1 193 ? -35.283 -28.713 -24.118 1.00 47.09  ? 187 SER B CA    1 
ATOM   5134 C  C     . SER B 1 193 ? -35.896 -27.397 -24.586 1.00 55.25  ? 187 SER B C     1 
ATOM   5135 O  O     . SER B 1 193 ? -36.001 -27.162 -25.783 1.00 63.51  ? 187 SER B O     1 
ATOM   5136 C  CB    . SER B 1 193 ? -36.338 -29.821 -24.160 1.00 54.24  ? 187 SER B CB    1 
ATOM   5137 O  OG    . SER B 1 193 ? -37.495 -29.471 -23.415 1.00 56.79  ? 187 SER B OG    1 
ATOM   5138 N  N     . ARG B 1 194 ? -36.296 -26.543 -23.641 1.00 55.52  ? 188 ARG B N     1 
ATOM   5139 C  CA    . ARG B 1 194 ? -36.924 -25.260 -23.961 1.00 44.93  ? 188 ARG B CA    1 
ATOM   5140 C  C     . ARG B 1 194 ? -36.019 -24.421 -24.848 1.00 52.87  ? 188 ARG B C     1 
ATOM   5141 O  O     . ARG B 1 194 ? -36.496 -23.641 -25.668 1.00 63.98  ? 188 ARG B O     1 
ATOM   5142 C  CB    . ARG B 1 194 ? -37.241 -24.453 -22.691 1.00 49.87  ? 188 ARG B CB    1 
ATOM   5143 C  CG    . ARG B 1 194 ? -38.201 -25.096 -21.668 1.00 57.25  ? 188 ARG B CG    1 
ATOM   5144 C  CD    . ARG B 1 194 ? -39.680 -24.964 -22.042 1.00 55.87  ? 188 ARG B CD    1 
ATOM   5145 N  NE    . ARG B 1 194 ? -40.072 -25.911 -23.085 1.00 63.02  ? 188 ARG B NE    1 
ATOM   5146 C  CZ    . ARG B 1 194 ? -41.318 -26.323 -23.292 1.00 59.61  ? 188 ARG B CZ    1 
ATOM   5147 N  NH1   . ARG B 1 194 ? -42.302 -25.876 -22.521 1.00 55.39  ? 188 ARG B NH1   1 
ATOM   5148 N  NH2   . ARG B 1 194 ? -41.582 -27.188 -24.263 1.00 56.79  ? 188 ARG B NH2   1 
ATOM   5149 N  N     . LEU B 1 195 ? -34.710 -24.595 -24.692 1.00 53.07  ? 189 LEU B N     1 
ATOM   5150 C  CA    . LEU B 1 195 ? -33.749 -23.660 -25.274 1.00 54.11  ? 189 LEU B CA    1 
ATOM   5151 C  C     . LEU B 1 195 ? -33.443 -23.888 -26.742 1.00 59.25  ? 189 LEU B C     1 
ATOM   5152 O  O     . LEU B 1 195 ? -33.082 -22.945 -27.446 1.00 60.36  ? 189 LEU B O     1 
ATOM   5153 C  CB    . LEU B 1 195 ? -32.446 -23.660 -24.478 1.00 44.19  ? 189 LEU B CB    1 
ATOM   5154 C  CG    . LEU B 1 195 ? -32.587 -23.048 -23.092 1.00 36.85  ? 189 LEU B CG    1 
ATOM   5155 C  CD1   . LEU B 1 195 ? -31.252 -23.015 -22.407 1.00 37.63  ? 189 LEU B CD1   1 
ATOM   5156 C  CD2   . LEU B 1 195 ? -33.149 -21.659 -23.225 1.00 42.88  ? 189 LEU B CD2   1 
ATOM   5157 N  N     . ARG B 1 196 ? -33.574 -25.134 -27.190 1.00 62.92  ? 190 ARG B N     1 
ATOM   5158 C  CA    . ARG B 1 196 ? -33.206 -25.510 -28.551 1.00 58.22  ? 190 ARG B CA    1 
ATOM   5159 C  C     . ARG B 1 196 ? -33.825 -24.589 -29.587 1.00 63.08  ? 190 ARG B C     1 
ATOM   5160 O  O     . ARG B 1 196 ? -35.029 -24.323 -29.552 1.00 59.77  ? 190 ARG B O     1 
ATOM   5161 C  CB    . ARG B 1 196 ? -33.600 -26.957 -28.844 1.00 56.22  ? 190 ARG B CB    1 
ATOM   5162 C  CG    . ARG B 1 196 ? -33.509 -27.332 -30.315 1.00 67.52  ? 190 ARG B CG    1 
ATOM   5163 C  CD    . ARG B 1 196 ? -33.526 -28.839 -30.515 1.00 73.61  ? 190 ARG B CD    1 
ATOM   5164 N  NE    . ARG B 1 196 ? -32.318 -29.470 -29.987 1.00 79.16  ? 190 ARG B NE    1 
ATOM   5165 C  CZ    . ARG B 1 196 ? -32.253 -30.131 -28.833 1.00 77.65  ? 190 ARG B CZ    1 
ATOM   5166 N  NH1   . ARG B 1 196 ? -33.338 -30.264 -28.074 1.00 58.15  ? 190 ARG B NH1   1 
ATOM   5167 N  NH2   . ARG B 1 196 ? -31.098 -30.665 -28.443 1.00 66.99  ? 190 ARG B NH2   1 
ATOM   5168 N  N     . SER B 1 197 ? -32.977 -24.089 -30.484 1.00 67.62  ? 191 SER B N     1 
ATOM   5169 C  CA    . SER B 1 197 ? -33.404 -23.268 -31.614 1.00 71.58  ? 191 SER B CA    1 
ATOM   5170 C  C     . SER B 1 197 ? -34.189 -22.041 -31.173 1.00 68.38  ? 191 SER B C     1 
ATOM   5171 O  O     . SER B 1 197 ? -35.215 -21.696 -31.765 1.00 72.40  ? 191 SER B O     1 
ATOM   5172 C  CB    . SER B 1 197 ? -34.232 -24.095 -32.606 1.00 77.65  ? 191 SER B CB    1 
ATOM   5173 O  OG    . SER B 1 197 ? -33.553 -25.283 -32.986 1.00 77.31  ? 191 SER B OG    1 
ATOM   5174 N  N     . LEU B 1 198 ? -33.713 -21.388 -30.124 1.00 59.60  ? 192 LEU B N     1 
ATOM   5175 C  CA    . LEU B 1 198 ? -34.335 -20.151 -29.689 1.00 61.25  ? 192 LEU B CA    1 
ATOM   5176 C  C     . LEU B 1 198 ? -33.367 -19.011 -29.905 1.00 51.54  ? 192 LEU B C     1 
ATOM   5177 O  O     . LEU B 1 198 ? -32.160 -19.180 -29.723 1.00 48.15  ? 192 LEU B O     1 
ATOM   5178 C  CB    . LEU B 1 198 ? -34.737 -20.218 -28.213 1.00 65.24  ? 192 LEU B CB    1 
ATOM   5179 C  CG    . LEU B 1 198 ? -35.972 -21.031 -27.812 1.00 63.18  ? 192 LEU B CG    1 
ATOM   5180 C  CD1   . LEU B 1 198 ? -36.612 -20.403 -26.583 1.00 57.06  ? 192 LEU B CD1   1 
ATOM   5181 C  CD2   . LEU B 1 198 ? -36.980 -21.145 -28.950 1.00 60.97  ? 192 LEU B CD2   1 
ATOM   5182 N  N     . ASP B 1 199 ? -33.898 -17.859 -30.306 1.00 42.41  ? 193 ASP B N     1 
ATOM   5183 C  CA    . ASP B 1 199 ? -33.094 -16.653 -30.411 1.00 44.93  ? 193 ASP B CA    1 
ATOM   5184 C  C     . ASP B 1 199 ? -32.453 -16.431 -29.046 1.00 47.12  ? 193 ASP B C     1 
ATOM   5185 O  O     . ASP B 1 199 ? -33.098 -16.662 -28.022 1.00 55.25  ? 193 ASP B O     1 
ATOM   5186 C  CB    . ASP B 1 199 ? -33.977 -15.464 -30.802 1.00 48.68  ? 193 ASP B CB    1 
ATOM   5187 C  CG    . ASP B 1 199 ? -33.168 -14.233 -31.219 1.00 61.70  ? 193 ASP B CG    1 
ATOM   5188 O  OD1   . ASP B 1 199 ? -31.920 -14.256 -31.124 1.00 60.51  ? 193 ASP B OD1   1 
ATOM   5189 O  OD2   . ASP B 1 199 ? -33.787 -13.230 -31.634 1.00 58.37  ? 193 ASP B OD2   1 
ATOM   5190 N  N     . ILE B 1 200 ? -31.192 -16.011 -29.014 1.00 41.58  ? 194 ILE B N     1 
ATOM   5191 C  CA    . ILE B 1 200 ? -30.501 -15.866 -27.734 1.00 45.77  ? 194 ILE B CA    1 
ATOM   5192 C  C     . ILE B 1 200 ? -31.131 -14.803 -26.832 1.00 45.30  ? 194 ILE B C     1 
ATOM   5193 O  O     . ILE B 1 200 ? -30.964 -14.849 -25.614 1.00 43.60  ? 194 ILE B O     1 
ATOM   5194 C  CB    . ILE B 1 200 ? -28.989 -15.594 -27.887 1.00 41.02  ? 194 ILE B CB    1 
ATOM   5195 C  CG1   . ILE B 1 200 ? -28.728 -14.121 -28.204 1.00 35.62  ? 194 ILE B CG1   1 
ATOM   5196 C  CG2   . ILE B 1 200 ? -28.388 -16.521 -28.927 1.00 46.60  ? 194 ILE B CG2   1 
ATOM   5197 C  CD1   . ILE B 1 200 ? -27.337 -13.675 -27.844 1.00 35.69  ? 194 ILE B CD1   1 
ATOM   5198 N  N     . ARG B 1 201 ? -31.851 -13.856 -27.430 1.00 45.01  ? 195 ARG B N     1 
ATOM   5199 C  CA    . ARG B 1 201 ? -32.616 -12.871 -26.665 1.00 47.24  ? 195 ARG B CA    1 
ATOM   5200 C  C     . ARG B 1 201 ? -33.638 -13.580 -25.784 1.00 40.22  ? 195 ARG B C     1 
ATOM   5201 O  O     . ARG B 1 201 ? -33.697 -13.347 -24.574 1.00 34.43  ? 195 ARG B O     1 
ATOM   5202 C  CB    . ARG B 1 201 ? -33.335 -11.890 -27.598 1.00 55.03  ? 195 ARG B CB    1 
ATOM   5203 C  CG    . ARG B 1 201 ? -32.441 -10.831 -28.227 1.00 53.84  ? 195 ARG B CG    1 
ATOM   5204 C  CD    . ARG B 1 201 ? -32.723 -10.679 -29.718 1.00 55.93  ? 195 ARG B CD    1 
ATOM   5205 N  NE    . ARG B 1 201 ? -33.666 -9.603  -30.014 1.00 64.21  ? 195 ARG B NE    1 
ATOM   5206 C  CZ    . ARG B 1 201 ? -34.658 -9.701  -30.896 1.00 60.68  ? 195 ARG B CZ    1 
ATOM   5207 N  NH1   . ARG B 1 201 ? -34.844 -10.829 -31.566 1.00 47.65  ? 195 ARG B NH1   1 
ATOM   5208 N  NH2   . ARG B 1 201 ? -35.469 -8.670  -31.106 1.00 70.27  ? 195 ARG B NH2   1 
ATOM   5209 N  N     . CYS B 1 202 ? -34.440 -14.438 -26.406 1.00 35.05  ? 196 CYS B N     1 
ATOM   5210 C  CA    . CYS B 1 202 ? -35.369 -15.286 -25.677 1.00 40.03  ? 196 CYS B CA    1 
ATOM   5211 C  C     . CYS B 1 202 ? -34.661 -16.080 -24.552 1.00 40.15  ? 196 CYS B C     1 
ATOM   5212 O  O     . CYS B 1 202 ? -35.109 -16.085 -23.402 1.00 34.03  ? 196 CYS B O     1 
ATOM   5213 C  CB    . CYS B 1 202 ? -36.116 -16.210 -26.654 1.00 39.81  ? 196 CYS B CB    1 
ATOM   5214 S  SG    . CYS B 1 202 ? -37.222 -15.334 -27.808 1.00 33.89  ? 196 CYS B SG    1 
ATOM   5215 N  N     . ILE B 1 203 ? -33.544 -16.722 -24.884 1.00 42.99  ? 197 ILE B N     1 
ATOM   5216 C  CA    . ILE B 1 203 ? -32.749 -17.478 -23.911 1.00 39.70  ? 197 ILE B CA    1 
ATOM   5217 C  C     . ILE B 1 203 ? -32.302 -16.651 -22.710 1.00 38.51  ? 197 ILE B C     1 
ATOM   5218 O  O     . ILE B 1 203 ? -32.390 -17.098 -21.562 1.00 37.44  ? 197 ILE B O     1 
ATOM   5219 C  CB    . ILE B 1 203 ? -31.486 -18.062 -24.569 1.00 42.44  ? 197 ILE B CB    1 
ATOM   5220 C  CG1   . ILE B 1 203 ? -31.870 -19.158 -25.563 1.00 44.76  ? 197 ILE B CG1   1 
ATOM   5221 C  CG2   . ILE B 1 203 ? -30.519 -18.590 -23.513 1.00 40.36  ? 197 ILE B CG2   1 
ATOM   5222 C  CD1   . ILE B 1 203 ? -30.688 -19.858 -26.180 1.00 46.68  ? 197 ILE B CD1   1 
ATOM   5223 N  N     . ARG B 1 204 ? -31.806 -15.449 -22.973 1.00 36.29  ? 198 ARG B N     1 
ATOM   5224 C  CA    . ARG B 1 204 ? -31.315 -14.603 -21.896 1.00 41.25  ? 198 ARG B CA    1 
ATOM   5225 C  C     . ARG B 1 204 ? -32.474 -14.083 -21.081 1.00 36.31  ? 198 ARG B C     1 
ATOM   5226 O  O     . ARG B 1 204 ? -32.292 -13.613 -19.962 1.00 41.59  ? 198 ARG B O     1 
ATOM   5227 C  CB    . ARG B 1 204 ? -30.491 -13.430 -22.433 1.00 48.76  ? 198 ARG B CB    1 
ATOM   5228 C  CG    . ARG B 1 204 ? -29.260 -13.838 -23.222 1.00 55.70  ? 198 ARG B CG    1 
ATOM   5229 C  CD    . ARG B 1 204 ? -28.051 -13.040 -22.793 1.00 64.09  ? 198 ARG B CD    1 
ATOM   5230 N  NE    . ARG B 1 204 ? -27.125 -12.813 -23.897 1.00 69.37  ? 198 ARG B NE    1 
ATOM   5231 C  CZ    . ARG B 1 204 ? -27.191 -11.767 -24.713 1.00 75.14  ? 198 ARG B CZ    1 
ATOM   5232 N  NH1   . ARG B 1 204 ? -28.136 -10.850 -24.544 1.00 66.01  ? 198 ARG B NH1   1 
ATOM   5233 N  NH2   . ARG B 1 204 ? -26.305 -11.627 -25.689 1.00 86.38  ? 198 ARG B NH2   1 
ATOM   5234 N  N     . SER B 1 205 ? -33.667 -14.160 -21.655 1.00 33.33  ? 199 SER B N     1 
ATOM   5235 C  CA    . SER B 1 205 ? -34.870 -13.699 -20.984 1.00 27.93  ? 199 SER B CA    1 
ATOM   5236 C  C     . SER B 1 205 ? -35.464 -14.826 -20.136 1.00 28.65  ? 199 SER B C     1 
ATOM   5237 O  O     . SER B 1 205 ? -36.187 -14.589 -19.171 1.00 29.11  ? 199 SER B O     1 
ATOM   5238 C  CB    . SER B 1 205 ? -35.888 -13.206 -22.016 1.00 33.65  ? 199 SER B CB    1 
ATOM   5239 O  OG    . SER B 1 205 ? -35.629 -11.878 -22.455 1.00 30.78  ? 199 SER B OG    1 
ATOM   5240 N  N     . LEU B 1 206 ? -35.164 -16.063 -20.504 1.00 26.57  ? 200 LEU B N     1 
ATOM   5241 C  CA    . LEU B 1 206 ? -35.592 -17.193 -19.705 1.00 21.43  ? 200 LEU B CA    1 
ATOM   5242 C  C     . LEU B 1 206 ? -34.663 -17.381 -18.509 1.00 24.60  ? 200 LEU B C     1 
ATOM   5243 O  O     . LEU B 1 206 ? -35.065 -17.918 -17.474 1.00 22.71  ? 200 LEU B O     1 
ATOM   5244 C  CB    . LEU B 1 206 ? -35.605 -18.463 -20.546 1.00 26.78  ? 200 LEU B CB    1 
ATOM   5245 C  CG    . LEU B 1 206 ? -36.794 -18.682 -21.475 1.00 23.78  ? 200 LEU B CG    1 
ATOM   5246 C  CD1   . LEU B 1 206 ? -36.752 -20.103 -22.005 1.00 25.18  ? 200 LEU B CD1   1 
ATOM   5247 C  CD2   . LEU B 1 206 ? -38.093 -18.430 -20.749 1.00 19.91  ? 200 LEU B CD2   1 
ATOM   5248 N  N     . ASN B 1 207 ? -33.424 -16.921 -18.653 1.00 25.28  ? 201 ASN B N     1 
ATOM   5249 C  CA    . ASN B 1 207 ? -32.381 -17.196 -17.671 1.00 20.75  ? 201 ASN B CA    1 
ATOM   5250 C  C     . ASN B 1 207 ? -32.752 -16.852 -16.228 1.00 20.43  ? 201 ASN B C     1 
ATOM   5251 O  O     . ASN B 1 207 ? -32.529 -17.656 -15.310 1.00 15.44  ? 201 ASN B O     1 
ATOM   5252 C  CB    . ASN B 1 207 ? -31.086 -16.484 -18.052 1.00 17.26  ? 201 ASN B CB    1 
ATOM   5253 C  CG    . ASN B 1 207 ? -29.912 -16.975 -17.247 1.00 19.34  ? 201 ASN B CG    1 
ATOM   5254 O  OD1   . ASN B 1 207 ? -29.749 -18.187 -17.045 1.00 16.79  ? 201 ASN B OD1   1 
ATOM   5255 N  ND2   . ASN B 1 207 ? -29.095 -16.042 -16.754 1.00 16.74  ? 201 ASN B ND2   1 
ATOM   5256 N  N     . GLY B 1 208 ? -33.309 -15.655 -16.045 1.00 20.96  ? 202 GLY B N     1 
ATOM   5257 C  CA    . GLY B 1 208 ? -33.657 -15.151 -14.729 1.00 18.82  ? 202 GLY B CA    1 
ATOM   5258 C  C     . GLY B 1 208 ? -34.556 -16.105 -13.963 1.00 20.00  ? 202 GLY B C     1 
ATOM   5259 O  O     . GLY B 1 208 ? -34.256 -16.487 -12.832 1.00 18.11  ? 202 GLY B O     1 
ATOM   5260 N  N     . CYS B 1 209 ? -35.661 -16.505 -14.576 1.00 15.63  ? 203 CYS B N     1 
ATOM   5261 C  CA    . CYS B 1 209 ? -36.483 -17.528 -13.964 1.00 19.79  ? 203 CYS B CA    1 
ATOM   5262 C  C     . CYS B 1 209 ? -35.718 -18.825 -13.748 1.00 21.76  ? 203 CYS B C     1 
ATOM   5263 O  O     . CYS B 1 209 ? -35.749 -19.387 -12.655 1.00 19.97  ? 203 CYS B O     1 
ATOM   5264 C  CB    . CYS B 1 209 ? -37.732 -17.789 -14.784 1.00 22.18  ? 203 CYS B CB    1 
ATOM   5265 S  SG    . CYS B 1 209 ? -38.916 -16.488 -14.543 1.00 39.50  ? 203 CYS B SG    1 
ATOM   5266 N  N     . ARG B 1 210 ? -35.028 -19.298 -14.780 1.00 19.28  ? 204 ARG B N     1 
ATOM   5267 C  CA    . ARG B 1 210 ? -34.349 -20.578 -14.661 1.00 18.01  ? 204 ARG B CA    1 
ATOM   5268 C  C     . ARG B 1 210 ? -33.364 -20.573 -13.481 1.00 18.16  ? 204 ARG B C     1 
ATOM   5269 O  O     . ARG B 1 210 ? -33.379 -21.498 -12.667 1.00 13.47  ? 204 ARG B O     1 
ATOM   5270 C  CB    . ARG B 1 210 ? -33.714 -21.004 -15.986 1.00 14.90  ? 204 ARG B CB    1 
ATOM   5271 C  CG    . ARG B 1 210 ? -34.671 -20.882 -17.164 1.00 21.91  ? 204 ARG B CG    1 
ATOM   5272 C  CD    . ARG B 1 210 ? -34.128 -21.508 -18.436 1.00 22.20  ? 204 ARG B CD    1 
ATOM   5273 N  NE    . ARG B 1 210 ? -34.069 -22.958 -18.288 1.00 31.77  ? 204 ARG B NE    1 
ATOM   5274 C  CZ    . ARG B 1 210 ? -32.958 -23.677 -18.373 1.00 30.40  ? 204 ARG B CZ    1 
ATOM   5275 N  NH1   . ARG B 1 210 ? -31.802 -23.084 -18.643 1.00 28.75  ? 204 ARG B NH1   1 
ATOM   5276 N  NH2   . ARG B 1 210 ? -33.008 -24.989 -18.200 1.00 35.30  ? 204 ARG B NH2   1 
ATOM   5277 N  N     . VAL B 1 211 ? -32.567 -19.509 -13.353 1.00 17.48  ? 205 VAL B N     1 
ATOM   5278 C  CA    . VAL B 1 211 ? -31.665 -19.365 -12.195 1.00 18.77  ? 205 VAL B CA    1 
ATOM   5279 C  C     . VAL B 1 211 ? -32.405 -19.299 -10.847 1.00 18.86  ? 205 VAL B C     1 
ATOM   5280 O  O     . VAL B 1 211 ? -32.123 -20.079 -9.933  1.00 17.89  ? 205 VAL B O     1 
ATOM   5281 C  CB    . VAL B 1 211 ? -30.762 -18.128 -12.309 1.00 16.00  ? 205 VAL B CB    1 
ATOM   5282 C  CG1   . VAL B 1 211 ? -30.127 -17.801 -10.970 1.00 9.68   ? 205 VAL B CG1   1 
ATOM   5283 C  CG2   . VAL B 1 211 ? -29.711 -18.339 -13.364 1.00 16.73  ? 205 VAL B CG2   1 
ATOM   5284 N  N     . THR B 1 212 ? -33.358 -18.379 -10.733 1.00 17.62  ? 206 THR B N     1 
ATOM   5285 C  CA    . THR B 1 212 ? -34.115 -18.221 -9.495  1.00 16.77  ? 206 THR B CA    1 
ATOM   5286 C  C     . THR B 1 212 ? -34.804 -19.522 -9.049  1.00 20.10  ? 206 THR B C     1 
ATOM   5287 O  O     . THR B 1 212 ? -34.671 -19.931 -7.890  1.00 20.45  ? 206 THR B O     1 
ATOM   5288 C  CB    . THR B 1 212 ? -35.137 -17.077 -9.595  1.00 14.58  ? 206 THR B CB    1 
ATOM   5289 O  OG1   . THR B 1 212 ? -34.454 -15.812 -9.642  1.00 15.39  ? 206 THR B OG1   1 
ATOM   5290 C  CG2   . THR B 1 212 ? -36.024 -17.095 -8.401  1.00 15.01  ? 206 THR B CG2   1 
ATOM   5291 N  N     . ASP B 1 213 ? -35.518 -20.176 -9.967  1.00 19.71  ? 207 ASP B N     1 
ATOM   5292 C  CA    . ASP B 1 213 ? -36.146 -21.457 -9.668  1.00 16.90  ? 207 ASP B CA    1 
ATOM   5293 C  C     . ASP B 1 213 ? -35.078 -22.456 -9.223  1.00 20.43  ? 207 ASP B C     1 
ATOM   5294 O  O     . ASP B 1 213 ? -35.313 -23.264 -8.321  1.00 22.24  ? 207 ASP B O     1 
ATOM   5295 C  CB    . ASP B 1 213 ? -36.912 -22.017 -10.878 1.00 18.63  ? 207 ASP B CB    1 
ATOM   5296 C  CG    . ASP B 1 213 ? -38.112 -21.156 -11.290 1.00 28.88  ? 207 ASP B CG    1 
ATOM   5297 O  OD1   . ASP B 1 213 ? -38.771 -20.567 -10.408 1.00 30.98  ? 207 ASP B OD1   1 
ATOM   5298 O  OD2   . ASP B 1 213 ? -38.407 -21.074 -12.509 1.00 26.37  ? 207 ASP B OD2   1 
ATOM   5299 N  N     . GLU B 1 214 ? -33.900 -22.390 -9.845  1.00 18.17  ? 208 GLU B N     1 
ATOM   5300 C  CA    . GLU B 1 214 ? -32.856 -23.388 -9.604  1.00 18.76  ? 208 GLU B CA    1 
ATOM   5301 C  C     . GLU B 1 214 ? -32.252 -23.244 -8.216  1.00 25.59  ? 208 GLU B C     1 
ATOM   5302 O  O     . GLU B 1 214 ? -31.956 -24.238 -7.538  1.00 25.90  ? 208 GLU B O     1 
ATOM   5303 C  CB    . GLU B 1 214 ? -31.751 -23.290 -10.655 1.00 19.79  ? 208 GLU B CB    1 
ATOM   5304 C  CG    . GLU B 1 214 ? -31.990 -24.115 -11.908 1.00 23.99  ? 208 GLU B CG    1 
ATOM   5305 C  CD    . GLU B 1 214 ? -31.561 -25.548 -11.737 1.00 31.48  ? 208 GLU B CD    1 
ATOM   5306 O  OE1   . GLU B 1 214 ? -30.647 -25.786 -10.927 1.00 26.32  ? 208 GLU B OE1   1 
ATOM   5307 O  OE2   . GLU B 1 214 ? -32.136 -26.440 -12.399 1.00 49.72  ? 208 GLU B OE2   1 
ATOM   5308 N  N     . ILE B 1 215 ? -32.067 -21.999 -7.793  1.00 23.51  ? 209 ILE B N     1 
ATOM   5309 C  CA    . ILE B 1 215 ? -31.518 -21.726 -6.483  1.00 14.89  ? 209 ILE B CA    1 
ATOM   5310 C  C     . ILE B 1 215 ? -32.453 -22.266 -5.407  1.00 20.72  ? 209 ILE B C     1 
ATOM   5311 O  O     . ILE B 1 215 ? -32.015 -22.752 -4.364  1.00 21.96  ? 209 ILE B O     1 
ATOM   5312 C  CB    . ILE B 1 215 ? -31.299 -20.245 -6.297  1.00 11.83  ? 209 ILE B CB    1 
ATOM   5313 C  CG1   . ILE B 1 215 ? -30.377 -19.727 -7.389  1.00 12.35  ? 209 ILE B CG1   1 
ATOM   5314 C  CG2   . ILE B 1 215 ? -30.668 -19.976 -4.953  1.00 17.19  ? 209 ILE B CG2   1 
ATOM   5315 C  CD1   . ILE B 1 215 ? -29.979 -18.305 -7.193  1.00 10.83  ? 209 ILE B CD1   1 
ATOM   5316 N  N     . LEU B 1 216 ? -33.747 -22.213 -5.675  1.00 19.87  ? 210 LEU B N     1 
ATOM   5317 C  CA    . LEU B 1 216 ? -34.715 -22.668 -4.696  1.00 20.11  ? 210 LEU B CA    1 
ATOM   5318 C  C     . LEU B 1 216 ? -34.774 -24.191 -4.591  1.00 22.54  ? 210 LEU B C     1 
ATOM   5319 O  O     . LEU B 1 216 ? -35.223 -24.740 -3.576  1.00 27.42  ? 210 LEU B O     1 
ATOM   5320 C  CB    . LEU B 1 216 ? -36.087 -22.049 -4.976  1.00 20.65  ? 210 LEU B CB    1 
ATOM   5321 C  CG    . LEU B 1 216 ? -36.106 -20.556 -4.621  1.00 17.97  ? 210 LEU B CG    1 
ATOM   5322 C  CD1   . LEU B 1 216 ? -37.408 -19.884 -4.999  1.00 18.43  ? 210 LEU B CD1   1 
ATOM   5323 C  CD2   . LEU B 1 216 ? -35.821 -20.358 -3.143  1.00 10.74  ? 210 LEU B CD2   1 
ATOM   5324 N  N     . HIS B 1 217 ? -34.294 -24.886 -5.612  1.00 20.51  ? 211 HIS B N     1 
ATOM   5325 C  CA    . HIS B 1 217 ? -34.306 -26.342 -5.550  1.00 27.43  ? 211 HIS B CA    1 
ATOM   5326 C  C     . HIS B 1 217 ? -32.991 -26.894 -5.041  1.00 24.75  ? 211 HIS B C     1 
ATOM   5327 O  O     . HIS B 1 217 ? -32.919 -28.045 -4.619  1.00 31.87  ? 211 HIS B O     1 
ATOM   5328 C  CB    . HIS B 1 217 ? -34.666 -26.962 -6.903  1.00 34.26  ? 211 HIS B CB    1 
ATOM   5329 C  CG    . HIS B 1 217 ? -36.030 -26.581 -7.388  1.00 52.98  ? 211 HIS B CG    1 
ATOM   5330 N  ND1   . HIS B 1 217 ? -36.415 -25.268 -7.577  1.00 46.66  ? 211 HIS B ND1   1 
ATOM   5331 C  CD2   . HIS B 1 217 ? -37.106 -27.337 -7.714  1.00 58.06  ? 211 HIS B CD2   1 
ATOM   5332 C  CE1   . HIS B 1 217 ? -37.666 -25.233 -8.002  1.00 48.71  ? 211 HIS B CE1   1 
ATOM   5333 N  NE2   . HIS B 1 217 ? -38.107 -26.476 -8.096  1.00 62.68  ? 211 HIS B NE2   1 
ATOM   5334 N  N     . LEU B 1 218 ? -31.948 -26.077 -5.075  1.00 20.28  ? 212 LEU B N     1 
ATOM   5335 C  CA    . LEU B 1 218 ? -30.637 -26.543 -4.651  1.00 19.27  ? 212 LEU B CA    1 
ATOM   5336 C  C     . LEU B 1 218 ? -30.426 -26.302 -3.151  1.00 18.12  ? 212 LEU B C     1 
ATOM   5337 O  O     . LEU B 1 218 ? -29.328 -26.464 -2.616  1.00 14.98  ? 212 LEU B O     1 
ATOM   5338 C  CB    . LEU B 1 218 ? -29.559 -25.870 -5.491  1.00 14.78  ? 212 LEU B CB    1 
ATOM   5339 C  CG    . LEU B 1 218 ? -29.595 -26.304 -6.960  1.00 19.41  ? 212 LEU B CG    1 
ATOM   5340 C  CD1   . LEU B 1 218 ? -28.663 -25.456 -7.816  1.00 16.58  ? 212 LEU B CD1   1 
ATOM   5341 C  CD2   . LEU B 1 218 ? -29.250 -27.777 -7.113  1.00 14.59  ? 212 LEU B CD2   1 
ATOM   5342 N  N     . VAL B 1 219 ? -31.506 -25.935 -2.477  1.00 14.17  ? 213 VAL B N     1 
ATOM   5343 C  CA    . VAL B 1 219 ? -31.442 -25.528 -1.089  1.00 11.07  ? 213 VAL B CA    1 
ATOM   5344 C  C     . VAL B 1 219 ? -32.209 -26.533 -0.207  1.00 15.89  ? 213 VAL B C     1 
ATOM   5345 O  O     . VAL B 1 219 ? -33.369 -26.852 -0.478  1.00 16.94  ? 213 VAL B O     1 
ATOM   5346 C  CB    . VAL B 1 219 ? -31.942 -24.071 -0.973  1.00 11.17  ? 213 VAL B CB    1 
ATOM   5347 C  CG1   . VAL B 1 219 ? -33.023 -23.906 0.062   1.00 12.18  ? 213 VAL B CG1   1 
ATOM   5348 C  CG2   . VAL B 1 219 ? -30.782 -23.138 -0.728  1.00 10.50  ? 213 VAL B CG2   1 
ATOM   5349 N  N     . PRO B 1 220 ? -31.531 -27.097 0.810   1.00 13.72  ? 214 PRO B N     1 
ATOM   5350 C  CA    . PRO B 1 220 ? -32.175 -28.081 1.683   1.00 14.67  ? 214 PRO B CA    1 
ATOM   5351 C  C     . PRO B 1 220 ? -33.421 -27.587 2.431   1.00 15.35  ? 214 PRO B C     1 
ATOM   5352 O  O     . PRO B 1 220 ? -34.359 -28.348 2.609   1.00 22.26  ? 214 PRO B O     1 
ATOM   5353 C  CB    . PRO B 1 220 ? -31.054 -28.485 2.660   1.00 14.42  ? 214 PRO B CB    1 
ATOM   5354 C  CG    . PRO B 1 220 ? -29.933 -27.540 2.416   1.00 13.62  ? 214 PRO B CG    1 
ATOM   5355 C  CD    . PRO B 1 220 ? -30.075 -27.069 1.018   1.00 13.84  ? 214 PRO B CD    1 
ATOM   5356 N  N     . ASN B 1 221 ? -33.431 -26.336 2.860   1.00 16.18  ? 215 ASN B N     1 
ATOM   5357 C  CA    . ASN B 1 221 ? -34.556 -25.798 3.604   1.00 15.21  ? 215 ASN B CA    1 
ATOM   5358 C  C     . ASN B 1 221 ? -34.837 -24.392 3.095   1.00 15.71  ? 215 ASN B C     1 
ATOM   5359 O  O     . ASN B 1 221 ? -34.016 -23.483 3.284   1.00 14.47  ? 215 ASN B O     1 
ATOM   5360 C  CB    . ASN B 1 221 ? -34.213 -25.782 5.102   1.00 17.37  ? 215 ASN B CB    1 
ATOM   5361 C  CG    . ASN B 1 221 ? -35.374 -25.337 5.984   1.00 14.38  ? 215 ASN B CG    1 
ATOM   5362 O  OD1   . ASN B 1 221 ? -36.308 -24.667 5.541   1.00 13.56  ? 215 ASN B OD1   1 
ATOM   5363 N  ND2   . ASN B 1 221 ? -35.303 -25.703 7.252   1.00 14.82  ? 215 ASN B ND2   1 
ATOM   5364 N  N     . LYS B 1 222 ? -35.983 -24.209 2.445   1.00 13.03  ? 216 LYS B N     1 
ATOM   5365 C  CA    . LYS B 1 222 ? -36.301 -22.899 1.894   1.00 15.01  ? 216 LYS B CA    1 
ATOM   5366 C  C     . LYS B 1 222 ? -36.486 -21.845 2.988   1.00 15.48  ? 216 LYS B C     1 
ATOM   5367 O  O     . LYS B 1 222 ? -36.107 -20.693 2.801   1.00 16.51  ? 216 LYS B O     1 
ATOM   5368 C  CB    . LYS B 1 222 ? -37.504 -22.950 0.947   1.00 13.61  ? 216 LYS B CB    1 
ATOM   5369 C  CG    . LYS B 1 222 ? -37.286 -23.811 -0.279  1.00 11.64  ? 216 LYS B CG    1 
ATOM   5370 C  CD    . LYS B 1 222 ? -38.437 -23.672 -1.253  1.00 17.09  ? 216 LYS B CD    1 
ATOM   5371 C  CE    . LYS B 1 222 ? -38.768 -24.999 -1.947  1.00 29.83  ? 216 LYS B CE    1 
ATOM   5372 N  NZ    . LYS B 1 222 ? -39.744 -25.858 -1.180  1.00 27.74  ? 216 LYS B NZ    1 
ATOM   5373 N  N     . GLU B 1 223 ? -37.029 -22.240 4.135   1.00 15.62  ? 217 GLU B N     1 
ATOM   5374 C  CA    . GLU B 1 223 ? -37.312 -21.279 5.201   1.00 16.82  ? 217 GLU B CA    1 
ATOM   5375 C  C     . GLU B 1 223 ? -36.065 -20.640 5.785   1.00 14.41  ? 217 GLU B C     1 
ATOM   5376 O  O     . GLU B 1 223 ? -35.953 -19.419 5.841   1.00 18.05  ? 217 GLU B O     1 
ATOM   5377 C  CB    . GLU B 1 223 ? -38.105 -21.930 6.322   1.00 21.13  ? 217 GLU B CB    1 
ATOM   5378 C  CG    . GLU B 1 223 ? -39.204 -21.048 6.881   1.00 33.52  ? 217 GLU B CG    1 
ATOM   5379 C  CD    . GLU B 1 223 ? -39.466 -21.325 8.348   1.00 51.25  ? 217 GLU B CD    1 
ATOM   5380 O  OE1   . GLU B 1 223 ? -38.488 -21.604 9.081   1.00 33.62  ? 217 GLU B OE1   1 
ATOM   5381 O  OE2   . GLU B 1 223 ? -40.645 -21.269 8.765   1.00 67.58  ? 217 GLU B OE2   1 
ATOM   5382 N  N     . THR B 1 224 ? -35.129 -21.466 6.223   1.00 14.15  ? 218 THR B N     1 
ATOM   5383 C  CA    . THR B 1 224 ? -33.866 -20.961 6.751   1.00 17.40  ? 218 THR B CA    1 
ATOM   5384 C  C     . THR B 1 224 ? -33.059 -20.232 5.675   1.00 16.10  ? 218 THR B C     1 
ATOM   5385 O  O     . THR B 1 224 ? -32.281 -19.320 5.962   1.00 15.02  ? 218 THR B O     1 
ATOM   5386 C  CB    . THR B 1 224 ? -33.015 -22.098 7.348   1.00 19.63  ? 218 THR B CB    1 
ATOM   5387 O  OG1   . THR B 1 224 ? -32.793 -23.116 6.359   1.00 12.88  ? 218 THR B OG1   1 
ATOM   5388 C  CG2   . THR B 1 224 ? -33.726 -22.706 8.542   1.00 16.26  ? 218 THR B CG2   1 
ATOM   5389 N  N     . PHE B 1 225 ? -33.243 -20.644 4.430   1.00 14.22  ? 219 PHE B N     1 
ATOM   5390 C  CA    . PHE B 1 225 ? -32.570 -19.981 3.336   1.00 12.59  ? 219 PHE B CA    1 
ATOM   5391 C  C     . PHE B 1 225 ? -32.983 -18.509 3.267   1.00 12.88  ? 219 PHE B C     1 
ATOM   5392 O  O     . PHE B 1 225 ? -32.126 -17.626 3.358   1.00 10.20  ? 219 PHE B O     1 
ATOM   5393 C  CB    . PHE B 1 225 ? -32.884 -20.691 2.033   1.00 9.92   ? 219 PHE B CB    1 
ATOM   5394 C  CG    . PHE B 1 225 ? -32.508 -19.910 0.822   1.00 12.59  ? 219 PHE B CG    1 
ATOM   5395 C  CD1   . PHE B 1 225 ? -31.197 -19.524 0.609   1.00 13.67  ? 219 PHE B CD1   1 
ATOM   5396 C  CD2   . PHE B 1 225 ? -33.458 -19.571 -0.119  1.00 11.55  ? 219 PHE B CD2   1 
ATOM   5397 C  CE1   . PHE B 1 225 ? -30.841 -18.811 -0.518  1.00 8.82   ? 219 PHE B CE1   1 
ATOM   5398 C  CE2   . PHE B 1 225 ? -33.106 -18.866 -1.245  1.00 9.12   ? 219 PHE B CE2   1 
ATOM   5399 C  CZ    . PHE B 1 225 ? -31.793 -18.485 -1.442  1.00 8.78   ? 219 PHE B CZ    1 
ATOM   5400 N  N     . ARG B 1 226 ? -34.292 -18.262 3.140   1.00 11.99  ? 220 ARG B N     1 
ATOM   5401 C  CA    . ARG B 1 226 ? -34.822 -16.917 2.956   1.00 8.01   ? 220 ARG B CA    1 
ATOM   5402 C  C     . ARG B 1 226 ? -34.411 -16.004 4.079   1.00 10.05  ? 220 ARG B C     1 
ATOM   5403 O  O     . ARG B 1 226 ? -34.052 -14.853 3.848   1.00 10.06  ? 220 ARG B O     1 
ATOM   5404 C  CB    . ARG B 1 226 ? -36.337 -16.908 2.884   1.00 6.92   ? 220 ARG B CB    1 
ATOM   5405 C  CG    . ARG B 1 226 ? -36.910 -17.594 1.697   1.00 10.20  ? 220 ARG B CG    1 
ATOM   5406 C  CD    . ARG B 1 226 ? -38.423 -17.453 1.649   1.00 8.39   ? 220 ARG B CD    1 
ATOM   5407 N  NE    . ARG B 1 226 ? -38.964 -18.128 0.472   1.00 11.99  ? 220 ARG B NE    1 
ATOM   5408 C  CZ    . ARG B 1 226 ? -39.405 -19.382 0.456   1.00 13.36  ? 220 ARG B CZ    1 
ATOM   5409 N  NH1   . ARG B 1 226 ? -39.394 -20.109 1.566   1.00 15.64  ? 220 ARG B NH1   1 
ATOM   5410 N  NH2   . ARG B 1 226 ? -39.875 -19.902 -0.671  1.00 13.03  ? 220 ARG B NH2   1 
ATOM   5411 N  N     . LEU B 1 227 ? -34.468 -16.502 5.303   1.00 10.71  ? 221 LEU B N     1 
ATOM   5412 C  CA    . LEU B 1 227 ? -34.145 -15.639 6.429   1.00 9.40   ? 221 LEU B CA    1 
ATOM   5413 C  C     . LEU B 1 227 ? -32.670 -15.272 6.376   1.00 8.30   ? 221 LEU B C     1 
ATOM   5414 O  O     . LEU B 1 227 ? -32.327 -14.101 6.479   1.00 8.89   ? 221 LEU B O     1 
ATOM   5415 C  CB    . LEU B 1 227 ? -34.507 -16.309 7.749   1.00 11.49  ? 221 LEU B CB    1 
ATOM   5416 C  CG    . LEU B 1 227 ? -34.464 -15.468 9.020   1.00 12.74  ? 221 LEU B CG    1 
ATOM   5417 C  CD1   . LEU B 1 227 ? -35.160 -14.123 8.814   1.00 10.03  ? 221 LEU B CD1   1 
ATOM   5418 C  CD2   . LEU B 1 227 ? -35.123 -16.260 10.138  1.00 12.95  ? 221 LEU B CD2   1 
ATOM   5419 N  N     . THR B 1 228 ? -31.804 -16.262 6.171   1.00 7.75   ? 222 THR B N     1 
ATOM   5420 C  CA    . THR B 1 228 ? -30.377 -15.991 6.101   1.00 8.84   ? 222 THR B CA    1 
ATOM   5421 C  C     . THR B 1 228 ? -30.093 -15.006 4.985   1.00 8.04   ? 222 THR B C     1 
ATOM   5422 O  O     . THR B 1 228 ? -29.288 -14.085 5.142   1.00 6.72   ? 222 THR B O     1 
ATOM   5423 C  CB    . THR B 1 228 ? -29.541 -17.253 5.862   1.00 10.65  ? 222 THR B CB    1 
ATOM   5424 O  OG1   . THR B 1 228 ? -29.790 -18.204 6.907   1.00 14.38  ? 222 THR B OG1   1 
ATOM   5425 C  CG2   . THR B 1 228 ? -28.055 -16.901 5.853   1.00 6.98   ? 222 THR B CG2   1 
ATOM   5426 N  N     . LEU B 1 229 ? -30.788 -15.186 3.870   1.00 7.95   ? 223 LEU B N     1 
ATOM   5427 C  CA    . LEU B 1 229 ? -30.579 -14.332 2.717   1.00 7.09   ? 223 LEU B CA    1 
ATOM   5428 C  C     . LEU B 1 229 ? -30.921 -12.890 3.053   1.00 8.41   ? 223 LEU B C     1 
ATOM   5429 O  O     . LEU B 1 229 ? -30.123 -11.990 2.791   1.00 8.49   ? 223 LEU B O     1 
ATOM   5430 C  CB    . LEU B 1 229 ? -31.394 -14.812 1.530   1.00 6.79   ? 223 LEU B CB    1 
ATOM   5431 C  CG    . LEU B 1 229 ? -30.815 -14.488 0.155   1.00 9.11   ? 223 LEU B CG    1 
ATOM   5432 C  CD1   . LEU B 1 229 ? -31.875 -13.905 -0.723  1.00 7.88   ? 223 LEU B CD1   1 
ATOM   5433 C  CD2   . LEU B 1 229 ? -29.582 -13.571 0.194   1.00 7.68   ? 223 LEU B CD2   1 
ATOM   5434 N  N     . ARG B 1 230 ? -32.086 -12.666 3.648   1.00 7.49   ? 224 ARG B N     1 
ATOM   5435 C  CA    . ARG B 1 230 ? -32.450 -11.312 4.044   1.00 7.81   ? 224 ARG B CA    1 
ATOM   5436 C  C     . ARG B 1 230 ? -31.379 -10.720 4.954   1.00 8.23   ? 224 ARG B C     1 
ATOM   5437 O  O     . ARG B 1 230 ? -31.051 -9.530  4.859   1.00 7.29   ? 224 ARG B O     1 
ATOM   5438 C  CB    . ARG B 1 230 ? -33.812 -11.281 4.731   1.00 7.97   ? 224 ARG B CB    1 
ATOM   5439 C  CG    . ARG B 1 230 ? -34.892 -12.035 3.988   1.00 8.48   ? 224 ARG B CG    1 
ATOM   5440 C  CD    . ARG B 1 230 ? -36.137 -12.160 4.852   1.00 10.15  ? 224 ARG B CD    1 
ATOM   5441 N  NE    . ARG B 1 230 ? -37.114 -11.149 4.483   1.00 11.60  ? 224 ARG B NE    1 
ATOM   5442 C  CZ    . ARG B 1 230 ? -38.334 -11.425 4.041   1.00 10.05  ? 224 ARG B CZ    1 
ATOM   5443 N  NH1   . ARG B 1 230 ? -38.738 -12.682 3.942   1.00 6.19   ? 224 ARG B NH1   1 
ATOM   5444 N  NH2   . ARG B 1 230 ? -39.151 -10.438 3.711   1.00 15.11  ? 224 ARG B NH2   1 
ATOM   5445 N  N     . ALA B 1 231 ? -30.818 -11.554 5.822   1.00 7.37   ? 225 ALA B N     1 
ATOM   5446 C  CA    . ALA B 1 231 ? -29.795 -11.057 6.729   1.00 10.36  ? 225 ALA B CA    1 
ATOM   5447 C  C     . ALA B 1 231 ? -28.588 -10.606 5.918   1.00 12.27  ? 225 ALA B C     1 
ATOM   5448 O  O     . ALA B 1 231 ? -28.060 -9.507  6.124   1.00 9.17   ? 225 ALA B O     1 
ATOM   5449 C  CB    . ALA B 1 231 ? -29.403 -12.113 7.765   1.00 6.61   ? 225 ALA B CB    1 
ATOM   5450 N  N     . VAL B 1 232 ? -28.181 -11.449 4.971   1.00 10.10  ? 226 VAL B N     1 
ATOM   5451 C  CA    . VAL B 1 232 ? -26.937 -11.230 4.247   1.00 9.64   ? 226 VAL B CA    1 
ATOM   5452 C  C     . VAL B 1 232 ? -27.000 -9.985  3.346   1.00 8.63   ? 226 VAL B C     1 
ATOM   5453 O  O     . VAL B 1 232 ? -26.004 -9.262  3.219   1.00 7.52   ? 226 VAL B O     1 
ATOM   5454 C  CB    . VAL B 1 232 ? -26.486 -12.517 3.471   1.00 10.44  ? 226 VAL B CB    1 
ATOM   5455 C  CG1   . VAL B 1 232 ? -25.293 -12.230 2.572   1.00 7.41   ? 226 VAL B CG1   1 
ATOM   5456 C  CG2   . VAL B 1 232 ? -26.160 -13.646 4.450   1.00 6.83   ? 226 VAL B CG2   1 
ATOM   5457 N  N     . LYS B 1 233 ? -28.164 -9.716  2.755   1.00 5.77   ? 227 LYS B N     1 
ATOM   5458 C  CA    . LYS B 1 233 ? -28.292 -8.568  1.861   1.00 6.04   ? 227 LYS B CA    1 
ATOM   5459 C  C     . LYS B 1 233 ? -28.325 -7.285  2.681   1.00 9.93   ? 227 LYS B C     1 
ATOM   5460 O  O     . LYS B 1 233 ? -27.671 -6.285  2.342   1.00 9.47   ? 227 LYS B O     1 
ATOM   5461 C  CB    . LYS B 1 233 ? -29.548 -8.675  1.007   1.00 5.49   ? 227 LYS B CB    1 
ATOM   5462 C  CG    . LYS B 1 233 ? -29.675 -9.984  0.260   1.00 7.74   ? 227 LYS B CG    1 
ATOM   5463 C  CD    . LYS B 1 233 ? -31.019 -10.128 -0.435  1.00 8.88   ? 227 LYS B CD    1 
ATOM   5464 C  CE    . LYS B 1 233 ? -31.158 -9.094  -1.551  1.00 16.49  ? 227 LYS B CE    1 
ATOM   5465 N  NZ    . LYS B 1 233 ? -32.125 -9.494  -2.634  1.00 14.72  ? 227 LYS B NZ    1 
ATOM   5466 N  N     . LEU B 1 234 ? -29.084 -7.329  3.774   1.00 8.82   ? 228 LEU B N     1 
ATOM   5467 C  CA    . LEU B 1 234 ? -29.169 -6.225  4.718   1.00 8.03   ? 228 LEU B CA    1 
ATOM   5468 C  C     . LEU B 1 234 ? -27.774 -5.822  5.195   1.00 10.80  ? 228 LEU B C     1 
ATOM   5469 O  O     . LEU B 1 234 ? -27.422 -4.635  5.250   1.00 12.12  ? 228 LEU B O     1 
ATOM   5470 C  CB    . LEU B 1 234 ? -30.011 -6.660  5.904   1.00 7.53   ? 228 LEU B CB    1 
ATOM   5471 C  CG    . LEU B 1 234 ? -30.639 -5.617  6.828   1.00 9.00   ? 228 LEU B CG    1 
ATOM   5472 C  CD1   . LEU B 1 234 ? -30.095 -5.803  8.227   1.00 13.97  ? 228 LEU B CD1   1 
ATOM   5473 C  CD2   . LEU B 1 234 ? -30.438 -4.200  6.351   1.00 6.44   ? 228 LEU B CD2   1 
ATOM   5474 N  N     . TRP B 1 235 ? -26.985 -6.829  5.539   1.00 8.62   ? 229 TRP B N     1 
ATOM   5475 C  CA    . TRP B 1 235 ? -25.624 -6.620  5.977   1.00 8.51   ? 229 TRP B CA    1 
ATOM   5476 C  C     . TRP B 1 235 ? -24.761 -6.052  4.861   1.00 11.10  ? 229 TRP B C     1 
ATOM   5477 O  O     . TRP B 1 235 ? -24.057 -5.073  5.075   1.00 13.82  ? 229 TRP B O     1 
ATOM   5478 C  CB    . TRP B 1 235 ? -25.044 -7.928  6.488   1.00 10.48  ? 229 TRP B CB    1 
ATOM   5479 C  CG    . TRP B 1 235 ? -23.572 -7.945  6.519   1.00 11.08  ? 229 TRP B CG    1 
ATOM   5480 C  CD1   . TRP B 1 235 ? -22.774 -7.426  7.480   1.00 10.90  ? 229 TRP B CD1   1 
ATOM   5481 C  CD2   . TRP B 1 235 ? -22.707 -8.525  5.539   1.00 10.65  ? 229 TRP B CD2   1 
ATOM   5482 N  NE1   . TRP B 1 235 ? -21.456 -7.650  7.171   1.00 16.09  ? 229 TRP B NE1   1 
ATOM   5483 C  CE2   . TRP B 1 235 ? -21.390 -8.320  5.976   1.00 14.98  ? 229 TRP B CE2   1 
ATOM   5484 C  CE3   . TRP B 1 235 ? -22.919 -9.189  4.330   1.00 10.89  ? 229 TRP B CE3   1 
ATOM   5485 C  CZ2   . TRP B 1 235 ? -20.281 -8.745  5.235   1.00 14.48  ? 229 TRP B CZ2   1 
ATOM   5486 C  CZ3   . TRP B 1 235 ? -21.820 -9.616  3.602   1.00 11.40  ? 229 TRP B CZ3   1 
ATOM   5487 C  CH2   . TRP B 1 235 ? -20.518 -9.391  4.058   1.00 11.85  ? 229 TRP B CH2   1 
ATOM   5488 N  N     . ALA B 1 236 ? -24.822 -6.651  3.671   1.00 10.46  ? 230 ALA B N     1 
ATOM   5489 C  CA    . ALA B 1 236 ? -24.041 -6.166  2.529   1.00 9.54   ? 230 ALA B CA    1 
ATOM   5490 C  C     . ALA B 1 236 ? -24.389 -4.719  2.156   1.00 11.02  ? 230 ALA B C     1 
ATOM   5491 O  O     . ALA B 1 236 ? -23.504 -3.891  1.899   1.00 8.80   ? 230 ALA B O     1 
ATOM   5492 C  CB    . ALA B 1 236 ? -24.217 -7.079  1.340   1.00 8.39   ? 230 ALA B CB    1 
ATOM   5493 N  N     . LYS B 1 237 ? -25.681 -4.413  2.133   1.00 10.75  ? 231 LYS B N     1 
ATOM   5494 C  CA    . LYS B 1 237 ? -26.098 -3.039  1.899   1.00 12.00  ? 231 LYS B CA    1 
ATOM   5495 C  C     . LYS B 1 237 ? -25.513 -2.147  2.991   1.00 14.09  ? 231 LYS B C     1 
ATOM   5496 O  O     . LYS B 1 237 ? -24.937 -1.109  2.702   1.00 12.75  ? 231 LYS B O     1 
ATOM   5497 C  CB    . LYS B 1 237 ? -27.620 -2.918  1.884   1.00 10.04  ? 231 LYS B CB    1 
ATOM   5498 C  CG    . LYS B 1 237 ? -28.279 -3.381  0.617   1.00 11.92  ? 231 LYS B CG    1 
ATOM   5499 C  CD    . LYS B 1 237 ? -29.778 -3.188  0.724   1.00 13.20  ? 231 LYS B CD    1 
ATOM   5500 C  CE    . LYS B 1 237 ? -30.480 -3.462  -0.598  1.00 14.36  ? 231 LYS B CE    1 
ATOM   5501 N  NZ    . LYS B 1 237 ? -30.862 -4.890  -0.726  1.00 19.12  ? 231 LYS B NZ    1 
ATOM   5502 N  N     . ARG B 1 238 ? -25.644 -2.569  4.244   1.00 12.51  ? 232 ARG B N     1 
ATOM   5503 C  CA    . ARG B 1 238 ? -25.127 -1.777  5.336   1.00 12.20  ? 232 ARG B CA    1 
ATOM   5504 C  C     . ARG B 1 238 ? -23.597 -1.599  5.275   1.00 15.71  ? 232 ARG B C     1 
ATOM   5505 O  O     . ARG B 1 238 ? -23.080 -0.562  5.687   1.00 19.95  ? 232 ARG B O     1 
ATOM   5506 C  CB    . ARG B 1 238 ? -25.609 -2.315  6.687   1.00 12.79  ? 232 ARG B CB    1 
ATOM   5507 C  CG    . ARG B 1 238 ? -27.041 -1.880  7.083   1.00 13.34  ? 232 ARG B CG    1 
ATOM   5508 C  CD    . ARG B 1 238 ? -27.366 -0.480  6.550   1.00 25.68  ? 232 ARG B CD    1 
ATOM   5509 N  NE    . ARG B 1 238 ? -27.809 0.548   7.512   1.00 24.59  ? 232 ARG B NE    1 
ATOM   5510 C  CZ    . ARG B 1 238 ? -27.191 0.895   8.644   1.00 22.87  ? 232 ARG B CZ    1 
ATOM   5511 N  NH1   . ARG B 1 238 ? -26.102 0.269   9.054   1.00 24.91  ? 232 ARG B NH1   1 
ATOM   5512 N  NH2   . ARG B 1 238 ? -27.681 1.870   9.391   1.00 28.63  ? 232 ARG B NH2   1 
ATOM   5513 N  N     . ARG B 1 239 ? -22.866 -2.563  4.726   1.00 13.20  ? 233 ARG B N     1 
ATOM   5514 C  CA    . ARG B 1 239 ? -21.416 -2.370  4.592   1.00 15.11  ? 233 ARG B CA    1 
ATOM   5515 C  C     . ARG B 1 239 ? -20.979 -1.840  3.211   1.00 15.81  ? 233 ARG B C     1 
ATOM   5516 O  O     . ARG B 1 239 ? -19.790 -1.859  2.879   1.00 14.53  ? 233 ARG B O     1 
ATOM   5517 C  CB    . ARG B 1 239 ? -20.622 -3.643  4.916   1.00 14.23  ? 233 ARG B CB    1 
ATOM   5518 C  CG    . ARG B 1 239 ? -21.122 -4.459  6.078   1.00 11.98  ? 233 ARG B CG    1 
ATOM   5519 C  CD    . ARG B 1 239 ? -21.315 -3.640  7.312   1.00 11.91  ? 233 ARG B CD    1 
ATOM   5520 N  NE    . ARG B 1 239 ? -20.102 -2.961  7.760   1.00 21.12  ? 233 ARG B NE    1 
ATOM   5521 C  CZ    . ARG B 1 239 ? -19.065 -3.563  8.336   1.00 20.90  ? 233 ARG B CZ    1 
ATOM   5522 N  NH1   . ARG B 1 239 ? -19.080 -4.882  8.510   1.00 39.34  ? 233 ARG B NH1   1 
ATOM   5523 N  NH2   . ARG B 1 239 ? -18.008 -2.855  8.719   1.00 12.67  ? 233 ARG B NH2   1 
ATOM   5524 N  N     . GLY B 1 240 ? -21.927 -1.378  2.404   1.00 13.78  ? 234 GLY B N     1 
ATOM   5525 C  CA    . GLY B 1 240 ? -21.585 -0.785  1.122   1.00 12.46  ? 234 GLY B CA    1 
ATOM   5526 C  C     . GLY B 1 240 ? -20.918 -1.709  0.111   1.00 10.36  ? 234 GLY B C     1 
ATOM   5527 O  O     . GLY B 1 240 ? -20.109 -1.261  -0.702  1.00 8.25   ? 234 GLY B O     1 
ATOM   5528 N  N     . ILE B 1 241 ? -21.237 -2.999  0.162   1.00 7.55   ? 235 ILE B N     1 
ATOM   5529 C  CA    . ILE B 1 241 ? -20.786 -3.920  -0.869  1.00 7.17   ? 235 ILE B CA    1 
ATOM   5530 C  C     . ILE B 1 241 ? -21.982 -4.572  -1.532  1.00 9.07   ? 235 ILE B C     1 
ATOM   5531 O  O     . ILE B 1 241 ? -21.940 -5.749  -1.900  1.00 8.79   ? 235 ILE B O     1 
ATOM   5532 C  CB    . ILE B 1 241 ? -19.850 -5.013  -0.345  1.00 7.67   ? 235 ILE B CB    1 
ATOM   5533 C  CG1   . ILE B 1 241 ? -20.475 -5.729  0.843   1.00 6.64   ? 235 ILE B CG1   1 
ATOM   5534 C  CG2   . ILE B 1 241 ? -18.526 -4.426  0.046   1.00 9.24   ? 235 ILE B CG2   1 
ATOM   5535 C  CD1   . ILE B 1 241 ? -19.910 -7.075  1.062   1.00 7.03   ? 235 ILE B CD1   1 
ATOM   5536 N  N     . TYR B 1 242 ? -23.052 -3.798  -1.682  1.00 10.23  ? 236 TYR B N     1 
ATOM   5537 C  CA    . TYR B 1 242 ? -24.229 -4.284  -2.375  1.00 10.68  ? 236 TYR B CA    1 
ATOM   5538 C  C     . TYR B 1 242 ? -24.467 -3.444  -3.620  1.00 14.49  ? 236 TYR B C     1 
ATOM   5539 O  O     . TYR B 1 242 ? -25.050 -2.355  -3.528  1.00 16.51  ? 236 TYR B O     1 
ATOM   5540 C  CB    . TYR B 1 242 ? -25.462 -4.250  -1.467  1.00 11.28  ? 236 TYR B CB    1 
ATOM   5541 C  CG    . TYR B 1 242 ? -26.632 -4.971  -2.076  1.00 12.62  ? 236 TYR B CG    1 
ATOM   5542 C  CD1   . TYR B 1 242 ? -27.524 -4.305  -2.908  1.00 12.66  ? 236 TYR B CD1   1 
ATOM   5543 C  CD2   . TYR B 1 242 ? -26.821 -6.335  -1.866  1.00 12.21  ? 236 TYR B CD2   1 
ATOM   5544 C  CE1   . TYR B 1 242 ? -28.589 -4.971  -3.505  1.00 15.21  ? 236 TYR B CE1   1 
ATOM   5545 C  CE2   . TYR B 1 242 ? -27.895 -7.016  -2.456  1.00 12.60  ? 236 TYR B CE2   1 
ATOM   5546 C  CZ    . TYR B 1 242 ? -28.774 -6.322  -3.272  1.00 16.09  ? 236 TYR B CZ    1 
ATOM   5547 O  OH    . TYR B 1 242 ? -29.836 -6.967  -3.857  1.00 17.02  ? 236 TYR B OH    1 
ATOM   5548 N  N     . SER B 1 243 ? -24.015 -3.968  -4.770  1.00 13.90  ? 237 SER B N     1 
ATOM   5549 C  CA    . SER B 1 243 ? -24.085 -3.301  -6.089  1.00 8.38   ? 237 SER B CA    1 
ATOM   5550 C  C     . SER B 1 243 ? -23.277 -4.051  -7.144  1.00 10.64  ? 237 SER B C     1 
ATOM   5551 O  O     . SER B 1 243 ? -22.050 -4.000  -7.138  1.00 12.65  ? 237 SER B O     1 
ATOM   5552 C  CB    . SER B 1 243 ? -23.546 -1.876  -6.021  1.00 7.67   ? 237 SER B CB    1 
ATOM   5553 O  OG    . SER B 1 243 ? -23.261 -1.413  -7.316  1.00 8.53   ? 237 SER B OG    1 
ATOM   5554 N  N     . ASN B 1 244 ? -23.949 -4.737  -8.061  1.00 13.83  ? 238 ASN B N     1 
ATOM   5555 C  CA    . ASN B 1 244 ? -23.237 -5.487  -9.092  1.00 12.71  ? 238 ASN B CA    1 
ATOM   5556 C  C     . ASN B 1 244 ? -22.534 -4.567  -10.073 1.00 13.76  ? 238 ASN B C     1 
ATOM   5557 O  O     . ASN B 1 244 ? -21.443 -4.875  -10.570 1.00 13.81  ? 238 ASN B O     1 
ATOM   5558 C  CB    . ASN B 1 244 ? -24.174 -6.441  -9.848  1.00 13.18  ? 238 ASN B CB    1 
ATOM   5559 C  CG    . ASN B 1 244 ? -23.520 -7.049  -11.084 1.00 12.96  ? 238 ASN B CG    1 
ATOM   5560 O  OD1   . ASN B 1 244 ? -22.557 -7.813  -10.999 1.00 16.23  ? 238 ASN B OD1   1 
ATOM   5561 N  ND2   . ASN B 1 244 ? -24.046 -6.710  -12.236 1.00 12.78  ? 238 ASN B ND2   1 
ATOM   5562 N  N     . MET B 1 245 ? -23.155 -3.429  -10.345 1.00 12.21  ? 239 MET B N     1 
ATOM   5563 C  CA    . MET B 1 245 ? -22.657 -2.577  -11.409 1.00 14.27  ? 239 MET B CA    1 
ATOM   5564 C  C     . MET B 1 245 ? -21.412 -1.812  -11.000 1.00 14.23  ? 239 MET B C     1 
ATOM   5565 O  O     . MET B 1 245 ? -20.565 -1.506  -11.839 1.00 14.11  ? 239 MET B O     1 
ATOM   5566 C  CB    . MET B 1 245 ? -23.750 -1.632  -11.894 1.00 12.47  ? 239 MET B CB    1 
ATOM   5567 C  CG    . MET B 1 245 ? -23.566 -0.200  -11.499 1.00 10.43  ? 239 MET B CG    1 
ATOM   5568 S  SD    . MET B 1 245 ? -25.004 0.727   -12.047 1.00 17.64  ? 239 MET B SD    1 
ATOM   5569 C  CE    . MET B 1 245 ? -25.208 0.082   -13.724 1.00 19.75  ? 239 MET B CE    1 
ATOM   5570 N  N     . LEU B 1 246 ? -21.296 -1.518  -9.707  1.00 15.09  ? 240 LEU B N     1 
ATOM   5571 C  CA    . LEU B 1 246 ? -20.182 -0.723  -9.208  1.00 9.70   ? 240 LEU B CA    1 
ATOM   5572 C  C     . LEU B 1 246 ? -19.055 -1.622  -8.781  1.00 8.57   ? 240 LEU B C     1 
ATOM   5573 O  O     . LEU B 1 246 ? -18.067 -1.156  -8.212  1.00 9.19   ? 240 LEU B O     1 
ATOM   5574 C  CB    . LEU B 1 246 ? -20.603 0.170   -8.044  1.00 11.12  ? 240 LEU B CB    1 
ATOM   5575 C  CG    . LEU B 1 246 ? -21.439 1.413   -8.345  1.00 13.57  ? 240 LEU B CG    1 
ATOM   5576 C  CD1   . LEU B 1 246 ? -21.836 2.121   -7.054  1.00 9.64   ? 240 LEU B CD1   1 
ATOM   5577 C  CD2   . LEU B 1 246 ? -20.664 2.347   -9.250  1.00 14.91  ? 240 LEU B CD2   1 
ATOM   5578 N  N     . GLY B 1 247 ? -19.208 -2.913  -9.039  1.00 6.32   ? 241 GLY B N     1 
ATOM   5579 C  CA    . GLY B 1 247 ? -18.093 -3.821  -8.881  1.00 8.49   ? 241 GLY B CA    1 
ATOM   5580 C  C     . GLY B 1 247 ? -18.124 -4.663  -7.629  1.00 9.04   ? 241 GLY B C     1 
ATOM   5581 O  O     . GLY B 1 247 ? -17.134 -5.296  -7.258  1.00 7.42   ? 241 GLY B O     1 
ATOM   5582 N  N     . PHE B 1 248 ? -19.271 -4.683  -6.970  1.00 11.06  ? 242 PHE B N     1 
ATOM   5583 C  CA    . PHE B 1 248 ? -19.422 -5.526  -5.801  1.00 8.61   ? 242 PHE B CA    1 
ATOM   5584 C  C     . PHE B 1 248 ? -20.315 -6.691  -6.143  1.00 10.58  ? 242 PHE B C     1 
ATOM   5585 O  O     . PHE B 1 248 ? -20.198 -7.235  -7.238  1.00 12.76  ? 242 PHE B O     1 
ATOM   5586 C  CB    . PHE B 1 248 ? -19.928 -4.708  -4.640  1.00 7.51   ? 242 PHE B CB    1 
ATOM   5587 C  CG    . PHE B 1 248 ? -18.921 -3.734  -4.156  1.00 7.99   ? 242 PHE B CG    1 
ATOM   5588 C  CD1   . PHE B 1 248 ? -17.848 -4.161  -3.398  1.00 8.15   ? 242 PHE B CD1   1 
ATOM   5589 C  CD2   . PHE B 1 248 ? -19.007 -2.403  -4.497  1.00 7.15   ? 242 PHE B CD2   1 
ATOM   5590 C  CE1   . PHE B 1 248 ? -16.897 -3.273  -2.961  1.00 7.08   ? 242 PHE B CE1   1 
ATOM   5591 C  CE2   . PHE B 1 248 ? -18.056 -1.515  -4.065  1.00 7.60   ? 242 PHE B CE2   1 
ATOM   5592 C  CZ    . PHE B 1 248 ? -16.999 -1.955  -3.295  1.00 6.73   ? 242 PHE B CZ    1 
ATOM   5593 N  N     . LEU B 1 249 ? -21.190 -7.085  -5.224  1.00 10.83  ? 243 LEU B N     1 
ATOM   5594 C  CA    . LEU B 1 249 ? -22.101 -8.201  -5.471  1.00 9.97   ? 243 LEU B CA    1 
ATOM   5595 C  C     . LEU B 1 249 ? -23.539 -7.744  -5.424  1.00 8.91   ? 243 LEU B C     1 
ATOM   5596 O  O     . LEU B 1 249 ? -23.902 -6.851  -4.650  1.00 7.71   ? 243 LEU B O     1 
ATOM   5597 C  CB    . LEU B 1 249 ? -21.891 -9.331  -4.466  1.00 10.49  ? 243 LEU B CB    1 
ATOM   5598 C  CG    . LEU B 1 249 ? -21.046 -10.526 -4.895  1.00 10.45  ? 243 LEU B CG    1 
ATOM   5599 C  CD1   . LEU B 1 249 ? -19.666 -10.081 -5.270  1.00 11.91  ? 243 LEU B CD1   1 
ATOM   5600 C  CD2   . LEU B 1 249 ? -20.974 -11.518 -3.765  1.00 10.59  ? 243 LEU B CD2   1 
ATOM   5601 N  N     . GLY B 1 250 ? -24.349 -8.366  -6.269  1.00 8.80   ? 244 GLY B N     1 
ATOM   5602 C  CA    . GLY B 1 250 ? -25.752 -8.027  -6.379  1.00 10.44  ? 244 GLY B CA    1 
ATOM   5603 C  C     . GLY B 1 250 ? -26.619 -9.171  -5.898  1.00 10.31  ? 244 GLY B C     1 
ATOM   5604 O  O     . GLY B 1 250 ? -26.098 -10.230 -5.543  1.00 8.13   ? 244 GLY B O     1 
ATOM   5605 N  N     . GLY B 1 251 ? -27.931 -8.940  -5.886  1.00 9.14   ? 245 GLY B N     1 
ATOM   5606 C  CA    . GLY B 1 251 ? -28.908 -9.907  -5.441  1.00 7.61   ? 245 GLY B CA    1 
ATOM   5607 C  C     . GLY B 1 251 ? -28.624 -11.357 -5.775  1.00 9.08   ? 245 GLY B C     1 
ATOM   5608 O  O     . GLY B 1 251 ? -28.522 -12.167 -4.866  1.00 8.79   ? 245 GLY B O     1 
ATOM   5609 N  N     . VAL B 1 252 ? -28.479 -11.695 -7.053  1.00 7.59   ? 246 VAL B N     1 
ATOM   5610 C  CA    . VAL B 1 252 ? -28.309 -13.095 -7.414  1.00 6.69   ? 246 VAL B CA    1 
ATOM   5611 C  C     . VAL B 1 252 ? -27.047 -13.692 -6.868  1.00 7.57   ? 246 VAL B C     1 
ATOM   5612 O  O     . VAL B 1 252 ? -27.019 -14.869 -6.539  1.00 9.92   ? 246 VAL B O     1 
ATOM   5613 C  CB    . VAL B 1 252 ? -28.224 -13.309 -8.905  1.00 10.82  ? 246 VAL B CB    1 
ATOM   5614 C  CG1   . VAL B 1 252 ? -29.167 -14.418 -9.314  1.00 10.83  ? 246 VAL B CG1   1 
ATOM   5615 C  CG2   . VAL B 1 252 ? -28.541 -12.037 -9.602  1.00 20.94  ? 246 VAL B CG2   1 
ATOM   5616 N  N     . SER B 1 253 ? -25.982 -12.908 -6.804  1.00 6.93   ? 247 SER B N     1 
ATOM   5617 C  CA    . SER B 1 253 ? -24.729 -13.448 -6.302  1.00 7.53   ? 247 SER B CA    1 
ATOM   5618 C  C     . SER B 1 253 ? -24.869 -13.705 -4.809  1.00 7.70   ? 247 SER B C     1 
ATOM   5619 O  O     . SER B 1 253 ? -24.442 -14.730 -4.295  1.00 9.15   ? 247 SER B O     1 
ATOM   5620 C  CB    . SER B 1 253 ? -23.569 -12.501 -6.591  1.00 8.62   ? 247 SER B CB    1 
ATOM   5621 O  OG    . SER B 1 253 ? -23.684 -11.971 -7.905  1.00 15.87  ? 247 SER B OG    1 
ATOM   5622 N  N     . TRP B 1 254 ? -25.503 -12.784 -4.110  1.00 7.15   ? 248 TRP B N     1 
ATOM   5623 C  CA    . TRP B 1 254 ? -25.657 -12.970 -2.694  1.00 5.45   ? 248 TRP B CA    1 
ATOM   5624 C  C     . TRP B 1 254 ? -26.485 -14.204 -2.429  1.00 6.40   ? 248 TRP B C     1 
ATOM   5625 O  O     . TRP B 1 254 ? -26.157 -14.994 -1.551  1.00 8.63   ? 248 TRP B O     1 
ATOM   5626 C  CB    . TRP B 1 254 ? -26.241 -11.727 -2.032  1.00 5.50   ? 248 TRP B CB    1 
ATOM   5627 C  CG    . TRP B 1 254 ? -25.239 -10.615 -1.927  1.00 5.47   ? 248 TRP B CG    1 
ATOM   5628 C  CD1   . TRP B 1 254 ? -25.337 -9.375  -2.473  1.00 6.96   ? 248 TRP B CD1   1 
ATOM   5629 C  CD2   . TRP B 1 254 ? -23.974 -10.660 -1.261  1.00 5.64   ? 248 TRP B CD2   1 
ATOM   5630 N  NE1   . TRP B 1 254 ? -24.223 -8.637  -2.180  1.00 8.48   ? 248 TRP B NE1   1 
ATOM   5631 C  CE2   . TRP B 1 254 ? -23.367 -9.403  -1.438  1.00 6.33   ? 248 TRP B CE2   1 
ATOM   5632 C  CE3   . TRP B 1 254 ? -23.293 -11.642 -0.535  1.00 6.49   ? 248 TRP B CE3   1 
ATOM   5633 C  CZ2   . TRP B 1 254 ? -22.117 -9.099  -0.922  1.00 6.69   ? 248 TRP B CZ2   1 
ATOM   5634 C  CZ3   . TRP B 1 254 ? -22.051 -11.338 -0.013  1.00 7.50   ? 248 TRP B CZ3   1 
ATOM   5635 C  CH2   . TRP B 1 254 ? -21.477 -10.075 -0.210  1.00 9.33   ? 248 TRP B CH2   1 
ATOM   5636 N  N     . ALA B 1 255 ? -27.533 -14.405 -3.213  1.00 6.13   ? 249 ALA B N     1 
ATOM   5637 C  CA    . ALA B 1 255 ? -28.417 -15.531 -2.966  1.00 6.00   ? 249 ALA B CA    1 
ATOM   5638 C  C     . ALA B 1 255 ? -27.691 -16.857 -3.220  1.00 7.70   ? 249 ALA B C     1 
ATOM   5639 O  O     . ALA B 1 255 ? -27.892 -17.862 -2.513  1.00 5.44   ? 249 ALA B O     1 
ATOM   5640 C  CB    . ALA B 1 255 ? -29.659 -15.411 -3.796  1.00 6.09   ? 249 ALA B CB    1 
ATOM   5641 N  N     . MET B 1 256 ? -26.812 -16.850 -4.208  1.00 6.71   ? 250 MET B N     1 
ATOM   5642 C  CA    . MET B 1 256 ? -26.062 -18.055 -4.480  1.00 7.57   ? 250 MET B CA    1 
ATOM   5643 C  C     . MET B 1 256 ? -25.066 -18.363 -3.357  1.00 8.38   ? 250 MET B C     1 
ATOM   5644 O  O     . MET B 1 256 ? -24.918 -19.520 -2.957  1.00 9.68   ? 250 MET B O     1 
ATOM   5645 C  CB    . MET B 1 256 ? -25.403 -17.981 -5.846  1.00 5.91   ? 250 MET B CB    1 
ATOM   5646 C  CG    . MET B 1 256 ? -26.420 -18.060 -6.960  1.00 6.37   ? 250 MET B CG    1 
ATOM   5647 S  SD    . MET B 1 256 ? -25.658 -18.151 -8.582  1.00 11.50  ? 250 MET B SD    1 
ATOM   5648 C  CE    . MET B 1 256 ? -24.670 -16.664 -8.596  1.00 10.26  ? 250 MET B CE    1 
ATOM   5649 N  N     . LEU B 1 257 ? -24.406 -17.334 -2.834  1.00 6.97   ? 251 LEU B N     1 
ATOM   5650 C  CA    . LEU B 1 257 ? -23.481 -17.528 -1.724  1.00 6.40   ? 251 LEU B CA    1 
ATOM   5651 C  C     . LEU B 1 257 ? -24.235 -18.061 -0.517  1.00 8.31   ? 251 LEU B C     1 
ATOM   5652 O  O     . LEU B 1 257 ? -23.766 -18.967 0.159   1.00 10.31  ? 251 LEU B O     1 
ATOM   5653 C  CB    . LEU B 1 257 ? -22.758 -16.232 -1.349  1.00 6.92   ? 251 LEU B CB    1 
ATOM   5654 C  CG    . LEU B 1 257 ? -21.647 -15.744 -2.269  1.00 7.19   ? 251 LEU B CG    1 
ATOM   5655 C  CD1   . LEU B 1 257 ? -20.842 -14.640 -1.609  1.00 5.77   ? 251 LEU B CD1   1 
ATOM   5656 C  CD2   . LEU B 1 257 ? -20.749 -16.904 -2.677  1.00 6.79   ? 251 LEU B CD2   1 
ATOM   5657 N  N     . VAL B 1 258 ? -25.410 -17.510 -0.238  1.00 7.34   ? 252 VAL B N     1 
ATOM   5658 C  CA    . VAL B 1 258 ? -26.157 -18.001 0.907   1.00 7.97   ? 252 VAL B CA    1 
ATOM   5659 C  C     . VAL B 1 258 ? -26.635 -19.419 0.638   1.00 10.69  ? 252 VAL B C     1 
ATOM   5660 O  O     . VAL B 1 258 ? -26.639 -20.255 1.537   1.00 12.85  ? 252 VAL B O     1 
ATOM   5661 C  CB    . VAL B 1 258 ? -27.344 -17.112 1.251   1.00 6.62   ? 252 VAL B CB    1 
ATOM   5662 C  CG1   . VAL B 1 258 ? -28.153 -17.726 2.387   1.00 5.21   ? 252 VAL B CG1   1 
ATOM   5663 C  CG2   . VAL B 1 258 ? -26.853 -15.733 1.613   1.00 7.21   ? 252 VAL B CG2   1 
ATOM   5664 N  N     . ALA B 1 259 ? -27.024 -19.692 -0.603  1.00 9.06   ? 253 ALA B N     1 
ATOM   5665 C  CA    . ALA B 1 259 ? -27.471 -21.021 -0.947  1.00 6.88   ? 253 ALA B CA    1 
ATOM   5666 C  C     . ALA B 1 259 ? -26.340 -21.998 -0.695  1.00 9.25   ? 253 ALA B C     1 
ATOM   5667 O  O     . ALA B 1 259 ? -26.555 -23.070 -0.143  1.00 13.78  ? 253 ALA B O     1 
ATOM   5668 C  CB    . ALA B 1 259 ? -27.908 -21.075 -2.376  1.00 8.65   ? 253 ALA B CB    1 
ATOM   5669 N  N     . ARG B 1 260 ? -25.125 -21.632 -1.077  1.00 8.16   ? 254 ARG B N     1 
ATOM   5670 C  CA    . ARG B 1 260 ? -23.988 -22.523 -0.850  1.00 11.98  ? 254 ARG B CA    1 
ATOM   5671 C  C     . ARG B 1 260 ? -23.819 -22.835 0.653   1.00 12.01  ? 254 ARG B C     1 
ATOM   5672 O  O     . ARG B 1 260 ? -23.665 -23.995 1.053   1.00 10.69  ? 254 ARG B O     1 
ATOM   5673 C  CB    . ARG B 1 260 ? -22.702 -21.922 -1.439  1.00 12.54  ? 254 ARG B CB    1 
ATOM   5674 C  CG    . ARG B 1 260 ? -21.512 -22.868 -1.476  1.00 9.25   ? 254 ARG B CG    1 
ATOM   5675 C  CD    . ARG B 1 260 ? -21.818 -24.060 -2.331  1.00 9.93   ? 254 ARG B CD    1 
ATOM   5676 N  NE    . ARG B 1 260 ? -21.509 -25.290 -1.612  1.00 18.76  ? 254 ARG B NE    1 
ATOM   5677 C  CZ    . ARG B 1 260 ? -20.555 -26.144 -1.961  1.00 21.46  ? 254 ARG B CZ    1 
ATOM   5678 N  NH1   . ARG B 1 260 ? -19.810 -25.912 -3.037  1.00 37.44  ? 254 ARG B NH1   1 
ATOM   5679 N  NH2   . ARG B 1 260 ? -20.350 -27.233 -1.239  1.00 14.56  ? 254 ARG B NH2   1 
ATOM   5680 N  N     . THR B 1 261 ? -23.866 -21.793 1.478   1.00 9.77   ? 255 THR B N     1 
ATOM   5681 C  CA    . THR B 1 261 ? -23.803 -21.947 2.923   1.00 8.37   ? 255 THR B CA    1 
ATOM   5682 C  C     . THR B 1 261 ? -24.874 -22.885 3.453   1.00 10.40  ? 255 THR B C     1 
ATOM   5683 O  O     . THR B 1 261 ? -24.612 -23.700 4.347   1.00 10.35  ? 255 THR B O     1 
ATOM   5684 C  CB    . THR B 1 261 ? -23.951 -20.611 3.604   1.00 8.28   ? 255 THR B CB    1 
ATOM   5685 O  OG1   . THR B 1 261 ? -22.998 -19.716 3.031   1.00 13.02  ? 255 THR B OG1   1 
ATOM   5686 C  CG2   . THR B 1 261 ? -23.701 -20.733 5.104   1.00 7.76   ? 255 THR B CG2   1 
ATOM   5687 N  N     . CYS B 1 262 ? -26.070 -22.773 2.890   1.00 8.56   ? 256 CYS B N     1 
ATOM   5688 C  CA    . CYS B 1 262 ? -27.173 -23.635 3.270   1.00 10.13  ? 256 CYS B CA    1 
ATOM   5689 C  C     . CYS B 1 262 ? -26.936 -25.111 2.956   1.00 11.65  ? 256 CYS B C     1 
ATOM   5690 O  O     . CYS B 1 262 ? -27.395 -25.998 3.675   1.00 10.84  ? 256 CYS B O     1 
ATOM   5691 C  CB    . CYS B 1 262 ? -28.461 -23.142 2.634   1.00 8.88   ? 256 CYS B CB    1 
ATOM   5692 S  SG    . CYS B 1 262 ? -29.014 -21.583 3.387   1.00 22.06  ? 256 CYS B SG    1 
ATOM   5693 N  N     . GLN B 1 263 ? -26.203 -25.388 1.893   1.00 11.30  ? 257 GLN B N     1 
ATOM   5694 C  CA    . GLN B 1 263 ? -25.965 -26.774 1.555   1.00 11.04  ? 257 GLN B CA    1 
ATOM   5695 C  C     . GLN B 1 263 ? -24.952 -27.387 2.511   1.00 8.72   ? 257 GLN B C     1 
ATOM   5696 O  O     . GLN B 1 263 ? -24.997 -28.573 2.800   1.00 13.02  ? 257 GLN B O     1 
ATOM   5697 C  CB    . GLN B 1 263 ? -25.497 -26.904 0.112   1.00 13.81  ? 257 GLN B CB    1 
ATOM   5698 C  CG    . GLN B 1 263 ? -26.411 -26.270 -0.912  1.00 10.71  ? 257 GLN B CG    1 
ATOM   5699 C  CD    . GLN B 1 263 ? -25.799 -26.326 -2.301  1.00 15.71  ? 257 GLN B CD    1 
ATOM   5700 O  OE1   . GLN B 1 263 ? -24.575 -26.294 -2.448  1.00 17.89  ? 257 GLN B OE1   1 
ATOM   5701 N  NE2   . GLN B 1 263 ? -26.642 -26.430 -3.326  1.00 13.17  ? 257 GLN B NE2   1 
ATOM   5702 N  N     . LEU B 1 264 ? -24.037 -26.574 3.006   1.00 9.35   ? 258 LEU B N     1 
ATOM   5703 C  CA    . LEU B 1 264 ? -22.972 -27.083 3.865   1.00 10.80  ? 258 LEU B CA    1 
ATOM   5704 C  C     . LEU B 1 264 ? -23.453 -27.288 5.292   1.00 13.65  ? 258 LEU B C     1 
ATOM   5705 O  O     . LEU B 1 264 ? -22.846 -28.038 6.041   1.00 16.37  ? 258 LEU B O     1 
ATOM   5706 C  CB    . LEU B 1 264 ? -21.786 -26.121 3.866   1.00 10.59  ? 258 LEU B CB    1 
ATOM   5707 C  CG    . LEU B 1 264 ? -21.130 -25.886 2.511   1.00 11.64  ? 258 LEU B CG    1 
ATOM   5708 C  CD1   . LEU B 1 264 ? -20.166 -24.704 2.565   1.00 7.32   ? 258 LEU B CD1   1 
ATOM   5709 C  CD2   . LEU B 1 264 ? -20.431 -27.174 2.081   1.00 11.50  ? 258 LEU B CD2   1 
ATOM   5710 N  N     . TYR B 1 265 ? -24.527 -26.595 5.664   1.00 11.52  ? 259 TYR B N     1 
ATOM   5711 C  CA    . TYR B 1 265 ? -25.108 -26.695 6.992   1.00 11.14  ? 259 TYR B CA    1 
ATOM   5712 C  C     . TYR B 1 265 ? -26.625 -26.737 6.869   1.00 15.89  ? 259 TYR B C     1 
ATOM   5713 O  O     . TYR B 1 265 ? -27.297 -25.739 7.145   1.00 19.50  ? 259 TYR B O     1 
ATOM   5714 C  CB    . TYR B 1 265 ? -24.690 -25.503 7.854   1.00 9.90   ? 259 TYR B CB    1 
ATOM   5715 C  CG    . TYR B 1 265 ? -23.196 -25.396 8.025   1.00 13.85  ? 259 TYR B CG    1 
ATOM   5716 C  CD1   . TYR B 1 265 ? -22.409 -24.711 7.100   1.00 17.88  ? 259 TYR B CD1   1 
ATOM   5717 C  CD2   . TYR B 1 265 ? -22.567 -25.980 9.096   1.00 13.12  ? 259 TYR B CD2   1 
ATOM   5718 C  CE1   . TYR B 1 265 ? -21.038 -24.619 7.253   1.00 11.73  ? 259 TYR B CE1   1 
ATOM   5719 C  CE2   . TYR B 1 265 ? -21.210 -25.898 9.248   1.00 15.62  ? 259 TYR B CE2   1 
ATOM   5720 C  CZ    . TYR B 1 265 ? -20.448 -25.221 8.329   1.00 12.85  ? 259 TYR B CZ    1 
ATOM   5721 O  OH    . TYR B 1 265 ? -19.089 -25.148 8.515   1.00 13.97  ? 259 TYR B OH    1 
ATOM   5722 N  N     . PRO B 1 266 ? -27.173 -27.895 6.462   1.00 12.65  ? 260 PRO B N     1 
ATOM   5723 C  CA    . PRO B 1 266 ? -28.580 -28.001 6.061   1.00 14.19  ? 260 PRO B CA    1 
ATOM   5724 C  C     . PRO B 1 266 ? -29.571 -28.076 7.213   1.00 14.26  ? 260 PRO B C     1 
ATOM   5725 O  O     . PRO B 1 266 ? -30.768 -27.937 7.001   1.00 19.81  ? 260 PRO B O     1 
ATOM   5726 C  CB    . PRO B 1 266 ? -28.607 -29.300 5.263   1.00 12.75  ? 260 PRO B CB    1 
ATOM   5727 C  CG    . PRO B 1 266 ? -27.560 -30.109 5.875   1.00 12.66  ? 260 PRO B CG    1 
ATOM   5728 C  CD    . PRO B 1 266 ? -26.461 -29.165 6.274   1.00 12.55  ? 260 PRO B CD    1 
ATOM   5729 N  N     . ASN B 1 267 ? -29.092 -28.287 8.425   1.00 17.31  ? 261 ASN B N     1 
ATOM   5730 C  CA    . ASN B 1 267 ? -30.005 -28.358 9.553   1.00 15.71  ? 261 ASN B CA    1 
ATOM   5731 C  C     . ASN B 1 267 ? -29.935 -27.132 10.445  1.00 12.54  ? 261 ASN B C     1 
ATOM   5732 O  O     . ASN B 1 267 ? -30.714 -26.996 11.381  1.00 16.60  ? 261 ASN B O     1 
ATOM   5733 C  CB    . ASN B 1 267 ? -29.780 -29.653 10.334  1.00 17.22  ? 261 ASN B CB    1 
ATOM   5734 C  CG    . ASN B 1 267 ? -30.208 -30.882 9.535   1.00 25.39  ? 261 ASN B CG    1 
ATOM   5735 O  OD1   . ASN B 1 267 ? -31.211 -30.829 8.812   1.00 24.54  ? 261 ASN B OD1   1 
ATOM   5736 N  ND2   . ASN B 1 267 ? -29.448 -31.984 9.642   1.00 20.69  ? 261 ASN B ND2   1 
ATOM   5737 N  N     . ALA B 1 268 ? -29.034 -26.217 10.125  1.00 9.11   ? 262 ALA B N     1 
ATOM   5738 C  CA    . ALA B 1 268 ? -28.772 -25.096 11.013  1.00 13.26  ? 262 ALA B CA    1 
ATOM   5739 C  C     . ALA B 1 268 ? -29.942 -24.132 11.071  1.00 11.79  ? 262 ALA B C     1 
ATOM   5740 O  O     . ALA B 1 268 ? -30.736 -24.059 10.139  1.00 12.65  ? 262 ALA B O     1 
ATOM   5741 C  CB    . ALA B 1 268 ? -27.502 -24.369 10.603  1.00 12.56  ? 262 ALA B CB    1 
ATOM   5742 N  N     . ALA B 1 269 ? -30.045 -23.411 12.181  1.00 9.31   ? 263 ALA B N     1 
ATOM   5743 C  CA    . ALA B 1 269 ? -31.015 -22.341 12.321  1.00 9.48   ? 263 ALA B CA    1 
ATOM   5744 C  C     . ALA B 1 269 ? -30.457 -21.143 11.599  1.00 11.22  ? 263 ALA B C     1 
ATOM   5745 O  O     . ALA B 1 269 ? -29.245 -21.038 11.434  1.00 14.61  ? 263 ALA B O     1 
ATOM   5746 C  CB    . ALA B 1 269 ? -31.204 -22.013 13.779  1.00 14.58  ? 263 ALA B CB    1 
ATOM   5747 N  N     . ALA B 1 270 ? -31.320 -20.226 11.184  1.00 11.36  ? 264 ALA B N     1 
ATOM   5748 C  CA    . ALA B 1 270 ? -30.854 -19.066 10.424  1.00 14.31  ? 264 ALA B CA    1 
ATOM   5749 C  C     . ALA B 1 270 ? -29.684 -18.351 11.108  1.00 14.47  ? 264 ALA B C     1 
ATOM   5750 O  O     . ALA B 1 270 ? -28.730 -17.926 10.453  1.00 15.70  ? 264 ALA B O     1 
ATOM   5751 C  CB    . ALA B 1 270 ? -31.993 -18.097 10.175  1.00 14.79  ? 264 ALA B CB    1 
ATOM   5752 N  N     . SER B 1 271 ? -29.749 -18.249 12.427  1.00 13.06  ? 265 SER B N     1 
ATOM   5753 C  CA    . SER B 1 271 ? -28.733 -17.529 13.165  1.00 13.52  ? 265 SER B CA    1 
ATOM   5754 C  C     . SER B 1 271 ? -27.383 -18.181 12.982  1.00 12.83  ? 265 SER B C     1 
ATOM   5755 O  O     . SER B 1 271 ? -26.383 -17.489 12.842  1.00 13.98  ? 265 SER B O     1 
ATOM   5756 C  CB    . SER B 1 271 ? -29.085 -17.463 14.650  1.00 13.90  ? 265 SER B CB    1 
ATOM   5757 O  OG    . SER B 1 271 ? -29.199 -18.759 15.193  1.00 14.29  ? 265 SER B OG    1 
ATOM   5758 N  N     . THR B 1 272 ? -27.336 -19.507 12.996  1.00 11.12  ? 266 THR B N     1 
ATOM   5759 C  CA    . THR B 1 272 ? -26.043 -20.160 12.803  1.00 16.81  ? 266 THR B CA    1 
ATOM   5760 C  C     . THR B 1 272 ? -25.646 -20.093 11.314  1.00 15.66  ? 266 THR B C     1 
ATOM   5761 O  O     . THR B 1 272 ? -24.479 -19.895 10.973  1.00 15.69  ? 266 THR B O     1 
ATOM   5762 C  CB    . THR B 1 272 ? -25.933 -21.600 13.455  1.00 15.92  ? 266 THR B CB    1 
ATOM   5763 O  OG1   . THR B 1 272 ? -27.075 -22.397 13.134  1.00 22.39  ? 266 THR B OG1   1 
ATOM   5764 C  CG2   . THR B 1 272 ? -25.845 -21.500 14.975  1.00 15.87  ? 266 THR B CG2   1 
ATOM   5765 N  N     . LEU B 1 273 ? -26.626 -20.200 10.430  1.00 11.33  ? 267 LEU B N     1 
ATOM   5766 C  CA    . LEU B 1 273 ? -26.346 -20.014 9.025   1.00 10.75  ? 267 LEU B CA    1 
ATOM   5767 C  C     . LEU B 1 273 ? -25.629 -18.690 8.738   1.00 10.29  ? 267 LEU B C     1 
ATOM   5768 O  O     . LEU B 1 273 ? -24.626 -18.687 8.033   1.00 10.07  ? 267 LEU B O     1 
ATOM   5769 C  CB    . LEU B 1 273 ? -27.611 -20.172 8.188   1.00 10.57  ? 267 LEU B CB    1 
ATOM   5770 C  CG    . LEU B 1 273 ? -28.030 -21.635 8.061   1.00 10.52  ? 267 LEU B CG    1 
ATOM   5771 C  CD1   . LEU B 1 273 ? -29.298 -21.807 7.220   1.00 13.83  ? 267 LEU B CD1   1 
ATOM   5772 C  CD2   . LEU B 1 273 ? -26.895 -22.444 7.475   1.00 10.21  ? 267 LEU B CD2   1 
ATOM   5773 N  N     . VAL B 1 274 ? -26.100 -17.580 9.297   1.00 8.10   ? 268 VAL B N     1 
ATOM   5774 C  CA    . VAL B 1 274 ? -25.421 -16.314 9.038   1.00 9.54   ? 268 VAL B CA    1 
ATOM   5775 C  C     . VAL B 1 274 ? -23.965 -16.417 9.491   1.00 12.62  ? 268 VAL B C     1 
ATOM   5776 O  O     . VAL B 1 274 ? -23.038 -16.046 8.765   1.00 10.43  ? 268 VAL B O     1 
ATOM   5777 C  CB    . VAL B 1 274 ? -26.096 -15.096 9.717   1.00 6.85   ? 268 VAL B CB    1 
ATOM   5778 C  CG1   . VAL B 1 274 ? -25.247 -13.872 9.539   1.00 6.73   ? 268 VAL B CG1   1 
ATOM   5779 C  CG2   . VAL B 1 274 ? -27.455 -14.833 9.124   1.00 7.33   ? 268 VAL B CG2   1 
ATOM   5780 N  N     . HIS B 1 275 ? -23.764 -16.959 10.683  1.00 11.10  ? 269 HIS B N     1 
ATOM   5781 C  CA    . HIS B 1 275 ? -22.418 -17.118 11.193  1.00 11.03  ? 269 HIS B CA    1 
ATOM   5782 C  C     . HIS B 1 275 ? -21.574 -18.048 10.309  1.00 14.03  ? 269 HIS B C     1 
ATOM   5783 O  O     . HIS B 1 275 ? -20.424 -17.735 9.997   1.00 11.62  ? 269 HIS B O     1 
ATOM   5784 C  CB    . HIS B 1 275 ? -22.441 -17.642 12.621  1.00 11.34  ? 269 HIS B CB    1 
ATOM   5785 C  CG    . HIS B 1 275 ? -21.089 -18.013 13.133  1.00 12.67  ? 269 HIS B CG    1 
ATOM   5786 N  ND1   . HIS B 1 275 ? -20.135 -17.071 13.453  1.00 13.10  ? 269 HIS B ND1   1 
ATOM   5787 C  CD2   . HIS B 1 275 ? -20.514 -19.220 13.343  1.00 13.69  ? 269 HIS B CD2   1 
ATOM   5788 C  CE1   . HIS B 1 275 ? -19.038 -17.683 13.859  1.00 18.01  ? 269 HIS B CE1   1 
ATOM   5789 N  NE2   . HIS B 1 275 ? -19.238 -18.989 13.798  1.00 14.55  ? 269 HIS B NE2   1 
ATOM   5790 N  N     . LYS B 1 276 ? -22.138 -19.189 9.913   1.00 12.66  ? 270 LYS B N     1 
ATOM   5791 C  CA    . LYS B 1 276 ? -21.409 -20.120 9.063   1.00 10.61  ? 270 LYS B CA    1 
ATOM   5792 C  C     . LYS B 1 276 ? -21.110 -19.490 7.709   1.00 13.04  ? 270 LYS B C     1 
ATOM   5793 O  O     . LYS B 1 276 ? -20.095 -19.795 7.103   1.00 14.47  ? 270 LYS B O     1 
ATOM   5794 C  CB    . LYS B 1 276 ? -22.176 -21.420 8.873   1.00 9.30   ? 270 LYS B CB    1 
ATOM   5795 C  CG    . LYS B 1 276 ? -22.263 -22.272 10.104  1.00 11.24  ? 270 LYS B CG    1 
ATOM   5796 C  CD    . LYS B 1 276 ? -20.908 -22.738 10.585  1.00 10.53  ? 270 LYS B CD    1 
ATOM   5797 C  CE    . LYS B 1 276 ? -21.069 -23.653 11.774  1.00 12.09  ? 270 LYS B CE    1 
ATOM   5798 N  NZ    . LYS B 1 276 ? -19.857 -24.437 12.083  1.00 18.93  ? 270 LYS B NZ    1 
ATOM   5799 N  N     . PHE B 1 277 ? -21.995 -18.615 7.238   1.00 11.69  ? 271 PHE B N     1 
ATOM   5800 C  CA    . PHE B 1 277 ? -21.756 -17.854 6.012   1.00 11.19  ? 271 PHE B CA    1 
ATOM   5801 C  C     . PHE B 1 277 ? -20.409 -17.130 6.071   1.00 12.80  ? 271 PHE B C     1 
ATOM   5802 O  O     . PHE B 1 277 ? -19.571 -17.283 5.186   1.00 13.17  ? 271 PHE B O     1 
ATOM   5803 C  CB    . PHE B 1 277 ? -22.898 -16.851 5.798   1.00 11.98  ? 271 PHE B CB    1 
ATOM   5804 C  CG    . PHE B 1 277 ? -22.735 -15.966 4.598   1.00 10.37  ? 271 PHE B CG    1 
ATOM   5805 C  CD1   . PHE B 1 277 ? -23.137 -16.395 3.343   1.00 11.12  ? 271 PHE B CD1   1 
ATOM   5806 C  CD2   . PHE B 1 277 ? -22.208 -14.688 4.727   1.00 10.87  ? 271 PHE B CD2   1 
ATOM   5807 C  CE1   . PHE B 1 277 ? -22.994 -15.567 2.229   1.00 8.59   ? 271 PHE B CE1   1 
ATOM   5808 C  CE2   . PHE B 1 277 ? -22.074 -13.861 3.621   1.00 9.49   ? 271 PHE B CE2   1 
ATOM   5809 C  CZ    . PHE B 1 277 ? -22.467 -14.304 2.377   1.00 7.09   ? 271 PHE B CZ    1 
ATOM   5810 N  N     . PHE B 1 278 ? -20.191 -16.351 7.122   1.00 13.52  ? 272 PHE B N     1 
ATOM   5811 C  CA    . PHE B 1 278 ? -18.919 -15.659 7.263   1.00 13.09  ? 272 PHE B CA    1 
ATOM   5812 C  C     . PHE B 1 278 ? -17.785 -16.648 7.497   1.00 13.31  ? 272 PHE B C     1 
ATOM   5813 O  O     . PHE B 1 278 ? -16.651 -16.412 7.116   1.00 14.95  ? 272 PHE B O     1 
ATOM   5814 C  CB    . PHE B 1 278 ? -18.988 -14.612 8.368   1.00 11.51  ? 272 PHE B CB    1 
ATOM   5815 C  CG    . PHE B 1 278 ? -19.973 -13.508 8.086   1.00 13.86  ? 272 PHE B CG    1 
ATOM   5816 C  CD1   . PHE B 1 278 ? -19.734 -12.593 7.072   1.00 15.88  ? 272 PHE B CD1   1 
ATOM   5817 C  CD2   . PHE B 1 278 ? -21.141 -13.394 8.819   1.00 9.92   ? 272 PHE B CD2   1 
ATOM   5818 C  CE1   . PHE B 1 278 ? -20.631 -11.588 6.804   1.00 12.55  ? 272 PHE B CE1   1 
ATOM   5819 C  CE2   . PHE B 1 278 ? -22.034 -12.396 8.553   1.00 9.52   ? 272 PHE B CE2   1 
ATOM   5820 C  CZ    . PHE B 1 278 ? -21.774 -11.484 7.546   1.00 12.27  ? 272 PHE B CZ    1 
ATOM   5821 N  N     . LEU B 1 279 ? -18.099 -17.776 8.106   1.00 15.38  ? 273 LEU B N     1 
ATOM   5822 C  CA    . LEU B 1 279 ? -17.079 -18.770 8.386   1.00 15.62  ? 273 LEU B CA    1 
ATOM   5823 C  C     . LEU B 1 279 ? -16.554 -19.328 7.075   1.00 14.55  ? 273 LEU B C     1 
ATOM   5824 O  O     . LEU B 1 279 ? -15.351 -19.402 6.879   1.00 23.07  ? 273 LEU B O     1 
ATOM   5825 C  CB    . LEU B 1 279 ? -17.647 -19.900 9.257   1.00 18.01  ? 273 LEU B CB    1 
ATOM   5826 C  CG    . LEU B 1 279 ? -16.748 -20.593 10.290  1.00 15.62  ? 273 LEU B CG    1 
ATOM   5827 C  CD1   . LEU B 1 279 ? -17.066 -22.073 10.338  1.00 16.78  ? 273 LEU B CD1   1 
ATOM   5828 C  CD2   . LEU B 1 279 ? -15.282 -20.375 10.025  1.00 13.50  ? 273 LEU B CD2   1 
ATOM   5829 N  N     . VAL B 1 280 ? -17.454 -19.711 6.177   1.00 10.75  ? 274 VAL B N     1 
ATOM   5830 C  CA    . VAL B 1 280 ? -17.057 -20.322 4.912   1.00 11.85  ? 274 VAL B CA    1 
ATOM   5831 C  C     . VAL B 1 280 ? -16.392 -19.324 3.978   1.00 14.42  ? 274 VAL B C     1 
ATOM   5832 O  O     . VAL B 1 280 ? -15.278 -19.561 3.517   1.00 17.72  ? 274 VAL B O     1 
ATOM   5833 C  CB    . VAL B 1 280 ? -18.248 -20.941 4.152   1.00 10.90  ? 274 VAL B CB    1 
ATOM   5834 C  CG1   . VAL B 1 280 ? -17.839 -21.342 2.751   1.00 7.20   ? 274 VAL B CG1   1 
ATOM   5835 C  CG2   . VAL B 1 280 ? -18.792 -22.124 4.902   1.00 9.89   ? 274 VAL B CG2   1 
ATOM   5836 N  N     . PHE B 1 281 ? -17.070 -18.215 3.692   1.00 12.54  ? 275 PHE B N     1 
ATOM   5837 C  CA    . PHE B 1 281 ? -16.568 -17.281 2.681   1.00 13.10  ? 275 PHE B CA    1 
ATOM   5838 C  C     . PHE B 1 281 ? -15.463 -16.304 3.106   1.00 16.48  ? 275 PHE B C     1 
ATOM   5839 O  O     . PHE B 1 281 ? -14.870 -15.655 2.238   1.00 19.19  ? 275 PHE B O     1 
ATOM   5840 C  CB    . PHE B 1 281 ? -17.716 -16.578 1.945   1.00 10.67  ? 275 PHE B CB    1 
ATOM   5841 C  CG    . PHE B 1 281 ? -18.538 -17.520 1.135   1.00 9.67   ? 275 PHE B CG    1 
ATOM   5842 C  CD1   . PHE B 1 281 ? -17.980 -18.178 0.055   1.00 8.28   ? 275 PHE B CD1   1 
ATOM   5843 C  CD2   . PHE B 1 281 ? -19.842 -17.801 1.481   1.00 10.04  ? 275 PHE B CD2   1 
ATOM   5844 C  CE1   . PHE B 1 281 ? -18.708 -19.087 -0.682  1.00 6.29   ? 275 PHE B CE1   1 
ATOM   5845 C  CE2   . PHE B 1 281 ? -20.574 -18.705 0.743   1.00 11.04  ? 275 PHE B CE2   1 
ATOM   5846 C  CZ    . PHE B 1 281 ? -20.000 -19.352 -0.343  1.00 6.61   ? 275 PHE B CZ    1 
ATOM   5847 N  N     . SER B 1 282 ? -15.162 -16.209 4.404   1.00 10.87  ? 276 SER B N     1 
ATOM   5848 C  CA    . SER B 1 282 ? -13.994 -15.441 4.819   1.00 10.16  ? 276 SER B CA    1 
ATOM   5849 C  C     . SER B 1 282 ? -12.696 -16.224 4.549   1.00 14.80  ? 276 SER B C     1 
ATOM   5850 O  O     . SER B 1 282 ? -11.608 -15.645 4.526   1.00 16.92  ? 276 SER B O     1 
ATOM   5851 C  CB    . SER B 1 282 ? -14.083 -15.001 6.284   1.00 13.13  ? 276 SER B CB    1 
ATOM   5852 O  OG    . SER B 1 282 ? -13.728 -16.043 7.183   1.00 15.83  ? 276 SER B OG    1 
ATOM   5853 N  N     . LYS B 1 283 ? -12.817 -17.532 4.322   1.00 14.44  ? 277 LYS B N     1 
ATOM   5854 C  CA    . LYS B 1 283 ? -11.653 -18.392 4.089   1.00 12.51  ? 277 LYS B CA    1 
ATOM   5855 C  C     . LYS B 1 283 ? -11.645 -19.043 2.704   1.00 13.66  ? 277 LYS B C     1 
ATOM   5856 O  O     . LYS B 1 283 ? -10.714 -19.772 2.350   1.00 13.61  ? 277 LYS B O     1 
ATOM   5857 C  CB    . LYS B 1 283 ? -11.548 -19.445 5.190   1.00 12.25  ? 277 LYS B CB    1 
ATOM   5858 C  CG    . LYS B 1 283 ? -11.117 -18.841 6.523   1.00 17.83  ? 277 LYS B CG    1 
ATOM   5859 C  CD    . LYS B 1 283 ? -11.286 -19.785 7.707   1.00 26.87  ? 277 LYS B CD    1 
ATOM   5860 C  CE    . LYS B 1 283 ? -10.593 -19.214 8.961   1.00 46.47  ? 277 LYS B CE    1 
ATOM   5861 N  NZ    . LYS B 1 283 ? -10.946 -17.776 9.258   1.00 42.23  ? 277 LYS B NZ    1 
ATOM   5862 N  N     . TRP B 1 284 ? -12.679 -18.743 1.922   1.00 13.73  ? 278 TRP B N     1 
ATOM   5863 C  CA    . TRP B 1 284 ? -12.809 -19.234 0.555   1.00 11.16  ? 278 TRP B CA    1 
ATOM   5864 C  C     . TRP B 1 284 ? -11.623 -18.830 -0.321  1.00 10.36  ? 278 TRP B C     1 
ATOM   5865 O  O     . TRP B 1 284 ? -11.325 -17.648 -0.478  1.00 12.03  ? 278 TRP B O     1 
ATOM   5866 C  CB    . TRP B 1 284 ? -14.120 -18.739 -0.077  1.00 11.78  ? 278 TRP B CB    1 
ATOM   5867 C  CG    . TRP B 1 284 ? -14.435 -19.457 -1.350  1.00 8.84   ? 278 TRP B CG    1 
ATOM   5868 C  CD1   . TRP B 1 284 ? -13.992 -19.139 -2.604  1.00 8.94   ? 278 TRP B CD1   1 
ATOM   5869 C  CD2   . TRP B 1 284 ? -15.224 -20.642 -1.491  1.00 7.54   ? 278 TRP B CD2   1 
ATOM   5870 N  NE1   . TRP B 1 284 ? -14.463 -20.052 -3.519  1.00 9.22   ? 278 TRP B NE1   1 
ATOM   5871 C  CE2   . TRP B 1 284 ? -15.221 -20.985 -2.862  1.00 8.42   ? 278 TRP B CE2   1 
ATOM   5872 C  CE3   . TRP B 1 284 ? -15.923 -21.449 -0.595  1.00 6.46   ? 278 TRP B CE3   1 
ATOM   5873 C  CZ2   . TRP B 1 284 ? -15.897 -22.093 -3.352  1.00 6.28   ? 278 TRP B CZ2   1 
ATOM   5874 C  CZ3   . TRP B 1 284 ? -16.587 -22.552 -1.084  1.00 6.23   ? 278 TRP B CZ3   1 
ATOM   5875 C  CH2   . TRP B 1 284 ? -16.573 -22.862 -2.449  1.00 8.48   ? 278 TRP B CH2   1 
ATOM   5876 N  N     . GLU B 1 285 ? -10.961 -19.823 -0.905  1.00 12.63  ? 279 GLU B N     1 
ATOM   5877 C  CA    . GLU B 1 285 ? -9.808  -19.577 -1.764  1.00 12.38  ? 279 GLU B CA    1 
ATOM   5878 C  C     . GLU B 1 285 ? -10.175 -19.129 -3.191  1.00 14.92  ? 279 GLU B C     1 
ATOM   5879 O  O     . GLU B 1 285 ? -10.190 -19.928 -4.134  1.00 11.67  ? 279 GLU B O     1 
ATOM   5880 C  CB    . GLU B 1 285 ? -8.906  -20.810 -1.812  1.00 12.62  ? 279 GLU B CB    1 
ATOM   5881 C  CG    . GLU B 1 285 ? -8.318  -21.212 -0.466  1.00 23.68  ? 279 GLU B CG    1 
ATOM   5882 C  CD    . GLU B 1 285 ? -7.351  -22.390 -0.574  1.00 28.62  ? 279 GLU B CD    1 
ATOM   5883 O  OE1   . GLU B 1 285 ? -7.035  -23.003 0.481   1.00 23.76  ? 279 GLU B OE1   1 
ATOM   5884 O  OE2   . GLU B 1 285 ? -6.906  -22.691 -1.714  1.00 21.00  ? 279 GLU B OE2   1 
ATOM   5885 N  N     . TRP B 1 286 ? -10.452 -17.841 -3.348  1.00 12.22  ? 280 TRP B N     1 
ATOM   5886 C  CA    . TRP B 1 286 ? -10.642 -17.282 -4.674  1.00 11.30  ? 280 TRP B CA    1 
ATOM   5887 C  C     . TRP B 1 286 ? -9.362  -17.459 -5.491  1.00 13.03  ? 280 TRP B C     1 
ATOM   5888 O  O     . TRP B 1 286 ? -8.258  -17.393 -4.948  1.00 12.23  ? 280 TRP B O     1 
ATOM   5889 C  CB    . TRP B 1 286 ? -10.982 -15.801 -4.560  1.00 12.85  ? 280 TRP B CB    1 
ATOM   5890 C  CG    . TRP B 1 286 ? -12.076 -15.514 -3.577  1.00 11.79  ? 280 TRP B CG    1 
ATOM   5891 C  CD1   . TRP B 1 286 ? -11.951 -14.930 -2.343  1.00 11.06  ? 280 TRP B CD1   1 
ATOM   5892 C  CD2   . TRP B 1 286 ? -13.458 -15.796 -3.745  1.00 7.06   ? 280 TRP B CD2   1 
ATOM   5893 N  NE1   . TRP B 1 286 ? -13.175 -14.831 -1.744  1.00 7.16   ? 280 TRP B NE1   1 
ATOM   5894 C  CE2   . TRP B 1 286 ? -14.118 -15.358 -2.586  1.00 8.41   ? 280 TRP B CE2   1 
ATOM   5895 C  CE3   . TRP B 1 286 ? -14.203 -16.385 -4.758  1.00 7.45   ? 280 TRP B CE3   1 
ATOM   5896 C  CZ2   . TRP B 1 286 ? -15.486 -15.494 -2.419  1.00 10.80  ? 280 TRP B CZ2   1 
ATOM   5897 C  CZ3   . TRP B 1 286 ? -15.562 -16.521 -4.590  1.00 7.85   ? 280 TRP B CZ3   1 
ATOM   5898 C  CH2   . TRP B 1 286 ? -16.192 -16.075 -3.437  1.00 8.26   ? 280 TRP B CH2   1 
ATOM   5899 N  N     . PRO B 1 287 ? -9.502  -17.648 -6.809  1.00 12.65  ? 281 PRO B N     1 
ATOM   5900 C  CA    . PRO B 1 287 ? -10.784 -17.677 -7.517  1.00 11.53  ? 281 PRO B CA    1 
ATOM   5901 C  C     . PRO B 1 287 ? -11.393 -19.066 -7.781  1.00 12.51  ? 281 PRO B C     1 
ATOM   5902 O  O     . PRO B 1 287 ? -11.805 -19.304 -8.914  1.00 16.28  ? 281 PRO B O     1 
ATOM   5903 C  CB    . PRO B 1 287 ? -10.420 -17.046 -8.856  1.00 11.45  ? 281 PRO B CB    1 
ATOM   5904 C  CG    . PRO B 1 287 ? -9.011  -17.455 -9.073  1.00 7.27   ? 281 PRO B CG    1 
ATOM   5905 C  CD    . PRO B 1 287 ? -8.377  -17.388 -7.729  1.00 7.06   ? 281 PRO B CD    1 
ATOM   5906 N  N     . ASN B 1 288 ? -11.450 -19.963 -6.801  1.00 12.71  ? 282 ASN B N     1 
ATOM   5907 C  CA    . ASN B 1 288 ? -12.151 -21.224 -7.019  1.00 11.49  ? 282 ASN B CA    1 
ATOM   5908 C  C     . ASN B 1 288 ? -13.606 -20.867 -7.201  1.00 11.34  ? 282 ASN B C     1 
ATOM   5909 O  O     . ASN B 1 288 ? -14.151 -20.082 -6.431  1.00 10.31  ? 282 ASN B O     1 
ATOM   5910 C  CB    . ASN B 1 288 ? -11.994 -22.200 -5.838  1.00 14.75  ? 282 ASN B CB    1 
ATOM   5911 C  CG    . ASN B 1 288 ? -10.539 -22.493 -5.506  1.00 20.20  ? 282 ASN B CG    1 
ATOM   5912 O  OD1   . ASN B 1 288 ? -9.636  -22.081 -6.235  1.00 34.92  ? 282 ASN B OD1   1 
ATOM   5913 N  ND2   . ASN B 1 288 ? -10.302 -23.199 -4.403  1.00 16.64  ? 282 ASN B ND2   1 
ATOM   5914 N  N     . PRO B 1 289 ? -14.241 -21.414 -8.238  1.00 10.00  ? 283 PRO B N     1 
ATOM   5915 C  CA    . PRO B 1 289 ? -15.638 -21.029 -8.442  1.00 11.93  ? 283 PRO B CA    1 
ATOM   5916 C  C     . PRO B 1 289 ? -16.533 -21.530 -7.312  1.00 11.22  ? 283 PRO B C     1 
ATOM   5917 O  O     . PRO B 1 289 ? -16.237 -22.556 -6.694  1.00 11.95  ? 283 PRO B O     1 
ATOM   5918 C  CB    . PRO B 1 289 ? -16.005 -21.710 -9.764  1.00 9.93   ? 283 PRO B CB    1 
ATOM   5919 C  CG    . PRO B 1 289 ? -14.963 -22.730 -9.986  1.00 8.05   ? 283 PRO B CG    1 
ATOM   5920 C  CD    . PRO B 1 289 ? -13.725 -22.241 -9.333  1.00 7.53   ? 283 PRO B CD    1 
ATOM   5921 N  N     . VAL B 1 290 ? -17.591 -20.781 -7.032  1.00 7.79   ? 284 VAL B N     1 
ATOM   5922 C  CA    . VAL B 1 290 ? -18.618 -21.239 -6.128  1.00 9.39   ? 284 VAL B CA    1 
ATOM   5923 C  C     . VAL B 1 290 ? -19.664 -21.891 -6.976  1.00 8.57   ? 284 VAL B C     1 
ATOM   5924 O  O     . VAL B 1 290 ? -20.269 -21.226 -7.801  1.00 12.11  ? 284 VAL B O     1 
ATOM   5925 C  CB    . VAL B 1 290 ? -19.262 -20.077 -5.364  1.00 8.48   ? 284 VAL B CB    1 
ATOM   5926 C  CG1   . VAL B 1 290 ? -20.516 -20.540 -4.633  1.00 6.34   ? 284 VAL B CG1   1 
ATOM   5927 C  CG2   . VAL B 1 290 ? -18.269 -19.501 -4.395  1.00 8.22   ? 284 VAL B CG2   1 
ATOM   5928 N  N     . LEU B 1 291 ? -19.878 -23.188 -6.772  1.00 12.41  ? 285 LEU B N     1 
ATOM   5929 C  CA    . LEU B 1 291 ? -20.870 -23.941 -7.546  1.00 15.26  ? 285 LEU B CA    1 
ATOM   5930 C  C     . LEU B 1 291 ? -21.990 -24.538 -6.692  1.00 13.23  ? 285 LEU B C     1 
ATOM   5931 O  O     . LEU B 1 291 ? -21.743 -25.092 -5.617  1.00 20.16  ? 285 LEU B O     1 
ATOM   5932 C  CB    . LEU B 1 291 ? -20.198 -25.075 -8.321  1.00 21.01  ? 285 LEU B CB    1 
ATOM   5933 C  CG    . LEU B 1 291 ? -19.042 -24.775 -9.266  1.00 15.97  ? 285 LEU B CG    1 
ATOM   5934 C  CD1   . LEU B 1 291 ? -18.658 -26.043 -9.988  1.00 15.61  ? 285 LEU B CD1   1 
ATOM   5935 C  CD2   . LEU B 1 291 ? -19.465 -23.734 -10.249 1.00 14.88  ? 285 LEU B CD2   1 
ATOM   5936 N  N     . LEU B 1 292 ? -23.217 -24.456 -7.191  1.00 11.14  ? 286 LEU B N     1 
ATOM   5937 C  CA    . LEU B 1 292 ? -24.358 -25.006 -6.474  1.00 14.60  ? 286 LEU B CA    1 
ATOM   5938 C  C     . LEU B 1 292 ? -24.717 -26.419 -6.933  1.00 14.25  ? 286 LEU B C     1 
ATOM   5939 O  O     . LEU B 1 292 ? -25.398 -27.148 -6.227  1.00 17.02  ? 286 LEU B O     1 
ATOM   5940 C  CB    . LEU B 1 292 ? -25.569 -24.075 -6.585  1.00 13.20  ? 286 LEU B CB    1 
ATOM   5941 C  CG    . LEU B 1 292 ? -25.409 -22.630 -6.101  1.00 8.95   ? 286 LEU B CG    1 
ATOM   5942 C  CD1   . LEU B 1 292 ? -26.657 -21.824 -6.422  1.00 5.65   ? 286 LEU B CD1   1 
ATOM   5943 C  CD2   . LEU B 1 292 ? -25.106 -22.594 -4.611  1.00 10.27  ? 286 LEU B CD2   1 
ATOM   5944 N  N     . LYS B 1 293 ? -24.268 -26.802 -8.120  1.00 18.43  ? 287 LYS B N     1 
ATOM   5945 C  CA    . LYS B 1 293 ? -24.418 -28.185 -8.572  1.00 24.63  ? 287 LYS B CA    1 
ATOM   5946 C  C     . LYS B 1 293 ? -23.420 -28.520 -9.666  1.00 27.15  ? 287 LYS B C     1 
ATOM   5947 O  O     . LYS B 1 293 ? -22.806 -27.624 -10.252 1.00 24.07  ? 287 LYS B O     1 
ATOM   5948 C  CB    . LYS B 1 293 ? -25.853 -28.496 -9.022  1.00 26.48  ? 287 LYS B CB    1 
ATOM   5949 C  CG    . LYS B 1 293 ? -26.222 -28.158 -10.469 1.00 25.58  ? 287 LYS B CG    1 
ATOM   5950 C  CD    . LYS B 1 293 ? -27.579 -28.805 -10.820 1.00 33.73  ? 287 LYS B CD    1 
ATOM   5951 C  CE    . LYS B 1 293 ? -28.176 -28.341 -12.161 1.00 34.58  ? 287 LYS B CE    1 
ATOM   5952 N  NZ    . LYS B 1 293 ? -29.437 -29.103 -12.473 1.00 34.48  ? 287 LYS B NZ    1 
ATOM   5953 N  N     . GLN B 1 294 ? -23.244 -29.815 -9.915  1.00 33.21  ? 288 GLN B N     1 
ATOM   5954 C  CA    . GLN B 1 294 ? -22.340 -30.273 -10.964 1.00 33.06  ? 288 GLN B CA    1 
ATOM   5955 C  C     . GLN B 1 294 ? -22.898 -29.896 -12.319 1.00 32.55  ? 288 GLN B C     1 
ATOM   5956 O  O     . GLN B 1 294 ? -23.978 -30.345 -12.689 1.00 39.08  ? 288 GLN B O     1 
ATOM   5957 C  CB    . GLN B 1 294 ? -22.119 -31.781 -10.882 1.00 32.28  ? 288 GLN B CB    1 
ATOM   5958 C  CG    . GLN B 1 294 ? -20.919 -32.188 -10.032 1.00 38.53  ? 288 GLN B CG    1 
ATOM   5959 C  CD    . GLN B 1 294 ? -19.579 -31.808 -10.671 1.00 49.62  ? 288 GLN B CD    1 
ATOM   5960 O  OE1   . GLN B 1 294 ? -19.522 -31.344 -11.817 1.00 41.13  ? 288 GLN B OE1   1 
ATOM   5961 N  NE2   . GLN B 1 294 ? -18.494 -32.008 -9.925  1.00 48.60  ? 288 GLN B NE2   1 
ATOM   5962 N  N     . PRO B 1 295 ? -22.161 -29.056 -13.057 1.00 36.30  ? 289 PRO B N     1 
ATOM   5963 C  CA    . PRO B 1 295 ? -22.584 -28.506 -14.350 1.00 34.74  ? 289 PRO B CA    1 
ATOM   5964 C  C     . PRO B 1 295 ? -22.579 -29.580 -15.428 1.00 42.34  ? 289 PRO B C     1 
ATOM   5965 O  O     . PRO B 1 295 ? -21.501 -29.916 -15.917 1.00 55.25  ? 289 PRO B O     1 
ATOM   5966 C  CB    . PRO B 1 295 ? -21.488 -27.475 -14.670 1.00 37.88  ? 289 PRO B CB    1 
ATOM   5967 C  CG    . PRO B 1 295 ? -20.627 -27.363 -13.428 1.00 31.55  ? 289 PRO B CG    1 
ATOM   5968 C  CD    . PRO B 1 295 ? -20.790 -28.650 -12.701 1.00 33.97  ? 289 PRO B CD    1 
ATOM   5969 N  N     . GLU B 1 296 ? -23.740 -30.112 -15.800 1.00 44.60  ? 290 GLU B N     1 
ATOM   5970 C  CA    . GLU B 1 296 ? -23.762 -31.222 -16.759 1.00 51.48  ? 290 GLU B CA    1 
ATOM   5971 C  C     . GLU B 1 296 ? -23.351 -30.785 -18.165 1.00 58.88  ? 290 GLU B C     1 
ATOM   5972 O  O     . GLU B 1 296 ? -23.350 -29.589 -18.492 1.00 50.02  ? 290 GLU B O     1 
ATOM   5973 C  CB    . GLU B 1 296 ? -25.112 -31.971 -16.769 1.00 39.29  ? 290 GLU B CB    1 
ATOM   5974 C  CG    . GLU B 1 296 ? -26.356 -31.084 -16.674 1.00 55.20  ? 290 GLU B CG    1 
ATOM   5975 C  CD    . GLU B 1 296 ? -27.185 -31.318 -15.398 1.00 57.05  ? 290 GLU B CD    1 
ATOM   5976 O  OE1   . GLU B 1 296 ? -27.530 -32.488 -15.097 1.00 52.84  ? 290 GLU B OE1   1 
ATOM   5977 O  OE2   . GLU B 1 296 ? -27.497 -30.326 -14.697 1.00 43.07  ? 290 GLU B OE2   1 
ATOM   5978 N  N     . GLU B 1 297 ? -22.971 -31.767 -18.977 1.00 63.91  ? 291 GLU B N     1 
ATOM   5979 C  CA    . GLU B 1 297 ? -22.655 -31.529 -20.380 1.00 59.43  ? 291 GLU B CA    1 
ATOM   5980 C  C     . GLU B 1 297 ? -23.944 -31.485 -21.202 1.00 45.92  ? 291 GLU B C     1 
ATOM   5981 O  O     . GLU B 1 297 ? -24.869 -32.267 -20.971 1.00 35.75  ? 291 GLU B O     1 
ATOM   5982 C  CB    . GLU B 1 297 ? -21.698 -32.608 -20.916 1.00 67.48  ? 291 GLU B CB    1 
ATOM   5983 C  CG    . GLU B 1 297 ? -20.239 -32.480 -20.444 1.00 66.16  ? 291 GLU B CG    1 
ATOM   5984 C  CD    . GLU B 1 297 ? -19.499 -31.290 -21.069 1.00 67.59  ? 291 GLU B CD    1 
ATOM   5985 O  OE1   . GLU B 1 297 ? -18.485 -30.841 -20.484 1.00 48.44  ? 291 GLU B OE1   1 
ATOM   5986 O  OE2   . GLU B 1 297 ? -19.924 -30.805 -22.145 1.00 59.90  ? 291 GLU B OE2   1 
ATOM   5987 N  N     . SER B 1 298 ? -23.999 -30.556 -22.151 1.00 49.21  ? 292 SER B N     1 
ATOM   5988 C  CA    . SER B 1 298 ? -25.180 -30.378 -22.996 1.00 49.72  ? 292 SER B CA    1 
ATOM   5989 C  C     . SER B 1 298 ? -24.798 -30.328 -24.481 1.00 51.72  ? 292 SER B C     1 
ATOM   5990 O  O     . SER B 1 298 ? -23.713 -29.858 -24.846 1.00 43.02  ? 292 SER B O     1 
ATOM   5991 C  CB    . SER B 1 298 ? -25.951 -29.111 -22.587 1.00 34.34  ? 292 SER B CB    1 
ATOM   5992 O  OG    . SER B 1 298 ? -27.095 -28.901 -23.395 1.00 31.48  ? 292 SER B OG    1 
ATOM   5993 N  N     . ASN B 1 299 ? -25.690 -30.834 -25.330 1.00 57.80  ? 293 ASN B N     1 
ATOM   5994 C  CA    . ASN B 1 299 ? -25.501 -30.763 -26.774 1.00 53.72  ? 293 ASN B CA    1 
ATOM   5995 C  C     . ASN B 1 299 ? -25.966 -29.420 -27.321 1.00 49.93  ? 293 ASN B C     1 
ATOM   5996 O  O     . ASN B 1 299 ? -25.806 -29.139 -28.509 1.00 47.88  ? 293 ASN B O     1 
ATOM   5997 C  CB    . ASN B 1 299 ? -26.225 -31.914 -27.480 1.00 52.65  ? 293 ASN B CB    1 
ATOM   5998 C  CG    . ASN B 1 299 ? -27.645 -32.115 -26.969 1.00 64.11  ? 293 ASN B CG    1 
ATOM   5999 O  OD1   . ASN B 1 299 ? -28.300 -31.169 -26.525 1.00 59.87  ? 293 ASN B OD1   1 
ATOM   6000 N  ND2   . ASN B 1 299 ? -28.124 -33.357 -27.023 1.00 62.43  ? 293 ASN B ND2   1 
ATOM   6001 N  N     . LEU B 1 300 ? -26.539 -28.592 -26.446 1.00 45.42  ? 294 LEU B N     1 
ATOM   6002 C  CA    . LEU B 1 300 ? -27.024 -27.269 -26.842 1.00 48.57  ? 294 LEU B CA    1 
ATOM   6003 C  C     . LEU B 1 300 ? -25.856 -26.388 -27.243 1.00 45.66  ? 294 LEU B C     1 
ATOM   6004 O  O     . LEU B 1 300 ? -25.997 -25.478 -28.069 1.00 46.16  ? 294 LEU B O     1 
ATOM   6005 C  CB    . LEU B 1 300 ? -27.817 -26.609 -25.713 1.00 41.25  ? 294 LEU B CB    1 
ATOM   6006 C  CG    . LEU B 1 300 ? -29.232 -27.134 -25.474 1.00 46.32  ? 294 LEU B CG    1 
ATOM   6007 C  CD1   . LEU B 1 300 ? -29.791 -26.606 -24.156 1.00 46.96  ? 294 LEU B CD1   1 
ATOM   6008 C  CD2   . LEU B 1 300 ? -30.129 -26.750 -26.632 1.00 41.70  ? 294 LEU B CD2   1 
ATOM   6009 N  N     . ASN B 1 301 ? -24.705 -26.681 -26.646 1.00 42.08  ? 295 ASN B N     1 
ATOM   6010 C  CA    . ASN B 1 301 ? -23.462 -25.983 -26.932 1.00 45.51  ? 295 ASN B CA    1 
ATOM   6011 C  C     . ASN B 1 301 ? -23.617 -24.464 -27.026 1.00 46.73  ? 295 ASN B C     1 
ATOM   6012 O  O     . ASN B 1 301 ? -23.415 -23.866 -28.087 1.00 41.03  ? 295 ASN B O     1 
ATOM   6013 C  CB    . ASN B 1 301 ? -22.824 -26.548 -28.198 1.00 49.99  ? 295 ASN B CB    1 
ATOM   6014 C  CG    . ASN B 1 301 ? -21.346 -26.249 -28.282 1.00 53.02  ? 295 ASN B CG    1 
ATOM   6015 O  OD1   . ASN B 1 301 ? -20.892 -25.179 -27.866 1.00 52.47  ? 295 ASN B OD1   1 
ATOM   6016 N  ND2   . ASN B 1 301 ? -20.580 -27.196 -28.816 1.00 48.10  ? 295 ASN B ND2   1 
ATOM   6017 N  N     . LEU B 1 302 ? -24.008 -23.855 -25.910 1.00 45.61  ? 296 LEU B N     1 
ATOM   6018 C  CA    . LEU B 1 302 ? -24.043 -22.403 -25.796 1.00 36.99  ? 296 LEU B CA    1 
ATOM   6019 C  C     . LEU B 1 302 ? -22.801 -21.981 -25.018 1.00 32.24  ? 296 LEU B C     1 
ATOM   6020 O  O     . LEU B 1 302 ? -22.188 -22.813 -24.341 1.00 29.44  ? 296 LEU B O     1 
ATOM   6021 C  CB    . LEU B 1 302 ? -25.318 -21.956 -25.077 1.00 30.05  ? 296 LEU B CB    1 
ATOM   6022 C  CG    . LEU B 1 302 ? -26.611 -21.968 -25.894 1.00 33.42  ? 296 LEU B CG    1 
ATOM   6023 C  CD1   . LEU B 1 302 ? -27.796 -21.716 -24.990 1.00 24.49  ? 296 LEU B CD1   1 
ATOM   6024 C  CD2   . LEU B 1 302 ? -26.565 -20.929 -27.006 1.00 32.20  ? 296 LEU B CD2   1 
ATOM   6025 N  N     . PRO B 1 303 ? -22.402 -20.702 -25.141 1.00 25.59  ? 297 PRO B N     1 
ATOM   6026 C  CA    . PRO B 1 303 ? -21.278 -20.127 -24.384 1.00 25.12  ? 297 PRO B CA    1 
ATOM   6027 C  C     . PRO B 1 303 ? -21.389 -20.319 -22.864 1.00 25.05  ? 297 PRO B C     1 
ATOM   6028 O  O     . PRO B 1 303 ? -22.342 -19.870 -22.224 1.00 25.15  ? 297 PRO B O     1 
ATOM   6029 C  CB    . PRO B 1 303 ? -21.351 -18.638 -24.734 1.00 25.41  ? 297 PRO B CB    1 
ATOM   6030 C  CG    . PRO B 1 303 ? -21.938 -18.616 -26.092 1.00 31.70  ? 297 PRO B CG    1 
ATOM   6031 C  CD    . PRO B 1 303 ? -22.906 -19.774 -26.166 1.00 26.01  ? 297 PRO B CD    1 
ATOM   6032 N  N     . VAL B 1 304 ? -20.392 -20.977 -22.291 1.00 22.29  ? 298 VAL B N     1 
ATOM   6033 C  CA    . VAL B 1 304 ? -20.420 -21.327 -20.883 1.00 19.66  ? 298 VAL B CA    1 
ATOM   6034 C  C     . VAL B 1 304 ? -19.163 -20.803 -20.158 1.00 24.43  ? 298 VAL B C     1 
ATOM   6035 O  O     . VAL B 1 304 ? -18.134 -20.543 -20.793 1.00 26.82  ? 298 VAL B O     1 
ATOM   6036 C  CB    . VAL B 1 304 ? -20.624 -22.859 -20.735 1.00 14.75  ? 298 VAL B CB    1 
ATOM   6037 C  CG1   . VAL B 1 304 ? -19.971 -23.409 -19.497 1.00 19.69  ? 298 VAL B CG1   1 
ATOM   6038 C  CG2   . VAL B 1 304 ? -22.099 -23.188 -20.750 1.00 17.97  ? 298 VAL B CG2   1 
ATOM   6039 N  N     . TRP B 1 305 ? -19.272 -20.579 -18.848 1.00 17.44  ? 299 TRP B N     1 
ATOM   6040 C  CA    . TRP B 1 305 ? -18.112 -20.268 -18.034 1.00 15.96  ? 299 TRP B CA    1 
ATOM   6041 C  C     . TRP B 1 305 ? -17.361 -21.559 -17.745 1.00 22.64  ? 299 TRP B C     1 
ATOM   6042 O  O     . TRP B 1 305 ? -17.898 -22.486 -17.130 1.00 25.39  ? 299 TRP B O     1 
ATOM   6043 C  CB    . TRP B 1 305 ? -18.520 -19.594 -16.726 1.00 17.17  ? 299 TRP B CB    1 
ATOM   6044 C  CG    . TRP B 1 305 ? -17.354 -19.054 -15.951 1.00 14.98  ? 299 TRP B CG    1 
ATOM   6045 C  CD1   . TRP B 1 305 ? -16.806 -17.812 -16.069 1.00 17.29  ? 299 TRP B CD1   1 
ATOM   6046 C  CD2   . TRP B 1 305 ? -16.592 -19.736 -14.947 1.00 14.41  ? 299 TRP B CD2   1 
ATOM   6047 N  NE1   . TRP B 1 305 ? -15.752 -17.673 -15.200 1.00 16.75  ? 299 TRP B NE1   1 
ATOM   6048 C  CE2   . TRP B 1 305 ? -15.591 -18.840 -14.505 1.00 11.98  ? 299 TRP B CE2   1 
ATOM   6049 C  CE3   . TRP B 1 305 ? -16.656 -21.012 -14.380 1.00 13.35  ? 299 TRP B CE3   1 
ATOM   6050 C  CZ2   . TRP B 1 305 ? -14.665 -19.176 -13.531 1.00 6.23   ? 299 TRP B CZ2   1 
ATOM   6051 C  CZ3   . TRP B 1 305 ? -15.733 -21.343 -13.407 1.00 12.10  ? 299 TRP B CZ3   1 
ATOM   6052 C  CH2   . TRP B 1 305 ? -14.750 -20.424 -12.993 1.00 9.55   ? 299 TRP B CH2   1 
ATOM   6053 N  N     . ASP B 1 306 ? -16.112 -21.603 -18.195 1.00 26.52  ? 300 ASP B N     1 
ATOM   6054 C  CA    . ASP B 1 306 ? -15.293 -22.805 -18.149 1.00 24.80  ? 300 ASP B CA    1 
ATOM   6055 C  C     . ASP B 1 306 ? -13.865 -22.404 -18.502 1.00 26.20  ? 300 ASP B C     1 
ATOM   6056 O  O     . ASP B 1 306 ? -13.552 -22.214 -19.670 1.00 27.15  ? 300 ASP B O     1 
ATOM   6057 C  CB    . ASP B 1 306 ? -15.815 -23.817 -19.167 1.00 18.28  ? 300 ASP B CB    1 
ATOM   6058 C  CG    . ASP B 1 306 ? -15.155 -25.167 -19.043 1.00 25.40  ? 300 ASP B CG    1 
ATOM   6059 O  OD1   . ASP B 1 306 ? -14.097 -25.282 -18.384 1.00 23.76  ? 300 ASP B OD1   1 
ATOM   6060 O  OD2   . ASP B 1 306 ? -15.701 -26.126 -19.625 1.00 35.69  ? 300 ASP B OD2   1 
ATOM   6061 N  N     . PRO B 1 307 ? -13.004 -22.249 -17.484 1.00 24.31  ? 301 PRO B N     1 
ATOM   6062 C  CA    . PRO B 1 307 ? -11.607 -21.809 -17.610 1.00 23.97  ? 301 PRO B CA    1 
ATOM   6063 C  C     . PRO B 1 307 ? -10.682 -22.823 -18.256 1.00 24.85  ? 301 PRO B C     1 
ATOM   6064 O  O     . PRO B 1 307 ? -9.481  -22.569 -18.361 1.00 29.16  ? 301 PRO B O     1 
ATOM   6065 C  CB    . PRO B 1 307 ? -11.179 -21.599 -16.157 1.00 19.59  ? 301 PRO B CB    1 
ATOM   6066 C  CG    . PRO B 1 307 ? -12.442 -21.321 -15.447 1.00 18.96  ? 301 PRO B CG    1 
ATOM   6067 C  CD    . PRO B 1 307 ? -13.460 -22.202 -16.088 1.00 17.17  ? 301 PRO B CD    1 
ATOM   6068 N  N     . ARG B 1 308 ? -11.237 -23.945 -18.687 1.00 23.94  ? 302 ARG B N     1 
ATOM   6069 C  CA    . ARG B 1 308 ? -10.449 -25.033 -19.232 1.00 27.17  ? 302 ARG B CA    1 
ATOM   6070 C  C     . ARG B 1 308 ? -10.615 -25.102 -20.760 1.00 31.58  ? 302 ARG B C     1 
ATOM   6071 O  O     . ARG B 1 308 ? -9.822  -25.724 -21.460 1.00 38.80  ? 302 ARG B O     1 
ATOM   6072 C  CB    . ARG B 1 308 ? -10.911 -26.326 -18.566 1.00 40.49  ? 302 ARG B CB    1 
ATOM   6073 C  CG    . ARG B 1 308 ? -9.935  -27.483 -18.610 1.00 63.24  ? 302 ARG B CG    1 
ATOM   6074 C  CD    . ARG B 1 308 ? -10.584 -28.732 -18.009 1.00 76.47  ? 302 ARG B CD    1 
ATOM   6075 N  NE    . ARG B 1 308 ? -11.862 -29.039 -18.657 1.00 76.17  ? 302 ARG B NE    1 
ATOM   6076 C  CZ    . ARG B 1 308 ? -12.018 -29.938 -19.626 1.00 80.54  ? 302 ARG B CZ    1 
ATOM   6077 N  NH1   . ARG B 1 308 ? -10.977 -30.641 -20.063 1.00 75.43  ? 302 ARG B NH1   1 
ATOM   6078 N  NH2   . ARG B 1 308 ? -13.218 -30.139 -20.157 1.00 81.22  ? 302 ARG B NH2   1 
ATOM   6079 N  N     . VAL B 1 309 ? -11.654 -24.452 -21.269 1.00 24.50  ? 303 VAL B N     1 
ATOM   6080 C  CA    . VAL B 1 309 ? -11.934 -24.427 -22.695 1.00 20.66  ? 303 VAL B CA    1 
ATOM   6081 C  C     . VAL B 1 309 ? -12.048 -22.990 -23.222 1.00 23.44  ? 303 VAL B C     1 
ATOM   6082 O  O     . VAL B 1 309 ? -12.245 -22.762 -24.410 1.00 25.11  ? 303 VAL B O     1 
ATOM   6083 C  CB    . VAL B 1 309 ? -13.255 -25.146 -22.997 1.00 26.17  ? 303 VAL B CB    1 
ATOM   6084 C  CG1   . VAL B 1 309 ? -13.340 -26.441 -22.216 1.00 29.68  ? 303 VAL B CG1   1 
ATOM   6085 C  CG2   . VAL B 1 309 ? -14.432 -24.253 -22.660 1.00 24.37  ? 303 VAL B CG2   1 
ATOM   6086 N  N     . ASN B 1 310 ? -11.941 -22.028 -22.317 1.00 24.13  ? 304 ASN B N     1 
ATOM   6087 C  CA    . ASN B 1 310 ? -12.033 -20.613 -22.634 1.00 18.69  ? 304 ASN B CA    1 
ATOM   6088 C  C     . ASN B 1 310 ? -10.982 -19.899 -21.798 1.00 22.41  ? 304 ASN B C     1 
ATOM   6089 O  O     . ASN B 1 310 ? -11.202 -19.668 -20.608 1.00 23.08  ? 304 ASN B O     1 
ATOM   6090 C  CB    . ASN B 1 310 ? -13.404 -20.064 -22.233 1.00 17.77  ? 304 ASN B CB    1 
ATOM   6091 C  CG    . ASN B 1 310 ? -14.540 -20.635 -23.051 1.00 18.21  ? 304 ASN B CG    1 
ATOM   6092 O  OD1   . ASN B 1 310 ? -14.377 -20.978 -24.220 1.00 19.16  ? 304 ASN B OD1   1 
ATOM   6093 N  ND2   . ASN B 1 310 ? -15.716 -20.714 -22.440 1.00 20.51  ? 304 ASN B ND2   1 
ATOM   6094 N  N     . PRO B 1 311 ? -9.840  -19.544 -22.404 1.00 21.57  ? 305 PRO B N     1 
ATOM   6095 C  CA    . PRO B 1 311 ? -8.718  -18.981 -21.639 1.00 23.69  ? 305 PRO B CA    1 
ATOM   6096 C  C     . PRO B 1 311 ? -9.089  -17.728 -20.816 1.00 24.97  ? 305 PRO B C     1 
ATOM   6097 O  O     . PRO B 1 311 ? -8.514  -17.482 -19.754 1.00 18.71  ? 305 PRO B O     1 
ATOM   6098 C  CB    . PRO B 1 311 ? -7.702  -18.599 -22.728 1.00 17.06  ? 305 PRO B CB    1 
ATOM   6099 C  CG    . PRO B 1 311 ? -8.123  -19.312 -23.942 1.00 14.89  ? 305 PRO B CG    1 
ATOM   6100 C  CD    . PRO B 1 311 ? -9.599  -19.510 -23.853 1.00 18.05  ? 305 PRO B CD    1 
ATOM   6101 N  N     . SER B 1 312 ? -10.040 -16.937 -21.299 1.00 19.03  ? 306 SER B N     1 
ATOM   6102 C  CA    . SER B 1 312 ? -10.300 -15.672 -20.641 1.00 16.15  ? 306 SER B CA    1 
ATOM   6103 C  C     . SER B 1 312 ? -11.026 -15.857 -19.309 1.00 18.34  ? 306 SER B C     1 
ATOM   6104 O  O     . SER B 1 312 ? -10.881 -15.029 -18.406 1.00 19.56  ? 306 SER B O     1 
ATOM   6105 C  CB    . SER B 1 312 ? -11.035 -14.701 -21.567 1.00 12.20  ? 306 SER B CB    1 
ATOM   6106 O  OG    . SER B 1 312 ? -12.350 -15.128 -21.825 1.00 17.11  ? 306 SER B OG    1 
ATOM   6107 N  N     . ASP B 1 313 ? -11.782 -16.945 -19.171 1.00 16.87  ? 307 ASP B N     1 
ATOM   6108 C  CA    . ASP B 1 313 ? -12.492 -17.219 -17.918 1.00 16.36  ? 307 ASP B CA    1 
ATOM   6109 C  C     . ASP B 1 313 ? -11.546 -17.414 -16.743 1.00 15.07  ? 307 ASP B C     1 
ATOM   6110 O  O     . ASP B 1 313 ? -11.954 -17.343 -15.596 1.00 17.53  ? 307 ASP B O     1 
ATOM   6111 C  CB    . ASP B 1 313 ? -13.413 -18.428 -18.046 1.00 14.86  ? 307 ASP B CB    1 
ATOM   6112 C  CG    . ASP B 1 313 ? -14.671 -18.113 -18.812 1.00 20.74  ? 307 ASP B CG    1 
ATOM   6113 O  OD1   . ASP B 1 313 ? -15.022 -16.913 -18.936 1.00 22.28  ? 307 ASP B OD1   1 
ATOM   6114 O  OD2   . ASP B 1 313 ? -15.311 -19.068 -19.296 1.00 25.57  ? 307 ASP B OD2   1 
ATOM   6115 N  N     . ARG B 1 314 ? -10.275 -17.647 -17.036 1.00 15.98  ? 308 ARG B N     1 
ATOM   6116 C  CA    . ARG B 1 314 ? -9.254  -17.750 -16.005 1.00 14.89  ? 308 ARG B CA    1 
ATOM   6117 C  C     . ARG B 1 314 ? -9.062  -16.424 -15.266 1.00 9.51   ? 308 ARG B C     1 
ATOM   6118 O  O     . ARG B 1 314 ? -8.469  -16.394 -14.207 1.00 10.83  ? 308 ARG B O     1 
ATOM   6119 C  CB    . ARG B 1 314 ? -7.919  -18.219 -16.619 1.00 23.00  ? 308 ARG B CB    1 
ATOM   6120 C  CG    . ARG B 1 314 ? -7.999  -19.551 -17.423 1.00 29.60  ? 308 ARG B CG    1 
ATOM   6121 C  CD    . ARG B 1 314 ? -6.621  -20.059 -17.910 1.00 40.38  ? 308 ARG B CD    1 
ATOM   6122 N  NE    . ARG B 1 314 ? -6.185  -19.495 -19.196 1.00 45.77  ? 308 ARG B NE    1 
ATOM   6123 C  CZ    . ARG B 1 314 ? -5.343  -18.468 -19.338 1.00 43.64  ? 308 ARG B CZ    1 
ATOM   6124 N  NH1   . ARG B 1 314 ? -4.829  -17.862 -18.270 1.00 46.42  ? 308 ARG B NH1   1 
ATOM   6125 N  NH2   . ARG B 1 314 ? -5.014  -18.036 -20.552 1.00 33.56  ? 308 ARG B NH2   1 
ATOM   6126 N  N     . TYR B 1 315 ? -9.580  -15.335 -15.820 1.00 9.83   ? 309 TYR B N     1 
ATOM   6127 C  CA    . TYR B 1 315 ? -9.295  -14.011 -15.294 1.00 8.80   ? 309 TYR B CA    1 
ATOM   6128 C  C     . TYR B 1 315 ? -10.422 -13.433 -14.472 1.00 10.34  ? 309 TYR B C     1 
ATOM   6129 O  O     . TYR B 1 315 ? -10.393 -12.251 -14.144 1.00 14.15  ? 309 TYR B O     1 
ATOM   6130 C  CB    . TYR B 1 315 ? -8.955  -13.018 -16.418 1.00 13.03  ? 309 TYR B CB    1 
ATOM   6131 C  CG    . TYR B 1 315 ? -7.596  -13.223 -17.055 1.00 14.69  ? 309 TYR B CG    1 
ATOM   6132 C  CD1   . TYR B 1 315 ? -6.430  -12.876 -16.383 1.00 12.57  ? 309 TYR B CD1   1 
ATOM   6133 C  CD2   . TYR B 1 315 ? -7.479  -13.773 -18.329 1.00 15.23  ? 309 TYR B CD2   1 
ATOM   6134 C  CE1   . TYR B 1 315 ? -5.188  -13.085 -16.958 1.00 20.23  ? 309 TYR B CE1   1 
ATOM   6135 C  CE2   . TYR B 1 315 ? -6.243  -13.986 -18.909 1.00 15.94  ? 309 TYR B CE2   1 
ATOM   6136 C  CZ    . TYR B 1 315 ? -5.102  -13.642 -18.225 1.00 21.61  ? 309 TYR B CZ    1 
ATOM   6137 O  OH    . TYR B 1 315 ? -3.872  -13.856 -18.807 1.00 24.61  ? 309 TYR B OH    1 
ATOM   6138 N  N     . HIS B 1 316 ? -11.431 -14.227 -14.149 1.00 9.73   ? 310 HIS B N     1 
ATOM   6139 C  CA    . HIS B 1 316 ? -12.437 -13.745 -13.212 1.00 11.25  ? 310 HIS B CA    1 
ATOM   6140 C  C     . HIS B 1 316 ? -11.895 -13.944 -11.798 1.00 12.87  ? 310 HIS B C     1 
ATOM   6141 O  O     . HIS B 1 316 ? -11.306 -14.993 -11.511 1.00 11.98  ? 310 HIS B O     1 
ATOM   6142 C  CB    . HIS B 1 316 ? -13.753 -14.480 -13.410 1.00 13.57  ? 310 HIS B CB    1 
ATOM   6143 C  CG    . HIS B 1 316 ? -14.408 -14.198 -14.726 1.00 14.16  ? 310 HIS B CG    1 
ATOM   6144 N  ND1   . HIS B 1 316 ? -15.776 -14.145 -14.883 1.00 14.74  ? 310 HIS B ND1   1 
ATOM   6145 C  CD2   . HIS B 1 316 ? -13.882 -13.958 -15.947 1.00 12.83  ? 310 HIS B CD2   1 
ATOM   6146 C  CE1   . HIS B 1 316 ? -16.065 -13.883 -16.142 1.00 10.97  ? 310 HIS B CE1   1 
ATOM   6147 N  NE2   . HIS B 1 316 ? -14.933 -13.762 -16.808 1.00 16.63  ? 310 HIS B NE2   1 
ATOM   6148 N  N     . LEU B 1 317 ? -12.053 -12.949 -10.924 1.00 8.68   ? 311 LEU B N     1 
ATOM   6149 C  CA    . LEU B 1 317 ? -11.334 -13.000 -9.649  1.00 8.84   ? 311 LEU B CA    1 
ATOM   6150 C  C     . LEU B 1 317 ? -12.077 -13.730 -8.532  1.00 12.46  ? 311 LEU B C     1 
ATOM   6151 O  O     . LEU B 1 317 ? -11.458 -14.293 -7.630  1.00 14.50  ? 311 LEU B O     1 
ATOM   6152 C  CB    . LEU B 1 317 ? -10.952 -11.600 -9.181  1.00 7.38   ? 311 LEU B CB    1 
ATOM   6153 C  CG    . LEU B 1 317 ? -9.898  -10.887 -10.031 1.00 12.26  ? 311 LEU B CG    1 
ATOM   6154 C  CD1   . LEU B 1 317 ? -10.089 -9.377  -9.974  1.00 13.58  ? 311 LEU B CD1   1 
ATOM   6155 C  CD2   . LEU B 1 317 ? -8.476  -11.249 -9.611  1.00 9.51   ? 311 LEU B CD2   1 
ATOM   6156 N  N     . MET B 1 318 ? -13.403 -13.722 -8.613  1.00 10.58  ? 312 MET B N     1 
ATOM   6157 C  CA    . MET B 1 318 ? -14.274 -14.124 -7.518  1.00 9.14   ? 312 MET B CA    1 
ATOM   6158 C  C     . MET B 1 318 ? -15.518 -14.752 -8.126  1.00 10.60  ? 312 MET B C     1 
ATOM   6159 O  O     . MET B 1 318 ? -16.593 -14.151 -8.128  1.00 12.44  ? 312 MET B O     1 
ATOM   6160 C  CB    . MET B 1 318 ? -14.638 -12.874 -6.709  1.00 8.55   ? 312 MET B CB    1 
ATOM   6161 C  CG    . MET B 1 318 ? -15.570 -13.051 -5.522  1.00 7.53   ? 312 MET B CG    1 
ATOM   6162 S  SD    . MET B 1 318 ? -15.696 -11.506 -4.589  1.00 10.64  ? 312 MET B SD    1 
ATOM   6163 C  CE    . MET B 1 318 ? -17.061 -11.936 -3.512  1.00 8.53   ? 312 MET B CE    1 
ATOM   6164 N  N     . PRO B 1 319 ? -15.370 -15.960 -8.677  1.00 9.00   ? 313 PRO B N     1 
ATOM   6165 C  CA    . PRO B 1 319 ? -16.383 -16.554 -9.561  1.00 7.10   ? 313 PRO B CA    1 
ATOM   6166 C  C     . PRO B 1 319 ? -17.508 -17.171 -8.795  1.00 8.27   ? 313 PRO B C     1 
ATOM   6167 O  O     . PRO B 1 319 ? -17.261 -18.067 -8.003  1.00 11.58  ? 313 PRO B O     1 
ATOM   6168 C  CB    . PRO B 1 319 ? -15.621 -17.671 -10.282 1.00 8.12   ? 313 PRO B CB    1 
ATOM   6169 C  CG    . PRO B 1 319 ? -14.159 -17.397 -10.010 1.00 12.15  ? 313 PRO B CG    1 
ATOM   6170 C  CD    . PRO B 1 319 ? -14.128 -16.740 -8.659  1.00 11.08  ? 313 PRO B CD    1 
ATOM   6171 N  N     . ILE B 1 320 ? -18.729 -16.716 -9.028  1.00 9.92   ? 314 ILE B N     1 
ATOM   6172 C  CA    . ILE B 1 320 ? -19.889 -17.315 -8.376  1.00 11.39  ? 314 ILE B CA    1 
ATOM   6173 C  C     . ILE B 1 320 ? -20.894 -17.737 -9.432  1.00 12.83  ? 314 ILE B C     1 
ATOM   6174 O  O     . ILE B 1 320 ? -21.582 -16.895 -10.016 1.00 14.41  ? 314 ILE B O     1 
ATOM   6175 C  CB    . ILE B 1 320 ? -20.555 -16.335 -7.427  1.00 7.35   ? 314 ILE B CB    1 
ATOM   6176 C  CG1   . ILE B 1 320 ? -19.533 -15.775 -6.460  1.00 5.36   ? 314 ILE B CG1   1 
ATOM   6177 C  CG2   . ILE B 1 320 ? -21.642 -17.024 -6.653  1.00 8.20   ? 314 ILE B CG2   1 
ATOM   6178 C  CD1   . ILE B 1 320 ? -20.150 -14.876 -5.447  1.00 7.42   ? 314 ILE B CD1   1 
ATOM   6179 N  N     . ILE B 1 321 ? -20.996 -19.037 -9.673  1.00 8.61   ? 315 ILE B N     1 
ATOM   6180 C  CA    . ILE B 1 321 ? -21.614 -19.483 -10.914 1.00 10.61  ? 315 ILE B CA    1 
ATOM   6181 C  C     . ILE B 1 321 ? -23.121 -19.762 -10.931 1.00 14.67  ? 315 ILE B C     1 
ATOM   6182 O  O     . ILE B 1 321 ? -23.636 -20.609 -10.193 1.00 16.80  ? 315 ILE B O     1 
ATOM   6183 C  CB    . ILE B 1 321 ? -20.877 -20.691 -11.479 1.00 11.39  ? 315 ILE B CB    1 
ATOM   6184 C  CG1   . ILE B 1 321 ? -19.370 -20.432 -11.435 1.00 10.62  ? 315 ILE B CG1   1 
ATOM   6185 C  CG2   . ILE B 1 321 ? -21.381 -21.018 -12.886 1.00 9.64   ? 315 ILE B CG2   1 
ATOM   6186 C  CD1   . ILE B 1 321 ? -18.932 -19.207 -12.203 1.00 11.56  ? 315 ILE B CD1   1 
ATOM   6187 N  N     . THR B 1 322 ? -23.800 -19.045 -11.822 1.00 15.48  ? 316 THR B N     1 
ATOM   6188 C  CA    . THR B 1 322 ? -25.168 -19.326 -12.227 1.00 12.51  ? 316 THR B CA    1 
ATOM   6189 C  C     . THR B 1 322 ? -25.352 -20.804 -12.569 1.00 16.79  ? 316 THR B C     1 
ATOM   6190 O  O     . THR B 1 322 ? -24.590 -21.367 -13.352 1.00 19.90  ? 316 THR B O     1 
ATOM   6191 C  CB    . THR B 1 322 ? -25.546 -18.394 -13.379 1.00 12.36  ? 316 THR B CB    1 
ATOM   6192 O  OG1   . THR B 1 322 ? -26.318 -17.323 -12.834 1.00 18.48  ? 316 THR B OG1   1 
ATOM   6193 C  CG2   . THR B 1 322 ? -26.341 -19.085 -14.492 1.00 13.70  ? 316 THR B CG2   1 
ATOM   6194 N  N     . PRO B 1 323 ? -26.345 -21.449 -11.939 1.00 17.38  ? 317 PRO B N     1 
ATOM   6195 C  CA    . PRO B 1 323 ? -26.451 -22.908 -11.944 1.00 16.57  ? 317 PRO B CA    1 
ATOM   6196 C  C     . PRO B 1 323 ? -27.360 -23.495 -13.019 1.00 16.19  ? 317 PRO B C     1 
ATOM   6197 O  O     . PRO B 1 323 ? -27.316 -24.705 -13.218 1.00 19.92  ? 317 PRO B O     1 
ATOM   6198 C  CB    . PRO B 1 323 ? -27.028 -23.198 -10.561 1.00 15.34  ? 317 PRO B CB    1 
ATOM   6199 C  CG    . PRO B 1 323 ? -27.935 -22.058 -10.325 1.00 16.12  ? 317 PRO B CG    1 
ATOM   6200 C  CD    . PRO B 1 323 ? -27.259 -20.851 -10.952 1.00 19.54  ? 317 PRO B CD    1 
ATOM   6201 N  N     . ALA B 1 324 ? -28.161 -22.673 -13.687 1.00 18.20  ? 318 ALA B N     1 
ATOM   6202 C  CA    . ALA B 1 324 ? -29.024 -23.143 -14.781 1.00 17.77  ? 318 ALA B CA    1 
ATOM   6203 C  C     . ALA B 1 324 ? -28.319 -22.921 -16.087 1.00 15.13  ? 318 ALA B C     1 
ATOM   6204 O  O     . ALA B 1 324 ? -27.658 -21.903 -16.240 1.00 21.81  ? 318 ALA B O     1 
ATOM   6205 C  CB    . ALA B 1 324 ? -30.328 -22.382 -14.784 1.00 17.57  ? 318 ALA B CB    1 
ATOM   6206 N  N     . TYR B 1 325 ? -28.467 -23.846 -17.033 1.00 20.32  ? 319 TYR B N     1 
ATOM   6207 C  CA    . TYR B 1 325 ? -27.760 -23.757 -18.326 1.00 23.94  ? 319 TYR B CA    1 
ATOM   6208 C  C     . TYR B 1 325 ? -28.215 -22.557 -19.157 1.00 17.90  ? 319 TYR B C     1 
ATOM   6209 O  O     . TYR B 1 325 ? -29.406 -22.246 -19.201 1.00 18.37  ? 319 TYR B O     1 
ATOM   6210 C  CB    . TYR B 1 325 ? -27.926 -25.054 -19.138 1.00 24.20  ? 319 TYR B CB    1 
ATOM   6211 C  CG    . TYR B 1 325 ? -26.987 -25.197 -20.331 1.00 23.92  ? 319 TYR B CG    1 
ATOM   6212 C  CD1   . TYR B 1 325 ? -27.323 -24.687 -21.581 1.00 22.41  ? 319 TYR B CD1   1 
ATOM   6213 C  CD2   . TYR B 1 325 ? -25.770 -25.860 -20.207 1.00 26.65  ? 319 TYR B CD2   1 
ATOM   6214 C  CE1   . TYR B 1 325 ? -26.462 -24.822 -22.669 1.00 26.85  ? 319 TYR B CE1   1 
ATOM   6215 C  CE2   . TYR B 1 325 ? -24.907 -25.999 -21.287 1.00 25.23  ? 319 TYR B CE2   1 
ATOM   6216 C  CZ    . TYR B 1 325 ? -25.256 -25.479 -22.515 1.00 27.89  ? 319 TYR B CZ    1 
ATOM   6217 O  OH    . TYR B 1 325 ? -24.394 -25.617 -23.588 1.00 32.59  ? 319 TYR B OH    1 
ATOM   6218 N  N     . PRO B 1 326 ? -27.263 -21.871 -19.808 1.00 17.26  ? 320 PRO B N     1 
ATOM   6219 C  CA    . PRO B 1 326 ? -25.825 -22.137 -19.722 1.00 18.51  ? 320 PRO B CA    1 
ATOM   6220 C  C     . PRO B 1 326 ? -25.199 -21.376 -18.583 1.00 18.54  ? 320 PRO B C     1 
ATOM   6221 O  O     . PRO B 1 326 ? -25.436 -20.172 -18.448 1.00 15.70  ? 320 PRO B O     1 
ATOM   6222 C  CB    . PRO B 1 326 ? -25.294 -21.595 -21.052 1.00 22.28  ? 320 PRO B CB    1 
ATOM   6223 C  CG    . PRO B 1 326 ? -26.228 -20.498 -21.403 1.00 19.26  ? 320 PRO B CG    1 
ATOM   6224 C  CD    . PRO B 1 326 ? -27.578 -20.891 -20.864 1.00 21.11  ? 320 PRO B CD    1 
ATOM   6225 N  N     . GLN B 1 327 ? -24.399 -22.072 -17.784 1.00 19.14  ? 321 GLN B N     1 
ATOM   6226 C  CA    . GLN B 1 327 ? -23.757 -21.469 -16.622 1.00 16.38  ? 321 GLN B CA    1 
ATOM   6227 C  C     . GLN B 1 327 ? -22.910 -20.252 -16.995 1.00 17.99  ? 321 GLN B C     1 
ATOM   6228 O  O     . GLN B 1 327 ? -22.352 -20.174 -18.077 1.00 17.89  ? 321 GLN B O     1 
ATOM   6229 C  CB    . GLN B 1 327 ? -22.924 -22.494 -15.862 1.00 17.56  ? 321 GLN B CB    1 
ATOM   6230 C  CG    . GLN B 1 327 ? -22.669 -23.802 -16.605 1.00 28.80  ? 321 GLN B CG    1 
ATOM   6231 C  CD    . GLN B 1 327 ? -23.860 -24.763 -16.563 1.00 34.54  ? 321 GLN B CD    1 
ATOM   6232 O  OE1   . GLN B 1 327 ? -24.628 -24.861 -17.526 1.00 34.32  ? 321 GLN B OE1   1 
ATOM   6233 N  NE2   . GLN B 1 327 ? -24.012 -25.476 -15.447 1.00 29.94  ? 321 GLN B NE2   1 
ATOM   6234 N  N     . GLN B 1 328 ? -22.857 -19.281 -16.093 1.00 20.28  ? 322 GLN B N     1 
ATOM   6235 C  CA    . GLN B 1 328 ? -22.171 -18.021 -16.327 1.00 16.64  ? 322 GLN B CA    1 
ATOM   6236 C  C     . GLN B 1 328 ? -21.634 -17.533 -14.988 1.00 14.05  ? 322 GLN B C     1 
ATOM   6237 O  O     . GLN B 1 328 ? -22.213 -17.824 -13.942 1.00 12.13  ? 322 GLN B O     1 
ATOM   6238 C  CB    . GLN B 1 328 ? -23.149 -16.977 -16.878 1.00 14.59  ? 322 GLN B CB    1 
ATOM   6239 C  CG    . GLN B 1 328 ? -24.020 -17.444 -18.040 1.00 20.17  ? 322 GLN B CG    1 
ATOM   6240 C  CD    . GLN B 1 328 ? -23.252 -17.592 -19.358 1.00 27.67  ? 322 GLN B CD    1 
ATOM   6241 O  OE1   . GLN B 1 328 ? -22.065 -17.274 -19.443 1.00 26.04  ? 322 GLN B OE1   1 
ATOM   6242 N  NE2   . GLN B 1 328 ? -23.938 -18.071 -20.394 1.00 33.21  ? 322 GLN B NE2   1 
ATOM   6243 N  N     . ASN B 1 329 ? -20.530 -16.799 -15.002 1.00 11.71  ? 323 ASN B N     1 
ATOM   6244 C  CA    . ASN B 1 329 ? -20.129 -16.135 -13.786 1.00 9.93   ? 323 ASN B CA    1 
ATOM   6245 C  C     . ASN B 1 329 ? -21.074 -14.964 -13.565 1.00 15.02  ? 323 ASN B C     1 
ATOM   6246 O  O     . ASN B 1 329 ? -21.592 -14.380 -14.525 1.00 17.68  ? 323 ASN B O     1 
ATOM   6247 C  CB    . ASN B 1 329 ? -18.689 -15.656 -13.845 1.00 9.82   ? 323 ASN B CB    1 
ATOM   6248 C  CG    . ASN B 1 329 ? -18.206 -15.161 -12.506 1.00 13.24  ? 323 ASN B CG    1 
ATOM   6249 O  OD1   . ASN B 1 329 ? -18.711 -15.595 -11.469 1.00 13.43  ? 323 ASN B OD1   1 
ATOM   6250 N  ND2   . ASN B 1 329 ? -17.233 -14.248 -12.507 1.00 12.58  ? 323 ASN B ND2   1 
ATOM   6251 N  N     . SER B 1 330 ? -21.327 -14.631 -12.305 1.00 15.23  ? 324 SER B N     1 
ATOM   6252 C  CA    . SER B 1 330 ? -22.288 -13.587 -11.987 1.00 12.44  ? 324 SER B CA    1 
ATOM   6253 C  C     . SER B 1 330 ? -21.587 -12.342 -11.515 1.00 12.39  ? 324 SER B C     1 
ATOM   6254 O  O     . SER B 1 330 ? -22.211 -11.298 -11.362 1.00 19.31  ? 324 SER B O     1 
ATOM   6255 C  CB    . SER B 1 330 ? -23.226 -14.053 -10.894 1.00 11.85  ? 324 SER B CB    1 
ATOM   6256 O  OG    . SER B 1 330 ? -22.581 -13.998 -9.640  1.00 9.95   ? 324 SER B OG    1 
ATOM   6257 N  N     . THR B 1 331 ? -20.287 -12.451 -11.290 1.00 10.05  ? 325 THR B N     1 
ATOM   6258 C  CA    . THR B 1 331 ? -19.530 -11.364 -10.690 1.00 15.36  ? 325 THR B CA    1 
ATOM   6259 C  C     . THR B 1 331 ? -18.438 -10.845 -11.611 1.00 17.78  ? 325 THR B C     1 
ATOM   6260 O  O     . THR B 1 331 ? -17.332 -10.559 -11.154 1.00 14.47  ? 325 THR B O     1 
ATOM   6261 C  CB    . THR B 1 331 ? -18.843 -11.826 -9.403  1.00 15.86  ? 325 THR B CB    1 
ATOM   6262 O  OG1   . THR B 1 331 ? -18.127 -13.047 -9.661  1.00 13.35  ? 325 THR B OG1   1 
ATOM   6263 C  CG2   . THR B 1 331 ? -19.860 -12.037 -8.278  1.00 11.01  ? 325 THR B CG2   1 
ATOM   6264 N  N     . TYR B 1 332 ? -18.752 -10.721 -12.899 1.00 17.39  ? 326 TYR B N     1 
ATOM   6265 C  CA    . TYR B 1 332 ? -17.776 -10.330 -13.921 1.00 16.57  ? 326 TYR B CA    1 
ATOM   6266 C  C     . TYR B 1 332 ? -17.233 -8.903  -13.747 1.00 19.15  ? 326 TYR B C     1 
ATOM   6267 O  O     . TYR B 1 332 ? -16.233 -8.541  -14.379 1.00 18.37  ? 326 TYR B O     1 
ATOM   6268 C  CB    . TYR B 1 332 ? -18.400 -10.469 -15.307 1.00 15.79  ? 326 TYR B CB    1 
ATOM   6269 C  CG    . TYR B 1 332 ? -19.735 -9.798  -15.356 1.00 24.98  ? 326 TYR B CG    1 
ATOM   6270 C  CD1   . TYR B 1 332 ? -20.891 -10.467 -14.933 1.00 31.32  ? 326 TYR B CD1   1 
ATOM   6271 C  CD2   . TYR B 1 332 ? -19.850 -8.468  -15.767 1.00 28.03  ? 326 TYR B CD2   1 
ATOM   6272 C  CE1   . TYR B 1 332 ? -22.143 -9.829  -14.941 1.00 36.33  ? 326 TYR B CE1   1 
ATOM   6273 C  CE2   . TYR B 1 332 ? -21.098 -7.815  -15.779 1.00 33.58  ? 326 TYR B CE2   1 
ATOM   6274 C  CZ    . TYR B 1 332 ? -22.239 -8.503  -15.368 1.00 36.53  ? 326 TYR B CZ    1 
ATOM   6275 O  OH    . TYR B 1 332 ? -23.464 -7.868  -15.380 1.00 35.09  ? 326 TYR B OH    1 
ATOM   6276 N  N     . ASN B 1 333 ? -17.885 -8.095  -12.907 1.00 12.80  ? 327 ASN B N     1 
ATOM   6277 C  CA    . ASN B 1 333 ? -17.465 -6.715  -12.712 1.00 8.55   ? 327 ASN B CA    1 
ATOM   6278 C  C     . ASN B 1 333 ? -16.521 -6.576  -11.540 1.00 10.45  ? 327 ASN B C     1 
ATOM   6279 O  O     . ASN B 1 333 ? -16.118 -5.473  -11.187 1.00 11.78  ? 327 ASN B O     1 
ATOM   6280 C  CB    . ASN B 1 333 ? -18.659 -5.795  -12.496 1.00 9.10   ? 327 ASN B CB    1 
ATOM   6281 C  CG    . ASN B 1 333 ? -19.369 -5.440  -13.780 1.00 13.41  ? 327 ASN B CG    1 
ATOM   6282 O  OD1   . ASN B 1 333 ? -18.762 -5.365  -14.846 1.00 19.96  ? 327 ASN B OD1   1 
ATOM   6283 N  ND2   . ASN B 1 333 ? -20.668 -5.214  -13.687 1.00 14.22  ? 327 ASN B ND2   1 
ATOM   6284 N  N     . VAL B 1 334 ? -16.157 -7.686  -10.922 1.00 8.53   ? 328 VAL B N     1 
ATOM   6285 C  CA    . VAL B 1 334 ? -15.281 -7.596  -9.770  1.00 7.80   ? 328 VAL B CA    1 
ATOM   6286 C  C     . VAL B 1 334 ? -13.821 -7.430  -10.145 1.00 9.54   ? 328 VAL B C     1 
ATOM   6287 O  O     . VAL B 1 334 ? -13.246 -8.256  -10.841 1.00 11.37  ? 328 VAL B O     1 
ATOM   6288 C  CB    . VAL B 1 334 ? -15.432 -8.792  -8.848  1.00 7.72   ? 328 VAL B CB    1 
ATOM   6289 C  CG1   . VAL B 1 334 ? -14.375 -8.746  -7.760  1.00 7.83   ? 328 VAL B CG1   1 
ATOM   6290 C  CG2   . VAL B 1 334 ? -16.817 -8.789  -8.244  1.00 11.81  ? 328 VAL B CG2   1 
ATOM   6291 N  N     . SER B 1 335 ? -13.233 -6.347  -9.660  1.00 8.19   ? 329 SER B N     1 
ATOM   6292 C  CA    . SER B 1 335 ? -11.814 -6.096  -9.800  1.00 7.78   ? 329 SER B CA    1 
ATOM   6293 C  C     . SER B 1 335 ? -11.095 -6.485  -8.528  1.00 10.73  ? 329 SER B C     1 
ATOM   6294 O  O     . SER B 1 335 ? -11.736 -6.737  -7.509  1.00 12.82  ? 329 SER B O     1 
ATOM   6295 C  CB    . SER B 1 335 ? -11.622 -4.614  -9.965  1.00 8.35   ? 329 SER B CB    1 
ATOM   6296 O  OG    . SER B 1 335 ? -11.967 -3.975  -8.761  1.00 8.83   ? 329 SER B OG    1 
ATOM   6297 N  N     . THR B 1 336 ? -9.765  -6.493  -8.560  1.00 12.04  ? 330 THR B N     1 
ATOM   6298 C  CA    . THR B 1 336 ? -8.999  -6.849  -7.361  1.00 12.50  ? 330 THR B CA    1 
ATOM   6299 C  C     . THR B 1 336 ? -9.302  -5.934  -6.186  1.00 15.20  ? 330 THR B C     1 
ATOM   6300 O  O     . THR B 1 336 ? -9.273  -6.373  -5.030  1.00 20.25  ? 330 THR B O     1 
ATOM   6301 C  CB    . THR B 1 336 ? -7.463  -6.861  -7.576  1.00 10.81  ? 330 THR B CB    1 
ATOM   6302 O  OG1   . THR B 1 336 ? -6.969  -5.524  -7.743  1.00 7.09   ? 330 THR B OG1   1 
ATOM   6303 C  CG2   . THR B 1 336 ? -7.082  -7.758  -8.754  1.00 13.35  ? 330 THR B CG2   1 
ATOM   6304 N  N     . SER B 1 337 ? -9.578  -4.667  -6.477  1.00 12.22  ? 331 SER B N     1 
ATOM   6305 C  CA    . SER B 1 337 ? -9.923  -3.725  -5.420  1.00 12.44  ? 331 SER B CA    1 
ATOM   6306 C  C     . SER B 1 337 ? -11.152 -4.191  -4.672  1.00 10.15  ? 331 SER B C     1 
ATOM   6307 O  O     . SER B 1 337 ? -11.077 -4.573  -3.511  1.00 15.11  ? 331 SER B O     1 
ATOM   6308 C  CB    . SER B 1 337 ? -10.173 -2.330  -5.986  1.00 11.94  ? 331 SER B CB    1 
ATOM   6309 O  OG    . SER B 1 337 ? -8.960  -1.651  -6.219  1.00 13.90  ? 331 SER B OG    1 
ATOM   6310 N  N     . THR B 1 338 ? -12.292 -4.169  -5.337  1.00 8.60   ? 332 THR B N     1 
ATOM   6311 C  CA    . THR B 1 338 ? -13.516 -4.537  -4.657  1.00 11.11  ? 332 THR B CA    1 
ATOM   6312 C  C     . THR B 1 338 ? -13.468 -5.945  -4.029  1.00 13.57  ? 332 THR B C     1 
ATOM   6313 O  O     . THR B 1 338 ? -14.108 -6.200  -3.010  1.00 17.51  ? 332 THR B O     1 
ATOM   6314 C  CB    . THR B 1 338 ? -14.747 -4.364  -5.557  1.00 8.15   ? 332 THR B CB    1 
ATOM   6315 O  OG1   . THR B 1 338 ? -14.683 -5.281  -6.659  1.00 6.99   ? 332 THR B OG1   1 
ATOM   6316 C  CG2   . THR B 1 338 ? -14.847 -2.914  -6.046  1.00 6.74   ? 332 THR B CG2   1 
ATOM   6317 N  N     . ARG B 1 339 ? -12.697 -6.856  -4.602  1.00 12.34  ? 333 ARG B N     1 
ATOM   6318 C  CA    . ARG B 1 339 ? -12.603 -8.175  -3.997  1.00 13.03  ? 333 ARG B CA    1 
ATOM   6319 C  C     . ARG B 1 339 ? -11.880 -8.060  -2.669  1.00 13.92  ? 333 ARG B C     1 
ATOM   6320 O  O     . ARG B 1 339 ? -12.311 -8.633  -1.676  1.00 16.52  ? 333 ARG B O     1 
ATOM   6321 C  CB    . ARG B 1 339 ? -11.880 -9.144  -4.916  1.00 13.33  ? 333 ARG B CB    1 
ATOM   6322 C  CG    . ARG B 1 339 ? -11.588 -10.500 -4.314  1.00 10.51  ? 333 ARG B CG    1 
ATOM   6323 C  CD    . ARG B 1 339 ? -10.125 -10.824 -4.571  1.00 15.76  ? 333 ARG B CD    1 
ATOM   6324 N  NE    . ARG B 1 339 ? -9.884  -11.936 -5.491  1.00 9.44   ? 333 ARG B NE    1 
ATOM   6325 C  CZ    . ARG B 1 339 ? -8.686  -12.171 -6.013  1.00 9.13   ? 333 ARG B CZ    1 
ATOM   6326 N  NH1   . ARG B 1 339 ? -7.679  -11.364 -5.714  1.00 10.12  ? 333 ARG B NH1   1 
ATOM   6327 N  NH2   . ARG B 1 339 ? -8.486  -13.191 -6.827  1.00 11.67  ? 333 ARG B NH2   1 
ATOM   6328 N  N     . THR B 1 340 ? -10.791 -7.299  -2.654  1.00 14.78  ? 334 THR B N     1 
ATOM   6329 C  CA    . THR B 1 340 ? -10.016 -7.095  -1.434  1.00 15.68  ? 334 THR B CA    1 
ATOM   6330 C  C     . THR B 1 340 ? -10.909 -6.520  -0.335  1.00 17.62  ? 334 THR B C     1 
ATOM   6331 O  O     . THR B 1 340 ? -10.940 -7.039  0.789   1.00 17.06  ? 334 THR B O     1 
ATOM   6332 C  CB    . THR B 1 340 ? -8.785  -6.186  -1.685  1.00 12.46  ? 334 THR B CB    1 
ATOM   6333 O  OG1   . THR B 1 340 ? -7.698  -6.982  -2.174  1.00 13.82  ? 334 THR B OG1   1 
ATOM   6334 C  CG2   . THR B 1 340 ? -8.343  -5.494  -0.416  1.00 6.26   ? 334 THR B CG2   1 
ATOM   6335 N  N     . VAL B 1 341 ? -11.657 -5.478  -0.686  1.00 13.25  ? 335 VAL B N     1 
ATOM   6336 C  CA    . VAL B 1 341 ? -12.559 -4.805  0.236   1.00 11.92  ? 335 VAL B CA    1 
ATOM   6337 C  C     . VAL B 1 341 ? -13.600 -5.770  0.776   1.00 12.60  ? 335 VAL B C     1 
ATOM   6338 O  O     . VAL B 1 341 ? -13.948 -5.739  1.949   1.00 17.62  ? 335 VAL B O     1 
ATOM   6339 C  CB    . VAL B 1 341 ? -13.257 -3.642  -0.477  1.00 12.59  ? 335 VAL B CB    1 
ATOM   6340 C  CG1   . VAL B 1 341 ? -14.473 -3.184  0.287   1.00 10.97  ? 335 VAL B CG1   1 
ATOM   6341 C  CG2   . VAL B 1 341 ? -12.285 -2.505  -0.693  1.00 10.69  ? 335 VAL B CG2   1 
ATOM   6342 N  N     . MET B 1 342 ? -14.074 -6.656  -0.079  1.00 12.35  ? 336 MET B N     1 
ATOM   6343 C  CA    . MET B 1 342 ? -15.073 -7.624  0.341   1.00 13.95  ? 336 MET B CA    1 
ATOM   6344 C  C     . MET B 1 342 ? -14.517 -8.743  1.210   1.00 16.84  ? 336 MET B C     1 
ATOM   6345 O  O     . MET B 1 342 ? -15.186 -9.206  2.129   1.00 20.01  ? 336 MET B O     1 
ATOM   6346 C  CB    . MET B 1 342 ? -15.768 -8.229  -0.867  1.00 9.92   ? 336 MET B CB    1 
ATOM   6347 C  CG    . MET B 1 342 ? -16.843 -7.370  -1.448  1.00 6.22   ? 336 MET B CG    1 
ATOM   6348 S  SD    . MET B 1 342 ? -17.401 -8.145  -2.959  1.00 9.39   ? 336 MET B SD    1 
ATOM   6349 C  CE    . MET B 1 342 ? -19.113 -7.677  -2.878  1.00 14.41  ? 336 MET B CE    1 
ATOM   6350 N  N     . VAL B 1 343 ? -13.309 -9.207  0.914   1.00 17.22  ? 337 VAL B N     1 
ATOM   6351 C  CA    . VAL B 1 343 ? -12.734 -10.286 1.704   1.00 14.05  ? 337 VAL B CA    1 
ATOM   6352 C  C     . VAL B 1 343 ? -12.570 -9.785  3.138   1.00 16.11  ? 337 VAL B C     1 
ATOM   6353 O  O     . VAL B 1 343 ? -12.762 -10.522 4.098   1.00 17.23  ? 337 VAL B O     1 
ATOM   6354 C  CB    . VAL B 1 343 ? -11.397 -10.777 1.108   1.00 14.55  ? 337 VAL B CB    1 
ATOM   6355 C  CG1   . VAL B 1 343 ? -10.716 -11.746 2.040   1.00 13.38  ? 337 VAL B CG1   1 
ATOM   6356 C  CG2   . VAL B 1 343 ? -11.628 -11.432 -0.247  1.00 10.93  ? 337 VAL B CG2   1 
ATOM   6357 N  N     . GLU B 1 344 ? -12.259 -8.503  3.275   1.00 20.16  ? 338 GLU B N     1 
ATOM   6358 C  CA    . GLU B 1 344 ? -12.082 -7.904  4.586   1.00 17.77  ? 338 GLU B CA    1 
ATOM   6359 C  C     . GLU B 1 344 ? -13.398 -7.833  5.337   1.00 21.61  ? 338 GLU B C     1 
ATOM   6360 O  O     . GLU B 1 344 ? -13.431 -8.011  6.555   1.00 22.73  ? 338 GLU B O     1 
ATOM   6361 C  CB    . GLU B 1 344 ? -11.505 -6.508  4.442   1.00 19.61  ? 338 GLU B CB    1 
ATOM   6362 C  CG    . GLU B 1 344 ? -10.116 -6.390  4.988   1.00 30.51  ? 338 GLU B CG    1 
ATOM   6363 C  CD    . GLU B 1 344 ? -10.096 -6.500  6.487   1.00 34.10  ? 338 GLU B CD    1 
ATOM   6364 O  OE1   . GLU B 1 344 ? -10.405 -5.483  7.155   1.00 29.33  ? 338 GLU B OE1   1 
ATOM   6365 O  OE2   . GLU B 1 344 ? -9.785  -7.607  6.989   1.00 38.48  ? 338 GLU B OE2   1 
ATOM   6366 N  N     . GLU B 1 345 ? -14.483 -7.570  4.611   1.00 21.35  ? 339 GLU B N     1 
ATOM   6367 C  CA    . GLU B 1 345 ? -15.801 -7.448  5.232   1.00 18.25  ? 339 GLU B CA    1 
ATOM   6368 C  C     . GLU B 1 345 ? -16.344 -8.796  5.683   1.00 17.16  ? 339 GLU B C     1 
ATOM   6369 O  O     . GLU B 1 345 ? -17.070 -8.864  6.674   1.00 20.31  ? 339 GLU B O     1 
ATOM   6370 C  CB    . GLU B 1 345 ? -16.797 -6.755  4.301   1.00 15.07  ? 339 GLU B CB    1 
ATOM   6371 C  CG    . GLU B 1 345 ? -16.394 -5.351  3.927   1.00 16.32  ? 339 GLU B CG    1 
ATOM   6372 C  CD    . GLU B 1 345 ? -16.381 -4.417  5.116   1.00 25.94  ? 339 GLU B CD    1 
ATOM   6373 O  OE1   . GLU B 1 345 ? -17.118 -4.700  6.083   1.00 24.25  ? 339 GLU B OE1   1 
ATOM   6374 O  OE2   . GLU B 1 345 ? -15.637 -3.404  5.088   1.00 40.18  ? 339 GLU B OE2   1 
ATOM   6375 N  N     . PHE B 1 346 ? -15.991 -9.858  4.961   1.00 13.96  ? 340 PHE B N     1 
ATOM   6376 C  CA    . PHE B 1 346 ? -16.392 -11.205 5.340   1.00 11.71  ? 340 PHE B CA    1 
ATOM   6377 C  C     . PHE B 1 346 ? -15.709 -11.562 6.653   1.00 13.76  ? 340 PHE B C     1 
ATOM   6378 O  O     . PHE B 1 346 ? -16.310 -12.183 7.514   1.00 15.95  ? 340 PHE B O     1 
ATOM   6379 C  CB    . PHE B 1 346 ? -15.968 -12.225 4.283   1.00 12.17  ? 340 PHE B CB    1 
ATOM   6380 C  CG    . PHE B 1 346 ? -16.857 -12.289 3.074   1.00 12.60  ? 340 PHE B CG    1 
ATOM   6381 C  CD1   . PHE B 1 346 ? -18.231 -12.163 3.185   1.00 14.98  ? 340 PHE B CD1   1 
ATOM   6382 C  CD2   . PHE B 1 346 ? -16.311 -12.511 1.819   1.00 12.42  ? 340 PHE B CD2   1 
ATOM   6383 C  CE1   . PHE B 1 346 ? -19.045 -12.236 2.062   1.00 10.40  ? 340 PHE B CE1   1 
ATOM   6384 C  CE2   . PHE B 1 346 ? -17.109 -12.579 0.704   1.00 9.39   ? 340 PHE B CE2   1 
ATOM   6385 C  CZ    . PHE B 1 346 ? -18.476 -12.441 0.823   1.00 11.52  ? 340 PHE B CZ    1 
ATOM   6386 N  N     . LYS B 1 347 ? -14.442 -11.184 6.796   1.00 13.69  ? 341 LYS B N     1 
ATOM   6387 C  CA    . LYS B 1 347 ? -13.697 -11.475 8.016   1.00 17.10  ? 341 LYS B CA    1 
ATOM   6388 C  C     . LYS B 1 347 ? -14.214 -10.657 9.189   1.00 19.03  ? 341 LYS B C     1 
ATOM   6389 O  O     . LYS B 1 347 ? -14.474 -11.198 10.264  1.00 15.63  ? 341 LYS B O     1 
ATOM   6390 C  CB    . LYS B 1 347 ? -12.200 -11.220 7.836   1.00 18.95  ? 341 LYS B CB    1 
ATOM   6391 C  CG    . LYS B 1 347 ? -11.509 -12.244 6.953   1.00 27.82  ? 341 LYS B CG    1 
ATOM   6392 C  CD    . LYS B 1 347 ? -10.002 -12.018 6.904   1.00 39.15  ? 341 LYS B CD    1 
ATOM   6393 C  CE    . LYS B 1 347 ? -9.372  -12.753 5.718   1.00 32.96  ? 341 LYS B CE    1 
ATOM   6394 N  NZ    . LYS B 1 347 ? -8.050  -12.152 5.363   1.00 32.57  ? 341 LYS B NZ    1 
ATOM   6395 N  N     . GLN B 1 348 ? -14.361 -9.354  8.985   1.00 15.52  ? 342 GLN B N     1 
ATOM   6396 C  CA    . GLN B 1 348 ? -14.920 -8.519  10.023  1.00 16.93  ? 342 GLN B CA    1 
ATOM   6397 C  C     . GLN B 1 348 ? -16.307 -9.007  10.427  1.00 16.46  ? 342 GLN B C     1 
ATOM   6398 O  O     . GLN B 1 348 ? -16.705 -8.859  11.575  1.00 21.78  ? 342 GLN B O     1 
ATOM   6399 C  CB    . GLN B 1 348 ? -14.969 -7.061  9.587   1.00 21.34  ? 342 GLN B CB    1 
ATOM   6400 C  CG    . GLN B 1 348 ? -14.008 -6.154  10.358  1.00 31.06  ? 342 GLN B CG    1 
ATOM   6401 C  CD    . GLN B 1 348 ? -12.704 -5.932  9.624   0.50 25.31  ? 342 GLN B CD    1 
ATOM   6402 O  OE1   . GLN B 1 348 ? -11.819 -6.789  9.642   0.50 24.63  ? 342 GLN B OE1   1 
ATOM   6403 N  NE2   . GLN B 1 348 ? -12.579 -4.780  8.965   0.50 19.65  ? 342 GLN B NE2   1 
ATOM   6404 N  N     . GLY B 1 349 ? -17.034 -9.599  9.489   1.00 13.16  ? 343 GLY B N     1 
ATOM   6405 C  CA    . GLY B 1 349 ? -18.332 -10.174 9.783   1.00 12.20  ? 343 GLY B CA    1 
ATOM   6406 C  C     . GLY B 1 349 ? -18.245 -11.413 10.660  1.00 17.11  ? 343 GLY B C     1 
ATOM   6407 O  O     . GLY B 1 349 ? -19.023 -11.582 11.604  1.00 17.42  ? 343 GLY B O     1 
ATOM   6408 N  N     . LEU B 1 350 ? -17.295 -12.291 10.358  1.00 16.38  ? 344 LEU B N     1 
ATOM   6409 C  CA    . LEU B 1 350 ? -17.090 -13.486 11.171  1.00 15.08  ? 344 LEU B CA    1 
ATOM   6410 C  C     . LEU B 1 350 ? -16.689 -13.120 12.587  1.00 15.01  ? 344 LEU B C     1 
ATOM   6411 O  O     . LEU B 1 350 ? -17.026 -13.816 13.537  1.00 18.83  ? 344 LEU B O     1 
ATOM   6412 C  CB    . LEU B 1 350 ? -16.004 -14.370 10.568  1.00 17.75  ? 344 LEU B CB    1 
ATOM   6413 C  CG    . LEU B 1 350 ? -15.489 -15.524 11.434  1.00 15.72  ? 344 LEU B CG    1 
ATOM   6414 C  CD1   . LEU B 1 350 ? -16.451 -16.670 11.332  1.00 13.55  ? 344 LEU B CD1   1 
ATOM   6415 C  CD2   . LEU B 1 350 ? -14.068 -15.945 11.044  1.00 13.08  ? 344 LEU B CD2   1 
ATOM   6416 N  N     . ALA B 1 351 ? -15.953 -12.029 12.722  1.00 15.74  ? 345 ALA B N     1 
ATOM   6417 C  CA    . ALA B 1 351 ? -15.448 -11.644 14.021  1.00 14.45  ? 345 ALA B CA    1 
ATOM   6418 C  C     . ALA B 1 351 ? -16.643 -11.289 14.860  1.00 18.37  ? 345 ALA B C     1 
ATOM   6419 O  O     . ALA B 1 351 ? -16.762 -11.741 15.998  1.00 23.73  ? 345 ALA B O     1 
ATOM   6420 C  CB    . ALA B 1 351 ? -14.510 -10.479 13.910  1.00 10.24  ? 345 ALA B CB    1 
ATOM   6421 N  N     . VAL B 1 352 ? -17.551 -10.522 14.262  1.00 16.04  ? 346 VAL B N     1 
ATOM   6422 C  CA    . VAL B 1 352 ? -18.722 -10.011 14.965  1.00 14.95  ? 346 VAL B CA    1 
ATOM   6423 C  C     . VAL B 1 352 ? -19.727 -11.107 15.297  1.00 18.68  ? 346 VAL B C     1 
ATOM   6424 O  O     . VAL B 1 352 ? -20.108 -11.265 16.459  1.00 21.12  ? 346 VAL B O     1 
ATOM   6425 C  CB    . VAL B 1 352 ? -19.425 -8.905  14.177  1.00 13.45  ? 346 VAL B CB    1 
ATOM   6426 C  CG1   . VAL B 1 352 ? -20.702 -8.514  14.870  1.00 14.00  ? 346 VAL B CG1   1 
ATOM   6427 C  CG2   . VAL B 1 352 ? -18.510 -7.700  14.017  1.00 11.48  ? 346 VAL B CG2   1 
ATOM   6428 N  N     . THR B 1 353 ? -20.151 -11.875 14.299  1.00 16.50  ? 347 THR B N     1 
ATOM   6429 C  CA    . THR B 1 353 ? -21.147 -12.905 14.567  1.00 15.68  ? 347 THR B CA    1 
ATOM   6430 C  C     . THR B 1 353 ? -20.635 -13.896 15.606  1.00 17.76  ? 347 THR B C     1 
ATOM   6431 O  O     . THR B 1 353 ? -21.417 -14.425 16.394  1.00 19.74  ? 347 THR B O     1 
ATOM   6432 C  CB    . THR B 1 353 ? -21.624 -13.639 13.290  1.00 12.21  ? 347 THR B CB    1 
ATOM   6433 O  OG1   . THR B 1 353 ? -20.580 -14.475 12.787  1.00 13.92  ? 347 THR B OG1   1 
ATOM   6434 C  CG2   . THR B 1 353 ? -22.022 -12.647 12.229  1.00 12.59  ? 347 THR B CG2   1 
ATOM   6435 N  N     . ASP B 1 354 ? -19.323 -14.120 15.623  1.00 17.91  ? 348 ASP B N     1 
ATOM   6436 C  CA    . ASP B 1 354 ? -18.710 -15.011 16.598  1.00 20.66  ? 348 ASP B CA    1 
ATOM   6437 C  C     . ASP B 1 354 ? -19.000 -14.512 18.008  1.00 23.29  ? 348 ASP B C     1 
ATOM   6438 O  O     . ASP B 1 354 ? -19.327 -15.283 18.919  1.00 20.64  ? 348 ASP B O     1 
ATOM   6439 C  CB    . ASP B 1 354 ? -17.202 -15.065 16.387  1.00 24.18  ? 348 ASP B CB    1 
ATOM   6440 C  CG    . ASP B 1 354 ? -16.555 -16.192 17.156  1.00 34.25  ? 348 ASP B CG    1 
ATOM   6441 O  OD1   . ASP B 1 354 ? -17.029 -17.337 17.005  1.00 43.27  ? 348 ASP B OD1   1 
ATOM   6442 O  OD2   . ASP B 1 354 ? -15.587 -15.943 17.912  1.00 31.60  ? 348 ASP B OD2   1 
ATOM   6443 N  N     . GLU B 1 355 ? -18.878 -13.203 18.174  1.00 18.99  ? 349 GLU B N     1 
ATOM   6444 C  CA    . GLU B 1 355 ? -19.184 -12.577 19.441  1.00 23.77  ? 349 GLU B CA    1 
ATOM   6445 C  C     . GLU B 1 355 ? -20.648 -12.802 19.811  1.00 22.98  ? 349 GLU B C     1 
ATOM   6446 O  O     . GLU B 1 355 ? -20.945 -13.271 20.900  1.00 23.09  ? 349 GLU B O     1 
ATOM   6447 C  CB    . GLU B 1 355 ? -18.864 -11.083 19.384  1.00 23.88  ? 349 GLU B CB    1 
ATOM   6448 C  CG    . GLU B 1 355 ? -17.388 -10.765 19.175  1.00 23.96  ? 349 GLU B CG    1 
ATOM   6449 C  CD    . GLU B 1 355 ? -17.131 -9.277  18.982  1.00 26.30  ? 349 GLU B CD    1 
ATOM   6450 O  OE1   . GLU B 1 355 ? -15.945 -8.886  18.887  1.00 33.41  ? 349 GLU B OE1   1 
ATOM   6451 O  OE2   . GLU B 1 355 ? -18.115 -8.500  18.929  1.00 23.95  ? 349 GLU B OE2   1 
ATOM   6452 N  N     . ILE B 1 356 ? -21.549 -12.478 18.889  1.00 22.64  ? 350 ILE B N     1 
ATOM   6453 C  CA    . ILE B 1 356 ? -22.988 -12.567 19.121  1.00 19.26  ? 350 ILE B CA    1 
ATOM   6454 C  C     . ILE B 1 356 ? -23.441 -13.936 19.601  1.00 21.60  ? 350 ILE B C     1 
ATOM   6455 O  O     . ILE B 1 356 ? -24.292 -14.040 20.496  1.00 21.81  ? 350 ILE B O     1 
ATOM   6456 C  CB    . ILE B 1 356 ? -23.754 -12.249 17.842  1.00 20.21  ? 350 ILE B CB    1 
ATOM   6457 C  CG1   . ILE B 1 356 ? -23.457 -10.832 17.387  1.00 16.76  ? 350 ILE B CG1   1 
ATOM   6458 C  CG2   . ILE B 1 356 ? -25.246 -12.405 18.049  1.00 20.35  ? 350 ILE B CG2   1 
ATOM   6459 C  CD1   . ILE B 1 356 ? -23.981 -10.572 16.029  1.00 17.65  ? 350 ILE B CD1   1 
ATOM   6460 N  N     . LEU B 1 357 ? -22.861 -14.978 19.010  1.00 20.08  ? 351 LEU B N     1 
ATOM   6461 C  CA    . LEU B 1 357 ? -23.244 -16.348 19.323  1.00 19.24  ? 351 LEU B CA    1 
ATOM   6462 C  C     . LEU B 1 357 ? -22.640 -16.862 20.637  1.00 24.66  ? 351 LEU B C     1 
ATOM   6463 O  O     . LEU B 1 357 ? -23.031 -17.922 21.133  1.00 28.08  ? 351 LEU B O     1 
ATOM   6464 C  CB    . LEU B 1 357 ? -22.920 -17.288 18.157  1.00 17.12  ? 351 LEU B CB    1 
ATOM   6465 C  CG    . LEU B 1 357 ? -23.747 -17.194 16.861  1.00 15.70  ? 351 LEU B CG    1 
ATOM   6466 C  CD1   . LEU B 1 357 ? -23.625 -18.473 16.021  1.00 12.40  ? 351 LEU B CD1   1 
ATOM   6467 C  CD2   . LEU B 1 357 ? -25.211 -16.883 17.139  1.00 17.37  ? 351 LEU B CD2   1 
ATOM   6468 N  N     . GLN B 1 358 ? -21.695 -16.109 21.199  1.00 27.52  ? 352 GLN B N     1 
ATOM   6469 C  CA    . GLN B 1 358 ? -21.193 -16.368 22.555  1.00 28.13  ? 352 GLN B CA    1 
ATOM   6470 C  C     . GLN B 1 358 ? -21.757 -15.347 23.535  1.00 26.75  ? 352 GLN B C     1 
ATOM   6471 O  O     . GLN B 1 358 ? -21.142 -15.056 24.570  1.00 26.61  ? 352 GLN B O     1 
ATOM   6472 C  CB    . GLN B 1 358 ? -19.672 -16.268 22.606  1.00 27.44  ? 352 GLN B CB    1 
ATOM   6473 C  CG    . GLN B 1 358 ? -18.915 -17.353 21.885  1.00 35.84  ? 352 GLN B CG    1 
ATOM   6474 C  CD    . GLN B 1 358 ? -17.434 -17.027 21.819  1.00 54.17  ? 352 GLN B CD    1 
ATOM   6475 O  OE1   . GLN B 1 358 ? -17.045 -15.870 21.598  1.00 41.85  ? 352 GLN B OE1   1 
ATOM   6476 N  NE2   . GLN B 1 358 ? -16.596 -18.038 22.035  1.00 61.63  ? 352 GLN B NE2   1 
ATOM   6477 N  N     . GLY B 1 359 ? -22.903 -14.776 23.177  1.00 20.84  ? 353 GLY B N     1 
ATOM   6478 C  CA    . GLY B 1 359 ? -23.534 -13.733 23.962  1.00 21.92  ? 353 GLY B CA    1 
ATOM   6479 C  C     . GLY B 1 359 ? -22.736 -12.475 24.273  1.00 21.70  ? 353 GLY B C     1 
ATOM   6480 O  O     . GLY B 1 359 ? -23.180 -11.650 25.075  1.00 24.67  ? 353 GLY B O     1 
ATOM   6481 N  N     . LYS B 1 360 ? -21.573 -12.307 23.655  1.00 21.02  ? 354 LYS B N     1 
ATOM   6482 C  CA    . LYS B 1 360 ? -20.749 -11.132 23.931  1.00 22.64  ? 354 LYS B CA    1 
ATOM   6483 C  C     . LYS B 1 360 ? -21.274 -9.865  23.253  1.00 24.77  ? 354 LYS B C     1 
ATOM   6484 O  O     . LYS B 1 360 ? -21.323 -8.802  23.875  1.00 28.48  ? 354 LYS B O     1 
ATOM   6485 C  CB    . LYS B 1 360 ? -19.278 -11.366 23.560  1.00 22.83  ? 354 LYS B CB    1 
ATOM   6486 C  CG    . LYS B 1 360 ? -18.513 -12.299 24.494  1.00 27.43  ? 354 LYS B CG    1 
ATOM   6487 C  CD    . LYS B 1 360 ? -16.997 -12.277 24.206  1.00 33.98  ? 354 LYS B CD    1 
ATOM   6488 C  CE    . LYS B 1 360 ? -16.672 -12.835 22.803  1.00 48.30  ? 354 LYS B CE    1 
ATOM   6489 N  NZ    . LYS B 1 360 ? -15.240 -12.686 22.377  1.00 45.06  ? 354 LYS B NZ    1 
ATOM   6490 N  N     . SER B 1 361 ? -21.658 -9.970  21.982  1.00 24.47  ? 355 SER B N     1 
ATOM   6491 C  CA    . SER B 1 361 ? -22.125 -8.802  21.238  1.00 18.93  ? 355 SER B CA    1 
ATOM   6492 C  C     . SER B 1 361 ? -23.558 -8.973  20.712  1.00 21.83  ? 355 SER B C     1 
ATOM   6493 O  O     . SER B 1 361 ? -24.120 -10.071 20.776  1.00 22.62  ? 355 SER B O     1 
ATOM   6494 C  CB    . SER B 1 361 ? -21.153 -8.466  20.119  1.00 15.93  ? 355 SER B CB    1 
ATOM   6495 O  OG    . SER B 1 361 ? -21.059 -7.062  19.965  1.00 27.86  ? 355 SER B OG    1 
ATOM   6496 N  N     . ASP B 1 362 ? -24.159 -7.886  20.226  1.00 19.38  ? 356 ASP B N     1 
ATOM   6497 C  CA    . ASP B 1 362 ? -25.553 -7.924  19.774  1.00 19.62  ? 356 ASP B CA    1 
ATOM   6498 C  C     . ASP B 1 362 ? -25.629 -7.895  18.244  1.00 20.42  ? 356 ASP B C     1 
ATOM   6499 O  O     . ASP B 1 362 ? -24.732 -7.356  17.595  1.00 20.86  ? 356 ASP B O     1 
ATOM   6500 C  CB    . ASP B 1 362 ? -26.328 -6.753  20.386  1.00 25.23  ? 356 ASP B CB    1 
ATOM   6501 C  CG    . ASP B 1 362 ? -27.851 -6.966  20.377  1.00 37.43  ? 356 ASP B CG    1 
ATOM   6502 O  OD1   . ASP B 1 362 ? -28.367 -7.636  21.308  1.00 37.49  ? 356 ASP B OD1   1 
ATOM   6503 O  OD2   . ASP B 1 362 ? -28.529 -6.437  19.458  1.00 31.60  ? 356 ASP B OD2   1 
ATOM   6504 N  N     . TRP B 1 363 ? -26.684 -8.469  17.661  1.00 21.64  ? 357 TRP B N     1 
ATOM   6505 C  CA    . TRP B 1 363 ? -26.799 -8.528  16.192  1.00 18.03  ? 357 TRP B CA    1 
ATOM   6506 C  C     . TRP B 1 363 ? -26.652 -7.163  15.561  1.00 16.65  ? 357 TRP B C     1 
ATOM   6507 O  O     . TRP B 1 363 ? -26.076 -7.026  14.489  1.00 15.23  ? 357 TRP B O     1 
ATOM   6508 C  CB    . TRP B 1 363 ? -28.135 -9.101  15.736  1.00 18.72  ? 357 TRP B CB    1 
ATOM   6509 C  CG    . TRP B 1 363 ? -28.273 -10.584 15.791  1.00 15.08  ? 357 TRP B CG    1 
ATOM   6510 C  CD1   . TRP B 1 363 ? -29.107 -11.282 16.602  1.00 18.77  ? 357 TRP B CD1   1 
ATOM   6511 C  CD2   . TRP B 1 363 ? -27.593 -11.551 14.988  1.00 15.53  ? 357 TRP B CD2   1 
ATOM   6512 N  NE1   . TRP B 1 363 ? -28.983 -12.625 16.371  1.00 22.14  ? 357 TRP B NE1   1 
ATOM   6513 C  CE2   . TRP B 1 363 ? -28.059 -12.820 15.381  1.00 19.21  ? 357 TRP B CE2   1 
ATOM   6514 C  CE3   . TRP B 1 363 ? -26.634 -11.472 13.979  1.00 18.35  ? 357 TRP B CE3   1 
ATOM   6515 C  CZ2   . TRP B 1 363 ? -27.597 -14.005 14.803  1.00 15.63  ? 357 TRP B CZ2   1 
ATOM   6516 C  CZ3   . TRP B 1 363 ? -26.174 -12.651 13.405  1.00 13.70  ? 357 TRP B CZ3   1 
ATOM   6517 C  CH2   . TRP B 1 363 ? -26.652 -13.898 13.821  1.00 13.36  ? 357 TRP B CH2   1 
ATOM   6518 N  N     . SER B 1 364 ? -27.176 -6.150  16.236  1.00 18.84  ? 358 SER B N     1 
ATOM   6519 C  CA    . SER B 1 364 ? -27.124 -4.791  15.725  1.00 17.18  ? 358 SER B CA    1 
ATOM   6520 C  C     . SER B 1 364 ? -25.702 -4.385  15.359  1.00 17.98  ? 358 SER B C     1 
ATOM   6521 O  O     . SER B 1 364 ? -25.503 -3.525  14.509  1.00 17.82  ? 358 SER B O     1 
ATOM   6522 C  CB    . SER B 1 364 ? -27.681 -3.824  16.757  1.00 17.51  ? 358 SER B CB    1 
ATOM   6523 O  OG    . SER B 1 364 ? -26.807 -3.744  17.861  1.00 16.45  ? 358 SER B OG    1 
ATOM   6524 N  N     . LYS B 1 365 ? -24.712 -5.009  15.993  1.00 17.93  ? 359 LYS B N     1 
ATOM   6525 C  CA    . LYS B 1 365 ? -23.326 -4.662  15.713  1.00 18.01  ? 359 LYS B CA    1 
ATOM   6526 C  C     . LYS B 1 365 ? -22.962 -5.028  14.279  1.00 17.70  ? 359 LYS B C     1 
ATOM   6527 O  O     . LYS B 1 365 ? -22.271 -4.269  13.603  1.00 21.87  ? 359 LYS B O     1 
ATOM   6528 C  CB    . LYS B 1 365 ? -22.361 -5.335  16.699  1.00 17.75  ? 359 LYS B CB    1 
ATOM   6529 C  CG    . LYS B 1 365 ? -21.011 -4.631  16.784  1.00 19.03  ? 359 LYS B CG    1 
ATOM   6530 C  CD    . LYS B 1 365 ? -19.932 -5.427  17.513  1.00 18.19  ? 359 LYS B CD    1 
ATOM   6531 C  CE    . LYS B 1 365 ? -18.669 -4.569  17.652  1.00 23.28  ? 359 LYS B CE    1 
ATOM   6532 N  NZ    . LYS B 1 365 ? -17.461 -5.334  18.032  1.00 28.59  ? 359 LYS B NZ    1 
ATOM   6533 N  N     . LEU B 1 366 ? -23.438 -6.188  13.823  1.00 16.67  ? 360 LEU B N     1 
ATOM   6534 C  CA    . LEU B 1 366 ? -23.191 -6.690  12.463  1.00 14.76  ? 360 LEU B CA    1 
ATOM   6535 C  C     . LEU B 1 366 ? -23.543 -5.630  11.435  1.00 13.82  ? 360 LEU B C     1 
ATOM   6536 O  O     . LEU B 1 366 ? -22.903 -5.522  10.400  1.00 13.10  ? 360 LEU B O     1 
ATOM   6537 C  CB    . LEU B 1 366 ? -24.070 -7.912  12.191  1.00 11.91  ? 360 LEU B CB    1 
ATOM   6538 C  CG    . LEU B 1 366 ? -23.521 -9.143  11.477  1.00 12.11  ? 360 LEU B CG    1 
ATOM   6539 C  CD1   . LEU B 1 366 ? -24.628 -9.945  10.830  1.00 7.07   ? 360 LEU B CD1   1 
ATOM   6540 C  CD2   . LEU B 1 366 ? -22.487 -8.751  10.468  1.00 14.03  ? 360 LEU B CD2   1 
ATOM   6541 N  N     . LEU B 1 367 ? -24.549 -4.835  11.776  1.00 13.76  ? 361 LEU B N     1 
ATOM   6542 C  CA    . LEU B 1 367 ? -25.237 -3.955  10.857  1.00 12.93  ? 361 LEU B CA    1 
ATOM   6543 C  C     . LEU B 1 367 ? -24.746 -2.506  10.854  1.00 16.87  ? 361 LEU B C     1 
ATOM   6544 O  O     . LEU B 1 367 ? -25.302 -1.667  10.146  1.00 16.23  ? 361 LEU B O     1 
ATOM   6545 C  CB    . LEU B 1 367 ? -26.727 -3.980  11.199  1.00 13.80  ? 361 LEU B CB    1 
ATOM   6546 C  CG    . LEU B 1 367 ? -27.582 -5.102  10.604  1.00 12.87  ? 361 LEU B CG    1 
ATOM   6547 C  CD1   . LEU B 1 367 ? -26.750 -6.238  10.065  1.00 10.88  ? 361 LEU B CD1   1 
ATOM   6548 C  CD2   . LEU B 1 367 ? -28.562 -5.617  11.613  1.00 13.33  ? 361 LEU B CD2   1 
ATOM   6549 N  N     . GLU B 1 368 ? -23.724 -2.204  11.647  1.00 19.26  ? 362 GLU B N     1 
ATOM   6550 C  CA    . GLU B 1 368 ? -23.190 -0.846  11.710  1.00 20.69  ? 362 GLU B CA    1 
ATOM   6551 C  C     . GLU B 1 368 ? -22.496 -0.493  10.402  1.00 21.18  ? 362 GLU B C     1 
ATOM   6552 O  O     . GLU B 1 368 ? -21.826 -1.334  9.817   1.00 23.84  ? 362 GLU B O     1 
ATOM   6553 C  CB    . GLU B 1 368 ? -22.164 -0.727  12.841  1.00 22.98  ? 362 GLU B CB    1 
ATOM   6554 C  CG    . GLU B 1 368 ? -22.701 -0.919  14.249  1.00 27.96  ? 362 GLU B CG    1 
ATOM   6555 C  CD    . GLU B 1 368 ? -21.586 -0.972  15.290  1.00 44.44  ? 362 GLU B CD    1 
ATOM   6556 O  OE1   . GLU B 1 368 ? -20.404 -0.733  14.921  1.00 40.61  ? 362 GLU B OE1   1 
ATOM   6557 O  OE2   . GLU B 1 368 ? -21.894 -1.265  16.471  1.00 39.28  ? 362 GLU B OE2   1 
ATOM   6558 N  N     . PRO B 1 369 ? -22.615 0.763   9.958   1.00 22.11  ? 363 PRO B N     1 
ATOM   6559 C  CA    . PRO B 1 369 ? -21.848 1.210   8.791   1.00 26.29  ? 363 PRO B CA    1 
ATOM   6560 C  C     . PRO B 1 369 ? -20.350 1.051   9.038   1.00 26.16  ? 363 PRO B C     1 
ATOM   6561 O  O     . PRO B 1 369 ? -19.926 1.193   10.187  1.00 28.32  ? 363 PRO B O     1 
ATOM   6562 C  CB    . PRO B 1 369 ? -22.190 2.698   8.710   1.00 24.69  ? 363 PRO B CB    1 
ATOM   6563 C  CG    . PRO B 1 369 ? -22.560 3.069   10.111  1.00 23.21  ? 363 PRO B CG    1 
ATOM   6564 C  CD    . PRO B 1 369 ? -23.299 1.882   10.621  1.00 26.30  ? 363 PRO B CD    1 
ATOM   6565 N  N     . PRO B 1 370 ? -19.566 0.755   7.984   1.00 23.92  ? 364 PRO B N     1 
ATOM   6566 C  CA    . PRO B 1 370 ? -18.108 0.612   8.091   1.00 23.56  ? 364 PRO B CA    1 
ATOM   6567 C  C     . PRO B 1 370 ? -17.482 1.980   8.251   1.00 27.67  ? 364 PRO B C     1 
ATOM   6568 O  O     . PRO B 1 370 ? -18.198 2.959   8.058   1.00 31.18  ? 364 PRO B O     1 
ATOM   6569 C  CB    . PRO B 1 370 ? -17.721 0.022   6.736   1.00 21.70  ? 364 PRO B CB    1 
ATOM   6570 C  CG    . PRO B 1 370 ? -18.776 0.493   5.812   1.00 15.78  ? 364 PRO B CG    1 
ATOM   6571 C  CD    . PRO B 1 370 ? -20.039 0.542   6.605   1.00 20.77  ? 364 PRO B CD    1 
ATOM   6572 N  N     . ASN B 1 371 ? -16.199 2.066   8.590   1.00 31.40  ? 365 ASN B N     1 
ATOM   6573 C  CA    . ASN B 1 371 ? -15.551 3.377   8.707   1.00 37.68  ? 365 ASN B CA    1 
ATOM   6574 C  C     . ASN B 1 371 ? -14.908 3.848   7.398   1.00 40.77  ? 365 ASN B C     1 
ATOM   6575 O  O     . ASN B 1 371 ? -13.688 4.007   7.311   1.00 39.34  ? 365 ASN B O     1 
ATOM   6576 C  CB    . ASN B 1 371 ? -14.533 3.393   9.851   1.00 49.17  ? 365 ASN B CB    1 
ATOM   6577 C  CG    . ASN B 1 371 ? -14.916 4.379   10.956  1.00 64.81  ? 365 ASN B CG    1 
ATOM   6578 O  OD1   . ASN B 1 371 ? -15.725 5.289   10.735  1.00 58.65  ? 365 ASN B OD1   1 
ATOM   6579 N  ND2   . ASN B 1 371 ? -14.332 4.206   12.148  1.00 49.49  ? 365 ASN B ND2   1 
ATOM   6580 N  N     . PHE B 1 372 ? -15.739 4.078   6.385   1.00 33.66  ? 366 PHE B N     1 
ATOM   6581 C  CA    . PHE B 1 372 ? -15.238 4.347   5.049   1.00 27.43  ? 366 PHE B CA    1 
ATOM   6582 C  C     . PHE B 1 372 ? -14.450 5.626   5.006   1.00 29.59  ? 366 PHE B C     1 
ATOM   6583 O  O     . PHE B 1 372 ? -13.492 5.737   4.251   1.00 29.80  ? 366 PHE B O     1 
ATOM   6584 C  CB    . PHE B 1 372 ? -16.378 4.440   4.040   1.00 27.16  ? 366 PHE B CB    1 
ATOM   6585 C  CG    . PHE B 1 372 ? -15.933 4.848   2.663   1.00 23.78  ? 366 PHE B CG    1 
ATOM   6586 C  CD1   . PHE B 1 372 ? -15.361 3.916   1.801   1.00 21.89  ? 366 PHE B CD1   1 
ATOM   6587 C  CD2   . PHE B 1 372 ? -16.085 6.156   2.232   1.00 20.97  ? 366 PHE B CD2   1 
ATOM   6588 C  CE1   . PHE B 1 372 ? -14.949 4.281   0.538   1.00 19.71  ? 366 PHE B CE1   1 
ATOM   6589 C  CE2   . PHE B 1 372 ? -15.676 6.536   0.972   1.00 21.15  ? 366 PHE B CE2   1 
ATOM   6590 C  CZ    . PHE B 1 372 ? -15.110 5.595   0.120   1.00 23.55  ? 366 PHE B CZ    1 
ATOM   6591 N  N     . PHE B 1 373 ? -14.864 6.598   5.811   1.00 29.87  ? 367 PHE B N     1 
ATOM   6592 C  CA    . PHE B 1 373 ? -14.277 7.926   5.724   1.00 27.18  ? 367 PHE B CA    1 
ATOM   6593 C  C     . PHE B 1 373 ? -13.081 8.149   6.637   1.00 30.29  ? 367 PHE B C     1 
ATOM   6594 O  O     . PHE B 1 373 ? -12.619 9.281   6.805   1.00 33.50  ? 367 PHE B O     1 
ATOM   6595 C  CB    . PHE B 1 373 ? -15.338 8.992   5.909   1.00 19.72  ? 367 PHE B CB    1 
ATOM   6596 C  CG    . PHE B 1 373 ? -16.333 9.018   4.804   1.00 22.17  ? 367 PHE B CG    1 
ATOM   6597 C  CD1   . PHE B 1 373 ? -15.980 9.513   3.558   1.00 21.22  ? 367 PHE B CD1   1 
ATOM   6598 C  CD2   . PHE B 1 373 ? -17.615 8.533   4.995   1.00 19.84  ? 367 PHE B CD2   1 
ATOM   6599 C  CE1   . PHE B 1 373 ? -16.891 9.532   2.524   1.00 19.42  ? 367 PHE B CE1   1 
ATOM   6600 C  CE2   . PHE B 1 373 ? -18.535 8.552   3.964   1.00 21.37  ? 367 PHE B CE2   1 
ATOM   6601 C  CZ    . PHE B 1 373 ? -18.172 9.052   2.726   1.00 22.79  ? 367 PHE B CZ    1 
ATOM   6602 N  N     . GLN B 1 374 ? -12.569 7.063   7.203   1.00 29.90  ? 368 GLN B N     1 
ATOM   6603 C  CA    . GLN B 1 374 ? -11.292 7.100   7.904   1.00 36.01  ? 368 GLN B CA    1 
ATOM   6604 C  C     . GLN B 1 374 ? -10.386 5.981   7.420   1.00 35.50  ? 368 GLN B C     1 
ATOM   6605 O  O     . GLN B 1 374 ? -9.272  5.821   7.912   1.00 37.14  ? 368 GLN B O     1 
ATOM   6606 C  CB    . GLN B 1 374 ? -11.477 6.995   9.419   1.00 38.28  ? 368 GLN B CB    1 
ATOM   6607 C  CG    . GLN B 1 374 ? -12.101 8.226   10.061  1.00 40.46  ? 368 GLN B CG    1 
ATOM   6608 C  CD    . GLN B 1 374 ? -13.547 7.994   10.450  1.00 47.39  ? 368 GLN B CD    1 
ATOM   6609 O  OE1   . GLN B 1 374 ? -14.419 7.847   9.589   1.00 39.17  ? 368 GLN B OE1   1 
ATOM   6610 N  NE2   . GLN B 1 374 ? -13.807 7.937   11.759  1.00 58.05  ? 368 GLN B NE2   1 
ATOM   6611 N  N     . LYS B 1 375 ? -10.865 5.205   6.454   1.00 32.89  ? 369 LYS B N     1 
ATOM   6612 C  CA    . LYS B 1 375 ? -10.104 4.055   5.980   1.00 33.89  ? 369 LYS B CA    1 
ATOM   6613 C  C     . LYS B 1 375 ? -8.991  4.478   5.008   1.00 32.03  ? 369 LYS B C     1 
ATOM   6614 O  O     . LYS B 1 375 ? -8.001  3.771   4.848   1.00 30.90  ? 369 LYS B O     1 
ATOM   6615 C  CB    . LYS B 1 375 ? -11.046 3.000   5.363   1.00 34.99  ? 369 LYS B CB    1 
ATOM   6616 C  CG    . LYS B 1 375 ? -10.466 1.569   5.240   1.00 37.41  ? 369 LYS B CG    1 
ATOM   6617 C  CD    . LYS B 1 375 ? -11.554 0.486   5.012   1.00 35.62  ? 369 LYS B CD    1 
ATOM   6618 C  CE    . LYS B 1 375 ? -12.106 -0.076  6.343   1.00 49.22  ? 369 LYS B CE    1 
ATOM   6619 N  NZ    . LYS B 1 375 ? -13.072 -1.222  6.199   1.00 45.43  ? 369 LYS B NZ    1 
ATOM   6620 N  N     . TYR B 1 376 ? -9.135  5.646   4.385   1.00 34.50  ? 370 TYR B N     1 
ATOM   6621 C  CA    . TYR B 1 376 ? -8.210  6.045   3.322   1.00 34.99  ? 370 TYR B CA    1 
ATOM   6622 C  C     . TYR B 1 376 ? -7.556  7.403   3.547   1.00 34.37  ? 370 TYR B C     1 
ATOM   6623 O  O     . TYR B 1 376 ? -8.163  8.315   4.103   1.00 32.16  ? 370 TYR B O     1 
ATOM   6624 C  CB    . TYR B 1 376 ? -8.909  5.981   1.950   1.00 25.96  ? 370 TYR B CB    1 
ATOM   6625 C  CG    . TYR B 1 376 ? -9.507  4.618   1.706   1.00 22.41  ? 370 TYR B CG    1 
ATOM   6626 C  CD1   . TYR B 1 376 ? -8.690  3.508   1.548   1.00 20.49  ? 370 TYR B CD1   1 
ATOM   6627 C  CD2   . TYR B 1 376 ? -10.878 4.430   1.681   1.00 21.30  ? 370 TYR B CD2   1 
ATOM   6628 C  CE1   . TYR B 1 376 ? -9.222  2.248   1.354   1.00 22.11  ? 370 TYR B CE1   1 
ATOM   6629 C  CE2   . TYR B 1 376 ? -11.425 3.170   1.474   1.00 22.53  ? 370 TYR B CE2   1 
ATOM   6630 C  CZ    . TYR B 1 376 ? -10.590 2.079   1.316   1.00 20.71  ? 370 TYR B CZ    1 
ATOM   6631 O  OH    . TYR B 1 376 ? -11.118 0.818   1.121   1.00 18.58  ? 370 TYR B OH    1 
ATOM   6632 N  N     . ARG B 1 377 ? -6.304  7.522   3.117   1.00 37.20  ? 371 ARG B N     1 
ATOM   6633 C  CA    . ARG B 1 377 ? -5.580  8.785   3.205   1.00 39.11  ? 371 ARG B CA    1 
ATOM   6634 C  C     . ARG B 1 377 ? -6.061  9.758   2.137   1.00 34.59  ? 371 ARG B C     1 
ATOM   6635 O  O     . ARG B 1 377 ? -6.252  10.947  2.396   1.00 33.70  ? 371 ARG B O     1 
ATOM   6636 C  CB    . ARG B 1 377 ? -4.078  8.542   3.051   1.00 46.35  ? 371 ARG B CB    1 
ATOM   6637 C  CG    . ARG B 1 377 ? -3.359  8.183   4.342   1.00 56.45  ? 371 ARG B CG    1 
ATOM   6638 C  CD    . ARG B 1 377 ? -2.892  9.442   5.060   1.00 68.34  ? 371 ARG B CD    1 
ATOM   6639 N  NE    . ARG B 1 377 ? -2.254  9.146   6.337   1.00 80.46  ? 371 ARG B NE    1 
ATOM   6640 C  CZ    . ARG B 1 377 ? -1.046  8.605   6.459   1.00 85.54  ? 371 ARG B CZ    1 
ATOM   6641 N  NH1   . ARG B 1 377 ? -0.345  8.289   5.374   1.00 73.24  ? 371 ARG B NH1   1 
ATOM   6642 N  NH2   . ARG B 1 377 ? -0.545  8.372   7.668   1.00 81.39  ? 371 ARG B NH2   1 
ATOM   6643 N  N     . HIS B 1 378 ? -6.251  9.241   0.929   1.00 31.54  ? 372 HIS B N     1 
ATOM   6644 C  CA    . HIS B 1 378 ? -6.681  10.065  -0.186  1.00 30.80  ? 372 HIS B CA    1 
ATOM   6645 C  C     . HIS B 1 378 ? -8.058  9.631   -0.631  1.00 25.04  ? 372 HIS B C     1 
ATOM   6646 O  O     . HIS B 1 378 ? -8.495  8.522   -0.349  1.00 30.69  ? 372 HIS B O     1 
ATOM   6647 C  CB    . HIS B 1 378 ? -5.712  9.953   -1.367  1.00 28.72  ? 372 HIS B CB    1 
ATOM   6648 C  CG    . HIS B 1 378 ? -4.290  10.255  -1.019  1.00 30.92  ? 372 HIS B CG    1 
ATOM   6649 N  ND1   . HIS B 1 378 ? -3.685  11.448  -1.341  1.00 35.49  ? 372 HIS B ND1   1 
ATOM   6650 C  CD2   . HIS B 1 378 ? -3.353  9.516   -0.377  1.00 33.71  ? 372 HIS B CD2   1 
ATOM   6651 C  CE1   . HIS B 1 378 ? -2.434  11.433  -0.910  1.00 40.65  ? 372 HIS B CE1   1 
ATOM   6652 N  NE2   . HIS B 1 378 ? -2.208  10.272  -0.322  1.00 33.27  ? 372 HIS B NE2   1 
ATOM   6653 N  N     . TYR B 1 379 ? -8.732  10.514  -1.344  1.00 20.37  ? 373 TYR B N     1 
ATOM   6654 C  CA    . TYR B 1 379 ? -10.076 10.267  -1.789  1.00 19.36  ? 373 TYR B CA    1 
ATOM   6655 C  C     . TYR B 1 379 ? -10.272 11.042  -3.070  1.00 24.28  ? 373 TYR B C     1 
ATOM   6656 O  O     . TYR B 1 379 ? -9.669  12.095  -3.260  1.00 25.01  ? 373 TYR B O     1 
ATOM   6657 C  CB    . TYR B 1 379 ? -11.089 10.769  -0.749  1.00 27.39  ? 373 TYR B CB    1 
ATOM   6658 C  CG    . TYR B 1 379 ? -11.313 9.844   0.426   1.00 25.78  ? 373 TYR B CG    1 
ATOM   6659 C  CD1   . TYR B 1 379 ? -10.464 9.866   1.522   1.00 32.52  ? 373 TYR B CD1   1 
ATOM   6660 C  CD2   . TYR B 1 379 ? -12.381 8.955   0.445   1.00 25.31  ? 373 TYR B CD2   1 
ATOM   6661 C  CE1   . TYR B 1 379 ? -10.653 9.017   2.599   1.00 31.25  ? 373 TYR B CE1   1 
ATOM   6662 C  CE2   . TYR B 1 379 ? -12.583 8.105   1.527   1.00 29.00  ? 373 TYR B CE2   1 
ATOM   6663 C  CZ    . TYR B 1 379 ? -11.709 8.143   2.598   1.00 28.09  ? 373 TYR B CZ    1 
ATOM   6664 O  OH    . TYR B 1 379 ? -11.878 7.308   3.672   1.00 27.43  ? 373 TYR B OH    1 
ATOM   6665 N  N     . ILE B 1 380 ? -11.114 10.521  -3.954  1.00 23.19  ? 374 ILE B N     1 
ATOM   6666 C  CA    . ILE B 1 380 ? -11.616 11.321  -5.056  1.00 24.73  ? 374 ILE B CA    1 
ATOM   6667 C  C     . ILE B 1 380 ? -13.107 11.545  -4.842  1.00 22.12  ? 374 ILE B C     1 
ATOM   6668 O  O     . ILE B 1 380 ? -13.853 10.602  -4.564  1.00 20.50  ? 374 ILE B O     1 
ATOM   6669 C  CB    . ILE B 1 380 ? -11.351 10.672  -6.429  1.00 24.90  ? 374 ILE B CB    1 
ATOM   6670 C  CG1   . ILE B 1 380 ? -9.855  10.520  -6.659  1.00 20.31  ? 374 ILE B CG1   1 
ATOM   6671 C  CG2   . ILE B 1 380 ? -11.921 11.522  -7.545  1.00 18.64  ? 374 ILE B CG2   1 
ATOM   6672 C  CD1   . ILE B 1 380 ? -9.529  10.121  -8.040  1.00 18.91  ? 374 ILE B CD1   1 
ATOM   6673 N  N     . VAL B 1 381 ? -13.522 12.804  -4.936  1.00 19.72  ? 375 VAL B N     1 
ATOM   6674 C  CA    . VAL B 1 381 ? -14.917 13.158  -4.821  1.00 18.77  ? 375 VAL B CA    1 
ATOM   6675 C  C     . VAL B 1 381 ? -15.428 13.332  -6.221  1.00 24.91  ? 375 VAL B C     1 
ATOM   6676 O  O     . VAL B 1 381 ? -14.733 13.862  -7.082  1.00 27.92  ? 375 VAL B O     1 
ATOM   6677 C  CB    . VAL B 1 381 ? -15.103 14.478  -4.090  1.00 22.40  ? 375 VAL B CB    1 
ATOM   6678 C  CG1   . VAL B 1 381 ? -16.567 14.717  -3.811  1.00 20.73  ? 375 VAL B CG1   1 
ATOM   6679 C  CG2   . VAL B 1 381 ? -14.326 14.465  -2.810  1.00 30.78  ? 375 VAL B CG2   1 
ATOM   6680 N  N     . LEU B 1 382 ? -16.657 12.901  -6.442  1.00 24.24  ? 376 LEU B N     1 
ATOM   6681 C  CA    . LEU B 1 382 ? -17.208 12.832  -7.770  1.00 23.08  ? 376 LEU B CA    1 
ATOM   6682 C  C     . LEU B 1 382 ? -18.535 13.557  -7.738  1.00 30.30  ? 376 LEU B C     1 
ATOM   6683 O  O     . LEU B 1 382 ? -19.522 13.009  -7.258  1.00 30.82  ? 376 LEU B O     1 
ATOM   6684 C  CB    . LEU B 1 382 ? -17.436 11.370  -8.109  1.00 23.54  ? 376 LEU B CB    1 
ATOM   6685 C  CG    . LEU B 1 382 ? -17.354 10.869  -9.542  1.00 29.92  ? 376 LEU B CG    1 
ATOM   6686 C  CD1   . LEU B 1 382 ? -18.338 9.717   -9.708  1.00 23.14  ? 376 LEU B CD1   1 
ATOM   6687 C  CD2   . LEU B 1 382 ? -17.611 11.971  -10.563 1.00 34.12  ? 376 LEU B CD2   1 
ATOM   6688 N  N     . THR B 1 383 ? -18.564 14.784  -8.249  1.00 33.15  ? 377 THR B N     1 
ATOM   6689 C  CA    . THR B 1 383 ? -19.763 15.613  -8.177  1.00 30.71  ? 377 THR B CA    1 
ATOM   6690 C  C     . THR B 1 383 ? -20.552 15.580  -9.479  1.00 28.69  ? 377 THR B C     1 
ATOM   6691 O  O     . THR B 1 383 ? -20.027 15.933  -10.529 1.00 30.87  ? 377 THR B O     1 
ATOM   6692 C  CB    . THR B 1 383 ? -19.400 17.079  -7.885  1.00 31.53  ? 377 THR B CB    1 
ATOM   6693 O  OG1   . THR B 1 383 ? -18.273 17.142  -6.997  1.00 26.72  ? 377 THR B OG1   1 
ATOM   6694 C  CG2   . THR B 1 383 ? -20.581 17.802  -7.280  1.00 28.82  ? 377 THR B CG2   1 
ATOM   6695 N  N     . ALA B 1 384 ? -21.815 15.180  -9.406  1.00 27.13  ? 378 ALA B N     1 
ATOM   6696 C  CA    . ALA B 1 384 ? -22.661 15.097  -10.596 1.00 31.83  ? 378 ALA B CA    1 
ATOM   6697 C  C     . ALA B 1 384 ? -23.853 16.051  -10.526 1.00 39.22  ? 378 ALA B C     1 
ATOM   6698 O  O     . ALA B 1 384 ? -24.697 15.934  -9.631  1.00 37.89  ? 378 ALA B O     1 
ATOM   6699 C  CB    . ALA B 1 384 ? -23.149 13.677  -10.786 1.00 34.51  ? 378 ALA B CB    1 
ATOM   6700 N  N     . SER B 1 385 ? -23.945 16.960  -11.494 1.00 35.64  ? 379 SER B N     1 
ATOM   6701 C  CA    . SER B 1 385 ? -24.892 18.074  -11.407 1.00 33.03  ? 379 SER B CA    1 
ATOM   6702 C  C     . SER B 1 385 ? -25.860 18.194  -12.585 1.00 33.92  ? 379 SER B C     1 
ATOM   6703 O  O     . SER B 1 385 ? -25.632 17.650  -13.656 1.00 32.97  ? 379 SER B O     1 
ATOM   6704 C  CB    . SER B 1 385 ? -24.122 19.384  -11.230 1.00 35.87  ? 379 SER B CB    1 
ATOM   6705 O  OG    . SER B 1 385 ? -23.082 19.225  -10.272 1.00 42.43  ? 379 SER B OG    1 
ATOM   6706 N  N     . ALA B 1 386 ? -26.952 18.913  -12.371 1.00 43.42  ? 380 ALA B N     1 
ATOM   6707 C  CA    . ALA B 1 386 ? -27.919 19.179  -13.431 1.00 47.16  ? 380 ALA B CA    1 
ATOM   6708 C  C     . ALA B 1 386 ? -28.722 20.437  -13.084 1.00 56.23  ? 380 ALA B C     1 
ATOM   6709 O  O     . ALA B 1 386 ? -28.335 21.190  -12.177 1.00 50.19  ? 380 ALA B O     1 
ATOM   6710 C  CB    . ALA B 1 386 ? -28.834 17.970  -13.658 1.00 39.05  ? 380 ALA B CB    1 
ATOM   6711 N  N     . SER B 1 387 ? -29.822 20.670  -13.803 1.00 53.89  ? 381 SER B N     1 
ATOM   6712 C  CA    . SER B 1 387 ? -30.633 21.869  -13.583 1.00 48.77  ? 381 SER B CA    1 
ATOM   6713 C  C     . SER B 1 387 ? -32.091 21.558  -13.279 1.00 51.71  ? 381 SER B C     1 
ATOM   6714 O  O     . SER B 1 387 ? -32.584 21.939  -12.221 1.00 64.40  ? 381 SER B O     1 
ATOM   6715 C  CB    . SER B 1 387 ? -30.508 22.840  -14.751 1.00 44.63  ? 381 SER B CB    1 
ATOM   6716 O  OG    . SER B 1 387 ? -29.193 23.369  -14.805 1.00 41.87  ? 381 SER B OG    1 
ATOM   6717 N  N     . THR B 1 388 ? -32.784 20.870  -14.184 1.00 50.50  ? 382 THR B N     1 
ATOM   6718 C  CA    . THR B 1 388 ? -34.123 20.376  -13.862 1.00 49.48  ? 382 THR B CA    1 
ATOM   6719 C  C     . THR B 1 388 ? -33.997 19.170  -12.941 1.00 54.57  ? 382 THR B C     1 
ATOM   6720 O  O     . THR B 1 388 ? -32.922 18.884  -12.417 1.00 47.24  ? 382 THR B O     1 
ATOM   6721 C  CB    . THR B 1 388 ? -34.945 19.951  -15.099 1.00 52.99  ? 382 THR B CB    1 
ATOM   6722 O  OG1   . THR B 1 388 ? -34.867 18.527  -15.264 1.00 54.65  ? 382 THR B OG1   1 
ATOM   6723 C  CG2   . THR B 1 388 ? -34.464 20.655  -16.361 1.00 47.53  ? 382 THR B CG2   1 
ATOM   6724 N  N     . GLU B 1 389 ? -35.102 18.462  -12.746 1.00 61.94  ? 383 GLU B N     1 
ATOM   6725 C  CA    . GLU B 1 389 ? -35.100 17.301  -11.871 1.00 59.16  ? 383 GLU B CA    1 
ATOM   6726 C  C     . GLU B 1 389 ? -34.940 16.049  -12.710 1.00 53.09  ? 383 GLU B C     1 
ATOM   6727 O  O     . GLU B 1 389 ? -34.139 15.179  -12.380 1.00 50.89  ? 383 GLU B O     1 
ATOM   6728 C  CB    . GLU B 1 389 ? -36.388 17.231  -11.042 1.00 62.95  ? 383 GLU B CB    1 
ATOM   6729 C  CG    . GLU B 1 389 ? -36.165 16.952  -9.549  1.00 74.81  ? 383 GLU B CG    1 
ATOM   6730 C  CD    . GLU B 1 389 ? -36.647 15.571  -9.098  1.00 83.27  ? 383 GLU B CD    1 
ATOM   6731 O  OE1   . GLU B 1 389 ? -36.503 14.593  -9.868  1.00 81.31  ? 383 GLU B OE1   1 
ATOM   6732 O  OE2   . GLU B 1 389 ? -37.171 15.468  -7.965  1.00 82.33  ? 383 GLU B OE2   1 
ATOM   6733 N  N     . GLU B 1 390 ? -35.700 15.969  -13.802 1.00 61.68  ? 384 GLU B N     1 
ATOM   6734 C  CA    . GLU B 1 390 ? -35.662 14.803  -14.685 1.00 62.28  ? 384 GLU B CA    1 
ATOM   6735 C  C     . GLU B 1 390 ? -34.304 14.716  -15.367 1.00 59.20  ? 384 GLU B C     1 
ATOM   6736 O  O     . GLU B 1 390 ? -33.826 13.627  -15.696 1.00 50.56  ? 384 GLU B O     1 
ATOM   6737 C  CB    . GLU B 1 390 ? -36.766 14.873  -15.738 1.00 58.06  ? 384 GLU B CB    1 
ATOM   6738 C  CG    . GLU B 1 390 ? -37.848 15.889  -15.451 1.00 68.81  ? 384 GLU B CG    1 
ATOM   6739 C  CD    . GLU B 1 390 ? -38.182 16.731  -16.670 1.00 85.07  ? 384 GLU B CD    1 
ATOM   6740 O  OE1   . GLU B 1 390 ? -37.288 17.467  -17.147 1.00 67.07  ? 384 GLU B OE1   1 
ATOM   6741 O  OE2   . GLU B 1 390 ? -39.335 16.650  -17.151 1.00 97.17  ? 384 GLU B OE2   1 
ATOM   6742 N  N     . ASN B 1 391 ? -33.692 15.876  -15.585 1.00 53.64  ? 385 ASN B N     1 
ATOM   6743 C  CA    . ASN B 1 391 ? -32.325 15.917  -16.062 1.00 51.12  ? 385 ASN B CA    1 
ATOM   6744 C  C     . ASN B 1 391 ? -31.425 15.210  -15.056 1.00 50.49  ? 385 ASN B C     1 
ATOM   6745 O  O     . ASN B 1 391 ? -30.665 14.309  -15.417 1.00 49.84  ? 385 ASN B O     1 
ATOM   6746 C  CB    . ASN B 1 391 ? -31.868 17.360  -16.288 1.00 50.65  ? 385 ASN B CB    1 
ATOM   6747 C  CG    . ASN B 1 391 ? -32.353 17.925  -17.615 1.00 48.55  ? 385 ASN B CG    1 
ATOM   6748 O  OD1   . ASN B 1 391 ? -33.169 17.305  -18.310 1.00 41.62  ? 385 ASN B OD1   1 
ATOM   6749 N  ND2   . ASN B 1 391 ? -31.848 19.105  -17.976 1.00 33.87  ? 385 ASN B ND2   1 
ATOM   6750 N  N     . HIS B 1 392 ? -31.545 15.591  -13.787 1.00 47.69  ? 386 HIS B N     1 
ATOM   6751 C  CA    . HIS B 1 392 ? -30.705 15.016  -12.740 1.00 41.86  ? 386 HIS B CA    1 
ATOM   6752 C  C     . HIS B 1 392 ? -30.799 13.500  -12.666 1.00 37.27  ? 386 HIS B C     1 
ATOM   6753 O  O     . HIS B 1 392 ? -29.782 12.808  -12.692 1.00 36.99  ? 386 HIS B O     1 
ATOM   6754 C  CB    . HIS B 1 392 ? -31.046 15.606  -11.380 1.00 43.32  ? 386 HIS B CB    1 
ATOM   6755 C  CG    . HIS B 1 392 ? -30.061 15.249  -10.315 1.00 40.83  ? 386 HIS B CG    1 
ATOM   6756 N  ND1   . HIS B 1 392 ? -28.768 15.726  -10.313 1.00 41.03  ? 386 HIS B ND1   1 
ATOM   6757 C  CD2   . HIS B 1 392 ? -30.172 14.450  -9.228  1.00 33.34  ? 386 HIS B CD2   1 
ATOM   6758 C  CE1   . HIS B 1 392 ? -28.125 15.244  -9.264  1.00 36.75  ? 386 HIS B CE1   1 
ATOM   6759 N  NE2   . HIS B 1 392 ? -28.953 14.464  -8.592  1.00 35.42  ? 386 HIS B NE2   1 
ATOM   6760 N  N     . LEU B 1 393 ? -32.018 12.989  -12.581 1.00 37.80  ? 387 LEU B N     1 
ATOM   6761 C  CA    . LEU B 1 393 ? -32.229 11.548  -12.505 1.00 44.69  ? 387 LEU B CA    1 
ATOM   6762 C  C     . LEU B 1 393 ? -31.604 10.854  -13.712 1.00 37.08  ? 387 LEU B C     1 
ATOM   6763 O  O     . LEU B 1 393 ? -30.938 9.829   -13.572 1.00 31.37  ? 387 LEU B O     1 
ATOM   6764 C  CB    . LEU B 1 393 ? -33.729 11.223  -12.420 1.00 52.85  ? 387 LEU B CB    1 
ATOM   6765 C  CG    . LEU B 1 393 ? -34.261 10.350  -11.273 1.00 46.14  ? 387 LEU B CG    1 
ATOM   6766 C  CD1   . LEU B 1 393 ? -35.617 10.876  -10.785 1.00 47.44  ? 387 LEU B CD1   1 
ATOM   6767 C  CD2   . LEU B 1 393 ? -34.366 8.874   -11.678 1.00 34.20  ? 387 LEU B CD2   1 
ATOM   6768 N  N     . GLU B 1 394 ? -31.814 11.438  -14.887 1.00 35.34  ? 388 GLU B N     1 
ATOM   6769 C  CA    . GLU B 1 394 ? -31.321 10.886  -16.139 1.00 30.32  ? 388 GLU B CA    1 
ATOM   6770 C  C     . GLU B 1 394 ? -29.796 10.858  -16.103 1.00 31.05  ? 388 GLU B C     1 
ATOM   6771 O  O     . GLU B 1 394 ? -29.162 9.865   -16.476 1.00 21.00  ? 388 GLU B O     1 
ATOM   6772 C  CB    . GLU B 1 394 ? -31.795 11.783  -17.270 1.00 34.43  ? 388 GLU B CB    1 
ATOM   6773 C  CG    . GLU B 1 394 ? -32.026 11.130  -18.615 1.00 37.81  ? 388 GLU B CG    1 
ATOM   6774 C  CD    . GLU B 1 394 ? -32.445 12.167  -19.656 1.00 46.46  ? 388 GLU B CD    1 
ATOM   6775 O  OE1   . GLU B 1 394 ? -32.221 11.944  -20.864 1.00 36.37  ? 388 GLU B OE1   1 
ATOM   6776 O  OE2   . GLU B 1 394 ? -32.990 13.224  -19.255 1.00 56.66  ? 388 GLU B OE2   1 
ATOM   6777 N  N     . TRP B 1 395 ? -29.222 11.957  -15.624 1.00 29.39  ? 389 TRP B N     1 
ATOM   6778 C  CA    . TRP B 1 395 ? -27.782 12.149  -15.615 1.00 25.09  ? 389 TRP B CA    1 
ATOM   6779 C  C     . TRP B 1 395 ? -27.143 11.311  -14.514 1.00 27.96  ? 389 TRP B C     1 
ATOM   6780 O  O     . TRP B 1 395 ? -26.169 10.594  -14.764 1.00 26.38  ? 389 TRP B O     1 
ATOM   6781 C  CB    . TRP B 1 395 ? -27.472 13.638  -15.464 1.00 19.87  ? 389 TRP B CB    1 
ATOM   6782 C  CG    . TRP B 1 395 ? -26.017 14.041  -15.415 1.00 21.16  ? 389 TRP B CG    1 
ATOM   6783 C  CD1   . TRP B 1 395 ? -25.390 14.675  -14.386 1.00 24.07  ? 389 TRP B CD1   1 
ATOM   6784 C  CD2   . TRP B 1 395 ? -25.026 13.885  -16.444 1.00 20.84  ? 389 TRP B CD2   1 
ATOM   6785 N  NE1   . TRP B 1 395 ? -24.075 14.909  -14.697 1.00 23.20  ? 389 TRP B NE1   1 
ATOM   6786 C  CE2   . TRP B 1 395 ? -23.827 14.433  -15.956 1.00 22.79  ? 389 TRP B CE2   1 
ATOM   6787 C  CE3   . TRP B 1 395 ? -25.030 13.316  -17.716 1.00 21.16  ? 389 TRP B CE3   1 
ATOM   6788 C  CZ2   . TRP B 1 395 ? -22.649 14.431  -16.699 1.00 22.46  ? 389 TRP B CZ2   1 
ATOM   6789 C  CZ3   . TRP B 1 395 ? -23.857 13.315  -18.449 1.00 18.35  ? 389 TRP B CZ3   1 
ATOM   6790 C  CH2   . TRP B 1 395 ? -22.688 13.872  -17.942 1.00 15.61  ? 389 TRP B CH2   1 
ATOM   6791 N  N     . VAL B 1 396 ? -27.707 11.395  -13.311 1.00 26.50  ? 390 VAL B N     1 
ATOM   6792 C  CA    . VAL B 1 396 ? -27.287 10.554  -12.194 1.00 26.85  ? 390 VAL B CA    1 
ATOM   6793 C  C     . VAL B 1 396 ? -27.227 9.096   -12.629 1.00 24.51  ? 390 VAL B C     1 
ATOM   6794 O  O     . VAL B 1 396 ? -26.246 8.400   -12.366 1.00 20.15  ? 390 VAL B O     1 
ATOM   6795 C  CB    . VAL B 1 396 ? -28.238 10.713  -10.970 1.00 26.82  ? 390 VAL B CB    1 
ATOM   6796 C  CG1   . VAL B 1 396 ? -28.634 9.359   -10.357 1.00 17.68  ? 390 VAL B CG1   1 
ATOM   6797 C  CG2   . VAL B 1 396 ? -27.601 11.613  -9.931  1.00 24.64  ? 390 VAL B CG2   1 
ATOM   6798 N  N     . GLY B 1 397 ? -28.268 8.660   -13.333 1.00 27.62  ? 391 GLY B N     1 
ATOM   6799 C  CA    . GLY B 1 397 ? -28.369 7.293   -13.807 1.00 26.35  ? 391 GLY B CA    1 
ATOM   6800 C  C     . GLY B 1 397 ? -27.221 6.906   -14.718 1.00 27.22  ? 391 GLY B C     1 
ATOM   6801 O  O     . GLY B 1 397 ? -26.596 5.857   -14.530 1.00 26.76  ? 391 GLY B O     1 
ATOM   6802 N  N     . LEU B 1 398 ? -26.939 7.752   -15.701 1.00 20.47  ? 392 LEU B N     1 
ATOM   6803 C  CA    . LEU B 1 398 ? -25.858 7.473   -16.619 1.00 20.70  ? 392 LEU B CA    1 
ATOM   6804 C  C     . LEU B 1 398 ? -24.555 7.457   -15.872 1.00 21.05  ? 392 LEU B C     1 
ATOM   6805 O  O     . LEU B 1 398 ? -23.847 6.454   -15.879 1.00 20.44  ? 392 LEU B O     1 
ATOM   6806 C  CB    . LEU B 1 398 ? -25.770 8.542   -17.686 1.00 27.49  ? 392 LEU B CB    1 
ATOM   6807 C  CG    . LEU B 1 398 ? -24.680 8.307   -18.724 1.00 17.21  ? 392 LEU B CG    1 
ATOM   6808 C  CD1   . LEU B 1 398 ? -25.371 8.071   -20.038 1.00 15.04  ? 392 LEU B CD1   1 
ATOM   6809 C  CD2   . LEU B 1 398 ? -23.727 9.504   -18.804 1.00 16.11  ? 392 LEU B CD2   1 
ATOM   6810 N  N     . VAL B 1 399 ? -24.246 8.583   -15.235 1.00 19.48  ? 393 VAL B N     1 
ATOM   6811 C  CA    . VAL B 1 399 ? -22.981 8.743   -14.526 1.00 19.50  ? 393 VAL B CA    1 
ATOM   6812 C  C     . VAL B 1 399 ? -22.684 7.554   -13.621 1.00 16.43  ? 393 VAL B C     1 
ATOM   6813 O  O     . VAL B 1 399 ? -21.598 6.999   -13.656 1.00 13.71  ? 393 VAL B O     1 
ATOM   6814 C  CB    . VAL B 1 399 ? -22.951 10.051  -13.714 1.00 22.81  ? 393 VAL B CB    1 
ATOM   6815 C  CG1   . VAL B 1 399 ? -21.724 10.101  -12.806 1.00 14.28  ? 393 VAL B CG1   1 
ATOM   6816 C  CG2   . VAL B 1 399 ? -22.997 11.254  -14.654 1.00 19.20  ? 393 VAL B CG2   1 
ATOM   6817 N  N     . GLU B 1 400 ? -23.672 7.131   -12.850 1.00 19.93  ? 394 GLU B N     1 
ATOM   6818 C  CA    . GLU B 1 400 ? -23.468 6.015   -11.946 1.00 17.34  ? 394 GLU B CA    1 
ATOM   6819 C  C     . GLU B 1 400 ? -23.011 4.760   -12.668 1.00 17.55  ? 394 GLU B C     1 
ATOM   6820 O  O     . GLU B 1 400 ? -22.219 3.994   -12.132 1.00 18.78  ? 394 GLU B O     1 
ATOM   6821 C  CB    . GLU B 1 400 ? -24.735 5.698   -11.161 1.00 21.14  ? 394 GLU B CB    1 
ATOM   6822 C  CG    . GLU B 1 400 ? -24.447 4.838   -9.934  1.00 25.25  ? 394 GLU B CG    1 
ATOM   6823 C  CD    . GLU B 1 400 ? -25.667 4.098   -9.422  1.00 23.07  ? 394 GLU B CD    1 
ATOM   6824 O  OE1   . GLU B 1 400 ? -26.564 3.788   -10.242 1.00 15.65  ? 394 GLU B OE1   1 
ATOM   6825 O  OE2   . GLU B 1 400 ? -25.713 3.833   -8.194  1.00 27.22  ? 394 GLU B OE2   1 
ATOM   6826 N  N     . SER B 1 401 ? -23.494 4.548   -13.888 1.00 19.50  ? 395 SER B N     1 
ATOM   6827 C  CA    . SER B 1 401 ? -23.219 3.289   -14.583 1.00 17.62  ? 395 SER B CA    1 
ATOM   6828 C  C     . SER B 1 401 ? -21.854 3.272   -15.255 1.00 15.14  ? 395 SER B C     1 
ATOM   6829 O  O     . SER B 1 401 ? -21.547 2.353   -16.013 1.00 15.04  ? 395 SER B O     1 
ATOM   6830 C  CB    . SER B 1 401 ? -24.318 2.970   -15.606 1.00 17.82  ? 395 SER B CB    1 
ATOM   6831 O  OG    . SER B 1 401 ? -24.105 3.617   -16.849 1.00 17.02  ? 395 SER B OG    1 
ATOM   6832 N  N     . LYS B 1 402 ? -21.044 4.290   -14.972 1.00 14.75  ? 396 LYS B N     1 
ATOM   6833 C  CA    . LYS B 1 402 ? -19.760 4.474   -15.646 1.00 16.69  ? 396 LYS B CA    1 
ATOM   6834 C  C     . LYS B 1 402 ? -18.665 4.698   -14.622 1.00 14.92  ? 396 LYS B C     1 
ATOM   6835 O  O     . LYS B 1 402 ? -17.518 4.976   -14.977 1.00 13.40  ? 396 LYS B O     1 
ATOM   6836 C  CB    . LYS B 1 402 ? -19.781 5.698   -16.584 1.00 13.45  ? 396 LYS B CB    1 
ATOM   6837 C  CG    . LYS B 1 402 ? -20.976 5.827   -17.521 1.00 14.73  ? 396 LYS B CG    1 
ATOM   6838 C  CD    . LYS B 1 402 ? -20.941 4.861   -18.702 1.00 13.19  ? 396 LYS B CD    1 
ATOM   6839 C  CE    . LYS B 1 402 ? -22.004 5.256   -19.722 1.00 14.84  ? 396 LYS B CE    1 
ATOM   6840 N  NZ    . LYS B 1 402 ? -22.189 4.276   -20.820 1.00 11.61  ? 396 LYS B NZ    1 
ATOM   6841 N  N     . ILE B 1 403 ? -19.020 4.615   -13.349 1.00 13.35  ? 397 ILE B N     1 
ATOM   6842 C  CA    . ILE B 1 403 ? -18.078 4.987   -12.310 1.00 11.37  ? 397 ILE B CA    1 
ATOM   6843 C  C     . ILE B 1 403 ? -16.966 3.965   -12.275 1.00 13.48  ? 397 ILE B C     1 
ATOM   6844 O  O     . ILE B 1 403 ? -15.808 4.288   -12.015 1.00 13.03  ? 397 ILE B O     1 
ATOM   6845 C  CB    . ILE B 1 403 ? -18.762 5.072   -10.961 1.00 12.72  ? 397 ILE B CB    1 
ATOM   6846 C  CG1   . ILE B 1 403 ? -19.682 6.296   -10.931 1.00 10.80  ? 397 ILE B CG1   1 
ATOM   6847 C  CG2   . ILE B 1 403 ? -17.723 5.098   -9.837  1.00 12.30  ? 397 ILE B CG2   1 
ATOM   6848 C  CD1   . ILE B 1 403 ? -20.219 6.618   -9.544  1.00 16.09  ? 397 ILE B CD1   1 
ATOM   6849 N  N     . ARG B 1 404 ? -17.334 2.728   -12.591 1.00 17.02  ? 398 ARG B N     1 
ATOM   6850 C  CA    . ARG B 1 404 ? -16.393 1.616   -12.639 1.00 14.92  ? 398 ARG B CA    1 
ATOM   6851 C  C     . ARG B 1 404 ? -15.257 1.900   -13.614 1.00 14.36  ? 398 ARG B C     1 
ATOM   6852 O  O     . ARG B 1 404 ? -14.164 1.375   -13.436 1.00 12.57  ? 398 ARG B O     1 
ATOM   6853 C  CB    . ARG B 1 404 ? -17.118 0.325   -13.013 1.00 14.43  ? 398 ARG B CB    1 
ATOM   6854 C  CG    . ARG B 1 404 ? -16.554 -0.907  -12.335 1.00 17.69  ? 398 ARG B CG    1 
ATOM   6855 C  CD    . ARG B 1 404 ? -17.311 -2.189  -12.711 1.00 17.88  ? 398 ARG B CD    1 
ATOM   6856 N  NE    . ARG B 1 404 ? -17.357 -2.453  -14.151 1.00 17.30  ? 398 ARG B NE    1 
ATOM   6857 C  CZ    . ARG B 1 404 ? -18.460 -2.334  -14.892 1.00 31.07  ? 398 ARG B CZ    1 
ATOM   6858 N  NH1   . ARG B 1 404 ? -19.598 -1.959  -14.315 1.00 28.31  ? 398 ARG B NH1   1 
ATOM   6859 N  NH2   . ARG B 1 404 ? -18.437 -2.586  -16.206 1.00 33.09  ? 398 ARG B NH2   1 
ATOM   6860 N  N     . VAL B 1 405 ? -15.531 2.746   -14.618 1.00 15.84  ? 399 VAL B N     1 
ATOM   6861 C  CA    . VAL B 1 405 ? -14.532 3.271   -15.563 1.00 13.70  ? 399 VAL B CA    1 
ATOM   6862 C  C     . VAL B 1 405 ? -13.448 4.060   -14.837 1.00 12.73  ? 399 VAL B C     1 
ATOM   6863 O  O     . VAL B 1 405 ? -12.252 3.872   -15.085 1.00 13.97  ? 399 VAL B O     1 
ATOM   6864 C  CB    . VAL B 1 405 ? -15.185 4.178   -16.661 1.00 15.28  ? 399 VAL B CB    1 
ATOM   6865 C  CG1   . VAL B 1 405 ? -14.142 4.879   -17.511 1.00 10.17  ? 399 VAL B CG1   1 
ATOM   6866 C  CG2   . VAL B 1 405 ? -16.136 3.372   -17.550 1.00 10.33  ? 399 VAL B CG2   1 
ATOM   6867 N  N     . LEU B 1 406 ? -13.873 4.937   -13.935 1.00 13.59  ? 400 LEU B N     1 
ATOM   6868 C  CA    . LEU B 1 406 ? -12.945 5.715   -13.112 1.00 15.53  ? 400 LEU B CA    1 
ATOM   6869 C  C     . LEU B 1 406 ? -12.180 4.824   -12.130 1.00 15.62  ? 400 LEU B C     1 
ATOM   6870 O  O     . LEU B 1 406 ? -11.064 5.154   -11.728 1.00 15.89  ? 400 LEU B O     1 
ATOM   6871 C  CB    . LEU B 1 406 ? -13.697 6.816   -12.347 1.00 14.76  ? 400 LEU B CB    1 
ATOM   6872 C  CG    . LEU B 1 406 ? -12.971 8.002   -11.700 1.00 10.76  ? 400 LEU B CG    1 
ATOM   6873 C  CD1   . LEU B 1 406 ? -13.142 7.962   -10.229 1.00 7.64   ? 400 LEU B CD1   1 
ATOM   6874 C  CD2   . LEU B 1 406 ? -11.493 8.077   -12.056 1.00 13.02  ? 400 LEU B CD2   1 
ATOM   6875 N  N     . VAL B 1 407 ? -12.775 3.704   -11.727 1.00 14.19  ? 401 VAL B N     1 
ATOM   6876 C  CA    . VAL B 1 407 ? -12.086 2.818   -10.798 1.00 11.08  ? 401 VAL B CA    1 
ATOM   6877 C  C     . VAL B 1 407 ? -11.004 2.097   -11.569 1.00 13.81  ? 401 VAL B C     1 
ATOM   6878 O  O     . VAL B 1 407 ? -9.850  2.063   -11.154 1.00 11.03  ? 401 VAL B O     1 
ATOM   6879 C  CB    . VAL B 1 407 ? -13.021 1.791   -10.198 1.00 11.29  ? 401 VAL B CB    1 
ATOM   6880 C  CG1   . VAL B 1 407 ? -12.291 0.994   -9.149  1.00 10.96  ? 401 VAL B CG1   1 
ATOM   6881 C  CG2   . VAL B 1 407 ? -14.230 2.471   -9.606  1.00 13.84  ? 401 VAL B CG2   1 
ATOM   6882 N  N     . GLY B 1 408 ? -11.397 1.530   -12.709 1.00 15.20  ? 402 GLY B N     1 
ATOM   6883 C  CA    . GLY B 1 408 ? -10.483 0.854   -13.606 1.00 10.19  ? 402 GLY B CA    1 
ATOM   6884 C  C     . GLY B 1 408 ? -9.324  1.751   -13.972 1.00 11.90  ? 402 GLY B C     1 
ATOM   6885 O  O     . GLY B 1 408 ? -8.164  1.341   -13.858 1.00 9.85   ? 402 GLY B O     1 
ATOM   6886 N  N     . ASN B 1 409 ? -9.631  2.974   -14.403 1.00 12.22  ? 403 ASN B N     1 
ATOM   6887 C  CA    . ASN B 1 409 ? -8.580  3.930   -14.715 1.00 12.75  ? 403 ASN B CA    1 
ATOM   6888 C  C     . ASN B 1 409 ? -7.583  3.990   -13.586 1.00 14.55  ? 403 ASN B C     1 
ATOM   6889 O  O     . ASN B 1 409 ? -6.395  3.726   -13.787 1.00 16.51  ? 403 ASN B O     1 
ATOM   6890 C  CB    . ASN B 1 409 ? -9.135  5.311   -15.012 1.00 11.46  ? 403 ASN B CB    1 
ATOM   6891 C  CG    . ASN B 1 409 ? -9.806  5.368   -16.343 1.00 14.38  ? 403 ASN B CG    1 
ATOM   6892 O  OD1   . ASN B 1 409 ? -9.758  4.407   -17.116 1.00 12.88  ? 403 ASN B OD1   1 
ATOM   6893 N  ND2   . ASN B 1 409 ? -10.428 6.499   -16.641 1.00 18.12  ? 403 ASN B ND2   1 
ATOM   6894 N  N     . LEU B 1 410 ? -8.082  4.273   -12.387 1.00 13.51  ? 404 LEU B N     1 
ATOM   6895 C  CA    . LEU B 1 410 ? -7.238  4.313   -11.202 1.00 11.91  ? 404 LEU B CA    1 
ATOM   6896 C  C     . LEU B 1 410 ? -6.481  3.000   -10.964 1.00 12.67  ? 404 LEU B C     1 
ATOM   6897 O  O     . LEU B 1 410 ? -5.302  3.031   -10.655 1.00 15.75  ? 404 LEU B O     1 
ATOM   6898 C  CB    . LEU B 1 410 ? -8.049  4.702   -9.962  1.00 10.70  ? 404 LEU B CB    1 
ATOM   6899 C  CG    . LEU B 1 410 ? -8.587  6.126   -9.907  1.00 10.27  ? 404 LEU B CG    1 
ATOM   6900 C  CD1   . LEU B 1 410 ? -9.530  6.289   -8.749  1.00 11.69  ? 404 LEU B CD1   1 
ATOM   6901 C  CD2   . LEU B 1 410 ? -7.432  7.095   -9.787  1.00 12.86  ? 404 LEU B CD2   1 
ATOM   6902 N  N     . GLU B 1 411 ? -7.138  1.851   -11.105 1.00 10.46  ? 405 GLU B N     1 
ATOM   6903 C  CA    . GLU B 1 411 ? -6.462  0.592   -10.797 1.00 10.48  ? 405 GLU B CA    1 
ATOM   6904 C  C     . GLU B 1 411 ? -5.287  0.370   -11.738 1.00 11.59  ? 405 GLU B C     1 
ATOM   6905 O  O     . GLU B 1 411 ? -4.210  -0.073  -11.312 1.00 8.49   ? 405 GLU B O     1 
ATOM   6906 C  CB    . GLU B 1 411 ? -7.418  -0.589  -10.895 1.00 11.77  ? 405 GLU B CB    1 
ATOM   6907 C  CG    . GLU B 1 411 ? -8.594  -0.557  -9.945  1.00 9.29   ? 405 GLU B CG    1 
ATOM   6908 C  CD    . GLU B 1 411 ? -9.490  -1.771  -10.143 1.00 12.12  ? 405 GLU B CD    1 
ATOM   6909 O  OE1   . GLU B 1 411 ? -9.880  -2.054  -11.304 1.00 12.68  ? 405 GLU B OE1   1 
ATOM   6910 O  OE2   . GLU B 1 411 ? -9.772  -2.463  -9.142  1.00 10.77  ? 405 GLU B OE2   1 
ATOM   6911 N  N     . ARG B 1 412 ? -5.522  0.693   -13.017 1.00 13.12  ? 406 ARG B N     1 
ATOM   6912 C  CA    . ARG B 1 412 ? -4.539  0.560   -14.089 1.00 8.56   ? 406 ARG B CA    1 
ATOM   6913 C  C     . ARG B 1 412 ? -3.327  1.440   -13.823 1.00 11.96  ? 406 ARG B C     1 
ATOM   6914 O  O     . ARG B 1 412 ? -2.238  1.152   -14.307 1.00 13.40  ? 406 ARG B O     1 
ATOM   6915 C  CB    . ARG B 1 412 ? -5.170  0.904   -15.446 1.00 8.29   ? 406 ARG B CB    1 
ATOM   6916 C  CG    . ARG B 1 412 ? -5.704  -0.305  -16.241 1.00 10.17  ? 406 ARG B CG    1 
ATOM   6917 C  CD    . ARG B 1 412 ? -6.461  0.093   -17.492 1.00 7.81   ? 406 ARG B CD    1 
ATOM   6918 N  NE    . ARG B 1 412 ? -7.864  0.411   -17.219 1.00 16.92  ? 406 ARG B NE    1 
ATOM   6919 C  CZ    . ARG B 1 412 ? -8.432  1.605   -17.420 1.00 16.53  ? 406 ARG B CZ    1 
ATOM   6920 N  NH1   . ARG B 1 412 ? -7.721  2.626   -17.905 1.00 11.34  ? 406 ARG B NH1   1 
ATOM   6921 N  NH2   . ARG B 1 412 ? -9.721  1.783   -17.127 1.00 14.21  ? 406 ARG B NH2   1 
ATOM   6922 N  N     . ASN B 1 413 ? -3.529  2.505   -13.045 1.00 12.38  ? 407 ASN B N     1 
ATOM   6923 C  CA    . ASN B 1 413 ? -2.467  3.442   -12.674 1.00 12.32  ? 407 ASN B CA    1 
ATOM   6924 C  C     . ASN B 1 413 ? -1.265  2.823   -11.985 1.00 17.01  ? 407 ASN B C     1 
ATOM   6925 O  O     . ASN B 1 413 ? -1.387  1.959   -11.118 1.00 19.14  ? 407 ASN B O     1 
ATOM   6926 C  CB    . ASN B 1 413 ? -3.011  4.564   -11.796 1.00 12.33  ? 407 ASN B CB    1 
ATOM   6927 C  CG    . ASN B 1 413 ? -1.959  5.593   -11.442 1.00 13.42  ? 407 ASN B CG    1 
ATOM   6928 O  OD1   . ASN B 1 413 ? -0.929  5.280   -10.852 1.00 16.93  ? 407 ASN B OD1   1 
ATOM   6929 N  ND2   . ASN B 1 413 ? -2.217  6.836   -11.805 1.00 11.83  ? 407 ASN B ND2   1 
ATOM   6930 N  N     . GLU B 1 414 ? -0.102  3.336   -12.357 1.00 21.08  ? 408 GLU B N     1 
ATOM   6931 C  CA    . GLU B 1 414 ? 1.179   2.815   -11.926 1.00 21.89  ? 408 GLU B CA    1 
ATOM   6932 C  C     . GLU B 1 414 ? 1.333   2.873   -10.416 1.00 24.92  ? 408 GLU B C     1 
ATOM   6933 O  O     . GLU B 1 414 ? 1.823   1.929   -9.799  1.00 32.01  ? 408 GLU B O     1 
ATOM   6934 C  CB    . GLU B 1 414 ? 2.267   3.651   -12.585 1.00 27.86  ? 408 GLU B CB    1 
ATOM   6935 C  CG    . GLU B 1 414 ? 3.659   3.086   -12.496 1.00 37.49  ? 408 GLU B CG    1 
ATOM   6936 C  CD    . GLU B 1 414 ? 4.706   4.140   -12.823 1.00 50.29  ? 408 GLU B CD    1 
ATOM   6937 O  OE1   . GLU B 1 414 ? 4.327   5.317   -13.055 1.00 43.39  ? 408 GLU B OE1   1 
ATOM   6938 O  OE2   . GLU B 1 414 ? 5.908   3.792   -12.843 1.00 66.76  ? 408 GLU B OE2   1 
ATOM   6939 N  N     . PHE B 1 415 ? 0.888   3.982   -9.831  1.00 26.84  ? 409 PHE B N     1 
ATOM   6940 C  CA    . PHE B 1 415 ? 1.150   4.315   -8.425  1.00 26.70  ? 409 PHE B CA    1 
ATOM   6941 C  C     . PHE B 1 415 ? 0.060   3.879   -7.429  1.00 24.44  ? 409 PHE B C     1 
ATOM   6942 O  O     . PHE B 1 415 ? 0.219   4.020   -6.219  1.00 23.47  ? 409 PHE B O     1 
ATOM   6943 C  CB    . PHE B 1 415 ? 1.355   5.828   -8.303  1.00 23.55  ? 409 PHE B CB    1 
ATOM   6944 C  CG    . PHE B 1 415 ? 2.618   6.324   -8.951  1.00 33.90  ? 409 PHE B CG    1 
ATOM   6945 C  CD1   . PHE B 1 415 ? 3.787   5.577   -8.885  1.00 36.86  ? 409 PHE B CD1   1 
ATOM   6946 C  CD2   . PHE B 1 415 ? 2.637   7.535   -9.622  1.00 31.38  ? 409 PHE B CD2   1 
ATOM   6947 C  CE1   . PHE B 1 415 ? 4.948   6.032   -9.472  1.00 37.08  ? 409 PHE B CE1   1 
ATOM   6948 C  CE2   . PHE B 1 415 ? 3.788   7.998   -10.212 1.00 33.41  ? 409 PHE B CE2   1 
ATOM   6949 C  CZ    . PHE B 1 415 ? 4.948   7.247   -10.139 1.00 44.62  ? 409 PHE B CZ    1 
ATOM   6950 N  N     . ILE B 1 416 ? -1.035  3.339   -7.949  1.00 22.62  ? 410 ILE B N     1 
ATOM   6951 C  CA    . ILE B 1 416 ? -2.248  3.114   -7.178  1.00 15.45  ? 410 ILE B CA    1 
ATOM   6952 C  C     . ILE B 1 416 ? -2.492  1.638   -6.976  1.00 16.41  ? 410 ILE B C     1 
ATOM   6953 O  O     . ILE B 1 416 ? -2.399  0.856   -7.915  1.00 22.36  ? 410 ILE B O     1 
ATOM   6954 C  CB    . ILE B 1 416 ? -3.435  3.710   -7.939  1.00 18.11  ? 410 ILE B CB    1 
ATOM   6955 C  CG1   . ILE B 1 416 ? -3.464  5.231   -7.735  1.00 16.14  ? 410 ILE B CG1   1 
ATOM   6956 C  CG2   . ILE B 1 416 ? -4.739  3.037   -7.548  1.00 12.01  ? 410 ILE B CG2   1 
ATOM   6957 C  CD1   . ILE B 1 416 ? -4.310  5.956   -8.727  1.00 10.96  ? 410 ILE B CD1   1 
ATOM   6958 N  N     . THR B 1 417 ? -2.804  1.249   -5.749  1.00 16.94  ? 411 THR B N     1 
ATOM   6959 C  CA    . THR B 1 417 ? -2.969  -0.162  -5.441  1.00 16.51  ? 411 THR B CA    1 
ATOM   6960 C  C     . THR B 1 417 ? -4.435  -0.564  -5.372  1.00 20.38  ? 411 THR B C     1 
ATOM   6961 O  O     . THR B 1 417 ? -4.836  -1.629  -5.859  1.00 17.46  ? 411 THR B O     1 
ATOM   6962 C  CB    . THR B 1 417 ? -2.303  -0.498  -4.118  1.00 20.29  ? 411 THR B CB    1 
ATOM   6963 O  OG1   . THR B 1 417 ? -0.909  -0.176  -4.210  1.00 28.78  ? 411 THR B OG1   1 
ATOM   6964 C  CG2   . THR B 1 417 ? -2.468  -1.980  -3.803  1.00 19.46  ? 411 THR B CG2   1 
ATOM   6965 N  N     . LEU B 1 418 ? -5.241  0.300   -4.774  1.00 17.62  ? 412 LEU B N     1 
ATOM   6966 C  CA    . LEU B 1 418 ? -6.638  -0.014  -4.595  1.00 12.65  ? 412 LEU B CA    1 
ATOM   6967 C  C     . LEU B 1 418 ? -7.472  1.227   -4.786  1.00 10.60  ? 412 LEU B C     1 
ATOM   6968 O  O     . LEU B 1 418 ? -7.105  2.307   -4.332  1.00 12.66  ? 412 LEU B O     1 
ATOM   6969 C  CB    . LEU B 1 418 ? -6.854  -0.595  -3.197  1.00 14.49  ? 412 LEU B CB    1 
ATOM   6970 C  CG    . LEU B 1 418 ? -8.254  -1.025  -2.772  1.00 11.87  ? 412 LEU B CG    1 
ATOM   6971 C  CD1   . LEU B 1 418 ? -8.144  -2.342  -2.040  1.00 11.30  ? 412 LEU B CD1   1 
ATOM   6972 C  CD2   . LEU B 1 418 ? -8.920  0.033   -1.880  1.00 12.11  ? 412 LEU B CD2   1 
ATOM   6973 N  N     . ALA B 1 419 ? -8.595  1.053   -5.470  1.00 11.44  ? 413 ALA B N     1 
ATOM   6974 C  CA    . ALA B 1 419 ? -9.606  2.086   -5.618  1.00 11.56  ? 413 ALA B CA    1 
ATOM   6975 C  C     . ALA B 1 419 ? -10.939 1.528   -5.155  1.00 9.68   ? 413 ALA B C     1 
ATOM   6976 O  O     . ALA B 1 419 ? -11.402 0.500   -5.640  1.00 7.64   ? 413 ALA B O     1 
ATOM   6977 C  CB    . ALA B 1 419 ? -9.700  2.562   -7.067  1.00 7.34   ? 413 ALA B CB    1 
ATOM   6978 N  N     . HIS B 1 420 ? -11.564 2.237   -4.229  1.00 13.11  ? 414 HIS B N     1 
ATOM   6979 C  CA    . HIS B 1 420 ? -12.741 1.738   -3.556  1.00 13.52  ? 414 HIS B CA    1 
ATOM   6980 C  C     . HIS B 1 420 ? -13.880 2.751   -3.648  1.00 13.08  ? 414 HIS B C     1 
ATOM   6981 O  O     . HIS B 1 420 ? -13.872 3.746   -2.929  1.00 12.40  ? 414 HIS B O     1 
ATOM   6982 C  CB    . HIS B 1 420 ? -12.364 1.454   -2.101  1.00 9.66   ? 414 HIS B CB    1 
ATOM   6983 C  CG    . HIS B 1 420 ? -13.500 0.993   -1.247  1.00 14.46  ? 414 HIS B CG    1 
ATOM   6984 N  ND1   . HIS B 1 420 ? -13.329 0.621   0.071   1.00 16.96  ? 414 HIS B ND1   1 
ATOM   6985 C  CD2   . HIS B 1 420 ? -14.819 0.838   -1.511  1.00 11.37  ? 414 HIS B CD2   1 
ATOM   6986 C  CE1   . HIS B 1 420 ? -14.492 0.256   0.577   1.00 13.54  ? 414 HIS B CE1   1 
ATOM   6987 N  NE2   . HIS B 1 420 ? -15.412 0.376   -0.364  1.00 13.13  ? 414 HIS B NE2   1 
ATOM   6988 N  N     . VAL B 1 421 ? -14.858 2.494   -4.520  1.00 8.79   ? 415 VAL B N     1 
ATOM   6989 C  CA    . VAL B 1 421 ? -16.059 3.332   -4.555  1.00 11.48  ? 415 VAL B CA    1 
ATOM   6990 C  C     . VAL B 1 421 ? -17.028 3.038   -3.443  1.00 15.33  ? 415 VAL B C     1 
ATOM   6991 O  O     . VAL B 1 421 ? -17.310 1.873   -3.143  1.00 12.93  ? 415 VAL B O     1 
ATOM   6992 C  CB    . VAL B 1 421 ? -16.948 3.114   -5.791  1.00 13.72  ? 415 VAL B CB    1 
ATOM   6993 C  CG1   . VAL B 1 421 ? -17.003 4.364   -6.610  1.00 13.98  ? 415 VAL B CG1   1 
ATOM   6994 C  CG2   . VAL B 1 421 ? -16.529 1.892   -6.591  1.00 17.02  ? 415 VAL B CG2   1 
ATOM   6995 N  N     . ASN B 1 422 ? -17.597 4.102   -2.890  1.00 14.04  ? 416 ASN B N     1 
ATOM   6996 C  CA    . ASN B 1 422 ? -18.720 3.976   -1.990  1.00 12.71  ? 416 ASN B CA    1 
ATOM   6997 C  C     . ASN B 1 422 ? -20.022 4.053   -2.777  1.00 14.59  ? 416 ASN B C     1 
ATOM   6998 O  O     . ASN B 1 422 ? -20.330 5.072   -3.377  1.00 16.53  ? 416 ASN B O     1 
ATOM   6999 C  CB    . ASN B 1 422 ? -18.667 5.084   -0.955  1.00 16.93  ? 416 ASN B CB    1 
ATOM   7000 C  CG    . ASN B 1 422 ? -19.626 4.857   0.173   1.00 21.74  ? 416 ASN B CG    1 
ATOM   7001 O  OD1   . ASN B 1 422 ? -20.701 4.285   -0.016  1.00 23.88  ? 416 ASN B OD1   1 
ATOM   7002 N  ND2   . ASN B 1 422 ? -19.242 5.290   1.368   1.00 23.04  ? 416 ASN B ND2   1 
ATOM   7003 N  N     . PRO B 1 423 ? -20.794 2.964   -2.782  1.00 14.66  ? 417 PRO B N     1 
ATOM   7004 C  CA    . PRO B 1 423 ? -22.039 2.917   -3.551  1.00 15.86  ? 417 PRO B CA    1 
ATOM   7005 C  C     . PRO B 1 423 ? -23.086 3.918   -3.100  1.00 19.24  ? 417 PRO B C     1 
ATOM   7006 O  O     . PRO B 1 423 ? -24.061 4.137   -3.813  1.00 22.72  ? 417 PRO B O     1 
ATOM   7007 C  CB    . PRO B 1 423 ? -22.541 1.485   -3.339  1.00 14.40  ? 417 PRO B CB    1 
ATOM   7008 C  CG    . PRO B 1 423 ? -21.728 0.926   -2.241  1.00 16.46  ? 417 PRO B CG    1 
ATOM   7009 C  CD    . PRO B 1 423 ? -20.426 1.644   -2.256  1.00 17.04  ? 417 PRO B CD    1 
ATOM   7010 N  N     . GLN B 1 424 ? -22.876 4.528   -1.944  1.00 19.89  ? 418 GLN B N     1 
ATOM   7011 C  CA    . GLN B 1 424 ? -23.775 5.564   -1.445  1.00 33.85  ? 418 GLN B CA    1 
ATOM   7012 C  C     . GLN B 1 424 ? -23.643 6.887   -2.201  1.00 29.43  ? 418 GLN B C     1 
ATOM   7013 O  O     . GLN B 1 424 ? -22.565 7.477   -2.218  1.00 31.48  ? 418 GLN B O     1 
ATOM   7014 C  CB    . GLN B 1 424 ? -23.456 5.849   0.025   1.00 35.32  ? 418 GLN B CB    1 
ATOM   7015 C  CG    . GLN B 1 424 ? -24.631 6.336   0.842   1.00 34.49  ? 418 GLN B CG    1 
ATOM   7016 C  CD    . GLN B 1 424 ? -25.190 5.227   1.697   1.00 42.97  ? 418 GLN B CD    1 
ATOM   7017 O  OE1   . GLN B 1 424 ? -24.879 5.140   2.887   1.00 54.52  ? 418 GLN B OE1   1 
ATOM   7018 N  NE2   . GLN B 1 424 ? -26.000 4.349   1.092   1.00 30.69  ? 418 GLN B NE2   1 
ATOM   7019 N  N     . SER B 1 425 ? -24.720 7.386   -2.796  1.00 25.06  ? 419 SER B N     1 
ATOM   7020 C  CA    . SER B 1 425 ? -24.666 8.774   -3.256  1.00 30.63  ? 419 SER B CA    1 
ATOM   7021 C  C     . SER B 1 425 ? -25.024 9.692   -2.094  1.00 31.51  ? 419 SER B C     1 
ATOM   7022 O  O     . SER B 1 425 ? -25.681 9.261   -1.147  1.00 33.28  ? 419 SER B O     1 
ATOM   7023 C  CB    . SER B 1 425 ? -25.565 9.028   -4.471  1.00 23.47  ? 419 SER B CB    1 
ATOM   7024 O  OG    . SER B 1 425 ? -26.852 8.470   -4.304  1.00 19.95  ? 419 SER B OG    1 
ATOM   7025 N  N     . PHE B 1 426 ? -24.563 10.938  -2.167  1.00 28.73  ? 420 PHE B N     1 
ATOM   7026 C  CA    . PHE B 1 426 ? -24.830 11.964  -1.155  1.00 33.07  ? 420 PHE B CA    1 
ATOM   7027 C  C     . PHE B 1 426 ? -25.250 13.278  -1.837  1.00 44.70  ? 420 PHE B C     1 
ATOM   7028 O  O     . PHE B 1 426 ? -24.983 13.470  -3.020  1.00 42.92  ? 420 PHE B O     1 
ATOM   7029 C  CB    . PHE B 1 426 ? -23.582 12.218  -0.312  1.00 24.39  ? 420 PHE B CB    1 
ATOM   7030 C  CG    . PHE B 1 426 ? -23.170 11.054  0.542   1.00 35.82  ? 420 PHE B CG    1 
ATOM   7031 C  CD1   . PHE B 1 426 ? -22.372 10.044  0.028   1.00 32.45  ? 420 PHE B CD1   1 
ATOM   7032 C  CD2   . PHE B 1 426 ? -23.566 10.975  1.869   1.00 39.18  ? 420 PHE B CD2   1 
ATOM   7033 C  CE1   . PHE B 1 426 ? -21.985 8.979   0.813   1.00 25.90  ? 420 PHE B CE1   1 
ATOM   7034 C  CE2   . PHE B 1 426 ? -23.182 9.908   2.653   1.00 31.90  ? 420 PHE B CE2   1 
ATOM   7035 C  CZ    . PHE B 1 426 ? -22.389 8.911   2.123   1.00 32.68  ? 420 PHE B CZ    1 
ATOM   7036 N  N     . PRO B 1 427 ? -25.919 14.186  -1.101  1.00 48.89  ? 421 PRO B N     1 
ATOM   7037 C  CA    . PRO B 1 427 ? -26.275 15.481  -1.706  1.00 46.54  ? 421 PRO B CA    1 
ATOM   7038 C  C     . PRO B 1 427 ? -25.399 16.679  -1.269  1.00 45.39  ? 421 PRO B C     1 
ATOM   7039 O  O     . PRO B 1 427 ? -24.276 16.473  -0.808  1.00 44.48  ? 421 PRO B O     1 
ATOM   7040 C  CB    . PRO B 1 427 ? -27.726 15.664  -1.269  1.00 49.86  ? 421 PRO B CB    1 
ATOM   7041 C  CG    . PRO B 1 427 ? -27.800 14.943  0.068   1.00 45.19  ? 421 PRO B CG    1 
ATOM   7042 C  CD    . PRO B 1 427 ? -26.731 13.887  0.094   1.00 37.71  ? 421 PRO B CD    1 
ATOM   7043 N  N     . GLY B 1 428 ? -25.903 17.906  -1.424  1.00 46.70  ? 422 GLY B N     1 
ATOM   7044 C  CA    . GLY B 1 428 ? -25.122 19.103  -1.135  1.00 52.61  ? 422 GLY B CA    1 
ATOM   7045 C  C     . GLY B 1 428 ? -25.582 19.940  0.051   1.00 44.39  ? 422 GLY B C     1 
ATOM   7046 O  O     . GLY B 1 428 ? -24.833 20.786  0.564   1.00 38.51  ? 422 GLY B O     1 
ATOM   7047 N  N     . ASN B 1 437 ? -30.069 24.153  -9.378  1.00 61.50  ? 431 ASN B N     1 
ATOM   7048 C  CA    . ASN B 1 437 ? -28.782 23.486  -9.195  1.00 63.26  ? 431 ASN B CA    1 
ATOM   7049 C  C     . ASN B 1 437 ? -28.916 22.215  -8.361  1.00 59.72  ? 431 ASN B C     1 
ATOM   7050 O  O     . ASN B 1 437 ? -28.885 22.268  -7.134  1.00 61.12  ? 431 ASN B O     1 
ATOM   7051 C  CB    . ASN B 1 437 ? -27.770 24.435  -8.544  1.00 65.28  ? 431 ASN B CB    1 
ATOM   7052 C  CG    . ASN B 1 437 ? -26.325 24.054  -8.844  1.00 66.48  ? 431 ASN B CG    1 
ATOM   7053 O  OD1   . ASN B 1 437 ? -26.049 23.287  -9.771  1.00 53.39  ? 431 ASN B OD1   1 
ATOM   7054 N  ND2   . ASN B 1 437 ? -25.394 24.604  -8.065  1.00 68.85  ? 431 ASN B ND2   1 
ATOM   7055 N  N     . TYR B 1 438 ? -29.061 21.074  -9.033  1.00 59.77  ? 432 TYR B N     1 
ATOM   7056 C  CA    . TYR B 1 438 ? -29.286 19.792  -8.357  1.00 53.82  ? 432 TYR B CA    1 
ATOM   7057 C  C     . TYR B 1 438 ? -28.023 18.909  -8.365  1.00 50.54  ? 432 TYR B C     1 
ATOM   7058 O  O     . TYR B 1 438 ? -27.475 18.622  -9.429  1.00 56.05  ? 432 TYR B O     1 
ATOM   7059 C  CB    . TYR B 1 438 ? -30.465 19.043  -8.999  1.00 47.53  ? 432 TYR B CB    1 
ATOM   7060 C  CG    . TYR B 1 438 ? -31.812 19.745  -8.902  1.00 57.86  ? 432 TYR B CG    1 
ATOM   7061 C  CD1   . TYR B 1 438 ? -31.931 21.002  -8.321  1.00 61.81  ? 432 TYR B CD1   1 
ATOM   7062 C  CD2   . TYR B 1 438 ? -32.972 19.135  -9.381  1.00 61.07  ? 432 TYR B CD2   1 
ATOM   7063 C  CE1   . TYR B 1 438 ? -33.154 21.640  -8.233  1.00 79.67  ? 432 TYR B CE1   1 
ATOM   7064 C  CE2   . TYR B 1 438 ? -34.203 19.763  -9.294  1.00 62.75  ? 432 TYR B CE2   1 
ATOM   7065 C  CZ    . TYR B 1 438 ? -34.288 21.018  -8.716  1.00 82.62  ? 432 TYR B CZ    1 
ATOM   7066 O  OH    . TYR B 1 438 ? -35.502 21.664  -8.619  1.00 91.93  ? 432 TYR B OH    1 
ATOM   7067 N  N     . VAL B 1 439 ? -27.576 18.464  -7.189  1.00 42.25  ? 433 VAL B N     1 
ATOM   7068 C  CA    . VAL B 1 439 ? -26.272 17.802  -7.057  1.00 35.04  ? 433 VAL B CA    1 
ATOM   7069 C  C     . VAL B 1 439 ? -26.267 16.465  -6.278  1.00 38.95  ? 433 VAL B C     1 
ATOM   7070 O  O     . VAL B 1 439 ? -26.886 16.346  -5.214  1.00 36.78  ? 433 VAL B O     1 
ATOM   7071 C  CB    . VAL B 1 439 ? -25.231 18.783  -6.434  1.00 34.45  ? 433 VAL B CB    1 
ATOM   7072 C  CG1   . VAL B 1 439 ? -24.012 18.051  -5.913  1.00 39.21  ? 433 VAL B CG1   1 
ATOM   7073 C  CG2   . VAL B 1 439 ? -24.825 19.847  -7.438  1.00 38.54  ? 433 VAL B CG2   1 
ATOM   7074 N  N     . SER B 1 440 ? -25.574 15.467  -6.838  1.00 43.34  ? 434 SER B N     1 
ATOM   7075 C  CA    . SER B 1 440 ? -25.199 14.236  -6.125  1.00 34.53  ? 434 SER B CA    1 
ATOM   7076 C  C     . SER B 1 440 ? -23.677 14.046  -6.099  1.00 26.55  ? 434 SER B C     1 
ATOM   7077 O  O     . SER B 1 440 ? -22.958 14.510  -6.984  1.00 28.51  ? 434 SER B O     1 
ATOM   7078 C  CB    . SER B 1 440 ? -25.838 12.997  -6.763  1.00 30.80  ? 434 SER B CB    1 
ATOM   7079 O  OG    . SER B 1 440 ? -27.242 13.000  -6.626  1.00 31.65  ? 434 SER B OG    1 
ATOM   7080 N  N     . MET B 1 441 ? -23.181 13.351  -5.089  1.00 24.70  ? 435 MET B N     1 
ATOM   7081 C  CA    . MET B 1 441 ? -21.752 13.100  -5.023  1.00 28.61  ? 435 MET B CA    1 
ATOM   7082 C  C     . MET B 1 441 ? -21.412 11.692  -4.560  1.00 25.91  ? 435 MET B C     1 
ATOM   7083 O  O     . MET B 1 441 ? -22.214 11.023  -3.905  1.00 23.27  ? 435 MET B O     1 
ATOM   7084 C  CB    . MET B 1 441 ? -21.019 14.177  -4.206  1.00 30.38  ? 435 MET B CB    1 
ATOM   7085 C  CG    . MET B 1 441 ? -21.606 14.457  -2.828  1.00 45.48  ? 435 MET B CG    1 
ATOM   7086 S  SD    . MET B 1 441 ? -21.166 16.080  -2.141  1.00 43.00  ? 435 MET B SD    1 
ATOM   7087 C  CE    . MET B 1 441 ? -19.500 16.278  -2.755  1.00 22.87  ? 435 MET B CE    1 
ATOM   7088 N  N     . TRP B 1 442 ? -20.223 11.243  -4.960  1.00 25.63  ? 436 TRP B N     1 
ATOM   7089 C  CA    . TRP B 1 442 ? -19.739 9.907   -4.654  1.00 21.58  ? 436 TRP B CA    1 
ATOM   7090 C  C     . TRP B 1 442 ? -18.305 9.998   -4.185  1.00 20.04  ? 436 TRP B C     1 
ATOM   7091 O  O     . TRP B 1 442 ? -17.613 10.976  -4.459  1.00 17.57  ? 436 TRP B O     1 
ATOM   7092 C  CB    . TRP B 1 442 ? -19.767 9.021   -5.885  1.00 21.11  ? 436 TRP B CB    1 
ATOM   7093 C  CG    . TRP B 1 442 ? -21.103 8.494   -6.313  1.00 21.89  ? 436 TRP B CG    1 
ATOM   7094 C  CD1   . TRP B 1 442 ? -21.703 7.349   -5.885  1.00 22.19  ? 436 TRP B CD1   1 
ATOM   7095 C  CD2   . TRP B 1 442 ? -21.966 9.048   -7.311  1.00 18.50  ? 436 TRP B CD2   1 
ATOM   7096 N  NE1   . TRP B 1 442 ? -22.904 7.170   -6.533  1.00 20.26  ? 436 TRP B NE1   1 
ATOM   7097 C  CE2   . TRP B 1 442 ? -23.086 8.196   -7.416  1.00 18.38  ? 436 TRP B CE2   1 
ATOM   7098 C  CE3   . TRP B 1 442 ? -21.906 10.184  -8.118  1.00 18.40  ? 436 TRP B CE3   1 
ATOM   7099 C  CZ2   . TRP B 1 442 ? -24.135 8.446   -8.291  1.00 18.09  ? 436 TRP B CZ2   1 
ATOM   7100 C  CZ3   . TRP B 1 442 ? -22.955 10.437  -8.984  1.00 17.79  ? 436 TRP B CZ3   1 
ATOM   7101 C  CH2   . TRP B 1 442 ? -24.053 9.570   -9.065  1.00 20.77  ? 436 TRP B CH2   1 
ATOM   7102 N  N     . PHE B 1 443 ? -17.850 8.955   -3.502  1.00 21.03  ? 437 PHE B N     1 
ATOM   7103 C  CA    . PHE B 1 443 ? -16.522 8.967   -2.924  1.00 15.56  ? 437 PHE B CA    1 
ATOM   7104 C  C     . PHE B 1 443 ? -15.708 7.722   -3.210  1.00 16.29  ? 437 PHE B C     1 
ATOM   7105 O  O     . PHE B 1 443 ? -16.172 6.596   -3.021  1.00 15.94  ? 437 PHE B O     1 
ATOM   7106 C  CB    . PHE B 1 443 ? -16.624 9.190   -1.424  1.00 21.07  ? 437 PHE B CB    1 
ATOM   7107 C  CG    . PHE B 1 443 ? -17.157 10.528  -1.074  1.00 22.26  ? 437 PHE B CG    1 
ATOM   7108 C  CD1   . PHE B 1 443 ? -16.316 11.624  -1.036  1.00 19.59  ? 437 PHE B CD1   1 
ATOM   7109 C  CD2   . PHE B 1 443 ? -18.504 10.702  -0.821  1.00 19.56  ? 437 PHE B CD2   1 
ATOM   7110 C  CE1   . PHE B 1 443 ? -16.807 12.855  -0.738  1.00 21.96  ? 437 PHE B CE1   1 
ATOM   7111 C  CE2   . PHE B 1 443 ? -18.997 11.934  -0.527  1.00 18.43  ? 437 PHE B CE2   1 
ATOM   7112 C  CZ    . PHE B 1 443 ? -18.153 13.011  -0.484  1.00 23.90  ? 437 PHE B CZ    1 
ATOM   7113 N  N     . LEU B 1 444 ? -14.479 7.943   -3.652  1.00 13.27  ? 438 LEU B N     1 
ATOM   7114 C  CA    . LEU B 1 444 ? -13.554 6.854   -3.866  1.00 16.21  ? 438 LEU B CA    1 
ATOM   7115 C  C     . LEU B 1 444 ? -12.391 6.952   -2.911  1.00 16.97  ? 438 LEU B C     1 
ATOM   7116 O  O     . LEU B 1 444 ? -11.778 7.996   -2.787  1.00 22.06  ? 438 LEU B O     1 
ATOM   7117 C  CB    . LEU B 1 444 ? -13.026 6.885   -5.292  1.00 16.74  ? 438 LEU B CB    1 
ATOM   7118 C  CG    . LEU B 1 444 ? -14.017 6.415   -6.343  1.00 11.28  ? 438 LEU B CG    1 
ATOM   7119 C  CD1   . LEU B 1 444 ? -14.981 7.510   -6.762  1.00 10.04  ? 438 LEU B CD1   1 
ATOM   7120 C  CD2   . LEU B 1 444 ? -13.223 5.905   -7.501  1.00 10.34  ? 438 LEU B CD2   1 
ATOM   7121 N  N     . GLY B 1 445 ? -12.072 5.861   -2.240  1.00 16.85  ? 439 GLY B N     1 
ATOM   7122 C  CA    . GLY B 1 445 ? -10.890 5.857   -1.410  1.00 17.55  ? 439 GLY B CA    1 
ATOM   7123 C  C     . GLY B 1 445 ? -9.743  5.311   -2.221  1.00 18.47  ? 439 GLY B C     1 
ATOM   7124 O  O     . GLY B 1 445 ? -9.951  4.502   -3.123  1.00 19.89  ? 439 GLY B O     1 
ATOM   7125 N  N     . ILE B 1 446 ? -8.530  5.744   -1.911  1.00 16.01  ? 440 ILE B N     1 
ATOM   7126 C  CA    . ILE B 1 446 ? -7.371  5.298   -2.658  1.00 14.79  ? 440 ILE B CA    1 
ATOM   7127 C  C     . ILE B 1 446 ? -6.219  4.964   -1.736  1.00 16.89  ? 440 ILE B C     1 
ATOM   7128 O  O     . ILE B 1 446 ? -5.926  5.698   -0.798  1.00 24.22  ? 440 ILE B O     1 
ATOM   7129 C  CB    . ILE B 1 446 ? -6.932  6.368   -3.672  1.00 19.77  ? 440 ILE B CB    1 
ATOM   7130 C  CG1   . ILE B 1 446 ? -7.915  6.429   -4.834  1.00 16.50  ? 440 ILE B CG1   1 
ATOM   7131 C  CG2   . ILE B 1 446 ? -5.539  6.095   -4.214  1.00 16.43  ? 440 ILE B CG2   1 
ATOM   7132 C  CD1   . ILE B 1 446 ? -8.099  7.822   -5.338  1.00 21.91  ? 440 ILE B CD1   1 
ATOM   7133 N  N     . ILE B 1 447 ? -5.587  3.826   -1.989  1.00 16.71  ? 441 ILE B N     1 
ATOM   7134 C  CA    . ILE B 1 447 ? -4.297  3.528   -1.394  1.00 21.24  ? 441 ILE B CA    1 
ATOM   7135 C  C     . ILE B 1 447 ? -3.234  3.778   -2.466  1.00 23.35  ? 441 ILE B C     1 
ATOM   7136 O  O     . ILE B 1 447 ? -3.472  3.496   -3.644  1.00 25.24  ? 441 ILE B O     1 
ATOM   7137 C  CB    . ILE B 1 447 ? -4.228  2.056   -0.958  1.00 22.97  ? 441 ILE B CB    1 
ATOM   7138 C  CG1   . ILE B 1 447 ? -5.309  1.745   0.074   1.00 24.44  ? 441 ILE B CG1   1 
ATOM   7139 C  CG2   . ILE B 1 447 ? -2.872  1.719   -0.387  1.00 18.79  ? 441 ILE B CG2   1 
ATOM   7140 C  CD1   . ILE B 1 447 ? -5.390  0.274   0.422   1.00 16.05  ? 441 ILE B CD1   1 
ATOM   7141 N  N     . PHE B 1 448 ? -2.078  4.317   -2.080  1.00 20.20  ? 442 PHE B N     1 
ATOM   7142 C  CA    . PHE B 1 448 ? -0.946  4.397   -3.004  1.00 17.96  ? 442 PHE B CA    1 
ATOM   7143 C  C     . PHE B 1 448 ? 0.097   3.364   -2.594  1.00 20.96  ? 442 PHE B C     1 
ATOM   7144 O  O     . PHE B 1 448 ? -0.090  2.683   -1.593  1.00 26.32  ? 442 PHE B O     1 
ATOM   7145 C  CB    . PHE B 1 448 ? -0.342  5.798   -3.006  1.00 14.00  ? 442 PHE B CB    1 
ATOM   7146 C  CG    . PHE B 1 448 ? -1.199  6.829   -3.680  1.00 14.50  ? 442 PHE B CG    1 
ATOM   7147 C  CD1   . PHE B 1 448 ? -1.215  6.940   -5.055  1.00 14.65  ? 442 PHE B CD1   1 
ATOM   7148 C  CD2   . PHE B 1 448 ? -1.975  7.703   -2.936  1.00 21.03  ? 442 PHE B CD2   1 
ATOM   7149 C  CE1   . PHE B 1 448 ? -2.002  7.897   -5.684  1.00 15.53  ? 442 PHE B CE1   1 
ATOM   7150 C  CE2   . PHE B 1 448 ? -2.761  8.668   -3.556  1.00 22.01  ? 442 PHE B CE2   1 
ATOM   7151 C  CZ    . PHE B 1 448 ? -2.780  8.761   -4.936  1.00 18.06  ? 442 PHE B CZ    1 
ATOM   7152 N  N     . ARG B 1 449 ? 1.176   3.228   -3.364  1.00 18.88  ? 443 ARG B N     1 
ATOM   7153 C  CA    . ARG B 1 449 ? 2.321   2.425   -2.939  1.00 18.68  ? 443 ARG B CA    1 
ATOM   7154 C  C     . ARG B 1 449 ? 3.277   3.287   -2.096  1.00 23.38  ? 443 ARG B C     1 
ATOM   7155 O  O     . ARG B 1 449 ? 4.497   3.065   -2.053  1.00 23.59  ? 443 ARG B O     1 
ATOM   7156 C  CB    . ARG B 1 449 ? 3.070   1.865   -4.142  1.00 29.69  ? 443 ARG B CB    1 
ATOM   7157 C  CG    . ARG B 1 449 ? 2.208   1.224   -5.223  1.00 33.93  ? 443 ARG B CG    1 
ATOM   7158 C  CD    . ARG B 1 449 ? 3.078   0.674   -6.383  1.00 41.26  ? 443 ARG B CD    1 
ATOM   7159 N  NE    . ARG B 1 449 ? 3.927   1.699   -7.000  1.00 44.91  ? 443 ARG B NE    1 
ATOM   7160 C  CZ    . ARG B 1 449 ? 4.947   1.446   -7.818  1.00 42.64  ? 443 ARG B CZ    1 
ATOM   7161 N  NH1   . ARG B 1 449 ? 5.254   0.190   -8.122  1.00 43.71  ? 443 ARG B NH1   1 
ATOM   7162 N  NH2   . ARG B 1 449 ? 5.665   2.448   -8.329  1.00 30.87  ? 443 ARG B NH2   1 
ATOM   7163 N  N     . ASP B 1 460 ? -0.095  11.890  -8.399  1.00 31.82  ? 454 ASP B N     1 
ATOM   7164 C  CA    . ASP B 1 460 ? -0.994  12.757  -9.179  1.00 34.92  ? 454 ASP B CA    1 
ATOM   7165 C  C     . ASP B 1 460 ? -2.109  12.041  -9.970  1.00 41.50  ? 454 ASP B C     1 
ATOM   7166 O  O     . ASP B 1 460 ? -1.870  11.005  -10.607 1.00 38.77  ? 454 ASP B O     1 
ATOM   7167 C  CB    . ASP B 1 460 ? -0.202  13.633  -10.149 1.00 31.81  ? 454 ASP B CB    1 
ATOM   7168 C  CG    . ASP B 1 460 ? -1.079  14.675  -10.825 1.00 37.14  ? 454 ASP B CG    1 
ATOM   7169 O  OD1   . ASP B 1 460 ? -2.080  15.068  -10.191 1.00 38.61  ? 454 ASP B OD1   1 
ATOM   7170 O  OD2   . ASP B 1 460 ? -0.783  15.100  -11.969 1.00 30.64  ? 454 ASP B OD2   1 
ATOM   7171 N  N     . LEU B 1 461 ? -3.312  12.628  -9.967  1.00 37.02  ? 455 LEU B N     1 
ATOM   7172 C  CA    . LEU B 1 461 ? -4.497  11.976  -10.544 1.00 26.34  ? 455 LEU B CA    1 
ATOM   7173 C  C     . LEU B 1 461 ? -5.274  12.772  -11.594 1.00 31.83  ? 455 LEU B C     1 
ATOM   7174 O  O     . LEU B 1 461 ? -6.412  12.423  -11.903 1.00 30.94  ? 455 LEU B O     1 
ATOM   7175 C  CB    . LEU B 1 461 ? -5.481  11.576  -9.440  1.00 21.23  ? 455 LEU B CB    1 
ATOM   7176 C  CG    . LEU B 1 461 ? -4.938  10.699  -8.316  1.00 22.35  ? 455 LEU B CG    1 
ATOM   7177 C  CD1   . LEU B 1 461 ? -6.042  10.270  -7.384  1.00 16.20  ? 455 LEU B CD1   1 
ATOM   7178 C  CD2   . LEU B 1 461 ? -4.213  9.505   -8.888  1.00 23.15  ? 455 LEU B CD2   1 
ATOM   7179 N  N     . THR B 1 462 ? -4.693  13.828  -12.151 1.00 36.06  ? 456 THR B N     1 
ATOM   7180 C  CA    . THR B 1 462 ? -5.444  14.617  -13.128 1.00 28.18  ? 456 THR B CA    1 
ATOM   7181 C  C     . THR B 1 462 ? -5.761  13.849  -14.425 1.00 24.92  ? 456 THR B C     1 
ATOM   7182 O  O     . THR B 1 462 ? -6.820  14.065  -15.026 1.00 20.15  ? 456 THR B O     1 
ATOM   7183 C  CB    . THR B 1 462 ? -4.783  15.992  -13.433 1.00 28.94  ? 456 THR B CB    1 
ATOM   7184 O  OG1   . THR B 1 462 ? -4.398  16.065  -14.812 1.00 33.90  ? 456 THR B OG1   1 
ATOM   7185 C  CG2   . THR B 1 462 ? -3.565  16.210  -12.578 1.00 26.09  ? 456 THR B CG2   1 
ATOM   7186 N  N     . TYR B 1 463 ? -4.866  12.948  -14.844 1.00 24.97  ? 457 TYR B N     1 
ATOM   7187 C  CA    . TYR B 1 463 ? -5.058  12.236  -16.118 1.00 23.43  ? 457 TYR B CA    1 
ATOM   7188 C  C     . TYR B 1 463 ? -6.166  11.184  -16.047 1.00 24.38  ? 457 TYR B C     1 
ATOM   7189 O  O     . TYR B 1 463 ? -6.960  11.041  -16.991 1.00 19.35  ? 457 TYR B O     1 
ATOM   7190 C  CB    . TYR B 1 463 ? -3.749  11.620  -16.668 1.00 24.74  ? 457 TYR B CB    1 
ATOM   7191 C  CG    . TYR B 1 463 ? -3.978  10.512  -17.691 1.00 26.17  ? 457 TYR B CG    1 
ATOM   7192 C  CD1   . TYR B 1 463 ? -4.127  9.191   -17.286 1.00 24.74  ? 457 TYR B CD1   1 
ATOM   7193 C  CD2   . TYR B 1 463 ? -4.064  10.786  -19.050 1.00 26.70  ? 457 TYR B CD2   1 
ATOM   7194 C  CE1   . TYR B 1 463 ? -4.362  8.183   -18.186 1.00 20.10  ? 457 TYR B CE1   1 
ATOM   7195 C  CE2   . TYR B 1 463 ? -4.299  9.767   -19.972 1.00 25.12  ? 457 TYR B CE2   1 
ATOM   7196 C  CZ    . TYR B 1 463 ? -4.448  8.465   -19.523 1.00 27.87  ? 457 TYR B CZ    1 
ATOM   7197 O  OH    . TYR B 1 463 ? -4.680  7.421   -20.392 1.00 35.38  ? 457 TYR B OH    1 
ATOM   7198 N  N     . ASP B 1 464 ? -6.216  10.439  -14.943 1.00 22.49  ? 458 ASP B N     1 
ATOM   7199 C  CA    . ASP B 1 464 ? -7.225  9.395   -14.821 1.00 20.14  ? 458 ASP B CA    1 
ATOM   7200 C  C     . ASP B 1 464 ? -8.598  10.035  -14.726 1.00 21.62  ? 458 ASP B C     1 
ATOM   7201 O  O     . ASP B 1 464 ? -9.552  9.571   -15.355 1.00 20.65  ? 458 ASP B O     1 
ATOM   7202 C  CB    . ASP B 1 464 ? -6.934  8.484   -13.635 1.00 17.12  ? 458 ASP B CB    1 
ATOM   7203 C  CG    . ASP B 1 464 ? -5.523  7.930   -13.671 1.00 21.08  ? 458 ASP B CG    1 
ATOM   7204 O  OD1   . ASP B 1 464 ? -4.626  8.630   -13.161 1.00 28.31  ? 458 ASP B OD1   1 
ATOM   7205 O  OD2   . ASP B 1 464 ? -5.298  6.825   -14.230 1.00 17.24  ? 458 ASP B OD2   1 
ATOM   7206 N  N     . ILE B 1 465 ? -8.673  11.130  -13.974 1.00 18.73  ? 459 ILE B N     1 
ATOM   7207 C  CA    . ILE B 1 465 ? -9.884  11.939  -13.905 1.00 17.84  ? 459 ILE B CA    1 
ATOM   7208 C  C     . ILE B 1 465 ? -10.377 12.447  -15.271 1.00 23.46  ? 459 ILE B C     1 
ATOM   7209 O  O     . ILE B 1 465 ? -11.541 12.247  -15.618 1.00 22.02  ? 459 ILE B O     1 
ATOM   7210 C  CB    . ILE B 1 465 ? -9.706  13.122  -12.940 1.00 19.50  ? 459 ILE B CB    1 
ATOM   7211 C  CG1   . ILE B 1 465 ? -9.546  12.595  -11.505 1.00 21.40  ? 459 ILE B CG1   1 
ATOM   7212 C  CG2   . ILE B 1 465 ? -10.884 14.099  -13.059 1.00 16.77  ? 459 ILE B CG2   1 
ATOM   7213 C  CD1   . ILE B 1 465 ? -9.572  13.658  -10.445 1.00 15.85  ? 459 ILE B CD1   1 
ATOM   7214 N  N     . GLN B 1 466 ? -9.499  13.099  -16.036 1.00 20.56  ? 460 GLN B N     1 
ATOM   7215 C  CA    . GLN B 1 466 ? -9.860  13.609  -17.353 1.00 15.37  ? 460 GLN B CA    1 
ATOM   7216 C  C     . GLN B 1 466 ? -10.396 12.503  -18.249 1.00 21.00  ? 460 GLN B C     1 
ATOM   7217 O  O     . GLN B 1 466 ? -11.428 12.677  -18.896 1.00 21.47  ? 460 GLN B O     1 
ATOM   7218 C  CB    . GLN B 1 466 ? -8.658  14.259  -18.044 1.00 22.10  ? 460 GLN B CB    1 
ATOM   7219 C  CG    . GLN B 1 466 ? -8.482  15.757  -17.819 1.00 26.58  ? 460 GLN B CG    1 
ATOM   7220 C  CD    . GLN B 1 466 ? -9.386  16.624  -18.694 1.00 29.46  ? 460 GLN B CD    1 
ATOM   7221 O  OE1   . GLN B 1 466 ? -10.286 16.127  -19.380 1.00 24.72  ? 460 GLN B OE1   1 
ATOM   7222 N  NE2   . GLN B 1 466 ? -9.145  17.937  -18.668 1.00 35.75  ? 460 GLN B NE2   1 
ATOM   7223 N  N     . SER B 1 467 ? -9.695  11.369  -18.302 1.00 22.23  ? 461 SER B N     1 
ATOM   7224 C  CA    . SER B 1 467 ? -10.130 10.265  -19.159 1.00 17.38  ? 461 SER B CA    1 
ATOM   7225 C  C     . SER B 1 467 ? -11.549 9.890   -18.808 1.00 16.65  ? 461 SER B C     1 
ATOM   7226 O  O     . SER B 1 467 ? -12.398 9.758   -19.683 1.00 18.73  ? 461 SER B O     1 
ATOM   7227 C  CB    . SER B 1 467 ? -9.230  9.037   -19.018 1.00 19.89  ? 461 SER B CB    1 
ATOM   7228 O  OG    . SER B 1 467 ? -9.966  7.849   -19.299 1.00 27.03  ? 461 SER B OG    1 
ATOM   7229 N  N     . PHE B 1 468 ? -11.796 9.742   -17.512 1.00 19.13  ? 462 PHE B N     1 
ATOM   7230 C  CA    . PHE B 1 468 ? -13.119 9.399   -17.013 1.00 17.20  ? 462 PHE B CA    1 
ATOM   7231 C  C     . PHE B 1 468 ? -14.172 10.398  -17.474 1.00 16.90  ? 462 PHE B C     1 
ATOM   7232 O  O     . PHE B 1 468 ? -15.189 10.001  -18.054 1.00 15.83  ? 462 PHE B O     1 
ATOM   7233 C  CB    . PHE B 1 468 ? -13.122 9.286   -15.485 1.00 16.72  ? 462 PHE B CB    1 
ATOM   7234 C  CG    . PHE B 1 468 ? -14.489 9.131   -14.907 1.00 14.30  ? 462 PHE B CG    1 
ATOM   7235 C  CD1   . PHE B 1 468 ? -15.275 8.055   -15.253 1.00 13.94  ? 462 PHE B CD1   1 
ATOM   7236 C  CD2   . PHE B 1 468 ? -14.997 10.071  -14.039 1.00 15.54  ? 462 PHE B CD2   1 
ATOM   7237 C  CE1   . PHE B 1 468 ? -16.537 7.916   -14.734 1.00 14.11  ? 462 PHE B CE1   1 
ATOM   7238 C  CE2   . PHE B 1 468 ? -16.268 9.938   -13.517 1.00 16.70  ? 462 PHE B CE2   1 
ATOM   7239 C  CZ    . PHE B 1 468 ? -17.034 8.860   -13.861 1.00 15.12  ? 462 PHE B CZ    1 
ATOM   7240 N  N     . THR B 1 469 ? -13.931 11.688  -17.235 1.00 14.17  ? 463 THR B N     1 
ATOM   7241 C  CA    . THR B 1 469 ? -14.929 12.688  -17.604 1.00 18.38  ? 463 THR B CA    1 
ATOM   7242 C  C     . THR B 1 469 ? -15.139 12.705  -19.114 1.00 17.73  ? 463 THR B C     1 
ATOM   7243 O  O     . THR B 1 469 ? -16.276 12.794  -19.586 1.00 15.45  ? 463 THR B O     1 
ATOM   7244 C  CB    . THR B 1 469 ? -14.585 14.117  -17.124 1.00 20.96  ? 463 THR B CB    1 
ATOM   7245 O  OG1   . THR B 1 469 ? -13.736 14.761  -18.080 1.00 31.80  ? 463 THR B OG1   1 
ATOM   7246 C  CG2   . THR B 1 469 ? -13.922 14.097  -15.767 1.00 22.34  ? 463 THR B CG2   1 
ATOM   7247 N  N     . ASP B 1 470 ? -14.040 12.608  -19.860 1.00 14.81  ? 464 ASP B N     1 
ATOM   7248 C  CA    . ASP B 1 470 ? -14.118 12.605  -21.308 1.00 15.08  ? 464 ASP B CA    1 
ATOM   7249 C  C     . ASP B 1 470 ? -14.985 11.441  -21.765 1.00 15.00  ? 464 ASP B C     1 
ATOM   7250 O  O     . ASP B 1 470 ? -15.878 11.606  -22.600 1.00 12.26  ? 464 ASP B O     1 
ATOM   7251 C  CB    . ASP B 1 470 ? -12.725 12.555  -21.941 1.00 18.20  ? 464 ASP B CB    1 
ATOM   7252 C  CG    . ASP B 1 470 ? -11.887 13.794  -21.615 1.00 24.40  ? 464 ASP B CG    1 
ATOM   7253 O  OD1   . ASP B 1 470 ? -12.482 14.857  -21.307 1.00 22.67  ? 464 ASP B OD1   1 
ATOM   7254 O  OD2   . ASP B 1 470 ? -10.634 13.700  -21.659 1.00 19.04  ? 464 ASP B OD2   1 
ATOM   7255 N  N     . THR B 1 471 ? -14.754 10.275  -21.182 1.00 12.36  ? 465 THR B N     1 
ATOM   7256 C  CA    . THR B 1 471 ? -15.551 9.119   -21.542 1.00 14.35  ? 465 THR B CA    1 
ATOM   7257 C  C     . THR B 1 471 ? -17.026 9.388   -21.265 1.00 16.13  ? 465 THR B C     1 
ATOM   7258 O  O     . THR B 1 471 ? -17.885 9.102   -22.098 1.00 14.94  ? 465 THR B O     1 
ATOM   7259 C  CB    . THR B 1 471 ? -15.114 7.854   -20.786 1.00 14.93  ? 465 THR B CB    1 
ATOM   7260 O  OG1   . THR B 1 471 ? -13.756 7.530   -21.121 1.00 16.68  ? 465 THR B OG1   1 
ATOM   7261 C  CG2   . THR B 1 471 ? -16.032 6.688   -21.134 1.00 10.98  ? 465 THR B CG2   1 
ATOM   7262 N  N     . VAL B 1 472 ? -17.319 9.951   -20.099 1.00 15.45  ? 466 VAL B N     1 
ATOM   7263 C  CA    . VAL B 1 472 ? -18.708 10.149  -19.715 1.00 17.41  ? 466 VAL B CA    1 
ATOM   7264 C  C     . VAL B 1 472 ? -19.415 11.102  -20.674 1.00 16.75  ? 466 VAL B C     1 
ATOM   7265 O  O     . VAL B 1 472 ? -20.515 10.816  -21.132 1.00 18.38  ? 466 VAL B O     1 
ATOM   7266 C  CB    . VAL B 1 472 ? -18.852 10.682  -18.262 1.00 20.27  ? 466 VAL B CB    1 
ATOM   7267 C  CG1   . VAL B 1 472 ? -20.331 10.800  -17.891 1.00 16.17  ? 466 VAL B CG1   1 
ATOM   7268 C  CG2   . VAL B 1 472 ? -18.131 9.786   -17.286 1.00 13.83  ? 466 VAL B CG2   1 
ATOM   7269 N  N     . TYR B 1 473 ? -18.786 12.234  -20.973 1.00 14.50  ? 467 TYR B N     1 
ATOM   7270 C  CA    . TYR B 1 473 ? -19.453 13.258  -21.760 1.00 17.58  ? 467 TYR B CA    1 
ATOM   7271 C  C     . TYR B 1 473 ? -19.629 12.725  -23.162 1.00 19.08  ? 467 TYR B C     1 
ATOM   7272 O  O     . TYR B 1 473 ? -20.696 12.844  -23.763 1.00 18.57  ? 467 TYR B O     1 
ATOM   7273 C  CB    . TYR B 1 473 ? -18.639 14.558  -21.804 1.00 18.80  ? 467 TYR B CB    1 
ATOM   7274 C  CG    . TYR B 1 473 ? -18.700 15.426  -20.560 1.00 16.08  ? 467 TYR B CG    1 
ATOM   7275 C  CD1   . TYR B 1 473 ? -19.915 15.878  -20.049 1.00 15.14  ? 467 TYR B CD1   1 
ATOM   7276 C  CD2   . TYR B 1 473 ? -17.537 15.822  -19.921 1.00 15.30  ? 467 TYR B CD2   1 
ATOM   7277 C  CE1   . TYR B 1 473 ? -19.961 16.676  -18.919 1.00 16.86  ? 467 TYR B CE1   1 
ATOM   7278 C  CE2   . TYR B 1 473 ? -17.575 16.619  -18.796 1.00 19.48  ? 467 TYR B CE2   1 
ATOM   7279 C  CZ    . TYR B 1 473 ? -18.786 17.044  -18.296 1.00 21.62  ? 467 TYR B CZ    1 
ATOM   7280 O  OH    . TYR B 1 473 ? -18.805 17.842  -17.171 1.00 23.00  ? 467 TYR B OH    1 
ATOM   7281 N  N     . ARG B 1 474 ? -18.561 12.120  -23.663 1.00 18.49  ? 468 ARG B N     1 
ATOM   7282 C  CA    . ARG B 1 474 ? -18.536 11.565  -25.000 1.00 16.15  ? 468 ARG B CA    1 
ATOM   7283 C  C     . ARG B 1 474 ? -19.676 10.571  -25.157 1.00 15.22  ? 468 ARG B C     1 
ATOM   7284 O  O     . ARG B 1 474 ? -20.435 10.622  -26.124 1.00 17.46  ? 468 ARG B O     1 
ATOM   7285 C  CB    . ARG B 1 474 ? -17.201 10.867  -25.214 1.00 15.68  ? 468 ARG B CB    1 
ATOM   7286 C  CG    . ARG B 1 474 ? -16.772 10.687  -26.634 1.00 10.83  ? 468 ARG B CG    1 
ATOM   7287 C  CD    . ARG B 1 474 ? -15.636 9.688   -26.687 1.00 10.70  ? 468 ARG B CD    1 
ATOM   7288 N  NE    . ARG B 1 474 ? -14.452 10.161  -25.982 1.00 10.76  ? 468 ARG B NE    1 
ATOM   7289 C  CZ    . ARG B 1 474 ? -13.709 9.394   -25.193 1.00 14.79  ? 468 ARG B CZ    1 
ATOM   7290 N  NH1   . ARG B 1 474 ? -14.038 8.119   -25.002 1.00 10.89  ? 468 ARG B NH1   1 
ATOM   7291 N  NH2   . ARG B 1 474 ? -12.641 9.901   -24.586 1.00 19.69  ? 468 ARG B NH2   1 
ATOM   7292 N  N     . GLN B 1 475 ? -19.805 9.673   -24.190 1.00 15.90  ? 469 GLN B N     1 
ATOM   7293 C  CA    . GLN B 1 475 ? -20.837 8.657   -24.261 1.00 14.45  ? 469 GLN B CA    1 
ATOM   7294 C  C     . GLN B 1 475 ? -22.199 9.287   -24.098 1.00 15.68  ? 469 GLN B C     1 
ATOM   7295 O  O     . GLN B 1 475 ? -23.160 8.873   -24.739 1.00 18.81  ? 469 GLN B O     1 
ATOM   7296 C  CB    . GLN B 1 475 ? -20.619 7.566   -23.226 1.00 11.32  ? 469 GLN B CB    1 
ATOM   7297 C  CG    . GLN B 1 475 ? -19.422 6.698   -23.499 1.00 11.45  ? 469 GLN B CG    1 
ATOM   7298 C  CD    . GLN B 1 475 ? -19.639 5.271   -23.059 1.00 14.42  ? 469 GLN B CD    1 
ATOM   7299 O  OE1   . GLN B 1 475 ? -19.607 4.955   -21.862 1.00 19.06  ? 469 GLN B OE1   1 
ATOM   7300 N  NE2   . GLN B 1 475 ? -19.862 4.393   -24.023 1.00 11.96  ? 469 GLN B NE2   1 
ATOM   7301 N  N     . ALA B 1 476 ? -22.288 10.303  -23.257 1.00 14.45  ? 470 ALA B N     1 
ATOM   7302 C  CA    . ALA B 1 476 ? -23.554 10.992  -23.116 1.00 16.40  ? 470 ALA B CA    1 
ATOM   7303 C  C     . ALA B 1 476 ? -23.942 11.616  -24.459 1.00 20.17  ? 470 ALA B C     1 
ATOM   7304 O  O     . ALA B 1 476 ? -25.043 11.372  -24.944 1.00 26.46  ? 470 ALA B O     1 
ATOM   7305 C  CB    . ALA B 1 476 ? -23.492 12.024  -22.013 1.00 20.44  ? 470 ALA B CB    1 
ATOM   7306 N  N     . ASN B 1 477 ? -23.034 12.375  -25.080 1.00 21.18  ? 471 ASN B N     1 
ATOM   7307 C  CA    . ASN B 1 477 ? -23.303 12.994  -26.395 1.00 22.35  ? 471 ASN B CA    1 
ATOM   7308 C  C     . ASN B 1 477 ? -23.732 11.989  -27.428 1.00 19.77  ? 471 ASN B C     1 
ATOM   7309 O  O     . ASN B 1 477 ? -24.688 12.219  -28.157 1.00 24.57  ? 471 ASN B O     1 
ATOM   7310 C  CB    . ASN B 1 477 ? -22.078 13.718  -26.948 1.00 20.90  ? 471 ASN B CB    1 
ATOM   7311 C  CG    . ASN B 1 477 ? -21.750 14.968  -26.180 1.00 35.07  ? 471 ASN B CG    1 
ATOM   7312 O  OD1   . ASN B 1 477 ? -22.650 15.701  -25.759 1.00 39.05  ? 471 ASN B OD1   1 
ATOM   7313 N  ND2   . ASN B 1 477 ? -20.452 15.225  -25.980 1.00 36.12  ? 471 ASN B ND2   1 
ATOM   7314 N  N     . ASN B 1 478 ? -23.005 10.877  -27.479 1.00 19.08  ? 472 ASN B N     1 
ATOM   7315 C  CA    . ASN B 1 478 ? -23.249 9.825   -28.451 1.00 18.93  ? 472 ASN B CA    1 
ATOM   7316 C  C     . ASN B 1 478 ? -24.693 9.348   -28.440 1.00 23.02  ? 472 ASN B C     1 
ATOM   7317 O  O     . ASN B 1 478 ? -25.315 9.245   -29.489 1.00 25.09  ? 472 ASN B O     1 
ATOM   7318 C  CB    . ASN B 1 478 ? -22.305 8.653   -28.211 1.00 17.67  ? 472 ASN B CB    1 
ATOM   7319 C  CG    . ASN B 1 478 ? -22.406 7.595   -29.285 1.00 17.94  ? 472 ASN B CG    1 
ATOM   7320 O  OD1   . ASN B 1 478 ? -23.017 6.539   -29.090 1.00 18.90  ? 472 ASN B OD1   1 
ATOM   7321 N  ND2   . ASN B 1 478 ? -21.801 7.871   -30.432 1.00 22.09  ? 472 ASN B ND2   1 
ATOM   7322 N  N     . ILE B 1 479 ? -25.232 9.087   -27.251 1.00 30.96  ? 473 ILE B N     1 
ATOM   7323 C  CA    . ILE B 1 479 ? -26.614 8.626   -27.128 1.00 26.94  ? 473 ILE B CA    1 
ATOM   7324 C  C     . ILE B 1 479 ? -27.639 9.758   -27.039 1.00 25.05  ? 473 ILE B C     1 
ATOM   7325 O  O     . ILE B 1 479 ? -28.792 9.512   -26.684 1.00 25.88  ? 473 ILE B O     1 
ATOM   7326 C  CB    . ILE B 1 479 ? -26.801 7.700   -25.929 1.00 20.07  ? 473 ILE B CB    1 
ATOM   7327 C  CG1   . ILE B 1 479 ? -26.302 8.380   -24.666 1.00 20.73  ? 473 ILE B CG1   1 
ATOM   7328 C  CG2   . ILE B 1 479 ? -26.061 6.411   -26.134 1.00 15.04  ? 473 ILE B CG2   1 
ATOM   7329 C  CD1   . ILE B 1 479 ? -26.672 7.632   -23.418 1.00 21.06  ? 473 ILE B CD1   1 
ATOM   7330 N  N     . ASN B 1 480 ? -27.217 10.977  -27.380 1.00 23.03  ? 474 ASN B N     1 
ATOM   7331 C  CA    . ASN B 1 480 ? -28.125 12.118  -27.541 1.00 27.38  ? 474 ASN B CA    1 
ATOM   7332 C  C     . ASN B 1 480 ? -28.962 12.382  -26.312 1.00 31.74  ? 474 ASN B C     1 
ATOM   7333 O  O     . ASN B 1 480 ? -30.192 12.377  -26.368 1.00 37.74  ? 474 ASN B O     1 
ATOM   7334 C  CB    . ASN B 1 480 ? -29.040 11.935  -28.749 1.00 27.00  ? 474 ASN B CB    1 
ATOM   7335 C  CG    . ASN B 1 480 ? -28.391 12.375  -30.028 1.00 42.53  ? 474 ASN B CG    1 
ATOM   7336 O  OD1   . ASN B 1 480 ? -28.712 13.438  -30.563 1.00 55.98  ? 474 ASN B OD1   1 
ATOM   7337 N  ND2   . ASN B 1 480 ? -27.454 11.572  -30.526 1.00 40.66  ? 474 ASN B ND2   1 
ATOM   7338 N  N     . MET B 1 481 ? -28.276 12.638  -25.209 1.00 27.26  ? 475 MET B N     1 
ATOM   7339 C  CA    . MET B 1 481 ? -28.897 12.670  -23.908 1.00 27.46  ? 475 MET B CA    1 
ATOM   7340 C  C     . MET B 1 481 ? -28.343 13.866  -23.167 1.00 29.37  ? 475 MET B C     1 
ATOM   7341 O  O     . MET B 1 481 ? -28.916 14.313  -22.180 1.00 38.41  ? 475 MET B O     1 
ATOM   7342 C  CB    . MET B 1 481 ? -28.584 11.346  -23.186 1.00 24.16  ? 475 MET B CB    1 
ATOM   7343 C  CG    . MET B 1 481 ? -28.665 11.353  -21.670 1.00 32.49  ? 475 MET B CG    1 
ATOM   7344 S  SD    . MET B 1 481 ? -27.202 12.004  -20.825 1.00 32.61  ? 475 MET B SD    1 
ATOM   7345 C  CE    . MET B 1 481 ? -27.794 11.965  -19.141 1.00 29.06  ? 475 MET B CE    1 
ATOM   7346 N  N     . LEU B 1 482 ? -27.234 14.401  -23.663 1.00 26.03  ? 476 LEU B N     1 
ATOM   7347 C  CA    . LEU B 1 482 ? -26.508 15.444  -22.941 1.00 28.82  ? 476 LEU B CA    1 
ATOM   7348 C  C     . LEU B 1 482 ? -27.181 16.828  -23.048 1.00 34.76  ? 476 LEU B C     1 
ATOM   7349 O  O     . LEU B 1 482 ? -26.707 17.729  -23.748 1.00 37.65  ? 476 LEU B O     1 
ATOM   7350 C  CB    . LEU B 1 482 ? -25.026 15.462  -23.364 1.00 27.11  ? 476 LEU B CB    1 
ATOM   7351 C  CG    . LEU B 1 482 ? -23.845 16.077  -22.588 1.00 26.16  ? 476 LEU B CG    1 
ATOM   7352 C  CD1   . LEU B 1 482 ? -23.789 17.590  -22.718 1.00 39.06  ? 476 LEU B CD1   1 
ATOM   7353 C  CD2   . LEU B 1 482 ? -23.809 15.677  -21.121 1.00 23.80  ? 476 LEU B CD2   1 
ATOM   7354 N  N     . LYS B 1 483 ? -28.300 16.987  -22.348 1.00 33.83  ? 477 LYS B N     1 
ATOM   7355 C  CA    . LYS B 1 483 ? -28.909 18.299  -22.196 1.00 32.27  ? 477 LYS B CA    1 
ATOM   7356 C  C     . LYS B 1 483 ? -27.901 19.157  -21.451 1.00 36.44  ? 477 LYS B C     1 
ATOM   7357 O  O     . LYS B 1 483 ? -27.289 18.700  -20.486 1.00 37.37  ? 477 LYS B O     1 
ATOM   7358 C  CB    . LYS B 1 483 ? -30.200 18.211  -21.381 1.00 30.39  ? 477 LYS B CB    1 
ATOM   7359 C  CG    . LYS B 1 483 ? -30.972 16.901  -21.511 1.00 35.90  ? 477 LYS B CG    1 
ATOM   7360 C  CD    . LYS B 1 483 ? -31.512 16.660  -22.924 1.00 37.65  ? 477 LYS B CD    1 
ATOM   7361 C  CE    . LYS B 1 483 ? -32.336 15.383  -22.960 1.00 35.30  ? 477 LYS B CE    1 
ATOM   7362 N  NZ    . LYS B 1 483 ? -31.706 14.308  -22.136 1.00 32.17  ? 477 LYS B NZ    1 
ATOM   7363 N  N     . GLU B 1 484 ? -27.711 20.394  -21.888 1.00 40.02  ? 478 GLU B N     1 
ATOM   7364 C  CA    . GLU B 1 484 ? -26.766 21.266  -21.208 1.00 46.39  ? 478 GLU B CA    1 
ATOM   7365 C  C     . GLU B 1 484 ? -27.272 21.528  -19.795 1.00 49.33  ? 478 GLU B C     1 
ATOM   7366 O  O     . GLU B 1 484 ? -28.460 21.358  -19.508 1.00 45.25  ? 478 GLU B O     1 
ATOM   7367 C  CB    . GLU B 1 484 ? -26.567 22.579  -21.965 1.00 52.75  ? 478 GLU B CB    1 
ATOM   7368 C  CG    . GLU B 1 484 ? -27.544 23.669  -21.574 1.00 65.29  ? 478 GLU B CG    1 
ATOM   7369 C  CD    . GLU B 1 484 ? -26.905 25.052  -21.574 1.00 76.48  ? 478 GLU B CD    1 
ATOM   7370 O  OE1   . GLU B 1 484 ? -27.515 25.994  -21.018 1.00 65.67  ? 478 GLU B OE1   1 
ATOM   7371 O  OE2   . GLU B 1 484 ? -25.794 25.193  -22.133 1.00 82.75  ? 478 GLU B OE2   1 
ATOM   7372 N  N     . GLY B 1 485 ? -26.368 21.938  -18.915 1.00 46.91  ? 479 GLY B N     1 
ATOM   7373 C  CA    . GLY B 1 485 ? -26.680 22.031  -17.503 1.00 40.55  ? 479 GLY B CA    1 
ATOM   7374 C  C     . GLY B 1 485 ? -26.022 20.869  -16.784 1.00 42.76  ? 479 GLY B C     1 
ATOM   7375 O  O     . GLY B 1 485 ? -25.452 21.036  -15.696 1.00 34.69  ? 479 GLY B O     1 
ATOM   7376 N  N     . MET B 1 486 ? -26.084 19.694  -17.417 1.00 39.82  ? 480 MET B N     1 
ATOM   7377 C  CA    . MET B 1 486 ? -25.525 18.456  -16.866 1.00 27.05  ? 480 MET B CA    1 
ATOM   7378 C  C     . MET B 1 486 ? -23.999 18.491  -16.775 1.00 27.09  ? 480 MET B C     1 
ATOM   7379 O  O     . MET B 1 486 ? -23.310 18.564  -17.782 1.00 34.73  ? 480 MET B O     1 
ATOM   7380 C  CB    . MET B 1 486 ? -26.014 17.254  -17.673 1.00 22.47  ? 480 MET B CB    1 
ATOM   7381 C  CG    . MET B 1 486 ? -27.515 17.050  -17.538 1.00 29.71  ? 480 MET B CG    1 
ATOM   7382 S  SD    . MET B 1 486 ? -28.240 15.755  -18.557 1.00 29.95  ? 480 MET B SD    1 
ATOM   7383 C  CE    . MET B 1 486 ? -26.862 15.455  -19.612 1.00 32.32  ? 480 MET B CE    1 
ATOM   7384 N  N     . LYS B 1 487 ? -23.478 18.455  -15.557 1.00 25.36  ? 481 LYS B N     1 
ATOM   7385 C  CA    . LYS B 1 487 ? -22.049 18.597  -15.335 1.00 25.60  ? 481 LYS B CA    1 
ATOM   7386 C  C     . LYS B 1 487 ? -21.470 17.345  -14.661 1.00 32.25  ? 481 LYS B C     1 
ATOM   7387 O  O     . LYS B 1 487 ? -22.173 16.624  -13.940 1.00 32.06  ? 481 LYS B O     1 
ATOM   7388 C  CB    . LYS B 1 487 ? -21.790 19.836  -14.469 1.00 27.13  ? 481 LYS B CB    1 
ATOM   7389 C  CG    . LYS B 1 487 ? -20.338 20.283  -14.404 1.00 30.27  ? 481 LYS B CG    1 
ATOM   7390 C  CD    . LYS B 1 487 ? -20.133 21.426  -13.415 1.00 44.13  ? 481 LYS B CD    1 
ATOM   7391 C  CE    . LYS B 1 487 ? -20.811 22.726  -13.866 1.00 53.41  ? 481 LYS B CE    1 
ATOM   7392 N  NZ    . LYS B 1 487 ? -20.526 23.891  -12.950 1.00 38.45  ? 481 LYS B NZ    1 
ATOM   7393 N  N     . ILE B 1 488 ? -20.194 17.066  -14.906 1.00 27.10  ? 482 ILE B N     1 
ATOM   7394 C  CA    . ILE B 1 488 ? -19.501 16.094  -14.078 1.00 22.23  ? 482 ILE B CA    1 
ATOM   7395 C  C     . ILE B 1 488 ? -18.044 16.484  -13.799 1.00 25.28  ? 482 ILE B C     1 
ATOM   7396 O  O     . ILE B 1 488 ? -17.201 16.555  -14.687 1.00 27.08  ? 482 ILE B O     1 
ATOM   7397 C  CB    . ILE B 1 488 ? -19.687 14.632  -14.562 1.00 26.76  ? 482 ILE B CB    1 
ATOM   7398 C  CG1   . ILE B 1 488 ? -19.038 13.673  -13.562 1.00 31.18  ? 482 ILE B CG1   1 
ATOM   7399 C  CG2   . ILE B 1 488 ? -19.161 14.428  -15.976 1.00 23.08  ? 482 ILE B CG2   1 
ATOM   7400 C  CD1   . ILE B 1 488 ? -19.138 12.226  -13.952 1.00 40.04  ? 482 ILE B CD1   1 
ATOM   7401 N  N     . GLU B 1 489 ? -17.784 16.764  -12.533 1.00 29.27  ? 483 GLU B N     1 
ATOM   7402 C  CA    . GLU B 1 489 ? -16.499 17.241  -12.068 1.00 33.43  ? 483 GLU B CA    1 
ATOM   7403 C  C     . GLU B 1 489 ? -16.010 16.142  -11.144 1.00 32.94  ? 483 GLU B C     1 
ATOM   7404 O  O     . GLU B 1 489 ? -16.828 15.413  -10.591 1.00 35.12  ? 483 GLU B O     1 
ATOM   7405 C  CB    . GLU B 1 489 ? -16.743 18.529  -11.275 1.00 40.28  ? 483 GLU B CB    1 
ATOM   7406 C  CG    . GLU B 1 489 ? -15.538 19.405  -10.981 1.00 46.42  ? 483 GLU B CG    1 
ATOM   7407 C  CD    . GLU B 1 489 ? -15.963 20.781  -10.494 1.00 55.65  ? 483 GLU B CD    1 
ATOM   7408 O  OE1   . GLU B 1 489 ? -17.175 20.961  -10.232 1.00 52.90  ? 483 GLU B OE1   1 
ATOM   7409 O  OE2   . GLU B 1 489 ? -15.097 21.678  -10.382 1.00 55.05  ? 483 GLU B OE2   1 
ATOM   7410 N  N     . ALA B 1 490 ? -14.701 16.002  -10.966 1.00 27.39  ? 484 ALA B N     1 
ATOM   7411 C  CA    . ALA B 1 490 ? -14.204 15.017  -10.009 1.00 26.26  ? 484 ALA B CA    1 
ATOM   7412 C  C     . ALA B 1 490 ? -12.901 15.457  -9.375  1.00 25.54  ? 484 ALA B C     1 
ATOM   7413 O  O     . ALA B 1 490 ? -11.909 15.692  -10.061 1.00 26.81  ? 484 ALA B O     1 
ATOM   7414 C  CB    . ALA B 1 490 ? -14.054 13.643  -10.660 1.00 22.77  ? 484 ALA B CB    1 
ATOM   7415 N  N     . THR B 1 491 ? -12.900 15.566  -8.054  1.00 30.00  ? 485 THR B N     1 
ATOM   7416 C  CA    . THR B 1 491 ? -11.740 16.131  -7.378  1.00 33.98  ? 485 THR B CA    1 
ATOM   7417 C  C     . THR B 1 491 ? -11.003 15.178  -6.429  1.00 35.83  ? 485 THR B C     1 
ATOM   7418 O  O     . THR B 1 491 ? -11.598 14.532  -5.554  1.00 29.50  ? 485 THR B O     1 
ATOM   7419 C  CB    . THR B 1 491 ? -12.076 17.446  -6.628  1.00 32.59  ? 485 THR B CB    1 
ATOM   7420 O  OG1   . THR B 1 491 ? -13.006 18.229  -7.392  1.00 33.60  ? 485 THR B OG1   1 
ATOM   7421 C  CG2   . THR B 1 491 ? -10.798 18.246  -6.404  1.00 36.29  ? 485 THR B CG2   1 
ATOM   7422 N  N     . HIS B 1 492 ? -9.692  15.110  -6.625  1.00 30.69  ? 486 HIS B N     1 
ATOM   7423 C  CA    . HIS B 1 492 ? -8.808  14.421  -5.716  1.00 27.21  ? 486 HIS B CA    1 
ATOM   7424 C  C     . HIS B 1 492 ? -8.704  15.290  -4.451  1.00 35.14  ? 486 HIS B C     1 
ATOM   7425 O  O     . HIS B 1 492 ? -8.626  16.514  -4.540  1.00 41.49  ? 486 HIS B O     1 
ATOM   7426 C  CB    . HIS B 1 492 ? -7.469  14.253  -6.417  1.00 22.23  ? 486 HIS B CB    1 
ATOM   7427 C  CG    . HIS B 1 492 ? -6.404  13.642  -5.570  1.00 26.98  ? 486 HIS B CG    1 
ATOM   7428 N  ND1   . HIS B 1 492 ? -5.170  13.294  -6.077  1.00 28.49  ? 486 HIS B ND1   1 
ATOM   7429 C  CD2   . HIS B 1 492 ? -6.373  13.329  -4.254  1.00 29.02  ? 486 HIS B CD2   1 
ATOM   7430 C  CE1   . HIS B 1 492 ? -4.429  12.786  -5.112  1.00 35.87  ? 486 HIS B CE1   1 
ATOM   7431 N  NE2   . HIS B 1 492 ? -5.133  12.797  -3.993  1.00 42.69  ? 486 HIS B NE2   1 
ATOM   7432 N  N     . VAL B 1 493 ? -8.725  14.662  -3.280  1.00 34.96  ? 487 VAL B N     1 
ATOM   7433 C  CA    . VAL B 1 493 ? -8.837  15.381  -2.007  1.00 34.84  ? 487 VAL B CA    1 
ATOM   7434 C  C     . VAL B 1 493 ? -8.203  14.553  -0.889  1.00 31.23  ? 487 VAL B C     1 
ATOM   7435 O  O     . VAL B 1 493 ? -8.343  13.337  -0.894  1.00 35.60  ? 487 VAL B O     1 
ATOM   7436 C  CB    . VAL B 1 493 ? -10.326 15.651  -1.687  1.00 33.72  ? 487 VAL B CB    1 
ATOM   7437 C  CG1   . VAL B 1 493 ? -10.574 15.696  -0.210  1.00 34.46  ? 487 VAL B CG1   1 
ATOM   7438 C  CG2   . VAL B 1 493 ? -10.799 16.941  -2.353  1.00 39.68  ? 487 VAL B CG2   1 
ATOM   7439 N  N     . LYS B 1 494 ? -7.481  15.181  0.042   1.00 29.23  ? 488 LYS B N     1 
ATOM   7440 C  CA    . LYS B 1 494 ? -6.910  14.436  1.173   1.00 37.23  ? 488 LYS B CA    1 
ATOM   7441 C  C     . LYS B 1 494 ? -7.932  14.274  2.297   1.00 40.82  ? 488 LYS B C     1 
ATOM   7442 O  O     . LYS B 1 494 ? -8.939  14.982  2.325   1.00 46.14  ? 488 LYS B O     1 
ATOM   7443 C  CB    . LYS B 1 494 ? -5.639  15.096  1.705   1.00 38.22  ? 488 LYS B CB    1 
ATOM   7444 C  CG    . LYS B 1 494 ? -4.359  14.606  1.060   1.00 39.65  ? 488 LYS B CG    1 
ATOM   7445 C  CD    . LYS B 1 494 ? -3.137  15.086  1.833   1.00 45.74  ? 488 LYS B CD    1 
ATOM   7446 C  CE    . LYS B 1 494 ? -1.831  14.649  1.176   1.00 52.86  ? 488 LYS B CE    1 
ATOM   7447 N  NZ    . LYS B 1 494 ? -1.536  15.415  -0.076  1.00 47.40  ? 488 LYS B NZ    1 
ATOM   7448 N  N     . LYS B 1 495 ? -7.679  13.346  3.219   1.00 43.37  ? 489 LYS B N     1 
ATOM   7449 C  CA    . LYS B 1 495 ? -8.656  13.021  4.267   1.00 48.38  ? 489 LYS B CA    1 
ATOM   7450 C  C     . LYS B 1 495 ? -9.147  14.281  4.959   1.00 47.47  ? 489 LYS B C     1 
ATOM   7451 O  O     . LYS B 1 495 ? -10.344 14.566  5.002   1.00 43.54  ? 489 LYS B O     1 
ATOM   7452 C  CB    . LYS B 1 495 ? -8.049  12.065  5.299   1.00 45.09  ? 489 LYS B CB    1 
ATOM   7453 C  CG    . LYS B 1 495 ? -8.995  11.669  6.433   1.00 46.31  ? 489 LYS B CG    1 
ATOM   7454 C  CD    . LYS B 1 495 ? -8.280  10.782  7.454   1.00 46.11  ? 489 LYS B CD    1 
ATOM   7455 C  CE    . LYS B 1 495 ? -9.179  10.397  8.614   1.00 42.92  ? 489 LYS B CE    1 
ATOM   7456 N  NZ    . LYS B 1 495 ? -8.382  9.841   9.748   1.00 49.81  ? 489 LYS B NZ    1 
ATOM   7457 N  N     . LYS B 1 496 ? -8.187  15.063  5.433   1.00 50.33  ? 490 LYS B N     1 
ATOM   7458 C  CA    . LYS B 1 496 ? -8.432  16.276  6.199   1.00 48.50  ? 490 LYS B CA    1 
ATOM   7459 C  C     . LYS B 1 496 ? -9.194  17.366  5.451   1.00 53.17  ? 490 LYS B C     1 
ATOM   7460 O  O     . LYS B 1 496 ? -9.147  18.525  5.860   1.00 58.34  ? 490 LYS B O     1 
ATOM   7461 C  CB    . LYS B 1 496 ? -7.096  16.849  6.704   1.00 47.29  ? 490 LYS B CB    1 
ATOM   7462 C  CG    . LYS B 1 496 ? -5.864  16.401  5.900   1.00 56.78  ? 490 LYS B CG    1 
ATOM   7463 C  CD    . LYS B 1 496 ? -5.236  15.111  6.457   1.00 65.31  ? 490 LYS B CD    1 
ATOM   7464 C  CE    . LYS B 1 496 ? -4.934  14.089  5.358   1.00 52.72  ? 490 LYS B CE    1 
ATOM   7465 N  NZ    . LYS B 1 496 ? -4.341  12.834  5.914   1.00 62.53  ? 490 LYS B NZ    1 
ATOM   7466 N  N     . GLN B 1 497 ? -9.889  17.016  4.369   1.00 46.87  ? 491 GLN B N     1 
ATOM   7467 C  CA    . GLN B 1 497 ? -10.582 18.022  3.568   1.00 48.00  ? 491 GLN B CA    1 
ATOM   7468 C  C     . GLN B 1 497 ? -12.032 17.652  3.335   1.00 44.55  ? 491 GLN B C     1 
ATOM   7469 O  O     . GLN B 1 497 ? -12.816 18.453  2.836   1.00 41.02  ? 491 GLN B O     1 
ATOM   7470 C  CB    . GLN B 1 497 ? -9.882  18.221  2.221   1.00 45.70  ? 491 GLN B CB    1 
ATOM   7471 C  CG    . GLN B 1 497 ? -8.407  18.619  2.314   1.00 57.43  ? 491 GLN B CG    1 
ATOM   7472 C  CD    . GLN B 1 497 ? -8.157  20.108  2.070   1.00 75.87  ? 491 GLN B CD    1 
ATOM   7473 O  OE1   . GLN B 1 497 ? -8.273  20.934  2.984   1.00 78.77  ? 491 GLN B OE1   1 
ATOM   7474 N  NE2   . GLN B 1 497 ? -7.796  20.451  0.833   1.00 65.43  ? 491 GLN B NE2   1 
ATOM   7475 N  N     . LEU B 1 498 ? -12.386 16.432  3.712   1.00 46.41  ? 492 LEU B N     1 
ATOM   7476 C  CA    . LEU B 1 498 ? -13.681 15.871  3.350   1.00 46.65  ? 492 LEU B CA    1 
ATOM   7477 C  C     . LEU B 1 498 ? -14.840 16.704  3.857   1.00 48.00  ? 492 LEU B C     1 
ATOM   7478 O  O     . LEU B 1 498 ? -15.891 16.773  3.220   1.00 43.55  ? 492 LEU B O     1 
ATOM   7479 C  CB    . LEU B 1 498 ? -13.795 14.437  3.866   1.00 46.77  ? 492 LEU B CB    1 
ATOM   7480 C  CG    . LEU B 1 498 ? -12.987 13.422  3.062   1.00 38.27  ? 492 LEU B CG    1 
ATOM   7481 C  CD1   . LEU B 1 498 ? -12.940 12.085  3.766   1.00 39.05  ? 492 LEU B CD1   1 
ATOM   7482 C  CD2   . LEU B 1 498 ? -13.607 13.279  1.688   1.00 37.89  ? 492 LEU B CD2   1 
ATOM   7483 N  N     . HIS B 1 499 ? -14.626 17.349  5.000   1.00 56.48  ? 493 HIS B N     1 
ATOM   7484 C  CA    . HIS B 1 499 ? -15.659 18.143  5.660   1.00 60.03  ? 493 HIS B CA    1 
ATOM   7485 C  C     . HIS B 1 499 ? -16.152 19.292  4.791   1.00 54.46  ? 493 HIS B C     1 
ATOM   7486 O  O     . HIS B 1 499 ? -17.246 19.824  5.012   1.00 56.48  ? 493 HIS B O     1 
ATOM   7487 C  CB    . HIS B 1 499 ? -15.123 18.700  6.970   1.00 56.43  ? 493 HIS B CB    1 
ATOM   7488 C  CG    . HIS B 1 499 ? -13.890 19.522  6.799   1.00 55.56  ? 493 HIS B CG    1 
ATOM   7489 N  ND1   . HIS B 1 499 ? -12.626 18.974  6.810   1.00 59.06  ? 493 HIS B ND1   1 
ATOM   7490 C  CD2   . HIS B 1 499 ? -13.726 20.848  6.586   1.00 55.65  ? 493 HIS B CD2   1 
ATOM   7491 C  CE1   . HIS B 1 499 ? -11.734 19.932  6.628   1.00 60.48  ? 493 HIS B CE1   1 
ATOM   7492 N  NE2   . HIS B 1 499 ? -12.375 21.078  6.488   1.00 60.28  ? 493 HIS B NE2   1 
ATOM   7493 N  N     . HIS B 1 500 ? -15.342 19.667  3.803   1.00 47.81  ? 494 HIS B N     1 
ATOM   7494 C  CA    . HIS B 1 500 ? -15.744 20.656  2.811   1.00 51.69  ? 494 HIS B CA    1 
ATOM   7495 C  C     . HIS B 1 500 ? -16.981 20.187  2.042   1.00 54.76  ? 494 HIS B C     1 
ATOM   7496 O  O     . HIS B 1 500 ? -17.614 20.979  1.339   1.00 49.00  ? 494 HIS B O     1 
ATOM   7497 C  CB    . HIS B 1 500 ? -14.615 20.912  1.804   1.00 56.30  ? 494 HIS B CB    1 
ATOM   7498 C  CG    . HIS B 1 500 ? -13.484 21.742  2.334   1.00 60.62  ? 494 HIS B CG    1 
ATOM   7499 N  ND1   . HIS B 1 500 ? -13.021 21.641  3.627   1.00 69.14  ? 494 HIS B ND1   1 
ATOM   7500 C  CD2   . HIS B 1 500 ? -12.706 22.670  1.725   1.00 57.10  ? 494 HIS B CD2   1 
ATOM   7501 C  CE1   . HIS B 1 500 ? -12.011 22.481  3.800   1.00 60.94  ? 494 HIS B CE1   1 
ATOM   7502 N  NE2   . HIS B 1 500 ? -11.803 23.115  2.662   1.00 70.40  ? 494 HIS B NE2   1 
ATOM   7503 N  N     . TYR B 1 501 ? -17.314 18.901  2.171   1.00 51.70  ? 495 TYR B N     1 
ATOM   7504 C  CA    . TYR B 1 501 ? -18.390 18.298  1.390   1.00 42.47  ? 495 TYR B CA    1 
ATOM   7505 C  C     . TYR B 1 501 ? -19.493 17.626  2.224   1.00 51.20  ? 495 TYR B C     1 
ATOM   7506 O  O     . TYR B 1 501 ? -20.613 17.450  1.731   1.00 42.13  ? 495 TYR B O     1 
ATOM   7507 C  CB    . TYR B 1 501 ? -17.816 17.267  0.412   1.00 39.13  ? 495 TYR B CB    1 
ATOM   7508 C  CG    . TYR B 1 501 ? -16.670 17.762  -0.449  1.00 43.30  ? 495 TYR B CG    1 
ATOM   7509 C  CD1   . TYR B 1 501 ? -15.361 17.758  0.028   1.00 45.51  ? 495 TYR B CD1   1 
ATOM   7510 C  CD2   . TYR B 1 501 ? -16.891 18.210  -1.752  1.00 34.19  ? 495 TYR B CD2   1 
ATOM   7511 C  CE1   . TYR B 1 501 ? -14.307 18.204  -0.764  1.00 45.52  ? 495 TYR B CE1   1 
ATOM   7512 C  CE2   . TYR B 1 501 ? -15.847 18.657  -2.550  1.00 29.87  ? 495 TYR B CE2   1 
ATOM   7513 C  CZ    . TYR B 1 501 ? -14.556 18.653  -2.052  1.00 41.78  ? 495 TYR B CZ    1 
ATOM   7514 O  OH    . TYR B 1 501 ? -13.509 19.091  -2.837  1.00 37.59  ? 495 TYR B OH    1 
ATOM   7515 N  N     . LEU B 1 502 ? -19.196 17.275  3.481   1.00 62.19  ? 496 LEU B N     1 
ATOM   7516 C  CA    . LEU B 1 502 ? -20.000 16.257  4.186   1.00 58.99  ? 496 LEU B CA    1 
ATOM   7517 C  C     . LEU B 1 502 ? -20.903 16.584  5.422   1.00 55.95  ? 496 LEU B C     1 
ATOM   7518 O  O     . LEU B 1 502 ? -22.056 16.970  5.234   1.00 53.68  ? 496 LEU B O     1 
ATOM   7519 C  CB    . LEU B 1 502 ? -19.166 14.981  4.395   1.00 50.79  ? 496 LEU B CB    1 
ATOM   7520 C  CG    . LEU B 1 502 ? -19.549 13.775  3.531   1.00 37.16  ? 496 LEU B CG    1 
ATOM   7521 C  CD1   . LEU B 1 502 ? -20.293 14.196  2.283   1.00 33.09  ? 496 LEU B CD1   1 
ATOM   7522 C  CD2   . LEU B 1 502 ? -18.311 12.996  3.164   1.00 31.24  ? 496 LEU B CD2   1 
ATOM   7523 N  N     . PRO B 1 503 ? -20.402 16.415  6.671   1.00 66.47  ? 497 PRO B N     1 
ATOM   7524 C  CA    . PRO B 1 503 ? -21.391 16.165  7.735   1.00 66.88  ? 497 PRO B CA    1 
ATOM   7525 C  C     . PRO B 1 503 ? -22.204 17.396  8.120   1.00 72.72  ? 497 PRO B C     1 
ATOM   7526 O  O     . PRO B 1 503 ? -21.654 18.496  8.175   1.00 82.56  ? 497 PRO B O     1 
ATOM   7527 C  CB    . PRO B 1 503 ? -20.522 15.715  8.919   1.00 60.37  ? 497 PRO B CB    1 
ATOM   7528 C  CG    . PRO B 1 503 ? -19.267 16.518  8.755   1.00 75.36  ? 497 PRO B CG    1 
ATOM   7529 C  CD    . PRO B 1 503 ? -19.086 16.769  7.244   1.00 70.65  ? 497 PRO B CD    1 
HETATM 7530 P  PG    . 3AT C 2 .   ? -0.008  -5.682  -46.991 1.00 24.46  ? 601 3AT A PG    1 
HETATM 7531 O  O1G   . 3AT C 2 .   ? -1.040  -6.474  -46.113 1.00 20.95  ? 601 3AT A O1G   1 
HETATM 7532 O  O2G   . 3AT C 2 .   ? 0.883   -6.717  -47.668 1.00 29.26  ? 601 3AT A O2G   1 
HETATM 7533 O  O3G   . 3AT C 2 .   ? -0.748  -4.909  -48.025 1.00 26.76  ? 601 3AT A O3G   1 
HETATM 7534 P  PB    . 3AT C 2 .   ? 2.334   -4.154  -46.295 1.00 27.56  ? 601 3AT A PB    1 
HETATM 7535 O  O1B   . 3AT C 2 .   ? 3.215   -5.275  -46.836 1.00 28.39  ? 601 3AT A O1B   1 
HETATM 7536 O  O2B   . 3AT C 2 .   ? 2.893   -3.708  -44.844 1.00 21.90  ? 601 3AT A O2B   1 
HETATM 7537 O  O3B   . 3AT C 2 .   ? 0.789   -4.696  -46.097 1.00 23.83  ? 601 3AT A O3B   1 
HETATM 7538 P  PA    . 3AT C 2 .   ? 2.170   -2.808  -48.753 1.00 37.63  ? 601 3AT A PA    1 
HETATM 7539 O  O1A   . 3AT C 2 .   ? 1.701   -4.130  -49.301 1.00 32.35  ? 601 3AT A O1A   1 
HETATM 7540 O  O2A   . 3AT C 2 .   ? 1.053   -1.723  -48.918 1.00 22.12  ? 601 3AT A O2A   1 
HETATM 7541 O  O3A   . 3AT C 2 .   ? 2.469   -2.895  -47.187 1.00 24.82  ? 601 3AT A O3A   1 
HETATM 7542 O  "O5'" . 3AT C 2 .   ? 3.430   -2.357  -49.509 1.00 28.49  ? 601 3AT A "O5'" 1 
HETATM 7543 C  "C5'" . 3AT C 2 .   ? 4.469   -3.230  -49.905 1.00 26.18  ? 601 3AT A "C5'" 1 
HETATM 7544 C  "C4'" . 3AT C 2 .   ? 5.838   -2.979  -49.504 1.00 25.89  ? 601 3AT A "C4'" 1 
HETATM 7545 O  "O4'" . 3AT C 2 .   ? 6.296   -1.619  -49.854 1.00 28.35  ? 601 3AT A "O4'" 1 
HETATM 7546 C  "C3'" . 3AT C 2 .   ? 5.994   -3.120  -48.043 1.00 24.49  ? 601 3AT A "C3'" 1 
HETATM 7547 C  "C2'" . 3AT C 2 .   ? 5.945   -1.731  -47.535 1.00 27.55  ? 601 3AT A "C2'" 1 
HETATM 7548 O  "O2'" . 3AT C 2 .   ? 6.645   -1.556  -46.411 1.00 24.24  ? 601 3AT A "O2'" 1 
HETATM 7549 C  "C1'" . 3AT C 2 .   ? 6.488   -0.892  -48.657 1.00 25.82  ? 601 3AT A "C1'" 1 
HETATM 7550 N  N9    . 3AT C 2 .   ? 6.028   0.636   -48.734 1.00 19.75  ? 601 3AT A N9    1 
HETATM 7551 C  C8    . 3AT C 2 .   ? 4.884   1.086   -49.294 1.00 19.50  ? 601 3AT A C8    1 
HETATM 7552 N  N7    . 3AT C 2 .   ? 4.811   2.425   -49.148 1.00 18.13  ? 601 3AT A N7    1 
HETATM 7553 C  C5    . 3AT C 2 .   ? 5.918   2.827   -48.487 0.75 16.64  ? 601 3AT A C5    1 
HETATM 7554 C  C6    . 3AT C 2 .   ? 6.364   4.069   -48.072 0.75 11.65  ? 601 3AT A C6    1 
HETATM 7555 N  N6    . 3AT C 2 .   ? 5.581   5.227   -48.350 0.75 11.50  ? 601 3AT A N6    1 
HETATM 7556 N  N1    . 3AT C 2 .   ? 7.544   4.122   -47.421 0.75 17.26  ? 601 3AT A N1    1 
HETATM 7557 C  C2    . 3AT C 2 .   ? 8.276   3.026   -47.165 0.75 14.54  ? 601 3AT A C2    1 
HETATM 7558 N  N3    . 3AT C 2 .   ? 7.867   1.815   -47.552 0.75 13.55  ? 601 3AT A N3    1 
HETATM 7559 C  C4    . 3AT C 2 .   ? 6.699   1.688   -48.216 0.75 19.00  ? 601 3AT A C4    1 
HETATM 7560 CA CA    . CA  D 3 .   ? 2.922   -6.697  -48.811 1.00 31.73  ? 602 CA  A CA    1 
HETATM 7561 P  PG    . 3AT E 2 .   ? -32.915 -6.855  -5.525  1.00 28.80  ? 601 3AT B PG    1 
HETATM 7562 O  O1G   . 3AT E 2 .   ? -33.700 -6.119  -6.668  1.00 24.21  ? 601 3AT B O1G   1 
HETATM 7563 O  O2G   . 3AT E 2 .   ? -31.916 -5.907  -4.868  1.00 24.67  ? 601 3AT B O2G   1 
HETATM 7564 O  O3G   . 3AT E 2 .   ? -33.897 -7.292  -4.510  1.00 23.34  ? 601 3AT B O3G   1 
HETATM 7565 P  PB    . 3AT E 2 .   ? -32.705 -9.100  -7.159  1.00 32.51  ? 601 3AT B PB    1 
HETATM 7566 O  O1B   . 3AT E 2 .   ? -34.160 -8.762  -7.478  1.00 27.71  ? 601 3AT B O1B   1 
HETATM 7567 O  O2B   . 3AT E 2 .   ? -32.561 -10.613 -6.617  1.00 20.80  ? 601 3AT B O2B   1 
HETATM 7568 O  O3B   . 3AT E 2 .   ? -32.120 -8.069  -6.042  1.00 25.01  ? 601 3AT B O3B   1 
HETATM 7569 P  PA    . 3AT E 2 .   ? -31.445 -7.751  -9.239  1.00 46.61  ? 601 3AT B PA    1 
HETATM 7570 O  O1A   . 3AT E 2 .   ? -32.390 -6.613  -8.979  1.00 37.50  ? 601 3AT B O1A   1 
HETATM 7571 O  O2A   . 3AT E 2 .   ? -29.999 -7.321  -8.842  1.00 28.21  ? 601 3AT B O2A   1 
HETATM 7572 O  O3A   . 3AT E 2 .   ? -31.833 -9.061  -8.431  1.00 31.35  ? 601 3AT B O3A   1 
HETATM 7573 O  "O5'" . 3AT E 2 .   ? -31.538 -8.149  -10.711 1.00 36.77  ? 601 3AT B "O5'" 1 
HETATM 7574 C  "C5'" . 3AT E 2 .   ? -32.788 -8.502  -11.272 1.00 33.26  ? 601 3AT B "C5'" 1 
HETATM 7575 C  "C4'" . 3AT E 2 .   ? -33.030 -9.828  -11.800 1.00 35.35  ? 601 3AT B "C4'" 1 
HETATM 7576 O  "O4'" . 3AT E 2 .   ? -32.013 -10.244 -12.805 1.00 48.40  ? 601 3AT B "O4'" 1 
HETATM 7577 C  "C3'" . 3AT E 2 .   ? -33.027 -10.850 -10.731 1.00 30.63  ? 601 3AT B "C3'" 1 
HETATM 7578 C  "C2'" . 3AT E 2 .   ? -31.876 -11.751 -11.013 1.00 30.74  ? 601 3AT B "C2'" 1 
HETATM 7579 O  "O2'" . 3AT E 2 .   ? -32.211 -13.034 -10.966 1.00 34.91  ? 601 3AT B "O2'" 1 
HETATM 7580 C  "C1'" . 3AT E 2 .   ? -31.400 -11.451 -12.398 1.00 28.25  ? 601 3AT B "C1'" 1 
HETATM 7581 N  N9    . 3AT E 2 .   ? -29.829 -11.535 -12.640 1.00 22.32  ? 601 3AT B N9    1 
HETATM 7582 C  C8    . 3AT E 2 .   ? -28.943 -10.528 -12.464 1.00 21.98  ? 601 3AT B C8    1 
HETATM 7583 N  N7    . 3AT E 2 .   ? -27.706 -10.996 -12.743 1.00 23.81  ? 601 3AT B N7    1 
HETATM 7584 C  C5    . 3AT E 2 .   ? -27.809 -12.299 -13.106 0.75 20.91  ? 601 3AT B C5    1 
HETATM 7585 C  C6    . 3AT E 2 .   ? -26.887 -13.269 -13.496 0.75 16.96  ? 601 3AT B C6    1 
HETATM 7586 N  N6    . 3AT E 2 .   ? -25.490 -12.962 -13.567 0.75 17.80  ? 601 3AT B N6    1 
HETATM 7587 N  N1    . 3AT E 2 .   ? -27.352 -14.501 -13.792 0.75 17.13  ? 601 3AT B N1    1 
HETATM 7588 C  C2    . 3AT E 2 .   ? -28.651 -14.811 -13.721 0.75 16.75  ? 601 3AT B C2    1 
HETATM 7589 N  N3    . 3AT E 2 .   ? -29.554 -13.898 -13.344 0.75 20.26  ? 601 3AT B N3    1 
HETATM 7590 C  C4    . 3AT E 2 .   ? -29.167 -12.643 -13.034 0.75 23.68  ? 601 3AT B C4    1 
HETATM 7591 CA CA    . CA  F 3 .   ? -35.127 -6.783  -8.392  1.00 34.02  ? 602 CA  B CA    1 
HETATM 7592 O  O     . HOH G 4 .   ? 6.032   9.124   -27.527 1.00 24.19  ? 701 HOH A O     1 
HETATM 7593 O  O     . HOH G 4 .   ? -4.325  -6.962  -11.970 1.00 17.99  ? 702 HOH A O     1 
HETATM 7594 O  O     . HOH G 4 .   ? -0.263  -13.885 -39.612 1.00 12.57  ? 703 HOH A O     1 
HETATM 7595 O  O     . HOH G 4 .   ? 7.040   -17.753 -42.035 1.00 11.65  ? 704 HOH A O     1 
HETATM 7596 O  O     . HOH G 4 .   ? 3.864   -20.321 -57.486 1.00 11.00  ? 705 HOH A O     1 
HETATM 7597 O  O     . HOH G 4 .   ? 15.797  4.913   -46.367 1.00 14.60  ? 706 HOH A O     1 
HETATM 7598 O  O     . HOH G 4 .   ? 1.649   -2.037  -24.555 1.00 8.55   ? 707 HOH A O     1 
HETATM 7599 O  O     . HOH G 4 .   ? -14.996 2.612   -37.634 1.00 10.76  ? 708 HOH A O     1 
HETATM 7600 O  O     . HOH G 4 .   ? -14.976 2.925   -22.103 1.00 12.57  ? 709 HOH A O     1 
HETATM 7601 O  O     . HOH G 4 .   ? -4.426  -1.688  -20.479 1.00 2.65   ? 710 HOH A O     1 
HETATM 7602 O  O     . HOH G 4 .   ? -1.001  15.217  -51.534 1.00 14.37  ? 711 HOH A O     1 
HETATM 7603 O  O     . HOH G 4 .   ? -1.030  13.230  -46.603 1.00 11.70  ? 712 HOH A O     1 
HETATM 7604 O  O     . HOH G 4 .   ? -10.853 -1.311  -47.440 1.00 8.39   ? 713 HOH A O     1 
HETATM 7605 O  O     . HOH G 4 .   ? 8.371   -0.222  -45.326 1.00 14.24  ? 714 HOH A O     1 
HETATM 7606 O  O     . HOH G 4 .   ? -2.121  -8.986  -45.687 1.00 18.43  ? 715 HOH A O     1 
HETATM 7607 O  O     . HOH G 4 .   ? -2.674  5.105   -58.883 1.00 18.53  ? 716 HOH A O     1 
HETATM 7608 O  O     . HOH G 4 .   ? -11.193 16.278  -44.673 1.00 17.68  ? 717 HOH A O     1 
HETATM 7609 O  O     . HOH G 4 .   ? -19.902 10.005  -44.999 1.00 13.91  ? 718 HOH A O     1 
HETATM 7610 O  O     . HOH G 4 .   ? -16.627 -5.862  -24.374 1.00 14.15  ? 719 HOH A O     1 
HETATM 7611 O  O     . HOH G 4 .   ? -16.437 21.474  -54.582 1.00 20.46  ? 720 HOH A O     1 
HETATM 7612 O  O     . HOH G 4 .   ? -16.806 0.116   -54.722 1.00 16.52  ? 721 HOH A O     1 
HETATM 7613 O  O     . HOH G 4 .   ? 5.447   -8.423  -46.615 1.00 17.48  ? 722 HOH A O     1 
HETATM 7614 O  O     . HOH G 4 .   ? -6.145  -7.860  -41.994 1.00 12.32  ? 723 HOH A O     1 
HETATM 7615 O  O     . HOH G 4 .   ? -5.161  -8.125  -39.832 1.00 8.72   ? 724 HOH A O     1 
HETATM 7616 O  O     . HOH G 4 .   ? 2.749   -11.849 -57.431 1.00 30.88  ? 725 HOH A O     1 
HETATM 7617 O  O     . HOH G 4 .   ? -1.329  -2.342  -48.287 1.00 13.45  ? 726 HOH A O     1 
HETATM 7618 O  O     . HOH G 4 .   ? 1.565   -3.236  -42.574 1.00 8.84   ? 727 HOH A O     1 
HETATM 7619 O  O     . HOH H 4 .   ? -31.656 -25.144 7.842   1.00 12.89  ? 701 HOH B O     1 
HETATM 7620 O  O     . HOH H 4 .   ? -1.774  -0.369  -10.226 1.00 8.95   ? 702 HOH B O     1 
HETATM 7621 O  O     . HOH H 4 .   ? -19.872 7.604   -2.422  1.00 24.15  ? 703 HOH B O     1 
HETATM 7622 O  O     . HOH H 4 .   ? -26.745 -28.352 9.767   1.00 13.24  ? 704 HOH B O     1 
HETATM 7623 O  O     . HOH H 4 .   ? -40.766 -8.705  2.515   1.00 11.45  ? 705 HOH B O     1 
HETATM 7624 O  O     . HOH H 4 .   ? -51.343 -12.812 -8.283  1.00 18.47  ? 706 HOH B O     1 
HETATM 7625 O  O     . HOH H 4 .   ? -50.368 4.219   -10.202 1.00 31.16  ? 707 HOH B O     1 
HETATM 7626 O  O     . HOH H 4 .   ? -15.279 -0.756  -8.605  1.00 10.71  ? 708 HOH B O     1 
HETATM 7627 O  O     . HOH H 4 .   ? -15.334 -12.641 -10.802 1.00 12.72  ? 709 HOH B O     1 
HETATM 7628 O  O     . HOH H 4 .   ? -21.401 -27.378 13.882  1.00 6.62   ? 710 HOH B O     1 
HETATM 7629 O  O     . HOH H 4 .   ? -50.201 -11.739 1.612   1.00 19.63  ? 711 HOH B O     1 
HETATM 7630 O  O     . HOH H 4 .   ? -50.637 -14.884 -30.073 1.00 48.68  ? 712 HOH B O     1 
HETATM 7631 O  O     . HOH H 4 .   ? -47.178 -30.630 -14.387 1.00 20.83  ? 713 HOH B O     1 
HETATM 7632 O  O     . HOH H 4 .   ? -11.678 -17.448 -12.845 1.00 11.02  ? 714 HOH B O     1 
HETATM 7633 O  O     . HOH H 4 .   ? -20.040 19.763  -10.603 1.00 33.62  ? 715 HOH B O     1 
HETATM 7634 O  O     . HOH H 4 .   ? -20.790 2.000   -22.768 1.00 8.21   ? 716 HOH B O     1 
HETATM 7635 O  O     . HOH H 4 .   ? -41.875 -12.435 -1.655  1.00 10.98  ? 717 HOH B O     1 
HETATM 7636 O  O     . HOH H 4 .   ? -32.035 -13.545 -7.815  1.00 16.62  ? 718 HOH B O     1 
HETATM 7637 O  O     . HOH H 4 .   ? -13.917 -10.106 -14.930 1.00 11.51  ? 719 HOH B O     1 
HETATM 7638 O  O     . HOH H 4 .   ? -19.890 -5.568  11.187  1.00 16.62  ? 720 HOH B O     1 
HETATM 7639 O  O     . HOH H 4 .   ? -20.100 -7.879  -10.583 1.00 13.05  ? 721 HOH B O     1 
HETATM 7640 O  O     . HOH H 4 .   ? -24.513 -10.264 -12.147 1.00 15.11  ? 722 HOH B O     1 
HETATM 7641 O  O     . HOH H 4 .   ? -31.678 -11.303 -3.767  1.00 9.88   ? 723 HOH B O     1 
HETATM 7642 O  O     . HOH H 4 .   ? -32.047 -15.175 -10.954 1.00 14.90  ? 724 HOH B O     1 
HETATM 7643 O  O     . HOH H 4 .   ? -18.164 -0.365  -0.156  1.00 12.78  ? 725 HOH B O     1 
HETATM 7644 O  O     . HOH H 4 .   ? -29.034 -6.418  -7.089  1.00 17.51  ? 726 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   ?   ?   ?   A . n 
A 1 8   LYS 8   2   ?   ?   ?   A . n 
A 1 9   GLU 9   3   ?   ?   ?   A . n 
A 1 10  MET 10  4   ?   ?   ?   A . n 
A 1 11  SER 11  5   ?   ?   ?   A . n 
A 1 12  ALA 12  6   ?   ?   ?   A . n 
A 1 13  ASN 13  7   ?   ?   ?   A . n 
A 1 14  THR 14  8   ?   ?   ?   A . n 
A 1 15  VAL 15  9   ?   ?   ?   A . n 
A 1 16  LEU 16  10  ?   ?   ?   A . n 
A 1 17  ASP 17  11  ?   ?   ?   A . n 
A 1 18  SER 18  12  ?   ?   ?   A . n 
A 1 19  GLN 19  13  ?   ?   ?   A . n 
A 1 20  ARG 20  14  ?   ?   ?   A . n 
A 1 21  GLN 21  15  ?   ?   ?   A . n 
A 1 22  GLN 22  16  ?   ?   ?   A . n 
A 1 23  LYS 23  17  17  LYS LYS A . n 
A 1 24  HIS 24  18  18  HIS HIS A . n 
A 1 25  TYR 25  19  19  TYR TYR A . n 
A 1 26  GLY 26  20  20  GLY GLY A . n 
A 1 27  ILE 27  21  21  ILE ILE A . n 
A 1 28  THR 28  22  22  THR THR A . n 
A 1 29  SER 29  23  23  SER SER A . n 
A 1 30  PRO 30  24  24  PRO PRO A . n 
A 1 31  ILE 31  25  25  ILE ILE A . n 
A 1 32  SER 32  26  26  SER SER A . n 
A 1 33  LEU 33  27  27  LEU LEU A . n 
A 1 34  ALA 34  28  28  ALA ALA A . n 
A 1 35  SER 35  29  29  SER SER A . n 
A 1 36  PRO 36  30  30  PRO PRO A . n 
A 1 37  LYS 37  31  31  LYS LYS A . n 
A 1 38  GLU 38  32  32  GLU GLU A . n 
A 1 39  ILE 39  33  33  ILE ILE A . n 
A 1 40  ASP 40  34  34  ASP ASP A . n 
A 1 41  HIS 41  35  35  HIS HIS A . n 
A 1 42  ILE 42  36  36  ILE ILE A . n 
A 1 43  TYR 43  37  37  TYR TYR A . n 
A 1 44  THR 44  38  38  THR THR A . n 
A 1 45  GLN 45  39  39  GLN GLN A . n 
A 1 46  LYS 46  40  40  LYS LYS A . n 
A 1 47  LEU 47  41  41  LEU LEU A . n 
A 1 48  ILE 48  42  42  ILE ILE A . n 
A 1 49  ASP 49  43  43  ASP ASP A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  MET 51  45  45  MET MET A . n 
A 1 52  LYS 52  46  46  LYS LYS A . n 
A 1 53  PRO 53  47  47  PRO PRO A . n 
A 1 54  PHE 54  48  48  PHE PHE A . n 
A 1 55  GLY 55  49  49  GLY GLY A . n 
A 1 56  VAL 56  50  50  VAL VAL A . n 
A 1 57  PHE 57  51  51  PHE PHE A . n 
A 1 58  GLU 58  52  52  GLU GLU A . n 
A 1 59  ASP 59  53  53  ASP ASP A . n 
A 1 60  GLU 60  54  54  GLU GLU A . n 
A 1 61  GLU 61  55  55  GLU GLU A . n 
A 1 62  GLU 62  56  56  GLU GLU A . n 
A 1 63  LEU 63  57  57  LEU LEU A . n 
A 1 64  ASN 64  58  58  ASN ASN A . n 
A 1 65  HIS 65  59  59  HIS HIS A . n 
A 1 66  ARG 66  60  60  ARG ARG A . n 
A 1 67  LEU 67  61  61  LEU LEU A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  VAL 69  63  63  VAL VAL A . n 
A 1 70  LEU 70  64  64  LEU LEU A . n 
A 1 71  GLY 71  65  65  GLY GLY A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  LEU 73  67  67  LEU LEU A . n 
A 1 74  ASN 74  68  68  ASN ASN A . n 
A 1 75  ASN 75  69  69  ASN ASN A . n 
A 1 76  LEU 76  70  70  LEU LEU A . n 
A 1 77  VAL 77  71  71  VAL VAL A . n 
A 1 78  LYS 78  72  72  LYS LYS A . n 
A 1 79  GLU 79  73  73  GLU GLU A . n 
A 1 80  TRP 80  74  74  TRP TRP A . n 
A 1 81  ILE 81  75  75  ILE ILE A . n 
A 1 82  SER 82  76  76  SER SER A . n 
A 1 83  ASP 83  77  77  ASP ASP A . n 
A 1 84  VAL 84  78  78  VAL VAL A . n 
A 1 85  SER 85  79  79  SER SER A . n 
A 1 86  GLU 86  80  80  GLU GLU A . n 
A 1 87  SER 87  81  81  SER SER A . n 
A 1 88  LYS 88  82  82  LYS LYS A . n 
A 1 89  ASN 89  83  83  ASN ASN A . n 
A 1 90  LEU 90  84  84  LEU LEU A . n 
A 1 91  PRO 91  85  85  PRO PRO A . n 
A 1 92  PRO 92  86  86  PRO PRO A . n 
A 1 93  SER 93  87  87  SER SER A . n 
A 1 94  VAL 94  88  88  VAL VAL A . n 
A 1 95  VAL 95  89  89  VAL VAL A . n 
A 1 96  ALA 96  90  90  ALA ALA A . n 
A 1 97  THR 97  91  91  THR THR A . n 
A 1 98  VAL 98  92  92  VAL VAL A . n 
A 1 99  GLY 99  93  93  GLY GLY A . n 
A 1 100 GLY 100 94  94  GLY GLY A . n 
A 1 101 LYS 101 95  95  LYS LYS A . n 
A 1 102 ILE 102 96  96  ILE ILE A . n 
A 1 103 PHE 103 97  97  PHE PHE A . n 
A 1 104 THR 104 98  98  THR THR A . n 
A 1 105 PHE 105 99  99  PHE PHE A . n 
A 1 106 GLY 106 100 100 GLY GLY A . n 
A 1 107 SER 107 101 101 SER SER A . n 
A 1 108 TYR 108 102 102 TYR TYR A . n 
A 1 109 ARG 109 103 103 ARG ARG A . n 
A 1 110 LEU 110 104 104 LEU LEU A . n 
A 1 111 GLY 111 105 105 GLY GLY A . n 
A 1 112 VAL 112 106 106 VAL VAL A . n 
A 1 113 HIS 113 107 107 HIS HIS A . n 
A 1 114 THR 114 108 108 THR THR A . n 
A 1 115 LYS 115 109 109 LYS LYS A . n 
A 1 116 GLY 116 110 110 GLY GLY A . n 
A 1 117 ALA 117 111 111 ALA ALA A . n 
A 1 118 ASP 118 112 112 ASP ASP A . n 
A 1 119 ILE 119 113 113 ILE ILE A . n 
A 1 120 ASP 120 114 114 ASP ASP A . n 
A 1 121 ALA 121 115 115 ALA ALA A . n 
A 1 122 LEU 122 116 116 LEU LEU A . n 
A 1 123 CYS 123 117 117 CYS CYS A . n 
A 1 124 VAL 124 118 118 VAL VAL A . n 
A 1 125 ALA 125 119 119 ALA ALA A . n 
A 1 126 PRO 126 120 120 PRO PRO A . n 
A 1 127 ARG 127 121 121 ARG ARG A . n 
A 1 128 HIS 128 122 122 HIS HIS A . n 
A 1 129 VAL 129 123 123 VAL VAL A . n 
A 1 130 GLU 130 124 124 GLU GLU A . n 
A 1 131 ARG 131 125 125 ARG ARG A . n 
A 1 132 SER 132 126 126 SER SER A . n 
A 1 133 ASP 133 127 127 ASP ASP A . n 
A 1 134 PHE 134 128 128 PHE PHE A . n 
A 1 135 PHE 135 129 129 PHE PHE A . n 
A 1 136 GLN 136 130 130 GLN GLN A . n 
A 1 137 SER 137 131 131 SER SER A . n 
A 1 138 PHE 138 132 132 PHE PHE A . n 
A 1 139 PHE 139 133 133 PHE PHE A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 LEU 142 136 136 LEU LEU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 HIS 144 138 138 HIS HIS A . n 
A 1 145 GLN 145 139 139 GLN GLN A . n 
A 1 146 ASP 146 140 140 ASP ASP A . n 
A 1 147 GLY 147 141 141 GLY GLY A . n 
A 1 148 ILE 148 142 142 ILE ILE A . n 
A 1 149 ARG 149 143 143 ARG ARG A . n 
A 1 150 ASN 150 144 144 ASN ASN A . n 
A 1 151 LEU 151 145 145 LEU LEU A . n 
A 1 152 ARG 152 146 146 ARG ARG A . n 
A 1 153 ALA 153 147 147 ALA ALA A . n 
A 1 154 VAL 154 148 148 VAL VAL A . n 
A 1 155 GLU 155 149 149 GLU GLU A . n 
A 1 156 ASP 156 150 150 ASP ASP A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 PHE 158 152 152 PHE PHE A . n 
A 1 159 VAL 159 153 153 VAL VAL A . n 
A 1 160 PRO 160 154 154 PRO PRO A . n 
A 1 161 VAL 161 155 155 VAL VAL A . n 
A 1 162 ILE 162 156 156 ILE ILE A . n 
A 1 163 LYS 163 157 157 LYS LYS A . n 
A 1 164 PHE 164 158 158 PHE PHE A . n 
A 1 165 GLU 165 159 159 GLU GLU A . n 
A 1 166 PHE 166 160 160 PHE PHE A . n 
A 1 167 ASP 167 161 161 ASP ASP A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 GLU 170 164 164 GLU GLU A . n 
A 1 171 ILE 171 165 165 ILE ILE A . n 
A 1 172 ASP 172 166 166 ASP ASP A . n 
A 1 173 LEU 173 167 167 LEU LEU A . n 
A 1 174 VAL 174 168 168 VAL VAL A . n 
A 1 175 PHE 175 169 169 PHE PHE A . n 
A 1 176 ALA 176 170 170 ALA ALA A . n 
A 1 177 ARG 177 171 171 ARG ARG A . n 
A 1 178 LEU 178 172 172 LEU LEU A . n 
A 1 179 ALA 179 173 173 ALA ALA A . n 
A 1 180 ILE 180 174 174 ILE ILE A . n 
A 1 181 GLN 181 175 175 GLN GLN A . n 
A 1 182 THR 182 176 176 THR THR A . n 
A 1 183 ILE 183 177 177 ILE ILE A . n 
A 1 184 SER 184 178 178 SER SER A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ASN 186 180 180 ASN ASN A . n 
A 1 187 LEU 187 181 181 LEU LEU A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 LEU 189 183 183 LEU LEU A . n 
A 1 190 ARG 190 184 184 ARG ARG A . n 
A 1 191 ASP 191 185 185 ASP ASP A . n 
A 1 192 ASP 192 186 186 ASP ASP A . n 
A 1 193 SER 193 187 187 SER SER A . n 
A 1 194 ARG 194 188 188 ARG ARG A . n 
A 1 195 LEU 195 189 189 LEU LEU A . n 
A 1 196 ARG 196 190 190 ARG ARG A . n 
A 1 197 SER 197 191 191 SER SER A . n 
A 1 198 LEU 198 192 192 LEU LEU A . n 
A 1 199 ASP 199 193 193 ASP ASP A . n 
A 1 200 ILE 200 194 194 ILE ILE A . n 
A 1 201 ARG 201 195 195 ARG ARG A . n 
A 1 202 CYS 202 196 196 CYS CYS A . n 
A 1 203 ILE 203 197 197 ILE ILE A . n 
A 1 204 ARG 204 198 198 ARG ARG A . n 
A 1 205 SER 205 199 199 SER SER A . n 
A 1 206 LEU 206 200 200 LEU LEU A . n 
A 1 207 ASN 207 201 201 ASN ASN A . n 
A 1 208 GLY 208 202 202 GLY GLY A . n 
A 1 209 CYS 209 203 203 CYS CYS A . n 
A 1 210 ARG 210 204 204 ARG ARG A . n 
A 1 211 VAL 211 205 205 VAL VAL A . n 
A 1 212 THR 212 206 206 THR THR A . n 
A 1 213 ASP 213 207 207 ASP ASP A . n 
A 1 214 GLU 214 208 208 GLU GLU A . n 
A 1 215 ILE 215 209 209 ILE ILE A . n 
A 1 216 LEU 216 210 210 LEU LEU A . n 
A 1 217 HIS 217 211 211 HIS HIS A . n 
A 1 218 LEU 218 212 212 LEU LEU A . n 
A 1 219 VAL 219 213 213 VAL VAL A . n 
A 1 220 PRO 220 214 214 PRO PRO A . n 
A 1 221 ASN 221 215 215 ASN ASN A . n 
A 1 222 LYS 222 216 216 LYS LYS A . n 
A 1 223 GLU 223 217 217 GLU GLU A . n 
A 1 224 THR 224 218 218 THR THR A . n 
A 1 225 PHE 225 219 219 PHE PHE A . n 
A 1 226 ARG 226 220 220 ARG ARG A . n 
A 1 227 LEU 227 221 221 LEU LEU A . n 
A 1 228 THR 228 222 222 THR THR A . n 
A 1 229 LEU 229 223 223 LEU LEU A . n 
A 1 230 ARG 230 224 224 ARG ARG A . n 
A 1 231 ALA 231 225 225 ALA ALA A . n 
A 1 232 VAL 232 226 226 VAL VAL A . n 
A 1 233 LYS 233 227 227 LYS LYS A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 TRP 235 229 229 TRP TRP A . n 
A 1 236 ALA 236 230 230 ALA ALA A . n 
A 1 237 LYS 237 231 231 LYS LYS A . n 
A 1 238 ARG 238 232 232 ARG ARG A . n 
A 1 239 ARG 239 233 233 ARG ARG A . n 
A 1 240 GLY 240 234 234 GLY GLY A . n 
A 1 241 ILE 241 235 235 ILE ILE A . n 
A 1 242 TYR 242 236 236 TYR TYR A . n 
A 1 243 SER 243 237 237 SER SER A . n 
A 1 244 ASN 244 238 238 ASN ASN A . n 
A 1 245 MET 245 239 239 MET MET A . n 
A 1 246 LEU 246 240 240 LEU LEU A . n 
A 1 247 GLY 247 241 241 GLY GLY A . n 
A 1 248 PHE 248 242 242 PHE PHE A . n 
A 1 249 LEU 249 243 243 LEU LEU A . n 
A 1 250 GLY 250 244 244 GLY GLY A . n 
A 1 251 GLY 251 245 245 GLY GLY A . n 
A 1 252 VAL 252 246 246 VAL VAL A . n 
A 1 253 SER 253 247 247 SER SER A . n 
A 1 254 TRP 254 248 248 TRP TRP A . n 
A 1 255 ALA 255 249 249 ALA ALA A . n 
A 1 256 MET 256 250 250 MET MET A . n 
A 1 257 LEU 257 251 251 LEU LEU A . n 
A 1 258 VAL 258 252 252 VAL VAL A . n 
A 1 259 ALA 259 253 253 ALA ALA A . n 
A 1 260 ARG 260 254 254 ARG ARG A . n 
A 1 261 THR 261 255 255 THR THR A . n 
A 1 262 CYS 262 256 256 CYS CYS A . n 
A 1 263 GLN 263 257 257 GLN GLN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 TYR 265 259 259 TYR TYR A . n 
A 1 266 PRO 266 260 260 PRO PRO A . n 
A 1 267 ASN 267 261 261 ASN ASN A . n 
A 1 268 ALA 268 262 262 ALA ALA A . n 
A 1 269 ALA 269 263 263 ALA ALA A . n 
A 1 270 ALA 270 264 264 ALA ALA A . n 
A 1 271 SER 271 265 265 SER SER A . n 
A 1 272 THR 272 266 266 THR THR A . n 
A 1 273 LEU 273 267 267 LEU LEU A . n 
A 1 274 VAL 274 268 268 VAL VAL A . n 
A 1 275 HIS 275 269 269 HIS HIS A . n 
A 1 276 LYS 276 270 270 LYS LYS A . n 
A 1 277 PHE 277 271 271 PHE PHE A . n 
A 1 278 PHE 278 272 272 PHE PHE A . n 
A 1 279 LEU 279 273 273 LEU LEU A . n 
A 1 280 VAL 280 274 274 VAL VAL A . n 
A 1 281 PHE 281 275 275 PHE PHE A . n 
A 1 282 SER 282 276 276 SER SER A . n 
A 1 283 LYS 283 277 277 LYS LYS A . n 
A 1 284 TRP 284 278 278 TRP TRP A . n 
A 1 285 GLU 285 279 279 GLU GLU A . n 
A 1 286 TRP 286 280 280 TRP TRP A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 ASN 288 282 282 ASN ASN A . n 
A 1 289 PRO 289 283 283 PRO PRO A . n 
A 1 290 VAL 290 284 284 VAL VAL A . n 
A 1 291 LEU 291 285 285 LEU LEU A . n 
A 1 292 LEU 292 286 286 LEU LEU A . n 
A 1 293 LYS 293 287 287 LYS LYS A . n 
A 1 294 GLN 294 288 288 GLN GLN A . n 
A 1 295 PRO 295 289 289 PRO PRO A . n 
A 1 296 GLU 296 290 290 GLU GLU A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 SER 298 292 292 SER SER A . n 
A 1 299 ASN 299 293 293 ASN ASN A . n 
A 1 300 LEU 300 294 294 LEU LEU A . n 
A 1 301 ASN 301 295 295 ASN ASN A . n 
A 1 302 LEU 302 296 296 LEU LEU A . n 
A 1 303 PRO 303 297 297 PRO PRO A . n 
A 1 304 VAL 304 298 298 VAL VAL A . n 
A 1 305 TRP 305 299 299 TRP TRP A . n 
A 1 306 ASP 306 300 300 ASP ASP A . n 
A 1 307 PRO 307 301 301 PRO PRO A . n 
A 1 308 ARG 308 302 302 ARG ARG A . n 
A 1 309 VAL 309 303 303 VAL VAL A . n 
A 1 310 ASN 310 304 304 ASN ASN A . n 
A 1 311 PRO 311 305 305 PRO PRO A . n 
A 1 312 SER 312 306 306 SER SER A . n 
A 1 313 ASP 313 307 307 ASP ASP A . n 
A 1 314 ARG 314 308 308 ARG ARG A . n 
A 1 315 TYR 315 309 309 TYR TYR A . n 
A 1 316 HIS 316 310 310 HIS HIS A . n 
A 1 317 LEU 317 311 311 LEU LEU A . n 
A 1 318 MET 318 312 312 MET MET A . n 
A 1 319 PRO 319 313 313 PRO PRO A . n 
A 1 320 ILE 320 314 314 ILE ILE A . n 
A 1 321 ILE 321 315 315 ILE ILE A . n 
A 1 322 THR 322 316 316 THR THR A . n 
A 1 323 PRO 323 317 317 PRO PRO A . n 
A 1 324 ALA 324 318 318 ALA ALA A . n 
A 1 325 TYR 325 319 319 TYR TYR A . n 
A 1 326 PRO 326 320 320 PRO PRO A . n 
A 1 327 GLN 327 321 321 GLN GLN A . n 
A 1 328 GLN 328 322 322 GLN GLN A . n 
A 1 329 ASN 329 323 323 ASN ASN A . n 
A 1 330 SER 330 324 324 SER SER A . n 
A 1 331 THR 331 325 325 THR THR A . n 
A 1 332 TYR 332 326 326 TYR TYR A . n 
A 1 333 ASN 333 327 327 ASN ASN A . n 
A 1 334 VAL 334 328 328 VAL VAL A . n 
A 1 335 SER 335 329 329 SER SER A . n 
A 1 336 THR 336 330 330 THR THR A . n 
A 1 337 SER 337 331 331 SER SER A . n 
A 1 338 THR 338 332 332 THR THR A . n 
A 1 339 ARG 339 333 333 ARG ARG A . n 
A 1 340 THR 340 334 334 THR THR A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 MET 342 336 336 MET MET A . n 
A 1 343 VAL 343 337 337 VAL VAL A . n 
A 1 344 GLU 344 338 338 GLU GLU A . n 
A 1 345 GLU 345 339 339 GLU GLU A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 LYS 347 341 341 LYS LYS A . n 
A 1 348 GLN 348 342 342 GLN GLN A . n 
A 1 349 GLY 349 343 343 GLY GLY A . n 
A 1 350 LEU 350 344 344 LEU LEU A . n 
A 1 351 ALA 351 345 345 ALA ALA A . n 
A 1 352 VAL 352 346 346 VAL VAL A . n 
A 1 353 THR 353 347 347 THR THR A . n 
A 1 354 ASP 354 348 348 ASP ASP A . n 
A 1 355 GLU 355 349 349 GLU GLU A . n 
A 1 356 ILE 356 350 350 ILE ILE A . n 
A 1 357 LEU 357 351 351 LEU LEU A . n 
A 1 358 GLN 358 352 352 GLN GLN A . n 
A 1 359 GLY 359 353 353 GLY GLY A . n 
A 1 360 LYS 360 354 354 LYS LYS A . n 
A 1 361 SER 361 355 355 SER SER A . n 
A 1 362 ASP 362 356 356 ASP ASP A . n 
A 1 363 TRP 363 357 357 TRP TRP A . n 
A 1 364 SER 364 358 358 SER SER A . n 
A 1 365 LYS 365 359 359 LYS LYS A . n 
A 1 366 LEU 366 360 360 LEU LEU A . n 
A 1 367 LEU 367 361 361 LEU LEU A . n 
A 1 368 GLU 368 362 362 GLU GLU A . n 
A 1 369 PRO 369 363 363 PRO PRO A . n 
A 1 370 PRO 370 364 364 PRO PRO A . n 
A 1 371 ASN 371 365 365 ASN ASN A . n 
A 1 372 PHE 372 366 366 PHE PHE A . n 
A 1 373 PHE 373 367 367 PHE PHE A . n 
A 1 374 GLN 374 368 368 GLN GLN A . n 
A 1 375 LYS 375 369 369 LYS LYS A . n 
A 1 376 TYR 376 370 370 TYR TYR A . n 
A 1 377 ARG 377 371 371 ARG ARG A . n 
A 1 378 HIS 378 372 372 HIS HIS A . n 
A 1 379 TYR 379 373 373 TYR TYR A . n 
A 1 380 ILE 380 374 374 ILE ILE A . n 
A 1 381 VAL 381 375 375 VAL VAL A . n 
A 1 382 LEU 382 376 376 LEU LEU A . n 
A 1 383 THR 383 377 377 THR THR A . n 
A 1 384 ALA 384 378 378 ALA ALA A . n 
A 1 385 SER 385 379 379 SER SER A . n 
A 1 386 ALA 386 380 380 ALA ALA A . n 
A 1 387 SER 387 381 381 SER SER A . n 
A 1 388 THR 388 382 382 THR THR A . n 
A 1 389 GLU 389 383 383 GLU GLU A . n 
A 1 390 GLU 390 384 384 GLU GLU A . n 
A 1 391 ASN 391 385 385 ASN ASN A . n 
A 1 392 HIS 392 386 386 HIS HIS A . n 
A 1 393 LEU 393 387 387 LEU LEU A . n 
A 1 394 GLU 394 388 388 GLU GLU A . n 
A 1 395 TRP 395 389 389 TRP TRP A . n 
A 1 396 VAL 396 390 390 VAL VAL A . n 
A 1 397 GLY 397 391 391 GLY GLY A . n 
A 1 398 LEU 398 392 392 LEU LEU A . n 
A 1 399 VAL 399 393 393 VAL VAL A . n 
A 1 400 GLU 400 394 394 GLU GLU A . n 
A 1 401 SER 401 395 395 SER SER A . n 
A 1 402 LYS 402 396 396 LYS LYS A . n 
A 1 403 ILE 403 397 397 ILE ILE A . n 
A 1 404 ARG 404 398 398 ARG ARG A . n 
A 1 405 VAL 405 399 399 VAL VAL A . n 
A 1 406 LEU 406 400 400 LEU LEU A . n 
A 1 407 VAL 407 401 401 VAL VAL A . n 
A 1 408 GLY 408 402 402 GLY GLY A . n 
A 1 409 ASN 409 403 403 ASN ASN A . n 
A 1 410 LEU 410 404 404 LEU LEU A . n 
A 1 411 GLU 411 405 405 GLU GLU A . n 
A 1 412 ARG 412 406 406 ARG ARG A . n 
A 1 413 ASN 413 407 407 ASN ASN A . n 
A 1 414 GLU 414 408 408 GLU GLU A . n 
A 1 415 PHE 415 409 409 PHE PHE A . n 
A 1 416 ILE 416 410 410 ILE ILE A . n 
A 1 417 THR 417 411 411 THR THR A . n 
A 1 418 LEU 418 412 412 LEU LEU A . n 
A 1 419 ALA 419 413 413 ALA ALA A . n 
A 1 420 HIS 420 414 414 HIS HIS A . n 
A 1 421 VAL 421 415 415 VAL VAL A . n 
A 1 422 ASN 422 416 416 ASN ASN A . n 
A 1 423 PRO 423 417 417 PRO PRO A . n 
A 1 424 GLN 424 418 418 GLN GLN A . n 
A 1 425 SER 425 419 419 SER SER A . n 
A 1 426 PHE 426 420 420 PHE PHE A . n 
A 1 427 PRO 427 421 421 PRO PRO A . n 
A 1 428 GLY 428 422 422 GLY GLY A . n 
A 1 429 ASN 429 423 ?   ?   ?   A . n 
A 1 430 LYS 430 424 ?   ?   ?   A . n 
A 1 431 GLU 431 425 ?   ?   ?   A . n 
A 1 432 HIS 432 426 ?   ?   ?   A . n 
A 1 433 HIS 433 427 ?   ?   ?   A . n 
A 1 434 LYS 434 428 ?   ?   ?   A . n 
A 1 435 ASP 435 429 ?   ?   ?   A . n 
A 1 436 ASN 436 430 ?   ?   ?   A . n 
A 1 437 ASN 437 431 431 ASN ASN A . n 
A 1 438 TYR 438 432 432 TYR TYR A . n 
A 1 439 VAL 439 433 433 VAL VAL A . n 
A 1 440 SER 440 434 434 SER SER A . n 
A 1 441 MET 441 435 435 MET MET A . n 
A 1 442 TRP 442 436 436 TRP TRP A . n 
A 1 443 PHE 443 437 437 PHE PHE A . n 
A 1 444 LEU 444 438 438 LEU LEU A . n 
A 1 445 GLY 445 439 439 GLY GLY A . n 
A 1 446 ILE 446 440 440 ILE ILE A . n 
A 1 447 ILE 447 441 441 ILE ILE A . n 
A 1 448 PHE 448 442 442 PHE PHE A . n 
A 1 449 ARG 449 443 443 ARG ARG A . n 
A 1 450 ARG 450 444 ?   ?   ?   A . n 
A 1 451 VAL 451 445 ?   ?   ?   A . n 
A 1 452 GLU 452 446 ?   ?   ?   A . n 
A 1 453 ASN 453 447 ?   ?   ?   A . n 
A 1 454 ALA 454 448 ?   ?   ?   A . n 
A 1 455 GLU 455 449 ?   ?   ?   A . n 
A 1 456 SER 456 450 ?   ?   ?   A . n 
A 1 457 VAL 457 451 ?   ?   ?   A . n 
A 1 458 ASN 458 452 ?   ?   ?   A . n 
A 1 459 ILE 459 453 ?   ?   ?   A . n 
A 1 460 ASP 460 454 454 ASP ASP A . n 
A 1 461 LEU 461 455 455 LEU LEU A . n 
A 1 462 THR 462 456 456 THR THR A . n 
A 1 463 TYR 463 457 457 TYR TYR A . n 
A 1 464 ASP 464 458 458 ASP ASP A . n 
A 1 465 ILE 465 459 459 ILE ILE A . n 
A 1 466 GLN 466 460 460 GLN GLN A . n 
A 1 467 SER 467 461 461 SER SER A . n 
A 1 468 PHE 468 462 462 PHE PHE A . n 
A 1 469 THR 469 463 463 THR THR A . n 
A 1 470 ASP 470 464 464 ASP ASP A . n 
A 1 471 THR 471 465 465 THR THR A . n 
A 1 472 VAL 472 466 466 VAL VAL A . n 
A 1 473 TYR 473 467 467 TYR TYR A . n 
A 1 474 ARG 474 468 468 ARG ARG A . n 
A 1 475 GLN 475 469 469 GLN GLN A . n 
A 1 476 ALA 476 470 470 ALA ALA A . n 
A 1 477 ASN 477 471 471 ASN ASN A . n 
A 1 478 ASN 478 472 472 ASN ASN A . n 
A 1 479 ILE 479 473 473 ILE ILE A . n 
A 1 480 ASN 480 474 474 ASN ASN A . n 
A 1 481 MET 481 475 475 MET MET A . n 
A 1 482 LEU 482 476 476 LEU LEU A . n 
A 1 483 LYS 483 477 477 LYS LYS A . n 
A 1 484 GLU 484 478 478 GLU GLU A . n 
A 1 485 GLY 485 479 479 GLY GLY A . n 
A 1 486 MET 486 480 480 MET MET A . n 
A 1 487 LYS 487 481 481 LYS LYS A . n 
A 1 488 ILE 488 482 482 ILE ILE A . n 
A 1 489 GLU 489 483 483 GLU GLU A . n 
A 1 490 ALA 490 484 484 ALA ALA A . n 
A 1 491 THR 491 485 485 THR THR A . n 
A 1 492 HIS 492 486 486 HIS HIS A . n 
A 1 493 VAL 493 487 487 VAL VAL A . n 
A 1 494 LYS 494 488 488 LYS LYS A . n 
A 1 495 LYS 495 489 489 LYS LYS A . n 
A 1 496 LYS 496 490 490 LYS LYS A . n 
A 1 497 GLN 497 491 491 GLN GLN A . n 
A 1 498 LEU 498 492 492 LEU LEU A . n 
A 1 499 HIS 499 493 493 HIS HIS A . n 
A 1 500 HIS 500 494 494 HIS HIS A . n 
A 1 501 TYR 501 495 495 TYR TYR A . n 
A 1 502 LEU 502 496 496 LEU LEU A . n 
A 1 503 PRO 503 497 497 PRO PRO A . n 
A 1 504 ALA 504 498 498 ALA ALA A . n 
A 1 505 GLU 505 499 499 GLU GLU A . n 
A 1 506 ILE 506 500 500 ILE ILE A . n 
A 1 507 LEU 507 501 501 LEU LEU A . n 
A 1 508 GLN 508 502 ?   ?   ?   A . n 
A 1 509 LYS 509 503 ?   ?   ?   A . n 
A 1 510 LYS 510 504 ?   ?   ?   A . n 
A 1 511 LYS 511 505 ?   ?   ?   A . n 
A 1 512 LYS 512 506 ?   ?   ?   A . n 
A 1 513 GLN 513 507 ?   ?   ?   A . n 
A 1 514 SER 514 508 ?   ?   ?   A . n 
B 1 1   HIS 1   -5  ?   ?   ?   B . n 
B 1 2   HIS 2   -4  ?   ?   ?   B . n 
B 1 3   HIS 3   -3  ?   ?   ?   B . n 
B 1 4   HIS 4   -2  ?   ?   ?   B . n 
B 1 5   HIS 5   -1  ?   ?   ?   B . n 
B 1 6   HIS 6   0   ?   ?   ?   B . n 
B 1 7   MET 7   1   ?   ?   ?   B . n 
B 1 8   LYS 8   2   ?   ?   ?   B . n 
B 1 9   GLU 9   3   ?   ?   ?   B . n 
B 1 10  MET 10  4   ?   ?   ?   B . n 
B 1 11  SER 11  5   ?   ?   ?   B . n 
B 1 12  ALA 12  6   ?   ?   ?   B . n 
B 1 13  ASN 13  7   ?   ?   ?   B . n 
B 1 14  THR 14  8   ?   ?   ?   B . n 
B 1 15  VAL 15  9   ?   ?   ?   B . n 
B 1 16  LEU 16  10  ?   ?   ?   B . n 
B 1 17  ASP 17  11  ?   ?   ?   B . n 
B 1 18  SER 18  12  ?   ?   ?   B . n 
B 1 19  GLN 19  13  ?   ?   ?   B . n 
B 1 20  ARG 20  14  ?   ?   ?   B . n 
B 1 21  GLN 21  15  ?   ?   ?   B . n 
B 1 22  GLN 22  16  ?   ?   ?   B . n 
B 1 23  LYS 23  17  ?   ?   ?   B . n 
B 1 24  HIS 24  18  18  HIS HIS B . n 
B 1 25  TYR 25  19  19  TYR TYR B . n 
B 1 26  GLY 26  20  20  GLY GLY B . n 
B 1 27  ILE 27  21  21  ILE ILE B . n 
B 1 28  THR 28  22  22  THR THR B . n 
B 1 29  SER 29  23  23  SER SER B . n 
B 1 30  PRO 30  24  24  PRO PRO B . n 
B 1 31  ILE 31  25  25  ILE ILE B . n 
B 1 32  SER 32  26  26  SER SER B . n 
B 1 33  LEU 33  27  27  LEU LEU B . n 
B 1 34  ALA 34  28  28  ALA ALA B . n 
B 1 35  SER 35  29  29  SER SER B . n 
B 1 36  PRO 36  30  30  PRO PRO B . n 
B 1 37  LYS 37  31  31  LYS LYS B . n 
B 1 38  GLU 38  32  32  GLU GLU B . n 
B 1 39  ILE 39  33  33  ILE ILE B . n 
B 1 40  ASP 40  34  34  ASP ASP B . n 
B 1 41  HIS 41  35  35  HIS HIS B . n 
B 1 42  ILE 42  36  36  ILE ILE B . n 
B 1 43  TYR 43  37  37  TYR TYR B . n 
B 1 44  THR 44  38  38  THR THR B . n 
B 1 45  GLN 45  39  39  GLN GLN B . n 
B 1 46  LYS 46  40  40  LYS LYS B . n 
B 1 47  LEU 47  41  41  LEU LEU B . n 
B 1 48  ILE 48  42  42  ILE ILE B . n 
B 1 49  ASP 49  43  43  ASP ASP B . n 
B 1 50  ALA 50  44  44  ALA ALA B . n 
B 1 51  MET 51  45  45  MET MET B . n 
B 1 52  LYS 52  46  46  LYS LYS B . n 
B 1 53  PRO 53  47  47  PRO PRO B . n 
B 1 54  PHE 54  48  48  PHE PHE B . n 
B 1 55  GLY 55  49  49  GLY GLY B . n 
B 1 56  VAL 56  50  50  VAL VAL B . n 
B 1 57  PHE 57  51  51  PHE PHE B . n 
B 1 58  GLU 58  52  52  GLU GLU B . n 
B 1 59  ASP 59  53  53  ASP ASP B . n 
B 1 60  GLU 60  54  54  GLU GLU B . n 
B 1 61  GLU 61  55  55  GLU GLU B . n 
B 1 62  GLU 62  56  56  GLU GLU B . n 
B 1 63  LEU 63  57  57  LEU LEU B . n 
B 1 64  ASN 64  58  58  ASN ASN B . n 
B 1 65  HIS 65  59  59  HIS HIS B . n 
B 1 66  ARG 66  60  60  ARG ARG B . n 
B 1 67  LEU 67  61  61  LEU LEU B . n 
B 1 68  VAL 68  62  62  VAL VAL B . n 
B 1 69  VAL 69  63  63  VAL VAL B . n 
B 1 70  LEU 70  64  64  LEU LEU B . n 
B 1 71  GLY 71  65  65  GLY GLY B . n 
B 1 72  LYS 72  66  66  LYS LYS B . n 
B 1 73  LEU 73  67  67  LEU LEU B . n 
B 1 74  ASN 74  68  68  ASN ASN B . n 
B 1 75  ASN 75  69  69  ASN ASN B . n 
B 1 76  LEU 76  70  70  LEU LEU B . n 
B 1 77  VAL 77  71  71  VAL VAL B . n 
B 1 78  LYS 78  72  72  LYS LYS B . n 
B 1 79  GLU 79  73  73  GLU GLU B . n 
B 1 80  TRP 80  74  74  TRP TRP B . n 
B 1 81  ILE 81  75  75  ILE ILE B . n 
B 1 82  SER 82  76  76  SER SER B . n 
B 1 83  ASP 83  77  77  ASP ASP B . n 
B 1 84  VAL 84  78  78  VAL VAL B . n 
B 1 85  SER 85  79  79  SER SER B . n 
B 1 86  GLU 86  80  80  GLU GLU B . n 
B 1 87  SER 87  81  81  SER SER B . n 
B 1 88  LYS 88  82  82  LYS LYS B . n 
B 1 89  ASN 89  83  83  ASN ASN B . n 
B 1 90  LEU 90  84  84  LEU LEU B . n 
B 1 91  PRO 91  85  85  PRO PRO B . n 
B 1 92  PRO 92  86  86  PRO PRO B . n 
B 1 93  SER 93  87  87  SER SER B . n 
B 1 94  VAL 94  88  88  VAL VAL B . n 
B 1 95  VAL 95  89  89  VAL VAL B . n 
B 1 96  ALA 96  90  90  ALA ALA B . n 
B 1 97  THR 97  91  91  THR THR B . n 
B 1 98  VAL 98  92  92  VAL VAL B . n 
B 1 99  GLY 99  93  93  GLY GLY B . n 
B 1 100 GLY 100 94  94  GLY GLY B . n 
B 1 101 LYS 101 95  95  LYS LYS B . n 
B 1 102 ILE 102 96  96  ILE ILE B . n 
B 1 103 PHE 103 97  97  PHE PHE B . n 
B 1 104 THR 104 98  98  THR THR B . n 
B 1 105 PHE 105 99  99  PHE PHE B . n 
B 1 106 GLY 106 100 100 GLY GLY B . n 
B 1 107 SER 107 101 101 SER SER B . n 
B 1 108 TYR 108 102 102 TYR TYR B . n 
B 1 109 ARG 109 103 103 ARG ARG B . n 
B 1 110 LEU 110 104 104 LEU LEU B . n 
B 1 111 GLY 111 105 105 GLY GLY B . n 
B 1 112 VAL 112 106 106 VAL VAL B . n 
B 1 113 HIS 113 107 107 HIS HIS B . n 
B 1 114 THR 114 108 108 THR THR B . n 
B 1 115 LYS 115 109 109 LYS LYS B . n 
B 1 116 GLY 116 110 110 GLY GLY B . n 
B 1 117 ALA 117 111 111 ALA ALA B . n 
B 1 118 ASP 118 112 112 ASP ASP B . n 
B 1 119 ILE 119 113 113 ILE ILE B . n 
B 1 120 ASP 120 114 114 ASP ASP B . n 
B 1 121 ALA 121 115 115 ALA ALA B . n 
B 1 122 LEU 122 116 116 LEU LEU B . n 
B 1 123 CYS 123 117 117 CYS CYS B . n 
B 1 124 VAL 124 118 118 VAL VAL B . n 
B 1 125 ALA 125 119 119 ALA ALA B . n 
B 1 126 PRO 126 120 120 PRO PRO B . n 
B 1 127 ARG 127 121 121 ARG ARG B . n 
B 1 128 HIS 128 122 122 HIS HIS B . n 
B 1 129 VAL 129 123 123 VAL VAL B . n 
B 1 130 GLU 130 124 124 GLU GLU B . n 
B 1 131 ARG 131 125 125 ARG ARG B . n 
B 1 132 SER 132 126 126 SER SER B . n 
B 1 133 ASP 133 127 127 ASP ASP B . n 
B 1 134 PHE 134 128 128 PHE PHE B . n 
B 1 135 PHE 135 129 129 PHE PHE B . n 
B 1 136 GLN 136 130 130 GLN GLN B . n 
B 1 137 SER 137 131 131 SER SER B . n 
B 1 138 PHE 138 132 132 PHE PHE B . n 
B 1 139 PHE 139 133 133 PHE PHE B . n 
B 1 140 GLU 140 134 134 GLU GLU B . n 
B 1 141 LYS 141 135 135 LYS LYS B . n 
B 1 142 LEU 142 136 136 LEU LEU B . n 
B 1 143 LYS 143 137 137 LYS LYS B . n 
B 1 144 HIS 144 138 138 HIS HIS B . n 
B 1 145 GLN 145 139 139 GLN GLN B . n 
B 1 146 ASP 146 140 140 ASP ASP B . n 
B 1 147 GLY 147 141 141 GLY GLY B . n 
B 1 148 ILE 148 142 142 ILE ILE B . n 
B 1 149 ARG 149 143 143 ARG ARG B . n 
B 1 150 ASN 150 144 144 ASN ASN B . n 
B 1 151 LEU 151 145 145 LEU LEU B . n 
B 1 152 ARG 152 146 146 ARG ARG B . n 
B 1 153 ALA 153 147 147 ALA ALA B . n 
B 1 154 VAL 154 148 148 VAL VAL B . n 
B 1 155 GLU 155 149 149 GLU GLU B . n 
B 1 156 ASP 156 150 150 ASP ASP B . n 
B 1 157 ALA 157 151 151 ALA ALA B . n 
B 1 158 PHE 158 152 152 PHE PHE B . n 
B 1 159 VAL 159 153 153 VAL VAL B . n 
B 1 160 PRO 160 154 154 PRO PRO B . n 
B 1 161 VAL 161 155 155 VAL VAL B . n 
B 1 162 ILE 162 156 156 ILE ILE B . n 
B 1 163 LYS 163 157 157 LYS LYS B . n 
B 1 164 PHE 164 158 158 PHE PHE B . n 
B 1 165 GLU 165 159 159 GLU GLU B . n 
B 1 166 PHE 166 160 160 PHE PHE B . n 
B 1 167 ASP 167 161 161 ASP ASP B . n 
B 1 168 GLY 168 162 162 GLY GLY B . n 
B 1 169 ILE 169 163 163 ILE ILE B . n 
B 1 170 GLU 170 164 164 GLU GLU B . n 
B 1 171 ILE 171 165 165 ILE ILE B . n 
B 1 172 ASP 172 166 166 ASP ASP B . n 
B 1 173 LEU 173 167 167 LEU LEU B . n 
B 1 174 VAL 174 168 168 VAL VAL B . n 
B 1 175 PHE 175 169 169 PHE PHE B . n 
B 1 176 ALA 176 170 170 ALA ALA B . n 
B 1 177 ARG 177 171 171 ARG ARG B . n 
B 1 178 LEU 178 172 172 LEU LEU B . n 
B 1 179 ALA 179 173 173 ALA ALA B . n 
B 1 180 ILE 180 174 174 ILE ILE B . n 
B 1 181 GLN 181 175 175 GLN GLN B . n 
B 1 182 THR 182 176 176 THR THR B . n 
B 1 183 ILE 183 177 177 ILE ILE B . n 
B 1 184 SER 184 178 178 SER SER B . n 
B 1 185 ASP 185 179 179 ASP ASP B . n 
B 1 186 ASN 186 180 180 ASN ASN B . n 
B 1 187 LEU 187 181 181 LEU LEU B . n 
B 1 188 ASP 188 182 182 ASP ASP B . n 
B 1 189 LEU 189 183 183 LEU LEU B . n 
B 1 190 ARG 190 184 184 ARG ARG B . n 
B 1 191 ASP 191 185 185 ASP ASP B . n 
B 1 192 ASP 192 186 186 ASP ASP B . n 
B 1 193 SER 193 187 187 SER SER B . n 
B 1 194 ARG 194 188 188 ARG ARG B . n 
B 1 195 LEU 195 189 189 LEU LEU B . n 
B 1 196 ARG 196 190 190 ARG ARG B . n 
B 1 197 SER 197 191 191 SER SER B . n 
B 1 198 LEU 198 192 192 LEU LEU B . n 
B 1 199 ASP 199 193 193 ASP ASP B . n 
B 1 200 ILE 200 194 194 ILE ILE B . n 
B 1 201 ARG 201 195 195 ARG ARG B . n 
B 1 202 CYS 202 196 196 CYS CYS B . n 
B 1 203 ILE 203 197 197 ILE ILE B . n 
B 1 204 ARG 204 198 198 ARG ARG B . n 
B 1 205 SER 205 199 199 SER SER B . n 
B 1 206 LEU 206 200 200 LEU LEU B . n 
B 1 207 ASN 207 201 201 ASN ASN B . n 
B 1 208 GLY 208 202 202 GLY GLY B . n 
B 1 209 CYS 209 203 203 CYS CYS B . n 
B 1 210 ARG 210 204 204 ARG ARG B . n 
B 1 211 VAL 211 205 205 VAL VAL B . n 
B 1 212 THR 212 206 206 THR THR B . n 
B 1 213 ASP 213 207 207 ASP ASP B . n 
B 1 214 GLU 214 208 208 GLU GLU B . n 
B 1 215 ILE 215 209 209 ILE ILE B . n 
B 1 216 LEU 216 210 210 LEU LEU B . n 
B 1 217 HIS 217 211 211 HIS HIS B . n 
B 1 218 LEU 218 212 212 LEU LEU B . n 
B 1 219 VAL 219 213 213 VAL VAL B . n 
B 1 220 PRO 220 214 214 PRO PRO B . n 
B 1 221 ASN 221 215 215 ASN ASN B . n 
B 1 222 LYS 222 216 216 LYS LYS B . n 
B 1 223 GLU 223 217 217 GLU GLU B . n 
B 1 224 THR 224 218 218 THR THR B . n 
B 1 225 PHE 225 219 219 PHE PHE B . n 
B 1 226 ARG 226 220 220 ARG ARG B . n 
B 1 227 LEU 227 221 221 LEU LEU B . n 
B 1 228 THR 228 222 222 THR THR B . n 
B 1 229 LEU 229 223 223 LEU LEU B . n 
B 1 230 ARG 230 224 224 ARG ARG B . n 
B 1 231 ALA 231 225 225 ALA ALA B . n 
B 1 232 VAL 232 226 226 VAL VAL B . n 
B 1 233 LYS 233 227 227 LYS LYS B . n 
B 1 234 LEU 234 228 228 LEU LEU B . n 
B 1 235 TRP 235 229 229 TRP TRP B . n 
B 1 236 ALA 236 230 230 ALA ALA B . n 
B 1 237 LYS 237 231 231 LYS LYS B . n 
B 1 238 ARG 238 232 232 ARG ARG B . n 
B 1 239 ARG 239 233 233 ARG ARG B . n 
B 1 240 GLY 240 234 234 GLY GLY B . n 
B 1 241 ILE 241 235 235 ILE ILE B . n 
B 1 242 TYR 242 236 236 TYR TYR B . n 
B 1 243 SER 243 237 237 SER SER B . n 
B 1 244 ASN 244 238 238 ASN ASN B . n 
B 1 245 MET 245 239 239 MET MET B . n 
B 1 246 LEU 246 240 240 LEU LEU B . n 
B 1 247 GLY 247 241 241 GLY GLY B . n 
B 1 248 PHE 248 242 242 PHE PHE B . n 
B 1 249 LEU 249 243 243 LEU LEU B . n 
B 1 250 GLY 250 244 244 GLY GLY B . n 
B 1 251 GLY 251 245 245 GLY GLY B . n 
B 1 252 VAL 252 246 246 VAL VAL B . n 
B 1 253 SER 253 247 247 SER SER B . n 
B 1 254 TRP 254 248 248 TRP TRP B . n 
B 1 255 ALA 255 249 249 ALA ALA B . n 
B 1 256 MET 256 250 250 MET MET B . n 
B 1 257 LEU 257 251 251 LEU LEU B . n 
B 1 258 VAL 258 252 252 VAL VAL B . n 
B 1 259 ALA 259 253 253 ALA ALA B . n 
B 1 260 ARG 260 254 254 ARG ARG B . n 
B 1 261 THR 261 255 255 THR THR B . n 
B 1 262 CYS 262 256 256 CYS CYS B . n 
B 1 263 GLN 263 257 257 GLN GLN B . n 
B 1 264 LEU 264 258 258 LEU LEU B . n 
B 1 265 TYR 265 259 259 TYR TYR B . n 
B 1 266 PRO 266 260 260 PRO PRO B . n 
B 1 267 ASN 267 261 261 ASN ASN B . n 
B 1 268 ALA 268 262 262 ALA ALA B . n 
B 1 269 ALA 269 263 263 ALA ALA B . n 
B 1 270 ALA 270 264 264 ALA ALA B . n 
B 1 271 SER 271 265 265 SER SER B . n 
B 1 272 THR 272 266 266 THR THR B . n 
B 1 273 LEU 273 267 267 LEU LEU B . n 
B 1 274 VAL 274 268 268 VAL VAL B . n 
B 1 275 HIS 275 269 269 HIS HIS B . n 
B 1 276 LYS 276 270 270 LYS LYS B . n 
B 1 277 PHE 277 271 271 PHE PHE B . n 
B 1 278 PHE 278 272 272 PHE PHE B . n 
B 1 279 LEU 279 273 273 LEU LEU B . n 
B 1 280 VAL 280 274 274 VAL VAL B . n 
B 1 281 PHE 281 275 275 PHE PHE B . n 
B 1 282 SER 282 276 276 SER SER B . n 
B 1 283 LYS 283 277 277 LYS LYS B . n 
B 1 284 TRP 284 278 278 TRP TRP B . n 
B 1 285 GLU 285 279 279 GLU GLU B . n 
B 1 286 TRP 286 280 280 TRP TRP B . n 
B 1 287 PRO 287 281 281 PRO PRO B . n 
B 1 288 ASN 288 282 282 ASN ASN B . n 
B 1 289 PRO 289 283 283 PRO PRO B . n 
B 1 290 VAL 290 284 284 VAL VAL B . n 
B 1 291 LEU 291 285 285 LEU LEU B . n 
B 1 292 LEU 292 286 286 LEU LEU B . n 
B 1 293 LYS 293 287 287 LYS LYS B . n 
B 1 294 GLN 294 288 288 GLN GLN B . n 
B 1 295 PRO 295 289 289 PRO PRO B . n 
B 1 296 GLU 296 290 290 GLU GLU B . n 
B 1 297 GLU 297 291 291 GLU GLU B . n 
B 1 298 SER 298 292 292 SER SER B . n 
B 1 299 ASN 299 293 293 ASN ASN B . n 
B 1 300 LEU 300 294 294 LEU LEU B . n 
B 1 301 ASN 301 295 295 ASN ASN B . n 
B 1 302 LEU 302 296 296 LEU LEU B . n 
B 1 303 PRO 303 297 297 PRO PRO B . n 
B 1 304 VAL 304 298 298 VAL VAL B . n 
B 1 305 TRP 305 299 299 TRP TRP B . n 
B 1 306 ASP 306 300 300 ASP ASP B . n 
B 1 307 PRO 307 301 301 PRO PRO B . n 
B 1 308 ARG 308 302 302 ARG ARG B . n 
B 1 309 VAL 309 303 303 VAL VAL B . n 
B 1 310 ASN 310 304 304 ASN ASN B . n 
B 1 311 PRO 311 305 305 PRO PRO B . n 
B 1 312 SER 312 306 306 SER SER B . n 
B 1 313 ASP 313 307 307 ASP ASP B . n 
B 1 314 ARG 314 308 308 ARG ARG B . n 
B 1 315 TYR 315 309 309 TYR TYR B . n 
B 1 316 HIS 316 310 310 HIS HIS B . n 
B 1 317 LEU 317 311 311 LEU LEU B . n 
B 1 318 MET 318 312 312 MET MET B . n 
B 1 319 PRO 319 313 313 PRO PRO B . n 
B 1 320 ILE 320 314 314 ILE ILE B . n 
B 1 321 ILE 321 315 315 ILE ILE B . n 
B 1 322 THR 322 316 316 THR THR B . n 
B 1 323 PRO 323 317 317 PRO PRO B . n 
B 1 324 ALA 324 318 318 ALA ALA B . n 
B 1 325 TYR 325 319 319 TYR TYR B . n 
B 1 326 PRO 326 320 320 PRO PRO B . n 
B 1 327 GLN 327 321 321 GLN GLN B . n 
B 1 328 GLN 328 322 322 GLN GLN B . n 
B 1 329 ASN 329 323 323 ASN ASN B . n 
B 1 330 SER 330 324 324 SER SER B . n 
B 1 331 THR 331 325 325 THR THR B . n 
B 1 332 TYR 332 326 326 TYR TYR B . n 
B 1 333 ASN 333 327 327 ASN ASN B . n 
B 1 334 VAL 334 328 328 VAL VAL B . n 
B 1 335 SER 335 329 329 SER SER B . n 
B 1 336 THR 336 330 330 THR THR B . n 
B 1 337 SER 337 331 331 SER SER B . n 
B 1 338 THR 338 332 332 THR THR B . n 
B 1 339 ARG 339 333 333 ARG ARG B . n 
B 1 340 THR 340 334 334 THR THR B . n 
B 1 341 VAL 341 335 335 VAL VAL B . n 
B 1 342 MET 342 336 336 MET MET B . n 
B 1 343 VAL 343 337 337 VAL VAL B . n 
B 1 344 GLU 344 338 338 GLU GLU B . n 
B 1 345 GLU 345 339 339 GLU GLU B . n 
B 1 346 PHE 346 340 340 PHE PHE B . n 
B 1 347 LYS 347 341 341 LYS LYS B . n 
B 1 348 GLN 348 342 342 GLN GLN B . n 
B 1 349 GLY 349 343 343 GLY GLY B . n 
B 1 350 LEU 350 344 344 LEU LEU B . n 
B 1 351 ALA 351 345 345 ALA ALA B . n 
B 1 352 VAL 352 346 346 VAL VAL B . n 
B 1 353 THR 353 347 347 THR THR B . n 
B 1 354 ASP 354 348 348 ASP ASP B . n 
B 1 355 GLU 355 349 349 GLU GLU B . n 
B 1 356 ILE 356 350 350 ILE ILE B . n 
B 1 357 LEU 357 351 351 LEU LEU B . n 
B 1 358 GLN 358 352 352 GLN GLN B . n 
B 1 359 GLY 359 353 353 GLY GLY B . n 
B 1 360 LYS 360 354 354 LYS LYS B . n 
B 1 361 SER 361 355 355 SER SER B . n 
B 1 362 ASP 362 356 356 ASP ASP B . n 
B 1 363 TRP 363 357 357 TRP TRP B . n 
B 1 364 SER 364 358 358 SER SER B . n 
B 1 365 LYS 365 359 359 LYS LYS B . n 
B 1 366 LEU 366 360 360 LEU LEU B . n 
B 1 367 LEU 367 361 361 LEU LEU B . n 
B 1 368 GLU 368 362 362 GLU GLU B . n 
B 1 369 PRO 369 363 363 PRO PRO B . n 
B 1 370 PRO 370 364 364 PRO PRO B . n 
B 1 371 ASN 371 365 365 ASN ASN B . n 
B 1 372 PHE 372 366 366 PHE PHE B . n 
B 1 373 PHE 373 367 367 PHE PHE B . n 
B 1 374 GLN 374 368 368 GLN GLN B . n 
B 1 375 LYS 375 369 369 LYS LYS B . n 
B 1 376 TYR 376 370 370 TYR TYR B . n 
B 1 377 ARG 377 371 371 ARG ARG B . n 
B 1 378 HIS 378 372 372 HIS HIS B . n 
B 1 379 TYR 379 373 373 TYR TYR B . n 
B 1 380 ILE 380 374 374 ILE ILE B . n 
B 1 381 VAL 381 375 375 VAL VAL B . n 
B 1 382 LEU 382 376 376 LEU LEU B . n 
B 1 383 THR 383 377 377 THR THR B . n 
B 1 384 ALA 384 378 378 ALA ALA B . n 
B 1 385 SER 385 379 379 SER SER B . n 
B 1 386 ALA 386 380 380 ALA ALA B . n 
B 1 387 SER 387 381 381 SER SER B . n 
B 1 388 THR 388 382 382 THR THR B . n 
B 1 389 GLU 389 383 383 GLU GLU B . n 
B 1 390 GLU 390 384 384 GLU GLU B . n 
B 1 391 ASN 391 385 385 ASN ASN B . n 
B 1 392 HIS 392 386 386 HIS HIS B . n 
B 1 393 LEU 393 387 387 LEU LEU B . n 
B 1 394 GLU 394 388 388 GLU GLU B . n 
B 1 395 TRP 395 389 389 TRP TRP B . n 
B 1 396 VAL 396 390 390 VAL VAL B . n 
B 1 397 GLY 397 391 391 GLY GLY B . n 
B 1 398 LEU 398 392 392 LEU LEU B . n 
B 1 399 VAL 399 393 393 VAL VAL B . n 
B 1 400 GLU 400 394 394 GLU GLU B . n 
B 1 401 SER 401 395 395 SER SER B . n 
B 1 402 LYS 402 396 396 LYS LYS B . n 
B 1 403 ILE 403 397 397 ILE ILE B . n 
B 1 404 ARG 404 398 398 ARG ARG B . n 
B 1 405 VAL 405 399 399 VAL VAL B . n 
B 1 406 LEU 406 400 400 LEU LEU B . n 
B 1 407 VAL 407 401 401 VAL VAL B . n 
B 1 408 GLY 408 402 402 GLY GLY B . n 
B 1 409 ASN 409 403 403 ASN ASN B . n 
B 1 410 LEU 410 404 404 LEU LEU B . n 
B 1 411 GLU 411 405 405 GLU GLU B . n 
B 1 412 ARG 412 406 406 ARG ARG B . n 
B 1 413 ASN 413 407 407 ASN ASN B . n 
B 1 414 GLU 414 408 408 GLU GLU B . n 
B 1 415 PHE 415 409 409 PHE PHE B . n 
B 1 416 ILE 416 410 410 ILE ILE B . n 
B 1 417 THR 417 411 411 THR THR B . n 
B 1 418 LEU 418 412 412 LEU LEU B . n 
B 1 419 ALA 419 413 413 ALA ALA B . n 
B 1 420 HIS 420 414 414 HIS HIS B . n 
B 1 421 VAL 421 415 415 VAL VAL B . n 
B 1 422 ASN 422 416 416 ASN ASN B . n 
B 1 423 PRO 423 417 417 PRO PRO B . n 
B 1 424 GLN 424 418 418 GLN GLN B . n 
B 1 425 SER 425 419 419 SER SER B . n 
B 1 426 PHE 426 420 420 PHE PHE B . n 
B 1 427 PRO 427 421 421 PRO PRO B . n 
B 1 428 GLY 428 422 422 GLY GLY B . n 
B 1 429 ASN 429 423 ?   ?   ?   B . n 
B 1 430 LYS 430 424 ?   ?   ?   B . n 
B 1 431 GLU 431 425 ?   ?   ?   B . n 
B 1 432 HIS 432 426 ?   ?   ?   B . n 
B 1 433 HIS 433 427 ?   ?   ?   B . n 
B 1 434 LYS 434 428 ?   ?   ?   B . n 
B 1 435 ASP 435 429 ?   ?   ?   B . n 
B 1 436 ASN 436 430 ?   ?   ?   B . n 
B 1 437 ASN 437 431 431 ASN ASN B . n 
B 1 438 TYR 438 432 432 TYR TYR B . n 
B 1 439 VAL 439 433 433 VAL VAL B . n 
B 1 440 SER 440 434 434 SER SER B . n 
B 1 441 MET 441 435 435 MET MET B . n 
B 1 442 TRP 442 436 436 TRP TRP B . n 
B 1 443 PHE 443 437 437 PHE PHE B . n 
B 1 444 LEU 444 438 438 LEU LEU B . n 
B 1 445 GLY 445 439 439 GLY GLY B . n 
B 1 446 ILE 446 440 440 ILE ILE B . n 
B 1 447 ILE 447 441 441 ILE ILE B . n 
B 1 448 PHE 448 442 442 PHE PHE B . n 
B 1 449 ARG 449 443 443 ARG ARG B . n 
B 1 450 ARG 450 444 ?   ?   ?   B . n 
B 1 451 VAL 451 445 ?   ?   ?   B . n 
B 1 452 GLU 452 446 ?   ?   ?   B . n 
B 1 453 ASN 453 447 ?   ?   ?   B . n 
B 1 454 ALA 454 448 ?   ?   ?   B . n 
B 1 455 GLU 455 449 ?   ?   ?   B . n 
B 1 456 SER 456 450 ?   ?   ?   B . n 
B 1 457 VAL 457 451 ?   ?   ?   B . n 
B 1 458 ASN 458 452 ?   ?   ?   B . n 
B 1 459 ILE 459 453 ?   ?   ?   B . n 
B 1 460 ASP 460 454 454 ASP ASP B . n 
B 1 461 LEU 461 455 455 LEU LEU B . n 
B 1 462 THR 462 456 456 THR THR B . n 
B 1 463 TYR 463 457 457 TYR TYR B . n 
B 1 464 ASP 464 458 458 ASP ASP B . n 
B 1 465 ILE 465 459 459 ILE ILE B . n 
B 1 466 GLN 466 460 460 GLN GLN B . n 
B 1 467 SER 467 461 461 SER SER B . n 
B 1 468 PHE 468 462 462 PHE PHE B . n 
B 1 469 THR 469 463 463 THR THR B . n 
B 1 470 ASP 470 464 464 ASP ASP B . n 
B 1 471 THR 471 465 465 THR THR B . n 
B 1 472 VAL 472 466 466 VAL VAL B . n 
B 1 473 TYR 473 467 467 TYR TYR B . n 
B 1 474 ARG 474 468 468 ARG ARG B . n 
B 1 475 GLN 475 469 469 GLN GLN B . n 
B 1 476 ALA 476 470 470 ALA ALA B . n 
B 1 477 ASN 477 471 471 ASN ASN B . n 
B 1 478 ASN 478 472 472 ASN ASN B . n 
B 1 479 ILE 479 473 473 ILE ILE B . n 
B 1 480 ASN 480 474 474 ASN ASN B . n 
B 1 481 MET 481 475 475 MET MET B . n 
B 1 482 LEU 482 476 476 LEU LEU B . n 
B 1 483 LYS 483 477 477 LYS LYS B . n 
B 1 484 GLU 484 478 478 GLU GLU B . n 
B 1 485 GLY 485 479 479 GLY GLY B . n 
B 1 486 MET 486 480 480 MET MET B . n 
B 1 487 LYS 487 481 481 LYS LYS B . n 
B 1 488 ILE 488 482 482 ILE ILE B . n 
B 1 489 GLU 489 483 483 GLU GLU B . n 
B 1 490 ALA 490 484 484 ALA ALA B . n 
B 1 491 THR 491 485 485 THR THR B . n 
B 1 492 HIS 492 486 486 HIS HIS B . n 
B 1 493 VAL 493 487 487 VAL VAL B . n 
B 1 494 LYS 494 488 488 LYS LYS B . n 
B 1 495 LYS 495 489 489 LYS LYS B . n 
B 1 496 LYS 496 490 490 LYS LYS B . n 
B 1 497 GLN 497 491 491 GLN GLN B . n 
B 1 498 LEU 498 492 492 LEU LEU B . n 
B 1 499 HIS 499 493 493 HIS HIS B . n 
B 1 500 HIS 500 494 494 HIS HIS B . n 
B 1 501 TYR 501 495 495 TYR TYR B . n 
B 1 502 LEU 502 496 496 LEU LEU B . n 
B 1 503 PRO 503 497 497 PRO PRO B . n 
B 1 504 ALA 504 498 ?   ?   ?   B . n 
B 1 505 GLU 505 499 ?   ?   ?   B . n 
B 1 506 ILE 506 500 ?   ?   ?   B . n 
B 1 507 LEU 507 501 ?   ?   ?   B . n 
B 1 508 GLN 508 502 ?   ?   ?   B . n 
B 1 509 LYS 509 503 ?   ?   ?   B . n 
B 1 510 LYS 510 504 ?   ?   ?   B . n 
B 1 511 LYS 511 505 ?   ?   ?   B . n 
B 1 512 LYS 512 506 ?   ?   ?   B . n 
B 1 513 GLN 513 507 ?   ?   ?   B . n 
B 1 514 SER 514 508 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1G ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 O1B ? E 3AT .   ? B 3AT 601 ? 1_555 72.8  ? 
2  O1G ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 OD2 ? B ASP 120 ? B ASP 114 ? 1_555 148.2 ? 
3  O1B ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 OD2 ? B ASP 120 ? B ASP 114 ? 1_555 77.8  ? 
4  O1G ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 OD1 ? B ASP 118 ? B ASP 112 ? 1_555 107.6 ? 
5  O1B ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 OD1 ? B ASP 118 ? B ASP 112 ? 1_555 153.2 ? 
6  OD2 ? B ASP 120 ? B ASP 114 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 OD1 ? B ASP 118 ? B ASP 112 ? 1_555 104.1 ? 
7  O1G ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 O1A ? E 3AT .   ? B 3AT 601 ? 1_555 62.7  ? 
8  O1B ? E 3AT .   ? B 3AT 601 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 O1A ? E 3AT .   ? B 3AT 601 ? 1_555 74.6  ? 
9  OD2 ? B ASP 120 ? B ASP 114 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 O1A ? E 3AT .   ? B 3AT 601 ? 1_555 98.1  ? 
10 OD1 ? B ASP 118 ? B ASP 112 ? 1_555 CA ? F CA . ? B CA 602 ? 1_555 O1A ? E 3AT .   ? B 3AT 601 ? 1_555 130.3 ? 
11 O2G ? C 3AT .   ? A 3AT 601 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 OD2 ? A ASP 120 ? A ASP 114 ? 1_555 153.4 ? 
12 O2G ? C 3AT .   ? A 3AT 601 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 OD1 ? A ASP 118 ? A ASP 112 ? 1_555 95.0  ? 
13 OD2 ? A ASP 120 ? A ASP 114 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 OD1 ? A ASP 118 ? A ASP 112 ? 1_555 108.5 ? 
14 O2G ? C 3AT .   ? A 3AT 601 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1B ? C 3AT .   ? A 3AT 601 ? 1_555 73.5  ? 
15 OD2 ? A ASP 120 ? A ASP 114 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1B ? C 3AT .   ? A 3AT 601 ? 1_555 80.2  ? 
16 OD1 ? A ASP 118 ? A ASP 112 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1B ? C 3AT .   ? A 3AT 601 ? 1_555 157.5 ? 
17 O2G ? C 3AT .   ? A 3AT 601 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1A ? C 3AT .   ? A 3AT 601 ? 1_555 73.8  ? 
18 OD2 ? A ASP 120 ? A ASP 114 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1A ? C 3AT .   ? A 3AT 601 ? 1_555 101.1 ? 
19 OD1 ? A ASP 118 ? A ASP 112 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1A ? C 3AT .   ? A 3AT 601 ? 1_555 125.4 ? 
20 O1B ? C 3AT .   ? A 3AT 601 ? 1_555 CA ? D CA . ? A CA 602 ? 1_555 O1A ? C 3AT .   ? A 3AT 601 ? 1_555 70.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-10-09 
2 'Structure model' 1 1 2013-10-16 
3 'Structure model' 1 2 2014-01-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .                          ? 1 
MOLREP    phasing           .                          ? 2 
PHENIX    refinement        '(phenix.refine: 1.6_289)' ? 3 
DENZO     'data reduction'  .                          ? 4 
SCALEPACK 'data scaling'    .                          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O     A SER 461 ? ? OG1 A THR 465 ? ? 2.07 
2 1 OG    B SER 101 ? ? O3G B 3AT 601 ? ? 2.10 
3 1 "O2'" B 3AT 601 ? ? O   B HOH 724 ? ? 2.15 
4 1 ND2   B ASN 180 ? ? O   B HOH 713 ? ? 2.17 
5 1 NZ    B LYS 227 ? ? O   B HOH 723 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 18  ? ? -88.32  -159.92 
2  1 TYR A 19  ? ? -102.20 -66.03  
3  1 SER A 101 ? ? -29.78  -61.33  
4  1 ARG A 121 ? ? -27.47  -53.69  
5  1 ARG A 146 ? ? -170.49 135.47  
6  1 ASN A 180 ? ? -109.45 60.08   
7  1 SER A 237 ? ? 176.29  107.42  
8  1 PHE A 242 ? ? -95.44  -147.97 
9  1 PRO A 281 ? ? -98.65  44.22   
10 1 ASP A 300 ? ? -170.26 102.54  
11 1 VAL A 303 ? ? -149.06 -3.76   
12 1 MET A 312 ? ? -149.45 55.09   
13 1 ALA A 498 ? ? 54.46   -31.85  
14 1 ILE A 500 ? ? -55.45  69.78   
15 1 PRO B 47  ? ? -67.23  3.30    
16 1 TRP B 74  ? ? -66.52  -70.07  
17 1 ILE B 75  ? ? -35.08  -29.80  
18 1 ASN B 83  ? ? 74.75   89.09   
19 1 PRO B 86  ? ? -69.62  39.14   
20 1 HIS B 122 ? ? -105.87 40.79   
21 1 GLN B 130 ? ? -108.53 -80.43  
22 1 ASP B 150 ? ? -84.10  49.96   
23 1 ALA B 173 ? ? -69.11  69.76   
24 1 SER B 178 ? ? -62.92  -175.09 
25 1 ASN B 180 ? ? -112.59 62.54   
26 1 SER B 237 ? ? 170.25  106.61  
27 1 PHE B 242 ? ? -107.65 -140.61 
28 1 PRO B 281 ? ? -96.46  47.01   
29 1 ASP B 300 ? ? -169.50 100.30  
30 1 SER B 381 ? ? -124.25 -58.75  
31 1 THR B 382 ? ? -75.30  -168.47 
32 1 PRO B 421 ? ? -103.66 -159.12 
33 1 LYS B 490 ? ? -62.23  18.93   
34 1 LEU B 496 ? ? -112.91 -94.51  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A MET 1   ? A MET 7   
8  1 Y 1 A LYS 2   ? A LYS 8   
9  1 Y 1 A GLU 3   ? A GLU 9   
10 1 Y 1 A MET 4   ? A MET 10  
11 1 Y 1 A SER 5   ? A SER 11  
12 1 Y 1 A ALA 6   ? A ALA 12  
13 1 Y 1 A ASN 7   ? A ASN 13  
14 1 Y 1 A THR 8   ? A THR 14  
15 1 Y 1 A VAL 9   ? A VAL 15  
16 1 Y 1 A LEU 10  ? A LEU 16  
17 1 Y 1 A ASP 11  ? A ASP 17  
18 1 Y 1 A SER 12  ? A SER 18  
19 1 Y 1 A GLN 13  ? A GLN 19  
20 1 Y 1 A ARG 14  ? A ARG 20  
21 1 Y 1 A GLN 15  ? A GLN 21  
22 1 Y 1 A GLN 16  ? A GLN 22  
23 1 Y 1 A ASN 423 ? A ASN 429 
24 1 Y 1 A LYS 424 ? A LYS 430 
25 1 Y 1 A GLU 425 ? A GLU 431 
26 1 Y 1 A HIS 426 ? A HIS 432 
27 1 Y 1 A HIS 427 ? A HIS 433 
28 1 Y 1 A LYS 428 ? A LYS 434 
29 1 Y 1 A ASP 429 ? A ASP 435 
30 1 Y 1 A ASN 430 ? A ASN 436 
31 1 Y 1 A ARG 444 ? A ARG 450 
32 1 Y 1 A VAL 445 ? A VAL 451 
33 1 Y 1 A GLU 446 ? A GLU 452 
34 1 Y 1 A ASN 447 ? A ASN 453 
35 1 Y 1 A ALA 448 ? A ALA 454 
36 1 Y 1 A GLU 449 ? A GLU 455 
37 1 Y 1 A SER 450 ? A SER 456 
38 1 Y 1 A VAL 451 ? A VAL 457 
39 1 Y 1 A ASN 452 ? A ASN 458 
40 1 Y 1 A ILE 453 ? A ILE 459 
41 1 Y 1 A GLN 502 ? A GLN 508 
42 1 Y 1 A LYS 503 ? A LYS 509 
43 1 Y 1 A LYS 504 ? A LYS 510 
44 1 Y 1 A LYS 505 ? A LYS 511 
45 1 Y 1 A LYS 506 ? A LYS 512 
46 1 Y 1 A GLN 507 ? A GLN 513 
47 1 Y 1 A SER 508 ? A SER 514 
48 1 Y 1 B HIS -5  ? B HIS 1   
49 1 Y 1 B HIS -4  ? B HIS 2   
50 1 Y 1 B HIS -3  ? B HIS 3   
51 1 Y 1 B HIS -2  ? B HIS 4   
52 1 Y 1 B HIS -1  ? B HIS 5   
53 1 Y 1 B HIS 0   ? B HIS 6   
54 1 Y 1 B MET 1   ? B MET 7   
55 1 Y 1 B LYS 2   ? B LYS 8   
56 1 Y 1 B GLU 3   ? B GLU 9   
57 1 Y 1 B MET 4   ? B MET 10  
58 1 Y 1 B SER 5   ? B SER 11  
59 1 Y 1 B ALA 6   ? B ALA 12  
60 1 Y 1 B ASN 7   ? B ASN 13  
61 1 Y 1 B THR 8   ? B THR 14  
62 1 Y 1 B VAL 9   ? B VAL 15  
63 1 Y 1 B LEU 10  ? B LEU 16  
64 1 Y 1 B ASP 11  ? B ASP 17  
65 1 Y 1 B SER 12  ? B SER 18  
66 1 Y 1 B GLN 13  ? B GLN 19  
67 1 Y 1 B ARG 14  ? B ARG 20  
68 1 Y 1 B GLN 15  ? B GLN 21  
69 1 Y 1 B GLN 16  ? B GLN 22  
70 1 Y 1 B LYS 17  ? B LYS 23  
71 1 Y 1 B ASN 423 ? B ASN 429 
72 1 Y 1 B LYS 424 ? B LYS 430 
73 1 Y 1 B GLU 425 ? B GLU 431 
74 1 Y 1 B HIS 426 ? B HIS 432 
75 1 Y 1 B HIS 427 ? B HIS 433 
76 1 Y 1 B LYS 428 ? B LYS 434 
77 1 Y 1 B ASP 429 ? B ASP 435 
78 1 Y 1 B ASN 430 ? B ASN 436 
79 1 Y 1 B ARG 444 ? B ARG 450 
80 1 Y 1 B VAL 445 ? B VAL 451 
81 1 Y 1 B GLU 446 ? B GLU 452 
82 1 Y 1 B ASN 447 ? B ASN 453 
83 1 Y 1 B ALA 448 ? B ALA 454 
84 1 Y 1 B GLU 449 ? B GLU 455 
85 1 Y 1 B SER 450 ? B SER 456 
86 1 Y 1 B VAL 451 ? B VAL 457 
87 1 Y 1 B ASN 452 ? B ASN 458 
88 1 Y 1 B ILE 453 ? B ILE 459 
89 1 Y 1 B ALA 498 ? B ALA 504 
90 1 Y 1 B GLU 499 ? B GLU 505 
91 1 Y 1 B ILE 500 ? B ILE 506 
92 1 Y 1 B LEU 501 ? B LEU 507 
93 1 Y 1 B GLN 502 ? B GLN 508 
94 1 Y 1 B LYS 503 ? B LYS 509 
95 1 Y 1 B LYS 504 ? B LYS 510 
96 1 Y 1 B LYS 505 ? B LYS 511 
97 1 Y 1 B LYS 506 ? B LYS 512 
98 1 Y 1 B GLN 507 ? B GLN 513 
99 1 Y 1 B SER 508 ? B SER 514 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "3'-DEOXYADENOSINE-5'-TRIPHOSPHATE" 3AT 
3 'CALCIUM ION'                       CA  
4 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 3AT 1  601 1  3AT 3AT A . 
D 3 CA  1  602 1  CA  CA  A . 
E 2 3AT 1  601 2  3AT 3AT B . 
F 3 CA  1  602 1  CA  CA  B . 
G 4 HOH 1  701 4  HOH HOH A . 
G 4 HOH 2  702 5  HOH HOH A . 
G 4 HOH 3  703 6  HOH HOH A . 
G 4 HOH 4  704 7  HOH HOH A . 
G 4 HOH 5  705 8  HOH HOH A . 
G 4 HOH 6  706 9  HOH HOH A . 
G 4 HOH 7  707 10 HOH HOH A . 
G 4 HOH 8  708 11 HOH HOH A . 
G 4 HOH 9  709 12 HOH HOH A . 
G 4 HOH 10 710 20 HOH HOH A . 
G 4 HOH 11 711 21 HOH HOH A . 
G 4 HOH 12 712 22 HOH HOH A . 
G 4 HOH 13 713 23 HOH HOH A . 
G 4 HOH 14 714 30 HOH HOH A . 
G 4 HOH 15 715 31 HOH HOH A . 
G 4 HOH 16 716 32 HOH HOH A . 
G 4 HOH 17 717 33 HOH HOH A . 
G 4 HOH 18 718 34 HOH HOH A . 
G 4 HOH 19 719 35 HOH HOH A . 
G 4 HOH 20 720 37 HOH HOH A . 
G 4 HOH 21 721 38 HOH HOH A . 
G 4 HOH 22 722 49 HOH HOH A . 
G 4 HOH 23 723 54 HOH HOH A . 
G 4 HOH 24 724 55 HOH HOH A . 
G 4 HOH 25 725 56 HOH HOH A . 
G 4 HOH 26 726 58 HOH HOH A . 
G 4 HOH 27 727 59 HOH HOH A . 
H 4 HOH 1  701 1  HOH HOH B . 
H 4 HOH 2  702 2  HOH HOH B . 
H 4 HOH 3  703 3  HOH HOH B . 
H 4 HOH 4  704 13 HOH HOH B . 
H 4 HOH 5  705 14 HOH HOH B . 
H 4 HOH 6  706 15 HOH HOH B . 
H 4 HOH 7  707 16 HOH HOH B . 
H 4 HOH 8  708 17 HOH HOH B . 
H 4 HOH 9  709 18 HOH HOH B . 
H 4 HOH 10 710 24 HOH HOH B . 
H 4 HOH 11 711 25 HOH HOH B . 
H 4 HOH 12 712 26 HOH HOH B . 
H 4 HOH 13 713 27 HOH HOH B . 
H 4 HOH 14 714 28 HOH HOH B . 
H 4 HOH 15 715 29 HOH HOH B . 
H 4 HOH 16 716 36 HOH HOH B . 
H 4 HOH 17 717 39 HOH HOH B . 
H 4 HOH 18 718 40 HOH HOH B . 
H 4 HOH 19 719 41 HOH HOH B . 
H 4 HOH 20 720 42 HOH HOH B . 
H 4 HOH 21 721 43 HOH HOH B . 
H 4 HOH 22 722 45 HOH HOH B . 
H 4 HOH 23 723 46 HOH HOH B . 
H 4 HOH 24 724 47 HOH HOH B . 
H 4 HOH 25 725 53 HOH HOH B . 
H 4 HOH 26 726 57 HOH HOH B . 
#