data_4ORA
# 
_entry.id   4ORA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ORA         
RCSB  RCSB084851   
WWPDB D_1000084851 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OR9 . unspecified 
PDB 4ORB . unspecified 
PDB 4ORC . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ORA 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, S.J.'   1 
'Wang, J.'   2 
'Wu, J.W.'   3 
'Wang, Z.X.' 4 
# 
_citation.id                        primary 
_citation.title                     'Cooperative autoinhibition and multi-level activation mechanisms of calcineurin' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, S.J.'   1 
primary 'Ma, L.'     2 
primary 'Wang, J.'   3 
primary 'Lu, C.'     4 
primary 'Wang, J.'   5 
primary 'Wu, J.W.'   6 
primary 'Wang, Z.X.' 7 
# 
_cell.entry_id           4ORA 
_cell.length_a           108.203 
_cell.length_b           108.203 
_cell.length_c           284.534 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ORA 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform' 61294.504 1  3.1.3.16 'V418Y, F419L' ? 
? 
2 polymer     man 'Calcineurin subunit B type 1'                                           19322.904 1  ?        ?              ? 
? 
3 non-polymer syn 'ZINC ION'                                                               65.409    1  ?        ?              ? 
? 
4 non-polymer syn 'FE (III) ION'                                                           55.845    1  ?        ?              ? 
? 
5 non-polymer syn 'CALCIUM ION'                                                            40.078    4  ?        ?              ? 
? 
6 water       nat water                                                                    18.015    45 ?        ?              ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAM-PRP catalytic subunit, Calmodulin-dependent calcineurin A subunit beta isoform'                      
2 'Protein phosphatase 2B regulatory subunit 1, Protein phosphatase 3 regulatory subunit B alpha isoform 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSSHHHHHHSSGLVPRGSHMAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDD
IRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSI
CSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARYLSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEA
IEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
;
;MGSSHHHHHHSSGLVPRGSHMAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDD
IRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSI
CSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARYLSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEA
IEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
;
A ? 
2 'polypeptide(L)' no no 
;MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS
QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGL
DIHKKMVVDV
;
;MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS
QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGL
DIHKKMVVDV
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  ALA n 
1 24  PRO n 
1 25  GLU n 
1 26  PRO n 
1 27  ALA n 
1 28  ARG n 
1 29  ALA n 
1 30  ALA n 
1 31  PRO n 
1 32  PRO n 
1 33  PRO n 
1 34  PRO n 
1 35  PRO n 
1 36  PRO n 
1 37  PRO n 
1 38  PRO n 
1 39  PRO n 
1 40  PRO n 
1 41  PRO n 
1 42  GLY n 
1 43  ALA n 
1 44  ASP n 
1 45  ARG n 
1 46  VAL n 
1 47  VAL n 
1 48  LYS n 
1 49  ALA n 
1 50  VAL n 
1 51  PRO n 
1 52  PHE n 
1 53  PRO n 
1 54  PRO n 
1 55  THR n 
1 56  HIS n 
1 57  ARG n 
1 58  LEU n 
1 59  THR n 
1 60  SER n 
1 61  GLU n 
1 62  GLU n 
1 63  VAL n 
1 64  PHE n 
1 65  ASP n 
1 66  LEU n 
1 67  ASP n 
1 68  GLY n 
1 69  ILE n 
1 70  PRO n 
1 71  ARG n 
1 72  VAL n 
1 73  ASP n 
1 74  VAL n 
1 75  LEU n 
1 76  LYS n 
1 77  ASN n 
1 78  HIS n 
1 79  LEU n 
1 80  VAL n 
1 81  LYS n 
1 82  GLU n 
1 83  GLY n 
1 84  ARG n 
1 85  VAL n 
1 86  ASP n 
1 87  GLU n 
1 88  GLU n 
1 89  ILE n 
1 90  ALA n 
1 91  LEU n 
1 92  ARG n 
1 93  ILE n 
1 94  ILE n 
1 95  ASN n 
1 96  GLU n 
1 97  GLY n 
1 98  ALA n 
1 99  ALA n 
1 100 ILE n 
1 101 LEU n 
1 102 ARG n 
1 103 ARG n 
1 104 GLU n 
1 105 LYS n 
1 106 THR n 
1 107 MET n 
1 108 ILE n 
1 109 GLU n 
1 110 VAL n 
1 111 GLU n 
1 112 ALA n 
1 113 PRO n 
1 114 ILE n 
1 115 THR n 
1 116 VAL n 
1 117 CYS n 
1 118 GLY n 
1 119 ASP n 
1 120 ILE n 
1 121 HIS n 
1 122 GLY n 
1 123 GLN n 
1 124 PHE n 
1 125 PHE n 
1 126 ASP n 
1 127 LEU n 
1 128 MET n 
1 129 LYS n 
1 130 LEU n 
1 131 PHE n 
1 132 GLU n 
1 133 VAL n 
1 134 GLY n 
1 135 GLY n 
1 136 SER n 
1 137 PRO n 
1 138 ALA n 
1 139 ASN n 
1 140 THR n 
1 141 ARG n 
1 142 TYR n 
1 143 LEU n 
1 144 PHE n 
1 145 LEU n 
1 146 GLY n 
1 147 ASP n 
1 148 TYR n 
1 149 VAL n 
1 150 ASP n 
1 151 ARG n 
1 152 GLY n 
1 153 TYR n 
1 154 PHE n 
1 155 SER n 
1 156 ILE n 
1 157 GLU n 
1 158 CYS n 
1 159 VAL n 
1 160 LEU n 
1 161 TYR n 
1 162 LEU n 
1 163 TRP n 
1 164 VAL n 
1 165 LEU n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 TYR n 
1 170 PRO n 
1 171 SER n 
1 172 THR n 
1 173 LEU n 
1 174 PHE n 
1 175 LEU n 
1 176 LEU n 
1 177 ARG n 
1 178 GLY n 
1 179 ASN n 
1 180 HIS n 
1 181 GLU n 
1 182 CYS n 
1 183 ARG n 
1 184 HIS n 
1 185 LEU n 
1 186 THR n 
1 187 GLU n 
1 188 TYR n 
1 189 PHE n 
1 190 THR n 
1 191 PHE n 
1 192 LYS n 
1 193 GLN n 
1 194 GLU n 
1 195 CYS n 
1 196 LYS n 
1 197 ILE n 
1 198 LYS n 
1 199 TYR n 
1 200 SER n 
1 201 GLU n 
1 202 ARG n 
1 203 VAL n 
1 204 TYR n 
1 205 GLU n 
1 206 ALA n 
1 207 CYS n 
1 208 MET n 
1 209 GLU n 
1 210 ALA n 
1 211 PHE n 
1 212 ASP n 
1 213 SER n 
1 214 LEU n 
1 215 PRO n 
1 216 LEU n 
1 217 ALA n 
1 218 ALA n 
1 219 LEU n 
1 220 LEU n 
1 221 ASN n 
1 222 GLN n 
1 223 GLN n 
1 224 PHE n 
1 225 LEU n 
1 226 CYS n 
1 227 VAL n 
1 228 HIS n 
1 229 GLY n 
1 230 GLY n 
1 231 LEU n 
1 232 SER n 
1 233 PRO n 
1 234 GLU n 
1 235 ILE n 
1 236 HIS n 
1 237 THR n 
1 238 LEU n 
1 239 ASP n 
1 240 ASP n 
1 241 ILE n 
1 242 ARG n 
1 243 ARG n 
1 244 LEU n 
1 245 ASP n 
1 246 ARG n 
1 247 PHE n 
1 248 LYS n 
1 249 GLU n 
1 250 PRO n 
1 251 PRO n 
1 252 ALA n 
1 253 PHE n 
1 254 GLY n 
1 255 PRO n 
1 256 MET n 
1 257 CYS n 
1 258 ASP n 
1 259 LEU n 
1 260 LEU n 
1 261 TRP n 
1 262 SER n 
1 263 ASP n 
1 264 PRO n 
1 265 SER n 
1 266 GLU n 
1 267 ASP n 
1 268 PHE n 
1 269 GLY n 
1 270 ASN n 
1 271 GLU n 
1 272 LYS n 
1 273 SER n 
1 274 GLN n 
1 275 GLU n 
1 276 HIS n 
1 277 PHE n 
1 278 SER n 
1 279 HIS n 
1 280 ASN n 
1 281 THR n 
1 282 VAL n 
1 283 ARG n 
1 284 GLY n 
1 285 CYS n 
1 286 SER n 
1 287 TYR n 
1 288 PHE n 
1 289 TYR n 
1 290 ASN n 
1 291 TYR n 
1 292 PRO n 
1 293 ALA n 
1 294 VAL n 
1 295 CYS n 
1 296 GLU n 
1 297 PHE n 
1 298 LEU n 
1 299 GLN n 
1 300 ASN n 
1 301 ASN n 
1 302 ASN n 
1 303 LEU n 
1 304 LEU n 
1 305 SER n 
1 306 ILE n 
1 307 ILE n 
1 308 ARG n 
1 309 ALA n 
1 310 HIS n 
1 311 GLU n 
1 312 ALA n 
1 313 GLN n 
1 314 ASP n 
1 315 ALA n 
1 316 GLY n 
1 317 TYR n 
1 318 ARG n 
1 319 MET n 
1 320 TYR n 
1 321 ARG n 
1 322 LYS n 
1 323 SER n 
1 324 GLN n 
1 325 THR n 
1 326 THR n 
1 327 GLY n 
1 328 PHE n 
1 329 PRO n 
1 330 SER n 
1 331 LEU n 
1 332 ILE n 
1 333 THR n 
1 334 ILE n 
1 335 PHE n 
1 336 SER n 
1 337 ALA n 
1 338 PRO n 
1 339 ASN n 
1 340 TYR n 
1 341 LEU n 
1 342 ASP n 
1 343 VAL n 
1 344 TYR n 
1 345 ASN n 
1 346 ASN n 
1 347 LYS n 
1 348 ALA n 
1 349 ALA n 
1 350 VAL n 
1 351 LEU n 
1 352 LYS n 
1 353 TYR n 
1 354 GLU n 
1 355 ASN n 
1 356 ASN n 
1 357 VAL n 
1 358 MET n 
1 359 ASN n 
1 360 ILE n 
1 361 ARG n 
1 362 GLN n 
1 363 PHE n 
1 364 ASN n 
1 365 CYS n 
1 366 SER n 
1 367 PRO n 
1 368 HIS n 
1 369 PRO n 
1 370 TYR n 
1 371 TRP n 
1 372 LEU n 
1 373 PRO n 
1 374 ASN n 
1 375 PHE n 
1 376 MET n 
1 377 ASP n 
1 378 VAL n 
1 379 PHE n 
1 380 THR n 
1 381 TRP n 
1 382 SER n 
1 383 LEU n 
1 384 PRO n 
1 385 PHE n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 LYS n 
1 390 VAL n 
1 391 THR n 
1 392 GLU n 
1 393 MET n 
1 394 LEU n 
1 395 VAL n 
1 396 ASN n 
1 397 VAL n 
1 398 LEU n 
1 399 SER n 
1 400 ILE n 
1 401 CYS n 
1 402 SER n 
1 403 ASP n 
1 404 ASP n 
1 405 GLU n 
1 406 LEU n 
1 407 MET n 
1 408 THR n 
1 409 GLU n 
1 410 GLY n 
1 411 GLU n 
1 412 ASP n 
1 413 GLN n 
1 414 PHE n 
1 415 ASP n 
1 416 GLY n 
1 417 SER n 
1 418 ALA n 
1 419 ALA n 
1 420 ALA n 
1 421 ARG n 
1 422 LYS n 
1 423 GLU n 
1 424 ILE n 
1 425 ILE n 
1 426 ARG n 
1 427 ASN n 
1 428 LYS n 
1 429 ILE n 
1 430 ARG n 
1 431 ALA n 
1 432 ILE n 
1 433 GLY n 
1 434 LYS n 
1 435 MET n 
1 436 ALA n 
1 437 ARG n 
1 438 TYR n 
1 439 LEU n 
1 440 SER n 
1 441 VAL n 
1 442 LEU n 
1 443 ARG n 
1 444 GLU n 
1 445 GLU n 
1 446 SER n 
1 447 GLU n 
1 448 SER n 
1 449 VAL n 
1 450 LEU n 
1 451 THR n 
1 452 LEU n 
1 453 LYS n 
1 454 GLY n 
1 455 LEU n 
1 456 THR n 
1 457 PRO n 
1 458 THR n 
1 459 GLY n 
1 460 MET n 
1 461 LEU n 
1 462 PRO n 
1 463 SER n 
1 464 GLY n 
1 465 VAL n 
1 466 LEU n 
1 467 ALA n 
1 468 GLY n 
1 469 GLY n 
1 470 ARG n 
1 471 GLN n 
1 472 THR n 
1 473 LEU n 
1 474 GLN n 
1 475 SER n 
1 476 ALA n 
1 477 THR n 
1 478 VAL n 
1 479 GLU n 
1 480 ALA n 
1 481 ILE n 
1 482 GLU n 
1 483 ALA n 
1 484 GLU n 
1 485 LYS n 
1 486 ALA n 
1 487 ILE n 
1 488 ARG n 
1 489 GLY n 
1 490 PHE n 
1 491 SER n 
1 492 PRO n 
1 493 PRO n 
1 494 HIS n 
1 495 ARG n 
1 496 ILE n 
1 497 CYS n 
1 498 SER n 
1 499 PHE n 
1 500 GLU n 
1 501 GLU n 
1 502 ALA n 
1 503 LYS n 
1 504 GLY n 
1 505 LEU n 
1 506 ASP n 
1 507 ARG n 
1 508 ILE n 
1 509 ASN n 
1 510 GLU n 
1 511 ARG n 
1 512 MET n 
1 513 PRO n 
1 514 PRO n 
1 515 ARG n 
1 516 LYS n 
1 517 ASP n 
1 518 ALA n 
1 519 VAL n 
1 520 GLN n 
1 521 GLN n 
1 522 ASP n 
1 523 GLY n 
1 524 PHE n 
1 525 ASN n 
1 526 SER n 
1 527 LEU n 
1 528 ASN n 
1 529 THR n 
1 530 ALA n 
1 531 HIS n 
1 532 ALA n 
1 533 THR n 
1 534 GLU n 
1 535 ASN n 
1 536 HIS n 
1 537 GLY n 
1 538 THR n 
1 539 GLY n 
1 540 ASN n 
1 541 HIS n 
1 542 THR n 
1 543 ALA n 
1 544 GLN n 
2 1   MET n 
2 2   GLY n 
2 3   ASN n 
2 4   GLU n 
2 5   ALA n 
2 6   SER n 
2 7   TYR n 
2 8   PRO n 
2 9   LEU n 
2 10  GLU n 
2 11  MET n 
2 12  CYS n 
2 13  SER n 
2 14  HIS n 
2 15  PHE n 
2 16  ASP n 
2 17  ALA n 
2 18  ASP n 
2 19  GLU n 
2 20  ILE n 
2 21  LYS n 
2 22  ARG n 
2 23  LEU n 
2 24  GLY n 
2 25  LYS n 
2 26  ARG n 
2 27  PHE n 
2 28  LYS n 
2 29  LYS n 
2 30  LEU n 
2 31  ASP n 
2 32  LEU n 
2 33  ASP n 
2 34  ASN n 
2 35  SER n 
2 36  GLY n 
2 37  SER n 
2 38  LEU n 
2 39  SER n 
2 40  VAL n 
2 41  GLU n 
2 42  GLU n 
2 43  PHE n 
2 44  MET n 
2 45  SER n 
2 46  LEU n 
2 47  PRO n 
2 48  GLU n 
2 49  LEU n 
2 50  GLN n 
2 51  GLN n 
2 52  ASN n 
2 53  PRO n 
2 54  LEU n 
2 55  VAL n 
2 56  GLN n 
2 57  ARG n 
2 58  VAL n 
2 59  ILE n 
2 60  ASP n 
2 61  ILE n 
2 62  PHE n 
2 63  ASP n 
2 64  THR n 
2 65  ASP n 
2 66  GLY n 
2 67  ASN n 
2 68  GLY n 
2 69  GLU n 
2 70  VAL n 
2 71  ASP n 
2 72  PHE n 
2 73  LYS n 
2 74  GLU n 
2 75  PHE n 
2 76  ILE n 
2 77  GLU n 
2 78  GLY n 
2 79  VAL n 
2 80  SER n 
2 81  GLN n 
2 82  PHE n 
2 83  SER n 
2 84  VAL n 
2 85  LYS n 
2 86  GLY n 
2 87  ASP n 
2 88  LYS n 
2 89  GLU n 
2 90  GLN n 
2 91  LYS n 
2 92  LEU n 
2 93  ARG n 
2 94  PHE n 
2 95  ALA n 
2 96  PHE n 
2 97  ARG n 
2 98  ILE n 
2 99  TYR n 
2 100 ASP n 
2 101 MET n 
2 102 ASP n 
2 103 LYS n 
2 104 ASP n 
2 105 GLY n 
2 106 TYR n 
2 107 ILE n 
2 108 SER n 
2 109 ASN n 
2 110 GLY n 
2 111 GLU n 
2 112 LEU n 
2 113 PHE n 
2 114 GLN n 
2 115 VAL n 
2 116 LEU n 
2 117 LYS n 
2 118 MET n 
2 119 MET n 
2 120 VAL n 
2 121 GLY n 
2 122 ASN n 
2 123 ASN n 
2 124 LEU n 
2 125 LYS n 
2 126 ASP n 
2 127 THR n 
2 128 GLN n 
2 129 LEU n 
2 130 GLN n 
2 131 GLN n 
2 132 ILE n 
2 133 VAL n 
2 134 ASP n 
2 135 LYS n 
2 136 THR n 
2 137 ILE n 
2 138 ILE n 
2 139 ASN n 
2 140 ALA n 
2 141 ASP n 
2 142 LYS n 
2 143 ASP n 
2 144 GLY n 
2 145 ASP n 
2 146 GLY n 
2 147 ARG n 
2 148 ILE n 
2 149 SER n 
2 150 PHE n 
2 151 GLU n 
2 152 GLU n 
2 153 PHE n 
2 154 CYS n 
2 155 ALA n 
2 156 VAL n 
2 157 VAL n 
2 158 GLY n 
2 159 GLY n 
2 160 LEU n 
2 161 ASP n 
2 162 ILE n 
2 163 HIS n 
2 164 LYS n 
2 165 LYS n 
2 166 MET n 
2 167 VAL n 
2 168 VAL n 
2 169 ASP n 
2 170 VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CALNA2, CALNB, CNA2, PPP3CB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 
2 1 sample ? ? ? human ? 'CNA2, CNB, PPP3R1'           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? 
? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PP2BB_HUMAN P16298 1 
;MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAI
LRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNH
ECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNY
LDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAA
RKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
;
1 ? 
2 UNP CANB1_HUMAN P63098 2 
;MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS
QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGL
DIHKKMVVDV
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ORA A 21 ? 544 ? P16298 1 ? 524 ? 1 524 
2 2 4ORA B 1  ? 170 ? P63098 1 ? 170 ? 0 169 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ORA MET A 1   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -19 1  
1 4ORA GLY A 2   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -18 2  
1 4ORA SER A 3   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -17 3  
1 4ORA SER A 4   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -16 4  
1 4ORA HIS A 5   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -15 5  
1 4ORA HIS A 6   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -14 6  
1 4ORA HIS A 7   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -13 7  
1 4ORA HIS A 8   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -12 8  
1 4ORA HIS A 9   ? UNP P16298 ?   ?   'EXPRESSION TAG'      -11 9  
1 4ORA HIS A 10  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -10 10 
1 4ORA SER A 11  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -9  11 
1 4ORA SER A 12  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -8  12 
1 4ORA GLY A 13  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -7  13 
1 4ORA LEU A 14  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -6  14 
1 4ORA VAL A 15  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -5  15 
1 4ORA PRO A 16  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -4  16 
1 4ORA ARG A 17  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -3  17 
1 4ORA GLY A 18  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -2  18 
1 4ORA SER A 19  ? UNP P16298 ?   ?   'EXPRESSION TAG'      -1  19 
1 4ORA HIS A 20  ? UNP P16298 ?   ?   'EXPRESSION TAG'      0   20 
1 4ORA TYR A 438 ? UNP P16298 VAL 418 'ENGINEERED MUTATION' 418 21 
1 4ORA LEU A 439 ? UNP P16298 PHE 419 'ENGINEERED MUTATION' 419 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          4ORA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '100 mM MES, pH 5.8, 9% PEG 3350, 4% Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-05-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91939 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91939 
# 
_reflns.entry_id                     4ORA 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.74 
_reflns.number_obs                   24485 
_reflns.number_all                   26604 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.098 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.4 
_reflns.B_iso_Wilson_estimate        31.7 
_reflns.pdbx_redundancy              15.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.74 
_reflns_shell.d_res_low                   2.84 
_reflns_shell.percent_possible_all        99.6 
_reflns_shell.Rmerge_I_obs                0.512 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         5.1 
_reflns_shell.pdbx_redundancy             15.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           2597 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ORA 
_refine.ls_number_reflns_obs                     24485 
_refine.ls_number_reflns_all                     26604 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.994 
_refine.ls_d_res_high                            2.747 
_refine.ls_percent_reflns_obs                    91.99 
_refine.ls_R_factor_obs                          0.2016 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1991 
_refine.ls_R_factor_R_free                       0.2490 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_number_reflns_R_free                  1246 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            2.7443 
_refine.aniso_B[2][2]                            -0.0000 
_refine.aniso_B[3][3]                            0.0000 
_refine.aniso_B[1][2]                            2.7443 
_refine.aniso_B[1][3]                            -5.4885 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1AUI 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 24.35 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4541 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             45 
_refine_hist.number_atoms_total               4592 
_refine_hist.d_res_high                       2.747 
_refine_hist.d_res_low                        46.994 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.010  ? ? 4675 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.212  ? ? 6328 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.987 ? ? 1759 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.083  ? ? 679  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 832  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 9 2.7472 2.8572  1605 0.2570 58.00  0.3007 . . 77  . . . . 
'X-RAY DIFFRACTION' 9 2.8572 2.9872  2185 0.2503 80.00  0.2919 . . 112 . . . . 
'X-RAY DIFFRACTION' 9 2.9872 3.1447  2556 0.2581 93.00  0.3146 . . 142 . . . . 
'X-RAY DIFFRACTION' 9 3.1447 3.3416  2705 0.2362 98.00  0.2806 . . 154 . . . . 
'X-RAY DIFFRACTION' 9 3.3416 3.5996  2747 0.2142 99.00  0.2440 . . 162 . . . . 
'X-RAY DIFFRACTION' 9 3.5996 3.9616  2754 0.1890 99.00  0.2490 . . 156 . . . . 
'X-RAY DIFFRACTION' 9 3.9616 4.5345  2810 0.1487 99.00  0.1952 . . 139 . . . . 
'X-RAY DIFFRACTION' 9 4.5345 5.7114  2840 0.1667 100.00 0.2178 . . 156 . . . . 
'X-RAY DIFFRACTION' 9 5.7114 47.0005 3037 0.1990 99.00  0.2575 . . 148 . . . . 
# 
_struct.entry_id                  4ORA 
_struct.title                     'Crystal structure of a human calcineurin mutant' 
_struct.pdbx_descriptor           
'Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (E.C.3.1.3.16), Calcineurin subunit B type 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ORA 
_struct_keywords.pdbx_keywords   'HYDROLASE/METAL BINDING PROTEIN' 
_struct_keywords.text            'Calmodulin-binding, HYDROLASE-METAL BINDING PROTEIN complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 40  ? ASP A 44  ? PRO A 20  ASP A 24  5 ? 5  
HELX_P HELX_P2  2  THR A 59  ? PHE A 64  ? THR A 39  PHE A 44  1 ? 6  
HELX_P HELX_P3  3  ARG A 71  ? LYS A 81  ? ARG A 51  LYS A 61  1 ? 11 
HELX_P HELX_P4  4  ASP A 86  ? ARG A 103 ? ASP A 66  ARG A 83  1 ? 18 
HELX_P HELX_P5  5  GLN A 123 ? GLY A 135 ? GLN A 103 GLY A 115 1 ? 13 
HELX_P HELX_P6  6  PHE A 154 ? TYR A 169 ? PHE A 134 TYR A 149 1 ? 16 
HELX_P HELX_P7  7  CYS A 182 ? PHE A 189 ? CYS A 162 PHE A 169 1 ? 8  
HELX_P HELX_P8  8  THR A 190 ? TYR A 199 ? THR A 170 TYR A 179 1 ? 10 
HELX_P HELX_P9  9  SER A 200 ? LEU A 214 ? SER A 180 LEU A 194 1 ? 15 
HELX_P HELX_P10 10 THR A 237 ? ARG A 243 ? THR A 217 ARG A 223 1 ? 7  
HELX_P HELX_P11 11 GLY A 254 ? SER A 262 ? GLY A 234 SER A 242 1 ? 9  
HELX_P HELX_P12 12 ASN A 290 ? ASN A 301 ? ASN A 270 ASN A 281 1 ? 12 
HELX_P HELX_P13 13 ASN A 339 ? VAL A 343 ? ASN A 319 VAL A 323 5 ? 5  
HELX_P HELX_P14 14 LEU A 372 ? MET A 376 ? LEU A 352 MET A 356 5 ? 5  
HELX_P HELX_P15 15 ASP A 377 ? SER A 399 ? ASP A 357 SER A 379 1 ? 23 
HELX_P HELX_P16 16 PHE A 499 ? LEU A 505 ? PHE A 479 LEU A 485 1 ? 7  
HELX_P HELX_P17 17 ASP A 506 ? ARG A 511 ? ASP A 486 ARG A 491 5 ? 6  
HELX_P HELX_P18 18 ASP B 16  ? ASP B 31  ? ASP B 15  ASP B 30  1 ? 16 
HELX_P HELX_P19 19 SER B 39  ? SER B 45  ? SER B 38  SER B 44  1 ? 7  
HELX_P HELX_P20 20 LEU B 46  ? GLN B 50  ? LEU B 45  GLN B 49  5 ? 5  
HELX_P HELX_P21 21 LEU B 54  ? ASP B 63  ? LEU B 53  ASP B 62  1 ? 10 
HELX_P HELX_P22 22 ASP B 71  ? GLN B 81  ? ASP B 70  GLN B 80  1 ? 11 
HELX_P HELX_P23 23 ASP B 87  ? ASP B 100 ? ASP B 86  ASP B 99  1 ? 14 
HELX_P HELX_P24 24 SER B 108 ? GLY B 121 ? SER B 107 GLY B 120 1 ? 14 
HELX_P HELX_P25 25 LYS B 125 ? ASP B 141 ? LYS B 124 ASP B 140 1 ? 17 
HELX_P HELX_P26 26 SER B 149 ? GLY B 158 ? SER B 148 GLY B 157 1 ? 10 
HELX_P HELX_P27 27 GLY B 159 ? LYS B 165 ? GLY B 158 LYS B 164 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 310 ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 290 A ZN  601 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc2  metalc ? ? B GLU 69  O   ? ? ? 1_555 F CA  . CA ? ? B GLU 68  B CA  202 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc3  metalc ? ? A HIS 121 NE2 ? ? ? 1_555 D FE  . FE ? ? A HIS 101 A FE  602 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc4  metalc ? ? B SER 37  O   ? ? ? 1_555 E CA  . CA ? ? B SER 36  B CA  201 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc5  metalc ? ? B GLU 74  OE1 ? ? ? 1_555 F CA  . CA ? ? B GLU 73  B CA  202 1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc6  metalc ? ? B GLU 152 OE1 ? ? ? 1_555 H CA  . CA ? ? B GLU 151 B CA  204 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc7  metalc ? ? B GLU 111 OE1 ? ? ? 1_555 G CA  . CA ? ? B GLU 110 B CA  203 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc8  metalc ? ? B ASN 67  OD1 ? ? ? 1_555 F CA  . CA ? ? B ASN 66  B CA  202 1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc9  metalc ? ? B ASP 33  OD1 ? ? ? 1_555 E CA  . CA ? ? B ASP 32  B CA  201 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc10 metalc ? ? B ASP 145 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 144 B CA  204 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc11 metalc ? ? B ASP 102 OD1 ? ? ? 1_555 G CA  . CA ? ? B ASP 101 B CA  203 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc12 metalc ? ? B GLU 152 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 151 B CA  204 1_555 ? ? ? ? ? ? ? 2.817 ? 
metalc13 metalc ? ? B TYR 106 O   ? ? ? 1_555 G CA  . CA ? ? B TYR 105 B CA  203 1_555 ? ? ? ? ? ? ? 2.827 ? 
metalc14 metalc ? ? B ASP 65  OD1 ? ? ? 1_555 F CA  . CA ? ? B ASP 64  B CA  202 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc15 metalc ? ? B ASP 100 OD1 ? ? ? 1_555 G CA  . CA ? ? B ASP 99  B CA  203 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc16 metalc ? ? B ASP 104 OD1 ? ? ? 1_555 G CA  . CA ? ? B ASP 103 B CA  203 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc17 metalc ? ? B ASP 143 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 142 B CA  204 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc18 metalc ? ? B ARG 147 O   ? ? ? 1_555 H CA  . CA ? ? B ARG 146 B CA  204 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc19 metalc ? ? B GLU 111 OE2 ? ? ? 1_555 G CA  . CA ? ? B GLU 110 B CA  203 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc20 metalc ? ? B ASP 141 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 140 B CA  204 1_555 ? ? ? ? ? ? ? 2.887 ? 
metalc21 metalc ? ? B GLU 74  OE2 ? ? ? 1_555 F CA  . CA ? ? B GLU 73  B CA  202 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc22 metalc ? ? B GLU 42  OE2 ? ? ? 1_555 E CA  . CA ? ? B GLU 41  B CA  201 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc23 metalc ? ? B ASP 31  OD1 ? ? ? 1_555 E CA  . CA ? ? B ASP 30  B CA  201 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc24 metalc ? ? B ASP 63  OD1 ? ? ? 1_555 F CA  . CA ? ? B ASP 62  B CA  202 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc25 metalc ? ? B GLU 42  OE1 ? ? ? 1_555 E CA  . CA ? ? B GLU 41  B CA  201 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc26 metalc ? ? B SER 35  OG  ? ? ? 1_555 E CA  . CA ? ? B SER 34  B CA  201 1_555 ? ? ? ? ? ? ? 3.042 ? 
metalc27 metalc ? ? D FE  .   FE  ? ? ? 1_555 I HOH . O  ? ? A FE  602 A HOH 712 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc28 metalc ? ? G CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  203 B HOH 301 1_555 ? ? ? ? ? ? ? 2.906 ? 
metalc29 metalc ? ? F CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  202 B HOH 309 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc30 metalc ? ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  204 B HOH 308 1_555 ? ? ? ? ? ? ? 3.101 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           112 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            92 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    113 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     93 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 107 ? VAL A 110 ? MET A 87  VAL A 90  
A 2 ALA A 217 ? LEU A 220 ? ALA A 197 LEU A 200 
A 3 PHE A 224 ? VAL A 227 ? PHE A 204 VAL A 207 
A 4 SER A 305 ? ARG A 308 ? SER A 285 ARG A 288 
A 5 LEU A 331 ? ILE A 334 ? LEU A 311 ILE A 314 
A 6 TYR A 317 ? MET A 319 ? TYR A 297 MET A 299 
B 1 LEU A 173 ? LEU A 175 ? LEU A 153 LEU A 155 
B 2 TYR A 142 ? PHE A 144 ? TYR A 122 PHE A 124 
B 3 ILE A 114 ? CYS A 117 ? ILE A 94  CYS A 97  
B 4 ALA A 348 ? GLU A 354 ? ALA A 328 GLU A 334 
B 5 VAL A 357 ? PHE A 363 ? VAL A 337 PHE A 343 
C 1 ASP A 263 ? PRO A 264 ? ASP A 243 PRO A 244 
C 2 TYR A 287 ? TYR A 289 ? TYR A 267 TYR A 269 
C 3 PHE A 277 ? HIS A 279 ? PHE A 257 HIS A 259 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 108 ? N ILE A 88  O LEU A 219 ? O LEU A 199 
A 2 3 N LEU A 220 ? N LEU A 200 O PHE A 224 ? O PHE A 204 
A 3 4 N LEU A 225 ? N LEU A 205 O ILE A 307 ? O ILE A 287 
A 4 5 N ARG A 308 ? N ARG A 288 O ILE A 332 ? O ILE A 312 
A 5 6 O THR A 333 ? O THR A 313 N ARG A 318 ? N ARG A 298 
B 1 2 O PHE A 174 ? O PHE A 154 N PHE A 144 ? N PHE A 124 
B 2 3 O LEU A 143 ? O LEU A 123 N CYS A 117 ? N CYS A 97  
B 3 4 N ILE A 114 ? N ILE A 94  O TYR A 353 ? O TYR A 333 
B 4 5 N LYS A 352 ? N LYS A 332 O ASN A 359 ? O ASN A 339 
C 1 2 N ASP A 263 ? N ASP A 243 O TYR A 289 ? O TYR A 269 
C 2 3 O PHE A 288 ? O PHE A 268 N SER A 278 ? N SER A 258 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 601' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FE A 602' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 201' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 202' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 203' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 119 ? ASP A 99  . ? 1_555 ? 
2  AC1 5 ASP A 147 ? ASP A 127 . ? 1_555 ? 
3  AC1 5 ASN A 179 ? ASN A 159 . ? 1_555 ? 
4  AC1 5 HIS A 310 ? HIS A 290 . ? 1_555 ? 
5  AC1 5 FE  D .   ? FE  A 602 . ? 1_555 ? 
6  AC2 7 ASP A 119 ? ASP A 99  . ? 1_555 ? 
7  AC2 7 HIS A 121 ? HIS A 101 . ? 1_555 ? 
8  AC2 7 ASP A 147 ? ASP A 127 . ? 1_555 ? 
9  AC2 7 HIS A 310 ? HIS A 290 . ? 1_555 ? 
10 AC2 7 GLU A 510 ? GLU A 490 . ? 1_555 ? 
11 AC2 7 ZN  C .   ? ZN  A 601 . ? 1_555 ? 
12 AC2 7 HOH I .   ? HOH A 712 . ? 1_555 ? 
13 AC3 5 ASP B 31  ? ASP B 30  . ? 1_555 ? 
14 AC3 5 ASP B 33  ? ASP B 32  . ? 1_555 ? 
15 AC3 5 SER B 35  ? SER B 34  . ? 1_555 ? 
16 AC3 5 SER B 37  ? SER B 36  . ? 1_555 ? 
17 AC3 5 GLU B 42  ? GLU B 41  . ? 1_555 ? 
18 AC4 6 ASP B 63  ? ASP B 62  . ? 1_555 ? 
19 AC4 6 ASP B 65  ? ASP B 64  . ? 1_555 ? 
20 AC4 6 ASN B 67  ? ASN B 66  . ? 1_555 ? 
21 AC4 6 GLU B 69  ? GLU B 68  . ? 1_555 ? 
22 AC4 6 GLU B 74  ? GLU B 73  . ? 1_555 ? 
23 AC4 6 HOH J .   ? HOH B 309 . ? 1_555 ? 
24 AC5 6 ASP B 100 ? ASP B 99  . ? 1_555 ? 
25 AC5 6 ASP B 102 ? ASP B 101 . ? 1_555 ? 
26 AC5 6 ASP B 104 ? ASP B 103 . ? 1_555 ? 
27 AC5 6 TYR B 106 ? TYR B 105 . ? 1_555 ? 
28 AC5 6 GLU B 111 ? GLU B 110 . ? 1_555 ? 
29 AC5 6 HOH J .   ? HOH B 301 . ? 1_555 ? 
30 AC6 5 ASP B 141 ? ASP B 140 . ? 1_555 ? 
31 AC6 5 ASP B 143 ? ASP B 142 . ? 1_555 ? 
32 AC6 5 ASP B 145 ? ASP B 144 . ? 1_555 ? 
33 AC6 5 ARG B 147 ? ARG B 146 . ? 1_555 ? 
34 AC6 5 GLU B 152 ? GLU B 151 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ORA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ORA 
_atom_sites.fract_transf_matrix[1][1]   0.009242 
_atom_sites.fract_transf_matrix[1][2]   0.005336 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010672 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003515 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 35  ? -39.160 33.786 -28.834 1.00 109.36 ? 15  PRO A N   1 
ATOM   2    C  CA  . PRO A 1 35  ? -38.412 34.883 -28.204 1.00 107.72 ? 15  PRO A CA  1 
ATOM   3    C  C   . PRO A 1 35  ? -36.995 34.443 -27.830 1.00 107.45 ? 15  PRO A C   1 
ATOM   4    O  O   . PRO A 1 35  ? -36.747 33.240 -27.786 1.00 111.87 ? 15  PRO A O   1 
ATOM   5    C  CB  . PRO A 1 35  ? -39.209 35.159 -26.924 1.00 104.76 ? 15  PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 35  ? -40.528 34.505 -27.116 1.00 107.30 ? 15  PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 35  ? -40.285 33.330 -28.002 1.00 109.11 ? 15  PRO A CD  1 
ATOM   8    N  N   . PRO A 1 36  ? -36.072 35.397 -27.576 1.00 85.60  ? 16  PRO A N   1 
ATOM   9    C  CA  . PRO A 1 36  ? -34.751 34.995 -27.066 1.00 79.32  ? 16  PRO A CA  1 
ATOM   10   C  C   . PRO A 1 36  ? -34.735 34.789 -25.544 1.00 76.63  ? 16  PRO A C   1 
ATOM   11   O  O   . PRO A 1 36  ? -35.610 35.325 -24.859 1.00 79.12  ? 16  PRO A O   1 
ATOM   12   C  CB  . PRO A 1 36  ? -33.839 36.186 -27.445 1.00 76.23  ? 16  PRO A CB  1 
ATOM   13   C  CG  . PRO A 1 36  ? -34.648 37.058 -28.349 1.00 78.50  ? 16  PRO A CG  1 
ATOM   14   C  CD  . PRO A 1 36  ? -36.079 36.810 -27.998 1.00 81.41  ? 16  PRO A CD  1 
ATOM   15   N  N   . PRO A 1 37  ? -33.762 34.013 -25.021 1.00 71.96  ? 17  PRO A N   1 
ATOM   16   C  CA  . PRO A 1 37  ? -33.544 33.919 -23.568 1.00 70.46  ? 17  PRO A CA  1 
ATOM   17   C  C   . PRO A 1 37  ? -33.032 35.261 -23.081 1.00 70.04  ? 17  PRO A C   1 
ATOM   18   O  O   . PRO A 1 37  ? -32.583 36.057 -23.908 1.00 67.51  ? 17  PRO A O   1 
ATOM   19   C  CB  . PRO A 1 37  ? -32.414 32.886 -23.441 1.00 67.77  ? 17  PRO A CB  1 
ATOM   20   C  CG  . PRO A 1 37  ? -31.802 32.766 -24.865 1.00 66.77  ? 17  PRO A CG  1 
ATOM   21   C  CD  . PRO A 1 37  ? -32.991 33.002 -25.764 1.00 69.22  ? 17  PRO A CD  1 
ATOM   22   N  N   . PRO A 1 38  ? -33.114 35.547 -21.772 1.00 74.56  ? 18  PRO A N   1 
ATOM   23   C  CA  . PRO A 1 38  ? -32.389 36.756 -21.376 1.00 71.20  ? 18  PRO A CA  1 
ATOM   24   C  C   . PRO A 1 38  ? -30.890 36.542 -21.578 1.00 68.22  ? 18  PRO A C   1 
ATOM   25   O  O   . PRO A 1 38  ? -30.431 35.392 -21.625 1.00 68.31  ? 18  PRO A O   1 
ATOM   26   C  CB  . PRO A 1 38  ? -32.722 36.888 -19.879 1.00 68.51  ? 18  PRO A CB  1 
ATOM   27   C  CG  . PRO A 1 38  ? -34.035 36.184 -19.730 1.00 68.03  ? 18  PRO A CG  1 
ATOM   28   C  CD  . PRO A 1 38  ? -33.918 35.007 -20.664 1.00 69.81  ? 18  PRO A CD  1 
ATOM   29   N  N   . PRO A 1 39  ? -30.139 37.637 -21.739 1.00 62.24  ? 19  PRO A N   1 
ATOM   30   C  CA  . PRO A 1 39  ? -28.685 37.518 -21.877 1.00 59.52  ? 19  PRO A CA  1 
ATOM   31   C  C   . PRO A 1 39  ? -28.095 36.870 -20.628 1.00 58.59  ? 19  PRO A C   1 
ATOM   32   O  O   . PRO A 1 39  ? -28.553 37.171 -19.506 1.00 58.59  ? 19  PRO A O   1 
ATOM   33   C  CB  . PRO A 1 39  ? -28.222 38.980 -21.977 1.00 52.74  ? 19  PRO A CB  1 
ATOM   34   C  CG  . PRO A 1 39  ? -29.321 39.792 -21.344 1.00 52.91  ? 19  PRO A CG  1 
ATOM   35   C  CD  . PRO A 1 39  ? -30.591 39.042 -21.676 1.00 57.86  ? 19  PRO A CD  1 
ATOM   36   N  N   . PRO A 1 40  ? -27.134 35.956 -20.815 1.00 55.01  ? 20  PRO A N   1 
ATOM   37   C  CA  . PRO A 1 40  ? -26.369 35.378 -19.705 1.00 54.40  ? 20  PRO A CA  1 
ATOM   38   C  C   . PRO A 1 40  ? -25.941 36.487 -18.746 1.00 60.47  ? 20  PRO A C   1 
ATOM   39   O  O   . PRO A 1 40  ? -25.325 37.447 -19.211 1.00 60.05  ? 20  PRO A O   1 
ATOM   40   C  CB  . PRO A 1 40  ? -25.143 34.770 -20.396 1.00 53.41  ? 20  PRO A CB  1 
ATOM   41   C  CG  . PRO A 1 40  ? -25.306 35.079 -21.928 1.00 53.19  ? 20  PRO A CG  1 
ATOM   42   C  CD  . PRO A 1 40  ? -26.758 35.379 -22.110 1.00 53.51  ? 20  PRO A CD  1 
ATOM   43   N  N   . PRO A 1 41  ? -26.224 36.362 -17.440 1.00 71.74  ? 21  PRO A N   1 
ATOM   44   C  CA  . PRO A 1 41  ? -26.136 37.481 -16.488 1.00 69.00  ? 21  PRO A CA  1 
ATOM   45   C  C   . PRO A 1 41  ? -24.801 38.240 -16.479 1.00 68.95  ? 21  PRO A C   1 
ATOM   46   O  O   . PRO A 1 41  ? -24.831 39.474 -16.377 1.00 74.67  ? 21  PRO A O   1 
ATOM   47   C  CB  . PRO A 1 41  ? -26.349 36.791 -15.134 1.00 63.48  ? 21  PRO A CB  1 
ATOM   48   C  CG  . PRO A 1 41  ? -27.198 35.594 -15.506 1.00 62.81  ? 21  PRO A CG  1 
ATOM   49   C  CD  . PRO A 1 41  ? -26.619 35.120 -16.770 1.00 66.82  ? 21  PRO A CD  1 
ATOM   50   N  N   . GLY A 1 42  ? -23.679 37.531 -16.606 1.00 56.06  ? 22  GLY A N   1 
ATOM   51   C  CA  . GLY A 1 42  ? -22.390 38.184 -16.693 1.00 57.67  ? 22  GLY A CA  1 
ATOM   52   C  C   . GLY A 1 42  ? -22.002 38.559 -18.116 1.00 58.89  ? 22  GLY A C   1 
ATOM   53   O  O   . GLY A 1 42  ? -20.825 38.550 -18.475 1.00 54.84  ? 22  GLY A O   1 
ATOM   54   N  N   . ALA A 1 43  ? -22.988 38.902 -18.936 1.00 66.94  ? 23  ALA A N   1 
ATOM   55   C  CA  . ALA A 1 43  ? -22.707 39.300 -20.309 1.00 64.77  ? 23  ALA A CA  1 
ATOM   56   C  C   . ALA A 1 43  ? -22.036 40.659 -20.330 1.00 64.56  ? 23  ALA A C   1 
ATOM   57   O  O   . ALA A 1 43  ? -21.287 40.981 -21.252 1.00 70.12  ? 23  ALA A O   1 
ATOM   58   C  CB  . ALA A 1 43  ? -23.981 39.346 -21.133 1.00 65.46  ? 23  ALA A CB  1 
ATOM   59   N  N   . ASP A 1 44  ? -22.320 41.469 -19.319 1.00 57.43  ? 24  ASP A N   1 
ATOM   60   C  CA  . ASP A 1 44  ? -21.784 42.823 -19.288 1.00 48.73  ? 24  ASP A CA  1 
ATOM   61   C  C   . ASP A 1 44  ? -21.094 43.153 -17.964 1.00 45.07  ? 24  ASP A C   1 
ATOM   62   O  O   . ASP A 1 44  ? -20.802 44.305 -17.675 1.00 50.38  ? 24  ASP A O   1 
ATOM   63   C  CB  . ASP A 1 44  ? -22.884 43.841 -19.609 1.00 44.12  ? 24  ASP A CB  1 
ATOM   64   C  CG  . ASP A 1 44  ? -23.951 43.916 -18.530 1.00 45.78  ? 24  ASP A CG  1 
ATOM   65   O  OD1 . ASP A 1 44  ? -23.998 43.028 -17.633 1.00 47.21  ? 24  ASP A OD1 1 
ATOM   66   O  OD2 . ASP A 1 44  ? -24.749 44.877 -18.597 1.00 45.18  ? 24  ASP A OD2 1 
ATOM   67   N  N   . ARG A 1 45  ? -20.845 42.125 -17.167 1.00 39.63  ? 25  ARG A N   1 
ATOM   68   C  CA  . ARG A 1 45  ? -20.130 42.278 -15.918 1.00 37.14  ? 25  ARG A CA  1 
ATOM   69   C  C   . ARG A 1 45  ? -18.784 42.872 -16.264 1.00 36.65  ? 25  ARG A C   1 
ATOM   70   O  O   . ARG A 1 45  ? -18.138 42.435 -17.218 1.00 39.31  ? 25  ARG A O   1 
ATOM   71   C  CB  . ARG A 1 45  ? -19.948 40.917 -15.274 1.00 33.88  ? 25  ARG A CB  1 
ATOM   72   C  CG  . ARG A 1 45  ? -19.904 40.950 -13.776 1.00 33.15  ? 25  ARG A CG  1 
ATOM   73   C  CD  . ARG A 1 45  ? -20.331 39.614 -13.189 1.00 33.79  ? 25  ARG A CD  1 
ATOM   74   N  NE  . ARG A 1 45  ? -19.675 39.396 -11.913 1.00 30.95  ? 25  ARG A NE  1 
ATOM   75   C  CZ  . ARG A 1 45  ? -18.463 38.874 -11.800 1.00 33.51  ? 25  ARG A CZ  1 
ATOM   76   N  NH1 . ARG A 1 45  ? -17.801 38.510 -12.895 1.00 35.83  ? 25  ARG A NH1 1 
ATOM   77   N  NH2 . ARG A 1 45  ? -17.918 38.710 -10.602 1.00 29.95  ? 25  ARG A NH2 1 
ATOM   78   N  N   . VAL A 1 46  ? -18.368 43.876 -15.504 1.00 33.49  ? 26  VAL A N   1 
ATOM   79   C  CA  . VAL A 1 46  ? -17.211 44.674 -15.894 1.00 33.52  ? 26  VAL A CA  1 
ATOM   80   C  C   . VAL A 1 46  ? -15.898 44.027 -15.465 1.00 32.83  ? 26  VAL A C   1 
ATOM   81   O  O   . VAL A 1 46  ? -14.940 43.962 -16.243 1.00 33.69  ? 26  VAL A O   1 
ATOM   82   C  CB  . VAL A 1 46  ? -17.307 46.119 -15.355 1.00 33.14  ? 26  VAL A CB  1 
ATOM   83   C  CG1 . VAL A 1 46  ? -16.014 46.852 -15.583 1.00 33.07  ? 26  VAL A CG1 1 
ATOM   84   C  CG2 . VAL A 1 46  ? -18.498 46.852 -15.994 1.00 34.05  ? 26  VAL A CG2 1 
ATOM   85   N  N   . VAL A 1 47  ? -15.854 43.553 -14.226 1.00 31.76  ? 27  VAL A N   1 
ATOM   86   C  CA  . VAL A 1 47  ? -14.658 42.908 -13.702 1.00 32.32  ? 27  VAL A CA  1 
ATOM   87   C  C   . VAL A 1 47  ? -14.909 41.409 -13.671 1.00 36.99  ? 27  VAL A C   1 
ATOM   88   O  O   . VAL A 1 47  ? -15.410 40.869 -12.679 1.00 34.26  ? 27  VAL A O   1 
ATOM   89   C  CB  . VAL A 1 47  ? -14.302 43.417 -12.292 1.00 29.89  ? 27  VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 47  ? -12.882 43.058 -11.960 1.00 29.42  ? 27  VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 47  ? -14.470 44.913 -12.225 1.00 29.95  ? 27  VAL A CG2 1 
ATOM   92   N  N   . LYS A 1 48  ? -14.558 40.744 -14.765 1.00 45.53  ? 28  LYS A N   1 
ATOM   93   C  CA  . LYS A 1 48  ? -14.978 39.369 -14.985 1.00 42.94  ? 28  LYS A CA  1 
ATOM   94   C  C   . LYS A 1 48  ? -14.234 38.361 -14.112 1.00 37.59  ? 28  LYS A C   1 
ATOM   95   O  O   . LYS A 1 48  ? -14.803 37.354 -13.702 1.00 37.54  ? 28  LYS A O   1 
ATOM   96   C  CB  . LYS A 1 48  ? -14.838 39.023 -16.466 1.00 43.30  ? 28  LYS A CB  1 
ATOM   97   C  CG  . LYS A 1 48  ? -15.661 39.931 -17.385 1.00 44.22  ? 28  LYS A CG  1 
ATOM   98   C  CD  . LYS A 1 48  ? -15.238 39.791 -18.853 1.00 45.64  ? 28  LYS A CD  1 
ATOM   99   C  CE  . LYS A 1 48  ? -16.237 40.451 -19.809 1.00 46.75  ? 28  LYS A CE  1 
ATOM   100  N  NZ  . LYS A 1 48  ? -17.623 39.996 -19.465 1.00 46.81  ? 28  LYS A NZ  1 
ATOM   101  N  N   . ALA A 1 49  ? -12.972 38.651 -13.813 1.00 34.29  ? 29  ALA A N   1 
ATOM   102  C  CA  . ALA A 1 49  ? -12.123 37.759 -13.017 1.00 32.33  ? 29  ALA A CA  1 
ATOM   103  C  C   . ALA A 1 49  ? -12.608 37.533 -11.578 1.00 35.79  ? 29  ALA A C   1 
ATOM   104  O  O   . ALA A 1 49  ? -12.268 36.522 -10.958 1.00 39.72  ? 29  ALA A O   1 
ATOM   105  C  CB  . ALA A 1 49  ? -10.674 38.281 -12.998 1.00 31.74  ? 29  ALA A CB  1 
ATOM   106  N  N   . VAL A 1 50  ? -13.374 38.475 -11.036 1.00 32.69  ? 30  VAL A N   1 
ATOM   107  C  CA  . VAL A 1 50  ? -13.865 38.351 -9.664  1.00 30.97  ? 30  VAL A CA  1 
ATOM   108  C  C   . VAL A 1 50  ? -14.917 37.263 -9.551  1.00 29.09  ? 30  VAL A C   1 
ATOM   109  O  O   . VAL A 1 50  ? -15.943 37.333 -10.222 1.00 31.41  ? 30  VAL A O   1 
ATOM   110  C  CB  . VAL A 1 50  ? -14.495 39.659 -9.168  1.00 27.78  ? 30  VAL A CB  1 
ATOM   111  C  CG1 . VAL A 1 50  ? -15.305 39.409 -7.931  1.00 26.73  ? 30  VAL A CG1 1 
ATOM   112  C  CG2 . VAL A 1 50  ? -13.422 40.696 -8.919  1.00 27.15  ? 30  VAL A CG2 1 
ATOM   113  N  N   . PRO A 1 51  ? -14.660 36.250 -8.707  1.00 27.38  ? 31  PRO A N   1 
ATOM   114  C  CA  . PRO A 1 51  ? -15.600 35.144 -8.475  1.00 27.49  ? 31  PRO A CA  1 
ATOM   115  C  C   . PRO A 1 51  ? -16.989 35.609 -8.057  1.00 28.35  ? 31  PRO A C   1 
ATOM   116  O  O   . PRO A 1 51  ? -17.148 36.461 -7.171  1.00 30.69  ? 31  PRO A O   1 
ATOM   117  C  CB  . PRO A 1 51  ? -14.924 34.349 -7.360  1.00 26.59  ? 31  PRO A CB  1 
ATOM   118  C  CG  . PRO A 1 51  ? -13.448 34.559 -7.628  1.00 26.54  ? 31  PRO A CG  1 
ATOM   119  C  CD  . PRO A 1 51  ? -13.353 36.001 -8.061  1.00 28.44  ? 31  PRO A CD  1 
ATOM   120  N  N   . PHE A 1 52  ? -17.981 35.044 -8.738  1.00 32.31  ? 32  PHE A N   1 
ATOM   121  C  CA  . PHE A 1 52  ? -19.391 35.353 -8.547  1.00 34.13  ? 32  PHE A CA  1 
ATOM   122  C  C   . PHE A 1 52  ? -19.946 34.360 -7.512  1.00 35.69  ? 32  PHE A C   1 
ATOM   123  O  O   . PHE A 1 52  ? -19.672 33.164 -7.583  1.00 43.17  ? 32  PHE A O   1 
ATOM   124  C  CB  . PHE A 1 52  ? -20.096 35.227 -9.912  1.00 30.79  ? 32  PHE A CB  1 
ATOM   125  C  CG  . PHE A 1 52  ? -21.507 35.776 -9.951  1.00 37.24  ? 32  PHE A CG  1 
ATOM   126  C  CD1 . PHE A 1 52  ? -21.736 37.144 -10.060 1.00 43.15  ? 32  PHE A CD1 1 
ATOM   127  C  CD2 . PHE A 1 52  ? -22.606 34.925 -9.944  1.00 40.73  ? 32  PHE A CD2 1 
ATOM   128  C  CE1 . PHE A 1 52  ? -23.035 37.660 -10.120 1.00 39.28  ? 32  PHE A CE1 1 
ATOM   129  C  CE2 . PHE A 1 52  ? -23.907 35.435 -10.001 1.00 43.67  ? 32  PHE A CE2 1 
ATOM   130  C  CZ  . PHE A 1 52  ? -24.115 36.808 -10.087 1.00 39.74  ? 32  PHE A CZ  1 
ATOM   131  N  N   . PRO A 1 53  ? -20.692 34.857 -6.516  1.00 33.65  ? 33  PRO A N   1 
ATOM   132  C  CA  . PRO A 1 53  ? -21.310 34.009 -5.475  1.00 29.34  ? 33  PRO A CA  1 
ATOM   133  C  C   . PRO A 1 53  ? -22.377 33.059 -6.025  1.00 29.24  ? 33  PRO A C   1 
ATOM   134  O  O   . PRO A 1 53  ? -22.854 33.270 -7.127  1.00 37.30  ? 33  PRO A O   1 
ATOM   135  C  CB  . PRO A 1 53  ? -21.953 35.028 -4.530  1.00 26.35  ? 33  PRO A CB  1 
ATOM   136  C  CG  . PRO A 1 53  ? -21.199 36.285 -4.758  1.00 27.55  ? 33  PRO A CG  1 
ATOM   137  C  CD  . PRO A 1 53  ? -20.797 36.290 -6.204  1.00 30.94  ? 33  PRO A CD  1 
ATOM   138  N  N   . PRO A 1 54  ? -22.733 32.003 -5.280  1.00 27.55  ? 34  PRO A N   1 
ATOM   139  C  CA  . PRO A 1 54  ? -23.818 31.111 -5.727  1.00 28.50  ? 34  PRO A CA  1 
ATOM   140  C  C   . PRO A 1 54  ? -25.162 31.832 -5.760  1.00 28.99  ? 34  PRO A C   1 
ATOM   141  O  O   . PRO A 1 54  ? -25.421 32.693 -4.919  1.00 31.20  ? 34  PRO A O   1 
ATOM   142  C  CB  . PRO A 1 54  ? -23.852 30.031 -4.646  1.00 27.87  ? 34  PRO A CB  1 
ATOM   143  C  CG  . PRO A 1 54  ? -22.458 30.036 -4.072  1.00 28.18  ? 34  PRO A CG  1 
ATOM   144  C  CD  . PRO A 1 54  ? -22.039 31.474 -4.094  1.00 27.83  ? 34  PRO A CD  1 
ATOM   145  N  N   . THR A 1 55  ? -26.016 31.468 -6.705  1.00 40.20  ? 35  THR A N   1 
ATOM   146  C  CA  . THR A 1 55  ? -27.308 32.121 -6.819  1.00 41.50  ? 35  THR A CA  1 
ATOM   147  C  C   . THR A 1 55  ? -28.404 31.322 -6.105  1.00 39.95  ? 35  THR A C   1 
ATOM   148  O  O   . THR A 1 55  ? -29.525 31.793 -5.942  1.00 43.69  ? 35  THR A O   1 
ATOM   149  C  CB  . THR A 1 55  ? -27.678 32.340 -8.295  1.00 45.60  ? 35  THR A CB  1 
ATOM   150  O  OG1 . THR A 1 55  ? -28.020 31.088 -8.899  1.00 48.50  ? 35  THR A OG1 1 
ATOM   151  C  CG2 . THR A 1 55  ? -26.500 32.954 -9.055  1.00 43.65  ? 35  THR A CG2 1 
ATOM   152  N  N   . HIS A 1 56  ? -28.081 30.108 -5.675  1.00 37.54  ? 36  HIS A N   1 
ATOM   153  C  CA  . HIS A 1 56  ? -29.063 29.287 -4.972  1.00 32.66  ? 36  HIS A CA  1 
ATOM   154  C  C   . HIS A 1 56  ? -28.662 28.990 -3.542  1.00 29.61  ? 36  HIS A C   1 
ATOM   155  O  O   . HIS A 1 56  ? -27.495 28.787 -3.237  1.00 33.56  ? 36  HIS A O   1 
ATOM   156  C  CB  . HIS A 1 56  ? -29.313 27.968 -5.712  1.00 32.76  ? 36  HIS A CB  1 
ATOM   157  C  CG  . HIS A 1 56  ? -30.130 28.120 -6.954  1.00 42.72  ? 36  HIS A CG  1 
ATOM   158  N  ND1 . HIS A 1 56  ? -29.566 28.165 -8.213  1.00 43.28  ? 36  HIS A ND1 1 
ATOM   159  C  CD2 . HIS A 1 56  ? -31.466 28.246 -7.133  1.00 47.09  ? 36  HIS A CD2 1 
ATOM   160  C  CE1 . HIS A 1 56  ? -30.522 28.300 -9.115  1.00 47.96  ? 36  HIS A CE1 1 
ATOM   161  N  NE2 . HIS A 1 56  ? -31.683 28.355 -8.485  1.00 51.43  ? 36  HIS A NE2 1 
ATOM   162  N  N   . ARG A 1 57  ? -29.647 28.957 -2.666  1.00 29.52  ? 37  ARG A N   1 
ATOM   163  C  CA  . ARG A 1 57  ? -29.411 28.551 -1.302  1.00 28.47  ? 37  ARG A CA  1 
ATOM   164  C  C   . ARG A 1 57  ? -29.339 27.032 -1.252  1.00 28.71  ? 37  ARG A C   1 
ATOM   165  O  O   . ARG A 1 57  ? -30.042 26.355 -2.005  1.00 32.54  ? 37  ARG A O   1 
ATOM   166  C  CB  . ARG A 1 57  ? -30.537 29.060 -0.416  1.00 28.43  ? 37  ARG A CB  1 
ATOM   167  C  CG  . ARG A 1 57  ? -30.592 30.573 -0.318  1.00 28.19  ? 37  ARG A CG  1 
ATOM   168  C  CD  . ARG A 1 57  ? -31.632 30.966 0.719   1.00 32.98  ? 37  ARG A CD  1 
ATOM   169  N  NE  . ARG A 1 57  ? -31.687 32.403 0.985   1.00 37.07  ? 37  ARG A NE  1 
ATOM   170  C  CZ  . ARG A 1 57  ? -31.464 32.940 2.177   1.00 35.83  ? 37  ARG A CZ  1 
ATOM   171  N  NH1 . ARG A 1 57  ? -31.152 32.163 3.195   1.00 36.21  ? 37  ARG A NH1 1 
ATOM   172  N  NH2 . ARG A 1 57  ? -31.537 34.249 2.348   1.00 37.39  ? 37  ARG A NH2 1 
ATOM   173  N  N   . LEU A 1 58  ? -28.465 26.508 -0.395  1.00 27.71  ? 38  LEU A N   1 
ATOM   174  C  CA  . LEU A 1 58  ? -28.364 25.077 -0.189  1.00 27.86  ? 38  LEU A CA  1 
ATOM   175  C  C   . LEU A 1 58  ? -29.663 24.588 0.394   1.00 29.37  ? 38  LEU A C   1 
ATOM   176  O  O   . LEU A 1 58  ? -30.171 25.165 1.350   1.00 35.18  ? 38  LEU A O   1 
ATOM   177  C  CB  . LEU A 1 58  ? -27.241 24.743 0.777   1.00 26.66  ? 38  LEU A CB  1 
ATOM   178  C  CG  . LEU A 1 58  ? -25.837 24.662 0.209   1.00 29.75  ? 38  LEU A CG  1 
ATOM   179  C  CD1 . LEU A 1 58  ? -24.930 24.062 1.243   1.00 29.38  ? 38  LEU A CD1 1 
ATOM   180  C  CD2 . LEU A 1 58  ? -25.827 23.821 -1.042  1.00 32.42  ? 38  LEU A CD2 1 
ATOM   181  N  N   . THR A 1 59  ? -30.209 23.527 -0.185  1.00 29.35  ? 39  THR A N   1 
ATOM   182  C  CA  . THR A 1 59  ? -31.431 22.958 0.339   1.00 29.89  ? 39  THR A CA  1 
ATOM   183  C  C   . THR A 1 59  ? -31.117 21.954 1.448   1.00 30.99  ? 39  THR A C   1 
ATOM   184  O  O   . THR A 1 59  ? -29.961 21.628 1.717   1.00 29.57  ? 39  THR A O   1 
ATOM   185  C  CB  . THR A 1 59  ? -32.226 22.265 -0.757  1.00 33.66  ? 39  THR A CB  1 
ATOM   186  O  OG1 . THR A 1 59  ? -31.576 21.039 -1.121  1.00 40.64  ? 39  THR A OG1 1 
ATOM   187  C  CG2 . THR A 1 59  ? -32.319 23.161 -1.966  1.00 36.08  ? 39  THR A CG2 1 
ATOM   188  N  N   . SER A 1 60  ? -32.164 21.471 2.096   1.00 33.96  ? 40  SER A N   1 
ATOM   189  C  CA  . SER A 1 60  ? -32.012 20.532 3.183   1.00 28.97  ? 40  SER A CA  1 
ATOM   190  C  C   . SER A 1 60  ? -31.456 19.189 2.700   1.00 29.43  ? 40  SER A C   1 
ATOM   191  O  O   . SER A 1 60  ? -30.614 18.580 3.351   1.00 28.66  ? 40  SER A O   1 
ATOM   192  C  CB  . SER A 1 60  ? -33.361 20.354 3.866   1.00 29.44  ? 40  SER A CB  1 
ATOM   193  O  OG  . SER A 1 60  ? -33.282 19.368 4.865   1.00 44.29  ? 40  SER A OG  1 
ATOM   194  N  N   . GLU A 1 61  ? -31.932 18.727 1.553   1.00 32.31  ? 41  GLU A N   1 
ATOM   195  C  CA  . GLU A 1 61  ? -31.433 17.485 0.965   1.00 37.67  ? 41  GLU A CA  1 
ATOM   196  C  C   . GLU A 1 61  ? -29.935 17.544 0.683   1.00 35.58  ? 41  GLU A C   1 
ATOM   197  O  O   . GLU A 1 61  ? -29.251 16.529 0.769   1.00 33.39  ? 41  GLU A O   1 
ATOM   198  C  CB  . GLU A 1 61  ? -32.182 17.143 -0.331  1.00 37.64  ? 41  GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 61  ? -33.642 16.745 -0.144  1.00 38.29  ? 41  GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 61  ? -34.564 17.933 0.130   1.00 42.63  ? 41  GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 61  ? -34.092 19.103 0.069   1.00 37.56  ? 41  GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 61  ? -35.765 17.688 0.407   1.00 45.51  ? 41  GLU A OE2 1 
ATOM   203  N  N   . GLU A 1 62  ? -29.429 18.726 0.347   1.00 32.20  ? 42  GLU A N   1 
ATOM   204  C  CA  . GLU A 1 62  ? -28.008 18.874 0.037   1.00 32.60  ? 42  GLU A CA  1 
ATOM   205  C  C   . GLU A 1 62  ? -27.124 18.915 1.291   1.00 33.23  ? 42  GLU A C   1 
ATOM   206  O  O   . GLU A 1 62  ? -25.948 18.561 1.229   1.00 37.97  ? 42  GLU A O   1 
ATOM   207  C  CB  . GLU A 1 62  ? -27.749 20.113 -0.843  1.00 29.68  ? 42  GLU A CB  1 
ATOM   208  C  CG  . GLU A 1 62  ? -28.617 20.184 -2.091  1.00 40.68  ? 42  GLU A CG  1 
ATOM   209  C  CD  . GLU A 1 62  ? -28.207 21.299 -3.036  1.00 46.33  ? 42  GLU A CD  1 
ATOM   210  O  OE1 . GLU A 1 62  ? -27.477 20.993 -4.017  1.00 48.94  ? 42  GLU A OE1 1 
ATOM   211  O  OE2 . GLU A 1 62  ? -28.618 22.469 -2.804  1.00 41.93  ? 42  GLU A OE2 1 
ATOM   212  N  N   . VAL A 1 63  ? -27.690 19.332 2.420   1.00 27.41  ? 43  VAL A N   1 
ATOM   213  C  CA  . VAL A 1 63  ? -26.913 19.530 3.645   1.00 26.06  ? 43  VAL A CA  1 
ATOM   214  C  C   . VAL A 1 63  ? -27.016 18.365 4.649   1.00 26.99  ? 43  VAL A C   1 
ATOM   215  O  O   . VAL A 1 63  ? -26.058 18.067 5.364   1.00 24.99  ? 43  VAL A O   1 
ATOM   216  C  CB  . VAL A 1 63  ? -27.343 20.831 4.358   1.00 25.36  ? 43  VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 63  ? -26.555 21.026 5.629   1.00 24.09  ? 43  VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 63  ? -27.150 22.010 3.467   1.00 25.51  ? 43  VAL A CG2 1 
ATOM   219  N  N   . PHE A 1 64  ? -28.180 17.720 4.707   1.00 28.00  ? 44  PHE A N   1 
ATOM   220  C  CA  . PHE A 1 64  ? -28.429 16.672 5.690   1.00 26.50  ? 44  PHE A CA  1 
ATOM   221  C  C   . PHE A 1 64  ? -28.508 15.295 5.070   1.00 28.06  ? 44  PHE A C   1 
ATOM   222  O  O   . PHE A 1 64  ? -29.284 15.069 4.143   1.00 29.95  ? 44  PHE A O   1 
ATOM   223  C  CB  . PHE A 1 64  ? -29.708 16.958 6.473   1.00 26.57  ? 44  PHE A CB  1 
ATOM   224  C  CG  . PHE A 1 64  ? -29.550 18.045 7.484   1.00 29.66  ? 44  PHE A CG  1 
ATOM   225  C  CD1 . PHE A 1 64  ? -28.897 17.801 8.678   1.00 32.94  ? 44  PHE A CD1 1 
ATOM   226  C  CD2 . PHE A 1 64  ? -30.029 19.315 7.238   1.00 27.06  ? 44  PHE A CD2 1 
ATOM   227  C  CE1 . PHE A 1 64  ? -28.721 18.806 9.612   1.00 30.41  ? 44  PHE A CE1 1 
ATOM   228  C  CE2 . PHE A 1 64  ? -29.862 20.319 8.157   1.00 24.55  ? 44  PHE A CE2 1 
ATOM   229  C  CZ  . PHE A 1 64  ? -29.207 20.067 9.354   1.00 26.87  ? 44  PHE A CZ  1 
ATOM   230  N  N   . ASP A 1 65  ? -27.710 14.367 5.589   1.00 27.18  ? 45  ASP A N   1 
ATOM   231  C  CA  . ASP A 1 65  ? -27.739 13.020 5.063   1.00 28.22  ? 45  ASP A CA  1 
ATOM   232  C  C   . ASP A 1 65  ? -28.889 12.184 5.611   1.00 28.85  ? 45  ASP A C   1 
ATOM   233  O  O   . ASP A 1 65  ? -29.697 12.654 6.412   1.00 28.47  ? 45  ASP A O   1 
ATOM   234  C  CB  . ASP A 1 65  ? -26.390 12.311 5.212   1.00 27.80  ? 45  ASP A CB  1 
ATOM   235  C  CG  . ASP A 1 65  ? -26.059 11.917 6.639   1.00 28.32  ? 45  ASP A CG  1 
ATOM   236  O  OD1 . ASP A 1 65  ? -26.951 11.851 7.516   1.00 27.06  ? 45  ASP A OD1 1 
ATOM   237  O  OD2 . ASP A 1 65  ? -24.865 11.640 6.880   1.00 39.22  ? 45  ASP A OD2 1 
ATOM   238  N  N   . LEU A 1 66  ? -28.932 10.935 5.170   1.00 31.38  ? 46  LEU A N   1 
ATOM   239  C  CA  . LEU A 1 66  ? -29.971 9.987  5.517   1.00 30.72  ? 46  LEU A CA  1 
ATOM   240  C  C   . LEU A 1 66  ? -30.336 9.951  6.997   1.00 34.96  ? 46  LEU A C   1 
ATOM   241  O  O   . LEU A 1 66  ? -31.506 9.764  7.351   1.00 38.46  ? 46  LEU A O   1 
ATOM   242  C  CB  . LEU A 1 66  ? -29.507 8.606  5.091   1.00 31.62  ? 46  LEU A CB  1 
ATOM   243  C  CG  . LEU A 1 66  ? -30.674 7.700  4.774   1.00 33.14  ? 46  LEU A CG  1 
ATOM   244  C  CD1 . LEU A 1 66  ? -31.582 8.440  3.806   1.00 34.89  ? 46  LEU A CD1 1 
ATOM   245  C  CD2 . LEU A 1 66  ? -30.150 6.415  4.194   1.00 36.23  ? 46  LEU A CD2 1 
ATOM   246  N  N   . ASP A 1 67  ? -29.335 10.133 7.856   1.00 30.34  ? 47  ASP A N   1 
ATOM   247  C  CA  . ASP A 1 67  ? -29.514 10.051 9.301   1.00 27.64  ? 47  ASP A CA  1 
ATOM   248  C  C   . ASP A 1 67  ? -29.837 11.389 9.957   1.00 26.73  ? 47  ASP A C   1 
ATOM   249  O  O   . ASP A 1 67  ? -29.844 11.483 11.195  1.00 27.31  ? 47  ASP A O   1 
ATOM   250  C  CB  . ASP A 1 67  ? -28.231 9.530  9.932   1.00 28.47  ? 47  ASP A CB  1 
ATOM   251  C  CG  . ASP A 1 67  ? -27.865 8.145  9.458   1.00 35.78  ? 47  ASP A CG  1 
ATOM   252  O  OD1 . ASP A 1 67  ? -28.787 7.312  9.318   1.00 40.83  ? 47  ASP A OD1 1 
ATOM   253  O  OD2 . ASP A 1 67  ? -26.656 7.889  9.248   1.00 37.03  ? 47  ASP A OD2 1 
ATOM   254  N  N   . GLY A 1 68  ? -30.063 12.426 9.144   1.00 26.91  ? 48  GLY A N   1 
ATOM   255  C  CA  . GLY A 1 68  ? -30.250 13.780 9.643   1.00 26.11  ? 48  GLY A CA  1 
ATOM   256  C  C   . GLY A 1 68  ? -28.967 14.418 10.157  1.00 26.38  ? 48  GLY A C   1 
ATOM   257  O  O   . GLY A 1 68  ? -28.997 15.396 10.895  1.00 28.66  ? 48  GLY A O   1 
ATOM   258  N  N   . ILE A 1 69  ? -27.835 13.850 9.755   1.00 25.85  ? 49  ILE A N   1 
ATOM   259  C  CA  . ILE A 1 69  ? -26.498 14.354 10.078  1.00 23.62  ? 49  ILE A CA  1 
ATOM   260  C  C   . ILE A 1 69  ? -25.980 15.328 9.009   1.00 24.46  ? 49  ILE A C   1 
ATOM   261  O  O   . ILE A 1 69  ? -26.097 15.065 7.818   1.00 24.55  ? 49  ILE A O   1 
ATOM   262  C  CB  . ILE A 1 69  ? -25.520 13.171 10.173  1.00 23.59  ? 49  ILE A CB  1 
ATOM   263  C  CG1 . ILE A 1 69  ? -26.046 12.132 11.175  1.00 23.67  ? 49  ILE A CG1 1 
ATOM   264  C  CG2 . ILE A 1 69  ? -24.118 13.634 10.513  1.00 22.60  ? 49  ILE A CG2 1 
ATOM   265  C  CD1 . ILE A 1 69  ? -26.174 12.651 12.575  1.00 22.71  ? 49  ILE A CD1 1 
ATOM   266  N  N   . PRO A 1 70  ? -25.422 16.473 9.433   1.00 25.21  ? 50  PRO A N   1 
ATOM   267  C  CA  . PRO A 1 70  ? -24.935 17.477 8.480   1.00 22.71  ? 50  PRO A CA  1 
ATOM   268  C  C   . PRO A 1 70  ? -23.676 17.042 7.751   1.00 22.78  ? 50  PRO A C   1 
ATOM   269  O  O   . PRO A 1 70  ? -22.815 16.333 8.291   1.00 22.37  ? 50  PRO A O   1 
ATOM   270  C  CB  . PRO A 1 70  ? -24.616 18.690 9.367   1.00 21.69  ? 50  PRO A CB  1 
ATOM   271  C  CG  . PRO A 1 70  ? -25.383 18.472 10.601  1.00 21.43  ? 50  PRO A CG  1 
ATOM   272  C  CD  . PRO A 1 70  ? -25.391 16.987 10.809  1.00 25.58  ? 50  PRO A CD  1 
ATOM   273  N  N   . ARG A 1 71  ? -23.584 17.488 6.506   1.00 23.37  ? 51  ARG A N   1 
ATOM   274  C  CA  . ARG A 1 71  ? -22.427 17.232 5.679   1.00 23.57  ? 51  ARG A CA  1 
ATOM   275  C  C   . ARG A 1 71  ? -21.560 18.474 5.750   1.00 23.58  ? 51  ARG A C   1 
ATOM   276  O  O   . ARG A 1 71  ? -21.855 19.481 5.114   1.00 24.78  ? 51  ARG A O   1 
ATOM   277  C  CB  . ARG A 1 71  ? -22.870 16.969 4.245   1.00 24.83  ? 51  ARG A CB  1 
ATOM   278  C  CG  . ARG A 1 71  ? -23.807 15.784 4.089   1.00 25.83  ? 51  ARG A CG  1 
ATOM   279  C  CD  . ARG A 1 71  ? -23.854 15.395 2.634   1.00 27.13  ? 51  ARG A CD  1 
ATOM   280  N  NE  . ARG A 1 71  ? -24.638 14.192 2.369   1.00 32.85  ? 51  ARG A NE  1 
ATOM   281  C  CZ  . ARG A 1 71  ? -25.951 14.191 2.146   1.00 38.52  ? 51  ARG A CZ  1 
ATOM   282  N  NH1 . ARG A 1 71  ? -26.633 15.335 2.195   1.00 38.24  ? 51  ARG A NH1 1 
ATOM   283  N  NH2 . ARG A 1 71  ? -26.590 13.051 1.887   1.00 40.31  ? 51  ARG A NH2 1 
ATOM   284  N  N   . VAL A 1 72  ? -20.494 18.402 6.537   1.00 24.40  ? 52  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 72  ? -19.738 19.596 6.893   1.00 23.71  ? 52  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 72  ? -18.907 20.150 5.730   1.00 27.02  ? 52  VAL A C   1 
ATOM   287  O  O   . VAL A 1 72  ? -18.733 21.368 5.621   1.00 28.37  ? 52  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 72  ? -18.850 19.362 8.149   1.00 21.48  ? 52  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 72  ? -17.709 18.421 7.832   1.00 22.15  ? 52  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 72  ? -18.327 20.676 8.680   1.00 20.28  ? 52  VAL A CG2 1 
ATOM   291  N  N   . ASP A 1 73  ? -18.419 19.270 4.854   1.00 31.12  ? 53  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 73  ? -17.580 19.722 3.743   1.00 29.58  ? 53  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 73  ? -18.396 20.363 2.638   1.00 28.56  ? 53  ASP A C   1 
ATOM   294  O  O   . ASP A 1 73  ? -17.902 21.237 1.923   1.00 27.02  ? 53  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 73  ? -16.691 18.604 3.198   1.00 30.95  ? 53  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 73  ? -15.496 18.335 4.099   1.00 42.65  ? 53  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 73  ? -15.109 19.259 4.857   1.00 40.61  ? 53  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 73  ? -14.955 17.206 4.062   1.00 51.67  ? 53  ASP A OD2 1 
ATOM   299  N  N   . VAL A 1 74  ? -19.648 19.934 2.512   1.00 25.74  ? 54  VAL A N   1 
ATOM   300  C  CA  . VAL A 1 74  ? -20.570 20.572 1.593   1.00 26.48  ? 54  VAL A CA  1 
ATOM   301  C  C   . VAL A 1 74  ? -20.874 21.968 2.108   1.00 25.40  ? 54  VAL A C   1 
ATOM   302  O  O   . VAL A 1 74  ? -20.844 22.937 1.356   1.00 32.19  ? 54  VAL A O   1 
ATOM   303  C  CB  . VAL A 1 74  ? -21.855 19.775 1.473   1.00 27.41  ? 54  VAL A CB  1 
ATOM   304  C  CG1 . VAL A 1 74  ? -22.964 20.631 0.889   1.00 27.90  ? 54  VAL A CG1 1 
ATOM   305  C  CG2 . VAL A 1 74  ? -21.597 18.546 0.620   1.00 28.95  ? 54  VAL A CG2 1 
ATOM   306  N  N   . LEU A 1 75  ? -21.121 22.066 3.406   1.00 25.42  ? 55  LEU A N   1 
ATOM   307  C  CA  . LEU A 1 75  ? -21.408 23.340 4.041   1.00 24.19  ? 55  LEU A CA  1 
ATOM   308  C  C   . LEU A 1 75  ? -20.249 24.318 3.915   1.00 23.10  ? 55  LEU A C   1 
ATOM   309  O  O   . LEU A 1 75  ? -20.440 25.488 3.612   1.00 27.94  ? 55  LEU A O   1 
ATOM   310  C  CB  . LEU A 1 75  ? -21.750 23.147 5.520   1.00 22.26  ? 55  LEU A CB  1 
ATOM   311  C  CG  . LEU A 1 75  ? -22.119 24.479 6.185   1.00 22.69  ? 55  LEU A CG  1 
ATOM   312  C  CD1 . LEU A 1 75  ? -23.398 25.074 5.600   1.00 22.31  ? 55  LEU A CD1 1 
ATOM   313  C  CD2 . LEU A 1 75  ? -22.242 24.327 7.684   1.00 24.85  ? 55  LEU A CD2 1 
ATOM   314  N  N   . LYS A 1 76  ? -19.041 23.837 4.155   1.00 22.77  ? 56  LYS A N   1 
ATOM   315  C  CA  . LYS A 1 76  ? -17.873 24.695 4.052   1.00 22.65  ? 56  LYS A CA  1 
ATOM   316  C  C   . LYS A 1 76  ? -17.667 25.219 2.636   1.00 25.52  ? 56  LYS A C   1 
ATOM   317  O  O   . LYS A 1 76  ? -17.492 26.419 2.451   1.00 25.26  ? 56  LYS A O   1 
ATOM   318  C  CB  . LYS A 1 76  ? -16.621 23.966 4.526   1.00 22.91  ? 56  LYS A CB  1 
ATOM   319  C  CG  . LYS A 1 76  ? -15.366 24.773 4.321   1.00 27.30  ? 56  LYS A CG  1 
ATOM   320  C  CD  . LYS A 1 76  ? -14.149 23.932 4.588   1.00 28.75  ? 56  LYS A CD  1 
ATOM   321  C  CE  . LYS A 1 76  ? -12.924 24.560 3.951   1.00 29.80  ? 56  LYS A CE  1 
ATOM   322  N  NZ  . LYS A 1 76  ? -11.897 23.501 3.678   1.00 36.79  ? 56  LYS A NZ  1 
ATOM   323  N  N   . ASN A 1 77  ? -17.694 24.328 1.641   1.00 24.55  ? 57  ASN A N   1 
ATOM   324  C  CA  . ASN A 1 77  ? -17.447 24.741 0.254   1.00 26.28  ? 57  ASN A CA  1 
ATOM   325  C  C   . ASN A 1 77  ? -18.446 25.786 -0.217  1.00 26.82  ? 57  ASN A C   1 
ATOM   326  O  O   . ASN A 1 77  ? -18.115 26.678 -0.983  1.00 32.97  ? 57  ASN A O   1 
ATOM   327  C  CB  . ASN A 1 77  ? -17.429 23.554 -0.723  1.00 27.25  ? 57  ASN A CB  1 
ATOM   328  C  CG  . ASN A 1 77  ? -16.385 22.488 -0.347  1.00 27.90  ? 57  ASN A CG  1 
ATOM   329  O  OD1 . ASN A 1 77  ? -15.419 22.765 0.371   1.00 28.82  ? 57  ASN A OD1 1 
ATOM   330  N  ND2 . ASN A 1 77  ? -16.592 21.256 -0.830  1.00 28.24  ? 57  ASN A ND2 1 
ATOM   331  N  N   . HIS A 1 78  ? -19.670 25.679 0.266   1.00 25.95  ? 58  HIS A N   1 
ATOM   332  C  CA  . HIS A 1 78  ? -20.694 26.641 -0.067  1.00 26.43  ? 58  HIS A CA  1 
ATOM   333  C  C   . HIS A 1 78  ? -20.431 27.967 0.625   1.00 27.14  ? 58  HIS A C   1 
ATOM   334  O  O   . HIS A 1 78  ? -20.556 29.014 0.012   1.00 28.58  ? 58  HIS A O   1 
ATOM   335  C  CB  . HIS A 1 78  ? -22.051 26.105 0.362   1.00 26.39  ? 58  HIS A CB  1 
ATOM   336  C  CG  . HIS A 1 78  ? -23.202 26.840 -0.232  1.00 28.80  ? 58  HIS A CG  1 
ATOM   337  N  ND1 . HIS A 1 78  ? -23.496 26.791 -1.576  1.00 29.25  ? 58  HIS A ND1 1 
ATOM   338  C  CD2 . HIS A 1 78  ? -24.132 27.644 0.331   1.00 29.24  ? 58  HIS A CD2 1 
ATOM   339  C  CE1 . HIS A 1 78  ? -24.565 27.529 -1.812  1.00 30.90  ? 58  HIS A CE1 1 
ATOM   340  N  NE2 . HIS A 1 78  ? -24.970 28.058 -0.674  1.00 28.62  ? 58  HIS A NE2 1 
ATOM   341  N  N   . LEU A 1 79  ? -20.072 27.929 1.904   1.00 24.24  ? 59  LEU A N   1 
ATOM   342  C  CA  . LEU A 1 79  ? -19.858 29.168 2.655   1.00 23.56  ? 59  LEU A CA  1 
ATOM   343  C  C   . LEU A 1 79  ? -18.625 29.935 2.166   1.00 23.96  ? 59  LEU A C   1 
ATOM   344  O  O   . LEU A 1 79  ? -18.659 31.164 2.072   1.00 24.35  ? 59  LEU A O   1 
ATOM   345  C  CB  . LEU A 1 79  ? -19.781 28.912 4.162   1.00 22.14  ? 59  LEU A CB  1 
ATOM   346  C  CG  . LEU A 1 79  ? -21.021 28.333 4.842   1.00 21.81  ? 59  LEU A CG  1 
ATOM   347  C  CD1 . LEU A 1 79  ? -20.723 28.025 6.286   1.00 20.57  ? 59  LEU A CD1 1 
ATOM   348  C  CD2 . LEU A 1 79  ? -22.184 29.285 4.737   1.00 22.35  ? 59  LEU A CD2 1 
ATOM   349  N  N   . VAL A 1 80  ? -17.554 29.216 1.839   1.00 24.09  ? 60  VAL A N   1 
ATOM   350  C  CA  . VAL A 1 80  ? -16.362 29.850 1.280   1.00 25.37  ? 60  VAL A CA  1 
ATOM   351  C  C   . VAL A 1 80  ? -16.677 30.647 0.020   1.00 29.61  ? 60  VAL A C   1 
ATOM   352  O  O   . VAL A 1 80  ? -16.052 31.670 -0.241  1.00 29.87  ? 60  VAL A O   1 
ATOM   353  C  CB  . VAL A 1 80  ? -15.270 28.828 0.928   1.00 25.56  ? 60  VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 80  ? -14.111 29.512 0.213   1.00 26.09  ? 60  VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 80  ? -14.777 28.113 2.175   1.00 23.76  ? 60  VAL A CG2 1 
ATOM   356  N  N   . LYS A 1 81  ? -17.662 30.191 -0.752  1.00 30.30  ? 61  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 81  ? -18.059 30.887 -1.983  1.00 30.11  ? 61  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 81  ? -19.034 32.033 -1.709  1.00 36.30  ? 61  LYS A C   1 
ATOM   359  O  O   . LYS A 1 81  ? -19.523 32.661 -2.638  1.00 43.52  ? 61  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 81  ? -18.640 29.896 -3.008  1.00 29.76  ? 61  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 81  ? -17.616 28.850 -3.461  1.00 30.11  ? 61  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 81  ? -18.124 27.928 -4.566  1.00 31.99  ? 61  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 81  ? -19.376 27.164 -4.161  1.00 38.55  ? 61  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 81  ? -19.335 25.725 -4.595  1.00 43.36  ? 61  LYS A NZ  1 
ATOM   365  N  N   . GLU A 1 82  ? -19.274 32.306 -0.428  1.00 29.71  ? 62  GLU A N   1 
ATOM   366  C  CA  . GLU A 1 82  ? -20.265 33.273 0.045   1.00 27.48  ? 62  GLU A CA  1 
ATOM   367  C  C   . GLU A 1 82  ? -21.693 32.786 -0.142  1.00 27.82  ? 62  GLU A C   1 
ATOM   368  O  O   . GLU A 1 82  ? -22.634 33.591 -0.134  1.00 28.45  ? 62  GLU A O   1 
ATOM   369  C  CB  . GLU A 1 82  ? -20.095 34.661 -0.575  1.00 28.82  ? 62  GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 82  ? -18.790 35.312 -0.236  1.00 36.29  ? 62  GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 82  ? -18.675 36.739 -0.739  1.00 38.02  ? 62  GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 82  ? -18.157 36.934 -1.875  1.00 33.89  ? 62  GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 82  ? -19.106 37.653 0.005   1.00 41.72  ? 62  GLU A OE2 1 
ATOM   374  N  N   . GLY A 1 83  ? -21.865 31.475 -0.298  1.00 27.57  ? 63  GLY A N   1 
ATOM   375  C  CA  . GLY A 1 83  ? -23.204 30.914 -0.398  1.00 27.98  ? 63  GLY A CA  1 
ATOM   376  C  C   . GLY A 1 83  ? -24.022 31.063 0.871   1.00 27.01  ? 63  GLY A C   1 
ATOM   377  O  O   . GLY A 1 83  ? -23.490 31.339 1.951   1.00 27.58  ? 63  GLY A O   1 
ATOM   378  N  N   . ARG A 1 84  ? -25.318 30.825 0.759   1.00 27.68  ? 64  ARG A N   1 
ATOM   379  C  CA  . ARG A 1 84  ? -26.219 30.993 1.886   1.00 27.10  ? 64  ARG A CA  1 
ATOM   380  C  C   . ARG A 1 84  ? -27.046 29.714 1.979   1.00 29.60  ? 64  ARG A C   1 
ATOM   381  O  O   . ARG A 1 84  ? -27.108 28.977 0.997   1.00 31.56  ? 64  ARG A O   1 
ATOM   382  C  CB  . ARG A 1 84  ? -27.096 32.177 1.537   1.00 29.18  ? 64  ARG A CB  1 
ATOM   383  C  CG  . ARG A 1 84  ? -27.953 32.670 2.605   1.00 33.39  ? 64  ARG A CG  1 
ATOM   384  C  CD  . ARG A 1 84  ? -28.394 34.040 2.230   1.00 45.44  ? 64  ARG A CD  1 
ATOM   385  N  NE  . ARG A 1 84  ? -27.271 34.935 2.024   1.00 50.76  ? 64  ARG A NE  1 
ATOM   386  C  CZ  . ARG A 1 84  ? -27.427 36.194 1.643   1.00 54.21  ? 64  ARG A CZ  1 
ATOM   387  N  NH1 . ARG A 1 84  ? -28.657 36.651 1.433   1.00 50.90  ? 64  ARG A NH1 1 
ATOM   388  N  NH2 . ARG A 1 84  ? -26.372 36.986 1.469   1.00 57.77  ? 64  ARG A NH2 1 
ATOM   389  N  N   . VAL A 1 85  ? -27.670 29.417 3.118   1.00 26.58  ? 65  VAL A N   1 
ATOM   390  C  CA  . VAL A 1 85  ? -28.522 28.212 3.187   1.00 27.90  ? 65  VAL A CA  1 
ATOM   391  C  C   . VAL A 1 85  ? -30.011 28.530 3.383   1.00 28.96  ? 65  VAL A C   1 
ATOM   392  O  O   . VAL A 1 85  ? -30.364 29.631 3.828   1.00 29.26  ? 65  VAL A O   1 
ATOM   393  C  CB  . VAL A 1 85  ? -28.086 27.230 4.292   1.00 27.83  ? 65  VAL A CB  1 
ATOM   394  C  CG1 . VAL A 1 85  ? -26.590 27.036 4.299   1.00 24.79  ? 65  VAL A CG1 1 
ATOM   395  C  CG2 . VAL A 1 85  ? -28.574 27.716 5.654   1.00 32.12  ? 65  VAL A CG2 1 
ATOM   396  N  N   . ASP A 1 86  ? -30.875 27.567 3.072   1.00 31.25  ? 66  ASP A N   1 
ATOM   397  C  CA  . ASP A 1 86  ? -32.295 27.711 3.376   1.00 37.75  ? 66  ASP A CA  1 
ATOM   398  C  C   . ASP A 1 86  ? -32.447 28.051 4.846   1.00 38.87  ? 66  ASP A C   1 
ATOM   399  O  O   . ASP A 1 86  ? -31.891 27.363 5.706   1.00 38.65  ? 66  ASP A O   1 
ATOM   400  C  CB  . ASP A 1 86  ? -33.068 26.419 3.098   1.00 42.78  ? 66  ASP A CB  1 
ATOM   401  C  CG  . ASP A 1 86  ? -33.778 26.423 1.751   1.00 51.17  ? 66  ASP A CG  1 
ATOM   402  O  OD1 . ASP A 1 86  ? -33.728 27.444 1.010   1.00 53.32  ? 66  ASP A OD1 1 
ATOM   403  O  OD2 . ASP A 1 86  ? -34.400 25.381 1.440   1.00 54.56  ? 66  ASP A OD2 1 
ATOM   404  N  N   . GLU A 1 87  ? -33.196 29.109 5.136   1.00 39.86  ? 67  GLU A N   1 
ATOM   405  C  CA  . GLU A 1 87  ? -33.421 29.526 6.517   1.00 35.82  ? 67  GLU A CA  1 
ATOM   406  C  C   . GLU A 1 87  ? -33.832 28.392 7.474   1.00 36.01  ? 67  GLU A C   1 
ATOM   407  O  O   . GLU A 1 87  ? -33.335 28.342 8.605   1.00 40.29  ? 67  GLU A O   1 
ATOM   408  C  CB  . GLU A 1 87  ? -34.390 30.703 6.580   1.00 36.61  ? 67  GLU A CB  1 
ATOM   409  C  CG  . GLU A 1 87  ? -35.451 30.589 7.670   1.00 40.07  ? 67  GLU A CG  1 
ATOM   410  C  CD  . GLU A 1 87  ? -35.880 31.942 8.173   1.00 47.73  ? 67  GLU A CD  1 
ATOM   411  O  OE1 . GLU A 1 87  ? -35.193 32.923 7.818   1.00 50.73  ? 67  GLU A OE1 1 
ATOM   412  O  OE2 . GLU A 1 87  ? -36.882 32.026 8.913   1.00 53.85  ? 67  GLU A OE2 1 
ATOM   413  N  N   . GLU A 1 88  ? -34.700 27.478 7.033   1.00 37.72  ? 68  GLU A N   1 
ATOM   414  C  CA  . GLU A 1 88  ? -35.086 26.339 7.886   1.00 42.78  ? 68  GLU A CA  1 
ATOM   415  C  C   . GLU A 1 88  ? -33.895 25.466 8.305   1.00 38.67  ? 68  GLU A C   1 
ATOM   416  O  O   . GLU A 1 88  ? -33.940 24.809 9.346   1.00 40.09  ? 68  GLU A O   1 
ATOM   417  C  CB  . GLU A 1 88  ? -36.154 25.477 7.217   1.00 53.53  ? 68  GLU A CB  1 
ATOM   418  C  CG  . GLU A 1 88  ? -37.502 26.177 7.029   1.00 65.27  ? 68  GLU A CG  1 
ATOM   419  C  CD  . GLU A 1 88  ? -38.499 25.337 6.213   1.00 74.87  ? 68  GLU A CD  1 
ATOM   420  O  OE1 . GLU A 1 88  ? -38.117 24.251 5.711   1.00 74.25  ? 68  GLU A OE1 1 
ATOM   421  O  OE2 . GLU A 1 88  ? -39.668 25.765 6.071   1.00 79.26  ? 68  GLU A OE2 1 
ATOM   422  N  N   . ILE A 1 89  ? -32.836 25.474 7.497   1.00 35.70  ? 69  ILE A N   1 
ATOM   423  C  CA  . ILE A 1 89  ? -31.603 24.750 7.800   1.00 33.57  ? 69  ILE A CA  1 
ATOM   424  C  C   . ILE A 1 89  ? -30.771 25.511 8.823   1.00 33.27  ? 69  ILE A C   1 
ATOM   425  O  O   . ILE A 1 89  ? -30.216 24.927 9.753   1.00 33.15  ? 69  ILE A O   1 
ATOM   426  C  CB  . ILE A 1 89  ? -30.767 24.567 6.536   1.00 33.39  ? 69  ILE A CB  1 
ATOM   427  C  CG1 . ILE A 1 89  ? -31.576 23.820 5.487   1.00 33.88  ? 69  ILE A CG1 1 
ATOM   428  C  CG2 . ILE A 1 89  ? -29.483 23.816 6.821   1.00 29.94  ? 69  ILE A CG2 1 
ATOM   429  C  CD1 . ILE A 1 89  ? -30.922 23.884 4.142   1.00 37.77  ? 69  ILE A CD1 1 
ATOM   430  N  N   . ALA A 1 90  ? -30.682 26.821 8.648   1.00 26.31  ? 70  ALA A N   1 
ATOM   431  C  CA  . ALA A 1 90  ? -30.025 27.651 9.639   1.00 23.73  ? 70  ALA A CA  1 
ATOM   432  C  C   . ALA A 1 90  ? -30.638 27.414 11.006  1.00 24.25  ? 70  ALA A C   1 
ATOM   433  O  O   . ALA A 1 90  ? -29.909 27.140 11.945  1.00 25.65  ? 70  ALA A O   1 
ATOM   434  C  CB  . ALA A 1 90  ? -30.107 29.093 9.265   1.00 26.38  ? 70  ALA A CB  1 
ATOM   435  N  N   . LEU A 1 91  ? -31.964 27.479 11.129  1.00 27.69  ? 71  LEU A N   1 
ATOM   436  C  CA  . LEU A 1 91  ? -32.600 27.224 12.430  1.00 28.34  ? 71  LEU A CA  1 
ATOM   437  C  C   . LEU A 1 91  ? -32.311 25.829 12.935  1.00 29.42  ? 71  LEU A C   1 
ATOM   438  O  O   . LEU A 1 91  ? -32.061 25.627 14.113  1.00 32.36  ? 71  LEU A O   1 
ATOM   439  C  CB  . LEU A 1 91  ? -34.108 27.408 12.380  1.00 27.06  ? 71  LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 91  ? -34.572 28.799 11.976  1.00 30.93  ? 71  LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 91  ? -36.099 28.836 11.925  1.00 29.17  ? 71  LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 91  ? -34.010 29.844 12.938  1.00 32.15  ? 71  LEU A CD2 1 
ATOM   443  N  N   . ARG A 1 92  ? -32.341 24.864 12.035  1.00 25.26  ? 72  ARG A N   1 
ATOM   444  C  CA  . ARG A 1 92  ? -32.139 23.481 12.430  1.00 25.34  ? 72  ARG A CA  1 
ATOM   445  C  C   . ARG A 1 92  ? -30.736 23.255 12.982  1.00 25.68  ? 72  ARG A C   1 
ATOM   446  O  O   . ARG A 1 92  ? -30.545 22.520 13.954  1.00 27.58  ? 72  ARG A O   1 
ATOM   447  C  CB  . ARG A 1 92  ? -32.399 22.572 11.238  1.00 26.43  ? 72  ARG A CB  1 
ATOM   448  C  CG  . ARG A 1 92  ? -32.129 21.126 11.507  1.00 26.75  ? 72  ARG A CG  1 
ATOM   449  C  CD  . ARG A 1 92  ? -32.688 20.311 10.364  1.00 34.18  ? 72  ARG A CD  1 
ATOM   450  N  NE  . ARG A 1 92  ? -32.383 18.897 10.536  1.00 39.96  ? 72  ARG A NE  1 
ATOM   451  C  CZ  . ARG A 1 92  ? -32.650 17.970 9.626   1.00 41.56  ? 72  ARG A CZ  1 
ATOM   452  N  NH1 . ARG A 1 92  ? -33.229 18.320 8.477   1.00 39.13  ? 72  ARG A NH1 1 
ATOM   453  N  NH2 . ARG A 1 92  ? -32.337 16.702 9.871   1.00 42.61  ? 72  ARG A NH2 1 
ATOM   454  N  N   . ILE A 1 93  ? -29.759 23.904 12.360  1.00 27.87  ? 73  ILE A N   1 
ATOM   455  C  CA  . ILE A 1 93  ? -28.376 23.807 12.805  1.00 25.37  ? 73  ILE A CA  1 
ATOM   456  C  C   . ILE A 1 93  ? -28.216 24.492 14.144  1.00 25.85  ? 73  ILE A C   1 
ATOM   457  O  O   . ILE A 1 93  ? -27.780 23.877 15.112  1.00 30.45  ? 73  ILE A O   1 
ATOM   458  C  CB  . ILE A 1 93  ? -27.398 24.403 11.769  1.00 23.14  ? 73  ILE A CB  1 
ATOM   459  C  CG1 . ILE A 1 93  ? -27.234 23.430 10.595  1.00 25.45  ? 73  ILE A CG1 1 
ATOM   460  C  CG2 . ILE A 1 93  ? -26.041 24.697 12.395  1.00 20.03  ? 73  ILE A CG2 1 
ATOM   461  C  CD1 . ILE A 1 93  ? -26.760 24.090 9.301   1.00 23.78  ? 73  ILE A CD1 1 
ATOM   462  N  N   . ILE A 1 94  ? -28.583 25.764 14.202  1.00 22.70  ? 74  ILE A N   1 
ATOM   463  C  CA  . ILE A 1 94  ? -28.507 26.525 15.442  1.00 20.32  ? 74  ILE A CA  1 
ATOM   464  C  C   . ILE A 1 94  ? -29.260 25.874 16.616  1.00 22.16  ? 74  ILE A C   1 
ATOM   465  O  O   . ILE A 1 94  ? -28.721 25.819 17.717  1.00 24.35  ? 74  ILE A O   1 
ATOM   466  C  CB  . ILE A 1 94  ? -28.999 27.945 15.211  1.00 20.66  ? 74  ILE A CB  1 
ATOM   467  C  CG1 . ILE A 1 94  ? -28.062 28.629 14.233  1.00 20.18  ? 74  ILE A CG1 1 
ATOM   468  C  CG2 . ILE A 1 94  ? -29.043 28.722 16.500  1.00 20.41  ? 74  ILE A CG2 1 
ATOM   469  C  CD1 . ILE A 1 94  ? -28.620 29.919 13.693  1.00 24.47  ? 74  ILE A CD1 1 
ATOM   470  N  N   . ASN A 1 95  ? -30.475 25.358 16.395  1.00 22.07  ? 75  ASN A N   1 
ATOM   471  C  CA  . ASN A 1 95  ? -31.217 24.730 17.497  1.00 22.80  ? 75  ASN A CA  1 
ATOM   472  C  C   . ASN A 1 95  ? -30.626 23.414 17.978  1.00 22.61  ? 75  ASN A C   1 
ATOM   473  O  O   . ASN A 1 95  ? -30.685 23.110 19.173  1.00 22.72  ? 75  ASN A O   1 
ATOM   474  C  CB  . ASN A 1 95  ? -32.699 24.512 17.180  1.00 24.45  ? 75  ASN A CB  1 
ATOM   475  C  CG  . ASN A 1 95  ? -33.443 25.802 16.886  1.00 27.89  ? 75  ASN A CG  1 
ATOM   476  O  OD1 . ASN A 1 95  ? -33.122 26.879 17.403  1.00 28.53  ? 75  ASN A OD1 1 
ATOM   477  N  ND2 . ASN A 1 95  ? -34.458 25.693 16.036  1.00 29.67  ? 75  ASN A ND2 1 
ATOM   478  N  N   . GLU A 1 96  ? -30.090 22.607 17.065  1.00 24.02  ? 76  GLU A N   1 
ATOM   479  C  CA  . GLU A 1 96  ? -29.536 21.325 17.490  1.00 28.72  ? 76  GLU A CA  1 
ATOM   480  C  C   . GLU A 1 96  ? -28.255 21.576 18.261  1.00 25.11  ? 76  GLU A C   1 
ATOM   481  O  O   . GLU A 1 96  ? -27.978 20.929 19.273  1.00 28.05  ? 76  GLU A O   1 
ATOM   482  C  CB  . GLU A 1 96  ? -29.303 20.362 16.325  1.00 38.30  ? 76  GLU A CB  1 
ATOM   483  C  CG  . GLU A 1 96  ? -28.549 19.105 16.780  1.00 48.63  ? 76  GLU A CG  1 
ATOM   484  C  CD  . GLU A 1 96  ? -28.925 17.834 16.017  1.00 55.25  ? 76  GLU A CD  1 
ATOM   485  O  OE1 . GLU A 1 96  ? -28.665 16.720 16.555  1.00 47.50  ? 76  GLU A OE1 1 
ATOM   486  O  OE2 . GLU A 1 96  ? -29.465 17.951 14.886  1.00 61.47  ? 76  GLU A OE2 1 
ATOM   487  N  N   . GLY A 1 97  ? -27.484 22.545 17.792  1.00 25.68  ? 77  GLY A N   1 
ATOM   488  C  CA  . GLY A 1 97  ? -26.330 23.014 18.535  1.00 21.82  ? 77  GLY A CA  1 
ATOM   489  C  C   . GLY A 1 97  ? -26.726 23.442 19.938  1.00 24.51  ? 77  GLY A C   1 
ATOM   490  O  O   . GLY A 1 97  ? -26.128 22.977 20.910  1.00 26.21  ? 77  GLY A O   1 
ATOM   491  N  N   . ALA A 1 98  ? -27.732 24.320 20.037  1.00 19.63  ? 78  ALA A N   1 
ATOM   492  C  CA  . ALA A 1 98  ? -28.242 24.812 21.322  1.00 19.93  ? 78  ALA A CA  1 
ATOM   493  C  C   . ALA A 1 98  ? -28.662 23.664 22.235  1.00 20.76  ? 78  ALA A C   1 
ATOM   494  O  O   . ALA A 1 98  ? -28.271 23.615 23.401  1.00 20.60  ? 78  ALA A O   1 
ATOM   495  C  CB  . ALA A 1 98  ? -29.398 25.742 21.111  1.00 20.70  ? 78  ALA A CB  1 
ATOM   496  N  N   . ALA A 1 99  ? -29.441 22.734 21.692  1.00 23.00  ? 79  ALA A N   1 
ATOM   497  C  CA  . ALA A 1 99  ? -29.830 21.538 22.422  1.00 22.83  ? 79  ALA A CA  1 
ATOM   498  C  C   . ALA A 1 99  ? -28.643 20.832 23.068  1.00 23.12  ? 79  ALA A C   1 
ATOM   499  O  O   . ALA A 1 99  ? -28.700 20.492 24.242  1.00 27.29  ? 79  ALA A O   1 
ATOM   500  C  CB  . ALA A 1 99  ? -30.576 20.591 21.514  1.00 23.99  ? 79  ALA A CB  1 
ATOM   501  N  N   . ILE A 1 100 ? -27.565 20.635 22.314  1.00 21.88  ? 80  ILE A N   1 
ATOM   502  C  CA  . ILE A 1 100 ? -26.381 19.930 22.828  1.00 20.92  ? 80  ILE A CA  1 
ATOM   503  C  C   . ILE A 1 100 ? -25.638 20.710 23.925  1.00 20.07  ? 80  ILE A C   1 
ATOM   504  O  O   . ILE A 1 100 ? -25.223 20.137 24.946  1.00 20.49  ? 80  ILE A O   1 
ATOM   505  C  CB  . ILE A 1 100 ? -25.415 19.605 21.688  1.00 20.32  ? 80  ILE A CB  1 
ATOM   506  C  CG1 . ILE A 1 100 ? -26.054 18.619 20.731  1.00 21.41  ? 80  ILE A CG1 1 
ATOM   507  C  CG2 . ILE A 1 100 ? -24.132 19.031 22.205  1.00 19.94  ? 80  ILE A CG2 1 
ATOM   508  C  CD1 . ILE A 1 100 ? -25.381 18.603 19.389  1.00 20.96  ? 80  ILE A CD1 1 
ATOM   509  N  N   . LEU A 1 101 ? -25.474 22.014 23.697  1.00 19.19  ? 81  LEU A N   1 
ATOM   510  C  CA  . LEU A 1 101 ? -24.775 22.921 24.610  1.00 18.48  ? 81  LEU A CA  1 
ATOM   511  C  C   . LEU A 1 101 ? -25.481 23.002 25.947  1.00 21.84  ? 81  LEU A C   1 
ATOM   512  O  O   . LEU A 1 101 ? -24.845 22.931 26.999  1.00 22.20  ? 81  LEU A O   1 
ATOM   513  C  CB  . LEU A 1 101 ? -24.717 24.317 23.986  1.00 18.68  ? 81  LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 101 ? -23.823 24.478 22.750  1.00 17.02  ? 81  LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 101 ? -24.025 25.835 22.132  1.00 16.73  ? 81  LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 101 ? -22.364 24.264 23.126  1.00 16.35  ? 81  LEU A CD2 1 
ATOM   517  N  N   . ARG A 1 102 ? -26.804 23.141 25.892  1.00 21.64  ? 82  ARG A N   1 
ATOM   518  C  CA  . ARG A 1 102 ? -27.651 23.229 27.086  1.00 22.68  ? 82  ARG A CA  1 
ATOM   519  C  C   . ARG A 1 102 ? -27.461 22.057 28.065  1.00 26.03  ? 82  ARG A C   1 
ATOM   520  O  O   . ARG A 1 102 ? -27.572 22.227 29.264  1.00 30.53  ? 82  ARG A O   1 
ATOM   521  C  CB  . ARG A 1 102 ? -29.098 23.335 26.630  1.00 22.28  ? 82  ARG A CB  1 
ATOM   522  C  CG  . ARG A 1 102 ? -30.130 23.516 27.709  1.00 28.21  ? 82  ARG A CG  1 
ATOM   523  C  CD  . ARG A 1 102 ? -31.501 23.709 27.063  1.00 39.12  ? 82  ARG A CD  1 
ATOM   524  N  NE  . ARG A 1 102 ? -31.505 24.841 26.126  1.00 44.38  ? 82  ARG A NE  1 
ATOM   525  C  CZ  . ARG A 1 102 ? -31.718 24.745 24.810  1.00 40.05  ? 82  ARG A CZ  1 
ATOM   526  N  NH1 . ARG A 1 102 ? -31.969 23.567 24.251  1.00 37.63  ? 82  ARG A NH1 1 
ATOM   527  N  NH2 . ARG A 1 102 ? -31.683 25.833 24.043  1.00 39.53  ? 82  ARG A NH2 1 
ATOM   528  N  N   . ARG A 1 103 ? -27.139 20.886 27.526  1.00 22.68  ? 83  ARG A N   1 
ATOM   529  C  CA  . ARG A 1 103 ? -26.883 19.658 28.281  1.00 24.21  ? 83  ARG A CA  1 
ATOM   530  C  C   . ARG A 1 103 ? -25.593 19.763 29.077  1.00 26.69  ? 83  ARG A C   1 
ATOM   531  O  O   . ARG A 1 103 ? -25.343 18.946 29.967  1.00 33.11  ? 83  ARG A O   1 
ATOM   532  C  CB  . ARG A 1 103 ? -26.653 18.524 27.268  1.00 32.49  ? 83  ARG A CB  1 
ATOM   533  C  CG  . ARG A 1 103 ? -27.531 17.287 27.387  1.00 41.06  ? 83  ARG A CG  1 
ATOM   534  C  CD  . ARG A 1 103 ? -26.890 16.200 28.290  1.00 51.10  ? 83  ARG A CD  1 
ATOM   535  N  NE  . ARG A 1 103 ? -25.444 16.013 28.098  1.00 57.36  ? 83  ARG A NE  1 
ATOM   536  C  CZ  . ARG A 1 103 ? -24.882 15.094 27.308  1.00 60.18  ? 83  ARG A CZ  1 
ATOM   537  N  NH1 . ARG A 1 103 ? -23.559 15.010 27.217  1.00 60.71  ? 83  ARG A NH1 1 
ATOM   538  N  NH2 . ARG A 1 103 ? -25.634 14.262 26.596  1.00 61.09  ? 83  ARG A NH2 1 
ATOM   539  N  N   . GLU A 1 104 ? -24.741 20.723 28.724  1.00 25.41  ? 84  GLU A N   1 
ATOM   540  C  CA  . GLU A 1 104 ? -23.367 20.708 29.217  1.00 21.08  ? 84  GLU A CA  1 
ATOM   541  C  C   . GLU A 1 104 ? -23.153 21.523 30.524  1.00 21.79  ? 84  GLU A C   1 
ATOM   542  O  O   . GLU A 1 104 ? -23.901 22.484 30.829  1.00 21.03  ? 84  GLU A O   1 
ATOM   543  C  CB  . GLU A 1 104 ? -22.396 21.181 28.120  1.00 23.83  ? 84  GLU A CB  1 
ATOM   544  C  CG  . GLU A 1 104 ? -22.263 20.239 26.908  1.00 29.22  ? 84  GLU A CG  1 
ATOM   545  C  CD  . GLU A 1 104 ? -21.116 20.633 25.964  1.00 34.08  ? 84  GLU A CD  1 
ATOM   546  O  OE1 . GLU A 1 104 ? -20.997 21.836 25.629  1.00 36.90  ? 84  GLU A OE1 1 
ATOM   547  O  OE2 . GLU A 1 104 ? -20.332 19.741 25.561  1.00 33.60  ? 84  GLU A OE2 1 
ATOM   548  N  N   . LYS A 1 105 ? -22.135 21.135 31.295  1.00 20.34  ? 85  LYS A N   1 
ATOM   549  C  CA  . LYS A 1 105 ? -21.875 21.794 32.569  1.00 20.56  ? 85  LYS A CA  1 
ATOM   550  C  C   . LYS A 1 105 ? -21.485 23.243 32.304  1.00 19.50  ? 85  LYS A C   1 
ATOM   551  O  O   . LYS A 1 105 ? -20.903 23.532 31.255  1.00 19.89  ? 85  LYS A O   1 
ATOM   552  C  CB  . LYS A 1 105 ? -20.716 21.122 33.325  1.00 20.84  ? 85  LYS A CB  1 
ATOM   553  C  CG  . LYS A 1 105 ? -20.589 19.630 33.131  1.00 23.90  ? 85  LYS A CG  1 
ATOM   554  C  CD  . LYS A 1 105 ? -20.456 18.968 34.478  1.00 22.94  ? 85  LYS A CD  1 
ATOM   555  C  CE  . LYS A 1 105 ? -19.729 17.642 34.370  1.00 23.63  ? 85  LYS A CE  1 
ATOM   556  N  NZ  . LYS A 1 105 ? -18.527 17.651 35.263  1.00 23.80  ? 85  LYS A NZ  1 
ATOM   557  N  N   . THR A 1 106 ? -21.805 24.142 33.239  1.00 20.80  ? 86  THR A N   1 
ATOM   558  C  CA  . THR A 1 106 ? -21.344 25.517 33.161  1.00 19.16  ? 86  THR A CA  1 
ATOM   559  C  C   . THR A 1 106 ? -19.823 25.558 33.171  1.00 19.39  ? 86  THR A C   1 
ATOM   560  O  O   . THR A 1 106 ? -19.206 26.423 32.554  1.00 20.98  ? 86  THR A O   1 
ATOM   561  C  CB  . THR A 1 106 ? -21.910 26.352 34.288  1.00 25.55  ? 86  THR A CB  1 
ATOM   562  O  OG1 . THR A 1 106 ? -23.335 26.315 34.188  1.00 25.52  ? 86  THR A OG1 1 
ATOM   563  C  CG2 . THR A 1 106 ? -21.448 27.797 34.185  1.00 33.25  ? 86  THR A CG2 1 
ATOM   564  N  N   . MET A 1 107 ? -19.205 24.623 33.861  1.00 18.95  ? 87  MET A N   1 
ATOM   565  C  CA  . MET A 1 107 ? -17.778 24.497 33.699  1.00 18.44  ? 87  MET A CA  1 
ATOM   566  C  C   . MET A 1 107 ? -17.413 23.112 33.243  1.00 20.07  ? 87  MET A C   1 
ATOM   567  O  O   . MET A 1 107 ? -17.253 22.207 34.048  1.00 24.57  ? 87  MET A O   1 
ATOM   568  C  CB  . MET A 1 107 ? -17.033 24.839 34.962  1.00 18.97  ? 87  MET A CB  1 
ATOM   569  C  CG  . MET A 1 107 ? -15.546 24.816 34.754  1.00 18.55  ? 87  MET A CG  1 
ATOM   570  S  SD  . MET A 1 107 ? -14.642 25.041 36.276  1.00 24.86  ? 87  MET A SD  1 
ATOM   571  C  CE  . MET A 1 107 ? -14.453 23.324 36.742  1.00 25.75  ? 87  MET A CE  1 
ATOM   572  N  N   . ILE A 1 108 ? -17.284 22.965 31.933  1.00 17.88  ? 88  ILE A N   1 
ATOM   573  C  CA  . ILE A 1 108 ? -16.989 21.684 31.324  1.00 18.69  ? 88  ILE A CA  1 
ATOM   574  C  C   . ILE A 1 108 ? -15.596 21.215 31.737  1.00 22.03  ? 88  ILE A C   1 
ATOM   575  O  O   . ILE A 1 108 ? -14.757 22.005 32.189  1.00 18.89  ? 88  ILE A O   1 
ATOM   576  C  CB  . ILE A 1 108 ? -17.078 21.779 29.794  1.00 17.37  ? 88  ILE A CB  1 
ATOM   577  C  CG1 . ILE A 1 108 ? -15.902 22.576 29.236  1.00 20.07  ? 88  ILE A CG1 1 
ATOM   578  C  CG2 . ILE A 1 108 ? -18.372 22.459 29.371  1.00 17.18  ? 88  ILE A CG2 1 
ATOM   579  C  CD1 . ILE A 1 108 ? -16.015 22.831 27.742  1.00 15.92  ? 88  ILE A CD1 1 
ATOM   580  N  N   . GLU A 1 109 ? -15.350 19.923 31.595  1.00 22.81  ? 89  GLU A N   1 
ATOM   581  C  CA  . GLU A 1 109 ? -14.018 19.419 31.850  1.00 19.42  ? 89  GLU A CA  1 
ATOM   582  C  C   . GLU A 1 109 ? -13.464 18.735 30.626  1.00 28.33  ? 89  GLU A C   1 
ATOM   583  O  O   . GLU A 1 109 ? -14.084 17.846 30.060  1.00 30.88  ? 89  GLU A O   1 
ATOM   584  C  CB  . GLU A 1 109 ? -14.028 18.491 33.045  1.00 20.77  ? 89  GLU A CB  1 
ATOM   585  C  CG  . GLU A 1 109 ? -14.566 19.174 34.308  1.00 29.35  ? 89  GLU A CG  1 
ATOM   586  C  CD  . GLU A 1 109 ? -14.544 18.254 35.517  1.00 43.18  ? 89  GLU A CD  1 
ATOM   587  O  OE1 . GLU A 1 109 ? -14.336 17.030 35.336  1.00 50.11  ? 89  GLU A OE1 1 
ATOM   588  O  OE2 . GLU A 1 109 ? -14.730 18.759 36.645  1.00 46.66  ? 89  GLU A OE2 1 
ATOM   589  N  N   . VAL A 1 110 ? -12.298 19.179 30.201  1.00 18.83  ? 90  VAL A N   1 
ATOM   590  C  CA  . VAL A 1 110 ? -11.726 18.694 28.968  1.00 18.75  ? 90  VAL A CA  1 
ATOM   591  C  C   . VAL A 1 110 ? -10.277 18.345 29.239  1.00 20.97  ? 90  VAL A C   1 
ATOM   592  O  O   . VAL A 1 110 ? -9.617  19.006 30.055  1.00 19.33  ? 90  VAL A O   1 
ATOM   593  C  CB  . VAL A 1 110 ? -11.834 19.751 27.841  1.00 17.62  ? 90  VAL A CB  1 
ATOM   594  C  CG1 . VAL A 1 110 ? -13.270 20.105 27.609  1.00 22.04  ? 90  VAL A CG1 1 
ATOM   595  C  CG2 . VAL A 1 110 ? -11.079 20.993 28.200  1.00 17.08  ? 90  VAL A CG2 1 
ATOM   596  N  N   . GLU A 1 111 ? -9.785  17.301 28.579  1.00 22.69  ? 91  GLU A N   1 
ATOM   597  C  CA  . GLU A 1 111 ? -8.442  16.827 28.850  1.00 26.44  ? 91  GLU A CA  1 
ATOM   598  C  C   . GLU A 1 111 ? -7.563  16.987 27.630  1.00 24.99  ? 91  GLU A C   1 
ATOM   599  O  O   . GLU A 1 111 ? -8.053  17.073 26.519  1.00 28.75  ? 91  GLU A O   1 
ATOM   600  C  CB  . GLU A 1 111 ? -8.462  15.379 29.350  1.00 36.54  ? 91  GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 111 ? -9.142  14.393 28.425  1.00 49.93  ? 91  GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 111 ? -10.645 14.284 28.659  1.00 57.25  ? 91  GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 111 ? -11.085 13.227 29.165  1.00 60.73  ? 91  GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 111 ? -11.386 15.242 28.327  1.00 55.48  ? 91  GLU A OE2 1 
ATOM   605  N  N   . ALA A 1 112 ? -6.258  17.066 27.847  1.00 30.21  ? 92  ALA A N   1 
ATOM   606  C  CA  . ALA A 1 112 ? -5.298  17.107 26.751  1.00 25.75  ? 92  ALA A CA  1 
ATOM   607  C  C   . ALA A 1 112 ? -5.329  15.774 25.997  1.00 29.47  ? 92  ALA A C   1 
ATOM   608  O  O   . ALA A 1 112 ? -5.745  14.755 26.554  1.00 36.39  ? 92  ALA A O   1 
ATOM   609  C  CB  . ALA A 1 112 ? -3.915  17.375 27.306  1.00 28.78  ? 92  ALA A CB  1 
ATOM   610  N  N   . PRO A 1 113 ? -4.911  15.769 24.722  1.00 25.82  ? 93  PRO A N   1 
ATOM   611  C  CA  . PRO A 1 113 ? -4.454  16.909 23.931  1.00 26.77  ? 93  PRO A CA  1 
ATOM   612  C  C   . PRO A 1 113 ? -5.617  17.782 23.465  1.00 26.35  ? 93  PRO A C   1 
ATOM   613  O  O   . PRO A 1 113 ? -6.736  17.288 23.313  1.00 27.52  ? 93  PRO A O   1 
ATOM   614  C  CB  . PRO A 1 113 ? -3.777  16.243 22.731  1.00 23.98  ? 93  PRO A CB  1 
ATOM   615  C  CG  . PRO A 1 113 ? -4.489  14.976 22.557  1.00 23.40  ? 93  PRO A CG  1 
ATOM   616  C  CD  . PRO A 1 113 ? -4.862  14.518 23.945  1.00 24.06  ? 93  PRO A CD  1 
ATOM   617  N  N   . ILE A 1 114 ? -5.346  19.068 23.256  1.00 22.47  ? 94  ILE A N   1 
ATOM   618  C  CA  . ILE A 1 114 ? -6.367  19.998 22.817  1.00 20.43  ? 94  ILE A CA  1 
ATOM   619  C  C   . ILE A 1 114 ? -5.745  21.222 22.158  1.00 21.97  ? 94  ILE A C   1 
ATOM   620  O  O   . ILE A 1 114 ? -4.615  21.602 22.476  1.00 23.80  ? 94  ILE A O   1 
ATOM   621  C  CB  . ILE A 1 114 ? -7.280  20.422 23.993  1.00 17.73  ? 94  ILE A CB  1 
ATOM   622  C  CG1 . ILE A 1 114 ? -8.681  20.776 23.477  1.00 16.94  ? 94  ILE A CG1 1 
ATOM   623  C  CG2 . ILE A 1 114 ? -6.644  21.551 24.786  1.00 17.48  ? 94  ILE A CG2 1 
ATOM   624  C  CD1 . ILE A 1 114 ? -9.755  20.771 24.528  1.00 16.85  ? 94  ILE A CD1 1 
ATOM   625  N  N   . THR A 1 115 ? -6.484  21.805 21.213  1.00 20.01  ? 95  THR A N   1 
ATOM   626  C  CA  . THR A 1 115 ? -6.154  23.092 20.590  1.00 17.05  ? 95  THR A CA  1 
ATOM   627  C  C   . THR A 1 115 ? -7.110  24.155 21.107  1.00 16.17  ? 95  THR A C   1 
ATOM   628  O  O   . THR A 1 115 ? -8.321  24.033 20.908  1.00 16.09  ? 95  THR A O   1 
ATOM   629  C  CB  . THR A 1 115 ? -6.375  23.043 19.086  1.00 17.17  ? 95  THR A CB  1 
ATOM   630  O  OG1 . THR A 1 115 ? -5.564  22.013 18.519  1.00 18.15  ? 95  THR A OG1 1 
ATOM   631  C  CG2 . THR A 1 115 ? -6.026  24.370 18.448  1.00 17.07  ? 95  THR A CG2 1 
ATOM   632  N  N   . VAL A 1 116 ? -6.567  25.191 21.754  1.00 16.12  ? 96  VAL A N   1 
ATOM   633  C  CA  . VAL A 1 116 ? -7.370  26.254 22.357  1.00 15.53  ? 96  VAL A CA  1 
ATOM   634  C  C   . VAL A 1 116 ? -7.284  27.499 21.511  1.00 15.50  ? 96  VAL A C   1 
ATOM   635  O  O   . VAL A 1 116 ? -6.203  27.911 21.146  1.00 16.05  ? 96  VAL A O   1 
ATOM   636  C  CB  . VAL A 1 116 ? -6.861  26.615 23.756  1.00 15.73  ? 96  VAL A CB  1 
ATOM   637  C  CG1 . VAL A 1 116 ? -7.773  27.648 24.421  1.00 15.28  ? 96  VAL A CG1 1 
ATOM   638  C  CG2 . VAL A 1 116 ? -6.753  25.369 24.606  1.00 16.04  ? 96  VAL A CG2 1 
ATOM   639  N  N   . CYS A 1 117 ? -8.427  28.101 21.214  1.00 15.02  ? 97  CYS A N   1 
ATOM   640  C  CA  . CYS A 1 117 ? -8.501  29.239 20.315  1.00 15.14  ? 97  CYS A CA  1 
ATOM   641  C  C   . CYS A 1 117 ? -9.202  30.402 20.994  1.00 14.95  ? 97  CYS A C   1 
ATOM   642  O  O   . CYS A 1 117 ? -10.117 30.188 21.789  1.00 14.57  ? 97  CYS A O   1 
ATOM   643  C  CB  . CYS A 1 117 ? -9.312  28.836 19.104  1.00 14.99  ? 97  CYS A CB  1 
ATOM   644  S  SG  . CYS A 1 117 ? -9.004  27.156 18.536  1.00 16.70  ? 97  CYS A SG  1 
ATOM   645  N  N   . GLY A 1 118 ? -8.795  31.630 20.665  1.00 15.41  ? 98  GLY A N   1 
ATOM   646  C  CA  . GLY A 1 118 ? -9.401  32.832 21.218  1.00 15.51  ? 98  GLY A CA  1 
ATOM   647  C  C   . GLY A 1 118 ? -10.345 33.476 20.240  1.00 15.57  ? 98  GLY A C   1 
ATOM   648  O  O   . GLY A 1 118 ? -10.780 32.818 19.322  1.00 15.34  ? 98  GLY A O   1 
ATOM   649  N  N   . ASP A 1 119 ? -10.642 34.761 20.431  1.00 16.05  ? 99  ASP A N   1 
ATOM   650  C  CA  . ASP A 1 119 ? -11.620 35.504 19.624  1.00 16.32  ? 99  ASP A CA  1 
ATOM   651  C  C   . ASP A 1 119 ? -11.519 35.226 18.124  1.00 16.55  ? 99  ASP A C   1 
ATOM   652  O  O   . ASP A 1 119 ? -10.421 35.139 17.576  1.00 22.28  ? 99  ASP A O   1 
ATOM   653  C  CB  . ASP A 1 119 ? -11.472 37.013 19.829  1.00 17.26  ? 99  ASP A CB  1 
ATOM   654  C  CG  . ASP A 1 119 ? -11.509 37.421 21.281  1.00 19.54  ? 99  ASP A CG  1 
ATOM   655  O  OD1 . ASP A 1 119 ? -11.214 36.547 22.128  1.00 22.14  ? 99  ASP A OD1 1 
ATOM   656  O  OD2 . ASP A 1 119 ? -11.822 38.617 21.574  1.00 22.07  ? 99  ASP A OD2 1 
ATOM   657  N  N   . ILE A 1 120 ? -12.677 35.096 17.481  1.00 16.85  ? 100 ILE A N   1 
ATOM   658  C  CA  . ILE A 1 120 ? -12.786 34.824 16.058  1.00 18.61  ? 100 ILE A CA  1 
ATOM   659  C  C   . ILE A 1 120 ? -13.377 36.050 15.392  1.00 22.97  ? 100 ILE A C   1 
ATOM   660  O  O   . ILE A 1 120 ? -12.888 36.510 14.370  1.00 21.47  ? 100 ILE A O   1 
ATOM   661  C  CB  . ILE A 1 120 ? -13.705 33.615 15.794  1.00 16.02  ? 100 ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 120 ? -13.021 32.334 16.258  1.00 15.47  ? 100 ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 120 ? -13.998 33.481 14.328  1.00 16.48  ? 100 ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 120 ? -11.718 32.113 15.553  1.00 15.89  ? 100 ILE A CD1 1 
ATOM   665  N  N   . HIS A 1 121 ? -14.446 36.564 15.982  1.00 24.71  ? 101 HIS A N   1 
ATOM   666  C  CA  . HIS A 1 121 ? -15.033 37.832 15.560  1.00 23.13  ? 101 HIS A CA  1 
ATOM   667  C  C   . HIS A 1 121 ? -15.537 37.897 14.116  1.00 22.42  ? 101 HIS A C   1 
ATOM   668  O  O   . HIS A 1 121 ? -15.339 38.901 13.432  1.00 25.66  ? 101 HIS A O   1 
ATOM   669  C  CB  . HIS A 1 121 ? -14.062 38.972 15.828  1.00 21.43  ? 101 HIS A CB  1 
ATOM   670  C  CG  . HIS A 1 121 ? -14.153 39.509 17.212  1.00 20.53  ? 101 HIS A CG  1 
ATOM   671  N  ND1 . HIS A 1 121 ? -15.351 39.600 17.890  1.00 19.18  ? 101 HIS A ND1 1 
ATOM   672  C  CD2 . HIS A 1 121 ? -13.199 39.956 18.064  1.00 26.24  ? 101 HIS A CD2 1 
ATOM   673  C  CE1 . HIS A 1 121 ? -15.128 40.100 19.095  1.00 23.08  ? 101 HIS A CE1 1 
ATOM   674  N  NE2 . HIS A 1 121 ? -13.833 40.323 19.223  1.00 26.77  ? 101 HIS A NE2 1 
ATOM   675  N  N   . GLY A 1 122 ? -16.203 36.839 13.672  1.00 21.64  ? 102 GLY A N   1 
ATOM   676  C  CA  . GLY A 1 122 ? -16.830 36.830 12.364  1.00 27.60  ? 102 GLY A CA  1 
ATOM   677  C  C   . GLY A 1 122 ? -15.859 36.700 11.205  1.00 28.27  ? 102 GLY A C   1 
ATOM   678  O  O   . GLY A 1 122 ? -16.238 36.877 10.055  1.00 29.71  ? 102 GLY A O   1 
ATOM   679  N  N   . GLN A 1 123 ? -14.605 36.379 11.497  1.00 20.46  ? 103 GLN A N   1 
ATOM   680  C  CA  . GLN A 1 123 ? -13.617 36.281 10.438  1.00 20.05  ? 103 GLN A CA  1 
ATOM   681  C  C   . GLN A 1 123 ? -13.537 34.881 9.829   1.00 19.61  ? 103 GLN A C   1 
ATOM   682  O  O   . GLN A 1 123 ? -12.529 34.185 9.949   1.00 19.37  ? 103 GLN A O   1 
ATOM   683  C  CB  . GLN A 1 123 ? -12.265 36.811 10.918  1.00 20.37  ? 103 GLN A CB  1 
ATOM   684  C  CG  . GLN A 1 123 ? -12.381 38.255 11.344  1.00 21.16  ? 103 GLN A CG  1 
ATOM   685  C  CD  . GLN A 1 123 ? -11.076 38.850 11.828  1.00 21.72  ? 103 GLN A CD  1 
ATOM   686  O  OE1 . GLN A 1 123 ? -10.005 38.433 11.404  1.00 22.00  ? 103 GLN A OE1 1 
ATOM   687  N  NE2 . GLN A 1 123 ? -11.161 39.841 12.718  1.00 22.07  ? 103 GLN A NE2 1 
ATOM   688  N  N   . PHE A 1 124 ? -14.615 34.508 9.147   1.00 19.72  ? 104 PHE A N   1 
ATOM   689  C  CA  . PHE A 1 124 ? -14.766 33.179 8.585   1.00 19.48  ? 104 PHE A CA  1 
ATOM   690  C  C   . PHE A 1 124 ? -13.578 32.711 7.745   1.00 20.05  ? 104 PHE A C   1 
ATOM   691  O  O   . PHE A 1 124 ? -13.192 31.539 7.797   1.00 19.68  ? 104 PHE A O   1 
ATOM   692  C  CB  . PHE A 1 124 ? -16.058 33.069 7.774   1.00 19.94  ? 104 PHE A CB  1 
ATOM   693  C  CG  . PHE A 1 124 ? -16.335 31.679 7.294   1.00 19.80  ? 104 PHE A CG  1 
ATOM   694  C  CD1 . PHE A 1 124 ? -16.882 30.733 8.143   1.00 18.94  ? 104 PHE A CD1 1 
ATOM   695  C  CD2 . PHE A 1 124 ? -16.003 31.299 6.002   1.00 21.29  ? 104 PHE A CD2 1 
ATOM   696  C  CE1 . PHE A 1 124 ? -17.106 29.444 7.711   1.00 19.29  ? 104 PHE A CE1 1 
ATOM   697  C  CE2 . PHE A 1 124 ? -16.228 30.005 5.563   1.00 20.76  ? 104 PHE A CE2 1 
ATOM   698  C  CZ  . PHE A 1 124 ? -16.781 29.076 6.421   1.00 19.94  ? 104 PHE A CZ  1 
ATOM   699  N  N   . PHE A 1 125 ? -12.974 33.608 6.977   1.00 21.15  ? 105 PHE A N   1 
ATOM   700  C  CA  . PHE A 1 125 ? -11.917 33.156 6.073   1.00 21.94  ? 105 PHE A CA  1 
ATOM   701  C  C   . PHE A 1 125 ? -10.622 32.884 6.836   1.00 21.61  ? 105 PHE A C   1 
ATOM   702  O  O   . PHE A 1 125 ? -9.724  32.185 6.345   1.00 23.82  ? 105 PHE A O   1 
ATOM   703  C  CB  . PHE A 1 125 ? -11.775 34.088 4.855   1.00 23.49  ? 105 PHE A CB  1 
ATOM   704  C  CG  . PHE A 1 125 ? -12.978 34.042 3.953   1.00 23.98  ? 105 PHE A CG  1 
ATOM   705  C  CD1 . PHE A 1 125 ? -14.089 34.847 4.208   1.00 23.95  ? 105 PHE A CD1 1 
ATOM   706  C  CD2 . PHE A 1 125 ? -13.038 33.129 2.908   1.00 24.56  ? 105 PHE A CD2 1 
ATOM   707  C  CE1 . PHE A 1 125 ? -15.203 34.766 3.433   1.00 24.49  ? 105 PHE A CE1 1 
ATOM   708  C  CE2 . PHE A 1 125 ? -14.155 33.046 2.118   1.00 25.10  ? 105 PHE A CE2 1 
ATOM   709  C  CZ  . PHE A 1 125 ? -15.241 33.866 2.379   1.00 25.06  ? 105 PHE A CZ  1 
ATOM   710  N  N   . ASP A 1 126 ? -10.571 33.392 8.062   1.00 20.89  ? 106 ASP A N   1 
ATOM   711  C  CA  . ASP A 1 126 ? -9.443  33.159 8.935   1.00 20.58  ? 106 ASP A CA  1 
ATOM   712  C  C   . ASP A 1 126 ? -9.677  31.906 9.765   1.00 19.44  ? 106 ASP A C   1 
ATOM   713  O  O   . ASP A 1 126 ? -8.754  31.143 10.033  1.00 19.43  ? 106 ASP A O   1 
ATOM   714  C  CB  . ASP A 1 126 ? -9.232  34.377 9.809   1.00 20.64  ? 106 ASP A CB  1 
ATOM   715  C  CG  . ASP A 1 126 ? -8.688  35.539 9.026   1.00 23.07  ? 106 ASP A CG  1 
ATOM   716  O  OD1 . ASP A 1 126 ? -7.792  35.294 8.196   1.00 23.56  ? 106 ASP A OD1 1 
ATOM   717  O  OD2 . ASP A 1 126 ? -9.150  36.687 9.216   1.00 25.07  ? 106 ASP A OD2 1 
ATOM   718  N  N   . LEU A 1 127 ? -10.931 31.697 10.147  1.00 18.68  ? 107 LEU A N   1 
ATOM   719  C  CA  . LEU A 1 127 ? -11.341 30.470 10.800  1.00 17.83  ? 107 LEU A CA  1 
ATOM   720  C  C   . LEU A 1 127 ? -11.000 29.264 9.930   1.00 18.27  ? 107 LEU A C   1 
ATOM   721  O  O   . LEU A 1 127 ? -10.574 28.223 10.434  1.00 22.77  ? 107 LEU A O   1 
ATOM   722  C  CB  . LEU A 1 127 ? -12.845 30.492 11.084  1.00 17.32  ? 107 LEU A CB  1 
ATOM   723  C  CG  . LEU A 1 127 ? -13.355 29.225 11.768  1.00 16.65  ? 107 LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1 127 ? -12.670 29.102 13.104  1.00 16.08  ? 107 LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1 127 ? -14.847 29.233 11.919  1.00 16.41  ? 107 LEU A CD2 1 
ATOM   726  N  N   . MET A 1 128 ? -11.207 29.398 8.626   1.00 22.77  ? 108 MET A N   1 
ATOM   727  C  CA  . MET A 1 128 ? -10.823 28.340 7.708   1.00 20.54  ? 108 MET A CA  1 
ATOM   728  C  C   . MET A 1 128 ? -9.345  28.059 7.859   1.00 23.88  ? 108 MET A C   1 
ATOM   729  O  O   . MET A 1 128 ? -8.945  26.916 8.044   1.00 23.33  ? 108 MET A O   1 
ATOM   730  C  CB  . MET A 1 128 ? -11.155 28.724 6.269   1.00 20.85  ? 108 MET A CB  1 
ATOM   731  C  CG  . MET A 1 128 ? -12.637 28.862 6.012   1.00 20.67  ? 108 MET A CG  1 
ATOM   732  S  SD  . MET A 1 128 ? -13.566 27.344 6.336   1.00 26.12  ? 108 MET A SD  1 
ATOM   733  C  CE  . MET A 1 128 ? -14.108 27.555 8.026   1.00 18.79  ? 108 MET A CE  1 
ATOM   734  N  N   . LYS A 1 129 ? -8.542  29.115 7.801   1.00 20.72  ? 109 LYS A N   1 
ATOM   735  C  CA  . LYS A 1 129 ? -7.108  28.979 7.942   1.00 21.33  ? 109 LYS A CA  1 
ATOM   736  C  C   . LYS A 1 129 ? -6.753  28.338 9.286   1.00 20.49  ? 109 LYS A C   1 
ATOM   737  O  O   . LYS A 1 129 ? -5.886  27.459 9.361   1.00 20.93  ? 109 LYS A O   1 
ATOM   738  C  CB  . LYS A 1 129 ? -6.433  30.340 7.783   1.00 22.08  ? 109 LYS A CB  1 
ATOM   739  C  CG  . LYS A 1 129 ? -4.929  30.331 8.000   1.00 22.89  ? 109 LYS A CG  1 
ATOM   740  C  CD  . LYS A 1 129 ? -4.174  29.682 6.863   1.00 24.93  ? 109 LYS A CD  1 
ATOM   741  C  CE  . LYS A 1 129 ? -2.701  29.535 7.239   1.00 34.05  ? 109 LYS A CE  1 
ATOM   742  N  NZ  . LYS A 1 129 ? -1.873  28.802 6.239   1.00 41.60  ? 109 LYS A NZ  1 
ATOM   743  N  N   . LEU A 1 130 ? -7.440  28.761 10.342  1.00 19.44  ? 110 LEU A N   1 
ATOM   744  C  CA  . LEU A 1 130 ? -7.210  28.214 11.681  1.00 18.71  ? 110 LEU A CA  1 
ATOM   745  C  C   . LEU A 1 130 ? -7.368  26.701 11.731  1.00 18.62  ? 110 LEU A C   1 
ATOM   746  O  O   . LEU A 1 130 ? -6.607  26.031 12.404  1.00 18.72  ? 110 LEU A O   1 
ATOM   747  C  CB  . LEU A 1 130 ? -8.147  28.866 12.699  1.00 17.73  ? 110 LEU A CB  1 
ATOM   748  C  CG  . LEU A 1 130 ? -8.106  28.467 14.167  1.00 17.01  ? 110 LEU A CG  1 
ATOM   749  C  CD1 . LEU A 1 130 ? -8.691  29.595 15.007  1.00 16.51  ? 110 LEU A CD1 1 
ATOM   750  C  CD2 . LEU A 1 130 ? -8.848  27.176 14.439  1.00 16.57  ? 110 LEU A CD2 1 
ATOM   751  N  N   . PHE A 1 131 ? -8.363  26.155 11.047  1.00 18.57  ? 111 PHE A N   1 
ATOM   752  C  CA  . PHE A 1 131 ? -8.549  24.714 11.098  1.00 18.70  ? 111 PHE A CA  1 
ATOM   753  C  C   . PHE A 1 131 ? -7.494  23.977 10.292  1.00 19.87  ? 111 PHE A C   1 
ATOM   754  O  O   . PHE A 1 131 ? -7.179  22.811 10.587  1.00 21.29  ? 111 PHE A O   1 
ATOM   755  C  CB  . PHE A 1 131 ? -9.937  24.314 10.634  1.00 18.51  ? 111 PHE A CB  1 
ATOM   756  C  CG  . PHE A 1 131 ? -10.985 24.547 11.645  1.00 17.54  ? 111 PHE A CG  1 
ATOM   757  C  CD1 . PHE A 1 131 ? -10.988 23.830 12.821  1.00 17.13  ? 111 PHE A CD1 1 
ATOM   758  C  CD2 . PHE A 1 131 ? -11.975 25.487 11.428  1.00 17.21  ? 111 PHE A CD2 1 
ATOM   759  C  CE1 . PHE A 1 131 ? -11.969 24.050 13.776  1.00 16.59  ? 111 PHE A CE1 1 
ATOM   760  C  CE2 . PHE A 1 131 ? -12.960 25.700 12.362  1.00 16.49  ? 111 PHE A CE2 1 
ATOM   761  C  CZ  . PHE A 1 131 ? -12.959 24.977 13.543  1.00 16.08  ? 111 PHE A CZ  1 
ATOM   762  N  N   . GLU A 1 132 ? -6.951  24.658 9.281   1.00 20.66  ? 112 GLU A N   1 
ATOM   763  C  CA  . GLU A 1 132 ? -5.841  24.113 8.502   1.00 22.04  ? 112 GLU A CA  1 
ATOM   764  C  C   . GLU A 1 132 ? -4.574  24.077 9.358   1.00 27.10  ? 112 GLU A C   1 
ATOM   765  O  O   . GLU A 1 132 ? -3.738  23.181 9.231   1.00 30.85  ? 112 GLU A O   1 
ATOM   766  C  CB  . GLU A 1 132 ? -5.619  24.939 7.239   1.00 22.92  ? 112 GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 132 ? -6.053  24.265 5.929   1.00 76.62  ? 112 GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 132 ? -7.568  24.054 5.800   1.00 76.41  ? 112 GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 132 ? -8.338  24.507 6.678   1.00 75.30  ? 112 GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 132 ? -7.993  23.429 4.802   1.00 76.21  ? 112 GLU A OE2 1 
ATOM   771  N  N   . VAL A 1 133 ? -4.460  25.051 10.253  1.00 27.34  ? 113 VAL A N   1 
ATOM   772  C  CA  . VAL A 1 133 ? -3.306  25.167 11.124  1.00 25.73  ? 113 VAL A CA  1 
ATOM   773  C  C   . VAL A 1 133 ? -3.396  24.266 12.354  1.00 24.42  ? 113 VAL A C   1 
ATOM   774  O  O   . VAL A 1 133 ? -2.446  23.549 12.664  1.00 27.72  ? 113 VAL A O   1 
ATOM   775  C  CB  . VAL A 1 133 ? -3.083  26.625 11.547  1.00 26.43  ? 113 VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 133 ? -2.060  26.702 12.650  1.00 30.45  ? 113 VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 133 ? -2.632  27.427 10.357  1.00 25.38  ? 113 VAL A CG2 1 
ATOM   778  N  N   . GLY A 1 134 ? -4.533  24.300 13.048  1.00 20.99  ? 114 GLY A N   1 
ATOM   779  C  CA  . GLY A 1 134 ? -4.758  23.441 14.200  1.00 19.53  ? 114 GLY A CA  1 
ATOM   780  C  C   . GLY A 1 134 ? -5.157  21.982 13.945  1.00 23.70  ? 114 GLY A C   1 
ATOM   781  O  O   . GLY A 1 134 ? -5.073  21.159 14.856  1.00 28.36  ? 114 GLY A O   1 
ATOM   782  N  N   . GLY A 1 135 ? -5.617  21.647 12.739  1.00 20.38  ? 115 GLY A N   1 
ATOM   783  C  CA  . GLY A 1 135 ? -5.932  20.265 12.423  1.00 21.05  ? 115 GLY A CA  1 
ATOM   784  C  C   . GLY A 1 135 ? -7.416  19.986 12.270  1.00 20.48  ? 115 GLY A C   1 
ATOM   785  O  O   . GLY A 1 135 ? -8.251  20.683 12.838  1.00 19.42  ? 115 GLY A O   1 
ATOM   786  N  N   . SER A 1 136 ? -7.751  18.954 11.506  1.00 21.36  ? 116 SER A N   1 
ATOM   787  C  CA  . SER A 1 136 ? -9.144  18.649 11.252  1.00 21.10  ? 116 SER A CA  1 
ATOM   788  C  C   . SER A 1 136 ? -9.906  18.310 12.522  1.00 20.40  ? 116 SER A C   1 
ATOM   789  O  O   . SER A 1 136 ? -9.443  17.524 13.345  1.00 22.47  ? 116 SER A O   1 
ATOM   790  C  CB  . SER A 1 136 ? -9.254  17.481 10.286  1.00 22.45  ? 116 SER A CB  1 
ATOM   791  O  OG  . SER A 1 136 ? -10.612 17.139 10.071  1.00 27.29  ? 116 SER A OG  1 
ATOM   792  N  N   . PRO A 1 137 ? -11.097 18.886 12.679  1.00 19.57  ? 117 PRO A N   1 
ATOM   793  C  CA  . PRO A 1 137 ? -11.939 18.555 13.825  1.00 19.10  ? 117 PRO A CA  1 
ATOM   794  C  C   . PRO A 1 137 ? -12.271 17.065 13.891  1.00 22.02  ? 117 PRO A C   1 
ATOM   795  O  O   . PRO A 1 137 ? -12.704 16.590 14.939  1.00 31.43  ? 117 PRO A O   1 
ATOM   796  C  CB  . PRO A 1 137 ? -13.207 19.370 13.564  1.00 18.45  ? 117 PRO A CB  1 
ATOM   797  C  CG  . PRO A 1 137 ? -12.768 20.500 12.779  1.00 18.17  ? 117 PRO A CG  1 
ATOM   798  C  CD  . PRO A 1 137 ? -11.656 19.996 11.897  1.00 19.11  ? 117 PRO A CD  1 
ATOM   799  N  N   . ALA A 1 138 ? -12.061 16.339 12.797  1.00 21.25  ? 118 ALA A N   1 
ATOM   800  C  CA  . ALA A 1 138 ? -12.312 14.894 12.791  1.00 22.54  ? 118 ALA A CA  1 
ATOM   801  C  C   . ALA A 1 138 ? -11.287 14.073 13.583  1.00 23.56  ? 118 ALA A C   1 
ATOM   802  O  O   . ALA A 1 138 ? -11.601 12.987 14.050  1.00 27.36  ? 118 ALA A O   1 
ATOM   803  C  CB  . ALA A 1 138 ? -12.427 14.371 11.383  1.00 23.71  ? 118 ALA A CB  1 
ATOM   804  N  N   . ASN A 1 139 ? -10.078 14.591 13.747  1.00 26.91  ? 119 ASN A N   1 
ATOM   805  C  CA  . ASN A 1 139 ? -9.064  13.898 14.527  1.00 25.10  ? 119 ASN A CA  1 
ATOM   806  C  C   . ASN A 1 139 ? -8.302  14.859 15.432  1.00 28.66  ? 119 ASN A C   1 
ATOM   807  O  O   . ASN A 1 139 ? -7.141  14.625 15.744  1.00 32.09  ? 119 ASN A O   1 
ATOM   808  C  CB  . ASN A 1 139 ? -8.072  13.194 13.606  1.00 25.26  ? 119 ASN A CB  1 
ATOM   809  C  CG  . ASN A 1 139 ? -7.289  14.176 12.756  1.00 24.96  ? 119 ASN A CG  1 
ATOM   810  O  OD1 . ASN A 1 139 ? -7.873  14.983 12.011  1.00 24.25  ? 119 ASN A OD1 1 
ATOM   811  N  ND2 . ASN A 1 139 ? -5.957  14.140 12.870  1.00 25.65  ? 119 ASN A ND2 1 
ATOM   812  N  N   . THR A 1 140 ? -8.962  15.945 15.839  1.00 24.19  ? 120 THR A N   1 
ATOM   813  C  CA  . THR A 1 140 ? -8.352  16.991 16.674  1.00 20.42  ? 120 THR A CA  1 
ATOM   814  C  C   . THR A 1 140 ? -9.340  17.584 17.656  1.00 19.33  ? 120 THR A C   1 
ATOM   815  O  O   . THR A 1 140 ? -10.443 17.968 17.297  1.00 22.01  ? 120 THR A O   1 
ATOM   816  C  CB  . THR A 1 140 ? -7.815  18.156 15.827  1.00 20.00  ? 120 THR A CB  1 
ATOM   817  O  OG1 . THR A 1 140 ? -6.977  17.639 14.785  1.00 21.15  ? 120 THR A OG1 1 
ATOM   818  C  CG2 . THR A 1 140 ? -7.054  19.157 16.687  1.00 19.39  ? 120 THR A CG2 1 
ATOM   819  N  N   . ARG A 1 141 ? -8.927  17.673 18.907  1.00 19.17  ? 121 ARG A N   1 
ATOM   820  C  CA  . ARG A 1 141 ? -9.789  18.211 19.945  1.00 18.34  ? 121 ARG A CA  1 
ATOM   821  C  C   . ARG A 1 141 ? -9.607  19.716 20.026  1.00 17.63  ? 121 ARG A C   1 
ATOM   822  O  O   . ARG A 1 141 ? -8.479  20.214 19.995  1.00 17.44  ? 121 ARG A O   1 
ATOM   823  C  CB  . ARG A 1 141 ? -9.491  17.534 21.275  1.00 21.09  ? 121 ARG A CB  1 
ATOM   824  C  CG  . ARG A 1 141 ? -9.271  16.042 21.098  1.00 31.60  ? 121 ARG A CG  1 
ATOM   825  C  CD  . ARG A 1 141 ? -8.986  15.370 22.402  1.00 36.88  ? 121 ARG A CD  1 
ATOM   826  N  NE  . ARG A 1 141 ? -9.849  15.920 23.422  1.00 34.44  ? 121 ARG A NE  1 
ATOM   827  C  CZ  . ARG A 1 141 ? -10.220 15.250 24.492  1.00 44.67  ? 121 ARG A CZ  1 
ATOM   828  N  NH1 . ARG A 1 141 ? -9.787  14.004 24.655  1.00 45.92  ? 121 ARG A NH1 1 
ATOM   829  N  NH2 . ARG A 1 141 ? -11.016 15.824 25.385  1.00 49.18  ? 121 ARG A NH2 1 
ATOM   830  N  N   . TYR A 1 142 ? -10.732 20.426 20.109  1.00 16.70  ? 122 TYR A N   1 
ATOM   831  C  CA  . TYR A 1 142 ? -10.748 21.883 20.062  1.00 15.84  ? 122 TYR A CA  1 
ATOM   832  C  C   . TYR A 1 142 ? -11.477 22.467 21.273  1.00 15.33  ? 122 TYR A C   1 
ATOM   833  O  O   . TYR A 1 142 ? -12.440 21.888 21.774  1.00 17.13  ? 122 TYR A O   1 
ATOM   834  C  CB  . TYR A 1 142 ? -11.406 22.367 18.756  1.00 15.65  ? 122 TYR A CB  1 
ATOM   835  C  CG  . TYR A 1 142 ? -10.460 22.512 17.572  1.00 16.06  ? 122 TYR A CG  1 
ATOM   836  C  CD1 . TYR A 1 142 ? -9.699  23.670 17.389  1.00 15.91  ? 122 TYR A CD1 1 
ATOM   837  C  CD2 . TYR A 1 142 ? -10.331 21.499 16.635  1.00 16.79  ? 122 TYR A CD2 1 
ATOM   838  C  CE1 . TYR A 1 142 ? -8.836  23.800 16.326  1.00 16.48  ? 122 TYR A CE1 1 
ATOM   839  C  CE2 . TYR A 1 142 ? -9.464  21.630 15.551  1.00 17.34  ? 122 TYR A CE2 1 
ATOM   840  C  CZ  . TYR A 1 142 ? -8.726  22.777 15.410  1.00 17.18  ? 122 TYR A CZ  1 
ATOM   841  O  OH  . TYR A 1 142 ? -7.884  22.883 14.345  1.00 17.92  ? 122 TYR A OH  1 
ATOM   842  N  N   . LEU A 1 143 ? -10.996 23.610 21.744  1.00 14.97  ? 123 LEU A N   1 
ATOM   843  C  CA  . LEU A 1 143 ? -11.718 24.428 22.714  1.00 14.57  ? 123 LEU A CA  1 
ATOM   844  C  C   . LEU A 1 143 ? -11.662 25.883 22.243  1.00 14.24  ? 123 LEU A C   1 
ATOM   845  O  O   . LEU A 1 143 ? -10.582 26.427 21.997  1.00 14.39  ? 123 LEU A O   1 
ATOM   846  C  CB  . LEU A 1 143 ? -11.130 24.299 24.117  1.00 14.80  ? 123 LEU A CB  1 
ATOM   847  C  CG  . LEU A 1 143 ? -11.651 25.266 25.206  1.00 16.08  ? 123 LEU A CG  1 
ATOM   848  C  CD1 . LEU A 1 143 ? -13.097 25.000 25.608  1.00 14.55  ? 123 LEU A CD1 1 
ATOM   849  C  CD2 . LEU A 1 143 ? -10.774 25.248 26.451  1.00 14.98  ? 123 LEU A CD2 1 
ATOM   850  N  N   . PHE A 1 144 ? -12.842 26.486 22.110  1.00 13.97  ? 124 PHE A N   1 
ATOM   851  C  CA  . PHE A 1 144 ? -12.978 27.860 21.662  1.00 13.85  ? 124 PHE A CA  1 
ATOM   852  C  C   . PHE A 1 144 ? -13.410 28.708 22.834  1.00 13.82  ? 124 PHE A C   1 
ATOM   853  O  O   . PHE A 1 144 ? -14.386 28.391 23.501  1.00 13.80  ? 124 PHE A O   1 
ATOM   854  C  CB  . PHE A 1 144 ? -13.995 27.968 20.504  1.00 13.84  ? 124 PHE A CB  1 
ATOM   855  C  CG  . PHE A 1 144 ? -13.434 27.538 19.179  1.00 14.04  ? 124 PHE A CG  1 
ATOM   856  C  CD1 . PHE A 1 144 ? -13.462 26.199 18.800  1.00 14.23  ? 124 PHE A CD1 1 
ATOM   857  C  CD2 . PHE A 1 144 ? -12.834 28.454 18.336  1.00 14.26  ? 124 PHE A CD2 1 
ATOM   858  C  CE1 . PHE A 1 144 ? -12.922 25.790 17.617  1.00 14.59  ? 124 PHE A CE1 1 
ATOM   859  C  CE2 . PHE A 1 144 ? -12.286 28.044 17.147  1.00 14.61  ? 124 PHE A CE2 1 
ATOM   860  C  CZ  . PHE A 1 144 ? -12.333 26.708 16.796  1.00 14.76  ? 124 PHE A CZ  1 
ATOM   861  N  N   . LEU A 1 145 ? -12.682 29.790 23.087  1.00 13.98  ? 125 LEU A N   1 
ATOM   862  C  CA  . LEU A 1 145 ? -12.977 30.617 24.244  1.00 14.14  ? 125 LEU A CA  1 
ATOM   863  C  C   . LEU A 1 145 ? -14.056 31.684 24.015  1.00 17.38  ? 125 LEU A C   1 
ATOM   864  O  O   . LEU A 1 145 ? -14.244 32.550 24.871  1.00 15.15  ? 125 LEU A O   1 
ATOM   865  C  CB  . LEU A 1 145 ? -11.706 31.269 24.757  1.00 14.49  ? 125 LEU A CB  1 
ATOM   866  C  CG  . LEU A 1 145 ? -10.613 30.303 25.181  1.00 14.59  ? 125 LEU A CG  1 
ATOM   867  C  CD1 . LEU A 1 145 ? -9.424  31.104 25.673  1.00 15.12  ? 125 LEU A CD1 1 
ATOM   868  C  CD2 . LEU A 1 145 ? -11.143 29.376 26.248  1.00 14.53  ? 125 LEU A CD2 1 
ATOM   869  N  N   . GLY A 1 146 ? -14.740 31.646 22.867  1.00 17.16  ? 126 GLY A N   1 
ATOM   870  C  CA  . GLY A 1 146 ? -15.807 32.599 22.599  1.00 16.55  ? 126 GLY A CA  1 
ATOM   871  C  C   . GLY A 1 146 ? -15.543 33.724 21.603  1.00 14.90  ? 126 GLY A C   1 
ATOM   872  O  O   . GLY A 1 146 ? -14.528 33.717 20.898  1.00 21.85  ? 126 GLY A O   1 
ATOM   873  N  N   . ASP A 1 147 ? -16.478 34.685 21.556  1.00 15.39  ? 127 ASP A N   1 
ATOM   874  C  CA  . ASP A 1 147 ? -16.477 35.827 20.613  1.00 16.05  ? 127 ASP A CA  1 
ATOM   875  C  C   . ASP A 1 147 ? -16.507 35.408 19.147  1.00 16.74  ? 127 ASP A C   1 
ATOM   876  O  O   . ASP A 1 147 ? -15.611 35.733 18.373  1.00 18.91  ? 127 ASP A O   1 
ATOM   877  C  CB  . ASP A 1 147 ? -15.315 36.778 20.874  1.00 16.75  ? 127 ASP A CB  1 
ATOM   878  C  CG  . ASP A 1 147 ? -15.647 37.818 21.933  1.00 21.99  ? 127 ASP A CG  1 
ATOM   879  O  OD1 . ASP A 1 147 ? -16.772 37.747 22.481  1.00 21.67  ? 127 ASP A OD1 1 
ATOM   880  O  OD2 . ASP A 1 147 ? -14.799 38.708 22.210  1.00 27.30  ? 127 ASP A OD2 1 
ATOM   881  N  N   . TYR A 1 148 ? -17.552 34.689 18.761  1.00 15.81  ? 128 TYR A N   1 
ATOM   882  C  CA  . TYR A 1 148 ? -17.639 34.183 17.401  1.00 15.86  ? 128 TYR A CA  1 
ATOM   883  C  C   . TYR A 1 148 ? -18.206 35.241 16.488  1.00 16.73  ? 128 TYR A C   1 
ATOM   884  O  O   . TYR A 1 148 ? -17.999 35.208 15.287  1.00 19.26  ? 128 TYR A O   1 
ATOM   885  C  CB  . TYR A 1 148 ? -18.497 32.922 17.357  1.00 15.50  ? 128 TYR A CB  1 
ATOM   886  C  CG  . TYR A 1 148 ? -18.132 31.976 18.471  1.00 16.44  ? 128 TYR A CG  1 
ATOM   887  C  CD1 . TYR A 1 148 ? -16.895 31.351 18.490  1.00 14.55  ? 128 TYR A CD1 1 
ATOM   888  C  CD2 . TYR A 1 148 ? -19.007 31.739 19.526  1.00 14.87  ? 128 TYR A CD2 1 
ATOM   889  C  CE1 . TYR A 1 148 ? -16.548 30.504 19.501  1.00 14.28  ? 128 TYR A CE1 1 
ATOM   890  C  CE2 . TYR A 1 148 ? -18.662 30.899 20.551  1.00 14.51  ? 128 TYR A CE2 1 
ATOM   891  C  CZ  . TYR A 1 148 ? -17.432 30.282 20.529  1.00 14.17  ? 128 TYR A CZ  1 
ATOM   892  O  OH  . TYR A 1 148 ? -17.077 29.439 21.546  1.00 14.17  ? 128 TYR A OH  1 
ATOM   893  N  N   . VAL A 1 149 ? -18.917 36.196 17.059  1.00 17.24  ? 129 VAL A N   1 
ATOM   894  C  CA  . VAL A 1 149 ? -19.602 37.157 16.231  1.00 18.25  ? 129 VAL A CA  1 
ATOM   895  C  C   . VAL A 1 149 ? -19.135 38.571 16.495  1.00 19.10  ? 129 VAL A C   1 
ATOM   896  O  O   . VAL A 1 149 ? -18.252 38.801 17.322  1.00 18.89  ? 129 VAL A O   1 
ATOM   897  C  CB  . VAL A 1 149 ? -21.112 37.101 16.460  1.00 18.89  ? 129 VAL A CB  1 
ATOM   898  C  CG1 . VAL A 1 149 ? -21.637 35.705 16.172  1.00 17.99  ? 129 VAL A CG1 1 
ATOM   899  C  CG2 . VAL A 1 149 ? -21.427 37.516 17.886  1.00 18.65  ? 129 VAL A CG2 1 
ATOM   900  N  N   . ASP A 1 150 ? -19.761 39.497 15.769  1.00 20.24  ? 130 ASP A N   1 
ATOM   901  C  CA  . ASP A 1 150 ? -19.470 40.926 15.791  1.00 21.47  ? 130 ASP A CA  1 
ATOM   902  C  C   . ASP A 1 150 ? -18.125 41.266 15.192  1.00 23.11  ? 130 ASP A C   1 
ATOM   903  O  O   . ASP A 1 150 ? -17.191 40.459 15.228  1.00 23.13  ? 130 ASP A O   1 
ATOM   904  C  CB  . ASP A 1 150 ? -19.601 41.529 17.189  1.00 23.36  ? 130 ASP A CB  1 
ATOM   905  C  CG  . ASP A 1 150 ? -21.053 41.690 17.636  1.00 28.25  ? 130 ASP A CG  1 
ATOM   906  O  OD1 . ASP A 1 150 ? -21.928 41.886 16.777  1.00 29.71  ? 130 ASP A OD1 1 
ATOM   907  O  OD2 . ASP A 1 150 ? -21.314 41.629 18.852  1.00 29.32  ? 130 ASP A OD2 1 
ATOM   908  N  N   . ARG A 1 151 ? -18.078 42.461 14.601  1.00 25.34  ? 131 ARG A N   1 
ATOM   909  C  CA  . ARG A 1 151 ? -16.866 43.103 14.073  1.00 25.12  ? 131 ARG A CA  1 
ATOM   910  C  C   . ARG A 1 151 ? -16.540 42.715 12.629  1.00 26.77  ? 131 ARG A C   1 
ATOM   911  O  O   . ARG A 1 151 ? -16.407 43.593 11.753  1.00 28.38  ? 131 ARG A O   1 
ATOM   912  C  CB  . ARG A 1 151 ? -15.653 42.934 14.998  1.00 23.46  ? 131 ARG A CB  1 
ATOM   913  C  CG  . ARG A 1 151 ? -15.892 43.369 16.440  1.00 23.43  ? 131 ARG A CG  1 
ATOM   914  C  CD  . ARG A 1 151 ? -16.822 44.573 16.505  1.00 31.33  ? 131 ARG A CD  1 
ATOM   915  N  NE  . ARG A 1 151 ? -16.155 45.799 16.090  1.00 35.05  ? 131 ARG A NE  1 
ATOM   916  C  CZ  . ARG A 1 151 ? -15.467 46.568 16.920  1.00 38.30  ? 131 ARG A CZ  1 
ATOM   917  N  NH1 . ARG A 1 151 ? -15.373 46.227 18.204  1.00 38.18  ? 131 ARG A NH1 1 
ATOM   918  N  NH2 . ARG A 1 151 ? -14.879 47.669 16.471  1.00 39.60  ? 131 ARG A NH2 1 
ATOM   919  N  N   . GLY A 1 152 ? -16.407 41.414 12.376  1.00 23.03  ? 132 GLY A N   1 
ATOM   920  C  CA  . GLY A 1 152 ? -16.225 40.916 11.015  1.00 23.29  ? 132 GLY A CA  1 
ATOM   921  C  C   . GLY A 1 152 ? -17.572 40.617 10.400  1.00 25.18  ? 132 GLY A C   1 
ATOM   922  O  O   . GLY A 1 152 ? -18.545 40.350 11.129  1.00 27.16  ? 132 GLY A O   1 
ATOM   923  N  N   . TYR A 1 153 ? -17.664 40.667 9.070   1.00 29.91  ? 133 TYR A N   1 
ATOM   924  C  CA  A TYR A 1 153 ? -18.971 40.514 8.427   0.57 27.59  ? 133 TYR A CA  1 
ATOM   925  C  CA  B TYR A 1 153 ? -18.965 40.504 8.433   0.43 27.59  ? 133 TYR A CA  1 
ATOM   926  C  C   . TYR A 1 153 ? -19.282 39.088 7.936   1.00 26.07  ? 133 TYR A C   1 
ATOM   927  O  O   . TYR A 1 153 ? -20.064 38.905 6.998   1.00 29.13  ? 133 TYR A O   1 
ATOM   928  C  CB  A TYR A 1 153 ? -19.188 41.560 7.318   0.57 28.55  ? 133 TYR A CB  1 
ATOM   929  C  CB  B TYR A 1 153 ? -19.271 41.588 7.377   0.43 28.55  ? 133 TYR A CB  1 
ATOM   930  C  CG  A TYR A 1 153 ? -19.406 42.979 7.821   0.57 27.90  ? 133 TYR A CG  1 
ATOM   931  C  CG  B TYR A 1 153 ? -18.118 42.205 6.593   0.43 30.11  ? 133 TYR A CG  1 
ATOM   932  C  CD1 A TYR A 1 153 ? -18.757 43.436 8.960   0.57 27.52  ? 133 TYR A CD1 1 
ATOM   933  C  CD1 B TYR A 1 153 ? -17.449 41.493 5.601   0.43 31.51  ? 133 TYR A CD1 1 
ATOM   934  C  CD2 A TYR A 1 153 ? -20.264 43.864 7.157   0.57 29.62  ? 133 TYR A CD2 1 
ATOM   935  C  CD2 B TYR A 1 153 ? -17.762 43.536 6.790   0.43 30.30  ? 133 TYR A CD2 1 
ATOM   936  C  CE1 A TYR A 1 153 ? -18.937 44.722 9.427   0.57 29.23  ? 133 TYR A CE1 1 
ATOM   937  C  CE1 B TYR A 1 153 ? -16.417 42.074 4.862   0.43 29.12  ? 133 TYR A CE1 1 
ATOM   938  C  CE2 A TYR A 1 153 ? -20.454 45.162 7.626   0.57 30.95  ? 133 TYR A CE2 1 
ATOM   939  C  CE2 B TYR A 1 153 ? -16.741 44.127 6.055   0.43 31.22  ? 133 TYR A CE2 1 
ATOM   940  C  CZ  A TYR A 1 153 ? -19.778 45.580 8.765   0.57 30.54  ? 133 TYR A CZ  1 
ATOM   941  C  CZ  B TYR A 1 153 ? -16.070 43.394 5.090   0.43 30.69  ? 133 TYR A CZ  1 
ATOM   942  O  OH  A TYR A 1 153 ? -19.932 46.842 9.270   0.57 31.98  ? 133 TYR A OH  1 
ATOM   943  O  OH  B TYR A 1 153 ? -15.054 43.995 4.367   0.43 31.94  ? 133 TYR A OH  1 
ATOM   944  N  N   . PHE A 1 154 ? -18.693 38.084 8.587   1.00 22.51  ? 134 PHE A N   1 
ATOM   945  C  CA  . PHE A 1 154 ? -19.049 36.679 8.333   1.00 23.83  ? 134 PHE A CA  1 
ATOM   946  C  C   . PHE A 1 154 ? -19.317 35.920 9.637   1.00 26.06  ? 134 PHE A C   1 
ATOM   947  O  O   . PHE A 1 154 ? -18.953 34.760 9.800   1.00 30.02  ? 134 PHE A O   1 
ATOM   948  C  CB  . PHE A 1 154 ? -17.986 35.981 7.501   1.00 21.73  ? 134 PHE A CB  1 
ATOM   949  C  CG  . PHE A 1 154 ? -17.568 36.770 6.326   1.00 23.13  ? 134 PHE A CG  1 
ATOM   950  C  CD1 . PHE A 1 154 ? -18.294 36.704 5.140   1.00 24.13  ? 134 PHE A CD1 1 
ATOM   951  C  CD2 . PHE A 1 154 ? -16.489 37.633 6.408   1.00 23.66  ? 134 PHE A CD2 1 
ATOM   952  C  CE1 . PHE A 1 154 ? -17.930 37.462 4.047   1.00 25.62  ? 134 PHE A CE1 1 
ATOM   953  C  CE2 . PHE A 1 154 ? -16.112 38.382 5.325   1.00 25.17  ? 134 PHE A CE2 1 
ATOM   954  C  CZ  . PHE A 1 154 ? -16.841 38.304 4.138   1.00 26.16  ? 134 PHE A CZ  1 
ATOM   955  N  N   . SER A 1 155 ? -19.976 36.601 10.558  1.00 23.59  ? 135 SER A N   1 
ATOM   956  C  CA  . SER A 1 155 ? -20.297 36.039 11.842  1.00 19.47  ? 135 SER A CA  1 
ATOM   957  C  C   . SER A 1 155 ? -21.251 34.860 11.731  1.00 22.84  ? 135 SER A C   1 
ATOM   958  O  O   . SER A 1 155 ? -20.996 33.803 12.296  1.00 25.98  ? 135 SER A O   1 
ATOM   959  C  CB  . SER A 1 155 ? -20.912 37.121 12.723  1.00 19.92  ? 135 SER A CB  1 
ATOM   960  O  OG  . SER A 1 155 ? -19.977 38.152 13.008  1.00 24.34  ? 135 SER A OG  1 
ATOM   961  N  N   . ILE A 1 156 ? -22.355 35.041 11.018  1.00 20.00  ? 136 ILE A N   1 
ATOM   962  C  CA  . ILE A 1 156 ? -23.347 33.981 10.901  1.00 19.96  ? 136 ILE A CA  1 
ATOM   963  C  C   . ILE A 1 156 ? -22.748 32.716 10.260  1.00 20.19  ? 136 ILE A C   1 
ATOM   964  O  O   . ILE A 1 156 ? -23.124 31.596 10.606  1.00 21.61  ? 136 ILE A O   1 
ATOM   965  C  CB  . ILE A 1 156 ? -24.617 34.450 10.151  1.00 21.21  ? 136 ILE A CB  1 
ATOM   966  C  CG1 . ILE A 1 156 ? -25.710 33.393 10.214  1.00 21.32  ? 136 ILE A CG1 1 
ATOM   967  C  CG2 . ILE A 1 156 ? -24.307 34.707 8.707   1.00 23.56  ? 136 ILE A CG2 1 
ATOM   968  C  CD1 . ILE A 1 156 ? -26.008 32.898 11.595  1.00 20.60  ? 136 ILE A CD1 1 
ATOM   969  N  N   . GLU A 1 157 ? -21.796 32.881 9.350   1.00 19.77  ? 137 GLU A N   1 
ATOM   970  C  CA  . GLU A 1 157 ? -21.142 31.719 8.767   1.00 19.53  ? 137 GLU A CA  1 
ATOM   971  C  C   . GLU A 1 157 ? -20.278 31.015 9.793   1.00 18.46  ? 137 GLU A C   1 
ATOM   972  O  O   . GLU A 1 157 ? -20.235 29.788 9.813   1.00 20.61  ? 137 GLU A O   1 
ATOM   973  C  CB  . GLU A 1 157 ? -20.292 32.097 7.562   1.00 20.23  ? 137 GLU A CB  1 
ATOM   974  C  CG  . GLU A 1 157 ? -21.084 32.479 6.350   1.00 21.47  ? 137 GLU A CG  1 
ATOM   975  C  CD  . GLU A 1 157 ? -21.461 33.956 6.348   1.00 31.81  ? 137 GLU A CD  1 
ATOM   976  O  OE1 . GLU A 1 157 ? -21.155 34.634 7.358   1.00 29.60  ? 137 GLU A OE1 1 
ATOM   977  O  OE2 . GLU A 1 157 ? -22.052 34.436 5.337   1.00 36.43  ? 137 GLU A OE2 1 
ATOM   978  N  N   . CYS A 1 158 ? -19.583 31.789 10.630  1.00 18.01  ? 138 CYS A N   1 
ATOM   979  C  CA  . CYS A 1 158 ? -18.818 31.226 11.743  1.00 17.11  ? 138 CYS A CA  1 
ATOM   980  C  C   . CYS A 1 158 ? -19.723 30.433 12.665  1.00 16.69  ? 138 CYS A C   1 
ATOM   981  O  O   . CYS A 1 158 ? -19.418 29.291 12.998  1.00 17.71  ? 138 CYS A O   1 
ATOM   982  C  CB  . CYS A 1 158 ? -18.094 32.299 12.547  1.00 16.91  ? 138 CYS A CB  1 
ATOM   983  S  SG  . CYS A 1 158 ? -16.744 33.093 11.682  1.00 20.78  ? 138 CYS A SG  1 
ATOM   984  N  N   . VAL A 1 159 ? -20.836 31.029 13.072  1.00 16.95  ? 139 VAL A N   1 
ATOM   985  C  CA  . VAL A 1 159 ? -21.755 30.327 13.949  1.00 16.78  ? 139 VAL A CA  1 
ATOM   986  C  C   . VAL A 1 159 ? -22.237 29.017 13.285  1.00 17.07  ? 139 VAL A C   1 
ATOM   987  O  O   . VAL A 1 159 ? -22.157 27.935 13.870  1.00 16.79  ? 139 VAL A O   1 
ATOM   988  C  CB  . VAL A 1 159 ? -22.954 31.220 14.344  1.00 17.32  ? 139 VAL A CB  1 
ATOM   989  C  CG1 . VAL A 1 159 ? -24.081 30.390 15.034  1.00 17.49  ? 139 VAL A CG1 1 
ATOM   990  C  CG2 . VAL A 1 159 ? -22.495 32.353 15.220  1.00 17.14  ? 139 VAL A CG2 1 
ATOM   991  N  N   . LEU A 1 160 ? -22.711 29.111 12.051  1.00 17.81  ? 140 LEU A N   1 
ATOM   992  C  CA  . LEU A 1 160 ? -23.238 27.941 11.373  1.00 18.32  ? 140 LEU A CA  1 
ATOM   993  C  C   . LEU A 1 160 ? -22.202 26.853 11.272  1.00 17.98  ? 140 LEU A C   1 
ATOM   994  O  O   . LEU A 1 160 ? -22.489 25.699 11.581  1.00 18.09  ? 140 LEU A O   1 
ATOM   995  C  CB  . LEU A 1 160 ? -23.750 28.308 9.986   1.00 19.28  ? 140 LEU A CB  1 
ATOM   996  C  CG  . LEU A 1 160 ? -25.112 28.992 9.985   1.00 20.04  ? 140 LEU A CG  1 
ATOM   997  C  CD1 . LEU A 1 160 ? -25.484 29.374 8.584   1.00 21.10  ? 140 LEU A CD1 1 
ATOM   998  C  CD2 . LEU A 1 160 ? -26.144 28.072 10.589  1.00 20.31  ? 140 LEU A CD2 1 
ATOM   999  N  N   . TYR A 1 161 ? -20.994 27.223 10.855  1.00 17.73  ? 141 TYR A N   1 
ATOM   1000 C  CA  . TYR A 1 161 ? -19.931 26.243 10.682  1.00 17.60  ? 141 TYR A CA  1 
ATOM   1001 C  C   . TYR A 1 161 ? -19.507 25.628 12.015  1.00 18.06  ? 141 TYR A C   1 
ATOM   1002 O  O   . TYR A 1 161 ? -19.388 24.411 12.121  1.00 17.65  ? 141 TYR A O   1 
ATOM   1003 C  CB  . TYR A 1 161 ? -18.740 26.836 9.945   1.00 17.69  ? 141 TYR A CB  1 
ATOM   1004 C  CG  . TYR A 1 161 ? -17.728 25.803 9.543   1.00 17.90  ? 141 TYR A CG  1 
ATOM   1005 C  CD1 . TYR A 1 161 ? -18.021 24.864 8.575   1.00 18.72  ? 141 TYR A CD1 1 
ATOM   1006 C  CD2 . TYR A 1 161 ? -16.479 25.761 10.137  1.00 17.46  ? 141 TYR A CD2 1 
ATOM   1007 C  CE1 . TYR A 1 161 ? -17.082 23.897 8.198   1.00 19.23  ? 141 TYR A CE1 1 
ATOM   1008 C  CE2 . TYR A 1 161 ? -15.540 24.806 9.784   1.00 18.73  ? 141 TYR A CE2 1 
ATOM   1009 C  CZ  . TYR A 1 161 ? -15.837 23.873 8.814   1.00 23.43  ? 141 TYR A CZ  1 
ATOM   1010 O  OH  . TYR A 1 161 ? -14.884 22.924 8.464   1.00 28.93  ? 141 TYR A OH  1 
ATOM   1011 N  N   . LEU A 1 162 ? -19.308 26.455 13.040  1.00 16.29  ? 142 LEU A N   1 
ATOM   1012 C  CA  . LEU A 1 162 ? -18.916 25.945 14.357  1.00 15.76  ? 142 LEU A CA  1 
ATOM   1013 C  C   . LEU A 1 162 ? -19.977 25.066 15.009  1.00 15.98  ? 142 LEU A C   1 
ATOM   1014 O  O   . LEU A 1 162 ? -19.651 24.054 15.631  1.00 15.98  ? 142 LEU A O   1 
ATOM   1015 C  CB  . LEU A 1 162 ? -18.557 27.089 15.287  1.00 15.24  ? 142 LEU A CB  1 
ATOM   1016 C  CG  . LEU A 1 162 ? -17.216 27.757 14.979  1.00 15.10  ? 142 LEU A CG  1 
ATOM   1017 C  CD1 . LEU A 1 162 ? -17.003 28.908 15.918  1.00 14.81  ? 142 LEU A CD1 1 
ATOM   1018 C  CD2 . LEU A 1 162 ? -16.067 26.781 15.068  1.00 15.04  ? 142 LEU A CD2 1 
ATOM   1019 N  N   . TRP A 1 163 ? -21.244 25.447 14.871  1.00 16.36  ? 143 TRP A N   1 
ATOM   1020 C  CA  . TRP A 1 163 ? -22.345 24.652 15.414  1.00 16.83  ? 143 TRP A CA  1 
ATOM   1021 C  C   . TRP A 1 163 ? -22.462 23.314 14.711  1.00 17.51  ? 143 TRP A C   1 
ATOM   1022 O  O   . TRP A 1 163 ? -22.836 22.328 15.324  1.00 17.90  ? 143 TRP A O   1 
ATOM   1023 C  CB  . TRP A 1 163 ? -23.669 25.393 15.277  1.00 17.32  ? 143 TRP A CB  1 
ATOM   1024 C  CG  . TRP A 1 163 ? -24.108 26.115 16.512  1.00 17.12  ? 143 TRP A CG  1 
ATOM   1025 C  CD1 . TRP A 1 163 ? -25.280 25.939 17.189  1.00 17.71  ? 143 TRP A CD1 1 
ATOM   1026 C  CD2 . TRP A 1 163 ? -23.385 27.132 17.227  1.00 16.47  ? 143 TRP A CD2 1 
ATOM   1027 N  NE1 . TRP A 1 163 ? -25.326 26.778 18.277  1.00 17.46  ? 143 TRP A NE1 1 
ATOM   1028 C  CE2 . TRP A 1 163 ? -24.178 27.519 18.318  1.00 16.69  ? 143 TRP A CE2 1 
ATOM   1029 C  CE3 . TRP A 1 163 ? -22.136 27.738 17.055  1.00 17.34  ? 143 TRP A CE3 1 
ATOM   1030 C  CZ2 . TRP A 1 163 ? -23.776 28.497 19.220  1.00 18.75  ? 143 TRP A CZ2 1 
ATOM   1031 C  CZ3 . TRP A 1 163 ? -21.734 28.705 17.963  1.00 19.19  ? 143 TRP A CZ3 1 
ATOM   1032 C  CH2 . TRP A 1 163 ? -22.552 29.074 19.028  1.00 19.99  ? 143 TRP A CH2 1 
ATOM   1033 N  N   . VAL A 1 164 ? -22.174 23.278 13.415  1.00 22.63  ? 144 VAL A N   1 
ATOM   1034 C  CA  . VAL A 1 164 ? -22.178 22.002 12.703  1.00 20.13  ? 144 VAL A CA  1 
ATOM   1035 C  C   . VAL A 1 164 ? -21.084 21.077 13.260  1.00 18.46  ? 144 VAL A C   1 
ATOM   1036 O  O   . VAL A 1 164 ? -21.333 19.906 13.542  1.00 19.12  ? 144 VAL A O   1 
ATOM   1037 C  CB  . VAL A 1 164 ? -22.060 22.172 11.155  1.00 19.47  ? 144 VAL A CB  1 
ATOM   1038 C  CG1 . VAL A 1 164 ? -21.489 20.926 10.521  1.00 21.82  ? 144 VAL A CG1 1 
ATOM   1039 C  CG2 . VAL A 1 164 ? -23.409 22.465 10.531  1.00 19.98  ? 144 VAL A CG2 1 
ATOM   1040 N  N   . LEU A 1 165 ? -19.884 21.608 13.453  1.00 17.74  ? 145 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 165 ? -18.826 20.831 14.068  1.00 17.64  ? 145 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 165 ? -19.213 20.326 15.467  1.00 17.58  ? 145 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 165 ? -18.928 19.182 15.820  1.00 18.14  ? 145 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 165 ? -17.539 21.641 14.132  1.00 16.98  ? 145 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 165 ? -17.000 22.105 12.778  1.00 17.24  ? 145 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 165 ? -15.778 22.994 12.942  1.00 16.73  ? 145 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 165 ? -16.655 20.923 11.911  1.00 18.17  ? 145 LEU A CD2 1 
ATOM   1048 N  N   . LYS A 1 166 ? -19.860 21.174 16.261  1.00 17.08  ? 146 LYS A N   1 
ATOM   1049 C  CA  . LYS A 1 166 ? -20.361 20.758 17.569  1.00 17.20  ? 146 LYS A CA  1 
ATOM   1050 C  C   . LYS A 1 166 ? -21.330 19.573 17.437  1.00 18.31  ? 146 LYS A C   1 
ATOM   1051 O  O   . LYS A 1 166 ? -21.219 18.591 18.168  1.00 19.98  ? 146 LYS A O   1 
ATOM   1052 C  CB  . LYS A 1 166 ? -21.034 21.928 18.282  1.00 16.73  ? 146 LYS A CB  1 
ATOM   1053 C  CG  . LYS A 1 166 ? -21.371 21.672 19.730  1.00 16.86  ? 146 LYS A CG  1 
ATOM   1054 C  CD  . LYS A 1 166 ? -20.162 21.215 20.528  1.00 16.61  ? 146 LYS A CD  1 
ATOM   1055 C  CE  . LYS A 1 166 ? -20.586 20.775 21.909  1.00 17.04  ? 146 LYS A CE  1 
ATOM   1056 N  NZ  . LYS A 1 166 ? -19.451 20.495 22.871  1.00 16.89  ? 146 LYS A NZ  1 
ATOM   1057 N  N   . ILE A 1 167 ? -22.264 19.653 16.492  1.00 18.83  ? 147 ILE A N   1 
ATOM   1058 C  CA  . ILE A 1 167 ? -23.180 18.548 16.213  1.00 20.09  ? 147 ILE A CA  1 
ATOM   1059 C  C   . ILE A 1 167 ? -22.449 17.266 15.784  1.00 20.83  ? 147 ILE A C   1 
ATOM   1060 O  O   . ILE A 1 167 ? -22.843 16.168 16.160  1.00 21.89  ? 147 ILE A O   1 
ATOM   1061 C  CB  . ILE A 1 167 ? -24.183 18.940 15.123  1.00 20.60  ? 147 ILE A CB  1 
ATOM   1062 C  CG1 . ILE A 1 167 ? -25.017 20.128 15.584  1.00 20.19  ? 147 ILE A CG1 1 
ATOM   1063 C  CG2 . ILE A 1 167 ? -25.080 17.786 14.759  1.00 22.09  ? 147 ILE A CG2 1 
ATOM   1064 C  CD1 . ILE A 1 167 ? -25.924 20.643 14.527  1.00 20.74  ? 147 ILE A CD1 1 
ATOM   1065 N  N   . LEU A 1 168 ? -21.380 17.404 15.005  1.00 21.90  ? 148 LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 168 ? -20.636 16.239 14.524  1.00 21.32  ? 148 LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 168 ? -19.685 15.653 15.552  1.00 22.28  ? 148 LEU A C   1 
ATOM   1068 O  O   . LEU A 1 168 ? -19.407 14.450 15.536  1.00 24.69  ? 148 LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 168 ? -19.809 16.598 13.304  1.00 21.16  ? 148 LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 168 ? -20.593 16.708 12.013  1.00 21.82  ? 148 LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 168 ? -19.611 17.021 10.921  1.00 21.78  ? 148 LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 168 ? -21.315 15.418 11.740  1.00 23.35  ? 148 LEU A CD2 1 
ATOM   1073 N  N   . TYR A 1 169 ? -19.155 16.511 16.416  1.00 20.14  ? 149 TYR A N   1 
ATOM   1074 C  CA  . TYR A 1 169 ? -18.136 16.098 17.354  1.00 20.08  ? 149 TYR A CA  1 
ATOM   1075 C  C   . TYR A 1 169 ? -18.407 16.673 18.718  1.00 19.43  ? 149 TYR A C   1 
ATOM   1076 O  O   . TYR A 1 169 ? -17.551 17.371 19.262  1.00 18.62  ? 149 TYR A O   1 
ATOM   1077 C  CB  . TYR A 1 169 ? -16.787 16.608 16.895  1.00 19.49  ? 149 TYR A CB  1 
ATOM   1078 C  CG  . TYR A 1 169 ? -16.496 16.292 15.455  1.00 20.09  ? 149 TYR A CG  1 
ATOM   1079 C  CD1 . TYR A 1 169 ? -16.248 14.992 15.054  1.00 21.41  ? 149 TYR A CD1 1 
ATOM   1080 C  CD2 . TYR A 1 169 ? -16.471 17.292 14.498  1.00 19.54  ? 149 TYR A CD2 1 
ATOM   1081 C  CE1 . TYR A 1 169 ? -15.981 14.686 13.748  1.00 22.13  ? 149 TYR A CE1 1 
ATOM   1082 C  CE2 . TYR A 1 169 ? -16.205 17.000 13.176  1.00 23.14  ? 149 TYR A CE2 1 
ATOM   1083 C  CZ  . TYR A 1 169 ? -15.959 15.682 12.803  1.00 22.42  ? 149 TYR A CZ  1 
ATOM   1084 O  OH  . TYR A 1 169 ? -15.697 15.344 11.484  1.00 22.44  ? 149 TYR A OH  1 
ATOM   1085 N  N   . PRO A 1 170 ? -19.584 16.363 19.292  1.00 19.98  ? 150 PRO A N   1 
ATOM   1086 C  CA  . PRO A 1 170 ? -19.990 16.992 20.543  1.00 19.51  ? 150 PRO A CA  1 
ATOM   1087 C  C   . PRO A 1 170 ? -19.014 16.740 21.670  1.00 19.45  ? 150 PRO A C   1 
ATOM   1088 O  O   . PRO A 1 170 ? -18.990 17.524 22.625  1.00 24.87  ? 150 PRO A O   1 
ATOM   1089 C  CB  . PRO A 1 170 ? -21.326 16.306 20.853  1.00 20.64  ? 150 PRO A CB  1 
ATOM   1090 C  CG  . PRO A 1 170 ? -21.234 15.019 20.166  1.00 21.83  ? 150 PRO A CG  1 
ATOM   1091 C  CD  . PRO A 1 170 ? -20.553 15.334 18.887  1.00 21.31  ? 150 PRO A CD  1 
ATOM   1092 N  N   . SER A 1 171 ? -18.220 15.681 21.592  1.00 20.21  ? 151 SER A N   1 
ATOM   1093 C  CA  . SER A 1 171 ? -17.322 15.399 22.718  1.00 24.06  ? 151 SER A CA  1 
ATOM   1094 C  C   . SER A 1 171 ? -15.832 15.653 22.408  1.00 23.74  ? 151 SER A C   1 
ATOM   1095 O  O   . SER A 1 171 ? -14.953 15.261 23.177  1.00 21.49  ? 151 SER A O   1 
ATOM   1096 C  CB  . SER A 1 171 ? -17.536 13.972 23.248  1.00 23.92  ? 151 SER A CB  1 
ATOM   1097 O  OG  . SER A 1 171 ? -16.914 13.008 22.398  1.00 28.74  ? 151 SER A OG  1 
ATOM   1098 N  N   . THR A 1 172 ? -15.546 16.300 21.281  1.00 24.03  ? 152 THR A N   1 
ATOM   1099 C  CA  . THR A 1 172 ? -14.170 16.656 20.973  1.00 21.35  ? 152 THR A CA  1 
ATOM   1100 C  C   . THR A 1 172 ? -14.032 18.108 20.552  1.00 21.11  ? 152 THR A C   1 
ATOM   1101 O  O   . THR A 1 172 ? -12.914 18.629 20.490  1.00 23.06  ? 152 THR A O   1 
ATOM   1102 C  CB  . THR A 1 172 ? -13.569 15.769 19.876  1.00 25.29  ? 152 THR A CB  1 
ATOM   1103 O  OG1 . THR A 1 172 ? -14.358 15.888 18.692  1.00 32.55  ? 152 THR A OG1 1 
ATOM   1104 C  CG2 . THR A 1 172 ? -13.536 14.329 20.320  1.00 21.13  ? 152 THR A CG2 1 
ATOM   1105 N  N   . LEU A 1 173 ? -15.156 18.754 20.240  1.00 17.22  ? 153 LEU A N   1 
ATOM   1106 C  CA  . LEU A 1 173 ? -15.132 20.187 19.957  1.00 16.29  ? 153 LEU A CA  1 
ATOM   1107 C  C   . LEU A 1 173 ? -15.925 20.926 21.009  1.00 18.18  ? 153 LEU A C   1 
ATOM   1108 O  O   . LEU A 1 173 ? -17.090 20.590 21.235  1.00 20.63  ? 153 LEU A O   1 
ATOM   1109 C  CB  . LEU A 1 173 ? -15.695 20.516 18.583  1.00 16.27  ? 153 LEU A CB  1 
ATOM   1110 C  CG  . LEU A 1 173 ? -15.612 22.007 18.222  1.00 15.55  ? 153 LEU A CG  1 
ATOM   1111 C  CD1 . LEU A 1 173 ? -14.788 22.239 16.981  1.00 15.68  ? 153 LEU A CD1 1 
ATOM   1112 C  CD2 . LEU A 1 173 ? -16.972 22.624 18.058  1.00 15.42  ? 153 LEU A CD2 1 
ATOM   1113 N  N   . PHE A 1 174 ? -15.300 21.928 21.640  1.00 15.29  ? 154 PHE A N   1 
ATOM   1114 C  CA  . PHE A 1 174 ? -15.957 22.667 22.712  1.00 15.04  ? 154 PHE A CA  1 
ATOM   1115 C  C   . PHE A 1 174 ? -16.036 24.164 22.500  1.00 14.48  ? 154 PHE A C   1 
ATOM   1116 O  O   . PHE A 1 174 ? -15.073 24.785 22.038  1.00 16.60  ? 154 PHE A O   1 
ATOM   1117 C  CB  . PHE A 1 174 ? -15.306 22.347 24.048  1.00 15.25  ? 154 PHE A CB  1 
ATOM   1118 C  CG  . PHE A 1 174 ? -15.350 20.887 24.389  1.00 16.05  ? 154 PHE A CG  1 
ATOM   1119 C  CD1 . PHE A 1 174 ? -16.517 20.311 24.841  1.00 16.59  ? 154 PHE A CD1 1 
ATOM   1120 C  CD2 . PHE A 1 174 ? -14.227 20.089 24.223  1.00 17.51  ? 154 PHE A CD2 1 
ATOM   1121 C  CE1 . PHE A 1 174 ? -16.566 18.976 25.144  1.00 17.55  ? 154 PHE A CE1 1 
ATOM   1122 C  CE2 . PHE A 1 174 ? -14.265 18.752 24.521  1.00 17.71  ? 154 PHE A CE2 1 
ATOM   1123 C  CZ  . PHE A 1 174 ? -15.448 18.190 24.981  1.00 17.99  ? 154 PHE A CZ  1 
ATOM   1124 N  N   . LEU A 1 175 ? -17.199 24.727 22.840  1.00 14.48  ? 155 LEU A N   1 
ATOM   1125 C  CA  . LEU A 1 175 ? -17.475 26.156 22.655  1.00 14.20  ? 155 LEU A CA  1 
ATOM   1126 C  C   . LEU A 1 175 ? -17.838 26.861 23.957  1.00 14.28  ? 155 LEU A C   1 
ATOM   1127 O  O   . LEU A 1 175 ? -18.860 26.553 24.568  1.00 14.66  ? 155 LEU A O   1 
ATOM   1128 C  CB  . LEU A 1 175 ? -18.640 26.325 21.676  1.00 14.39  ? 155 LEU A CB  1 
ATOM   1129 C  CG  . LEU A 1 175 ? -18.500 25.682 20.296  1.00 14.50  ? 155 LEU A CG  1 
ATOM   1130 C  CD1 . LEU A 1 175 ? -19.816 25.641 19.557  1.00 14.91  ? 155 LEU A CD1 1 
ATOM   1131 C  CD2 . LEU A 1 175 ? -17.482 26.436 19.478  1.00 14.24  ? 155 LEU A CD2 1 
ATOM   1132 N  N   . LEU A 1 176 ? -17.018 27.810 24.387  1.00 14.11  ? 156 LEU A N   1 
ATOM   1133 C  CA  . LEU A 1 176 ? -17.409 28.681 25.497  1.00 14.58  ? 156 LEU A CA  1 
ATOM   1134 C  C   . LEU A 1 176 ? -18.057 30.008 25.021  1.00 16.30  ? 156 LEU A C   1 
ATOM   1135 O  O   . LEU A 1 176 ? -17.972 30.400 23.853  1.00 14.35  ? 156 LEU A O   1 
ATOM   1136 C  CB  . LEU A 1 176 ? -16.210 28.999 26.369  1.00 14.35  ? 156 LEU A CB  1 
ATOM   1137 C  CG  . LEU A 1 176 ? -15.410 27.797 26.838  1.00 16.87  ? 156 LEU A CG  1 
ATOM   1138 C  CD1 . LEU A 1 176 ? -14.320 28.271 27.782  1.00 14.58  ? 156 LEU A CD1 1 
ATOM   1139 C  CD2 . LEU A 1 176 ? -16.309 26.786 27.507  1.00 14.76  ? 156 LEU A CD2 1 
ATOM   1140 N  N   . ARG A 1 177 ? -18.687 30.706 25.954  1.00 14.90  ? 157 ARG A N   1 
ATOM   1141 C  CA  . ARG A 1 177 ? -19.377 31.951 25.663  1.00 15.30  ? 157 ARG A CA  1 
ATOM   1142 C  C   . ARG A 1 177 ? -18.445 33.149 25.839  1.00 15.44  ? 157 ARG A C   1 
ATOM   1143 O  O   . ARG A 1 177 ? -17.802 33.283 26.875  1.00 16.59  ? 157 ARG A O   1 
ATOM   1144 C  CB  . ARG A 1 177 ? -20.553 32.085 26.623  1.00 15.97  ? 157 ARG A CB  1 
ATOM   1145 C  CG  . ARG A 1 177 ? -21.468 33.213 26.289  1.00 16.60  ? 157 ARG A CG  1 
ATOM   1146 C  CD  . ARG A 1 177 ? -22.572 33.380 27.312  1.00 17.46  ? 157 ARG A CD  1 
ATOM   1147 N  NE  . ARG A 1 177 ? -23.676 34.132 26.729  1.00 18.18  ? 157 ARG A NE  1 
ATOM   1148 C  CZ  . ARG A 1 177 ? -24.928 34.147 27.183  1.00 22.54  ? 157 ARG A CZ  1 
ATOM   1149 N  NH1 . ARG A 1 177 ? -25.283 33.444 28.250  1.00 26.01  ? 157 ARG A NH1 1 
ATOM   1150 N  NH2 . ARG A 1 177 ? -25.837 34.870 26.544  1.00 20.52  ? 157 ARG A NH2 1 
ATOM   1151 N  N   . GLY A 1 178 ? -18.372 34.020 24.834  1.00 20.23  ? 158 GLY A N   1 
ATOM   1152 C  CA  . GLY A 1 178 ? -17.618 35.266 24.951  1.00 16.03  ? 158 GLY A CA  1 
ATOM   1153 C  C   . GLY A 1 178 ? -18.560 36.425 25.241  1.00 19.76  ? 158 GLY A C   1 
ATOM   1154 O  O   . GLY A 1 178 ? -19.781 36.261 25.223  1.00 20.07  ? 158 GLY A O   1 
ATOM   1155 N  N   . ASN A 1 179 ? -18.012 37.604 25.509  1.00 17.69  ? 159 ASN A N   1 
ATOM   1156 C  CA  . ASN A 1 179 ? -18.850 38.742 25.897  1.00 18.69  ? 159 ASN A CA  1 
ATOM   1157 C  C   . ASN A 1 179 ? -19.782 39.215 24.778  1.00 20.17  ? 159 ASN A C   1 
ATOM   1158 O  O   . ASN A 1 179 ? -20.796 39.877 25.030  1.00 21.97  ? 159 ASN A O   1 
ATOM   1159 C  CB  . ASN A 1 179 ? -18.010 39.904 26.473  1.00 22.44  ? 159 ASN A CB  1 
ATOM   1160 C  CG  . ASN A 1 179 ? -16.908 40.371 25.530  1.00 20.66  ? 159 ASN A CG  1 
ATOM   1161 O  OD1 . ASN A 1 179 ? -16.203 39.562 24.927  1.00 20.96  ? 159 ASN A OD1 1 
ATOM   1162 N  ND2 . ASN A 1 179 ? -16.760 41.685 25.400  1.00 20.82  ? 159 ASN A ND2 1 
ATOM   1163 N  N   . HIS A 1 180 ? -19.439 38.856 23.544  1.00 18.64  ? 160 HIS A N   1 
ATOM   1164 C  CA  . HIS A 1 180 ? -20.254 39.223 22.396  1.00 19.59  ? 160 HIS A CA  1 
ATOM   1165 C  C   . HIS A 1 180 ? -21.464 38.321 22.155  1.00 21.03  ? 160 HIS A C   1 
ATOM   1166 O  O   . HIS A 1 180 ? -22.352 38.674 21.407  1.00 25.64  ? 160 HIS A O   1 
ATOM   1167 C  CB  . HIS A 1 180 ? -19.396 39.317 21.146  1.00 18.98  ? 160 HIS A CB  1 
ATOM   1168 C  CG  . HIS A 1 180 ? -18.584 40.566 21.080  1.00 24.56  ? 160 HIS A CG  1 
ATOM   1169 N  ND1 . HIS A 1 180 ? -19.012 41.692 20.415  1.00 22.75  ? 160 HIS A ND1 1 
ATOM   1170 C  CD2 . HIS A 1 180 ? -17.386 40.879 21.628  1.00 23.79  ? 160 HIS A CD2 1 
ATOM   1171 C  CE1 . HIS A 1 180 ? -18.108 42.646 20.544  1.00 24.70  ? 160 HIS A CE1 1 
ATOM   1172 N  NE2 . HIS A 1 180 ? -17.111 42.178 21.274  1.00 25.10  ? 160 HIS A NE2 1 
ATOM   1173 N  N   . GLU A 1 181 ? -21.513 37.165 22.791  1.00 18.09  ? 161 GLU A N   1 
ATOM   1174 C  CA  . GLU A 1 181 ? -22.662 36.293 22.608  1.00 18.50  ? 161 GLU A CA  1 
ATOM   1175 C  C   . GLU A 1 181 ? -23.842 36.673 23.519  1.00 22.06  ? 161 GLU A C   1 
ATOM   1176 O  O   . GLU A 1 181 ? -24.168 35.983 24.500  1.00 24.04  ? 161 GLU A O   1 
ATOM   1177 C  CB  . GLU A 1 181 ? -22.275 34.817 22.761  1.00 17.41  ? 161 GLU A CB  1 
ATOM   1178 C  CG  . GLU A 1 181 ? -21.483 34.251 21.591  1.00 16.45  ? 161 GLU A CG  1 
ATOM   1179 C  CD  . GLU A 1 181 ? -20.082 34.839 21.493  1.00 21.94  ? 161 GLU A CD  1 
ATOM   1180 O  OE1 . GLU A 1 181 ? -19.295 34.710 22.456  1.00 23.23  ? 161 GLU A OE1 1 
ATOM   1181 O  OE2 . GLU A 1 181 ? -19.761 35.431 20.444  1.00 27.46  ? 161 GLU A OE2 1 
ATOM   1182 N  N   . CYS A 1 182 ? -24.499 37.770 23.169  1.00 20.03  ? 162 CYS A N   1 
ATOM   1183 C  CA  . CYS A 1 182 ? -25.572 38.275 24.001  1.00 24.02  ? 162 CYS A CA  1 
ATOM   1184 C  C   . CYS A 1 182 ? -26.367 39.284 23.199  1.00 28.69  ? 162 CYS A C   1 
ATOM   1185 O  O   . CYS A 1 182 ? -25.886 39.797 22.187  1.00 29.89  ? 162 CYS A O   1 
ATOM   1186 C  CB  . CYS A 1 182 ? -24.977 38.948 25.232  1.00 21.48  ? 162 CYS A CB  1 
ATOM   1187 S  SG  . CYS A 1 182 ? -23.968 40.387 24.816  1.00 26.51  ? 162 CYS A SG  1 
ATOM   1188 N  N   . ARG A 1 183 ? -27.582 39.569 23.655  1.00 28.87  ? 163 ARG A N   1 
ATOM   1189 C  CA  . ARG A 1 183 ? -28.469 40.494 22.953  1.00 25.28  ? 163 ARG A CA  1 
ATOM   1190 C  C   . ARG A 1 183 ? -27.908 41.906 22.951  1.00 28.71  ? 163 ARG A C   1 
ATOM   1191 O  O   . ARG A 1 183 ? -27.976 42.619 21.944  1.00 31.39  ? 163 ARG A O   1 
ATOM   1192 C  CB  . ARG A 1 183 ? -29.837 40.494 23.619  1.00 26.29  ? 163 ARG A CB  1 
ATOM   1193 C  CG  . ARG A 1 183 ? -30.496 39.159 23.538  1.00 25.78  ? 163 ARG A CG  1 
ATOM   1194 C  CD  . ARG A 1 183 ? -31.409 38.868 24.709  1.00 26.68  ? 163 ARG A CD  1 
ATOM   1195 N  NE  . ARG A 1 183 ? -31.846 37.474 24.602  1.00 26.13  ? 163 ARG A NE  1 
ATOM   1196 C  CZ  . ARG A 1 183 ? -31.181 36.433 25.109  1.00 24.91  ? 163 ARG A CZ  1 
ATOM   1197 N  NH1 . ARG A 1 183 ? -30.036 36.606 25.779  1.00 24.15  ? 163 ARG A NH1 1 
ATOM   1198 N  NH2 . ARG A 1 183 ? -31.654 35.205 24.938  1.00 24.71  ? 163 ARG A NH2 1 
ATOM   1199 N  N   . HIS A 1 184 ? -27.328 42.302 24.075  1.00 27.22  ? 164 HIS A N   1 
ATOM   1200 C  CA  A HIS A 1 184 ? -26.906 43.678 24.262  0.54 29.20  ? 164 HIS A CA  1 
ATOM   1201 C  CA  B HIS A 1 184 ? -26.930 43.690 24.250  0.46 29.24  ? 164 HIS A CA  1 
ATOM   1202 C  C   . HIS A 1 184 ? -25.885 44.141 23.235  1.00 31.27  ? 164 HIS A C   1 
ATOM   1203 O  O   . HIS A 1 184 ? -26.010 45.218 22.673  1.00 41.14  ? 164 HIS A O   1 
ATOM   1204 C  CB  A HIS A 1 184 ? -26.342 43.860 25.663  0.54 28.38  ? 164 HIS A CB  1 
ATOM   1205 C  CB  B HIS A 1 184 ? -26.474 43.970 25.689  0.46 28.62  ? 164 HIS A CB  1 
ATOM   1206 C  CG  A HIS A 1 184 ? -25.993 45.274 25.987  0.54 30.36  ? 164 HIS A CG  1 
ATOM   1207 C  CG  B HIS A 1 184 ? -27.603 44.210 26.651  0.46 30.52  ? 164 HIS A CG  1 
ATOM   1208 N  ND1 A HIS A 1 184 ? -26.910 46.300 25.916  0.54 35.93  ? 164 HIS A ND1 1 
ATOM   1209 N  ND1 B HIS A 1 184 ? -28.095 43.229 27.487  0.46 29.99  ? 164 HIS A ND1 1 
ATOM   1210 C  CD2 A HIS A 1 184 ? -24.826 45.835 26.379  0.54 29.62  ? 164 HIS A CD2 1 
ATOM   1211 C  CD2 B HIS A 1 184 ? -28.332 45.322 26.909  0.46 33.66  ? 164 HIS A CD2 1 
ATOM   1212 C  CE1 A HIS A 1 184 ? -26.324 47.432 26.259  0.54 38.26  ? 164 HIS A CE1 1 
ATOM   1213 C  CE1 B HIS A 1 184 ? -29.078 43.725 28.217  0.46 29.97  ? 164 HIS A CE1 1 
ATOM   1214 N  NE2 A HIS A 1 184 ? -25.060 47.175 26.548  0.54 34.93  ? 164 HIS A NE2 1 
ATOM   1215 N  NE2 B HIS A 1 184 ? -29.242 44.993 27.886  0.46 32.74  ? 164 HIS A NE2 1 
ATOM   1216 N  N   . LEU A 1 185 ? -24.872 43.319 22.991  1.00 29.87  ? 165 LEU A N   1 
ATOM   1217 C  CA  . LEU A 1 185 ? -23.793 43.711 22.087  1.00 29.64  ? 165 LEU A CA  1 
ATOM   1218 C  C   . LEU A 1 185 ? -24.103 43.453 20.613  1.00 33.38  ? 165 LEU A C   1 
ATOM   1219 O  O   . LEU A 1 185 ? -23.642 44.187 19.723  1.00 28.54  ? 165 LEU A O   1 
ATOM   1220 C  CB  . LEU A 1 185 ? -22.488 43.019 22.479  1.00 26.75  ? 165 LEU A CB  1 
ATOM   1221 C  CG  . LEU A 1 185 ? -21.583 43.820 23.414  1.00 30.85  ? 165 LEU A CG  1 
ATOM   1222 C  CD1 . LEU A 1 185 ? -22.221 43.909 24.790  1.00 28.81  ? 165 LEU A CD1 1 
ATOM   1223 C  CD2 . LEU A 1 185 ? -20.191 43.215 23.482  1.00 31.34  ? 165 LEU A CD2 1 
ATOM   1224 N  N   . THR A 1 186 ? -24.867 42.403 20.342  1.00 29.84  ? 166 THR A N   1 
ATOM   1225 C  CA  . THR A 1 186 ? -25.197 42.112 18.964  1.00 28.44  ? 166 THR A CA  1 
ATOM   1226 C  C   . THR A 1 186 ? -26.222 43.088 18.398  1.00 30.15  ? 166 THR A C   1 
ATOM   1227 O  O   . THR A 1 186 ? -26.242 43.297 17.190  1.00 32.37  ? 166 THR A O   1 
ATOM   1228 C  CB  . THR A 1 186 ? -25.666 40.667 18.757  1.00 28.67  ? 166 THR A CB  1 
ATOM   1229 O  OG1 . THR A 1 186 ? -26.915 40.460 19.429  1.00 28.89  ? 166 THR A OG1 1 
ATOM   1230 C  CG2 . THR A 1 186 ? -24.616 39.702 19.261  1.00 21.65  ? 166 THR A CG2 1 
ATOM   1231 N  N   . GLU A 1 187 ? -27.074 43.678 19.243  1.00 32.66  ? 167 GLU A N   1 
ATOM   1232 C  CA  A GLU A 1 187 ? -27.975 44.709 18.739  0.45 31.54  ? 167 GLU A CA  1 
ATOM   1233 C  CA  B GLU A 1 187 ? -28.000 44.732 18.818  0.55 31.49  ? 167 GLU A CA  1 
ATOM   1234 C  C   . GLU A 1 187 ? -27.204 45.988 18.487  1.00 32.84  ? 167 GLU A C   1 
ATOM   1235 O  O   . GLU A 1 187 ? -27.532 46.731 17.577  1.00 42.68  ? 167 GLU A O   1 
ATOM   1236 C  CB  A GLU A 1 187 ? -29.164 44.967 19.663  0.45 32.87  ? 167 GLU A CB  1 
ATOM   1237 C  CB  B GLU A 1 187 ? -29.034 45.041 19.917  0.55 32.66  ? 167 GLU A CB  1 
ATOM   1238 C  CG  A GLU A 1 187 ? -28.828 45.609 20.990  0.45 36.20  ? 167 GLU A CG  1 
ATOM   1239 C  CG  B GLU A 1 187 ? -30.386 44.305 19.784  0.55 34.61  ? 167 GLU A CG  1 
ATOM   1240 C  CD  A GLU A 1 187 ? -30.052 45.715 21.878  0.45 42.04  ? 167 GLU A CD  1 
ATOM   1241 C  CD  B GLU A 1 187 ? -30.844 43.586 21.073  0.55 35.84  ? 167 GLU A CD  1 
ATOM   1242 O  OE1 A GLU A 1 187 ? -31.171 45.636 21.321  0.45 44.57  ? 167 GLU A OE1 1 
ATOM   1243 O  OE1 B GLU A 1 187 ? -30.897 44.234 22.145  0.55 40.80  ? 167 GLU A OE1 1 
ATOM   1244 O  OE2 A GLU A 1 187 ? -29.900 45.867 23.116  0.45 39.23  ? 167 GLU A OE2 1 
ATOM   1245 O  OE2 B GLU A 1 187 ? -31.157 42.370 21.015  0.55 29.85  ? 167 GLU A OE2 1 
ATOM   1246 N  N   . TYR A 1 188 ? -26.150 46.217 19.256  1.00 32.01  ? 168 TYR A N   1 
ATOM   1247 C  CA  . TYR A 1 188 ? -25.365 47.429 19.108  1.00 32.98  ? 168 TYR A CA  1 
ATOM   1248 C  C   . TYR A 1 188 ? -24.395 47.309 17.955  1.00 37.64  ? 168 TYR A C   1 
ATOM   1249 O  O   . TYR A 1 188 ? -24.269 48.220 17.144  1.00 44.34  ? 168 TYR A O   1 
ATOM   1250 C  CB  . TYR A 1 188 ? -24.617 47.714 20.398  1.00 30.89  ? 168 TYR A CB  1 
ATOM   1251 C  CG  . TYR A 1 188 ? -23.675 48.902 20.353  1.00 37.42  ? 168 TYR A CG  1 
ATOM   1252 C  CD1 . TYR A 1 188 ? -22.348 48.756 19.949  1.00 39.38  ? 168 TYR A CD1 1 
ATOM   1253 C  CD2 . TYR A 1 188 ? -24.098 50.156 20.766  1.00 37.46  ? 168 TYR A CD2 1 
ATOM   1254 C  CE1 . TYR A 1 188 ? -21.480 49.832 19.935  1.00 38.13  ? 168 TYR A CE1 1 
ATOM   1255 C  CE2 . TYR A 1 188 ? -23.234 51.243 20.756  1.00 39.17  ? 168 TYR A CE2 1 
ATOM   1256 C  CZ  . TYR A 1 188 ? -21.928 51.078 20.340  1.00 38.35  ? 168 TYR A CZ  1 
ATOM   1257 O  OH  . TYR A 1 188 ? -21.078 52.165 20.328  1.00 40.09  ? 168 TYR A OH  1 
ATOM   1258 N  N   . PHE A 1 189 ? -23.688 46.194 17.888  1.00 40.47  ? 169 PHE A N   1 
ATOM   1259 C  CA  . PHE A 1 189 ? -22.824 45.964 16.746  1.00 37.37  ? 169 PHE A CA  1 
ATOM   1260 C  C   . PHE A 1 189 ? -23.621 45.369 15.601  1.00 36.22  ? 169 PHE A C   1 
ATOM   1261 O  O   . PHE A 1 189 ? -24.850 45.461 15.582  1.00 40.19  ? 169 PHE A O   1 
ATOM   1262 C  CB  . PHE A 1 189 ? -21.635 45.094 17.120  1.00 32.15  ? 169 PHE A CB  1 
ATOM   1263 C  CG  . PHE A 1 189 ? -20.719 45.745 18.087  1.00 30.02  ? 169 PHE A CG  1 
ATOM   1264 C  CD1 . PHE A 1 189 ? -19.860 46.745 17.676  1.00 29.09  ? 169 PHE A CD1 1 
ATOM   1265 C  CD2 . PHE A 1 189 ? -20.728 45.383 19.416  1.00 35.21  ? 169 PHE A CD2 1 
ATOM   1266 C  CE1 . PHE A 1 189 ? -19.012 47.364 18.573  1.00 31.04  ? 169 PHE A CE1 1 
ATOM   1267 C  CE2 . PHE A 1 189 ? -19.873 46.002 20.326  1.00 29.82  ? 169 PHE A CE2 1 
ATOM   1268 C  CZ  . PHE A 1 189 ? -19.020 46.991 19.903  1.00 27.62  ? 169 PHE A CZ  1 
ATOM   1269 N  N   . THR A 1 190 ? -22.926 44.752 14.654  1.00 31.10  ? 170 THR A N   1 
ATOM   1270 C  CA  . THR A 1 190 ? -23.557 44.404 13.384  1.00 30.38  ? 170 THR A CA  1 
ATOM   1271 C  C   . THR A 1 190 ? -24.213 43.028 13.296  1.00 29.96  ? 170 THR A C   1 
ATOM   1272 O  O   . THR A 1 190 ? -24.807 42.696 12.275  1.00 33.43  ? 170 THR A O   1 
ATOM   1273 C  CB  . THR A 1 190 ? -22.572 44.539 12.225  1.00 31.03  ? 170 THR A CB  1 
ATOM   1274 O  OG1 . THR A 1 190 ? -21.384 43.805 12.530  1.00 42.56  ? 170 THR A OG1 1 
ATOM   1275 C  CG2 . THR A 1 190 ? -22.225 45.990 12.012  1.00 29.80  ? 170 THR A CG2 1 
ATOM   1276 N  N   . PHE A 1 191 ? -24.143 42.228 14.343  1.00 25.03  ? 171 PHE A N   1 
ATOM   1277 C  CA  . PHE A 1 191 ? -24.605 40.870 14.171  1.00 24.53  ? 171 PHE A CA  1 
ATOM   1278 C  C   . PHE A 1 191 ? -26.132 40.742 14.020  1.00 29.52  ? 171 PHE A C   1 
ATOM   1279 O  O   . PHE A 1 191 ? -26.612 39.850 13.317  1.00 30.71  ? 171 PHE A O   1 
ATOM   1280 C  CB  . PHE A 1 191 ? -24.067 39.948 15.259  1.00 24.94  ? 171 PHE A CB  1 
ATOM   1281 C  CG  . PHE A 1 191 ? -24.485 38.530 15.084  1.00 22.50  ? 171 PHE A CG  1 
ATOM   1282 C  CD1 . PHE A 1 191 ? -23.991 37.790 14.042  1.00 21.09  ? 171 PHE A CD1 1 
ATOM   1283 C  CD2 . PHE A 1 191 ? -25.398 37.948 15.941  1.00 22.60  ? 171 PHE A CD2 1 
ATOM   1284 C  CE1 . PHE A 1 191 ? -24.388 36.485 13.859  1.00 21.61  ? 171 PHE A CE1 1 
ATOM   1285 C  CE2 . PHE A 1 191 ? -25.794 36.649 15.764  1.00 22.14  ? 171 PHE A CE2 1 
ATOM   1286 C  CZ  . PHE A 1 191 ? -25.293 35.916 14.719  1.00 21.22  ? 171 PHE A CZ  1 
ATOM   1287 N  N   . LYS A 1 192 ? -26.895 41.626 14.655  1.00 32.79  ? 172 LYS A N   1 
ATOM   1288 C  CA  . LYS A 1 192 ? -28.348 41.596 14.482  1.00 32.07  ? 172 LYS A CA  1 
ATOM   1289 C  C   . LYS A 1 192 ? -28.695 41.965 13.048  1.00 33.44  ? 172 LYS A C   1 
ATOM   1290 O  O   . LYS A 1 192 ? -29.476 41.276 12.375  1.00 30.64  ? 172 LYS A O   1 
ATOM   1291 C  CB  . LYS A 1 192 ? -29.054 42.549 15.447  1.00 33.28  ? 172 LYS A CB  1 
ATOM   1292 C  CG  . LYS A 1 192 ? -30.530 42.259 15.570  1.00 32.78  ? 172 LYS A CG  1 
ATOM   1293 C  CD  . LYS A 1 192 ? -31.217 43.249 16.464  1.00 38.71  ? 172 LYS A CD  1 
ATOM   1294 C  CE  . LYS A 1 192 ? -32.713 42.999 16.477  1.00 41.64  ? 172 LYS A CE  1 
ATOM   1295 N  NZ  . LYS A 1 192 ? -33.465 43.972 17.309  1.00 42.93  ? 172 LYS A NZ  1 
ATOM   1296 N  N   . GLN A 1 193 ? -28.095 43.048 12.576  1.00 37.59  ? 173 GLN A N   1 
ATOM   1297 C  CA  . GLN A 1 193 ? -28.252 43.427 11.185  1.00 41.54  ? 173 GLN A CA  1 
ATOM   1298 C  C   . GLN A 1 193 ? -27.884 42.276 10.247  1.00 40.21  ? 173 GLN A C   1 
ATOM   1299 O  O   . GLN A 1 193 ? -28.652 41.956 9.342   1.00 42.06  ? 173 GLN A O   1 
ATOM   1300 C  CB  . GLN A 1 193 ? -27.436 44.684 10.871  1.00 44.63  ? 173 GLN A CB  1 
ATOM   1301 C  CG  . GLN A 1 193 ? -27.638 45.244 9.475   1.00 47.26  ? 173 GLN A CG  1 
ATOM   1302 C  CD  . GLN A 1 193 ? -29.048 45.767 9.241   1.00 51.74  ? 173 GLN A CD  1 
ATOM   1303 O  OE1 . GLN A 1 193 ? -29.918 45.682 10.115  1.00 52.21  ? 173 GLN A OE1 1 
ATOM   1304 N  NE2 . GLN A 1 193 ? -29.281 46.313 8.046   1.00 51.31  ? 173 GLN A NE2 1 
ATOM   1305 N  N   . GLU A 1 194 ? -26.736 41.641 10.489  1.00 32.98  ? 174 GLU A N   1 
ATOM   1306 C  CA  . GLU A 1 194 ? -26.274 40.522 9.657   1.00 28.37  ? 174 GLU A CA  1 
ATOM   1307 C  C   . GLU A 1 194 ? -27.334 39.414 9.467   1.00 28.89  ? 174 GLU A C   1 
ATOM   1308 O  O   . GLU A 1 194 ? -27.589 38.956 8.350   1.00 27.07  ? 174 GLU A O   1 
ATOM   1309 C  CB  . GLU A 1 194 ? -24.970 39.929 10.197  1.00 25.18  ? 174 GLU A CB  1 
ATOM   1310 C  CG  . GLU A 1 194 ? -24.370 38.862 9.284   1.00 31.66  ? 174 GLU A CG  1 
ATOM   1311 C  CD  . GLU A 1 194 ? -22.998 38.360 9.740   1.00 30.62  ? 174 GLU A CD  1 
ATOM   1312 O  OE1 . GLU A 1 194 ? -22.374 38.969 10.631  1.00 30.25  ? 174 GLU A OE1 1 
ATOM   1313 O  OE2 . GLU A 1 194 ? -22.532 37.344 9.192   1.00 32.41  ? 174 GLU A OE2 1 
ATOM   1314 N  N   . CYS A 1 195 ? -27.958 39.003 10.563  1.00 26.36  ? 175 CYS A N   1 
ATOM   1315 C  CA  . CYS A 1 195 ? -28.989 37.981 10.507  1.00 29.48  ? 175 CYS A CA  1 
ATOM   1316 C  C   . CYS A 1 195 ? -30.208 38.478 9.773   1.00 38.75  ? 175 CYS A C   1 
ATOM   1317 O  O   . CYS A 1 195 ? -30.818 37.741 9.003   1.00 44.02  ? 175 CYS A O   1 
ATOM   1318 C  CB  . CYS A 1 195 ? -29.399 37.566 11.912  1.00 28.81  ? 175 CYS A CB  1 
ATOM   1319 S  SG  . CYS A 1 195 ? -28.099 36.740 12.820  1.00 29.06  ? 175 CYS A SG  1 
ATOM   1320 N  N   . LYS A 1 196 ? -30.575 39.727 10.031  1.00 43.08  ? 176 LYS A N   1 
ATOM   1321 C  CA  . LYS A 1 196 ? -31.754 40.300 9.411   1.00 47.45  ? 176 LYS A CA  1 
ATOM   1322 C  C   . LYS A 1 196 ? -31.558 40.374 7.878   1.00 45.40  ? 176 LYS A C   1 
ATOM   1323 O  O   . LYS A 1 196 ? -32.439 39.963 7.111   1.00 41.52  ? 176 LYS A O   1 
ATOM   1324 C  CB  . LYS A 1 196 ? -32.065 41.659 10.042  1.00 53.78  ? 176 LYS A CB  1 
ATOM   1325 C  CG  . LYS A 1 196 ? -33.312 42.324 9.503   1.00 61.88  ? 176 LYS A CG  1 
ATOM   1326 C  CD  . LYS A 1 196 ? -33.275 43.837 9.718   1.00 65.01  ? 176 LYS A CD  1 
ATOM   1327 C  CE  . LYS A 1 196 ? -34.101 44.575 8.664   1.00 66.53  ? 176 LYS A CE  1 
ATOM   1328 N  NZ  . LYS A 1 196 ? -35.503 44.063 8.584   1.00 66.89  ? 176 LYS A NZ  1 
ATOM   1329 N  N   . ILE A 1 197 ? -30.384 40.840 7.444   1.00 42.89  ? 177 ILE A N   1 
ATOM   1330 C  CA  . ILE A 1 197 ? -30.056 40.914 6.012   1.00 37.68  ? 177 ILE A CA  1 
ATOM   1331 C  C   . ILE A 1 197 ? -29.890 39.550 5.346   1.00 36.47  ? 177 ILE A C   1 
ATOM   1332 O  O   . ILE A 1 197 ? -30.608 39.238 4.396   1.00 46.84  ? 177 ILE A O   1 
ATOM   1333 C  CB  . ILE A 1 197 ? -28.781 41.762 5.731   1.00 39.38  ? 177 ILE A CB  1 
ATOM   1334 C  CG1 . ILE A 1 197 ? -29.051 43.249 5.959   1.00 38.77  ? 177 ILE A CG1 1 
ATOM   1335 C  CG2 . ILE A 1 197 ? -28.266 41.551 4.312   1.00 33.01  ? 177 ILE A CG2 1 
ATOM   1336 C  CD1 . ILE A 1 197 ? -30.504 43.642 5.936   1.00 39.67  ? 177 ILE A CD1 1 
ATOM   1337 N  N   . LYS A 1 198 ? -28.943 38.744 5.828   1.00 34.67  ? 178 LYS A N   1 
ATOM   1338 C  CA  . LYS A 1 198 ? -28.645 37.436 5.214   1.00 30.91  ? 178 LYS A CA  1 
ATOM   1339 C  C   . LYS A 1 198 ? -29.701 36.358 5.464   1.00 28.80  ? 178 LYS A C   1 
ATOM   1340 O  O   . LYS A 1 198 ? -29.890 35.487 4.633   1.00 33.72  ? 178 LYS A O   1 
ATOM   1341 C  CB  . LYS A 1 198 ? -27.295 36.888 5.696   1.00 27.97  ? 178 LYS A CB  1 
ATOM   1342 C  CG  . LYS A 1 198 ? -26.073 37.715 5.326   1.00 27.33  ? 178 LYS A CG  1 
ATOM   1343 C  CD  . LYS A 1 198 ? -24.829 37.135 6.003   1.00 26.42  ? 178 LYS A CD  1 
ATOM   1344 C  CE  . LYS A 1 198 ? -23.555 37.795 5.511   1.00 29.25  ? 178 LYS A CE  1 
ATOM   1345 N  NZ  . LYS A 1 198 ? -22.329 37.233 6.154   1.00 24.57  ? 178 LYS A NZ  1 
ATOM   1346 N  N   . TYR A 1 199 ? -30.357 36.386 6.620   1.00 29.89  ? 179 TYR A N   1 
ATOM   1347 C  CA  . TYR A 1 199 ? -31.305 35.323 6.974   1.00 34.02  ? 179 TYR A CA  1 
ATOM   1348 C  C   . TYR A 1 199 ? -32.637 35.900 7.440   1.00 37.19  ? 179 TYR A C   1 
ATOM   1349 O  O   . TYR A 1 199 ? -33.509 36.161 6.617   1.00 39.73  ? 179 TYR A O   1 
ATOM   1350 C  CB  . TYR A 1 199 ? -30.690 34.325 7.970   1.00 33.03  ? 179 TYR A CB  1 
ATOM   1351 C  CG  . TYR A 1 199 ? -29.617 33.485 7.316   1.00 26.33  ? 179 TYR A CG  1 
ATOM   1352 C  CD1 . TYR A 1 199 ? -28.323 33.964 7.180   1.00 29.25  ? 179 TYR A CD1 1 
ATOM   1353 C  CD2 . TYR A 1 199 ? -29.910 32.243 6.789   1.00 26.47  ? 179 TYR A CD2 1 
ATOM   1354 C  CE1 . TYR A 1 199 ? -27.339 33.216 6.544   1.00 34.47  ? 179 TYR A CE1 1 
ATOM   1355 C  CE2 . TYR A 1 199 ? -28.933 31.478 6.146   1.00 29.10  ? 179 TYR A CE2 1 
ATOM   1356 C  CZ  . TYR A 1 199 ? -27.651 31.974 6.028   1.00 31.77  ? 179 TYR A CZ  1 
ATOM   1357 O  OH  . TYR A 1 199 ? -26.675 31.238 5.404   1.00 28.06  ? 179 TYR A OH  1 
ATOM   1358 N  N   . SER A 1 200 ? -32.798 36.100 8.742   1.00 41.74  ? 180 SER A N   1 
ATOM   1359 C  CA  . SER A 1 200 ? -34.004 36.736 9.266   1.00 39.97  ? 180 SER A CA  1 
ATOM   1360 C  C   . SER A 1 200 ? -33.917 36.900 10.769  1.00 37.57  ? 180 SER A C   1 
ATOM   1361 O  O   . SER A 1 200 ? -33.048 36.315 11.412  1.00 39.87  ? 180 SER A O   1 
ATOM   1362 C  CB  . SER A 1 200 ? -35.234 35.887 8.963   1.00 37.80  ? 180 SER A CB  1 
ATOM   1363 O  OG  . SER A 1 200 ? -35.270 34.777 9.842   1.00 39.83  ? 180 SER A OG  1 
ATOM   1364 N  N   . GLU A 1 201 ? -34.856 37.663 11.322  1.00 36.14  ? 181 GLU A N   1 
ATOM   1365 C  CA  . GLU A 1 201 ? -34.994 37.852 12.770  1.00 33.25  ? 181 GLU A CA  1 
ATOM   1366 C  C   . GLU A 1 201 ? -35.125 36.533 13.514  1.00 35.36  ? 181 GLU A C   1 
ATOM   1367 O  O   . GLU A 1 201 ? -34.660 36.398 14.640  1.00 39.09  ? 181 GLU A O   1 
ATOM   1368 C  CB  . GLU A 1 201 ? -36.237 38.690 13.055  1.00 44.34  ? 181 GLU A CB  1 
ATOM   1369 C  CG  . GLU A 1 201 ? -36.398 39.124 14.506  1.00 55.89  ? 181 GLU A CG  1 
ATOM   1370 C  CD  . GLU A 1 201 ? -35.859 40.534 14.764  1.00 63.05  ? 181 GLU A CD  1 
ATOM   1371 O  OE1 . GLU A 1 201 ? -35.784 41.339 13.797  1.00 64.71  ? 181 GLU A OE1 1 
ATOM   1372 O  OE2 . GLU A 1 201 ? -35.516 40.830 15.935  1.00 62.39  ? 181 GLU A OE2 1 
ATOM   1373 N  N   . ARG A 1 202 ? -35.770 35.562 12.886  1.00 36.44  ? 182 ARG A N   1 
ATOM   1374 C  CA  . ARG A 1 202 ? -35.970 34.270 13.517  1.00 37.67  ? 182 ARG A CA  1 
ATOM   1375 C  C   . ARG A 1 202 ? -34.640 33.606 13.832  1.00 35.55  ? 182 ARG A C   1 
ATOM   1376 O  O   . ARG A 1 202 ? -34.467 33.030 14.911  1.00 33.89  ? 182 ARG A O   1 
ATOM   1377 C  CB  . ARG A 1 202 ? -36.807 33.365 12.615  1.00 40.65  ? 182 ARG A CB  1 
ATOM   1378 C  CG  . ARG A 1 202 ? -38.221 33.209 13.090  1.00 45.05  ? 182 ARG A CG  1 
ATOM   1379 C  CD  . ARG A 1 202 ? -39.190 33.105 11.924  1.00 57.55  ? 182 ARG A CD  1 
ATOM   1380 N  NE  . ARG A 1 202 ? -38.976 31.904 11.115  1.00 62.81  ? 182 ARG A NE  1 
ATOM   1381 C  CZ  . ARG A 1 202 ? -39.353 30.675 11.468  1.00 60.74  ? 182 ARG A CZ  1 
ATOM   1382 N  NH1 . ARG A 1 202 ? -39.956 30.459 12.637  1.00 61.85  ? 182 ARG A NH1 1 
ATOM   1383 N  NH2 . ARG A 1 202 ? -39.114 29.657 10.649  1.00 55.33  ? 182 ARG A NH2 1 
ATOM   1384 N  N   . VAL A 1 203 ? -33.709 33.683 12.885  1.00 33.73  ? 183 VAL A N   1 
ATOM   1385 C  CA  . VAL A 1 203 ? -32.398 33.085 13.067  1.00 32.90  ? 183 VAL A CA  1 
ATOM   1386 C  C   . VAL A 1 203 ? -31.616 33.823 14.157  1.00 33.33  ? 183 VAL A C   1 
ATOM   1387 O  O   . VAL A 1 203 ? -31.009 33.196 15.022  1.00 34.16  ? 183 VAL A O   1 
ATOM   1388 C  CB  . VAL A 1 203 ? -31.609 33.025 11.740  1.00 29.83  ? 183 VAL A CB  1 
ATOM   1389 C  CG1 . VAL A 1 203 ? -30.143 32.709 11.982  1.00 27.16  ? 183 VAL A CG1 1 
ATOM   1390 C  CG2 . VAL A 1 203 ? -32.206 31.986 10.833  1.00 27.03  ? 183 VAL A CG2 1 
ATOM   1391 N  N   . TYR A 1 204 ? -31.643 35.149 14.125  1.00 29.46  ? 184 TYR A N   1 
ATOM   1392 C  CA  . TYR A 1 204 ? -31.071 35.942 15.214  1.00 30.58  ? 184 TYR A CA  1 
ATOM   1393 C  C   . TYR A 1 204 ? -31.590 35.479 16.574  1.00 33.55  ? 184 TYR A C   1 
ATOM   1394 O  O   . TYR A 1 204 ? -30.811 35.218 17.492  1.00 33.19  ? 184 TYR A O   1 
ATOM   1395 C  CB  . TYR A 1 204 ? -31.392 37.417 15.026  1.00 27.00  ? 184 TYR A CB  1 
ATOM   1396 C  CG  . TYR A 1 204 ? -30.898 38.296 16.138  1.00 31.35  ? 184 TYR A CG  1 
ATOM   1397 C  CD1 . TYR A 1 204 ? -29.567 38.665 16.216  1.00 37.11  ? 184 TYR A CD1 1 
ATOM   1398 C  CD2 . TYR A 1 204 ? -31.766 38.772 17.110  1.00 36.99  ? 184 TYR A CD2 1 
ATOM   1399 C  CE1 . TYR A 1 204 ? -29.108 39.482 17.244  1.00 36.89  ? 184 TYR A CE1 1 
ATOM   1400 C  CE2 . TYR A 1 204 ? -31.322 39.586 18.140  1.00 36.00  ? 184 TYR A CE2 1 
ATOM   1401 C  CZ  . TYR A 1 204 ? -29.991 39.942 18.200  1.00 34.71  ? 184 TYR A CZ  1 
ATOM   1402 O  OH  . TYR A 1 204 ? -29.535 40.760 19.211  1.00 35.56  ? 184 TYR A OH  1 
ATOM   1403 N  N   . GLU A 1 205 ? -32.906 35.369 16.702  1.00 33.61  ? 185 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 205 ? -33.483 34.926 17.959  1.00 29.00  ? 185 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 205 ? -32.963 33.545 18.350  1.00 30.92  ? 185 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 205 ? -32.525 33.350 19.490  1.00 39.11  ? 185 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 205 ? -35.014 34.970 17.927  1.00 31.90  ? 185 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 205 ? -35.629 35.815 19.051  1.00 45.05  ? 185 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 205 ? -35.396 35.225 20.461  1.00 54.79  ? 185 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 205 ? -36.057 34.215 20.817  1.00 56.61  ? 185 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 205 ? -34.560 35.776 21.221  1.00 56.41  ? 185 GLU A OE2 1 
ATOM   1412 N  N   . ALA A 1 206 ? -32.973 32.601 17.408  1.00 25.10  ? 186 ALA A N   1 
ATOM   1413 C  CA  . ALA A 1 206 ? -32.499 31.245 17.696  1.00 23.83  ? 186 ALA A CA  1 
ATOM   1414 C  C   . ALA A 1 206 ? -31.034 31.233 18.159  1.00 23.67  ? 186 ALA A C   1 
ATOM   1415 O  O   . ALA A 1 206 ? -30.637 30.366 18.951  1.00 25.28  ? 186 ALA A O   1 
ATOM   1416 C  CB  . ALA A 1 206 ? -32.689 30.343 16.508  1.00 24.06  ? 186 ALA A CB  1 
ATOM   1417 N  N   . CYS A 1 207 ? -30.250 32.198 17.673  1.00 21.82  ? 187 CYS A N   1 
ATOM   1418 C  CA  . CYS A 1 207 ? -28.860 32.359 18.084  1.00 22.55  ? 187 CYS A CA  1 
ATOM   1419 C  C   . CYS A 1 207 ? -28.754 32.868 19.509  1.00 24.01  ? 187 CYS A C   1 
ATOM   1420 O  O   . CYS A 1 207 ? -27.889 32.417 20.266  1.00 23.98  ? 187 CYS A O   1 
ATOM   1421 C  CB  . CYS A 1 207 ? -28.122 33.348 17.187  1.00 22.52  ? 187 CYS A CB  1 
ATOM   1422 S  SG  . CYS A 1 207 ? -27.601 32.722 15.618  1.00 24.61  ? 187 CYS A SG  1 
ATOM   1423 N  N   . MET A 1 208 ? -29.604 33.827 19.868  1.00 24.12  ? 188 MET A N   1 
ATOM   1424 C  CA  . MET A 1 208 ? -29.619 34.313 21.244  1.00 23.37  ? 188 MET A CA  1 
ATOM   1425 C  C   . MET A 1 208 ? -29.928 33.186 22.241  1.00 23.26  ? 188 MET A C   1 
ATOM   1426 O  O   . MET A 1 208 ? -29.254 33.055 23.258  1.00 21.18  ? 188 MET A O   1 
ATOM   1427 C  CB  . MET A 1 208 ? -30.575 35.492 21.418  1.00 23.27  ? 188 MET A CB  1 
ATOM   1428 C  CG  . MET A 1 208 ? -30.237 36.723 20.564  1.00 23.63  ? 188 MET A CG  1 
ATOM   1429 S  SD  . MET A 1 208 ? -28.561 37.362 20.761  1.00 28.40  ? 188 MET A SD  1 
ATOM   1430 C  CE  . MET A 1 208 ? -27.762 36.654 19.324  1.00 28.26  ? 188 MET A CE  1 
ATOM   1431 N  N   . GLU A 1 209 ? -30.909 32.345 21.951  1.00 27.28  ? 189 GLU A N   1 
ATOM   1432 C  CA  . GLU A 1 209 ? -31.115 31.179 22.821  1.00 28.03  ? 189 GLU A CA  1 
ATOM   1433 C  C   . GLU A 1 209 ? -29.951 30.156 22.801  1.00 24.96  ? 189 GLU A C   1 
ATOM   1434 O  O   . GLU A 1 209 ? -29.672 29.507 23.804  1.00 29.08  ? 189 GLU A O   1 
ATOM   1435 C  CB  . GLU A 1 209 ? -32.454 30.491 22.521  1.00 32.79  ? 189 GLU A CB  1 
ATOM   1436 C  CG  . GLU A 1 209 ? -33.663 31.377 22.733  1.00 46.81  ? 189 GLU A CG  1 
ATOM   1437 C  CD  . GLU A 1 209 ? -34.953 30.611 22.572  1.00 60.07  ? 189 GLU A CD  1 
ATOM   1438 O  OE1 . GLU A 1 209 ? -35.001 29.455 23.045  1.00 62.92  ? 189 GLU A OE1 1 
ATOM   1439 O  OE2 . GLU A 1 209 ? -35.906 31.149 21.961  1.00 64.17  ? 189 GLU A OE2 1 
ATOM   1440 N  N   . ALA A 1 210 ? -29.287 30.002 21.661  1.00 20.39  ? 190 ALA A N   1 
ATOM   1441 C  CA  . ALA A 1 210 ? -28.144 29.113 21.576  1.00 19.33  ? 190 ALA A CA  1 
ATOM   1442 C  C   . ALA A 1 210 ? -26.990 29.727 22.367  1.00 18.97  ? 190 ALA A C   1 
ATOM   1443 O  O   . ALA A 1 210 ? -26.211 29.009 23.009  1.00 18.64  ? 190 ALA A O   1 
ATOM   1444 C  CB  . ALA A 1 210 ? -27.739 28.868 20.113  1.00 18.96  ? 190 ALA A CB  1 
ATOM   1445 N  N   . PHE A 1 211 ? -26.885 31.058 22.328  1.00 18.60  ? 191 PHE A N   1 
ATOM   1446 C  CA  . PHE A 1 211 ? -25.826 31.754 23.051  1.00 18.06  ? 191 PHE A CA  1 
ATOM   1447 C  C   . PHE A 1 211 ? -25.996 31.614 24.551  1.00 18.37  ? 191 PHE A C   1 
ATOM   1448 O  O   . PHE A 1 211 ? -25.009 31.448 25.269  1.00 17.81  ? 191 PHE A O   1 
ATOM   1449 C  CB  . PHE A 1 211 ? -25.731 33.226 22.649  1.00 18.39  ? 191 PHE A CB  1 
ATOM   1450 C  CG  . PHE A 1 211 ? -25.146 33.434 21.286  1.00 19.55  ? 191 PHE A CG  1 
ATOM   1451 C  CD1 . PHE A 1 211 ? -24.619 32.367 20.575  1.00 18.97  ? 191 PHE A CD1 1 
ATOM   1452 C  CD2 . PHE A 1 211 ? -25.130 34.684 20.705  1.00 19.88  ? 191 PHE A CD2 1 
ATOM   1453 C  CE1 . PHE A 1 211 ? -24.089 32.542 19.297  1.00 17.17  ? 191 PHE A CE1 1 
ATOM   1454 C  CE2 . PHE A 1 211 ? -24.591 34.869 19.429  1.00 19.88  ? 191 PHE A CE2 1 
ATOM   1455 C  CZ  . PHE A 1 211 ? -24.072 33.788 18.730  1.00 17.67  ? 191 PHE A CZ  1 
ATOM   1456 N  N   . ASP A 1 212 ? -27.246 31.663 25.015  1.00 19.41  ? 192 ASP A N   1 
ATOM   1457 C  CA  . ASP A 1 212 ? -27.566 31.434 26.423  1.00 19.99  ? 192 ASP A CA  1 
ATOM   1458 C  C   . ASP A 1 212 ? -27.163 30.020 26.855  1.00 23.34  ? 192 ASP A C   1 
ATOM   1459 O  O   . ASP A 1 212 ? -26.873 29.782 28.027  1.00 20.75  ? 192 ASP A O   1 
ATOM   1460 C  CB  . ASP A 1 212 ? -29.050 31.680 26.722  1.00 28.22  ? 192 ASP A CB  1 
ATOM   1461 C  CG  . ASP A 1 212 ? -29.491 33.130 26.460  1.00 30.87  ? 192 ASP A CG  1 
ATOM   1462 O  OD1 . ASP A 1 212 ? -28.630 34.031 26.314  1.00 28.55  ? 192 ASP A OD1 1 
ATOM   1463 O  OD2 . ASP A 1 212 ? -30.723 33.359 26.396  1.00 32.45  ? 192 ASP A OD2 1 
ATOM   1464 N  N   . SER A 1 213 ? -27.113 29.081 25.918  1.00 23.43  ? 193 SER A N   1 
ATOM   1465 C  CA  . SER A 1 213 ? -26.772 27.710 26.288  1.00 22.93  ? 193 SER A CA  1 
ATOM   1466 C  C   . SER A 1 213 ? -25.289 27.468 26.542  1.00 20.64  ? 193 SER A C   1 
ATOM   1467 O  O   . SER A 1 213 ? -24.927 26.499 27.215  1.00 18.20  ? 193 SER A O   1 
ATOM   1468 C  CB  . SER A 1 213 ? -27.300 26.714 25.260  1.00 23.57  ? 193 SER A CB  1 
ATOM   1469 O  OG  . SER A 1 213 ? -28.661 26.435 25.535  1.00 32.02  ? 193 SER A OG  1 
ATOM   1470 N  N   . LEU A 1 214 ? -24.437 28.342 26.015  1.00 17.35  ? 194 LEU A N   1 
ATOM   1471 C  CA  . LEU A 1 214 ? -22.989 28.112 26.054  1.00 16.51  ? 194 LEU A CA  1 
ATOM   1472 C  C   . LEU A 1 214 ? -22.390 28.037 27.458  1.00 16.61  ? 194 LEU A C   1 
ATOM   1473 O  O   . LEU A 1 214 ? -22.658 28.908 28.285  1.00 21.46  ? 194 LEU A O   1 
ATOM   1474 C  CB  . LEU A 1 214 ? -22.269 29.221 25.295  1.00 15.97  ? 194 LEU A CB  1 
ATOM   1475 C  CG  . LEU A 1 214 ? -22.426 29.354 23.793  1.00 15.79  ? 194 LEU A CG  1 
ATOM   1476 C  CD1 . LEU A 1 214 ? -21.976 30.752 23.396  1.00 15.69  ? 194 LEU A CD1 1 
ATOM   1477 C  CD2 . LEU A 1 214 ? -21.604 28.285 23.085  1.00 15.30  ? 194 LEU A CD2 1 
ATOM   1478 N  N   . PRO A 1 215 ? -21.559 27.006 27.721  1.00 16.38  ? 195 PRO A N   1 
ATOM   1479 C  CA  . PRO A 1 215 ? -20.751 26.960 28.946  1.00 16.48  ? 195 PRO A CA  1 
ATOM   1480 C  C   . PRO A 1 215 ? -19.998 28.270 29.170  1.00 16.15  ? 195 PRO A C   1 
ATOM   1481 O  O   . PRO A 1 215 ? -19.710 28.999 28.233  1.00 15.70  ? 195 PRO A O   1 
ATOM   1482 C  CB  . PRO A 1 215 ? -19.760 25.826 28.667  1.00 16.18  ? 195 PRO A CB  1 
ATOM   1483 C  CG  . PRO A 1 215 ? -20.495 24.927 27.814  1.00 16.72  ? 195 PRO A CG  1 
ATOM   1484 C  CD  . PRO A 1 215 ? -21.350 25.800 26.905  1.00 16.24  ? 195 PRO A CD  1 
ATOM   1485 N  N   . LEU A 1 216 ? -19.690 28.577 30.418  1.00 16.57  ? 196 LEU A N   1 
ATOM   1486 C  CA  . LEU A 1 216 ? -18.941 29.781 30.718  1.00 16.48  ? 196 LEU A CA  1 
ATOM   1487 C  C   . LEU A 1 216 ? -17.454 29.529 30.897  1.00 16.15  ? 196 LEU A C   1 
ATOM   1488 O  O   . LEU A 1 216 ? -16.670 30.453 30.800  1.00 16.71  ? 196 LEU A O   1 
ATOM   1489 C  CB  . LEU A 1 216 ? -19.489 30.453 31.978  1.00 21.99  ? 196 LEU A CB  1 
ATOM   1490 C  CG  . LEU A 1 216 ? -20.938 30.927 31.891  1.00 21.18  ? 196 LEU A CG  1 
ATOM   1491 C  CD1 . LEU A 1 216 ? -21.299 31.785 33.092  1.00 19.34  ? 196 LEU A CD1 1 
ATOM   1492 C  CD2 . LEU A 1 216 ? -21.161 31.684 30.601  1.00 17.56  ? 196 LEU A CD2 1 
ATOM   1493 N  N   . ALA A 1 217 ? -17.066 28.293 31.165  1.00 16.17  ? 197 ALA A N   1 
ATOM   1494 C  CA  . ALA A 1 217 ? -15.690 28.026 31.535  1.00 16.14  ? 197 ALA A CA  1 
ATOM   1495 C  C   . ALA A 1 217 ? -15.316 26.573 31.337  1.00 16.16  ? 197 ALA A C   1 
ATOM   1496 O  O   . ALA A 1 217 ? -16.176 25.706 31.247  1.00 20.29  ? 197 ALA A O   1 
ATOM   1497 C  CB  . ALA A 1 217 ? -15.470 28.407 32.949  1.00 16.84  ? 197 ALA A CB  1 
ATOM   1498 N  N   . ALA A 1 218 ? -14.026 26.297 31.268  1.00 16.09  ? 198 ALA A N   1 
ATOM   1499 C  CA  . ALA A 1 218 ? -13.597 24.933 31.083  1.00 16.32  ? 198 ALA A CA  1 
ATOM   1500 C  C   . ALA A 1 218 ? -12.420 24.654 31.994  1.00 16.88  ? 198 ALA A C   1 
ATOM   1501 O  O   . ALA A 1 218 ? -11.489 25.455 32.074  1.00 17.76  ? 198 ALA A O   1 
ATOM   1502 C  CB  . ALA A 1 218 ? -13.211 24.710 29.655  1.00 15.78  ? 198 ALA A CB  1 
ATOM   1503 N  N   . LEU A 1 219 ? -12.459 23.527 32.697  1.00 19.53  ? 199 LEU A N   1 
ATOM   1504 C  CA  . LEU A 1 219 ? -11.296 23.111 33.443  1.00 21.32  ? 199 LEU A CA  1 
ATOM   1505 C  C   . LEU A 1 219 ? -10.516 22.135 32.577  1.00 21.80  ? 199 LEU A C   1 
ATOM   1506 O  O   . LEU A 1 219 ? -10.992 21.048 32.265  1.00 21.95  ? 199 LEU A O   1 
ATOM   1507 C  CB  . LEU A 1 219 ? -11.686 22.486 34.772  1.00 21.35  ? 199 LEU A CB  1 
ATOM   1508 C  CG  . LEU A 1 219 ? -10.516 22.014 35.637  1.00 24.37  ? 199 LEU A CG  1 
ATOM   1509 C  CD1 . LEU A 1 219 ? -9.648  23.166 36.102  1.00 20.28  ? 199 LEU A CD1 1 
ATOM   1510 C  CD2 . LEU A 1 219 ? -11.051 21.264 36.809  1.00 25.83  ? 199 LEU A CD2 1 
ATOM   1511 N  N   . LEU A 1 220 ? -9.319  22.545 32.178  1.00 18.28  ? 200 LEU A N   1 
ATOM   1512 C  CA  . LEU A 1 220 ? -8.544  21.812 31.190  1.00 18.39  ? 200 LEU A CA  1 
ATOM   1513 C  C   . LEU A 1 220 ? -7.428  21.012 31.842  1.00 20.27  ? 200 LEU A C   1 
ATOM   1514 O  O   . LEU A 1 220 ? -6.564  21.559 32.520  1.00 21.97  ? 200 LEU A O   1 
ATOM   1515 C  CB  . LEU A 1 220 ? -7.972  22.774 30.135  1.00 20.14  ? 200 LEU A CB  1 
ATOM   1516 C  CG  . LEU A 1 220 ? -6.739  22.319 29.343  1.00 18.22  ? 200 LEU A CG  1 
ATOM   1517 C  CD1 . LEU A 1 220 ? -7.078  21.146 28.455  1.00 18.84  ? 200 LEU A CD1 1 
ATOM   1518 C  CD2 . LEU A 1 220 ? -6.141  23.445 28.512  1.00 17.63  ? 200 LEU A CD2 1 
ATOM   1519 N  N   . ASN A 1 221 ? -7.468  19.705 31.616  1.00 20.19  ? 201 ASN A N   1 
ATOM   1520 C  CA  . ASN A 1 221 ? -6.491  18.769 32.153  1.00 21.49  ? 201 ASN A CA  1 
ATOM   1521 C  C   . ASN A 1 221 ? -6.292  18.909 33.644  1.00 23.65  ? 201 ASN A C   1 
ATOM   1522 O  O   . ASN A 1 221 ? -5.189  18.703 34.151  1.00 25.57  ? 201 ASN A O   1 
ATOM   1523 C  CB  . ASN A 1 221 ? -5.152  18.929 31.448  1.00 26.22  ? 201 ASN A CB  1 
ATOM   1524 C  CG  . ASN A 1 221 ? -4.513  17.608 31.147  1.00 31.30  ? 201 ASN A CG  1 
ATOM   1525 O  OD1 . ASN A 1 221 ? -5.183  16.679 30.691  1.00 35.25  ? 201 ASN A OD1 1 
ATOM   1526 N  ND2 . ASN A 1 221 ? -3.216  17.501 31.410  1.00 28.64  ? 201 ASN A ND2 1 
ATOM   1527 N  N   . GLN A 1 222 ? -7.357  19.293 34.340  1.00 30.97  ? 202 GLN A N   1 
ATOM   1528 C  CA  . GLN A 1 222 ? -7.313  19.481 35.786  1.00 29.18  ? 202 GLN A CA  1 
ATOM   1529 C  C   . GLN A 1 222 ? -6.196  20.452 36.209  1.00 25.27  ? 202 GLN A C   1 
ATOM   1530 O  O   . GLN A 1 222 ? -5.729  20.397 37.346  1.00 29.91  ? 202 GLN A O   1 
ATOM   1531 C  CB  . GLN A 1 222 ? -7.154  18.120 36.477  1.00 24.35  ? 202 GLN A CB  1 
ATOM   1532 C  CG  . GLN A 1 222 ? -7.870  17.970 37.808  1.00 36.85  ? 202 GLN A CG  1 
ATOM   1533 C  CD  . GLN A 1 222 ? -9.382  17.770 37.680  1.00 46.90  ? 202 GLN A CD  1 
ATOM   1534 O  OE1 . GLN A 1 222 ? -9.880  17.339 36.638  1.00 50.45  ? 202 GLN A OE1 1 
ATOM   1535 N  NE2 . GLN A 1 222 ? -10.117 18.091 38.750  1.00 49.23  ? 202 GLN A NE2 1 
ATOM   1536 N  N   . GLN A 1 223 ? -5.763  21.343 35.317  1.00 24.02  ? 203 GLN A N   1 
ATOM   1537 C  CA  . GLN A 1 223 ? -4.716  22.294 35.702  1.00 26.15  ? 203 GLN A CA  1 
ATOM   1538 C  C   . GLN A 1 223 ? -4.827  23.744 35.182  1.00 24.54  ? 203 GLN A C   1 
ATOM   1539 O  O   . GLN A 1 223 ? -4.226  24.644 35.748  1.00 26.77  ? 203 GLN A O   1 
ATOM   1540 C  CB  . GLN A 1 223 ? -3.327  21.716 35.436  1.00 24.11  ? 203 GLN A CB  1 
ATOM   1541 C  CG  . GLN A 1 223 ? -3.098  21.306 34.011  1.00 30.20  ? 203 GLN A CG  1 
ATOM   1542 C  CD  . GLN A 1 223 ? -1.806  20.517 33.825  1.00 32.08  ? 203 GLN A CD  1 
ATOM   1543 O  OE1 . GLN A 1 223 ? -1.670  19.777 32.861  1.00 31.25  ? 203 GLN A OE1 1 
ATOM   1544 N  NE2 . GLN A 1 223 ? -0.855  20.678 34.747  1.00 27.14  ? 203 GLN A NE2 1 
ATOM   1545 N  N   . PHE A 1 224 ? -5.599  23.973 34.131  1.00 21.61  ? 204 PHE A N   1 
ATOM   1546 C  CA  . PHE A 1 224 ? -5.864  25.328 33.661  1.00 19.32  ? 204 PHE A CA  1 
ATOM   1547 C  C   . PHE A 1 224 ? -7.343  25.641 33.714  1.00 18.66  ? 204 PHE A C   1 
ATOM   1548 O  O   . PHE A 1 224 ? -8.169  24.839 33.302  1.00 23.22  ? 204 PHE A O   1 
ATOM   1549 C  CB  . PHE A 1 224 ? -5.384  25.478 32.229  1.00 18.80  ? 204 PHE A CB  1 
ATOM   1550 C  CG  . PHE A 1 224 ? -3.955  25.099 32.036  1.00 19.59  ? 204 PHE A CG  1 
ATOM   1551 C  CD1 . PHE A 1 224 ? -2.937  25.880 32.571  1.00 20.30  ? 204 PHE A CD1 1 
ATOM   1552 C  CD2 . PHE A 1 224 ? -3.621  23.956 31.323  1.00 20.56  ? 204 PHE A CD2 1 
ATOM   1553 C  CE1 . PHE A 1 224 ? -1.600  25.525 32.393  1.00 21.22  ? 204 PHE A CE1 1 
ATOM   1554 C  CE2 . PHE A 1 224 ? -2.299  23.587 31.149  1.00 20.75  ? 204 PHE A CE2 1 
ATOM   1555 C  CZ  . PHE A 1 224 ? -1.282  24.375 31.682  1.00 21.45  ? 204 PHE A CZ  1 
ATOM   1556 N  N   . LEU A 1 225 ? -7.688  26.806 34.232  1.00 18.62  ? 205 LEU A N   1 
ATOM   1557 C  CA  . LEU A 1 225 ? -9.049  27.292 34.082  1.00 18.72  ? 205 LEU A CA  1 
ATOM   1558 C  C   . LEU A 1 225 ? -9.096  28.156 32.817  1.00 19.64  ? 205 LEU A C   1 
ATOM   1559 O  O   . LEU A 1 225 ? -8.281  29.069 32.635  1.00 19.57  ? 205 LEU A O   1 
ATOM   1560 C  CB  . LEU A 1 225 ? -9.487  28.097 35.290  1.00 18.61  ? 205 LEU A CB  1 
ATOM   1561 C  CG  . LEU A 1 225 ? -10.813 28.832 35.090  1.00 18.21  ? 205 LEU A CG  1 
ATOM   1562 C  CD1 . LEU A 1 225 ? -11.970 27.860 35.038  1.00 18.06  ? 205 LEU A CD1 1 
ATOM   1563 C  CD2 . LEU A 1 225 ? -11.054 29.883 36.162  1.00 18.92  ? 205 LEU A CD2 1 
ATOM   1564 N  N   . CYS A 1 226 ? -10.030 27.840 31.928  1.00 18.83  ? 206 CYS A N   1 
ATOM   1565 C  CA  . CYS A 1 226 ? -10.153 28.539 30.661  1.00 16.29  ? 206 CYS A CA  1 
ATOM   1566 C  C   . CYS A 1 226 ? -11.457 29.308 30.616  1.00 18.82  ? 206 CYS A C   1 
ATOM   1567 O  O   . CYS A 1 226 ? -12.525 28.716 30.722  1.00 16.98  ? 206 CYS A O   1 
ATOM   1568 C  CB  . CYS A 1 226 ? -10.117 27.537 29.519  1.00 15.63  ? 206 CYS A CB  1 
ATOM   1569 S  SG  . CYS A 1 226 ? -8.585  26.579 29.433  1.00 17.03  ? 206 CYS A SG  1 
ATOM   1570 N  N   . VAL A 1 227 ? -11.366 30.625 30.475  1.00 15.88  ? 207 VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 227 ? -12.547 31.473 30.364  1.00 15.85  ? 207 VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 227 ? -12.315 32.555 29.339  1.00 15.98  ? 207 VAL A C   1 
ATOM   1573 O  O   . VAL A 1 227 ? -11.177 32.836 28.974  1.00 17.15  ? 207 VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 227 ? -12.876 32.190 31.686  1.00 16.57  ? 207 VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 227 ? -13.452 31.232 32.661  1.00 16.81  ? 207 VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 227 ? -11.638 32.894 32.268  1.00 17.17  ? 207 VAL A CG2 1 
ATOM   1577 N  N   . HIS A 1 228 ? -13.386 33.198 28.896  1.00 15.90  ? 208 HIS A N   1 
ATOM   1578 C  CA  . HIS A 1 228 ? -13.213 34.252 27.922  1.00 15.92  ? 208 HIS A CA  1 
ATOM   1579 C  C   . HIS A 1 228 ? -12.489 35.496 28.467  1.00 17.11  ? 208 HIS A C   1 
ATOM   1580 O  O   . HIS A 1 228 ? -11.552 35.998 27.840  1.00 19.66  ? 208 HIS A O   1 
ATOM   1581 C  CB  . HIS A 1 228 ? -14.529 34.662 27.271  1.00 15.87  ? 208 HIS A CB  1 
ATOM   1582 C  CG  . HIS A 1 228 ? -14.352 35.771 26.281  1.00 16.23  ? 208 HIS A CG  1 
ATOM   1583 N  ND1 . HIS A 1 228 ? -13.919 35.550 24.994  1.00 15.92  ? 208 HIS A ND1 1 
ATOM   1584 C  CD2 . HIS A 1 228 ? -14.458 37.115 26.422  1.00 17.06  ? 208 HIS A CD2 1 
ATOM   1585 C  CE1 . HIS A 1 228 ? -13.798 36.707 24.370  1.00 16.54  ? 208 HIS A CE1 1 
ATOM   1586 N  NE2 . HIS A 1 228 ? -14.121 37.673 25.213  1.00 17.76  ? 208 HIS A NE2 1 
ATOM   1587 N  N   . GLY A 1 229 ? -12.938 35.991 29.619  1.00 17.30  ? 209 GLY A N   1 
ATOM   1588 C  CA  . GLY A 1 229 ? -12.516 37.284 30.131  1.00 18.31  ? 209 GLY A CA  1 
ATOM   1589 C  C   . GLY A 1 229 ? -11.539 37.158 31.279  1.00 18.80  ? 209 GLY A C   1 
ATOM   1590 O  O   . GLY A 1 229 ? -10.346 37.395 31.093  1.00 19.11  ? 209 GLY A O   1 
ATOM   1591 N  N   . GLY A 1 230 ? -12.033 36.790 32.463  1.00 19.04  ? 210 GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 230 ? -11.149 36.518 33.577  1.00 19.56  ? 210 GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 230 ? -11.806 36.261 34.924  1.00 24.48  ? 210 GLY A C   1 
ATOM   1594 O  O   . GLY A 1 230 ? -12.870 35.650 34.996  1.00 24.52  ? 210 GLY A O   1 
ATOM   1595 N  N   . LEU A 1 231 ? -11.155 36.731 35.992  1.00 21.48  ? 211 LEU A N   1 
ATOM   1596 C  CA  . LEU A 1 231 ? -11.612 36.520 37.355  1.00 21.89  ? 211 LEU A CA  1 
ATOM   1597 C  C   . LEU A 1 231 ? -12.628 37.552 37.805  1.00 25.65  ? 211 LEU A C   1 
ATOM   1598 O  O   . LEU A 1 231 ? -12.854 38.548 37.131  1.00 28.71  ? 211 LEU A O   1 
ATOM   1599 C  CB  . LEU A 1 231 ? -10.433 36.553 38.325  1.00 23.86  ? 211 LEU A CB  1 
ATOM   1600 C  CG  . LEU A 1 231 ? -9.263  35.629 37.972  1.00 22.33  ? 211 LEU A CG  1 
ATOM   1601 C  CD1 . LEU A 1 231 ? -8.105  35.801 38.970  1.00 23.46  ? 211 LEU A CD1 1 
ATOM   1602 C  CD2 . LEU A 1 231 ? -9.776  34.191 37.914  1.00 21.46  ? 211 LEU A CD2 1 
ATOM   1603 N  N   . SER A 1 232 ? -13.215 37.304 38.971  1.00 31.69  ? 212 SER A N   1 
ATOM   1604 C  CA  . SER A 1 232 ? -14.234 38.171 39.536  1.00 29.03  ? 212 SER A CA  1 
ATOM   1605 C  C   . SER A 1 232 ? -14.016 38.297 41.028  1.00 30.19  ? 212 SER A C   1 
ATOM   1606 O  O   . SER A 1 232 ? -13.697 37.308 41.677  1.00 36.38  ? 212 SER A O   1 
ATOM   1607 C  CB  . SER A 1 232 ? -15.601 37.559 39.320  1.00 29.93  ? 212 SER A CB  1 
ATOM   1608 O  OG  . SER A 1 232 ? -16.574 38.329 39.997  1.00 34.45  ? 212 SER A OG  1 
ATOM   1609 N  N   . PRO A 1 233 ? -14.193 39.505 41.593  1.00 32.70  ? 213 PRO A N   1 
ATOM   1610 C  CA  . PRO A 1 233 ? -14.058 39.573 43.050  1.00 32.46  ? 213 PRO A CA  1 
ATOM   1611 C  C   . PRO A 1 233 ? -15.067 38.673 43.758  1.00 31.33  ? 213 PRO A C   1 
ATOM   1612 O  O   . PRO A 1 233 ? -14.805 38.256 44.884  1.00 38.63  ? 213 PRO A O   1 
ATOM   1613 C  CB  . PRO A 1 233 ? -14.305 41.050 43.376  1.00 30.52  ? 213 PRO A CB  1 
ATOM   1614 C  CG  . PRO A 1 233 ? -14.848 41.660 42.144  1.00 29.89  ? 213 PRO A CG  1 
ATOM   1615 C  CD  . PRO A 1 233 ? -14.363 40.840 40.994  1.00 31.94  ? 213 PRO A CD  1 
ATOM   1616 N  N   . GLU A 1 234 ? -16.177 38.339 43.109  1.00 28.37  ? 214 GLU A N   1 
ATOM   1617 C  CA  . GLU A 1 234 ? -17.122 37.435 43.742  1.00 28.68  ? 214 GLU A CA  1 
ATOM   1618 C  C   . GLU A 1 234 ? -16.931 35.962 43.373  1.00 27.41  ? 214 GLU A C   1 
ATOM   1619 O  O   . GLU A 1 234 ? -17.797 35.146 43.689  1.00 33.07  ? 214 GLU A O   1 
ATOM   1620 C  CB  . GLU A 1 234 ? -18.555 37.856 43.445  1.00 30.27  ? 214 GLU A CB  1 
ATOM   1621 C  CG  . GLU A 1 234 ? -18.829 39.330 43.630  1.00 35.99  ? 214 GLU A CG  1 
ATOM   1622 C  CD  . GLU A 1 234 ? -20.190 39.718 43.072  1.00 47.20  ? 214 GLU A CD  1 
ATOM   1623 O  OE1 . GLU A 1 234 ? -20.241 40.531 42.112  1.00 51.81  ? 214 GLU A OE1 1 
ATOM   1624 O  OE2 . GLU A 1 234 ? -21.205 39.192 43.588  1.00 48.77  ? 214 GLU A OE2 1 
ATOM   1625 N  N   . ILE A 1 235 ? -15.818 35.620 42.718  1.00 27.11  ? 215 ILE A N   1 
ATOM   1626 C  CA  . ILE A 1 235 ? -15.509 34.220 42.357  1.00 29.32  ? 215 ILE A CA  1 
ATOM   1627 C  C   . ILE A 1 235 ? -14.175 33.711 42.940  1.00 29.17  ? 215 ILE A C   1 
ATOM   1628 O  O   . ILE A 1 235 ? -13.099 34.028 42.420  1.00 30.83  ? 215 ILE A O   1 
ATOM   1629 C  CB  . ILE A 1 235 ? -15.506 34.017 40.818  1.00 28.46  ? 215 ILE A CB  1 
ATOM   1630 C  CG1 . ILE A 1 235 ? -16.915 34.216 40.266  1.00 27.76  ? 215 ILE A CG1 1 
ATOM   1631 C  CG2 . ILE A 1 235 ? -14.973 32.631 40.429  1.00 22.81  ? 215 ILE A CG2 1 
ATOM   1632 C  CD1 . ILE A 1 235 ? -16.951 34.332 38.759  1.00 25.83  ? 215 ILE A CD1 1 
ATOM   1633 N  N   . HIS A 1 236 ? -14.253 32.898 43.995  1.00 28.30  ? 216 HIS A N   1 
ATOM   1634 C  CA  . HIS A 1 236 ? -13.063 32.467 44.731  1.00 27.01  ? 216 HIS A CA  1 
ATOM   1635 C  C   . HIS A 1 236 ? -12.693 31.000 44.568  1.00 28.17  ? 216 HIS A C   1 
ATOM   1636 O  O   . HIS A 1 236 ? -11.541 30.622 44.737  1.00 31.34  ? 216 HIS A O   1 
ATOM   1637 C  CB  . HIS A 1 236 ? -13.240 32.748 46.207  1.00 28.81  ? 216 HIS A CB  1 
ATOM   1638 C  CG  . HIS A 1 236 ? -13.539 34.178 46.515  1.00 31.21  ? 216 HIS A CG  1 
ATOM   1639 N  ND1 . HIS A 1 236 ? -14.795 34.606 46.892  1.00 30.42  ? 216 HIS A ND1 1 
ATOM   1640 C  CD2 . HIS A 1 236 ? -12.749 35.279 46.493  1.00 32.11  ? 216 HIS A CD2 1 
ATOM   1641 C  CE1 . HIS A 1 236 ? -14.762 35.912 47.100  1.00 34.24  ? 216 HIS A CE1 1 
ATOM   1642 N  NE2 . HIS A 1 236 ? -13.535 36.344 46.863  1.00 38.61  ? 216 HIS A NE2 1 
ATOM   1643 N  N   . THR A 1 237 ? -13.672 30.166 44.268  1.00 28.65  ? 217 THR A N   1 
ATOM   1644 C  CA  . THR A 1 237 ? -13.421 28.748 44.055  1.00 27.18  ? 217 THR A CA  1 
ATOM   1645 C  C   . THR A 1 237 ? -13.999 28.356 42.710  1.00 28.37  ? 217 THR A C   1 
ATOM   1646 O  O   . THR A 1 237 ? -14.799 29.084 42.131  1.00 25.86  ? 217 THR A O   1 
ATOM   1647 C  CB  . THR A 1 237 ? -14.121 27.909 45.137  1.00 33.72  ? 217 THR A CB  1 
ATOM   1648 O  OG1 . THR A 1 237 ? -15.338 28.562 45.536  1.00 38.78  ? 217 THR A OG1 1 
ATOM   1649 C  CG2 . THR A 1 237 ? -13.244 27.764 46.353  1.00 30.24  ? 217 THR A CG2 1 
ATOM   1650 N  N   . LEU A 1 238 ? -13.618 27.195 42.211  1.00 29.25  ? 218 LEU A N   1 
ATOM   1651 C  CA  . LEU A 1 238 ? -14.235 26.700 40.996  1.00 23.01  ? 218 LEU A CA  1 
ATOM   1652 C  C   . LEU A 1 238 ? -15.736 26.480 41.234  1.00 26.72  ? 218 LEU A C   1 
ATOM   1653 O  O   . LEU A 1 238 ? -16.559 26.663 40.328  1.00 29.10  ? 218 LEU A O   1 
ATOM   1654 C  CB  . LEU A 1 238 ? -13.538 25.420 40.527  1.00 22.81  ? 218 LEU A CB  1 
ATOM   1655 C  CG  . LEU A 1 238 ? -12.087 25.630 40.064  1.00 25.09  ? 218 LEU A CG  1 
ATOM   1656 C  CD1 . LEU A 1 238 ? -11.419 24.339 39.571  1.00 23.77  ? 218 LEU A CD1 1 
ATOM   1657 C  CD2 . LEU A 1 238 ? -12.013 26.709 38.983  1.00 22.41  ? 218 LEU A CD2 1 
ATOM   1658 N  N   . ASP A 1 239 ? -16.094 26.123 42.464  1.00 35.25  ? 219 ASP A N   1 
ATOM   1659 C  CA  . ASP A 1 239 ? -17.492 25.893 42.802  1.00 36.54  ? 219 ASP A CA  1 
ATOM   1660 C  C   . ASP A 1 239 ? -18.345 27.120 42.537  1.00 35.33  ? 219 ASP A C   1 
ATOM   1661 O  O   . ASP A 1 239 ? -19.491 26.989 42.127  1.00 39.37  ? 219 ASP A O   1 
ATOM   1662 C  CB  . ASP A 1 239 ? -17.650 25.444 44.256  1.00 45.76  ? 219 ASP A CB  1 
ATOM   1663 C  CG  . ASP A 1 239 ? -17.371 23.955 44.447  1.00 50.36  ? 219 ASP A CG  1 
ATOM   1664 O  OD1 . ASP A 1 239 ? -16.826 23.327 43.507  1.00 50.51  ? 219 ASP A OD1 1 
ATOM   1665 O  OD2 . ASP A 1 239 ? -17.690 23.420 45.542  1.00 49.55  ? 219 ASP A OD2 1 
ATOM   1666 N  N   . ASP A 1 240 ? -17.799 28.314 42.751  1.00 29.18  ? 220 ASP A N   1 
ATOM   1667 C  CA  . ASP A 1 240 ? -18.579 29.533 42.490  1.00 29.74  ? 220 ASP A CA  1 
ATOM   1668 C  C   . ASP A 1 240 ? -18.924 29.656 41.019  1.00 29.20  ? 220 ASP A C   1 
ATOM   1669 O  O   . ASP A 1 240 ? -19.886 30.335 40.655  1.00 32.30  ? 220 ASP A O   1 
ATOM   1670 C  CB  . ASP A 1 240 ? -17.844 30.796 42.932  1.00 31.18  ? 220 ASP A CB  1 
ATOM   1671 C  CG  . ASP A 1 240 ? -17.542 30.804 44.391  1.00 36.68  ? 220 ASP A CG  1 
ATOM   1672 O  OD1 . ASP A 1 240 ? -18.433 30.461 45.188  1.00 39.59  ? 220 ASP A OD1 1 
ATOM   1673 O  OD2 . ASP A 1 240 ? -16.398 31.138 44.743  1.00 42.14  ? 220 ASP A OD2 1 
ATOM   1674 N  N   . ILE A 1 241 ? -18.129 29.013 40.168  1.00 23.51  ? 221 ILE A N   1 
ATOM   1675 C  CA  . ILE A 1 241 ? -18.446 29.000 38.752  1.00 21.65  ? 221 ILE A CA  1 
ATOM   1676 C  C   . ILE A 1 241 ? -19.462 27.902 38.513  1.00 24.60  ? 221 ILE A C   1 
ATOM   1677 O  O   . ILE A 1 241 ? -20.514 28.145 37.928  1.00 23.48  ? 221 ILE A O   1 
ATOM   1678 C  CB  . ILE A 1 241 ? -17.213 28.778 37.848  1.00 20.52  ? 221 ILE A CB  1 
ATOM   1679 C  CG1 . ILE A 1 241 ? -16.134 29.847 38.107  1.00 20.52  ? 221 ILE A CG1 1 
ATOM   1680 C  CG2 . ILE A 1 241 ? -17.642 28.794 36.389  1.00 19.49  ? 221 ILE A CG2 1 
ATOM   1681 C  CD1 . ILE A 1 241 ? -14.818 29.565 37.441  1.00 19.78  ? 221 ILE A CD1 1 
ATOM   1682 N  N   . ARG A 1 242 ? -19.155 26.703 38.998  1.00 25.09  ? 222 ARG A N   1 
ATOM   1683 C  CA  . ARG A 1 242 ? -20.044 25.555 38.835  1.00 22.84  ? 222 ARG A CA  1 
ATOM   1684 C  C   . ARG A 1 242 ? -21.513 25.849 39.169  1.00 23.78  ? 222 ARG A C   1 
ATOM   1685 O  O   . ARG A 1 242 ? -22.401 25.327 38.502  1.00 26.55  ? 222 ARG A O   1 
ATOM   1686 C  CB  . ARG A 1 242 ? -19.563 24.363 39.675  1.00 27.65  ? 222 ARG A CB  1 
ATOM   1687 C  CG  . ARG A 1 242 ? -18.234 23.739 39.279  1.00 23.15  ? 222 ARG A CG  1 
ATOM   1688 C  CD  . ARG A 1 242 ? -18.103 22.401 39.990  1.00 43.16  ? 222 ARG A CD  1 
ATOM   1689 N  NE  . ARG A 1 242 ? -16.730 21.911 40.067  1.00 48.38  ? 222 ARG A NE  1 
ATOM   1690 C  CZ  . ARG A 1 242 ? -16.140 21.164 39.132  1.00 52.41  ? 222 ARG A CZ  1 
ATOM   1691 N  NH1 . ARG A 1 242 ? -16.802 20.825 38.022  1.00 55.23  ? 222 ARG A NH1 1 
ATOM   1692 N  NH2 . ARG A 1 242 ? -14.880 20.758 39.305  1.00 47.38  ? 222 ARG A NH2 1 
ATOM   1693 N  N   . ARG A 1 243 ? -21.764 26.683 40.179  1.00 24.69  ? 223 ARG A N   1 
ATOM   1694 C  CA  . ARG A 1 243 ? -23.141 26.959 40.628  1.00 28.17  ? 223 ARG A CA  1 
ATOM   1695 C  C   . ARG A 1 243 ? -23.835 28.155 39.955  1.00 27.61  ? 223 ARG A C   1 
ATOM   1696 O  O   . ARG A 1 243 ? -24.974 28.511 40.305  1.00 29.16  ? 223 ARG A O   1 
ATOM   1697 C  CB  . ARG A 1 243 ? -23.232 27.083 42.161  1.00 36.34  ? 223 ARG A CB  1 
ATOM   1698 C  CG  . ARG A 1 243 ? -22.774 28.394 42.772  1.00 36.40  ? 223 ARG A CG  1 
ATOM   1699 C  CD  . ARG A 1 243 ? -23.160 28.453 44.247  1.00 41.18  ? 223 ARG A CD  1 
ATOM   1700 N  NE  . ARG A 1 243 ? -22.818 27.202 44.920  1.00 48.39  ? 223 ARG A NE  1 
ATOM   1701 C  CZ  . ARG A 1 243 ? -21.595 26.902 45.361  1.00 51.88  ? 223 ARG A CZ  1 
ATOM   1702 N  NH1 . ARG A 1 243 ? -20.601 27.776 45.217  1.00 48.77  ? 223 ARG A NH1 1 
ATOM   1703 N  NH2 . ARG A 1 243 ? -21.360 25.733 45.956  1.00 52.72  ? 223 ARG A NH2 1 
ATOM   1704 N  N   . LEU A 1 244 ? -23.148 28.775 39.001  1.00 27.24  ? 224 LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 244 ? -23.727 29.892 38.274  1.00 26.71  ? 224 LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 244 ? -24.849 29.410 37.379  1.00 30.49  ? 224 LEU A C   1 
ATOM   1707 O  O   . LEU A 1 244 ? -24.759 28.342 36.755  1.00 34.34  ? 224 LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 244 ? -22.673 30.602 37.417  1.00 22.56  ? 224 LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 244 ? -21.684 31.537 38.114  1.00 23.47  ? 224 LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 244 ? -20.622 32.006 37.143  1.00 25.91  ? 224 LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 244 ? -22.416 32.717 38.689  1.00 23.88  ? 224 LEU A CD2 1 
ATOM   1712 N  N   . ASP A 1 245 ? -25.904 30.214 37.323  1.00 29.32  ? 225 ASP A N   1 
ATOM   1713 C  CA  . ASP A 1 245 ? -26.990 30.008 36.376  1.00 30.67  ? 225 ASP A CA  1 
ATOM   1714 C  C   . ASP A 1 245 ? -26.741 30.847 35.123  1.00 29.40  ? 225 ASP A C   1 
ATOM   1715 O  O   . ASP A 1 245 ? -26.879 32.062 35.150  1.00 31.58  ? 225 ASP A O   1 
ATOM   1716 C  CB  . ASP A 1 245 ? -28.315 30.394 37.021  1.00 30.32  ? 225 ASP A CB  1 
ATOM   1717 C  CG  . ASP A 1 245 ? -29.445 30.463 36.022  1.00 34.85  ? 225 ASP A CG  1 
ATOM   1718 O  OD1 . ASP A 1 245 ? -29.633 29.480 35.250  1.00 32.87  ? 225 ASP A OD1 1 
ATOM   1719 O  OD2 . ASP A 1 245 ? -30.129 31.516 36.014  1.00 38.74  ? 225 ASP A OD2 1 
ATOM   1720 N  N   . ARG A 1 246 ? -26.389 30.179 34.028  1.00 26.84  ? 226 ARG A N   1 
ATOM   1721 C  CA  . ARG A 1 246 ? -25.862 30.833 32.830  1.00 21.44  ? 226 ARG A CA  1 
ATOM   1722 C  C   . ARG A 1 246 ? -26.914 31.060 31.755  1.00 21.67  ? 226 ARG A C   1 
ATOM   1723 O  O   . ARG A 1 246 ? -26.684 31.803 30.805  1.00 21.11  ? 226 ARG A O   1 
ATOM   1724 C  CB  . ARG A 1 246 ? -24.742 29.976 32.229  1.00 20.19  ? 226 ARG A CB  1 
ATOM   1725 C  CG  . ARG A 1 246 ? -25.241 28.770 31.420  1.00 20.05  ? 226 ARG A CG  1 
ATOM   1726 C  CD  . ARG A 1 246 ? -24.072 27.928 30.928  1.00 19.04  ? 226 ARG A CD  1 
ATOM   1727 N  NE  . ARG A 1 246 ? -24.454 26.851 30.020  1.00 18.96  ? 226 ARG A NE  1 
ATOM   1728 C  CZ  . ARG A 1 246 ? -24.511 25.570 30.371  1.00 25.70  ? 226 ARG A CZ  1 
ATOM   1729 N  NH1 . ARG A 1 246 ? -24.211 25.208 31.618  1.00 27.44  ? 226 ARG A NH1 1 
ATOM   1730 N  NH2 . ARG A 1 246 ? -24.859 24.654 29.475  1.00 23.58  ? 226 ARG A NH2 1 
ATOM   1731 N  N   . PHE A 1 247 ? -28.067 30.411 31.884  1.00 23.49  ? 227 PHE A N   1 
ATOM   1732 C  CA  . PHE A 1 247 ? -29.079 30.483 30.824  1.00 23.03  ? 227 PHE A CA  1 
ATOM   1733 C  C   . PHE A 1 247 ? -29.848 31.801 30.821  1.00 23.94  ? 227 PHE A C   1 
ATOM   1734 O  O   . PHE A 1 247 ? -31.041 31.835 31.091  1.00 27.03  ? 227 PHE A O   1 
ATOM   1735 C  CB  . PHE A 1 247 ? -30.016 29.280 30.898  1.00 23.87  ? 227 PHE A CB  1 
ATOM   1736 C  CG  . PHE A 1 247 ? -29.295 27.967 30.863  1.00 23.33  ? 227 PHE A CG  1 
ATOM   1737 C  CD1 . PHE A 1 247 ? -28.603 27.572 29.724  1.00 25.31  ? 227 PHE A CD1 1 
ATOM   1738 C  CD2 . PHE A 1 247 ? -29.287 27.134 31.961  1.00 23.90  ? 227 PHE A CD2 1 
ATOM   1739 C  CE1 . PHE A 1 247 ? -27.916 26.361 29.685  1.00 26.11  ? 227 PHE A CE1 1 
ATOM   1740 C  CE2 . PHE A 1 247 ? -28.609 25.922 31.926  1.00 24.03  ? 227 PHE A CE2 1 
ATOM   1741 C  CZ  . PHE A 1 247 ? -27.919 25.536 30.783  1.00 22.29  ? 227 PHE A CZ  1 
ATOM   1742 N  N   . LYS A 1 248 ? -29.157 32.886 30.508  1.00 23.38  ? 228 LYS A N   1 
ATOM   1743 C  CA  . LYS A 1 248 ? -29.769 34.202 30.544  1.00 27.04  ? 228 LYS A CA  1 
ATOM   1744 C  C   . LYS A 1 248 ? -28.846 35.164 29.826  1.00 24.37  ? 228 LYS A C   1 
ATOM   1745 O  O   . LYS A 1 248 ? -27.691 34.817 29.541  1.00 25.37  ? 228 LYS A O   1 
ATOM   1746 C  CB  . LYS A 1 248 ? -29.912 34.668 31.996  1.00 29.19  ? 228 LYS A CB  1 
ATOM   1747 C  CG  . LYS A 1 248 ? -28.547 34.916 32.664  1.00 28.75  ? 228 LYS A CG  1 
ATOM   1748 C  CD  . LYS A 1 248 ? -28.658 35.537 34.051  1.00 29.47  ? 228 LYS A CD  1 
ATOM   1749 C  CE  . LYS A 1 248 ? -28.875 34.479 35.118  1.00 31.50  ? 228 LYS A CE  1 
ATOM   1750 N  NZ  . LYS A 1 248 ? -28.858 35.058 36.488  1.00 34.14  ? 228 LYS A NZ  1 
ATOM   1751 N  N   . GLU A 1 249 ? -29.342 36.370 29.543  1.00 24.57  ? 229 GLU A N   1 
ATOM   1752 C  CA  . GLU A 1 249 ? -28.473 37.441 29.074  1.00 25.43  ? 229 GLU A CA  1 
ATOM   1753 C  C   . GLU A 1 249 ? -27.516 37.766 30.217  1.00 24.12  ? 229 GLU A C   1 
ATOM   1754 O  O   . GLU A 1 249 ? -27.931 37.813 31.376  1.00 25.70  ? 229 GLU A O   1 
ATOM   1755 C  CB  . GLU A 1 249 ? -29.282 38.680 28.743  1.00 25.67  ? 229 GLU A CB  1 
ATOM   1756 C  CG  . GLU A 1 249 ? -28.408 39.883 28.386  1.00 25.69  ? 229 GLU A CG  1 
ATOM   1757 C  CD  . GLU A 1 249 ? -27.951 39.902 26.916  1.00 31.66  ? 229 GLU A CD  1 
ATOM   1758 O  OE1 . GLU A 1 249 ? -28.360 39.012 26.119  1.00 29.72  ? 229 GLU A OE1 1 
ATOM   1759 O  OE2 . GLU A 1 249 ? -27.184 40.822 26.551  1.00 31.78  ? 229 GLU A OE2 1 
ATOM   1760 N  N   . PRO A 1 250 ? -26.224 37.942 29.911  1.00 23.71  ? 230 PRO A N   1 
ATOM   1761 C  CA  . PRO A 1 250 ? -25.265 38.373 30.936  1.00 25.72  ? 230 PRO A CA  1 
ATOM   1762 C  C   . PRO A 1 250 ? -25.732 39.667 31.608  1.00 26.46  ? 230 PRO A C   1 
ATOM   1763 O  O   . PRO A 1 250 ? -26.143 40.598 30.913  1.00 29.78  ? 230 PRO A O   1 
ATOM   1764 C  CB  . PRO A 1 250 ? -23.985 38.621 30.122  1.00 22.14  ? 230 PRO A CB  1 
ATOM   1765 C  CG  . PRO A 1 250 ? -24.069 37.638 29.005  1.00 21.05  ? 230 PRO A CG  1 
ATOM   1766 C  CD  . PRO A 1 250 ? -25.559 37.566 28.652  1.00 21.84  ? 230 PRO A CD  1 
ATOM   1767 N  N   . PRO A 1 251 ? -25.727 39.709 32.945  1.00 27.03  ? 231 PRO A N   1 
ATOM   1768 C  CA  . PRO A 1 251 ? -26.116 40.979 33.568  1.00 28.56  ? 231 PRO A CA  1 
ATOM   1769 C  C   . PRO A 1 251 ? -24.998 42.000 33.473  1.00 29.74  ? 231 PRO A C   1 
ATOM   1770 O  O   . PRO A 1 251 ? -23.910 41.661 33.002  1.00 30.24  ? 231 PRO A O   1 
ATOM   1771 C  CB  . PRO A 1 251 ? -26.424 40.603 35.029  1.00 28.19  ? 231 PRO A CB  1 
ATOM   1772 C  CG  . PRO A 1 251 ? -25.781 39.264 35.247  1.00 34.67  ? 231 PRO A CG  1 
ATOM   1773 C  CD  . PRO A 1 251 ? -25.753 38.580 33.895  1.00 31.36  ? 231 PRO A CD  1 
ATOM   1774 N  N   . ALA A 1 252 ? -25.277 43.231 33.897  1.00 34.12  ? 232 ALA A N   1 
ATOM   1775 C  CA  . ALA A 1 252 ? -24.326 44.331 33.745  1.00 33.99  ? 232 ALA A CA  1 
ATOM   1776 C  C   . ALA A 1 252 ? -23.224 44.346 34.820  1.00 36.76  ? 232 ALA A C   1 
ATOM   1777 O  O   . ALA A 1 252 ? -22.245 45.080 34.698  1.00 41.96  ? 232 ALA A O   1 
ATOM   1778 C  CB  . ALA A 1 252 ? -25.069 45.649 33.715  1.00 34.44  ? 232 ALA A CB  1 
ATOM   1779 N  N   . PHE A 1 253 ? -23.402 43.524 35.855  1.00 32.50  ? 233 PHE A N   1 
ATOM   1780 C  CA  . PHE A 1 253 ? -22.451 43.370 36.964  1.00 32.75  ? 233 PHE A CA  1 
ATOM   1781 C  C   . PHE A 1 253 ? -22.619 41.965 37.544  1.00 32.12  ? 233 PHE A C   1 
ATOM   1782 O  O   . PHE A 1 253 ? -23.622 41.299 37.299  1.00 37.70  ? 233 PHE A O   1 
ATOM   1783 C  CB  . PHE A 1 253 ? -22.705 44.404 38.071  1.00 32.08  ? 233 PHE A CB  1 
ATOM   1784 C  CG  . PHE A 1 253 ? -24.056 44.263 38.728  1.00 38.72  ? 233 PHE A CG  1 
ATOM   1785 C  CD1 . PHE A 1 253 ? -25.176 44.908 38.203  1.00 46.75  ? 233 PHE A CD1 1 
ATOM   1786 C  CD2 . PHE A 1 253 ? -24.218 43.470 39.856  1.00 39.13  ? 233 PHE A CD2 1 
ATOM   1787 C  CE1 . PHE A 1 253 ? -26.431 44.766 38.799  1.00 49.77  ? 233 PHE A CE1 1 
ATOM   1788 C  CE2 . PHE A 1 253 ? -25.466 43.325 40.460  1.00 42.37  ? 233 PHE A CE2 1 
ATOM   1789 C  CZ  . PHE A 1 253 ? -26.572 43.972 39.931  1.00 47.24  ? 233 PHE A CZ  1 
ATOM   1790 N  N   . GLY A 1 254 ? -21.647 41.516 38.324  1.00 30.40  ? 234 GLY A N   1 
ATOM   1791 C  CA  . GLY A 1 254 ? -21.729 40.189 38.903  1.00 29.55  ? 234 GLY A CA  1 
ATOM   1792 C  C   . GLY A 1 254 ? -20.706 39.233 38.326  1.00 28.33  ? 234 GLY A C   1 
ATOM   1793 O  O   . GLY A 1 254 ? -19.989 39.584 37.392  1.00 32.44  ? 234 GLY A O   1 
ATOM   1794 N  N   . PRO A 1 255 ? -20.648 38.013 38.871  1.00 25.60  ? 235 PRO A N   1 
ATOM   1795 C  CA  . PRO A 1 255 ? -19.690 36.958 38.510  1.00 24.22  ? 235 PRO A CA  1 
ATOM   1796 C  C   . PRO A 1 255 ? -19.701 36.638 37.008  1.00 25.61  ? 235 PRO A C   1 
ATOM   1797 O  O   . PRO A 1 255 ? -18.662 36.740 36.336  1.00 28.40  ? 235 PRO A O   1 
ATOM   1798 C  CB  . PRO A 1 255 ? -20.187 35.735 39.306  1.00 24.45  ? 235 PRO A CB  1 
ATOM   1799 C  CG  . PRO A 1 255 ? -21.111 36.272 40.350  1.00 26.11  ? 235 PRO A CG  1 
ATOM   1800 C  CD  . PRO A 1 255 ? -21.679 37.546 39.817  1.00 26.64  ? 235 PRO A CD  1 
ATOM   1801 N  N   . MET A 1 256 ? -20.869 36.251 36.497  1.00 23.22  ? 236 MET A N   1 
ATOM   1802 C  CA  . MET A 1 256 ? -21.049 35.951 35.076  1.00 21.64  ? 236 MET A CA  1 
ATOM   1803 C  C   . MET A 1 256 ? -20.571 37.088 34.188  1.00 22.91  ? 236 MET A C   1 
ATOM   1804 O  O   . MET A 1 256 ? -19.798 36.861 33.269  1.00 26.74  ? 236 MET A O   1 
ATOM   1805 C  CB  . MET A 1 256 ? -22.508 35.620 34.777  1.00 22.01  ? 236 MET A CB  1 
ATOM   1806 C  CG  . MET A 1 256 ? -22.765 35.116 33.372  1.00 23.44  ? 236 MET A CG  1 
ATOM   1807 S  SD  . MET A 1 256 ? -24.432 34.466 33.232  1.00 28.71  ? 236 MET A SD  1 
ATOM   1808 C  CE  . MET A 1 256 ? -24.522 34.162 31.484  1.00 26.47  ? 236 MET A CE  1 
ATOM   1809 N  N   . CYS A 1 257 ? -21.013 38.306 34.467  1.00 25.38  ? 237 CYS A N   1 
ATOM   1810 C  CA  . CYS A 1 257 ? -20.485 39.464 33.759  1.00 23.36  ? 237 CYS A CA  1 
ATOM   1811 C  C   . CYS A 1 257 ? -18.946 39.513 33.783  1.00 26.18  ? 237 CYS A C   1 
ATOM   1812 O  O   . CYS A 1 257 ? -18.312 39.700 32.751  1.00 25.93  ? 237 CYS A O   1 
ATOM   1813 C  CB  . CYS A 1 257 ? -21.049 40.746 34.351  1.00 24.56  ? 237 CYS A CB  1 
ATOM   1814 S  SG  . CYS A 1 257 ? -20.283 42.214 33.706  1.00 32.75  ? 237 CYS A SG  1 
ATOM   1815 N  N   . ASP A 1 258 ? -18.352 39.323 34.956  1.00 22.76  ? 238 ASP A N   1 
ATOM   1816 C  CA  . ASP A 1 258 ? -16.901 39.411 35.113  1.00 22.57  ? 238 ASP A CA  1 
ATOM   1817 C  C   . ASP A 1 258 ? -16.127 38.359 34.345  1.00 21.86  ? 238 ASP A C   1 
ATOM   1818 O  O   . ASP A 1 258 ? -15.082 38.667 33.762  1.00 25.61  ? 238 ASP A O   1 
ATOM   1819 C  CB  . ASP A 1 258 ? -16.516 39.274 36.579  1.00 23.38  ? 238 ASP A CB  1 
ATOM   1820 C  CG  . ASP A 1 258 ? -16.943 40.446 37.398  1.00 25.72  ? 238 ASP A CG  1 
ATOM   1821 O  OD1 . ASP A 1 258 ? -17.199 41.507 36.783  1.00 27.93  ? 238 ASP A OD1 1 
ATOM   1822 O  OD2 . ASP A 1 258 ? -17.022 40.318 38.642  1.00 25.91  ? 238 ASP A OD2 1 
ATOM   1823 N  N   . LEU A 1 259 ? -16.609 37.113 34.403  1.00 20.44  ? 239 LEU A N   1 
ATOM   1824 C  CA  . LEU A 1 259 ? -16.010 36.000 33.674  1.00 19.27  ? 239 LEU A CA  1 
ATOM   1825 C  C   . LEU A 1 259 ? -15.840 36.353 32.216  1.00 20.87  ? 239 LEU A C   1 
ATOM   1826 O  O   . LEU A 1 259 ? -14.823 36.025 31.612  1.00 22.12  ? 239 LEU A O   1 
ATOM   1827 C  CB  . LEU A 1 259 ? -16.896 34.768 33.751  1.00 18.85  ? 239 LEU A CB  1 
ATOM   1828 C  CG  . LEU A 1 259 ? -16.845 33.993 35.051  1.00 19.33  ? 239 LEU A CG  1 
ATOM   1829 C  CD1 . LEU A 1 259 ? -17.877 32.925 35.030  1.00 24.70  ? 239 LEU A CD1 1 
ATOM   1830 C  CD2 . LEU A 1 259 ? -15.486 33.377 35.221  1.00 20.38  ? 239 LEU A CD2 1 
ATOM   1831 N  N   . LEU A 1 260 ? -16.849 37.023 31.658  1.00 18.95  ? 240 LEU A N   1 
ATOM   1832 C  CA  . LEU A 1 260 ? -16.852 37.413 30.255  1.00 18.59  ? 240 LEU A CA  1 
ATOM   1833 C  C   . LEU A 1 260 ? -16.125 38.711 30.013  1.00 19.31  ? 240 LEU A C   1 
ATOM   1834 O  O   . LEU A 1 260 ? -15.624 38.928 28.913  1.00 19.04  ? 240 LEU A O   1 
ATOM   1835 C  CB  . LEU A 1 260 ? -18.285 37.571 29.755  1.00 18.80  ? 240 LEU A CB  1 
ATOM   1836 C  CG  . LEU A 1 260 ? -19.201 36.368 29.982  1.00 18.40  ? 240 LEU A CG  1 
ATOM   1837 C  CD1 . LEU A 1 260 ? -20.519 36.560 29.292  1.00 18.70  ? 240 LEU A CD1 1 
ATOM   1838 C  CD2 . LEU A 1 260 ? -18.528 35.121 29.479  1.00 17.34  ? 240 LEU A CD2 1 
ATOM   1839 N  N   . TRP A 1 261 ? -16.071 39.580 31.026  1.00 20.40  ? 241 TRP A N   1 
ATOM   1840 C  CA  . TRP A 1 261 ? -15.611 40.958 30.816  1.00 21.47  ? 241 TRP A CA  1 
ATOM   1841 C  C   . TRP A 1 261 ? -14.255 41.374 31.388  1.00 22.04  ? 241 TRP A C   1 
ATOM   1842 O  O   . TRP A 1 261 ? -13.661 42.297 30.856  1.00 22.75  ? 241 TRP A O   1 
ATOM   1843 C  CB  . TRP A 1 261 ? -16.682 41.980 31.223  1.00 22.76  ? 241 TRP A CB  1 
ATOM   1844 C  CG  . TRP A 1 261 ? -17.795 42.092 30.233  1.00 22.67  ? 241 TRP A CG  1 
ATOM   1845 C  CD1 . TRP A 1 261 ? -18.946 41.362 30.211  1.00 22.24  ? 241 TRP A CD1 1 
ATOM   1846 C  CD2 . TRP A 1 261 ? -17.864 42.974 29.099  1.00 23.20  ? 241 TRP A CD2 1 
ATOM   1847 N  NE1 . TRP A 1 261 ? -19.729 41.735 29.139  1.00 22.44  ? 241 TRP A NE1 1 
ATOM   1848 C  CE2 . TRP A 1 261 ? -19.087 42.725 28.448  1.00 23.04  ? 241 TRP A CE2 1 
ATOM   1849 C  CE3 . TRP A 1 261 ? -17.014 43.952 28.577  1.00 23.98  ? 241 TRP A CE3 1 
ATOM   1850 C  CZ2 . TRP A 1 261 ? -19.475 43.406 27.309  1.00 26.70  ? 241 TRP A CZ2 1 
ATOM   1851 C  CZ3 . TRP A 1 261 ? -17.404 44.630 27.439  1.00 24.86  ? 241 TRP A CZ3 1 
ATOM   1852 C  CH2 . TRP A 1 261 ? -18.621 44.353 26.816  1.00 24.33  ? 241 TRP A CH2 1 
ATOM   1853 N  N   . SER A 1 262 ? -13.739 40.735 32.435  1.00 21.92  ? 242 SER A N   1 
ATOM   1854 C  CA  . SER A 1 262 ? -12.554 41.312 33.087  1.00 22.84  ? 242 SER A CA  1 
ATOM   1855 C  C   . SER A 1 262 ? -11.253 41.166 32.306  1.00 22.49  ? 242 SER A C   1 
ATOM   1856 O  O   . SER A 1 262 ? -11.088 40.235 31.531  1.00 22.79  ? 242 SER A O   1 
ATOM   1857 C  CB  . SER A 1 262 ? -12.387 40.775 34.503  1.00 23.12  ? 242 SER A CB  1 
ATOM   1858 O  OG  . SER A 1 262 ? -12.222 39.373 34.484  1.00 21.92  ? 242 SER A OG  1 
ATOM   1859 N  N   . ASP A 1 263 ? -10.338 42.109 32.511  1.00 23.70  ? 243 ASP A N   1 
ATOM   1860 C  CA  . ASP A 1 263 ? -9.008  42.079 31.895  1.00 23.77  ? 243 ASP A CA  1 
ATOM   1861 C  C   . ASP A 1 263 ? -7.925  42.073 32.946  1.00 24.60  ? 243 ASP A C   1 
ATOM   1862 O  O   . ASP A 1 263 ? -8.133  42.533 34.054  1.00 25.54  ? 243 ASP A O   1 
ATOM   1863 C  CB  . ASP A 1 263 ? -8.764  43.335 31.068  1.00 24.87  ? 243 ASP A CB  1 
ATOM   1864 C  CG  . ASP A 1 263 ? -9.715  43.475 29.946  1.00 26.17  ? 243 ASP A CG  1 
ATOM   1865 O  OD1 . ASP A 1 263 ? -9.748  42.571 29.091  1.00 29.86  ? 243 ASP A OD1 1 
ATOM   1866 O  OD2 . ASP A 1 263 ? -10.447 44.479 29.934  1.00 27.41  ? 243 ASP A OD2 1 
ATOM   1867 N  N   . PRO A 1 264 ? -6.740  41.580 32.589  1.00 24.43  ? 244 PRO A N   1 
ATOM   1868 C  CA  . PRO A 1 264 ? -5.623  41.857 33.479  1.00 25.66  ? 244 PRO A CA  1 
ATOM   1869 C  C   . PRO A 1 264 ? -5.361  43.345 33.460  1.00 27.37  ? 244 PRO A C   1 
ATOM   1870 O  O   . PRO A 1 264 ? -5.679  44.002 32.472  1.00 29.87  ? 244 PRO A O   1 
ATOM   1871 C  CB  . PRO A 1 264 ? -4.466  41.096 32.836  1.00 25.26  ? 244 PRO A CB  1 
ATOM   1872 C  CG  . PRO A 1 264 ? -4.854  40.904 31.446  1.00 24.28  ? 244 PRO A CG  1 
ATOM   1873 C  CD  . PRO A 1 264 ? -6.339  40.752 31.446  1.00 23.36  ? 244 PRO A CD  1 
ATOM   1874 N  N   . SER A 1 265 ? -4.817  43.868 34.550  1.00 30.14  ? 245 SER A N   1 
ATOM   1875 C  CA  . SER A 1 265 ? -4.532  45.281 34.641  1.00 33.27  ? 245 SER A CA  1 
ATOM   1876 C  C   . SER A 1 265 ? -3.441  45.614 33.636  1.00 31.75  ? 245 SER A C   1 
ATOM   1877 O  O   . SER A 1 265 ? -2.688  44.728 33.232  1.00 33.06  ? 245 SER A O   1 
ATOM   1878 C  CB  . SER A 1 265 ? -4.098  45.626 36.060  1.00 33.48  ? 245 SER A CB  1 
ATOM   1879 O  OG  . SER A 1 265 ? -3.076  44.751 36.479  1.00 35.78  ? 245 SER A OG  1 
ATOM   1880 N  N   . GLU A 1 266 ? -3.365  46.874 33.215  1.00 32.90  ? 246 GLU A N   1 
ATOM   1881 C  CA  . GLU A 1 266 ? -2.370  47.265 32.217  1.00 33.75  ? 246 GLU A CA  1 
ATOM   1882 C  C   . GLU A 1 266 ? -0.940  47.014 32.710  1.00 36.12  ? 246 GLU A C   1 
ATOM   1883 O  O   . GLU A 1 266 ? -0.045  46.715 31.914  1.00 37.16  ? 246 GLU A O   1 
ATOM   1884 C  CB  . GLU A 1 266 ? -2.554  48.723 31.797  1.00 37.62  ? 246 GLU A CB  1 
ATOM   1885 C  CG  . GLU A 1 266 ? -1.679  49.131 30.607  1.00 39.13  ? 246 GLU A CG  1 
ATOM   1886 C  CD  . GLU A 1 266 ? -1.980  50.563 30.126  1.00 41.23  ? 246 GLU A CD  1 
ATOM   1887 O  OE1 . GLU A 1 266 ? -2.856  51.228 30.750  1.00 41.93  ? 246 GLU A OE1 1 
ATOM   1888 O  OE2 . GLU A 1 266 ? -1.352  51.032 29.130  1.00 42.36  ? 246 GLU A OE2 1 
ATOM   1889 N  N   . ASP A 1 267 ? -0.741  47.117 34.025  1.00 39.92  ? 247 ASP A N   1 
ATOM   1890 C  CA  . ASP A 1 267 ? 0.560   46.860 34.643  1.00 47.00  ? 247 ASP A CA  1 
ATOM   1891 C  C   . ASP A 1 267 ? 0.637   45.502 35.358  1.00 43.09  ? 247 ASP A C   1 
ATOM   1892 O  O   . ASP A 1 267 ? 1.272   45.384 36.406  1.00 39.36  ? 247 ASP A O   1 
ATOM   1893 C  CB  . ASP A 1 267 ? 0.907   47.978 35.629  1.00 55.10  ? 247 ASP A CB  1 
ATOM   1894 C  CG  . ASP A 1 267 ? -0.233  48.291 36.578  1.00 60.93  ? 247 ASP A CG  1 
ATOM   1895 O  OD1 . ASP A 1 267 ? -0.388  47.586 37.603  1.00 58.94  ? 247 ASP A OD1 1 
ATOM   1896 O  OD2 . ASP A 1 267 ? -0.977  49.252 36.293  1.00 67.42  ? 247 ASP A OD2 1 
ATOM   1897 N  N   . PHE A 1 268 ? 0.004   44.481 34.785  1.00 33.09  ? 248 PHE A N   1 
ATOM   1898 C  CA  . PHE A 1 268 ? 0.002   43.136 35.371  1.00 31.82  ? 248 PHE A CA  1 
ATOM   1899 C  C   . PHE A 1 268 ? 1.409   42.604 35.679  1.00 33.59  ? 248 PHE A C   1 
ATOM   1900 O  O   . PHE A 1 268 ? 2.277   42.587 34.812  1.00 37.40  ? 248 PHE A O   1 
ATOM   1901 C  CB  . PHE A 1 268 ? -0.726  42.166 34.441  1.00 29.70  ? 248 PHE A CB  1 
ATOM   1902 C  CG  . PHE A 1 268 ? -0.995  40.821 35.048  1.00 28.47  ? 248 PHE A CG  1 
ATOM   1903 C  CD1 . PHE A 1 268 ? -0.071  39.802 34.934  1.00 28.25  ? 248 PHE A CD1 1 
ATOM   1904 C  CD2 . PHE A 1 268 ? -2.189  40.565 35.714  1.00 27.70  ? 248 PHE A CD2 1 
ATOM   1905 C  CE1 . PHE A 1 268 ? -0.320  38.555 35.488  1.00 27.33  ? 248 PHE A CE1 1 
ATOM   1906 C  CE2 . PHE A 1 268 ? -2.436  39.328 36.267  1.00 26.79  ? 248 PHE A CE2 1 
ATOM   1907 C  CZ  . PHE A 1 268 ? -1.501  38.323 36.154  1.00 26.61  ? 248 PHE A CZ  1 
ATOM   1908 N  N   . GLY A 1 269 ? 1.632   42.175 36.916  1.00 41.58  ? 249 GLY A N   1 
ATOM   1909 C  CA  . GLY A 1 269 ? 2.893   41.547 37.283  1.00 43.39  ? 249 GLY A CA  1 
ATOM   1910 C  C   . GLY A 1 269 ? 3.972   42.536 37.669  1.00 41.92  ? 249 GLY A C   1 
ATOM   1911 O  O   . GLY A 1 269 ? 5.056   42.147 38.100  1.00 42.81  ? 249 GLY A O   1 
ATOM   1912 N  N   . ASN A 1 270 ? 3.668   43.818 37.502  1.00 40.76  ? 250 ASN A N   1 
ATOM   1913 C  CA  . ASN A 1 270 ? 4.567   44.889 37.905  1.00 48.45  ? 250 ASN A CA  1 
ATOM   1914 C  C   . ASN A 1 270 ? 3.781   46.038 38.516  1.00 48.96  ? 250 ASN A C   1 
ATOM   1915 O  O   . ASN A 1 270 ? 3.884   47.189 38.085  1.00 47.50  ? 250 ASN A O   1 
ATOM   1916 C  CB  . ASN A 1 270 ? 5.423   45.343 36.720  1.00 52.56  ? 250 ASN A CB  1 
ATOM   1917 C  CG  . ASN A 1 270 ? 6.538   44.351 36.406  1.00 57.23  ? 250 ASN A CG  1 
ATOM   1918 O  OD1 . ASN A 1 270 ? 7.519   44.258 37.150  1.00 64.26  ? 250 ASN A OD1 1 
ATOM   1919 N  ND2 . ASN A 1 270 ? 6.385   43.594 35.322  1.00 53.07  ? 250 ASN A ND2 1 
ATOM   1920 N  N   . GLU A 1 271 ? 3.009   45.689 39.543  1.00 53.71  ? 251 GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 271 ? 1.992   46.558 40.127  1.00 58.19  ? 251 GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 271 ? 2.522   47.685 40.989  1.00 62.09  ? 251 GLU A C   1 
ATOM   1923 O  O   . GLU A 1 271 ? 3.415   47.486 41.825  1.00 59.39  ? 251 GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 271 ? 1.019   45.745 40.985  1.00 56.77  ? 251 GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 271 ? -0.021  44.974 40.209  1.00 51.45  ? 251 GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 271 ? 0.498   43.647 39.710  1.00 51.24  ? 251 GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 271 ? 1.511   43.156 40.264  1.00 46.91  ? 251 GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 271 ? -0.107  43.099 38.765  1.00 51.99  ? 251 GLU A OE2 1 
ATOM   1929 N  N   . LYS A 1 272 ? 1.935   48.863 40.785  1.00 63.19  ? 252 LYS A N   1 
ATOM   1930 C  CA  . LYS A 1 272 ? 2.053   49.965 41.727  1.00 68.26  ? 252 LYS A CA  1 
ATOM   1931 C  C   . LYS A 1 272 ? 1.204   49.658 42.973  1.00 70.26  ? 252 LYS A C   1 
ATOM   1932 O  O   . LYS A 1 272 ? 1.738   49.304 44.029  1.00 71.01  ? 252 LYS A O   1 
ATOM   1933 C  CB  . LYS A 1 272 ? 1.618   51.282 41.069  1.00 67.66  ? 252 LYS A CB  1 
ATOM   1934 C  CG  . LYS A 1 272 ? 2.627   51.862 40.053  1.00 69.16  ? 252 LYS A CG  1 
ATOM   1935 C  CD  . LYS A 1 272 ? 2.421   53.378 39.872  1.00 71.77  ? 252 LYS A CD  1 
ATOM   1936 C  CE  . LYS A 1 272 ? 3.588   54.060 39.144  1.00 73.87  ? 252 LYS A CE  1 
ATOM   1937 N  NZ  . LYS A 1 272 ? 3.398   55.545 39.022  1.00 76.59  ? 252 LYS A NZ  1 
ATOM   1938 N  N   . SER A 1 273 ? -0.115  49.771 42.841  1.00 75.90  ? 253 SER A N   1 
ATOM   1939 C  CA  . SER A 1 273 ? -1.028  49.437 43.935  1.00 74.99  ? 253 SER A CA  1 
ATOM   1940 C  C   . SER A 1 273 ? -1.069  47.922 44.169  1.00 69.71  ? 253 SER A C   1 
ATOM   1941 O  O   . SER A 1 273 ? -0.935  47.140 43.230  1.00 67.96  ? 253 SER A O   1 
ATOM   1942 C  CB  . SER A 1 273 ? -2.431  49.986 43.641  1.00 75.83  ? 253 SER A CB  1 
ATOM   1943 O  OG  . SER A 1 273 ? -3.362  49.632 44.651  1.00 78.25  ? 253 SER A OG  1 
ATOM   1944 N  N   . GLN A 1 274 ? -1.247  47.509 45.420  1.00 63.46  ? 254 GLN A N   1 
ATOM   1945 C  CA  . GLN A 1 274 ? -1.368  46.086 45.741  1.00 60.83  ? 254 GLN A CA  1 
ATOM   1946 C  C   . GLN A 1 274 ? -2.826  45.602 45.658  1.00 58.84  ? 254 GLN A C   1 
ATOM   1947 O  O   . GLN A 1 274 ? -3.143  44.476 46.041  1.00 60.00  ? 254 GLN A O   1 
ATOM   1948 C  CB  . GLN A 1 274 ? -0.748  45.780 47.116  1.00 58.73  ? 254 GLN A CB  1 
ATOM   1949 C  CG  . GLN A 1 274 ? 0.799   45.945 47.161  1.00 60.33  ? 254 GLN A CG  1 
ATOM   1950 C  CD  . GLN A 1 274 ? 1.405   45.957 48.596  1.00 62.60  ? 254 GLN A CD  1 
ATOM   1951 O  OE1 . GLN A 1 274 ? 0.687   46.149 49.586  1.00 63.47  ? 254 GLN A OE1 1 
ATOM   1952 N  NE2 . GLN A 1 274 ? 2.734   45.761 48.695  1.00 63.70  ? 254 GLN A NE2 1 
ATOM   1953 N  N   . GLU A 1 275 ? -3.701  46.461 45.143  1.00 54.43  ? 255 GLU A N   1 
ATOM   1954 C  CA  . GLU A 1 275 ? -5.128  46.161 45.010  1.00 53.66  ? 255 GLU A CA  1 
ATOM   1955 C  C   . GLU A 1 275 ? -5.398  44.948 44.116  1.00 53.37  ? 255 GLU A C   1 
ATOM   1956 O  O   . GLU A 1 275 ? -4.698  44.747 43.140  1.00 62.39  ? 255 GLU A O   1 
ATOM   1957 C  CB  . GLU A 1 275 ? -5.836  47.400 44.447  1.00 59.85  ? 255 GLU A CB  1 
ATOM   1958 C  CG  . GLU A 1 275 ? -7.313  47.486 44.751  1.00 69.12  ? 255 GLU A CG  1 
ATOM   1959 C  CD  . GLU A 1 275 ? -7.595  47.686 46.227  1.00 72.82  ? 255 GLU A CD  1 
ATOM   1960 O  OE1 . GLU A 1 275 ? -8.787  47.655 46.609  1.00 72.21  ? 255 GLU A OE1 1 
ATOM   1961 O  OE2 . GLU A 1 275 ? -6.631  47.875 47.002  1.00 70.05  ? 255 GLU A OE2 1 
ATOM   1962 N  N   . HIS A 1 276 ? -6.409  44.150 44.432  1.00 39.68  ? 256 HIS A N   1 
ATOM   1963 C  CA  . HIS A 1 276 ? -6.670  42.946 43.645  1.00 33.79  ? 256 HIS A CA  1 
ATOM   1964 C  C   . HIS A 1 276 ? -7.543  43.238 42.441  1.00 34.08  ? 256 HIS A C   1 
ATOM   1965 O  O   . HIS A 1 276 ? -7.347  42.660 41.358  1.00 33.11  ? 256 HIS A O   1 
ATOM   1966 C  CB  . HIS A 1 276 ? -7.375  41.870 44.475  1.00 33.47  ? 256 HIS A CB  1 
ATOM   1967 C  CG  . HIS A 1 276 ? -6.459  41.071 45.345  1.00 33.88  ? 256 HIS A CG  1 
ATOM   1968 N  ND1 . HIS A 1 276 ? -6.694  39.746 45.650  1.00 32.91  ? 256 HIS A ND1 1 
ATOM   1969 C  CD2 . HIS A 1 276 ? -5.314  41.411 45.978  1.00 35.29  ? 256 HIS A CD2 1 
ATOM   1970 C  CE1 . HIS A 1 276 ? -5.727  39.305 46.436  1.00 33.83  ? 256 HIS A CE1 1 
ATOM   1971 N  NE2 . HIS A 1 276 ? -4.879  40.297 46.652  1.00 35.26  ? 256 HIS A NE2 1 
ATOM   1972 N  N   . PHE A 1 277 ? -8.532  44.108 42.637  1.00 33.46  ? 257 PHE A N   1 
ATOM   1973 C  CA  . PHE A 1 277 ? -9.463  44.446 41.568  1.00 32.62  ? 257 PHE A CA  1 
ATOM   1974 C  C   . PHE A 1 277 ? -9.692  45.940 41.536  1.00 34.37  ? 257 PHE A C   1 
ATOM   1975 O  O   . PHE A 1 277 ? -9.646  46.601 42.574  1.00 40.64  ? 257 PHE A O   1 
ATOM   1976 C  CB  . PHE A 1 277 ? -10.809 43.742 41.782  1.00 31.76  ? 257 PHE A CB  1 
ATOM   1977 C  CG  . PHE A 1 277 ? -10.742 42.240 41.666  1.00 30.07  ? 257 PHE A CG  1 
ATOM   1978 C  CD1 . PHE A 1 277 ? -10.871 41.616 40.427  1.00 28.34  ? 257 PHE A CD1 1 
ATOM   1979 C  CD2 . PHE A 1 277 ? -10.542 41.457 42.785  1.00 30.41  ? 257 PHE A CD2 1 
ATOM   1980 C  CE1 . PHE A 1 277 ? -10.793 40.253 40.308  1.00 27.01  ? 257 PHE A CE1 1 
ATOM   1981 C  CE2 . PHE A 1 277 ? -10.468 40.095 42.673  1.00 29.11  ? 257 PHE A CE2 1 
ATOM   1982 C  CZ  . PHE A 1 277 ? -10.595 39.489 41.429  1.00 27.42  ? 257 PHE A CZ  1 
ATOM   1983 N  N   . SER A 1 278 ? -9.950  46.473 40.351  1.00 33.98  ? 258 SER A N   1 
ATOM   1984 C  CA  . SER A 1 278 ? -10.357 47.869 40.214  1.00 36.39  ? 258 SER A CA  1 
ATOM   1985 C  C   . SER A 1 278 ? -11.303 48.030 39.024  1.00 37.72  ? 258 SER A C   1 
ATOM   1986 O  O   . SER A 1 278 ? -11.290 47.213 38.106  1.00 35.90  ? 258 SER A O   1 
ATOM   1987 C  CB  . SER A 1 278 ? -9.141  48.796 40.089  1.00 38.04  ? 258 SER A CB  1 
ATOM   1988 O  OG  . SER A 1 278 ? -8.162  48.272 39.203  1.00 41.03  ? 258 SER A OG  1 
ATOM   1989 N  N   . HIS A 1 279 ? -12.128 49.073 39.046  1.00 41.37  ? 259 HIS A N   1 
ATOM   1990 C  CA  . HIS A 1 279 ? -13.155 49.258 38.018  1.00 40.25  ? 259 HIS A CA  1 
ATOM   1991 C  C   . HIS A 1 279 ? -12.497 49.381 36.659  1.00 36.49  ? 259 HIS A C   1 
ATOM   1992 O  O   . HIS A 1 279 ? -11.541 50.135 36.497  1.00 37.93  ? 259 HIS A O   1 
ATOM   1993 C  CB  . HIS A 1 279 ? -14.061 50.458 38.326  1.00 46.56  ? 259 HIS A CB  1 
ATOM   1994 C  CG  . HIS A 1 279 ? -14.771 50.355 39.646  1.00 56.66  ? 259 HIS A CG  1 
ATOM   1995 N  ND1 . HIS A 1 279 ? -15.631 49.319 39.954  1.00 58.60  ? 259 HIS A ND1 1 
ATOM   1996 C  CD2 . HIS A 1 279 ? -14.740 51.153 40.743  1.00 59.03  ? 259 HIS A CD2 1 
ATOM   1997 C  CE1 . HIS A 1 279 ? -16.100 49.487 41.179  1.00 57.26  ? 259 HIS A CE1 1 
ATOM   1998 N  NE2 . HIS A 1 279 ? -15.576 50.592 41.680  1.00 58.11  ? 259 HIS A NE2 1 
ATOM   1999 N  N   . ASN A 1 280 ? -12.990 48.597 35.704  1.00 33.19  ? 260 ASN A N   1 
ATOM   2000 C  CA  . ASN A 1 280 ? -12.373 48.493 34.394  1.00 32.33  ? 260 ASN A CA  1 
ATOM   2001 C  C   . ASN A 1 280 ? -12.747 49.706 33.534  1.00 33.71  ? 260 ASN A C   1 
ATOM   2002 O  O   . ASN A 1 280 ? -13.824 49.779 32.935  1.00 33.48  ? 260 ASN A O   1 
ATOM   2003 C  CB  . ASN A 1 280 ? -12.756 47.160 33.745  1.00 30.02  ? 260 ASN A CB  1 
ATOM   2004 C  CG  . ASN A 1 280 ? -11.951 46.865 32.499  1.00 29.10  ? 260 ASN A CG  1 
ATOM   2005 O  OD1 . ASN A 1 280 ? -11.688 47.754 31.703  1.00 32.69  ? 260 ASN A OD1 1 
ATOM   2006 N  ND2 . ASN A 1 280 ? -11.555 45.617 32.322  1.00 27.42  ? 260 ASN A ND2 1 
ATOM   2007 N  N   . THR A 1 281 ? -11.837 50.668 33.496  1.00 36.66  ? 261 THR A N   1 
ATOM   2008 C  CA  . THR A 1 281 ? -12.069 51.945 32.826  1.00 37.62  ? 261 THR A CA  1 
ATOM   2009 C  C   . THR A 1 281 ? -12.268 51.767 31.329  1.00 41.00  ? 261 THR A C   1 
ATOM   2010 O  O   . THR A 1 281 ? -13.061 52.480 30.711  1.00 44.56  ? 261 THR A O   1 
ATOM   2011 C  CB  . THR A 1 281 ? -10.877 52.911 33.039  1.00 39.25  ? 261 THR A CB  1 
ATOM   2012 O  OG1 . THR A 1 281 ? -9.670  52.317 32.516  1.00 38.25  ? 261 THR A OG1 1 
ATOM   2013 C  CG2 . THR A 1 281 ? -10.680 53.224 34.522  1.00 40.60  ? 261 THR A CG2 1 
ATOM   2014 N  N   . VAL A 1 282 ? -11.532 50.815 30.758  1.00 36.33  ? 262 VAL A N   1 
ATOM   2015 C  CA  . VAL A 1 282 ? -11.615 50.470 29.330  1.00 33.49  ? 262 VAL A CA  1 
ATOM   2016 C  C   . VAL A 1 282 ? -12.973 49.895 28.890  1.00 33.52  ? 262 VAL A C   1 
ATOM   2017 O  O   . VAL A 1 282 ? -13.557 50.363 27.913  1.00 37.65  ? 262 VAL A O   1 
ATOM   2018 C  CB  . VAL A 1 282 ? -10.508 49.463 28.931  1.00 32.00  ? 262 VAL A CB  1 
ATOM   2019 C  CG1 . VAL A 1 282 ? -10.791 48.849 27.558  1.00 30.66  ? 262 VAL A CG1 1 
ATOM   2020 C  CG2 . VAL A 1 282 ? -9.144  50.123 28.969  1.00 33.48  ? 262 VAL A CG2 1 
ATOM   2021 N  N   . ARG A 1 283 ? -13.466 48.881 29.603  1.00 35.38  ? 263 ARG A N   1 
ATOM   2022 C  CA  . ARG A 1 283 ? -14.733 48.231 29.255  1.00 33.81  ? 263 ARG A CA  1 
ATOM   2023 C  C   . ARG A 1 283 ? -15.959 49.005 29.733  1.00 37.13  ? 263 ARG A C   1 
ATOM   2024 O  O   . ARG A 1 283 ? -17.051 48.809 29.216  1.00 39.88  ? 263 ARG A O   1 
ATOM   2025 C  CB  . ARG A 1 283 ? -14.810 46.813 29.842  1.00 31.56  ? 263 ARG A CB  1 
ATOM   2026 C  CG  . ARG A 1 283 ? -13.640 45.909 29.534  1.00 26.54  ? 263 ARG A CG  1 
ATOM   2027 C  CD  . ARG A 1 283 ? -13.578 45.502 28.080  1.00 25.60  ? 263 ARG A CD  1 
ATOM   2028 N  NE  . ARG A 1 283 ? -12.313 44.826 27.818  1.00 27.20  ? 263 ARG A NE  1 
ATOM   2029 C  CZ  . ARG A 1 283 ? -11.942 44.298 26.653  1.00 27.73  ? 263 ARG A CZ  1 
ATOM   2030 N  NH1 . ARG A 1 283 ? -12.750 44.349 25.599  1.00 29.11  ? 263 ARG A NH1 1 
ATOM   2031 N  NH2 . ARG A 1 283 ? -10.756 43.702 26.550  1.00 23.53  ? 263 ARG A NH2 1 
ATOM   2032 N  N   . GLY A 1 284 ? -15.805 49.853 30.740  1.00 37.20  ? 264 GLY A N   1 
ATOM   2033 C  CA  . GLY A 1 284 ? -16.965 50.536 31.290  1.00 35.22  ? 264 GLY A CA  1 
ATOM   2034 C  C   . GLY A 1 284 ? -17.842 49.638 32.164  1.00 38.09  ? 264 GLY A C   1 
ATOM   2035 O  O   . GLY A 1 284 ? -18.928 50.047 32.600  1.00 38.18  ? 264 GLY A O   1 
ATOM   2036 N  N   . CYS A 1 285 ? -17.377 48.413 32.413  1.00 37.76  ? 265 CYS A N   1 
ATOM   2037 C  CA  . CYS A 1 285 ? -17.996 47.527 33.391  1.00 32.43  ? 265 CYS A CA  1 
ATOM   2038 C  C   . CYS A 1 285 ? -16.986 46.478 33.829  1.00 31.50  ? 265 CYS A C   1 
ATOM   2039 O  O   . CYS A 1 285 ? -15.903 46.376 33.253  1.00 35.10  ? 265 CYS A O   1 
ATOM   2040 C  CB  . CYS A 1 285 ? -19.263 46.876 32.829  1.00 30.55  ? 265 CYS A CB  1 
ATOM   2041 S  SG  . CYS A 1 285 ? -19.001 45.602 31.552  1.00 35.66  ? 265 CYS A SG  1 
ATOM   2042 N  N   . SER A 1 286 ? -17.331 45.702 34.851  1.00 29.00  ? 266 SER A N   1 
ATOM   2043 C  CA  . SER A 1 286 ? -16.421 44.680 35.382  1.00 27.90  ? 266 SER A CA  1 
ATOM   2044 C  C   . SER A 1 286 ? -15.085 45.277 35.854  1.00 29.42  ? 266 SER A C   1 
ATOM   2045 O  O   . SER A 1 286 ? -15.024 46.468 36.217  1.00 30.53  ? 266 SER A O   1 
ATOM   2046 C  CB  . SER A 1 286 ? -16.172 43.580 34.352  1.00 28.50  ? 266 SER A CB  1 
ATOM   2047 O  OG  . SER A 1 286 ? -15.565 42.458 34.957  1.00 34.23  ? 266 SER A OG  1 
ATOM   2048 N  N   . TYR A 1 287 ? -14.028 44.456 35.865  1.00 30.11  ? 267 TYR A N   1 
ATOM   2049 C  CA  . TYR A 1 287 ? -12.797 44.833 36.562  1.00 29.43  ? 267 TYR A CA  1 
ATOM   2050 C  C   . TYR A 1 287 ? -11.486 44.571 35.822  1.00 28.43  ? 267 TYR A C   1 
ATOM   2051 O  O   . TYR A 1 287 ? -11.461 43.845 34.831  1.00 31.69  ? 267 TYR A O   1 
ATOM   2052 C  CB  . TYR A 1 287 ? -12.726 44.100 37.903  1.00 28.75  ? 267 TYR A CB  1 
ATOM   2053 C  CG  . TYR A 1 287 ? -13.916 44.298 38.812  1.00 30.39  ? 267 TYR A CG  1 
ATOM   2054 C  CD1 . TYR A 1 287 ? -15.009 43.450 38.743  1.00 30.13  ? 267 TYR A CD1 1 
ATOM   2055 C  CD2 . TYR A 1 287 ? -13.938 45.315 39.753  1.00 31.64  ? 267 TYR A CD2 1 
ATOM   2056 C  CE1 . TYR A 1 287 ? -16.097 43.616 39.566  1.00 37.01  ? 267 TYR A CE1 1 
ATOM   2057 C  CE2 . TYR A 1 287 ? -15.029 45.488 40.586  1.00 34.59  ? 267 TYR A CE2 1 
ATOM   2058 C  CZ  . TYR A 1 287 ? -16.105 44.630 40.487  1.00 41.84  ? 267 TYR A CZ  1 
ATOM   2059 O  OH  . TYR A 1 287 ? -17.201 44.786 41.301  1.00 46.78  ? 267 TYR A OH  1 
ATOM   2060 N  N   . PHE A 1 288 ? -10.412 45.185 36.323  1.00 30.15  ? 268 PHE A N   1 
ATOM   2061 C  CA  . PHE A 1 288 ? -9.046  44.763 36.034  1.00 28.90  ? 268 PHE A CA  1 
ATOM   2062 C  C   . PHE A 1 288 ? -8.651  43.856 37.190  1.00 28.70  ? 268 PHE A C   1 
ATOM   2063 O  O   . PHE A 1 288 ? -8.946  44.163 38.332  1.00 29.77  ? 268 PHE A O   1 
ATOM   2064 C  CB  . PHE A 1 288 ? -8.078  45.951 36.002  1.00 30.69  ? 268 PHE A CB  1 
ATOM   2065 C  CG  . PHE A 1 288 ? -8.262  46.878 34.824  1.00 31.19  ? 268 PHE A CG  1 
ATOM   2066 C  CD1 . PHE A 1 288 ? -8.007  46.439 33.532  1.00 32.30  ? 268 PHE A CD1 1 
ATOM   2067 C  CD2 . PHE A 1 288 ? -8.647  48.205 35.017  1.00 33.05  ? 268 PHE A CD2 1 
ATOM   2068 C  CE1 . PHE A 1 288 ? -8.168  47.287 32.452  1.00 30.65  ? 268 PHE A CE1 1 
ATOM   2069 C  CE2 . PHE A 1 288 ? -8.813  49.061 33.952  1.00 33.74  ? 268 PHE A CE2 1 
ATOM   2070 C  CZ  . PHE A 1 288 ? -8.574  48.598 32.658  1.00 32.51  ? 268 PHE A CZ  1 
ATOM   2071 N  N   . TYR A 1 289 ? -8.000  42.737 36.908  1.00 27.49  ? 269 TYR A N   1 
ATOM   2072 C  CA  . TYR A 1 289 ? -7.419  41.913 37.966  1.00 27.58  ? 269 TYR A CA  1 
ATOM   2073 C  C   . TYR A 1 289 ? -5.917  41.925 37.837  1.00 28.14  ? 269 TYR A C   1 
ATOM   2074 O  O   . TYR A 1 289 ? -5.375  42.030 36.745  1.00 27.78  ? 269 TYR A O   1 
ATOM   2075 C  CB  . TYR A 1 289 ? -7.933  40.469 37.935  1.00 26.02  ? 269 TYR A CB  1 
ATOM   2076 C  CG  . TYR A 1 289 ? -7.913  39.804 36.577  1.00 24.53  ? 269 TYR A CG  1 
ATOM   2077 C  CD1 . TYR A 1 289 ? -6.760  39.207 36.089  1.00 24.17  ? 269 TYR A CD1 1 
ATOM   2078 C  CD2 . TYR A 1 289 ? -9.060  39.753 35.795  1.00 24.78  ? 269 TYR A CD2 1 
ATOM   2079 C  CE1 . TYR A 1 289 ? -6.743  38.593 34.849  1.00 23.54  ? 269 TYR A CE1 1 
ATOM   2080 C  CE2 . TYR A 1 289 ? -9.059  39.139 34.561  1.00 25.46  ? 269 TYR A CE2 1 
ATOM   2081 C  CZ  . TYR A 1 289 ? -7.902  38.558 34.091  1.00 23.72  ? 269 TYR A CZ  1 
ATOM   2082 O  OH  . TYR A 1 289 ? -7.919  37.946 32.854  1.00 20.99  ? 269 TYR A OH  1 
ATOM   2083 N  N   . ASN A 1 290 ? -5.227  41.825 38.953  1.00 29.19  ? 270 ASN A N   1 
ATOM   2084 C  CA  . ASN A 1 290 ? -3.790  41.885 38.867  1.00 29.97  ? 270 ASN A CA  1 
ATOM   2085 C  C   . ASN A 1 290 ? -3.113  40.625 39.359  1.00 29.56  ? 270 ASN A C   1 
ATOM   2086 O  O   . ASN A 1 290 ? -3.768  39.670 39.766  1.00 28.66  ? 270 ASN A O   1 
ATOM   2087 C  CB  . ASN A 1 290 ? -3.240  43.145 39.531  1.00 32.12  ? 270 ASN A CB  1 
ATOM   2088 C  CG  . ASN A 1 290 ? -3.391  43.130 41.019  1.00 39.99  ? 270 ASN A CG  1 
ATOM   2089 O  OD1 . ASN A 1 290 ? -3.868  42.155 41.608  1.00 41.06  ? 270 ASN A OD1 1 
ATOM   2090 N  ND2 . ASN A 1 290 ? -2.971  44.218 41.655  1.00 44.94  ? 270 ASN A ND2 1 
ATOM   2091 N  N   . TYR A 1 291 ? -1.792  40.637 39.294  1.00 30.62  ? 271 TYR A N   1 
ATOM   2092 C  CA  . TYR A 1 291 ? -0.994  39.461 39.572  1.00 31.59  ? 271 TYR A CA  1 
ATOM   2093 C  C   . TYR A 1 291 ? -1.305  38.830 40.938  1.00 30.56  ? 271 TYR A C   1 
ATOM   2094 O  O   . TYR A 1 291 ? -1.530  37.617 41.010  1.00 30.22  ? 271 TYR A O   1 
ATOM   2095 C  CB  . TYR A 1 291 ? 0.485   39.789 39.398  1.00 31.54  ? 271 TYR A CB  1 
ATOM   2096 C  CG  . TYR A 1 291 ? 1.411   38.636 39.632  1.00 31.60  ? 271 TYR A CG  1 
ATOM   2097 C  CD1 . TYR A 1 291 ? 1.589   37.652 38.676  1.00 30.35  ? 271 TYR A CD1 1 
ATOM   2098 C  CD2 . TYR A 1 291 ? 2.129   38.547 40.804  1.00 33.12  ? 271 TYR A CD2 1 
ATOM   2099 C  CE1 . TYR A 1 291 ? 2.456   36.607 38.899  1.00 32.65  ? 271 TYR A CE1 1 
ATOM   2100 C  CE2 . TYR A 1 291 ? 2.989   37.517 41.035  1.00 33.44  ? 271 TYR A CE2 1 
ATOM   2101 C  CZ  . TYR A 1 291 ? 3.155   36.550 40.091  1.00 36.40  ? 271 TYR A CZ  1 
ATOM   2102 O  OH  . TYR A 1 291 ? 4.024   35.523 40.364  1.00 44.38  ? 271 TYR A OH  1 
ATOM   2103 N  N   . PRO A 1 292 ? -1.347  39.641 42.014  1.00 32.11  ? 272 PRO A N   1 
ATOM   2104 C  CA  . PRO A 1 292 ? -1.751  39.001 43.270  1.00 33.96  ? 272 PRO A CA  1 
ATOM   2105 C  C   . PRO A 1 292 ? -3.126  38.320 43.201  1.00 32.49  ? 272 PRO A C   1 
ATOM   2106 O  O   . PRO A 1 292 ? -3.244  37.187 43.675  1.00 36.42  ? 272 PRO A O   1 
ATOM   2107 C  CB  . PRO A 1 292 ? -1.749  40.167 44.277  1.00 35.53  ? 272 PRO A CB  1 
ATOM   2108 C  CG  . PRO A 1 292 ? -0.761  41.115 43.744  1.00 35.43  ? 272 PRO A CG  1 
ATOM   2109 C  CD  . PRO A 1 292 ? -0.914  41.035 42.239  1.00 33.84  ? 272 PRO A CD  1 
ATOM   2110 N  N   . ALA A 1 293 ? -4.125  38.971 42.614  1.00 30.37  ? 273 ALA A N   1 
ATOM   2111 C  CA  . ALA A 1 293 ? -5.447  38.356 42.483  1.00 29.12  ? 273 ALA A CA  1 
ATOM   2112 C  C   . ALA A 1 293 ? -5.392  36.971 41.831  1.00 27.63  ? 273 ALA A C   1 
ATOM   2113 O  O   . ALA A 1 293 ? -6.084  36.044 42.258  1.00 28.18  ? 273 ALA A O   1 
ATOM   2114 C  CB  . ALA A 1 293 ? -6.389  39.266 41.723  1.00 28.69  ? 273 ALA A CB  1 
ATOM   2115 N  N   . VAL A 1 294 ? -4.541  36.833 40.819  1.00 27.07  ? 274 VAL A N   1 
ATOM   2116 C  CA  . VAL A 1 294 ? -4.395  35.579 40.094  1.00 25.83  ? 274 VAL A CA  1 
ATOM   2117 C  C   . VAL A 1 294 ? -3.631  34.565 40.923  1.00 26.48  ? 274 VAL A C   1 
ATOM   2118 O  O   . VAL A 1 294 ? -4.045  33.417 41.013  1.00 27.56  ? 274 VAL A O   1 
ATOM   2119 C  CB  . VAL A 1 294 ? -3.682  35.782 38.735  1.00 25.27  ? 274 VAL A CB  1 
ATOM   2120 C  CG1 . VAL A 1 294 ? -3.258  34.446 38.128  1.00 24.43  ? 274 VAL A CG1 1 
ATOM   2121 C  CG2 . VAL A 1 294 ? -4.567  36.567 37.769  1.00 24.51  ? 274 VAL A CG2 1 
ATOM   2122 N  N   . CYS A 1 295 ? -2.523  34.976 41.535  1.00 27.88  ? 275 CYS A N   1 
ATOM   2123 C  CA  . CYS A 1 295 ? -1.742  34.065 42.382  1.00 28.78  ? 275 CYS A CA  1 
ATOM   2124 C  C   . CYS A 1 295 ? -2.620  33.449 43.458  1.00 29.35  ? 275 CYS A C   1 
ATOM   2125 O  O   . CYS A 1 295 ? -2.647  32.224 43.621  1.00 29.85  ? 275 CYS A O   1 
ATOM   2126 C  CB  . CYS A 1 295 ? -0.541  34.769 43.017  1.00 30.54  ? 275 CYS A CB  1 
ATOM   2127 S  SG  . CYS A 1 295 ? 0.795   35.099 41.834  1.00 48.47  ? 275 CYS A SG  1 
ATOM   2128 N  N   . GLU A 1 296 ? -3.363  34.290 44.170  1.00 29.60  ? 276 GLU A N   1 
ATOM   2129 C  CA  . GLU A 1 296 ? -4.282  33.798 45.184  1.00 29.99  ? 276 GLU A CA  1 
ATOM   2130 C  C   . GLU A 1 296 ? -5.243  32.767 44.593  1.00 31.23  ? 276 GLU A C   1 
ATOM   2131 O  O   . GLU A 1 296 ? -5.407  31.672 45.134  1.00 28.81  ? 276 GLU A O   1 
ATOM   2132 C  CB  . GLU A 1 296 ? -5.066  34.951 45.788  1.00 30.74  ? 276 GLU A CB  1 
ATOM   2133 C  CG  . GLU A 1 296 ? -6.198  34.544 46.725  1.00 31.17  ? 276 GLU A CG  1 
ATOM   2134 C  CD  . GLU A 1 296 ? -6.764  35.754 47.483  1.00 42.28  ? 276 GLU A CD  1 
ATOM   2135 O  OE1 . GLU A 1 296 ? -8.011  35.878 47.584  1.00 44.34  ? 276 GLU A OE1 1 
ATOM   2136 O  OE2 . GLU A 1 296 ? -5.952  36.586 47.971  1.00 39.68  ? 276 GLU A OE2 1 
ATOM   2137 N  N   . PHE A 1 297 ? -5.863  33.107 43.468  1.00 27.22  ? 277 PHE A N   1 
ATOM   2138 C  CA  . PHE A 1 297 ? -6.878  32.239 42.920  1.00 26.03  ? 277 PHE A CA  1 
ATOM   2139 C  C   . PHE A 1 297 ? -6.264  30.951 42.426  1.00 25.52  ? 277 PHE A C   1 
ATOM   2140 O  O   . PHE A 1 297 ? -6.863  29.884 42.568  1.00 25.32  ? 277 PHE A O   1 
ATOM   2141 C  CB  . PHE A 1 297 ? -7.649  32.925 41.794  1.00 24.87  ? 277 PHE A CB  1 
ATOM   2142 C  CG  . PHE A 1 297 ? -8.755  32.082 41.227  1.00 23.79  ? 277 PHE A CG  1 
ATOM   2143 C  CD1 . PHE A 1 297 ? -8.509  31.196 40.189  1.00 24.34  ? 277 PHE A CD1 1 
ATOM   2144 C  CD2 . PHE A 1 297 ? -10.038 32.164 41.745  1.00 24.03  ? 277 PHE A CD2 1 
ATOM   2145 C  CE1 . PHE A 1 297 ? -9.514  30.414 39.678  1.00 21.96  ? 277 PHE A CE1 1 
ATOM   2146 C  CE2 . PHE A 1 297 ? -11.064 31.383 41.227  1.00 26.25  ? 277 PHE A CE2 1 
ATOM   2147 C  CZ  . PHE A 1 297 ? -10.798 30.512 40.190  1.00 22.23  ? 277 PHE A CZ  1 
ATOM   2148 N  N   . LEU A 1 298 ? -5.073  31.043 41.840  1.00 25.50  ? 278 LEU A N   1 
ATOM   2149 C  CA  . LEU A 1 298 ? -4.374  29.847 41.376  1.00 25.28  ? 278 LEU A CA  1 
ATOM   2150 C  C   . LEU A 1 298 ? -4.013  28.901 42.530  1.00 31.26  ? 278 LEU A C   1 
ATOM   2151 O  O   . LEU A 1 298 ? -4.135  27.685 42.405  1.00 30.65  ? 278 LEU A O   1 
ATOM   2152 C  CB  . LEU A 1 298 ? -3.111  30.221 40.605  1.00 25.34  ? 278 LEU A CB  1 
ATOM   2153 C  CG  . LEU A 1 298 ? -3.266  30.912 39.252  1.00 24.22  ? 278 LEU A CG  1 
ATOM   2154 C  CD1 . LEU A 1 298 ? -1.907  31.048 38.630  1.00 24.64  ? 278 LEU A CD1 1 
ATOM   2155 C  CD2 . LEU A 1 298 ? -4.225  30.161 38.322  1.00 22.85  ? 278 LEU A CD2 1 
ATOM   2156 N  N   . GLN A 1 299 ? -3.568  29.459 43.651  1.00 33.66  ? 279 GLN A N   1 
ATOM   2157 C  CA  . GLN A 1 299 ? -3.149  28.640 44.782  1.00 33.84  ? 279 GLN A CA  1 
ATOM   2158 C  C   . GLN A 1 299 ? -4.331  28.034 45.548  1.00 34.40  ? 279 GLN A C   1 
ATOM   2159 O  O   . GLN A 1 299 ? -4.293  26.867 45.934  1.00 32.86  ? 279 GLN A O   1 
ATOM   2160 C  CB  . GLN A 1 299 ? -2.253  29.444 45.722  1.00 35.31  ? 279 GLN A CB  1 
ATOM   2161 C  CG  . GLN A 1 299 ? -0.813  29.472 45.289  1.00 41.60  ? 279 GLN A CG  1 
ATOM   2162 C  CD  . GLN A 1 299 ? -0.163  30.824 45.526  1.00 52.69  ? 279 GLN A CD  1 
ATOM   2163 O  OE1 . GLN A 1 299 ? -0.713  31.672 46.230  1.00 59.15  ? 279 GLN A OE1 1 
ATOM   2164 N  NE2 . GLN A 1 299 ? 1.005   31.037 44.924  1.00 52.78  ? 279 GLN A NE2 1 
ATOM   2165 N  N   . ASN A 1 300 ? -5.376  28.828 45.771  1.00 34.75  ? 280 ASN A N   1 
ATOM   2166 C  CA  . ASN A 1 300 ? -6.559  28.346 46.474  1.00 29.67  ? 280 ASN A CA  1 
ATOM   2167 C  C   . ASN A 1 300 ? -7.304  27.277 45.693  1.00 36.73  ? 280 ASN A C   1 
ATOM   2168 O  O   . ASN A 1 300 ? -8.222  26.656 46.221  1.00 42.61  ? 280 ASN A O   1 
ATOM   2169 C  CB  . ASN A 1 300 ? -7.529  29.480 46.753  1.00 29.67  ? 280 ASN A CB  1 
ATOM   2170 C  CG  . ASN A 1 300 ? -6.944  30.530 47.653  1.00 37.32  ? 280 ASN A CG  1 
ATOM   2171 O  OD1 . ASN A 1 300 ? -5.920  30.304 48.305  1.00 44.75  ? 280 ASN A OD1 1 
ATOM   2172 N  ND2 . ASN A 1 300 ? -7.593  31.694 47.704  1.00 37.67  ? 280 ASN A ND2 1 
ATOM   2173 N  N   . ASN A 1 301 ? -6.931  27.069 44.434  1.00 32.90  ? 281 ASN A N   1 
ATOM   2174 C  CA  . ASN A 1 301 ? -7.633  26.088 43.620  1.00 28.36  ? 281 ASN A CA  1 
ATOM   2175 C  C   . ASN A 1 301 ? -6.733  25.016 42.997  1.00 29.33  ? 281 ASN A C   1 
ATOM   2176 O  O   . ASN A 1 301 ? -7.190  24.168 42.214  1.00 29.02  ? 281 ASN A O   1 
ATOM   2177 C  CB  . ASN A 1 301 ? -8.487  26.795 42.571  1.00 24.99  ? 281 ASN A CB  1 
ATOM   2178 C  CG  . ASN A 1 301 ? -9.620  27.570 43.195  1.00 30.94  ? 281 ASN A CG  1 
ATOM   2179 O  OD1 . ASN A 1 301 ? -10.636 26.992 43.579  1.00 41.91  ? 281 ASN A OD1 1 
ATOM   2180 N  ND2 . ASN A 1 301 ? -9.448  28.884 43.322  1.00 29.81  ? 281 ASN A ND2 1 
ATOM   2181 N  N   . ASN A 1 302 ? -5.462  25.044 43.378  1.00 29.75  ? 282 ASN A N   1 
ATOM   2182 C  CA  . ASN A 1 302 ? -4.476  24.127 42.841  1.00 33.46  ? 282 ASN A CA  1 
ATOM   2183 C  C   . ASN A 1 302 ? -4.490  24.127 41.311  1.00 29.61  ? 282 ASN A C   1 
ATOM   2184 O  O   . ASN A 1 302 ? -4.736  23.094 40.679  1.00 30.62  ? 282 ASN A O   1 
ATOM   2185 C  CB  . ASN A 1 302 ? -4.650  22.710 43.423  1.00 35.32  ? 282 ASN A CB  1 
ATOM   2186 C  CG  . ASN A 1 302 ? -3.413  21.822 43.190  1.00 43.24  ? 282 ASN A CG  1 
ATOM   2187 O  OD1 . ASN A 1 302 ? -2.258  22.265 43.352  1.00 42.22  ? 282 ASN A OD1 1 
ATOM   2188 N  ND2 . ASN A 1 302 ? -3.654  20.572 42.783  1.00 46.42  ? 282 ASN A ND2 1 
ATOM   2189 N  N   . LEU A 1 303 ? -4.240  25.305 40.736  1.00 25.21  ? 283 LEU A N   1 
ATOM   2190 C  CA  . LEU A 1 303 ? -4.248  25.498 39.281  1.00 23.91  ? 283 LEU A CA  1 
ATOM   2191 C  C   . LEU A 1 303 ? -2.912  26.065 38.820  1.00 24.18  ? 283 LEU A C   1 
ATOM   2192 O  O   . LEU A 1 303 ? -2.304  26.932 39.474  1.00 24.95  ? 283 LEU A O   1 
ATOM   2193 C  CB  . LEU A 1 303 ? -5.377  26.431 38.828  1.00 22.78  ? 283 LEU A CB  1 
ATOM   2194 C  CG  . LEU A 1 303 ? -6.815  25.929 38.923  1.00 22.36  ? 283 LEU A CG  1 
ATOM   2195 C  CD1 . LEU A 1 303 ? -7.801  27.015 38.523  1.00 21.50  ? 283 LEU A CD1 1 
ATOM   2196 C  CD2 . LEU A 1 303 ? -6.994  24.702 38.060  1.00 21.93  ? 283 LEU A CD2 1 
ATOM   2197 N  N   . LEU A 1 304 ? -2.464  25.577 37.677  1.00 23.71  ? 284 LEU A N   1 
ATOM   2198 C  CA  . LEU A 1 304 ? -1.185  25.973 37.141  1.00 24.14  ? 284 LEU A CA  1 
ATOM   2199 C  C   . LEU A 1 304 ? -1.227  27.373 36.532  1.00 23.50  ? 284 LEU A C   1 
ATOM   2200 O  O   . LEU A 1 304 ? -0.262  28.133 36.652  1.00 30.54  ? 284 LEU A O   1 
ATOM   2201 C  CB  . LEU A 1 304 ? -0.779  24.952 36.105  1.00 24.00  ? 284 LEU A CB  1 
ATOM   2202 C  CG  . LEU A 1 304 ? 0.663   24.972 35.670  1.00 28.77  ? 284 LEU A CG  1 
ATOM   2203 C  CD1 . LEU A 1 304 ? 1.564   25.013 36.890  1.00 28.41  ? 284 LEU A CD1 1 
ATOM   2204 C  CD2 . LEU A 1 304 ? 0.864   23.711 34.871  1.00 31.02  ? 284 LEU A CD2 1 
ATOM   2205 N  N   . SER A 1 305 ? -2.352  27.714 35.903  1.00 22.27  ? 285 SER A N   1 
ATOM   2206 C  CA  . SER A 1 305 ? -2.474  28.959 35.163  1.00 21.94  ? 285 SER A CA  1 
ATOM   2207 C  C   . SER A 1 305 ? -3.889  29.186 34.644  1.00 20.53  ? 285 SER A C   1 
ATOM   2208 O  O   . SER A 1 305 ? -4.727  28.283 34.662  1.00 24.56  ? 285 SER A O   1 
ATOM   2209 C  CB  . SER A 1 305 ? -1.508  28.945 33.988  1.00 22.30  ? 285 SER A CB  1 
ATOM   2210 O  OG  . SER A 1 305 ? -1.742  30.025 33.119  1.00 21.23  ? 285 SER A OG  1 
ATOM   2211 N  N   . ILE A 1 306 ? -4.144  30.400 34.170  1.00 20.24  ? 286 ILE A N   1 
ATOM   2212 C  CA  . ILE A 1 306 ? -5.447  30.784 33.633  1.00 19.30  ? 286 ILE A CA  1 
ATOM   2213 C  C   . ILE A 1 306 ? -5.296  31.149 32.172  1.00 20.57  ? 286 ILE A C   1 
ATOM   2214 O  O   . ILE A 1 306 ? -4.542  32.064 31.843  1.00 28.66  ? 286 ILE A O   1 
ATOM   2215 C  CB  . ILE A 1 306 ? -5.993  32.031 34.359  1.00 19.70  ? 286 ILE A CB  1 
ATOM   2216 C  CG1 . ILE A 1 306 ? -6.326  31.698 35.814  1.00 20.79  ? 286 ILE A CG1 1 
ATOM   2217 C  CG2 . ILE A 1 306 ? -7.239  32.572 33.679  1.00 18.94  ? 286 ILE A CG2 1 
ATOM   2218 C  CD1 . ILE A 1 306 ? -6.859  32.876 36.565  1.00 23.56  ? 286 ILE A CD1 1 
ATOM   2219 N  N   . ILE A 1 307 ? -6.004  30.442 31.298  1.00 17.89  ? 287 ILE A N   1 
ATOM   2220 C  CA  . ILE A 1 307 ? -5.980  30.725 29.864  1.00 17.42  ? 287 ILE A CA  1 
ATOM   2221 C  C   . ILE A 1 307 ? -7.248  31.450 29.439  1.00 16.85  ? 287 ILE A C   1 
ATOM   2222 O  O   . ILE A 1 307 ? -8.360  31.031 29.764  1.00 18.59  ? 287 ILE A O   1 
ATOM   2223 C  CB  . ILE A 1 307 ? -5.903  29.427 29.060  1.00 17.04  ? 287 ILE A CB  1 
ATOM   2224 C  CG1 . ILE A 1 307 ? -4.666  28.652 29.476  1.00 17.79  ? 287 ILE A CG1 1 
ATOM   2225 C  CG2 . ILE A 1 307 ? -5.896  29.711 27.575  1.00 16.69  ? 287 ILE A CG2 1 
ATOM   2226 C  CD1 . ILE A 1 307 ? -4.750  27.203 29.112  1.00 17.68  ? 287 ILE A CD1 1 
ATOM   2227 N  N   . ARG A 1 308 ? -7.094  32.512 28.675  1.00 16.98  ? 288 ARG A N   1 
ATOM   2228 C  CA  . ARG A 1 308 ? -8.236  33.344 28.371  1.00 16.73  ? 288 ARG A CA  1 
ATOM   2229 C  C   . ARG A 1 308 ? -8.026  34.112 27.055  1.00 16.82  ? 288 ARG A C   1 
ATOM   2230 O  O   . ARG A 1 308 ? -7.058  33.851 26.349  1.00 17.00  ? 288 ARG A O   1 
ATOM   2231 C  CB  . ARG A 1 308 ? -8.428  34.286 29.535  1.00 17.38  ? 288 ARG A CB  1 
ATOM   2232 C  CG  . ARG A 1 308 ? -7.290  35.257 29.661  1.00 21.95  ? 288 ARG A CG  1 
ATOM   2233 C  CD  . ARG A 1 308 ? -7.871  36.582 29.882  1.00 18.92  ? 288 ARG A CD  1 
ATOM   2234 N  NE  . ARG A 1 308 ? -7.225  37.641 29.125  1.00 19.65  ? 288 ARG A NE  1 
ATOM   2235 C  CZ  . ARG A 1 308 ? -7.765  38.842 28.915  1.00 20.56  ? 288 ARG A CZ  1 
ATOM   2236 N  NH1 . ARG A 1 308 ? -8.975  39.150 29.395  1.00 20.20  ? 288 ARG A NH1 1 
ATOM   2237 N  NH2 . ARG A 1 308 ? -7.078  39.735 28.220  1.00 21.12  ? 288 ARG A NH2 1 
ATOM   2238 N  N   . ALA A 1 309 ? -8.914  35.042 26.708  1.00 16.87  ? 289 ALA A N   1 
ATOM   2239 C  CA  . ALA A 1 309 ? -8.849  35.631 25.377  1.00 17.02  ? 289 ALA A CA  1 
ATOM   2240 C  C   . ALA A 1 309 ? -9.158  37.112 25.428  1.00 17.82  ? 289 ALA A C   1 
ATOM   2241 O  O   . ALA A 1 309 ? -8.454  37.856 26.091  1.00 19.47  ? 289 ALA A O   1 
ATOM   2242 C  CB  . ALA A 1 309 ? -9.794  34.919 24.455  1.00 16.25  ? 289 ALA A CB  1 
ATOM   2243 N  N   . HIS A 1 310 ? -10.178 37.546 24.689  1.00 17.74  ? 290 HIS A N   1 
ATOM   2244 C  CA  . HIS A 1 310 ? -10.851 38.836 24.953  1.00 18.55  ? 290 HIS A CA  1 
ATOM   2245 C  C   . HIS A 1 310 ? -10.057 40.098 24.560  1.00 19.81  ? 290 HIS A C   1 
ATOM   2246 O  O   . HIS A 1 310 ? -10.645 41.138 24.243  1.00 20.60  ? 290 HIS A O   1 
ATOM   2247 C  CB  . HIS A 1 310 ? -11.242 38.888 26.432  1.00 20.19  ? 290 HIS A CB  1 
ATOM   2248 C  CG  . HIS A 1 310 ? -12.162 40.011 26.801  1.00 20.29  ? 290 HIS A CG  1 
ATOM   2249 N  ND1 . HIS A 1 310 ? -13.256 40.363 26.044  1.00 27.49  ? 290 HIS A ND1 1 
ATOM   2250 C  CD2 . HIS A 1 310 ? -12.182 40.810 27.891  1.00 20.48  ? 290 HIS A CD2 1 
ATOM   2251 C  CE1 . HIS A 1 310 ? -13.888 41.359 26.629  1.00 26.06  ? 290 HIS A CE1 1 
ATOM   2252 N  NE2 . HIS A 1 310 ? -13.270 41.645 27.760  1.00 21.14  ? 290 HIS A NE2 1 
ATOM   2253 N  N   . GLU A 1 311 ? -8.731  39.998 24.562  1.00 20.16  ? 291 GLU A N   1 
ATOM   2254 C  CA  . GLU A 1 311 ? -7.881  41.142 24.252  1.00 21.57  ? 291 GLU A CA  1 
ATOM   2255 C  C   . GLU A 1 311 ? -6.927  40.936 23.065  1.00 23.77  ? 291 GLU A C   1 
ATOM   2256 O  O   . GLU A 1 311 ? -6.110  40.000 23.073  1.00 25.40  ? 291 GLU A O   1 
ATOM   2257 C  CB  . GLU A 1 311 ? -7.050  41.510 25.468  1.00 22.37  ? 291 GLU A CB  1 
ATOM   2258 C  CG  . GLU A 1 311 ? -7.744  42.427 26.417  1.00 23.52  ? 291 GLU A CG  1 
ATOM   2259 C  CD  . GLU A 1 311 ? -6.823  42.886 27.521  1.00 24.58  ? 291 GLU A CD  1 
ATOM   2260 O  OE1 . GLU A 1 311 ? -6.112  42.028 28.100  1.00 23.89  ? 291 GLU A OE1 1 
ATOM   2261 O  OE2 . GLU A 1 311 ? -6.799  44.102 27.805  1.00 26.11  ? 291 GLU A OE2 1 
ATOM   2262 N  N   . ALA A 1 312 ? -7.003  41.838 22.080  1.00 24.34  ? 292 ALA A N   1 
ATOM   2263 C  CA  . ALA A 1 312 ? -6.149  41.780 20.887  1.00 23.30  ? 292 ALA A CA  1 
ATOM   2264 C  C   . ALA A 1 312 ? -4.641  41.765 21.221  1.00 24.15  ? 292 ALA A C   1 
ATOM   2265 O  O   . ALA A 1 312 ? -4.204  42.507 22.102  1.00 28.31  ? 292 ALA A O   1 
ATOM   2266 C  CB  . ALA A 1 312 ? -6.475  42.946 19.994  1.00 24.55  ? 292 ALA A CB  1 
ATOM   2267 N  N   . GLN A 1 313 ? -3.857  40.932 20.528  1.00 23.96  ? 293 GLN A N   1 
ATOM   2268 C  CA  . GLN A 1 313 ? -2.398  40.866 20.742  1.00 26.55  ? 293 GLN A CA  1 
ATOM   2269 C  C   . GLN A 1 313 ? -1.639  40.899 19.414  1.00 30.76  ? 293 GLN A C   1 
ATOM   2270 O  O   . GLN A 1 313 ? -1.994  40.193 18.485  1.00 29.70  ? 293 GLN A O   1 
ATOM   2271 C  CB  . GLN A 1 313 ? -1.991  39.595 21.504  1.00 24.25  ? 293 GLN A CB  1 
ATOM   2272 C  CG  . GLN A 1 313 ? -2.705  39.358 22.812  1.00 25.92  ? 293 GLN A CG  1 
ATOM   2273 C  CD  . GLN A 1 313 ? -2.254  40.303 23.899  1.00 26.22  ? 293 GLN A CD  1 
ATOM   2274 O  OE1 . GLN A 1 313 ? -1.058  40.514 24.094  1.00 30.11  ? 293 GLN A OE1 1 
ATOM   2275 N  NE2 . GLN A 1 313 ? -3.208  40.879 24.620  1.00 24.01  ? 293 GLN A NE2 1 
ATOM   2276 N  N   . ASP A 1 314 ? -0.578  41.694 19.328  1.00 34.15  ? 294 ASP A N   1 
ATOM   2277 C  CA  . ASP A 1 314 ? 0.199   41.767 18.091  1.00 30.93  ? 294 ASP A CA  1 
ATOM   2278 C  C   . ASP A 1 314 ? 0.729   40.393 17.645  1.00 28.48  ? 294 ASP A C   1 
ATOM   2279 O  O   . ASP A 1 314 ? 0.695   40.069 16.458  1.00 28.36  ? 294 ASP A O   1 
ATOM   2280 C  CB  . ASP A 1 314 ? 1.347   42.773 18.217  1.00 33.77  ? 294 ASP A CB  1 
ATOM   2281 C  CG  . ASP A 1 314 ? 1.763   43.356 16.873  1.00 47.46  ? 294 ASP A CG  1 
ATOM   2282 O  OD1 . ASP A 1 314 ? 0.871   43.720 16.072  1.00 53.67  ? 294 ASP A OD1 1 
ATOM   2283 O  OD2 . ASP A 1 314 ? 2.982   43.450 16.608  1.00 55.60  ? 294 ASP A OD2 1 
ATOM   2284 N  N   . ALA A 1 315 ? 1.200   39.588 18.598  1.00 27.57  ? 295 ALA A N   1 
ATOM   2285 C  CA  . ALA A 1 315 ? 1.670   38.233 18.313  1.00 27.00  ? 295 ALA A CA  1 
ATOM   2286 C  C   . ALA A 1 315 ? 0.543   37.170 18.291  1.00 25.05  ? 295 ALA A C   1 
ATOM   2287 O  O   . ALA A 1 315 ? 0.798   35.988 18.062  1.00 24.58  ? 295 ALA A O   1 
ATOM   2288 C  CB  . ALA A 1 315 ? 2.721   37.845 19.315  1.00 27.53  ? 295 ALA A CB  1 
ATOM   2289 N  N   . GLY A 1 316 ? -0.698  37.584 18.534  1.00 24.10  ? 296 GLY A N   1 
ATOM   2290 C  CA  . GLY A 1 316 ? -1.802  36.645 18.632  1.00 22.44  ? 296 GLY A CA  1 
ATOM   2291 C  C   . GLY A 1 316 ? -1.868  35.859 19.936  1.00 22.50  ? 296 GLY A C   1 
ATOM   2292 O  O   . GLY A 1 316 ? -2.741  35.008 20.113  1.00 20.34  ? 296 GLY A O   1 
ATOM   2293 N  N   . TYR A 1 317 ? -0.930  36.136 20.843  1.00 22.35  ? 297 TYR A N   1 
ATOM   2294 C  CA  . TYR A 1 317 ? -0.922  35.549 22.184  1.00 22.77  ? 297 TYR A CA  1 
ATOM   2295 C  C   . TYR A 1 317 ? -0.126  36.424 23.142  1.00 27.89  ? 297 TYR A C   1 
ATOM   2296 O  O   . TYR A 1 317 ? 0.659   37.262 22.720  1.00 27.91  ? 297 TYR A O   1 
ATOM   2297 C  CB  . TYR A 1 317 ? -0.324  34.136 22.172  1.00 22.77  ? 297 TYR A CB  1 
ATOM   2298 C  CG  . TYR A 1 317 ? 1.188   34.100 22.060  1.00 29.93  ? 297 TYR A CG  1 
ATOM   2299 C  CD1 . TYR A 1 317 ? 1.819   34.261 20.830  1.00 30.73  ? 297 TYR A CD1 1 
ATOM   2300 C  CD2 . TYR A 1 317 ? 1.986   33.900 23.182  1.00 29.71  ? 297 TYR A CD2 1 
ATOM   2301 C  CE1 . TYR A 1 317 ? 3.197   34.228 20.725  1.00 29.50  ? 297 TYR A CE1 1 
ATOM   2302 C  CE2 . TYR A 1 317 ? 3.369   33.869 23.082  1.00 31.63  ? 297 TYR A CE2 1 
ATOM   2303 C  CZ  . TYR A 1 317 ? 3.969   34.032 21.853  1.00 31.69  ? 297 TYR A CZ  1 
ATOM   2304 O  OH  . TYR A 1 317 ? 5.342   34.000 21.748  1.00 31.30  ? 297 TYR A OH  1 
ATOM   2305 N  N   . ARG A 1 318 ? -0.337  36.233 24.439  1.00 22.62  ? 298 ARG A N   1 
ATOM   2306 C  CA  . ARG A 1 318 ? 0.548   36.826 25.427  1.00 23.84  ? 298 ARG A CA  1 
ATOM   2307 C  C   . ARG A 1 318 ? 0.768   35.930 26.640  1.00 23.58  ? 298 ARG A C   1 
ATOM   2308 O  O   . ARG A 1 318 ? -0.173  35.363 27.186  1.00 24.49  ? 298 ARG A O   1 
ATOM   2309 C  CB  . ARG A 1 318 ? 0.056   38.196 25.855  1.00 24.39  ? 298 ARG A CB  1 
ATOM   2310 C  CG  . ARG A 1 318 ? 0.936   38.795 26.916  1.00 25.78  ? 298 ARG A CG  1 
ATOM   2311 C  CD  . ARG A 1 318 ? 0.763   40.294 27.063  1.00 26.93  ? 298 ARG A CD  1 
ATOM   2312 N  NE  . ARG A 1 318 ? 1.568   40.752 28.197  1.00 34.91  ? 298 ARG A NE  1 
ATOM   2313 C  CZ  . ARG A 1 318 ? 1.466   41.953 28.757  1.00 37.45  ? 298 ARG A CZ  1 
ATOM   2314 N  NH1 . ARG A 1 318 ? 0.591   42.838 28.284  1.00 38.17  ? 298 ARG A NH1 1 
ATOM   2315 N  NH2 . ARG A 1 318 ? 2.238   42.266 29.795  1.00 37.33  ? 298 ARG A NH2 1 
ATOM   2316 N  N   . MET A 1 319 ? 2.028   35.800 27.044  1.00 24.78  ? 299 MET A N   1 
ATOM   2317 C  CA  . MET A 1 319 ? 2.400   35.012 28.218  1.00 24.90  ? 299 MET A CA  1 
ATOM   2318 C  C   . MET A 1 319 ? 2.758   35.971 29.319  1.00 26.04  ? 299 MET A C   1 
ATOM   2319 O  O   . MET A 1 319 ? 3.751   36.681 29.218  1.00 30.99  ? 299 MET A O   1 
ATOM   2320 C  CB  . MET A 1 319 ? 3.627   34.159 27.916  1.00 25.75  ? 299 MET A CB  1 
ATOM   2321 C  CG  . MET A 1 319 ? 3.444   33.140 26.833  1.00 24.96  ? 299 MET A CG  1 
ATOM   2322 S  SD  . MET A 1 319 ? 2.391   31.856 27.435  1.00 31.81  ? 299 MET A SD  1 
ATOM   2323 C  CE  . MET A 1 319 ? 2.178   30.852 25.981  1.00 39.89  ? 299 MET A CE  1 
ATOM   2324 N  N   . TYR A 1 320 ? 1.967   36.012 30.378  1.00 25.53  ? 300 TYR A N   1 
ATOM   2325 C  CA  . TYR A 1 320 ? 2.227   37.007 31.410  1.00 26.74  ? 300 TYR A CA  1 
ATOM   2326 C  C   . TYR A 1 320 ? 3.219   36.493 32.444  1.00 27.80  ? 300 TYR A C   1 
ATOM   2327 O  O   . TYR A 1 320 ? 3.636   35.344 32.380  1.00 27.56  ? 300 TYR A O   1 
ATOM   2328 C  CB  . TYR A 1 320 ? 0.935   37.475 32.059  1.00 26.04  ? 300 TYR A CB  1 
ATOM   2329 C  CG  . TYR A 1 320 ? -0.065  38.112 31.118  1.00 25.27  ? 300 TYR A CG  1 
ATOM   2330 C  CD1 . TYR A 1 320 ? -0.813  37.341 30.248  1.00 23.81  ? 300 TYR A CD1 1 
ATOM   2331 C  CD2 . TYR A 1 320 ? -0.285  39.482 31.135  1.00 26.17  ? 300 TYR A CD2 1 
ATOM   2332 C  CE1 . TYR A 1 320 ? -1.739  37.924 29.395  1.00 23.25  ? 300 TYR A CE1 1 
ATOM   2333 C  CE2 . TYR A 1 320 ? -1.206  40.075 30.305  1.00 25.67  ? 300 TYR A CE2 1 
ATOM   2334 C  CZ  . TYR A 1 320 ? -1.932  39.292 29.436  1.00 24.18  ? 300 TYR A CZ  1 
ATOM   2335 O  OH  . TYR A 1 320 ? -2.858  39.873 28.603  1.00 23.80  ? 300 TYR A OH  1 
ATOM   2336 N  N   . ARG A 1 321 ? 3.597   37.361 33.378  1.00 29.16  ? 301 ARG A N   1 
ATOM   2337 C  CA  . ARG A 1 321 ? 4.602   37.061 34.404  1.00 30.53  ? 301 ARG A CA  1 
ATOM   2338 C  C   . ARG A 1 321 ? 4.446   35.665 34.978  1.00 29.79  ? 301 ARG A C   1 
ATOM   2339 O  O   . ARG A 1 321 ? 3.334   35.268 35.315  1.00 29.53  ? 301 ARG A O   1 
ATOM   2340 C  CB  . ARG A 1 321 ? 4.551   38.112 35.526  1.00 31.77  ? 301 ARG A CB  1 
ATOM   2341 C  CG  . ARG A 1 321 ? 5.339   37.716 36.768  1.00 35.65  ? 301 ARG A CG  1 
ATOM   2342 C  CD  . ARG A 1 321 ? 5.402   38.803 37.852  1.00 43.41  ? 301 ARG A CD  1 
ATOM   2343 N  NE  . ARG A 1 321 ? 5.972   38.257 39.085  1.00 48.98  ? 301 ARG A NE  1 
ATOM   2344 C  CZ  . ARG A 1 321 ? 5.990   38.882 40.258  1.00 47.42  ? 301 ARG A CZ  1 
ATOM   2345 N  NH1 . ARG A 1 321 ? 5.469   40.100 40.385  1.00 42.24  ? 301 ARG A NH1 1 
ATOM   2346 N  NH2 . ARG A 1 321 ? 6.531   38.278 41.311  1.00 48.09  ? 301 ARG A NH2 1 
ATOM   2347 N  N   . LYS A 1 322 ? 5.552   34.914 35.042  1.00 34.29  ? 302 LYS A N   1 
ATOM   2348 C  CA  . LYS A 1 322 ? 5.548   33.549 35.584  1.00 30.37  ? 302 LYS A CA  1 
ATOM   2349 C  C   . LYS A 1 322 ? 5.345   33.632 37.077  1.00 35.49  ? 302 LYS A C   1 
ATOM   2350 O  O   . LYS A 1 322 ? 5.701   34.626 37.694  1.00 39.26  ? 302 LYS A O   1 
ATOM   2351 C  CB  . LYS A 1 322 ? 6.877   32.831 35.333  1.00 31.95  ? 302 LYS A CB  1 
ATOM   2352 C  CG  . LYS A 1 322 ? 7.499   33.039 33.956  1.00 35.17  ? 302 LYS A CG  1 
ATOM   2353 C  CD  . LYS A 1 322 ? 8.459   31.896 33.637  1.00 40.76  ? 302 LYS A CD  1 
ATOM   2354 C  CE  . LYS A 1 322 ? 9.031   31.999 32.222  1.00 48.52  ? 302 LYS A CE  1 
ATOM   2355 N  NZ  . LYS A 1 322 ? 10.181  32.966 32.123  1.00 54.69  ? 302 LYS A NZ  1 
ATOM   2356 N  N   . SER A 1 323 ? 4.777   32.597 37.671  1.00 30.54  ? 303 SER A N   1 
ATOM   2357 C  CA  . SER A 1 323 ? 4.629   32.601 39.111  1.00 33.36  ? 303 SER A CA  1 
ATOM   2358 C  C   . SER A 1 323 ? 5.846   31.958 39.764  1.00 38.39  ? 303 SER A C   1 
ATOM   2359 O  O   . SER A 1 323 ? 6.325   30.921 39.301  1.00 40.43  ? 303 SER A O   1 
ATOM   2360 C  CB  . SER A 1 323 ? 3.312   31.933 39.546  1.00 38.00  ? 303 SER A CB  1 
ATOM   2361 O  OG  . SER A 1 323 ? 3.194   30.610 39.055  1.00 39.84  ? 303 SER A OG  1 
ATOM   2362 N  N   . GLN A 1 324 ? 6.339   32.589 40.832  1.00 45.28  ? 304 GLN A N   1 
ATOM   2363 C  CA  . GLN A 1 324 ? 7.541   32.145 41.548  1.00 47.84  ? 304 GLN A CA  1 
ATOM   2364 C  C   . GLN A 1 324 ? 7.511   30.664 41.942  1.00 47.00  ? 304 GLN A C   1 
ATOM   2365 O  O   . GLN A 1 324 ? 8.472   29.924 41.708  1.00 47.30  ? 304 GLN A O   1 
ATOM   2366 C  CB  . GLN A 1 324 ? 7.726   32.988 42.803  1.00 50.09  ? 304 GLN A CB  1 
ATOM   2367 C  CG  . GLN A 1 324 ? 7.612   34.473 42.568  1.00 52.97  ? 304 GLN A CG  1 
ATOM   2368 C  CD  . GLN A 1 324 ? 8.960   35.141 42.491  1.00 55.52  ? 304 GLN A CD  1 
ATOM   2369 O  OE1 . GLN A 1 324 ? 9.956   34.530 42.084  1.00 51.52  ? 304 GLN A OE1 1 
ATOM   2370 N  NE2 . GLN A 1 324 ? 9.008   36.404 42.900  1.00 57.99  ? 304 GLN A NE2 1 
ATOM   2371 N  N   . THR A 1 325 ? 6.402   30.258 42.557  1.00 46.46  ? 305 THR A N   1 
ATOM   2372 C  CA  . THR A 1 325 ? 6.126   28.864 42.882  1.00 46.54  ? 305 THR A CA  1 
ATOM   2373 C  C   . THR A 1 325 ? 6.427   27.883 41.742  1.00 47.35  ? 305 THR A C   1 
ATOM   2374 O  O   . THR A 1 325 ? 7.178   26.931 41.929  1.00 48.41  ? 305 THR A O   1 
ATOM   2375 C  CB  . THR A 1 325 ? 4.647   28.707 43.256  1.00 48.49  ? 305 THR A CB  1 
ATOM   2376 O  OG1 . THR A 1 325 ? 4.352   29.545 44.378  1.00 50.71  ? 305 THR A OG1 1 
ATOM   2377 C  CG2 . THR A 1 325 ? 4.314   27.257 43.589  1.00 49.98  ? 305 THR A CG2 1 
ATOM   2378 N  N   . THR A 1 326 ? 5.849   28.110 40.561  1.00 40.46  ? 306 THR A N   1 
ATOM   2379 C  CA  . THR A 1 326 ? 5.885   27.088 39.502  1.00 36.67  ? 306 THR A CA  1 
ATOM   2380 C  C   . THR A 1 326 ? 6.846   27.329 38.344  1.00 37.15  ? 306 THR A C   1 
ATOM   2381 O  O   . THR A 1 326 ? 7.253   26.379 37.673  1.00 42.05  ? 306 THR A O   1 
ATOM   2382 C  CB  . THR A 1 326 ? 4.482   26.807 38.901  1.00 33.62  ? 306 THR A CB  1 
ATOM   2383 O  OG1 . THR A 1 326 ? 4.025   27.944 38.154  1.00 34.04  ? 306 THR A OG1 1 
ATOM   2384 C  CG2 . THR A 1 326 ? 3.493   26.496 39.999  1.00 30.49  ? 306 THR A CG2 1 
ATOM   2385 N  N   . GLY A 1 327 ? 7.198   28.585 38.090  1.00 38.20  ? 307 GLY A N   1 
ATOM   2386 C  CA  . GLY A 1 327 ? 8.015   28.904 36.930  1.00 37.67  ? 307 GLY A CA  1 
ATOM   2387 C  C   . GLY A 1 327 ? 7.204   28.915 35.638  1.00 37.90  ? 307 GLY A C   1 
ATOM   2388 O  O   . GLY A 1 327 ? 7.757   29.002 34.533  1.00 44.05  ? 307 GLY A O   1 
ATOM   2389 N  N   . PHE A 1 328 ? 5.884   28.832 35.781  1.00 31.47  ? 308 PHE A N   1 
ATOM   2390 C  CA  . PHE A 1 328 ? 4.974   28.816 34.644  1.00 28.18  ? 308 PHE A CA  1 
ATOM   2391 C  C   . PHE A 1 328 ? 4.153   30.119 34.577  1.00 27.35  ? 308 PHE A C   1 
ATOM   2392 O  O   . PHE A 1 328 ? 3.720   30.625 35.603  1.00 30.18  ? 308 PHE A O   1 
ATOM   2393 C  CB  . PHE A 1 328 ? 4.053   27.600 34.755  1.00 27.23  ? 308 PHE A CB  1 
ATOM   2394 C  CG  . PHE A 1 328 ? 3.363   27.261 33.484  1.00 27.77  ? 308 PHE A CG  1 
ATOM   2395 C  CD1 . PHE A 1 328 ? 2.181   27.893 33.128  1.00 28.72  ? 308 PHE A CD1 1 
ATOM   2396 C  CD2 . PHE A 1 328 ? 3.906   26.335 32.626  1.00 26.19  ? 308 PHE A CD2 1 
ATOM   2397 C  CE1 . PHE A 1 328 ? 1.557   27.599 31.935  1.00 24.55  ? 308 PHE A CE1 1 
ATOM   2398 C  CE2 . PHE A 1 328 ? 3.291   26.037 31.449  1.00 25.11  ? 308 PHE A CE2 1 
ATOM   2399 C  CZ  . PHE A 1 328 ? 2.113   26.671 31.098  1.00 24.83  ? 308 PHE A CZ  1 
ATOM   2400 N  N   . PRO A 1 329 ? 3.952   30.677 33.369  1.00 26.64  ? 309 PRO A N   1 
ATOM   2401 C  CA  . PRO A 1 329 ? 3.133   31.889 33.191  1.00 25.96  ? 309 PRO A CA  1 
ATOM   2402 C  C   . PRO A 1 329 ? 1.821   31.806 33.969  1.00 25.19  ? 309 PRO A C   1 
ATOM   2403 O  O   . PRO A 1 329 ? 1.084   30.830 33.797  1.00 24.00  ? 309 PRO A O   1 
ATOM   2404 C  CB  . PRO A 1 329 ? 2.796   31.859 31.705  1.00 25.01  ? 309 PRO A CB  1 
ATOM   2405 C  CG  . PRO A 1 329 ? 3.898   31.134 31.084  1.00 25.78  ? 309 PRO A CG  1 
ATOM   2406 C  CD  . PRO A 1 329 ? 4.415   30.138 32.081  1.00 26.53  ? 309 PRO A CD  1 
ATOM   2407 N  N   . SER A 1 330 ? 1.537   32.792 34.814  1.00 25.45  ? 310 SER A N   1 
ATOM   2408 C  CA  . SER A 1 330 ? 0.294   32.780 35.579  1.00 24.76  ? 310 SER A CA  1 
ATOM   2409 C  C   . SER A 1 330 ? -0.919  32.983 34.686  1.00 23.34  ? 310 SER A C   1 
ATOM   2410 O  O   . SER A 1 330 ? -1.983  32.457 34.960  1.00 22.52  ? 310 SER A O   1 
ATOM   2411 C  CB  . SER A 1 330 ? 0.307   33.867 36.640  1.00 25.80  ? 310 SER A CB  1 
ATOM   2412 O  OG  . SER A 1 330 ? 0.600   35.116 36.046  1.00 26.26  ? 310 SER A OG  1 
ATOM   2413 N  N   . LEU A 1 331 ? -0.761  33.755 33.622  1.00 23.21  ? 311 LEU A N   1 
ATOM   2414 C  CA  . LEU A 1 331 ? -1.880  34.106 32.776  1.00 22.10  ? 311 LEU A CA  1 
ATOM   2415 C  C   . LEU A 1 331 ? -1.480  33.972 31.319  1.00 21.76  ? 311 LEU A C   1 
ATOM   2416 O  O   . LEU A 1 331 ? -0.332  34.222 30.962  1.00 22.67  ? 311 LEU A O   1 
ATOM   2417 C  CB  . LEU A 1 331 ? -2.329  35.545 33.069  1.00 22.61  ? 311 LEU A CB  1 
ATOM   2418 C  CG  . LEU A 1 331 ? -3.621  36.039 32.404  1.00 21.72  ? 311 LEU A CG  1 
ATOM   2419 C  CD1 . LEU A 1 331 ? -4.871  35.419 33.022  1.00 20.91  ? 311 LEU A CD1 1 
ATOM   2420 C  CD2 . LEU A 1 331 ? -3.715  37.546 32.429  1.00 22.62  ? 311 LEU A CD2 1 
ATOM   2421 N  N   . ILE A 1 332 ? -2.429  33.566 30.479  1.00 23.86  ? 312 ILE A N   1 
ATOM   2422 C  CA  . ILE A 1 332 ? -2.212  33.525 29.032  1.00 21.21  ? 312 ILE A CA  1 
ATOM   2423 C  C   . ILE A 1 332 ? -3.376  34.151 28.289  1.00 19.57  ? 312 ILE A C   1 
ATOM   2424 O  O   . ILE A 1 332 ? -4.522  33.805 28.531  1.00 20.15  ? 312 ILE A O   1 
ATOM   2425 C  CB  . ILE A 1 332 ? -2.031  32.089 28.511  1.00 19.82  ? 312 ILE A CB  1 
ATOM   2426 C  CG1 . ILE A 1 332 ? -0.905  31.395 29.271  1.00 20.71  ? 312 ILE A CG1 1 
ATOM   2427 C  CG2 . ILE A 1 332 ? -1.703  32.115 27.047  1.00 19.79  ? 312 ILE A CG2 1 
ATOM   2428 C  CD1 . ILE A 1 332 ? -0.744  29.964 28.917  1.00 20.48  ? 312 ILE A CD1 1 
ATOM   2429 N  N   . THR A 1 333 ? -3.083  35.102 27.412  1.00 20.06  ? 313 THR A N   1 
ATOM   2430 C  CA  . THR A 1 333 ? -4.076  35.560 26.461  1.00 19.49  ? 313 THR A CA  1 
ATOM   2431 C  C   . THR A 1 333 ? -3.821  34.833 25.158  1.00 19.24  ? 313 THR A C   1 
ATOM   2432 O  O   . THR A 1 333 ? -2.686  34.700 24.725  1.00 22.87  ? 313 THR A O   1 
ATOM   2433 C  CB  . THR A 1 333 ? -4.029  37.084 26.229  1.00 20.43  ? 313 THR A CB  1 
ATOM   2434 O  OG1 . THR A 1 333 ? -4.454  37.756 27.421  1.00 20.81  ? 313 THR A OG1 1 
ATOM   2435 C  CG2 . THR A 1 333 ? -4.957  37.492 25.082  1.00 20.03  ? 313 THR A CG2 1 
ATOM   2436 N  N   . ILE A 1 334 ? -4.886  34.334 24.552  1.00 20.36  ? 314 ILE A N   1 
ATOM   2437 C  CA  . ILE A 1 334 ? -4.814  33.740 23.234  1.00 17.95  ? 314 ILE A CA  1 
ATOM   2438 C  C   . ILE A 1 334 ? -5.855  34.431 22.335  1.00 18.26  ? 314 ILE A C   1 
ATOM   2439 O  O   . ILE A 1 334 ? -7.024  34.551 22.696  1.00 18.22  ? 314 ILE A O   1 
ATOM   2440 C  CB  . ILE A 1 334 ? -4.984  32.200 23.309  1.00 22.22  ? 314 ILE A CB  1 
ATOM   2441 C  CG1 . ILE A 1 334 ? -4.961  31.590 21.922  1.00 27.77  ? 314 ILE A CG1 1 
ATOM   2442 C  CG2 . ILE A 1 334 ? -6.264  31.814 23.999  1.00 22.33  ? 314 ILE A CG2 1 
ATOM   2443 C  CD1 . ILE A 1 334 ? -3.566  31.384 21.408  1.00 38.16  ? 314 ILE A CD1 1 
ATOM   2444 N  N   . PHE A 1 335 ? -5.409  34.929 21.184  1.00 18.31  ? 315 PHE A N   1 
ATOM   2445 C  CA  . PHE A 1 335 ? -6.240  35.743 20.290  1.00 18.42  ? 315 PHE A CA  1 
ATOM   2446 C  C   . PHE A 1 335 ? -6.211  35.192 18.850  1.00 18.42  ? 315 PHE A C   1 
ATOM   2447 O  O   . PHE A 1 335 ? -5.158  35.156 18.218  1.00 19.19  ? 315 PHE A O   1 
ATOM   2448 C  CB  . PHE A 1 335 ? -5.770  37.199 20.328  1.00 19.62  ? 315 PHE A CB  1 
ATOM   2449 C  CG  . PHE A 1 335 ? -6.745  38.150 19.728  1.00 19.89  ? 315 PHE A CG  1 
ATOM   2450 C  CD1 . PHE A 1 335 ? -7.980  38.360 20.317  1.00 19.34  ? 315 PHE A CD1 1 
ATOM   2451 C  CD2 . PHE A 1 335 ? -6.448  38.818 18.553  1.00 20.97  ? 315 PHE A CD2 1 
ATOM   2452 C  CE1 . PHE A 1 335 ? -8.908  39.244 19.743  1.00 20.11  ? 315 PHE A CE1 1 
ATOM   2453 C  CE2 . PHE A 1 335 ? -7.367  39.698 17.978  1.00 21.29  ? 315 PHE A CE2 1 
ATOM   2454 C  CZ  . PHE A 1 335 ? -8.591  39.909 18.571  1.00 20.75  ? 315 PHE A CZ  1 
ATOM   2455 N  N   . SER A 1 336 ? -7.361  34.770 18.327  1.00 17.72  ? 316 SER A N   1 
ATOM   2456 C  CA  . SER A 1 336 ? -7.378  33.980 17.099  1.00 17.67  ? 316 SER A CA  1 
ATOM   2457 C  C   . SER A 1 336 ? -7.932  34.683 15.856  1.00 18.19  ? 316 SER A C   1 
ATOM   2458 O  O   . SER A 1 336 ? -8.315  34.019 14.891  1.00 18.07  ? 316 SER A O   1 
ATOM   2459 C  CB  . SER A 1 336 ? -8.121  32.669 17.334  1.00 16.71  ? 316 SER A CB  1 
ATOM   2460 O  OG  . SER A 1 336 ? -7.514  31.929 18.371  1.00 17.91  ? 316 SER A OG  1 
ATOM   2461 N  N   . ALA A 1 337 ? -7.969  36.013 15.874  1.00 18.92  ? 317 ALA A N   1 
ATOM   2462 C  CA  . ALA A 1 337 ? -8.444  36.789 14.734  1.00 19.67  ? 317 ALA A CA  1 
ATOM   2463 C  C   . ALA A 1 337 ? -7.316  37.658 14.198  1.00 21.10  ? 317 ALA A C   1 
ATOM   2464 O  O   . ALA A 1 337 ? -7.024  38.718 14.766  1.00 21.82  ? 317 ALA A O   1 
ATOM   2465 C  CB  . ALA A 1 337 ? -9.614  37.645 15.140  1.00 19.62  ? 317 ALA A CB  1 
ATOM   2466 N  N   . PRO A 1 338 ? -6.676  37.236 13.093  1.00 21.69  ? 318 PRO A N   1 
ATOM   2467 C  CA  . PRO A 1 338 ? -5.502  37.958 12.581  1.00 23.24  ? 318 PRO A CA  1 
ATOM   2468 C  C   . PRO A 1 338 ? -5.918  39.198 11.805  1.00 24.47  ? 318 PRO A C   1 
ATOM   2469 O  O   . PRO A 1 338 ? -7.022  39.221 11.253  1.00 26.83  ? 318 PRO A O   1 
ATOM   2470 C  CB  . PRO A 1 338 ? -4.863  36.940 11.639  1.00 23.47  ? 318 PRO A CB  1 
ATOM   2471 C  CG  . PRO A 1 338 ? -6.018  36.185 11.109  1.00 22.53  ? 318 PRO A CG  1 
ATOM   2472 C  CD  . PRO A 1 338 ? -7.070  36.136 12.199  1.00 21.22  ? 318 PRO A CD  1 
ATOM   2473 N  N   . ASN A 1 339 ? -5.044  40.201 11.752  1.00 26.00  ? 319 ASN A N   1 
ATOM   2474 C  CA  . ASN A 1 339 ? -5.369  41.479 11.128  1.00 27.46  ? 319 ASN A CA  1 
ATOM   2475 C  C   . ASN A 1 339 ? -6.729  41.996 11.545  1.00 26.89  ? 319 ASN A C   1 
ATOM   2476 O  O   . ASN A 1 339 ? -7.572  42.293 10.718  1.00 27.27  ? 319 ASN A O   1 
ATOM   2477 C  CB  . ASN A 1 339 ? -5.294  41.402 9.611   1.00 28.49  ? 319 ASN A CB  1 
ATOM   2478 C  CG  . ASN A 1 339 ? -5.417  42.775 8.968   1.00 30.41  ? 319 ASN A CG  1 
ATOM   2479 O  OD1 . ASN A 1 339 ? -5.029  43.791 9.559   1.00 33.18  ? 319 ASN A OD1 1 
ATOM   2480 N  ND2 . ASN A 1 339 ? -5.983  42.820 7.775   1.00 31.04  ? 319 ASN A ND2 1 
ATOM   2481 N  N   . TYR A 1 340 ? -6.929  42.087 12.848  1.00 26.10  ? 320 TYR A N   1 
ATOM   2482 C  CA  . TYR A 1 340 ? -8.235  42.395 13.411  1.00 28.34  ? 320 TYR A CA  1 
ATOM   2483 C  C   . TYR A 1 340 ? -8.833  43.672 12.799  1.00 28.57  ? 320 TYR A C   1 
ATOM   2484 O  O   . TYR A 1 340 ? -8.147  44.688 12.676  1.00 31.46  ? 320 TYR A O   1 
ATOM   2485 C  CB  . TYR A 1 340 ? -8.089  42.494 14.927  1.00 27.83  ? 320 TYR A CB  1 
ATOM   2486 C  CG  . TYR A 1 340 ? -9.358  42.760 15.715  1.00 24.28  ? 320 TYR A CG  1 
ATOM   2487 C  CD1 . TYR A 1 340 ? -10.536 42.069 15.456  1.00 23.19  ? 320 TYR A CD1 1 
ATOM   2488 C  CD2 . TYR A 1 340 ? -9.351  43.681 16.755  1.00 24.96  ? 320 TYR A CD2 1 
ATOM   2489 C  CE1 . TYR A 1 340 ? -11.676 42.315 16.177  1.00 23.50  ? 320 TYR A CE1 1 
ATOM   2490 C  CE2 . TYR A 1 340 ? -10.471 43.928 17.492  1.00 24.61  ? 320 TYR A CE2 1 
ATOM   2491 C  CZ  . TYR A 1 340 ? -11.639 43.244 17.204  1.00 26.99  ? 320 TYR A CZ  1 
ATOM   2492 O  OH  . TYR A 1 340 ? -12.769 43.496 17.972  1.00 31.87  ? 320 TYR A OH  1 
ATOM   2493 N  N   . LEU A 1 341 ? -10.090 43.585 12.358  1.00 26.60  ? 321 LEU A N   1 
ATOM   2494 C  CA  . LEU A 1 341 ? -10.806 44.715 11.759  1.00 30.03  ? 321 LEU A CA  1 
ATOM   2495 C  C   . LEU A 1 341 ? -10.138 45.218 10.483  1.00 35.13  ? 321 LEU A C   1 
ATOM   2496 O  O   . LEU A 1 341 ? -10.323 46.371 10.091  1.00 33.57  ? 321 LEU A O   1 
ATOM   2497 C  CB  . LEU A 1 341 ? -10.892 45.868 12.751  1.00 31.32  ? 321 LEU A CB  1 
ATOM   2498 C  CG  . LEU A 1 341 ? -11.554 45.559 14.083  1.00 29.46  ? 321 LEU A CG  1 
ATOM   2499 C  CD1 . LEU A 1 341 ? -11.463 46.769 14.994  1.00 29.00  ? 321 LEU A CD1 1 
ATOM   2500 C  CD2 . LEU A 1 341 ? -12.994 45.149 13.832  1.00 30.18  ? 321 LEU A CD2 1 
ATOM   2501 N  N   . ASP A 1 342 ? -9.342  44.348 9.864   1.00 35.64  ? 322 ASP A N   1 
ATOM   2502 C  CA  . ASP A 1 342 ? -8.576  44.674 8.664   1.00 35.86  ? 322 ASP A CA  1 
ATOM   2503 C  C   . ASP A 1 342 ? -7.545  45.776 8.866   1.00 38.28  ? 322 ASP A C   1 
ATOM   2504 O  O   . ASP A 1 342 ? -6.931  46.227 7.911   1.00 38.41  ? 322 ASP A O   1 
ATOM   2505 C  CB  . ASP A 1 342 ? -9.505  45.011 7.493   1.00 32.05  ? 322 ASP A CB  1 
ATOM   2506 C  CG  . ASP A 1 342 ? -10.295 43.810 7.031   1.00 36.76  ? 322 ASP A CG  1 
ATOM   2507 O  OD1 . ASP A 1 342 ? -9.670  42.726 6.892   1.00 40.05  ? 322 ASP A OD1 1 
ATOM   2508 O  OD2 . ASP A 1 342 ? -11.530 43.937 6.831   1.00 34.73  ? 322 ASP A OD2 1 
ATOM   2509 N  N   . VAL A 1 343 ? -7.330  46.210 10.097  1.00 35.21  ? 323 VAL A N   1 
ATOM   2510 C  CA  . VAL A 1 343 ? -6.444  47.348 10.286  1.00 36.78  ? 323 VAL A CA  1 
ATOM   2511 C  C   . VAL A 1 343 ? -5.306  47.168 11.292  1.00 35.03  ? 323 VAL A C   1 
ATOM   2512 O  O   . VAL A 1 343 ? -4.349  47.925 11.258  1.00 38.83  ? 323 VAL A O   1 
ATOM   2513 C  CB  . VAL A 1 343 ? -7.239  48.639 10.615  1.00 37.85  ? 323 VAL A CB  1 
ATOM   2514 C  CG1 . VAL A 1 343 ? -8.381  48.850 9.602   1.00 36.58  ? 323 VAL A CG1 1 
ATOM   2515 C  CG2 . VAL A 1 343 ? -7.765  48.615 12.053  1.00 34.85  ? 323 VAL A CG2 1 
ATOM   2516 N  N   . TYR A 1 344 ? -5.401  46.167 12.166  1.00 33.53  ? 324 TYR A N   1 
ATOM   2517 C  CA  . TYR A 1 344 ? -4.387  45.956 13.194  1.00 36.28  ? 324 TYR A CA  1 
ATOM   2518 C  C   . TYR A 1 344 ? -3.085  45.310 12.710  1.00 36.79  ? 324 TYR A C   1 
ATOM   2519 O  O   . TYR A 1 344 ? -2.049  45.441 13.373  1.00 38.00  ? 324 TYR A O   1 
ATOM   2520 C  CB  . TYR A 1 344 ? -4.929  45.071 14.304  1.00 36.23  ? 324 TYR A CB  1 
ATOM   2521 C  CG  . TYR A 1 344 ? -5.731  45.747 15.386  1.00 39.35  ? 324 TYR A CG  1 
ATOM   2522 C  CD1 . TYR A 1 344 ? -6.938  46.371 15.101  1.00 38.13  ? 324 TYR A CD1 1 
ATOM   2523 C  CD2 . TYR A 1 344 ? -5.314  45.701 16.711  1.00 40.13  ? 324 TYR A CD2 1 
ATOM   2524 C  CE1 . TYR A 1 344 ? -7.703  46.956 16.106  1.00 38.74  ? 324 TYR A CE1 1 
ATOM   2525 C  CE2 . TYR A 1 344 ? -6.066  46.286 17.724  1.00 39.16  ? 324 TYR A CE2 1 
ATOM   2526 C  CZ  . TYR A 1 344 ? -7.263  46.912 17.417  1.00 40.24  ? 324 TYR A CZ  1 
ATOM   2527 O  OH  . TYR A 1 344 ? -8.019  47.498 18.419  1.00 39.64  ? 324 TYR A OH  1 
ATOM   2528 N  N   . ASN A 1 345 ? -3.142  44.574 11.600  1.00 38.54  ? 325 ASN A N   1 
ATOM   2529 C  CA  . ASN A 1 345 ? -1.959  43.869 11.093  1.00 38.35  ? 325 ASN A CA  1 
ATOM   2530 C  C   . ASN A 1 345 ? -1.316  42.942 12.133  1.00 39.23  ? 325 ASN A C   1 
ATOM   2531 O  O   . ASN A 1 345 ? -0.105  42.754 12.138  1.00 43.72  ? 325 ASN A O   1 
ATOM   2532 C  CB  . ASN A 1 345 ? -0.925  44.880 10.563  1.00 36.13  ? 325 ASN A CB  1 
ATOM   2533 C  CG  . ASN A 1 345 ? 0.068   44.257 9.580   1.00 37.28  ? 325 ASN A CG  1 
ATOM   2534 O  OD1 . ASN A 1 345 ? -0.291  43.962 8.419   1.00 37.56  ? 325 ASN A OD1 1 
ATOM   2535 N  ND2 . ASN A 1 345 ? 1.328   44.083 10.021  1.00 38.15  ? 325 ASN A ND2 1 
ATOM   2536 N  N   . ASN A 1 346 ? -2.138  42.376 13.017  1.00 30.16  ? 326 ASN A N   1 
ATOM   2537 C  CA  . ASN A 1 346 ? -1.669  41.450 14.057  1.00 28.57  ? 326 ASN A CA  1 
ATOM   2538 C  C   . ASN A 1 346 ? -1.688  40.005 13.603  1.00 27.36  ? 326 ASN A C   1 
ATOM   2539 O  O   . ASN A 1 346 ? -2.545  39.605 12.815  1.00 26.70  ? 326 ASN A O   1 
ATOM   2540 C  CB  . ASN A 1 346 ? -2.542  41.565 15.304  1.00 27.32  ? 326 ASN A CB  1 
ATOM   2541 C  CG  . ASN A 1 346 ? -3.932  41.001 15.089  1.00 25.75  ? 326 ASN A CG  1 
ATOM   2542 O  OD1 . ASN A 1 346 ? -4.770  41.617 14.411  1.00 26.12  ? 326 ASN A OD1 1 
ATOM   2543 N  ND2 . ASN A 1 346 ? -4.188  39.819 15.653  1.00 24.18  ? 326 ASN A ND2 1 
ATOM   2544 N  N   . LYS A 1 347 ? -0.753  39.213 14.105  1.00 27.21  ? 327 LYS A N   1 
ATOM   2545 C  CA  . LYS A 1 347 ? -0.801  37.773 13.867  1.00 26.10  ? 327 LYS A CA  1 
ATOM   2546 C  C   . LYS A 1 347 ? -1.916  37.146 14.715  1.00 24.20  ? 327 LYS A C   1 
ATOM   2547 O  O   . LYS A 1 347 ? -2.408  37.758 15.649  1.00 23.82  ? 327 LYS A O   1 
ATOM   2548 C  CB  . LYS A 1 347 ? 0.550   37.122 14.192  1.00 26.75  ? 327 LYS A CB  1 
ATOM   2549 C  CG  . LYS A 1 347 ? 1.724   37.645 13.380  1.00 28.83  ? 327 LYS A CG  1 
ATOM   2550 C  CD  . LYS A 1 347 ? 3.001   36.883 13.715  1.00 38.34  ? 327 LYS A CD  1 
ATOM   2551 C  CE  . LYS A 1 347 ? 4.047   36.995 12.607  1.00 47.60  ? 327 LYS A CE  1 
ATOM   2552 N  NZ  . LYS A 1 347 ? 3.615   36.336 11.325  1.00 49.66  ? 327 LYS A NZ  1 
ATOM   2553 N  N   . ALA A 1 348 ? -2.334  35.934 14.391  1.00 23.26  ? 328 ALA A N   1 
ATOM   2554 C  CA  . ALA A 1 348 ? -3.276  35.243 15.269  1.00 21.61  ? 328 ALA A CA  1 
ATOM   2555 C  C   . ALA A 1 348 ? -2.552  34.056 15.878  1.00 21.29  ? 328 ALA A C   1 
ATOM   2556 O  O   . ALA A 1 348 ? -1.428  33.769 15.496  1.00 25.62  ? 328 ALA A O   1 
ATOM   2557 C  CB  . ALA A 1 348 ? -4.511  34.799 14.500  1.00 20.82  ? 328 ALA A CB  1 
ATOM   2558 N  N   . ALA A 1 349 ? -3.164  33.369 16.827  1.00 20.14  ? 329 ALA A N   1 
ATOM   2559 C  CA  . ALA A 1 349 ? -2.536  32.168 17.348  1.00 19.99  ? 329 ALA A CA  1 
ATOM   2560 C  C   . ALA A 1 349 ? -3.569  31.231 17.897  1.00 18.76  ? 329 ALA A C   1 
ATOM   2561 O  O   . ALA A 1 349 ? -4.665  31.658 18.267  1.00 18.02  ? 329 ALA A O   1 
ATOM   2562 C  CB  . ALA A 1 349 ? -1.525  32.496 18.424  1.00 20.60  ? 329 ALA A CB  1 
ATOM   2563 N  N   . VAL A 1 350 ? -3.218  29.947 17.913  1.00 18.74  ? 330 VAL A N   1 
ATOM   2564 C  CA  . VAL A 1 350 ? -3.925  28.971 18.711  1.00 17.90  ? 330 VAL A CA  1 
ATOM   2565 C  C   . VAL A 1 350 ? -2.891  28.304 19.590  1.00 18.97  ? 330 VAL A C   1 
ATOM   2566 O  O   . VAL A 1 350 ? -1.706  28.302 19.274  1.00 21.28  ? 330 VAL A O   1 
ATOM   2567 C  CB  . VAL A 1 350 ? -4.640  27.902 17.864  1.00 17.59  ? 330 VAL A CB  1 
ATOM   2568 C  CG1 . VAL A 1 350 ? -5.628  28.546 16.938  1.00 17.27  ? 330 VAL A CG1 1 
ATOM   2569 C  CG2 . VAL A 1 350 ? -3.643  27.072 17.099  1.00 18.52  ? 330 VAL A CG2 1 
ATOM   2570 N  N   . LEU A 1 351 ? -3.352  27.741 20.696  1.00 19.91  ? 331 LEU A N   1 
ATOM   2571 C  CA  . LEU A 1 351 ? -2.499  27.067 21.665  1.00 19.05  ? 331 LEU A CA  1 
ATOM   2572 C  C   . LEU A 1 351 ? -2.638  25.554 21.543  1.00 18.79  ? 331 LEU A C   1 
ATOM   2573 O  O   . LEU A 1 351 ? -3.710  25.008 21.816  1.00 22.02  ? 331 LEU A O   1 
ATOM   2574 C  CB  . LEU A 1 351 ? -2.926  27.485 23.063  1.00 22.53  ? 331 LEU A CB  1 
ATOM   2575 C  CG  . LEU A 1 351 ? -1.962  27.219 24.204  1.00 26.23  ? 331 LEU A CG  1 
ATOM   2576 C  CD1 . LEU A 1 351 ? -2.008  28.431 25.088  1.00 30.31  ? 331 LEU A CD1 1 
ATOM   2577 C  CD2 . LEU A 1 351 ? -2.383  25.986 24.970  1.00 26.21  ? 331 LEU A CD2 1 
ATOM   2578 N  N   . LYS A 1 352 ? -1.575  24.870 21.132  1.00 20.12  ? 332 LYS A N   1 
ATOM   2579 C  CA  . LYS A 1 352 ? -1.647  23.419 21.048  1.00 21.92  ? 332 LYS A CA  1 
ATOM   2580 C  C   . LYS A 1 352 ? -1.005  22.744 22.257  1.00 24.68  ? 332 LYS A C   1 
ATOM   2581 O  O   . LYS A 1 352 ? 0.179   22.914 22.521  1.00 31.73  ? 332 LYS A O   1 
ATOM   2582 C  CB  . LYS A 1 352 ? -1.054  22.920 19.738  1.00 21.56  ? 332 LYS A CB  1 
ATOM   2583 C  CG  . LYS A 1 352 ? -1.693  23.594 18.527  1.00 25.82  ? 332 LYS A CG  1 
ATOM   2584 C  CD  . LYS A 1 352 ? -1.884  22.643 17.350  1.00 29.97  ? 332 LYS A CD  1 
ATOM   2585 C  CE  . LYS A 1 352 ? -2.595  21.358 17.797  1.00 31.34  ? 332 LYS A CE  1 
ATOM   2586 N  NZ  . LYS A 1 352 ? -3.557  20.826 16.770  1.00 30.15  ? 332 LYS A NZ  1 
ATOM   2587 N  N   . TYR A 1 353 ? -1.807  21.993 22.998  1.00 20.19  ? 333 TYR A N   1 
ATOM   2588 C  CA  . TYR A 1 353 ? -1.349  21.345 24.220  1.00 20.89  ? 333 TYR A CA  1 
ATOM   2589 C  C   . TYR A 1 353 ? -1.320  19.821 24.044  1.00 21.76  ? 333 TYR A C   1 
ATOM   2590 O  O   . TYR A 1 353 ? -2.352  19.170 24.131  1.00 25.48  ? 333 TYR A O   1 
ATOM   2591 C  CB  . TYR A 1 353 ? -2.285  21.711 25.376  1.00 20.46  ? 333 TYR A CB  1 
ATOM   2592 C  CG  . TYR A 1 353 ? -1.828  21.230 26.734  1.00 24.26  ? 333 TYR A CG  1 
ATOM   2593 C  CD1 . TYR A 1 353 ? -0.478  21.076 27.018  1.00 32.68  ? 333 TYR A CD1 1 
ATOM   2594 C  CD2 . TYR A 1 353 ? -2.745  20.921 27.734  1.00 20.57  ? 333 TYR A CD2 1 
ATOM   2595 C  CE1 . TYR A 1 353 ? -0.051  20.635 28.259  1.00 32.54  ? 333 TYR A CE1 1 
ATOM   2596 C  CE2 . TYR A 1 353 ? -2.326  20.481 28.976  1.00 22.64  ? 333 TYR A CE2 1 
ATOM   2597 C  CZ  . TYR A 1 353 ? -0.978  20.340 29.228  1.00 31.49  ? 333 TYR A CZ  1 
ATOM   2598 O  OH  . TYR A 1 353 ? -0.540  19.905 30.450  1.00 40.38  ? 333 TYR A OH  1 
ATOM   2599 N  N   . GLU A 1 354 ? -0.144  19.263 23.771  1.00 23.76  ? 334 GLU A N   1 
ATOM   2600 C  CA  . GLU A 1 354 ? 0.022   17.814 23.661  1.00 27.37  ? 334 GLU A CA  1 
ATOM   2601 C  C   . GLU A 1 354 ? 1.347   17.372 24.262  1.00 33.77  ? 334 GLU A C   1 
ATOM   2602 O  O   . GLU A 1 354 ? 2.326   18.123 24.223  1.00 37.78  ? 334 GLU A O   1 
ATOM   2603 C  CB  . GLU A 1 354 ? -0.000  17.353 22.202  1.00 26.61  ? 334 GLU A CB  1 
ATOM   2604 C  CG  . GLU A 1 354 ? -1.127  17.897 21.370  1.00 36.33  ? 334 GLU A CG  1 
ATOM   2605 C  CD  . GLU A 1 354 ? -1.048  17.439 19.920  1.00 44.17  ? 334 GLU A CD  1 
ATOM   2606 O  OE1 . GLU A 1 354 ? -0.847  18.316 19.034  1.00 41.46  ? 334 GLU A OE1 1 
ATOM   2607 O  OE2 . GLU A 1 354 ? -1.193  16.207 19.684  1.00 47.31  ? 334 GLU A OE2 1 
ATOM   2608 N  N   . ASN A 1 355 ? 1.370   16.146 24.795  1.00 24.22  ? 335 ASN A N   1 
ATOM   2609 C  CA  . ASN A 1 355 ? 2.610   15.506 25.251  1.00 21.14  ? 335 ASN A CA  1 
ATOM   2610 C  C   . ASN A 1 355 ? 3.372   16.399 26.225  1.00 23.23  ? 335 ASN A C   1 
ATOM   2611 O  O   . ASN A 1 355 ? 4.601   16.542 26.124  1.00 24.92  ? 335 ASN A O   1 
ATOM   2612 C  CB  . ASN A 1 355 ? 3.540   15.167 24.067  1.00 19.89  ? 335 ASN A CB  1 
ATOM   2613 C  CG  . ASN A 1 355 ? 2.866   14.315 22.998  1.00 19.88  ? 335 ASN A CG  1 
ATOM   2614 O  OD1 . ASN A 1 355 ? 2.067   13.422 23.296  1.00 19.70  ? 335 ASN A OD1 1 
ATOM   2615 N  ND2 . ASN A 1 355 ? 3.199   14.589 21.738  1.00 20.15  ? 335 ASN A ND2 1 
ATOM   2616 N  N   . ASN A 1 356 ? 2.625   17.036 27.123  1.00 20.29  ? 336 ASN A N   1 
ATOM   2617 C  CA  . ASN A 1 356 ? 3.195   17.953 28.099  1.00 23.95  ? 336 ASN A CA  1 
ATOM   2618 C  C   . ASN A 1 356 ? 3.959   19.150 27.512  1.00 26.64  ? 336 ASN A C   1 
ATOM   2619 O  O   . ASN A 1 356 ? 4.814   19.729 28.181  1.00 28.11  ? 336 ASN A O   1 
ATOM   2620 C  CB  . ASN A 1 356 ? 4.085   17.185 29.069  1.00 23.33  ? 336 ASN A CB  1 
ATOM   2621 C  CG  . ASN A 1 356 ? 3.902   17.632 30.488  1.00 27.15  ? 336 ASN A CG  1 
ATOM   2622 O  OD1 . ASN A 1 356 ? 2.774   17.735 30.980  1.00 36.01  ? 336 ASN A OD1 1 
ATOM   2623 N  ND2 . ASN A 1 356 ? 5.010   17.917 31.162  1.00 26.65  ? 336 ASN A ND2 1 
ATOM   2624 N  N   . VAL A 1 357 ? 3.649   19.515 26.270  1.00 23.16  ? 337 VAL A N   1 
ATOM   2625 C  CA  . VAL A 1 357 ? 4.179   20.737 25.668  1.00 21.30  ? 337 VAL A CA  1 
ATOM   2626 C  C   . VAL A 1 357 ? 3.039   21.656 25.261  1.00 21.36  ? 337 VAL A C   1 
ATOM   2627 O  O   . VAL A 1 357 ? 2.127   21.238 24.558  1.00 22.18  ? 337 VAL A O   1 
ATOM   2628 C  CB  . VAL A 1 357 ? 4.984   20.436 24.387  1.00 21.74  ? 337 VAL A CB  1 
ATOM   2629 C  CG1 . VAL A 1 357 ? 5.440   21.734 23.727  1.00 21.80  ? 337 VAL A CG1 1 
ATOM   2630 C  CG2 . VAL A 1 357 ? 6.149   19.511 24.680  1.00 21.16  ? 337 VAL A CG2 1 
ATOM   2631 N  N   . MET A 1 358 ? 3.076   22.905 25.701  1.00 21.83  ? 338 MET A N   1 
ATOM   2632 C  CA  . MET A 1 358 ? 2.155   23.902 25.166  1.00 22.33  ? 338 MET A CA  1 
ATOM   2633 C  C   . MET A 1 358 ? 2.854   24.598 24.035  1.00 25.90  ? 338 MET A C   1 
ATOM   2634 O  O   . MET A 1 358 ? 3.847   25.277 24.241  1.00 26.35  ? 338 MET A O   1 
ATOM   2635 C  CB  . MET A 1 358 ? 1.790   24.939 26.207  1.00 26.12  ? 338 MET A CB  1 
ATOM   2636 C  CG  . MET A 1 358 ? 1.126   24.348 27.438  1.00 33.67  ? 338 MET A CG  1 
ATOM   2637 S  SD  . MET A 1 358 ? -0.319  25.316 27.891  1.00 57.79  ? 338 MET A SD  1 
ATOM   2638 C  CE  . MET A 1 358 ? 0.253   26.929 27.377  1.00 29.15  ? 338 MET A CE  1 
ATOM   2639 N  N   . ASN A 1 359 ? 2.341   24.429 22.831  1.00 27.77  ? 339 ASN A N   1 
ATOM   2640 C  CA  . ASN A 1 359 ? 2.943   25.063 21.684  1.00 26.39  ? 339 ASN A CA  1 
ATOM   2641 C  C   . ASN A 1 359 ? 1.993   26.056 21.030  1.00 26.11  ? 339 ASN A C   1 
ATOM   2642 O  O   . ASN A 1 359 ? 0.843   25.728 20.722  1.00 25.96  ? 339 ASN A O   1 
ATOM   2643 C  CB  . ASN A 1 359 ? 3.391   23.998 20.694  1.00 25.80  ? 339 ASN A CB  1 
ATOM   2644 C  CG  . ASN A 1 359 ? 4.048   24.582 19.486  1.00 28.84  ? 339 ASN A CG  1 
ATOM   2645 O  OD1 . ASN A 1 359 ? 5.139   25.135 19.568  1.00 32.34  ? 339 ASN A OD1 1 
ATOM   2646 N  ND2 . ASN A 1 359 ? 3.390   24.467 18.345  1.00 37.29  ? 339 ASN A ND2 1 
ATOM   2647 N  N   . ILE A 1 360 ? 2.484   27.276 20.837  1.00 24.73  ? 340 ILE A N   1 
ATOM   2648 C  CA  . ILE A 1 360 ? 1.717   28.335 20.197  1.00 23.62  ? 340 ILE A CA  1 
ATOM   2649 C  C   . ILE A 1 360 ? 1.922   28.333 18.697  1.00 26.12  ? 340 ILE A C   1 
ATOM   2650 O  O   . ILE A 1 360 ? 3.004   28.643 18.227  1.00 30.95  ? 340 ILE A O   1 
ATOM   2651 C  CB  . ILE A 1 360 ? 2.161   29.707 20.704  1.00 24.35  ? 340 ILE A CB  1 
ATOM   2652 C  CG1 . ILE A 1 360 ? 2.148   29.748 22.229  1.00 24.58  ? 340 ILE A CG1 1 
ATOM   2653 C  CG2 . ILE A 1 360 ? 1.278   30.781 20.136  1.00 27.27  ? 340 ILE A CG2 1 
ATOM   2654 C  CD1 . ILE A 1 360 ? 0.755   29.703 22.811  1.00 29.37  ? 340 ILE A CD1 1 
ATOM   2655 N  N   . ARG A 1 361 ? 0.879   27.990 17.947  1.00 24.39  ? 341 ARG A N   1 
ATOM   2656 C  CA  . ARG A 1 361 ? 0.908   28.081 16.486  1.00 23.42  ? 341 ARG A CA  1 
ATOM   2657 C  C   . ARG A 1 361 ? 0.432   29.445 16.036  1.00 23.92  ? 341 ARG A C   1 
ATOM   2658 O  O   . ARG A 1 361 ? -0.729  29.785 16.249  1.00 25.66  ? 341 ARG A O   1 
ATOM   2659 C  CB  . ARG A 1 361 ? 0.002   27.023 15.855  1.00 22.91  ? 341 ARG A CB  1 
ATOM   2660 C  CG  . ARG A 1 361 ? 0.527   25.619 15.969  1.00 23.05  ? 341 ARG A CG  1 
ATOM   2661 C  CD  . ARG A 1 361 ? 1.884   25.509 15.305  1.00 22.97  ? 341 ARG A CD  1 
ATOM   2662 N  NE  . ARG A 1 361 ? 1.818   25.811 13.879  1.00 23.41  ? 341 ARG A NE  1 
ATOM   2663 C  CZ  . ARG A 1 361 ? 1.552   24.896 12.945  1.00 28.88  ? 341 ARG A CZ  1 
ATOM   2664 N  NH1 . ARG A 1 361 ? 1.319   23.630 13.312  1.00 27.89  ? 341 ARG A NH1 1 
ATOM   2665 N  NH2 . ARG A 1 361 ? 1.515   25.237 11.650  1.00 26.80  ? 341 ARG A NH2 1 
ATOM   2666 N  N   . GLN A 1 362 ? 1.302   30.231 15.407  1.00 28.12  ? 342 GLN A N   1 
ATOM   2667 C  CA  . GLN A 1 362 ? 0.865   31.529 14.901  1.00 24.83  ? 342 GLN A CA  1 
ATOM   2668 C  C   . GLN A 1 362 ? 0.439   31.401 13.453  1.00 24.74  ? 342 GLN A C   1 
ATOM   2669 O  O   . GLN A 1 362 ? 0.884   30.491 12.765  1.00 24.59  ? 342 GLN A O   1 
ATOM   2670 C  CB  . GLN A 1 362 ? 1.960   32.579 15.025  1.00 25.62  ? 342 GLN A CB  1 
ATOM   2671 C  CG  . GLN A 1 362 ? 2.299   32.978 16.445  1.00 26.98  ? 342 GLN A CG  1 
ATOM   2672 C  CD  . GLN A 1 362 ? 3.405   34.032 16.498  1.00 29.53  ? 342 GLN A CD  1 
ATOM   2673 O  OE1 . GLN A 1 362 ? 4.524   33.805 16.019  1.00 29.26  ? 342 GLN A OE1 1 
ATOM   2674 N  NE2 . GLN A 1 362 ? 3.090   35.196 17.075  1.00 30.87  ? 342 GLN A NE2 1 
ATOM   2675 N  N   . PHE A 1 363 ? -0.440  32.301 13.006  1.00 24.87  ? 343 PHE A N   1 
ATOM   2676 C  CA  . PHE A 1 363 ? -0.847  32.387 11.599  1.00 24.89  ? 343 PHE A CA  1 
ATOM   2677 C  C   . PHE A 1 363 ? -1.307  33.795 11.196  1.00 25.33  ? 343 PHE A C   1 
ATOM   2678 O  O   . PHE A 1 363 ? -1.755  34.574 12.038  1.00 27.32  ? 343 PHE A O   1 
ATOM   2679 C  CB  . PHE A 1 363 ? -1.901  31.325 11.236  1.00 24.25  ? 343 PHE A CB  1 
ATOM   2680 C  CG  . PHE A 1 363 ? -3.234  31.491 11.933  1.00 23.92  ? 343 PHE A CG  1 
ATOM   2681 C  CD1 . PHE A 1 363 ? -3.472  30.886 13.156  1.00 23.60  ? 343 PHE A CD1 1 
ATOM   2682 C  CD2 . PHE A 1 363 ? -4.267  32.197 11.334  1.00 23.97  ? 343 PHE A CD2 1 
ATOM   2683 C  CE1 . PHE A 1 363 ? -4.707  31.017 13.790  1.00 27.24  ? 343 PHE A CE1 1 
ATOM   2684 C  CE2 . PHE A 1 363 ? -5.503  32.325 11.962  1.00 23.73  ? 343 PHE A CE2 1 
ATOM   2685 C  CZ  . PHE A 1 363 ? -5.722  31.733 13.196  1.00 23.47  ? 343 PHE A CZ  1 
ATOM   2686 N  N   . ASN A 1 364 ? -1.178  34.119 9.912   1.00 26.23  ? 344 ASN A N   1 
ATOM   2687 C  CA  . ASN A 1 364 ? -1.554  35.438 9.400   1.00 26.06  ? 344 ASN A CA  1 
ATOM   2688 C  C   . ASN A 1 364 ? -2.937  35.444 8.792   1.00 25.67  ? 344 ASN A C   1 
ATOM   2689 O  O   . ASN A 1 364 ? -3.640  34.438 8.860   1.00 31.01  ? 344 ASN A O   1 
ATOM   2690 C  CB  . ASN A 1 364 ? -0.549  35.893 8.364   1.00 26.71  ? 344 ASN A CB  1 
ATOM   2691 C  CG  . ASN A 1 364 ? 0.829   35.948 8.919   1.00 29.86  ? 344 ASN A CG  1 
ATOM   2692 O  OD1 . ASN A 1 364 ? 1.109   36.790 9.775   1.00 37.09  ? 344 ASN A OD1 1 
ATOM   2693 N  ND2 . ASN A 1 364 ? 1.708   35.042 8.470   1.00 32.39  ? 344 ASN A ND2 1 
ATOM   2694 N  N   . CYS A 1 365 ? -3.341  36.562 8.192   1.00 26.13  ? 345 CYS A N   1 
ATOM   2695 C  CA  . CYS A 1 365 ? -4.691  36.615 7.635   1.00 28.67  ? 345 CYS A CA  1 
ATOM   2696 C  C   . CYS A 1 365 ? -4.778  36.031 6.245   1.00 27.06  ? 345 CYS A C   1 
ATOM   2697 O  O   . CYS A 1 365 ? -3.780  35.663 5.630   1.00 32.26  ? 345 CYS A O   1 
ATOM   2698 C  CB  . CYS A 1 365 ? -5.237  38.031 7.618   1.00 27.25  ? 345 CYS A CB  1 
ATOM   2699 S  SG  . CYS A 1 365 ? -4.215  39.182 6.688   1.00 28.26  ? 345 CYS A SG  1 
ATOM   2700 N  N   . SER A 1 366 ? -6.006  35.948 5.760   1.00 25.24  ? 346 SER A N   1 
ATOM   2701 C  CA  . SER A 1 366 ? -6.308  35.428 4.433   1.00 25.16  ? 346 SER A CA  1 
ATOM   2702 C  C   . SER A 1 366 ? -7.317  36.388 3.819   1.00 26.70  ? 346 SER A C   1 
ATOM   2703 O  O   . SER A 1 366 ? -8.063  37.049 4.537   1.00 28.53  ? 346 SER A O   1 
ATOM   2704 C  CB  . SER A 1 366 ? -6.921  34.033 4.527   1.00 24.60  ? 346 SER A CB  1 
ATOM   2705 O  OG  . SER A 1 366 ? -6.090  33.145 5.238   1.00 24.74  ? 346 SER A OG  1 
ATOM   2706 N  N   . PRO A 1 367 ? -7.336  36.474 2.489   1.00 27.47  ? 347 PRO A N   1 
ATOM   2707 C  CA  . PRO A 1 367 ? -8.265  37.366 1.788   1.00 25.55  ? 347 PRO A CA  1 
ATOM   2708 C  C   . PRO A 1 367 ? -9.717  37.042 2.117   1.00 25.03  ? 347 PRO A C   1 
ATOM   2709 O  O   . PRO A 1 367 ? -10.065 35.885 2.417   1.00 24.61  ? 347 PRO A O   1 
ATOM   2710 C  CB  . PRO A 1 367 ? -8.008  37.046 0.319   1.00 25.79  ? 347 PRO A CB  1 
ATOM   2711 C  CG  . PRO A 1 367 ? -6.627  36.461 0.290   1.00 26.09  ? 347 PRO A CG  1 
ATOM   2712 C  CD  . PRO A 1 367 ? -6.469  35.721 1.563   1.00 25.68  ? 347 PRO A CD  1 
ATOM   2713 N  N   . HIS A 1 368 ? -10.553 38.068 2.080   1.00 25.11  ? 348 HIS A N   1 
ATOM   2714 C  CA  . HIS A 1 368 ? -11.977 37.885 2.271   1.00 24.73  ? 348 HIS A CA  1 
ATOM   2715 C  C   . HIS A 1 368 ? -12.742 38.912 1.430   1.00 27.06  ? 348 HIS A C   1 
ATOM   2716 O  O   . HIS A 1 368 ? -12.243 40.011 1.177   1.00 26.53  ? 348 HIS A O   1 
ATOM   2717 C  CB  . HIS A 1 368 ? -12.342 38.002 3.756   1.00 24.58  ? 348 HIS A CB  1 
ATOM   2718 C  CG  . HIS A 1 368 ? -12.229 39.390 4.314   1.00 25.03  ? 348 HIS A CG  1 
ATOM   2719 N  ND1 . HIS A 1 368 ? -13.255 40.308 4.235   1.00 30.51  ? 348 HIS A ND1 1 
ATOM   2720 C  CD2 . HIS A 1 368 ? -11.229 40.003 4.989   1.00 26.29  ? 348 HIS A CD2 1 
ATOM   2721 C  CE1 . HIS A 1 368 ? -12.884 41.431 4.826   1.00 29.47  ? 348 HIS A CE1 1 
ATOM   2722 N  NE2 . HIS A 1 368 ? -11.663 41.271 5.299   1.00 25.85  ? 348 HIS A NE2 1 
ATOM   2723 N  N   . PRO A 1 369 ? -13.952 38.548 0.980   1.00 25.18  ? 349 PRO A N   1 
ATOM   2724 C  CA  . PRO A 1 369 ? -14.762 39.412 0.122   1.00 27.89  ? 349 PRO A CA  1 
ATOM   2725 C  C   . PRO A 1 369 ? -15.190 40.661 0.859   1.00 28.11  ? 349 PRO A C   1 
ATOM   2726 O  O   . PRO A 1 369 ? -15.157 40.678 2.077   1.00 27.61  ? 349 PRO A O   1 
ATOM   2727 C  CB  . PRO A 1 369 ? -15.973 38.539 -0.199  1.00 29.15  ? 349 PRO A CB  1 
ATOM   2728 C  CG  . PRO A 1 369 ? -15.483 37.139 -0.027  1.00 26.07  ? 349 PRO A CG  1 
ATOM   2729 C  CD  . PRO A 1 369 ? -14.559 37.216 1.134   1.00 27.43  ? 349 PRO A CD  1 
ATOM   2730 N  N   . TYR A 1 370 ? -15.587 41.685 0.112   1.00 29.57  ? 350 TYR A N   1 
ATOM   2731 C  CA  . TYR A 1 370 ? -15.921 42.990 0.672   1.00 25.61  ? 350 TYR A CA  1 
ATOM   2732 C  C   . TYR A 1 370 ? -17.422 43.171 0.924   1.00 25.42  ? 350 TYR A C   1 
ATOM   2733 O  O   . TYR A 1 370 ? -18.258 42.646 0.200   1.00 25.95  ? 350 TYR A O   1 
ATOM   2734 C  CB  . TYR A 1 370 ? -15.389 44.093 -0.248  1.00 26.11  ? 350 TYR A CB  1 
ATOM   2735 C  CG  . TYR A 1 370 ? -15.655 45.474 0.280   1.00 33.54  ? 350 TYR A CG  1 
ATOM   2736 C  CD1 . TYR A 1 370 ? -14.860 46.017 1.276   1.00 35.76  ? 350 TYR A CD1 1 
ATOM   2737 C  CD2 . TYR A 1 370 ? -16.713 46.232 -0.201  1.00 34.04  ? 350 TYR A CD2 1 
ATOM   2738 C  CE1 . TYR A 1 370 ? -15.103 47.279 1.771   1.00 35.87  ? 350 TYR A CE1 1 
ATOM   2739 C  CE2 . TYR A 1 370 ? -16.971 47.496 0.295   1.00 35.36  ? 350 TYR A CE2 1 
ATOM   2740 C  CZ  . TYR A 1 370 ? -16.161 48.014 1.279   1.00 38.47  ? 350 TYR A CZ  1 
ATOM   2741 O  OH  . TYR A 1 370 ? -16.401 49.269 1.775   1.00 45.08  ? 350 TYR A OH  1 
ATOM   2742 N  N   . TRP A 1 371 ? -17.757 43.901 1.974   1.00 25.68  ? 351 TRP A N   1 
ATOM   2743 C  CA  . TRP A 1 371 ? -19.145 44.249 2.264   1.00 25.66  ? 351 TRP A CA  1 
ATOM   2744 C  C   . TRP A 1 371 ? -19.173 45.720 2.658   1.00 28.38  ? 351 TRP A C   1 
ATOM   2745 O  O   . TRP A 1 371 ? -18.257 46.209 3.328   1.00 31.51  ? 351 TRP A O   1 
ATOM   2746 C  CB  . TRP A 1 371 ? -19.659 43.452 3.450   1.00 25.44  ? 351 TRP A CB  1 
ATOM   2747 C  CG  . TRP A 1 371 ? -20.363 42.156 3.181   1.00 25.03  ? 351 TRP A CG  1 
ATOM   2748 C  CD1 . TRP A 1 371 ? -19.834 40.902 3.265   1.00 25.64  ? 351 TRP A CD1 1 
ATOM   2749 C  CD2 . TRP A 1 371 ? -21.752 41.982 2.880   1.00 27.45  ? 351 TRP A CD2 1 
ATOM   2750 N  NE1 . TRP A 1 371 ? -20.799 39.953 3.005   1.00 25.93  ? 351 TRP A NE1 1 
ATOM   2751 C  CE2 . TRP A 1 371 ? -21.988 40.590 2.770   1.00 28.33  ? 351 TRP A CE2 1 
ATOM   2752 C  CE3 . TRP A 1 371 ? -22.823 42.869 2.680   1.00 27.23  ? 351 TRP A CE3 1 
ATOM   2753 C  CZ2 . TRP A 1 371 ? -23.254 40.060 2.462   1.00 29.38  ? 351 TRP A CZ2 1 
ATOM   2754 C  CZ3 . TRP A 1 371 ? -24.081 42.342 2.376   1.00 26.70  ? 351 TRP A CZ3 1 
ATOM   2755 C  CH2 . TRP A 1 371 ? -24.284 40.946 2.271   1.00 24.92  ? 351 TRP A CH2 1 
ATOM   2756 N  N   . LEU A 1 372 ? -20.211 46.435 2.247   1.00 31.89  ? 352 LEU A N   1 
ATOM   2757 C  CA  . LEU A 1 372 ? -20.392 47.802 2.712   1.00 31.91  ? 352 LEU A CA  1 
ATOM   2758 C  C   . LEU A 1 372 ? -20.724 47.730 4.190   1.00 34.82  ? 352 LEU A C   1 
ATOM   2759 O  O   . LEU A 1 372 ? -21.375 46.772 4.614   1.00 36.35  ? 352 LEU A O   1 
ATOM   2760 C  CB  . LEU A 1 372 ? -21.545 48.471 1.961   1.00 27.62  ? 352 LEU A CB  1 
ATOM   2761 C  CG  . LEU A 1 372 ? -21.213 48.890 0.532   1.00 29.08  ? 352 LEU A CG  1 
ATOM   2762 C  CD1 . LEU A 1 372 ? -22.475 49.246 -0.228  1.00 27.03  ? 352 LEU A CD1 1 
ATOM   2763 C  CD2 . LEU A 1 372 ? -20.212 50.055 0.541   1.00 27.82  ? 352 LEU A CD2 1 
ATOM   2764 N  N   . PRO A 1 373 ? -20.279 48.727 4.973   1.00 31.48  ? 353 PRO A N   1 
ATOM   2765 C  CA  . PRO A 1 373 ? -20.644 48.867 6.379   1.00 28.41  ? 353 PRO A CA  1 
ATOM   2766 C  C   . PRO A 1 373 ? -22.111 48.568 6.603   1.00 32.44  ? 353 PRO A C   1 
ATOM   2767 O  O   . PRO A 1 373 ? -22.954 48.909 5.777   1.00 33.06  ? 353 PRO A O   1 
ATOM   2768 C  CB  . PRO A 1 373 ? -20.399 50.346 6.644   1.00 29.35  ? 353 PRO A CB  1 
ATOM   2769 C  CG  . PRO A 1 373 ? -19.235 50.667 5.805   1.00 29.42  ? 353 PRO A CG  1 
ATOM   2770 C  CD  . PRO A 1 373 ? -19.379 49.809 4.548   1.00 34.74  ? 353 PRO A CD  1 
ATOM   2771 N  N   . ASN A 1 374 ? -22.401 47.909 7.713   1.00 34.24  ? 354 ASN A N   1 
ATOM   2772 C  CA  . ASN A 1 374 ? -23.761 47.585 8.093   1.00 32.77  ? 354 ASN A CA  1 
ATOM   2773 C  C   . ASN A 1 374 ? -24.564 46.810 7.065   1.00 28.15  ? 354 ASN A C   1 
ATOM   2774 O  O   . ASN A 1 374 ? -25.802 46.774 7.144   1.00 29.96  ? 354 ASN A O   1 
ATOM   2775 C  CB  . ASN A 1 374 ? -24.523 48.836 8.508   1.00 38.17  ? 354 ASN A CB  1 
ATOM   2776 C  CG  . ASN A 1 374 ? -25.479 48.559 9.642   1.00 43.13  ? 354 ASN A CG  1 
ATOM   2777 O  OD1 . ASN A 1 374 ? -25.231 47.675 10.474  1.00 45.88  ? 354 ASN A OD1 1 
ATOM   2778 N  ND2 . ASN A 1 374 ? -26.584 49.295 9.682   1.00 42.66  ? 354 ASN A ND2 1 
ATOM   2779 N  N   . PHE A 1 375 ? -23.856 46.192 6.121   1.00 26.94  ? 355 PHE A N   1 
ATOM   2780 C  CA  . PHE A 1 375 ? -24.458 45.300 5.133   1.00 27.37  ? 355 PHE A CA  1 
ATOM   2781 C  C   . PHE A 1 375 ? -25.448 45.979 4.198   1.00 31.29  ? 355 PHE A C   1 
ATOM   2782 O  O   . PHE A 1 375 ? -26.433 45.360 3.782   1.00 36.01  ? 355 PHE A O   1 
ATOM   2783 C  CB  . PHE A 1 375 ? -25.164 44.125 5.821   1.00 26.09  ? 355 PHE A CB  1 
ATOM   2784 C  CG  . PHE A 1 375 ? -24.267 43.299 6.680   1.00 31.71  ? 355 PHE A CG  1 
ATOM   2785 C  CD1 . PHE A 1 375 ? -24.098 43.604 8.014   1.00 33.77  ? 355 PHE A CD1 1 
ATOM   2786 C  CD2 . PHE A 1 375 ? -23.594 42.210 6.158   1.00 30.90  ? 355 PHE A CD2 1 
ATOM   2787 C  CE1 . PHE A 1 375 ? -23.281 42.841 8.803   1.00 27.88  ? 355 PHE A CE1 1 
ATOM   2788 C  CE2 . PHE A 1 375 ? -22.767 41.443 6.960   1.00 31.06  ? 355 PHE A CE2 1 
ATOM   2789 C  CZ  . PHE A 1 375 ? -22.616 41.761 8.275   1.00 28.77  ? 355 PHE A CZ  1 
ATOM   2790 N  N   . MET A 1 376 ? -25.215 47.248 3.879   1.00 29.61  ? 356 MET A N   1 
ATOM   2791 C  CA  . MET A 1 376 ? -26.120 47.903 2.948   1.00 33.83  ? 356 MET A CA  1 
ATOM   2792 C  C   . MET A 1 376 ? -25.762 47.509 1.510   1.00 34.56  ? 356 MET A C   1 
ATOM   2793 O  O   . MET A 1 376 ? -24.576 47.299 1.184   1.00 33.64  ? 356 MET A O   1 
ATOM   2794 C  CB  . MET A 1 376 ? -26.148 49.413 3.156   1.00 34.98  ? 356 MET A CB  1 
ATOM   2795 C  CG  . MET A 1 376 ? -24.857 50.113 2.846   1.00 39.45  ? 356 MET A CG  1 
ATOM   2796 S  SD  . MET A 1 376 ? -24.808 51.819 3.468   1.00 50.07  ? 356 MET A SD  1 
ATOM   2797 C  CE  . MET A 1 376 ? -26.521 52.001 3.982   1.00 32.86  ? 356 MET A CE  1 
ATOM   2798 N  N   . ASP A 1 377 ? -26.805 47.340 0.694   1.00 34.04  ? 357 ASP A N   1 
ATOM   2799 C  CA  . ASP A 1 377 ? -26.670 47.107 -0.736  1.00 32.00  ? 357 ASP A CA  1 
ATOM   2800 C  C   . ASP A 1 377 ? -26.340 48.424 -1.435  1.00 34.60  ? 357 ASP A C   1 
ATOM   2801 O  O   . ASP A 1 377 ? -26.528 49.515 -0.881  1.00 37.52  ? 357 ASP A O   1 
ATOM   2802 C  CB  . ASP A 1 377 ? -27.952 46.516 -1.313  1.00 29.94  ? 357 ASP A CB  1 
ATOM   2803 C  CG  . ASP A 1 377 ? -29.143 47.438 -1.143  1.00 39.30  ? 357 ASP A CG  1 
ATOM   2804 O  OD1 . ASP A 1 377 ? -29.494 47.783 0.005   1.00 43.44  ? 357 ASP A OD1 1 
ATOM   2805 O  OD2 . ASP A 1 377 ? -29.732 47.827 -2.165  1.00 47.37  ? 357 ASP A OD2 1 
ATOM   2806 N  N   . VAL A 1 378 ? -25.852 48.320 -2.660  1.00 27.53  ? 358 VAL A N   1 
ATOM   2807 C  CA  . VAL A 1 378 ? -25.385 49.499 -3.352  1.00 28.92  ? 358 VAL A CA  1 
ATOM   2808 C  C   . VAL A 1 378 ? -26.511 50.474 -3.694  1.00 30.24  ? 358 VAL A C   1 
ATOM   2809 O  O   . VAL A 1 378 ? -26.252 51.642 -3.918  1.00 33.13  ? 358 VAL A O   1 
ATOM   2810 C  CB  . VAL A 1 378 ? -24.640 49.091 -4.595  1.00 26.50  ? 358 VAL A CB  1 
ATOM   2811 C  CG1 . VAL A 1 378 ? -23.572 48.088 -4.211  1.00 26.07  ? 358 VAL A CG1 1 
ATOM   2812 C  CG2 . VAL A 1 378 ? -25.596 48.461 -5.549  1.00 30.30  ? 358 VAL A CG2 1 
ATOM   2813 N  N   . PHE A 1 379 ? -27.755 50.002 -3.727  1.00 31.86  ? 359 PHE A N   1 
ATOM   2814 C  CA  . PHE A 1 379 ? -28.897 50.891 -3.952  1.00 26.70  ? 359 PHE A CA  1 
ATOM   2815 C  C   . PHE A 1 379 ? -29.143 51.768 -2.738  1.00 33.96  ? 359 PHE A C   1 
ATOM   2816 O  O   . PHE A 1 379 ? -29.183 52.996 -2.847  1.00 38.34  ? 359 PHE A O   1 
ATOM   2817 C  CB  . PHE A 1 379 ? -30.170 50.100 -4.221  1.00 26.38  ? 359 PHE A CB  1 
ATOM   2818 C  CG  . PHE A 1 379 ? -30.198 49.423 -5.557  1.00 28.01  ? 359 PHE A CG  1 
ATOM   2819 C  CD1 . PHE A 1 379 ? -29.808 50.097 -6.699  1.00 27.61  ? 359 PHE A CD1 1 
ATOM   2820 C  CD2 . PHE A 1 379 ? -30.624 48.109 -5.670  1.00 27.65  ? 359 PHE A CD2 1 
ATOM   2821 C  CE1 . PHE A 1 379 ? -29.836 49.468 -7.935  1.00 28.31  ? 359 PHE A CE1 1 
ATOM   2822 C  CE2 . PHE A 1 379 ? -30.654 47.474 -6.900  1.00 25.41  ? 359 PHE A CE2 1 
ATOM   2823 C  CZ  . PHE A 1 379 ? -30.261 48.151 -8.034  1.00 25.93  ? 359 PHE A CZ  1 
ATOM   2824 N  N   . THR A 1 380 ? -29.321 51.128 -1.583  1.00 37.03  ? 360 THR A N   1 
ATOM   2825 C  CA  . THR A 1 380 ? -29.525 51.845 -0.328  1.00 38.83  ? 360 THR A CA  1 
ATOM   2826 C  C   . THR A 1 380 ? -28.358 52.800 -0.079  1.00 40.01  ? 360 THR A C   1 
ATOM   2827 O  O   . THR A 1 380 ? -28.530 53.893 0.458   1.00 42.81  ? 360 THR A O   1 
ATOM   2828 C  CB  . THR A 1 380 ? -29.649 50.868 0.862   1.00 41.68  ? 360 THR A CB  1 
ATOM   2829 O  OG1 . THR A 1 380 ? -30.707 49.930 0.615   1.00 43.20  ? 360 THR A OG1 1 
ATOM   2830 C  CG2 . THR A 1 380 ? -29.933 51.617 2.150   1.00 41.95  ? 360 THR A CG2 1 
ATOM   2831 N  N   . TRP A 1 381 ? -27.172 52.379 -0.496  1.00 35.31  ? 361 TRP A N   1 
ATOM   2832 C  CA  . TRP A 1 381 ? -25.959 53.156 -0.305  1.00 29.91  ? 361 TRP A CA  1 
ATOM   2833 C  C   . TRP A 1 381 ? -25.875 54.391 -1.205  1.00 34.21  ? 361 TRP A C   1 
ATOM   2834 O  O   . TRP A 1 381 ? -25.354 55.435 -0.797  1.00 38.18  ? 361 TRP A O   1 
ATOM   2835 C  CB  . TRP A 1 381 ? -24.760 52.267 -0.595  1.00 28.80  ? 361 TRP A CB  1 
ATOM   2836 C  CG  . TRP A 1 381 ? -23.473 52.969 -0.451  1.00 30.31  ? 361 TRP A CG  1 
ATOM   2837 C  CD1 . TRP A 1 381 ? -23.163 53.909 0.474   1.00 29.43  ? 361 TRP A CD1 1 
ATOM   2838 C  CD2 . TRP A 1 381 ? -22.307 52.804 -1.267  1.00 30.87  ? 361 TRP A CD2 1 
ATOM   2839 N  NE1 . TRP A 1 381 ? -21.876 54.341 0.296   1.00 33.93  ? 361 TRP A NE1 1 
ATOM   2840 C  CE2 . TRP A 1 381 ? -21.325 53.675 -0.766  1.00 32.79  ? 361 TRP A CE2 1 
ATOM   2841 C  CE3 . TRP A 1 381 ? -21.999 51.998 -2.368  1.00 28.85  ? 361 TRP A CE3 1 
ATOM   2842 C  CZ2 . TRP A 1 381 ? -20.052 53.772 -1.324  1.00 31.12  ? 361 TRP A CZ2 1 
ATOM   2843 C  CZ3 . TRP A 1 381 ? -20.736 52.095 -2.925  1.00 30.99  ? 361 TRP A CZ3 1 
ATOM   2844 C  CH2 . TRP A 1 381 ? -19.776 52.976 -2.401  1.00 29.69  ? 361 TRP A CH2 1 
ATOM   2845 N  N   . SER A 1 382 ? -26.376 54.265 -2.432  1.00 34.52  ? 362 SER A N   1 
ATOM   2846 C  CA  . SER A 1 382 ? -26.147 55.272 -3.465  1.00 34.88  ? 362 SER A CA  1 
ATOM   2847 C  C   . SER A 1 382 ? -27.354 56.143 -3.683  1.00 39.12  ? 362 SER A C   1 
ATOM   2848 O  O   . SER A 1 382 ? -27.218 57.345 -3.900  1.00 42.57  ? 362 SER A O   1 
ATOM   2849 C  CB  . SER A 1 382 ? -25.794 54.604 -4.785  1.00 32.54  ? 362 SER A CB  1 
ATOM   2850 O  OG  . SER A 1 382 ? -26.820 53.707 -5.158  1.00 32.94  ? 362 SER A OG  1 
ATOM   2851 N  N   . LEU A 1 383 ? -28.528 55.524 -3.633  1.00 36.50  ? 363 LEU A N   1 
ATOM   2852 C  CA  . LEU A 1 383 ? -29.795 56.221 -3.853  1.00 37.02  ? 363 LEU A CA  1 
ATOM   2853 C  C   . LEU A 1 383 ? -29.886 57.637 -3.242  1.00 36.85  ? 363 LEU A C   1 
ATOM   2854 O  O   . LEU A 1 383 ? -30.249 58.572 -3.951  1.00 37.25  ? 363 LEU A O   1 
ATOM   2855 C  CB  . LEU A 1 383 ? -30.973 55.341 -3.422  1.00 37.65  ? 363 LEU A CB  1 
ATOM   2856 C  CG  . LEU A 1 383 ? -32.371 55.846 -3.751  1.00 35.67  ? 363 LEU A CG  1 
ATOM   2857 C  CD1 . LEU A 1 383 ? -32.426 56.258 -5.205  1.00 30.12  ? 363 LEU A CD1 1 
ATOM   2858 C  CD2 . LEU A 1 383 ? -33.400 54.752 -3.456  1.00 36.11  ? 363 LEU A CD2 1 
ATOM   2859 N  N   . PRO A 1 384 ? -29.536 57.802 -1.944  1.00 40.73  ? 364 PRO A N   1 
ATOM   2860 C  CA  . PRO A 1 384 ? -29.480 59.139 -1.336  1.00 37.36  ? 364 PRO A CA  1 
ATOM   2861 C  C   . PRO A 1 384 ? -28.625 60.117 -2.122  1.00 37.93  ? 364 PRO A C   1 
ATOM   2862 O  O   . PRO A 1 384 ? -29.010 61.283 -2.299  1.00 41.38  ? 364 PRO A O   1 
ATOM   2863 C  CB  . PRO A 1 384 ? -28.787 58.878 -0.001  1.00 38.16  ? 364 PRO A CB  1 
ATOM   2864 C  CG  . PRO A 1 384 ? -29.208 57.515 0.357   1.00 40.08  ? 364 PRO A CG  1 
ATOM   2865 C  CD  . PRO A 1 384 ? -29.274 56.753 -0.937  1.00 43.11  ? 364 PRO A CD  1 
ATOM   2866 N  N   . PHE A 1 385 ? -27.465 59.646 -2.568  1.00 33.44  ? 365 PHE A N   1 
ATOM   2867 C  CA  . PHE A 1 385 ? -26.544 60.494 -3.308  1.00 33.03  ? 365 PHE A CA  1 
ATOM   2868 C  C   . PHE A 1 385 ? -27.190 60.851 -4.636  1.00 35.99  ? 365 PHE A C   1 
ATOM   2869 O  O   . PHE A 1 385 ? -27.189 62.008 -5.051  1.00 38.77  ? 365 PHE A O   1 
ATOM   2870 C  CB  . PHE A 1 385 ? -25.215 59.775 -3.519  1.00 32.83  ? 365 PHE A CB  1 
ATOM   2871 C  CG  . PHE A 1 385 ? -24.193 60.586 -4.261  1.00 32.17  ? 365 PHE A CG  1 
ATOM   2872 C  CD1 . PHE A 1 385 ? -23.518 61.612 -3.633  1.00 34.56  ? 365 PHE A CD1 1 
ATOM   2873 C  CD2 . PHE A 1 385 ? -23.892 60.305 -5.582  1.00 31.75  ? 365 PHE A CD2 1 
ATOM   2874 C  CE1 . PHE A 1 385 ? -22.570 62.359 -4.318  1.00 37.21  ? 365 PHE A CE1 1 
ATOM   2875 C  CE2 . PHE A 1 385 ? -22.941 61.047 -6.274  1.00 34.12  ? 365 PHE A CE2 1 
ATOM   2876 C  CZ  . PHE A 1 385 ? -22.284 62.072 -5.644  1.00 38.44  ? 365 PHE A CZ  1 
ATOM   2877 N  N   . VAL A 1 386 ? -27.752 59.845 -5.289  1.00 37.38  ? 366 VAL A N   1 
ATOM   2878 C  CA  . VAL A 1 386 ? -28.475 60.059 -6.526  1.00 36.65  ? 366 VAL A CA  1 
ATOM   2879 C  C   . VAL A 1 386 ? -29.546 61.127 -6.314  1.00 43.39  ? 366 VAL A C   1 
ATOM   2880 O  O   . VAL A 1 386 ? -29.541 62.164 -6.982  1.00 46.14  ? 366 VAL A O   1 
ATOM   2881 C  CB  . VAL A 1 386 ? -29.115 58.747 -7.029  1.00 30.76  ? 366 VAL A CB  1 
ATOM   2882 C  CG1 . VAL A 1 386 ? -30.082 59.018 -8.160  1.00 29.62  ? 366 VAL A CG1 1 
ATOM   2883 C  CG2 . VAL A 1 386 ? -28.041 57.771 -7.469  1.00 29.13  ? 366 VAL A CG2 1 
ATOM   2884 N  N   . GLY A 1 387 ? -30.438 60.878 -5.361  1.00 39.58  ? 367 GLY A N   1 
ATOM   2885 C  CA  . GLY A 1 387 ? -31.511 61.803 -5.044  1.00 38.36  ? 367 GLY A CA  1 
ATOM   2886 C  C   . GLY A 1 387 ? -31.027 63.218 -4.796  1.00 39.19  ? 367 GLY A C   1 
ATOM   2887 O  O   . GLY A 1 387 ? -31.613 64.172 -5.293  1.00 45.02  ? 367 GLY A O   1 
ATOM   2888 N  N   . GLU A 1 388 ? -29.948 63.359 -4.038  1.00 39.50  ? 368 GLU A N   1 
ATOM   2889 C  CA  . GLU A 1 388 ? -29.407 64.678 -3.743  1.00 40.13  ? 368 GLU A CA  1 
ATOM   2890 C  C   . GLU A 1 388 ? -28.850 65.386 -4.988  1.00 41.09  ? 368 GLU A C   1 
ATOM   2891 O  O   . GLU A 1 388 ? -29.054 66.578 -5.165  1.00 44.03  ? 368 GLU A O   1 
ATOM   2892 C  CB  . GLU A 1 388 ? -28.336 64.577 -2.655  1.00 40.18  ? 368 GLU A CB  1 
ATOM   2893 C  CG  . GLU A 1 388 ? -27.578 65.869 -2.386  1.00 52.41  ? 368 GLU A CG  1 
ATOM   2894 C  CD  . GLU A 1 388 ? -26.332 65.644 -1.529  1.00 59.47  ? 368 GLU A CD  1 
ATOM   2895 O  OE1 . GLU A 1 388 ? -26.366 64.746 -0.655  1.00 59.87  ? 368 GLU A OE1 1 
ATOM   2896 O  OE2 . GLU A 1 388 ? -25.317 66.356 -1.737  1.00 60.84  ? 368 GLU A OE2 1 
ATOM   2897 N  N   . LYS A 1 389 ? -28.170 64.647 -5.858  1.00 41.51  ? 369 LYS A N   1 
ATOM   2898 C  CA  . LYS A 1 389 ? -27.426 65.251 -6.965  1.00 40.77  ? 369 LYS A CA  1 
ATOM   2899 C  C   . LYS A 1 389 ? -28.282 65.589 -8.187  1.00 37.23  ? 369 LYS A C   1 
ATOM   2900 O  O   . LYS A 1 389 ? -28.040 66.589 -8.875  1.00 36.66  ? 369 LYS A O   1 
ATOM   2901 C  CB  . LYS A 1 389 ? -26.250 64.356 -7.370  1.00 41.91  ? 369 LYS A CB  1 
ATOM   2902 C  CG  . LYS A 1 389 ? -25.135 64.309 -6.333  1.00 44.65  ? 369 LYS A CG  1 
ATOM   2903 C  CD  . LYS A 1 389 ? -24.632 65.711 -6.045  1.00 48.89  ? 369 LYS A CD  1 
ATOM   2904 C  CE  . LYS A 1 389 ? -23.347 65.718 -5.235  1.00 51.43  ? 369 LYS A CE  1 
ATOM   2905 N  NZ  . LYS A 1 389 ? -22.650 67.028 -5.398  1.00 53.16  ? 369 LYS A NZ  1 
ATOM   2906 N  N   . VAL A 1 390 ? -29.276 64.753 -8.471  1.00 34.28  ? 370 VAL A N   1 
ATOM   2907 C  CA  . VAL A 1 390 ? -30.192 65.070 -9.556  1.00 32.46  ? 370 VAL A CA  1 
ATOM   2908 C  C   . VAL A 1 390 ? -31.110 66.226 -9.140  1.00 34.06  ? 370 VAL A C   1 
ATOM   2909 O  O   . VAL A 1 390 ? -31.379 67.123 -9.932  1.00 36.74  ? 370 VAL A O   1 
ATOM   2910 C  CB  . VAL A 1 390 ? -30.979 63.829 -10.083 1.00 36.21  ? 370 VAL A CB  1 
ATOM   2911 C  CG1 . VAL A 1 390 ? -30.033 62.681 -10.356 1.00 34.29  ? 370 VAL A CG1 1 
ATOM   2912 C  CG2 . VAL A 1 390 ? -32.053 63.393 -9.121  1.00 40.10  ? 370 VAL A CG2 1 
ATOM   2913 N  N   . THR A 1 391 ? -31.556 66.226 -7.889  1.00 33.71  ? 371 THR A N   1 
ATOM   2914 C  CA  . THR A 1 391 ? -32.419 67.293 -7.407  1.00 34.30  ? 371 THR A CA  1 
ATOM   2915 C  C   . THR A 1 391 ? -31.649 68.587 -7.360  1.00 35.39  ? 371 THR A C   1 
ATOM   2916 O  O   . THR A 1 391 ? -32.195 69.643 -7.653  1.00 38.05  ? 371 THR A O   1 
ATOM   2917 C  CB  . THR A 1 391 ? -32.980 66.995 -6.017  1.00 34.57  ? 371 THR A CB  1 
ATOM   2918 O  OG1 . THR A 1 391 ? -33.610 65.711 -6.032  1.00 37.33  ? 371 THR A OG1 1 
ATOM   2919 C  CG2 . THR A 1 391 ? -34.013 68.036 -5.628  1.00 35.40  ? 371 THR A CG2 1 
ATOM   2920 N  N   . GLU A 1 392 ? -30.374 68.498 -6.997  1.00 38.22  ? 372 GLU A N   1 
ATOM   2921 C  CA  . GLU A 1 392 ? -29.497 69.663 -6.968  1.00 41.67  ? 372 GLU A CA  1 
ATOM   2922 C  C   . GLU A 1 392 ? -29.358 70.258 -8.366  1.00 43.63  ? 372 GLU A C   1 
ATOM   2923 O  O   . GLU A 1 392 ? -29.407 71.472 -8.555  1.00 42.09  ? 372 GLU A O   1 
ATOM   2924 C  CB  . GLU A 1 392 ? -28.130 69.263 -6.434  1.00 44.32  ? 372 GLU A CB  1 
ATOM   2925 C  CG  . GLU A 1 392 ? -27.087 70.349 -6.476  1.00 53.26  ? 372 GLU A CG  1 
ATOM   2926 C  CD  . GLU A 1 392 ? -25.763 69.899 -5.870  1.00 61.57  ? 372 GLU A CD  1 
ATOM   2927 O  OE1 . GLU A 1 392 ? -25.781 69.165 -4.849  1.00 61.57  ? 372 GLU A OE1 1 
ATOM   2928 O  OE2 . GLU A 1 392 ? -24.704 70.278 -6.422  1.00 64.73  ? 372 GLU A OE2 1 
ATOM   2929 N  N   . MET A 1 393 ? -29.201 69.381 -9.347  1.00 38.90  ? 373 MET A N   1 
ATOM   2930 C  CA  . MET A 1 393 ? -29.035 69.792 -10.730 1.00 39.52  ? 373 MET A CA  1 
ATOM   2931 C  C   . MET A 1 393 ? -30.264 70.523 -11.247 1.00 42.45  ? 373 MET A C   1 
ATOM   2932 O  O   . MET A 1 393 ? -30.157 71.579 -11.859 1.00 43.40  ? 373 MET A O   1 
ATOM   2933 C  CB  . MET A 1 393 ? -28.769 68.564 -11.598 1.00 35.76  ? 373 MET A CB  1 
ATOM   2934 C  CG  . MET A 1 393 ? -29.001 68.792 -13.073 1.00 34.35  ? 373 MET A CG  1 
ATOM   2935 S  SD  . MET A 1 393 ? -28.625 67.317 -14.022 1.00 40.25  ? 373 MET A SD  1 
ATOM   2936 C  CE  . MET A 1 393 ? -29.036 67.878 -15.663 1.00 33.22  ? 373 MET A CE  1 
ATOM   2937 N  N   . LEU A 1 394 ? -31.433 69.945 -11.012 1.00 39.95  ? 374 LEU A N   1 
ATOM   2938 C  CA  . LEU A 1 394 ? -32.672 70.555 -11.465 1.00 39.58  ? 374 LEU A CA  1 
ATOM   2939 C  C   . LEU A 1 394 ? -32.927 71.892 -10.806 1.00 40.79  ? 374 LEU A C   1 
ATOM   2940 O  O   . LEU A 1 394 ? -33.468 72.799 -11.434 1.00 39.06  ? 374 LEU A O   1 
ATOM   2941 C  CB  . LEU A 1 394 ? -33.861 69.636 -11.210 1.00 38.75  ? 374 LEU A CB  1 
ATOM   2942 C  CG  . LEU A 1 394 ? -33.859 68.427 -12.132 1.00 38.62  ? 374 LEU A CG  1 
ATOM   2943 C  CD1 . LEU A 1 394 ? -35.222 67.832 -12.144 1.00 39.70  ? 374 LEU A CD1 1 
ATOM   2944 C  CD2 . LEU A 1 394 ? -33.459 68.838 -13.529 1.00 37.54  ? 374 LEU A CD2 1 
ATOM   2945 N  N   . VAL A 1 395 ? -32.561 72.011 -9.535  1.00 37.03  ? 375 VAL A N   1 
ATOM   2946 C  CA  . VAL A 1 395 ? -32.755 73.270 -8.836  1.00 38.34  ? 375 VAL A CA  1 
ATOM   2947 C  C   . VAL A 1 395 ? -31.840 74.340 -9.436  1.00 39.62  ? 375 VAL A C   1 
ATOM   2948 O  O   . VAL A 1 395 ? -32.270 75.469 -9.693  1.00 42.07  ? 375 VAL A O   1 
ATOM   2949 C  CB  . VAL A 1 395 ? -32.545 73.116 -7.320  1.00 39.72  ? 375 VAL A CB  1 
ATOM   2950 C  CG1 . VAL A 1 395 ? -32.303 74.472 -6.663  1.00 40.54  ? 375 VAL A CG1 1 
ATOM   2951 C  CG2 . VAL A 1 395 ? -33.748 72.417 -6.705  1.00 38.43  ? 375 VAL A CG2 1 
ATOM   2952 N  N   . ASN A 1 396 ? -30.594 73.967 -9.703  1.00 46.66  ? 376 ASN A N   1 
ATOM   2953 C  CA  . ASN A 1 396 ? -29.675 74.870 -10.364 1.00 47.66  ? 376 ASN A CA  1 
ATOM   2954 C  C   . ASN A 1 396 ? -30.106 75.239 -11.775 1.00 47.39  ? 376 ASN A C   1 
ATOM   2955 O  O   . ASN A 1 396 ? -29.958 76.386 -12.192 1.00 51.35  ? 376 ASN A O   1 
ATOM   2956 C  CB  . ASN A 1 396 ? -28.274 74.293 -10.349 1.00 48.94  ? 376 ASN A CB  1 
ATOM   2957 C  CG  . ASN A 1 396 ? -27.674 74.329 -8.975  1.00 53.94  ? 376 ASN A CG  1 
ATOM   2958 O  OD1 . ASN A 1 396 ? -27.258 75.390 -8.507  1.00 53.64  ? 376 ASN A OD1 1 
ATOM   2959 N  ND2 . ASN A 1 396 ? -27.649 73.183 -8.299  1.00 58.90  ? 376 ASN A ND2 1 
ATOM   2960 N  N   . VAL A 1 397 ? -30.650 74.276 -12.507 1.00 38.25  ? 377 VAL A N   1 
ATOM   2961 C  CA  . VAL A 1 397 ? -31.194 74.565 -13.829 1.00 37.87  ? 377 VAL A CA  1 
ATOM   2962 C  C   . VAL A 1 397 ? -32.382 75.535 -13.760 1.00 38.34  ? 377 VAL A C   1 
ATOM   2963 O  O   . VAL A 1 397 ? -32.420 76.532 -14.475 1.00 38.92  ? 377 VAL A O   1 
ATOM   2964 C  CB  . VAL A 1 397 ? -31.634 73.281 -14.568 1.00 36.48  ? 377 VAL A CB  1 
ATOM   2965 C  CG1 . VAL A 1 397 ? -32.515 73.627 -15.735 1.00 36.14  ? 377 VAL A CG1 1 
ATOM   2966 C  CG2 . VAL A 1 397 ? -30.430 72.488 -15.037 1.00 36.11  ? 377 VAL A CG2 1 
ATOM   2967 N  N   . LEU A 1 398 ? -33.340 75.245 -12.886 1.00 38.92  ? 378 LEU A N   1 
ATOM   2968 C  CA  . LEU A 1 398 ? -34.579 76.015 -12.820 1.00 39.64  ? 378 LEU A CA  1 
ATOM   2969 C  C   . LEU A 1 398 ? -34.374 77.416 -12.275 1.00 46.41  ? 378 LEU A C   1 
ATOM   2970 O  O   . LEU A 1 398 ? -35.242 78.277 -12.408 1.00 49.14  ? 378 LEU A O   1 
ATOM   2971 C  CB  . LEU A 1 398 ? -35.600 75.290 -11.954 1.00 38.08  ? 378 LEU A CB  1 
ATOM   2972 C  CG  . LEU A 1 398 ? -36.134 74.012 -12.576 1.00 36.69  ? 378 LEU A CG  1 
ATOM   2973 C  CD1 . LEU A 1 398 ? -36.826 73.223 -11.496 1.00 36.42  ? 378 LEU A CD1 1 
ATOM   2974 C  CD2 . LEU A 1 398 ? -37.077 74.347 -13.696 1.00 36.33  ? 378 LEU A CD2 1 
ATOM   2975 N  N   . SER A 1 399 ? -33.227 77.643 -11.652 1.00 55.90  ? 379 SER A N   1 
ATOM   2976 C  CA  . SER A 1 399 ? -32.934 78.947 -11.088 1.00 56.14  ? 379 SER A CA  1 
ATOM   2977 C  C   . SER A 1 399 ? -32.236 79.842 -12.104 1.00 58.07  ? 379 SER A C   1 
ATOM   2978 O  O   . SER A 1 399 ? -31.735 80.910 -11.749 1.00 59.07  ? 379 SER A O   1 
ATOM   2979 C  CB  . SER A 1 399 ? -32.048 78.789 -9.860  1.00 53.42  ? 379 SER A CB  1 
ATOM   2980 O  OG  . SER A 1 399 ? -30.760 78.348 -10.249 1.00 53.12  ? 379 SER A OG  1 
ATOM   2981 N  N   . ILE A 1 400 ? -32.188 79.403 -13.361 1.00 58.88  ? 380 ILE A N   1 
ATOM   2982 C  CA  . ILE A 1 400 ? -31.585 80.207 -14.424 1.00 59.25  ? 380 ILE A CA  1 
ATOM   2983 C  C   . ILE A 1 400 ? -32.305 81.558 -14.553 1.00 61.64  ? 380 ILE A C   1 
ATOM   2984 O  O   . ILE A 1 400 ? -31.665 82.607 -14.699 1.00 67.57  ? 380 ILE A O   1 
ATOM   2985 C  CB  . ILE A 1 400 ? -31.529 79.451 -15.793 1.00 52.43  ? 380 ILE A CB  1 
ATOM   2986 C  CG1 . ILE A 1 400 ? -30.640 80.204 -16.785 1.00 54.30  ? 380 ILE A CG1 1 
ATOM   2987 C  CG2 . ILE A 1 400 ? -32.928 79.214 -16.390 1.00 51.36  ? 380 ILE A CG2 1 
ATOM   2988 C  CD1 . ILE A 1 400 ? -29.215 80.368 -16.306 1.00 57.12  ? 380 ILE A CD1 1 
ATOM   2989 N  N   . CYS A 1 401 ? -33.633 81.524 -14.480 1.00 54.90  ? 381 CYS A N   1 
ATOM   2990 C  CA  . CYS A 1 401 ? -34.427 82.737 -14.349 1.00 58.58  ? 381 CYS A CA  1 
ATOM   2991 C  C   . CYS A 1 401 ? -34.646 82.971 -12.861 1.00 71.23  ? 381 CYS A C   1 
ATOM   2992 O  O   . CYS A 1 401 ? -34.867 82.012 -12.108 1.00 75.54  ? 381 CYS A O   1 
ATOM   2993 C  CB  . CYS A 1 401 ? -35.772 82.576 -15.052 1.00 55.46  ? 381 CYS A CB  1 
ATOM   2994 S  SG  . CYS A 1 401 ? -35.645 82.299 -16.826 1.00 60.00  ? 381 CYS A SG  1 
ATOM   2995 N  N   . SER A 1 402 ? -34.566 84.227 -12.424 1.00 86.84  ? 382 SER A N   1 
ATOM   2996 C  CA  . SER A 1 402 ? -34.772 84.541 -11.009 1.00 93.87  ? 382 SER A CA  1 
ATOM   2997 C  C   . SER A 1 402 ? -35.853 85.606 -10.846 1.00 98.96  ? 382 SER A C   1 
ATOM   2998 O  O   . SER A 1 402 ? -35.558 86.780 -10.572 1.00 99.77  ? 382 SER A O   1 
ATOM   2999 C  CB  . SER A 1 402 ? -33.466 84.990 -10.349 1.00 97.54  ? 382 SER A CB  1 
ATOM   3000 O  OG  . SER A 1 402 ? -33.640 85.188 -8.956  1.00 101.52 ? 382 SER A OG  1 
ATOM   3001 N  N   . ASP A 1 403 ? -37.103 85.176 -11.015 1.00 97.29  ? 383 ASP A N   1 
ATOM   3002 C  CA  . ASP A 1 403 ? -38.260 86.064 -10.985 1.00 99.40  ? 383 ASP A CA  1 
ATOM   3003 C  C   . ASP A 1 403 ? -38.122 87.174 -12.023 1.00 99.70  ? 383 ASP A C   1 
ATOM   3004 O  O   . ASP A 1 403 ? -38.523 88.318 -11.791 1.00 99.11  ? 383 ASP A O   1 
ATOM   3005 C  CB  . ASP A 1 403 ? -38.510 86.576 -9.563  1.00 102.05 ? 383 ASP A CB  1 
ATOM   3006 C  CG  . ASP A 1 403 ? -38.601 85.440 -8.559  1.00 102.64 ? 383 ASP A CG  1 
ATOM   3007 O  OD1 . ASP A 1 403 ? -37.797 84.487 -8.656  1.00 96.79  ? 383 ASP A OD1 1 
ATOM   3008 O  OD2 . ASP A 1 403 ? -39.482 85.490 -7.680  1.00 106.31 ? 383 ASP A OD2 1 
ATOM   3009 N  N   . ASP A 1 404 ? -37.509 86.805 -13.153 1.00 117.25 ? 384 ASP A N   1 
ATOM   3010 C  CA  . ASP A 1 404 ? -37.687 87.507 -14.419 1.00 117.19 ? 384 ASP A CA  1 
ATOM   3011 C  C   . ASP A 1 404 ? -38.885 86.825 -15.070 1.00 117.04 ? 384 ASP A C   1 
ATOM   3012 O  O   . ASP A 1 404 ? -39.125 86.948 -16.273 1.00 116.59 ? 384 ASP A O   1 
ATOM   3013 C  CB  . ASP A 1 404 ? -36.463 87.351 -15.327 1.00 114.70 ? 384 ASP A CB  1 
ATOM   3014 C  CG  . ASP A 1 404 ? -35.224 86.915 -14.578 1.00 114.48 ? 384 ASP A CG  1 
ATOM   3015 O  OD1 . ASP A 1 404 ? -35.117 87.199 -13.367 1.00 116.40 ? 384 ASP A OD1 1 
ATOM   3016 O  OD2 . ASP A 1 404 ? -34.344 86.278 -15.204 1.00 112.34 ? 384 ASP A OD2 1 
ATOM   3017 N  N   . GLU A 1 405 ? -39.613 86.074 -14.247 1.00 95.49  ? 385 GLU A N   1 
ATOM   3018 C  CA  . GLU A 1 405 ? -40.795 85.342 -14.667 1.00 94.50  ? 385 GLU A CA  1 
ATOM   3019 C  C   . GLU A 1 405 ? -42.046 86.113 -14.280 1.00 100.25 ? 385 GLU A C   1 
ATOM   3020 O  O   . GLU A 1 405 ? -43.154 85.576 -14.318 1.00 102.89 ? 385 GLU A O   1 
ATOM   3021 C  CB  . GLU A 1 405 ? -40.804 83.963 -14.022 1.00 89.27  ? 385 GLU A CB  1 
ATOM   3022 C  CG  . GLU A 1 405 ? -39.774 83.022 -14.608 1.00 87.21  ? 385 GLU A CG  1 
ATOM   3023 C  CD  . GLU A 1 405 ? -39.292 82.005 -13.605 1.00 86.86  ? 385 GLU A CD  1 
ATOM   3024 O  OE1 . GLU A 1 405 ? -39.765 82.048 -12.452 1.00 90.11  ? 385 GLU A OE1 1 
ATOM   3025 O  OE2 . GLU A 1 405 ? -38.443 81.167 -13.970 1.00 83.13  ? 385 GLU A OE2 1 
ATOM   3026 N  N   . LEU A 1 406 ? -41.859 87.376 -13.908 1.00 104.11 ? 386 LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 406 ? -42.978 88.263 -13.612 1.00 99.14  ? 386 LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 406 ? -43.436 89.004 -14.871 1.00 95.14  ? 386 LEU A C   1 
ATOM   3029 O  O   . LEU A 1 406 ? -42.634 89.624 -15.574 1.00 90.87  ? 386 LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 406 ? -42.606 89.263 -12.510 1.00 98.63  ? 386 LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 406 ? -42.741 88.840 -11.041 1.00 96.69  ? 386 LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 406 ? -41.601 87.921 -10.588 1.00 91.48  ? 386 LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 406 ? -42.843 90.071 -10.139 1.00 96.09  ? 386 LEU A CD2 1 
ATOM   3034 N  N   . ALA A 1 436 ? -21.767 65.355 -1.652  1.00 68.27  ? 416 ALA A N   1 
ATOM   3035 C  CA  . ALA A 1 436 ? -20.311 65.598 -1.445  1.00 68.72  ? 416 ALA A CA  1 
ATOM   3036 C  C   . ALA A 1 436 ? -19.474 65.787 -2.752  1.00 68.24  ? 416 ALA A C   1 
ATOM   3037 O  O   . ALA A 1 436 ? -18.234 66.028 -2.662  1.00 68.68  ? 416 ALA A O   1 
ATOM   3038 C  CB  . ALA A 1 436 ? -19.661 64.470 -0.535  1.00 69.02  ? 416 ALA A CB  1 
ATOM   3039 N  N   . ARG A 1 437 ? -20.131 65.672 -3.922  1.00 139.02 ? 417 ARG A N   1 
ATOM   3040 C  CA  . ARG A 1 437 ? -19.471 65.656 -5.255  1.00 138.47 ? 417 ARG A CA  1 
ATOM   3041 C  C   . ARG A 1 437 ? -18.859 64.276 -5.623  1.00 138.06 ? 417 ARG A C   1 
ATOM   3042 O  O   . ARG A 1 437 ? -18.634 63.972 -6.799  1.00 137.49 ? 417 ARG A O   1 
ATOM   3043 C  CB  . ARG A 1 437 ? -18.499 66.849 -5.452  1.00 128.98 ? 417 ARG A CB  1 
ATOM   3044 C  CG  . ARG A 1 437 ? -17.177 66.543 -6.148  1.00 128.90 ? 417 ARG A CG  1 
ATOM   3045 C  CD  . ARG A 1 437 ? -17.252 66.568 -7.690  1.00 128.14 ? 417 ARG A CD  1 
ATOM   3046 N  NE  . ARG A 1 437 ? -16.199 65.739 -8.284  1.00 127.98 ? 417 ARG A NE  1 
ATOM   3047 C  CZ  . ARG A 1 437 ? -14.947 66.147 -8.502  1.00 128.44 ? 417 ARG A CZ  1 
ATOM   3048 N  NH1 . ARG A 1 437 ? -14.061 65.314 -9.037  1.00 128.38 ? 417 ARG A NH1 1 
ATOM   3049 N  NH2 . ARG A 1 437 ? -14.571 67.384 -8.181  1.00 129.07 ? 417 ARG A NH2 1 
ATOM   3050 N  N   . TYR A 1 438 ? -18.630 63.443 -4.605  1.00 138.82 ? 418 TYR A N   1 
ATOM   3051 C  CA  . TYR A 1 438 ? -18.406 62.003 -4.779  1.00 138.53 ? 418 TYR A CA  1 
ATOM   3052 C  C   . TYR A 1 438 ? -19.087 61.186 -3.670  1.00 138.75 ? 418 TYR A C   1 
ATOM   3053 O  O   . TYR A 1 438 ? -19.114 61.591 -2.502  1.00 139.39 ? 418 TYR A O   1 
ATOM   3054 C  CB  . TYR A 1 438 ? -16.915 61.646 -4.860  1.00 128.95 ? 418 TYR A CB  1 
ATOM   3055 C  CG  . TYR A 1 438 ? -16.414 61.343 -6.268  1.00 128.45 ? 418 TYR A CG  1 
ATOM   3056 C  CD1 . TYR A 1 438 ? -17.262 61.437 -7.367  1.00 127.65 ? 418 TYR A CD1 1 
ATOM   3057 C  CD2 . TYR A 1 438 ? -15.091 60.952 -6.496  1.00 128.87 ? 418 TYR A CD2 1 
ATOM   3058 C  CE1 . TYR A 1 438 ? -16.812 61.165 -8.651  1.00 127.26 ? 418 TYR A CE1 1 
ATOM   3059 C  CE2 . TYR A 1 438 ? -14.633 60.675 -7.782  1.00 128.50 ? 418 TYR A CE2 1 
ATOM   3060 C  CZ  . TYR A 1 438 ? -15.502 60.785 -8.856  1.00 127.67 ? 418 TYR A CZ  1 
ATOM   3061 O  OH  . TYR A 1 438 ? -15.064 60.513 -10.135 1.00 127.35 ? 418 TYR A OH  1 
ATOM   3062 N  N   . LEU A 1 439 ? -19.656 60.045 -4.062  1.00 68.27  ? 419 LEU A N   1 
ATOM   3063 C  CA  . LEU A 1 439 ? -20.180 59.048 -3.130  1.00 67.82  ? 419 LEU A CA  1 
ATOM   3064 C  C   . LEU A 1 439 ? -18.977 58.618 -2.312  1.00 78.21  ? 419 LEU A C   1 
ATOM   3065 O  O   . LEU A 1 439 ? -17.835 58.785 -2.753  1.00 83.28  ? 419 LEU A O   1 
ATOM   3066 C  CB  . LEU A 1 439 ? -20.770 57.870 -3.918  1.00 58.82  ? 419 LEU A CB  1 
ATOM   3067 C  CG  . LEU A 1 439 ? -21.594 56.717 -3.349  1.00 50.11  ? 419 LEU A CG  1 
ATOM   3068 C  CD1 . LEU A 1 439 ? -22.487 57.161 -2.222  1.00 43.24  ? 419 LEU A CD1 1 
ATOM   3069 C  CD2 . LEU A 1 439 ? -22.447 56.137 -4.431  1.00 52.14  ? 419 LEU A CD2 1 
ATOM   3070 N  N   . SER A 1 440 ? -19.209 58.095 -1.116  1.00 76.40  ? 420 SER A N   1 
ATOM   3071 C  CA  . SER A 1 440 ? -18.101 57.605 -0.308  1.00 75.51  ? 420 SER A CA  1 
ATOM   3072 C  C   . SER A 1 440 ? -18.546 56.496 0.621   1.00 78.83  ? 420 SER A C   1 
ATOM   3073 O  O   . SER A 1 440 ? -19.613 56.581 1.239   1.00 76.52  ? 420 SER A O   1 
ATOM   3074 C  CB  . SER A 1 440 ? -17.453 58.732 0.499   1.00 70.95  ? 420 SER A CB  1 
ATOM   3075 O  OG  . SER A 1 440 ? -16.153 58.349 0.907   1.00 71.83  ? 420 SER A OG  1 
ATOM   3076 N  N   . VAL A 1 441 ? -17.710 55.464 0.700   1.00 87.02  ? 421 VAL A N   1 
ATOM   3077 C  CA  . VAL A 1 441 ? -17.914 54.360 1.621   1.00 86.20  ? 421 VAL A CA  1 
ATOM   3078 C  C   . VAL A 1 441 ? -18.298 54.915 2.981   1.00 96.29  ? 421 VAL A C   1 
ATOM   3079 O  O   . VAL A 1 441 ? -17.604 55.774 3.521   1.00 97.54  ? 421 VAL A O   1 
ATOM   3080 C  CB  . VAL A 1 441 ? -16.640 53.537 1.790   1.00 72.75  ? 421 VAL A CB  1 
ATOM   3081 C  CG1 . VAL A 1 441 ? -16.947 52.257 2.529   1.00 66.75  ? 421 VAL A CG1 1 
ATOM   3082 C  CG2 . VAL A 1 441 ? -16.010 53.253 0.434   1.00 66.60  ? 421 VAL A CG2 1 
ATOM   3083 N  N   . LEU A 1 442 ? -19.403 54.417 3.530   1.00 100.33 ? 422 LEU A N   1 
ATOM   3084 C  CA  . LEU A 1 442 ? -19.921 54.886 4.817   1.00 101.18 ? 422 LEU A CA  1 
ATOM   3085 C  C   . LEU A 1 442 ? -18.890 54.750 5.968   1.00 105.55 ? 422 LEU A C   1 
ATOM   3086 O  O   . LEU A 1 442 ? -19.153 55.148 7.107   1.00 106.24 ? 422 LEU A O   1 
ATOM   3087 C  CB  . LEU A 1 442 ? -21.203 54.128 5.182   1.00 95.74  ? 422 LEU A CB  1 
ATOM   3088 C  CG  . LEU A 1 442 ? -22.296 54.902 5.917   1.00 90.05  ? 422 LEU A CG  1 
ATOM   3089 C  CD1 . LEU A 1 442 ? -23.139 55.686 4.912   1.00 87.91  ? 422 LEU A CD1 1 
ATOM   3090 C  CD2 . LEU A 1 442 ? -23.161 53.982 6.796   1.00 85.66  ? 422 LEU A CD2 1 
ATOM   3091 N  N   . SER A 1 498 ? 0.629   50.839 13.557  1.00 95.28  ? 478 SER A N   1 
ATOM   3092 C  CA  . SER A 1 498 ? -0.554  50.071 13.160  1.00 97.81  ? 478 SER A CA  1 
ATOM   3093 C  C   . SER A 1 498 ? -1.339  49.429 14.334  1.00 106.57 ? 478 SER A C   1 
ATOM   3094 O  O   . SER A 1 498 ? -2.558  49.601 14.409  1.00 105.39 ? 478 SER A O   1 
ATOM   3095 C  CB  . SER A 1 498 ? -0.208  49.024 12.081  1.00 93.76  ? 478 SER A CB  1 
ATOM   3096 O  OG  . SER A 1 498 ? 0.702   48.033 12.556  1.00 92.53  ? 478 SER A OG  1 
ATOM   3097 N  N   . PHE A 1 499 ? -0.662  48.709 15.242  1.00 112.92 ? 479 PHE A N   1 
ATOM   3098 C  CA  . PHE A 1 499 ? -1.347  48.070 16.385  1.00 112.79 ? 479 PHE A CA  1 
ATOM   3099 C  C   . PHE A 1 499 ? -1.753  49.084 17.464  1.00 113.84 ? 479 PHE A C   1 
ATOM   3100 O  O   . PHE A 1 499 ? -2.912  49.119 17.881  1.00 111.68 ? 479 PHE A O   1 
ATOM   3101 C  CB  . PHE A 1 499 ? -0.517  46.924 17.002  1.00 112.75 ? 479 PHE A CB  1 
ATOM   3102 C  CG  . PHE A 1 499 ? -1.305  46.032 17.950  1.00 107.85 ? 479 PHE A CG  1 
ATOM   3103 C  CD1 . PHE A 1 499 ? -1.439  46.359 19.300  1.00 107.39 ? 479 PHE A CD1 1 
ATOM   3104 C  CD2 . PHE A 1 499 ? -1.918  44.871 17.487  1.00 98.36  ? 479 PHE A CD2 1 
ATOM   3105 C  CE1 . PHE A 1 499 ? -2.174  45.548 20.168  1.00 103.81 ? 479 PHE A CE1 1 
ATOM   3106 C  CE2 . PHE A 1 499 ? -2.651  44.056 18.353  1.00 93.75  ? 479 PHE A CE2 1 
ATOM   3107 C  CZ  . PHE A 1 499 ? -2.773  44.402 19.694  1.00 96.74  ? 479 PHE A CZ  1 
ATOM   3108 N  N   . GLU A 1 500 ? -0.803  49.901 17.913  1.00 117.90 ? 480 GLU A N   1 
ATOM   3109 C  CA  . GLU A 1 500 ? -1.089  50.922 18.918  1.00 114.79 ? 480 GLU A CA  1 
ATOM   3110 C  C   . GLU A 1 500 ? -2.011  52.001 18.350  1.00 111.03 ? 480 GLU A C   1 
ATOM   3111 O  O   . GLU A 1 500 ? -2.856  52.554 19.063  1.00 105.75 ? 480 GLU A O   1 
ATOM   3112 C  CB  . GLU A 1 500 ? 0.213   51.540 19.442  1.00 113.35 ? 480 GLU A CB  1 
ATOM   3113 C  CG  . GLU A 1 500 ? 0.390   51.432 20.951  1.00 115.37 ? 480 GLU A CG  1 
ATOM   3114 C  CD  . GLU A 1 500 ? 0.116   50.030 21.475  1.00 119.45 ? 480 GLU A CD  1 
ATOM   3115 O  OE1 . GLU A 1 500 ? 0.605   49.047 20.871  1.00 121.40 ? 480 GLU A OE1 1 
ATOM   3116 O  OE2 . GLU A 1 500 ? -0.601  49.911 22.492  1.00 119.31 ? 480 GLU A OE2 1 
ATOM   3117 N  N   . GLU A 1 501 ? -1.845  52.278 17.059  1.00 110.35 ? 481 GLU A N   1 
ATOM   3118 C  CA  . GLU A 1 501 ? -2.629  53.294 16.369  1.00 110.80 ? 481 GLU A CA  1 
ATOM   3119 C  C   . GLU A 1 501 ? -4.094  52.880 16.163  1.00 108.11 ? 481 GLU A C   1 
ATOM   3120 O  O   . GLU A 1 501 ? -5.003  53.704 16.274  1.00 104.70 ? 481 GLU A O   1 
ATOM   3121 C  CB  . GLU A 1 501 ? -1.971  53.628 15.024  1.00 111.60 ? 481 GLU A CB  1 
ATOM   3122 C  CG  . GLU A 1 501 ? -2.279  55.027 14.486  1.00 110.52 ? 481 GLU A CG  1 
ATOM   3123 C  CD  . GLU A 1 501 ? -1.675  55.260 13.109  1.00 109.03 ? 481 GLU A CD  1 
ATOM   3124 O  OE1 . GLU A 1 501 ? -1.875  56.358 12.538  1.00 106.53 ? 481 GLU A OE1 1 
ATOM   3125 O  OE2 . GLU A 1 501 ? -1.002  54.336 12.599  1.00 109.87 ? 481 GLU A OE2 1 
ATOM   3126 N  N   . ALA A 1 502 ? -4.320  51.607 15.853  1.00 107.23 ? 482 ALA A N   1 
ATOM   3127 C  CA  . ALA A 1 502 ? -5.672  51.112 15.612  1.00 105.36 ? 482 ALA A CA  1 
ATOM   3128 C  C   . ALA A 1 502 ? -6.379  50.686 16.899  1.00 106.70 ? 482 ALA A C   1 
ATOM   3129 O  O   . ALA A 1 502 ? -7.580  50.412 16.891  1.00 105.14 ? 482 ALA A O   1 
ATOM   3130 C  CB  . ALA A 1 502 ? -5.647  49.966 14.620  1.00 104.31 ? 482 ALA A CB  1 
ATOM   3131 N  N   . LYS A 1 503 ? -5.629  50.626 17.998  1.00 108.02 ? 483 LYS A N   1 
ATOM   3132 C  CA  . LYS A 1 503 ? -6.163  50.212 19.298  1.00 105.13 ? 483 LYS A CA  1 
ATOM   3133 C  C   . LYS A 1 503 ? -6.775  51.402 20.041  1.00 105.50 ? 483 LYS A C   1 
ATOM   3134 O  O   . LYS A 1 503 ? -7.697  51.245 20.850  1.00 101.68 ? 483 LYS A O   1 
ATOM   3135 C  CB  . LYS A 1 503 ? -5.051  49.562 20.135  1.00 104.57 ? 483 LYS A CB  1 
ATOM   3136 C  CG  . LYS A 1 503 ? -5.470  49.002 21.493  1.00 102.68 ? 483 LYS A CG  1 
ATOM   3137 C  CD  . LYS A 1 503 ? -4.305  48.253 22.138  1.00 100.70 ? 483 LYS A CD  1 
ATOM   3138 C  CE  . LYS A 1 503 ? -4.445  48.170 23.652  1.00 98.51  ? 483 LYS A CE  1 
ATOM   3139 N  NZ  . LYS A 1 503 ? -3.238  47.555 24.280  1.00 101.26 ? 483 LYS A NZ  1 
ATOM   3140 N  N   . GLY A 1 504 ? -6.254  52.593 19.748  1.00 115.47 ? 484 GLY A N   1 
ATOM   3141 C  CA  . GLY A 1 504 ? -6.743  53.826 20.337  1.00 113.11 ? 484 GLY A CA  1 
ATOM   3142 C  C   . GLY A 1 504 ? -7.919  54.411 19.577  1.00 112.35 ? 484 GLY A C   1 
ATOM   3143 O  O   . GLY A 1 504 ? -8.683  55.205 20.128  1.00 114.90 ? 484 GLY A O   1 
ATOM   3144 N  N   . LEU A 1 505 ? -8.060  54.024 18.311  1.00 103.42 ? 485 LEU A N   1 
ATOM   3145 C  CA  . LEU A 1 505 ? -9.205  54.430 17.498  1.00 99.63  ? 485 LEU A CA  1 
ATOM   3146 C  C   . LEU A 1 505 ? -10.386 53.490 17.721  1.00 99.50  ? 485 LEU A C   1 
ATOM   3147 O  O   . LEU A 1 505 ? -11.442 53.642 17.096  1.00 96.88  ? 485 LEU A O   1 
ATOM   3148 C  CB  . LEU A 1 505 ? -8.841  54.443 16.009  1.00 93.97  ? 485 LEU A CB  1 
ATOM   3149 C  CG  . LEU A 1 505 ? -7.976  55.589 15.481  1.00 89.32  ? 485 LEU A CG  1 
ATOM   3150 C  CD1 . LEU A 1 505 ? -7.623  55.332 14.023  1.00 86.68  ? 485 LEU A CD1 1 
ATOM   3151 C  CD2 . LEU A 1 505 ? -8.672  56.944 15.654  1.00 86.54  ? 485 LEU A CD2 1 
ATOM   3152 N  N   . ASP A 1 506 ? -10.202 52.524 18.619  1.00 104.48 ? 486 ASP A N   1 
ATOM   3153 C  CA  . ASP A 1 506 ? -11.183 51.463 18.819  1.00 103.20 ? 486 ASP A CA  1 
ATOM   3154 C  C   . ASP A 1 506 ? -11.528 51.227 20.290  1.00 103.81 ? 486 ASP A C   1 
ATOM   3155 O  O   . ASP A 1 506 ? -12.259 50.291 20.612  1.00 103.07 ? 486 ASP A O   1 
ATOM   3156 C  CB  . ASP A 1 506 ? -10.670 50.166 18.189  1.00 102.93 ? 486 ASP A CB  1 
ATOM   3157 C  CG  . ASP A 1 506 ? -11.757 49.134 18.022  1.00 101.55 ? 486 ASP A CG  1 
ATOM   3158 O  OD1 . ASP A 1 506 ? -12.786 49.462 17.386  1.00 98.67  ? 486 ASP A OD1 1 
ATOM   3159 O  OD2 . ASP A 1 506 ? -11.587 48.011 18.546  1.00 102.62 ? 486 ASP A OD2 1 
ATOM   3160 N  N   . ARG A 1 507 ? -11.009 52.069 21.180  1.00 109.11 ? 487 ARG A N   1 
ATOM   3161 C  CA  . ARG A 1 507 ? -11.274 51.906 22.610  1.00 112.13 ? 487 ARG A CA  1 
ATOM   3162 C  C   . ARG A 1 507 ? -12.759 52.090 22.958  1.00 116.40 ? 487 ARG A C   1 
ATOM   3163 O  O   . ARG A 1 507 ? -13.281 51.414 23.856  1.00 117.52 ? 487 ARG A O   1 
ATOM   3164 C  CB  . ARG A 1 507 ? -10.384 52.830 23.456  1.00 108.60 ? 487 ARG A CB  1 
ATOM   3165 C  CG  . ARG A 1 507 ? -9.376  52.081 24.345  1.00 107.98 ? 487 ARG A CG  1 
ATOM   3166 C  CD  . ARG A 1 507 ? -8.703  52.995 25.377  1.00 108.36 ? 487 ARG A CD  1 
ATOM   3167 N  NE  . ARG A 1 507 ? -8.035  54.141 24.754  1.00 107.30 ? 487 ARG A NE  1 
ATOM   3168 C  CZ  . ARG A 1 507 ? -6.797  54.118 24.259  1.00 107.15 ? 487 ARG A CZ  1 
ATOM   3169 N  NH1 . ARG A 1 507 ? -6.070  52.999 24.303  1.00 107.66 ? 487 ARG A NH1 1 
ATOM   3170 N  NH2 . ARG A 1 507 ? -6.284  55.217 23.711  1.00 106.83 ? 487 ARG A NH2 1 
ATOM   3171 N  N   . ILE A 1 508 ? -13.434 52.980 22.226  1.00 115.56 ? 488 ILE A N   1 
ATOM   3172 C  CA  . ILE A 1 508 ? -14.867 53.234 22.415  1.00 112.81 ? 488 ILE A CA  1 
ATOM   3173 C  C   . ILE A 1 508 ? -15.712 51.984 22.103  1.00 109.23 ? 488 ILE A C   1 
ATOM   3174 O  O   . ILE A 1 508 ? -16.808 51.812 22.642  1.00 108.49 ? 488 ILE A O   1 
ATOM   3175 C  CB  . ILE A 1 508 ? -15.338 54.475 21.579  1.00 66.92  ? 488 ILE A CB  1 
ATOM   3176 C  CG1 . ILE A 1 508 ? -16.705 55.003 22.050  1.00 67.31  ? 488 ILE A CG1 1 
ATOM   3177 C  CG2 . ILE A 1 508 ? -15.351 54.172 20.062  1.00 65.71  ? 488 ILE A CG2 1 
ATOM   3178 C  CD1 . ILE A 1 508 ? -16.724 55.551 23.501  1.00 69.12  ? 488 ILE A CD1 1 
ATOM   3179 N  N   . ASN A 1 509 ? -15.177 51.101 21.260  1.00 101.51 ? 489 ASN A N   1 
ATOM   3180 C  CA  . ASN A 1 509 ? -15.896 49.896 20.843  1.00 94.36  ? 489 ASN A CA  1 
ATOM   3181 C  C   . ASN A 1 509 ? -15.607 48.644 21.684  1.00 93.92  ? 489 ASN A C   1 
ATOM   3182 O  O   . ASN A 1 509 ? -16.283 47.627 21.532  1.00 93.12  ? 489 ASN A O   1 
ATOM   3183 C  CB  . ASN A 1 509 ? -15.667 49.612 19.352  1.00 86.50  ? 489 ASN A CB  1 
ATOM   3184 C  CG  . ASN A 1 509 ? -16.393 50.603 18.443  1.00 78.88  ? 489 ASN A CG  1 
ATOM   3185 O  OD1 . ASN A 1 509 ? -17.525 51.013 18.722  1.00 79.34  ? 489 ASN A OD1 1 
ATOM   3186 N  ND2 . ASN A 1 509 ? -15.741 50.987 17.349  1.00 71.99  ? 489 ASN A ND2 1 
ATOM   3187 N  N   . GLU A 1 510 ? -14.615 48.710 22.569  1.00 103.58 ? 490 GLU A N   1 
ATOM   3188 C  CA  . GLU A 1 510 ? -14.374 47.607 23.501  1.00 104.49 ? 490 GLU A CA  1 
ATOM   3189 C  C   . GLU A 1 510 ? -15.125 47.842 24.822  1.00 104.18 ? 490 GLU A C   1 
ATOM   3190 O  O   . GLU A 1 510 ? -14.811 47.232 25.839  1.00 102.34 ? 490 GLU A O   1 
ATOM   3191 C  CB  . GLU A 1 510 ? -12.870 47.384 23.743  1.00 105.09 ? 490 GLU A CB  1 
ATOM   3192 C  CG  . GLU A 1 510 ? -12.045 46.996 22.490  1.00 107.78 ? 490 GLU A CG  1 
ATOM   3193 C  CD  . GLU A 1 510 ? -12.385 45.608 21.893  1.00 108.49 ? 490 GLU A CD  1 
ATOM   3194 O  OE1 . GLU A 1 510 ? -12.359 45.480 20.644  1.00 105.88 ? 490 GLU A OE1 1 
ATOM   3195 O  OE2 . GLU A 1 510 ? -12.655 44.644 22.658  1.00 105.69 ? 490 GLU A OE2 1 
ATOM   3196 N  N   . ARG A 1 511 ? -16.132 48.716 24.778  1.00 99.23  ? 491 ARG A N   1 
ATOM   3197 C  CA  . ARG A 1 511 ? -16.916 49.116 25.955  1.00 100.37 ? 491 ARG A CA  1 
ATOM   3198 C  C   . ARG A 1 511 ? -18.357 48.559 25.950  1.00 99.06  ? 491 ARG A C   1 
ATOM   3199 O  O   . ARG A 1 511 ? -18.961 48.373 24.882  1.00 98.63  ? 491 ARG A O   1 
ATOM   3200 C  CB  . ARG A 1 511 ? -16.921 50.657 26.077  1.00 98.84  ? 491 ARG A CB  1 
ATOM   3201 C  CG  . ARG A 1 511 ? -18.031 51.256 26.952  1.00 98.26  ? 491 ARG A CG  1 
ATOM   3202 C  CD  . ARG A 1 511 ? -17.950 52.775 27.046  1.00 97.50  ? 491 ARG A CD  1 
ATOM   3203 N  NE  . ARG A 1 511 ? -17.170 53.212 28.201  1.00 100.87 ? 491 ARG A NE  1 
ATOM   3204 C  CZ  . ARG A 1 511 ? -15.870 53.488 28.167  1.00 103.10 ? 491 ARG A CZ  1 
ATOM   3205 N  NH1 . ARG A 1 511 ? -15.197 53.376 27.031  1.00 104.50 ? 491 ARG A NH1 1 
ATOM   3206 N  NH2 . ARG A 1 511 ? -15.243 53.876 29.270  1.00 103.05 ? 491 ARG A NH2 1 
ATOM   3207 N  N   . MET A 1 512 ? -18.887 48.281 27.147  1.00 91.90  ? 492 MET A N   1 
ATOM   3208 C  CA  . MET A 1 512 ? -20.289 47.887 27.335  1.00 88.66  ? 492 MET A CA  1 
ATOM   3209 C  C   . MET A 1 512 ? -21.210 49.047 26.968  1.00 95.23  ? 492 MET A C   1 
ATOM   3210 O  O   . MET A 1 512 ? -21.158 50.095 27.616  1.00 98.63  ? 492 MET A O   1 
ATOM   3211 C  CB  . MET A 1 512 ? -20.525 47.473 28.794  1.00 84.68  ? 492 MET A CB  1 
ATOM   3212 C  CG  . MET A 1 512 ? -21.991 47.313 29.220  1.00 86.74  ? 492 MET A CG  1 
ATOM   3213 S  SD  . MET A 1 512 ? -22.787 45.708 28.878  1.00 102.41 ? 492 MET A SD  1 
ATOM   3214 C  CE  . MET A 1 512 ? -22.221 44.681 30.230  1.00 85.32  ? 492 MET A CE  1 
ATOM   3215 N  N   . PRO A 1 513 ? -22.040 48.874 25.915  1.00 100.26 ? 493 PRO A N   1 
ATOM   3216 C  CA  . PRO A 1 513 ? -23.000 49.905 25.483  1.00 102.11 ? 493 PRO A CA  1 
ATOM   3217 C  C   . PRO A 1 513 ? -23.956 50.303 26.610  1.00 110.49 ? 493 PRO A C   1 
ATOM   3218 O  O   . PRO A 1 513 ? -24.430 49.436 27.340  1.00 114.11 ? 493 PRO A O   1 
ATOM   3219 C  CB  . PRO A 1 513 ? -23.768 49.214 24.354  1.00 96.71  ? 493 PRO A CB  1 
ATOM   3220 C  CG  . PRO A 1 513 ? -22.815 48.201 23.826  1.00 94.81  ? 493 PRO A CG  1 
ATOM   3221 C  CD  . PRO A 1 513 ? -22.053 47.704 25.018  1.00 96.54  ? 493 PRO A CD  1 
ATOM   3222 N  N   . PRO A 1 514 ? -24.227 51.607 26.761  1.00 122.02 ? 494 PRO A N   1 
ATOM   3223 C  CA  . PRO A 1 514 ? -25.012 52.084 27.911  1.00 124.07 ? 494 PRO A CA  1 
ATOM   3224 C  C   . PRO A 1 514 ? -26.448 51.542 27.939  1.00 123.35 ? 494 PRO A C   1 
ATOM   3225 O  O   . PRO A 1 514 ? -26.942 51.085 26.903  1.00 123.22 ? 494 PRO A O   1 
ATOM   3226 C  CB  . PRO A 1 514 ? -25.008 53.608 27.728  1.00 123.17 ? 494 PRO A CB  1 
ATOM   3227 C  CG  . PRO A 1 514 ? -23.812 53.888 26.856  1.00 121.04 ? 494 PRO A CG  1 
ATOM   3228 C  CD  . PRO A 1 514 ? -23.733 52.716 25.927  1.00 119.70 ? 494 PRO A CD  1 
ATOM   3229 N  N   . ARG A 1 515 ? -27.087 51.594 29.112  1.00 113.36 ? 495 ARG A N   1 
ATOM   3230 C  CA  . ARG A 1 515 ? -28.458 51.096 29.314  1.00 107.12 ? 495 ARG A CA  1 
ATOM   3231 C  C   . ARG A 1 515 ? -28.647 49.637 28.878  1.00 105.80 ? 495 ARG A C   1 
ATOM   3232 O  O   . ARG A 1 515 ? -27.945 48.735 29.341  1.00 104.16 ? 495 ARG A O   1 
ATOM   3233 C  CB  . ARG A 1 515 ? -29.497 51.997 28.614  1.00 100.35 ? 495 ARG A CB  1 
ATOM   3234 C  CG  . ARG A 1 515 ? -30.245 52.973 29.537  1.00 98.90  ? 495 ARG A CG  1 
ATOM   3235 C  CD  . ARG A 1 515 ? -31.066 52.229 30.609  1.00 97.47  ? 495 ARG A CD  1 
ATOM   3236 N  NE  . ARG A 1 515 ? -31.799 53.123 31.516  1.00 96.71  ? 495 ARG A NE  1 
ATOM   3237 C  CZ  . ARG A 1 515 ? -33.020 53.607 31.272  1.00 95.20  ? 495 ARG A CZ  1 
ATOM   3238 N  NH1 . ARG A 1 515 ? -33.647 53.294 30.138  1.00 93.61  ? 495 ARG A NH1 1 
ATOM   3239 N  NH2 . ARG A 1 515 ? -33.613 54.410 32.156  1.00 95.75  ? 495 ARG A NH2 1 
ATOM   3240 N  N   . ALA B 2 5   ? -47.693 80.442 -36.941 1.00 84.46  ? 4   ALA B N   1 
ATOM   3241 C  CA  . ALA B 2 5   ? -48.636 79.493 -36.353 1.00 82.56  ? 4   ALA B CA  1 
ATOM   3242 C  C   . ALA B 2 5   ? -48.187 78.048 -36.574 1.00 81.08  ? 4   ALA B C   1 
ATOM   3243 O  O   . ALA B 2 5   ? -48.074 77.593 -37.714 1.00 86.01  ? 4   ALA B O   1 
ATOM   3244 C  CB  . ALA B 2 5   ? -50.042 79.713 -36.920 1.00 79.51  ? 4   ALA B CB  1 
ATOM   3245 N  N   . SER B 2 6   ? -47.929 77.332 -35.480 1.00 62.52  ? 5   SER B N   1 
ATOM   3246 C  CA  . SER B 2 6   ? -47.513 75.934 -35.561 1.00 54.50  ? 5   SER B CA  1 
ATOM   3247 C  C   . SER B 2 6   ? -48.484 74.986 -34.859 1.00 53.81  ? 5   SER B C   1 
ATOM   3248 O  O   . SER B 2 6   ? -49.375 75.418 -34.127 1.00 55.06  ? 5   SER B O   1 
ATOM   3249 C  CB  . SER B 2 6   ? -46.100 75.752 -35.003 1.00 53.64  ? 5   SER B CB  1 
ATOM   3250 O  OG  . SER B 2 6   ? -46.009 76.216 -33.665 1.00 53.68  ? 5   SER B OG  1 
ATOM   3251 N  N   . TYR B 2 7   ? -48.306 73.691 -35.105 1.00 49.96  ? 6   TYR B N   1 
ATOM   3252 C  CA  . TYR B 2 7   ? -49.120 72.652 -34.480 1.00 43.10  ? 6   TYR B CA  1 
ATOM   3253 C  C   . TYR B 2 7   ? -48.800 72.599 -32.992 1.00 40.74  ? 6   TYR B C   1 
ATOM   3254 O  O   . TYR B 2 7   ? -47.670 72.933 -32.588 1.00 39.41  ? 6   TYR B O   1 
ATOM   3255 C  CB  . TYR B 2 7   ? -48.826 71.279 -35.103 1.00 43.74  ? 6   TYR B CB  1 
ATOM   3256 C  CG  . TYR B 2 7   ? -49.111 71.159 -36.583 1.00 50.52  ? 6   TYR B CG  1 
ATOM   3257 C  CD1 . TYR B 2 7   ? -50.307 71.617 -37.122 1.00 50.72  ? 6   TYR B CD1 1 
ATOM   3258 C  CD2 . TYR B 2 7   ? -48.180 70.581 -37.445 1.00 52.81  ? 6   TYR B CD2 1 
ATOM   3259 C  CE1 . TYR B 2 7   ? -50.572 71.503 -38.474 1.00 53.69  ? 6   TYR B CE1 1 
ATOM   3260 C  CE2 . TYR B 2 7   ? -48.432 70.460 -38.803 1.00 55.04  ? 6   TYR B CE2 1 
ATOM   3261 C  CZ  . TYR B 2 7   ? -49.636 70.925 -39.316 1.00 57.13  ? 6   TYR B CZ  1 
ATOM   3262 O  OH  . TYR B 2 7   ? -49.920 70.816 -40.674 1.00 59.99  ? 6   TYR B OH  1 
ATOM   3263 N  N   . PRO B 2 8   ? -49.788 72.173 -32.176 1.00 37.69  ? 7   PRO B N   1 
ATOM   3264 C  CA  . PRO B 2 8   ? -49.652 72.032 -30.725 1.00 36.71  ? 7   PRO B CA  1 
ATOM   3265 C  C   . PRO B 2 8   ? -48.594 71.027 -30.326 1.00 35.98  ? 7   PRO B C   1 
ATOM   3266 O  O   . PRO B 2 8   ? -48.404 70.009 -31.000 1.00 36.01  ? 7   PRO B O   1 
ATOM   3267 C  CB  . PRO B 2 8   ? -51.020 71.505 -30.297 1.00 36.32  ? 7   PRO B CB  1 
ATOM   3268 C  CG  . PRO B 2 8   ? -51.938 71.996 -31.316 1.00 37.22  ? 7   PRO B CG  1 
ATOM   3269 C  CD  . PRO B 2 8   ? -51.175 71.924 -32.601 1.00 37.90  ? 7   PRO B CD  1 
ATOM   3270 N  N   . LEU B 2 9   ? -47.893 71.350 -29.241 1.00 36.71  ? 8   LEU B N   1 
ATOM   3271 C  CA  . LEU B 2 9   ? -47.021 70.410 -28.562 1.00 34.65  ? 8   LEU B CA  1 
ATOM   3272 C  C   . LEU B 2 9   ? -47.916 69.536 -27.736 1.00 33.81  ? 8   LEU B C   1 
ATOM   3273 O  O   . LEU B 2 9   ? -48.893 70.009 -27.161 1.00 38.82  ? 8   LEU B O   1 
ATOM   3274 C  CB  . LEU B 2 9   ? -46.074 71.140 -27.627 1.00 36.21  ? 8   LEU B CB  1 
ATOM   3275 C  CG  . LEU B 2 9   ? -44.784 71.682 -28.220 1.00 39.25  ? 8   LEU B CG  1 
ATOM   3276 C  CD1 . LEU B 2 9   ? -43.755 71.747 -27.106 1.00 37.85  ? 8   LEU B CD1 1 
ATOM   3277 C  CD2 . LEU B 2 9   ? -44.313 70.805 -29.375 1.00 41.46  ? 8   LEU B CD2 1 
ATOM   3278 N  N   . GLU B 2 10  ? -47.598 68.258 -27.672 1.00 34.92  ? 9   GLU B N   1 
ATOM   3279 C  CA  . GLU B 2 10  ? -48.421 67.346 -26.912 1.00 33.40  ? 9   GLU B CA  1 
ATOM   3280 C  C   . GLU B 2 10  ? -47.536 66.718 -25.850 1.00 31.83  ? 9   GLU B C   1 
ATOM   3281 O  O   . GLU B 2 10  ? -46.393 66.371 -26.128 1.00 36.59  ? 9   GLU B O   1 
ATOM   3282 C  CB  . GLU B 2 10  ? -49.044 66.324 -27.858 1.00 37.81  ? 9   GLU B CB  1 
ATOM   3283 C  CG  . GLU B 2 10  ? -49.531 65.077 -27.200 1.00 49.87  ? 9   GLU B CG  1 
ATOM   3284 C  CD  . GLU B 2 10  ? -48.459 64.019 -27.154 1.00 59.55  ? 9   GLU B CD  1 
ATOM   3285 O  OE1 . GLU B 2 10  ? -47.676 63.945 -28.137 1.00 62.19  ? 9   GLU B OE1 1 
ATOM   3286 O  OE2 . GLU B 2 10  ? -48.392 63.287 -26.133 1.00 58.68  ? 9   GLU B OE2 1 
ATOM   3287 N  N   . MET B 2 11  ? -48.036 66.607 -24.625 1.00 31.30  ? 10  MET B N   1 
ATOM   3288 C  CA  . MET B 2 11  ? -47.203 66.115 -23.530 1.00 30.56  ? 10  MET B CA  1 
ATOM   3289 C  C   . MET B 2 11  ? -48.013 65.640 -22.338 1.00 30.22  ? 10  MET B C   1 
ATOM   3290 O  O   . MET B 2 11  ? -49.226 65.870 -22.261 1.00 32.24  ? 10  MET B O   1 
ATOM   3291 C  CB  . MET B 2 11  ? -46.235 67.204 -23.070 1.00 30.60  ? 10  MET B CB  1 
ATOM   3292 C  CG  . MET B 2 11  ? -46.932 68.429 -22.531 1.00 33.36  ? 10  MET B CG  1 
ATOM   3293 S  SD  . MET B 2 11  ? -45.817 69.825 -22.346 1.00 36.39  ? 10  MET B SD  1 
ATOM   3294 C  CE  . MET B 2 11  ? -45.338 70.146 -24.033 1.00 49.08  ? 10  MET B CE  1 
ATOM   3295 N  N   . CYS B 2 12  ? -47.322 64.989 -21.404 1.00 29.53  ? 11  CYS B N   1 
ATOM   3296 C  CA  . CYS B 2 12  ? -47.936 64.506 -20.180 1.00 29.26  ? 11  CYS B CA  1 
ATOM   3297 C  C   . CYS B 2 12  ? -47.189 64.996 -18.952 1.00 28.92  ? 11  CYS B C   1 
ATOM   3298 O  O   . CYS B 2 12  ? -46.140 64.460 -18.612 1.00 30.44  ? 11  CYS B O   1 
ATOM   3299 C  CB  . CYS B 2 12  ? -47.963 62.981 -20.174 1.00 28.96  ? 11  CYS B CB  1 
ATOM   3300 S  SG  . CYS B 2 12  ? -48.839 62.271 -18.757 1.00 31.32  ? 11  CYS B SG  1 
ATOM   3301 N  N   . SER B 2 13  ? -47.733 66.002 -18.274 1.00 29.38  ? 12  SER B N   1 
ATOM   3302 C  CA  . SER B 2 13  ? -47.130 66.487 -17.035 1.00 29.30  ? 12  SER B CA  1 
ATOM   3303 C  C   . SER B 2 13  ? -48.144 66.765 -15.919 1.00 32.13  ? 12  SER B C   1 
ATOM   3304 O  O   . SER B 2 13  ? -49.358 66.680 -16.129 1.00 31.93  ? 12  SER B O   1 
ATOM   3305 C  CB  . SER B 2 13  ? -46.329 67.752 -17.312 1.00 29.69  ? 12  SER B CB  1 
ATOM   3306 O  OG  . SER B 2 13  ? -47.203 68.821 -17.572 1.00 30.59  ? 12  SER B OG  1 
ATOM   3307 N  N   . HIS B 2 14  ? -47.620 67.102 -14.737 1.00 32.05  ? 13  HIS B N   1 
ATOM   3308 C  CA  . HIS B 2 14  ? -48.414 67.543 -13.581 1.00 30.80  ? 13  HIS B CA  1 
ATOM   3309 C  C   . HIS B 2 14  ? -48.670 69.054 -13.576 1.00 37.65  ? 13  HIS B C   1 
ATOM   3310 O  O   . HIS B 2 14  ? -49.345 69.568 -12.689 1.00 41.62  ? 13  HIS B O   1 
ATOM   3311 C  CB  . HIS B 2 14  ? -47.703 67.186 -12.281 1.00 30.54  ? 13  HIS B CB  1 
ATOM   3312 C  CG  . HIS B 2 14  ? -47.618 65.716 -12.024 1.00 36.44  ? 13  HIS B CG  1 
ATOM   3313 N  ND1 . HIS B 2 14  ? -48.733 64.933 -11.813 1.00 36.23  ? 13  HIS B ND1 1 
ATOM   3314 C  CD2 . HIS B 2 14  ? -46.550 64.887 -11.932 1.00 34.17  ? 13  HIS B CD2 1 
ATOM   3315 C  CE1 . HIS B 2 14  ? -48.358 63.682 -11.620 1.00 34.43  ? 13  HIS B CE1 1 
ATOM   3316 N  NE2 . HIS B 2 14  ? -47.038 63.628 -11.679 1.00 35.63  ? 13  HIS B NE2 1 
ATOM   3317 N  N   . PHE B 2 15  ? -48.129 69.760 -14.559 1.00 31.92  ? 14  PHE B N   1 
ATOM   3318 C  CA  . PHE B 2 15  ? -48.099 71.209 -14.513 1.00 33.05  ? 14  PHE B CA  1 
ATOM   3319 C  C   . PHE B 2 15  ? -49.325 71.873 -15.123 1.00 34.02  ? 14  PHE B C   1 
ATOM   3320 O  O   . PHE B 2 15  ? -49.919 71.370 -16.070 1.00 37.71  ? 14  PHE B O   1 
ATOM   3321 C  CB  . PHE B 2 15  ? -46.835 71.731 -15.205 1.00 32.84  ? 14  PHE B CB  1 
ATOM   3322 C  CG  . PHE B 2 15  ? -45.569 71.243 -14.584 1.00 32.12  ? 14  PHE B CG  1 
ATOM   3323 C  CD1 . PHE B 2 15  ? -45.377 71.339 -13.216 1.00 32.44  ? 14  PHE B CD1 1 
ATOM   3324 C  CD2 . PHE B 2 15  ? -44.578 70.669 -15.360 1.00 31.27  ? 14  PHE B CD2 1 
ATOM   3325 C  CE1 . PHE B 2 15  ? -44.204 70.878 -12.627 1.00 31.80  ? 14  PHE B CE1 1 
ATOM   3326 C  CE2 . PHE B 2 15  ? -43.403 70.203 -14.783 1.00 30.70  ? 14  PHE B CE2 1 
ATOM   3327 C  CZ  . PHE B 2 15  ? -43.217 70.303 -13.414 1.00 30.90  ? 14  PHE B CZ  1 
ATOM   3328 N  N   . ASP B 2 16  ? -49.684 73.028 -14.583 1.00 35.39  ? 15  ASP B N   1 
ATOM   3329 C  CA  . ASP B 2 16  ? -50.807 73.778 -15.116 1.00 36.50  ? 15  ASP B CA  1 
ATOM   3330 C  C   . ASP B 2 16  ? -50.344 74.856 -16.098 1.00 40.04  ? 15  ASP B C   1 
ATOM   3331 O  O   . ASP B 2 16  ? -49.143 75.022 -16.338 1.00 42.32  ? 15  ASP B O   1 
ATOM   3332 C  CB  . ASP B 2 16  ? -51.655 74.382 -13.989 1.00 42.76  ? 15  ASP B CB  1 
ATOM   3333 C  CG  . ASP B 2 16  ? -50.889 75.406 -13.131 1.00 51.85  ? 15  ASP B CG  1 
ATOM   3334 O  OD1 . ASP B 2 16  ? -49.927 76.045 -13.618 1.00 51.85  ? 15  ASP B OD1 1 
ATOM   3335 O  OD2 . ASP B 2 16  ? -51.274 75.588 -11.952 1.00 57.20  ? 15  ASP B OD2 1 
ATOM   3336 N  N   . ALA B 2 17  ? -51.304 75.595 -16.642 1.00 38.57  ? 16  ALA B N   1 
ATOM   3337 C  CA  . ALA B 2 17  ? -51.017 76.598 -17.658 1.00 38.48  ? 16  ALA B CA  1 
ATOM   3338 C  C   . ALA B 2 17  ? -49.908 77.571 -17.249 1.00 40.33  ? 16  ALA B C   1 
ATOM   3339 O  O   . ALA B 2 17  ? -48.958 77.778 -17.998 1.00 40.37  ? 16  ALA B O   1 
ATOM   3340 C  CB  . ALA B 2 17  ? -52.286 77.351 -18.020 1.00 41.32  ? 16  ALA B CB  1 
ATOM   3341 N  N   . ASP B 2 18  ? -50.040 78.152 -16.060 1.00 45.76  ? 17  ASP B N   1 
ATOM   3342 C  CA  . ASP B 2 18  ? -49.051 79.073 -15.510 1.00 47.59  ? 17  ASP B CA  1 
ATOM   3343 C  C   . ASP B 2 18  ? -47.672 78.448 -15.446 1.00 42.92  ? 17  ASP B C   1 
ATOM   3344 O  O   . ASP B 2 18  ? -46.709 79.006 -15.964 1.00 43.86  ? 17  ASP B O   1 
ATOM   3345 C  CB  . ASP B 2 18  ? -49.442 79.485 -14.092 1.00 57.50  ? 17  ASP B CB  1 
ATOM   3346 C  CG  . ASP B 2 18  ? -50.751 80.244 -14.041 1.00 67.64  ? 17  ASP B CG  1 
ATOM   3347 O  OD1 . ASP B 2 18  ? -51.033 80.998 -15.002 1.00 69.18  ? 17  ASP B OD1 1 
ATOM   3348 O  OD2 . ASP B 2 18  ? -51.490 80.087 -13.038 1.00 70.16  ? 17  ASP B OD2 1 
ATOM   3349 N  N   . GLU B 2 19  ? -47.580 77.294 -14.793 1.00 40.07  ? 18  GLU B N   1 
ATOM   3350 C  CA  . GLU B 2 19  ? -46.301 76.629 -14.582 1.00 38.54  ? 18  GLU B CA  1 
ATOM   3351 C  C   . GLU B 2 19  ? -45.623 76.266 -15.905 1.00 38.52  ? 18  GLU B C   1 
ATOM   3352 O  O   . GLU B 2 19  ? -44.408 76.367 -16.043 1.00 36.73  ? 18  GLU B O   1 
ATOM   3353 C  CB  . GLU B 2 19  ? -46.485 75.380 -13.720 1.00 38.38  ? 18  GLU B CB  1 
ATOM   3354 C  CG  . GLU B 2 19  ? -46.977 75.670 -12.304 1.00 44.99  ? 18  GLU B CG  1 
ATOM   3355 C  CD  . GLU B 2 19  ? -47.462 74.418 -11.567 1.00 45.43  ? 18  GLU B CD  1 
ATOM   3356 O  OE1 . GLU B 2 19  ? -48.038 73.525 -12.227 1.00 39.47  ? 18  GLU B OE1 1 
ATOM   3357 O  OE2 . GLU B 2 19  ? -47.269 74.329 -10.329 1.00 48.85  ? 18  GLU B OE2 1 
ATOM   3358 N  N   . ILE B 2 20  ? -46.405 75.844 -16.885 1.00 38.87  ? 19  ILE B N   1 
ATOM   3359 C  CA  . ILE B 2 20  ? -45.820 75.485 -18.158 1.00 35.61  ? 19  ILE B CA  1 
ATOM   3360 C  C   . ILE B 2 20  ? -45.230 76.733 -18.792 1.00 37.97  ? 19  ILE B C   1 
ATOM   3361 O  O   . ILE B 2 20  ? -44.145 76.691 -19.386 1.00 36.90  ? 19  ILE B O   1 
ATOM   3362 C  CB  . ILE B 2 20  ? -46.839 74.786 -19.069 1.00 34.81  ? 19  ILE B CB  1 
ATOM   3363 C  CG1 . ILE B 2 20  ? -46.993 73.332 -18.624 1.00 33.11  ? 19  ILE B CG1 1 
ATOM   3364 C  CG2 . ILE B 2 20  ? -46.385 74.820 -20.512 1.00 34.77  ? 19  ILE B CG2 1 
ATOM   3365 C  CD1 . ILE B 2 20  ? -48.127 72.603 -19.274 1.00 32.48  ? 19  ILE B CD1 1 
ATOM   3366 N  N   . LYS B 2 21  ? -45.929 77.851 -18.624 1.00 38.92  ? 20  LYS B N   1 
ATOM   3367 C  CA  . LYS B 2 21  ? -45.479 79.141 -19.144 1.00 41.32  ? 20  LYS B CA  1 
ATOM   3368 C  C   . LYS B 2 21  ? -44.131 79.537 -18.499 1.00 41.68  ? 20  LYS B C   1 
ATOM   3369 O  O   . LYS B 2 21  ? -43.198 79.962 -19.191 1.00 41.31  ? 20  LYS B O   1 
ATOM   3370 C  CB  . LYS B 2 21  ? -46.576 80.202 -18.923 1.00 41.98  ? 20  LYS B CB  1 
ATOM   3371 C  CG  . LYS B 2 21  ? -46.324 81.569 -19.534 1.00 43.88  ? 20  LYS B CG  1 
ATOM   3372 C  CD  . LYS B 2 21  ? -46.637 81.587 -21.031 1.00 43.91  ? 20  LYS B CD  1 
ATOM   3373 C  CE  . LYS B 2 21  ? -48.148 81.782 -21.353 1.00 44.46  ? 20  LYS B CE  1 
ATOM   3374 N  NZ  . LYS B 2 21  ? -48.390 81.895 -22.869 1.00 44.69  ? 20  LYS B NZ  1 
ATOM   3375 N  N   . ARG B 2 22  ? -44.026 79.353 -17.182 1.00 40.61  ? 21  ARG B N   1 
ATOM   3376 C  CA  . ARG B 2 22  ? -42.799 79.682 -16.444 1.00 41.13  ? 21  ARG B CA  1 
ATOM   3377 C  C   . ARG B 2 22  ? -41.618 78.768 -16.796 1.00 44.07  ? 21  ARG B C   1 
ATOM   3378 O  O   . ARG B 2 22  ? -40.468 79.205 -16.866 1.00 48.94  ? 21  ARG B O   1 
ATOM   3379 C  CB  . ARG B 2 22  ? -43.035 79.646 -14.927 1.00 41.28  ? 21  ARG B CB  1 
ATOM   3380 C  CG  . ARG B 2 22  ? -44.114 80.596 -14.431 1.00 48.68  ? 21  ARG B CG  1 
ATOM   3381 C  CD  . ARG B 2 22  ? -43.910 80.973 -12.963 1.00 49.21  ? 21  ARG B CD  1 
ATOM   3382 N  NE  . ARG B 2 22  ? -43.927 79.821 -12.055 1.00 52.38  ? 21  ARG B NE  1 
ATOM   3383 C  CZ  . ARG B 2 22  ? -45.024 79.345 -11.462 1.00 54.19  ? 21  ARG B CZ  1 
ATOM   3384 N  NH1 . ARG B 2 22  ? -46.206 79.910 -11.690 1.00 54.88  ? 21  ARG B NH1 1 
ATOM   3385 N  NH2 . ARG B 2 22  ? -44.946 78.301 -10.643 1.00 51.42  ? 21  ARG B NH2 1 
ATOM   3386 N  N   . LEU B 2 23  ? -41.909 77.490 -16.993 1.00 42.13  ? 22  LEU B N   1 
ATOM   3387 C  CA  . LEU B 2 23  ? -40.896 76.539 -17.409 1.00 37.58  ? 22  LEU B CA  1 
ATOM   3388 C  C   . LEU B 2 23  ? -40.420 76.894 -18.799 1.00 37.98  ? 22  LEU B C   1 
ATOM   3389 O  O   . LEU B 2 23  ? -39.243 76.735 -19.113 1.00 38.90  ? 22  LEU B O   1 
ATOM   3390 C  CB  . LEU B 2 23  ? -41.478 75.132 -17.405 1.00 34.94  ? 22  LEU B CB  1 
ATOM   3391 C  CG  . LEU B 2 23  ? -41.583 74.557 -15.998 1.00 34.29  ? 22  LEU B CG  1 
ATOM   3392 C  CD1 . LEU B 2 23  ? -42.511 73.363 -15.934 1.00 32.86  ? 22  LEU B CD1 1 
ATOM   3393 C  CD2 . LEU B 2 23  ? -40.201 74.176 -15.550 1.00 34.42  ? 22  LEU B CD2 1 
ATOM   3394 N  N   . GLY B 2 24  ? -41.346 77.376 -19.627 1.00 37.86  ? 23  GLY B N   1 
ATOM   3395 C  CA  . GLY B 2 24  ? -41.038 77.783 -20.987 1.00 39.94  ? 23  GLY B CA  1 
ATOM   3396 C  C   . GLY B 2 24  ? -40.066 78.945 -21.033 1.00 44.37  ? 23  GLY B C   1 
ATOM   3397 O  O   . GLY B 2 24  ? -39.235 79.029 -21.936 1.00 44.37  ? 23  GLY B O   1 
ATOM   3398 N  N   . LYS B 2 25  ? -40.159 79.837 -20.050 1.00 44.80  ? 24  LYS B N   1 
ATOM   3399 C  CA  . LYS B 2 25  ? -39.240 80.965 -19.961 1.00 43.38  ? 24  LYS B CA  1 
ATOM   3400 C  C   . LYS B 2 25  ? -37.818 80.514 -19.642 1.00 44.18  ? 24  LYS B C   1 
ATOM   3401 O  O   . LYS B 2 25  ? -36.868 81.005 -20.257 1.00 50.08  ? 24  LYS B O   1 
ATOM   3402 C  CB  . LYS B 2 25  ? -39.741 81.990 -18.943 1.00 47.22  ? 24  LYS B CB  1 
ATOM   3403 C  CG  . LYS B 2 25  ? -41.026 82.675 -19.387 1.00 53.82  ? 24  LYS B CG  1 
ATOM   3404 C  CD  . LYS B 2 25  ? -41.490 83.768 -18.418 1.00 58.01  ? 24  LYS B CD  1 
ATOM   3405 C  CE  . LYS B 2 25  ? -42.823 84.370 -18.868 1.00 57.74  ? 24  LYS B CE  1 
ATOM   3406 N  NZ  . LYS B 2 25  ? -42.759 84.923 -20.259 1.00 58.54  ? 24  LYS B NZ  1 
ATOM   3407 N  N   . ARG B 2 26  ? -37.670 79.584 -18.696 1.00 41.39  ? 25  ARG B N   1 
ATOM   3408 C  CA  . ARG B 2 26  ? -36.349 79.045 -18.369 1.00 40.98  ? 25  ARG B CA  1 
ATOM   3409 C  C   . ARG B 2 26  ? -35.757 78.317 -19.561 1.00 43.51  ? 25  ARG B C   1 
ATOM   3410 O  O   . ARG B 2 26  ? -34.553 78.413 -19.811 1.00 48.82  ? 25  ARG B O   1 
ATOM   3411 C  CB  . ARG B 2 26  ? -36.408 78.099 -17.178 1.00 39.60  ? 25  ARG B CB  1 
ATOM   3412 C  CG  . ARG B 2 26  ? -36.587 78.758 -15.815 1.00 42.05  ? 25  ARG B CG  1 
ATOM   3413 C  CD  . ARG B 2 26  ? -37.776 78.175 -15.064 1.00 41.33  ? 25  ARG B CD  1 
ATOM   3414 N  NE  . ARG B 2 26  ? -37.610 78.219 -13.613 1.00 42.43  ? 25  ARG B NE  1 
ATOM   3415 C  CZ  . ARG B 2 26  ? -38.613 78.161 -12.741 1.00 46.86  ? 25  ARG B CZ  1 
ATOM   3416 N  NH1 . ARG B 2 26  ? -39.863 78.057 -13.168 1.00 44.32  ? 25  ARG B NH1 1 
ATOM   3417 N  NH2 . ARG B 2 26  ? -38.367 78.217 -11.437 1.00 53.17  ? 25  ARG B NH2 1 
ATOM   3418 N  N   . PHE B 2 27  ? -36.605 77.591 -20.291 1.00 40.82  ? 26  PHE B N   1 
ATOM   3419 C  CA  . PHE B 2 27  ? -36.166 76.864 -21.476 1.00 38.64  ? 26  PHE B CA  1 
ATOM   3420 C  C   . PHE B 2 27  ? -35.480 77.794 -22.474 1.00 44.46  ? 26  PHE B C   1 
ATOM   3421 O  O   . PHE B 2 27  ? -34.329 77.555 -22.844 1.00 47.59  ? 26  PHE B O   1 
ATOM   3422 C  CB  . PHE B 2 27  ? -37.334 76.129 -22.136 1.00 37.48  ? 26  PHE B CB  1 
ATOM   3423 C  CG  . PHE B 2 27  ? -36.913 75.170 -23.225 1.00 37.04  ? 26  PHE B CG  1 
ATOM   3424 C  CD1 . PHE B 2 27  ? -36.509 73.872 -22.914 1.00 35.34  ? 26  PHE B CD1 1 
ATOM   3425 C  CD2 . PHE B 2 27  ? -36.915 75.562 -24.559 1.00 38.04  ? 26  PHE B CD2 1 
ATOM   3426 C  CE1 . PHE B 2 27  ? -36.124 72.984 -23.902 1.00 34.78  ? 26  PHE B CE1 1 
ATOM   3427 C  CE2 . PHE B 2 27  ? -36.527 74.673 -25.550 1.00 37.18  ? 26  PHE B CE2 1 
ATOM   3428 C  CZ  . PHE B 2 27  ? -36.133 73.379 -25.211 1.00 36.48  ? 26  PHE B CZ  1 
ATOM   3429 N  N   . LYS B 2 28  ? -36.174 78.860 -22.878 1.00 46.03  ? 27  LYS B N   1 
ATOM   3430 C  CA  . LYS B 2 28  ? -35.622 79.834 -23.823 1.00 45.47  ? 27  LYS B CA  1 
ATOM   3431 C  C   . LYS B 2 28  ? -34.312 80.494 -23.360 1.00 49.28  ? 27  LYS B C   1 
ATOM   3432 O  O   . LYS B 2 28  ? -33.413 80.728 -24.168 1.00 55.02  ? 27  LYS B O   1 
ATOM   3433 C  CB  . LYS B 2 28  ? -36.657 80.907 -24.158 1.00 44.62  ? 27  LYS B CB  1 
ATOM   3434 C  CG  . LYS B 2 28  ? -37.940 80.354 -24.732 1.00 43.57  ? 27  LYS B CG  1 
ATOM   3435 C  CD  . LYS B 2 28  ? -38.797 81.466 -25.298 1.00 48.03  ? 27  LYS B CD  1 
ATOM   3436 C  CE  . LYS B 2 28  ? -40.291 81.149 -25.171 1.00 52.11  ? 27  LYS B CE  1 
ATOM   3437 N  NZ  . LYS B 2 28  ? -40.808 81.427 -23.783 1.00 51.99  ? 27  LYS B NZ  1 
ATOM   3438 N  N   . LYS B 2 29  ? -34.202 80.794 -22.070 1.00 44.88  ? 28  LYS B N   1 
ATOM   3439 C  CA  . LYS B 2 29  ? -32.993 81.438 -21.566 1.00 46.26  ? 28  LYS B CA  1 
ATOM   3440 C  C   . LYS B 2 29  ? -31.833 80.460 -21.586 1.00 45.49  ? 28  LYS B C   1 
ATOM   3441 O  O   . LYS B 2 29  ? -30.681 80.852 -21.779 1.00 51.32  ? 28  LYS B O   1 
ATOM   3442 C  CB  . LYS B 2 29  ? -33.199 82.003 -20.152 1.00 46.66  ? 28  LYS B CB  1 
ATOM   3443 C  CG  . LYS B 2 29  ? -32.246 83.162 -19.803 1.00 48.80  ? 28  LYS B CG  1 
ATOM   3444 C  CD  . LYS B 2 29  ? -32.445 83.648 -18.359 1.00 49.22  ? 28  LYS B CD  1 
ATOM   3445 C  CE  . LYS B 2 29  ? -31.345 84.637 -17.922 1.00 51.28  ? 28  LYS B CE  1 
ATOM   3446 N  NZ  . LYS B 2 29  ? -31.509 85.103 -16.495 1.00 51.84  ? 28  LYS B NZ  1 
ATOM   3447 N  N   . LEU B 2 30  ? -32.154 79.185 -21.381 1.00 48.23  ? 29  LEU B N   1 
ATOM   3448 C  CA  . LEU B 2 30  ? -31.162 78.111 -21.410 1.00 44.96  ? 29  LEU B CA  1 
ATOM   3449 C  C   . LEU B 2 30  ? -30.797 77.765 -22.847 1.00 46.18  ? 29  LEU B C   1 
ATOM   3450 O  O   . LEU B 2 30  ? -29.710 77.251 -23.115 1.00 47.41  ? 29  LEU B O   1 
ATOM   3451 C  CB  . LEU B 2 30  ? -31.694 76.857 -20.714 1.00 40.50  ? 29  LEU B CB  1 
ATOM   3452 C  CG  . LEU B 2 30  ? -31.622 76.848 -19.191 1.00 40.15  ? 29  LEU B CG  1 
ATOM   3453 C  CD1 . LEU B 2 30  ? -32.388 75.669 -18.635 1.00 38.15  ? 29  LEU B CD1 1 
ATOM   3454 C  CD2 . LEU B 2 30  ? -30.174 76.789 -18.753 1.00 41.45  ? 29  LEU B CD2 1 
ATOM   3455 N  N   . ASP B 2 31  ? -31.710 78.049 -23.766 1.00 47.84  ? 30  ASP B N   1 
ATOM   3456 C  CA  . ASP B 2 31  ? -31.474 77.788 -25.174 1.00 50.65  ? 30  ASP B CA  1 
ATOM   3457 C  C   . ASP B 2 31  ? -30.672 78.942 -25.783 1.00 55.28  ? 30  ASP B C   1 
ATOM   3458 O  O   . ASP B 2 31  ? -31.242 79.865 -26.372 1.00 60.00  ? 30  ASP B O   1 
ATOM   3459 C  CB  . ASP B 2 31  ? -32.817 77.607 -25.884 1.00 47.74  ? 30  ASP B CB  1 
ATOM   3460 C  CG  . ASP B 2 31  ? -32.679 76.975 -27.239 1.00 50.55  ? 30  ASP B CG  1 
ATOM   3461 O  OD1 . ASP B 2 31  ? -31.556 76.510 -27.549 1.00 49.79  ? 30  ASP B OD1 1 
ATOM   3462 O  OD2 . ASP B 2 31  ? -33.696 76.940 -27.983 1.00 45.16  ? 30  ASP B OD2 1 
ATOM   3463 N  N   . LEU B 2 32  ? -29.352 78.874 -25.625 1.00 48.31  ? 31  LEU B N   1 
ATOM   3464 C  CA  . LEU B 2 32  ? -28.427 79.914 -26.074 1.00 49.69  ? 31  LEU B CA  1 
ATOM   3465 C  C   . LEU B 2 32  ? -28.550 80.256 -27.568 1.00 56.08  ? 31  LEU B C   1 
ATOM   3466 O  O   . LEU B 2 32  ? -28.936 81.372 -27.934 1.00 55.08  ? 31  LEU B O   1 
ATOM   3467 C  CB  . LEU B 2 32  ? -26.998 79.494 -25.746 1.00 49.41  ? 31  LEU B CB  1 
ATOM   3468 C  CG  . LEU B 2 32  ? -26.831 79.182 -24.257 1.00 49.00  ? 31  LEU B CG  1 
ATOM   3469 C  CD1 . LEU B 2 32  ? -25.459 78.592 -23.936 1.00 48.61  ? 31  LEU B CD1 1 
ATOM   3470 C  CD2 . LEU B 2 32  ? -27.127 80.427 -23.392 1.00 49.92  ? 31  LEU B CD2 1 
ATOM   3471 N  N   . ASP B 2 33  ? -28.234 79.283 -28.423 1.00 56.88  ? 32  ASP B N   1 
ATOM   3472 C  CA  . ASP B 2 33  ? -28.318 79.452 -29.881 1.00 58.17  ? 32  ASP B CA  1 
ATOM   3473 C  C   . ASP B 2 33  ? -29.767 79.515 -30.378 1.00 56.45  ? 32  ASP B C   1 
ATOM   3474 O  O   . ASP B 2 33  ? -30.018 79.649 -31.586 1.00 56.78  ? 32  ASP B O   1 
ATOM   3475 C  CB  . ASP B 2 33  ? -27.566 78.330 -30.601 1.00 64.61  ? 32  ASP B CB  1 
ATOM   3476 C  CG  . ASP B 2 33  ? -28.037 76.974 -30.166 1.00 71.77  ? 32  ASP B CG  1 
ATOM   3477 O  OD1 . ASP B 2 33  ? -29.191 76.900 -29.695 1.00 76.00  ? 32  ASP B OD1 1 
ATOM   3478 O  OD2 . ASP B 2 33  ? -27.272 75.995 -30.266 1.00 72.42  ? 32  ASP B OD2 1 
ATOM   3479 N  N   . ASN B 2 34  ? -30.699 79.359 -29.439 1.00 57.21  ? 33  ASN B N   1 
ATOM   3480 C  CA  . ASN B 2 34  ? -32.138 79.438 -29.706 1.00 56.33  ? 33  ASN B CA  1 
ATOM   3481 C  C   . ASN B 2 34  ? -32.627 78.528 -30.827 1.00 52.18  ? 33  ASN B C   1 
ATOM   3482 O  O   . ASN B 2 34  ? -33.322 78.985 -31.735 1.00 51.08  ? 33  ASN B O   1 
ATOM   3483 C  CB  . ASN B 2 34  ? -32.580 80.893 -29.945 1.00 62.16  ? 33  ASN B CB  1 
ATOM   3484 C  CG  . ASN B 2 34  ? -32.341 81.783 -28.726 1.00 70.30  ? 33  ASN B CG  1 
ATOM   3485 O  OD1 . ASN B 2 34  ? -31.507 82.691 -28.766 1.00 75.31  ? 33  ASN B OD1 1 
ATOM   3486 N  ND2 . ASN B 2 34  ? -33.067 81.518 -27.632 1.00 67.39  ? 33  ASN B ND2 1 
ATOM   3487 N  N   . SER B 2 35  ? -32.256 77.248 -30.734 1.00 52.19  ? 34  SER B N   1 
ATOM   3488 C  CA  . SER B 2 35  ? -32.545 76.229 -31.746 1.00 47.80  ? 34  SER B CA  1 
ATOM   3489 C  C   . SER B 2 35  ? -33.815 75.445 -31.440 1.00 48.63  ? 34  SER B C   1 
ATOM   3490 O  O   . SER B 2 35  ? -34.303 74.709 -32.300 1.00 50.85  ? 34  SER B O   1 
ATOM   3491 C  CB  . SER B 2 35  ? -31.372 75.245 -31.866 1.00 52.07  ? 34  SER B CB  1 
ATOM   3492 O  OG  . SER B 2 35  ? -31.598 74.075 -31.086 1.00 55.22  ? 34  SER B OG  1 
ATOM   3493 N  N   . GLY B 2 36  ? -34.326 75.579 -30.212 1.00 43.69  ? 35  GLY B N   1 
ATOM   3494 C  CA  . GLY B 2 36  ? -35.550 74.898 -29.798 1.00 40.15  ? 35  GLY B CA  1 
ATOM   3495 C  C   . GLY B 2 36  ? -35.311 73.560 -29.087 1.00 43.10  ? 35  GLY B C   1 
ATOM   3496 O  O   . GLY B 2 36  ? -36.255 72.786 -28.836 1.00 38.81  ? 35  GLY B O   1 
ATOM   3497 N  N   . SER B 2 37  ? -34.044 73.295 -28.762 1.00 42.38  ? 36  SER B N   1 
ATOM   3498 C  CA  . SER B 2 37  ? -33.623 72.033 -28.169 1.00 37.14  ? 36  SER B CA  1 
ATOM   3499 C  C   . SER B 2 37  ? -32.497 72.395 -27.230 1.00 37.66  ? 36  SER B C   1 
ATOM   3500 O  O   . SER B 2 37  ? -32.058 73.513 -27.236 1.00 43.79  ? 36  SER B O   1 
ATOM   3501 C  CB  . SER B 2 37  ? -33.102 71.096 -29.256 1.00 37.22  ? 36  SER B CB  1 
ATOM   3502 O  OG  . SER B 2 37  ? -33.775 69.842 -29.252 1.00 35.57  ? 36  SER B OG  1 
ATOM   3503 N  N   . LEU B 2 38  ? -32.033 71.478 -26.399 1.00 38.89  ? 37  LEU B N   1 
ATOM   3504 C  CA  . LEU B 2 38  ? -31.005 71.824 -25.416 1.00 41.35  ? 37  LEU B CA  1 
ATOM   3505 C  C   . LEU B 2 38  ? -29.859 70.825 -25.502 1.00 41.48  ? 37  LEU B C   1 
ATOM   3506 O  O   . LEU B 2 38  ? -30.033 69.620 -25.321 1.00 38.83  ? 37  LEU B O   1 
ATOM   3507 C  CB  . LEU B 2 38  ? -31.579 71.894 -23.984 1.00 36.89  ? 37  LEU B CB  1 
ATOM   3508 C  CG  . LEU B 2 38  ? -32.446 73.086 -23.527 1.00 36.57  ? 37  LEU B CG  1 
ATOM   3509 C  CD1 . LEU B 2 38  ? -32.844 72.924 -22.070 1.00 41.92  ? 37  LEU B CD1 1 
ATOM   3510 C  CD2 . LEU B 2 38  ? -31.747 74.418 -23.720 1.00 38.58  ? 37  LEU B CD2 1 
ATOM   3511 N  N   . SER B 2 39  ? -28.682 71.339 -25.806 1.00 38.77  ? 38  SER B N   1 
ATOM   3512 C  CA  . SER B 2 39  ? -27.536 70.492 -26.041 1.00 39.80  ? 38  SER B CA  1 
ATOM   3513 C  C   . SER B 2 39  ? -26.810 70.268 -24.740 1.00 39.17  ? 38  SER B C   1 
ATOM   3514 O  O   . SER B 2 39  ? -27.029 70.989 -23.776 1.00 41.92  ? 38  SER B O   1 
ATOM   3515 C  CB  . SER B 2 39  ? -26.585 71.171 -27.020 1.00 43.24  ? 38  SER B CB  1 
ATOM   3516 O  OG  . SER B 2 39  ? -25.991 72.308 -26.413 1.00 45.93  ? 38  SER B OG  1 
ATOM   3517 N  N   . VAL B 2 40  ? -25.922 69.284 -24.723 1.00 42.81  ? 39  VAL B N   1 
ATOM   3518 C  CA  . VAL B 2 40  ? -25.121 69.027 -23.534 1.00 42.98  ? 39  VAL B CA  1 
ATOM   3519 C  C   . VAL B 2 40  ? -24.306 70.263 -23.151 1.00 50.95  ? 39  VAL B C   1 
ATOM   3520 O  O   . VAL B 2 40  ? -24.192 70.588 -21.971 1.00 53.72  ? 39  VAL B O   1 
ATOM   3521 C  CB  . VAL B 2 40  ? -24.191 67.807 -23.716 1.00 42.93  ? 39  VAL B CB  1 
ATOM   3522 C  CG1 . VAL B 2 40  ? -23.270 67.660 -22.527 1.00 43.38  ? 39  VAL B CG1 1 
ATOM   3523 C  CG2 . VAL B 2 40  ? -25.004 66.543 -23.889 1.00 41.94  ? 39  VAL B CG2 1 
ATOM   3524 N  N   . GLU B 2 41  ? -23.761 70.956 -24.150 1.00 55.56  ? 40  GLU B N   1 
ATOM   3525 C  CA  . GLU B 2 41  ? -22.932 72.141 -23.910 1.00 51.96  ? 40  GLU B CA  1 
ATOM   3526 C  C   . GLU B 2 41  ? -23.722 73.223 -23.172 1.00 51.62  ? 40  GLU B C   1 
ATOM   3527 O  O   . GLU B 2 41  ? -23.197 73.880 -22.264 1.00 47.21  ? 40  GLU B O   1 
ATOM   3528 C  CB  . GLU B 2 41  ? -22.373 72.710 -25.230 1.00 47.88  ? 40  GLU B CB  1 
ATOM   3529 C  CG  . GLU B 2 41  ? -21.582 71.696 -26.096 1.00 48.30  ? 40  GLU B CG  1 
ATOM   3530 C  CD  . GLU B 2 41  ? -22.502 70.776 -26.968 1.00 47.62  ? 40  GLU B CD  1 
ATOM   3531 O  OE1 . GLU B 2 41  ? -23.128 71.323 -27.936 1.00 47.90  ? 40  GLU B OE1 1 
ATOM   3532 O  OE2 . GLU B 2 41  ? -22.578 69.526 -26.694 1.00 46.95  ? 40  GLU B OE2 1 
ATOM   3533 N  N   . GLU B 2 42  ? -24.985 73.393 -23.564 1.00 45.94  ? 41  GLU B N   1 
ATOM   3534 C  CA  . GLU B 2 42  ? -25.852 74.402 -22.963 1.00 45.88  ? 41  GLU B CA  1 
ATOM   3535 C  C   . GLU B 2 42  ? -26.177 74.091 -21.503 1.00 45.43  ? 41  GLU B C   1 
ATOM   3536 O  O   . GLU B 2 42  ? -26.369 75.005 -20.700 1.00 46.02  ? 41  GLU B O   1 
ATOM   3537 C  CB  . GLU B 2 42  ? -27.140 74.554 -23.763 1.00 45.34  ? 41  GLU B CB  1 
ATOM   3538 C  CG  . GLU B 2 42  ? -27.065 75.530 -24.913 1.00 46.75  ? 41  GLU B CG  1 
ATOM   3539 C  CD  . GLU B 2 42  ? -28.105 75.222 -25.960 1.00 55.27  ? 41  GLU B CD  1 
ATOM   3540 O  OE1 . GLU B 2 42  ? -28.475 74.037 -26.049 1.00 62.50  ? 41  GLU B OE1 1 
ATOM   3541 O  OE2 . GLU B 2 42  ? -28.565 76.140 -26.675 1.00 46.38  ? 41  GLU B OE2 1 
ATOM   3542 N  N   . PHE B 2 43  ? -26.245 72.808 -21.161 1.00 44.49  ? 42  PHE B N   1 
ATOM   3543 C  CA  . PHE B 2 43  ? -26.457 72.410 -19.775 1.00 45.08  ? 42  PHE B CA  1 
ATOM   3544 C  C   . PHE B 2 43  ? -25.191 72.635 -18.985 1.00 50.50  ? 42  PHE B C   1 
ATOM   3545 O  O   . PHE B 2 43  ? -25.219 73.185 -17.883 1.00 53.57  ? 42  PHE B O   1 
ATOM   3546 C  CB  . PHE B 2 43  ? -26.819 70.934 -19.685 1.00 43.44  ? 42  PHE B CB  1 
ATOM   3547 C  CG  . PHE B 2 43  ? -28.285 70.669 -19.767 1.00 44.28  ? 42  PHE B CG  1 
ATOM   3548 C  CD1 . PHE B 2 43  ? -29.101 70.952 -18.693 1.00 43.33  ? 42  PHE B CD1 1 
ATOM   3549 C  CD2 . PHE B 2 43  ? -28.845 70.116 -20.909 1.00 45.13  ? 42  PHE B CD2 1 
ATOM   3550 C  CE1 . PHE B 2 43  ? -30.450 70.701 -18.751 1.00 43.03  ? 42  PHE B CE1 1 
ATOM   3551 C  CE2 . PHE B 2 43  ? -30.195 69.859 -20.973 1.00 44.78  ? 42  PHE B CE2 1 
ATOM   3552 C  CZ  . PHE B 2 43  ? -31.002 70.156 -19.892 1.00 44.21  ? 42  PHE B CZ  1 
ATOM   3553 N  N   . MET B 2 44  ? -24.082 72.199 -19.571 1.00 51.88  ? 43  MET B N   1 
ATOM   3554 C  CA  . MET B 2 44  ? -22.767 72.265 -18.946 1.00 54.09  ? 43  MET B CA  1 
ATOM   3555 C  C   . MET B 2 44  ? -22.230 73.689 -18.798 1.00 58.58  ? 43  MET B C   1 
ATOM   3556 O  O   . MET B 2 44  ? -21.269 73.921 -18.059 1.00 64.14  ? 43  MET B O   1 
ATOM   3557 C  CB  . MET B 2 44  ? -21.776 71.415 -19.744 1.00 52.54  ? 43  MET B CB  1 
ATOM   3558 C  CG  . MET B 2 44  ? -21.980 69.932 -19.563 1.00 45.70  ? 43  MET B CG  1 
ATOM   3559 S  SD  . MET B 2 44  ? -21.884 69.599 -17.802 1.00 54.36  ? 43  MET B SD  1 
ATOM   3560 C  CE  . MET B 2 44  ? -21.461 67.843 -17.805 1.00 50.96  ? 43  MET B CE  1 
ATOM   3561 N  N   . SER B 2 45  ? -22.845 74.641 -19.493 1.00 54.00  ? 44  SER B N   1 
ATOM   3562 C  CA  . SER B 2 45  ? -22.404 76.018 -19.378 1.00 51.55  ? 44  SER B CA  1 
ATOM   3563 C  C   . SER B 2 45  ? -22.815 76.642 -18.042 1.00 54.82  ? 44  SER B C   1 
ATOM   3564 O  O   . SER B 2 45  ? -22.254 77.658 -17.632 1.00 60.61  ? 44  SER B O   1 
ATOM   3565 C  CB  . SER B 2 45  ? -22.922 76.853 -20.538 1.00 51.56  ? 44  SER B CB  1 
ATOM   3566 O  OG  . SER B 2 45  ? -24.170 77.431 -20.215 1.00 59.28  ? 44  SER B OG  1 
ATOM   3567 N  N   . LEU B 2 46  ? -23.790 76.047 -17.361 1.00 54.15  ? 45  LEU B N   1 
ATOM   3568 C  CA  . LEU B 2 46  ? -24.097 76.477 -15.996 1.00 55.76  ? 45  LEU B CA  1 
ATOM   3569 C  C   . LEU B 2 46  ? -23.013 75.933 -15.064 1.00 64.43  ? 45  LEU B C   1 
ATOM   3570 O  O   . LEU B 2 46  ? -22.856 74.711 -14.925 1.00 63.79  ? 45  LEU B O   1 
ATOM   3571 C  CB  . LEU B 2 46  ? -25.464 75.981 -15.520 1.00 50.18  ? 45  LEU B CB  1 
ATOM   3572 C  CG  . LEU B 2 46  ? -26.699 75.927 -16.419 1.00 50.06  ? 45  LEU B CG  1 
ATOM   3573 C  CD1 . LEU B 2 46  ? -27.932 76.048 -15.545 1.00 47.88  ? 45  LEU B CD1 1 
ATOM   3574 C  CD2 . LEU B 2 46  ? -26.723 76.979 -17.516 1.00 49.23  ? 45  LEU B CD2 1 
ATOM   3575 N  N   . PRO B 2 47  ? -22.257 76.835 -14.422 1.00 66.44  ? 46  PRO B N   1 
ATOM   3576 C  CA  . PRO B 2 47  ? -21.112 76.462 -13.580 1.00 64.63  ? 46  PRO B CA  1 
ATOM   3577 C  C   . PRO B 2 47  ? -21.448 75.430 -12.509 1.00 62.72  ? 46  PRO B C   1 
ATOM   3578 O  O   . PRO B 2 47  ? -20.637 74.542 -12.249 1.00 66.46  ? 46  PRO B O   1 
ATOM   3579 C  CB  . PRO B 2 47  ? -20.710 77.788 -12.923 1.00 66.80  ? 46  PRO B CB  1 
ATOM   3580 C  CG  . PRO B 2 47  ? -21.888 78.708 -13.129 1.00 68.42  ? 46  PRO B CG  1 
ATOM   3581 C  CD  . PRO B 2 47  ? -22.488 78.288 -14.425 1.00 66.67  ? 46  PRO B CD  1 
ATOM   3582 N  N   . GLU B 2 48  ? -22.629 75.543 -11.908 1.00 61.57  ? 47  GLU B N   1 
ATOM   3583 C  CA  . GLU B 2 48  ? -23.035 74.642 -10.827 1.00 60.65  ? 47  GLU B CA  1 
ATOM   3584 C  C   . GLU B 2 48  ? -23.171 73.174 -11.266 1.00 58.66  ? 47  GLU B C   1 
ATOM   3585 O  O   . GLU B 2 48  ? -23.175 72.270 -10.433 1.00 58.91  ? 47  GLU B O   1 
ATOM   3586 C  CB  . GLU B 2 48  ? -24.339 75.120 -10.165 1.00 56.97  ? 47  GLU B CB  1 
ATOM   3587 C  CG  . GLU B 2 48  ? -24.242 76.461 -9.433  1.00 58.10  ? 47  GLU B CG  1 
ATOM   3588 C  CD  . GLU B 2 48  ? -24.472 77.660 -10.359 1.00 58.07  ? 47  GLU B CD  1 
ATOM   3589 O  OE1 . GLU B 2 48  ? -24.904 77.433 -11.523 1.00 56.77  ? 47  GLU B OE1 1 
ATOM   3590 O  OE2 . GLU B 2 48  ? -24.225 78.826 -9.926  1.00 59.50  ? 47  GLU B OE2 1 
ATOM   3591 N  N   . LEU B 2 49  ? -23.268 72.945 -12.572 1.00 57.04  ? 48  LEU B N   1 
ATOM   3592 C  CA  . LEU B 2 49  ? -23.472 71.600 -13.100 1.00 52.43  ? 48  LEU B CA  1 
ATOM   3593 C  C   . LEU B 2 49  ? -22.169 70.885 -13.443 1.00 56.98  ? 48  LEU B C   1 
ATOM   3594 O  O   . LEU B 2 49  ? -22.153 69.664 -13.613 1.00 53.05  ? 48  LEU B O   1 
ATOM   3595 C  CB  . LEU B 2 49  ? -24.348 71.655 -14.348 1.00 46.19  ? 48  LEU B CB  1 
ATOM   3596 C  CG  . LEU B 2 49  ? -25.831 71.322 -14.192 1.00 44.91  ? 48  LEU B CG  1 
ATOM   3597 C  CD1 . LEU B 2 49  ? -26.472 72.169 -13.105 1.00 45.36  ? 48  LEU B CD1 1 
ATOM   3598 C  CD2 . LEU B 2 49  ? -26.569 71.508 -15.512 1.00 44.16  ? 48  LEU B CD2 1 
ATOM   3599 N  N   . GLN B 2 50  ? -21.083 71.643 -13.550 1.00 60.56  ? 49  GLN B N   1 
ATOM   3600 C  CA  . GLN B 2 50  ? -19.838 71.113 -14.101 1.00 63.35  ? 49  GLN B CA  1 
ATOM   3601 C  C   . GLN B 2 50  ? -19.189 70.016 -13.251 1.00 68.70  ? 49  GLN B C   1 
ATOM   3602 O  O   . GLN B 2 50  ? -18.538 69.113 -13.785 1.00 67.86  ? 49  GLN B O   1 
ATOM   3603 C  CB  . GLN B 2 50  ? -18.856 72.252 -14.389 1.00 62.78  ? 49  GLN B CB  1 
ATOM   3604 C  CG  . GLN B 2 50  ? -19.252 73.087 -15.602 1.00 63.22  ? 49  GLN B CG  1 
ATOM   3605 C  CD  . GLN B 2 50  ? -18.585 74.444 -15.613 1.00 66.61  ? 49  GLN B CD  1 
ATOM   3606 O  OE1 . GLN B 2 50  ? -17.913 74.823 -14.650 1.00 68.90  ? 49  GLN B OE1 1 
ATOM   3607 N  NE2 . GLN B 2 50  ? -18.768 75.187 -16.697 1.00 67.12  ? 49  GLN B NE2 1 
ATOM   3608 N  N   . GLN B 2 51  ? -19.381 70.082 -11.936 1.00 69.11  ? 50  GLN B N   1 
ATOM   3609 C  CA  . GLN B 2 51  ? -18.824 69.066 -11.051 1.00 65.83  ? 50  GLN B CA  1 
ATOM   3610 C  C   . GLN B 2 51  ? -19.884 68.099 -10.516 1.00 60.46  ? 50  GLN B C   1 
ATOM   3611 O  O   . GLN B 2 51  ? -19.696 67.441 -9.494  1.00 60.93  ? 50  GLN B O   1 
ATOM   3612 C  CB  . GLN B 2 51  ? -18.025 69.710 -9.911  1.00 72.44  ? 50  GLN B CB  1 
ATOM   3613 C  CG  . GLN B 2 51  ? -16.822 70.547 -10.371 1.00 78.96  ? 50  GLN B CG  1 
ATOM   3614 C  CD  . GLN B 2 51  ? -15.995 69.873 -11.465 1.00 80.83  ? 50  GLN B CD  1 
ATOM   3615 O  OE1 . GLN B 2 51  ? -15.759 68.662 -11.432 1.00 81.12  ? 50  GLN B OE1 1 
ATOM   3616 N  NE2 . GLN B 2 51  ? -15.553 70.662 -12.441 1.00 83.33  ? 50  GLN B NE2 1 
ATOM   3617 N  N   . ASN B 2 52  ? -20.998 68.014 -11.229 1.00 52.14  ? 51  ASN B N   1 
ATOM   3618 C  CA  . ASN B 2 52  ? -22.041 67.061 -10.906 1.00 44.72  ? 51  ASN B CA  1 
ATOM   3619 C  C   . ASN B 2 52  ? -21.848 65.805 -11.749 1.00 41.67  ? 51  ASN B C   1 
ATOM   3620 O  O   . ASN B 2 52  ? -21.957 65.854 -12.969 1.00 43.41  ? 51  ASN B O   1 
ATOM   3621 C  CB  . ASN B 2 52  ? -23.414 67.689 -11.161 1.00 41.96  ? 51  ASN B CB  1 
ATOM   3622 C  CG  . ASN B 2 52  ? -24.561 66.901 -10.525 1.00 40.58  ? 51  ASN B CG  1 
ATOM   3623 O  OD1 . ASN B 2 52  ? -24.552 65.670 -10.492 1.00 41.71  ? 51  ASN B OD1 1 
ATOM   3624 N  ND2 . ASN B 2 52  ? -25.562 67.618 -10.030 1.00 37.50  ? 51  ASN B ND2 1 
ATOM   3625 N  N   . PRO B 2 53  ? -21.560 64.668 -11.094 1.00 40.12  ? 52  PRO B N   1 
ATOM   3626 C  CA  . PRO B 2 53  ? -21.301 63.390 -11.780 1.00 36.69  ? 52  PRO B CA  1 
ATOM   3627 C  C   . PRO B 2 53  ? -22.537 62.769 -12.437 1.00 37.94  ? 52  PRO B C   1 
ATOM   3628 O  O   . PRO B 2 53  ? -22.404 61.795 -13.182 1.00 39.80  ? 52  PRO B O   1 
ATOM   3629 C  CB  . PRO B 2 53  ? -20.816 62.479 -10.640 1.00 37.20  ? 52  PRO B CB  1 
ATOM   3630 C  CG  . PRO B 2 53  ? -21.468 63.038 -9.437  1.00 36.98  ? 52  PRO B CG  1 
ATOM   3631 C  CD  . PRO B 2 53  ? -21.488 64.525 -9.629  1.00 37.87  ? 52  PRO B CD  1 
ATOM   3632 N  N   . LEU B 2 54  ? -23.720 63.310 -12.165 1.00 38.95  ? 53  LEU B N   1 
ATOM   3633 C  CA  . LEU B 2 54  ? -24.937 62.713 -12.693 1.00 35.41  ? 53  LEU B CA  1 
ATOM   3634 C  C   . LEU B 2 54  ? -25.585 63.475 -13.844 1.00 37.87  ? 53  LEU B C   1 
ATOM   3635 O  O   . LEU B 2 54  ? -26.564 62.986 -14.407 1.00 36.33  ? 53  LEU B O   1 
ATOM   3636 C  CB  . LEU B 2 54  ? -25.954 62.478 -11.571 1.00 32.89  ? 53  LEU B CB  1 
ATOM   3637 C  CG  . LEU B 2 54  ? -25.631 61.234 -10.740 1.00 32.28  ? 53  LEU B CG  1 
ATOM   3638 C  CD1 . LEU B 2 54  ? -26.389 61.210 -9.428  1.00 32.04  ? 53  LEU B CD1 1 
ATOM   3639 C  CD2 . LEU B 2 54  ? -25.909 59.974 -11.541 1.00 30.64  ? 53  LEU B CD2 1 
ATOM   3640 N  N   . VAL B 2 55  ? -25.048 64.648 -14.200 1.00 35.27  ? 54  VAL B N   1 
ATOM   3641 C  CA  . VAL B 2 55  ? -25.654 65.487 -15.249 1.00 32.01  ? 54  VAL B CA  1 
ATOM   3642 C  C   . VAL B 2 55  ? -26.036 64.709 -16.506 1.00 35.56  ? 54  VAL B C   1 
ATOM   3643 O  O   . VAL B 2 55  ? -27.185 64.777 -16.952 1.00 41.02  ? 54  VAL B O   1 
ATOM   3644 C  CB  . VAL B 2 55  ? -24.760 66.663 -15.663 1.00 33.70  ? 54  VAL B CB  1 
ATOM   3645 C  CG1 . VAL B 2 55  ? -25.338 67.359 -16.880 1.00 33.53  ? 54  VAL B CG1 1 
ATOM   3646 C  CG2 . VAL B 2 55  ? -24.637 67.639 -14.532 1.00 34.61  ? 54  VAL B CG2 1 
ATOM   3647 N  N   . GLN B 2 56  ? -25.086 63.948 -17.050 1.00 34.55  ? 55  GLN B N   1 
ATOM   3648 C  CA  . GLN B 2 56  ? -25.343 63.206 -18.285 1.00 31.72  ? 55  GLN B CA  1 
ATOM   3649 C  C   . GLN B 2 56  ? -26.450 62.150 -18.170 1.00 30.35  ? 55  GLN B C   1 
ATOM   3650 O  O   . GLN B 2 56  ? -27.233 61.982 -19.107 1.00 29.99  ? 55  GLN B O   1 
ATOM   3651 C  CB  . GLN B 2 56  ? -24.068 62.575 -18.851 1.00 34.02  ? 55  GLN B CB  1 
ATOM   3652 C  CG  . GLN B 2 56  ? -24.291 61.875 -20.189 1.00 37.31  ? 55  GLN B CG  1 
ATOM   3653 C  CD  . GLN B 2 56  ? -24.630 62.849 -21.309 1.00 39.04  ? 55  GLN B CD  1 
ATOM   3654 O  OE1 . GLN B 2 56  ? -23.976 63.882 -21.460 1.00 40.14  ? 55  GLN B OE1 1 
ATOM   3655 N  NE2 . GLN B 2 56  ? -25.658 62.527 -22.097 1.00 34.21  ? 55  GLN B NE2 1 
ATOM   3656 N  N   . ARG B 2 57  ? -26.513 61.441 -17.044 1.00 29.85  ? 56  ARG B N   1 
ATOM   3657 C  CA  . ARG B 2 57  ? -27.599 60.492 -16.832 1.00 28.78  ? 56  ARG B CA  1 
ATOM   3658 C  C   . ARG B 2 57  ? -28.959 61.193 -16.886 1.00 27.97  ? 56  ARG B C   1 
ATOM   3659 O  O   . ARG B 2 57  ? -29.888 60.708 -17.525 1.00 27.58  ? 56  ARG B O   1 
ATOM   3660 C  CB  . ARG B 2 57  ? -27.457 59.750 -15.497 1.00 28.51  ? 56  ARG B CB  1 
ATOM   3661 C  CG  . ARG B 2 57  ? -26.226 58.871 -15.367 1.00 29.39  ? 56  ARG B CG  1 
ATOM   3662 C  CD  . ARG B 2 57  ? -26.137 57.829 -16.469 1.00 29.70  ? 56  ARG B CD  1 
ATOM   3663 N  NE  . ARG B 2 57  ? -27.319 56.977 -16.515 1.00 28.88  ? 56  ARG B NE  1 
ATOM   3664 C  CZ  . ARG B 2 57  ? -28.096 56.828 -17.581 1.00 28.79  ? 56  ARG B CZ  1 
ATOM   3665 N  NH1 . ARG B 2 57  ? -27.821 57.466 -18.707 1.00 30.22  ? 56  ARG B NH1 1 
ATOM   3666 N  NH2 . ARG B 2 57  ? -29.149 56.036 -17.519 1.00 28.35  ? 56  ARG B NH2 1 
ATOM   3667 N  N   . VAL B 2 58  ? -29.070 62.334 -16.218 1.00 27.97  ? 57  VAL B N   1 
ATOM   3668 C  CA  . VAL B 2 58  ? -30.319 63.072 -16.209 1.00 27.44  ? 57  VAL B CA  1 
ATOM   3669 C  C   . VAL B 2 58  ? -30.721 63.464 -17.627 1.00 27.66  ? 57  VAL B C   1 
ATOM   3670 O  O   . VAL B 2 58  ? -31.862 63.239 -18.053 1.00 27.60  ? 57  VAL B O   1 
ATOM   3671 C  CB  . VAL B 2 58  ? -30.210 64.325 -15.347 1.00 27.80  ? 57  VAL B CB  1 
ATOM   3672 C  CG1 . VAL B 2 58  ? -31.417 65.250 -15.568 1.00 27.56  ? 57  VAL B CG1 1 
ATOM   3673 C  CG2 . VAL B 2 58  ? -30.073 63.932 -13.886 1.00 27.66  ? 57  VAL B CG2 1 
ATOM   3674 N  N   . ILE B 2 59  ? -29.773 64.035 -18.359 1.00 28.52  ? 58  ILE B N   1 
ATOM   3675 C  CA  . ILE B 2 59  ? -30.004 64.411 -19.744 1.00 28.97  ? 58  ILE B CA  1 
ATOM   3676 C  C   . ILE B 2 59  ? -30.434 63.213 -20.575 1.00 28.85  ? 58  ILE B C   1 
ATOM   3677 O  O   . ILE B 2 59  ? -31.356 63.329 -21.377 1.00 28.89  ? 58  ILE B O   1 
ATOM   3678 C  CB  . ILE B 2 59  ? -28.758 65.031 -20.351 1.00 30.16  ? 58  ILE B CB  1 
ATOM   3679 C  CG1 . ILE B 2 59  ? -28.482 66.374 -19.698 1.00 30.65  ? 58  ILE B CG1 1 
ATOM   3680 C  CG2 . ILE B 2 59  ? -28.929 65.219 -21.815 1.00 30.76  ? 58  ILE B CG2 1 
ATOM   3681 C  CD1 . ILE B 2 59  ? -27.186 66.984 -20.132 1.00 32.11  ? 58  ILE B CD1 1 
ATOM   3682 N  N   . ASP B 2 60  ? -29.792 62.060 -20.382 1.00 28.91  ? 59  ASP B N   1 
ATOM   3683 C  CA  . ASP B 2 60  ? -30.139 60.886 -21.183 1.00 29.12  ? 59  ASP B CA  1 
ATOM   3684 C  C   . ASP B 2 60  ? -31.544 60.411 -20.874 1.00 28.44  ? 59  ASP B C   1 
ATOM   3685 O  O   . ASP B 2 60  ? -32.246 59.903 -21.750 1.00 30.20  ? 59  ASP B O   1 
ATOM   3686 C  CB  . ASP B 2 60  ? -29.154 59.734 -20.988 1.00 31.60  ? 59  ASP B CB  1 
ATOM   3687 C  CG  . ASP B 2 60  ? -27.832 59.984 -21.670 1.00 47.40  ? 59  ASP B CG  1 
ATOM   3688 O  OD1 . ASP B 2 60  ? -27.818 60.771 -22.647 1.00 56.59  ? 59  ASP B OD1 1 
ATOM   3689 O  OD2 . ASP B 2 60  ? -26.810 59.405 -21.228 1.00 52.04  ? 59  ASP B OD2 1 
ATOM   3690 N  N   . ILE B 2 61  ? -31.963 60.568 -19.625 1.00 27.63  ? 60  ILE B N   1 
ATOM   3691 C  CA  . ILE B 2 61  ? -33.332 60.202 -19.293 1.00 27.20  ? 60  ILE B CA  1 
ATOM   3692 C  C   . ILE B 2 61  ? -34.333 61.187 -19.902 1.00 29.27  ? 60  ILE B C   1 
ATOM   3693 O  O   . ILE B 2 61  ? -35.360 60.762 -20.411 1.00 31.37  ? 60  ILE B O   1 
ATOM   3694 C  CB  . ILE B 2 61  ? -33.556 60.055 -17.786 1.00 26.49  ? 60  ILE B CB  1 
ATOM   3695 C  CG1 . ILE B 2 61  ? -32.601 59.007 -17.221 1.00 26.51  ? 60  ILE B CG1 1 
ATOM   3696 C  CG2 . ILE B 2 61  ? -34.993 59.653 -17.512 1.00 26.32  ? 60  ILE B CG2 1 
ATOM   3697 C  CD1 . ILE B 2 61  ? -32.403 59.115 -15.725 1.00 26.06  ? 60  ILE B CD1 1 
ATOM   3698 N  N   . PHE B 2 62  ? -34.023 62.484 -19.864 1.00 27.38  ? 61  PHE B N   1 
ATOM   3699 C  CA  . PHE B 2 62  ? -34.901 63.517 -20.430 1.00 34.16  ? 61  PHE B CA  1 
ATOM   3700 C  C   . PHE B 2 62  ? -35.046 63.357 -21.944 1.00 30.87  ? 61  PHE B C   1 
ATOM   3701 O  O   . PHE B 2 62  ? -36.134 63.495 -22.512 1.00 33.61  ? 61  PHE B O   1 
ATOM   3702 C  CB  . PHE B 2 62  ? -34.377 64.924 -20.128 1.00 27.82  ? 61  PHE B CB  1 
ATOM   3703 C  CG  . PHE B 2 62  ? -34.719 65.430 -18.749 1.00 27.36  ? 61  PHE B CG  1 
ATOM   3704 C  CD1 . PHE B 2 62  ? -34.914 64.560 -17.687 1.00 26.76  ? 61  PHE B CD1 1 
ATOM   3705 C  CD2 . PHE B 2 62  ? -34.842 66.792 -18.512 1.00 27.73  ? 61  PHE B CD2 1 
ATOM   3706 C  CE1 . PHE B 2 62  ? -35.227 65.048 -16.422 1.00 26.55  ? 61  PHE B CE1 1 
ATOM   3707 C  CE2 . PHE B 2 62  ? -35.160 67.279 -17.246 1.00 27.58  ? 61  PHE B CE2 1 
ATOM   3708 C  CZ  . PHE B 2 62  ? -35.352 66.405 -16.210 1.00 27.00  ? 61  PHE B CZ  1 
ATOM   3709 N  N   . ASP B 2 63  ? -33.927 63.065 -22.587 1.00 28.81  ? 62  ASP B N   1 
ATOM   3710 C  CA  . ASP B 2 63  ? -33.867 62.844 -24.024 1.00 30.50  ? 62  ASP B CA  1 
ATOM   3711 C  C   . ASP B 2 63  ? -34.560 61.530 -24.402 1.00 29.21  ? 62  ASP B C   1 
ATOM   3712 O  O   . ASP B 2 63  ? -33.903 60.508 -24.614 1.00 32.44  ? 62  ASP B O   1 
ATOM   3713 C  CB  . ASP B 2 63  ? -32.390 62.854 -24.408 1.00 29.78  ? 62  ASP B CB  1 
ATOM   3714 C  CG  . ASP B 2 63  ? -32.134 62.448 -25.816 1.00 34.57  ? 62  ASP B CG  1 
ATOM   3715 O  OD1 . ASP B 2 63  ? -33.038 62.555 -26.655 1.00 37.31  ? 62  ASP B OD1 1 
ATOM   3716 O  OD2 . ASP B 2 63  ? -30.997 62.009 -26.089 1.00 33.31  ? 62  ASP B OD2 1 
ATOM   3717 N  N   . THR B 2 64  ? -35.891 61.562 -24.482 1.00 29.64  ? 63  THR B N   1 
ATOM   3718 C  CA  . THR B 2 64  ? -36.676 60.343 -24.711 1.00 28.89  ? 63  THR B CA  1 
ATOM   3719 C  C   . THR B 2 64  ? -36.754 59.876 -26.158 1.00 29.83  ? 63  THR B C   1 
ATOM   3720 O  O   . THR B 2 64  ? -36.921 58.681 -26.394 1.00 33.61  ? 63  THR B O   1 
ATOM   3721 C  CB  . THR B 2 64  ? -38.121 60.442 -24.163 1.00 28.41  ? 63  THR B CB  1 
ATOM   3722 O  OG1 . THR B 2 64  ? -38.667 61.735 -24.474 1.00 28.38  ? 63  THR B OG1 1 
ATOM   3723 C  CG2 . THR B 2 64  ? -38.132 60.222 -22.667 1.00 27.82  ? 63  THR B CG2 1 
ATOM   3724 N  N   . ASP B 2 65  ? -36.658 60.794 -27.123 1.00 30.50  ? 64  ASP B N   1 
ATOM   3725 C  CA  . ASP B 2 65  ? -36.656 60.384 -28.538 1.00 35.01  ? 64  ASP B CA  1 
ATOM   3726 C  C   . ASP B 2 65  ? -35.285 59.875 -28.992 1.00 39.89  ? 64  ASP B C   1 
ATOM   3727 O  O   . ASP B 2 65  ? -35.168 59.180 -30.001 1.00 47.04  ? 64  ASP B O   1 
ATOM   3728 C  CB  . ASP B 2 65  ? -37.219 61.461 -29.491 1.00 31.87  ? 64  ASP B CB  1 
ATOM   3729 C  CG  . ASP B 2 65  ? -36.328 62.663 -29.623 1.00 43.78  ? 64  ASP B CG  1 
ATOM   3730 O  OD1 . ASP B 2 65  ? -35.093 62.546 -29.452 1.00 36.78  ? 64  ASP B OD1 1 
ATOM   3731 O  OD2 . ASP B 2 65  ? -36.874 63.742 -29.913 1.00 42.28  ? 64  ASP B OD2 1 
ATOM   3732 N  N   . GLY B 2 66  ? -34.257 60.259 -28.244 1.00 34.75  ? 65  GLY B N   1 
ATOM   3733 C  CA  . GLY B 2 66  ? -32.937 59.707 -28.434 1.00 34.57  ? 65  GLY B CA  1 
ATOM   3734 C  C   . GLY B 2 66  ? -31.953 60.542 -29.242 1.00 36.91  ? 65  GLY B C   1 
ATOM   3735 O  O   . GLY B 2 66  ? -30.847 60.070 -29.515 1.00 42.42  ? 65  GLY B O   1 
ATOM   3736 N  N   . ASN B 2 67  ? -32.316 61.770 -29.612 1.00 36.11  ? 66  ASN B N   1 
ATOM   3737 C  CA  . ASN B 2 67  ? -31.443 62.566 -30.482 1.00 35.86  ? 66  ASN B CA  1 
ATOM   3738 C  C   . ASN B 2 67  ? -30.326 63.387 -29.820 1.00 37.63  ? 66  ASN B C   1 
ATOM   3739 O  O   . ASN B 2 67  ? -29.724 64.237 -30.474 1.00 39.27  ? 66  ASN B O   1 
ATOM   3740 C  CB  . ASN B 2 67  ? -32.258 63.448 -31.428 1.00 36.70  ? 66  ASN B CB  1 
ATOM   3741 C  CG  . ASN B 2 67  ? -32.778 64.689 -30.763 1.00 41.80  ? 66  ASN B CG  1 
ATOM   3742 O  OD1 . ASN B 2 67  ? -32.418 65.001 -29.633 1.00 44.44  ? 66  ASN B OD1 1 
ATOM   3743 N  ND2 . ASN B 2 67  ? -33.626 65.423 -31.470 1.00 36.10  ? 66  ASN B ND2 1 
ATOM   3744 N  N   . GLY B 2 68  ? -30.088 63.167 -28.528 1.00 34.39  ? 67  GLY B N   1 
ATOM   3745 C  CA  . GLY B 2 68  ? -28.961 63.778 -27.842 1.00 33.95  ? 67  GLY B CA  1 
ATOM   3746 C  C   . GLY B 2 68  ? -29.187 65.182 -27.296 1.00 33.59  ? 67  GLY B C   1 
ATOM   3747 O  O   . GLY B 2 68  ? -28.309 65.750 -26.651 1.00 36.25  ? 67  GLY B O   1 
ATOM   3748 N  N   . GLU B 2 69  ? -30.356 65.757 -27.560 1.00 34.41  ? 68  GLU B N   1 
ATOM   3749 C  CA  . GLU B 2 69  ? -30.686 67.095 -27.057 1.00 32.90  ? 68  GLU B CA  1 
ATOM   3750 C  C   . GLU B 2 69  ? -32.020 67.054 -26.316 1.00 35.74  ? 68  GLU B C   1 
ATOM   3751 O  O   . GLU B 2 69  ? -32.724 66.093 -26.383 1.00 34.07  ? 68  GLU B O   1 
ATOM   3752 C  CB  . GLU B 2 69  ? -30.710 68.131 -28.196 1.00 35.41  ? 68  GLU B CB  1 
ATOM   3753 C  CG  . GLU B 2 69  ? -29.369 68.215 -28.980 1.00 44.87  ? 68  GLU B CG  1 
ATOM   3754 C  CD  . GLU B 2 69  ? -29.140 69.568 -29.660 1.00 49.34  ? 68  GLU B CD  1 
ATOM   3755 O  OE1 . GLU B 2 69  ? -30.046 70.427 -29.579 1.00 57.10  ? 68  GLU B OE1 1 
ATOM   3756 O  OE2 . GLU B 2 69  ? -28.064 69.786 -30.271 1.00 48.22  ? 68  GLU B OE2 1 
ATOM   3757 N  N   . VAL B 2 70  ? -32.351 68.086 -25.559 1.00 35.24  ? 69  VAL B N   1 
ATOM   3758 C  CA  . VAL B 2 70  ? -33.620 68.098 -24.852 1.00 30.26  ? 69  VAL B CA  1 
ATOM   3759 C  C   . VAL B 2 70  ? -34.514 69.179 -25.402 1.00 30.56  ? 69  VAL B C   1 
ATOM   3760 O  O   . VAL B 2 70  ? -34.218 70.372 -25.302 1.00 31.16  ? 69  VAL B O   1 
ATOM   3761 C  CB  . VAL B 2 70  ? -33.457 68.331 -23.339 1.00 30.57  ? 69  VAL B CB  1 
ATOM   3762 C  CG1 . VAL B 2 70  ? -34.815 68.266 -22.679 1.00 28.83  ? 69  VAL B CG1 1 
ATOM   3763 C  CG2 . VAL B 2 70  ? -32.517 67.288 -22.723 1.00 29.58  ? 69  VAL B CG2 1 
ATOM   3764 N  N   . ASP B 2 71  ? -35.611 68.761 -26.005 1.00 30.34  ? 70  ASP B N   1 
ATOM   3765 C  CA  . ASP B 2 71  ? -36.542 69.738 -26.499 1.00 31.67  ? 70  ASP B CA  1 
ATOM   3766 C  C   . ASP B 2 71  ? -37.562 70.049 -25.413 1.00 34.24  ? 70  ASP B C   1 
ATOM   3767 O  O   . ASP B 2 71  ? -37.516 69.471 -24.324 1.00 34.12  ? 70  ASP B O   1 
ATOM   3768 C  CB  . ASP B 2 71  ? -37.174 69.292 -27.820 1.00 32.65  ? 70  ASP B CB  1 
ATOM   3769 C  CG  . ASP B 2 71  ? -38.146 68.153 -27.657 1.00 36.31  ? 70  ASP B CG  1 
ATOM   3770 O  OD1 . ASP B 2 71  ? -39.261 68.400 -27.147 1.00 43.17  ? 70  ASP B OD1 1 
ATOM   3771 O  OD2 . ASP B 2 71  ? -37.815 67.024 -28.074 1.00 39.79  ? 70  ASP B OD2 1 
ATOM   3772 N  N   . PHE B 2 72  ? -38.472 70.969 -25.711 1.00 30.26  ? 71  PHE B N   1 
ATOM   3773 C  CA  . PHE B 2 72  ? -39.361 71.515 -24.694 1.00 29.80  ? 71  PHE B CA  1 
ATOM   3774 C  C   . PHE B 2 72  ? -40.311 70.498 -24.077 1.00 28.92  ? 71  PHE B C   1 
ATOM   3775 O  O   . PHE B 2 72  ? -40.538 70.532 -22.873 1.00 31.21  ? 71  PHE B O   1 
ATOM   3776 C  CB  . PHE B 2 72  ? -40.140 72.713 -25.227 1.00 30.59  ? 71  PHE B CB  1 
ATOM   3777 C  CG  . PHE B 2 72  ? -40.962 73.400 -24.187 1.00 30.37  ? 71  PHE B CG  1 
ATOM   3778 C  CD1 . PHE B 2 72  ? -40.384 73.840 -23.009 1.00 30.19  ? 71  PHE B CD1 1 
ATOM   3779 C  CD2 . PHE B 2 72  ? -42.313 73.611 -24.381 1.00 30.52  ? 71  PHE B CD2 1 
ATOM   3780 C  CE1 . PHE B 2 72  ? -41.139 74.474 -22.036 1.00 30.18  ? 71  PHE B CE1 1 
ATOM   3781 C  CE2 . PHE B 2 72  ? -43.074 74.247 -23.410 1.00 30.48  ? 71  PHE B CE2 1 
ATOM   3782 C  CZ  . PHE B 2 72  ? -42.477 74.680 -22.233 1.00 30.31  ? 71  PHE B CZ  1 
ATOM   3783 N  N   . LYS B 2 73  ? -40.862 69.603 -24.889 1.00 28.96  ? 72  LYS B N   1 
ATOM   3784 C  CA  . LYS B 2 73  ? -41.714 68.540 -24.373 1.00 28.38  ? 72  LYS B CA  1 
ATOM   3785 C  C   . LYS B 2 73  ? -40.975 67.654 -23.355 1.00 28.25  ? 72  LYS B C   1 
ATOM   3786 O  O   . LYS B 2 73  ? -41.491 67.359 -22.272 1.00 27.25  ? 72  LYS B O   1 
ATOM   3787 C  CB  . LYS B 2 73  ? -42.244 67.688 -25.518 1.00 28.82  ? 72  LYS B CB  1 
ATOM   3788 C  CG  . LYS B 2 73  ? -43.010 66.453 -25.078 1.00 28.48  ? 72  LYS B CG  1 
ATOM   3789 C  CD  . LYS B 2 73  ? -43.099 65.446 -26.222 1.00 29.10  ? 72  LYS B CD  1 
ATOM   3790 C  CE  . LYS B 2 73  ? -43.281 64.015 -25.713 1.00 30.21  ? 72  LYS B CE  1 
ATOM   3791 N  NZ  . LYS B 2 73  ? -44.714 63.594 -25.811 1.00 36.52  ? 72  LYS B NZ  1 
ATOM   3792 N  N   . GLU B 2 74  ? -39.756 67.244 -23.702 1.00 27.83  ? 73  GLU B N   1 
ATOM   3793 C  CA  . GLU B 2 74  ? -38.967 66.342 -22.857 1.00 27.41  ? 73  GLU B CA  1 
ATOM   3794 C  C   . GLU B 2 74  ? -38.443 67.044 -21.652 1.00 27.18  ? 73  GLU B C   1 
ATOM   3795 O  O   . GLU B 2 74  ? -38.137 66.403 -20.639 1.00 26.85  ? 73  GLU B O   1 
ATOM   3796 C  CB  . GLU B 2 74  ? -37.759 65.805 -23.600 1.00 27.82  ? 73  GLU B CB  1 
ATOM   3797 C  CG  . GLU B 2 74  ? -38.098 65.295 -24.958 1.00 28.38  ? 73  GLU B CG  1 
ATOM   3798 C  CD  . GLU B 2 74  ? -36.888 64.893 -25.719 1.00 34.37  ? 73  GLU B CD  1 
ATOM   3799 O  OE1 . GLU B 2 74  ? -35.877 65.571 -25.551 1.00 29.23  ? 73  GLU B OE1 1 
ATOM   3800 O  OE2 . GLU B 2 74  ? -36.932 63.897 -26.470 1.00 34.20  ? 73  GLU B OE2 1 
ATOM   3801 N  N   . PHE B 2 75  ? -38.303 68.355 -21.794 1.00 27.56  ? 74  PHE B N   1 
ATOM   3802 C  CA  . PHE B 2 75  ? -37.939 69.214 -20.700 1.00 27.61  ? 74  PHE B CA  1 
ATOM   3803 C  C   . PHE B 2 75  ? -39.092 69.269 -19.699 1.00 27.23  ? 74  PHE B C   1 
ATOM   3804 O  O   . PHE B 2 75  ? -38.903 68.998 -18.510 1.00 27.51  ? 74  PHE B O   1 
ATOM   3805 C  CB  . PHE B 2 75  ? -37.624 70.606 -21.223 1.00 28.37  ? 74  PHE B CB  1 
ATOM   3806 C  CG  . PHE B 2 75  ? -37.234 71.556 -20.159 1.00 28.69  ? 74  PHE B CG  1 
ATOM   3807 C  CD1 . PHE B 2 75  ? -36.019 71.409 -19.509 1.00 28.89  ? 74  PHE B CD1 1 
ATOM   3808 C  CD2 . PHE B 2 75  ? -38.077 72.579 -19.786 1.00 28.96  ? 74  PHE B CD2 1 
ATOM   3809 C  CE1 . PHE B 2 75  ? -35.634 72.277 -18.499 1.00 29.41  ? 74  PHE B CE1 1 
ATOM   3810 C  CE2 . PHE B 2 75  ? -37.709 73.460 -18.788 1.00 29.47  ? 74  PHE B CE2 1 
ATOM   3811 C  CZ  . PHE B 2 75  ? -36.475 73.309 -18.139 1.00 29.72  ? 74  PHE B CZ  1 
ATOM   3812 N  N   . ILE B 2 76  ? -40.287 69.612 -20.179 1.00 27.31  ? 75  ILE B N   1 
ATOM   3813 C  CA  . ILE B 2 76  ? -41.472 69.574 -19.334 1.00 27.12  ? 75  ILE B CA  1 
ATOM   3814 C  C   . ILE B 2 76  ? -41.667 68.200 -18.710 1.00 26.67  ? 75  ILE B C   1 
ATOM   3815 O  O   . ILE B 2 76  ? -41.837 68.089 -17.510 1.00 26.60  ? 75  ILE B O   1 
ATOM   3816 C  CB  . ILE B 2 76  ? -42.743 69.900 -20.103 1.00 27.39  ? 75  ILE B CB  1 
ATOM   3817 C  CG1 . ILE B 2 76  ? -42.759 71.372 -20.536 1.00 28.04  ? 75  ILE B CG1 1 
ATOM   3818 C  CG2 . ILE B 2 76  ? -43.964 69.558 -19.256 1.00 27.29  ? 75  ILE B CG2 1 
ATOM   3819 C  CD1 . ILE B 2 76  ? -42.573 72.360 -19.431 1.00 28.31  ? 75  ILE B CD1 1 
ATOM   3820 N  N   . GLU B 2 77  ? -41.633 67.149 -19.517 1.00 26.55  ? 76  GLU B N   1 
ATOM   3821 C  CA  . GLU B 2 77  ? -41.902 65.816 -18.992 1.00 28.79  ? 76  GLU B CA  1 
ATOM   3822 C  C   . GLU B 2 77  ? -40.860 65.334 -17.992 1.00 28.98  ? 76  GLU B C   1 
ATOM   3823 O  O   . GLU B 2 77  ? -41.177 64.570 -17.086 1.00 33.94  ? 76  GLU B O   1 
ATOM   3824 C  CB  . GLU B 2 77  ? -42.070 64.808 -20.119 1.00 26.51  ? 76  GLU B CB  1 
ATOM   3825 C  CG  . GLU B 2 77  ? -43.341 65.014 -20.951 1.00 26.86  ? 76  GLU B CG  1 
ATOM   3826 C  CD  . GLU B 2 77  ? -43.573 63.876 -21.944 1.00 29.62  ? 76  GLU B CD  1 
ATOM   3827 O  OE1 . GLU B 2 77  ? -42.660 63.021 -22.101 1.00 31.94  ? 76  GLU B OE1 1 
ATOM   3828 O  OE2 . GLU B 2 77  ? -44.665 63.829 -22.557 1.00 28.71  ? 76  GLU B OE2 1 
ATOM   3829 N  N   . GLY B 2 78  ? -39.622 65.793 -18.149 1.00 26.27  ? 77  GLY B N   1 
ATOM   3830 C  CA  . GLY B 2 78  ? -38.541 65.453 -17.238 1.00 26.32  ? 77  GLY B CA  1 
ATOM   3831 C  C   . GLY B 2 78  ? -38.718 66.149 -15.910 1.00 26.46  ? 77  GLY B C   1 
ATOM   3832 O  O   . GLY B 2 78  ? -38.817 65.492 -14.890 1.00 26.53  ? 77  GLY B O   1 
ATOM   3833 N  N   . VAL B 2 79  ? -38.787 67.479 -15.925 1.00 26.68  ? 78  VAL B N   1 
ATOM   3834 C  CA  . VAL B 2 79  ? -39.068 68.251 -14.714 1.00 27.02  ? 78  VAL B CA  1 
ATOM   3835 C  C   . VAL B 2 79  ? -40.306 67.766 -13.952 1.00 27.40  ? 78  VAL B C   1 
ATOM   3836 O  O   . VAL B 2 79  ? -40.324 67.781 -12.727 1.00 35.01  ? 78  VAL B O   1 
ATOM   3837 C  CB  . VAL B 2 79  ? -39.236 69.753 -15.011 1.00 27.42  ? 78  VAL B CB  1 
ATOM   3838 C  CG1 . VAL B 2 79  ? -39.435 70.525 -13.725 1.00 27.99  ? 78  VAL B CG1 1 
ATOM   3839 C  CG2 . VAL B 2 79  ? -38.027 70.281 -15.745 1.00 27.74  ? 78  VAL B CG2 1 
ATOM   3840 N  N   . SER B 2 80  ? -41.332 67.323 -14.672 1.00 26.71  ? 79  SER B N   1 
ATOM   3841 C  CA  . SER B 2 80  ? -42.567 66.877 -14.036 1.00 26.87  ? 79  SER B CA  1 
ATOM   3842 C  C   . SER B 2 80  ? -42.355 65.655 -13.098 1.00 27.00  ? 79  SER B C   1 
ATOM   3843 O  O   . SER B 2 80  ? -43.108 65.448 -12.131 1.00 27.44  ? 79  SER B O   1 
ATOM   3844 C  CB  . SER B 2 80  ? -43.651 66.649 -15.097 1.00 26.78  ? 79  SER B CB  1 
ATOM   3845 O  OG  . SER B 2 80  ? -44.730 65.856 -14.625 1.00 30.91  ? 79  SER B OG  1 
ATOM   3846 N  N   . GLN B 2 81  ? -41.315 64.869 -13.358 1.00 26.81  ? 80  GLN B N   1 
ATOM   3847 C  CA  . GLN B 2 81  ? -40.957 63.752 -12.475 1.00 27.37  ? 80  GLN B CA  1 
ATOM   3848 C  C   . GLN B 2 81  ? -40.685 64.246 -11.057 1.00 31.15  ? 80  GLN B C   1 
ATOM   3849 O  O   . GLN B 2 81  ? -40.787 63.499 -10.087 1.00 35.16  ? 80  GLN B O   1 
ATOM   3850 C  CB  . GLN B 2 81  ? -39.687 63.062 -12.979 1.00 26.99  ? 80  GLN B CB  1 
ATOM   3851 C  CG  . GLN B 2 81  ? -39.758 62.499 -14.393 1.00 26.65  ? 80  GLN B CG  1 
ATOM   3852 C  CD  . GLN B 2 81  ? -40.981 61.629 -14.588 1.00 33.64  ? 80  GLN B CD  1 
ATOM   3853 O  OE1 . GLN B 2 81  ? -41.089 60.533 -14.009 1.00 41.17  ? 80  GLN B OE1 1 
ATOM   3854 N  NE2 . GLN B 2 81  ? -41.927 62.117 -15.398 1.00 31.78  ? 80  GLN B NE2 1 
ATOM   3855 N  N   . PHE B 2 82  ? -40.326 65.519 -10.957 1.00 31.89  ? 81  PHE B N   1 
ATOM   3856 C  CA  . PHE B 2 82  ? -39.920 66.130 -9.707  1.00 31.92  ? 81  PHE B CA  1 
ATOM   3857 C  C   . PHE B 2 82  ? -40.982 67.062 -9.153  1.00 33.45  ? 81  PHE B C   1 
ATOM   3858 O  O   . PHE B 2 82  ? -40.727 67.801 -8.210  1.00 36.30  ? 81  PHE B O   1 
ATOM   3859 C  CB  . PHE B 2 82  ? -38.629 66.910 -9.931  1.00 32.26  ? 81  PHE B CB  1 
ATOM   3860 C  CG  . PHE B 2 82  ? -37.448 66.037 -10.169 1.00 35.24  ? 81  PHE B CG  1 
ATOM   3861 C  CD1 . PHE B 2 82  ? -37.271 65.414 -11.388 1.00 35.74  ? 81  PHE B CD1 1 
ATOM   3862 C  CD2 . PHE B 2 82  ? -36.529 65.807 -9.163  1.00 35.09  ? 81  PHE B CD2 1 
ATOM   3863 C  CE1 . PHE B 2 82  ? -36.186 64.598 -11.609 1.00 36.56  ? 81  PHE B CE1 1 
ATOM   3864 C  CE2 . PHE B 2 82  ? -35.442 64.990 -9.376  1.00 40.16  ? 81  PHE B CE2 1 
ATOM   3865 C  CZ  . PHE B 2 82  ? -35.268 64.386 -10.604 1.00 39.38  ? 81  PHE B CZ  1 
ATOM   3866 N  N   . SER B 2 83  ? -42.168 67.042 -9.748  1.00 36.24  ? 82  SER B N   1 
ATOM   3867 C  CA  . SER B 2 83  ? -43.246 67.898 -9.287  1.00 36.55  ? 82  SER B CA  1 
ATOM   3868 C  C   . SER B 2 83  ? -43.638 67.526 -7.869  1.00 39.19  ? 82  SER B C   1 
ATOM   3869 O  O   . SER B 2 83  ? -43.495 66.373 -7.439  1.00 35.95  ? 82  SER B O   1 
ATOM   3870 C  CB  . SER B 2 83  ? -44.465 67.795 -10.198 1.00 36.16  ? 82  SER B CB  1 
ATOM   3871 O  OG  . SER B 2 83  ? -45.438 68.761 -9.832  1.00 39.16  ? 82  SER B OG  1 
ATOM   3872 N  N   . VAL B 2 84  ? -44.137 68.514 -7.140  1.00 48.59  ? 83  VAL B N   1 
ATOM   3873 C  CA  . VAL B 2 84  ? -44.590 68.300 -5.772  1.00 49.62  ? 83  VAL B CA  1 
ATOM   3874 C  C   . VAL B 2 84  ? -45.809 67.376 -5.756  1.00 45.94  ? 83  VAL B C   1 
ATOM   3875 O  O   . VAL B 2 84  ? -46.153 66.812 -4.723  1.00 44.13  ? 83  VAL B O   1 
ATOM   3876 C  CB  . VAL B 2 84  ? -44.937 69.639 -5.097  1.00 52.57  ? 83  VAL B CB  1 
ATOM   3877 C  CG1 . VAL B 2 84  ? -43.830 70.659 -5.358  1.00 55.24  ? 83  VAL B CG1 1 
ATOM   3878 C  CG2 . VAL B 2 84  ? -46.258 70.174 -5.627  1.00 50.56  ? 83  VAL B CG2 1 
ATOM   3879 N  N   . LYS B 2 85  ? -46.443 67.223 -6.920  1.00 39.20  ? 84  LYS B N   1 
ATOM   3880 C  CA  . LYS B 2 85  ? -47.662 66.434 -7.066  1.00 33.71  ? 84  LYS B CA  1 
ATOM   3881 C  C   . LYS B 2 85  ? -47.372 65.006 -7.559  1.00 37.45  ? 84  LYS B C   1 
ATOM   3882 O  O   . LYS B 2 85  ? -48.292 64.225 -7.821  1.00 38.88  ? 84  LYS B O   1 
ATOM   3883 C  CB  . LYS B 2 85  ? -48.618 67.142 -8.027  1.00 31.97  ? 84  LYS B CB  1 
ATOM   3884 C  CG  . LYS B 2 85  ? -49.122 68.482 -7.536  1.00 32.22  ? 84  LYS B CG  1 
ATOM   3885 C  CD  . LYS B 2 85  ? -49.516 69.356 -8.707  1.00 32.16  ? 84  LYS B CD  1 
ATOM   3886 C  CE  . LYS B 2 85  ? -50.534 70.397 -8.315  1.00 32.82  ? 84  LYS B CE  1 
ATOM   3887 N  NZ  . LYS B 2 85  ? -50.838 71.197 -9.545  1.00 32.45  ? 84  LYS B NZ  1 
ATOM   3888 N  N   . GLY B 2 86  ? -46.090 64.671 -7.681  1.00 37.25  ? 85  GLY B N   1 
ATOM   3889 C  CA  . GLY B 2 86  ? -45.690 63.357 -8.143  1.00 34.08  ? 85  GLY B CA  1 
ATOM   3890 C  C   . GLY B 2 86  ? -45.819 62.282 -7.087  1.00 39.15  ? 85  GLY B C   1 
ATOM   3891 O  O   . GLY B 2 86  ? -45.447 62.480 -5.931  1.00 41.25  ? 85  GLY B O   1 
ATOM   3892 N  N   . ASP B 2 87  ? -46.348 61.132 -7.489  1.00 45.90  ? 86  ASP B N   1 
ATOM   3893 C  CA  . ASP B 2 87  ? -46.456 59.986 -6.588  1.00 47.23  ? 86  ASP B CA  1 
ATOM   3894 C  C   . ASP B 2 87  ? -45.092 59.347 -6.314  1.00 49.00  ? 86  ASP B C   1 
ATOM   3895 O  O   . ASP B 2 87  ? -44.115 59.631 -6.999  1.00 48.97  ? 86  ASP B O   1 
ATOM   3896 C  CB  . ASP B 2 87  ? -47.482 58.947 -7.095  1.00 51.13  ? 86  ASP B CB  1 
ATOM   3897 C  CG  . ASP B 2 87  ? -47.278 58.555 -8.558  1.00 57.60  ? 86  ASP B CG  1 
ATOM   3898 O  OD1 . ASP B 2 87  ? -46.824 59.397 -9.362  1.00 61.98  ? 86  ASP B OD1 1 
ATOM   3899 O  OD2 . ASP B 2 87  ? -47.599 57.401 -8.911  1.00 58.38  ? 86  ASP B OD2 1 
ATOM   3900 N  N   . LYS B 2 88  ? -45.036 58.500 -5.294  1.00 54.11  ? 87  LYS B N   1 
ATOM   3901 C  CA  . LYS B 2 88  ? -43.804 57.822 -4.911  1.00 49.98  ? 87  LYS B CA  1 
ATOM   3902 C  C   . LYS B 2 88  ? -43.267 56.957 -6.050  1.00 46.02  ? 87  LYS B C   1 
ATOM   3903 O  O   . LYS B 2 88  ? -42.069 56.935 -6.326  1.00 47.23  ? 87  LYS B O   1 
ATOM   3904 C  CB  . LYS B 2 88  ? -44.079 56.965 -3.676  1.00 52.63  ? 87  LYS B CB  1 
ATOM   3905 C  CG  . LYS B 2 88  ? -42.989 55.979 -3.271  1.00 53.27  ? 87  LYS B CG  1 
ATOM   3906 C  CD  . LYS B 2 88  ? -43.595 54.877 -2.384  1.00 56.39  ? 87  LYS B CD  1 
ATOM   3907 C  CE  . LYS B 2 88  ? -42.538 53.934 -1.808  1.00 58.89  ? 87  LYS B CE  1 
ATOM   3908 N  NZ  . LYS B 2 88  ? -43.115 52.970 -0.814  1.00 59.92  ? 87  LYS B NZ  1 
ATOM   3909 N  N   . GLU B 2 89  ? -44.165 56.253 -6.719  1.00 41.66  ? 88  GLU B N   1 
ATOM   3910 C  CA  . GLU B 2 89  ? -43.775 55.332 -7.768  1.00 41.28  ? 88  GLU B CA  1 
ATOM   3911 C  C   . GLU B 2 89  ? -43.089 56.068 -8.922  1.00 44.73  ? 88  GLU B C   1 
ATOM   3912 O  O   . GLU B 2 89  ? -42.195 55.528 -9.574  1.00 48.71  ? 88  GLU B O   1 
ATOM   3913 C  CB  . GLU B 2 89  ? -44.998 54.562 -8.258  1.00 41.70  ? 88  GLU B CB  1 
ATOM   3914 C  CG  . GLU B 2 89  ? -44.775 53.752 -9.516  1.00 45.11  ? 88  GLU B CG  1 
ATOM   3915 C  CD  . GLU B 2 89  ? -46.039 53.040 -9.967  1.00 57.80  ? 88  GLU B CD  1 
ATOM   3916 O  OE1 . GLU B 2 89  ? -46.981 52.928 -9.149  1.00 61.74  ? 88  GLU B OE1 1 
ATOM   3917 O  OE2 . GLU B 2 89  ? -46.093 52.590 -11.136 1.00 61.50  ? 88  GLU B OE2 1 
ATOM   3918 N  N   . GLN B 2 90  ? -43.494 57.309 -9.156  1.00 43.88  ? 89  GLN B N   1 
ATOM   3919 C  CA  . GLN B 2 90  ? -42.907 58.118 -10.224 1.00 42.65  ? 89  GLN B CA  1 
ATOM   3920 C  C   . GLN B 2 90  ? -41.480 58.558 -9.895  1.00 44.04  ? 89  GLN B C   1 
ATOM   3921 O  O   . GLN B 2 90  ? -40.601 58.552 -10.759 1.00 45.62  ? 89  GLN B O   1 
ATOM   3922 C  CB  . GLN B 2 90  ? -43.781 59.343 -10.490 1.00 41.13  ? 89  GLN B CB  1 
ATOM   3923 C  CG  . GLN B 2 90  ? -43.345 60.202 -11.640 1.00 43.98  ? 89  GLN B CG  1 
ATOM   3924 C  CD  . GLN B 2 90  ? -44.306 61.334 -11.879 1.00 49.91  ? 89  GLN B CD  1 
ATOM   3925 O  OE1 . GLN B 2 90  ? -45.079 61.702 -10.985 1.00 52.76  ? 89  GLN B OE1 1 
ATOM   3926 N  NE2 . GLN B 2 90  ? -44.283 61.892 -13.094 1.00 49.39  ? 89  GLN B NE2 1 
ATOM   3927 N  N   . LYS B 2 91  ? -41.263 58.950 -8.647  1.00 36.88  ? 90  LYS B N   1 
ATOM   3928 C  CA  . LYS B 2 91  ? -39.945 59.374 -8.206  1.00 36.68  ? 90  LYS B CA  1 
ATOM   3929 C  C   . LYS B 2 91  ? -38.992 58.183 -8.191  1.00 38.33  ? 90  LYS B C   1 
ATOM   3930 O  O   . LYS B 2 91  ? -37.799 58.319 -8.465  1.00 39.05  ? 90  LYS B O   1 
ATOM   3931 C  CB  . LYS B 2 91  ? -40.014 60.010 -6.816  1.00 34.81  ? 90  LYS B CB  1 
ATOM   3932 C  CG  . LYS B 2 91  ? -40.253 61.511 -6.818  1.00 39.82  ? 90  LYS B CG  1 
ATOM   3933 C  CD  . LYS B 2 91  ? -41.724 61.845 -6.920  1.00 43.17  ? 90  LYS B CD  1 
ATOM   3934 C  CE  . LYS B 2 91  ? -42.018 63.250 -6.410  1.00 41.01  ? 90  LYS B CE  1 
ATOM   3935 N  NZ  . LYS B 2 91  ? -41.295 64.261 -7.213  1.00 46.01  ? 90  LYS B NZ  1 
ATOM   3936 N  N   . LEU B 2 92  ? -39.526 57.014 -7.869  1.00 36.88  ? 91  LEU B N   1 
ATOM   3937 C  CA  . LEU B 2 92  ? -38.712 55.810 -7.836  1.00 39.55  ? 91  LEU B CA  1 
ATOM   3938 C  C   . LEU B 2 92  ? -38.352 55.320 -9.230  1.00 40.32  ? 91  LEU B C   1 
ATOM   3939 O  O   . LEU B 2 92  ? -37.230 54.868 -9.471  1.00 39.77  ? 91  LEU B O   1 
ATOM   3940 C  CB  . LEU B 2 92  ? -39.440 54.694 -7.100  1.00 44.32  ? 91  LEU B CB  1 
ATOM   3941 C  CG  . LEU B 2 92  ? -39.529 54.838 -5.589  1.00 39.81  ? 91  LEU B CG  1 
ATOM   3942 C  CD1 . LEU B 2 92  ? -40.154 53.563 -5.064  1.00 40.17  ? 91  LEU B CD1 1 
ATOM   3943 C  CD2 . LEU B 2 92  ? -38.156 55.098 -4.966  1.00 32.52  ? 91  LEU B CD2 1 
ATOM   3944 N  N   . ARG B 2 93  ? -39.313 55.382 -10.141 1.00 36.21  ? 92  ARG B N   1 
ATOM   3945 C  CA  . ARG B 2 93  ? -39.021 54.999 -11.502 1.00 33.74  ? 92  ARG B CA  1 
ATOM   3946 C  C   . ARG B 2 93  ? -37.929 55.904 -12.093 1.00 32.36  ? 92  ARG B C   1 
ATOM   3947 O  O   . ARG B 2 93  ? -37.111 55.448 -12.889 1.00 29.85  ? 92  ARG B O   1 
ATOM   3948 C  CB  . ARG B 2 93  ? -40.281 54.959 -12.380 1.00 34.59  ? 92  ARG B CB  1 
ATOM   3949 C  CG  . ARG B 2 93  ? -40.033 54.241 -13.722 1.00 40.54  ? 92  ARG B CG  1 
ATOM   3950 C  CD  . ARG B 2 93  ? -41.299 53.948 -14.512 1.00 44.44  ? 92  ARG B CD  1 
ATOM   3951 N  NE  . ARG B 2 93  ? -41.926 52.676 -14.143 1.00 48.92  ? 92  ARG B NE  1 
ATOM   3952 C  CZ  . ARG B 2 93  ? -43.054 52.567 -13.439 1.00 48.01  ? 92  ARG B CZ  1 
ATOM   3953 N  NH1 . ARG B 2 93  ? -43.694 53.659 -13.014 1.00 43.23  ? 92  ARG B NH1 1 
ATOM   3954 N  NH2 . ARG B 2 93  ? -43.544 51.360 -13.161 1.00 47.63  ? 92  ARG B NH2 1 
ATOM   3955 N  N   . PHE B 2 94  ? -37.882 57.170 -11.686 1.00 35.11  ? 93  PHE B N   1 
ATOM   3956 C  CA  . PHE B 2 94  ? -36.836 58.046 -12.203 1.00 30.65  ? 93  PHE B CA  1 
ATOM   3957 C  C   . PHE B 2 94  ? -35.477 57.604 -11.678 1.00 34.39  ? 93  PHE B C   1 
ATOM   3958 O  O   . PHE B 2 94  ? -34.520 57.503 -12.435 1.00 37.23  ? 93  PHE B O   1 
ATOM   3959 C  CB  . PHE B 2 94  ? -37.093 59.516 -11.861 1.00 29.92  ? 93  PHE B CB  1 
ATOM   3960 C  CG  . PHE B 2 94  ? -36.158 60.456 -12.547 1.00 30.35  ? 93  PHE B CG  1 
ATOM   3961 C  CD1 . PHE B 2 94  ? -34.894 60.688 -12.043 1.00 31.98  ? 93  PHE B CD1 1 
ATOM   3962 C  CD2 . PHE B 2 94  ? -36.535 61.093 -13.715 1.00 35.14  ? 93  PHE B CD2 1 
ATOM   3963 C  CE1 . PHE B 2 94  ? -34.025 61.535 -12.685 1.00 34.79  ? 93  PHE B CE1 1 
ATOM   3964 C  CE2 . PHE B 2 94  ? -35.676 61.948 -14.363 1.00 35.71  ? 93  PHE B CE2 1 
ATOM   3965 C  CZ  . PHE B 2 94  ? -34.414 62.169 -13.848 1.00 37.79  ? 93  PHE B CZ  1 
ATOM   3966 N  N   . ALA B 2 95  ? -35.395 57.342 -10.379 1.00 37.43  ? 94  ALA B N   1 
ATOM   3967 C  CA  . ALA B 2 95  ? -34.163 56.843 -9.777  1.00 31.18  ? 94  ALA B CA  1 
ATOM   3968 C  C   . ALA B 2 95  ? -33.770 55.501 -10.392 1.00 30.44  ? 94  ALA B C   1 
ATOM   3969 O  O   . ALA B 2 95  ? -32.588 55.223 -10.574 1.00 25.20  ? 94  ALA B O   1 
ATOM   3970 C  CB  . ALA B 2 95  ? -34.329 56.706 -8.282  1.00 27.28  ? 94  ALA B CB  1 
ATOM   3971 N  N   . PHE B 2 96  ? -34.768 54.680 -10.716 1.00 26.46  ? 95  PHE B N   1 
ATOM   3972 C  CA  . PHE B 2 96  ? -34.517 53.419 -11.390 1.00 27.60  ? 95  PHE B CA  1 
ATOM   3973 C  C   . PHE B 2 96  ? -33.854 53.692 -12.727 1.00 29.54  ? 95  PHE B C   1 
ATOM   3974 O  O   . PHE B 2 96  ? -32.933 52.988 -13.124 1.00 31.88  ? 95  PHE B O   1 
ATOM   3975 C  CB  . PHE B 2 96  ? -35.818 52.629 -11.596 1.00 29.27  ? 95  PHE B CB  1 
ATOM   3976 C  CG  . PHE B 2 96  ? -35.644 51.338 -12.372 1.00 26.29  ? 95  PHE B CG  1 
ATOM   3977 C  CD1 . PHE B 2 96  ? -35.188 50.196 -11.746 1.00 25.85  ? 95  PHE B CD1 1 
ATOM   3978 C  CD2 . PHE B 2 96  ? -35.957 51.267 -13.722 1.00 26.61  ? 95  PHE B CD2 1 
ATOM   3979 C  CE1 . PHE B 2 96  ? -35.033 49.000 -12.436 1.00 27.20  ? 95  PHE B CE1 1 
ATOM   3980 C  CE2 . PHE B 2 96  ? -35.807 50.064 -14.443 1.00 26.52  ? 95  PHE B CE2 1 
ATOM   3981 C  CZ  . PHE B 2 96  ? -35.338 48.930 -13.795 1.00 26.48  ? 95  PHE B CZ  1 
ATOM   3982 N  N   . ARG B 2 97  ? -34.317 54.730 -13.409 1.00 28.86  ? 96  ARG B N   1 
ATOM   3983 C  CA  . ARG B 2 97  ? -33.814 55.045 -14.741 1.00 29.80  ? 96  ARG B CA  1 
ATOM   3984 C  C   . ARG B 2 97  ? -32.377 55.545 -14.758 1.00 29.22  ? 96  ARG B C   1 
ATOM   3985 O  O   . ARG B 2 97  ? -31.683 55.432 -15.774 1.00 33.34  ? 96  ARG B O   1 
ATOM   3986 C  CB  . ARG B 2 97  ? -34.716 56.052 -15.416 1.00 27.01  ? 96  ARG B CB  1 
ATOM   3987 C  CG  . ARG B 2 97  ? -35.991 55.431 -15.890 1.00 27.77  ? 96  ARG B CG  1 
ATOM   3988 C  CD  . ARG B 2 97  ? -36.995 56.498 -16.217 1.00 33.26  ? 96  ARG B CD  1 
ATOM   3989 N  NE  . ARG B 2 97  ? -38.158 55.932 -16.871 1.00 41.10  ? 96  ARG B NE  1 
ATOM   3990 C  CZ  . ARG B 2 97  ? -39.237 56.635 -17.164 1.00 44.25  ? 96  ARG B CZ  1 
ATOM   3991 N  NH1 . ARG B 2 97  ? -39.272 57.923 -16.837 1.00 45.02  ? 96  ARG B NH1 1 
ATOM   3992 N  NH2 . ARG B 2 97  ? -40.265 56.051 -17.769 1.00 43.10  ? 96  ARG B NH2 1 
ATOM   3993 N  N   . ILE B 2 98  ? -31.940 56.109 -13.640 1.00 25.23  ? 97  ILE B N   1 
ATOM   3994 C  CA  . ILE B 2 98  ? -30.546 56.479 -13.493 1.00 25.70  ? 97  ILE B CA  1 
ATOM   3995 C  C   . ILE B 2 98  ? -29.639 55.261 -13.690 1.00 23.87  ? 97  ILE B C   1 
ATOM   3996 O  O   . ILE B 2 98  ? -28.618 55.371 -14.359 1.00 23.76  ? 97  ILE B O   1 
ATOM   3997 C  CB  . ILE B 2 98  ? -30.270 57.129 -12.125 1.00 28.01  ? 97  ILE B CB  1 
ATOM   3998 C  CG1 . ILE B 2 98  ? -30.918 58.509 -12.049 1.00 26.10  ? 97  ILE B CG1 1 
ATOM   3999 C  CG2 . ILE B 2 98  ? -28.791 57.260 -11.885 1.00 24.66  ? 97  ILE B CG2 1 
ATOM   4000 C  CD1 . ILE B 2 98  ? -30.213 59.533 -12.881 1.00 26.61  ? 97  ILE B CD1 1 
ATOM   4001 N  N   . TYR B 2 99  ? -30.012 54.106 -13.130 1.00 23.45  ? 98  TYR B N   1 
ATOM   4002 C  CA  . TYR B 2 99  ? -29.163 52.901 -13.198 1.00 22.64  ? 98  TYR B CA  1 
ATOM   4003 C  C   . TYR B 2 99  ? -29.346 52.126 -14.502 1.00 22.61  ? 98  TYR B C   1 
ATOM   4004 O  O   . TYR B 2 99  ? -28.424 51.494 -15.004 1.00 22.59  ? 98  TYR B O   1 
ATOM   4005 C  CB  . TYR B 2 99  ? -29.473 51.958 -12.040 1.00 22.42  ? 98  TYR B CB  1 
ATOM   4006 C  CG  . TYR B 2 99  ? -29.292 52.579 -10.664 1.00 23.89  ? 98  TYR B CG  1 
ATOM   4007 C  CD1 . TYR B 2 99  ? -30.341 53.227 -10.036 1.00 25.12  ? 98  TYR B CD1 1 
ATOM   4008 C  CD2 . TYR B 2 99  ? -28.074 52.515 -10.000 1.00 22.18  ? 98  TYR B CD2 1 
ATOM   4009 C  CE1 . TYR B 2 99  ? -30.184 53.795 -8.803  1.00 23.73  ? 98  TYR B CE1 1 
ATOM   4010 C  CE2 . TYR B 2 99  ? -27.911 53.077 -8.769  1.00 22.56  ? 98  TYR B CE2 1 
ATOM   4011 C  CZ  . TYR B 2 99  ? -28.973 53.723 -8.171  1.00 23.34  ? 98  TYR B CZ  1 
ATOM   4012 O  OH  . TYR B 2 99  ? -28.840 54.295 -6.921  1.00 23.92  ? 98  TYR B OH  1 
ATOM   4013 N  N   . ASP B 2 100 ? -30.551 52.194 -15.048 1.00 26.82  ? 99  ASP B N   1 
ATOM   4014 C  CA  . ASP B 2 100 ? -30.919 51.485 -16.258 1.00 26.67  ? 99  ASP B CA  1 
ATOM   4015 C  C   . ASP B 2 100 ? -30.425 52.233 -17.506 1.00 31.22  ? 99  ASP B C   1 
ATOM   4016 O  O   . ASP B 2 100 ? -31.203 52.912 -18.201 1.00 32.19  ? 99  ASP B O   1 
ATOM   4017 C  CB  . ASP B 2 100 ? -32.438 51.338 -16.268 1.00 26.70  ? 99  ASP B CB  1 
ATOM   4018 C  CG  . ASP B 2 100 ? -32.941 50.517 -17.409 1.00 27.46  ? 99  ASP B CG  1 
ATOM   4019 O  OD1 . ASP B 2 100 ? -32.162 49.742 -17.985 1.00 29.14  ? 99  ASP B OD1 1 
ATOM   4020 O  OD2 . ASP B 2 100 ? -34.139 50.662 -17.729 1.00 26.82  ? 99  ASP B OD2 1 
ATOM   4021 N  N   . MET B 2 101 ? -29.132 52.108 -17.790 1.00 29.30  ? 100 MET B N   1 
ATOM   4022 C  CA  . MET B 2 101 ? -28.532 52.860 -18.889 1.00 27.98  ? 100 MET B CA  1 
ATOM   4023 C  C   . MET B 2 101 ? -29.181 52.628 -20.256 1.00 28.55  ? 100 MET B C   1 
ATOM   4024 O  O   . MET B 2 101 ? -29.494 53.599 -20.945 1.00 33.43  ? 100 MET B O   1 
ATOM   4025 C  CB  . MET B 2 101 ? -27.031 52.621 -18.981 1.00 27.75  ? 100 MET B CB  1 
ATOM   4026 C  CG  . MET B 2 101 ? -26.294 52.775 -17.677 1.00 27.73  ? 100 MET B CG  1 
ATOM   4027 S  SD  . MET B 2 101 ? -24.537 52.908 -17.985 1.00 48.06  ? 100 MET B SD  1 
ATOM   4028 C  CE  . MET B 2 101 ? -24.393 54.663 -18.296 1.00 42.72  ? 100 MET B CE  1 
ATOM   4029 N  N   . ASP B 2 102 ? -29.399 51.378 -20.662 1.00 27.33  ? 101 ASP B N   1 
ATOM   4030 C  CA  . ASP B 2 102 ? -29.913 51.169 -22.023 1.00 27.54  ? 101 ASP B CA  1 
ATOM   4031 C  C   . ASP B 2 102 ? -31.437 51.214 -22.119 1.00 30.38  ? 101 ASP B C   1 
ATOM   4032 O  O   . ASP B 2 102 ? -32.008 50.940 -23.169 1.00 31.86  ? 101 ASP B O   1 
ATOM   4033 C  CB  . ASP B 2 102 ? -29.335 49.918 -22.701 1.00 27.58  ? 101 ASP B CB  1 
ATOM   4034 C  CG  . ASP B 2 102 ? -29.786 48.618 -22.044 1.00 33.43  ? 101 ASP B CG  1 
ATOM   4035 O  OD1 . ASP B 2 102 ? -30.876 48.581 -21.430 1.00 39.64  ? 101 ASP B OD1 1 
ATOM   4036 O  OD2 . ASP B 2 102 ? -29.050 47.612 -22.176 1.00 34.65  ? 101 ASP B OD2 1 
ATOM   4037 N  N   . LYS B 2 103 ? -32.075 51.547 -21.002 1.00 27.25  ? 102 LYS B N   1 
ATOM   4038 C  CA  . LYS B 2 103 ? -33.523 51.734 -20.922 1.00 27.29  ? 102 LYS B CA  1 
ATOM   4039 C  C   . LYS B 2 103 ? -34.338 50.508 -21.314 1.00 27.23  ? 102 LYS B C   1 
ATOM   4040 O  O   . LYS B 2 103 ? -35.464 50.642 -21.781 1.00 27.44  ? 102 LYS B O   1 
ATOM   4041 C  CB  . LYS B 2 103 ? -33.986 52.917 -21.780 1.00 27.72  ? 102 LYS B CB  1 
ATOM   4042 C  CG  . LYS B 2 103 ? -33.045 54.113 -21.851 1.00 28.09  ? 102 LYS B CG  1 
ATOM   4043 C  CD  . LYS B 2 103 ? -33.720 55.299 -22.519 1.00 28.64  ? 102 LYS B CD  1 
ATOM   4044 C  CE  . LYS B 2 103 ? -32.956 56.583 -22.261 1.00 29.21  ? 102 LYS B CE  1 
ATOM   4045 N  NZ  . LYS B 2 103 ? -33.588 57.760 -22.934 1.00 29.91  ? 102 LYS B NZ  1 
ATOM   4046 N  N   . ASP B 2 104 ? -33.790 49.312 -21.139 1.00 34.67  ? 103 ASP B N   1 
ATOM   4047 C  CA  . ASP B 2 104 ? -34.519 48.121 -21.568 1.00 34.17  ? 103 ASP B CA  1 
ATOM   4048 C  C   . ASP B 2 104 ? -35.547 47.650 -20.554 1.00 34.65  ? 103 ASP B C   1 
ATOM   4049 O  O   . ASP B 2 104 ? -36.283 46.702 -20.812 1.00 41.24  ? 103 ASP B O   1 
ATOM   4050 C  CB  . ASP B 2 104 ? -33.580 46.994 -22.039 1.00 31.67  ? 103 ASP B CB  1 
ATOM   4051 C  CG  . ASP B 2 104 ? -32.983 46.199 -20.902 1.00 36.37  ? 103 ASP B CG  1 
ATOM   4052 O  OD1 . ASP B 2 104 ? -33.259 46.503 -19.726 1.00 30.36  ? 103 ASP B OD1 1 
ATOM   4053 O  OD2 . ASP B 2 104 ? -32.198 45.274 -21.173 1.00 32.15  ? 103 ASP B OD2 1 
ATOM   4054 N  N   . GLY B 2 105 ? -35.534 48.291 -19.390 1.00 27.06  ? 104 GLY B N   1 
ATOM   4055 C  CA  . GLY B 2 105 ? -36.454 47.973 -18.310 1.00 28.21  ? 104 GLY B CA  1 
ATOM   4056 C  C   . GLY B 2 105 ? -35.857 47.162 -17.167 1.00 34.37  ? 104 GLY B C   1 
ATOM   4057 O  O   . GLY B 2 105 ? -36.540 46.866 -16.194 1.00 33.71  ? 104 GLY B O   1 
ATOM   4058 N  N   . TYR B 2 106 ? -34.584 46.802 -17.291 1.00 39.54  ? 105 TYR B N   1 
ATOM   4059 C  CA  . TYR B 2 106 ? -33.896 45.982 -16.299 1.00 32.51  ? 105 TYR B CA  1 
ATOM   4060 C  C   . TYR B 2 106 ? -32.634 46.707 -15.848 1.00 32.38  ? 105 TYR B C   1 
ATOM   4061 O  O   . TYR B 2 106 ? -32.233 47.646 -16.483 1.00 36.70  ? 105 TYR B O   1 
ATOM   4062 C  CB  . TYR B 2 106 ? -33.548 44.608 -16.885 1.00 29.05  ? 105 TYR B CB  1 
ATOM   4063 C  CG  . TYR B 2 106 ? -34.783 43.805 -17.248 1.00 35.29  ? 105 TYR B CG  1 
ATOM   4064 C  CD1 . TYR B 2 106 ? -35.592 43.250 -16.261 1.00 36.74  ? 105 TYR B CD1 1 
ATOM   4065 C  CD2 . TYR B 2 106 ? -35.155 43.626 -18.565 1.00 36.49  ? 105 TYR B CD2 1 
ATOM   4066 C  CE1 . TYR B 2 106 ? -36.732 42.532 -16.574 1.00 33.35  ? 105 TYR B CE1 1 
ATOM   4067 C  CE2 . TYR B 2 106 ? -36.292 42.911 -18.892 1.00 38.90  ? 105 TYR B CE2 1 
ATOM   4068 C  CZ  . TYR B 2 106 ? -37.080 42.363 -17.891 1.00 37.35  ? 105 TYR B CZ  1 
ATOM   4069 O  OH  . TYR B 2 106 ? -38.216 41.641 -18.198 1.00 40.12  ? 105 TYR B OH  1 
ATOM   4070 N  N   . ILE B 2 107 ? -32.051 46.321 -14.720 1.00 26.31  ? 106 ILE B N   1 
ATOM   4071 C  CA  . ILE B 2 107 ? -30.753 46.822 -14.319 1.00 26.12  ? 106 ILE B CA  1 
ATOM   4072 C  C   . ILE B 2 107 ? -29.786 45.661 -14.318 1.00 27.05  ? 106 ILE B C   1 
ATOM   4073 O  O   . ILE B 2 107 ? -29.970 44.691 -13.598 1.00 26.21  ? 106 ILE B O   1 
ATOM   4074 C  CB  . ILE B 2 107 ? -30.774 47.435 -12.919 1.00 26.13  ? 106 ILE B CB  1 
ATOM   4075 C  CG1 . ILE B 2 107 ? -31.591 48.722 -12.923 1.00 26.29  ? 106 ILE B CG1 1 
ATOM   4076 C  CG2 . ILE B 2 107 ? -29.359 47.753 -12.480 1.00 26.05  ? 106 ILE B CG2 1 
ATOM   4077 C  CD1 . ILE B 2 107 ? -31.699 49.376 -11.561 1.00 26.48  ? 106 ILE B CD1 1 
ATOM   4078 N  N   . SER B 2 108 ? -28.760 45.741 -15.142 1.00 26.10  ? 107 SER B N   1 
ATOM   4079 C  CA  . SER B 2 108 ? -27.849 44.628 -15.259 1.00 26.22  ? 107 SER B CA  1 
ATOM   4080 C  C   . SER B 2 108 ? -26.679 44.876 -14.338 1.00 26.70  ? 107 SER B C   1 
ATOM   4081 O  O   . SER B 2 108 ? -26.462 46.012 -13.898 1.00 27.74  ? 107 SER B O   1 
ATOM   4082 C  CB  . SER B 2 108 ? -27.363 44.446 -16.700 1.00 28.53  ? 107 SER B CB  1 
ATOM   4083 O  OG  . SER B 2 108 ? -26.541 45.528 -17.117 1.00 26.51  ? 107 SER B OG  1 
ATOM   4084 N  N   . ASN B 2 109 ? -25.949 43.800 -14.036 1.00 26.30  ? 108 ASN B N   1 
ATOM   4085 C  CA  . ASN B 2 109 ? -24.703 43.886 -13.293 1.00 26.34  ? 108 ASN B CA  1 
ATOM   4086 C  C   . ASN B 2 109 ? -23.794 44.971 -13.879 1.00 28.16  ? 108 ASN B C   1 
ATOM   4087 O  O   . ASN B 2 109 ? -23.358 45.884 -13.162 1.00 26.88  ? 108 ASN B O   1 
ATOM   4088 C  CB  . ASN B 2 109 ? -24.004 42.534 -13.315 1.00 26.65  ? 108 ASN B CB  1 
ATOM   4089 C  CG  . ASN B 2 109 ? -22.808 42.476 -12.401 1.00 28.35  ? 108 ASN B CG  1 
ATOM   4090 O  OD1 . ASN B 2 109 ? -21.943 43.349 -12.420 1.00 36.63  ? 108 ASN B OD1 1 
ATOM   4091 N  ND2 . ASN B 2 109 ? -22.746 41.437 -11.595 1.00 26.93  ? 108 ASN B ND2 1 
ATOM   4092 N  N   . GLY B 2 110 ? -23.524 44.877 -15.181 1.00 28.71  ? 109 GLY B N   1 
ATOM   4093 C  CA  . GLY B 2 110 ? -22.664 45.831 -15.847 1.00 26.97  ? 109 GLY B CA  1 
ATOM   4094 C  C   . GLY B 2 110 ? -23.097 47.266 -15.644 1.00 26.87  ? 109 GLY B C   1 
ATOM   4095 O  O   . GLY B 2 110 ? -22.258 48.123 -15.421 1.00 27.18  ? 109 GLY B O   1 
ATOM   4096 N  N   . GLU B 2 111 ? -24.400 47.530 -15.704 1.00 26.60  ? 110 GLU B N   1 
ATOM   4097 C  CA  . GLU B 2 111 ? -24.914 48.898 -15.571 1.00 26.65  ? 110 GLU B CA  1 
ATOM   4098 C  C   . GLU B 2 111 ? -24.770 49.465 -14.183 1.00 26.64  ? 110 GLU B C   1 
ATOM   4099 O  O   . GLU B 2 111 ? -24.332 50.605 -14.002 1.00 27.00  ? 110 GLU B O   1 
ATOM   4100 C  CB  . GLU B 2 111 ? -26.384 48.961 -15.915 1.00 30.86  ? 110 GLU B CB  1 
ATOM   4101 C  CG  . GLU B 2 111 ? -26.665 49.223 -17.332 1.00 26.65  ? 110 GLU B CG  1 
ATOM   4102 C  CD  . GLU B 2 111 ? -27.974 48.656 -17.749 1.00 47.49  ? 110 GLU B CD  1 
ATOM   4103 O  OE1 . GLU B 2 111 ? -28.307 48.822 -18.924 1.00 26.67  ? 110 GLU B OE1 1 
ATOM   4104 O  OE2 . GLU B 2 111 ? -28.660 48.042 -16.922 1.00 52.90  ? 110 GLU B OE2 1 
ATOM   4105 N  N   . LEU B 2 112 ? -25.174 48.662 -13.206 1.00 26.36  ? 111 LEU B N   1 
ATOM   4106 C  CA  . LEU B 2 112 ? -25.019 49.023 -11.818 1.00 26.41  ? 111 LEU B CA  1 
ATOM   4107 C  C   . LEU B 2 112 ? -23.568 49.410 -11.534 1.00 28.25  ? 111 LEU B C   1 
ATOM   4108 O  O   . LEU B 2 112 ? -23.310 50.473 -10.968 1.00 31.53  ? 111 LEU B O   1 
ATOM   4109 C  CB  . LEU B 2 112 ? -25.453 47.872 -10.930 1.00 26.19  ? 111 LEU B CB  1 
ATOM   4110 C  CG  . LEU B 2 112 ? -25.705 48.287 -9.486  1.00 26.32  ? 111 LEU B CG  1 
ATOM   4111 C  CD1 . LEU B 2 112 ? -26.383 49.650 -9.450  1.00 26.53  ? 111 LEU B CD1 1 
ATOM   4112 C  CD2 . LEU B 2 112 ? -26.565 47.241 -8.811  1.00 28.71  ? 111 LEU B CD2 1 
ATOM   4113 N  N   . PHE B 2 113 ? -22.624 48.580 -11.963 1.00 26.79  ? 112 PHE B N   1 
ATOM   4114 C  CA  . PHE B 2 113 ? -21.217 48.898 -11.751 1.00 27.23  ? 112 PHE B CA  1 
ATOM   4115 C  C   . PHE B 2 113 ? -20.870 50.231 -12.368 1.00 27.74  ? 112 PHE B C   1 
ATOM   4116 O  O   . PHE B 2 113 ? -20.232 51.062 -11.743 1.00 30.77  ? 112 PHE B O   1 
ATOM   4117 C  CB  . PHE B 2 113 ? -20.304 47.828 -12.351 1.00 27.36  ? 112 PHE B CB  1 
ATOM   4118 C  CG  . PHE B 2 113 ? -18.832 48.082 -12.126 1.00 27.93  ? 112 PHE B CG  1 
ATOM   4119 C  CD1 . PHE B 2 113 ? -18.105 48.902 -12.983 1.00 28.54  ? 112 PHE B CD1 1 
ATOM   4120 C  CD2 . PHE B 2 113 ? -18.172 47.483 -11.073 1.00 27.99  ? 112 PHE B CD2 1 
ATOM   4121 C  CE1 . PHE B 2 113 ? -16.754 49.128 -12.782 1.00 29.23  ? 112 PHE B CE1 1 
ATOM   4122 C  CE2 . PHE B 2 113 ? -16.809 47.693 -10.867 1.00 28.62  ? 112 PHE B CE2 1 
ATOM   4123 C  CZ  . PHE B 2 113 ? -16.103 48.522 -11.719 1.00 29.26  ? 112 PHE B CZ  1 
ATOM   4124 N  N   . GLN B 2 114 ? -21.280 50.429 -13.610 1.00 28.34  ? 113 GLN B N   1 
ATOM   4125 C  CA  . GLN B 2 114 ? -20.860 51.615 -14.338 1.00 28.44  ? 113 GLN B CA  1 
ATOM   4126 C  C   . GLN B 2 114 ? -21.379 52.874 -13.680 1.00 30.32  ? 113 GLN B C   1 
ATOM   4127 O  O   . GLN B 2 114 ? -20.635 53.841 -13.497 1.00 31.68  ? 113 GLN B O   1 
ATOM   4128 C  CB  . GLN B 2 114 ? -21.284 51.527 -15.798 1.00 30.41  ? 113 GLN B CB  1 
ATOM   4129 C  CG  . GLN B 2 114 ? -20.451 50.518 -16.578 1.00 37.22  ? 113 GLN B CG  1 
ATOM   4130 C  CD  . GLN B 2 114 ? -20.659 50.595 -18.083 1.00 41.22  ? 113 GLN B CD  1 
ATOM   4131 O  OE1 . GLN B 2 114 ? -21.122 51.615 -18.617 1.00 39.98  ? 113 GLN B OE1 1 
ATOM   4132 N  NE2 . GLN B 2 114 ? -20.298 49.515 -18.781 1.00 39.99  ? 113 GLN B NE2 1 
ATOM   4133 N  N   . VAL B 2 115 ? -22.650 52.857 -13.295 1.00 28.23  ? 114 VAL B N   1 
ATOM   4134 C  CA  . VAL B 2 115 ? -23.229 54.033 -12.670 1.00 28.61  ? 114 VAL B CA  1 
ATOM   4135 C  C   . VAL B 2 115 ? -22.604 54.284 -11.286 1.00 33.23  ? 114 VAL B C   1 
ATOM   4136 O  O   . VAL B 2 115 ? -22.330 55.425 -10.928 1.00 38.60  ? 114 VAL B O   1 
ATOM   4137 C  CB  . VAL B 2 115 ? -24.766 53.960 -12.633 1.00 28.16  ? 114 VAL B CB  1 
ATOM   4138 C  CG1 . VAL B 2 115 ? -25.339 55.207 -12.024 1.00 28.70  ? 114 VAL B CG1 1 
ATOM   4139 C  CG2 . VAL B 2 115 ? -25.309 53.780 -14.036 1.00 27.99  ? 114 VAL B CG2 1 
ATOM   4140 N  N   . LEU B 2 116 ? -22.343 53.232 -10.520 1.00 32.99  ? 115 LEU B N   1 
ATOM   4141 C  CA  . LEU B 2 116 ? -21.660 53.425 -9.239  1.00 28.89  ? 115 LEU B CA  1 
ATOM   4142 C  C   . LEU B 2 116 ? -20.245 53.965 -9.405  1.00 32.14  ? 115 LEU B C   1 
ATOM   4143 O  O   . LEU B 2 116 ? -19.868 54.905 -8.706  1.00 34.18  ? 115 LEU B O   1 
ATOM   4144 C  CB  . LEU B 2 116 ? -21.617 52.145 -8.415  1.00 28.26  ? 115 LEU B CB  1 
ATOM   4145 C  CG  . LEU B 2 116 ? -22.553 52.164 -7.217  1.00 31.08  ? 115 LEU B CG  1 
ATOM   4146 C  CD1 . LEU B 2 116 ? -23.978 51.937 -7.654  1.00 30.81  ? 115 LEU B CD1 1 
ATOM   4147 C  CD2 . LEU B 2 116 ? -22.131 51.099 -6.259  1.00 42.01  ? 115 LEU B CD2 1 
ATOM   4148 N  N   . LYS B 2 117 ? -19.477 53.374 -10.323 1.00 29.53  ? 116 LYS B N   1 
ATOM   4149 C  CA  . LYS B 2 117 ? -18.104 53.792 -10.599 1.00 30.88  ? 116 LYS B CA  1 
ATOM   4150 C  C   . LYS B 2 117 ? -18.060 55.276 -10.916 1.00 36.39  ? 116 LYS B C   1 
ATOM   4151 O  O   . LYS B 2 117 ? -17.141 55.996 -10.527 1.00 43.30  ? 116 LYS B O   1 
ATOM   4152 C  CB  . LYS B 2 117 ? -17.542 53.007 -11.787 1.00 30.29  ? 116 LYS B CB  1 
ATOM   4153 C  CG  . LYS B 2 117 ? -16.066 53.275 -12.104 1.00 31.28  ? 116 LYS B CG  1 
ATOM   4154 C  CD  . LYS B 2 117 ? -15.191 52.925 -10.903 1.00 32.87  ? 116 LYS B CD  1 
ATOM   4155 C  CE  . LYS B 2 117 ? -13.718 53.049 -11.258 1.00 40.80  ? 116 LYS B CE  1 
ATOM   4156 N  NZ  . LYS B 2 117 ? -12.837 52.804 -10.078 1.00 44.80  ? 116 LYS B NZ  1 
ATOM   4157 N  N   . MET B 2 118 ? -19.089 55.711 -11.625 1.00 36.41  ? 117 MET B N   1 
ATOM   4158 C  CA  . MET B 2 118 ? -19.280 57.093 -12.027 1.00 35.98  ? 117 MET B CA  1 
ATOM   4159 C  C   . MET B 2 118 ? -19.413 58.001 -10.796 1.00 40.29  ? 117 MET B C   1 
ATOM   4160 O  O   . MET B 2 118 ? -18.904 59.117 -10.777 1.00 47.45  ? 117 MET B O   1 
ATOM   4161 C  CB  . MET B 2 118 ? -20.538 57.127 -12.888 1.00 33.30  ? 117 MET B CB  1 
ATOM   4162 C  CG  . MET B 2 118 ? -20.928 58.421 -13.537 1.00 32.56  ? 117 MET B CG  1 
ATOM   4163 S  SD  . MET B 2 118 ? -22.536 58.138 -14.335 1.00 45.99  ? 117 MET B SD  1 
ATOM   4164 C  CE  . MET B 2 118 ? -22.162 56.978 -15.675 1.00 31.10  ? 117 MET B CE  1 
ATOM   4165 N  N   . MET B 2 119 ? -20.082 57.506 -9.762  1.00 36.81  ? 118 MET B N   1 
ATOM   4166 C  CA  . MET B 2 119 ? -20.273 58.272 -8.535  1.00 40.93  ? 118 MET B CA  1 
ATOM   4167 C  C   . MET B 2 119 ? -19.193 58.014 -7.465  1.00 42.38  ? 118 MET B C   1 
ATOM   4168 O  O   . MET B 2 119 ? -18.862 58.896 -6.675  1.00 40.86  ? 118 MET B O   1 
ATOM   4169 C  CB  . MET B 2 119 ? -21.637 57.952 -7.936  1.00 40.44  ? 118 MET B CB  1 
ATOM   4170 C  CG  . MET B 2 119 ? -22.795 58.029 -8.899  1.00 35.85  ? 118 MET B CG  1 
ATOM   4171 S  SD  . MET B 2 119 ? -24.314 57.651 -8.012  1.00 40.12  ? 118 MET B SD  1 
ATOM   4172 C  CE  . MET B 2 119 ? -24.406 55.875 -8.189  1.00 32.67  ? 118 MET B CE  1 
ATOM   4173 N  N   . VAL B 2 120 ? -18.654 56.804 -7.422  1.00 42.46  ? 119 VAL B N   1 
ATOM   4174 C  CA  . VAL B 2 120 ? -17.706 56.473 -6.369  1.00 40.44  ? 119 VAL B CA  1 
ATOM   4175 C  C   . VAL B 2 120 ? -16.292 56.905 -6.726  1.00 40.28  ? 119 VAL B C   1 
ATOM   4176 O  O   . VAL B 2 120 ? -15.509 57.280 -5.853  1.00 40.19  ? 119 VAL B O   1 
ATOM   4177 C  CB  . VAL B 2 120 ? -17.768 54.981 -6.005  1.00 31.54  ? 119 VAL B CB  1 
ATOM   4178 C  CG1 . VAL B 2 120 ? -16.592 54.575 -5.136  1.00 31.95  ? 119 VAL B CG1 1 
ATOM   4179 C  CG2 . VAL B 2 120 ? -19.073 54.698 -5.274  1.00 31.52  ? 119 VAL B CG2 1 
ATOM   4180 N  N   . GLY B 2 121 ? -15.976 56.890 -8.015  1.00 38.24  ? 120 GLY B N   1 
ATOM   4181 C  CA  . GLY B 2 121 ? -14.630 57.215 -8.455  1.00 39.80  ? 120 GLY B CA  1 
ATOM   4182 C  C   . GLY B 2 121 ? -13.618 56.187 -7.976  1.00 43.25  ? 120 GLY B C   1 
ATOM   4183 O  O   . GLY B 2 121 ? -13.791 54.988 -8.180  1.00 43.00  ? 120 GLY B O   1 
ATOM   4184 N  N   . ASN B 2 122 ? -12.560 56.649 -7.325  1.00 53.60  ? 121 ASN B N   1 
ATOM   4185 C  CA  . ASN B 2 122 ? -11.490 55.750 -6.907  1.00 52.46  ? 121 ASN B CA  1 
ATOM   4186 C  C   . ASN B 2 122 ? -11.483 55.427 -5.414  1.00 50.74  ? 121 ASN B C   1 
ATOM   4187 O  O   . ASN B 2 122 ? -10.530 54.834 -4.908  1.00 54.88  ? 121 ASN B O   1 
ATOM   4188 C  CB  . ASN B 2 122 ? -10.129 56.277 -7.369  1.00 54.34  ? 121 ASN B CB  1 
ATOM   4189 C  CG  . ASN B 2 122 ? -9.940  56.153 -8.873  1.00 59.08  ? 121 ASN B CG  1 
ATOM   4190 O  OD1 . ASN B 2 122 ? -9.890  57.156 -9.594  1.00 62.16  ? 121 ASN B OD1 1 
ATOM   4191 N  ND2 . ASN B 2 122 ? -9.840  54.915 -9.356  1.00 57.83  ? 121 ASN B ND2 1 
ATOM   4192 N  N   . ASN B 2 123 ? -12.557 55.803 -4.725  1.00 44.64  ? 122 ASN B N   1 
ATOM   4193 C  CA  . ASN B 2 123 ? -12.747 55.438 -3.323  1.00 48.07  ? 122 ASN B CA  1 
ATOM   4194 C  C   . ASN B 2 123 ? -12.642 53.930 -3.079  1.00 49.50  ? 122 ASN B C   1 
ATOM   4195 O  O   . ASN B 2 123 ? -11.843 53.491 -2.248  1.00 59.40  ? 122 ASN B O   1 
ATOM   4196 C  CB  . ASN B 2 123 ? -14.074 55.993 -2.785  1.00 50.96  ? 122 ASN B CB  1 
ATOM   4197 C  CG  . ASN B 2 123 ? -14.102 57.530 -2.751  1.00 52.88  ? 122 ASN B CG  1 
ATOM   4198 O  OD1 . ASN B 2 123 ? -13.128 58.199 -3.131  1.00 54.25  ? 122 ASN B OD1 1 
ATOM   4199 N  ND2 . ASN B 2 123 ? -15.229 58.092 -2.306  1.00 46.11  ? 122 ASN B ND2 1 
ATOM   4200 N  N   . LEU B 2 124 ? -13.435 53.143 -3.804  1.00 43.10  ? 123 LEU B N   1 
ATOM   4201 C  CA  . LEU B 2 124 ? -13.333 51.679 -3.744  1.00 36.53  ? 123 LEU B CA  1 
ATOM   4202 C  C   . LEU B 2 124 ? -12.421 51.127 -4.837  1.00 35.08  ? 123 LEU B C   1 
ATOM   4203 O  O   . LEU B 2 124 ? -12.280 51.748 -5.906  1.00 36.01  ? 123 LEU B O   1 
ATOM   4204 C  CB  . LEU B 2 124 ? -14.713 51.042 -3.882  1.00 31.66  ? 123 LEU B CB  1 
ATOM   4205 C  CG  . LEU B 2 124 ? -15.613 51.079 -2.651  1.00 35.69  ? 123 LEU B CG  1 
ATOM   4206 C  CD1 . LEU B 2 124 ? -16.946 50.411 -2.929  1.00 33.86  ? 123 LEU B CD1 1 
ATOM   4207 C  CD2 . LEU B 2 124 ? -14.922 50.394 -1.502  1.00 39.41  ? 123 LEU B CD2 1 
ATOM   4208 N  N   . LYS B 2 125 ? -11.795 49.975 -4.579  1.00 33.47  ? 124 LYS B N   1 
ATOM   4209 C  CA  . LYS B 2 125 ? -11.102 49.251 -5.650  1.00 35.64  ? 124 LYS B CA  1 
ATOM   4210 C  C   . LYS B 2 125 ? -12.192 48.676 -6.549  1.00 33.49  ? 124 LYS B C   1 
ATOM   4211 O  O   . LYS B 2 125 ? -13.311 48.436 -6.083  1.00 33.08  ? 124 LYS B O   1 
ATOM   4212 C  CB  . LYS B 2 125 ? -10.217 48.119 -5.101  1.00 36.42  ? 124 LYS B CB  1 
ATOM   4213 C  CG  . LYS B 2 125 ? -8.950  48.575 -4.379  1.00 33.93  ? 124 LYS B CG  1 
ATOM   4214 C  CD  . LYS B 2 125 ? -8.337  47.432 -3.536  1.00 34.27  ? 124 LYS B CD  1 
ATOM   4215 C  CE  . LYS B 2 125 ? -7.315  47.979 -2.503  1.00 35.55  ? 124 LYS B CE  1 
ATOM   4216 N  NZ  . LYS B 2 125 ? -6.977  47.004 -1.365  1.00 35.79  ? 124 LYS B NZ  1 
ATOM   4217 N  N   . ASP B 2 126 ? -11.878 48.463 -7.825  1.00 32.07  ? 125 ASP B N   1 
ATOM   4218 C  CA  . ASP B 2 126 ? -12.812 47.813 -8.752  1.00 30.72  ? 125 ASP B CA  1 
ATOM   4219 C  C   . ASP B 2 126 ? -13.320 46.459 -8.230  1.00 33.09  ? 125 ASP B C   1 
ATOM   4220 O  O   . ASP B 2 126 ? -14.510 46.141 -8.329  1.00 33.13  ? 125 ASP B O   1 
ATOM   4221 C  CB  . ASP B 2 126 ? -12.161 47.617 -10.120 1.00 31.22  ? 125 ASP B CB  1 
ATOM   4222 C  CG  . ASP B 2 126 ? -11.951 48.929 -10.865 1.00 37.47  ? 125 ASP B CG  1 
ATOM   4223 O  OD1 . ASP B 2 126 ? -12.680 49.906 -10.564 1.00 38.40  ? 125 ASP B OD1 1 
ATOM   4224 O  OD2 . ASP B 2 126 ? -11.061 48.975 -11.753 1.00 41.62  ? 125 ASP B OD2 1 
ATOM   4225 N  N   . THR B 2 127 ? -12.410 45.673 -7.666  1.00 34.10  ? 126 THR B N   1 
ATOM   4226 C  CA  . THR B 2 127 ? -12.741 44.355 -7.142  1.00 32.15  ? 126 THR B CA  1 
ATOM   4227 C  C   . THR B 2 127 ? -13.776 44.442 -6.041  1.00 30.10  ? 126 THR B C   1 
ATOM   4228 O  O   . THR B 2 127 ? -14.689 43.634 -5.958  1.00 30.88  ? 126 THR B O   1 
ATOM   4229 C  CB  . THR B 2 127 ? -11.480 43.663 -6.599  1.00 38.03  ? 126 THR B CB  1 
ATOM   4230 O  OG1 . THR B 2 127 ? -10.676 43.237 -7.704  1.00 36.64  ? 126 THR B OG1 1 
ATOM   4231 C  CG2 . THR B 2 127 ? -11.845 42.453 -5.747  1.00 41.44  ? 126 THR B CG2 1 
ATOM   4232 N  N   . GLN B 2 128 ? -13.622 45.431 -5.180  1.00 33.00  ? 127 GLN B N   1 
ATOM   4233 C  CA  . GLN B 2 128 ? -14.536 45.580 -4.071  1.00 31.05  ? 127 GLN B CA  1 
ATOM   4234 C  C   . GLN B 2 128 ? -15.897 45.927 -4.623  1.00 29.76  ? 127 GLN B C   1 
ATOM   4235 O  O   . GLN B 2 128 ? -16.901 45.299 -4.268  1.00 28.48  ? 127 GLN B O   1 
ATOM   4236 C  CB  . GLN B 2 128 ? -14.045 46.667 -3.124  1.00 31.00  ? 127 GLN B CB  1 
ATOM   4237 C  CG  . GLN B 2 128 ? -12.795 46.269 -2.355  1.00 34.40  ? 127 GLN B CG  1 
ATOM   4238 C  CD  . GLN B 2 128 ? -12.149 47.444 -1.624  1.00 40.56  ? 127 GLN B CD  1 
ATOM   4239 O  OE1 . GLN B 2 128 ? -11.827 48.475 -2.231  1.00 39.58  ? 127 GLN B OE1 1 
ATOM   4240 N  NE2 . GLN B 2 128 ? -11.962 47.293 -0.318  1.00 42.06  ? 127 GLN B NE2 1 
ATOM   4241 N  N   . LEU B 2 129 ? -15.904 46.912 -5.522  1.00 33.96  ? 128 LEU B N   1 
ATOM   4242 C  CA  . LEU B 2 129 ? -17.123 47.404 -6.144  1.00 34.05  ? 128 LEU B CA  1 
ATOM   4243 C  C   . LEU B 2 129 ? -17.864 46.282 -6.851  1.00 30.26  ? 128 LEU B C   1 
ATOM   4244 O  O   . LEU B 2 129 ? -19.071 46.112 -6.666  1.00 27.52  ? 128 LEU B O   1 
ATOM   4245 C  CB  . LEU B 2 129 ? -16.805 48.533 -7.121  1.00 35.47  ? 128 LEU B CB  1 
ATOM   4246 C  CG  . LEU B 2 129 ? -18.008 49.208 -7.776  1.00 39.56  ? 128 LEU B CG  1 
ATOM   4247 C  CD1 . LEU B 2 129 ? -18.980 49.700 -6.736  1.00 40.06  ? 128 LEU B CD1 1 
ATOM   4248 C  CD2 . LEU B 2 129 ? -17.560 50.361 -8.640  1.00 43.34  ? 128 LEU B CD2 1 
ATOM   4249 N  N   . GLN B 2 130 ? -17.133 45.495 -7.635  1.00 28.71  ? 129 GLN B N   1 
ATOM   4250 C  CA  . GLN B 2 130 ? -17.725 44.353 -8.325  1.00 27.80  ? 129 GLN B CA  1 
ATOM   4251 C  C   . GLN B 2 130 ? -18.417 43.377 -7.379  1.00 27.61  ? 129 GLN B C   1 
ATOM   4252 O  O   . GLN B 2 130 ? -19.469 42.842 -7.701  1.00 28.00  ? 129 GLN B O   1 
ATOM   4253 C  CB  . GLN B 2 130 ? -16.688 43.598 -9.140  1.00 28.23  ? 129 GLN B CB  1 
ATOM   4254 C  CG  . GLN B 2 130 ? -17.308 42.471 -9.929  1.00 28.12  ? 129 GLN B CG  1 
ATOM   4255 C  CD  . GLN B 2 130 ? -18.243 42.989 -10.998 1.00 29.16  ? 129 GLN B CD  1 
ATOM   4256 O  OE1 . GLN B 2 130 ? -17.800 43.551 -11.988 1.00 36.63  ? 129 GLN B OE1 1 
ATOM   4257 N  NE2 . GLN B 2 130 ? -19.535 42.820 -10.798 1.00 27.36  ? 129 GLN B NE2 1 
ATOM   4258 N  N   . GLN B 2 131 ? -17.835 43.155 -6.206  1.00 30.33  ? 130 GLN B N   1 
ATOM   4259 C  CA  . GLN B 2 131 ? -18.399 42.214 -5.256  1.00 27.89  ? 130 GLN B CA  1 
ATOM   4260 C  C   . GLN B 2 131 ? -19.684 42.680 -4.573  1.00 30.56  ? 130 GLN B C   1 
ATOM   4261 O  O   . GLN B 2 131 ? -20.651 41.921 -4.489  1.00 29.45  ? 130 GLN B O   1 
ATOM   4262 C  CB  . GLN B 2 131 ? -17.357 41.850 -4.233  1.00 28.37  ? 130 GLN B CB  1 
ATOM   4263 C  CG  . GLN B 2 131 ? -16.190 41.131 -4.837  1.00 28.79  ? 130 GLN B CG  1 
ATOM   4264 C  CD  . GLN B 2 131 ? -15.213 40.662 -3.780  1.00 29.36  ? 130 GLN B CD  1 
ATOM   4265 O  OE1 . GLN B 2 131 ? -14.830 41.428 -2.872  1.00 29.55  ? 130 GLN B OE1 1 
ATOM   4266 N  NE2 . GLN B 2 131 ? -14.821 39.391 -3.867  1.00 29.76  ? 130 GLN B NE2 1 
ATOM   4267 N  N   . ILE B 2 132 ? -19.715 43.913 -4.081  1.00 28.55  ? 131 ILE B N   1 
ATOM   4268 C  CA  . ILE B 2 132 ? -20.959 44.415 -3.491  1.00 27.54  ? 131 ILE B CA  1 
ATOM   4269 C  C   . ILE B 2 132 ? -22.037 44.602 -4.565  1.00 27.79  ? 131 ILE B C   1 
ATOM   4270 O  O   . ILE B 2 132 ? -23.240 44.551 -4.274  1.00 28.60  ? 131 ILE B O   1 
ATOM   4271 C  CB  . ILE B 2 132 ? -20.757 45.721 -2.725  1.00 27.82  ? 131 ILE B CB  1 
ATOM   4272 C  CG1 . ILE B 2 132 ? -20.178 46.788 -3.648  1.00 27.82  ? 131 ILE B CG1 1 
ATOM   4273 C  CG2 . ILE B 2 132 ? -19.840 45.497 -1.543  1.00 28.32  ? 131 ILE B CG2 1 
ATOM   4274 C  CD1 . ILE B 2 132 ? -19.924 48.101 -2.951  1.00 28.31  ? 131 ILE B CD1 1 
ATOM   4275 N  N   . VAL B 2 133 ? -21.607 44.808 -5.809  1.00 26.97  ? 132 VAL B N   1 
ATOM   4276 C  CA  . VAL B 2 133 ? -22.557 44.847 -6.920  1.00 27.37  ? 132 VAL B CA  1 
ATOM   4277 C  C   . VAL B 2 133 ? -23.141 43.447 -7.167  1.00 27.06  ? 132 VAL B C   1 
ATOM   4278 O  O   . VAL B 2 133 ? -24.351 43.279 -7.269  1.00 26.58  ? 132 VAL B O   1 
ATOM   4279 C  CB  . VAL B 2 133 ? -21.923 45.422 -8.196  1.00 26.66  ? 132 VAL B CB  1 
ATOM   4280 C  CG1 . VAL B 2 133 ? -22.587 44.857 -9.407  1.00 26.47  ? 132 VAL B CG1 1 
ATOM   4281 C  CG2 . VAL B 2 133 ? -22.018 46.927 -8.187  1.00 26.74  ? 132 VAL B CG2 1 
ATOM   4282 N  N   . ASP B 2 134 ? -22.271 42.446 -7.242  1.00 31.24  ? 133 ASP B N   1 
ATOM   4283 C  CA  . ASP B 2 134 ? -22.703 41.056 -7.305  1.00 29.17  ? 133 ASP B CA  1 
ATOM   4284 C  C   . ASP B 2 134 ? -23.722 40.742 -6.206  1.00 33.64  ? 133 ASP B C   1 
ATOM   4285 O  O   . ASP B 2 134 ? -24.831 40.279 -6.490  1.00 31.14  ? 133 ASP B O   1 
ATOM   4286 C  CB  . ASP B 2 134 ? -21.504 40.119 -7.163  1.00 32.06  ? 133 ASP B CB  1 
ATOM   4287 C  CG  . ASP B 2 134 ? -20.672 40.024 -8.428  1.00 41.01  ? 133 ASP B CG  1 
ATOM   4288 O  OD1 . ASP B 2 134 ? -21.170 40.432 -9.492  1.00 44.60  ? 133 ASP B OD1 1 
ATOM   4289 O  OD2 . ASP B 2 134 ? -19.523 39.526 -8.360  1.00 45.98  ? 133 ASP B OD2 1 
ATOM   4290 N  N   . LYS B 2 135 ? -23.342 41.006 -4.954  1.00 33.87  ? 134 LYS B N   1 
ATOM   4291 C  CA  . LYS B 2 135 ? -24.181 40.655 -3.800  1.00 29.66  ? 134 LYS B CA  1 
ATOM   4292 C  C   . LYS B 2 135 ? -25.501 41.416 -3.780  1.00 31.77  ? 134 LYS B C   1 
ATOM   4293 O  O   . LYS B 2 135 ? -26.496 40.920 -3.254  1.00 32.10  ? 134 LYS B O   1 
ATOM   4294 C  CB  . LYS B 2 135 ? -23.435 40.854 -2.476  1.00 28.03  ? 134 LYS B CB  1 
ATOM   4295 C  CG  . LYS B 2 135 ? -22.451 39.733 -2.119  1.00 28.42  ? 134 LYS B CG  1 
ATOM   4296 C  CD  . LYS B 2 135 ? -21.750 40.013 -0.763  1.00 28.93  ? 134 LYS B CD  1 
ATOM   4297 C  CE  . LYS B 2 135 ? -20.293 40.506 -0.907  1.00 29.43  ? 134 LYS B CE  1 
ATOM   4298 N  NZ  . LYS B 2 135 ? -19.487 39.610 -1.826  1.00 35.97  ? 134 LYS B NZ  1 
ATOM   4299 N  N   . THR B 2 136 ? -25.520 42.614 -4.361  1.00 31.57  ? 135 THR B N   1 
ATOM   4300 C  CA  . THR B 2 136 ? -26.746 43.404 -4.340  1.00 31.86  ? 135 THR B CA  1 
ATOM   4301 C  C   . THR B 2 136 ? -27.781 42.803 -5.283  1.00 32.04  ? 135 THR B C   1 
ATOM   4302 O  O   . THR B 2 136 ? -28.950 42.645 -4.922  1.00 35.29  ? 135 THR B O   1 
ATOM   4303 C  CB  . THR B 2 136 ? -26.502 44.867 -4.702  1.00 29.68  ? 135 THR B CB  1 
ATOM   4304 O  OG1 . THR B 2 136 ? -25.889 45.554 -3.593  1.00 31.30  ? 135 THR B OG1 1 
ATOM   4305 C  CG2 . THR B 2 136 ? -27.827 45.523 -5.042  1.00 27.03  ? 135 THR B CG2 1 
ATOM   4306 N  N   . ILE B 2 137 ? -27.322 42.448 -6.480  1.00 28.14  ? 136 ILE B N   1 
ATOM   4307 C  CA  . ILE B 2 137 ? -28.155 41.838 -7.515  1.00 30.25  ? 136 ILE B CA  1 
ATOM   4308 C  C   . ILE B 2 137 ? -28.690 40.484 -7.056  1.00 36.93  ? 136 ILE B C   1 
ATOM   4309 O  O   . ILE B 2 137 ? -29.892 40.230 -7.137  1.00 38.50  ? 136 ILE B O   1 
ATOM   4310 C  CB  . ILE B 2 137 ? -27.349 41.606 -8.824  1.00 29.01  ? 136 ILE B CB  1 
ATOM   4311 C  CG1 . ILE B 2 137 ? -26.736 42.911 -9.366  1.00 27.44  ? 136 ILE B CG1 1 
ATOM   4312 C  CG2 . ILE B 2 137 ? -28.191 40.877 -9.879  1.00 29.27  ? 136 ILE B CG2 1 
ATOM   4313 C  CD1 . ILE B 2 137 ? -27.619 43.710 -10.257 1.00 26.27  ? 136 ILE B CD1 1 
ATOM   4314 N  N   . ILE B 2 138 ? -27.787 39.623 -6.578  1.00 35.00  ? 137 ILE B N   1 
ATOM   4315 C  CA  . ILE B 2 138 ? -28.124 38.251 -6.201  1.00 32.72  ? 137 ILE B CA  1 
ATOM   4316 C  C   . ILE B 2 138 ? -29.252 38.229 -5.180  1.00 35.65  ? 137 ILE B C   1 
ATOM   4317 O  O   . ILE B 2 138 ? -30.122 37.341 -5.216  1.00 35.49  ? 137 ILE B O   1 
ATOM   4318 C  CB  . ILE B 2 138 ? -26.910 37.521 -5.586  1.00 34.61  ? 137 ILE B CB  1 
ATOM   4319 C  CG1 . ILE B 2 138 ? -25.838 37.248 -6.638  1.00 35.20  ? 137 ILE B CG1 1 
ATOM   4320 C  CG2 . ILE B 2 138 ? -27.326 36.207 -4.957  1.00 32.87  ? 137 ILE B CG2 1 
ATOM   4321 C  CD1 . ILE B 2 138 ? -24.694 36.466 -6.084  1.00 33.81  ? 137 ILE B CD1 1 
ATOM   4322 N  N   . ASN B 2 139 ? -29.228 39.220 -4.284  1.00 36.22  ? 138 ASN B N   1 
ATOM   4323 C  CA  . ASN B 2 139 ? -30.171 39.326 -3.174  1.00 38.73  ? 138 ASN B CA  1 
ATOM   4324 C  C   . ASN B 2 139 ? -31.539 39.814 -3.585  1.00 45.10  ? 138 ASN B C   1 
ATOM   4325 O  O   . ASN B 2 139 ? -32.544 39.468 -2.950  1.00 50.21  ? 138 ASN B O   1 
ATOM   4326 C  CB  . ASN B 2 139 ? -29.630 40.282 -2.118  1.00 43.90  ? 138 ASN B CB  1 
ATOM   4327 C  CG  . ASN B 2 139 ? -28.993 39.557 -0.946  1.00 56.97  ? 138 ASN B CG  1 
ATOM   4328 O  OD1 . ASN B 2 139 ? -29.386 39.757 0.212   1.00 59.81  ? 138 ASN B OD1 1 
ATOM   4329 N  ND2 . ASN B 2 139 ? -28.011 38.697 -1.238  1.00 56.89  ? 138 ASN B ND2 1 
ATOM   4330 N  N   . ALA B 2 140 ? -31.574 40.627 -4.641  1.00 41.21  ? 139 ALA B N   1 
ATOM   4331 C  CA  . ALA B 2 140 ? -32.812 41.288 -5.050  1.00 37.50  ? 139 ALA B CA  1 
ATOM   4332 C  C   . ALA B 2 140 ? -33.445 40.612 -6.262  1.00 38.34  ? 139 ALA B C   1 
ATOM   4333 O  O   . ALA B 2 140 ? -34.571 40.918 -6.641  1.00 45.92  ? 139 ALA B O   1 
ATOM   4334 C  CB  . ALA B 2 140 ? -32.569 42.765 -5.312  1.00 36.92  ? 139 ALA B CB  1 
ATOM   4335 N  N   . ASP B 2 141 ? -32.717 39.671 -6.845  1.00 42.06  ? 140 ASP B N   1 
ATOM   4336 C  CA  . ASP B 2 141 ? -33.124 38.999 -8.073  1.00 44.67  ? 140 ASP B CA  1 
ATOM   4337 C  C   . ASP B 2 141 ? -34.058 37.817 -7.784  1.00 53.33  ? 140 ASP B C   1 
ATOM   4338 O  O   . ASP B 2 141 ? -33.627 36.661 -7.770  1.00 58.30  ? 140 ASP B O   1 
ATOM   4339 C  CB  . ASP B 2 141 ? -31.861 38.549 -8.824  1.00 38.12  ? 140 ASP B CB  1 
ATOM   4340 C  CG  . ASP B 2 141 ? -32.161 37.729 -10.054 1.00 43.74  ? 140 ASP B CG  1 
ATOM   4341 O  OD1 . ASP B 2 141 ? -33.227 37.934 -10.658 1.00 47.90  ? 140 ASP B OD1 1 
ATOM   4342 O  OD2 . ASP B 2 141 ? -31.317 36.873 -10.421 1.00 45.81  ? 140 ASP B OD2 1 
ATOM   4343 N  N   . LYS B 2 142 ? -35.339 38.109 -7.571  1.00 52.82  ? 141 LYS B N   1 
ATOM   4344 C  CA  . LYS B 2 142 ? -36.292 37.073 -7.176  1.00 51.54  ? 141 LYS B CA  1 
ATOM   4345 C  C   . LYS B 2 142 ? -36.509 35.974 -8.226  1.00 49.70  ? 141 LYS B C   1 
ATOM   4346 O  O   . LYS B 2 142 ? -36.727 34.820 -7.869  1.00 59.79  ? 141 LYS B O   1 
ATOM   4347 C  CB  . LYS B 2 142 ? -37.635 37.678 -6.756  1.00 48.50  ? 141 LYS B CB  1 
ATOM   4348 C  CG  . LYS B 2 142 ? -37.552 38.682 -5.612  1.00 43.60  ? 141 LYS B CG  1 
ATOM   4349 C  CD  . LYS B 2 142 ? -36.664 38.168 -4.498  1.00 45.11  ? 141 LYS B CD  1 
ATOM   4350 C  CE  . LYS B 2 142 ? -36.772 39.045 -3.243  1.00 52.40  ? 141 LYS B CE  1 
ATOM   4351 N  NZ  . LYS B 2 142 ? -35.818 38.637 -2.146  1.00 55.18  ? 141 LYS B NZ  1 
ATOM   4352 N  N   . ASP B 2 143 ? -36.446 36.314 -9.510  1.00 39.46  ? 142 ASP B N   1 
ATOM   4353 C  CA  . ASP B 2 143 ? -36.719 35.317 -10.552 1.00 45.66  ? 142 ASP B CA  1 
ATOM   4354 C  C   . ASP B 2 143 ? -35.500 34.778 -11.341 1.00 49.91  ? 142 ASP B C   1 
ATOM   4355 O  O   . ASP B 2 143 ? -35.662 34.102 -12.368 1.00 52.89  ? 142 ASP B O   1 
ATOM   4356 C  CB  . ASP B 2 143 ? -37.827 35.798 -11.496 1.00 52.62  ? 142 ASP B CB  1 
ATOM   4357 C  CG  . ASP B 2 143 ? -37.447 37.047 -12.264 1.00 59.60  ? 142 ASP B CG  1 
ATOM   4358 O  OD1 . ASP B 2 143 ? -36.237 37.280 -12.481 1.00 63.15  ? 142 ASP B OD1 1 
ATOM   4359 O  OD2 . ASP B 2 143 ? -38.364 37.791 -12.670 1.00 61.04  ? 142 ASP B OD2 1 
ATOM   4360 N  N   . GLY B 2 144 ? -34.295 35.109 -10.870 1.00 50.13  ? 143 GLY B N   1 
ATOM   4361 C  CA  . GLY B 2 144 ? -33.059 34.493 -11.340 1.00 47.93  ? 143 GLY B CA  1 
ATOM   4362 C  C   . GLY B 2 144 ? -32.599 34.683 -12.779 1.00 52.22  ? 143 GLY B C   1 
ATOM   4363 O  O   . GLY B 2 144 ? -31.907 33.810 -13.322 1.00 54.70  ? 143 GLY B O   1 
ATOM   4364 N  N   . ASP B 2 145 ? -32.965 35.817 -13.386 1.00 51.10  ? 144 ASP B N   1 
ATOM   4365 C  CA  . ASP B 2 145 ? -32.550 36.158 -14.755 1.00 45.28  ? 144 ASP B CA  1 
ATOM   4366 C  C   . ASP B 2 145 ? -31.240 36.926 -14.740 1.00 49.52  ? 144 ASP B C   1 
ATOM   4367 O  O   . ASP B 2 145 ? -30.722 37.324 -15.790 1.00 52.29  ? 144 ASP B O   1 
ATOM   4368 C  CB  . ASP B 2 145 ? -33.622 36.978 -15.466 1.00 42.33  ? 144 ASP B CB  1 
ATOM   4369 C  CG  . ASP B 2 145 ? -33.922 38.267 -14.757 1.00 51.42  ? 144 ASP B CG  1 
ATOM   4370 O  OD1 . ASP B 2 145 ? -33.219 38.582 -13.769 1.00 46.13  ? 144 ASP B OD1 1 
ATOM   4371 O  OD2 . ASP B 2 145 ? -34.859 38.971 -15.192 1.00 53.37  ? 144 ASP B OD2 1 
ATOM   4372 N  N   . GLY B 2 146 ? -30.764 37.181 -13.523 1.00 47.00  ? 145 GLY B N   1 
ATOM   4373 C  CA  . GLY B 2 146 ? -29.505 37.855 -13.300 1.00 42.88  ? 145 GLY B CA  1 
ATOM   4374 C  C   . GLY B 2 146 ? -29.553 39.377 -13.326 1.00 40.43  ? 145 GLY B C   1 
ATOM   4375 O  O   . GLY B 2 146 ? -28.518 40.008 -13.153 1.00 38.04  ? 145 GLY B O   1 
ATOM   4376 N  N   . ARG B 2 147 ? -30.725 39.974 -13.547 1.00 37.03  ? 146 ARG B N   1 
ATOM   4377 C  CA  . ARG B 2 147 ? -30.845 41.431 -13.580 1.00 33.90  ? 146 ARG B CA  1 
ATOM   4378 C  C   . ARG B 2 147 ? -31.910 41.876 -12.585 1.00 38.36  ? 146 ARG B C   1 
ATOM   4379 O  O   . ARG B 2 147 ? -32.408 41.060 -11.852 1.00 48.30  ? 146 ARG B O   1 
ATOM   4380 C  CB  . ARG B 2 147 ? -31.174 41.894 -14.991 1.00 35.72  ? 146 ARG B CB  1 
ATOM   4381 C  CG  . ARG B 2 147 ? -32.030 40.885 -15.719 1.00 36.96  ? 146 ARG B CG  1 
ATOM   4382 C  CD  . ARG B 2 147 ? -32.257 41.250 -17.155 1.00 36.21  ? 146 ARG B CD  1 
ATOM   4383 N  NE  . ARG B 2 147 ? -33.488 40.637 -17.635 1.00 41.04  ? 146 ARG B NE  1 
ATOM   4384 C  CZ  . ARG B 2 147 ? -33.843 40.591 -18.912 1.00 40.49  ? 146 ARG B CZ  1 
ATOM   4385 N  NH1 . ARG B 2 147 ? -33.041 41.115 -19.832 1.00 40.55  ? 146 ARG B NH1 1 
ATOM   4386 N  NH2 . ARG B 2 147 ? -34.987 40.013 -19.268 1.00 37.71  ? 146 ARG B NH2 1 
ATOM   4387 N  N   . ILE B 2 148 ? -32.247 43.161 -12.543 1.00 30.84  ? 147 ILE B N   1 
ATOM   4388 C  CA  . ILE B 2 148 ? -33.173 43.697 -11.537 1.00 31.01  ? 147 ILE B CA  1 
ATOM   4389 C  C   . ILE B 2 148 ? -34.311 44.495 -12.162 1.00 33.76  ? 147 ILE B C   1 
ATOM   4390 O  O   . ILE B 2 148 ? -34.124 45.619 -12.602 1.00 34.62  ? 147 ILE B O   1 
ATOM   4391 C  CB  . ILE B 2 148 ? -32.457 44.629 -10.548 1.00 31.64  ? 147 ILE B CB  1 
ATOM   4392 C  CG1 . ILE B 2 148 ? -31.289 43.906 -9.879  1.00 31.99  ? 147 ILE B CG1 1 
ATOM   4393 C  CG2 . ILE B 2 148 ? -33.429 45.156 -9.491  1.00 30.58  ? 147 ILE B CG2 1 
ATOM   4394 C  CD1 . ILE B 2 148 ? -31.690 42.701 -9.106  1.00 39.08  ? 147 ILE B CD1 1 
ATOM   4395 N  N   . SER B 2 149 ? -35.492 43.903 -12.200 1.00 42.22  ? 148 SER B N   1 
ATOM   4396 C  CA  . SER B 2 149 ? -36.683 44.580 -12.682 1.00 45.01  ? 148 SER B CA  1 
ATOM   4397 C  C   . SER B 2 149 ? -37.038 45.743 -11.764 1.00 42.56  ? 148 SER B C   1 
ATOM   4398 O  O   . SER B 2 149 ? -36.458 45.896 -10.694 1.00 35.92  ? 148 SER B O   1 
ATOM   4399 C  CB  . SER B 2 149 ? -37.851 43.600 -12.710 1.00 50.45  ? 148 SER B CB  1 
ATOM   4400 O  OG  . SER B 2 149 ? -38.092 43.079 -11.409 1.00 53.40  ? 148 SER B OG  1 
ATOM   4401 N  N   . PHE B 2 150 ? -38.005 46.555 -12.185 1.00 41.23  ? 149 PHE B N   1 
ATOM   4402 C  CA  . PHE B 2 150 ? -38.435 47.706 -11.395 1.00 36.71  ? 149 PHE B CA  1 
ATOM   4403 C  C   . PHE B 2 150 ? -39.138 47.282 -10.125 1.00 39.82  ? 149 PHE B C   1 
ATOM   4404 O  O   . PHE B 2 150 ? -38.940 47.885 -9.072  1.00 37.33  ? 149 PHE B O   1 
ATOM   4405 C  CB  . PHE B 2 150 ? -39.383 48.587 -12.194 1.00 33.81  ? 149 PHE B CB  1 
ATOM   4406 C  CG  . PHE B 2 150 ? -39.893 49.776 -11.426 1.00 36.36  ? 149 PHE B CG  1 
ATOM   4407 C  CD1 . PHE B 2 150 ? -39.018 50.695 -10.881 1.00 35.20  ? 149 PHE B CD1 1 
ATOM   4408 C  CD2 . PHE B 2 150 ? -41.254 49.992 -11.272 1.00 40.96  ? 149 PHE B CD2 1 
ATOM   4409 C  CE1 . PHE B 2 150 ? -39.489 51.804 -10.182 1.00 38.01  ? 149 PHE B CE1 1 
ATOM   4410 C  CE2 . PHE B 2 150 ? -41.727 51.108 -10.570 1.00 41.76  ? 149 PHE B CE2 1 
ATOM   4411 C  CZ  . PHE B 2 150 ? -40.841 52.009 -10.035 1.00 39.84  ? 149 PHE B CZ  1 
ATOM   4412 N  N   . GLU B 2 151 ? -39.979 46.261 -10.242 1.00 47.13  ? 150 GLU B N   1 
ATOM   4413 C  CA  . GLU B 2 151 ? -40.691 45.716 -9.100  1.00 45.59  ? 150 GLU B CA  1 
ATOM   4414 C  C   . GLU B 2 151 ? -39.702 45.228 -8.042  1.00 47.11  ? 150 GLU B C   1 
ATOM   4415 O  O   . GLU B 2 151 ? -39.904 45.460 -6.845  1.00 45.45  ? 150 GLU B O   1 
ATOM   4416 C  CB  . GLU B 2 151 ? -41.625 44.581 -9.530  1.00 41.53  ? 150 GLU B CB  1 
ATOM   4417 C  CG  . GLU B 2 151 ? -42.843 45.044 -10.354 1.00 43.03  ? 150 GLU B CG  1 
ATOM   4418 C  CD  . GLU B 2 151 ? -42.487 45.527 -11.795 1.00 42.96  ? 150 GLU B CD  1 
ATOM   4419 O  OE1 . GLU B 2 151 ? -41.458 45.058 -12.379 1.00 42.46  ? 150 GLU B OE1 1 
ATOM   4420 O  OE2 . GLU B 2 151 ? -43.254 46.369 -12.367 1.00 43.44  ? 150 GLU B OE2 1 
ATOM   4421 N  N   . GLU B 2 152 ? -38.625 44.573 -8.480  1.00 44.77  ? 151 GLU B N   1 
ATOM   4422 C  CA  . GLU B 2 152 ? -37.575 44.139 -7.551  1.00 34.15  ? 151 GLU B CA  1 
ATOM   4423 C  C   . GLU B 2 152 ? -36.810 45.294 -6.923  1.00 43.86  ? 151 GLU B C   1 
ATOM   4424 O  O   . GLU B 2 152 ? -36.476 45.266 -5.744  1.00 44.43  ? 151 GLU B O   1 
ATOM   4425 C  CB  . GLU B 2 152 ? -36.597 43.210 -8.242  1.00 45.41  ? 151 GLU B CB  1 
ATOM   4426 C  CG  . GLU B 2 152 ? -37.141 41.856 -8.435  1.00 35.18  ? 151 GLU B CG  1 
ATOM   4427 C  CD  . GLU B 2 152 ? -36.486 41.177 -9.574  1.00 44.78  ? 151 GLU B CD  1 
ATOM   4428 O  OE1 . GLU B 2 152 ? -35.758 41.872 -10.303 1.00 44.47  ? 151 GLU B OE1 1 
ATOM   4429 O  OE2 . GLU B 2 152 ? -36.699 39.956 -9.733  1.00 44.79  ? 151 GLU B OE2 1 
ATOM   4430 N  N   . PHE B 2 153 ? -36.532 46.302 -7.736  1.00 43.52  ? 152 PHE B N   1 
ATOM   4431 C  CA  . PHE B 2 153 ? -35.885 47.504 -7.284  1.00 36.89  ? 152 PHE B CA  1 
ATOM   4432 C  C   . PHE B 2 153 ? -36.690 48.129 -6.163  1.00 38.85  ? 152 PHE B C   1 
ATOM   4433 O  O   . PHE B 2 153 ? -36.141 48.454 -5.125  1.00 40.68  ? 152 PHE B O   1 
ATOM   4434 C  CB  . PHE B 2 153 ? -35.750 48.483 -8.446  1.00 35.16  ? 152 PHE B CB  1 
ATOM   4435 C  CG  . PHE B 2 153 ? -35.127 49.799 -8.064  1.00 29.72  ? 152 PHE B CG  1 
ATOM   4436 C  CD1 . PHE B 2 153 ? -33.776 49.889 -7.801  1.00 28.32  ? 152 PHE B CD1 1 
ATOM   4437 C  CD2 . PHE B 2 153 ? -35.890 50.946 -7.983  1.00 29.62  ? 152 PHE B CD2 1 
ATOM   4438 C  CE1 . PHE B 2 153 ? -33.201 51.096 -7.460  1.00 28.55  ? 152 PHE B CE1 1 
ATOM   4439 C  CE2 . PHE B 2 153 ? -35.316 52.156 -7.636  1.00 28.85  ? 152 PHE B CE2 1 
ATOM   4440 C  CZ  . PHE B 2 153 ? -33.972 52.228 -7.377  1.00 27.81  ? 152 PHE B CZ  1 
ATOM   4441 N  N   . CYS B 2 154 ? -37.995 48.283 -6.353  1.00 44.84  ? 153 CYS B N   1 
ATOM   4442 C  CA  . CYS B 2 154 ? -38.825 48.922 -5.323  1.00 45.43  ? 153 CYS B CA  1 
ATOM   4443 C  C   . CYS B 2 154 ? -38.831 48.154 -4.003  1.00 45.05  ? 153 CYS B C   1 
ATOM   4444 O  O   . CYS B 2 154 ? -38.747 48.752 -2.928  1.00 44.15  ? 153 CYS B O   1 
ATOM   4445 C  CB  . CYS B 2 154 ? -40.251 49.137 -5.816  1.00 44.25  ? 153 CYS B CB  1 
ATOM   4446 S  SG  . CYS B 2 154 ? -40.386 50.446 -7.043  1.00 56.53  ? 153 CYS B SG  1 
ATOM   4447 N  N   . ALA B 2 155 ? -38.906 46.829 -4.104  1.00 43.46  ? 154 ALA B N   1 
ATOM   4448 C  CA  . ALA B 2 155 ? -38.883 45.949 -2.938  1.00 41.63  ? 154 ALA B CA  1 
ATOM   4449 C  C   . ALA B 2 155 ? -37.709 46.231 -2.014  1.00 46.96  ? 154 ALA B C   1 
ATOM   4450 O  O   . ALA B 2 155 ? -37.822 46.073 -0.799  1.00 50.42  ? 154 ALA B O   1 
ATOM   4451 C  CB  . ALA B 2 155 ? -38.859 44.488 -3.374  1.00 37.49  ? 154 ALA B CB  1 
ATOM   4452 N  N   . VAL B 2 156 ? -36.587 46.646 -2.593  1.00 45.37  ? 155 VAL B N   1 
ATOM   4453 C  CA  . VAL B 2 156 ? -35.391 46.943 -1.819  1.00 39.65  ? 155 VAL B CA  1 
ATOM   4454 C  C   . VAL B 2 156 ? -35.412 48.356 -1.239  1.00 45.44  ? 155 VAL B C   1 
ATOM   4455 O  O   . VAL B 2 156 ? -35.116 48.553 -0.059  1.00 50.57  ? 155 VAL B O   1 
ATOM   4456 C  CB  . VAL B 2 156 ? -34.121 46.786 -2.666  1.00 36.99  ? 155 VAL B CB  1 
ATOM   4457 C  CG1 . VAL B 2 156 ? -32.888 47.186 -1.861  1.00 34.98  ? 155 VAL B CG1 1 
ATOM   4458 C  CG2 . VAL B 2 156 ? -34.011 45.369 -3.204  1.00 31.01  ? 155 VAL B CG2 1 
ATOM   4459 N  N   . VAL B 2 157 ? -35.777 49.339 -2.056  1.00 39.86  ? 156 VAL B N   1 
ATOM   4460 C  CA  . VAL B 2 157 ? -35.587 50.725 -1.654  1.00 39.19  ? 156 VAL B CA  1 
ATOM   4461 C  C   . VAL B 2 157 ? -36.868 51.472 -1.294  1.00 39.86  ? 156 VAL B C   1 
ATOM   4462 O  O   . VAL B 2 157 ? -36.805 52.618 -0.837  1.00 40.48  ? 156 VAL B O   1 
ATOM   4463 C  CB  . VAL B 2 157 ? -34.857 51.510 -2.742  1.00 39.94  ? 156 VAL B CB  1 
ATOM   4464 C  CG1 . VAL B 2 157 ? -33.460 50.943 -2.956  1.00 36.53  ? 156 VAL B CG1 1 
ATOM   4465 C  CG2 . VAL B 2 157 ? -35.670 51.468 -4.028  1.00 43.65  ? 156 VAL B CG2 1 
ATOM   4466 N  N   . GLY B 2 158 ? -38.021 50.831 -1.489  1.00 57.26  ? 157 GLY B N   1 
ATOM   4467 C  CA  . GLY B 2 158 ? -39.311 51.466 -1.240  1.00 62.10  ? 157 GLY B CA  1 
ATOM   4468 C  C   . GLY B 2 158 ? -39.508 52.093 0.137   1.00 68.37  ? 157 GLY B C   1 
ATOM   4469 O  O   . GLY B 2 158 ? -40.213 53.097 0.278   1.00 70.89  ? 157 GLY B O   1 
ATOM   4470 N  N   . GLY B 2 159 ? -38.879 51.503 1.151   1.00 59.42  ? 158 GLY B N   1 
ATOM   4471 C  CA  . GLY B 2 159 ? -39.003 51.983 2.513   1.00 59.31  ? 158 GLY B CA  1 
ATOM   4472 C  C   . GLY B 2 159 ? -38.031 53.078 2.922   1.00 66.31  ? 158 GLY B C   1 
ATOM   4473 O  O   . GLY B 2 159 ? -38.025 53.499 4.081   1.00 68.48  ? 158 GLY B O   1 
ATOM   4474 N  N   . LEU B 2 160 ? -37.217 53.557 1.986   1.00 68.66  ? 159 LEU B N   1 
ATOM   4475 C  CA  . LEU B 2 160 ? -36.218 54.572 2.310   1.00 63.73  ? 159 LEU B CA  1 
ATOM   4476 C  C   . LEU B 2 160 ? -36.764 55.995 2.235   1.00 61.96  ? 159 LEU B C   1 
ATOM   4477 O  O   . LEU B 2 160 ? -36.124 56.933 2.730   1.00 64.12  ? 159 LEU B O   1 
ATOM   4478 C  CB  . LEU B 2 160 ? -35.012 54.447 1.391   1.00 60.88  ? 159 LEU B CB  1 
ATOM   4479 C  CG  . LEU B 2 160 ? -33.817 53.684 1.931   1.00 61.80  ? 159 LEU B CG  1 
ATOM   4480 C  CD1 . LEU B 2 160 ? -34.233 52.304 2.403   1.00 65.37  ? 159 LEU B CD1 1 
ATOM   4481 C  CD2 . LEU B 2 160 ? -32.786 53.591 0.829   1.00 59.36  ? 159 LEU B CD2 1 
ATOM   4482 N  N   . ASP B 2 161 ? -37.928 56.156 1.608   1.00 59.34  ? 160 ASP B N   1 
ATOM   4483 C  CA  . ASP B 2 161 ? -38.572 57.465 1.523   1.00 71.51  ? 160 ASP B CA  1 
ATOM   4484 C  C   . ASP B 2 161 ? -37.638 58.549 0.963   1.00 71.56  ? 160 ASP B C   1 
ATOM   4485 O  O   . ASP B 2 161 ? -37.603 59.674 1.464   1.00 70.46  ? 160 ASP B O   1 
ATOM   4486 C  CB  . ASP B 2 161 ? -39.114 57.884 2.901   1.00 81.46  ? 160 ASP B CB  1 
ATOM   4487 C  CG  . ASP B 2 161 ? -40.330 57.057 3.340   1.00 84.96  ? 160 ASP B CG  1 
ATOM   4488 O  OD1 . ASP B 2 161 ? -40.619 56.011 2.706   1.00 83.47  ? 160 ASP B OD1 1 
ATOM   4489 O  OD2 . ASP B 2 161 ? -40.993 57.459 4.328   1.00 85.22  ? 160 ASP B OD2 1 
ATOM   4490 N  N   . ILE B 2 162 ? -36.866 58.193 -0.061  1.00 72.16  ? 161 ILE B N   1 
ATOM   4491 C  CA  . ILE B 2 162 ? -35.972 59.146 -0.715  1.00 68.99  ? 161 ILE B CA  1 
ATOM   4492 C  C   . ILE B 2 162 ? -36.781 60.034 -1.657  1.00 64.79  ? 161 ILE B C   1 
ATOM   4493 O  O   . ILE B 2 162 ? -36.444 61.200 -1.890  1.00 65.18  ? 161 ILE B O   1 
ATOM   4494 C  CB  . ILE B 2 162 ? -34.857 58.427 -1.489  1.00 65.62  ? 161 ILE B CB  1 
ATOM   4495 C  CG1 . ILE B 2 162 ? -33.956 57.665 -0.517  1.00 66.06  ? 161 ILE B CG1 1 
ATOM   4496 C  CG2 . ILE B 2 162 ? -34.023 59.418 -2.287  1.00 62.46  ? 161 ILE B CG2 1 
ATOM   4497 C  CD1 . ILE B 2 162 ? -33.128 58.566 0.373   1.00 63.96  ? 161 ILE B CD1 1 
ATOM   4498 N  N   . HIS B 2 163 ? -37.873 59.470 -2.165  1.00 51.81  ? 162 HIS B N   1 
ATOM   4499 C  CA  . HIS B 2 163 ? -38.819 60.189 -3.008  1.00 54.55  ? 162 HIS B CA  1 
ATOM   4500 C  C   . HIS B 2 163 ? -39.338 61.502 -2.407  1.00 61.22  ? 162 HIS B C   1 
ATOM   4501 O  O   . HIS B 2 163 ? -39.832 62.363 -3.134  1.00 65.06  ? 162 HIS B O   1 
ATOM   4502 C  CB  . HIS B 2 163 ? -40.003 59.287 -3.331  1.00 58.92  ? 162 HIS B CB  1 
ATOM   4503 C  CG  . HIS B 2 163 ? -40.888 59.024 -2.158  1.00 64.91  ? 162 HIS B CG  1 
ATOM   4504 N  ND1 . HIS B 2 163 ? -40.494 58.243 -1.092  1.00 66.41  ? 162 HIS B ND1 1 
ATOM   4505 C  CD2 . HIS B 2 163 ? -42.143 59.448 -1.876  1.00 66.30  ? 162 HIS B CD2 1 
ATOM   4506 C  CE1 . HIS B 2 163 ? -41.471 58.194 -0.204  1.00 69.79  ? 162 HIS B CE1 1 
ATOM   4507 N  NE2 . HIS B 2 163 ? -42.482 58.918 -0.654  1.00 70.96  ? 162 HIS B NE2 1 
ATOM   4508 N  N   . LYS B 2 164 ? -39.246 61.650 -1.087  1.00 67.86  ? 163 LYS B N   1 
ATOM   4509 C  CA  . LYS B 2 164 ? -39.650 62.892 -0.439  1.00 63.59  ? 163 LYS B CA  1 
ATOM   4510 C  C   . LYS B 2 164 ? -38.593 63.963 -0.683  1.00 62.65  ? 163 LYS B C   1 
ATOM   4511 O  O   . LYS B 2 164 ? -38.871 65.153 -0.569  1.00 66.09  ? 163 LYS B O   1 
ATOM   4512 C  CB  . LYS B 2 164 ? -39.862 62.694 1.067   1.00 66.88  ? 163 LYS B CB  1 
ATOM   4513 C  CG  . LYS B 2 164 ? -40.776 61.527 1.446   1.00 71.67  ? 163 LYS B CG  1 
ATOM   4514 C  CD  . LYS B 2 164 ? -41.175 61.569 2.933   1.00 77.78  ? 163 LYS B CD  1 
ATOM   4515 C  CE  . LYS B 2 164 ? -39.960 61.559 3.874   1.00 77.95  ? 163 LYS B CE  1 
ATOM   4516 N  NZ  . LYS B 2 164 ? -40.321 61.731 5.317   1.00 80.15  ? 163 LYS B NZ  1 
ATOM   4517 N  N   . LYS B 2 165 ? -37.382 63.535 -1.025  1.00 62.21  ? 164 LYS B N   1 
ATOM   4518 C  CA  . LYS B 2 165 ? -36.274 64.459 -1.270  1.00 60.43  ? 164 LYS B CA  1 
ATOM   4519 C  C   . LYS B 2 165 ? -36.206 64.938 -2.733  1.00 59.88  ? 164 LYS B C   1 
ATOM   4520 O  O   . LYS B 2 165 ? -35.730 66.043 -3.017  1.00 63.91  ? 164 LYS B O   1 
ATOM   4521 C  CB  . LYS B 2 165 ? -34.947 63.818 -0.838  1.00 53.66  ? 164 LYS B CB  1 
ATOM   4522 C  CG  . LYS B 2 165 ? -34.384 64.355 0.496   1.00 56.32  ? 164 LYS B CG  1 
ATOM   4523 C  CD  . LYS B 2 165 ? -35.356 64.183 1.702   1.00 58.88  ? 164 LYS B CD  1 
ATOM   4524 C  CE  . LYS B 2 165 ? -34.869 64.909 2.999   1.00 61.52  ? 164 LYS B CE  1 
ATOM   4525 N  NZ  . LYS B 2 165 ? -34.805 66.433 2.925   1.00 62.75  ? 164 LYS B NZ  1 
ATOM   4526 N  N   . MET B 2 166 ? -36.699 64.107 -3.649  1.00 54.79  ? 165 MET B N   1 
ATOM   4527 C  CA  . MET B 2 166 ? -36.700 64.422 -5.072  1.00 51.38  ? 165 MET B CA  1 
ATOM   4528 C  C   . MET B 2 166 ? -37.871 65.326 -5.479  1.00 52.09  ? 165 MET B C   1 
ATOM   4529 O  O   . MET B 2 166 ? -38.773 64.893 -6.198  1.00 50.73  ? 165 MET B O   1 
ATOM   4530 C  CB  . MET B 2 166 ? -36.750 63.132 -5.885  1.00 52.17  ? 165 MET B CB  1 
ATOM   4531 C  CG  . MET B 2 166 ? -35.625 62.145 -5.567  1.00 56.66  ? 165 MET B CG  1 
ATOM   4532 S  SD  . MET B 2 166 ? -35.723 60.585 -6.487  1.00 57.16  ? 165 MET B SD  1 
ATOM   4533 C  CE  . MET B 2 166 ? -35.326 61.151 -8.135  1.00 82.06  ? 165 MET B CE  1 
ATOM   4534 N  N   . VAL B 2 167 ? -37.853 66.578 -5.028  1.00 51.86  ? 166 VAL B N   1 
ATOM   4535 C  CA  . VAL B 2 167 ? -38.937 67.508 -5.314  1.00 51.55  ? 166 VAL B CA  1 
ATOM   4536 C  C   . VAL B 2 167 ? -38.372 68.901 -5.587  1.00 52.87  ? 166 VAL B C   1 
ATOM   4537 O  O   . VAL B 2 167 ? -37.425 69.329 -4.926  1.00 56.12  ? 166 VAL B O   1 
ATOM   4538 C  CB  . VAL B 2 167 ? -39.959 67.569 -4.144  1.00 51.60  ? 166 VAL B CB  1 
ATOM   4539 C  CG1 . VAL B 2 167 ? -40.865 68.772 -4.281  1.00 53.21  ? 166 VAL B CG1 1 
ATOM   4540 C  CG2 . VAL B 2 167 ? -40.806 66.314 -4.102  1.00 52.08  ? 166 VAL B CG2 1 
ATOM   4541 N  N   . VAL B 2 168 ? -38.943 69.593 -6.573  1.00 47.58  ? 167 VAL B N   1 
ATOM   4542 C  CA  . VAL B 2 168 ? -38.532 70.954 -6.914  1.00 51.60  ? 167 VAL B CA  1 
ATOM   4543 C  C   . VAL B 2 168 ? -39.736 71.887 -7.045  1.00 54.30  ? 167 VAL B C   1 
ATOM   4544 O  O   . VAL B 2 168 ? -40.850 71.446 -7.362  1.00 54.53  ? 167 VAL B O   1 
ATOM   4545 C  CB  . VAL B 2 168 ? -37.758 71.012 -8.250  1.00 48.38  ? 167 VAL B CB  1 
ATOM   4546 C  CG1 . VAL B 2 168 ? -36.523 70.133 -8.211  1.00 47.06  ? 167 VAL B CG1 1 
ATOM   4547 C  CG2 . VAL B 2 168 ? -38.663 70.608 -9.387  1.00 47.51  ? 167 VAL B CG2 1 
ATOM   4548 N  N   . ASP B 2 169 ? -39.506 73.178 -6.805  1.00 57.39  ? 168 ASP B N   1 
ATOM   4549 C  CA  . ASP B 2 169 ? -40.518 74.201 -7.058  1.00 62.29  ? 168 ASP B CA  1 
ATOM   4550 C  C   . ASP B 2 169 ? -40.374 74.651 -8.498  1.00 62.57  ? 168 ASP B C   1 
ATOM   4551 O  O   . ASP B 2 169 ? -39.262 74.736 -9.006  1.00 64.20  ? 168 ASP B O   1 
ATOM   4552 C  CB  . ASP B 2 169 ? -40.335 75.415 -6.140  1.00 67.00  ? 168 ASP B CB  1 
ATOM   4553 C  CG  . ASP B 2 169 ? -40.611 75.102 -4.674  1.00 73.93  ? 168 ASP B CG  1 
ATOM   4554 O  OD1 . ASP B 2 169 ? -41.353 74.133 -4.388  1.00 75.37  ? 168 ASP B OD1 1 
ATOM   4555 O  OD2 . ASP B 2 169 ? -40.083 75.839 -3.807  1.00 75.51  ? 168 ASP B OD2 1 
ATOM   4556 N  N   . VAL B 2 170 ? -41.490 74.940 -9.159  1.00 64.80  ? 169 VAL B N   1 
ATOM   4557 C  CA  . VAL B 2 170 ? -41.440 75.472 -10.520 1.00 65.12  ? 169 VAL B CA  1 
ATOM   4558 C  C   . VAL B 2 170 ? -42.112 76.841 -10.613 1.00 70.70  ? 169 VAL B C   1 
ATOM   4559 O  O   . VAL B 2 170 ? -41.858 77.606 -11.544 1.00 72.23  ? 169 VAL B O   1 
ATOM   4560 C  CB  . VAL B 2 170 ? -42.090 74.513 -11.548 1.00 58.98  ? 169 VAL B CB  1 
ATOM   4561 C  CG1 . VAL B 2 170 ? -41.494 73.104 -11.435 1.00 50.37  ? 169 VAL B CG1 1 
ATOM   4562 C  CG2 . VAL B 2 170 ? -43.604 74.488 -11.376 1.00 62.92  ? 169 VAL B CG2 1 
ATOM   4563 O  OXT . VAL B 2 170 ? -42.923 77.213 -9.760  1.00 72.40  ? 169 VAL B OXT 1 
HETATM 4564 ZN ZN  . ZN  C 3 .   ? -13.702 41.049 23.558  1.00 23.73  ? 601 ZN  A ZN  1 
HETATM 4565 FE FE  . FE  D 4 .   ? -12.632 41.548 21.304  1.00 23.73  ? 602 FE  A FE  1 
HETATM 4566 CA CA  . CA  E 5 .   ? -29.859 74.400 -28.611 1.00 57.66  ? 201 CA  B CA  1 
HETATM 4567 CA CA  . CA  F 5 .   ? -34.524 64.786 -27.811 1.00 42.08  ? 202 CA  B CA  1 
HETATM 4568 CA CA  . CA  G 5 .   ? -30.712 47.447 -18.858 1.00 32.85  ? 203 CA  B CA  1 
HETATM 4569 CA CA  . CA  H 5 .   ? -34.990 39.808 -11.967 1.00 42.60  ? 204 CA  B CA  1 
HETATM 4570 O  O   . HOH I 6 .   ? -5.956  33.623 7.934   1.00 35.09  ? 701 HOH A O   1 
HETATM 4571 O  O   . HOH I 6 .   ? -24.345 32.337 4.893   1.00 35.09  ? 702 HOH A O   1 
HETATM 4572 O  O   . HOH I 6 .   ? -9.825  18.766 33.540  1.00 35.09  ? 703 HOH A O   1 
HETATM 4573 O  O   . HOH I 6 .   ? -10.458 37.057 6.572   1.00 35.09  ? 704 HOH A O   1 
HETATM 4574 O  O   . HOH I 6 .   ? -12.952 17.870 17.439  1.00 35.09  ? 705 HOH A O   1 
HETATM 4575 O  O   . HOH I 6 .   ? 4.551   36.811 25.143  1.00 35.09  ? 706 HOH A O   1 
HETATM 4576 O  O   . HOH I 6 .   ? -3.544  42.202 28.282  1.00 35.09  ? 707 HOH A O   1 
HETATM 4577 O  O   . HOH I 6 .   ? -20.880 22.511 -1.579  1.00 35.09  ? 708 HOH A O   1 
HETATM 4578 O  O   . HOH I 6 .   ? -15.045 34.247 -1.731  1.00 35.09  ? 709 HOH A O   1 
HETATM 4579 O  O   . HOH I 6 .   ? -10.672 40.641 9.170   1.00 35.09  ? 710 HOH A O   1 
HETATM 4580 O  O   . HOH I 6 .   ? -1.918  38.562 9.032   1.00 23.73  ? 711 HOH A O   1 
HETATM 4581 O  O   . HOH I 6 .   ? -10.445 42.896 21.582  1.00 23.73  ? 712 HOH A O   1 
HETATM 4582 O  O   . HOH I 6 .   ? -12.591 33.930 22.802  1.00 23.73  ? 713 HOH A O   1 
HETATM 4583 O  O   . HOH I 6 .   ? -13.346 31.365 19.896  1.00 23.73  ? 714 HOH A O   1 
HETATM 4584 O  O   . HOH I 6 .   ? -20.221 15.488 7.368   1.00 23.73  ? 715 HOH A O   1 
HETATM 4585 O  O   . HOH I 6 .   ? -35.151 22.980 14.579  1.00 23.73  ? 716 HOH A O   1 
HETATM 4586 O  O   . HOH I 6 .   ? -32.606 24.176 21.308  1.00 23.73  ? 717 HOH A O   1 
HETATM 4587 O  O   . HOH I 6 .   ? -21.882 17.573 24.780  1.00 23.73  ? 718 HOH A O   1 
HETATM 4588 O  O   . HOH I 6 .   ? -23.423 17.507 31.646  1.00 23.73  ? 719 HOH A O   1 
HETATM 4589 O  O   . HOH I 6 .   ? -21.471 40.938 12.164  1.00 23.73  ? 720 HOH A O   1 
HETATM 4590 O  O   . HOH I 6 .   ? -19.739 44.789 14.376  1.00 23.73  ? 721 HOH A O   1 
HETATM 4591 O  O   . HOH I 6 .   ? -26.916 44.712 14.382  1.00 23.73  ? 722 HOH A O   1 
HETATM 4592 O  O   . HOH I 6 .   ? -24.292 30.964 29.190  1.00 23.73  ? 723 HOH A O   1 
HETATM 4593 O  O   . HOH I 6 .   ? -16.104 32.335 29.186  1.00 23.73  ? 724 HOH A O   1 
HETATM 4594 O  O   . HOH I 6 .   ? -5.433  45.273 30.074  1.00 23.73  ? 725 HOH A O   1 
HETATM 4595 O  O   . HOH I 6 .   ? -19.888 45.599 36.099  1.00 23.73  ? 726 HOH A O   1 
HETATM 4596 O  O   . HOH I 6 .   ? -19.268 43.240 37.327  1.00 23.73  ? 727 HOH A O   1 
HETATM 4597 O  O   . HOH I 6 .   ? -8.179  21.458 40.498  1.00 23.73  ? 728 HOH A O   1 
HETATM 4598 O  O   . HOH I 6 .   ? -0.096  23.140 40.443  1.00 23.73  ? 729 HOH A O   1 
HETATM 4599 O  O   . HOH I 6 .   ? -2.597  21.582 39.281  1.00 23.73  ? 730 HOH A O   1 
HETATM 4600 O  O   . HOH I 6 .   ? -28.879 79.986 -11.667 1.00 23.73  ? 731 HOH A O   1 
HETATM 4601 O  O   . HOH I 6 .   ? -17.757 46.694 13.921  1.00 23.73  ? 732 HOH A O   1 
HETATM 4602 O  O   . HOH I 6 .   ? -9.297  31.210 3.737   1.00 23.73  ? 733 HOH A O   1 
HETATM 4603 O  O   . HOH I 6 .   ? -8.745  44.808 22.103  1.00 23.73  ? 734 HOH A O   1 
HETATM 4604 O  O   . HOH J 6 .   ? -29.075 45.247 -19.819 1.00 35.09  ? 301 HOH B O   1 
HETATM 4605 O  O   . HOH J 6 .   ? -39.338 63.328 -21.870 1.00 35.09  ? 302 HOH B O   1 
HETATM 4606 O  O   . HOH J 6 .   ? -39.801 51.760 -15.174 1.00 35.09  ? 303 HOH B O   1 
HETATM 4607 O  O   . HOH J 6 .   ? -44.128 62.814 -17.241 1.00 35.09  ? 304 HOH B O   1 
HETATM 4608 O  O   . HOH J 6 .   ? -37.063 38.168 -17.574 1.00 35.09  ? 305 HOH B O   1 
HETATM 4609 O  O   . HOH J 6 .   ? -23.551 61.284 -15.989 1.00 35.61  ? 306 HOH B O   1 
HETATM 4610 O  O   . HOH J 6 .   ? -46.795 61.700 -23.919 1.00 35.61  ? 307 HOH B O   1 
HETATM 4611 O  O   . HOH J 6 .   ? -37.149 40.740 -13.989 1.00 23.73  ? 308 HOH B O   1 
HETATM 4612 O  O   . HOH J 6 .   ? -35.823 66.385 -29.948 1.00 23.73  ? 309 HOH B O   1 
HETATM 4613 O  O   . HOH J 6 .   ? -39.035 72.772 -28.671 1.00 23.73  ? 310 HOH B O   1 
HETATM 4614 O  O   . HOH J 6 .   ? -28.840 72.833 -31.374 1.00 23.73  ? 311 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 35  ? 1.6458 1.3110 1.1983 -0.2851 -0.4108 0.1670  15  PRO A N   
2    C CA  . PRO A 35  ? 1.6105 1.2943 1.1881 -0.2701 -0.4000 0.1679  15  PRO A CA  
3    C C   . PRO A 35  ? 1.6223 1.2862 1.1741 -0.2586 -0.3840 0.1532  15  PRO A C   
4    O O   . PRO A 35  ? 1.6962 1.3352 1.2191 -0.2619 -0.3809 0.1427  15  PRO A O   
5    C CB  . PRO A 35  ? 1.5483 1.2578 1.1744 -0.2679 -0.4013 0.1747  15  PRO A CB  
6    C CG  . PRO A 35  ? 1.5783 1.2889 1.2097 -0.2826 -0.4150 0.1818  15  PRO A CG  
7    C CD  . PRO A 35  ? 1.6288 1.3063 1.2107 -0.2918 -0.4179 0.1726  15  PRO A CD  
8    N N   . PRO A 36  ? 1.3387 1.0129 0.9009 -0.2454 -0.3737 0.1531  16  PRO A N   
9    C CA  . PRO A 36  ? 1.2710 0.9290 0.8137 -0.2341 -0.3579 0.1404  16  PRO A CA  
10   C C   . PRO A 36  ? 1.2241 0.8920 0.7954 -0.2278 -0.3515 0.1368  16  PRO A C   
11   O O   . PRO A 36  ? 1.2338 0.9265 0.8459 -0.2288 -0.3575 0.1455  16  PRO A O   
12   C CB  . PRO A 36  ? 1.2281 0.8954 0.7729 -0.2230 -0.3506 0.1441  16  PRO A CB  
13   C CG  . PRO A 36  ? 1.2472 0.9307 0.8047 -0.2298 -0.3629 0.1571  16  PRO A CG  
14   C CD  . PRO A 36  ? 1.2711 0.9674 0.8548 -0.2409 -0.3758 0.1642  16  PRO A CD  
15   N N   . PRO A 37  ? 1.1782 0.8273 0.7285 -0.2212 -0.3390 0.1245  17  PRO A N   
16   C CA  . PRO A 37  ? 1.1473 0.8064 0.7234 -0.2134 -0.3313 0.1206  17  PRO A CA  
17   C C   . PRO A 37  ? 1.1249 0.8062 0.7300 -0.2018 -0.3256 0.1262  17  PRO A C   
18   O O   . PRO A 37  ? 1.0950 0.7780 0.6919 -0.1986 -0.3247 0.1306  17  PRO A O   
19   C CB  . PRO A 37  ? 1.1348 0.7658 0.6742 -0.2084 -0.3180 0.1068  17  PRO A CB  
20   C CG  . PRO A 37  ? 1.1439 0.7527 0.6402 -0.2097 -0.3162 0.1042  17  PRO A CG  
21   C CD  . PRO A 37  ? 1.1712 0.7872 0.6718 -0.2223 -0.3326 0.1136  17  PRO A CD  
22   N N   . PRO A 38  ? 1.1650 0.8636 0.8045 -0.1954 -0.3218 0.1267  18  PRO A N   
23   C CA  . PRO A 38  ? 1.1104 0.8244 0.7704 -0.1834 -0.3145 0.1305  18  PRO A CA  
24   C C   . PRO A 38  ? 1.0901 0.7846 0.7174 -0.1747 -0.3007 0.1219  18  PRO A C   
25   O O   . PRO A 38  ? 1.1095 0.7807 0.7052 -0.1763 -0.2950 0.1118  18  PRO A O   
26   C CB  . PRO A 38  ? 1.0576 0.7897 0.7559 -0.1785 -0.3123 0.1306  18  PRO A CB  
27   C CG  . PRO A 38  ? 1.0462 0.7826 0.7559 -0.1893 -0.3228 0.1331  18  PRO A CG  
28   C CD  . PRO A 38  ? 1.0929 0.8014 0.7582 -0.1982 -0.3247 0.1261  18  PRO A CD  
29   N N   . PRO A 39  ? 1.0089 0.7123 0.6437 -0.1654 -0.2948 0.1267  19  PRO A N   
30   C CA  . PRO A 39  ? 0.9888 0.6764 0.5964 -0.1559 -0.2803 0.1205  19  PRO A CA  
31   C C   . PRO A 39  ? 0.9780 0.6601 0.5879 -0.1499 -0.2701 0.1119  19  PRO A C   
32   O O   . PRO A 39  ? 0.9607 0.6603 0.6052 -0.1481 -0.2723 0.1138  19  PRO A O   
33   C CB  . PRO A 39  ? 0.8894 0.5951 0.5193 -0.1471 -0.2774 0.1299  19  PRO A CB  
34   C CG  . PRO A 39  ? 0.8678 0.5994 0.5431 -0.1493 -0.2873 0.1384  19  PRO A CG  
35   C CD  . PRO A 39  ? 0.9322 0.6617 0.6046 -0.1623 -0.3000 0.1386  19  PRO A CD  
36   N N   . PRO A 40  ? 0.9528 0.6110 0.5265 -0.1468 -0.2588 0.1027  20  PRO A N   
37   C CA  . PRO A 40  ? 0.9474 0.5993 0.5201 -0.1397 -0.2467 0.0950  20  PRO A CA  
38   C C   . PRO A 40  ? 1.0055 0.6789 0.6130 -0.1299 -0.2420 0.1007  20  PRO A C   
39   O O   . PRO A 40  ? 0.9972 0.6767 0.6079 -0.1235 -0.2378 0.1070  20  PRO A O   
40   C CB  . PRO A 40  ? 0.9570 0.5842 0.4880 -0.1342 -0.2326 0.0888  20  PRO A CB  
41   C CG  . PRO A 40  ? 0.9634 0.5843 0.4732 -0.1386 -0.2383 0.0932  20  PRO A CG  
42   C CD  . PRO A 40  ? 0.9555 0.5907 0.4869 -0.1498 -0.2564 0.0991  20  PRO A CD  
43   N N   . PRO A 41  ? 1.1361 0.8203 0.7693 -0.1284 -0.2422 0.0986  21  PRO A N   
44   C CA  . PRO A 41  ? 1.0809 0.7875 0.7531 -0.1208 -0.2410 0.1048  21  PRO A CA  
45   C C   . PRO A 41  ? 1.0811 0.7873 0.7514 -0.1094 -0.2278 0.1078  21  PRO A C   
46   O O   . PRO A 41  ? 1.1385 0.8619 0.8368 -0.1050 -0.2296 0.1159  21  PRO A O   
47   C CB  . PRO A 41  ? 1.0039 0.7150 0.6930 -0.1199 -0.2373 0.0976  21  PRO A CB  
48   C CG  . PRO A 41  ? 1.0067 0.7047 0.6750 -0.1316 -0.2470 0.0927  21  PRO A CG  
49   C CD  . PRO A 41  ? 1.0790 0.7541 0.7058 -0.1336 -0.2428 0.0899  21  PRO A CD  
50   N N   . GLY A 42  ? 0.9343 0.6218 0.5741 -0.1047 -0.2143 0.1018  22  GLY A N   
51   C CA  . GLY A 42  ? 0.9550 0.6428 0.5933 -0.0943 -0.2007 0.1054  22  GLY A CA  
52   C C   . GLY A 42  ? 0.9794 0.6614 0.5967 -0.0938 -0.1994 0.1097  22  GLY A C   
53   O O   . GLY A 42  ? 0.9363 0.6105 0.5369 -0.0863 -0.1857 0.1099  22  GLY A O   
54   N N   . ALA A 43  ? 1.0788 0.7661 0.6985 -0.1015 -0.2131 0.1140  23  ALA A N   
55   C CA  . ALA A 43  ? 1.0591 0.7421 0.6597 -0.1015 -0.2131 0.1188  23  ALA A CA  
56   C C   . ALA A 43  ? 1.0434 0.7426 0.6670 -0.0928 -0.2079 0.1281  23  ALA A C   
57   O O   . ALA A 43  ? 1.1204 0.8160 0.7280 -0.0884 -0.2014 0.1320  23  ALA A O   
58   C CB  . ALA A 43  ? 1.0672 0.7531 0.6669 -0.1126 -0.2296 0.1217  23  ALA A CB  
59   N N   . ASP A 44  ? 0.9342 0.6515 0.5962 -0.0903 -0.2108 0.1319  24  ASP A N   
60   C CA  . ASP A 44  ? 0.8105 0.5433 0.4979 -0.0830 -0.2069 0.1407  24  ASP A CA  
61   C C   . ASP A 44  ? 0.7537 0.4935 0.4653 -0.0752 -0.1974 0.1394  24  ASP A C   
62   O O   . ASP A 44  ? 0.8070 0.5608 0.5463 -0.0700 -0.1955 0.1457  24  ASP A O   
63   C CB  . ASP A 44  ? 0.7373 0.4873 0.4519 -0.0874 -0.2207 0.1489  24  ASP A CB  
64   C CG  . ASP A 44  ? 0.7439 0.5057 0.4898 -0.0908 -0.2295 0.1478  24  ASP A CG  
65   O OD1 . ASP A 44  ? 0.7653 0.5206 0.5078 -0.0916 -0.2273 0.1401  24  ASP A OD1 
66   O OD2 . ASP A 44  ? 0.7214 0.4995 0.4958 -0.0922 -0.2380 0.1552  24  ASP A OD2 
67   N N   . ARG A 45  ? 0.6919 0.4213 0.3927 -0.0749 -0.1915 0.1312  25  ARG A N   
68   C CA  . ARG A 45  ? 0.6524 0.3866 0.3723 -0.0681 -0.1816 0.1293  25  ARG A CA  
69   C C   . ARG A 45  ? 0.6463 0.3821 0.3640 -0.0598 -0.1685 0.1340  25  ARG A C   
70   O O   . ARG A 45  ? 0.6933 0.4183 0.3819 -0.0582 -0.1616 0.1341  25  ARG A O   
71   C CB  . ARG A 45  ? 0.6207 0.3428 0.3238 -0.0688 -0.1742 0.1186  25  ARG A CB  
72   C CG  . ARG A 45  ? 0.5965 0.3315 0.3316 -0.0652 -0.1677 0.1125  25  ARG A CG  
73   C CD  . ARG A 45  ? 0.6101 0.3379 0.3360 -0.0690 -0.1658 0.1017  25  ARG A CD  
74   N NE  . ARG A 45  ? 0.5662 0.3005 0.3093 -0.0632 -0.1531 0.0959  25  ARG A NE  
75   C CZ  . ARG A 45  ? 0.6070 0.3324 0.3338 -0.0577 -0.1385 0.0940  25  ARG A CZ  
76   N NH1 . ARG A 45  ? 0.6534 0.3623 0.3457 -0.0566 -0.1342 0.0971  25  ARG A NH1 
77   N NH2 . ARG A 45  ? 0.5535 0.2867 0.2979 -0.0532 -0.1281 0.0897  25  ARG A NH2 
78   N N   . VAL A 46  ? 0.5913 0.3408 0.3403 -0.0546 -0.1650 0.1379  26  VAL A N   
79   C CA  . VAL A 46  ? 0.5884 0.3435 0.3417 -0.0477 -0.1550 0.1444  26  VAL A CA  
80   C C   . VAL A 46  ? 0.5858 0.3346 0.3271 -0.0416 -0.1386 0.1414  26  VAL A C   
81   O O   . VAL A 46  ? 0.6033 0.3489 0.3278 -0.0369 -0.1287 0.1451  26  VAL A O   
82   C CB  . VAL A 46  ? 0.5648 0.3372 0.3571 -0.0452 -0.1585 0.1500  26  VAL A CB  
83   C CG1 . VAL A 46  ? 0.5602 0.3382 0.3580 -0.0383 -0.1473 0.1560  26  VAL A CG1 
84   C CG2 . VAL A 46  ? 0.5698 0.3498 0.3741 -0.0500 -0.1728 0.1550  26  VAL A CG2 
85   N N   . VAL A 47  ? 0.5692 0.3174 0.3203 -0.0412 -0.1352 0.1354  27  VAL A N   
86   C CA  . VAL A 47  ? 0.5804 0.3245 0.3233 -0.0357 -0.1195 0.1329  27  VAL A CA  
87   C C   . VAL A 47  ? 0.6547 0.3820 0.3687 -0.0385 -0.1169 0.1245  27  VAL A C   
88   O O   . VAL A 47  ? 0.6157 0.3453 0.3407 -0.0408 -0.1177 0.1163  27  VAL A O   
89   C CB  . VAL A 47  ? 0.5354 0.2909 0.3095 -0.0332 -0.1161 0.1321  27  VAL A CB  
90   C CG1 . VAL A 47  ? 0.5304 0.2868 0.3005 -0.0270 -0.0995 0.1330  27  VAL A CG1 
91   C CG2 . VAL A 47  ? 0.5211 0.2912 0.3256 -0.0326 -0.1227 0.1383  27  VAL A CG2 
92   N N   . LYS A 48  ? 0.7777 0.4926 0.4597 -0.0376 -0.1115 0.1240  28  LYS A N   
93   C CA  . LYS A 48  ? 0.7614 0.4577 0.4126 -0.0415 -0.1114 0.1156  28  LYS A CA  
94   C C   . LYS A 48  ? 0.6978 0.3876 0.3430 -0.0374 -0.0971 0.1098  28  LYS A C   
95   O O   . LYS A 48  ? 0.7039 0.3839 0.3386 -0.0416 -0.0988 0.1014  28  LYS A O   
96   C CB  . LYS A 48  ? 0.7809 0.4648 0.3996 -0.0416 -0.1099 0.1164  28  LYS A CB  
97   C CG  . LYS A 48  ? 0.7890 0.4792 0.4120 -0.0466 -0.1245 0.1222  28  LYS A CG  
98   C CD  . LYS A 48  ? 0.8198 0.5007 0.4135 -0.0447 -0.1203 0.1249  28  LYS A CD  
99   C CE  . LYS A 48  ? 0.8327 0.5174 0.4260 -0.0514 -0.1362 0.1294  28  LYS A CE  
100  N NZ  . LYS A 48  ? 0.8345 0.5152 0.4290 -0.0618 -0.1515 0.1235  28  LYS A NZ  
101  N N   . ALA A 49  ? 0.6493 0.3482 0.3055 -0.0294 -0.0829 0.1141  29  ALA A N   
102  C CA  . ALA A 49  ? 0.6260 0.3225 0.2800 -0.0246 -0.0678 0.1102  29  ALA A CA  
103  C C   . ALA A 49  ? 0.6611 0.3630 0.3358 -0.0276 -0.0707 0.1046  29  ALA A C   
104  O O   . ALA A 49  ? 0.7143 0.4116 0.3834 -0.0258 -0.0607 0.0988  29  ALA A O   
105  C CB  . ALA A 49  ? 0.6090 0.3197 0.2772 -0.0159 -0.0535 0.1182  29  ALA A CB  
106  N N   . VAL A 50  ? 0.6062 0.3240 0.3119 -0.0312 -0.0823 0.1042  30  VAL A N   
107  C CA  . VAL A 50  ? 0.5710 0.3013 0.3044 -0.0330 -0.0835 0.0966  30  VAL A CA  
108  C C   . VAL A 50  ? 0.5534 0.2756 0.2762 -0.0387 -0.0888 0.0867  30  VAL A C   
109  O O   . VAL A 50  ? 0.5865 0.3044 0.3024 -0.0445 -0.1015 0.0859  30  VAL A O   
110  C CB  . VAL A 50  ? 0.5136 0.2610 0.2811 -0.0348 -0.0943 0.0988  30  VAL A CB  
111  C CG1 . VAL A 50  ? 0.4892 0.2467 0.2798 -0.0374 -0.0975 0.0899  30  VAL A CG1 
112  C CG2 . VAL A 50  ? 0.4969 0.2538 0.2807 -0.0297 -0.0886 0.1072  30  VAL A CG2 
113  N N   . PRO A 51  ? 0.5325 0.2531 0.2546 -0.0375 -0.0795 0.0799  31  PRO A N   
114  C CA  . PRO A 51  ? 0.5391 0.2523 0.2531 -0.0430 -0.0837 0.0706  31  PRO A CA  
115  C C   . PRO A 51  ? 0.5377 0.2634 0.2762 -0.0490 -0.0986 0.0676  31  PRO A C   
116  O O   . PRO A 51  ? 0.5508 0.2943 0.3210 -0.0474 -0.1006 0.0685  31  PRO A O   
117  C CB  . PRO A 51  ? 0.5242 0.2408 0.2452 -0.0391 -0.0702 0.0662  31  PRO A CB  
118  C CG  . PRO A 51  ? 0.5276 0.2417 0.2392 -0.0316 -0.0566 0.0739  31  PRO A CG  
119  C CD  . PRO A 51  ? 0.5439 0.2676 0.2690 -0.0308 -0.0636 0.0822  31  PRO A CD  
120  N N   . PHE A 52  ? 0.5969 0.3120 0.3188 -0.0560 -0.1090 0.0646  32  PHE A N   
121  C CA  . PHE A 52  ? 0.6101 0.3354 0.3514 -0.0625 -0.1241 0.0634  32  PHE A CA  
122  C C   . PHE A 52  ? 0.6253 0.3540 0.3767 -0.0651 -0.1226 0.0552  32  PHE A C   
123  O O   . PHE A 52  ? 0.7324 0.4465 0.4614 -0.0661 -0.1161 0.0501  32  PHE A O   
124  C CB  . PHE A 52  ? 0.5807 0.2924 0.2967 -0.0696 -0.1366 0.0660  32  PHE A CB  
125  C CG  . PHE A 52  ? 0.6516 0.3753 0.3882 -0.0762 -0.1535 0.0685  32  PHE A CG  
126  C CD1 . PHE A 52  ? 0.7139 0.4521 0.4736 -0.0743 -0.1600 0.0761  32  PHE A CD1 
127  C CD2 . PHE A 52  ? 0.6983 0.4183 0.4309 -0.0845 -0.1632 0.0643  32  PHE A CD2 
128  C CE1 . PHE A 52  ? 0.6543 0.4042 0.4340 -0.0797 -0.1748 0.0797  32  PHE A CE1 
129  C CE2 . PHE A 52  ? 0.7245 0.4571 0.4777 -0.0905 -0.1787 0.0684  32  PHE A CE2 
130  C CZ  . PHE A 52  ? 0.6617 0.4095 0.4386 -0.0877 -0.1841 0.0763  32  PHE A CZ  
131  N N   . PRO A 53  ? 0.5818 0.3296 0.3672 -0.0654 -0.1275 0.0542  33  PRO A N   
132  C CA  . PRO A 53  ? 0.5206 0.2748 0.3195 -0.0676 -0.1266 0.0476  33  PRO A CA  
133  C C   . PRO A 53  ? 0.5279 0.2716 0.3115 -0.0766 -0.1374 0.0450  33  PRO A C   
134  O O   . PRO A 53  ? 0.6378 0.3733 0.4063 -0.0819 -0.1482 0.0488  33  PRO A O   
135  C CB  . PRO A 53  ? 0.4624 0.2390 0.2998 -0.0655 -0.1312 0.0492  33  PRO A CB  
136  C CG  . PRO A 53  ? 0.4740 0.2548 0.3180 -0.0601 -0.1286 0.0549  33  PRO A CG  
137  C CD  . PRO A 53  ? 0.5324 0.2969 0.3462 -0.0620 -0.1312 0.0596  33  PRO A CD  
138  N N   . PRO A 54  ? 0.5053 0.2491 0.2922 -0.0790 -0.1349 0.0390  34  PRO A N   
139  C CA  . PRO A 54  ? 0.5242 0.2590 0.2995 -0.0887 -0.1464 0.0370  34  PRO A CA  
140  C C   . PRO A 54  ? 0.5171 0.2677 0.3167 -0.0938 -0.1623 0.0423  34  PRO A C   
141  O O   . PRO A 54  ? 0.5273 0.2985 0.3597 -0.0892 -0.1618 0.0446  34  PRO A O   
142  C CB  . PRO A 54  ? 0.5129 0.2502 0.2960 -0.0884 -0.1388 0.0306  34  PRO A CB  
143  C CG  . PRO A 54  ? 0.5172 0.2546 0.2988 -0.0791 -0.1212 0.0286  34  PRO A CG  
144  C CD  . PRO A 54  ? 0.5035 0.2532 0.3006 -0.0734 -0.1208 0.0342  34  PRO A CD  
145  N N   . THR A 55  ? 0.6677 0.4083 0.4513 -0.1034 -0.1762 0.0444  35  THR A N   
146  C CA  . THR A 55  ? 0.6714 0.4275 0.4781 -0.1087 -0.1918 0.0512  35  THR A CA  
147  C C   . THR A 55  ? 0.6431 0.4079 0.4668 -0.1147 -0.1982 0.0498  35  THR A C   
148  O O   . THR A 55  ? 0.6764 0.4579 0.5256 -0.1181 -0.2095 0.0560  35  THR A O   
149  C CB  . THR A 55  ? 0.7355 0.4790 0.5180 -0.1164 -0.2053 0.0567  35  THR A CB  
150  O OG1 . THR A 55  ? 0.7891 0.5123 0.5415 -0.1262 -0.2117 0.0528  35  THR A OG1 
151  C CG2 . THR A 55  ? 0.7216 0.4541 0.4828 -0.1103 -0.1976 0.0581  35  THR A CG2 
152  N N   . HIS A 56  ? 0.6205 0.3745 0.4313 -0.1159 -0.1907 0.0424  36  HIS A N   
153  C CA  . HIS A 56  ? 0.5506 0.3127 0.3775 -0.1216 -0.1962 0.0414  36  HIS A CA  
154  C C   . HIS A 56  ? 0.5006 0.2753 0.3490 -0.1139 -0.1821 0.0365  36  HIS A C   
155  O O   . HIS A 56  ? 0.5569 0.3243 0.3941 -0.1070 -0.1675 0.0313  36  HIS A O   
156  C CB  . HIS A 56  ? 0.5708 0.3089 0.3649 -0.1324 -0.2029 0.0377  36  HIS A CB  
157  C CG  . HIS A 56  ? 0.7050 0.4346 0.4834 -0.1433 -0.2211 0.0434  36  HIS A CG  
158  N ND1 . HIS A 56  ? 0.7322 0.4392 0.4732 -0.1457 -0.2230 0.0427  36  HIS A ND1 
159  C CD2 . HIS A 56  ? 0.7508 0.4922 0.5461 -0.1524 -0.2383 0.0509  36  HIS A CD2 
160  C CE1 . HIS A 56  ? 0.7940 0.4993 0.5291 -0.1559 -0.2401 0.0491  36  HIS A CE1 
161  N NE2 . HIS A 56  ? 0.8188 0.5464 0.5890 -0.1586 -0.2472 0.0549  36  HIS A NE2 
162  N N   . ARG A 57  ? 0.4825 0.2770 0.3621 -0.1150 -0.1866 0.0390  37  ARG A N   
163  C CA  . ARG A 57  ? 0.4585 0.2653 0.3578 -0.1089 -0.1746 0.0347  37  ARG A CA  
164  C C   . ARG A 57  ? 0.4731 0.2645 0.3533 -0.1147 -0.1724 0.0292  37  ARG A C   
165  O O   . ARG A 57  ? 0.5307 0.3098 0.3957 -0.1253 -0.1846 0.0306  37  ARG A O   
166  C CB  . ARG A 57  ? 0.4361 0.2694 0.3748 -0.1075 -0.1800 0.0401  37  ARG A CB  
167  C CG  . ARG A 57  ? 0.4211 0.2693 0.3806 -0.1004 -0.1803 0.0450  37  ARG A CG  
168  C CD  . ARG A 57  ? 0.4605 0.3340 0.4586 -0.0972 -0.1823 0.0496  37  ARG A CD  
169  N NE  . ARG A 57  ? 0.5005 0.3878 0.5203 -0.0891 -0.1807 0.0535  37  ARG A NE  
170  C CZ  . ARG A 57  ? 0.4727 0.3741 0.5145 -0.0795 -0.1700 0.0510  37  ARG A CZ  
171  N NH1 . ARG A 57  ? 0.4752 0.3803 0.5204 -0.0769 -0.1601 0.0451  37  ARG A NH1 
172  N NH2 . ARG A 57  ? 0.4836 0.3943 0.5427 -0.0726 -0.1692 0.0543  37  ARG A NH2 
173  N N   . LEU A 58  ? 0.4605 0.2516 0.3408 -0.1082 -0.1571 0.0234  38  LEU A N   
174  C CA  . LEU A 58  ? 0.4714 0.2495 0.3375 -0.1125 -0.1531 0.0185  38  LEU A CA  
175  C C   . LEU A 58  ? 0.4779 0.2703 0.3679 -0.1188 -0.1627 0.0217  38  LEU A C   
176  O O   . LEU A 58  ? 0.5318 0.3493 0.4555 -0.1141 -0.1619 0.0251  38  LEU A O   
177  C CB  . LEU A 58  ? 0.4544 0.2352 0.3232 -0.1033 -0.1346 0.0135  38  LEU A CB  
178  C CG  . LEU A 58  ? 0.5101 0.2712 0.3492 -0.0984 -0.1228 0.0100  38  LEU A CG  
179  C CD1 . LEU A 58  ? 0.5023 0.2675 0.3466 -0.0914 -0.1062 0.0064  38  LEU A CD1 
180  C CD2 . LEU A 58  ? 0.5665 0.2979 0.3676 -0.1061 -0.1282 0.0078  38  LEU A CD2 
181  N N   . THR A 59  ? 0.4890 0.2650 0.3612 -0.1295 -0.1718 0.0210  39  THR A N   
182  C CA  . THR A 59  ? 0.4840 0.2730 0.3785 -0.1365 -0.1815 0.0250  39  THR A CA  
183  C C   . THR A 59  ? 0.4939 0.2866 0.3971 -0.1333 -0.1694 0.0206  39  THR A C   
184  O O   . THR A 59  ? 0.4837 0.2667 0.3730 -0.1266 -0.1544 0.0145  39  THR A O   
185  C CB  . THR A 59  ? 0.5443 0.3167 0.4179 -0.1488 -0.1962 0.0275  39  THR A CB  
186  O OG1 . THR A 59  ? 0.6524 0.3984 0.4934 -0.1509 -0.1892 0.0203  39  THR A OG1 
187  C CG2 . THR A 59  ? 0.5824 0.3477 0.4408 -0.1512 -0.2058 0.0313  39  THR A CG2 
188  N N   . SER A 60  ? 0.5183 0.3263 0.4459 -0.1381 -0.1761 0.0249  40  SER A N   
189  C CA  . SER A 60  ? 0.4489 0.2633 0.3884 -0.1356 -0.1661 0.0223  40  SER A CA  
190  C C   . SER A 60  ? 0.4758 0.2603 0.3821 -0.1414 -0.1628 0.0158  40  SER A C   
191  O O   . SER A 60  ? 0.4683 0.2495 0.3712 -0.1354 -0.1480 0.0109  40  SER A O   
192  C CB  . SER A 60  ? 0.4359 0.2736 0.4092 -0.1401 -0.1756 0.0299  40  SER A CB  
193  O OG  . SER A 60  ? 0.6185 0.4619 0.6026 -0.1387 -0.1670 0.0281  40  SER A OG  
194  N N   . GLU A 61  ? 0.5261 0.2929 0.4087 -0.1494 -0.1731 0.0167  41  GLU A N   
195  C CA  . GLU A 61  ? 0.6149 0.3530 0.4635 -0.1526 -0.1684 0.0107  41  GLU A CA  
196  C C   . GLU A 61  ? 0.6050 0.3215 0.4252 -0.1461 -0.1544 0.0031  41  GLU A C   
197  O O   . GLU A 61  ? 0.5893 0.2881 0.3914 -0.1447 -0.1438 -0.0023 41  GLU A O   
198  C CB  . GLU A 61  ? 0.6272 0.3497 0.4531 -0.1615 -0.1821 0.0133  41  GLU A CB  
199  C CG  . GLU A 61  ? 0.6226 0.3611 0.4711 -0.1690 -0.1952 0.0212  41  GLU A CG  
200  C CD  . GLU A 61  ? 0.6568 0.4243 0.5388 -0.1684 -0.2047 0.0306  41  GLU A CD  
201  O OE1 . GLU A 61  ? 0.5892 0.3629 0.4751 -0.1628 -0.2025 0.0305  41  GLU A OE1 
202  O OE2 . GLU A 61  ? 0.6803 0.4640 0.5849 -0.1731 -0.2141 0.0386  41  GLU A OE2 
203  N N   . GLU A 62  ? 0.5629 0.2807 0.3798 -0.1420 -0.1540 0.0034  42  GLU A N   
204  C CA  . GLU A 62  ? 0.5817 0.2832 0.3739 -0.1336 -0.1391 -0.0016 42  GLU A CA  
205  C C   . GLU A 62  ? 0.5770 0.2959 0.3895 -0.1217 -0.1207 -0.0028 42  GLU A C   
206  O O   . GLU A 62  ? 0.6483 0.3530 0.4415 -0.1153 -0.1062 -0.0066 42  GLU A O   
207  C CB  . GLU A 62  ? 0.5483 0.2488 0.3307 -0.1311 -0.1433 0.0007  42  GLU A CB  
208  C CG  . GLU A 62  ? 0.6985 0.3850 0.4621 -0.1423 -0.1617 0.0031  42  GLU A CG  
209  C CD  . GLU A 62  ? 0.7767 0.4582 0.5256 -0.1399 -0.1646 0.0051  42  GLU A CD  
210  O OE1 . GLU A 62  ? 0.8318 0.4856 0.5422 -0.1402 -0.1609 0.0012  42  GLU A OE1 
211  O OE2 . GLU A 62  ? 0.7039 0.4094 0.4798 -0.1369 -0.1697 0.0110  42  GLU A OE2 
212  N N   . VAL A 63  ? 0.4805 0.2298 0.3312 -0.1188 -0.1212 0.0009  43  VAL A N   
213  C CA  . VAL A 63  ? 0.4502 0.2185 0.3214 -0.1080 -0.1053 0.0003  43  VAL A CA  
214  C C   . VAL A 63  ? 0.4561 0.2298 0.3395 -0.1084 -0.0984 -0.0008 43  VAL A C   
215  O O   . VAL A 63  ? 0.4290 0.2061 0.3144 -0.1008 -0.0829 -0.0027 43  VAL A O   
216  C CB  . VAL A 63  ? 0.4202 0.2187 0.3248 -0.1026 -0.1078 0.0046  43  VAL A CB  
217  C CG1 . VAL A 63  ? 0.3917 0.2085 0.3152 -0.0925 -0.0924 0.0035  43  VAL A CG1 
218  C CG2 . VAL A 63  ? 0.4265 0.2210 0.3216 -0.1012 -0.1131 0.0061  43  VAL A CG2 
219  N N   . PHE A 64  ? 0.4650 0.2408 0.3580 -0.1174 -0.1101 0.0013  44  PHE A N   
220  C CA  . PHE A 64  ? 0.4380 0.2219 0.3468 -0.1183 -0.1052 0.0016  44  PHE A CA  
221  C C   . PHE A 64  ? 0.4761 0.2311 0.3588 -0.1271 -0.1080 -0.0016 44  PHE A C   
222  O O   . PHE A 64  ? 0.5101 0.2495 0.3783 -0.1378 -0.1231 -0.0010 44  PHE A O   
223  C CB  . PHE A 64  ? 0.4171 0.2297 0.3628 -0.1208 -0.1147 0.0079  44  PHE A CB  
224  C CG  . PHE A 64  ? 0.4369 0.2790 0.4112 -0.1104 -0.1074 0.0101  44  PHE A CG  
225  C CD1 . PHE A 64  ? 0.4690 0.3253 0.4574 -0.1023 -0.0925 0.0088  44  PHE A CD1 
226  C CD2 . PHE A 64  ? 0.3959 0.2504 0.3819 -0.1087 -0.1153 0.0134  44  PHE A CD2 
227  C CE1 . PHE A 64  ? 0.4208 0.3020 0.4326 -0.0931 -0.0859 0.0101  44  PHE A CE1 
228  C CE2 . PHE A 64  ? 0.3482 0.2266 0.3579 -0.0991 -0.1082 0.0146  44  PHE A CE2 
229  C CZ  . PHE A 64  ? 0.3693 0.2606 0.3912 -0.0915 -0.0937 0.0126  44  PHE A CZ  
230  N N   . ASP A 65  ? 0.4696 0.2169 0.3461 -0.1230 -0.0937 -0.0047 45  ASP A N   
231  C CA  . ASP A 65  ? 0.5010 0.2189 0.3525 -0.1306 -0.0949 -0.0081 45  ASP A CA  
232  C C   . ASP A 65  ? 0.4991 0.2258 0.3711 -0.1394 -0.1045 -0.0046 45  ASP A C   
233  O O   . ASP A 65  ? 0.4726 0.2298 0.3794 -0.1391 -0.1099 0.0011  45  ASP A O   
234  C CB  . ASP A 65  ? 0.5074 0.2088 0.3400 -0.1227 -0.0755 -0.0123 45  ASP A CB  
235  C CG  . ASP A 65  ? 0.4967 0.2216 0.3577 -0.1156 -0.0623 -0.0098 45  ASP A CG  
236  O OD1 . ASP A 65  ? 0.4622 0.2115 0.3545 -0.1182 -0.0681 -0.0057 45  ASP A OD1 
237  O OD2 . ASP A 65  ? 0.6398 0.3589 0.4915 -0.1072 -0.0455 -0.0114 45  ASP A OD2 
238  N N   . LEU A 66  ? 0.5449 0.2503 0.3972 -0.1436 -0.1038 -0.0074 46  LEU A N   
239  C CA  . LEU A 66  ? 0.5290 0.2415 0.3969 -0.1506 -0.1118 -0.0040 46  LEU A CA  
240  C C   . LEU A 66  ? 0.5592 0.3015 0.4676 -0.1490 -0.1086 0.0015  46  LEU A C   
241  O O   . LEU A 66  ? 0.5894 0.3502 0.5218 -0.1544 -0.1193 0.0075  46  LEU A O   
242  C CB  . LEU A 66  ? 0.5591 0.2427 0.3997 -0.1521 -0.1048 -0.0091 46  LEU A CB  
243  C CG  . LEU A 66  ? 0.5789 0.2591 0.4210 -0.1619 -0.1181 -0.0066 46  LEU A CG  
244  C CD1 . LEU A 66  ? 0.6022 0.2848 0.4388 -0.1682 -0.1354 -0.0036 46  LEU A CD1 
245  C CD2 . LEU A 66  ? 0.6393 0.2873 0.4500 -0.1631 -0.1115 -0.0126 46  LEU A CD2 
246  N N   . ASP A 67  ? 0.4950 0.2460 0.4116 -0.1395 -0.0924 0.0003  47  ASP A N   
247  C CA  . ASP A 67  ? 0.4373 0.2215 0.3914 -0.1337 -0.0849 0.0054  47  ASP A CA  
248  C C   . ASP A 67  ? 0.4045 0.2231 0.3879 -0.1270 -0.0862 0.0095  47  ASP A C   
249  O O   . ASP A 67  ? 0.3929 0.2395 0.4052 -0.1202 -0.0780 0.0130  47  ASP A O   
250  C CB  . ASP A 67  ? 0.4504 0.2319 0.3996 -0.1241 -0.0645 0.0027  47  ASP A CB  
251  C CG  . ASP A 67  ? 0.5625 0.3111 0.4857 -0.1289 -0.0603 -0.0009 47  ASP A CG  
252  O OD1 . ASP A 67  ? 0.6287 0.3688 0.5538 -0.1394 -0.0714 0.0006  47  ASP A OD1 
253  O OD2 . ASP A 67  ? 0.5913 0.3228 0.4929 -0.1220 -0.0457 -0.0048 47  ASP A OD2 
254  N N   . GLY A 68  ? 0.4106 0.2263 0.3855 -0.1282 -0.0956 0.0091  48  GLY A N   
255  C CA  . GLY A 68  ? 0.3833 0.2270 0.3817 -0.1210 -0.0957 0.0122  48  GLY A CA  
256  C C   . GLY A 68  ? 0.3849 0.2357 0.3816 -0.1087 -0.0791 0.0088  48  GLY A C   
257  O O   . GLY A 68  ? 0.3982 0.2738 0.4169 -0.1015 -0.0760 0.0108  48  GLY A O   
258  N N   . ILE A 69  ? 0.3949 0.2227 0.3647 -0.1066 -0.0686 0.0040  49  ILE A N   
259  C CA  . ILE A 69  ? 0.3675 0.1982 0.3317 -0.0961 -0.0531 0.0017  49  ILE A CA  
260  C C   . ILE A 69  ? 0.3904 0.2068 0.3323 -0.0945 -0.0557 -0.0008 49  ILE A C   
261  O O   . ILE A 69  ? 0.4091 0.1994 0.3243 -0.1008 -0.0631 -0.0031 49  ILE A O   
262  C CB  . ILE A 69  ? 0.3785 0.1919 0.3259 -0.0940 -0.0393 -0.0006 49  ILE A CB  
263  C CG1 . ILE A 69  ? 0.3682 0.1943 0.3370 -0.0962 -0.0371 0.0024  49  ILE A CG1 
264  C CG2 . ILE A 69  ? 0.3660 0.1836 0.3090 -0.0836 -0.0234 -0.0012 49  ILE A CG2 
265  C CD1 . ILE A 69  ? 0.3325 0.1947 0.3358 -0.0895 -0.0317 0.0063  49  ILE A CD1 
266  N N   . PRO A 70  ? 0.3906 0.2238 0.3434 -0.0863 -0.0499 -0.0001 50  PRO A N   
267  C CA  . PRO A 70  ? 0.3686 0.1909 0.3035 -0.0845 -0.0524 -0.0014 50  PRO A CA  
268  C C   . PRO A 70  ? 0.3884 0.1854 0.2917 -0.0817 -0.0418 -0.0041 50  PRO A C   
269  O O   . PRO A 70  ? 0.3845 0.1800 0.2856 -0.0771 -0.0280 -0.0043 50  PRO A O   
270  C CB  . PRO A 70  ? 0.3392 0.1876 0.2972 -0.0763 -0.0474 0.0003  50  PRO A CB  
271  C CG  . PRO A 70  ? 0.3174 0.1907 0.3060 -0.0757 -0.0476 0.0025  50  PRO A CG  
272  C CD  . PRO A 70  ? 0.3747 0.2389 0.3582 -0.0794 -0.0432 0.0022  50  PRO A CD  
273  N N   . ARG A 71  ? 0.4104 0.1880 0.2896 -0.0843 -0.0483 -0.0054 51  ARG A N   
274  C CA  . ARG A 71  ? 0.4316 0.1847 0.2792 -0.0809 -0.0387 -0.0073 51  ARG A CA  
275  C C   . ARG A 71  ? 0.4263 0.1910 0.2786 -0.0730 -0.0327 -0.0051 51  ARG A C   
276  O O   . ARG A 71  ? 0.4420 0.2073 0.2921 -0.0742 -0.0420 -0.0042 51  ARG A O   
277  C CB  . ARG A 71  ? 0.4677 0.1918 0.2841 -0.0888 -0.0497 -0.0098 51  ARG A CB  
278  C CG  . ARG A 71  ? 0.4869 0.1973 0.2971 -0.0985 -0.0582 -0.0119 51  ARG A CG  
279  C CD  . ARG A 71  ? 0.5282 0.2038 0.2990 -0.1050 -0.0650 -0.0153 51  ARG A CD  
280  N NE  . ARG A 71  ? 0.6107 0.2675 0.3698 -0.1152 -0.0731 -0.0179 51  ARG A NE  
281  C CZ  . ARG A 71  ? 0.6785 0.3389 0.4461 -0.1261 -0.0915 -0.0164 51  ARG A CZ  
282  N NH1 . ARG A 71  ? 0.6603 0.3433 0.4495 -0.1271 -0.1025 -0.0120 51  ARG A NH1 
283  N NH2 . ARG A 71  ? 0.7078 0.3568 0.4671 -0.1330 -0.0970 -0.0175 51  ARG A NH2 
284  N N   . VAL A 72  ? 0.4134 0.2227 0.2908 -0.0711 -0.0704 -0.0297 52  VAL A N   
285  C CA  . VAL A 72  ? 0.4005 0.2206 0.2799 -0.0642 -0.0664 -0.0154 52  VAL A CA  
286  C C   . VAL A 72  ? 0.4466 0.2723 0.3079 -0.0547 -0.0641 -0.0138 52  VAL A C   
287  O O   . VAL A 72  ? 0.4605 0.2980 0.3196 -0.0518 -0.0651 -0.0038 52  VAL A O   
288  C CB  . VAL A 72  ? 0.3712 0.1829 0.2622 -0.0632 -0.0583 -0.0057 52  VAL A CB  
289  C CG1 . VAL A 72  ? 0.3874 0.1842 0.2700 -0.0558 -0.0510 -0.0090 52  VAL A CG1 
290  C CG2 . VAL A 72  ? 0.3500 0.1745 0.2462 -0.0596 -0.0564 0.0078  52  VAL A CG2 
291  N N   . ASP A 73  ? 0.5061 0.3229 0.3534 -0.0502 -0.0610 -0.0238 53  ASP A N   
292  C CA  . ASP A 73  ? 0.4899 0.3150 0.3189 -0.0414 -0.0572 -0.0223 53  ASP A CA  
293  C C   . ASP A 73  ? 0.4779 0.3150 0.2924 -0.0419 -0.0658 -0.0258 53  ASP A C   
294  O O   . ASP A 73  ? 0.4591 0.3072 0.2604 -0.0368 -0.0642 -0.0181 53  ASP A O   
295  C CB  . ASP A 73  ? 0.5146 0.3286 0.3329 -0.0339 -0.0500 -0.0324 53  ASP A CB  
296  C CG  . ASP A 73  ? 0.6608 0.4697 0.4900 -0.0286 -0.0403 -0.0243 53  ASP A CG  
297  O OD1 . ASP A 73  ? 0.6279 0.4468 0.4682 -0.0300 -0.0379 -0.0097 53  ASP A OD1 
298  O OD2 . ASP A 73  ? 0.7807 0.5751 0.6073 -0.0226 -0.0357 -0.0331 53  ASP A OD2 
299  N N   . VAL A 74  ? 0.4416 0.2778 0.2587 -0.0485 -0.0753 -0.0367 54  VAL A N   
300  C CA  . VAL A 74  ? 0.4498 0.3002 0.2560 -0.0488 -0.0856 -0.0397 54  VAL A CA  
301  C C   . VAL A 74  ? 0.4294 0.2913 0.2442 -0.0483 -0.0893 -0.0247 54  VAL A C   
302  O O   . VAL A 74  ? 0.5171 0.3880 0.3178 -0.0431 -0.0928 -0.0177 54  VAL A O   
303  C CB  . VAL A 74  ? 0.4600 0.3101 0.2712 -0.0573 -0.0953 -0.0551 54  VAL A CB  
304  C CG1 . VAL A 74  ? 0.4610 0.3307 0.2685 -0.0575 -0.1076 -0.0552 54  VAL A CG1 
305  C CG2 . VAL A 74  ? 0.4888 0.3263 0.2847 -0.0566 -0.0940 -0.0718 54  VAL A CG2 
306  N N   . LEU A 75  ? 0.4232 0.2829 0.2596 -0.0531 -0.0883 -0.0195 55  LEU A N   
307  C CA  . LEU A 75  ? 0.4017 0.2698 0.2475 -0.0519 -0.0917 -0.0072 55  LEU A CA  
308  C C   . LEU A 75  ? 0.3916 0.2578 0.2284 -0.0461 -0.0856 0.0073  55  LEU A C   
309  O O   . LEU A 75  ? 0.4533 0.3245 0.2837 -0.0426 -0.0908 0.0160  55  LEU A O   
310  C CB  . LEU A 75  ? 0.3700 0.2366 0.2392 -0.0580 -0.0899 -0.0054 55  LEU A CB  
311  C CG  . LEU A 75  ? 0.3695 0.2448 0.2479 -0.0555 -0.0941 0.0048  55  LEU A CG  
312  C CD1 . LEU A 75  ? 0.3605 0.2503 0.2370 -0.0531 -0.1064 0.0004  55  LEU A CD1 
313  C CD2 . LEU A 75  ? 0.3901 0.2651 0.2891 -0.0605 -0.0903 0.0074  55  LEU A CD2 
314  N N   . LYS A 76  ? 0.3898 0.2487 0.2266 -0.0451 -0.0748 0.0100  56  LYS A N   
315  C CA  . LYS A 76  ? 0.3900 0.2503 0.2204 -0.0418 -0.0682 0.0235  56  LYS A CA  
316  C C   . LYS A 76  ? 0.4323 0.2987 0.2388 -0.0376 -0.0695 0.0262  56  LYS A C   
317  O O   . LYS A 76  ? 0.4305 0.2989 0.2305 -0.0370 -0.0715 0.0389  56  LYS A O   
318  C CB  . LYS A 76  ? 0.3927 0.2489 0.2288 -0.0406 -0.0566 0.0244  56  LYS A CB  
319  C CG  . LYS A 76  ? 0.4481 0.3106 0.2784 -0.0386 -0.0492 0.0372  56  LYS A CG  
320  C CD  . LYS A 76  ? 0.4646 0.3279 0.2997 -0.0352 -0.0382 0.0358  56  LYS A CD  
321  C CE  . LYS A 76  ? 0.4769 0.3529 0.3024 -0.0332 -0.0302 0.0456  56  LYS A CE  
322  N NZ  . LYS A 76  ? 0.5643 0.4454 0.3883 -0.0260 -0.0201 0.0388  56  LYS A NZ  
323  N N   . ASN A 77  ? 0.4243 0.2922 0.2162 -0.0349 -0.0688 0.0144  57  ASN A N   
324  C CA  . ASN A 77  ? 0.4521 0.3280 0.2185 -0.0306 -0.0691 0.0166  57  ASN A CA  
325  C C   . ASN A 77  ? 0.4605 0.3406 0.2180 -0.0301 -0.0813 0.0224  57  ASN A C   
326  O O   . ASN A 77  ? 0.5430 0.4270 0.2826 -0.0277 -0.0816 0.0336  57  ASN A O   
327  C CB  . ASN A 77  ? 0.4691 0.3461 0.2202 -0.0272 -0.0675 -0.0001 57  ASN A CB  
328  C CG  . ASN A 77  ? 0.4771 0.3480 0.2348 -0.0246 -0.0557 -0.0064 57  ASN A CG  
329  O OD1 . ASN A 77  ? 0.4848 0.3564 0.2538 -0.0243 -0.0471 0.0041  57  ASN A OD1 
330  N ND2 . ASN A 77  ? 0.4859 0.3504 0.2367 -0.0223 -0.0561 -0.0244 57  ASN A ND2 
331  N N   . HIS A 78  ? 0.4452 0.3252 0.2157 -0.0322 -0.0914 0.0153  58  HIS A N   
332  C CA  . HIS A 78  ? 0.4510 0.3366 0.2165 -0.0295 -0.1041 0.0197  58  HIS A CA  
333  C C   . HIS A 78  ? 0.4598 0.3393 0.2320 -0.0287 -0.1044 0.0367  58  HIS A C   
334  O O   . HIS A 78  ? 0.4834 0.3621 0.2405 -0.0246 -0.1104 0.0474  58  HIS A O   
335  C CB  . HIS A 78  ? 0.4431 0.3349 0.2248 -0.0323 -0.1138 0.0065  58  HIS A CB  
336  C CG  . HIS A 78  ? 0.4722 0.3750 0.2470 -0.0275 -0.1282 0.0066  58  HIS A CG  
337  N ND1 . HIS A 78  ? 0.4832 0.3939 0.2344 -0.0234 -0.1350 0.0023  58  HIS A ND1 
338  C CD2 . HIS A 78  ? 0.4715 0.3800 0.2593 -0.0246 -0.1377 0.0101  58  HIS A CD2 
339  C CE1 . HIS A 78  ? 0.5008 0.4217 0.2514 -0.0182 -0.1486 0.0039  58  HIS A CE1 
340  N NE2 . HIS A 78  ? 0.4648 0.3846 0.2380 -0.0183 -0.1504 0.0083  58  HIS A NE2 
341  N N   . LEU A 79  ? 0.4179 0.2916 0.2114 -0.0326 -0.0986 0.0392  59  LEU A N   
342  C CA  . LEU A 79  ? 0.4094 0.2758 0.2100 -0.0323 -0.0998 0.0530  59  LEU A CA  
343  C C   . LEU A 79  ? 0.4216 0.2821 0.2068 -0.0333 -0.0929 0.0682  59  LEU A C   
344  O O   . LEU A 79  ? 0.4315 0.2841 0.2095 -0.0319 -0.0980 0.0806  59  LEU A O   
345  C CB  . LEU A 79  ? 0.3839 0.2475 0.2097 -0.0365 -0.0956 0.0510  59  LEU A CB  
346  C CG  . LEU A 79  ? 0.3715 0.2423 0.2148 -0.0375 -0.1017 0.0389  59  LEU A CG  
347  C CD1 . LEU A 79  ? 0.3497 0.2179 0.2138 -0.0421 -0.0953 0.0390  59  LEU A CD1 
348  C CD2 . LEU A 79  ? 0.3765 0.2525 0.2201 -0.0318 -0.1144 0.0397  59  LEU A CD2 
349  N N   . VAL A 80  ? 0.4236 0.2880 0.2038 -0.0356 -0.0814 0.0671  60  VAL A N   
350  C CA  . VAL A 80  ? 0.4444 0.3092 0.2104 -0.0378 -0.0735 0.0809  60  VAL A CA  
351  C C   . VAL A 80  ? 0.5070 0.3716 0.2466 -0.0350 -0.0799 0.0894  60  VAL A C   
352  O O   . VAL A 80  ? 0.5156 0.3748 0.2445 -0.0383 -0.0780 0.1056  60  VAL A O   
353  C CB  . VAL A 80  ? 0.4444 0.3193 0.2075 -0.0381 -0.0604 0.0757  60  VAL A CB  
354  C CG1 . VAL A 80  ? 0.4542 0.3355 0.2017 -0.0410 -0.0520 0.0901  60  VAL A CG1 
355  C CG2 . VAL A 80  ? 0.4138 0.2876 0.2012 -0.0401 -0.0538 0.0705  60  VAL A CG2 
356  N N   . LYS A 81  ? 0.5175 0.3876 0.2461 -0.0296 -0.0883 0.0789  61  LYS A N   
357  C CA  . LYS A 81  ? 0.5238 0.3950 0.2253 -0.0254 -0.0960 0.0865  61  LYS A CA  
358  C C   . LYS A 81  ? 0.6043 0.4657 0.3091 -0.0213 -0.1094 0.0940  61  LYS A C   
359  O O   . LYS A 81  ? 0.6985 0.5641 0.3911 -0.0152 -0.1147 0.0982  61  LYS A O   
360  C CB  . LYS A 81  ? 0.5199 0.4040 0.2068 -0.0209 -0.0996 0.0710  61  LYS A CB  
361  C CG  . LYS A 81  ? 0.5236 0.4167 0.2038 -0.0223 -0.0859 0.0631  61  LYS A CG  
362  C CD  . LYS A 81  ? 0.5500 0.4536 0.2118 -0.0177 -0.0897 0.0468  61  LYS A CD  
363  C CE  . LYS A 81  ? 0.6280 0.5313 0.3053 -0.0174 -0.1003 0.0290  61  LYS A CE  
364  N NZ  . LYS A 81  ? 0.6889 0.5962 0.3623 -0.0170 -0.0968 0.0082  61  LYS A NZ  
365  N N   . GLU A 82  ? 0.5157 0.3689 0.2444 -0.0227 -0.1112 0.0933  62  GLU A N   
366  C CA  . GLU A 82  ? 0.4842 0.3330 0.2269 -0.0164 -0.1206 0.0942  62  GLU A CA  
367  C C   . GLU A 82  ? 0.4850 0.3439 0.2280 -0.0097 -0.1345 0.0815  62  GLU A C   
368  O O   . GLU A 82  ? 0.4905 0.3509 0.2396 -0.0015 -0.1434 0.0820  62  GLU A O   
369  C CB  . GLU A 82  ? 0.5056 0.3483 0.2413 -0.0124 -0.1197 0.1073  62  GLU A CB  
370  C CG  . GLU A 82  ? 0.6010 0.4356 0.3423 -0.0200 -0.1073 0.1182  62  GLU A CG  
371  C CD  . GLU A 82  ? 0.6282 0.4531 0.3632 -0.0174 -0.1077 0.1308  62  GLU A CD  
372  O OE1 . GLU A 82  ? 0.5809 0.4099 0.2967 -0.0183 -0.1033 0.1400  62  GLU A OE1 
373  O OE2 . GLU A 82  ? 0.6748 0.4877 0.4226 -0.0144 -0.1126 0.1313  62  GLU A OE2 
374  N N   . GLY A 83  ? 0.4774 0.3483 0.2220 -0.0129 -0.1329 0.0671  63  GLY A N   
375  C CA  . GLY A 83  ? 0.4748 0.3606 0.2276 -0.0093 -0.1437 0.0520  63  GLY A CA  
376  C C   . GLY A 83  ? 0.4522 0.3411 0.2328 -0.0087 -0.1481 0.0466  63  GLY A C   
377  O O   . GLY A 83  ? 0.4578 0.3369 0.2531 -0.0120 -0.1413 0.0517  63  GLY A O   
378  N N   . ARG A 84  ? 0.4524 0.3581 0.2411 -0.0049 -0.1593 0.0354  64  ARG A N   
379  C CA  . ARG A 84  ? 0.4335 0.3479 0.2482 -0.0033 -0.1639 0.0297  64  ARG A CA  
380  C C   . ARG A 84  ? 0.4533 0.3882 0.2831 -0.0104 -0.1652 0.0118  64  ARG A C   
381  O O   . ARG A 84  ? 0.4805 0.4214 0.2971 -0.0132 -0.1670 0.0043  64  ARG A O   
382  C CB  . ARG A 84  ? 0.4606 0.3786 0.2696 0.0101  -0.1785 0.0351  64  ARG A CB  
383  C CG  . ARG A 84  ? 0.5031 0.4298 0.3359 0.0156  -0.1830 0.0312  64  ARG A CG  
384  C CD  . ARG A 84  ? 0.6584 0.5815 0.4867 0.0299  -0.1880 0.0395  64  ARG A CD  
385  N NE  . ARG A 84  ? 0.7402 0.6356 0.5528 0.0300  -0.1808 0.0552  64  ARG A NE  
386  C CZ  . ARG A 84  ? 0.7897 0.6749 0.5952 0.0401  -0.1837 0.0645  64  ARG A CZ  
387  N NH1 . ARG A 84  ? 0.7406 0.6410 0.5522 0.0525  -0.1942 0.0598  64  ARG A NH1 
388  N NH2 . ARG A 84  ? 0.8468 0.7081 0.6402 0.0372  -0.1761 0.0780  64  ARG A NH2 
389  N N   . VAL A 85  ? 0.4029 0.3484 0.2588 -0.0144 -0.1643 0.0047  65  VAL A N   
390  C CA  . VAL A 85  ? 0.4083 0.3732 0.2787 -0.0236 -0.1660 -0.0113 65  VAL A CA  
391  C C   . VAL A 85  ? 0.4065 0.3997 0.2940 -0.0189 -0.1784 -0.0191 65  VAL A C   
392  O O   . VAL A 85  ? 0.4075 0.4037 0.3007 -0.0078 -0.1836 -0.0128 65  VAL A O   
393  C CB  . VAL A 85  ? 0.4037 0.3623 0.2914 -0.0362 -0.1535 -0.0151 65  VAL A CB  
394  C CG1 . VAL A 85  ? 0.3776 0.3116 0.2528 -0.0384 -0.1412 -0.0067 65  VAL A CG1 
395  C CG2 . VAL A 85  ? 0.4473 0.4148 0.3583 -0.0353 -0.1524 -0.0132 65  VAL A CG2 
396  N N   . ASP A 86  ? 0.4257 0.4398 0.3218 -0.0272 -0.1832 -0.0333 66  ASP A N   
397  C CA  . ASP A 86  ? 0.4901 0.5371 0.4073 -0.0252 -0.1934 -0.0421 66  ASP A CA  
398  C C   . ASP A 86  ? 0.4949 0.5465 0.4355 -0.0255 -0.1869 -0.0391 66  ASP A C   
399  O O   . ASP A 86  ? 0.4931 0.5332 0.4423 -0.0372 -0.1747 -0.0386 66  ASP A O   
400  C CB  . ASP A 86  ? 0.5431 0.6109 0.4715 -0.0401 -0.1950 -0.0581 66  ASP A CB  
401  C CG  . ASP A 86  ? 0.6465 0.7337 0.5640 -0.0355 -0.2038 -0.0642 66  ASP A CG  
402  O OD1 . ASP A 86  ? 0.6797 0.7653 0.5809 -0.0201 -0.2096 -0.0554 66  ASP A OD1 
403  O OD2 . ASP A 86  ? 0.6815 0.7849 0.6066 -0.0489 -0.2046 -0.0771 66  ASP A OD2 
404  N N   . GLU A 87  ? 0.4989 0.5670 0.4486 -0.0115 -0.1954 -0.0374 67  GLU A N   
405  C CA  . GLU A 87  ? 0.4383 0.5138 0.4090 -0.0095 -0.1900 -0.0361 67  GLU A CA  
406  C C   . GLU A 87  ? 0.4268 0.5204 0.4211 -0.0273 -0.1813 -0.0449 67  GLU A C   
407  O O   . GLU A 87  ? 0.4815 0.5651 0.4841 -0.0318 -0.1704 -0.0404 67  GLU A O   
408  C CB  . GLU A 87  ? 0.4387 0.5348 0.4175 0.0089  -0.1991 -0.0362 67  GLU A CB  
409  C CG  . GLU A 87  ? 0.4608 0.5921 0.4695 0.0071  -0.1971 -0.0450 67  GLU A CG  
410  C CD  . GLU A 87  ? 0.5547 0.6903 0.5686 0.0273  -0.2006 -0.0416 67  GLU A CD  
411  O OE1 . GLU A 87  ? 0.6095 0.7142 0.6038 0.0400  -0.2034 -0.0315 67  GLU A OE1 
412  O OE2 . GLU A 87  ? 0.6138 0.7818 0.6504 0.0298  -0.1998 -0.0489 67  GLU A OE2 
413  N N   . GLU A 88  ? 0.4368 0.5556 0.4409 -0.0383 -0.1861 -0.0566 68  GLU A N   
414  C CA  . GLU A 88  ? 0.4891 0.6222 0.5141 -0.0581 -0.1777 -0.0636 68  GLU A CA  
415  C C   . GLU A 88  ? 0.4517 0.5497 0.4679 -0.0712 -0.1638 -0.0580 68  GLU A C   
416  O O   . GLU A 88  ? 0.4638 0.5647 0.4948 -0.0841 -0.1545 -0.0581 68  GLU A O   
417  C CB  . GLU A 88  ? 0.6132 0.7742 0.6466 -0.0702 -0.1826 -0.0750 68  GLU A CB  
418  C CG  . GLU A 88  ? 0.7457 0.9419 0.7922 -0.0597 -0.1908 -0.0768 68  GLU A CG  
419  C CD  . GLU A 88  ? 0.8598 1.0734 0.9117 -0.0708 -0.1969 -0.0853 68  GLU A CD  
420  O OE1 . GLU A 88  ? 0.8611 1.0562 0.9038 -0.0856 -0.1958 -0.0900 68  GLU A OE1 
421  O OE2 . GLU A 88  ? 0.9004 1.1450 0.9660 -0.0636 -0.2033 -0.0881 68  GLU A OE2 
422  N N   . ILE A 89  ? 0.4327 0.4993 0.4246 -0.0672 -0.1625 -0.0526 69  ILE A N   
423  C CA  . ILE A 89  ? 0.4198 0.4536 0.4021 -0.0756 -0.1502 -0.0470 69  ILE A CA  
424  C C   . ILE A 89  ? 0.4207 0.4394 0.4039 -0.0684 -0.1418 -0.0349 69  ILE A C   
425  O O   . ILE A 89  ? 0.4212 0.4280 0.4102 -0.0771 -0.1312 -0.0313 69  ILE A O   
426  C CB  . ILE A 89  ? 0.4337 0.4447 0.3901 -0.0721 -0.1515 -0.0463 69  ILE A CB  
427  C CG1 . ILE A 89  ? 0.4361 0.4616 0.3894 -0.0790 -0.1609 -0.0599 69  ILE A CG1 
428  C CG2 . ILE A 89  ? 0.4033 0.3834 0.3509 -0.0785 -0.1390 -0.0415 69  ILE A CG2 
429  C CD1 . ILE A 89  ? 0.4998 0.5097 0.4256 -0.0720 -0.1643 -0.0599 69  ILE A CD1 
430  N N   . ALA A 90  ? 0.3351 0.3531 0.3114 -0.0526 -0.1472 -0.0285 70  ALA A N   
431  C CA  . ALA A 90  ? 0.3060 0.3116 0.2842 -0.0460 -0.1412 -0.0189 70  ALA A CA  
432  C C   . ALA A 90  ? 0.2985 0.3234 0.2994 -0.0521 -0.1361 -0.0222 70  ALA A C   
433  O O   . ALA A 90  ? 0.3197 0.3317 0.3232 -0.0577 -0.1261 -0.0168 70  ALA A O   
434  C CB  . ALA A 90  ? 0.3433 0.3464 0.3126 -0.0288 -0.1500 -0.0135 70  ALA A CB  
435  N N   . LEU A 91  ? 0.3254 0.3837 0.3429 -0.0513 -0.1428 -0.0310 71  LEU A N   
436  C CA  . LEU A 91  ? 0.3186 0.4002 0.3580 -0.0581 -0.1368 -0.0342 71  LEU A CA  
437  C C   . LEU A 91  ? 0.3330 0.4077 0.3772 -0.0781 -0.1265 -0.0341 71  LEU A C   
438  O O   . LEU A 91  ? 0.3680 0.4419 0.4198 -0.0837 -0.1172 -0.0299 71  LEU A O   
439  C CB  . LEU A 91  ? 0.2818 0.4062 0.3400 -0.0552 -0.1453 -0.0446 71  LEU A CB  
440  C CG  . LEU A 91  ? 0.3285 0.4626 0.3841 -0.0329 -0.1568 -0.0455 71  LEU A CG  
441  C CD1 . LEU A 91  ? 0.2831 0.4652 0.3601 -0.0302 -0.1652 -0.0570 71  LEU A CD1 
442  C CD2 . LEU A 91  ? 0.3496 0.4690 0.4029 -0.0205 -0.1527 -0.0389 71  LEU A CD2 
443  N N   . ARG A 92  ? 0.2846 0.3525 0.3228 -0.0886 -0.1285 -0.0389 72  ARG A N   
444  C CA  . ARG A 92  ? 0.2879 0.3452 0.3296 -0.1077 -0.1201 -0.0395 72  ARG A CA  
445  C C   . ARG A 92  ? 0.3077 0.3304 0.3377 -0.1077 -0.1097 -0.0289 72  ARG A C   
446  O O   . ARG A 92  ? 0.3313 0.3486 0.3679 -0.1188 -0.1010 -0.0250 72  ARG A O   
447  C CB  . ARG A 92  ? 0.3056 0.3583 0.3404 -0.1169 -0.1259 -0.0484 72  ARG A CB  
448  C CG  . ARG A 92  ? 0.3157 0.3496 0.3509 -0.1351 -0.1180 -0.0495 72  ARG A CG  
449  C CD  . ARG A 92  ? 0.4100 0.4462 0.4424 -0.1410 -0.1230 -0.0616 72  ARG A CD  
450  N NE  . ARG A 92  ? 0.4915 0.5037 0.5230 -0.1535 -0.1138 -0.0629 72  ARG A NE  
451  C CZ  . ARG A 92  ? 0.5157 0.5203 0.5430 -0.1599 -0.1168 -0.0734 72  ARG A CZ  
452  N NH1 . ARG A 92  ? 0.4805 0.5022 0.5039 -0.1553 -0.1282 -0.0835 72  ARG A NH1 
453  N NH2 . ARG A 92  ? 0.5375 0.5172 0.5641 -0.1697 -0.1089 -0.0738 72  ARG A NH2 
454  N N   . ILE A 93  ? 0.3485 0.3495 0.3611 -0.0952 -0.1110 -0.0236 73  ILE A N   
455  C CA  . ILE A 93  ? 0.3297 0.3022 0.3320 -0.0936 -0.1020 -0.0138 73  ILE A CA  
456  C C   . ILE A 93  ? 0.3306 0.3094 0.3420 -0.0898 -0.0971 -0.0071 73  ILE A C   
457  O O   . ILE A 93  ? 0.3900 0.3614 0.4054 -0.0973 -0.0887 -0.0022 73  ILE A O   
458  C CB  . ILE A 93  ? 0.3146 0.2675 0.2972 -0.0824 -0.1044 -0.0096 73  ILE A CB  
459  C CG1 . ILE A 93  ? 0.3517 0.2929 0.3222 -0.0876 -0.1058 -0.0161 73  ILE A CG1 
460  C CG2 . ILE A 93  ? 0.2841 0.2166 0.2605 -0.0785 -0.0961 0.0012  73  ILE A CG2 
461  C CD1 . ILE A 93  ? 0.3395 0.2733 0.2907 -0.0768 -0.1110 -0.0149 73  ILE A CD1 
462  N N   . ILE A 94  ? 0.2858 0.2773 0.2993 -0.0774 -0.1029 -0.0071 74  ILE A N   
463  C CA  . ILE A 94  ? 0.2509 0.2491 0.2719 -0.0721 -0.0995 -0.0032 74  ILE A CA  
464  C C   . ILE A 94  ? 0.2611 0.2816 0.2991 -0.0828 -0.0936 -0.0058 74  ILE A C   
465  O O   . ILE A 94  ? 0.2901 0.3057 0.3295 -0.0850 -0.0861 0.0000  74  ILE A O   
466  C CB  . ILE A 94  ? 0.2520 0.2601 0.2729 -0.0563 -0.1085 -0.0054 74  ILE A CB  
467  C CG1 . ILE A 94  ? 0.2609 0.2429 0.2628 -0.0477 -0.1124 0.0009  74  ILE A CG1 
468  C CG2 . ILE A 94  ? 0.2435 0.2598 0.2722 -0.0503 -0.1057 -0.0043 74  ILE A CG2 
469  C CD1 . ILE A 94  ? 0.3150 0.3016 0.3131 -0.0325 -0.1234 -0.0006 74  ILE A CD1 
470  N N   . ASN A 95  ? 0.2472 0.2935 0.2978 -0.0904 -0.0968 -0.0140 75  ASN A N   
471  C CA  . ASN A 95  ? 0.2431 0.3133 0.3099 -0.1027 -0.0903 -0.0153 75  ASN A CA  
472  C C   . ASN A 95  ? 0.2483 0.2988 0.3119 -0.1191 -0.0810 -0.0089 75  ASN A C   
473  O O   . ASN A 95  ? 0.2448 0.3035 0.3150 -0.1262 -0.0732 -0.0042 75  ASN A O   
474  C CB  . ASN A 95  ? 0.2460 0.3534 0.3295 -0.1086 -0.0957 -0.0257 75  ASN A CB  
475  C CG  . ASN A 95  ? 0.2794 0.4116 0.3688 -0.0905 -0.1052 -0.0323 75  ASN A CG  
476  O OD1 . ASN A 95  ? 0.2896 0.4186 0.3758 -0.0755 -0.1055 -0.0299 75  ASN A OD1 
477  N ND2 . ASN A 95  ? 0.2910 0.4474 0.3889 -0.0915 -0.1139 -0.0413 75  ASN A ND2 
478  N N   . GLU A 96  ? 0.2784 0.3031 0.3311 -0.1246 -0.0820 -0.0089 76  GLU A N   
479  C CA  . GLU A 96  ? 0.3467 0.3489 0.3956 -0.1385 -0.0742 -0.0031 76  GLU A CA  
480  C C   . GLU A 96  ? 0.3112 0.2922 0.3508 -0.1311 -0.0676 0.0077  76  GLU A C   
481  O O   . GLU A 96  ? 0.3500 0.3254 0.3904 -0.1368 -0.0590 0.0146  76  GLU A O   
482  C CB  . GLU A 96  ? 0.4789 0.4585 0.5179 -0.1422 -0.0755 -0.0080 76  GLU A CB  
483  C CG  . GLU A 96  ? 0.6212 0.5731 0.6535 -0.1461 -0.0649 -0.0020 76  GLU A CG  
484  C CD  . GLU A 96  ? 0.7093 0.6495 0.7403 -0.1546 -0.0647 -0.0095 76  GLU A CD  
485  O OE1 . GLU A 96  ? 0.6172 0.5403 0.6473 -0.1596 -0.0569 -0.0053 76  GLU A OE1 
486  O OE2 . GLU A 96  ? 0.7859 0.7334 0.8161 -0.1556 -0.0731 -0.0196 76  GLU A OE2 
487  N N   . GLY A 97  ? 0.3249 0.2959 0.3549 -0.1163 -0.0708 0.0092  77  GLY A N   
488  C CA  . GLY A 97  ? 0.2828 0.2400 0.3063 -0.1088 -0.0660 0.0182  77  GLY A CA  
489  C C   . GLY A 97  ? 0.3069 0.2844 0.3399 -0.1093 -0.0622 0.0208  77  GLY A C   
490  O O   . GLY A 97  ? 0.3316 0.3014 0.3628 -0.1135 -0.0555 0.0286  77  GLY A O   
491  N N   . ALA A 98  ? 0.2330 0.2374 0.2753 -0.1040 -0.0668 0.0140  78  ALA A N   
492  C CA  . ALA A 98  ? 0.2257 0.2543 0.2773 -0.1026 -0.0634 0.0137  78  ALA A CA  
493  C C   . ALA A 98  ? 0.2304 0.2694 0.2888 -0.1188 -0.0551 0.0177  78  ALA A C   
494  O O   . ALA A 98  ? 0.2285 0.2690 0.2853 -0.1203 -0.0488 0.0243  78  ALA A O   
495  C CB  . ALA A 98  ? 0.2223 0.2800 0.2842 -0.0940 -0.0700 0.0038  78  ALA A CB  
496  N N   . ALA A 99  ? 0.2545 0.2998 0.3195 -0.1318 -0.0557 0.0142  79  ALA A N   
497  C CA  . ALA A 99  ? 0.2491 0.2990 0.3192 -0.1502 -0.0482 0.0193  79  ALA A CA  
498  C C   . ALA A 99  ? 0.2679 0.2863 0.3244 -0.1494 -0.0404 0.0307  79  ALA A C   
499  O O   . ALA A 99  ? 0.3181 0.3439 0.3750 -0.1541 -0.0330 0.0374  79  ALA A O   
500  C CB  . ALA A 99  ? 0.2630 0.3115 0.3371 -0.1590 -0.0495 0.0128  79  ALA A CB  
501  N N   . ILE A 100 ? 0.2670 0.2534 0.3110 -0.1414 -0.0419 0.0324  80  ILE A N   
502  C CA  . ILE A 100 ? 0.2675 0.2277 0.2996 -0.1362 -0.0352 0.0412  80  ILE A CA  
503  C C   . ILE A 100 ? 0.2565 0.2208 0.2852 -0.1297 -0.0333 0.0486  80  ILE A C   
504  O O   . ILE A 100 ? 0.2647 0.2247 0.2890 -0.1302 -0.0270 0.0562  80  ILE A O   
505  C CB  . ILE A 100 ? 0.2724 0.2053 0.2943 -0.1277 -0.0371 0.0394  80  ILE A CB  
506  C CG1 . ILE A 100 ? 0.2882 0.2137 0.3116 -0.1353 -0.0382 0.0323  80  ILE A CG1 
507  C CG2 . ILE A 100 ? 0.2773 0.1904 0.2900 -0.1197 -0.0312 0.0468  80  ILE A CG2 
508  C CD1 . ILE A 100 ? 0.2917 0.1984 0.3061 -0.1283 -0.0425 0.0276  80  ILE A CD1 
509  N N   . LEU A 101 ? 0.2423 0.2141 0.2729 -0.1239 -0.0400 0.0461  81  LEU A N   
510  C CA  . LEU A 101 ? 0.2330 0.2089 0.2602 -0.1153 -0.0394 0.0501  81  LEU A CA  
511  C C   . LEU A 101 ? 0.2650 0.2672 0.2978 -0.1200 -0.0346 0.0514  81  LEU A C   
512  O O   . LEU A 101 ? 0.2719 0.2725 0.2990 -0.1195 -0.0305 0.0590  81  LEU A O   
513  C CB  . LEU A 101 ? 0.2343 0.2141 0.2615 -0.1021 -0.0465 0.0425  81  LEU A CB  
514  C CG  . LEU A 101 ? 0.2239 0.1796 0.2430 -0.0960 -0.0506 0.0429  81  LEU A CG  
515  C CD1 . LEU A 101 ? 0.2189 0.1791 0.2376 -0.0851 -0.0579 0.0364  81  LEU A CD1 
516  C CD2 . LEU A 101 ? 0.2245 0.1613 0.2353 -0.0936 -0.0473 0.0520  81  LEU A CD2 
517  N N   . ARG A 102 ? 0.2496 0.2789 0.2938 -0.1242 -0.0350 0.0436  82  ARG A N   
518  C CA  . ARG A 102 ? 0.2498 0.3112 0.3009 -0.1289 -0.0296 0.0432  82  ARG A CA  
519  C C   . ARG A 102 ? 0.2953 0.3522 0.3415 -0.1430 -0.0210 0.0558  82  ARG A C   
520  O O   . ARG A 102 ? 0.3466 0.4221 0.3913 -0.1437 -0.0158 0.0594  82  ARG A O   
521  C CB  . ARG A 102 ? 0.2297 0.3213 0.2957 -0.1330 -0.0315 0.0330  82  ARG A CB  
522  C CG  . ARG A 102 ? 0.2878 0.4204 0.3638 -0.1368 -0.0257 0.0301  82  ARG A CG  
523  C CD  . ARG A 102 ? 0.4096 0.5742 0.5025 -0.1384 -0.0294 0.0185  82  ARG A CD  
524  N NE  . ARG A 102 ? 0.4770 0.6382 0.5709 -0.1204 -0.0397 0.0082  82  ARG A NE  
525  C CZ  . ARG A 102 ? 0.4246 0.5762 0.5208 -0.1199 -0.0472 0.0036  82  ARG A CZ  
526  N NH1 . ARG A 102 ? 0.3953 0.5401 0.4943 -0.1367 -0.0460 0.0062  82  ARG A NH1 
527  N NH2 . ARG A 102 ? 0.4201 0.5674 0.5145 -0.1027 -0.0565 -0.0038 82  ARG A NH2 
528  N N   . ARG A 103 ? 0.2639 0.2932 0.3048 -0.1489 -0.0196 0.0608  83  ARG A N   
529  C CA  . ARG A 103 ? 0.2908 0.3057 0.3232 -0.1527 -0.0122 0.0698  83  ARG A CA  
530  C C   . ARG A 103 ? 0.3314 0.3314 0.3514 -0.1435 -0.0109 0.0785  83  ARG A C   
531  O O   . ARG A 103 ? 0.4172 0.4107 0.4301 -0.1454 -0.0056 0.0869  83  ARG A O   
532  C CB  . ARG A 103 ? 0.4069 0.3916 0.4360 -0.1523 -0.0126 0.0680  83  ARG A CB  
533  C CG  . ARG A 103 ? 0.5144 0.4984 0.5472 -0.1650 -0.0078 0.0692  83  ARG A CG  
534  C CD  . ARG A 103 ? 0.6520 0.6152 0.6744 -0.1651 -0.0018 0.0804  83  ARG A CD  
535  N NE  . ARG A 103 ? 0.7441 0.6793 0.7559 -0.1514 -0.0030 0.0835  83  ARG A NE  
536  C CZ  . ARG A 103 ? 0.7906 0.6975 0.7986 -0.1475 -0.0033 0.0821  83  ARG A CZ  
537  N NH1 . ARG A 103 ? 0.8062 0.6944 0.8060 -0.1345 -0.0036 0.0847  83  ARG A NH1 
538  N NH2 . ARG A 103 ? 0.8031 0.7021 0.8161 -0.1570 -0.0032 0.0775  83  ARG A NH2 
539  N N   . GLU A 104 ? 0.3182 0.3117 0.3357 -0.1333 -0.0164 0.0765  84  GLU A N   
540  C CA  . GLU A 104 ? 0.2724 0.2492 0.2792 -0.1231 -0.0162 0.0830  84  GLU A CA  
541  C C   . GLU A 104 ? 0.2760 0.2724 0.2796 -0.1236 -0.0156 0.0885  84  GLU A C   
542  O O   . GLU A 104 ? 0.2554 0.2783 0.2653 -0.1242 -0.0164 0.0818  84  GLU A O   
543  C CB  . GLU A 104 ? 0.3140 0.2724 0.3189 -0.1117 -0.0216 0.0782  84  GLU A CB  
544  C CG  . GLU A 104 ? 0.3894 0.3272 0.3935 -0.1093 -0.0210 0.0740  84  GLU A CG  
545  C CD  . GLU A 104 ? 0.4570 0.3806 0.4574 -0.0975 -0.0242 0.0709  84  GLU A CD  
546  O OE1 . GLU A 104 ? 0.4901 0.4199 0.4922 -0.0940 -0.0293 0.0678  84  GLU A OE1 
547  O OE2 . GLU A 104 ? 0.4580 0.3648 0.4540 -0.0922 -0.0213 0.0717  84  GLU A OE2 
548  N N   . LYS A 105 ? 0.2643 0.2505 0.2581 -0.1176 -0.0140 0.0961  85  LYS A N   
549  C CA  . LYS A 105 ? 0.2629 0.2675 0.2509 -0.1182 -0.0134 0.1019  85  LYS A CA  
550  C C   . LYS A 105 ? 0.2465 0.2573 0.2372 -0.1081 -0.0199 0.0919  85  LYS A C   
551  O O   . LYS A 105 ? 0.2566 0.2495 0.2496 -0.1027 -0.0247 0.0884  85  LYS A O   
552  C CB  . LYS A 105 ? 0.2744 0.2656 0.2518 -0.1110 -0.0125 0.1102  85  LYS A CB  
553  C CG  . LYS A 105 ? 0.3211 0.2909 0.2960 -0.1104 -0.0085 0.1138  85  LYS A CG  
554  C CD  . LYS A 105 ? 0.3109 0.2849 0.2760 -0.1125 -0.0043 0.1245  85  LYS A CD  
555  C CE  . LYS A 105 ? 0.3306 0.2770 0.2901 -0.1072 -0.0023 0.1299  85  LYS A CE  
556  N NZ  . LYS A 105 ? 0.3363 0.2815 0.2865 -0.0985 -0.0043 0.1375  85  LYS A NZ  
557  N N   . THR A 106 ? 0.2554 0.2903 0.2447 -0.1039 -0.0198 0.0856  86  THR A N   
558  C CA  . THR A 106 ? 0.2340 0.2706 0.2235 -0.0925 -0.0265 0.0748  86  THR A CA  
559  C C   . THR A 106 ? 0.2453 0.2632 0.2283 -0.0881 -0.0306 0.0812  86  THR A C   
560  O O   . THR A 106 ? 0.2682 0.2759 0.2531 -0.0818 -0.0366 0.0752  86  THR A O   
561  C CB  . THR A 106 ? 0.3064 0.3706 0.2936 -0.0885 -0.0256 0.0664  86  THR A CB  
562  O OG1 . THR A 106 ? 0.2961 0.3817 0.2919 -0.0918 -0.0216 0.0598  86  THR A OG1 
563  C CG2 . THR A 106 ? 0.4054 0.4659 0.3919 -0.0772 -0.0336 0.0542  86  THR A CG2 
564  N N   . MET A 107 ? 0.2435 0.2577 0.2190 -0.0915 -0.0275 0.0940  87  MET A N   
565  C CA  . MET A 107 ? 0.2435 0.2416 0.2155 -0.0868 -0.0313 0.1004  87  MET A CA  
566  C C   . MET A 107 ? 0.2706 0.2499 0.2422 -0.0877 -0.0278 0.1092  87  MET A C   
567  O O   . MET A 107 ? 0.3294 0.3091 0.2951 -0.0875 -0.0242 0.1162  87  MET A O   
568  C CB  . MET A 107 ? 0.2487 0.2597 0.2122 -0.0833 -0.0335 0.1033  87  MET A CB  
569  C CG  . MET A 107 ? 0.2475 0.2470 0.2103 -0.0781 -0.0383 0.1086  87  MET A CG  
570  S SD  . MET A 107 ? 0.3251 0.3420 0.2776 -0.0746 -0.0418 0.1131  87  MET A SD  
571  C CE  . MET A 107 ? 0.3415 0.3501 0.2869 -0.0756 -0.0363 0.1304  87  MET A CE  
572  N N   . ILE A 108 ? 0.2456 0.2098 0.2239 -0.0837 -0.0284 0.1024  88  ILE A N   
573  C CA  . ILE A 108 ? 0.2613 0.2088 0.2399 -0.0795 -0.0242 0.1025  88  ILE A CA  
574  C C   . ILE A 108 ? 0.3070 0.2487 0.2815 -0.0713 -0.0245 0.1081  88  ILE A C   
575  O O   . ILE A 108 ? 0.2644 0.2150 0.2384 -0.0682 -0.0290 0.1098  88  ILE A O   
576  C CB  . ILE A 108 ? 0.2464 0.1829 0.2307 -0.0766 -0.0250 0.0938  88  ILE A CB  
577  C CG1 . ILE A 108 ? 0.2806 0.2155 0.2666 -0.0690 -0.0288 0.0909  88  ILE A CG1 
578  C CG2 . ILE A 108 ? 0.2397 0.1841 0.2288 -0.0840 -0.0268 0.0885  88  ILE A CG2 
579  C CD1 . ILE A 108 ? 0.2294 0.1566 0.2189 -0.0667 -0.0295 0.0831  88  ILE A CD1 
580  N N   . GLU A 109 ? 0.3230 0.2495 0.2942 -0.0683 -0.0202 0.1114  89  GLU A N   
581  C CA  . GLU A 109 ? 0.2834 0.2034 0.2509 -0.0596 -0.0209 0.1170  89  GLU A CA  
582  C C   . GLU A 109 ? 0.4018 0.3041 0.3707 -0.0533 -0.0189 0.1136  89  GLU A C   
583  O O   . GLU A 109 ? 0.4395 0.3268 0.4070 -0.0556 -0.0148 0.1119  89  GLU A O   
584  C CB  . GLU A 109 ? 0.3046 0.2216 0.2629 -0.0601 -0.0184 0.1273  89  GLU A CB  
585  C CG  . GLU A 109 ? 0.4076 0.3453 0.3624 -0.0666 -0.0199 0.1315  89  GLU A CG  
586  C CD  . GLU A 109 ? 0.5871 0.5228 0.5307 -0.0670 -0.0172 0.1426  89  GLU A CD  
587  O OE1 . GLU A 109 ? 0.6835 0.5980 0.6223 -0.0637 -0.0138 0.1470  89  GLU A OE1 
588  O OE2 . GLU A 109 ? 0.6268 0.5814 0.5648 -0.0704 -0.0185 0.1472  89  GLU A OE2 
589  N N   . VAL A 110 ? 0.2794 0.1847 0.2515 -0.0464 -0.0219 0.1128  90  VAL A N   
590  C CA  . VAL A 110 ? 0.2825 0.1744 0.2557 -0.0405 -0.0202 0.1097  90  VAL A CA  
591  C C   . VAL A 110 ? 0.3112 0.2026 0.2829 -0.0311 -0.0223 0.1170  90  VAL A C   
592  O O   . VAL A 110 ? 0.2841 0.1921 0.2583 -0.0301 -0.0267 0.1213  90  VAL A O   
593  C CB  . VAL A 110 ? 0.2637 0.1623 0.2436 -0.0423 -0.0218 0.1010  90  VAL A CB  
594  C CG1 . VAL A 110 ? 0.3184 0.2189 0.3000 -0.0502 -0.0212 0.0947  90  VAL A CG1 
595  C CG2 . VAL A 110 ? 0.2493 0.1654 0.2343 -0.0421 -0.0268 0.1018  90  VAL A CG2 
596  N N   . GLU A 111 ? 0.3405 0.2134 0.3082 -0.0240 -0.0202 0.1189  91  GLU A N   
597  C CA  . GLU A 111 ? 0.3889 0.2606 0.3552 -0.0129 -0.0231 0.1269  91  GLU A CA  
598  C C   . GLU A 111 ? 0.3684 0.2403 0.3409 -0.0064 -0.0240 0.1249  91  GLU A C   
599  O O   . GLU A 111 ? 0.4184 0.2823 0.3917 -0.0096 -0.0214 0.1179  91  GLU A O   
600  C CB  . GLU A 111 ? 0.5285 0.3770 0.4829 -0.0072 -0.0210 0.1337  91  GLU A CB  
601  C CG  . GLU A 111 ? 0.7088 0.5303 0.6581 -0.0081 -0.0159 0.1296  91  GLU A CG  
602  C CD  . GLU A 111 ? 0.8026 0.6213 0.7513 -0.0210 -0.0114 0.1261  91  GLU A CD  
603  O OE1 . GLU A 111 ? 0.8551 0.6560 0.7962 -0.0224 -0.0082 0.1316  91  GLU A OE1 
604  O OE2 . GLU A 111 ? 0.7725 0.6067 0.7287 -0.0295 -0.0115 0.1186  91  GLU A OE2 
605  N N   . ALA A 112 ? 0.4284 0.3129 0.4067 0.0028  -0.0281 0.1320  92  ALA A N   
606  C CA  . ALA A 112 ? 0.3678 0.2562 0.3544 0.0110  -0.0287 0.1331  92  ALA A CA  
607  C C   . ALA A 112 ? 0.4274 0.2863 0.4062 0.0205  -0.0263 0.1324  92  ALA A C   
608  O O   . ALA A 112 ? 0.5263 0.3633 0.4931 0.0226  -0.0256 0.1339  92  ALA A O   
609  C CB  . ALA A 112 ? 0.3941 0.3079 0.3914 0.0203  -0.0334 0.1423  92  ALA A CB  
610  N N   . PRO A 113 ? 0.3798 0.2365 0.3647 0.0263  -0.0248 0.1304  93  PRO A N   
611  C CA  . PRO A 113 ? 0.3797 0.2600 0.3773 0.0232  -0.0242 0.1305  93  PRO A CA  
612  C C   . PRO A 113 ? 0.3765 0.2547 0.3698 0.0069  -0.0228 0.1211  93  PRO A C   
613  O O   . PRO A 113 ? 0.4016 0.2593 0.3849 0.0014  -0.0206 0.1139  93  PRO A O   
614  C CB  . PRO A 113 ? 0.3457 0.2214 0.3441 0.0370  -0.0200 0.1248  93  PRO A CB  
615  C CG  . PRO A 113 ? 0.3552 0.1921 0.3418 0.0408  -0.0197 0.1232  93  PRO A CG  
616  C CD  . PRO A 113 ? 0.3694 0.1967 0.3480 0.0374  -0.0232 0.1286  93  PRO A CD  
617  N N   . ILE A 114 ? 0.3172 0.2180 0.3185 -0.0003 -0.0238 0.1213  94  ILE A N   
618  C CA  . ILE A 114 ? 0.2928 0.1931 0.2904 -0.0129 -0.0231 0.1120  94  ILE A CA  
619  C C   . ILE A 114 ? 0.3035 0.2228 0.3085 -0.0178 -0.0238 0.1140  94  ILE A C   
620  O O   . ILE A 114 ? 0.3163 0.2579 0.3302 -0.0150 -0.0245 0.1187  94  ILE A O   
621  C CB  . ILE A 114 ? 0.2582 0.1623 0.2531 -0.0205 -0.0245 0.1074  94  ILE A CB  
622  C CG1 . ILE A 114 ? 0.2523 0.1489 0.2425 -0.0280 -0.0227 0.0972  94  ILE A CG1 
623  C CG2 . ILE A 114 ? 0.2447 0.1718 0.2475 -0.0245 -0.0288 0.1111  94  ILE A CG2 
624  C CD1 . ILE A 114 ? 0.2516 0.1490 0.2398 -0.0329 -0.0229 0.0944  94  ILE A CD1 
625  N N   . THR A 115 ? 0.2823 0.1957 0.2822 -0.0246 -0.0225 0.1066  95  THR A N   
626  C CA  . THR A 115 ? 0.2392 0.1664 0.2421 -0.0318 -0.0230 0.1068  95  THR A CA  
627  C C   . THR A 115 ? 0.2282 0.1570 0.2291 -0.0394 -0.0259 0.0978  95  THR A C   
628  O O   . THR A 115 ? 0.2330 0.1506 0.2278 -0.0402 -0.0254 0.0900  95  THR A O   
629  C CB  . THR A 115 ? 0.2457 0.1653 0.2415 -0.0314 -0.0195 0.1028  95  THR A CB  
630  O OG1 . THR A 115 ? 0.2572 0.1793 0.2531 -0.0195 -0.0142 0.1015  95  THR A OG1 
631  C CG2 . THR A 115 ? 0.2398 0.1724 0.2363 -0.0395 -0.0195 0.1041  95  THR A CG2 
632  N N   . VAL A 116 ? 0.2206 0.1642 0.2278 -0.0447 -0.0294 0.1000  96  VAL A N   
633  C CA  . VAL A 116 ? 0.2134 0.1573 0.2193 -0.0501 -0.0334 0.0931  96  VAL A CA  
634  C C   . VAL A 116 ? 0.2130 0.1582 0.2176 -0.0556 -0.0346 0.0909  96  VAL A C   
635  O O   . VAL A 116 ? 0.2153 0.1703 0.2243 -0.0594 -0.0342 0.0970  96  VAL A O   
636  C CB  . VAL A 116 ? 0.2101 0.1657 0.2219 -0.0529 -0.0383 0.0973  96  VAL A CB  
637  C CG1 . VAL A 116 ? 0.2062 0.1593 0.2152 -0.0576 -0.0430 0.0908  96  VAL A CG1 
638  C CG2 . VAL A 116 ? 0.2140 0.1694 0.2261 -0.0466 -0.0372 0.1021  96  VAL A CG2 
639  N N   . CYS A 117 ? 0.2118 0.1481 0.2107 -0.0562 -0.0362 0.0836  97  CYS A N   
640  C CA  . CYS A 117 ? 0.2156 0.1488 0.2107 -0.0598 -0.0376 0.0820  97  CYS A CA  
641  C C   . CYS A 117 ? 0.2148 0.1444 0.2089 -0.0624 -0.0437 0.0775  97  CYS A C   
642  O O   . CYS A 117 ? 0.2108 0.1381 0.2046 -0.0604 -0.0458 0.0738  97  CYS A O   
643  C CB  . CYS A 117 ? 0.2195 0.1429 0.2072 -0.0567 -0.0350 0.0792  97  CYS A CB  
644  S SG  . CYS A 117 ? 0.2429 0.1628 0.2289 -0.0519 -0.0291 0.0824  97  CYS A SG  
645  N N   . GLY A 118 ? 0.2218 0.1495 0.2143 -0.0674 -0.0467 0.0785  98  GLY A N   
646  C CA  . GLY A 118 ? 0.2265 0.1464 0.2164 -0.0696 -0.0534 0.0748  98  GLY A CA  
647  C C   . GLY A 118 ? 0.2339 0.1416 0.2162 -0.0675 -0.0550 0.0720  98  GLY A C   
648  O O   . GLY A 118 ? 0.2324 0.1389 0.2116 -0.0640 -0.0515 0.0719  98  GLY A O   
649  N N   . ASP A 119 ? 0.2447 0.1419 0.2232 -0.0698 -0.0613 0.0704  99  ASP A N   
650  C CA  . ASP A 119 ? 0.2553 0.1388 0.2261 -0.0671 -0.0651 0.0687  99  ASP A CA  
651  C C   . ASP A 119 ? 0.2601 0.1430 0.2259 -0.0663 -0.0607 0.0724  99  ASP A C   
652  O O   . ASP A 119 ? 0.3305 0.2191 0.2968 -0.0705 -0.0559 0.0774  99  ASP A O   
653  C CB  . ASP A 119 ? 0.2731 0.1429 0.2397 -0.0708 -0.0718 0.0687  99  ASP A CB  
654  C CG  . ASP A 119 ? 0.3019 0.1692 0.2714 -0.0725 -0.0775 0.0649  99  ASP A CG  
655  O OD1 . ASP A 119 ? 0.3285 0.2086 0.3043 -0.0730 -0.0750 0.0647  99  ASP A OD1 
656  O OD2 . ASP A 119 ? 0.3411 0.1919 0.3055 -0.0731 -0.0849 0.0623  99  ASP A OD2 
657  N N   . ILE A 120 ? 0.2680 0.1440 0.2284 -0.0617 -0.0631 0.0703  100 ILE A N   
658  C CA  . ILE A 120 ? 0.2935 0.1669 0.2466 -0.0608 -0.0607 0.0737  100 ILE A CA  
659  C C   . ILE A 120 ? 0.3570 0.2151 0.3007 -0.0600 -0.0673 0.0753  100 ILE A C   
660  O O   . ILE A 120 ? 0.3419 0.1956 0.2784 -0.0626 -0.0657 0.0811  100 ILE A O   
661  C CB  . ILE A 120 ? 0.2599 0.1360 0.2127 -0.0567 -0.0600 0.0706  100 ILE A CB  
662  C CG1 . ILE A 120 ? 0.2467 0.1343 0.2067 -0.0570 -0.0529 0.0704  100 ILE A CG1 
663  C CG2 . ILE A 120 ? 0.2713 0.1414 0.2135 -0.0559 -0.0604 0.0739  100 ILE A CG2 
664  C CD1 . ILE A 120 ? 0.2509 0.1433 0.2094 -0.0598 -0.0466 0.0761  100 ILE A CD1 
665  N N   . HIS A 121 ? 0.3820 0.2314 0.3254 -0.0559 -0.0749 0.0708  101 HIS A N   
666  C CA  . HIS A 121 ? 0.3708 0.2025 0.3055 -0.0534 -0.0828 0.0719  101 HIS A CA  
667  C C   . HIS A 121 ? 0.3678 0.1925 0.2914 -0.0506 -0.0846 0.0761  101 HIS A C   
668  O O   . HIS A 121 ? 0.4159 0.2283 0.3309 -0.0515 -0.0869 0.0812  101 HIS A O   
669  C CB  . HIS A 121 ? 0.3524 0.1762 0.2858 -0.0591 -0.0831 0.0749  101 HIS A CB  
670  C CG  . HIS A 121 ? 0.3409 0.1600 0.2793 -0.0590 -0.0882 0.0696  101 HIS A CG  
671  N ND1 . HIS A 121 ? 0.3259 0.1383 0.2647 -0.0518 -0.0955 0.0632  101 HIS A ND1 
672  C CD2 . HIS A 121 ? 0.4116 0.2314 0.3541 -0.0652 -0.0877 0.0696  101 HIS A CD2 
673  C CE1 . HIS A 121 ? 0.3757 0.1837 0.3177 -0.0532 -0.0990 0.0592  101 HIS A CE1 
674  N NE2 . HIS A 121 ? 0.4202 0.2325 0.3643 -0.0617 -0.0946 0.0630  101 HIS A NE2 
675  N N   . GLY A 122 ? 0.3560 0.1873 0.2790 -0.0476 -0.0843 0.0745  102 GLY A N   
676  C CA  . GLY A 122 ? 0.4376 0.2625 0.3487 -0.0442 -0.0880 0.0780  102 GLY A CA  
677  C C   . GLY A 122 ? 0.4481 0.2753 0.3507 -0.0488 -0.0812 0.0855  102 GLY A C   
678  O O   . GLY A 122 ? 0.4727 0.2938 0.3625 -0.0463 -0.0843 0.0900  102 GLY A O   
679  N N   . GLN A 123 ? 0.3437 0.1808 0.2528 -0.0549 -0.0724 0.0874  103 GLN A N   
680  C CA  . GLN A 123 ? 0.3399 0.1805 0.2413 -0.0594 -0.0658 0.0952  103 GLN A CA  
681  C C   . GLN A 123 ? 0.3325 0.1823 0.2303 -0.0588 -0.0612 0.0951  103 GLN A C   
682  O O   . GLN A 123 ? 0.3243 0.1847 0.2270 -0.0621 -0.0533 0.0966  103 GLN A O   
683  C CB  . GLN A 123 ? 0.3401 0.1855 0.2485 -0.0665 -0.0602 0.0988  103 GLN A CB  
684  C CG  . GLN A 123 ? 0.3550 0.1864 0.2626 -0.0680 -0.0662 0.0996  103 GLN A CG  
685  C CD  . GLN A 123 ? 0.3591 0.1936 0.2726 -0.0767 -0.0624 0.1032  103 GLN A CD  
686  O OE1 . GLN A 123 ? 0.3583 0.2045 0.2730 -0.0824 -0.0550 0.1084  103 GLN A OE1 
687  N NE2 . GLN A 123 ? 0.3662 0.1898 0.2827 -0.0782 -0.0682 0.1005  103 GLN A NE2 
688  N N   . PHE A 124 ? 0.3392 0.1834 0.2268 -0.0543 -0.0671 0.0937  104 PHE A N   
689  C CA  . PHE A 124 ? 0.3371 0.1852 0.2178 -0.0538 -0.0655 0.0924  104 PHE A CA  
690  C C   . PHE A 124 ? 0.3450 0.2000 0.2169 -0.0576 -0.0566 0.0989  104 PHE A C   
691  O O   . PHE A 124 ? 0.3387 0.1985 0.2106 -0.0584 -0.0518 0.0973  104 PHE A O   
692  C CB  . PHE A 124 ? 0.3504 0.1906 0.2167 -0.0490 -0.0754 0.0910  104 PHE A CB  
693  C CG  . PHE A 124 ? 0.3517 0.1925 0.2082 -0.0492 -0.0762 0.0882  104 PHE A CG  
694  C CD1 . PHE A 124 ? 0.3357 0.1792 0.2049 -0.0492 -0.0769 0.0793  104 PHE A CD1 
695  C CD2 . PHE A 124 ? 0.3768 0.2191 0.2131 -0.0491 -0.0741 0.0914  104 PHE A CD2 
696  C CE1 . PHE A 124 ? 0.3380 0.1886 0.2065 -0.0482 -0.0737 0.0696  104 PHE A CE1 
697  C CE2 . PHE A 124 ? 0.3675 0.2186 0.2028 -0.0467 -0.0709 0.0800  104 PHE A CE2 
698  C CZ  . PHE A 124 ? 0.3509 0.2042 0.2025 -0.0466 -0.0711 0.0690  104 PHE A CZ  
699  N N   . PHE A 125 ? 0.3618 0.2167 0.2251 -0.0600 -0.0540 0.1070  105 PHE A N   
700  C CA  . PHE A 125 ? 0.3724 0.2367 0.2247 -0.0636 -0.0453 0.1139  105 PHE A CA  
701  C C   . PHE A 125 ? 0.3590 0.2357 0.2264 -0.0683 -0.0364 0.1152  105 PHE A C   
702  O O   . PHE A 125 ? 0.3851 0.2733 0.2466 -0.0705 -0.0284 0.1194  105 PHE A O   
703  C CB  . PHE A 125 ? 0.3985 0.2602 0.2339 -0.0649 -0.0452 0.1231  105 PHE A CB  
704  C CG  . PHE A 125 ? 0.4135 0.2669 0.2308 -0.0588 -0.0538 0.1219  105 PHE A CG  
705  C CD1 . PHE A 125 ? 0.4164 0.2575 0.2361 -0.0541 -0.0641 0.1194  105 PHE A CD1 
706  C CD2 . PHE A 125 ? 0.4258 0.2849 0.2225 -0.0570 -0.0525 0.1220  105 PHE A CD2 
707  C CE1 . PHE A 125 ? 0.4299 0.2661 0.2345 -0.0476 -0.0731 0.1179  105 PHE A CE1 
708  C CE2 . PHE A 125 ? 0.4402 0.2937 0.2197 -0.0511 -0.0619 0.1193  105 PHE A CE2 
709  C CZ  . PHE A 125 ? 0.4415 0.2845 0.2262 -0.0463 -0.0724 0.1177  105 PHE A CZ  
710  N N   . ASP A 126 ? 0.3442 0.2199 0.2295 -0.0691 -0.0384 0.1110  106 ASP A N   
711  C CA  . ASP A 126 ? 0.3314 0.2192 0.2315 -0.0729 -0.0323 0.1113  106 ASP A CA  
712  C C   . ASP A 126 ? 0.3128 0.2037 0.2221 -0.0687 -0.0317 0.1045  106 ASP A C   
713  O O   . ASP A 126 ? 0.3071 0.2089 0.2221 -0.0698 -0.0255 0.1066  106 ASP A O   
714  C CB  . ASP A 126 ? 0.3297 0.2141 0.2403 -0.0764 -0.0356 0.1105  106 ASP A CB  
715  C CG  . ASP A 126 ? 0.3645 0.2453 0.2668 -0.0828 -0.0346 0.1191  106 ASP A CG  
716  O OD1 . ASP A 126 ? 0.3692 0.2607 0.2652 -0.0873 -0.0273 0.1265  106 ASP A OD1 
717  O OD2 . ASP A 126 ? 0.3948 0.2620 0.2956 -0.0835 -0.0409 0.1190  106 ASP A OD2 
718  N N   . LEU A 127 ? 0.3060 0.1874 0.2163 -0.0641 -0.0385 0.0972  107 LEU A N   
719  C CA  . LEU A 127 ? 0.2932 0.1745 0.2098 -0.0608 -0.0384 0.0911  107 LEU A CA  
720  C C   . LEU A 127 ? 0.3034 0.1833 0.2075 -0.0605 -0.0342 0.0941  107 LEU A C   
721  O O   . LEU A 127 ? 0.3580 0.2395 0.2677 -0.0592 -0.0305 0.0930  107 LEU A O   
722  C CB  . LEU A 127 ? 0.2897 0.1619 0.2063 -0.0577 -0.0467 0.0842  107 LEU A CB  
723  C CG  . LEU A 127 ? 0.2794 0.1505 0.2026 -0.0561 -0.0466 0.0781  107 LEU A CG  
724  C CD1 . LEU A 127 ? 0.2635 0.1446 0.2027 -0.0556 -0.0421 0.0766  107 LEU A CD1 
725  C CD2 . LEU A 127 ? 0.2790 0.1432 0.2014 -0.0551 -0.0550 0.0727  107 LEU A CD2 
726  N N   . MET A 128 ? 0.3685 0.2439 0.2528 -0.0611 -0.0354 0.0979  108 MET A N   
727  C CA  . MET A 128 ? 0.3406 0.2239 0.2161 -0.0559 -0.0285 0.0927  108 MET A CA  
728  C C   . MET A 128 ? 0.3748 0.2747 0.2578 -0.0562 -0.0183 0.0970  108 MET A C   
729  O O   . MET A 128 ? 0.3639 0.2694 0.2530 -0.0494 -0.0130 0.0898  108 MET A O   
730  C CB  . MET A 128 ? 0.3518 0.2347 0.2057 -0.0552 -0.0301 0.0945  108 MET A CB  
731  C CG  . MET A 128 ? 0.3559 0.2266 0.2028 -0.0529 -0.0408 0.0886  108 MET A CG  
732  S SD  . MET A 128 ? 0.4237 0.2908 0.2781 -0.0476 -0.0429 0.0715  108 MET A SD  
733  C CE  . MET A 128 ? 0.3256 0.1864 0.2018 -0.0509 -0.0477 0.0717  108 MET A CE  
734  N N   . LYS A 129 ? 0.3322 0.2397 0.2152 -0.0640 -0.0161 0.1088  109 LYS A N   
735  C CA  . LYS A 129 ? 0.3299 0.2585 0.2221 -0.0657 -0.0066 0.1136  109 LYS A CA  
736  C C   . LYS A 129 ? 0.3112 0.2436 0.2237 -0.0625 -0.0063 0.1097  109 LYS A C   
737  O O   . LYS A 129 ? 0.3091 0.2572 0.2290 -0.0558 0.0010  0.1066  109 LYS A O   
738  C CB  . LYS A 129 ? 0.3374 0.2723 0.2293 -0.0770 -0.0057 0.1259  109 LYS A CB  
739  C CG  . LYS A 129 ? 0.3350 0.2961 0.2387 -0.0821 0.0034  0.1326  109 LYS A CG  
740  C CD  . LYS A 129 ? 0.3561 0.3401 0.2512 -0.0770 0.0145  0.1321  109 LYS A CD  
741  C CE  . LYS A 129 ? 0.4552 0.4710 0.3677 -0.0790 0.0236  0.1359  109 LYS A CE  
742  N NZ  . LYS A 129 ? 0.5432 0.5866 0.4507 -0.0709 0.0357  0.1328  109 LYS A NZ  
743  N N   . LEU A 130 ? 0.3000 0.2184 0.2202 -0.0660 -0.0144 0.1097  110 LEU A N   
744  C CA  . LEU A 130 ? 0.2843 0.2054 0.2212 -0.0635 -0.0150 0.1069  110 LEU A CA  
745  C C   . LEU A 130 ? 0.2832 0.2025 0.2216 -0.0524 -0.0118 0.0977  110 LEU A C   
746  O O   . LEU A 130 ? 0.2776 0.2065 0.2271 -0.0476 -0.0082 0.0974  110 LEU A O   
747  C CB  . LEU A 130 ? 0.2719 0.1843 0.2174 -0.0628 -0.0221 0.0988  110 LEU A CB  
748  C CG  . LEU A 130 ? 0.2571 0.1727 0.2166 -0.0602 -0.0234 0.0947  110 LEU A CG  
749  C CD1 . LEU A 130 ? 0.2495 0.1636 0.2142 -0.0617 -0.0289 0.0891  110 LEU A CD1 
750  C CD2 . LEU A 130 ? 0.2550 0.1606 0.2139 -0.0547 -0.0239 0.0901  110 LEU A CD2 
751  N N   . PHE A 131 ? 0.2909 0.1967 0.2181 -0.0485 -0.0139 0.0900  111 PHE A N   
752  C CA  . PHE A 131 ? 0.2945 0.1937 0.2223 -0.0395 -0.0117 0.0808  111 PHE A CA  
753  C C   . PHE A 131 ? 0.3064 0.2183 0.2304 -0.0307 -0.0029 0.0780  111 PHE A C   
754  O O   . PHE A 131 ? 0.3239 0.2327 0.2523 -0.0216 0.0001  0.0724  111 PHE A O   
755  C CB  . PHE A 131 ? 0.3011 0.1831 0.2191 -0.0394 -0.0172 0.0722  111 PHE A CB  
756  C CG  . PHE A 131 ? 0.2897 0.1615 0.2151 -0.0446 -0.0245 0.0719  111 PHE A CG  
757  C CD1 . PHE A 131 ? 0.2823 0.1499 0.2188 -0.0435 -0.0243 0.0714  111 PHE A CD1 
758  C CD2 . PHE A 131 ? 0.2885 0.1561 0.2092 -0.0497 -0.0315 0.0725  111 PHE A CD2 
759  C CE1 . PHE A 131 ? 0.2753 0.1370 0.2182 -0.0486 -0.0299 0.0712  111 PHE A CE1 
760  C CE2 . PHE A 131 ? 0.2787 0.1408 0.2070 -0.0532 -0.0375 0.0710  111 PHE A CE2 
761  C CZ  . PHE A 131 ? 0.2694 0.1318 0.2098 -0.0524 -0.0357 0.0692  111 PHE A CZ  
762  N N   . GLU A 132 ? 0.3145 0.2405 0.2300 -0.0331 0.0014  0.0823  112 GLU A N   
763  C CA  . GLU A 132 ? 0.3267 0.2716 0.2393 -0.0249 0.0111  0.0801  112 GLU A CA  
764  C C   . GLU A 132 ? 0.3778 0.3433 0.3085 -0.0229 0.0158  0.0860  112 GLU A C   
765  O O   . GLU A 132 ? 0.4198 0.3978 0.3547 -0.0112 0.0224  0.0814  112 GLU A O   
766  C CB  . GLU A 132 ? 0.3386 0.2959 0.2364 -0.0300 0.0148  0.0850  112 GLU A CB  
767  C CG  . GLU A 132 ? 1.0267 0.9797 0.9047 -0.0224 0.0170  0.0746  112 GLU A CG  
768  C CD  . GLU A 132 ? 1.0360 0.9631 0.9043 -0.0237 0.0072  0.0670  112 GLU A CD  
769  O OE1 . GLU A 132 ? 1.0236 0.9372 0.9001 -0.0303 -0.0008 0.0703  112 GLU A OE1 
770  O OE2 . GLU A 132 ? 1.0403 0.9627 0.8928 -0.0179 0.0075  0.0567  112 GLU A OE2 
771  N N   . VAL A 133 ? 0.3762 0.3450 0.3177 -0.0334 0.0116  0.0953  113 VAL A N   
772  C CA  . VAL A 133 ? 0.3427 0.3331 0.3019 -0.0337 0.0143  0.1011  113 VAL A CA  
773  C C   . VAL A 133 ? 0.3252 0.3069 0.2956 -0.0257 0.0107  0.0977  113 VAL A C   
774  O O   . VAL A 133 ? 0.3584 0.3560 0.3387 -0.0156 0.0150  0.0969  113 VAL A O   
775  C CB  . VAL A 133 ? 0.3474 0.3446 0.3123 -0.0496 0.0107  0.1117  113 VAL A CB  
776  C CG1 . VAL A 133 ? 0.3850 0.4027 0.3694 -0.0509 0.0109  0.1162  113 VAL A CG1 
777  C CG2 . VAL A 133 ? 0.3328 0.3435 0.2881 -0.0574 0.0162  0.1180  113 VAL A CG2 
778  N N   . GLY A 134 ? 0.2904 0.2482 0.2588 -0.0297 0.0030  0.0961  114 GLY A N   
779  C CA  . GLY A 134 ? 0.2730 0.2201 0.2490 -0.0237 -0.0003 0.0942  114 GLY A CA  
780  C C   . GLY A 134 ? 0.3340 0.2629 0.3035 -0.0118 0.0011  0.0856  114 GLY A C   
781  O O   . GLY A 134 ? 0.3935 0.3149 0.3690 -0.0054 -0.0004 0.0858  114 GLY A O   
782  N N   . GLY A 135 ? 0.2995 0.2192 0.2556 -0.0092 0.0033  0.0780  115 GLY A N   
783  C CA  . GLY A 135 ? 0.3167 0.2172 0.2658 0.0014  0.0044  0.0684  115 GLY A CA  
784  C C   . GLY A 135 ? 0.3213 0.1958 0.2610 -0.0049 -0.0015 0.0620  115 GLY A C   
785  O O   . GLY A 135 ? 0.3084 0.1786 0.2508 -0.0155 -0.0071 0.0658  115 GLY A O   
786  N N   . SER A 136 ? 0.3415 0.1996 0.2706 0.0018  -0.0005 0.0512  116 SER A N   
787  C CA  . SER A 136 ? 0.3481 0.1846 0.2689 -0.0053 -0.0063 0.0439  116 SER A CA  
788  C C   . SER A 136 ? 0.3416 0.1627 0.2708 -0.0118 -0.0113 0.0475  116 SER A C   
789  O O   . SER A 136 ? 0.3687 0.1813 0.3036 -0.0060 -0.0101 0.0504  116 SER A O   
790  C CB  . SER A 136 ? 0.3749 0.1950 0.2832 0.0030  -0.0046 0.0305  116 SER A CB  
791  O OG  . SER A 136 ? 0.4448 0.2455 0.3466 -0.0056 -0.0110 0.0229  116 SER A OG  
792  N N   . PRO A 137 ? 0.3321 0.1503 0.2612 -0.0234 -0.0170 0.0475  117 PRO A N   
793  C CA  . PRO A 137 ? 0.3276 0.1343 0.2638 -0.0308 -0.0209 0.0502  117 PRO A CA  
794  C C   . PRO A 137 ? 0.3744 0.1555 0.3066 -0.0289 -0.0210 0.0439  117 PRO A C   
795  O O   . PRO A 137 ? 0.4954 0.2659 0.4330 -0.0340 -0.0226 0.0485  117 PRO A O   
796  C CB  . PRO A 137 ? 0.3183 0.1294 0.2533 -0.0412 -0.0266 0.0476  117 PRO A CB  
797  C CG  . PRO A 137 ? 0.3109 0.1380 0.2416 -0.0396 -0.0260 0.0497  117 PRO A CG  
798  C CD  . PRO A 137 ? 0.3246 0.1535 0.2480 -0.0296 -0.0199 0.0468  117 PRO A CD  
799  N N   . ALA A 138 ? 0.3718 0.1421 0.2936 -0.0220 -0.0193 0.0337  118 ALA A N   
800  C CA  . ALA A 138 ? 0.3998 0.1406 0.3161 -0.0198 -0.0200 0.0265  118 ALA A CA  
801  C C   . ALA A 138 ? 0.4152 0.1448 0.3351 -0.0083 -0.0166 0.0325  118 ALA A C   
802  O O   . ALA A 138 ? 0.4733 0.1752 0.3910 -0.0093 -0.0183 0.0317  118 ALA A O   
803  C CB  . ALA A 138 ? 0.4224 0.1536 0.3249 -0.0153 -0.0200 0.0116  118 ALA A CB  
804  N N   . ASN A 139 ? 0.4487 0.1996 0.3742 0.0020  -0.0124 0.0391  119 ASN A N   
805  C CA  . ASN A 139 ? 0.4260 0.1715 0.3563 0.0146  -0.0101 0.0455  119 ASN A CA  
806  C C   . ASN A 139 ? 0.4573 0.2316 0.4001 0.0150  -0.0090 0.0583  119 ASN A C   
807  O O   . ASN A 139 ? 0.4956 0.2799 0.4437 0.0281  -0.0062 0.0626  119 ASN A O   
808  C CB  . ASN A 139 ? 0.4311 0.1737 0.3549 0.0326  -0.0056 0.0365  119 ASN A CB  
809  C CG  . ASN A 139 ? 0.4152 0.1926 0.3405 0.0369  -0.0005 0.0353  119 ASN A CG  
810  O OD1 . ASN A 139 ? 0.4043 0.1922 0.3247 0.0270  -0.0011 0.0320  119 ASN A OD1 
811  N ND2 . ASN A 139 ? 0.4151 0.2121 0.3473 0.0514  0.0043  0.0388  119 ASN A ND2 
812  N N   . THR A 140 ? 0.3944 0.1827 0.3420 0.0012  -0.0116 0.0634  120 THR A N   
813  C CA  . THR A 140 ? 0.3343 0.1488 0.2928 -0.0009 -0.0117 0.0738  120 THR A CA  
814  C C   . THR A 140 ? 0.3192 0.1338 0.2816 -0.0144 -0.0162 0.0792  120 THR A C   
815  O O   . THR A 140 ? 0.3556 0.1661 0.3146 -0.0245 -0.0187 0.0746  120 THR A O   
816  C CB  . THR A 140 ? 0.3199 0.1602 0.2798 -0.0019 -0.0092 0.0730  120 THR A CB  
817  O OG1 . THR A 140 ? 0.3349 0.1789 0.2899 0.0102  -0.0039 0.0667  120 THR A OG1 
818  C CG2 . THR A 140 ? 0.3001 0.1653 0.2714 -0.0045 -0.0096 0.0828  120 THR A CG2 
819  N N   . ARG A 141 ? 0.3124 0.1343 0.2817 -0.0138 -0.0173 0.0886  121 ARG A N   
820  C CA  . ARG A 141 ? 0.2961 0.1317 0.2690 -0.0222 -0.0167 0.0865  121 ARG A CA  
821  C C   . ARG A 141 ? 0.2776 0.1367 0.2557 -0.0269 -0.0183 0.0868  121 ARG A C   
822  O O   . ARG A 141 ? 0.2697 0.1407 0.2524 -0.0238 -0.0191 0.0933  121 ARG A O   
823  C CB  . ARG A 141 ? 0.3311 0.1655 0.3046 -0.0181 -0.0158 0.0921  121 ARG A CB  
824  C CG  . ARG A 141 ? 0.4749 0.2829 0.4428 -0.0100 -0.0145 0.0938  121 ARG A CG  
825  C CD  . ARG A 141 ? 0.5436 0.3486 0.5092 -0.0057 -0.0139 0.1007  121 ARG A CD  
826  N NE  . ARG A 141 ? 0.5073 0.3269 0.4745 -0.0157 -0.0132 0.0998  121 ARG A NE  
827  C CZ  . ARG A 141 ? 0.6402 0.4537 0.6033 -0.0170 -0.0117 0.1041  121 ARG A CZ  
828  N NH1 . ARG A 141 ? 0.6654 0.4571 0.6222 -0.0089 -0.0104 0.1093  121 ARG A NH1 
829  N NH2 . ARG A 141 ? 0.6918 0.5199 0.6570 -0.0256 -0.0118 0.1036  121 ARG A NH2 
830  N N   . TYR A 142 ? 0.2632 0.1293 0.2420 -0.0343 -0.0192 0.0803  122 TYR A N   
831  C CA  . TYR A 142 ? 0.2457 0.1282 0.2278 -0.0382 -0.0216 0.0787  122 TYR A CA  
832  C C   . TYR A 142 ? 0.2345 0.1275 0.2204 -0.0419 -0.0236 0.0765  122 TYR A C   
833  O O   . TYR A 142 ? 0.2590 0.1476 0.2443 -0.0441 -0.0230 0.0743  122 TYR A O   
834  C CB  . TYR A 142 ? 0.2462 0.1246 0.2237 -0.0415 -0.0231 0.0739  122 TYR A CB  
835  C CG  . TYR A 142 ? 0.2540 0.1294 0.2268 -0.0398 -0.0224 0.0782  122 TYR A CG  
836  C CD1 . TYR A 142 ? 0.2468 0.1359 0.2217 -0.0417 -0.0228 0.0821  122 TYR A CD1 
837  C CD2 . TYR A 142 ? 0.2720 0.1293 0.2366 -0.0370 -0.0218 0.0786  122 TYR A CD2 
838  C CE1 . TYR A 142 ? 0.2553 0.1453 0.2256 -0.0418 -0.0212 0.0884  122 TYR A CE1 
839  C CE2 . TYR A 142 ? 0.2779 0.1429 0.2382 -0.0318 -0.0179 0.0776  122 TYR A CE2 
840  C CZ  . TYR A 142 ? 0.2688 0.1518 0.2322 -0.0346 -0.0171 0.0832  122 TYR A CZ  
841  O OH  . TYR A 142 ? 0.2758 0.1699 0.2350 -0.0305 -0.0120 0.0827  122 TYR A OH  
842  N N   . LEU A 143 ? 0.2244 0.1303 0.2141 -0.0434 -0.0263 0.0777  123 LEU A N   
843  C CA  . LEU A 143 ? 0.2159 0.1298 0.2079 -0.0471 -0.0298 0.0753  123 LEU A CA  
844  C C   . LEU A 143 ? 0.2098 0.1288 0.2024 -0.0496 -0.0336 0.0729  123 LEU A C   
845  O O   . LEU A 143 ? 0.2096 0.1333 0.2039 -0.0500 -0.0341 0.0761  123 LEU A O   
846  C CB  . LEU A 143 ? 0.2155 0.1368 0.2102 -0.0468 -0.0310 0.0806  123 LEU A CB  
847  C CG  . LEU A 143 ? 0.2284 0.1581 0.2245 -0.0512 -0.0358 0.0797  123 LEU A CG  
848  C CD1 . LEU A 143 ? 0.2105 0.1377 0.2046 -0.0542 -0.0356 0.0770  123 LEU A CD1 
849  C CD2 . LEU A 143 ? 0.2108 0.1494 0.2089 -0.0515 -0.0381 0.0865  123 LEU A CD2 
850  N N   . PHE A 144 ? 0.2076 0.1247 0.1986 -0.0518 -0.0368 0.0682  124 PHE A N   
851  C CA  . PHE A 144 ? 0.2066 0.1236 0.1962 -0.0534 -0.0413 0.0662  124 PHE A CA  
852  C C   . PHE A 144 ? 0.2046 0.1247 0.1958 -0.0560 -0.0466 0.0654  124 PHE A C   
853  O O   . PHE A 144 ? 0.2041 0.1246 0.1958 -0.0573 -0.0477 0.0644  124 PHE A O   
854  C CB  . PHE A 144 ? 0.2103 0.1200 0.1954 -0.0533 -0.0430 0.0628  124 PHE A CB  
855  C CG  . PHE A 144 ? 0.2159 0.1209 0.1968 -0.0520 -0.0397 0.0643  124 PHE A CG  
856  C CD1 . PHE A 144 ? 0.2204 0.1202 0.1999 -0.0509 -0.0357 0.0644  124 PHE A CD1 
857  C CD2 . PHE A 144 ? 0.2201 0.1242 0.1974 -0.0527 -0.0406 0.0663  124 PHE A CD2 
858  C CE1 . PHE A 144 ? 0.2289 0.1223 0.2030 -0.0500 -0.0335 0.0664  124 PHE A CE1 
859  C CE2 . PHE A 144 ? 0.2276 0.1280 0.1996 -0.0524 -0.0375 0.0693  124 PHE A CE2 
860  C CZ  . PHE A 144 ? 0.2320 0.1269 0.2020 -0.0508 -0.0342 0.0693  124 PHE A CZ  
861  N N   . LEU A 145 ? 0.2060 0.1274 0.1977 -0.0580 -0.0502 0.0664  125 LEU A N   
862  C CA  . LEU A 145 ? 0.2081 0.1292 0.1999 -0.0611 -0.0563 0.0658  125 LEU A CA  
863  C C   . LEU A 145 ? 0.2538 0.1646 0.2418 -0.0612 -0.0628 0.0616  125 LEU A C   
864  O O   . LEU A 145 ? 0.2276 0.1335 0.2144 -0.0637 -0.0693 0.0601  125 LEU A O   
865  C CB  . LEU A 145 ? 0.2107 0.1356 0.2044 -0.0648 -0.0590 0.0689  125 LEU A CB  
866  C CG  . LEU A 145 ? 0.2067 0.1424 0.2051 -0.0648 -0.0551 0.0746  125 LEU A CG  
867  C CD1 . LEU A 145 ? 0.2107 0.1517 0.2121 -0.0708 -0.0598 0.0783  125 LEU A CD1 
868  C CD2 . LEU A 145 ? 0.2048 0.1443 0.2030 -0.0638 -0.0541 0.0767  125 LEU A CD2 
869  N N   . GLY A 146 ? 0.2537 0.1592 0.2392 -0.0586 -0.0623 0.0596  126 GLY A N   
870  C CA  . GLY A 146 ? 0.2509 0.1452 0.2329 -0.0573 -0.0699 0.0564  126 GLY A CA  
871  C C   . GLY A 146 ? 0.2353 0.1192 0.2116 -0.0558 -0.0733 0.0563  126 GLY A C   
872  O O   . GLY A 146 ? 0.3226 0.2096 0.2979 -0.0570 -0.0686 0.0592  126 GLY A O   
873  N N   . ASP A 147 ? 0.2473 0.1178 0.2198 -0.0529 -0.0820 0.0533  127 ASP A N   
874  C CA  . ASP A 147 ? 0.2626 0.1196 0.2277 -0.0504 -0.0866 0.0536  127 ASP A CA  
875  C C   . ASP A 147 ? 0.2722 0.1307 0.2331 -0.0496 -0.0830 0.0568  127 ASP A C   
876  O O   . ASP A 147 ? 0.3011 0.1590 0.2584 -0.0520 -0.0793 0.0606  127 ASP A O   
877  C CB  . ASP A 147 ? 0.2735 0.1262 0.2368 -0.0544 -0.0865 0.0551  127 ASP A CB  
878  C CG  . ASP A 147 ? 0.3451 0.1838 0.3067 -0.0531 -0.0955 0.0500  127 ASP A CG  
879  O OD1 . ASP A 147 ? 0.3426 0.1760 0.3049 -0.0479 -0.1014 0.0449  127 ASP A OD1 
880  O OD2 . ASP A 147 ? 0.4153 0.2471 0.3747 -0.0573 -0.0973 0.0505  127 ASP A OD2 
881  N N   . TYR A 148 ? 0.2601 0.1196 0.2211 -0.0470 -0.0851 0.0556  128 TYR A N   
882  C CA  . TYR A 148 ? 0.2625 0.1221 0.2180 -0.0468 -0.0830 0.0582  128 TYR A CA  
883  C C   . TYR A 148 ? 0.2814 0.1268 0.2273 -0.0421 -0.0911 0.0594  128 TYR A C   
884  O O   . TYR A 148 ? 0.3169 0.1599 0.2550 -0.0424 -0.0897 0.0631  128 TYR A O   
885  C CB  . TYR A 148 ? 0.2550 0.1200 0.2140 -0.0476 -0.0830 0.0568  128 TYR A CB  
886  C CG  . TYR A 148 ? 0.2598 0.1367 0.2280 -0.0512 -0.0760 0.0556  128 TYR A CG  
887  C CD1 . TYR A 148 ? 0.2326 0.1177 0.2026 -0.0528 -0.0666 0.0575  128 TYR A CD1 
888  C CD2 . TYR A 148 ? 0.2370 0.1162 0.2119 -0.0528 -0.0793 0.0533  128 TYR A CD2 
889  C CE1 . TYR A 148 ? 0.2240 0.1181 0.2006 -0.0543 -0.0612 0.0572  128 TYR A CE1 
890  C CE2 . TYR A 148 ? 0.2267 0.1167 0.2080 -0.0564 -0.0726 0.0536  128 TYR A CE2 
891  C CZ  . TYR A 148 ? 0.2201 0.1167 0.2015 -0.0562 -0.0639 0.0557  128 TYR A CZ  
892  O OH  . TYR A 148 ? 0.2158 0.1208 0.2019 -0.0580 -0.0585 0.0569  128 TYR A OH  
893  N N   . VAL A 149 ? 0.2916 0.1265 0.2371 -0.0367 -0.1000 0.0562  129 VAL A N   
894  C CA  . VAL A 149 ? 0.3121 0.1330 0.2483 -0.0294 -0.1086 0.0568  129 VAL A CA  
895  C C   . VAL A 149 ? 0.3292 0.1357 0.2609 -0.0284 -0.1114 0.0568  129 VAL A C   
896  O O   . VAL A 149 ? 0.3245 0.1328 0.2605 -0.0341 -0.1073 0.0564  129 VAL A O   
897  C CB  . VAL A 149 ? 0.3200 0.1394 0.2584 -0.0188 -0.1200 0.0519  129 VAL A CB  
898  C CG1 . VAL A 149 ? 0.2994 0.1398 0.2445 -0.0215 -0.1156 0.0493  129 VAL A CG1 
899  C CG2 . VAL A 149 ? 0.3132 0.1352 0.2604 -0.0146 -0.1223 0.0440  129 VAL A CG2 
900  N N   . ASP A 150 ? 0.3514 0.1435 0.2741 -0.0207 -0.1191 0.0575  130 ASP A N   
901  C CA  . ASP A 150 ? 0.3756 0.1488 0.2913 -0.0191 -0.1232 0.0584  130 ASP A CA  
902  C C   . ASP A 150 ? 0.3985 0.1699 0.3097 -0.0299 -0.1154 0.0665  130 ASP A C   
903  O O   . ASP A 150 ? 0.3917 0.1786 0.3085 -0.0384 -0.1061 0.0690  130 ASP A O   
904  C CB  . ASP A 150 ? 0.4006 0.1659 0.3211 -0.0158 -0.1283 0.0509  130 ASP A CB  
905  C CG  . ASP A 150 ? 0.4631 0.2246 0.3858 -0.0001 -0.1392 0.0421  130 ASP A CG  
906  O OD1 . ASP A 150 ? 0.4841 0.2429 0.4018 0.0097  -0.1450 0.0424  130 ASP A OD1 
907  O OD2 . ASP A 150 ? 0.4737 0.2367 0.4035 0.0037  -0.1422 0.0345  130 ASP A OD2 
908  N N   . ARG A 151 ? 0.4365 0.1887 0.3375 -0.0282 -0.1199 0.0707  131 ARG A N   
909  C CA  . ARG A 151 ? 0.4377 0.1833 0.3334 -0.0381 -0.1148 0.0790  131 ARG A CA  
910  C C   . ARG A 151 ? 0.4593 0.2104 0.3475 -0.0413 -0.1093 0.0880  131 ARG A C   
911  O O   . ARG A 151 ? 0.4886 0.2243 0.3654 -0.0418 -0.1113 0.0957  131 ARG A O   
912  C CB  . ARG A 151 ? 0.4103 0.1657 0.3153 -0.0485 -0.1084 0.0781  131 ARG A CB  
913  C CG  . ARG A 151 ? 0.4104 0.1591 0.3207 -0.0460 -0.1143 0.0696  131 ARG A CG  
914  C CD  . ARG A 151 ? 0.5220 0.2449 0.4236 -0.0364 -0.1256 0.0662  131 ARG A CD  
915  N NE  . ARG A 151 ? 0.5789 0.2809 0.4718 -0.0421 -0.1274 0.0724  131 ARG A NE  
916  C CZ  . ARG A 151 ? 0.6236 0.3143 0.5174 -0.0483 -0.1295 0.0704  131 ARG A CZ  
917  N NH1 . ARG A 151 ? 0.6164 0.3156 0.5187 -0.0487 -0.1301 0.0621  131 ARG A NH1 
918  N NH2 . ARG A 151 ? 0.6497 0.3197 0.5352 -0.0547 -0.1314 0.0769  131 ARG A NH2 
919  N N   . GLY A 152 ? 0.4036 0.1749 0.2967 -0.0431 -0.1026 0.0874  132 GLY A N   
920  C CA  . GLY A 152 ? 0.4079 0.1846 0.2924 -0.0445 -0.0983 0.0946  132 GLY A CA  
921  C C   . GLY A 152 ? 0.4349 0.2093 0.3125 -0.0343 -0.1057 0.0926  132 GLY A C   
922  O O   . GLY A 152 ? 0.4572 0.2335 0.3413 -0.0273 -0.1118 0.0846  132 GLY A O   
923  N N   . TYR A 153 ? 0.5002 0.2718 0.3645 -0.0328 -0.1060 0.1000  133 TYR A N   
924  C CA  A TYR A 153 ? 0.4741 0.2438 0.3305 -0.0220 -0.1150 0.0984  133 TYR A CA  
925  C CA  B TYR A 153 ? 0.4740 0.2439 0.3305 -0.0220 -0.1149 0.0983  133 TYR A CA  
926  C C   . TYR A 153 ? 0.4495 0.2359 0.3051 -0.0218 -0.1133 0.0958  133 TYR A C   
927  O O   . TYR A 153 ? 0.4914 0.2791 0.3362 -0.0151 -0.1194 0.0970  133 TYR A O   
928  C CB  A TYR A 153 ? 0.4968 0.2512 0.3369 -0.0173 -0.1199 0.1074  133 TYR A CB  
929  C CB  B TYR A 153 ? 0.4968 0.2508 0.3373 -0.0166 -0.1206 0.1068  133 TYR A CB  
930  C CG  A TYR A 153 ? 0.4960 0.2291 0.3351 -0.0131 -0.1264 0.1079  133 TYR A CG  
931  C CG  B TYR A 153 ? 0.5223 0.2689 0.3528 -0.0254 -0.1138 0.1187  133 TYR A CG  
932  C CD1 A TYR A 153 ? 0.4898 0.2172 0.3388 -0.0193 -0.1239 0.1044  133 TYR A CD1 
933  C CD1 B TYR A 153 ? 0.5387 0.2972 0.3612 -0.0311 -0.1061 0.1252  133 TYR A CD1 
934  C CD2 A TYR A 153 ? 0.5267 0.2448 0.3540 -0.0021 -0.1359 0.1118  133 TYR A CD2 
935  C CD2 B TYR A 153 ? 0.5324 0.2590 0.3597 -0.0274 -0.1159 0.1238  133 TYR A CD2 
936  C CE1 A TYR A 153 ? 0.5196 0.2250 0.3659 -0.0156 -0.1306 0.1041  133 TYR A CE1 
937  C CE1 B TYR A 153 ? 0.5133 0.2667 0.3263 -0.0390 -0.0998 0.1369  133 TYR A CE1 
938  C CE2 A TYR A 153 ? 0.5518 0.2472 0.3771 0.0025  -0.1423 0.1120  133 TYR A CE2 
939  C CE2 B TYR A 153 ? 0.5496 0.2692 0.3676 -0.0364 -0.1102 0.1357  133 TYR A CE2 
940  C CZ  A TYR A 153 ? 0.5459 0.2341 0.3804 -0.0047 -0.1397 0.1078  133 TYR A CZ  
941  C CZ  B TYR A 153 ? 0.5402 0.2744 0.3515 -0.0421 -0.1018 0.1425  133 TYR A CZ  
942  O OH  A TYR A 153 ? 0.5733 0.2372 0.4047 -0.0005 -0.1467 0.1069  133 TYR A OH  
943  O OH  B TYR A 153 ? 0.5610 0.2896 0.3628 -0.0512 -0.0959 0.1549  133 TYR A OH  
944  N N   . PHE A 154 ? 0.3968 0.1955 0.2631 -0.0288 -0.1059 0.0918  134 PHE A N   
945  C CA  . PHE A 154 ? 0.4094 0.2203 0.2756 -0.0290 -0.1055 0.0881  134 PHE A CA  
946  C C   . PHE A 154 ? 0.4298 0.2482 0.3122 -0.0305 -0.1051 0.0801  134 PHE A C   
947  O O   . PHE A 154 ? 0.4757 0.3029 0.3622 -0.0356 -0.0995 0.0784  134 PHE A O   
948  C CB  . PHE A 154 ? 0.3832 0.2008 0.2416 -0.0360 -0.0961 0.0936  134 PHE A CB  
949  C CG  . PHE A 154 ? 0.4081 0.2197 0.2510 -0.0360 -0.0950 0.1030  134 PHE A CG  
950  C CD1 . PHE A 154 ? 0.4268 0.2374 0.2526 -0.0301 -0.1014 0.1055  134 PHE A CD1 
951  C CD2 . PHE A 154 ? 0.4155 0.2230 0.2603 -0.0420 -0.0884 0.1096  134 PHE A CD2 
952  C CE1 . PHE A 154 ? 0.4526 0.2580 0.2629 -0.0300 -0.1002 0.1155  134 PHE A CE1 
953  C CE2 . PHE A 154 ? 0.4417 0.2430 0.2717 -0.0430 -0.0873 0.1197  134 PHE A CE2 
954  C CZ  . PHE A 154 ? 0.4606 0.2605 0.2730 -0.0368 -0.0928 0.1232  134 PHE A CZ  
955  N N   . SER A 155 ? 0.3973 0.2112 0.2877 -0.0253 -0.1113 0.0757  135 SER A N   
956  C CA  . SER A 155 ? 0.3381 0.1589 0.2426 -0.0261 -0.1116 0.0692  135 SER A CA  
957  C C   . SER A 155 ? 0.3771 0.2072 0.2834 -0.0243 -0.1172 0.0657  135 SER A C   
958  O O   . SER A 155 ? 0.4102 0.2507 0.3261 -0.0307 -0.1100 0.0623  135 SER A O   
959  C CB  . SER A 155 ? 0.3448 0.1577 0.2543 -0.0187 -0.1190 0.0651  135 SER A CB  
960  O OG  . SER A 155 ? 0.4045 0.2077 0.3127 -0.0224 -0.1148 0.0678  135 SER A OG  
961  N N   . ILE A 156 ? 0.3416 0.1756 0.2426 -0.0155 -0.1270 0.0627  136 ILE A N   
962  C CA  . ILE A 156 ? 0.3301 0.1874 0.2408 -0.0151 -0.1273 0.0519  136 ILE A CA  
963  C C   . ILE A 156 ? 0.3330 0.1949 0.2393 -0.0243 -0.1190 0.0518  136 ILE A C   
964  O O   . ILE A 156 ? 0.3424 0.2186 0.2601 -0.0293 -0.1149 0.0436  136 ILE A O   
965  C CB  . ILE A 156 ? 0.3445 0.2100 0.2513 -0.0037 -0.1397 0.0476  136 ILE A CB  
966  C CG1 . ILE A 156 ? 0.3318 0.2253 0.2528 -0.0053 -0.1404 0.0351  136 ILE A CG1 
967  C CG2 . ILE A 156 ? 0.3852 0.2396 0.2702 -0.0019 -0.1437 0.0558  136 ILE A CG2 
968  C CD1 . ILE A 156 ? 0.3110 0.2190 0.2527 -0.0099 -0.1343 0.0279  136 ILE A CD1 
969  N N   . GLU A 157 ? 0.3373 0.1866 0.2271 -0.0266 -0.1163 0.0608  137 GLU A N   
970  C CA  . GLU A 157 ? 0.3345 0.1879 0.2195 -0.0333 -0.1079 0.0596  137 GLU A CA  
971  C C   . GLU A 157 ? 0.3168 0.1705 0.2141 -0.0405 -0.0974 0.0594  137 GLU A C   
972  O O   . GLU A 157 ? 0.3403 0.2005 0.2422 -0.0445 -0.0919 0.0531  137 GLU A O   
973  C CB  . GLU A 157 ? 0.3536 0.1973 0.2176 -0.0336 -0.1064 0.0694  137 GLU A CB  
974  C CG  . GLU A 157 ? 0.3742 0.2193 0.2222 -0.0268 -0.1161 0.0695  137 GLU A CG  
975  C CD  . GLU A 157 ? 0.5110 0.3441 0.3535 -0.0195 -0.1252 0.0772  137 GLU A CD  
976  O OE1 . GLU A 157 ? 0.4805 0.3077 0.3363 -0.0204 -0.1215 0.0782  137 GLU A OE1 
977  O OE2 . GLU A 157 ? 0.5733 0.4075 0.4034 -0.0125 -0.1321 0.0785  137 GLU A OE2 
978  N N   . CYS A 158 ? 0.3124 0.1579 0.2141 -0.0419 -0.0953 0.0662  138 CYS A N   
979  C CA  . CYS A 158 ? 0.2961 0.1440 0.2100 -0.0475 -0.0870 0.0663  138 CYS A CA  
980  C C   . CYS A 158 ? 0.2819 0.1414 0.2109 -0.0482 -0.0868 0.0569  138 CYS A C   
981  O O   . CYS A 158 ? 0.2916 0.1550 0.2263 -0.0526 -0.0800 0.0544  138 CYS A O   
982  C CB  . CYS A 158 ? 0.2904 0.1400 0.2120 -0.0471 -0.0833 0.0680  138 CYS A CB  
983  S SG  . CYS A 158 ? 0.3424 0.1911 0.2559 -0.0487 -0.0767 0.0748  138 CYS A SG  
984  N N   . VAL A 159 ? 0.2813 0.1464 0.2163 -0.0435 -0.0941 0.0521  139 VAL A N   
985  C CA  . VAL A 159 ? 0.2692 0.1495 0.2189 -0.0453 -0.0933 0.0437  139 VAL A CA  
986  C C   . VAL A 159 ? 0.2703 0.1580 0.2203 -0.0499 -0.0916 0.0375  139 VAL A C   
987  O O   . VAL A 159 ? 0.2631 0.1540 0.2207 -0.0567 -0.0853 0.0352  139 VAL A O   
988  C CB  . VAL A 159 ? 0.2707 0.1605 0.2269 -0.0377 -0.1018 0.0382  139 VAL A CB  
989  C CG1 . VAL A 159 ? 0.2602 0.1724 0.2319 -0.0409 -0.1006 0.0289  139 VAL A CG1 
990  C CG2 . VAL A 159 ? 0.2713 0.1518 0.2282 -0.0339 -0.1031 0.0418  139 VAL A CG2 
991  N N   . LEU A 160 ? 0.2826 0.1712 0.2228 -0.0466 -0.0976 0.0350  140 LEU A N   
992  C CA  . LEU A 160 ? 0.2871 0.1822 0.2267 -0.0513 -0.0975 0.0271  140 LEU A CA  
993  C C   . LEU A 160 ? 0.2878 0.1720 0.2232 -0.0571 -0.0883 0.0286  140 LEU A C   
994  O O   . LEU A 160 ? 0.2864 0.1724 0.2287 -0.0638 -0.0850 0.0228  140 LEU A O   
995  C CB  . LEU A 160 ? 0.3029 0.2004 0.2294 -0.0458 -0.1060 0.0248  140 LEU A CB  
996  C CG  . LEU A 160 ? 0.3047 0.2184 0.2382 -0.0396 -0.1167 0.0196  140 LEU A CG  
997  C CD1 . LEU A 160 ? 0.3231 0.2378 0.2408 -0.0331 -0.1257 0.0190  140 LEU A CD1 
998  C CD2 . LEU A 160 ? 0.2957 0.2289 0.2469 -0.0467 -0.1164 0.0093  140 LEU A CD2 
999  N N   . TYR A 161 ? 0.2921 0.1650 0.2164 -0.0545 -0.0843 0.0365  141 TYR A N   
1000 C CA  . TYR A 161 ? 0.2946 0.1593 0.2147 -0.0571 -0.0756 0.0374  141 TYR A CA  
1001 C C   . TYR A 161 ? 0.2967 0.1596 0.2298 -0.0612 -0.0690 0.0393  141 TYR A C   
1002 O O   . TYR A 161 ? 0.2926 0.1505 0.2276 -0.0645 -0.0647 0.0353  141 TYR A O   
1003 C CB  . TYR A 161 ? 0.3022 0.1611 0.2090 -0.0536 -0.0722 0.0456  141 TYR A CB  
1004 C CG  . TYR A 161 ? 0.3081 0.1626 0.2095 -0.0537 -0.0637 0.0444  141 TYR A CG  
1005 C CD1 . TYR A 161 ? 0.3221 0.1750 0.2142 -0.0530 -0.0640 0.0352  141 TYR A CD1 
1006 C CD2 . TYR A 161 ? 0.3015 0.1546 0.2074 -0.0536 -0.0560 0.0514  141 TYR A CD2 
1007 C CE1 . TYR A 161 ? 0.3322 0.1799 0.2187 -0.0508 -0.0562 0.0325  141 TYR A CE1 
1008 C CE2 . TYR A 161 ? 0.3195 0.1705 0.2216 -0.0511 -0.0484 0.0496  141 TYR A CE2 
1009 C CZ  . TYR A 161 ? 0.3837 0.2310 0.2757 -0.0491 -0.0482 0.0399  141 TYR A CZ  
1010 O OH  . TYR A 161 ? 0.4558 0.3000 0.3435 -0.0444 -0.0407 0.0368  141 TYR A OH  
1011 N N   . LEU A 162 ? 0.2709 0.1363 0.2118 -0.0607 -0.0690 0.0452  142 LEU A N   
1012 C CA  . LEU A 162 ? 0.2605 0.1262 0.2122 -0.0640 -0.0635 0.0478  142 LEU A CA  
1013 C C   . LEU A 162 ? 0.2582 0.1295 0.2196 -0.0696 -0.0638 0.0418  142 LEU A C   
1014 O O   . LEU A 162 ? 0.2583 0.1252 0.2236 -0.0731 -0.0581 0.0428  142 LEU A O   
1015 C CB  . LEU A 162 ? 0.2506 0.1211 0.2075 -0.0616 -0.0640 0.0530  142 LEU A CB  
1016 C CG  . LEU A 162 ? 0.2497 0.1218 0.2023 -0.0572 -0.0595 0.0576  142 LEU A CG  
1017 C CD1 . LEU A 162 ? 0.2416 0.1206 0.2004 -0.0550 -0.0603 0.0585  142 LEU A CD1 
1018 C CD2 . LEU A 162 ? 0.2477 0.1216 0.2021 -0.0562 -0.0506 0.0589  142 LEU A CD2 
1019 N N   . TRP A 163 ? 0.2579 0.1404 0.2233 -0.0701 -0.0701 0.0358  143 TRP A N   
1020 C CA  . TRP A 163 ? 0.2570 0.1495 0.2330 -0.0774 -0.0703 0.0299  143 TRP A CA  
1021 C C   . TRP A 163 ? 0.2699 0.1533 0.2420 -0.0836 -0.0687 0.0247  143 TRP A C   
1022 O O   . TRP A 163 ? 0.2731 0.1554 0.2518 -0.0922 -0.0655 0.0233  143 TRP A O   
1023 C CB  . TRP A 163 ? 0.2550 0.1660 0.2372 -0.0753 -0.0780 0.0236  143 TRP A CB  
1024 C CG  . TRP A 163 ? 0.2441 0.1692 0.2371 -0.0735 -0.0780 0.0246  143 TRP A CG  
1025 C CD1 . TRP A 163 ? 0.2403 0.1866 0.2461 -0.0777 -0.0787 0.0192  143 TRP A CD1 
1026 C CD2 . TRP A 163 ? 0.2379 0.1585 0.2292 -0.0672 -0.0772 0.0303  143 TRP A CD2 
1027 N NE1 . TRP A 163 ? 0.2321 0.1877 0.2435 -0.0728 -0.0779 0.0208  143 TRP A NE1 
1028 C CE2 . TRP A 163 ? 0.2312 0.1697 0.2334 -0.0665 -0.0776 0.0271  143 TRP A CE2 
1029 C CE3 . TRP A 163 ? 0.2574 0.1621 0.2395 -0.0630 -0.0761 0.0374  143 TRP A CE3 
1030 C CZ2 . TRP A 163 ? 0.2572 0.1954 0.2598 -0.0608 -0.0778 0.0294  143 TRP A CZ2 
1031 C CZ3 . TRP A 163 ? 0.2803 0.1847 0.2642 -0.0592 -0.0766 0.0405  143 TRP A CZ3 
1032 C CH2 . TRP A 163 ? 0.2822 0.2019 0.2755 -0.0577 -0.0777 0.0359  143 TRP A CH2 
1033 N N   . VAL A 164 ? 0.3413 0.2173 0.3014 -0.0798 -0.0711 0.0214  144 VAL A N   
1034 C CA  . VAL A 164 ? 0.3155 0.1799 0.2696 -0.0846 -0.0698 0.0147  144 VAL A CA  
1035 C C   . VAL A 164 ? 0.3007 0.1473 0.2534 -0.0851 -0.0616 0.0196  144 VAL A C   
1036 O O   . VAL A 164 ? 0.3116 0.1478 0.2669 -0.0924 -0.0595 0.0164  144 VAL A O   
1037 C CB  . VAL A 164 ? 0.3129 0.1749 0.2519 -0.0792 -0.0740 0.0093  144 VAL A CB  
1038 C CG1 . VAL A 164 ? 0.3517 0.1963 0.2811 -0.0805 -0.0701 0.0036  144 VAL A CG1 
1039 C CG2 . VAL A 164 ? 0.3136 0.1913 0.2543 -0.0814 -0.0835 0.0010  144 VAL A CG2 
1040 N N   . LEU A 165 ? 0.2938 0.1371 0.2430 -0.0777 -0.0573 0.0278  145 LEU A N   
1041 C CA  . LEU A 165 ? 0.2968 0.1273 0.2463 -0.0760 -0.0503 0.0331  145 LEU A CA  
1042 C C   . LEU A 165 ? 0.2887 0.1282 0.2511 -0.0783 -0.0456 0.0353  145 LEU A C   
1043 O O   . LEU A 165 ? 0.2987 0.1285 0.2621 -0.0782 -0.0406 0.0351  145 LEU A O   
1044 C CB  . LEU A 165 ? 0.2880 0.1220 0.2350 -0.0680 -0.0469 0.0414  145 LEU A CB  
1045 C CG  . LEU A 165 ? 0.2950 0.1301 0.2298 -0.0621 -0.0472 0.0395  145 LEU A CG  
1046 C CD1 . LEU A 165 ? 0.2866 0.1280 0.2212 -0.0573 -0.0437 0.0489  145 LEU A CD1 
1047 C CD2 . LEU A 165 ? 0.3140 0.1369 0.2396 -0.0591 -0.0442 0.0322  145 LEU A CD2 
1048 N N   . LYS A 166 ? 0.2740 0.1303 0.2447 -0.0801 -0.0475 0.0374  146 LYS A N   
1049 C CA  . LYS A 166 ? 0.2694 0.1347 0.2496 -0.0837 -0.0435 0.0393  146 LYS A CA  
1050 C C   . LYS A 166 ? 0.2842 0.1445 0.2669 -0.0932 -0.0431 0.0339  146 LYS A C   
1051 O O   . LYS A 166 ? 0.3064 0.1613 0.2915 -0.0949 -0.0373 0.0365  146 LYS A O   
1052 C CB  . LYS A 166 ? 0.2555 0.1379 0.2424 -0.0854 -0.0473 0.0409  146 LYS A CB  
1053 C CG  . LYS A 166 ? 0.2512 0.1439 0.2455 -0.0888 -0.0429 0.0444  146 LYS A CG  
1054 C CD  . LYS A 166 ? 0.2506 0.1382 0.2424 -0.0821 -0.0360 0.0503  146 LYS A CD  
1055 C CE  . LYS A 166 ? 0.2521 0.1471 0.2483 -0.0871 -0.0322 0.0543  146 LYS A CE  
1056 N NZ  . LYS A 166 ? 0.2519 0.1443 0.2454 -0.0807 -0.0274 0.0607  146 LYS A NZ  
1057 N N   . ILE A 167 ? 0.2904 0.1525 0.2725 -0.0996 -0.0499 0.0263  147 ILE A N   
1058 C CA  . ILE A 167 ? 0.3065 0.1653 0.2914 -0.1095 -0.0503 0.0193  147 ILE A CA  
1059 C C   . ILE A 167 ? 0.3267 0.1609 0.3038 -0.1078 -0.0461 0.0176  147 ILE A C   
1060 O O   . ILE A 167 ? 0.3412 0.1685 0.3221 -0.1142 -0.0427 0.0164  147 ILE A O   
1061 C CB  . ILE A 167 ? 0.3101 0.1777 0.2948 -0.1153 -0.0598 0.0096  147 ILE A CB  
1062 C CG1 . ILE A 167 ? 0.2933 0.1861 0.2879 -0.1167 -0.0651 0.0103  147 ILE A CG1 
1063 C CG2 . ILE A 167 ? 0.3284 0.1942 0.3166 -0.1258 -0.0603 0.0010  147 ILE A CG2 
1064 C CD1 . ILE A 167 ? 0.2954 0.2023 0.2903 -0.1174 -0.0752 0.0009  147 ILE A CD1 
1065 N N   . LEU A 168 ? 0.3486 0.1689 0.3147 -0.0993 -0.0468 0.0175  148 LEU A N   
1066 C CA  . LEU A 168 ? 0.3523 0.1478 0.3099 -0.0962 -0.0439 0.0145  148 LEU A CA  
1067 C C   . LEU A 168 ? 0.3659 0.1541 0.3266 -0.0895 -0.0362 0.0233  148 LEU A C   
1068 O O   . LEU A 168 ? 0.4040 0.1721 0.3619 -0.0890 -0.0336 0.0217  148 LEU A O   
1069 C CB  . LEU A 168 ? 0.3595 0.1422 0.3021 -0.0895 -0.0473 0.0108  148 LEU A CB  
1070 C CG  . LEU A 168 ? 0.3718 0.1521 0.3051 -0.0954 -0.0557 -0.0012 148 LEU A CG  
1071 C CD1 . LEU A 168 ? 0.3763 0.1553 0.2959 -0.0826 -0.0541 -0.0039 148 LEU A CD1 
1072 C CD2 . LEU A 168 ? 0.3945 0.1641 0.3287 -0.1030 -0.0564 -0.0113 148 LEU A CD2 
1073 N N   . TYR A 169 ? 0.3320 0.1355 0.2976 -0.0838 -0.0334 0.0321  149 TYR A N   
1074 C CA  . TYR A 169 ? 0.3321 0.1315 0.2995 -0.0764 -0.0274 0.0402  149 TYR A CA  
1075 C C   . TYR A 169 ? 0.3146 0.1336 0.2902 -0.0777 -0.0248 0.0469  149 TYR A C   
1076 O O   . TYR A 169 ? 0.3007 0.1293 0.2773 -0.0705 -0.0232 0.0524  149 TYR A O   
1077 C CB  . TYR A 169 ? 0.3274 0.1242 0.2891 -0.0659 -0.0269 0.0433  149 TYR A CB  
1078 C CG  . TYR A 169 ? 0.3456 0.1230 0.2949 -0.0641 -0.0302 0.0361  149 TYR A CG  
1079 C CD1 . TYR A 169 ? 0.3731 0.1248 0.3155 -0.0619 -0.0293 0.0312  149 TYR A CD1 
1080 C CD2 . TYR A 169 ? 0.3394 0.1215 0.2814 -0.0641 -0.0345 0.0338  149 TYR A CD2 
1081 C CE1 . TYR A 169 ? 0.3942 0.1252 0.3214 -0.0590 -0.0323 0.0220  149 TYR A CE1 
1082 C CE2 . TYR A 169 ? 0.3939 0.1629 0.3224 -0.0605 -0.0360 0.0255  149 TYR A CE2 
1083 C CZ  . TYR A 169 ? 0.3952 0.1402 0.3164 -0.0573 -0.0345 0.0184  149 TYR A CZ  
1084 O OH  . TYR A 169 ? 0.4016 0.1409 0.3103 -0.0507 -0.0344 0.0072  149 TYR A OH  
1085 N N   . PRO A 170 ? 0.3177 0.1427 0.2988 -0.0874 -0.0247 0.0460  150 PRO A N   
1086 C CA  . PRO A 170 ? 0.3036 0.1473 0.2905 -0.0897 -0.0233 0.0512  150 PRO A CA  
1087 C C   . PRO A 170 ? 0.3039 0.1457 0.2894 -0.0831 -0.0185 0.0596  150 PRO A C   
1088 O O   . PRO A 170 ? 0.3667 0.2240 0.3544 -0.0822 -0.0184 0.0636  150 PRO A O   
1089 C CB  . PRO A 170 ? 0.3155 0.1612 0.3075 -0.1025 -0.0230 0.0492  150 PRO A CB  
1090 C CG  . PRO A 170 ? 0.3394 0.1623 0.3279 -0.1047 -0.0220 0.0459  150 PRO A CG  
1091 C CD  . PRO A 170 ? 0.3378 0.1520 0.3198 -0.0975 -0.0256 0.0403  150 PRO A CD  
1092 N N   . SER A 171 ? 0.3214 0.1439 0.3026 -0.0784 -0.0153 0.0623  151 SER A N   
1093 C CA  . SER A 171 ? 0.3714 0.1922 0.3505 -0.0721 -0.0115 0.0712  151 SER A CA  
1094 C C   . SER A 171 ? 0.3697 0.1871 0.3454 -0.0600 -0.0114 0.0736  151 SER A C   
1095 O O   . SER A 171 ? 0.3436 0.1565 0.3164 -0.0535 -0.0092 0.0808  151 SER A O   
1096 C CB  . SER A 171 ? 0.3766 0.1787 0.3535 -0.0758 -0.0079 0.0759  151 SER A CB  
1097 O OG  . SER A 171 ? 0.4469 0.2248 0.4201 -0.0706 -0.0077 0.0741  151 SER A OG  
1098 N N   . THR A 172 ? 0.3726 0.1923 0.3480 -0.0572 -0.0142 0.0683  152 THR A N   
1099 C CA  . THR A 172 ? 0.3394 0.1592 0.3126 -0.0474 -0.0142 0.0714  152 THR A CA  
1100 C C   . THR A 172 ? 0.3296 0.1674 0.3050 -0.0474 -0.0171 0.0691  152 THR A C   
1101 O O   . THR A 172 ? 0.3525 0.1959 0.3278 -0.0413 -0.0172 0.0728  152 THR A O   
1102 C CB  . THR A 172 ? 0.3986 0.1958 0.3664 -0.0419 -0.0143 0.0694  152 THR A CB  
1103 O OG1 . THR A 172 ? 0.4931 0.2853 0.4582 -0.0478 -0.0176 0.0607  152 THR A OG1 
1104 C CG2 . THR A 172 ? 0.3538 0.1298 0.3194 -0.0401 -0.0119 0.0722  152 THR A CG2 
1105 N N   . LEU A 173 ? 0.2769 0.1231 0.2543 -0.0542 -0.0201 0.0637  153 LEU A N   
1106 C CA  . LEU A 173 ? 0.2596 0.1208 0.2386 -0.0541 -0.0235 0.0623  153 LEU A CA  
1107 C C   . LEU A 173 ? 0.2770 0.1528 0.2608 -0.0581 -0.0253 0.0624  153 LEU A C   
1108 O O   . LEU A 173 ? 0.3074 0.1834 0.2930 -0.0647 -0.0262 0.0602  153 LEU A O   
1109 C CB  . LEU A 173 ? 0.2623 0.1188 0.2372 -0.0570 -0.0275 0.0569  153 LEU A CB  
1110 C CG  . LEU A 173 ? 0.2492 0.1175 0.2240 -0.0561 -0.0312 0.0569  153 LEU A CG  
1111 C CD1 . LEU A 173 ? 0.2555 0.1171 0.2230 -0.0533 -0.0317 0.0580  153 LEU A CD1 
1112 C CD2 . LEU A 173 ? 0.2457 0.1187 0.2214 -0.0617 -0.0369 0.0528  153 LEU A CD2 
1113 N N   . PHE A 174 ? 0.2359 0.1234 0.2217 -0.0553 -0.0265 0.0650  154 PHE A N   
1114 C CA  . PHE A 174 ? 0.2277 0.1268 0.2169 -0.0588 -0.0291 0.0654  154 PHE A CA  
1115 C C   . PHE A 174 ? 0.2177 0.1244 0.2079 -0.0586 -0.0343 0.0633  154 PHE A C   
1116 O O   . PHE A 174 ? 0.2447 0.1522 0.2339 -0.0550 -0.0347 0.0639  154 PHE A O   
1117 C CB  . PHE A 174 ? 0.2289 0.1320 0.2185 -0.0573 -0.0270 0.0712  154 PHE A CB  
1118 C CG  . PHE A 174 ? 0.2434 0.1360 0.2305 -0.0577 -0.0224 0.0746  154 PHE A CG  
1119 C CD1 . PHE A 174 ? 0.2505 0.1420 0.2380 -0.0647 -0.0213 0.0747  154 PHE A CD1 
1120 C CD2 . PHE A 174 ? 0.2662 0.1488 0.2504 -0.0515 -0.0196 0.0783  154 PHE A CD2 
1121 C CE1 . PHE A 174 ? 0.2677 0.1468 0.2523 -0.0659 -0.0171 0.0784  154 PHE A CE1 
1122 C CE2 . PHE A 174 ? 0.2746 0.1432 0.2552 -0.0511 -0.0160 0.0820  154 PHE A CE2 
1123 C CZ  . PHE A 174 ? 0.2790 0.1450 0.2597 -0.0587 -0.0146 0.0819  154 PHE A CZ  
1124 N N   . LEU A 175 ? 0.2155 0.1270 0.2077 -0.0634 -0.0385 0.0615  155 LEU A N   
1125 C CA  . LEU A 175 ? 0.2111 0.1250 0.2033 -0.0633 -0.0449 0.0597  155 LEU A CA  
1126 C C   . LEU A 175 ? 0.2090 0.1299 0.2038 -0.0665 -0.0483 0.0614  155 LEU A C   
1127 O O   . LEU A 175 ? 0.2109 0.1373 0.2088 -0.0727 -0.0487 0.0619  155 LEU A O   
1128 C CB  . LEU A 175 ? 0.2149 0.1249 0.2068 -0.0663 -0.0496 0.0560  155 LEU A CB  
1129 C CG  . LEU A 175 ? 0.2206 0.1221 0.2081 -0.0651 -0.0482 0.0540  155 LEU A CG  
1130 C CD1 . LEU A 175 ? 0.2265 0.1256 0.2144 -0.0706 -0.0542 0.0502  155 LEU A CD1 
1131 C CD2 . LEU A 175 ? 0.2202 0.1181 0.2026 -0.0598 -0.0487 0.0552  155 LEU A CD2 
1132 N N   . LEU A 176 ? 0.2069 0.1285 0.2006 -0.0642 -0.0509 0.0625  156 LEU A N   
1133 C CA  . LEU A 176 ? 0.2118 0.1361 0.2062 -0.0681 -0.0564 0.0632  156 LEU A CA  
1134 C C   . LEU A 176 ? 0.2349 0.1557 0.2287 -0.0640 -0.0633 0.0557  156 LEU A C   
1135 O O   . LEU A 176 ? 0.2150 0.1242 0.2061 -0.0624 -0.0663 0.0558  156 LEU A O   
1136 C CB  . LEU A 176 ? 0.2082 0.1357 0.2012 -0.0674 -0.0566 0.0665  156 LEU A CB  
1137 C CG  . LEU A 176 ? 0.2380 0.1718 0.2313 -0.0660 -0.0500 0.0714  156 LEU A CG  
1138 C CD1 . LEU A 176 ? 0.2076 0.1462 0.2001 -0.0669 -0.0529 0.0755  156 LEU A CD1 
1139 C CD2 . LEU A 176 ? 0.2097 0.1482 0.2029 -0.0699 -0.0463 0.0744  156 LEU A CD2 
1140 N N   . ARG A 177 ? 0.2133 0.1446 0.2084 -0.0608 -0.0658 0.0488  157 ARG A N   
1141 C CA  . ARG A 177 ? 0.2198 0.1477 0.2140 -0.0539 -0.0726 0.0402  157 ARG A CA  
1142 C C   . ARG A 177 ? 0.2280 0.1418 0.2170 -0.0524 -0.0783 0.0396  157 ARG A C   
1143 O O   . ARG A 177 ? 0.2412 0.1598 0.2292 -0.0545 -0.0778 0.0397  157 ARG A O   
1144 C CB  . ARG A 177 ? 0.2200 0.1682 0.2185 -0.0499 -0.0721 0.0314  157 ARG A CB  
1145 C CG  . ARG A 177 ? 0.2281 0.1754 0.2272 -0.0401 -0.0792 0.0214  157 ARG A CG  
1146 C CD  . ARG A 177 ? 0.2291 0.2010 0.2333 -0.0346 -0.0779 0.0114  157 ARG A CD  
1147 N NE  . ARG A 177 ? 0.2359 0.2113 0.2436 -0.0240 -0.0841 0.0022  157 ARG A NE  
1148 C CZ  . ARG A 177 ? 0.2796 0.2816 0.2952 -0.0180 -0.0829 -0.0070 157 ARG A CZ  
1149 N NH1 . ARG A 177 ? 0.3134 0.3413 0.3335 -0.0232 -0.0750 -0.0078 157 ARG A NH1 
1150 N NH2 . ARG A 177 ? 0.2521 0.2563 0.2711 -0.0064 -0.0899 -0.0150 157 ARG A NH2 
1151 N N   . GLY A 178 ? 0.2958 0.1921 0.2807 -0.0498 -0.0841 0.0395  158 GLY A N   
1152 C CA  . GLY A 178 ? 0.2500 0.1295 0.2294 -0.0499 -0.0904 0.0387  158 GLY A CA  
1153 C C   . GLY A 178 ? 0.3000 0.1738 0.2771 -0.0401 -0.0980 0.0277  158 GLY A C   
1154 O O   . GLY A 178 ? 0.2987 0.1845 0.2795 -0.0327 -0.0981 0.0212  158 GLY A O   
1155 N N   . ASN A 179 ? 0.2816 0.1373 0.2531 -0.0400 -0.1047 0.0248  159 ASN A N   
1156 C CA  . ASN A 179 ? 0.2983 0.1454 0.2664 -0.0288 -0.1126 0.0128  159 ASN A CA  
1157 C C   . ASN A 179 ? 0.3219 0.1570 0.2874 -0.0193 -0.1181 0.0120  159 ASN A C   
1158 O O   . ASN A 179 ? 0.3446 0.1801 0.3100 -0.0064 -0.1236 0.0012  159 ASN A O   
1159 C CB  . ASN A 179 ? 0.3551 0.1811 0.3165 -0.0318 -0.1194 0.0090  159 ASN A CB  
1160 C CG  . ASN A 179 ? 0.3426 0.1436 0.2986 -0.0421 -0.1222 0.0203  159 ASN A CG  
1161 O OD1 . ASN A 179 ? 0.3421 0.1530 0.3012 -0.0503 -0.1150 0.0313  159 ASN A OD1 
1162 N ND2 . ASN A 179 ? 0.3558 0.1310 0.3041 -0.0402 -0.1303 0.0170  159 ASN A ND2 
1163 N N   . HIS A 180 ? 0.3062 0.1327 0.2692 -0.0246 -0.1167 0.0230  160 HIS A N   
1164 C CA  . HIS A 180 ? 0.3230 0.1395 0.2818 -0.0161 -0.1224 0.0239  160 HIS A CA  
1165 C C   . HIS A 180 ? 0.3297 0.1725 0.2969 -0.0101 -0.1192 0.0197  160 HIS A C   
1166 O O   . HIS A 180 ? 0.3894 0.2299 0.3549 -0.0004 -0.1252 0.0173  160 HIS A O   
1167 C CB  . HIS A 180 ? 0.3240 0.1227 0.2744 -0.0241 -0.1221 0.0368  160 HIS A CB  
1168 C CG  . HIS A 180 ? 0.4019 0.1862 0.3452 -0.0267 -0.1235 0.0374  160 HIS A CG  
1169 N ND1 . HIS A 180 ? 0.3881 0.1537 0.3227 -0.0193 -0.1305 0.0366  160 HIS A ND1 
1170 C CD2 . HIS A 180 ? 0.3916 0.1767 0.3355 -0.0360 -0.1196 0.0391  160 HIS A CD2 
1171 C CE1 . HIS A 180 ? 0.4184 0.1720 0.3482 -0.0253 -0.1305 0.0383  160 HIS A CE1 
1172 N NE2 . HIS A 180 ? 0.4173 0.1831 0.3531 -0.0355 -0.1243 0.0396  160 HIS A NE2 
1173 N N   . GLU A 181 ? 0.2812 0.1489 0.2572 -0.0162 -0.1104 0.0190  161 GLU A N   
1174 C CA  . GLU A 181 ? 0.2752 0.1679 0.2600 -0.0134 -0.1074 0.0149  161 GLU A CA  
1175 C C   . GLU A 181 ? 0.3108 0.2241 0.3031 -0.0026 -0.1094 0.0019  161 GLU A C   
1176 O O   . GLU A 181 ? 0.3251 0.2631 0.3252 -0.0060 -0.1025 -0.0018 161 GLU A O   
1177 C CB  . GLU A 181 ? 0.2547 0.1620 0.2447 -0.0255 -0.0973 0.0210  161 GLU A CB  
1178 C CG  . GLU A 181 ? 0.2489 0.1427 0.2333 -0.0327 -0.0952 0.0311  161 GLU A CG  
1179 C CD  . GLU A 181 ? 0.3282 0.2008 0.3045 -0.0374 -0.0958 0.0388  161 GLU A CD  
1180 O OE1 . GLU A 181 ? 0.3431 0.2183 0.3213 -0.0424 -0.0921 0.0402  161 GLU A OE1 
1181 O OE2 . GLU A 181 ? 0.4069 0.2617 0.3748 -0.0366 -0.1001 0.0438  161 GLU A OE2 
1182 N N   . CYS A 182 ? 0.2892 0.1931 0.2786 0.0111  -0.1188 -0.0045 162 CYS A N   
1183 C CA  . CYS A 182 ? 0.3310 0.2543 0.3272 0.0243  -0.1213 -0.0183 162 CYS A CA  
1184 C C   . CYS A 182 ? 0.3950 0.3069 0.3882 0.0409  -0.1327 -0.0232 162 CYS A C   
1185 O O   . CYS A 182 ? 0.4237 0.3059 0.4060 0.0412  -0.1391 -0.0151 162 CYS A O   
1186 C CB  . CYS A 182 ? 0.3032 0.2180 0.2948 0.0255  -0.1213 -0.0242 162 CYS A CB  
1187 S SG  . CYS A 182 ? 0.3886 0.2544 0.3644 0.0281  -0.1319 -0.0210 162 CYS A SG  
1188 N N   . ARG A 183 ? 0.3859 0.3227 0.3882 0.0552  -0.1352 -0.0360 163 ARG A N   
1189 C CA  . ARG A 183 ? 0.3430 0.2734 0.3440 0.0742  -0.1468 -0.0418 163 ARG A CA  
1190 C C   . ARG A 183 ? 0.4058 0.2930 0.3919 0.0841  -0.1568 -0.0427 163 ARG A C   
1191 O O   . ARG A 183 ? 0.4518 0.3124 0.4283 0.0925  -0.1668 -0.0377 163 ARG A O   
1192 C CB  . ARG A 183 ? 0.3372 0.3086 0.3532 0.0883  -0.1463 -0.0568 163 ARG A CB  
1193 C CG  . ARG A 183 ? 0.3117 0.3250 0.3430 0.0773  -0.1375 -0.0557 163 ARG A CG  
1194 C CD  . ARG A 183 ? 0.3030 0.3613 0.3493 0.0812  -0.1305 -0.0681 163 ARG A CD  
1195 N NE  . ARG A 183 ? 0.2804 0.3727 0.3396 0.0648  -0.1213 -0.0637 163 ARG A NE  
1196 C CZ  . ARG A 183 ? 0.2643 0.3591 0.3229 0.0450  -0.1103 -0.0554 163 ARG A CZ  
1197 N NH1 . ARG A 183 ? 0.2670 0.3369 0.3138 0.0393  -0.1070 -0.0508 163 ARG A NH1 
1198 N NH2 . ARG A 183 ? 0.2493 0.3707 0.3189 0.0306  -0.1033 -0.0517 163 ARG A NH2 
1199 N N   . HIS A 184 ? 0.3910 0.2696 0.3737 0.0821  -0.1544 -0.0485 164 HIS A N   
1200 C CA  A HIS A 184 ? 0.4339 0.2723 0.4034 0.0916  -0.1643 -0.0527 164 HIS A CA  
1201 C CA  B HIS A 184 ? 0.4344 0.2728 0.4039 0.0920  -0.1645 -0.0529 164 HIS A CA  
1202 C C   . HIS A 184 ? 0.4799 0.2738 0.4345 0.0822  -0.1699 -0.0375 164 HIS A C   
1203 O O   . HIS A 184 ? 0.6197 0.3800 0.5633 0.0937  -0.1813 -0.0369 164 HIS A O   
1204 C CB  A HIS A 184 ? 0.4236 0.2632 0.3917 0.0872  -0.1600 -0.0616 164 HIS A CB  
1205 C CB  B HIS A 184 ? 0.4265 0.2663 0.3948 0.0901  -0.1611 -0.0634 164 HIS A CB  
1206 C CG  A HIS A 184 ? 0.4666 0.2655 0.4216 0.0969  -0.1708 -0.0693 164 HIS A CG  
1207 C CG  B HIS A 184 ? 0.4375 0.3080 0.4143 0.1081  -0.1608 -0.0822 164 HIS A CG  
1208 N ND1 A HIS A 184 ? 0.5419 0.3290 0.4942 0.1206  -0.1814 -0.0814 164 HIS A ND1 
1209 N ND1 B HIS A 184 ? 0.4105 0.3288 0.4001 0.1037  -0.1493 -0.0873 164 HIS A ND1 
1210 C CD2 A HIS A 184 ? 0.4717 0.2379 0.4158 0.0860  -0.1732 -0.0672 164 HIS A CD2 
1211 C CD2 B HIS A 184 ? 0.4813 0.3423 0.4553 0.1311  -0.1703 -0.0972 164 HIS A CD2 
1212 C CE1 A HIS A 184 ? 0.5900 0.3350 0.5288 0.1237  -0.1900 -0.0865 164 HIS A CE1 
1213 C CE1 B HIS A 184 ? 0.4011 0.3417 0.3960 0.1225  -0.1510 -0.1047 164 HIS A CE1 
1214 N NE2 A HIS A 184 ? 0.5536 0.2861 0.4876 0.1019  -0.1851 -0.0781 164 HIS A NE2 
1215 N NE2 B HIS A 184 ? 0.4505 0.3571 0.4365 0.1405  -0.1638 -0.1118 164 HIS A NE2 
1216 N N   . LEU A 185 ? 0.4623 0.2565 0.4161 0.0616  -0.1616 -0.0247 165 LEU A N   
1217 C CA  . LEU A 185 ? 0.4762 0.2334 0.4167 0.0504  -0.1649 -0.0098 165 LEU A CA  
1218 C C   . LEU A 185 ? 0.5261 0.2800 0.4622 0.0515  -0.1675 0.0014  165 LEU A C   
1219 O O   . LEU A 185 ? 0.4764 0.2077 0.4002 0.0473  -0.1691 0.0098  165 LEU A O   
1220 C CB  . LEU A 185 ? 0.4382 0.1985 0.3798 0.0293  -0.1552 -0.0018 165 LEU A CB  
1221 C CG  . LEU A 185 ? 0.4993 0.2377 0.4352 0.0235  -0.1578 -0.0059 165 LEU A CG  
1222 C CD1 . LEU A 185 ? 0.4643 0.2234 0.4069 0.0337  -0.1571 -0.0233 165 LEU A CD1 
1223 C CD2 . LEU A 185 ? 0.5049 0.2446 0.4413 0.0027  -0.1501 0.0052  165 LEU A CD2 
1224 N N   . THR A 186 ? 0.4657 0.2552 0.4130 0.0526  -0.1622 -0.0002 166 THR A N   
1225 C CA  . THR A 186 ? 0.4496 0.2389 0.3922 0.0538  -0.1653 0.0086  166 THR A CA  
1226 C C   . THR A 186 ? 0.4766 0.2550 0.4139 0.0747  -0.1785 0.0045  166 THR A C   
1227 O O   . THR A 186 ? 0.5105 0.2813 0.4383 0.0729  -0.1786 0.0124  166 THR A O   
1228 C CB  . THR A 186 ? 0.4353 0.2633 0.3906 0.0468  -0.1566 0.0079  166 THR A CB  
1229 O OG1 . THR A 186 ? 0.4220 0.2835 0.3923 0.0579  -0.1568 -0.0059 166 THR A OG1 
1230 C CG2 . THR A 186 ? 0.3430 0.1777 0.3018 0.0280  -0.1444 0.0131  166 THR A CG2 
1231 N N   . GLU A 187 ? 0.5032 0.2902 0.4476 0.0915  -0.1834 -0.0101 167 GLU A N   
1232 C CA  A GLU A 187 ? 0.4939 0.2715 0.4329 0.1106  -0.1930 -0.0151 167 GLU A CA  
1233 C CA  B GLU A 187 ? 0.4929 0.2710 0.4325 0.1114  -0.1932 -0.0160 167 GLU A CA  
1234 C C   . GLU A 187 ? 0.5303 0.2661 0.4514 0.1059  -0.1946 -0.0095 167 GLU A C   
1235 O O   . GLU A 187 ? 0.6629 0.3848 0.5740 0.1123  -0.1992 -0.0052 167 GLU A O   
1236 C CB  A GLU A 187 ? 0.4979 0.3005 0.4507 0.1328  -0.1985 -0.0333 167 GLU A CB  
1237 C CB  B GLU A 187 ? 0.4962 0.2958 0.4489 0.1325  -0.1982 -0.0347 167 GLU A CB  
1238 C CG  A GLU A 187 ? 0.5445 0.3339 0.4969 0.1372  -0.1987 -0.0445 167 GLU A CG  
1239 C CG  B GLU A 187 ? 0.4977 0.3485 0.4689 0.1430  -0.1977 -0.0433 167 GLU A CG  
1240 C CD  A GLU A 187 ? 0.6012 0.4275 0.5686 0.1568  -0.1991 -0.0640 167 GLU A CD  
1241 C CD  B GLU A 187 ? 0.4919 0.3879 0.4819 0.1399  -0.1865 -0.0567 167 GLU A CD  
1242 O OE1 A GLU A 187 ? 0.6220 0.4733 0.5980 0.1719  -0.2043 -0.0679 167 GLU A OE1 
1243 O OE1 B GLU A 187 ? 0.5555 0.4486 0.5462 0.1494  -0.1868 -0.0687 167 GLU A OE1 
1244 O OE2 A GLU A 187 ? 0.5622 0.3955 0.5330 0.1572  -0.1943 -0.0756 167 GLU A OE2 
1245 O OE2 B GLU A 187 ? 0.3990 0.3330 0.4022 0.1275  -0.1775 -0.0554 167 GLU A OE2 
1246 N N   . TYR A 188 ? 0.5268 0.2452 0.4444 0.0936  -0.1908 -0.0087 168 TYR A N   
1247 C CA  . TYR A 188 ? 0.5552 0.2393 0.4584 0.0869  -0.1923 -0.0038 168 TYR A CA  
1248 C C   . TYR A 188 ? 0.6201 0.2956 0.5143 0.0683  -0.1857 0.0134  168 TYR A C   
1249 O O   . TYR A 188 ? 0.7161 0.3704 0.5983 0.0687  -0.1887 0.0205  168 TYR A O   
1250 C CB  . TYR A 188 ? 0.5316 0.2059 0.4361 0.0804  -0.1910 -0.0108 168 TYR A CB  
1251 C CG  . TYR A 188 ? 0.6291 0.2716 0.5209 0.0707  -0.1923 -0.0056 168 TYR A CG  
1252 C CD1 . TYR A 188 ? 0.6566 0.2946 0.5450 0.0484  -0.1842 0.0078  168 TYR A CD1 
1253 C CD2 . TYR A 188 ? 0.6396 0.2592 0.5244 0.0842  -0.2012 -0.0150 168 TYR A CD2 
1254 C CE1 . TYR A 188 ? 0.6525 0.2646 0.5316 0.0392  -0.1854 0.0124  168 TYR A CE1 
1255 C CE2 . TYR A 188 ? 0.6751 0.2643 0.5490 0.0746  -0.2030 -0.0101 168 TYR A CE2 
1256 C CZ  . TYR A 188 ? 0.6666 0.2526 0.5381 0.0517  -0.1951 0.0038  168 TYR A CZ  
1257 O OH  . TYR A 188 ? 0.7010 0.2588 0.5633 0.0420  -0.1969 0.0084  168 TYR A OH  
1258 N N   . PHE A 189 ? 0.6483 0.3409 0.5483 0.0527  -0.1763 0.0200  169 PHE A N   
1259 C CA  . PHE A 189 ? 0.6118 0.3031 0.5049 0.0375  -0.1689 0.0345  169 PHE A CA  
1260 C C   . PHE A 189 ? 0.5932 0.2980 0.4851 0.0441  -0.1699 0.0385  169 PHE A C   
1261 O O   . PHE A 189 ? 0.6403 0.3516 0.5351 0.0614  -0.1780 0.0310  169 PHE A O   
1262 C CB  . PHE A 189 ? 0.5391 0.2439 0.4386 0.0190  -0.1579 0.0392  169 PHE A CB  
1263 C CG  . PHE A 189 ? 0.5161 0.2090 0.4156 0.0110  -0.1569 0.0368  169 PHE A CG  
1264 C CD1 . PHE A 189 ? 0.5137 0.1873 0.4042 0.0028  -0.1563 0.0439  169 PHE A CD1 
1265 C CD2 . PHE A 189 ? 0.5764 0.2768 0.4846 0.0118  -0.1573 0.0276  169 PHE A CD2 
1266 C CE1 . PHE A 189 ? 0.5418 0.2047 0.4327 -0.0051 -0.1564 0.0413  169 PHE A CE1 
1267 C CE2 . PHE A 189 ? 0.5120 0.2017 0.4194 0.0044  -0.1573 0.0248  169 PHE A CE2 
1268 C CZ  . PHE A 189 ? 0.4930 0.1644 0.3922 -0.0041 -0.1570 0.0315  169 PHE A CZ  
1269 N N   . THR A 190 ? 0.5272 0.2391 0.4154 0.0313  -0.1620 0.0492  170 THR A N   
1270 C CA  . THR A 190 ? 0.5174 0.2370 0.4000 0.0368  -0.1639 0.0543  170 THR A CA  
1271 C C   . THR A 190 ? 0.4997 0.2469 0.3918 0.0389  -0.1630 0.0506  170 THR A C   
1272 O O   . THR A 190 ? 0.5421 0.2983 0.4298 0.0439  -0.1658 0.0534  170 THR A O   
1273 C CB  . THR A 190 ? 0.5319 0.2441 0.4030 0.0245  -0.1570 0.0675  170 THR A CB  
1274 O OG1 . THR A 190 ? 0.6724 0.3953 0.5493 0.0083  -0.1459 0.0704  170 THR A OG1 
1275 C CG2 . THR A 190 ? 0.5293 0.2136 0.3893 0.0253  -0.1608 0.0728  170 THR A CG2 
1276 N N   . PHE A 191 ? 0.4284 0.1896 0.3331 0.0351  -0.1600 0.0445  171 PHE A N   
1277 C CA  . PHE A 191 ? 0.4111 0.1972 0.3239 0.0337  -0.1587 0.0431  171 PHE A CA  
1278 C C   . PHE A 191 ? 0.4653 0.2711 0.3852 0.0506  -0.1690 0.0346  171 PHE A C   
1279 O O   . PHE A 191 ? 0.4731 0.2988 0.3951 0.0497  -0.1700 0.0348  171 PHE A O   
1280 C CB  . PHE A 191 ? 0.4090 0.2057 0.3330 0.0237  -0.1523 0.0412  171 PHE A CB  
1281 C CG  . PHE A 191 ? 0.3658 0.1902 0.2990 0.0191  -0.1485 0.0391  171 PHE A CG  
1282 C CD1 . PHE A 191 ? 0.3505 0.1750 0.2758 0.0102  -0.1443 0.0469  171 PHE A CD1 
1283 C CD2 . PHE A 191 ? 0.3513 0.2055 0.3018 0.0223  -0.1459 0.0270  171 PHE A CD2 
1284 C CE1 . PHE A 191 ? 0.3457 0.1957 0.2798 0.0046  -0.1386 0.0420  171 PHE A CE1 
1285 C CE2 . PHE A 191 ? 0.3335 0.2141 0.2935 0.0148  -0.1398 0.0238  171 PHE A CE2 
1286 C CZ  . PHE A 191 ? 0.3261 0.2026 0.2777 0.0061  -0.1367 0.0309  171 PHE A CZ  
1287 N N   . LYS A 192 ? 0.5059 0.3097 0.4304 0.0660  -0.1764 0.0257  172 LYS A N   
1288 C CA  . LYS A 192 ? 0.4851 0.3145 0.4189 0.0830  -0.1848 0.0161  172 LYS A CA  
1289 C C   . LYS A 192 ? 0.5086 0.3322 0.4298 0.0877  -0.1886 0.0226  172 LYS A C   
1290 O O   . LYS A 192 ? 0.4627 0.3125 0.3890 0.0906  -0.1915 0.0203  172 LYS A O   
1291 C CB  . LYS A 192 ? 0.4983 0.3273 0.4390 0.1004  -0.1909 0.0041  172 LYS A CB  
1292 C CG  . LYS A 192 ? 0.4729 0.3422 0.4305 0.1159  -0.1963 -0.0085 172 LYS A CG  
1293 C CD  . LYS A 192 ? 0.5457 0.4158 0.5092 0.1350  -0.2013 -0.0214 172 LYS A CD  
1294 C CE  . LYS A 192 ? 0.5617 0.4774 0.5432 0.1498  -0.2047 -0.0339 172 LYS A CE  
1295 N NZ  . LYS A 192 ? 0.5745 0.4948 0.5618 0.1705  -0.2089 -0.0479 172 LYS A NZ  
1296 N N   . GLN A 193 ? 0.5774 0.3684 0.4825 0.0871  -0.1888 0.0307  173 GLN A N   
1297 C CA  . GLN A 193 ? 0.6347 0.4180 0.5256 0.0900  -0.1918 0.0394  173 GLN A CA  
1298 C C   . GLN A 193 ? 0.6144 0.4119 0.5015 0.0776  -0.1866 0.0463  173 GLN A C   
1299 O O   . GLN A 193 ? 0.6328 0.4472 0.5179 0.0841  -0.1916 0.0460  173 GLN A O   
1300 C CB  . GLN A 193 ? 0.6915 0.4383 0.5661 0.0867  -0.1910 0.0489  173 GLN A CB  
1301 C CG  . GLN A 193 ? 0.7333 0.4703 0.5922 0.0915  -0.1952 0.0591  173 GLN A CG  
1302 C CD  . GLN A 193 ? 0.7862 0.5321 0.6474 0.1133  -0.2068 0.0526  173 GLN A CD  
1303 O OE1 . GLN A 193 ? 0.7815 0.5445 0.6576 0.1252  -0.2111 0.0393  173 GLN A OE1 
1304 N NE2 . GLN A 193 ? 0.7886 0.5255 0.6356 0.1190  -0.2116 0.0620  173 GLN A NE2 
1305 N N   . GLU A 194 ? 0.5247 0.3172 0.4110 0.0605  -0.1767 0.0512  174 GLU A N   
1306 C CA  . GLU A 194 ? 0.4642 0.2679 0.3457 0.0488  -0.1711 0.0566  174 GLU A CA  
1307 C C   . GLU A 194 ? 0.4568 0.2924 0.3483 0.0531  -0.1764 0.0482  174 GLU A C   
1308 O O   . GLU A 194 ? 0.4333 0.2788 0.3166 0.0528  -0.1785 0.0505  174 GLU A O   
1309 C CB  . GLU A 194 ? 0.4249 0.2232 0.3086 0.0317  -0.1596 0.0605  174 GLU A CB  
1310 C CG  . GLU A 194 ? 0.5066 0.3131 0.3831 0.0208  -0.1531 0.0660  174 GLU A CG  
1311 C CD  . GLU A 194 ? 0.4939 0.2967 0.3730 0.0054  -0.1407 0.0700  174 GLU A CD  
1312 O OE1 . GLU A 194 ? 0.4905 0.2838 0.3752 0.0017  -0.1365 0.0699  174 GLU A OE1 
1313 O OE2 . GLU A 194 ? 0.5150 0.3260 0.3904 -0.0024 -0.1352 0.0724  174 GLU A OE2 
1314 N N   . CYS A 195 ? 0.4124 0.2671 0.3222 0.0564  -0.1787 0.0376  175 CYS A N   
1315 C CA  . CYS A 195 ? 0.4353 0.3259 0.3588 0.0578  -0.1830 0.0277  175 CYS A CA  
1316 C C   . CYS A 195 ? 0.5472 0.4536 0.4715 0.0729  -0.1920 0.0230  175 CYS A C   
1317 O O   . CYS A 195 ? 0.6056 0.5353 0.5317 0.0713  -0.1950 0.0193  175 CYS A O   
1318 C CB  . CYS A 195 ? 0.4123 0.3246 0.3579 0.0565  -0.1797 0.0167  175 CYS A CB  
1319 S SG  . CYS A 195 ? 0.4170 0.3207 0.3665 0.0362  -0.1631 0.0203  175 CYS A SG  
1320 N N   . LYS A 196 ? 0.6067 0.5005 0.5295 0.0875  -0.1965 0.0224  176 LYS A N   
1321 C CA  . LYS A 196 ? 0.6568 0.5651 0.5809 0.1038  -0.2054 0.0183  176 LYS A CA  
1322 C C   . LYS A 196 ? 0.6407 0.5392 0.5450 0.1022  -0.2077 0.0288  176 LYS A C   
1323 O O   . LYS A 196 ? 0.5819 0.5066 0.4890 0.1067  -0.2133 0.0249  176 LYS A O   
1324 C CB  . LYS A 196 ? 0.7426 0.6339 0.6670 0.1198  -0.2097 0.0156  176 LYS A CB  
1325 C CG  . LYS A 196 ? 0.8396 0.7453 0.7662 0.1387  -0.2193 0.0112  176 LYS A CG  
1326 C CD  . LYS A 196 ? 0.8938 0.7664 0.8100 0.1526  -0.2239 0.0134  176 LYS A CD  
1327 C CE  . LYS A 196 ? 0.9159 0.7885 0.8235 0.1680  -0.2334 0.0168  176 LYS A CE  
1328 N NZ  . LYS A 196 ? 0.8984 0.8181 0.8249 0.1789  -0.2387 0.0050  176 LYS A NZ  
1329 N N   . ILE A 197 ? 0.6267 0.4910 0.5120 0.0944  -0.2026 0.0417  177 ILE A N   
1330 C CA  . ILE A 197 ? 0.5702 0.4259 0.4355 0.0917  -0.2031 0.0527  177 ILE A CA  
1331 C C   . ILE A 197 ? 0.5490 0.4247 0.4121 0.0801  -0.2002 0.0514  177 ILE A C   
1332 O O   . ILE A 197 ? 0.6751 0.5702 0.5343 0.0847  -0.2064 0.0494  177 ILE A O   
1333 C CB  . ILE A 197 ? 0.6102 0.4287 0.4575 0.0842  -0.1966 0.0668  177 ILE A CB  
1334 C CG1 . ILE A 197 ? 0.6114 0.4068 0.4548 0.0966  -0.2023 0.0694  177 ILE A CG1 
1335 C CG2 . ILE A 197 ? 0.5370 0.3525 0.3648 0.0780  -0.1943 0.0779  177 ILE A CG2 
1336 C CD1 . ILE A 197 ? 0.6145 0.4269 0.4659 0.1162  -0.2138 0.0611  177 ILE A CD1 
1337 N N   . LYS A 198 ? 0.5273 0.3980 0.3921 0.0652  -0.1913 0.0519  178 LYS A N   
1338 C CA  . LYS A 198 ? 0.4766 0.3610 0.3370 0.0535  -0.1881 0.0503  178 LYS A CA  
1339 C C   . LYS A 198 ? 0.4323 0.3517 0.3103 0.0527  -0.1932 0.0356  178 LYS A C   
1340 O O   . LYS A 198 ? 0.4915 0.4257 0.3641 0.0474  -0.1948 0.0318  178 LYS A O   
1341 C CB  . LYS A 198 ? 0.4456 0.3139 0.3033 0.0382  -0.1769 0.0553  178 LYS A CB  
1342 C CG  . LYS A 198 ? 0.4520 0.2925 0.2941 0.0336  -0.1689 0.0689  178 LYS A CG  
1343 C CD  . LYS A 198 ? 0.4420 0.2742 0.2878 0.0191  -0.1573 0.0716  178 LYS A CD  
1344 C CE  . LYS A 198 ? 0.4882 0.3019 0.3214 0.0121  -0.1479 0.0836  178 LYS A CE  
1345 N NZ  . LYS A 198 ? 0.4277 0.2389 0.2671 -0.0010 -0.1360 0.0852  178 LYS A NZ  
1346 N N   . TYR A 199 ? 0.4340 0.3680 0.3335 0.0565  -0.1948 0.0266  179 TYR A N   
1347 C CA  . TYR A 199 ? 0.4673 0.4379 0.3873 0.0519  -0.1971 0.0124  179 TYR A CA  
1348 C C   . TYR A 199 ? 0.4925 0.4895 0.4311 0.0660  -0.2034 0.0035  179 TYR A C   
1349 O O   . TYR A 199 ? 0.5196 0.5330 0.4569 0.0751  -0.2105 0.0014  179 TYR A O   
1350 C CB  . TYR A 199 ? 0.4508 0.4219 0.3823 0.0359  -0.1877 0.0090  179 TYR A CB  
1351 C CG  . TYR A 199 ? 0.3762 0.3314 0.2928 0.0217  -0.1789 0.0144  179 TYR A CG  
1352 C CD1 . TYR A 199 ? 0.4295 0.3530 0.3288 0.0195  -0.1730 0.0273  179 TYR A CD1 
1353 C CD2 . TYR A 199 ? 0.3713 0.3438 0.2907 0.0111  -0.1770 0.0060  179 TYR A CD2 
1354 C CE1 . TYR A 199 ? 0.5036 0.4164 0.3897 0.0085  -0.1647 0.0315  179 TYR A CE1 
1355 C CE2 . TYR A 199 ? 0.4146 0.3721 0.3191 0.0006  -0.1693 0.0094  179 TYR A CE2 
1356 C CZ  . TYR A 199 ? 0.4631 0.3925 0.3514 0.0003  -0.1629 0.0221  179 TYR A CZ  
1357 O OH  . TYR A 199 ? 0.4244 0.3427 0.2989 -0.0084 -0.1547 0.0247  179 TYR A OH  
1358 N N   . SER A 200 ? 0.5425 0.5454 0.4981 0.0682  -0.2009 -0.0017 180 SER A N   
1359 C CA  . SER A 200 ? 0.5059 0.5339 0.4788 0.0833  -0.2057 -0.0106 180 SER A CA  
1360 C C   . SER A 200 ? 0.4694 0.5005 0.4576 0.0841  -0.2009 -0.0160 180 SER A C   
1361 O O   . SER A 200 ? 0.5020 0.5220 0.4907 0.0707  -0.1944 -0.0138 180 SER A O   
1362 C CB  . SER A 200 ? 0.4573 0.5311 0.4480 0.0798  -0.2083 -0.0218 180 SER A CB  
1363 O OG  . SER A 200 ? 0.4695 0.5650 0.4787 0.0639  -0.2013 -0.0298 180 SER A OG  
1364 N N   . GLU A 201 ? 0.4414 0.4897 0.4422 0.1001  -0.2044 -0.0236 181 GLU A N   
1365 C CA  . GLU A 201 ? 0.3956 0.4552 0.4126 0.1036  -0.2002 -0.0316 181 GLU A CA  
1366 C C   . GLU A 201 ? 0.4049 0.4971 0.4414 0.0858  -0.1925 -0.0388 181 GLU A C   
1367 O O   . GLU A 201 ? 0.4512 0.5405 0.4936 0.0792  -0.1834 -0.0399 181 GLU A O   
1368 C CB  . GLU A 201 ? 0.5241 0.6073 0.5534 0.1238  -0.2050 -0.0413 181 GLU A CB  
1369 C CG  . GLU A 201 ? 0.6629 0.7555 0.7052 0.1318  -0.2012 -0.0506 181 GLU A CG  
1370 C CD  . GLU A 201 ? 0.7737 0.8226 0.7993 0.1476  -0.2056 -0.0472 181 GLU A CD  
1371 O OE1 . GLU A 201 ? 0.8101 0.8304 0.8181 0.1565  -0.2123 -0.0397 181 GLU A OE1 
1372 O OE2 . GLU A 201 ? 0.7658 0.8092 0.7954 0.1502  -0.2022 -0.0524 181 GLU A OE2 
1373 N N   . ARG A 202 ? 0.4059 0.5273 0.4512 0.0753  -0.1923 -0.0427 182 ARG A N   
1374 C CA  . ARG A 202 ? 0.4057 0.5562 0.4692 0.0555  -0.1835 -0.0489 182 ARG A CA  
1375 C C   . ARG A 202 ? 0.3938 0.5112 0.4457 0.0370  -0.1707 -0.0396 182 ARG A C   
1376 O O   . ARG A 202 ? 0.3664 0.4922 0.4289 0.0252  -0.1592 -0.0409 182 ARG A O   
1377 C CB  . ARG A 202 ? 0.4313 0.6107 0.5025 0.0455  -0.1859 -0.0536 182 ARG A CB  
1378 C CG  . ARG A 202 ? 0.4624 0.6906 0.5586 0.0468  -0.1839 -0.0639 182 ARG A CG  
1379 C CD  . ARG A 202 ? 0.6138 0.8616 0.7114 0.0495  -0.1916 -0.0665 182 ARG A CD  
1380 N NE  . ARG A 202 ? 0.6827 0.9285 0.7754 0.0291  -0.1911 -0.0659 182 ARG A NE  
1381 C CZ  . ARG A 202 ? 0.6438 0.9120 0.7522 0.0075  -0.1843 -0.0711 182 ARG A CZ  
1382 N NH1 . ARG A 202 ? 0.6409 0.9380 0.7711 0.0023  -0.1761 -0.0761 182 ARG A NH1 
1383 N NH2 . ARG A 202 ? 0.5807 0.8402 0.6814 -0.0093 -0.1850 -0.0713 182 ARG A NH2 
1384 N N   . VAL A 203 ? 0.3900 0.4719 0.4198 0.0351  -0.1729 -0.0299 183 VAL A N   
1385 C CA  . VAL A 203 ? 0.3931 0.4453 0.4117 0.0198  -0.1616 -0.0211 183 VAL A CA  
1386 C C   . VAL A 203 ? 0.4065 0.4376 0.4224 0.0237  -0.1558 -0.0166 183 VAL A C   
1387 O O   . VAL A 203 ? 0.4167 0.4445 0.4369 0.0113  -0.1445 -0.0147 183 VAL A O   
1388 C CB  . VAL A 203 ? 0.3711 0.3953 0.3669 0.0177  -0.1650 -0.0125 183 VAL A CB  
1389 C CG1 . VAL A 203 ? 0.3518 0.3445 0.3358 0.0066  -0.1540 -0.0029 183 VAL A CG1 
1390 C CG2 . VAL A 203 ? 0.3282 0.3723 0.3265 0.0088  -0.1678 -0.0186 183 VAL A CG2 
1391 N N   . TYR A 204 ? 0.3650 0.3811 0.3733 0.0413  -0.1642 -0.0150 184 TYR A N   
1392 C CA  . TYR A 204 ? 0.3854 0.3840 0.3924 0.0462  -0.1606 -0.0137 184 TYR A CA  
1393 C C   . TYR A 204 ? 0.4063 0.4354 0.4332 0.0419  -0.1523 -0.0229 184 TYR A C   
1394 O O   . TYR A 204 ? 0.4049 0.4246 0.4315 0.0325  -0.1426 -0.0200 184 TYR A O   
1395 C CB  . TYR A 204 ? 0.3479 0.3309 0.3471 0.0678  -0.1729 -0.0144 184 TYR A CB  
1396 C CG  . TYR A 204 ? 0.4099 0.3740 0.4073 0.0737  -0.1709 -0.0157 184 TYR A CG  
1397 C CD1 . TYR A 204 ? 0.5008 0.4265 0.4829 0.0662  -0.1675 -0.0055 184 TYR A CD1 
1398 C CD2 . TYR A 204 ? 0.4691 0.4558 0.4806 0.0870  -0.1726 -0.0280 184 TYR A CD2 
1399 C CE1 . TYR A 204 ? 0.5044 0.4126 0.4846 0.0705  -0.1666 -0.0079 184 TYR A CE1 
1400 C CE2 . TYR A 204 ? 0.4635 0.4324 0.4719 0.0929  -0.1713 -0.0311 184 TYR A CE2 
1401 C CZ  . TYR A 204 ? 0.4660 0.3944 0.4585 0.0842  -0.1688 -0.0212 184 TYR A CZ  
1402 O OH  . TYR A 204 ? 0.4841 0.3942 0.4730 0.0889  -0.1686 -0.0253 184 TYR A OH  
1403 N N   . GLU A 205 ? 0.3884 0.4564 0.4324 0.0487  -0.1559 -0.0335 185 GLU A N   
1404 C CA  . GLU A 205 ? 0.3124 0.4142 0.3752 0.0441  -0.1473 -0.0418 185 GLU A CA  
1405 C C   . GLU A 205 ? 0.3346 0.4395 0.4008 0.0202  -0.1344 -0.0370 185 GLU A C   
1406 O O   . GLU A 205 ? 0.4376 0.5424 0.5060 0.0138  -0.1250 -0.0359 185 GLU A O   
1407 C CB  . GLU A 205 ? 0.3268 0.4758 0.4093 0.0540  -0.1530 -0.0539 185 GLU A CB  
1408 C CG  . GLU A 205 ? 0.4827 0.6529 0.5761 0.0704  -0.1529 -0.0643 185 GLU A CG  
1409 C CD  . GLU A 205 ? 0.5985 0.7836 0.6998 0.0572  -0.1383 -0.0657 185 GLU A CD  
1410 O OE1 . GLU A 205 ? 0.6033 0.8266 0.7212 0.0430  -0.1306 -0.0687 185 GLU A OE1 
1411 O OE2 . GLU A 205 ? 0.6313 0.7903 0.7218 0.0602  -0.1348 -0.0634 185 GLU A OE2 
1412 N N   . ALA A 206 ? 0.2613 0.3664 0.3259 0.0079  -0.1346 -0.0340 186 ALA A N   
1413 C CA  . ALA A 206 ? 0.2452 0.3487 0.3117 -0.0137 -0.1235 -0.0296 186 ALA A CA  
1414 C C   . ALA A 206 ? 0.2598 0.3273 0.3122 -0.0189 -0.1161 -0.0195 186 ALA A C   
1415 O O   . ALA A 206 ? 0.2789 0.3472 0.3346 -0.0324 -0.1060 -0.0162 186 ALA A O   
1416 C CB  . ALA A 206 ? 0.2486 0.3525 0.3129 -0.0238 -0.1267 -0.0296 186 ALA A CB  
1417 N N   . CYS A 207 ? 0.2517 0.2889 0.2885 -0.0085 -0.1216 -0.0142 187 CYS A N   
1418 C CA  . CYS A 207 ? 0.2752 0.2816 0.2999 -0.0125 -0.1160 -0.0053 187 CYS A CA  
1419 C C   . CYS A 207 ? 0.2901 0.3020 0.3200 -0.0089 -0.1117 -0.0079 187 CYS A C   
1420 O O   . CYS A 207 ? 0.2935 0.2966 0.3212 -0.0182 -0.1035 -0.0027 187 CYS A O   
1421 C CB  . CYS A 207 ? 0.2910 0.2661 0.2986 -0.0037 -0.1232 0.0012  187 CYS A CB  
1422 S SG  . CYS A 207 ? 0.3273 0.2865 0.3212 -0.0104 -0.1247 0.0080  187 CYS A SG  
1423 N N   . MET A 208 ? 0.2847 0.3110 0.3207 0.0058  -0.1179 -0.0165 188 MET A N   
1424 C CA  . MET A 208 ? 0.2708 0.3058 0.3113 0.0104  -0.1141 -0.0216 188 MET A CA  
1425 C C   . MET A 208 ? 0.2559 0.3196 0.3084 -0.0031 -0.1027 -0.0228 188 MET A C   
1426 O O   . MET A 208 ? 0.2321 0.2911 0.2816 -0.0085 -0.0958 -0.0199 188 MET A O   
1427 C CB  . MET A 208 ? 0.2638 0.3114 0.3091 0.0307  -0.1228 -0.0326 188 MET A CB  
1428 C CG  . MET A 208 ? 0.2845 0.2979 0.3154 0.0449  -0.1347 -0.0301 188 MET A CG  
1429 S SD  . MET A 208 ? 0.3672 0.3327 0.3793 0.0398  -0.1338 -0.0201 188 MET A SD  
1430 C CE  . MET A 208 ? 0.3758 0.3210 0.3770 0.0269  -0.1331 -0.0062 188 MET A CE  
1431 N N   . GLU A 209 ? 0.2929 0.3857 0.3581 -0.0099 -0.1010 -0.0262 189 GLU A N   
1432 C CA  . GLU A 209 ? 0.2919 0.4067 0.3663 -0.0261 -0.0898 -0.0244 189 GLU A CA  
1433 C C   . GLU A 209 ? 0.2651 0.3533 0.3298 -0.0421 -0.0827 -0.0126 189 GLU A C   
1434 O O   . GLU A 209 ? 0.3152 0.4088 0.3810 -0.0520 -0.0738 -0.0082 189 GLU A O   
1435 C CB  . GLU A 209 ? 0.3338 0.4866 0.4253 -0.0325 -0.0897 -0.0308 189 GLU A CB  
1436 C CG  . GLU A 209 ? 0.4954 0.6833 0.5999 -0.0164 -0.0952 -0.0432 189 GLU A CG  
1437 C CD  . GLU A 209 ? 0.6421 0.8739 0.7662 -0.0255 -0.0938 -0.0492 189 GLU A CD  
1438 O OE1 . GLU A 209 ? 0.6728 0.9154 0.8023 -0.0457 -0.0841 -0.0444 189 GLU A OE1 
1439 O OE2 . GLU A 209 ? 0.6831 0.9381 0.8170 -0.0130 -0.1028 -0.0581 189 GLU A OE2 
1440 N N   . ALA A 210 ? 0.2197 0.2805 0.2744 -0.0436 -0.0868 -0.0073 190 ALA A N   
1441 C CA  . ALA A 210 ? 0.2177 0.2536 0.2632 -0.0552 -0.0807 0.0027  190 ALA A CA  
1442 C C   . ALA A 210 ? 0.2224 0.2397 0.2588 -0.0511 -0.0783 0.0080  190 ALA A C   
1443 O O   . ALA A 210 ? 0.2219 0.2313 0.2552 -0.0598 -0.0711 0.0152  190 ALA A O   
1444 C CB  . ALA A 210 ? 0.2230 0.2378 0.2596 -0.0561 -0.0855 0.0054  190 ALA A CB  
1445 N N   . PHE A 211 ? 0.2218 0.2314 0.2537 -0.0377 -0.0852 0.0044  191 PHE A N   
1446 C CA  . PHE A 211 ? 0.2235 0.2156 0.2471 -0.0345 -0.0845 0.0079  191 PHE A CA  
1447 C C   . PHE A 211 ? 0.2193 0.2307 0.2480 -0.0365 -0.0782 0.0052  191 PHE A C   
1448 O O   . PHE A 211 ? 0.2174 0.2190 0.2403 -0.0412 -0.0740 0.0110  191 PHE A O   
1449 C CB  . PHE A 211 ? 0.2354 0.2112 0.2521 -0.0209 -0.0940 0.0043  191 PHE A CB  
1450 C CG  . PHE A 211 ? 0.2617 0.2126 0.2685 -0.0206 -0.0990 0.0109  191 PHE A CG  
1451 C CD1 . PHE A 211 ? 0.2573 0.2021 0.2613 -0.0311 -0.0943 0.0181  191 PHE A CD1 
1452 C CD2 . PHE A 211 ? 0.2746 0.2074 0.2733 -0.0097 -0.1083 0.0100  191 PHE A CD2 
1453 C CE1 . PHE A 211 ? 0.2445 0.1697 0.2380 -0.0306 -0.0980 0.0237  191 PHE A CE1 
1454 C CE2 . PHE A 211 ? 0.2855 0.1968 0.2731 -0.0104 -0.1122 0.0176  191 PHE A CE2 
1455 C CZ  . PHE A 211 ? 0.2588 0.1685 0.2439 -0.0209 -0.1066 0.0242  191 PHE A CZ  
1456 N N   . ASP A 212 ? 0.2188 0.2606 0.2582 -0.0329 -0.0776 -0.0035 192 ASP A N   
1457 C CA  . ASP A 212 ? 0.2164 0.2826 0.2604 -0.0356 -0.0704 -0.0062 192 ASP A CA  
1458 C C   . ASP A 212 ? 0.2584 0.3263 0.3022 -0.0523 -0.0608 0.0043  192 ASP A C   
1459 O O   . ASP A 212 ? 0.2236 0.3000 0.2647 -0.0562 -0.0547 0.0071  192 ASP A O   
1460 C CB  . ASP A 212 ? 0.3038 0.4074 0.3609 -0.0290 -0.0706 -0.0176 192 ASP A CB  
1461 C CG  . ASP A 212 ? 0.3381 0.4400 0.3950 -0.0091 -0.0806 -0.0289 192 ASP A CG  
1462 O OD1 . ASP A 212 ? 0.3229 0.3938 0.3682 -0.0015 -0.0866 -0.0280 192 ASP A OD1 
1463 O OD2 . ASP A 212 ? 0.3441 0.4760 0.4129 -0.0010 -0.0827 -0.0386 192 ASP A OD2 
1464 N N   . SER A 213 ? 0.2626 0.3204 0.3074 -0.0617 -0.0601 0.0100  193 SER A N   
1465 C CA  . SER A 213 ? 0.2576 0.3124 0.3013 -0.0767 -0.0519 0.0198  193 SER A CA  
1466 C C   . SER A 213 ? 0.2414 0.2693 0.2735 -0.0784 -0.0498 0.0298  193 SER A C   
1467 O O   . SER A 213 ? 0.2119 0.2383 0.2414 -0.0877 -0.0432 0.0383  193 SER A O   
1468 C CB  . SER A 213 ? 0.2645 0.3176 0.3134 -0.0865 -0.0519 0.0206  193 SER A CB  
1469 O OG  . SER A 213 ? 0.3561 0.4425 0.4181 -0.0920 -0.0497 0.0147  193 SER A OG  
1470 N N   . LEU A 214 ? 0.2088 0.2164 0.2340 -0.0698 -0.0557 0.0294  194 LEU A N   
1471 C CA  . LEU A 214 ? 0.2087 0.1936 0.2250 -0.0715 -0.0544 0.0385  194 LEU A CA  
1472 C C   . LEU A 214 ? 0.2092 0.2001 0.2218 -0.0730 -0.0502 0.0429  194 LEU A C   
1473 O O   . LEU A 214 ? 0.2662 0.2702 0.2788 -0.0673 -0.0518 0.0366  194 LEU A O   
1474 C CB  . LEU A 214 ? 0.2098 0.1764 0.2205 -0.0633 -0.0613 0.0369  194 LEU A CB  
1475 C CG  . LEU A 214 ? 0.2121 0.1665 0.2213 -0.0611 -0.0660 0.0357  194 LEU A CG  
1476 C CD1 . LEU A 214 ? 0.2174 0.1580 0.2207 -0.0525 -0.0732 0.0337  194 LEU A CD1 
1477 C CD2 . LEU A 214 ? 0.2124 0.1516 0.2175 -0.0676 -0.0621 0.0435  194 LEU A CD2 
1478 N N   . PRO A 215 ? 0.2110 0.1920 0.2195 -0.0795 -0.0455 0.0534  195 PRO A N   
1479 C CA  . PRO A 215 ? 0.2130 0.1972 0.2159 -0.0796 -0.0431 0.0591  195 PRO A CA  
1480 C C   . PRO A 215 ? 0.2114 0.1917 0.2107 -0.0718 -0.0490 0.0544  195 PRO A C   
1481 O O   . PRO A 215 ? 0.2100 0.1771 0.2094 -0.0678 -0.0542 0.0511  195 PRO A O   
1482 C CB  . PRO A 215 ? 0.2165 0.1828 0.2155 -0.0838 -0.0401 0.0705  195 PRO A CB  
1483 C CG  . PRO A 215 ? 0.2239 0.1846 0.2266 -0.0898 -0.0379 0.0706  195 PRO A CG  
1484 C CD  . PRO A 215 ? 0.2143 0.1803 0.2224 -0.0860 -0.0427 0.0598  195 PRO A CD  
1485 N N   . LEU A 216 ? 0.2143 0.2057 0.2094 -0.0706 -0.0485 0.0542  196 LEU A N   
1486 C CA  . LEU A 216 ? 0.2161 0.2027 0.2075 -0.0651 -0.0548 0.0489  196 LEU A CA  
1487 C C   . LEU A 216 ? 0.2162 0.1935 0.2038 -0.0673 -0.0556 0.0577  196 LEU A C   
1488 O O   . LEU A 216 ? 0.2264 0.1958 0.2126 -0.0653 -0.0611 0.0548  196 LEU A O   
1489 C CB  . LEU A 216 ? 0.2804 0.2863 0.2688 -0.0612 -0.0553 0.0401  196 LEU A CB  
1490 C CG  . LEU A 216 ? 0.2636 0.2838 0.2572 -0.0561 -0.0553 0.0289  196 LEU A CG  
1491 C CD1 . LEU A 216 ? 0.2360 0.2736 0.2253 -0.0496 -0.0566 0.0178  196 LEU A CD1 
1492 C CD2 . LEU A 216 ? 0.2222 0.2254 0.2195 -0.0509 -0.0617 0.0236  196 LEU A CD2 
1493 N N   . ALA A 217 ? 0.2167 0.1949 0.2029 -0.0713 -0.0504 0.0685  197 ALA A N   
1494 C CA  . ALA A 217 ? 0.2183 0.1934 0.2016 -0.0714 -0.0515 0.0765  197 ALA A CA  
1495 C C   . ALA A 217 ? 0.2211 0.1891 0.2038 -0.0736 -0.0464 0.0886  197 ALA A C   
1496 O O   . ALA A 217 ? 0.2739 0.2406 0.2566 -0.0772 -0.0416 0.0914  197 ALA A O   
1497 C CB  . ALA A 217 ? 0.2238 0.2148 0.2012 -0.0704 -0.0531 0.0748  197 ALA A CB  
1498 N N   . ALA A 218 ? 0.2219 0.1852 0.2044 -0.0714 -0.0478 0.0955  198 ALA A N   
1499 C CA  . ALA A 218 ? 0.2259 0.1846 0.2094 -0.0663 -0.0419 0.0986  198 ALA A CA  
1500 C C   . ALA A 218 ? 0.2314 0.1976 0.2123 -0.0631 -0.0437 0.1063  198 ALA A C   
1501 O O   . ALA A 218 ? 0.2400 0.2121 0.2228 -0.0628 -0.0492 0.1070  198 ALA A O   
1502 C CB  . ALA A 218 ? 0.2209 0.1691 0.2096 -0.0615 -0.0397 0.0930  198 ALA A CB  
1503 N N   . LEU A 219 ? 0.2667 0.2325 0.2428 -0.0611 -0.0398 0.1127  199 LEU A N   
1504 C CA  . LEU A 219 ? 0.2883 0.2600 0.2618 -0.0558 -0.0417 0.1204  199 LEU A CA  
1505 C C   . LEU A 219 ? 0.2976 0.2562 0.2746 -0.0480 -0.0384 0.1211  199 LEU A C   
1506 O O   . LEU A 219 ? 0.3054 0.2493 0.2792 -0.0464 -0.0330 0.1215  199 LEU A O   
1507 C CB  . LEU A 219 ? 0.2899 0.2679 0.2534 -0.0570 -0.0400 0.1282  199 LEU A CB  
1508 C CG  . LEU A 219 ? 0.3274 0.3122 0.2864 -0.0501 -0.0428 0.1367  199 LEU A CG  
1509 C CD1 . LEU A 219 ? 0.2687 0.2727 0.2291 -0.0504 -0.0512 0.1365  199 LEU A CD1 
1510 C CD2 . LEU A 219 ? 0.3490 0.3361 0.2964 -0.0512 -0.0397 0.1442  199 LEU A CD2 
1511 N N   . LEU A 220 ? 0.2491 0.2134 0.2322 -0.0441 -0.0420 0.1219  200 LEU A N   
1512 C CA  . LEU A 220 ? 0.2525 0.2070 0.2392 -0.0369 -0.0394 0.1225  200 LEU A CA  
1513 C C   . LEU A 220 ? 0.2756 0.2340 0.2605 -0.0282 -0.0412 0.1322  200 LEU A C   
1514 O O   . LEU A 220 ? 0.2899 0.2669 0.2780 -0.0272 -0.0470 0.1371  200 LEU A O   
1515 C CB  . LEU A 220 ? 0.2700 0.2298 0.2656 -0.0386 -0.0415 0.1179  200 LEU A CB  
1516 C CG  . LEU A 220 ? 0.2435 0.2040 0.2447 -0.0313 -0.0410 0.1223  200 LEU A CG  
1517 C CD1 . LEU A 220 ? 0.2598 0.1996 0.2563 -0.0256 -0.0349 0.1201  200 LEU A CD1 
1518 C CD2 . LEU A 220 ? 0.2299 0.2005 0.2396 -0.0359 -0.0434 0.1203  200 LEU A CD2 
1519 N N   . ASN A 221 ? 0.2827 0.2227 0.2616 -0.0216 -0.0370 0.1350  201 ASN A N   
1520 C CA  . ASN A 221 ? 0.3011 0.2393 0.2762 -0.0108 -0.0388 0.1444  201 ASN A CA  
1521 C C   . ASN A 221 ? 0.3252 0.2784 0.2950 -0.0108 -0.0431 0.1514  201 ASN A C   
1522 O O   . ASN A 221 ? 0.3453 0.3099 0.3162 -0.0021 -0.0478 0.1583  201 ASN A O   
1523 C CB  . ASN A 221 ? 0.3539 0.3028 0.3395 -0.0026 -0.0420 0.1468  201 ASN A CB  
1524 C CG  . ASN A 221 ? 0.4249 0.3578 0.4065 0.0110  -0.0410 0.1521  201 ASN A CG  
1525 O OD1 . ASN A 221 ? 0.4871 0.3928 0.4595 0.0119  -0.0365 0.1498  201 ASN A OD1 
1526 N ND2 . ASN A 221 ? 0.3832 0.3333 0.3716 0.0222  -0.0459 0.1592  201 ASN A ND2 
1527 N N   . GLN A 222 ? 0.4190 0.3747 0.3832 -0.0200 -0.0418 0.1495  202 GLN A N   
1528 C CA  . GLN A 222 ? 0.3936 0.3646 0.3504 -0.0210 -0.0454 0.1557  202 GLN A CA  
1529 C C   . GLN A 222 ? 0.3329 0.3307 0.2964 -0.0191 -0.0536 0.1569  202 GLN A C   
1530 O O   . GLN A 222 ? 0.3891 0.4010 0.3462 -0.0157 -0.0580 0.1628  202 GLN A O   
1531 C CB  . GLN A 222 ? 0.3414 0.2980 0.2857 -0.0134 -0.0438 0.1652  202 GLN A CB  
1532 C CG  . GLN A 222 ? 0.5024 0.4638 0.4338 -0.0184 -0.0429 0.1709  202 GLN A CG  
1533 C CD  . GLN A 222 ? 0.6348 0.5845 0.5625 -0.0290 -0.0357 0.1678  202 GLN A CD  
1534 O OE1 . GLN A 222 ? 0.6847 0.6159 0.6164 -0.0308 -0.0310 0.1628  202 GLN A OE1 
1535 N NE2 . GLN A 222 ? 0.6624 0.6257 0.5824 -0.0360 -0.0350 0.1708  202 GLN A NE2 
1536 N N   . GLN A 223 ? 0.3104 0.3161 0.2860 -0.0219 -0.0560 0.1514  203 GLN A N   
1537 C CA  . GLN A 223 ? 0.3262 0.3585 0.3087 -0.0224 -0.0644 0.1523  203 GLN A CA  
1538 C C   . GLN A 223 ? 0.3006 0.3415 0.2903 -0.0331 -0.0685 0.1451  203 GLN A C   
1539 O O   . GLN A 223 ? 0.3211 0.3833 0.3129 -0.0369 -0.0767 0.1441  203 GLN A O   
1540 C CB  . GLN A 223 ? 0.2946 0.3363 0.2853 -0.0110 -0.0670 0.1581  203 GLN A CB  
1541 C CG  . GLN A 223 ? 0.3732 0.4016 0.3725 -0.0069 -0.0622 0.1569  203 GLN A CG  
1542 C CD  . GLN A 223 ? 0.3918 0.4293 0.3979 0.0076  -0.0641 0.1636  203 GLN A CD  
1543 O OE1 . GLN A 223 ? 0.3854 0.4079 0.3939 0.0151  -0.0596 0.1641  203 GLN A OE1 
1544 N NE2 . GLN A 223 ? 0.3194 0.3832 0.3286 0.0125  -0.0712 0.1679  203 GLN A NE2 
1545 N N   . PHE A 224 ? 0.2684 0.2920 0.2606 -0.0381 -0.0636 0.1391  204 PHE A N   
1546 C CA  . PHE A 224 ? 0.2377 0.2630 0.2335 -0.0480 -0.0672 0.1318  204 PHE A CA  
1547 C C   . PHE A 224 ? 0.2362 0.2484 0.2243 -0.0539 -0.0642 0.1256  204 PHE A C   
1548 O O   . PHE A 224 ? 0.2996 0.2969 0.2858 -0.0518 -0.0570 0.1244  204 PHE A O   
1549 C CB  . PHE A 224 ? 0.2297 0.2486 0.2360 -0.0482 -0.0644 0.1296  204 PHE A CB  
1550 C CG  . PHE A 224 ? 0.2311 0.2662 0.2471 -0.0415 -0.0658 0.1352  204 PHE A CG  
1551 C CD1 . PHE A 224 ? 0.2292 0.2894 0.2527 -0.0446 -0.0724 0.1333  204 PHE A CD1 
1552 C CD2 . PHE A 224 ? 0.2454 0.2721 0.2637 -0.0316 -0.0610 0.1414  204 PHE A CD2 
1553 C CE1 . PHE A 224 ? 0.2302 0.3111 0.2651 -0.0381 -0.0738 0.1382  204 PHE A CE1 
1554 C CE2 . PHE A 224 ? 0.2384 0.2833 0.2667 -0.0231 -0.0621 0.1458  204 PHE A CE2 
1555 C CZ  . PHE A 224 ? 0.2344 0.3087 0.2720 -0.0264 -0.0683 0.1445  204 PHE A CZ  
1556 N N   . LEU A 225 ? 0.2339 0.2535 0.2199 -0.0596 -0.0684 0.1160  205 LEU A N   
1557 C CA  . LEU A 225 ? 0.2401 0.2495 0.2217 -0.0636 -0.0660 0.1078  205 LEU A CA  
1558 C C   . LEU A 225 ? 0.2533 0.2507 0.2423 -0.0671 -0.0666 0.1005  205 LEU A C   
1559 O O   . LEU A 225 ? 0.2492 0.2511 0.2433 -0.0704 -0.0716 0.0965  205 LEU A O   
1560 C CB  . LEU A 225 ? 0.2369 0.2592 0.2109 -0.0657 -0.0701 0.0999  205 LEU A CB  
1561 C CG  . LEU A 225 ? 0.2351 0.2500 0.2068 -0.0680 -0.0686 0.0888  205 LEU A CG  
1562 C CD1 . LEU A 225 ? 0.2358 0.2464 0.2040 -0.0676 -0.0610 0.0936  205 LEU A CD1 
1563 C CD2 . LEU A 225 ? 0.2423 0.2694 0.2073 -0.0686 -0.0739 0.0775  205 LEU A CD2 
1564 N N   . CYS A 226 ? 0.2480 0.2305 0.2371 -0.0673 -0.0618 0.0995  206 CYS A N   
1565 C CA  . CYS A 226 ? 0.2184 0.1885 0.2121 -0.0696 -0.0622 0.0943  206 CYS A CA  
1566 C C   . CYS A 226 ? 0.2537 0.2175 0.2440 -0.0710 -0.0634 0.0847  206 CYS A C   
1567 O O   . CYS A 226 ? 0.2316 0.1943 0.2193 -0.0701 -0.0594 0.0844  206 CYS A O   
1568 C CB  . CYS A 226 ? 0.2113 0.1739 0.2087 -0.0644 -0.0551 0.0951  206 CYS A CB  
1569 S SG  . CYS A 226 ? 0.2247 0.1952 0.2273 -0.0587 -0.0528 0.1033  206 CYS A SG  
1570 N N   . VAL A 227 ? 0.2176 0.1775 0.2082 -0.0734 -0.0690 0.0768  207 VAL A N   
1571 C CA  . VAL A 227 ? 0.2206 0.1732 0.2083 -0.0721 -0.0714 0.0668  207 VAL A CA  
1572 C C   . VAL A 227 ? 0.2272 0.1638 0.2160 -0.0743 -0.0759 0.0635  207 VAL A C   
1573 O O   . VAL A 227 ? 0.2417 0.1764 0.2334 -0.0789 -0.0776 0.0678  207 VAL A O   
1574 C CB  . VAL A 227 ? 0.2280 0.1908 0.2107 -0.0708 -0.0756 0.0578  207 VAL A CB  
1575 C CG1 . VAL A 227 ? 0.2270 0.2055 0.2061 -0.0688 -0.0704 0.0607  207 VAL A CG1 
1576 C CG2 . VAL A 227 ? 0.2343 0.2012 0.2168 -0.0747 -0.0818 0.0565  207 VAL A CG2 
1577 N N   . HIS A 228 ? 0.2304 0.1567 0.2169 -0.0712 -0.0781 0.0563  208 HIS A N   
1578 C CA  . HIS A 228 ? 0.2373 0.1452 0.2224 -0.0729 -0.0830 0.0546  208 HIS A CA  
1579 C C   . HIS A 228 ? 0.2553 0.1565 0.2382 -0.0772 -0.0906 0.0497  208 HIS A C   
1580 O O   . HIS A 228 ? 0.2902 0.1826 0.2741 -0.0838 -0.0926 0.0543  208 HIS A O   
1581 C CB  . HIS A 228 ? 0.2409 0.1386 0.2236 -0.0668 -0.0849 0.0486  208 HIS A CB  
1582 C CG  . HIS A 228 ? 0.2540 0.1298 0.2327 -0.0679 -0.0907 0.0487  208 HIS A CG  
1583 N ND1 . HIS A 228 ? 0.2493 0.1277 0.2279 -0.0662 -0.0848 0.0535  208 HIS A ND1 
1584 C CD2 . HIS A 228 ? 0.2718 0.1310 0.2455 -0.0667 -0.0989 0.0419  208 HIS A CD2 
1585 C CE1 . HIS A 228 ? 0.2633 0.1282 0.2370 -0.0655 -0.0889 0.0519  208 HIS A CE1 
1586 N NE2 . HIS A 228 ? 0.2845 0.1354 0.2550 -0.0656 -0.0977 0.0457  208 HIS A NE2 
1587 N N   . GLY A 229 ? 0.2572 0.1635 0.2366 -0.0739 -0.0944 0.0396  209 GLY A N   
1588 C CA  . GLY A 229 ? 0.2750 0.1703 0.2504 -0.0769 -0.1030 0.0313  209 GLY A CA  
1589 C C   . GLY A 229 ? 0.2754 0.1874 0.2516 -0.0821 -0.1047 0.0307  209 GLY A C   
1590 O O   . GLY A 229 ? 0.2783 0.1896 0.2582 -0.0913 -0.1071 0.0357  209 GLY A O   
1591 N N   . GLY A 230 ? 0.2737 0.2033 0.2464 -0.0767 -0.1034 0.0248  210 GLY A N   
1592 C CA  . GLY A 230 ? 0.2742 0.2229 0.2462 -0.0805 -0.1049 0.0254  210 GLY A CA  
1593 C C   . GLY A 230 ? 0.3327 0.3002 0.2973 -0.0741 -0.1038 0.0180  210 GLY A C   
1594 O O   . GLY A 230 ? 0.3312 0.3059 0.2944 -0.0678 -0.0975 0.0184  210 GLY A O   
1595 N N   . LEU A 231 ? 0.2930 0.2703 0.2528 -0.0769 -0.1100 0.0113  211 LEU A N   
1596 C CA  . LEU A 231 ? 0.2944 0.2925 0.2448 -0.0715 -0.1094 0.0045  211 LEU A CA  
1597 C C   . LEU A 231 ? 0.3471 0.3381 0.2895 -0.0644 -0.1131 -0.0136 211 LEU A C   
1598 O O   . LEU A 231 ? 0.3936 0.3602 0.3370 -0.0637 -0.1183 -0.0214 211 LEU A O   
1599 C CB  . LEU A 231 ? 0.3150 0.3293 0.2624 -0.0769 -0.1153 0.0045  211 LEU A CB  
1600 C CG  . LEU A 231 ? 0.2893 0.3137 0.2456 -0.0823 -0.1132 0.0210  211 LEU A CG  
1601 C CD1 . LEU A 231 ? 0.2980 0.3414 0.2521 -0.0870 -0.1211 0.0191  211 LEU A CD1 
1602 C CD2 . LEU A 231 ? 0.2748 0.3094 0.2311 -0.0767 -0.1030 0.0345  211 LEU A CD2 
1603 N N   . SER A 232 ? 0.4193 0.4321 0.3526 -0.0584 -0.1105 -0.0199 212 SER A N   
1604 C CA  . SER A 232 ? 0.3884 0.4010 0.3135 -0.0491 -0.1127 -0.0384 212 SER A CA  
1605 C C   . SER A 232 ? 0.3998 0.4349 0.3122 -0.0475 -0.1154 -0.0477 212 SER A C   
1606 O O   . SER A 232 ? 0.4715 0.5301 0.3806 -0.0500 -0.1106 -0.0368 212 SER A O   
1607 C CB  . SER A 232 ? 0.3951 0.4192 0.3228 -0.0414 -0.1030 -0.0365 212 SER A CB  
1608 O OG  . SER A 232 ? 0.4525 0.4836 0.3727 -0.0307 -0.1044 -0.0549 212 SER A OG  
1609 N N   . PRO A 233 ? 0.4373 0.4641 0.3409 -0.0426 -0.1236 -0.0682 213 PRO A N   
1610 C CA  . PRO A 233 ? 0.4309 0.4822 0.3202 -0.0402 -0.1257 -0.0782 213 PRO A CA  
1611 C C   . PRO A 233 ? 0.4078 0.4915 0.2911 -0.0329 -0.1141 -0.0746 213 PRO A C   
1612 O O   . PRO A 233 ? 0.4955 0.6051 0.3672 -0.0334 -0.1130 -0.0738 213 PRO A O   
1613 C CB  . PRO A 233 ? 0.4153 0.4479 0.2963 -0.0340 -0.1357 -0.1031 213 PRO A CB  
1614 C CG  . PRO A 233 ? 0.4150 0.4155 0.3052 -0.0304 -0.1371 -0.1050 213 PRO A CG  
1615 C CD  . PRO A 233 ? 0.4386 0.4322 0.3429 -0.0398 -0.1323 -0.0825 213 PRO A CD  
1616 N N   . GLU A 234 ? 0.3677 0.4516 0.2586 -0.0274 -0.1058 -0.0713 214 GLU A N   
1617 C CA  . GLU A 234 ? 0.3623 0.4784 0.2490 -0.0236 -0.0941 -0.0662 214 GLU A CA  
1618 C C   . GLU A 234 ? 0.3412 0.4656 0.2345 -0.0321 -0.0852 -0.0414 214 GLU A C   
1619 O O   . GLU A 234 ? 0.4060 0.5526 0.2980 -0.0313 -0.0748 -0.0347 214 GLU A O   
1620 C CB  . GLU A 234 ? 0.3797 0.4996 0.2707 -0.0125 -0.0895 -0.0784 214 GLU A CB  
1621 C CG  . GLU A 234 ? 0.4589 0.5641 0.3445 -0.0014 -0.0987 -0.1033 214 GLU A CG  
1622 C CD  . GLU A 234 ? 0.5980 0.7038 0.4915 0.0111  -0.0953 -0.1132 214 GLU A CD  
1623 O OE1 . GLU A 234 ? 0.6649 0.7384 0.5651 0.0154  -0.1028 -0.1190 214 GLU A OE1 
1624 O OE2 . GLU A 234 ? 0.6066 0.7466 0.4998 0.0163  -0.0850 -0.1144 214 GLU A OE2 
1625 N N   . ILE A 235 ? 0.3410 0.4479 0.2412 -0.0403 -0.0891 -0.0283 215 ILE A N   
1626 C CA  . ILE A 235 ? 0.3660 0.4767 0.2715 -0.0469 -0.0820 -0.0056 215 ILE A CA  
1627 C C   . ILE A 235 ? 0.3636 0.4811 0.2637 -0.0521 -0.0862 0.0055  215 ILE A C   
1628 O O   . ILE A 235 ? 0.3873 0.4900 0.2941 -0.0562 -0.0935 0.0073  215 ILE A O   
1629 C CB  . ILE A 235 ? 0.3582 0.4439 0.2792 -0.0499 -0.0808 0.0023  215 ILE A CB  
1630 C CG1 . ILE A 235 ? 0.3478 0.4326 0.2745 -0.0445 -0.0757 -0.0050 215 ILE A CG1 
1631 C CG2 . ILE A 235 ? 0.2853 0.3704 0.2108 -0.0559 -0.0753 0.0238  215 ILE A CG2 
1632 C CD1 . ILE A 235 ? 0.3276 0.3868 0.2669 -0.0459 -0.0770 -0.0015 215 ILE A CD1 
1633 N N   . HIS A 236 ? 0.3485 0.4900 0.2367 -0.0519 -0.0814 0.0140  216 HIS A N   
1634 C CA  . HIS A 236 ? 0.3312 0.4835 0.2117 -0.0543 -0.0866 0.0234  216 HIS A CA  
1635 C C   . HIS A 236 ? 0.3450 0.4982 0.2270 -0.0571 -0.0808 0.0473  216 HIS A C   
1636 O O   . HIS A 236 ? 0.3846 0.5399 0.2664 -0.0580 -0.0862 0.0569  216 HIS A O   
1637 C CB  . HIS A 236 ? 0.3515 0.5304 0.2128 -0.0508 -0.0881 0.0146  216 HIS A CB  
1638 C CG  . HIS A 236 ? 0.3837 0.5613 0.2408 -0.0466 -0.0948 -0.0108 216 HIS A CG  
1639 N ND1 . HIS A 236 ? 0.3722 0.5606 0.2230 -0.0401 -0.0891 -0.0245 216 HIS A ND1 
1640 C CD2 . HIS A 236 ? 0.3987 0.5644 0.2570 -0.0479 -0.1069 -0.0254 216 HIS A CD2 
1641 C CE1 . HIS A 236 ? 0.4242 0.6052 0.2714 -0.0357 -0.0979 -0.0471 216 HIS A CE1 
1642 N NE2 . HIS A 236 ? 0.4834 0.6488 0.3347 -0.0414 -0.1089 -0.0479 216 HIS A NE2 
1643 N N   . THR A 237 ? 0.3511 0.5030 0.2345 -0.0581 -0.0702 0.0567  217 THR A N   
1644 C CA  . THR A 237 ? 0.3341 0.4807 0.2181 -0.0609 -0.0648 0.0789  217 THR A CA  
1645 C C   . THR A 237 ? 0.3513 0.4764 0.2502 -0.0636 -0.0590 0.0825  217 THR A C   
1646 O O   . THR A 237 ? 0.3187 0.4388 0.2250 -0.0631 -0.0578 0.0694  217 THR A O   
1647 C CB  . THR A 237 ? 0.4156 0.5821 0.2835 -0.0621 -0.0568 0.0894  217 THR A CB  
1648 O OG1 . THR A 237 ? 0.4756 0.6582 0.3396 -0.0614 -0.0517 0.0748  217 THR A OG1 
1649 C CG2 . THR A 237 ? 0.3710 0.5555 0.2225 -0.0595 -0.0626 0.0951  217 THR A CG2 
1650 N N   . LEU A 238 ? 0.3656 0.4776 0.2680 -0.0656 -0.0559 0.0997  218 LEU A N   
1651 C CA  . LEU A 238 ? 0.2892 0.3818 0.2033 -0.0687 -0.0501 0.1031  218 LEU A CA  
1652 C C   . LEU A 238 ? 0.3335 0.4367 0.2451 -0.0727 -0.0412 0.1009  218 LEU A C   
1653 O O   . LEU A 238 ? 0.3627 0.4581 0.2850 -0.0745 -0.0383 0.0943  218 LEU A O   
1654 C CB  . LEU A 238 ? 0.2915 0.3674 0.2076 -0.0691 -0.0486 0.1212  218 LEU A CB  
1655 C CG  . LEU A 238 ? 0.3206 0.3891 0.2437 -0.0645 -0.0565 0.1223  218 LEU A CG  
1656 C CD1 . LEU A 238 ? 0.3085 0.3608 0.2337 -0.0620 -0.0548 0.1388  218 LEU A CD1 
1657 C CD2 . LEU A 238 ? 0.2855 0.3442 0.2217 -0.0650 -0.0600 0.1082  218 LEU A CD2 
1658 N N   . ASP A 239 ? 0.4393 0.5633 0.3366 -0.0742 -0.0372 0.1064  219 ASP A N   
1659 C CA  . ASP A 239 ? 0.4510 0.5913 0.3460 -0.0792 -0.0277 0.1052  219 ASP A CA  
1660 C C   . ASP A 239 ? 0.4295 0.5804 0.3324 -0.0752 -0.0284 0.0836  219 ASP A C   
1661 O O   . ASP A 239 ? 0.4760 0.6329 0.3868 -0.0786 -0.0219 0.0804  219 ASP A O   
1662 C CB  . ASP A 239 ? 0.5660 0.7306 0.4420 -0.0813 -0.0233 0.1141  219 ASP A CB  
1663 C CG  . ASP A 239 ? 0.6310 0.7837 0.4989 -0.0876 -0.0190 0.1387  219 ASP A CG  
1664 O OD1 . ASP A 239 ? 0.6392 0.7640 0.5158 -0.0881 -0.0211 0.1472  219 ASP A OD1 
1665 O OD2 . ASP A 239 ? 0.6198 0.7885 0.4743 -0.0904 -0.0135 0.1473  219 ASP A OD2 
1666 N N   . ASP A 240 ? 0.3516 0.5042 0.2529 -0.0678 -0.0369 0.0686  220 ASP A N   
1667 C CA  . ASP A 240 ? 0.3547 0.5127 0.2625 -0.0619 -0.0389 0.0476  220 ASP A CA  
1668 C C   . ASP A 240 ? 0.3497 0.4858 0.2741 -0.0623 -0.0397 0.0450  220 ASP A C   
1669 O O   . ASP A 240 ? 0.3849 0.5261 0.3163 -0.0579 -0.0390 0.0317  220 ASP A O   
1670 C CB  . ASP A 240 ? 0.3753 0.5320 0.2773 -0.0549 -0.0492 0.0320  220 ASP A CB  
1671 C CG  . ASP A 240 ? 0.4430 0.6235 0.3272 -0.0534 -0.0497 0.0314  220 ASP A CG  
1672 O OD1 . ASP A 240 ? 0.4742 0.6803 0.3499 -0.0538 -0.0413 0.0321  220 ASP A OD1 
1673 O OD2 . ASP A 240 ? 0.5156 0.6914 0.3942 -0.0526 -0.0584 0.0305  220 ASP A OD2 
1674 N N   . ILE A 241 ? 0.2834 0.3963 0.2136 -0.0663 -0.0415 0.0573  221 ILE A N   
1675 C CA  . ILE A 241 ? 0.2618 0.3551 0.2057 -0.0673 -0.0417 0.0563  221 ILE A CA  
1676 C C   . ILE A 241 ? 0.2958 0.3950 0.2437 -0.0742 -0.0324 0.0652  221 ILE A C   
1677 O O   . ILE A 241 ? 0.2771 0.3810 0.2340 -0.0739 -0.0302 0.0572  221 ILE A O   
1678 C CB  . ILE A 241 ? 0.2544 0.3223 0.2031 -0.0683 -0.0467 0.0643  221 ILE A CB  
1679 C CG1 . ILE A 241 ? 0.2566 0.3205 0.2024 -0.0643 -0.0560 0.0564  221 ILE A CG1 
1680 C CG2 . ILE A 241 ? 0.2434 0.2935 0.2038 -0.0690 -0.0465 0.0622  221 ILE A CG2 
1681 C CD1 . ILE A 241 ? 0.2511 0.2987 0.2016 -0.0660 -0.0599 0.0654  221 ILE A CD1 
1682 N N   . ARG A 242 ? 0.3043 0.4036 0.2453 -0.0806 -0.0275 0.0817  222 ARG A N   
1683 C CA  . ARG A 242 ? 0.2742 0.3758 0.2177 -0.0900 -0.0189 0.0920  222 ARG A CA  
1684 C C   . ARG A 242 ? 0.2755 0.4051 0.2230 -0.0924 -0.0126 0.0827  222 ARG A C   
1685 O O   . ARG A 242 ? 0.3072 0.4371 0.2644 -0.0992 -0.0081 0.0840  222 ARG A O   
1686 C CB  . ARG A 242 ? 0.3399 0.4400 0.2707 -0.0959 -0.0148 0.1111  222 ARG A CB  
1687 C CG  . ARG A 242 ? 0.2925 0.3660 0.2211 -0.0935 -0.0196 0.1230  222 ARG A CG  
1688 C CD  . ARG A 242 ? 0.5513 0.6204 0.4680 -0.0995 -0.0147 0.1427  222 ARG A CD  
1689 N NE  . ARG A 242 ? 0.6241 0.6751 0.5392 -0.0902 -0.0198 0.1479  222 ARG A NE  
1690 C CZ  . ARG A 242 ? 0.6813 0.7051 0.6051 -0.0854 -0.0207 0.1484  222 ARG A CZ  
1691 N NH1 . ARG A 242 ? 0.7185 0.7275 0.6525 -0.0891 -0.0176 0.1434  222 ARG A NH1 
1692 N NH2 . ARG A 242 ? 0.6216 0.6355 0.5430 -0.0763 -0.0246 0.1529  222 ARG A NH2 
1693 N N   . ARG A 243 ? 0.2809 0.4357 0.2214 -0.0864 -0.0126 0.0723  223 ARG A N   
1694 C CA  . ARG A 243 ? 0.3129 0.5006 0.2569 -0.0869 -0.0058 0.0629  223 ARG A CA  
1695 C C   . ARG A 243 ? 0.3000 0.4928 0.2563 -0.0767 -0.0103 0.0424  223 ARG A C   
1696 O O   . ARG A 243 ? 0.3080 0.5311 0.2690 -0.0741 -0.0054 0.0320  223 ARG A O   
1697 C CB  . ARG A 243 ? 0.4117 0.6293 0.3399 -0.0857 -0.0012 0.0627  223 ARG A CB  
1698 C CG  . ARG A 243 ? 0.4127 0.6373 0.3332 -0.0725 -0.0086 0.0456  223 ARG A CG  
1699 C CD  . ARG A 243 ? 0.4663 0.7268 0.3714 -0.0716 -0.0024 0.0435  223 ARG A CD  
1700 N NE  . ARG A 243 ? 0.5610 0.8243 0.4534 -0.0828 0.0038  0.0661  223 ARG A NE  
1701 C CZ  . ARG A 243 ? 0.6144 0.8629 0.4938 -0.0825 -0.0018 0.0769  223 ARG A CZ  
1702 N NH1 . ARG A 243 ? 0.5805 0.8135 0.4590 -0.0734 -0.0130 0.0666  223 ARG A NH1 
1703 N NH2 . ARG A 243 ? 0.6289 0.8783 0.4959 -0.0914 0.0035  0.0986  223 ARG A NH2 
1704 N N   . LEU A 244 ? 0.3031 0.4674 0.2645 -0.0705 -0.0195 0.0372  224 LEU A N   
1705 C CA  . LEU A 244 ? 0.2937 0.4563 0.2649 -0.0603 -0.0251 0.0201  224 LEU A CA  
1706 C C   . LEU A 244 ? 0.3343 0.5043 0.3200 -0.0648 -0.0211 0.0204  224 LEU A C   
1707 O O   . LEU A 244 ? 0.3859 0.5432 0.3755 -0.0757 -0.0180 0.0335  224 LEU A O   
1708 C CB  . LEU A 244 ? 0.2524 0.3806 0.2240 -0.0550 -0.0356 0.0174  224 LEU A CB  
1709 C CG  . LEU A 244 ? 0.2700 0.3908 0.2308 -0.0486 -0.0429 0.0104  224 LEU A CG  
1710 C CD1 . LEU A 244 ? 0.3112 0.3989 0.2744 -0.0480 -0.0515 0.0119  224 LEU A CD1 
1711 C CD2 . LEU A 244 ? 0.2706 0.4075 0.2293 -0.0370 -0.0455 -0.0092 224 LEU A CD2 
1712 N N   . ASP A 245 ? 0.3098 0.5007 0.3034 -0.0557 -0.0217 0.0049  225 ASP A N   
1713 C CA  . ASP A 245 ? 0.3187 0.5189 0.3279 -0.0572 -0.0205 0.0017  225 ASP A CA  
1714 C C   . ASP A 245 ? 0.3102 0.4821 0.3246 -0.0475 -0.0312 -0.0056 225 ASP A C   
1715 O O   . ASP A 245 ? 0.3385 0.5092 0.3521 -0.0331 -0.0379 -0.0198 225 ASP A O   
1716 C CB  . ASP A 245 ? 0.2974 0.5412 0.3136 -0.0513 -0.0152 -0.0109 225 ASP A CB  
1717 C CG  . ASP A 245 ? 0.3444 0.6012 0.3784 -0.0490 -0.0166 -0.0179 225 ASP A CG  
1718 O OD1 . ASP A 245 ? 0.3189 0.5693 0.3606 -0.0623 -0.0143 -0.0074 225 ASP A OD1 
1719 O OD2 . ASP A 245 ? 0.3865 0.6593 0.4262 -0.0330 -0.0207 -0.0347 225 ASP A OD2 
1720 N N   . ARG A 246 ? 0.2845 0.4327 0.3027 -0.0554 -0.0329 0.0043  226 ARG A N   
1721 C CA  . ARG A 246 ? 0.2262 0.3432 0.2451 -0.0487 -0.0424 0.0018  226 ARG A CA  
1722 C C   . ARG A 246 ? 0.2229 0.3464 0.2540 -0.0441 -0.0460 -0.0055 226 ARG A C   
1723 O O   . ARG A 246 ? 0.2233 0.3249 0.2539 -0.0360 -0.0545 -0.0093 226 ARG A O   
1724 C CB  . ARG A 246 ? 0.2216 0.3096 0.2358 -0.0586 -0.0423 0.0164  226 ARG A CB  
1725 C CG  . ARG A 246 ? 0.2174 0.3051 0.2392 -0.0698 -0.0380 0.0243  226 ARG A CG  
1726 C CD  . ARG A 246 ? 0.2163 0.2750 0.2320 -0.0770 -0.0376 0.0373  226 ARG A CD  
1727 N NE  . ARG A 246 ? 0.2159 0.2676 0.2370 -0.0864 -0.0352 0.0428  226 ARG A NE  
1728 C CZ  . ARG A 246 ? 0.3015 0.3535 0.3215 -0.0985 -0.0285 0.0530  226 ARG A CZ  
1729 N NH1 . ARG A 246 ? 0.3230 0.3834 0.3361 -0.1021 -0.0232 0.0604  226 ARG A NH1 
1730 N NH2 . ARG A 246 ? 0.2765 0.3186 0.3009 -0.1071 -0.0275 0.0559  226 ARG A NH2 
1731 N N   . PHE A 247 ? 0.2320 0.3867 0.2737 -0.0499 -0.0398 -0.0066 227 PHE A N   
1732 C CA  . PHE A 247 ? 0.2186 0.3831 0.2732 -0.0470 -0.0436 -0.0129 227 PHE A CA  
1733 C C   . PHE A 247 ? 0.2234 0.4030 0.2831 -0.0279 -0.0502 -0.0292 227 PHE A C   
1734 O O   . PHE A 247 ? 0.2460 0.4633 0.3178 -0.0246 -0.0473 -0.0377 227 PHE A O   
1735 C CB  . PHE A 247 ? 0.2160 0.4090 0.2819 -0.0623 -0.0352 -0.0082 227 PHE A CB  
1736 C CG  . PHE A 247 ? 0.2180 0.3908 0.2777 -0.0798 -0.0297 0.0077  227 PHE A CG  
1737 C CD1 . PHE A 247 ? 0.2555 0.3943 0.3118 -0.0833 -0.0344 0.0138  227 PHE A CD1 
1738 C CD2 . PHE A 247 ? 0.2217 0.4086 0.2777 -0.0919 -0.0199 0.0166  227 PHE A CD2 
1739 C CE1 . PHE A 247 ? 0.2745 0.3928 0.3247 -0.0970 -0.0298 0.0272  227 PHE A CE1 
1740 C CE2 . PHE A 247 ? 0.2332 0.3974 0.2824 -0.1064 -0.0158 0.0316  227 PHE A CE2 
1741 C CZ  . PHE A 247 ? 0.2237 0.3529 0.2704 -0.1082 -0.0210 0.0363  227 PHE A CZ  
1742 N N   . LYS A 248 ? 0.2291 0.3792 0.2799 -0.0155 -0.0592 -0.0335 228 LYS A N   
1743 C CA  . LYS A 248 ? 0.2728 0.4291 0.3255 0.0044  -0.0668 -0.0489 228 LYS A CA  
1744 C C   . LYS A 248 ? 0.2574 0.3695 0.2990 0.0126  -0.0775 -0.0483 228 LYS A C   
1745 O O   . LYS A 248 ? 0.2825 0.3660 0.3154 0.0023  -0.0773 -0.0369 228 LYS A O   
1746 C CB  . LYS A 248 ? 0.2940 0.4722 0.3427 0.0113  -0.0623 -0.0584 228 LYS A CB  
1747 C CG  . LYS A 248 ? 0.3033 0.4533 0.3357 0.0079  -0.0630 -0.0538 228 LYS A CG  
1748 C CD  . LYS A 248 ? 0.3083 0.4773 0.3341 0.0167  -0.0607 -0.0657 228 LYS A CD  
1749 C CE  . LYS A 248 ? 0.3226 0.5259 0.3485 0.0041  -0.0479 -0.0592 228 LYS A CE  
1750 N NZ  . LYS A 248 ? 0.3532 0.5746 0.3693 0.0122  -0.0455 -0.0702 228 LYS A NZ  
1751 N N   . GLU A 249 ? 0.2618 0.3683 0.3035 0.0310  -0.0868 -0.0602 229 GLU A N   
1752 C CA  . GLU A 249 ? 0.2914 0.3544 0.3205 0.0386  -0.0970 -0.0602 229 GLU A CA  
1753 C C   . GLU A 249 ? 0.2822 0.3340 0.3002 0.0356  -0.0950 -0.0618 229 GLU A C   
1754 O O   . GLU A 249 ? 0.2930 0.3714 0.3121 0.0397  -0.0901 -0.0710 229 GLU A O   
1755 C CB  . GLU A 249 ? 0.2954 0.3545 0.3256 0.0604  -0.1074 -0.0736 229 GLU A CB  
1756 C CG  . GLU A 249 ? 0.3167 0.3274 0.3321 0.0676  -0.1183 -0.0737 229 GLU A CG  
1757 C CD  . GLU A 249 ? 0.4043 0.3836 0.4149 0.0630  -0.1246 -0.0610 229 GLU A CD  
1758 O OE1 . GLU A 249 ? 0.3721 0.3668 0.3904 0.0562  -0.1216 -0.0539 229 GLU A OE1 
1759 O OE2 . GLU A 249 ? 0.4235 0.3625 0.4215 0.0656  -0.1328 -0.0584 229 GLU A OE2 
1760 N N   . PRO A 250 ? 0.2924 0.3085 0.2999 0.0276  -0.0983 -0.0527 230 PRO A N   
1761 C CA  . PRO A 250 ? 0.3251 0.3298 0.3223 0.0250  -0.0986 -0.0553 230 PRO A CA  
1762 C C   . PRO A 250 ? 0.3369 0.3390 0.3293 0.0425  -0.1056 -0.0734 230 PRO A C   
1763 O O   . PRO A 250 ? 0.3858 0.3684 0.3772 0.0555  -0.1149 -0.0796 230 PRO A O   
1764 C CB  . PRO A 250 ? 0.2955 0.2608 0.2849 0.0164  -0.1040 -0.0441 230 PRO A CB  
1765 C CG  . PRO A 250 ? 0.2789 0.2461 0.2747 0.0080  -0.1002 -0.0314 230 PRO A CG  
1766 C CD  . PRO A 250 ? 0.2777 0.2686 0.2834 0.0183  -0.1004 -0.0389 230 PRO A CD  
1767 N N   . PRO A 251 ? 0.3388 0.3609 0.3273 0.0440  -0.1013 -0.0823 231 PRO A N   
1768 C CA  . PRO A 251 ? 0.3622 0.3786 0.3445 0.0619  -0.1086 -0.1016 231 PRO A CA  
1769 C C   . PRO A 251 ? 0.3967 0.3672 0.3661 0.0608  -0.1191 -0.1031 231 PRO A C   
1770 O O   . PRO A 251 ? 0.4109 0.3605 0.3775 0.0453  -0.1194 -0.0887 231 PRO A O   
1771 C CB  . PRO A 251 ? 0.3450 0.4004 0.3258 0.0623  -0.0997 -0.1101 231 PRO A CB  
1772 C CG  . PRO A 251 ? 0.4221 0.4911 0.4040 0.0419  -0.0899 -0.0924 231 PRO A CG  
1773 C CD  . PRO A 251 ? 0.3812 0.4382 0.3720 0.0332  -0.0894 -0.0771 231 PRO A CD  
1774 N N   . ALA A 252 ? 0.4597 0.4149 0.4217 0.0769  -0.1277 -0.1208 232 ALA A N   
1775 C CA  . ALA A 252 ? 0.4783 0.3854 0.4279 0.0758  -0.1393 -0.1235 232 ALA A CA  
1776 C C   . ALA A 252 ? 0.5172 0.4221 0.4573 0.0638  -0.1386 -0.1259 232 ALA A C   
1777 O O   . ALA A 252 ? 0.5984 0.4661 0.5297 0.0569  -0.1472 -0.1254 232 ALA A O   
1778 C CB  . ALA A 252 ? 0.4927 0.3788 0.4372 0.0984  -0.1501 -0.1417 232 ALA A CB  
1779 N N   . PHE A 253 ? 0.4491 0.3950 0.3909 0.0605  -0.1286 -0.1277 233 PHE A N   
1780 C CA  . PHE A 253 ? 0.4529 0.4056 0.3857 0.0500  -0.1272 -0.1292 233 PHE A CA  
1781 C C   . PHE A 253 ? 0.4285 0.4255 0.3665 0.0411  -0.1136 -0.1186 233 PHE A C   
1782 O O   . PHE A 253 ? 0.4869 0.5110 0.4347 0.0451  -0.1057 -0.1153 233 PHE A O   
1783 C CB  . PHE A 253 ? 0.4486 0.4006 0.3697 0.0639  -0.1331 -0.1533 233 PHE A CB  
1784 C CG  . PHE A 253 ? 0.5180 0.5107 0.4423 0.0807  -0.1259 -0.1670 233 PHE A CG  
1785 C CD1 . PHE A 253 ? 0.6190 0.6082 0.5489 0.1004  -0.1296 -0.1782 233 PHE A CD1 
1786 C CD2 . PHE A 253 ? 0.5093 0.5461 0.4312 0.0770  -0.1152 -0.1677 233 PHE A CD2 
1787 C CE1 . PHE A 253 ? 0.6411 0.6737 0.5762 0.1161  -0.1224 -0.1911 233 PHE A CE1 
1788 C CE2 . PHE A 253 ? 0.5353 0.6140 0.4607 0.0911  -0.1073 -0.1796 233 PHE A CE2 
1789 C CZ  . PHE A 253 ? 0.5944 0.6728 0.5276 0.1105  -0.1106 -0.1918 233 PHE A CZ  
1790 N N   . GLY A 254 ? 0.4064 0.4109 0.3377 0.0288  -0.1114 -0.1129 234 GLY A N   
1791 C CA  . GLY A 254 ? 0.3825 0.4240 0.3161 0.0202  -0.0994 -0.1010 234 GLY A CA  
1792 C C   . GLY A 254 ? 0.3687 0.4012 0.3066 0.0034  -0.0968 -0.0791 234 GLY A C   
1793 O O   . GLY A 254 ? 0.4303 0.4313 0.3708 -0.0017 -0.1032 -0.0730 234 GLY A O   
1794 N N   . PRO A 255 ? 0.3248 0.3848 0.2629 -0.0047 -0.0871 -0.0668 235 PRO A N   
1795 C CA  . PRO A 255 ? 0.3079 0.3633 0.2489 -0.0186 -0.0838 -0.0465 235 PRO A CA  
1796 C C   . PRO A 255 ? 0.3288 0.3633 0.2811 -0.0225 -0.0837 -0.0355 235 PRO A C   
1797 O O   . PRO A 255 ? 0.3715 0.3826 0.3250 -0.0292 -0.0884 -0.0277 235 PRO A O   
1798 C CB  . PRO A 255 ? 0.3000 0.3895 0.2393 -0.0226 -0.0724 -0.0375 235 PRO A CB  
1799 C CG  . PRO A 255 ? 0.3147 0.4301 0.2472 -0.0124 -0.0703 -0.0541 235 PRO A CG  
1800 C CD  . PRO A 255 ? 0.3258 0.4246 0.2618 0.0003  -0.0779 -0.0718 235 PRO A CD  
1801 N N   . MET A 256 ? 0.2919 0.3379 0.2523 -0.0185 -0.0783 -0.0354 236 MET A N   
1802 C CA  . MET A 256 ? 0.2743 0.3037 0.2442 -0.0209 -0.0784 -0.0270 236 MET A CA  
1803 C C   . MET A 256 ? 0.3021 0.2976 0.2709 -0.0172 -0.0888 -0.0315 236 MET A C   
1804 O O   . MET A 256 ? 0.3565 0.3323 0.3273 -0.0246 -0.0903 -0.0204 236 MET A O   
1805 C CB  . MET A 256 ? 0.2691 0.3193 0.2478 -0.0155 -0.0732 -0.0308 236 MET A CB  
1806 C CG  . MET A 256 ? 0.2882 0.3266 0.2760 -0.0191 -0.0729 -0.0220 236 MET A CG  
1807 S SD  . MET A 256 ? 0.3398 0.4116 0.3395 -0.0168 -0.0657 -0.0252 236 MET A SD  
1808 C CE  . MET A 256 ? 0.3159 0.3666 0.3231 -0.0197 -0.0692 -0.0176 236 MET A CE  
1809 N N   . CYS A 257 ? 0.3372 0.3252 0.3018 -0.0057 -0.0958 -0.0475 237 CYS A N   
1810 C CA  . CYS A 257 ? 0.3251 0.2766 0.2859 -0.0034 -0.1065 -0.0512 237 CYS A CA  
1811 C C   . CYS A 257 ? 0.3682 0.3019 0.3246 -0.0165 -0.1097 -0.0426 237 CYS A C   
1812 O O   . CYS A 257 ? 0.3726 0.2822 0.3305 -0.0226 -0.1131 -0.0337 237 CYS A O   
1813 C CB  . CYS A 257 ? 0.3449 0.2891 0.2991 0.0109  -0.1141 -0.0711 237 CYS A CB  
1814 S SG  . CYS A 257 ? 0.4680 0.3621 0.4143 0.0115  -0.1281 -0.0753 237 CYS A SG  
1815 N N   . ASP A 258 ? 0.3216 0.2703 0.2728 -0.0209 -0.1085 -0.0449 238 ASP A N   
1816 C CA  . ASP A 258 ? 0.3238 0.2617 0.2722 -0.0326 -0.1124 -0.0385 238 ASP A CA  
1817 C C   . ASP A 258 ? 0.3120 0.2511 0.2676 -0.0434 -0.1070 -0.0195 238 ASP A C   
1818 O O   . ASP A 258 ? 0.3648 0.2863 0.3218 -0.0518 -0.1112 -0.0132 238 ASP A O   
1819 C CB  . ASP A 258 ? 0.3292 0.2891 0.2702 -0.0339 -0.1121 -0.0445 238 ASP A CB  
1820 C CG  . ASP A 258 ? 0.3635 0.3187 0.2952 -0.0246 -0.1192 -0.0653 238 ASP A CG  
1821 O OD1 . ASP A 258 ? 0.4013 0.3279 0.3320 -0.0192 -0.1268 -0.0739 238 ASP A OD1 
1822 O OD2 . ASP A 258 ? 0.3606 0.3394 0.2846 -0.0219 -0.1176 -0.0731 238 ASP A OD2 
1823 N N   . LEU A 259 ? 0.2854 0.2462 0.2452 -0.0434 -0.0975 -0.0108 239 LEU A N   
1824 C CA  . LEU A 259 ? 0.2683 0.2296 0.2342 -0.0512 -0.0919 0.0059  239 LEU A CA  
1825 C C   . LEU A 259 ? 0.2952 0.2323 0.2653 -0.0530 -0.0945 0.0105  239 LEU A C   
1826 O O   . LEU A 259 ? 0.3124 0.2425 0.2855 -0.0604 -0.0939 0.0210  239 LEU A O   
1827 C CB  . LEU A 259 ? 0.2555 0.2361 0.2247 -0.0500 -0.0824 0.0120  239 LEU A CB  
1828 C CG  . LEU A 259 ? 0.2549 0.2601 0.2193 -0.0516 -0.0773 0.0150  239 LEU A CG  
1829 C CD1 . LEU A 259 ? 0.3167 0.3373 0.2844 -0.0519 -0.0684 0.0204  239 LEU A CD1 
1830 C CD2 . LEU A 259 ? 0.2688 0.2733 0.2324 -0.0584 -0.0775 0.0270  239 LEU A CD2 
1831 N N   . LEU A 260 ? 0.2745 0.2010 0.2445 -0.0453 -0.0975 0.0026  240 LEU A N   
1832 C CA  . LEU A 260 ? 0.2770 0.1807 0.2485 -0.0455 -0.1006 0.0071  240 LEU A CA  
1833 C C   . LEU A 260 ? 0.2969 0.1738 0.2630 -0.0482 -0.1097 0.0038  240 LEU A C   
1834 O O   . LEU A 260 ? 0.2996 0.1583 0.2657 -0.0533 -0.1114 0.0121  240 LEU A O   
1835 C CB  . LEU A 260 ? 0.2786 0.1836 0.2520 -0.0350 -0.1009 0.0006  240 LEU A CB  
1836 C CG  . LEU A 260 ? 0.2624 0.1946 0.2420 -0.0337 -0.0923 0.0024  240 LEU A CG  
1837 C CD1 . LEU A 260 ? 0.2640 0.1990 0.2477 -0.0246 -0.0937 -0.0034 240 LEU A CD1 
1838 C CD2 . LEU A 260 ? 0.2470 0.1819 0.2300 -0.0435 -0.0856 0.0167  240 LEU A CD2 
1839 N N   . TRP A 261 ? 0.3134 0.1875 0.2741 -0.0455 -0.1157 -0.0083 241 TRP A N   
1840 C CA  . TRP A 261 ? 0.3394 0.1827 0.2938 -0.0473 -0.1259 -0.0140 241 TRP A CA  
1841 C C   . TRP A 261 ? 0.3489 0.1872 0.3014 -0.0598 -0.1304 -0.0136 241 TRP A C   
1842 O O   . TRP A 261 ? 0.3680 0.1791 0.3173 -0.0666 -0.1373 -0.0124 241 TRP A O   
1843 C CB  . TRP A 261 ? 0.3615 0.1935 0.3097 -0.0330 -0.1327 -0.0309 241 TRP A CB  
1844 C CG  . TRP A 261 ? 0.3627 0.1864 0.3123 -0.0219 -0.1332 -0.0304 241 TRP A CG  
1845 C CD1 . TRP A 261 ? 0.3469 0.1955 0.3025 -0.0125 -0.1271 -0.0323 241 TRP A CD1 
1846 C CD2 . TRP A 261 ? 0.3824 0.1720 0.3272 -0.0197 -0.1407 -0.0271 241 TRP A CD2 
1847 N NE1 . TRP A 261 ? 0.3542 0.1885 0.3100 -0.0037 -0.1309 -0.0315 241 TRP A NE1 
1848 C CE2 . TRP A 261 ? 0.3767 0.1738 0.3248 -0.0072 -0.1393 -0.0279 241 TRP A CE2 
1849 C CE3 . TRP A 261 ? 0.4066 0.1604 0.3442 -0.0279 -0.1486 -0.0229 241 TRP A CE3 
1850 C CZ2 . TRP A 261 ? 0.4336 0.2040 0.3770 -0.0009 -0.1460 -0.0244 241 TRP A CZ2 
1851 C CZ3 . TRP A 261 ? 0.4279 0.1563 0.3604 -0.0223 -0.1533 -0.0178 241 TRP A CZ3 
1852 C CH2 . TRP A 261 ? 0.4190 0.1522 0.3533 -0.0085 -0.1535 -0.0190 241 TRP A CH2 
1853 N N   . SER A 262 ? 0.3383 0.2022 0.2924 -0.0636 -0.1271 -0.0140 242 SER A N   
1854 C CA  . SER A 262 ? 0.3517 0.2123 0.3037 -0.0742 -0.1337 -0.0172 242 SER A CA  
1855 C C   . SER A 262 ? 0.3466 0.2028 0.3053 -0.0889 -0.1332 -0.0031 242 SER A C   
1856 O O   . SER A 262 ? 0.3450 0.2108 0.3103 -0.0904 -0.1256 0.0103  242 SER A O   
1857 C CB  . SER A 262 ? 0.3461 0.2364 0.2959 -0.0729 -0.1319 -0.0227 242 SER A CB  
1858 O OG  . SER A 262 ? 0.3203 0.2362 0.2763 -0.0739 -0.1224 -0.0093 242 SER A OG  
1859 N N   . ASP A 263 ? 0.3658 0.2113 0.3235 -0.0976 -0.1387 -0.0063 243 ASP A N   
1860 C CA  . ASP A 263 ? 0.3620 0.2135 0.3275 -0.1086 -0.1342 0.0064  243 ASP A CA  
1861 C C   . ASP A 263 ? 0.3648 0.2362 0.3337 -0.1172 -0.1374 0.0029  243 ASP A C   
1862 O O   . ASP A 263 ? 0.3785 0.2508 0.3411 -0.1154 -0.1440 -0.0110 243 ASP A O   
1863 C CB  . ASP A 263 ? 0.3858 0.2109 0.3481 -0.1113 -0.1355 0.0074  243 ASP A CB  
1864 C CG  . ASP A 263 ? 0.4098 0.2167 0.3680 -0.1025 -0.1331 0.0116  243 ASP A CG  
1865 O OD1 . ASP A 263 ? 0.4512 0.2694 0.4138 -0.1012 -0.1257 0.0228  243 ASP A OD1 
1866 O OD2 . ASP A 263 ? 0.4364 0.2186 0.3865 -0.0960 -0.1391 0.0030  243 ASP A OD2 
1867 N N   . PRO A 264 ? 0.3535 0.2427 0.3321 -0.1259 -0.1329 0.0145  244 PRO A N   
1868 C CA  . PRO A 264 ? 0.3620 0.2681 0.3447 -0.1348 -0.1373 0.0103  244 PRO A CA  
1869 C C   . PRO A 264 ? 0.3930 0.2753 0.3717 -0.1408 -0.1424 0.0016  244 PRO A C   
1870 O O   . PRO A 264 ? 0.4340 0.2913 0.4095 -0.1400 -0.1405 0.0051  244 PRO A O   
1871 C CB  . PRO A 264 ? 0.3455 0.2736 0.3405 -0.1415 -0.1310 0.0251  244 PRO A CB  
1872 C CG  . PRO A 264 ? 0.3378 0.2520 0.3329 -0.1380 -0.1238 0.0351  244 PRO A CG  
1873 C CD  . PRO A 264 ? 0.3344 0.2324 0.3207 -0.1269 -0.1243 0.0301  244 PRO A CD  
1874 N N   . SER A 265 ? 0.4257 0.3157 0.4036 -0.1462 -0.1491 -0.0096 245 SER A N   
1875 C CA  . SER A 265 ? 0.4743 0.3412 0.4485 -0.1530 -0.1546 -0.0191 245 SER A CA  
1876 C C   . SER A 265 ? 0.4523 0.3183 0.4357 -0.1656 -0.1506 -0.0069 245 SER A C   
1877 O O   . SER A 265 ? 0.4570 0.3484 0.4507 -0.1694 -0.1449 0.0052  245 SER A O   
1878 C CB  . SER A 265 ? 0.4730 0.3537 0.4453 -0.1566 -0.1623 -0.0343 245 SER A CB  
1879 O OG  . SER A 265 ? 0.4863 0.4041 0.4690 -0.1623 -0.1612 -0.0279 245 SER A OG  
1880 N N   . GLU A 266 ? 0.4779 0.3152 0.4570 -0.1715 -0.1534 -0.0100 246 GLU A N   
1881 C CA  . GLU A 266 ? 0.4866 0.3228 0.4729 -0.1842 -0.1494 0.0016  246 GLU A CA  
1882 C C   . GLU A 266 ? 0.5013 0.3699 0.5011 -0.1976 -0.1499 0.0028  246 GLU A C   
1883 O O   . GLU A 266 ? 0.5060 0.3906 0.5155 -0.2057 -0.1441 0.0152  246 GLU A O   
1884 C CB  . GLU A 266 ? 0.5509 0.3493 0.5290 -0.1890 -0.1535 -0.0023 246 GLU A CB  
1885 C CG  . GLU A 266 ? 0.5694 0.3648 0.5525 -0.2016 -0.1486 0.0113  246 GLU A CG  
1886 C CD  . GLU A 266 ? 0.6131 0.3675 0.5860 -0.2055 -0.1530 0.0092  246 GLU A CD  
1887 O OE1 . GLU A 266 ? 0.6341 0.3624 0.5966 -0.1973 -0.1601 -0.0037 246 GLU A OE1 
1888 O OE2 . GLU A 266 ? 0.6290 0.3769 0.6037 -0.2163 -0.1495 0.0202  246 GLU A OE2 
1889 N N   . ASP A 267 ? 0.5453 0.4260 0.5455 -0.1991 -0.1571 -0.0108 247 ASP A N   
1890 C CA  . ASP A 267 ? 0.6192 0.5342 0.6325 -0.2100 -0.1593 -0.0115 247 ASP A CA  
1891 C C   . ASP A 267 ? 0.5557 0.5077 0.5737 -0.2015 -0.1585 -0.0095 247 ASP A C   
1892 O O   . ASP A 267 ? 0.4986 0.4757 0.5212 -0.2046 -0.1643 -0.0173 247 ASP A O   
1893 C CB  . ASP A 267 ? 0.7253 0.6316 0.7365 -0.2189 -0.1691 -0.0286 247 ASP A CB  
1894 C CG  . ASP A 267 ? 0.8101 0.6987 0.8063 -0.2071 -0.1752 -0.0453 247 ASP A CG  
1895 O OD1 . ASP A 267 ? 0.7771 0.6906 0.7716 -0.1996 -0.1781 -0.0523 247 ASP A OD1 
1896 O OD2 . ASP A 267 ? 0.9086 0.7592 0.8940 -0.2047 -0.1773 -0.0512 247 ASP A OD2 
1897 N N   . PHE A 268 ? 0.4284 0.3839 0.4448 -0.1907 -0.1516 0.0012  248 PHE A N   
1898 C CA  . PHE A 268 ? 0.4007 0.3880 0.4203 -0.1820 -0.1503 0.0053  248 PHE A CA  
1899 C C   . PHE A 268 ? 0.4049 0.4317 0.4395 -0.1889 -0.1508 0.0106  248 PHE A C   
1900 O O   . PHE A 268 ? 0.4464 0.4823 0.4922 -0.1969 -0.1460 0.0204  248 PHE A O   
1901 C CB  . PHE A 268 ? 0.3757 0.3587 0.3939 -0.1724 -0.1420 0.0181  248 PHE A CB  
1902 C CG  . PHE A 268 ? 0.3515 0.3599 0.3702 -0.1624 -0.1410 0.0222  248 PHE A CG  
1903 C CD1 . PHE A 268 ? 0.3338 0.3747 0.3648 -0.1625 -0.1376 0.0335  248 PHE A CD1 
1904 C CD2 . PHE A 268 ? 0.3485 0.3489 0.3551 -0.1521 -0.1434 0.0153  248 PHE A CD2 
1905 C CE1 . PHE A 268 ? 0.3152 0.3775 0.3456 -0.1523 -0.1369 0.0388  248 PHE A CE1 
1906 C CE2 . PHE A 268 ? 0.3295 0.3531 0.3352 -0.1435 -0.1421 0.0207  248 PHE A CE2 
1907 C CZ  . PHE A 268 ? 0.3136 0.3666 0.3308 -0.1434 -0.1390 0.0331  248 PHE A CZ  
1908 N N   . GLY A 269 ? 0.4978 0.5499 0.5322 -0.1849 -0.1567 0.0040  249 GLY A N   
1909 C CA  . GLY A 269 ? 0.5027 0.5951 0.5509 -0.1878 -0.1578 0.0092  249 GLY A CA  
1910 C C   . GLY A 269 ? 0.4784 0.5792 0.5351 -0.2019 -0.1643 0.0003  249 GLY A C   
1911 O O   . GLY A 269 ? 0.4739 0.6100 0.5428 -0.2045 -0.1669 0.0023  249 GLY A O   
1912 N N   . ASN A 270 ? 0.4766 0.5447 0.5273 -0.2105 -0.1672 -0.0094 250 ASN A N   
1913 C CA  . ASN A 270 ? 0.5711 0.6413 0.6285 -0.2253 -0.1743 -0.0197 250 ASN A CA  
1914 C C   . ASN A 270 ? 0.5935 0.6300 0.6367 -0.2262 -0.1815 -0.0374 250 ASN A C   
1915 O O   . ASN A 270 ? 0.5845 0.5934 0.6270 -0.2375 -0.1829 -0.0418 250 ASN A O   
1916 C CB  . ASN A 270 ? 0.6199 0.6876 0.6897 -0.2395 -0.1687 -0.0094 250 ASN A CB  
1917 C CG  . ASN A 270 ? 0.6588 0.7699 0.7459 -0.2405 -0.1641 0.0034  250 ASN A CG  
1918 O OD1 . ASN A 270 ? 0.7332 0.8769 0.8316 -0.2450 -0.1699 -0.0010 250 ASN A OD1 
1919 N ND2 . ASN A 270 ? 0.6048 0.7176 0.6942 -0.2350 -0.1541 0.0183  250 ASN A ND2 
1920 N N   . GLU A 271 ? 0.6565 0.6967 0.6876 -0.2137 -0.1859 -0.0474 251 GLU A N   
1921 C CA  . GLU A 271 ? 0.7289 0.7387 0.7435 -0.2093 -0.1912 -0.0646 251 GLU A CA  
1922 C C   . GLU A 271 ? 0.7794 0.7860 0.7938 -0.2195 -0.2014 -0.0834 251 GLU A C   
1923 O O   . GLU A 271 ? 0.7319 0.7708 0.7538 -0.2231 -0.2079 -0.0886 251 GLU A O   
1924 C CB  . GLU A 271 ? 0.7117 0.7325 0.7129 -0.1923 -0.1920 -0.0692 251 GLU A CB  
1925 C CG  . GLU A 271 ? 0.6504 0.6587 0.6459 -0.1812 -0.1834 -0.0569 251 GLU A CG  
1926 C CD  . GLU A 271 ? 0.6345 0.6712 0.6412 -0.1786 -0.1765 -0.0376 251 GLU A CD  
1927 O OE1 . GLU A 271 ? 0.5653 0.6361 0.5810 -0.1810 -0.1793 -0.0350 251 GLU A OE1 
1928 O OE2 . GLU A 271 ? 0.6481 0.6730 0.6544 -0.1734 -0.1688 -0.0255 251 GLU A OE2 
1929 N N   . LYS A 272 ? 0.8100 0.7763 0.8148 -0.2230 -0.2034 -0.0937 252 LYS A N   
1930 C CA  . LYS A 272 ? 0.8798 0.8354 0.8785 -0.2291 -0.2132 -0.1155 252 LYS A CA  
1931 C C   . LYS A 272 ? 0.9068 0.8733 0.8894 -0.2139 -0.2177 -0.1314 252 LYS A C   
1932 O O   . LYS A 272 ? 0.9044 0.9048 0.8887 -0.2126 -0.2242 -0.1397 252 LYS A O   
1933 C CB  . LYS A 272 ? 0.8911 0.7970 0.8827 -0.2358 -0.2133 -0.1201 252 LYS A CB  
1934 C CG  . LYS A 272 ? 0.9085 0.8048 0.9145 -0.2544 -0.2110 -0.1082 252 LYS A CG  
1935 C CD  . LYS A 272 ? 0.9598 0.8096 0.9575 -0.2635 -0.2155 -0.1187 252 LYS A CD  
1936 C CE  . LYS A 272 ? 0.9832 0.8284 0.9953 -0.2853 -0.2155 -0.1103 252 LYS A CE  
1937 N NZ  . LYS A 272 ? 1.0364 0.8342 1.0394 -0.2947 -0.2206 -0.1203 252 LYS A NZ  
1938 N N   . SER A 273 ? 0.9926 0.9323 0.9591 -0.2015 -0.2143 -0.1349 253 SER A N   
1939 C CA  . SER A 273 ? 0.9828 0.9341 0.9323 -0.1866 -0.2166 -0.1485 253 SER A CA  
1940 C C   . SER A 273 ? 0.9023 0.8918 0.8544 -0.1760 -0.2127 -0.1355 253 SER A C   
1941 O O   . SER A 273 ? 0.8756 0.8688 0.8379 -0.1759 -0.2057 -0.1154 253 SER A O   
1942 C CB  . SER A 273 ? 1.0122 0.9241 0.9450 -0.1757 -0.2138 -0.1549 253 SER A CB  
1943 O OG  . SER A 273 ? 1.0442 0.9693 0.9595 -0.1613 -0.2145 -0.1669 253 SER A OG  
1944 N N   . GLN A 274 ? 0.8173 0.8349 0.7589 -0.1670 -0.2172 -0.1465 254 GLN A N   
1945 C CA  . GLN A 274 ? 0.7735 0.8237 0.7140 -0.1552 -0.2143 -0.1335 254 GLN A CA  
1946 C C   . GLN A 274 ? 0.7567 0.7972 0.6819 -0.1411 -0.2076 -0.1318 254 GLN A C   
1947 O O   . GLN A 274 ? 0.7652 0.8294 0.6851 -0.1305 -0.2050 -0.1225 254 GLN A O   
1948 C CB  . GLN A 274 ? 0.7367 0.8219 0.6730 -0.1506 -0.2239 -0.1423 254 GLN A CB  
1949 C CG  . GLN A 274 ? 0.7453 0.8472 0.6996 -0.1634 -0.2308 -0.1391 254 GLN A CG  
1950 C CD  . GLN A 274 ? 0.7684 0.8945 0.7155 -0.1592 -0.2446 -0.1509 254 GLN A CD  
1951 O OE1 . GLN A 274 ? 0.7877 0.9097 0.7141 -0.1480 -0.2512 -0.1653 254 GLN A OE1 
1952 N NE2 . GLN A 274 ? 0.7698 0.9185 0.7319 -0.1681 -0.2499 -0.1435 254 GLN A NE2 
1953 N N   . GLU A 275 ? 0.7156 0.7191 0.6334 -0.1407 -0.2053 -0.1395 255 GLU A N   
1954 C CA  . GLU A 275 ? 0.7145 0.7055 0.6188 -0.1269 -0.2000 -0.1397 255 GLU A CA  
1955 C C   . GLU A 275 ? 0.7058 0.7033 0.6188 -0.1223 -0.1923 -0.1176 255 GLU A C   
1956 O O   . GLU A 275 ? 0.8166 0.8088 0.7453 -0.1308 -0.1894 -0.1023 255 GLU A O   
1957 C CB  . GLU A 275 ? 0.8101 0.7550 0.7088 -0.1259 -0.2006 -0.1501 255 GLU A CB  
1958 C CG  . GLU A 275 ? 0.9372 0.8703 0.8188 -0.1090 -0.1985 -0.1604 255 GLU A CG  
1959 C CD  . GLU A 275 ? 0.9845 0.9358 0.8465 -0.1033 -0.2020 -0.1783 255 GLU A CD  
1960 O OE1 . GLU A 275 ? 0.9821 0.9311 0.8304 -0.0874 -0.1993 -0.1868 255 GLU A OE1 
1961 O OE2 . GLU A 275 ? 0.9439 0.9133 0.8042 -0.1141 -0.2071 -0.1837 255 GLU A OE2 
1962 N N   . HIS A 276 ? 0.5322 0.5415 0.4340 -0.1098 -0.1884 -0.1155 256 HIS A N   
1963 C CA  . HIS A 276 ? 0.4529 0.4690 0.3618 -0.1068 -0.1810 -0.0944 256 HIS A CA  
1964 C C   . HIS A 276 ? 0.4668 0.4491 0.3788 -0.1038 -0.1769 -0.0911 256 HIS A C   
1965 O O   . HIS A 276 ? 0.4522 0.4295 0.3763 -0.1077 -0.1715 -0.0735 256 HIS A O   
1966 C CB  . HIS A 276 ? 0.4439 0.4886 0.3392 -0.0962 -0.1778 -0.0907 256 HIS A CB  
1967 C CG  . HIS A 276 ? 0.4370 0.5176 0.3325 -0.0972 -0.1786 -0.0824 256 HIS A CG  
1968 N ND1 . HIS A 276 ? 0.4177 0.5240 0.3088 -0.0911 -0.1712 -0.0660 256 HIS A ND1 
1969 C CD2 . HIS A 276 ? 0.4492 0.5428 0.3488 -0.1024 -0.1858 -0.0875 256 HIS A CD2 
1970 C CE1 . HIS A 276 ? 0.4209 0.5520 0.3125 -0.0912 -0.1738 -0.0608 256 HIS A CE1 
1971 N NE2 . HIS A 276 ? 0.4394 0.5641 0.3362 -0.0979 -0.1834 -0.0740 256 HIS A NE2 
1972 N N   . PHE A 277 ? 0.4699 0.4306 0.3707 -0.0951 -0.1791 -0.1082 257 PHE A N   
1973 C CA  . PHE A 277 ? 0.4691 0.3984 0.3719 -0.0887 -0.1763 -0.1068 257 PHE A CA  
1974 C C   . PHE A 277 ? 0.5043 0.3995 0.4021 -0.0869 -0.1812 -0.1232 257 PHE A C   
1975 O O   . PHE A 277 ? 0.5862 0.4844 0.4735 -0.0851 -0.1859 -0.1404 257 PHE A O   
1976 C CB  . PHE A 277 ? 0.4568 0.3984 0.3514 -0.0732 -0.1717 -0.1089 257 PHE A CB  
1977 C CG  . PHE A 277 ? 0.4225 0.3955 0.3247 -0.0731 -0.1599 -0.0879 257 PHE A CG  
1978 C CD1 . PHE A 277 ? 0.3991 0.3638 0.3139 -0.0746 -0.1522 -0.0703 257 PHE A CD1 
1979 C CD2 . PHE A 277 ? 0.4172 0.4258 0.3126 -0.0713 -0.1570 -0.0857 257 PHE A CD2 
1980 C CE1 . PHE A 277 ? 0.3722 0.3610 0.2932 -0.0744 -0.1423 -0.0523 257 PHE A CE1 
1981 C CE2 . PHE A 277 ? 0.3910 0.4228 0.2921 -0.0710 -0.1471 -0.0659 257 PHE A CE2 
1982 C CZ  . PHE A 277 ? 0.3689 0.3896 0.2832 -0.0726 -0.1398 -0.0497 257 PHE A CZ  
1983 N N   . SER A 278 ? 0.5084 0.3706 0.4120 -0.0870 -0.1801 -0.1172 258 SER A N   
1984 C CA  . SER A 278 ? 0.5533 0.3787 0.4505 -0.0822 -0.1848 -0.1305 258 SER A CA  
1985 C C   . SER A 278 ? 0.5785 0.3770 0.4777 -0.0724 -0.1825 -0.1239 258 SER A C   
1986 O O   . SER A 278 ? 0.5508 0.3546 0.4587 -0.0754 -0.1772 -0.1068 258 SER A O   
1987 C CB  . SER A 278 ? 0.5781 0.3872 0.4802 -0.0986 -0.1889 -0.1298 258 SER A CB  
1988 O OG  . SER A 278 ? 0.6087 0.4252 0.5251 -0.1126 -0.1847 -0.1096 258 SER A OG  
1989 N N   . HIS A 279 ? 0.6368 0.4074 0.5276 -0.0600 -0.1866 -0.1377 259 HIS A N   
1990 C CA  . HIS A 279 ? 0.6299 0.3779 0.5214 -0.0473 -0.1857 -0.1335 259 HIS A CA  
1991 C C   . HIS A 279 ? 0.5860 0.3141 0.4862 -0.0597 -0.1837 -0.1129 259 HIS A C   
1992 O O   . HIS A 279 ? 0.6092 0.3214 0.5106 -0.0729 -0.1861 -0.1095 259 HIS A O   
1993 C CB  . HIS A 279 ? 0.7221 0.4437 0.6033 -0.0305 -0.1916 -0.1520 259 HIS A CB  
1994 C CG  . HIS A 279 ? 0.8452 0.5905 0.7173 -0.0162 -0.1918 -0.1729 259 HIS A CG  
1995 N ND1 . HIS A 279 ? 0.8584 0.6372 0.7308 -0.0047 -0.1863 -0.1754 259 HIS A ND1 
1996 C CD2 . HIS A 279 ? 0.8795 0.6222 0.7413 -0.0118 -0.1962 -0.1922 259 HIS A CD2 
1997 C CE1 . HIS A 279 ? 0.8381 0.6365 0.7009 0.0066  -0.1862 -0.1945 259 HIS A CE1 
1998 N NE2 . HIS A 279 ? 0.8586 0.6348 0.7145 0.0029  -0.1924 -0.2052 259 HIS A NE2 
1999 N N   . ASN A 280 ? 0.5409 0.2735 0.4468 -0.0559 -0.1787 -0.0995 260 ASN A N   
2000 C CA  . ASN A 280 ? 0.5309 0.2532 0.4444 -0.0670 -0.1747 -0.0786 260 ASN A CA  
2001 C C   . ASN A 280 ? 0.5629 0.2472 0.4709 -0.0616 -0.1788 -0.0773 260 ASN A C   
2002 O O   . ASN A 280 ? 0.5647 0.2374 0.4699 -0.0471 -0.1798 -0.0774 260 ASN A O   
2003 C CB  . ASN A 280 ? 0.4924 0.2354 0.4130 -0.0651 -0.1677 -0.0657 260 ASN A CB  
2004 C CG  . ASN A 280 ? 0.4786 0.2202 0.4070 -0.0771 -0.1616 -0.0445 260 ASN A CG  
2005 O OD1 . ASN A 280 ? 0.5326 0.2508 0.4587 -0.0802 -0.1628 -0.0385 260 ASN A OD1 
2006 N ND2 . ASN A 280 ? 0.4457 0.2140 0.3823 -0.0831 -0.1548 -0.0331 260 ASN A ND2 
2007 N N   . THR A 281 ? 0.6068 0.2730 0.5132 -0.0736 -0.1818 -0.0761 261 THR A N   
2008 C CA  . THR A 281 ? 0.6340 0.2624 0.5331 -0.0704 -0.1870 -0.0755 261 THR A CA  
2009 C C   . THR A 281 ? 0.6786 0.2995 0.5796 -0.0701 -0.1828 -0.0567 261 THR A C   
2010 O O   . THR A 281 ? 0.7345 0.3301 0.6283 -0.0587 -0.1871 -0.0569 261 THR A O   
2011 C CB  . THR A 281 ? 0.6600 0.2731 0.5583 -0.0879 -0.1902 -0.0761 261 THR A CB  
2012 O OG1 . THR A 281 ? 0.6372 0.2704 0.5459 -0.1064 -0.1834 -0.0598 261 THR A OG1 
2013 C CG2 . THR A 281 ? 0.6763 0.2952 0.5710 -0.0883 -0.1953 -0.0965 261 THR A CG2 
2014 N N   . VAL A 282 ? 0.6084 0.2532 0.5186 -0.0819 -0.1747 -0.0412 262 VAL A N   
2015 C CA  . VAL A 282 ? 0.5718 0.2169 0.4838 -0.0825 -0.1690 -0.0235 262 VAL A CA  
2016 C C   . VAL A 282 ? 0.5717 0.2196 0.4822 -0.0649 -0.1687 -0.0241 262 VAL A C   
2017 O O   . VAL A 282 ? 0.6317 0.2621 0.5367 -0.0578 -0.1704 -0.0184 262 VAL A O   
2018 C CB  . VAL A 282 ? 0.5394 0.2142 0.4621 -0.0971 -0.1597 -0.0093 262 VAL A CB  
2019 C CG1 . VAL A 282 ? 0.5197 0.2015 0.4439 -0.0942 -0.1529 0.0056  262 VAL A CG1 
2020 C CG2 . VAL A 282 ? 0.5584 0.2300 0.4838 -0.1150 -0.1597 -0.0055 262 VAL A CG2 
2021 N N   . ARG A 283 ? 0.5861 0.2569 0.5011 -0.0585 -0.1668 -0.0309 263 ARG A N   
2022 C CA  . ARG A 283 ? 0.5641 0.2410 0.4796 -0.0433 -0.1663 -0.0326 263 ARG A CA  
2023 C C   . ARG A 283 ? 0.6144 0.2737 0.5226 -0.0237 -0.1749 -0.0498 263 ARG A C   
2024 O O   . ARG A 283 ? 0.6497 0.3081 0.5575 -0.0094 -0.1763 -0.0510 263 ARG A O   
2025 C CB  . ARG A 283 ? 0.5224 0.2311 0.4457 -0.0448 -0.1609 -0.0336 263 ARG A CB  
2026 C CG  . ARG A 283 ? 0.4488 0.1792 0.3804 -0.0611 -0.1524 -0.0184 263 ARG A CG  
2027 C CD  . ARG A 283 ? 0.4353 0.1676 0.3696 -0.0631 -0.1459 -0.0018 263 ARG A CD  
2028 N NE  . ARG A 283 ? 0.4464 0.1991 0.3880 -0.0771 -0.1379 0.0105  263 ARG A NE  
2029 C CZ  . ARG A 283 ? 0.4487 0.2114 0.3936 -0.0806 -0.1303 0.0239  263 ARG A CZ  
2030 N NH1 . ARG A 283 ? 0.4702 0.2248 0.4112 -0.0726 -0.1296 0.0276  263 ARG A NH1 
2031 N NH2 . ARG A 283 ? 0.3865 0.1691 0.3384 -0.0912 -0.1236 0.0322  263 ARG A NH2 
2032 N N   . GLY A 284 ? 0.6209 0.2688 0.5236 -0.0219 -0.1806 -0.0644 264 GLY A N   
2033 C CA  . GLY A 284 ? 0.6021 0.2380 0.4981 -0.0009 -0.1878 -0.0830 264 GLY A CA  
2034 C C   . GLY A 284 ? 0.6276 0.2927 0.5269 0.0118  -0.1860 -0.0977 264 GLY A C   
2035 O O   . GLY A 284 ? 0.6303 0.2945 0.5260 0.0322  -0.1903 -0.1143 264 GLY A O   
2036 N N   . CYS A 285 ? 0.6117 0.3054 0.5177 0.0003  -0.1794 -0.0917 265 CYS A N   
2037 C CA  . CYS A 285 ? 0.5327 0.2593 0.4401 0.0079  -0.1770 -0.1053 265 CYS A CA  
2038 C C   . CYS A 285 ? 0.5091 0.2654 0.4225 -0.0102 -0.1692 -0.0944 265 CYS A C   
2039 O O   . CYS A 285 ? 0.5569 0.3034 0.4735 -0.0271 -0.1685 -0.0794 265 CYS A O   
2040 C CB  . CYS A 285 ? 0.4989 0.2477 0.4140 0.0227  -0.1703 -0.1022 265 CYS A CB  
2041 S SG  . CYS A 285 ? 0.5548 0.3188 0.4814 0.0100  -0.1604 -0.0763 265 CYS A SG  
2042 N N   . SER A 286 ? 0.4632 0.2597 0.3788 -0.0057 -0.1616 -0.1002 266 SER A N   
2043 C CA  . SER A 286 ? 0.4381 0.2638 0.3580 -0.0201 -0.1546 -0.0898 266 SER A CA  
2044 C C   . SER A 286 ? 0.4641 0.2748 0.3791 -0.0350 -0.1627 -0.0923 266 SER A C   
2045 O O   . SER A 286 ? 0.4896 0.2744 0.3959 -0.0321 -0.1720 -0.1069 266 SER A O   
2046 C CB  . SER A 286 ? 0.4387 0.2748 0.3694 -0.0287 -0.1459 -0.0680 266 SER A CB  
2047 O OG  . SER A 286 ? 0.4993 0.3673 0.4341 -0.0373 -0.1383 -0.0592 266 SER A OG  
2048 N N   . TYR A 287 ? 0.4647 0.2934 0.3860 -0.0500 -0.1582 -0.0780 267 TYR A N   
2049 C CA  . TYR A 287 ? 0.4571 0.2853 0.3757 -0.0637 -0.1650 -0.0815 267 TYR A CA  
2050 C C   . TYR A 287 ? 0.4408 0.2695 0.3701 -0.0805 -0.1611 -0.0628 267 TYR A C   
2051 O O   . TYR A 287 ? 0.4787 0.3097 0.4156 -0.0833 -0.1554 -0.0471 267 TYR A O   
2052 C CB  . TYR A 287 ? 0.4365 0.3039 0.3519 -0.0613 -0.1610 -0.0866 267 TYR A CB  
2053 C CG  . TYR A 287 ? 0.4564 0.3359 0.3622 -0.0441 -0.1599 -0.1042 267 TYR A CG  
2054 C CD1 . TYR A 287 ? 0.4442 0.3471 0.3535 -0.0327 -0.1492 -0.0998 267 TYR A CD1 
2055 C CD2 . TYR A 287 ? 0.4796 0.3493 0.3732 -0.0397 -0.1693 -0.1259 267 TYR A CD2 
2056 C CE1 . TYR A 287 ? 0.5284 0.4476 0.4304 -0.0175 -0.1470 -0.1156 267 TYR A CE1 
2057 C CE2 . TYR A 287 ? 0.5151 0.3994 0.3998 -0.0226 -0.1673 -0.1430 267 TYR A CE2 
2058 C CZ  . TYR A 287 ? 0.5963 0.5074 0.4859 -0.0116 -0.1556 -0.1372 267 TYR A CZ  
2059 O OH  . TYR A 287 ? 0.6548 0.5857 0.5370 0.0050  -0.1525 -0.1538 267 TYR A OH  
2060 N N   . PHE A 288 ? 0.4623 0.2909 0.3922 -0.0908 -0.1642 -0.0658 268 PHE A N   
2061 C CA  . PHE A 288 ? 0.4379 0.2815 0.3786 -0.1059 -0.1608 -0.0515 268 PHE A CA  
2062 C C   . PHE A 288 ? 0.4231 0.3035 0.3637 -0.1073 -0.1613 -0.0535 268 PHE A C   
2063 O O   . PHE A 288 ? 0.4375 0.3252 0.3684 -0.1022 -0.1663 -0.0691 268 PHE A O   
2064 C CB  . PHE A 288 ? 0.4656 0.2927 0.4077 -0.1169 -0.1647 -0.0547 268 PHE A CB  
2065 C CG  . PHE A 288 ? 0.4838 0.2762 0.4249 -0.1174 -0.1642 -0.0491 268 PHE A CG  
2066 C CD1 . PHE A 288 ? 0.4958 0.2875 0.4438 -0.1210 -0.1572 -0.0309 268 PHE A CD1 
2067 C CD2 . PHE A 288 ? 0.5208 0.2824 0.4527 -0.1138 -0.1708 -0.0620 268 PHE A CD2 
2068 C CE1 . PHE A 288 ? 0.4855 0.2487 0.4303 -0.1210 -0.1569 -0.0250 268 PHE A CE1 
2069 C CE2 . PHE A 288 ? 0.5407 0.2710 0.4701 -0.1137 -0.1711 -0.0555 268 PHE A CE2 
2070 C CZ  . PHE A 288 ? 0.5225 0.2547 0.4581 -0.1176 -0.1641 -0.0365 268 PHE A CZ  
2071 N N   . TYR A 289 ? 0.3968 0.3010 0.3468 -0.1128 -0.1560 -0.0376 269 TYR A N   
2072 C CA  . TYR A 289 ? 0.3861 0.3257 0.3363 -0.1145 -0.1568 -0.0364 269 TYR A CA  
2073 C C   . TYR A 289 ? 0.3848 0.3376 0.3469 -0.1266 -0.1567 -0.0283 269 TYR A C   
2074 O O   . TYR A 289 ? 0.3803 0.3231 0.3521 -0.1332 -0.1525 -0.0175 269 TYR A O   
2075 C CB  . TYR A 289 ? 0.3586 0.3203 0.3099 -0.1068 -0.1488 -0.0241 269 TYR A CB  
2076 C CG  . TYR A 289 ? 0.3383 0.2933 0.3003 -0.1078 -0.1404 -0.0074 269 TYR A CG  
2077 C CD1 . TYR A 289 ? 0.3253 0.2941 0.2990 -0.1163 -0.1382 0.0066  269 TYR A CD1 
2078 C CD2 . TYR A 289 ? 0.3478 0.2855 0.3082 -0.0993 -0.1349 -0.0065 269 TYR A CD2 
2079 C CE1 . TYR A 289 ? 0.3164 0.2798 0.2983 -0.1161 -0.1303 0.0202  269 TYR A CE1 
2080 C CE2 . TYR A 289 ? 0.3557 0.2878 0.3240 -0.1001 -0.1278 0.0074  269 TYR A CE2 
2081 C CZ  . TYR A 289 ? 0.3262 0.2704 0.3045 -0.1084 -0.1253 0.0204  269 TYR A CZ  
2082 O OH  . TYR A 289 ? 0.2912 0.2303 0.2759 -0.1080 -0.1179 0.0327  269 TYR A OH  
2083 N N   . ASN A 290 ? 0.3901 0.3679 0.3511 -0.1290 -0.1612 -0.0338 270 ASN A N   
2084 C CA  . ASN A 290 ? 0.3907 0.3839 0.3643 -0.1399 -0.1620 -0.0279 270 ASN A CA  
2085 C C   . ASN A 290 ? 0.3710 0.4021 0.3502 -0.1378 -0.1601 -0.0167 270 ASN A C   
2086 O O   . ASN A 290 ? 0.3575 0.4017 0.3297 -0.1283 -0.1576 -0.0121 270 ASN A O   
2087 C CB  . ASN A 290 ? 0.4209 0.4071 0.3925 -0.1475 -0.1699 -0.0440 270 ASN A CB  
2088 C CG  . ASN A 290 ? 0.5177 0.5235 0.4783 -0.1419 -0.1765 -0.0583 270 ASN A CG  
2089 O OD1 . ASN A 290 ? 0.5266 0.5534 0.4801 -0.1323 -0.1748 -0.0547 270 ASN A OD1 
2090 N ND2 . ASN A 290 ? 0.5832 0.5832 0.5413 -0.1481 -0.1840 -0.0745 270 ASN A ND2 
2091 N N   . TYR A 291 ? 0.3742 0.4230 0.3661 -0.1463 -0.1612 -0.0118 271 TYR A N   
2092 C CA  . TYR A 291 ? 0.3722 0.4561 0.3720 -0.1433 -0.1593 0.0005  271 TYR A CA  
2093 C C   . TYR A 291 ? 0.3557 0.4622 0.3434 -0.1331 -0.1627 -0.0032 271 TYR A C   
2094 O O   . TYR A 291 ? 0.3470 0.4685 0.3329 -0.1242 -0.1580 0.0094  271 TYR A O   
2095 C CB  . TYR A 291 ? 0.3607 0.4615 0.3760 -0.1540 -0.1614 0.0026  271 TYR A CB  
2096 C CG  . TYR A 291 ? 0.3458 0.4837 0.3711 -0.1495 -0.1600 0.0147  271 TYR A CG  
2097 C CD1 . TYR A 291 ? 0.3245 0.4695 0.3593 -0.1458 -0.1521 0.0310  271 TYR A CD1 
2098 C CD2 . TYR A 291 ? 0.3559 0.5214 0.3810 -0.1477 -0.1669 0.0093  271 TYR A CD2 
2099 C CE1 . TYR A 291 ? 0.3395 0.5177 0.3835 -0.1394 -0.1512 0.0415  271 TYR A CE1 
2100 C CE2 . TYR A 291 ? 0.3461 0.5445 0.3799 -0.1415 -0.1661 0.0203  271 TYR A CE2 
2101 C CZ  . TYR A 291 ? 0.3784 0.5828 0.4218 -0.1368 -0.1582 0.0363  271 TYR A CZ  
2102 O OH  . TYR A 291 ? 0.4660 0.7025 0.5177 -0.1283 -0.1579 0.0465  271 TYR A OH  
2103 N N   . PRO A 292 ? 0.3781 0.4858 0.3560 -0.1338 -0.1707 -0.0202 272 PRO A N   
2104 C CA  . PRO A 292 ? 0.3993 0.5282 0.3627 -0.1229 -0.1726 -0.0225 272 PRO A CA  
2105 C C   . PRO A 292 ? 0.3876 0.5086 0.3383 -0.1130 -0.1660 -0.0174 272 PRO A C   
2106 O O   . PRO A 292 ? 0.4324 0.5737 0.3777 -0.1046 -0.1620 -0.0059 272 PRO A O   
2107 C CB  . PRO A 292 ? 0.4237 0.5489 0.3773 -0.1253 -0.1823 -0.0445 272 PRO A CB  
2108 C CG  . PRO A 292 ? 0.4206 0.5366 0.3891 -0.1389 -0.1863 -0.0494 272 PRO A CG  
2109 C CD  . PRO A 292 ? 0.4039 0.4986 0.3833 -0.1437 -0.1782 -0.0368 272 PRO A CD  
2110 N N   . ALA A 293 ? 0.3719 0.4639 0.3181 -0.1137 -0.1648 -0.0250 273 ALA A N   
2111 C CA  . ALA A 293 ? 0.3615 0.4478 0.2973 -0.1053 -0.1588 -0.0208 273 ALA A CA  
2112 C C   . ALA A 293 ? 0.3366 0.4323 0.2809 -0.1010 -0.1490 0.0009  273 ALA A C   
2113 O O   . ALA A 293 ? 0.3428 0.4488 0.2790 -0.0914 -0.1414 0.0080  273 ALA A O   
2114 C CB  . ALA A 293 ? 0.3680 0.4199 0.3022 -0.1054 -0.1585 -0.0310 273 ALA A CB  
2115 N N   . VAL A 294 ? 0.3254 0.4173 0.2858 -0.1080 -0.1483 0.0111  274 VAL A N   
2116 C CA  . VAL A 294 ? 0.3050 0.4023 0.2743 -0.1028 -0.1389 0.0297  274 VAL A CA  
2117 C C   . VAL A 294 ? 0.3031 0.4314 0.2716 -0.0978 -0.1401 0.0402  274 VAL A C   
2118 O O   . VAL A 294 ? 0.3167 0.4493 0.2810 -0.0884 -0.1325 0.0522  274 VAL A O   
2119 C CB  . VAL A 294 ? 0.2959 0.3823 0.2820 -0.1110 -0.1374 0.0363  274 VAL A CB  
2120 C CG1 . VAL A 294 ? 0.2785 0.3761 0.2738 -0.1046 -0.1293 0.0539  274 VAL A CG1 
2121 C CG2 . VAL A 294 ? 0.2978 0.3508 0.2828 -0.1134 -0.1347 0.0301  274 VAL A CG2 
2122 N N   . CYS A 295 ? 0.3134 0.4597 0.2862 -0.1018 -0.1472 0.0352  275 CYS A N   
2123 C CA  . CYS A 295 ? 0.3156 0.4902 0.2876 -0.0942 -0.1478 0.0441  275 CYS A CA  
2124 C C   . CYS A 295 ? 0.3272 0.5085 0.2795 -0.0845 -0.1455 0.0458  275 CYS A C   
2125 O O   . CYS A 295 ? 0.3318 0.5213 0.2810 -0.0755 -0.1401 0.0610  275 CYS A O   
2126 C CB  . CYS A 295 ? 0.3300 0.5222 0.3080 -0.0997 -0.1562 0.0347  275 CYS A CB  
2127 S SG  . CYS A 295 ? 0.5474 0.7437 0.5507 -0.1102 -0.1564 0.0388  275 CYS A SG  
2128 N N   . GLU A 296 ? 0.3366 0.5129 0.2751 -0.0858 -0.1489 0.0301  276 GLU A N   
2129 C CA  . GLU A 296 ? 0.3453 0.5300 0.2641 -0.0775 -0.1454 0.0307  276 GLU A CA  
2130 C C   . GLU A 296 ? 0.3649 0.5405 0.2811 -0.0730 -0.1353 0.0456  276 GLU A C   
2131 O O   . GLU A 296 ? 0.3338 0.5194 0.2416 -0.0656 -0.1296 0.0590  276 GLU A O   
2132 C CB  . GLU A 296 ? 0.3613 0.5397 0.2671 -0.0793 -0.1497 0.0096  276 GLU A CB  
2133 C CG  . GLU A 296 ? 0.3703 0.5585 0.2556 -0.0712 -0.1440 0.0087  276 GLU A CG  
2134 C CD  . GLU A 296 ? 0.5161 0.7023 0.3881 -0.0708 -0.1494 -0.0152 276 GLU A CD  
2135 O OE1 . GLU A 296 ? 0.5466 0.7303 0.4080 -0.0667 -0.1440 -0.0219 276 GLU A OE1 
2136 O OE2 . GLU A 296 ? 0.4825 0.6700 0.3553 -0.0741 -0.1591 -0.0281 276 GLU A OE2 
2137 N N   . PHE A 297 ? 0.3194 0.4703 0.2445 -0.0759 -0.1302 0.0427  277 PHE A N   
2138 C CA  . PHE A 297 ? 0.3089 0.4468 0.2333 -0.0708 -0.1183 0.0528  277 PHE A CA  
2139 C C   . PHE A 297 ? 0.2993 0.4390 0.2315 -0.0674 -0.1139 0.0727  277 PHE A C   
2140 O O   . PHE A 297 ? 0.2995 0.4376 0.2249 -0.0623 -0.1061 0.0847  277 PHE A O   
2141 C CB  . PHE A 297 ? 0.3003 0.4118 0.2327 -0.0736 -0.1146 0.0444  277 PHE A CB  
2142 C CG  . PHE A 297 ? 0.2904 0.3909 0.2228 -0.0694 -0.1033 0.0528  277 PHE A CG  
2143 C CD1 . PHE A 297 ? 0.2973 0.3870 0.2404 -0.0691 -0.0977 0.0666  277 PHE A CD1 
2144 C CD2 . PHE A 297 ? 0.2960 0.3991 0.2180 -0.0660 -0.0982 0.0461  277 PHE A CD2 
2145 C CE1 . PHE A 297 ? 0.2708 0.3499 0.2136 -0.0668 -0.0882 0.0733  277 PHE A CE1 
2146 C CE2 . PHE A 297 ? 0.3261 0.4218 0.2496 -0.0641 -0.0882 0.0536  277 PHE A CE2 
2147 C CZ  . PHE A 297 ? 0.2761 0.3586 0.2099 -0.0651 -0.0836 0.0670  277 PHE A CZ  
2148 N N   . LEU A 298 ? 0.2932 0.4359 0.2397 -0.0703 -0.1188 0.0759  278 LEU A N   
2149 C CA  . LEU A 298 ? 0.2866 0.4326 0.2412 -0.0647 -0.1155 0.0932  278 LEU A CA  
2150 C C   . LEU A 298 ? 0.3598 0.5248 0.3033 -0.0563 -0.1167 0.1039  278 LEU A C   
2151 O O   . LEU A 298 ? 0.3551 0.5127 0.2966 -0.0488 -0.1096 0.1179  278 LEU A O   
2152 C CB  . LEU A 298 ? 0.2792 0.4314 0.2521 -0.0691 -0.1204 0.0930  278 LEU A CB  
2153 C CG  . LEU A 298 ? 0.2680 0.3991 0.2531 -0.0764 -0.1170 0.0871  278 LEU A CG  
2154 C CD1 . LEU A 298 ? 0.2631 0.4077 0.2655 -0.0804 -0.1207 0.0904  278 LEU A CD1 
2155 C CD2 . LEU A 298 ? 0.2587 0.3664 0.2431 -0.0717 -0.1061 0.0939  278 LEU A CD2 
2156 N N   . GLN A 299 ? 0.3863 0.5700 0.3228 -0.0567 -0.1234 0.0951  279 GLN A N   
2157 C CA  . GLN A 299 ? 0.3869 0.5857 0.3132 -0.0477 -0.1234 0.1031  279 GLN A CA  
2158 C C   . GLN A 299 ? 0.4021 0.5964 0.3087 -0.0441 -0.1163 0.1085  279 GLN A C   
2159 O O   . GLN A 299 ? 0.3852 0.5777 0.2855 -0.0365 -0.1114 0.1225  279 GLN A O   
2160 C CB  . GLN A 299 ? 0.3986 0.6193 0.3237 -0.0494 -0.1335 0.0914  279 GLN A CB  
2161 C CG  . GLN A 299 ? 0.4679 0.7011 0.4117 -0.0495 -0.1389 0.0930  279 GLN A CG  
2162 C CD  . GLN A 299 ? 0.6025 0.8467 0.5527 -0.0593 -0.1485 0.0756  279 GLN A CD  
2163 O OE1 . GLN A 299 ? 0.6888 0.9317 0.6268 -0.0635 -0.1522 0.0617  279 GLN A OE1 
2164 N NE2 . GLN A 299 ? 0.5938 0.8484 0.5633 -0.0631 -0.1522 0.0755  279 GLN A NE2 
2165 N N   . ASN A 300 ? 0.4102 0.6027 0.3073 -0.0496 -0.1156 0.0968  280 ASN A N   
2166 C CA  . ASN A 300 ? 0.3515 0.5446 0.2311 -0.0476 -0.1078 0.1008  280 ASN A CA  
2167 C C   . ASN A 300 ? 0.4466 0.6203 0.3288 -0.0470 -0.0973 0.1156  280 ASN A C   
2168 O O   . ASN A 300 ? 0.5252 0.6986 0.3950 -0.0465 -0.0894 0.1221  280 ASN A O   
2169 C CB  . ASN A 300 ? 0.3531 0.5504 0.2239 -0.0525 -0.1091 0.0829  280 ASN A CB  
2170 C CG  . ASN A 300 ? 0.4466 0.6592 0.3120 -0.0528 -0.1187 0.0658  280 ASN A CG  
2171 O OD1 . ASN A 300 ? 0.5369 0.7616 0.4017 -0.0495 -0.1238 0.0692  280 ASN A OD1 
2172 N ND2 . ASN A 300 ? 0.4531 0.6639 0.3144 -0.0563 -0.1217 0.0463  280 ASN A ND2 
2173 N N   . ASN A 301 ? 0.3981 0.5554 0.2965 -0.0479 -0.0968 0.1200  281 ASN A N   
2174 C CA  . ASN A 301 ? 0.3467 0.4823 0.2485 -0.0476 -0.0869 0.1313  281 ASN A CA  
2175 C C   . ASN A 301 ? 0.3596 0.4824 0.2724 -0.0407 -0.0848 0.1429  281 ASN A C   
2176 O O   . ASN A 301 ? 0.3615 0.4626 0.2786 -0.0398 -0.0770 0.1496  281 ASN A O   
2177 C CB  . ASN A 301 ? 0.3061 0.4271 0.2162 -0.0539 -0.0840 0.1211  281 ASN A CB  
2178 C CG  . ASN A 301 ? 0.3820 0.5111 0.2824 -0.0571 -0.0817 0.1078  281 ASN A CG  
2179 O OD1 . ASN A 301 ? 0.5235 0.6541 0.4146 -0.0580 -0.0738 0.1132  281 ASN A OD1 
2180 N ND2 . ASN A 301 ? 0.3650 0.4998 0.2677 -0.0589 -0.0886 0.0901  281 ASN A ND2 
2181 N N   . ASN A 302 ? 0.3588 0.4959 0.2757 -0.0352 -0.0919 0.1436  282 ASN A N   
2182 C CA  . ASN A 302 ? 0.4046 0.5348 0.3318 -0.0267 -0.0913 0.1526  282 ASN A CA  
2183 C C   . ASN A 302 ? 0.3566 0.4694 0.2991 -0.0288 -0.0878 0.1517  282 ASN A C   
2184 O O   . ASN A 302 ? 0.3758 0.4674 0.3201 -0.0243 -0.0806 0.1584  282 ASN A O   
2185 C CB  . ASN A 302 ? 0.4362 0.5541 0.3518 -0.0185 -0.0857 0.1653  282 ASN A CB  
2186 C CG  . ASN A 302 ? 0.5349 0.6507 0.4575 -0.0066 -0.0884 0.1731  282 ASN A CG  
2187 O OD1 . ASN A 302 ? 0.5120 0.6495 0.4428 -0.0029 -0.0964 0.1704  282 ASN A OD1 
2188 N ND2 . ASN A 302 ? 0.5848 0.6748 0.5042 -0.0006 -0.0819 0.1817  282 ASN A ND2 
2189 N N   . LEU A 303 ? 0.2949 0.4156 0.2474 -0.0362 -0.0933 0.1422  283 LEU A N   
2190 C CA  . LEU A 303 ? 0.2788 0.3850 0.2448 -0.0396 -0.0908 0.1408  283 LEU A CA  
2191 C C   . LEU A 303 ? 0.2712 0.3948 0.2528 -0.0403 -0.0979 0.1383  283 LEU A C   
2192 O O   . LEU A 303 ? 0.2732 0.4181 0.2565 -0.0449 -0.1062 0.1310  283 LEU A O   
2193 C CB  . LEU A 303 ? 0.2693 0.3628 0.2336 -0.0492 -0.0886 0.1298  283 LEU A CB  
2194 C CG  . LEU A 303 ? 0.2728 0.3504 0.2263 -0.0503 -0.0807 0.1318  283 LEU A CG  
2195 C CD1 . LEU A 303 ? 0.2641 0.3338 0.2190 -0.0574 -0.0791 0.1171  283 LEU A CD1 
2196 C CD2 . LEU A 303 ? 0.2729 0.3297 0.2305 -0.0457 -0.0726 0.1408  283 LEU A CD2 
2197 N N   . LEU A 304 ? 0.2640 0.3794 0.2575 -0.0365 -0.0939 0.1430  284 LEU A N   
2198 C CA  . LEU A 304 ? 0.2574 0.3919 0.2678 -0.0369 -0.0982 0.1414  284 LEU A CA  
2199 C C   . LEU A 304 ? 0.2470 0.3803 0.2655 -0.0508 -0.0995 0.1284  284 LEU A C   
2200 O O   . LEU A 304 ? 0.3254 0.4805 0.3543 -0.0569 -0.1062 0.1238  284 LEU A O   
2201 C CB  . LEU A 304 ? 0.2558 0.3815 0.2745 -0.0270 -0.0920 0.1497  284 LEU A CB  
2202 C CG  . LEU A 304 ? 0.3017 0.4534 0.3382 -0.0227 -0.0949 0.1511  284 LEU A CG  
2203 C CD1 . LEU A 304 ? 0.2872 0.4680 0.3243 -0.0188 -0.1030 0.1517  284 LEU A CD1 
2204 C CD2 . LEU A 304 ? 0.3334 0.4728 0.3726 -0.0086 -0.0884 0.1595  284 LEU A CD2 
2205 N N   . SER A 305 ? 0.2417 0.3494 0.2552 -0.0560 -0.0939 0.1230  285 SER A N   
2206 C CA  . SER A 305 ? 0.2381 0.3378 0.2576 -0.0676 -0.0947 0.1126  285 SER A CA  
2207 C C   . SER A 305 ? 0.2323 0.3043 0.2436 -0.0699 -0.0893 0.1075  285 SER A C   
2208 O O   . SER A 305 ? 0.2898 0.3498 0.2935 -0.0638 -0.0835 0.1125  285 SER A O   
2209 C CB  . SER A 305 ? 0.2356 0.3412 0.2704 -0.0688 -0.0921 0.1158  285 SER A CB  
2210 O OG  . SER A 305 ? 0.2254 0.3178 0.2636 -0.0799 -0.0915 0.1086  285 SER A OG  
2211 N N   . ILE A 306 ? 0.2313 0.2932 0.2444 -0.0792 -0.0916 0.0979  286 ILE A N   
2212 C CA  . ILE A 306 ? 0.2297 0.2676 0.2362 -0.0806 -0.0880 0.0919  286 ILE A CA  
2213 C C   . ILE A 306 ? 0.2479 0.2721 0.2617 -0.0849 -0.0849 0.0925  286 ILE A C   
2214 O O   . ILE A 306 ? 0.3471 0.3744 0.3673 -0.0932 -0.0891 0.0897  286 ILE A O   
2215 C CB  . ILE A 306 ? 0.2383 0.2724 0.2377 -0.0860 -0.0946 0.0790  286 ILE A CB  
2216 C CG1 . ILE A 306 ? 0.2508 0.2992 0.2399 -0.0814 -0.0967 0.0774  286 ILE A CG1 
2217 C CG2 . ILE A 306 ? 0.2380 0.2488 0.2330 -0.0862 -0.0921 0.0722  286 ILE A CG2 
2218 C CD1 . ILE A 306 ? 0.2894 0.3354 0.2703 -0.0848 -0.1029 0.0628  286 ILE A CD1 
2219 N N   . ILE A 307 ? 0.2194 0.2290 0.2315 -0.0801 -0.0778 0.0961  287 ILE A N   
2220 C CA  . ILE A 307 ? 0.2164 0.2130 0.2325 -0.0832 -0.0745 0.0968  287 ILE A CA  
2221 C C   . ILE A 307 ? 0.2186 0.1941 0.2276 -0.0851 -0.0751 0.0895  287 ILE A C   
2222 O O   . ILE A 307 ? 0.2445 0.2142 0.2475 -0.0804 -0.0730 0.0870  287 ILE A O   
2223 C CB  . ILE A 307 ? 0.2117 0.2059 0.2298 -0.0757 -0.0668 0.1045  287 ILE A CB  
2224 C CG1 . ILE A 307 ? 0.2119 0.2269 0.2372 -0.0705 -0.0666 0.1118  287 ILE A CG1 
2225 C CG2 . ILE A 307 ? 0.2102 0.1936 0.2303 -0.0778 -0.0630 0.1039  287 ILE A CG2 
2226 C CD1 . ILE A 307 ? 0.2128 0.2222 0.2367 -0.0601 -0.0603 0.1184  287 ILE A CD1 
2227 N N   . ARG A 308 ? 0.2235 0.1883 0.2335 -0.0918 -0.0778 0.0866  288 ARG A N   
2228 C CA  . ARG A 308 ? 0.2292 0.1742 0.2322 -0.0919 -0.0804 0.0791  288 ARG A CA  
2229 C C   . ARG A 308 ? 0.2337 0.1699 0.2354 -0.0908 -0.0782 0.0765  288 ARG A C   
2230 O O   . ARG A 308 ? 0.2313 0.1766 0.2379 -0.0920 -0.0740 0.0814  288 ARG A O   
2231 C CB  . ARG A 308 ? 0.2387 0.1839 0.2378 -0.0942 -0.0879 0.0698  288 ARG A CB  
2232 C CG  . ARG A 308 ? 0.2946 0.2419 0.2976 -0.1044 -0.0942 0.0687  288 ARG A CG  
2233 C CD  . ARG A 308 ? 0.2650 0.1927 0.2610 -0.1071 -0.1017 0.0581  288 ARG A CD  
2234 N NE  . ARG A 308 ? 0.2783 0.1947 0.2736 -0.1114 -0.1022 0.0580  288 ARG A NE  
2235 C CZ  . ARG A 308 ? 0.2999 0.1938 0.2876 -0.1103 -0.1063 0.0507  288 ARG A CZ  
2236 N NH1 . ARG A 308 ? 0.3021 0.1823 0.2830 -0.1042 -0.1110 0.0415  288 ARG A NH1 
2237 N NH2 . ARG A 308 ? 0.3099 0.1955 0.2971 -0.1154 -0.1060 0.0527  288 ARG A NH2 
2238 N N   . ALA A 309 ? 0.2423 0.1615 0.2372 -0.0888 -0.0810 0.0698  289 ALA A N   
2239 C CA  . ALA A 309 ? 0.2478 0.1589 0.2399 -0.0873 -0.0783 0.0696  289 ALA A CA  
2240 C C   . ALA A 309 ? 0.2662 0.1589 0.2521 -0.0900 -0.0853 0.0644  289 ALA A C   
2241 O O   . ALA A 309 ? 0.2874 0.1783 0.2739 -0.0973 -0.0904 0.0632  289 ALA A O   
2242 C CB  . ALA A 309 ? 0.2394 0.1487 0.2293 -0.0790 -0.0726 0.0686  289 ALA A CB  
2243 N N   . HIS A 310 ? 0.2719 0.1505 0.2516 -0.0841 -0.0860 0.0614  290 HIS A N   
2244 C CA  . HIS A 310 ? 0.2917 0.1488 0.2644 -0.0832 -0.0944 0.0551  290 HIS A CA  
2245 C C   . HIS A 310 ? 0.3127 0.1578 0.2820 -0.0898 -0.0973 0.0563  290 HIS A C   
2246 O O   . HIS A 310 ? 0.3321 0.1565 0.2941 -0.0871 -0.1025 0.0531  290 HIS A O   
2247 C CB  . HIS A 310 ? 0.3131 0.1682 0.2860 -0.0838 -0.1009 0.0480  290 HIS A CB  
2248 C CG  . HIS A 310 ? 0.3242 0.1568 0.2899 -0.0793 -0.1100 0.0381  290 HIS A CG  
2249 N ND1 . HIS A 310 ? 0.4217 0.2402 0.3826 -0.0707 -0.1121 0.0360  290 HIS A ND1 
2250 C CD2 . HIS A 310 ? 0.3310 0.1538 0.2935 -0.0808 -0.1181 0.0279  290 HIS A CD2 
2251 C CE1 . HIS A 310 ? 0.4119 0.2112 0.3670 -0.0658 -0.1213 0.0254  290 HIS A CE1 
2252 N NE2 . HIS A 310 ? 0.3487 0.1502 0.3043 -0.0716 -0.1248 0.0193  290 HIS A NE2 
2253 N N   . GLU A 311 ? 0.3113 0.1688 0.2859 -0.0985 -0.0942 0.0615  291 GLU A N   
2254 C CA  . GLU A 311 ? 0.3330 0.1808 0.3056 -0.1074 -0.0965 0.0634  291 GLU A CA  
2255 C C   . GLU A 311 ? 0.3563 0.2149 0.3319 -0.1128 -0.0892 0.0723  291 GLU A C   
2256 O O   . GLU A 311 ? 0.3670 0.2474 0.3508 -0.1153 -0.0839 0.0767  291 GLU A O   
2257 C CB  . GLU A 311 ? 0.3404 0.1924 0.3173 -0.1164 -0.1015 0.0601  291 GLU A CB  
2258 C CG  . GLU A 311 ? 0.3637 0.1956 0.3343 -0.1145 -0.1105 0.0497  291 GLU A CG  
2259 C CD  . GLU A 311 ? 0.3743 0.2109 0.3486 -0.1246 -0.1155 0.0449  291 GLU A CD  
2260 O OE1 . GLU A 311 ? 0.3547 0.2157 0.3373 -0.1287 -0.1135 0.0472  291 GLU A OE1 
2261 O OE2 . GLU A 311 ? 0.4023 0.2186 0.3713 -0.1284 -0.1219 0.0384  291 GLU A OE2 
2262 N N   . ALA A 312 ? 0.3711 0.2139 0.3397 -0.1148 -0.0895 0.0752  292 ALA A N   
2263 C CA  . ALA A 312 ? 0.3550 0.2058 0.3246 -0.1209 -0.0829 0.0837  292 ALA A CA  
2264 C C   . ALA A 312 ? 0.3569 0.2250 0.3357 -0.1335 -0.0810 0.0881  292 ALA A C   
2265 O O   . ALA A 312 ? 0.4107 0.2735 0.3913 -0.1412 -0.0867 0.0850  292 ALA A O   
2266 C CB  . ALA A 312 ? 0.3820 0.2096 0.3413 -0.1228 -0.0855 0.0864  292 ALA A CB  
2267 N N   . GLN A 313 ? 0.3454 0.2347 0.3303 -0.1357 -0.0733 0.0946  293 GLN A N   
2268 C CA  . GLN A 313 ? 0.3676 0.2780 0.3631 -0.1477 -0.0711 0.0995  293 GLN A CA  
2269 C C   . GLN A 313 ? 0.4180 0.3373 0.4135 -0.1542 -0.0638 0.1084  293 GLN A C   
2270 O O   . GLN A 313 ? 0.4045 0.3273 0.3967 -0.1470 -0.0578 0.1110  293 GLN A O   
2271 C CB  . GLN A 313 ? 0.3263 0.2621 0.3329 -0.1443 -0.0692 0.0992  293 GLN A CB  
2272 C CG  . GLN A 313 ? 0.3491 0.2801 0.3556 -0.1382 -0.0754 0.0919  293 GLN A CG  
2273 C CD  . GLN A 313 ? 0.3537 0.2806 0.3621 -0.1478 -0.0832 0.0876  293 GLN A CD  
2274 O OE1 . GLN A 313 ? 0.3945 0.3378 0.4116 -0.1590 -0.0832 0.0906  293 GLN A OE1 
2275 N NE2 . GLN A 313 ? 0.3352 0.2413 0.3359 -0.1436 -0.0898 0.0797  293 GLN A NE2 
2276 N N   . ASP A 314 ? 0.4580 0.3822 0.4575 -0.1687 -0.0639 0.1129  294 ASP A N   
2277 C CA  . ASP A 314 ? 0.4135 0.3486 0.4132 -0.1765 -0.0564 0.1221  294 ASP A CA  
2278 C C   . ASP A 314 ? 0.3693 0.3351 0.3776 -0.1720 -0.0480 0.1261  294 ASP A C   
2279 O O   . ASP A 314 ? 0.3685 0.3375 0.3716 -0.1699 -0.0411 0.1314  294 ASP A O   
2280 C CB  . ASP A 314 ? 0.4460 0.3859 0.4512 -0.1945 -0.0578 0.1262  294 ASP A CB  
2281 C CG  . ASP A 314 ? 0.6226 0.5593 0.6215 -0.2035 -0.0520 0.1358  294 ASP A CG  
2282 O OD1 . ASP A 314 ? 0.7138 0.6267 0.6989 -0.1975 -0.0521 0.1375  294 ASP A OD1 
2283 O OD2 . ASP A 314 ? 0.7148 0.6748 0.7230 -0.2167 -0.0474 0.1421  294 ASP A OD2 
2284 N N   . ALA A 315 ? 0.3462 0.3342 0.3671 -0.1704 -0.0488 0.1239  295 ALA A N   
2285 C CA  . ALA A 315 ? 0.3263 0.3431 0.3565 -0.1647 -0.0415 0.1277  295 ALA A CA  
2286 C C   . ALA A 315 ? 0.3068 0.3136 0.3313 -0.1486 -0.0406 0.1238  295 ALA A C   
2287 O O   . ALA A 315 ? 0.2923 0.3185 0.3232 -0.1425 -0.0348 0.1268  295 ALA A O   
2288 C CB  . ALA A 315 ? 0.3172 0.3644 0.3646 -0.1700 -0.0431 0.1284  295 ALA A CB  
2289 N N   . GLY A 316 ? 0.3081 0.2862 0.3214 -0.1417 -0.0460 0.1171  296 GLY A N   
2290 C CA  . GLY A 316 ? 0.2914 0.2611 0.3003 -0.1278 -0.0457 0.1123  296 GLY A CA  
2291 C C   . GLY A 316 ? 0.2862 0.2651 0.3035 -0.1232 -0.0491 0.1092  296 GLY A C   
2292 O O   . GLY A 316 ? 0.2618 0.2348 0.2764 -0.1126 -0.0485 0.1057  296 GLY A O   
2293 N N   . TYR A 317 ? 0.2757 0.2702 0.3033 -0.1318 -0.0528 0.1109  297 TYR A N   
2294 C CA  . TYR A 317 ? 0.2753 0.2794 0.3103 -0.1293 -0.0576 0.1091  297 TYR A CA  
2295 C C   . TYR A 317 ? 0.3353 0.3478 0.3767 -0.1410 -0.0642 0.1079  297 TYR A C   
2296 O O   . TYR A 317 ? 0.3335 0.3502 0.3769 -0.1515 -0.0636 0.1099  297 TYR A O   
2297 C CB  . TYR A 317 ? 0.2628 0.2929 0.3096 -0.1245 -0.0522 0.1159  297 TYR A CB  
2298 C CG  . TYR A 317 ? 0.3369 0.4010 0.3992 -0.1335 -0.0493 0.1230  297 TYR A CG  
2299 C CD1 . TYR A 317 ? 0.3433 0.4178 0.4065 -0.1377 -0.0418 0.1277  297 TYR A CD1 
2300 C CD2 . TYR A 317 ? 0.3207 0.4107 0.3976 -0.1374 -0.0540 0.1247  297 TYR A CD2 
2301 C CE1 . TYR A 317 ? 0.3104 0.4211 0.3893 -0.1454 -0.0382 0.1333  297 TYR A CE1 
2302 C CE2 . TYR A 317 ? 0.3271 0.4542 0.4205 -0.1442 -0.0513 0.1295  297 TYR A CE2 
2303 C CZ  . TYR A 317 ? 0.3239 0.4617 0.4186 -0.1481 -0.0430 0.1337  297 TYR A CZ  
2304 O OH  . TYR A 317 ? 0.2997 0.4780 0.4115 -0.1541 -0.0395 0.1376  297 TYR A OH  
2305 N N   . ARG A 318 ? 0.2669 0.2818 0.3109 -0.1397 -0.0706 0.1043  298 ARG A N   
2306 C CA  . ARG A 318 ? 0.2748 0.3043 0.3268 -0.1502 -0.0769 0.1024  298 ARG A CA  
2307 C C   . ARG A 318 ? 0.2608 0.3126 0.3224 -0.1470 -0.0811 0.1030  298 ARG A C   
2308 O O   . ARG A 318 ? 0.2776 0.3193 0.3337 -0.1389 -0.0831 0.1011  298 ARG A O   
2309 C CB  . ARG A 318 ? 0.2941 0.2970 0.3356 -0.1555 -0.0836 0.0941  298 ARG A CB  
2310 C CG  . ARG A 318 ? 0.3047 0.3212 0.3536 -0.1662 -0.0903 0.0900  298 ARG A CG  
2311 C CD  . ARG A 318 ? 0.3308 0.3214 0.3712 -0.1744 -0.0957 0.0829  298 ARG A CD  
2312 N NE  . ARG A 318 ? 0.4246 0.4295 0.4723 -0.1840 -0.1026 0.0770  298 ARG A NE  
2313 C CZ  . ARG A 318 ? 0.4652 0.4505 0.5072 -0.1911 -0.1095 0.0680  298 ARG A CZ  
2314 N NH1 . ARG A 318 ? 0.4903 0.4404 0.5195 -0.1893 -0.1105 0.0651  298 ARG A NH1 
2315 N NH2 . ARG A 318 ? 0.4558 0.4575 0.5051 -0.1994 -0.1158 0.0615  298 ARG A NH2 
2316 N N   . MET A 319 ? 0.2602 0.3449 0.3365 -0.1533 -0.0824 0.1058  299 MET A N   
2317 C CA  . MET A 319 ? 0.2492 0.3612 0.3358 -0.1493 -0.0876 0.1064  299 MET A CA  
2318 C C   . MET A 319 ? 0.2636 0.3772 0.3485 -0.1575 -0.0963 0.0975  299 MET A C   
2319 O O   . MET A 319 ? 0.3198 0.4461 0.4116 -0.1678 -0.0968 0.0961  299 MET A O   
2320 C CB  . MET A 319 ? 0.2396 0.3934 0.3453 -0.1471 -0.0833 0.1146  299 MET A CB  
2321 C CG  . MET A 319 ? 0.2273 0.3843 0.3369 -0.1381 -0.0739 0.1230  299 MET A CG  
2322 S SD  . MET A 319 ? 0.3241 0.4636 0.4211 -0.1159 -0.0727 0.1217  299 MET A SD  
2323 C CE  . MET A 319 ? 0.4298 0.5615 0.5242 -0.1036 -0.0602 0.1269  299 MET A CE  
2324 N N   . TYR A 320 ? 0.2641 0.3660 0.3399 -0.1535 -0.1030 0.0907  300 TYR A N   
2325 C CA  . TYR A 320 ? 0.2810 0.3815 0.3534 -0.1610 -0.1111 0.0801  300 TYR A CA  
2326 C C   . TYR A 320 ? 0.2781 0.4170 0.3613 -0.1594 -0.1161 0.0800  300 TYR A C   
2327 O O   . TYR A 320 ? 0.2630 0.4284 0.3558 -0.1507 -0.1135 0.0887  300 TYR A O   
2328 C CB  . TYR A 320 ? 0.2874 0.3583 0.3437 -0.1573 -0.1160 0.0707  300 TYR A CB  
2329 C CG  . TYR A 320 ? 0.2939 0.3272 0.3390 -0.1568 -0.1123 0.0694  300 TYR A CG  
2330 C CD1 . TYR A 320 ? 0.2796 0.3031 0.3220 -0.1484 -0.1056 0.0764  300 TYR A CD1 
2331 C CD2 . TYR A 320 ? 0.3165 0.3244 0.3536 -0.1632 -0.1160 0.0605  300 TYR A CD2 
2332 C CE1 . TYR A 320 ? 0.2865 0.2787 0.3181 -0.1456 -0.1027 0.0745  300 TYR A CE1 
2333 C CE2 . TYR A 320 ? 0.3243 0.2999 0.3510 -0.1602 -0.1136 0.0596  300 TYR A CE2 
2334 C CZ  . TYR A 320 ? 0.3085 0.2778 0.3324 -0.1509 -0.1069 0.0665  300 TYR A CZ  
2335 O OH  . TYR A 320 ? 0.3166 0.2574 0.3302 -0.1462 -0.1050 0.0652  300 TYR A OH  
2336 N N   . ARG A 321 ? 0.2950 0.4365 0.3763 -0.1666 -0.1235 0.0696  301 ARG A N   
2337 C CA  . ARG A 321 ? 0.2973 0.4750 0.3877 -0.1656 -0.1292 0.0675  301 ARG A CA  
2338 C C   . ARG A 321 ? 0.2808 0.4797 0.3713 -0.1495 -0.1294 0.0745  301 ARG A C   
2339 O O   . ARG A 321 ? 0.2876 0.4693 0.3651 -0.1413 -0.1299 0.0742  301 ARG A O   
2340 C CB  . ARG A 321 ? 0.3184 0.4878 0.4009 -0.1724 -0.1385 0.0527  301 ARG A CB  
2341 C CG  . ARG A 321 ? 0.3543 0.5587 0.4417 -0.1681 -0.1456 0.0492  301 ARG A CG  
2342 C CD  . ARG A 321 ? 0.4566 0.6553 0.5373 -0.1757 -0.1554 0.0331  301 ARG A CD  
2343 N NE  . ARG A 321 ? 0.5160 0.7473 0.5978 -0.1683 -0.1622 0.0305  301 ARG A NE  
2344 C CZ  . ARG A 321 ? 0.4981 0.7313 0.5722 -0.1703 -0.1716 0.0167  301 ARG A CZ  
2345 N NH1 . ARG A 321 ? 0.4451 0.6490 0.5107 -0.1795 -0.1756 0.0032  301 ARG A NH1 
2346 N NH2 . ARG A 321 ? 0.4964 0.7602 0.5705 -0.1620 -0.1774 0.0164  301 ARG A NH2 
2347 N N   . LYS A 322 ? 0.3207 0.5564 0.4256 -0.1443 -0.1287 0.0812  302 LYS A N   
2348 C CA  . LYS A 322 ? 0.2645 0.5200 0.3693 -0.1265 -0.1290 0.0892  302 LYS A CA  
2349 C C   . LYS A 322 ? 0.3322 0.5916 0.4248 -0.1222 -0.1372 0.0817  302 LYS A C   
2350 O O   . LYS A 322 ? 0.3796 0.6410 0.4712 -0.1324 -0.1434 0.0705  302 LYS A O   
2351 C CB  . LYS A 322 ? 0.2653 0.5598 0.3887 -0.1201 -0.1268 0.0966  302 LYS A CB  
2352 C CG  . LYS A 322 ? 0.2986 0.6005 0.4371 -0.1280 -0.1191 0.1010  302 LYS A CG  
2353 C CD  . LYS A 322 ? 0.3519 0.6903 0.5065 -0.1136 -0.1152 0.1101  302 LYS A CD  
2354 C CE  . LYS A 322 ? 0.4419 0.7910 0.6108 -0.1196 -0.1060 0.1146  302 LYS A CE  
2355 N NZ  . LYS A 322 ? 0.5090 0.8795 0.6896 -0.1354 -0.1067 0.1092  302 LYS A NZ  
2356 N N   . SER A 323 ? 0.2728 0.5325 0.3551 -0.1070 -0.1371 0.0878  303 SER A N   
2357 C CA  . SER A 323 ? 0.3108 0.5770 0.3799 -0.1019 -0.1439 0.0818  303 SER A CA  
2358 C C   . SER A 323 ? 0.3598 0.6615 0.4375 -0.0927 -0.1476 0.0859  303 SER A C   
2359 O O   . SER A 323 ? 0.3781 0.6933 0.4649 -0.0810 -0.1433 0.0973  303 SER A O   
2360 C CB  . SER A 323 ? 0.3826 0.6286 0.4325 -0.0915 -0.1415 0.0858  303 SER A CB  
2361 O OG  . SER A 323 ? 0.4055 0.6513 0.4570 -0.0779 -0.1351 0.1004  303 SER A OG  
2362 N N   . GLN A 324 ? 0.4432 0.7591 0.5181 -0.0972 -0.1561 0.0757  304 GLN A N   
2363 C CA  . GLN A 324 ? 0.4614 0.8120 0.5444 -0.0899 -0.1616 0.0775  304 GLN A CA  
2364 C C   . GLN A 324 ? 0.4502 0.8086 0.5268 -0.0688 -0.1594 0.0908  304 GLN A C   
2365 O O   . GLN A 324 ? 0.4419 0.8235 0.5318 -0.0591 -0.1587 0.0984  304 GLN A O   
2366 C CB  . GLN A 324 ? 0.4902 0.8482 0.5649 -0.0963 -0.1719 0.0639  304 GLN A CB  
2367 C CG  . GLN A 324 ? 0.5311 0.8735 0.6081 -0.1158 -0.1750 0.0494  304 GLN A CG  
2368 C CD  . GLN A 324 ? 0.5487 0.9159 0.6448 -0.1274 -0.1802 0.0436  304 GLN A CD  
2369 O OE1 . GLN A 324 ? 0.4834 0.8782 0.5961 -0.1231 -0.1781 0.0521  304 GLN A OE1 
2370 N NE2 . GLN A 324 ? 0.5838 0.9418 0.6778 -0.1420 -0.1872 0.0286  304 GLN A NE2 
2371 N N   . THR A 325 ? 0.4572 0.7951 0.5128 -0.0617 -0.1581 0.0932  305 THR A N   
2372 C CA  . THR A 325 ? 0.4630 0.7971 0.5083 -0.0431 -0.1545 0.1067  305 THR A CA  
2373 C C   . THR A 325 ? 0.4695 0.8020 0.5276 -0.0331 -0.1470 0.1190  305 THR A C   
2374 O O   . THR A 325 ? 0.4765 0.8239 0.5389 -0.0184 -0.1478 0.1271  305 THR A O   
2375 C CB  . THR A 325 ? 0.5047 0.8099 0.5277 -0.0419 -0.1505 0.1078  305 THR A CB  
2376 O OG1 . THR A 325 ? 0.5362 0.8446 0.5458 -0.0485 -0.1572 0.0959  305 THR A OG1 
2377 C CG2 . THR A 325 ? 0.5307 0.8268 0.5417 -0.0246 -0.1458 0.1225  305 THR A CG2 
2378 N N   . THR A 326 ? 0.3867 0.7004 0.4503 -0.0401 -0.1403 0.1198  306 THR A N   
2379 C CA  . THR A 326 ? 0.3385 0.6449 0.4098 -0.0289 -0.1326 0.1311  306 THR A CA  
2380 C C   . THR A 326 ? 0.3302 0.6562 0.4251 -0.0330 -0.1301 0.1309  306 THR A C   
2381 O O   . THR A 326 ? 0.3879 0.7186 0.4912 -0.0195 -0.1252 0.1392  306 THR A O   
2382 C CB  . THR A 326 ? 0.3162 0.5859 0.3754 -0.0295 -0.1254 0.1353  306 THR A CB  
2383 O OG1 . THR A 326 ? 0.3232 0.5828 0.3873 -0.0467 -0.1248 0.1274  306 THR A OG1 
2384 C CG2 . THR A 326 ? 0.2900 0.5423 0.3263 -0.0257 -0.1258 0.1362  306 THR A CG2 
2385 N N   . GLY A 327 ? 0.3369 0.6727 0.4417 -0.0515 -0.1327 0.1211  307 GLY A N   
2386 C CA  . GLY A 327 ? 0.3176 0.6703 0.4434 -0.0585 -0.1286 0.1211  307 GLY A CA  
2387 C C   . GLY A 327 ? 0.3285 0.6566 0.4548 -0.0629 -0.1208 0.1250  307 GLY A C   
2388 O O   . GLY A 327 ? 0.3971 0.7373 0.5392 -0.0666 -0.1153 0.1271  307 GLY A O   
2389 N N   . PHE A 328 ? 0.2640 0.5589 0.3729 -0.0625 -0.1200 0.1258  308 PHE A N   
2390 C CA  . PHE A 328 ? 0.2323 0.4997 0.3388 -0.0658 -0.1133 0.1287  308 PHE A CA  
2391 C C   . PHE A 328 ? 0.2329 0.4752 0.3309 -0.0843 -0.1149 0.1185  308 PHE A C   
2392 O O   . PHE A 328 ? 0.2745 0.5113 0.3608 -0.0885 -0.1216 0.1118  308 PHE A O   
2393 C CB  . PHE A 328 ? 0.2346 0.4749 0.3252 -0.0488 -0.1077 0.1358  308 PHE A CB  
2394 C CG  . PHE A 328 ? 0.2522 0.4629 0.3401 -0.0468 -0.0966 0.1369  308 PHE A CG  
2395 C CD1 . PHE A 328 ? 0.2787 0.4573 0.3553 -0.0568 -0.0933 0.1310  308 PHE A CD1 
2396 C CD2 . PHE A 328 ? 0.2274 0.4437 0.3240 -0.0342 -0.0899 0.1430  308 PHE A CD2 
2397 C CE1 . PHE A 328 ? 0.2351 0.3888 0.3090 -0.0552 -0.0841 0.1317  308 PHE A CE1 
2398 C CE2 . PHE A 328 ? 0.2237 0.4139 0.3166 -0.0326 -0.0803 0.1428  308 PHE A CE2 
2399 C CZ  . PHE A 328 ? 0.2342 0.3936 0.3158 -0.0437 -0.0777 0.1374  308 PHE A CZ  
2400 N N   . PRO A 329 ? 0.2281 0.4538 0.3302 -0.0940 -0.1083 0.1167  309 PRO A N   
2401 C CA  . PRO A 329 ? 0.2321 0.4292 0.3251 -0.1092 -0.1100 0.1080  309 PRO A CA  
2402 C C   . PRO A 329 ? 0.2378 0.4084 0.3110 -0.1036 -0.1114 0.1035  309 PRO A C   
2403 O O   . PRO A 329 ? 0.2306 0.3860 0.2954 -0.0909 -0.1047 0.1089  309 PRO A O   
2404 C CB  . PRO A 329 ? 0.2263 0.4032 0.3207 -0.1106 -0.0997 0.1114  309 PRO A CB  
2405 C CG  . PRO A 329 ? 0.2211 0.4272 0.3314 -0.1042 -0.0947 0.1189  309 PRO A CG  
2406 C CD  . PRO A 329 ? 0.2214 0.4522 0.3345 -0.0890 -0.0987 0.1230  309 PRO A CD  
2407 N N   . SER A 330 ? 0.2450 0.4110 0.3108 -0.1131 -0.1199 0.0934  310 SER A N   
2408 C CA  . SER A 330 ? 0.2492 0.3948 0.2966 -0.1076 -0.1207 0.0880  310 SER A CA  
2409 C C   . SER A 330 ? 0.2456 0.3560 0.2851 -0.1076 -0.1135 0.0861  310 SER A C   
2410 O O   . SER A 330 ? 0.2438 0.3403 0.2716 -0.0989 -0.1096 0.0863  310 SER A O   
2411 C CB  . SER A 330 ? 0.2638 0.4122 0.3043 -0.1165 -0.1307 0.0751  310 SER A CB  
2412 O OG  . SER A 330 ? 0.2728 0.4068 0.3181 -0.1298 -0.1315 0.0670  310 SER A OG  
2413 N N   . LEU A 331 ? 0.2460 0.3437 0.2920 -0.1177 -0.1120 0.0846  311 LEU A N   
2414 C CA  . LEU A 331 ? 0.2455 0.3107 0.2836 -0.1180 -0.1073 0.0821  311 LEU A CA  
2415 C C   . LEU A 331 ? 0.2396 0.3006 0.2864 -0.1209 -0.1002 0.0897  311 LEU A C   
2416 O O   . LEU A 331 ? 0.2409 0.3203 0.3001 -0.1291 -0.1011 0.0932  311 LEU A O   
2417 C CB  . LEU A 331 ? 0.2608 0.3065 0.2917 -0.1282 -0.1150 0.0698  311 LEU A CB  
2418 C CG  . LEU A 331 ? 0.2641 0.2761 0.2850 -0.1262 -0.1124 0.0653  311 LEU A CG  
2419 C CD1 . LEU A 331 ? 0.2592 0.2662 0.2692 -0.1135 -0.1094 0.0621  311 LEU A CD1 
2420 C CD2 . LEU A 331 ? 0.2846 0.2751 0.2998 -0.1339 -0.1181 0.0546  311 LEU A CD2 
2421 N N   . ILE A 332 ? 0.2755 0.3151 0.3159 -0.1144 -0.0932 0.0920  312 ILE A N   
2422 C CA  . ILE A 332 ? 0.2428 0.2755 0.2877 -0.1169 -0.0866 0.0979  312 ILE A CA  
2423 C C   . ILE A 332 ? 0.2362 0.2371 0.2703 -0.1179 -0.0855 0.0939  312 ILE A C   
2424 O O   . ILE A 332 ? 0.2509 0.2382 0.2764 -0.1102 -0.0846 0.0907  312 ILE A O   
2425 C CB  . ILE A 332 ? 0.2207 0.2632 0.2691 -0.1045 -0.0780 0.1060  312 ILE A CB  
2426 C CG1 . ILE A 332 ? 0.2180 0.2921 0.2766 -0.0996 -0.0796 0.1102  312 ILE A CG1 
2427 C CG2 . ILE A 332 ? 0.2201 0.2595 0.2723 -0.1074 -0.0713 0.1107  312 ILE A CG2 
2428 C CD1 . ILE A 332 ? 0.2125 0.2926 0.2731 -0.0852 -0.0725 0.1172  312 ILE A CD1 
2429 N N   . THR A 333 ? 0.2466 0.2378 0.2778 -0.1217 -0.0839 0.0916  313 THR A N   
2430 C CA  . THR A 333 ? 0.2513 0.2180 0.2714 -0.1157 -0.0807 0.0875  313 THR A CA  
2431 C C   . THR A 333 ? 0.2455 0.2178 0.2678 -0.1109 -0.0719 0.0931  313 THR A C   
2432 O O   . THR A 333 ? 0.2829 0.2723 0.3136 -0.1163 -0.0689 0.0993  313 THR A O   
2433 C CB  . THR A 333 ? 0.2708 0.2208 0.2848 -0.1223 -0.0847 0.0823  313 THR A CB  
2434 O OG1 . THR A 333 ? 0.2799 0.2207 0.2899 -0.1247 -0.0930 0.0743  313 THR A OG1 
2435 C CG2 . THR A 333 ? 0.2757 0.2053 0.2802 -0.1158 -0.0815 0.0803  313 THR A CG2 
2436 N N   . ILE A 334 ? 0.2660 0.2262 0.2814 -0.1011 -0.0677 0.0904  314 ILE A N   
2437 C CA  . ILE A 334 ? 0.2352 0.1969 0.2500 -0.0964 -0.0599 0.0931  314 ILE A CA  
2438 C C   . ILE A 334 ? 0.2491 0.1913 0.2533 -0.0927 -0.0594 0.0875  314 ILE A C   
2439 O O   . ILE A 334 ? 0.2543 0.1849 0.2531 -0.0875 -0.0622 0.0817  314 ILE A O   
2440 C CB  . ILE A 334 ? 0.2857 0.2548 0.3037 -0.0878 -0.0549 0.0958  314 ILE A CB  
2441 C CG1 . ILE A 334 ? 0.3573 0.3251 0.3728 -0.0832 -0.0473 0.0975  314 ILE A CG1 
2442 C CG2 . ILE A 334 ? 0.2925 0.2511 0.3050 -0.0811 -0.0566 0.0899  314 ILE A CG2 
2443 C CD1 . ILE A 334 ? 0.4798 0.4664 0.5038 -0.0884 -0.0435 0.1066  314 ILE A CD1 
2444 N N   . PHE A 335 ? 0.2512 0.1917 0.2529 -0.0963 -0.0562 0.0906  315 PHE A N   
2445 C CA  . PHE A 335 ? 0.2618 0.1846 0.2534 -0.0944 -0.0569 0.0878  315 PHE A CA  
2446 C C   . PHE A 335 ? 0.2625 0.1871 0.2502 -0.0916 -0.0499 0.0914  315 PHE A C   
2447 O O   . PHE A 335 ? 0.2679 0.2029 0.2582 -0.0975 -0.0456 0.0979  315 PHE A O   
2448 C CB  . PHE A 335 ? 0.2809 0.1946 0.2699 -0.1036 -0.0618 0.0890  315 PHE A CB  
2449 C CG  . PHE A 335 ? 0.2949 0.1874 0.2734 -0.1010 -0.0650 0.0864  315 PHE A CG  
2450 C CD1 . PHE A 335 ? 0.2935 0.1735 0.2680 -0.0941 -0.0704 0.0797  315 PHE A CD1 
2451 C CD2 . PHE A 335 ? 0.3130 0.1984 0.2855 -0.1054 -0.0630 0.0916  315 PHE A CD2 
2452 C CE1 . PHE A 335 ? 0.3127 0.1733 0.2779 -0.0909 -0.0745 0.0780  315 PHE A CE1 
2453 C CE2 . PHE A 335 ? 0.3273 0.1921 0.2896 -0.1025 -0.0669 0.0906  315 PHE A CE2 
2454 C CZ  . PHE A 335 ? 0.3256 0.1782 0.2846 -0.0948 -0.0730 0.0837  315 PHE A CZ  
2455 N N   . SER A 336 ? 0.2587 0.1744 0.2401 -0.0836 -0.0489 0.0875  316 SER A N   
2456 C CA  . SER A 336 ? 0.2588 0.1767 0.2360 -0.0805 -0.0427 0.0904  316 SER A CA  
2457 C C   . SER A 336 ? 0.2731 0.1787 0.2392 -0.0806 -0.0433 0.0919  316 SER A C   
2458 O O   . SER A 336 ? 0.2741 0.1783 0.2340 -0.0768 -0.0401 0.0929  316 SER A O   
2459 C CB  . SER A 336 ? 0.2459 0.1648 0.2242 -0.0725 -0.0407 0.0862  316 SER A CB  
2460 O OG  . SER A 336 ? 0.2545 0.1843 0.2418 -0.0722 -0.0397 0.0871  316 SER A OG  
2461 N N   . ALA A 337 ? 0.2870 0.1823 0.2495 -0.0851 -0.0482 0.0928  317 ALA A N   
2462 C CA  . ALA A 337 ? 0.3048 0.1867 0.2559 -0.0854 -0.0497 0.0960  317 ALA A CA  
2463 C C   . ALA A 337 ? 0.3234 0.2058 0.2724 -0.0956 -0.0476 0.1041  317 ALA A C   
2464 O O   . ALA A 337 ? 0.3348 0.2094 0.2850 -0.1015 -0.0522 0.1044  317 ALA A O   
2465 C CB  . ALA A 337 ? 0.3111 0.1765 0.2580 -0.0814 -0.0579 0.0910  317 ALA A CB  
2466 N N   . PRO A 338 ? 0.3294 0.2206 0.2743 -0.0985 -0.0407 0.1111  318 PRO A N   
2467 C CA  . PRO A 338 ? 0.3475 0.2438 0.2916 -0.1098 -0.0374 0.1199  318 PRO A CA  
2468 C C   . PRO A 338 ? 0.3738 0.2504 0.3054 -0.1128 -0.0410 0.1245  318 PRO A C   
2469 O O   . PRO A 338 ? 0.4113 0.2750 0.3332 -0.1051 -0.0441 0.1229  318 PRO A O   
2470 C CB  . PRO A 338 ? 0.3452 0.2592 0.2874 -0.1101 -0.0282 0.1255  318 PRO A CB  
2471 C CG  . PRO A 338 ? 0.3388 0.2448 0.2723 -0.0995 -0.0289 0.1215  318 PRO A CG  
2472 C CD  . PRO A 338 ? 0.3238 0.2196 0.2627 -0.0922 -0.0361 0.1117  318 PRO A CD  
2473 N N   . ASN A 339 ? 0.3939 0.2681 0.3257 -0.1243 -0.0411 0.1308  319 ASN A N   
2474 C CA  . ASN A 339 ? 0.4238 0.2759 0.3436 -0.1281 -0.0452 0.1364  319 ASN A CA  
2475 C C   . ASN A 339 ? 0.4258 0.2554 0.3404 -0.1188 -0.0543 0.1297  319 ASN A C   
2476 O O   . ASN A 339 ? 0.4394 0.2550 0.3419 -0.1133 -0.0569 0.1323  319 ASN A O   
2477 C CB  . ASN A 339 ? 0.4408 0.2941 0.3476 -0.1293 -0.0395 0.1459  319 ASN A CB  
2478 C CG  . ASN A 339 ? 0.4769 0.3075 0.3711 -0.1353 -0.0432 0.1542  319 ASN A CG  
2479 O OD1 . ASN A 339 ? 0.5149 0.3337 0.4121 -0.1436 -0.0474 0.1553  319 ASN A OD1 
2480 N ND2 . ASN A 339 ? 0.4925 0.3153 0.3715 -0.1309 -0.0422 0.1603  319 ASN A ND2 
2481 N N   . TYR A 340 ? 0.4135 0.2412 0.3368 -0.1168 -0.0595 0.1213  320 TYR A N   
2482 C CA  . TYR A 340 ? 0.4484 0.2598 0.3687 -0.1070 -0.0677 0.1135  320 TYR A CA  
2483 C C   . TYR A 340 ? 0.4646 0.2491 0.3718 -0.1067 -0.0740 0.1180  320 TYR A C   
2484 O O   . TYR A 340 ? 0.5064 0.2789 0.4100 -0.1166 -0.0752 0.1241  320 TYR A O   
2485 C CB  . TYR A 340 ? 0.4379 0.2513 0.3683 -0.1080 -0.0719 0.1058  320 TYR A CB  
2486 C CG  . TYR A 340 ? 0.3981 0.1977 0.3267 -0.0984 -0.0800 0.0971  320 TYR A CG  
2487 C CD1 . TYR A 340 ? 0.3845 0.1859 0.3109 -0.0874 -0.0808 0.0930  320 TYR A CD1 
2488 C CD2 . TYR A 340 ? 0.4111 0.1967 0.3404 -0.1011 -0.0872 0.0928  320 TYR A CD2 
2489 C CE1 . TYR A 340 ? 0.3922 0.1830 0.3177 -0.0791 -0.0884 0.0855  320 TYR A CE1 
2490 C CE2 . TYR A 340 ? 0.4114 0.1849 0.3386 -0.0921 -0.0947 0.0848  320 TYR A CE2 
2491 C CZ  . TYR A 340 ? 0.4409 0.2179 0.3668 -0.0810 -0.0952 0.0813  320 TYR A CZ  
2492 O OH  . TYR A 340 ? 0.5068 0.2728 0.4314 -0.0721 -0.1031 0.0732  320 TYR A OH  
2493 N N   . LEU A 341 ? 0.4453 0.2203 0.3449 -0.0958 -0.0782 0.1157  321 LEU A N   
2494 C CA  . LEU A 341 ? 0.5020 0.2508 0.3883 -0.0927 -0.0853 0.1199  321 LEU A CA  
2495 C C   . LEU A 341 ? 0.5721 0.3151 0.4475 -0.1006 -0.0811 0.1330  321 LEU A C   
2496 O O   . LEU A 341 ? 0.5640 0.2828 0.4287 -0.1022 -0.0864 0.1391  321 LEU A O   
2497 C CB  . LEU A 341 ? 0.5252 0.2529 0.4118 -0.0944 -0.0935 0.1160  321 LEU A CB  
2498 C CG  . LEU A 341 ? 0.4977 0.2286 0.3929 -0.0870 -0.0984 0.1036  321 LEU A CG  
2499 C CD1 . LEU A 341 ? 0.4999 0.2083 0.3935 -0.0900 -0.1063 0.1002  321 LEU A CD1 
2500 C CD2 . LEU A 341 ? 0.5088 0.2377 0.4003 -0.0731 -0.1029 0.0988  321 LEU A CD2 
2501 N N   . ASP A 342 ? 0.5706 0.3352 0.4483 -0.1055 -0.0717 0.1376  322 ASP A N   
2502 C CA  . ASP A 342 ? 0.5767 0.3412 0.4445 -0.1141 -0.0659 0.1506  322 ASP A CA  
2503 C C   . ASP A 342 ? 0.6106 0.3650 0.4790 -0.1284 -0.0658 0.1575  322 ASP A C   
2504 O O   . ASP A 342 ? 0.6162 0.3677 0.4755 -0.1371 -0.0616 0.1693  322 ASP A O   
2505 C CB  . ASP A 342 ? 0.5394 0.2886 0.3898 -0.1067 -0.0694 0.1571  322 ASP A CB  
2506 C CG  . ASP A 342 ? 0.5950 0.3583 0.4435 -0.0957 -0.0680 0.1525  322 ASP A CG  
2507 O OD1 . ASP A 342 ? 0.6272 0.4134 0.4813 -0.0981 -0.0598 0.1515  322 ASP A OD1 
2508 O OD2 . ASP A 342 ? 0.5755 0.3270 0.4169 -0.0849 -0.0756 0.1496  322 ASP A OD2 
2509 N N   . VAL A 343 ? 0.5703 0.3193 0.4484 -0.1319 -0.0705 0.1505  323 VAL A N   
2510 C CA  . VAL A 343 ? 0.5949 0.3304 0.4723 -0.1462 -0.0719 0.1568  323 VAL A CA  
2511 C C   . VAL A 343 ? 0.5618 0.3146 0.4545 -0.1570 -0.0693 0.1530  323 VAL A C   
2512 O O   . VAL A 343 ? 0.6111 0.3598 0.5044 -0.1717 -0.0683 0.1597  323 VAL A O   
2513 C CB  . VAL A 343 ? 0.6233 0.3230 0.4917 -0.1429 -0.0828 0.1555  323 VAL A CB  
2514 C CG1 . VAL A 343 ? 0.6180 0.3009 0.4710 -0.1314 -0.0864 0.1601  323 VAL A CG1 
2515 C CG2 . VAL A 343 ? 0.5836 0.2798 0.4609 -0.1361 -0.0899 0.1416  323 VAL A CG2 
2516 N N   . TYR A 344 ? 0.5322 0.3047 0.4369 -0.1504 -0.0684 0.1429  324 TYR A N   
2517 C CA  . TYR A 344 ? 0.5566 0.3462 0.4755 -0.1592 -0.0671 0.1392  324 TYR A CA  
2518 C C   . TYR A 344 ? 0.5508 0.3695 0.4775 -0.1694 -0.0573 0.1462  324 TYR A C   
2519 O O   . TYR A 344 ? 0.5583 0.3897 0.4957 -0.1806 -0.0566 0.1462  324 TYR A O   
2520 C CB  . TYR A 344 ? 0.5492 0.3500 0.4773 -0.1483 -0.0694 0.1274  324 TYR A CB  
2521 C CG  . TYR A 344 ? 0.5962 0.3762 0.5229 -0.1431 -0.0792 0.1185  324 TYR A CG  
2522 C CD1 . TYR A 344 ? 0.5929 0.3477 0.5083 -0.1339 -0.0856 0.1167  324 TYR A CD1 
2523 C CD2 . TYR A 344 ? 0.6005 0.3873 0.5370 -0.1465 -0.0824 0.1115  324 TYR A CD2 
2524 C CE1 . TYR A 344 ? 0.6071 0.3437 0.5212 -0.1280 -0.0947 0.1079  324 TYR A CE1 
2525 C CE2 . TYR A 344 ? 0.5952 0.3634 0.5294 -0.1413 -0.0912 0.1028  324 TYR A CE2 
2526 C CZ  . TYR A 344 ? 0.6210 0.3640 0.5440 -0.1318 -0.0972 0.1008  324 TYR A CZ  
2527 O OH  . TYR A 344 ? 0.6204 0.3449 0.5409 -0.1257 -0.1062 0.0915  324 TYR A OH  
2528 N N   . ASN A 345 ? 0.5706 0.4014 0.4922 -0.1652 -0.0500 0.1515  325 ASN A N   
2529 C CA  . ASN A 345 ? 0.5560 0.4168 0.4845 -0.1732 -0.0401 0.1578  325 ASN A CA  
2530 C C   . ASN A 345 ? 0.5526 0.4396 0.4983 -0.1729 -0.0384 0.1511  325 ASN A C   
2531 O O   . ASN A 345 ? 0.5982 0.5092 0.5536 -0.1835 -0.0330 0.1557  325 ASN A O   
2532 C CB  . ASN A 345 ? 0.5291 0.3885 0.4553 -0.1910 -0.0375 0.1689  325 ASN A CB  
2533 C CG  . ASN A 345 ? 0.5331 0.4221 0.4611 -0.1979 -0.0260 0.1779  325 ASN A CG  
2534 O OD1 . ASN A 345 ? 0.5410 0.4297 0.4565 -0.1929 -0.0210 0.1836  325 ASN A OD1 
2535 N ND2 . ASN A 345 ? 0.5302 0.4463 0.4730 -0.2094 -0.0218 0.1793  325 ASN A ND2 
2536 N N   . ASN A 346 ? 0.4377 0.3211 0.3871 -0.1608 -0.0431 0.1409  326 ASN A N   
2537 C CA  . ASN A 346 ? 0.4053 0.3109 0.3693 -0.1589 -0.0423 0.1352  326 ASN A CA  
2538 C C   . ASN A 346 ? 0.3822 0.3082 0.3491 -0.1501 -0.0350 0.1351  326 ASN A C   
2539 O O   . ASN A 346 ? 0.3801 0.2974 0.3369 -0.1409 -0.0333 0.1347  326 ASN A O   
2540 C CB  . ASN A 346 ? 0.3937 0.2851 0.3593 -0.1510 -0.0509 0.1249  326 ASN A CB  
2541 C CG  . ASN A 346 ? 0.3799 0.2603 0.3383 -0.1358 -0.0522 0.1193  326 ASN A CG  
2542 O OD1 . ASN A 346 ? 0.3951 0.2554 0.3419 -0.1322 -0.0548 0.1204  326 ASN A OD1 
2543 N ND2 . ASN A 346 ? 0.3532 0.2470 0.3185 -0.1273 -0.0506 0.1139  326 ASN A ND2 
2544 N N   . LYS A 347 ? 0.3669 0.3198 0.3473 -0.1528 -0.0312 0.1356  327 LYS A N   
2545 C CA  . LYS A 347 ? 0.3459 0.3162 0.3297 -0.1434 -0.0251 0.1350  327 LYS A CA  
2546 C C   . LYS A 347 ? 0.3259 0.2840 0.3097 -0.1307 -0.0303 0.1257  327 LYS A C   
2547 O O   . LYS A 347 ? 0.3256 0.2695 0.3098 -0.1301 -0.0379 0.1200  327 LYS A O   
2548 C CB  . LYS A 347 ? 0.3372 0.3424 0.3369 -0.1494 -0.0197 0.1392  327 LYS A CB  
2549 C CG  . LYS A 347 ? 0.3562 0.3808 0.3584 -0.1625 -0.0131 0.1481  327 LYS A CG  
2550 C CD  . LYS A 347 ? 0.4568 0.5226 0.4773 -0.1660 -0.0073 0.1513  327 LYS A CD  
2551 C CE  . LYS A 347 ? 0.5645 0.6574 0.5868 -0.1749 0.0028  0.1599  327 LYS A CE  
2552 N NZ  . LYS A 347 ? 0.5950 0.6880 0.6040 -0.1667 0.0113  0.1628  327 LYS A NZ  
2553 N N   . ALA A 348 ? 0.3127 0.2759 0.2951 -0.1209 -0.0261 0.1243  328 ALA A N   
2554 C CA  . ALA A 348 ? 0.2940 0.2489 0.2782 -0.1104 -0.0302 0.1163  328 ALA A CA  
2555 C C   . ALA A 348 ? 0.2785 0.2554 0.2750 -0.1084 -0.0268 0.1182  328 ALA A C   
2556 O O   . ALA A 348 ? 0.3234 0.3231 0.3268 -0.1138 -0.0208 0.1255  328 ALA A O   
2557 C CB  . ALA A 348 ? 0.2929 0.2326 0.2654 -0.1007 -0.0296 0.1127  328 ALA A CB  
2558 N N   . ALA A 349 ? 0.2642 0.2369 0.2641 -0.1006 -0.0301 0.1128  329 ALA A N   
2559 C CA  . ALA A 349 ? 0.2525 0.2438 0.2631 -0.0974 -0.0270 0.1166  329 ALA A CA  
2560 C C   . ALA A 349 ? 0.2420 0.2208 0.2499 -0.0866 -0.0287 0.1108  329 ALA A C   
2561 O O   . ALA A 349 ? 0.2404 0.2020 0.2422 -0.0835 -0.0335 0.1029  329 ALA A O   
2562 C CB  . ALA A 349 ? 0.2494 0.2595 0.2738 -0.1050 -0.0304 0.1198  329 ALA A CB  
2563 N N   . VAL A 350 ? 0.2369 0.2254 0.2496 -0.0808 -0.0243 0.1156  330 VAL A N   
2564 C CA  . VAL A 350 ? 0.2294 0.2086 0.2421 -0.0719 -0.0263 0.1119  330 VAL A CA  
2565 C C   . VAL A 350 ? 0.2318 0.2310 0.2578 -0.0708 -0.0260 0.1209  330 VAL A C   
2566 O O   . VAL A 350 ? 0.2501 0.2737 0.2849 -0.0713 -0.0217 0.1245  330 VAL A O   
2567 C CB  . VAL A 350 ? 0.2331 0.1986 0.2366 -0.0636 -0.0221 0.1102  330 VAL A CB  
2568 C CG1 . VAL A 350 ? 0.2382 0.1884 0.2296 -0.0648 -0.0229 0.1035  330 VAL A CG1 
2569 C CG2 . VAL A 350 ? 0.2387 0.2198 0.2450 -0.0581 -0.0147 0.1157  330 VAL A CG2 
2570 N N   . LEU A 351 ? 0.2455 0.2383 0.2725 -0.0652 -0.0299 0.1187  331 LEU A N   
2571 C CA  . LEU A 351 ? 0.2251 0.2365 0.2623 -0.0584 -0.0305 0.1213  331 LEU A CA  
2572 C C   . LEU A 351 ? 0.2252 0.2293 0.2596 -0.0434 -0.0263 0.1204  331 LEU A C   
2573 O O   . LEU A 351 ? 0.2763 0.2582 0.3022 -0.0406 -0.0277 0.1180  331 LEU A O   
2574 C CB  . LEU A 351 ? 0.2702 0.2782 0.3078 -0.0627 -0.0381 0.1205  331 LEU A CB  
2575 C CG  . LEU A 351 ? 0.3060 0.3370 0.3538 -0.0592 -0.0414 0.1237  331 LEU A CG  
2576 C CD1 . LEU A 351 ? 0.3559 0.3906 0.4051 -0.0712 -0.0490 0.1217  331 LEU A CD1 
2577 C CD2 . LEU A 351 ? 0.3100 0.3324 0.3534 -0.0473 -0.0416 0.1251  331 LEU A CD2 
2578 N N   . LYS A 352 ? 0.2336 0.2559 0.2750 -0.0337 -0.0214 0.1221  332 LYS A N   
2579 C CA  . LYS A 352 ? 0.2612 0.2727 0.2991 -0.0181 -0.0183 0.1208  332 LYS A CA  
2580 C C   . LYS A 352 ? 0.2900 0.3124 0.3352 -0.0085 -0.0218 0.1254  332 LYS A C   
2581 O O   . LYS A 352 ? 0.3652 0.4175 0.4229 -0.0055 -0.0221 0.1284  332 LYS A O   
2582 C CB  . LYS A 352 ? 0.2542 0.2733 0.2917 -0.0095 -0.0105 0.1178  332 LYS A CB  
2583 C CG  . LYS A 352 ? 0.3148 0.3237 0.3425 -0.0188 -0.0075 0.1143  332 LYS A CG  
2584 C CD  . LYS A 352 ? 0.3745 0.3718 0.3926 -0.0081 -0.0014 0.1080  332 LYS A CD  
2585 C CE  . LYS A 352 ? 0.4031 0.3729 0.4148 0.0021  -0.0035 0.1045  332 LYS A CE  
2586 N NZ  . LYS A 352 ? 0.4012 0.3459 0.3986 0.0034  -0.0016 0.0966  332 LYS A NZ  
2587 N N   . TYR A 353 ? 0.2434 0.2431 0.2808 -0.0044 -0.0247 0.1264  333 TYR A N   
2588 C CA  . TYR A 353 ? 0.2490 0.2550 0.2896 0.0043  -0.0289 0.1325  333 TYR A CA  
2589 C C   . TYR A 353 ? 0.2683 0.2552 0.3034 0.0210  -0.0263 0.1335  333 TYR A C   
2590 O O   . TYR A 353 ? 0.3293 0.2858 0.3531 0.0203  -0.0263 0.1330  333 TYR A O   
2591 C CB  . TYR A 353 ? 0.2495 0.2444 0.2836 -0.0051 -0.0345 0.1346  333 TYR A CB  
2592 C CG  . TYR A 353 ? 0.2941 0.2982 0.3294 0.0018  -0.0396 0.1419  333 TYR A CG  
2593 C CD1 . TYR A 353 ? 0.3877 0.4198 0.4343 0.0115  -0.0415 0.1457  333 TYR A CD1 
2594 C CD2 . TYR A 353 ? 0.2563 0.2440 0.2814 -0.0011 -0.0426 0.1454  333 TYR A CD2 
2595 C CE1 . TYR A 353 ? 0.3827 0.4245 0.4293 0.0189  -0.0473 0.1529  333 TYR A CE1 
2596 C CE2 . TYR A 353 ? 0.2801 0.2767 0.3035 0.0052  -0.0467 0.1510  333 TYR A CE2 
2597 C CZ  . TYR A 353 ? 0.3800 0.4026 0.4139 0.0158  -0.0503 0.1571  333 TYR A CZ  
2598 O OH  . TYR A 353 ? 0.4902 0.5226 0.5216 0.0230  -0.0556 0.1637  333 TYR A OH  
2599 N N   . GLU A 354 ? 0.2849 0.2897 0.3283 0.0358  -0.0242 0.1344  334 GLU A N   
2600 C CA  . GLU A 354 ? 0.3387 0.3242 0.3769 0.0544  -0.0228 0.1351  334 GLU A CA  
2601 C C   . GLU A 354 ? 0.4073 0.4192 0.4567 0.0710  -0.0255 0.1406  334 GLU A C   
2602 O O   . GLU A 354 ? 0.4401 0.4911 0.5041 0.0695  -0.0254 0.1407  334 GLU A O   
2603 C CB  . GLU A 354 ? 0.3341 0.3088 0.3683 0.0611  -0.0157 0.1262  334 GLU A CB  
2604 C CG  . GLU A 354 ? 0.4662 0.4230 0.4911 0.0459  -0.0131 0.1197  334 GLU A CG  
2605 C CD  . GLU A 354 ? 0.5696 0.5195 0.5893 0.0535  -0.0065 0.1104  334 GLU A CD  
2606 O OE1 . GLU A 354 ? 0.5281 0.4970 0.5503 0.0460  -0.0024 0.1069  334 GLU A OE1 
2607 O OE2 . GLU A 354 ? 0.6205 0.5446 0.6323 0.0666  -0.0056 0.1068  334 GLU A OE2 
2608 N N   . ASN A 355 ? 0.2561 0.3955 0.2688 -0.0813 -0.0311 0.0919  335 ASN A N   
2609 C CA  . ASN A 355 ? 0.2117 0.3592 0.2325 -0.0843 -0.0252 0.0965  335 ASN A CA  
2610 C C   . ASN A 355 ? 0.2320 0.3888 0.2618 -0.0865 -0.0256 0.0949  335 ASN A C   
2611 O O   . ASN A 355 ? 0.2531 0.4075 0.2863 -0.0894 -0.0211 0.0993  335 ASN A O   
2612 C CB  . ASN A 355 ? 0.2037 0.3354 0.2167 -0.0844 -0.0187 0.1019  335 ASN A CB  
2613 C CG  . ASN A 355 ? 0.2120 0.3303 0.2130 -0.0813 -0.0192 0.1027  335 ASN A CG  
2614 O OD1 . ASN A 355 ? 0.2073 0.3315 0.2099 -0.0811 -0.0229 0.1023  335 ASN A OD1 
2615 N ND2 . ASN A 355 ? 0.2255 0.3256 0.2144 -0.0787 -0.0162 0.1047  335 ASN A ND2 
2616 N N   . ASN A 356 ? 0.1906 0.3570 0.2233 -0.0844 -0.0318 0.0891  336 ASN A N   
2617 C CA  . ASN A 356 ? 0.2327 0.4058 0.2716 -0.0853 -0.0347 0.0859  336 ASN A CA  
2618 C C   . ASN A 356 ? 0.2735 0.4298 0.3090 -0.0875 -0.0360 0.0861  336 ASN A C   
2619 O O   . ASN A 356 ? 0.2890 0.4482 0.3310 -0.0902 -0.0379 0.0862  336 ASN A O   
2620 C CB  . ASN A 356 ? 0.2153 0.4053 0.2660 -0.0886 -0.0308 0.0897  336 ASN A CB  
2621 C CG  . ASN A 356 ? 0.2562 0.4623 0.3132 -0.0865 -0.0359 0.0846  336 ASN A CG  
2622 O OD1 . ASN A 356 ? 0.3661 0.5810 0.4210 -0.0811 -0.0404 0.0800  336 ASN A OD1 
2623 N ND2 . ASN A 356 ? 0.2460 0.4564 0.3101 -0.0902 -0.0356 0.0859  336 ASN A ND2 
2624 N N   . VAL A 357 ? 0.2382 0.3775 0.2644 -0.0864 -0.0356 0.0868  337 VAL A N   
2625 C CA  . VAL A 357 ? 0.2203 0.3447 0.2442 -0.0880 -0.0381 0.0875  337 VAL A CA  
2626 C C   . VAL A 357 ? 0.2276 0.3415 0.2425 -0.0840 -0.0443 0.0808  337 VAL A C   
2627 O O   . VAL A 357 ? 0.2421 0.3516 0.2492 -0.0812 -0.0431 0.0801  337 VAL A O   
2628 C CB  . VAL A 357 ? 0.2306 0.3438 0.2515 -0.0897 -0.0310 0.0962  337 VAL A CB  
2629 C CG1 . VAL A 357 ? 0.2361 0.3357 0.2564 -0.0912 -0.0341 0.0984  337 VAL A CG1 
2630 C CG2 . VAL A 357 ? 0.2174 0.3404 0.2463 -0.0929 -0.0238 0.1039  337 VAL A CG2 
2631 N N   . MET A 358 ? 0.2348 0.3440 0.2505 -0.0836 -0.0517 0.0761  338 MET A N   
2632 C CA  . MET A 358 ? 0.2483 0.3449 0.2554 -0.0800 -0.0573 0.0708  338 MET A CA  
2633 C C   . MET A 358 ? 0.2989 0.3796 0.3054 -0.0834 -0.0565 0.0763  338 MET A C   
2634 O O   . MET A 358 ? 0.3036 0.3807 0.3170 -0.0874 -0.0595 0.0795  338 MET A O   
2635 C CB  . MET A 358 ? 0.2961 0.3939 0.3026 -0.0766 -0.0667 0.0624  338 MET A CB  
2636 C CG  . MET A 358 ? 0.3851 0.5016 0.3927 -0.0716 -0.0677 0.0577  338 MET A CG  
2637 S SD  . MET A 358 ? 0.6943 0.8096 0.6918 -0.0619 -0.0761 0.0478  338 MET A SD  
2638 C CE  . MET A 358 ? 0.3406 0.4321 0.3349 -0.0641 -0.0840 0.0450  338 MET A CE  
2639 N N   . ASN A 359 ? 0.3284 0.3998 0.3271 -0.0819 -0.0529 0.0785  339 ASN A N   
2640 C CA  . ASN A 359 ? 0.3156 0.3736 0.3136 -0.0840 -0.0516 0.0847  339 ASN A CA  
2641 C C   . ASN A 359 ? 0.3186 0.3642 0.3091 -0.0812 -0.0568 0.0800  339 ASN A C   
2642 O O   . ASN A 359 ? 0.3199 0.3645 0.3018 -0.0774 -0.0564 0.0758  339 ASN A O   
2643 C CB  . ASN A 359 ? 0.3095 0.3667 0.3041 -0.0839 -0.0419 0.0928  339 ASN A CB  
2644 C CG  . ASN A 359 ? 0.3519 0.3982 0.3458 -0.0847 -0.0393 0.1008  339 ASN A CG  
2645 O OD1 . ASN A 359 ? 0.3927 0.4398 0.3962 -0.0884 -0.0398 0.1078  339 ASN A OD1 
2646 N ND2 . ASN A 359 ? 0.4657 0.5024 0.4488 -0.0811 -0.0368 0.1009  339 ASN A ND2 
2647 N N   . ILE A 360 ? 0.3029 0.3392 0.2977 -0.0836 -0.0623 0.0815  340 ILE A N   
2648 C CA  . ILE A 360 ? 0.2948 0.3186 0.2840 -0.0814 -0.0677 0.0779  340 ILE A CA  
2649 C C   . ILE A 360 ? 0.3303 0.3455 0.3165 -0.0819 -0.0620 0.0859  340 ILE A C   
2650 O O   . ILE A 360 ? 0.3897 0.4029 0.3835 -0.0854 -0.0604 0.0951  340 ILE A O   
2651 C CB  . ILE A 360 ? 0.3043 0.3208 0.3002 -0.0837 -0.0782 0.0759  340 ILE A CB  
2652 C CG1 . ILE A 360 ? 0.3039 0.3281 0.3019 -0.0825 -0.0844 0.0683  340 ILE A CG1 
2653 C CG2 . ILE A 360 ? 0.3475 0.3512 0.3373 -0.0809 -0.0842 0.0713  340 ILE A CG2 
2654 C CD1 . ILE A 360 ? 0.3665 0.3946 0.3547 -0.0751 -0.0870 0.0576  340 ILE A CD1 
2655 N N   . ARG A 361 ? 0.3134 0.3244 0.2888 -0.0781 -0.0592 0.0832  341 ARG A N   
2656 C CA  . ARG A 361 ? 0.3059 0.3077 0.2762 -0.0772 -0.0547 0.0895  341 ARG A CA  
2657 C C   . ARG A 361 ? 0.3158 0.3070 0.2860 -0.0771 -0.0614 0.0874  341 ARG A C   
2658 O O   . ARG A 361 ? 0.3409 0.3293 0.3049 -0.0744 -0.0659 0.0792  341 ARG A O   
2659 C CB  . ARG A 361 ? 0.3041 0.3046 0.2618 -0.0734 -0.0498 0.0877  341 ARG A CB  
2660 C CG  . ARG A 361 ? 0.3039 0.3116 0.2602 -0.0730 -0.0429 0.0914  341 ARG A CG  
2661 C CD  . ARG A 361 ? 0.3019 0.3089 0.2618 -0.0737 -0.0364 0.1020  341 ARG A CD  
2662 N NE  . ARG A 361 ? 0.3135 0.3101 0.2657 -0.0706 -0.0334 0.1069  341 ARG A NE  
2663 C CZ  . ARG A 361 ? 0.3892 0.3800 0.3281 -0.0658 -0.0282 0.1085  341 ARG A CZ  
2664 N NH1 . ARG A 361 ? 0.3775 0.3714 0.3107 -0.0644 -0.0261 0.1056  341 ARG A NH1 
2665 N NH2 . ARG A 361 ? 0.3684 0.3502 0.2997 -0.0622 -0.0256 0.1130  341 ARG A NH2 
2666 N N   . GLN A 362 ? 0.3681 0.3544 0.3459 -0.0799 -0.0621 0.0956  342 GLN A N   
2667 C CA  . GLN A 362 ? 0.3295 0.3055 0.3083 -0.0801 -0.0687 0.0944  342 GLN A CA  
2668 C C   . GLN A 362 ? 0.3331 0.3032 0.3037 -0.0773 -0.0628 0.0988  342 GLN A C   
2669 O O   . GLN A 362 ? 0.3316 0.3047 0.2980 -0.0755 -0.0542 0.1055  342 GLN A O   
2670 C CB  . GLN A 362 ? 0.3355 0.3090 0.3289 -0.0851 -0.0751 0.1016  342 GLN A CB  
2671 C CG  . GLN A 362 ? 0.3498 0.3251 0.3503 -0.0878 -0.0841 0.0960  342 GLN A CG  
2672 C CD  . GLN A 362 ? 0.3785 0.3493 0.3941 -0.0938 -0.0923 0.1046  342 GLN A CD  
2673 O OE1 . GLN A 362 ? 0.3700 0.3464 0.3953 -0.0973 -0.0876 0.1181  342 GLN A OE1 
2674 N NE2 . GLN A 362 ? 0.3981 0.3588 0.4159 -0.0945 -0.1053 0.0976  342 GLN A NE2 
2675 N N   . PHE A 363 ? 0.3387 0.3003 0.3059 -0.0761 -0.0677 0.0947  343 PHE A N   
2676 C CA  . PHE A 363 ? 0.3434 0.2987 0.3036 -0.0736 -0.0633 0.0991  343 PHE A CA  
2677 C C   . PHE A 363 ? 0.3506 0.2971 0.3147 -0.0745 -0.0704 0.0981  343 PHE A C   
2678 O O   . PHE A 363 ? 0.3761 0.3193 0.3428 -0.0752 -0.0791 0.0903  343 PHE A O   
2679 C CB  . PHE A 363 ? 0.3407 0.2952 0.2856 -0.0694 -0.0584 0.0940  343 PHE A CB  
2680 C CG  . PHE A 363 ? 0.3386 0.2923 0.2780 -0.0680 -0.0641 0.0833  343 PHE A CG  
2681 C CD1 . PHE A 363 ? 0.3317 0.2936 0.2713 -0.0676 -0.0658 0.0773  343 PHE A CD1 
2682 C CD2 . PHE A 363 ? 0.3435 0.2896 0.2775 -0.0663 -0.0671 0.0803  343 PHE A CD2 
2683 C CE1 . PHE A 363 ? 0.3789 0.3426 0.3136 -0.0648 -0.0704 0.0692  343 PHE A CE1 
2684 C CE2 . PHE A 363 ? 0.3419 0.2889 0.2708 -0.0640 -0.0716 0.0720  343 PHE A CE2 
2685 C CZ  . PHE A 363 ? 0.3354 0.2918 0.2646 -0.0628 -0.0732 0.0668  343 PHE A CZ  
2686 N N   . ASN A 364 ? 0.3633 0.3062 0.3272 -0.0738 -0.0669 0.1060  344 ASN A N   
2687 C CA  . ASN A 364 ? 0.3621 0.2972 0.3309 -0.0749 -0.0732 0.1067  344 ASN A CA  
2688 C C   . ASN A 364 ? 0.3635 0.2925 0.3194 -0.0713 -0.0722 0.1002  344 ASN A C   
2689 O O   . ASN A 364 ? 0.4347 0.3652 0.3783 -0.0684 -0.0680 0.0951  344 ASN A O   
2690 C CB  . ASN A 364 ? 0.3663 0.3032 0.3452 -0.0763 -0.0704 0.1212  344 ASN A CB  
2691 C CG  . ASN A 364 ? 0.3991 0.3429 0.3926 -0.0804 -0.0719 0.1299  344 ASN A CG  
2692 O OD1 . ASN A 364 ? 0.4879 0.4288 0.4924 -0.0849 -0.0821 0.1278  344 ASN A OD1 
2693 N ND2 . ASN A 364 ? 0.4284 0.3809 0.4215 -0.0785 -0.0624 0.1398  344 ASN A ND2 
2694 N N   . CYS A 365 ? 0.3705 0.2926 0.3297 -0.0719 -0.0767 0.1013  345 CYS A N   
2695 C CA  . CYS A 365 ? 0.4084 0.3251 0.3559 -0.0688 -0.0760 0.0956  345 CYS A CA  
2696 C C   . CYS A 365 ? 0.3910 0.3072 0.3301 -0.0662 -0.0676 0.1023  345 CYS A C   
2697 O O   . CYS A 365 ? 0.4545 0.3748 0.3964 -0.0656 -0.0618 0.1119  345 CYS A O   
2698 C CB  . CYS A 365 ? 0.3911 0.3001 0.3441 -0.0698 -0.0844 0.0926  345 CYS A CB  
2699 S SG  . CYS A 365 ? 0.3990 0.3061 0.3686 -0.0735 -0.0870 0.1055  345 CYS A SG  
2700 N N   . SER A 366 ? 0.3733 0.2846 0.3010 -0.0638 -0.0672 0.0974  346 SER A N   
2701 C CA  . SER A 366 ? 0.3769 0.2852 0.2937 -0.0607 -0.0609 0.1020  346 SER A CA  
2702 C C   . SER A 366 ? 0.3990 0.3010 0.3146 -0.0608 -0.0643 0.1003  346 SER A C   
2703 O O   . SER A 366 ? 0.4220 0.3220 0.3400 -0.0619 -0.0706 0.0934  346 SER A O   
2704 C CB  . SER A 366 ? 0.3752 0.2829 0.2767 -0.0581 -0.0576 0.0974  346 SER A CB  
2705 O OG  . SER A 366 ? 0.3744 0.2881 0.2774 -0.0582 -0.0551 0.0979  346 SER A OG  
2706 N N   . PRO A 367 ? 0.4110 0.3104 0.3223 -0.0588 -0.0600 0.1069  347 PRO A N   
2707 C CA  . PRO A 367 ? 0.3887 0.2828 0.2992 -0.0590 -0.0625 0.1064  347 PRO A CA  
2708 C C   . PRO A 367 ? 0.3873 0.2773 0.2863 -0.0584 -0.0651 0.0975  347 PRO A C   
2709 O O   . PRO A 367 ? 0.3855 0.2759 0.2737 -0.0570 -0.0635 0.0941  347 PRO A O   
2710 C CB  . PRO A 367 ? 0.3945 0.2877 0.2978 -0.0554 -0.0557 0.1147  347 PRO A CB  
2711 C CG  . PRO A 367 ? 0.3949 0.2946 0.3017 -0.0535 -0.0506 0.1222  347 PRO A CG  
2712 C CD  . PRO A 367 ? 0.3893 0.2912 0.2954 -0.0551 -0.0522 0.1155  347 PRO A CD  
2713 N N   . HIS A 368 ? 0.3884 0.2750 0.2906 -0.0593 -0.0697 0.0949  348 HIS A N   
2714 C CA  . HIS A 368 ? 0.3876 0.2718 0.2801 -0.0583 -0.0719 0.0889  348 HIS A CA  
2715 C C   . HIS A 368 ? 0.4184 0.2978 0.3119 -0.0586 -0.0734 0.0907  348 HIS A C   
2716 O O   . HIS A 368 ? 0.4082 0.2865 0.3132 -0.0600 -0.0754 0.0939  348 HIS A O   
2717 C CB  . HIS A 368 ? 0.3836 0.2715 0.2790 -0.0580 -0.0772 0.0812  348 HIS A CB  
2718 C CG  . HIS A 368 ? 0.3863 0.2720 0.2926 -0.0584 -0.0834 0.0784  348 HIS A CG  
2719 N ND1 . HIS A 368 ? 0.4574 0.3392 0.3628 -0.0570 -0.0873 0.0756  348 HIS A ND1 
2720 C CD2 . HIS A 368 ? 0.3985 0.2842 0.3162 -0.0598 -0.0876 0.0780  348 HIS A CD2 
2721 C CE1 . HIS A 368 ? 0.4421 0.3204 0.3571 -0.0570 -0.0938 0.0729  348 HIS A CE1 
2722 N NE2 . HIS A 368 ? 0.3931 0.2733 0.3158 -0.0590 -0.0947 0.0742  348 HIS A NE2 
2723 N N   . PRO A 369 ? 0.3993 0.2760 0.2815 -0.0577 -0.0730 0.0895  349 PRO A N   
2724 C CA  . PRO A 369 ? 0.4350 0.3076 0.3170 -0.0580 -0.0738 0.0915  349 PRO A CA  
2725 C C   . PRO A 369 ? 0.4349 0.3073 0.3260 -0.0580 -0.0795 0.0874  349 PRO A C   
2726 O O   . PRO A 369 ? 0.4268 0.3019 0.3202 -0.0569 -0.0831 0.0818  349 PRO A O   
2727 C CB  . PRO A 369 ? 0.4564 0.3271 0.3242 -0.0573 -0.0733 0.0908  349 PRO A CB  
2728 C CG  . PRO A 369 ? 0.4197 0.2912 0.2795 -0.0567 -0.0710 0.0907  349 PRO A CG  
2729 C CD  . PRO A 369 ? 0.4319 0.3091 0.3013 -0.0568 -0.0719 0.0877  349 PRO A CD  
2730 N N   . TYR A 370 ? 0.4532 0.3219 0.3484 -0.0587 -0.0805 0.0900  350 TYR A N   
2731 C CA  . TYR A 370 ? 0.4010 0.2672 0.3047 -0.0581 -0.0866 0.0864  350 TYR A CA  
2732 C C   . TYR A 370 ? 0.4014 0.2674 0.2971 -0.0555 -0.0883 0.0826  350 TYR A C   
2733 O O   . TYR A 370 ? 0.4109 0.2773 0.2978 -0.0558 -0.0850 0.0857  350 TYR A O   
2734 C CB  . TYR A 370 ? 0.4045 0.2675 0.3200 -0.0605 -0.0874 0.0925  350 TYR A CB  
2735 C CG  . TYR A 370 ? 0.4973 0.3553 0.4218 -0.0600 -0.0952 0.0888  350 TYR A CG  
2736 C CD1 . TYR A 370 ? 0.5232 0.3786 0.4568 -0.0600 -0.1021 0.0851  350 TYR A CD1 
2737 C CD2 . TYR A 370 ? 0.5053 0.3600 0.4282 -0.0590 -0.0963 0.0887  350 TYR A CD2 
2738 C CE1 . TYR A 370 ? 0.5250 0.3730 0.4649 -0.0587 -0.1107 0.0809  350 TYR A CE1 
2739 C CE2 . TYR A 370 ? 0.5217 0.3703 0.4515 -0.0575 -0.1039 0.0848  350 TYR A CE2 
2740 C CZ  . TYR A 370 ? 0.5599 0.4043 0.4976 -0.0570 -0.1115 0.0806  350 TYR A CZ  
2741 O OH  . TYR A 370 ? 0.6448 0.4804 0.5876 -0.0547 -0.1207 0.0759  350 TYR A OH  
2742 N N   . TRP A 371 ? 0.4041 0.2693 0.3023 -0.0522 -0.0940 0.0765  351 TRP A N   
2743 C CA  . TRP A 371 ? 0.4057 0.2719 0.2974 -0.0481 -0.0956 0.0740  351 TRP A CA  
2744 C C   . TRP A 371 ? 0.4400 0.2996 0.3387 -0.0453 -0.1022 0.0700  351 TRP A C   
2745 O O   . TRP A 371 ? 0.4786 0.3342 0.3845 -0.0449 -0.1074 0.0662  351 TRP A O   
2746 C CB  . TRP A 371 ? 0.4029 0.2767 0.2871 -0.0437 -0.0962 0.0698  351 TRP A CB  
2747 C CG  . TRP A 371 ? 0.3985 0.2789 0.2736 -0.0449 -0.0920 0.0740  351 TRP A CG  
2748 C CD1 . TRP A 371 ? 0.4060 0.2900 0.2782 -0.0473 -0.0895 0.0752  351 TRP A CD1 
2749 C CD2 . TRP A 371 ? 0.4302 0.3143 0.2985 -0.0436 -0.0913 0.0778  351 TRP A CD2 
2750 N NE1 . TRP A 371 ? 0.4110 0.2992 0.2750 -0.0479 -0.0881 0.0794  351 TRP A NE1 
2751 C CE2 . TRP A 371 ? 0.4418 0.3308 0.3037 -0.0460 -0.0893 0.0816  351 TRP A CE2 
2752 C CE3 . TRP A 371 ? 0.4279 0.3116 0.2952 -0.0408 -0.0925 0.0791  351 TRP A CE3 
2753 C CZ2 . TRP A 371 ? 0.4559 0.3491 0.3113 -0.0464 -0.0894 0.0874  351 TRP A CZ2 
2754 C CZ3 . TRP A 371 ? 0.4215 0.3109 0.2821 -0.0408 -0.0913 0.0851  351 TRP A CZ3 
2755 C CH2 . TRP A 371 ? 0.3992 0.2932 0.2544 -0.0439 -0.0902 0.0896  351 TRP A CH2 
2756 N N   . LEU A 372 ? 0.4859 0.3434 0.3825 -0.0432 -0.1027 0.0709  352 LEU A N   
2757 C CA  . LEU A 372 ? 0.4872 0.3373 0.3880 -0.0390 -0.1098 0.0662  352 LEU A CA  
2758 C C   . LEU A 372 ? 0.5256 0.3782 0.4191 -0.0308 -0.1138 0.0582  352 LEU A C   
2759 O O   . LEU A 372 ? 0.5447 0.4071 0.4294 -0.0280 -0.1099 0.0587  352 LEU A O   
2760 C CB  . LEU A 372 ? 0.4340 0.2827 0.3327 -0.0379 -0.1085 0.0695  352 LEU A CB  
2761 C CG  . LEU A 372 ? 0.4507 0.2960 0.3581 -0.0448 -0.1060 0.0768  352 LEU A CG  
2762 C CD1 . LEU A 372 ? 0.4258 0.2722 0.3291 -0.0441 -0.1031 0.0808  352 LEU A CD1 
2763 C CD2 . LEU A 372 ? 0.4331 0.2695 0.3546 -0.0466 -0.1132 0.0759  352 LEU A CD2 
2764 N N   . PRO A 373 ? 0.4852 0.3288 0.3821 -0.0266 -0.1223 0.0514  353 PRO A N   
2765 C CA  . PRO A 373 ? 0.4489 0.2933 0.3371 -0.0165 -0.1272 0.0430  353 PRO A CA  
2766 C C   . PRO A 373 ? 0.5005 0.3548 0.3772 -0.0090 -0.1228 0.0443  353 PRO A C   
2767 O O   . PRO A 373 ? 0.5086 0.3630 0.3846 -0.0098 -0.1198 0.0492  353 PRO A O   
2768 C CB  . PRO A 373 ? 0.4647 0.2937 0.3568 -0.0129 -0.1376 0.0372  353 PRO A CB  
2769 C CG  . PRO A 373 ? 0.4629 0.2850 0.3701 -0.0233 -0.1398 0.0421  353 PRO A CG  
2770 C CD  . PRO A 373 ? 0.5262 0.3580 0.4358 -0.0310 -0.1290 0.0519  353 PRO A CD  
2771 N N   . ASN A 374 ? 0.5228 0.3868 0.3915 -0.0019 -0.1223 0.0410  354 ASN A N   
2772 C CA  . ASN A 374 ? 0.5033 0.3797 0.3621 0.0064  -0.1186 0.0438  354 ASN A CA  
2773 C C   . ASN A 374 ? 0.4417 0.3271 0.3006 0.0000  -0.1111 0.0543  354 ASN A C   
2774 O O   . ASN A 374 ? 0.4636 0.3582 0.3164 0.0058  -0.1087 0.0589  354 ASN A O   
2775 C CB  . ASN A 374 ? 0.5759 0.4461 0.4283 0.0177  -0.1235 0.0392  354 ASN A CB  
2776 C CG  . ASN A 374 ? 0.6380 0.5219 0.4789 0.0314  -0.1226 0.0384  354 ASN A CG  
2777 O OD1 . ASN A 374 ? 0.6699 0.5646 0.5086 0.0337  -0.1214 0.0375  354 ASN A OD1 
2778 N ND2 . ASN A 374 ? 0.6341 0.5191 0.4678 0.0411  -0.1227 0.0396  354 ASN A ND2 
2779 N N   . PHE A 375 ? 0.4252 0.3079 0.2904 -0.0113 -0.1079 0.0584  355 PHE A N   
2780 C CA  . PHE A 375 ? 0.4291 0.3180 0.2929 -0.0179 -0.1020 0.0676  355 PHE A CA  
2781 C C   . PHE A 375 ? 0.4799 0.3663 0.3428 -0.0185 -0.1005 0.0729  355 PHE A C   
2782 O O   . PHE A 375 ? 0.5383 0.4326 0.3972 -0.0199 -0.0973 0.0805  355 PHE A O   
2783 C CB  . PHE A 375 ? 0.4097 0.3138 0.2677 -0.0148 -0.0998 0.0716  355 PHE A CB  
2784 C CG  . PHE A 375 ? 0.4790 0.3876 0.3382 -0.0150 -0.1004 0.0676  355 PHE A CG  
2785 C CD1 . PHE A 375 ? 0.5044 0.4170 0.3617 -0.0060 -0.1039 0.0608  355 PHE A CD1 
2786 C CD2 . PHE A 375 ? 0.4682 0.3766 0.3294 -0.0234 -0.0977 0.0706  355 PHE A CD2 
2787 C CE1 . PHE A 375 ? 0.4277 0.3451 0.2864 -0.0064 -0.1043 0.0576  355 PHE A CE1 
2788 C CE2 . PHE A 375 ? 0.4683 0.3811 0.3309 -0.0235 -0.0980 0.0674  355 PHE A CE2 
2789 C CZ  . PHE A 375 ? 0.4377 0.3556 0.2998 -0.0156 -0.1012 0.0611  355 PHE A CZ  
2790 N N   . MET A 376 ? 0.4607 0.3362 0.3282 -0.0177 -0.1037 0.0695  356 MET A N   
2791 C CA  . MET A 376 ? 0.5148 0.3882 0.3824 -0.0187 -0.1019 0.0748  356 MET A CA  
2792 C C   . MET A 376 ? 0.5236 0.3936 0.3958 -0.0294 -0.0980 0.0812  356 MET A C   
2793 O O   . MET A 376 ? 0.5117 0.3768 0.3896 -0.0349 -0.0980 0.0800  356 MET A O   
2794 C CB  . MET A 376 ? 0.5318 0.3951 0.4021 -0.0129 -0.1073 0.0693  356 MET A CB  
2795 C CG  . MET A 376 ? 0.5891 0.4398 0.4699 -0.0181 -0.1119 0.0654  356 MET A CG  
2796 S SD  . MET A 376 ? 0.7277 0.5641 0.6105 -0.0098 -0.1218 0.0571  356 MET A SD  
2797 C CE  . MET A 376 ? 0.5115 0.3562 0.3807 0.0023  -0.1193 0.0579  356 MET A CE  
2798 N N   . ASP A 377 ? 0.5170 0.3908 0.3857 -0.0317 -0.0945 0.0887  357 ASP A N   
2799 C CA  . ASP A 377 ? 0.4917 0.3617 0.3626 -0.0402 -0.0912 0.0949  357 ASP A CA  
2800 C C   . ASP A 377 ? 0.5244 0.3860 0.4042 -0.0416 -0.0924 0.0944  357 ASP A C   
2801 O O   . ASP A 377 ? 0.5617 0.4196 0.4444 -0.0361 -0.0963 0.0901  357 ASP A O   
2802 C CB  . ASP A 377 ? 0.4658 0.3419 0.3297 -0.0420 -0.0885 0.1033  357 ASP A CB  
2803 C CG  . ASP A 377 ? 0.5836 0.4629 0.4467 -0.0366 -0.0890 0.1056  357 ASP A CG  
2804 O OD1 . ASP A 377 ? 0.6351 0.5192 0.4961 -0.0279 -0.0911 0.1019  357 ASP A OD1 
2805 O OD2 . ASP A 377 ? 0.6862 0.5636 0.5502 -0.0402 -0.0871 0.1114  357 ASP A OD2 
2806 N N   . VAL A 378 ? 0.4347 0.2930 0.3185 -0.0484 -0.0896 0.0991  358 VAL A N   
2807 C CA  . VAL A 378 ? 0.4506 0.3027 0.3454 -0.0505 -0.0909 0.1001  358 VAL A CA  
2808 C C   . VAL A 378 ? 0.4674 0.3188 0.3629 -0.0485 -0.0913 0.1026  358 VAL A C   
2809 O O   . VAL A 378 ? 0.5026 0.3484 0.4078 -0.0484 -0.0944 0.1019  358 VAL A O   
2810 C CB  . VAL A 378 ? 0.4190 0.2706 0.3172 -0.0569 -0.0870 0.1059  358 VAL A CB  
2811 C CG1 . VAL A 378 ? 0.4139 0.2665 0.3101 -0.0578 -0.0862 0.1037  358 VAL A CG1 
2812 C CG2 . VAL A 378 ? 0.4693 0.3236 0.3584 -0.0595 -0.0827 0.1122  358 VAL A CG2 
2813 N N   . PHE A 379 ? 0.4891 0.3464 0.3752 -0.0471 -0.0887 0.1064  359 PHE A N   
2814 C CA  . PHE A 379 ? 0.4234 0.2814 0.3095 -0.0443 -0.0886 0.1095  359 PHE A CA  
2815 C C   . PHE A 379 ? 0.5161 0.3722 0.4019 -0.0350 -0.0933 0.1026  359 PHE A C   
2816 O O   . PHE A 379 ? 0.5717 0.4213 0.4637 -0.0326 -0.0963 0.1007  359 PHE A O   
2817 C CB  . PHE A 379 ? 0.4198 0.2860 0.2965 -0.0451 -0.0852 0.1169  359 PHE A CB  
2818 C CG  . PHE A 379 ? 0.4412 0.3069 0.3160 -0.0534 -0.0818 0.1240  359 PHE A CG  
2819 C CD1 . PHE A 379 ? 0.4353 0.2962 0.3175 -0.0578 -0.0802 0.1265  359 PHE A CD1 
2820 C CD2 . PHE A 379 ? 0.4385 0.3081 0.3039 -0.0562 -0.0809 0.1284  359 PHE A CD2 
2821 C CE1 . PHE A 379 ? 0.4457 0.3059 0.3241 -0.0638 -0.0772 0.1326  359 PHE A CE1 
2822 C CE2 . PHE A 379 ? 0.4125 0.2792 0.2737 -0.0628 -0.0791 0.1340  359 PHE A CE2 
2823 C CZ  . PHE A 379 ? 0.4188 0.2808 0.2856 -0.0660 -0.0769 0.1358  359 PHE A CZ  
2824 N N   . THR A 380 ? 0.5558 0.4174 0.4337 -0.0289 -0.0943 0.0991  360 THR A N   
2825 C CA  . THR A 380 ? 0.5802 0.4402 0.4548 -0.0179 -0.0989 0.0918  360 THR A CA  
2826 C C   . THR A 380 ? 0.5968 0.4437 0.4798 -0.0175 -0.1055 0.0836  360 THR A C   
2827 O O   . THR A 380 ? 0.6348 0.4742 0.5175 -0.0099 -0.1110 0.0782  360 THR A O   
2828 C CB  . THR A 380 ? 0.6161 0.4855 0.4821 -0.0120 -0.0987 0.0896  360 THR A CB  
2829 O OG1 . THR A 380 ? 0.6330 0.5151 0.4933 -0.0134 -0.0940 0.0990  360 THR A OG1 
2830 C CG2 . THR A 380 ? 0.6218 0.4902 0.4819 0.0015  -0.1033 0.0822  360 THR A CG2 
2831 N N   . TRP A 381 ? 0.5358 0.3796 0.4262 -0.0256 -0.1056 0.0835  361 TRP A N   
2832 C CA  . TRP A 381 ? 0.4677 0.3006 0.3683 -0.0270 -0.1124 0.0781  361 TRP A CA  
2833 C C   . TRP A 381 ? 0.5209 0.3457 0.4331 -0.0304 -0.1154 0.0811  361 TRP A C   
2834 O O   . TRP A 381 ? 0.5726 0.3863 0.4916 -0.0280 -0.1240 0.0760  361 TRP A O   
2835 C CB  . TRP A 381 ? 0.4511 0.2860 0.3570 -0.0346 -0.1104 0.0799  361 TRP A CB  
2836 C CG  . TRP A 381 ? 0.4692 0.2950 0.3874 -0.0371 -0.1174 0.0770  361 TRP A CG  
2837 C CD1 . TRP A 381 ? 0.4607 0.2763 0.3813 -0.0318 -0.1270 0.0694  361 TRP A CD1 
2838 C CD2 . TRP A 381 ? 0.4722 0.2982 0.4024 -0.0455 -0.1162 0.0827  361 TRP A CD2 
2839 N NE1 . TRP A 381 ? 0.5152 0.3242 0.4499 -0.0375 -0.1328 0.0706  361 TRP A NE1 
2840 C CE2 . TRP A 381 ? 0.4959 0.3126 0.4373 -0.0457 -0.1257 0.0794  361 TRP A CE2 
2841 C CE3 . TRP A 381 ? 0.4438 0.2769 0.3755 -0.0519 -0.1085 0.0908  361 TRP A CE3 
2842 C CZ2 . TRP A 381 ? 0.4699 0.2865 0.4261 -0.0528 -0.1273 0.0855  361 TRP A CZ2 
2843 C CZ3 . TRP A 381 ? 0.4666 0.2996 0.4111 -0.0573 -0.1091 0.0960  361 TRP A CZ3 
2844 C CH2 . TRP A 381 ? 0.4481 0.2741 0.4058 -0.0580 -0.1182 0.0942  361 TRP A CH2 
2845 N N   . SER A 382 ? 0.5224 0.3522 0.4369 -0.0362 -0.1091 0.0896  362 SER A N   
2846 C CA  . SER A 382 ? 0.5242 0.3491 0.4520 -0.0412 -0.1106 0.0945  362 SER A CA  
2847 C C   . SER A 382 ? 0.5790 0.4026 0.5047 -0.0371 -0.1106 0.0959  362 SER A C   
2848 O O   . SER A 382 ? 0.6222 0.4376 0.5578 -0.0369 -0.1162 0.0955  362 SER A O   
2849 C CB  . SER A 382 ? 0.4908 0.3225 0.4232 -0.0500 -0.1035 0.1035  362 SER A CB  
2850 O OG  . SER A 382 ? 0.4973 0.3368 0.4175 -0.0503 -0.0965 0.1075  362 SER A OG  
2851 N N   . LEU A 383 ? 0.5471 0.3791 0.4605 -0.0340 -0.1046 0.0986  363 LEU A N   
2852 C CA  . LEU A 383 ? 0.5544 0.3876 0.4645 -0.0298 -0.1032 0.1017  363 LEU A CA  
2853 C C   . LEU A 383 ? 0.5551 0.3771 0.4681 -0.0218 -0.1111 0.0952  363 LEU A C   
2854 O O   . LEU A 383 ? 0.5589 0.3774 0.4792 -0.0233 -0.1118 0.0988  363 LEU A O   
2855 C CB  . LEU A 383 ? 0.5635 0.4078 0.4594 -0.0251 -0.0979 0.1048  363 LEU A CB  
2856 C CG  . LEU A 383 ? 0.5380 0.3872 0.4301 -0.0214 -0.0947 0.1111  363 LEU A CG  
2857 C CD1 . LEU A 383 ? 0.4649 0.3129 0.3667 -0.0307 -0.0917 0.1184  363 LEU A CD1 
2858 C CD2 . LEU A 383 ? 0.5429 0.4054 0.4236 -0.0193 -0.0897 0.1174  363 LEU A CD2 
2859 N N   . PRO A 384 ? 0.6084 0.4239 0.5154 -0.0131 -0.1178 0.0855  364 PRO A N   
2860 C CA  . PRO A 384 ? 0.5701 0.3711 0.4783 -0.0050 -0.1277 0.0780  364 PRO A CA  
2861 C C   . PRO A 384 ? 0.5749 0.3651 0.5012 -0.0129 -0.1341 0.0796  364 PRO A C   
2862 O O   . PRO A 384 ? 0.6202 0.4014 0.5505 -0.0096 -0.1392 0.0789  364 PRO A O   
2863 C CB  . PRO A 384 ? 0.5845 0.3799 0.4856 0.0019  -0.1343 0.0678  364 PRO A CB  
2864 C CG  . PRO A 384 ? 0.6073 0.4180 0.4976 0.0030  -0.1259 0.0704  364 PRO A CG  
2865 C CD  . PRO A 384 ? 0.6400 0.4609 0.5371 -0.0093 -0.1171 0.0810  364 PRO A CD  
2866 N N   . PHE A 385 ? 0.5138 0.3055 0.4513 -0.0228 -0.1342 0.0825  365 PHE A N   
2867 C CA  . PHE A 385 ? 0.5045 0.2890 0.4616 -0.0308 -0.1405 0.0864  365 PHE A CA  
2868 C C   . PHE A 385 ? 0.5371 0.3282 0.5020 -0.0363 -0.1340 0.0962  365 PHE A C   
2869 O O   . PHE A 385 ? 0.5709 0.3545 0.5476 -0.0374 -0.1400 0.0982  365 PHE A O   
2870 C CB  . PHE A 385 ? 0.4975 0.2859 0.4639 -0.0391 -0.1401 0.0895  365 PHE A CB  
2871 C CG  . PHE A 385 ? 0.4832 0.2673 0.4718 -0.0472 -0.1465 0.0960  365 PHE A CG  
2872 C CD1 . PHE A 385 ? 0.5153 0.2844 0.5134 -0.0458 -0.1608 0.0912  365 PHE A CD1 
2873 C CD2 . PHE A 385 ? 0.4703 0.2657 0.4702 -0.0559 -0.1390 0.1076  365 PHE A CD2 
2874 C CE1 . PHE A 385 ? 0.5421 0.3086 0.5630 -0.0539 -0.1678 0.0994  365 PHE A CE1 
2875 C CE2 . PHE A 385 ? 0.4933 0.2879 0.5153 -0.0628 -0.1446 0.1157  365 PHE A CE2 
2876 C CZ  . PHE A 385 ? 0.5487 0.3294 0.5823 -0.0624 -0.1591 0.1123  365 PHE A CZ  
2877 N N   . VAL A 386 ? 0.5525 0.3571 0.5105 -0.0397 -0.1226 0.1025  366 VAL A N   
2878 C CA  . VAL A 386 ? 0.5395 0.3510 0.5020 -0.0445 -0.1159 0.1118  366 VAL A CA  
2879 C C   . VAL A 386 ? 0.6276 0.4335 0.5874 -0.0375 -0.1187 0.1099  366 VAL A C   
2880 O O   . VAL A 386 ? 0.6595 0.4612 0.6324 -0.0404 -0.1220 0.1138  366 VAL A O   
2881 C CB  . VAL A 386 ? 0.4645 0.2889 0.4152 -0.0473 -0.1049 0.1172  366 VAL A CB  
2882 C CG1 . VAL A 386 ? 0.4474 0.2780 0.3999 -0.0507 -0.0989 0.1260  366 VAL A CG1 
2883 C CG2 . VAL A 386 ? 0.4412 0.2704 0.3951 -0.0541 -0.1019 0.1201  366 VAL A CG2 
2884 N N   . GLY A 387 ? 0.5848 0.3912 0.5279 -0.0277 -0.1177 0.1046  367 GLY A N   
2885 C CA  . GLY A 387 ? 0.5727 0.3747 0.5100 -0.0186 -0.1195 0.1029  367 GLY A CA  
2886 C C   . GLY A 387 ? 0.5856 0.3708 0.5327 -0.0154 -0.1314 0.0972  367 GLY A C   
2887 O O   . GLY A 387 ? 0.6588 0.4405 0.6112 -0.0144 -0.1325 0.1003  367 GLY A O   
2888 N N   . GLU A 388 ? 0.5922 0.3664 0.5421 -0.0142 -0.1411 0.0893  368 GLU A N   
2889 C CA  . GLU A 388 ? 0.6031 0.3589 0.5626 -0.0116 -0.1550 0.0838  368 GLU A CA  
2890 C C   . GLU A 388 ? 0.6076 0.3630 0.5908 -0.0235 -0.1574 0.0931  368 GLU A C   
2891 O O   . GLU A 388 ? 0.6458 0.3904 0.6369 -0.0216 -0.1651 0.0929  368 GLU A O   
2892 C CB  . GLU A 388 ? 0.6083 0.3526 0.5657 -0.0087 -0.1656 0.0743  368 GLU A CB  
2893 C CG  . GLU A 388 ? 0.7662 0.4897 0.7356 -0.0083 -0.1826 0.0695  368 GLU A CG  
2894 C CD  . GLU A 388 ? 0.8580 0.5720 0.8294 -0.0092 -0.1929 0.0629  368 GLU A CD  
2895 O OE1 . GLU A 388 ? 0.8669 0.5855 0.8225 -0.0033 -0.1891 0.0567  368 GLU A OE1 
2896 O OE2 . GLU A 388 ? 0.8729 0.5760 0.8627 -0.0163 -0.2050 0.0650  368 GLU A OE2 
2897 N N   . LYS A 389 ? 0.6051 0.3728 0.5992 -0.0348 -0.1508 0.1017  369 LYS A N   
2898 C CA  . LYS A 389 ? 0.5871 0.3566 0.6052 -0.0454 -0.1535 0.1115  369 LYS A CA  
2899 C C   . LYS A 389 ? 0.5370 0.3162 0.5613 -0.0493 -0.1454 0.1212  369 LYS A C   
2900 O O   . LYS A 389 ? 0.5246 0.3009 0.5676 -0.0541 -0.1507 0.1273  369 LYS A O   
2901 C CB  . LYS A 389 ? 0.5954 0.3746 0.6222 -0.0540 -0.1501 0.1172  369 LYS A CB  
2902 C CG  . LYS A 389 ? 0.6331 0.4018 0.6616 -0.0528 -0.1608 0.1102  369 LYS A CG  
2903 C CD  . LYS A 389 ? 0.6873 0.4391 0.7311 -0.0526 -0.1774 0.1084  369 LYS A CD  
2904 C CE  . LYS A 389 ? 0.7206 0.4626 0.7710 -0.0542 -0.1894 0.1046  369 LYS A CE  
2905 N NZ  . LYS A 389 ? 0.7392 0.4684 0.8122 -0.0587 -0.2055 0.1086  369 LYS A NZ  
2906 N N   . VAL A 390 ? 0.5006 0.2915 0.5102 -0.0479 -0.1330 0.1235  370 VAL A N   
2907 C CA  . VAL A 390 ? 0.4735 0.2728 0.4870 -0.0511 -0.1256 0.1323  370 VAL A CA  
2908 C C   . VAL A 390 ? 0.4981 0.2871 0.5088 -0.0429 -0.1309 0.1282  370 VAL A C   
2909 O O   . VAL A 390 ? 0.5278 0.3167 0.5516 -0.0462 -0.1319 0.1344  370 VAL A O   
2910 C CB  . VAL A 390 ? 0.5206 0.3349 0.5203 -0.0532 -0.1120 0.1376  370 VAL A CB  
2911 C CG1 . VAL A 390 ? 0.4938 0.3153 0.4936 -0.0592 -0.1081 0.1397  370 VAL A CG1 
2912 C CG2 . VAL A 390 ? 0.5769 0.3910 0.5556 -0.0437 -0.1093 0.1317  370 VAL A CG2 
2913 N N   . THR A 391 ? 0.5024 0.2826 0.4958 -0.0314 -0.1347 0.1180  371 THR A N   
2914 C CA  . THR A 391 ? 0.5154 0.2849 0.5030 -0.0211 -0.1399 0.1133  371 THR A CA  
2915 C C   . THR A 391 ? 0.5296 0.2818 0.5334 -0.0220 -0.1546 0.1102  371 THR A C   
2916 O O   . THR A 391 ? 0.5636 0.3092 0.5729 -0.0194 -0.1583 0.1117  371 THR A O   
2917 C CB  . THR A 391 ? 0.5282 0.2926 0.4926 -0.0065 -0.1412 0.1030  371 THR A CB  
2918 O OG1 . THR A 391 ? 0.5619 0.3433 0.5133 -0.0068 -0.1288 0.1073  371 THR A OG1 
2919 C CG2 . THR A 391 ? 0.5446 0.3001 0.5003 0.0059  -0.1445 0.0997  371 THR A CG2 
2920 N N   . GLU A 392 ? 0.5650 0.3099 0.5774 -0.0260 -0.1635 0.1067  372 GLU A N   
2921 C CA  . GLU A 392 ? 0.6080 0.3365 0.6387 -0.0288 -0.1795 0.1055  372 GLU A CA  
2922 C C   . GLU A 392 ? 0.6219 0.3588 0.6771 -0.0401 -0.1777 0.1189  372 GLU A C   
2923 O O   . GLU A 392 ? 0.6020 0.3275 0.6697 -0.0399 -0.1877 0.1199  372 GLU A O   
2924 C CB  . GLU A 392 ? 0.6412 0.3647 0.6780 -0.0330 -0.1877 0.1024  372 GLU A CB  
2925 C CG  . GLU A 392 ? 0.7521 0.4605 0.8111 -0.0383 -0.2051 0.1039  372 GLU A CG  
2926 C CD  . GLU A 392 ? 0.8571 0.5612 0.9212 -0.0421 -0.2131 0.1015  372 GLU A CD  
2927 O OE1 . GLU A 392 ? 0.8647 0.5658 0.9088 -0.0348 -0.2118 0.0914  372 GLU A OE1 
2928 O OE2 . GLU A 392 ? 0.8886 0.5936 0.9774 -0.0525 -0.2207 0.1108  372 GLU A OE2 
2929 N N   . MET A 393 ? 0.5534 0.3102 0.6146 -0.0494 -0.1650 0.1291  373 MET A N   
2930 C CA  . MET A 393 ? 0.5498 0.3182 0.6334 -0.0596 -0.1615 0.1428  373 MET A CA  
2931 C C   . MET A 393 ? 0.5869 0.3563 0.6696 -0.0569 -0.1575 0.1458  373 MET A C   
2932 O O   . MET A 393 ? 0.5933 0.3600 0.6957 -0.0610 -0.1638 0.1521  373 MET A O   
2933 C CB  . MET A 393 ? 0.4955 0.2844 0.5789 -0.0671 -0.1476 0.1515  373 MET A CB  
2934 C CG  . MET A 393 ? 0.4675 0.2716 0.5662 -0.0750 -0.1398 0.1652  373 MET A CG  
2935 S SD  . MET A 393 ? 0.5367 0.3616 0.6312 -0.0814 -0.1251 0.1738  373 MET A SD  
2936 C CE  . MET A 393 ? 0.4353 0.2815 0.5453 -0.0859 -0.1158 0.1832  373 MET A CE  
2937 N N   . LEU A 394 ? 0.5608 0.3354 0.6218 -0.0503 -0.1471 0.1426  374 LEU A N   
2938 C CA  . LEU A 394 ? 0.5561 0.3331 0.6146 -0.0472 -0.1422 0.1463  374 LEU A CA  
2939 C C   . LEU A 394 ? 0.5776 0.3349 0.6373 -0.0386 -0.1551 0.1391  374 LEU A C   
2940 O O   . LEU A 394 ? 0.5524 0.3092 0.6224 -0.0397 -0.1557 0.1445  374 LEU A O   
2941 C CB  . LEU A 394 ? 0.5503 0.3369 0.5852 -0.0412 -0.1297 0.1452  374 LEU A CB  
2942 C CG  . LEU A 394 ? 0.5426 0.3480 0.5766 -0.0504 -0.1170 0.1542  374 LEU A CG  
2943 C CD1 . LEU A 394 ? 0.5591 0.3740 0.5752 -0.0463 -0.1064 0.1568  374 LEU A CD1 
2944 C CD2 . LEU A 394 ? 0.5186 0.3330 0.5749 -0.0614 -0.1149 0.1658  374 LEU A CD2 
2945 N N   . VAL A 395 ? 0.5395 0.2798 0.5877 -0.0294 -0.1657 0.1267  375 VAL A N   
2946 C CA  . VAL A 395 ? 0.5641 0.2822 0.6104 -0.0195 -0.1799 0.1183  375 VAL A CA  
2947 C C   . VAL A 395 ? 0.5738 0.2829 0.6488 -0.0288 -0.1934 0.1237  375 VAL A C   
2948 O O   . VAL A 395 ? 0.6052 0.3049 0.6884 -0.0266 -0.2000 0.1250  375 VAL A O   
2949 C CB  . VAL A 395 ? 0.5941 0.2955 0.6196 -0.0066 -0.1889 0.1033  375 VAL A CB  
2950 C CG1 . VAL A 395 ? 0.6129 0.2868 0.6405 0.0015  -0.2084 0.0942  375 VAL A CG1 
2951 C CG2 . VAL A 395 ? 0.5842 0.2939 0.5822 0.0058  -0.1770 0.0993  375 VAL A CG2 
2952 N N   . ASN A 396 ? 0.6560 0.3696 0.7474 -0.0394 -0.1971 0.1284  376 ASN A N   
2953 C CA  . ASN A 396 ? 0.6597 0.3696 0.7815 -0.0496 -0.2089 0.1371  376 ASN A CA  
2954 C C   . ASN A 396 ? 0.6439 0.3727 0.7841 -0.0579 -0.1994 0.1506  376 ASN A C   
2955 O O   . ASN A 396 ? 0.6877 0.4168 0.8465 -0.0606 -0.2070 0.1525  376 ASN A O   
2956 C CB  . ASN A 396 ? 0.6698 0.3854 0.8043 -0.0582 -0.2127 0.1405  376 ASN A CB  
2957 C CG  . ASN A 396 ? 0.7443 0.4376 0.8674 -0.0511 -0.2274 0.1275  376 ASN A CG  
2958 O OD1 . ASN A 396 ? 0.7431 0.4205 0.8743 -0.0490 -0.2442 0.1216  376 ASN A OD1 
2959 N ND2 . ASN A 396 ? 0.8125 0.5106 0.9150 -0.0467 -0.2194 0.1204  376 ASN A ND2 
2960 N N   . VAL A 397 ? 0.5238 0.2725 0.6572 -0.0615 -0.1818 0.1581  377 VAL A N   
2961 C CA  . VAL A 397 ? 0.5076 0.2773 0.6541 -0.0677 -0.1705 0.1685  377 VAL A CA  
2962 C C   . VAL A 397 ? 0.5189 0.2772 0.6608 -0.0609 -0.1729 0.1671  377 VAL A C   
2963 O O   . VAL A 397 ? 0.5177 0.2826 0.6784 -0.0646 -0.1752 0.1713  377 VAL A O   
2964 C CB  . VAL A 397 ? 0.4862 0.2776 0.6222 -0.0716 -0.1518 0.1752  377 VAL A CB  
2965 C CG1 . VAL A 397 ? 0.4738 0.2829 0.6163 -0.0747 -0.1407 0.1827  377 VAL A CG1 
2966 C CG2 . VAL A 397 ? 0.4728 0.2810 0.6182 -0.0788 -0.1477 0.1788  377 VAL A CG2 
2967 N N   . LEU A 398 ? 0.5383 0.2872 0.6534 -0.0492 -0.1698 0.1580  378 LEU A N   
2968 C CA  . LEU A 398 ? 0.5522 0.2952 0.6587 -0.0407 -0.1684 0.1563  378 LEU A CA  
2969 C C   . LEU A 398 ? 0.6437 0.3619 0.7578 -0.0346 -0.1869 0.1497  378 LEU A C   
2970 O O   . LEU A 398 ? 0.6805 0.3929 0.7936 -0.0289 -0.1878 0.1501  378 LEU A O   
2971 C CB  . LEU A 398 ? 0.5427 0.2864 0.6178 -0.0282 -0.1595 0.1483  378 LEU A CB  
2972 C CG  . LEU A 398 ? 0.5201 0.2873 0.5866 -0.0337 -0.1415 0.1562  378 LEU A CG  
2973 C CD1 . LEU A 398 ? 0.5264 0.2930 0.5643 -0.0216 -0.1363 0.1480  378 LEU A CD1 
2974 C CD2 . LEU A 398 ? 0.5083 0.2890 0.5829 -0.0385 -0.1317 0.1679  378 LEU A CD2 
2975 N N   . SER A 399 ? 0.8271 0.5080 0.7887 0.0597  -0.1740 -0.0641 379 SER A N   
2976 C CA  . SER A 399 ? 0.8613 0.4913 0.7804 0.0701  -0.1806 -0.0673 379 SER A CA  
2977 C C   . SER A 399 ? 0.8935 0.5081 0.8047 0.0528  -0.1945 -0.0697 379 SER A C   
2978 O O   . SER A 399 ? 0.9335 0.5033 0.8075 0.0552  -0.2028 -0.0740 379 SER A O   
2979 C CB  . SER A 399 ? 0.8445 0.4462 0.7390 0.0703  -0.1842 -0.0767 379 SER A CB  
2980 O OG  . SER A 399 ? 0.8348 0.4437 0.7398 0.0451  -0.1953 -0.0844 379 SER A OG  
2981 N N   . ILE A 400 ? 0.8809 0.5314 0.8249 0.0342  -0.1970 -0.0670 380 ILE A N   
2982 C CA  . ILE A 400 ? 0.8906 0.5308 0.8297 0.0163  -0.2099 -0.0685 380 ILE A CA  
2983 C C   . ILE A 400 ? 0.9399 0.5495 0.8526 0.0330  -0.2108 -0.0616 380 ILE A C   
2984 O O   . ILE A 400 ? 1.0372 0.6094 0.9206 0.0268  -0.2223 -0.0656 380 ILE A O   
2985 C CB  . ILE A 400 ? 0.7751 0.4618 0.7552 -0.0065 -0.2107 -0.0662 380 ILE A CB  
2986 C CG1 . ILE A 400 ? 0.8053 0.4795 0.7782 -0.0287 -0.2255 -0.0702 380 ILE A CG1 
2987 C CG2 . ILE A 400 ? 0.7422 0.4625 0.7467 0.0035  -0.1999 -0.0535 380 ILE A CG2 
2988 C CD1 . ILE A 400 ? 0.8567 0.5046 0.8091 -0.0422 -0.2368 -0.0819 380 ILE A CD1 
2989 N N   . CYS A 401 ? 0.8459 0.4715 0.7685 0.0543  -0.1985 -0.0509 381 CYS A N   
2990 C CA  . CYS A 401 ? 0.9113 0.5065 0.8078 0.0768  -0.1963 -0.0436 381 CYS A CA  
2991 C C   . CYS A 401 ? 1.0936 0.6545 0.9582 0.1012  -0.1886 -0.0468 381 CYS A C   
2992 O O   . CYS A 401 ? 1.1375 0.7179 1.0147 0.1074  -0.1793 -0.0480 381 CYS A O   
2993 C CB  . CYS A 401 ? 0.8492 0.4833 0.7746 0.0879  -0.1866 -0.0290 381 CYS A CB  
2994 S SG  . CYS A 401 ? 0.8806 0.5564 0.8426 0.0588  -0.1947 -0.0241 381 CYS A SG  
2995 N N   . SER A 402 ? 1.3232 0.8314 1.1451 0.1140  -0.1923 -0.0484 382 SER A N   
2996 C CA  . SER A 402 ? 1.4364 0.9070 1.2233 0.1368  -0.1846 -0.0518 382 SER A CA  
2997 C C   . SER A 402 ? 1.5171 0.9614 1.2816 0.1661  -0.1762 -0.0429 382 SER A C   
2998 O O   . SER A 402 ? 1.5599 0.9497 1.2812 0.1725  -0.1814 -0.0463 382 SER A O   
2999 C CB  . SER A 402 ? 1.5115 0.9350 1.2596 0.1238  -0.1963 -0.0646 382 SER A CB  
3000 O OG  . SER A 402 ? 1.5845 0.9737 1.2992 0.1436  -0.1886 -0.0684 382 SER A OG  
3001 N N   . ASP A 403 ? 1.4732 0.9567 1.2666 0.1836  -0.1629 -0.0312 383 ASP A N   
3002 C CA  . ASP A 403 ? 1.5084 0.9785 1.2897 0.2130  -0.1534 -0.0202 383 ASP A CA  
3003 C C   . ASP A 403 ? 1.5234 0.9716 1.2931 0.2074  -0.1640 -0.0159 383 ASP A C   
3004 O O   . ASP A 403 ? 1.5411 0.9468 1.2778 0.2285  -0.1615 -0.0124 383 ASP A O   
3005 C CB  . ASP A 403 ? 1.5713 0.9953 1.3110 0.2393  -0.1435 -0.0244 383 ASP A CB  
3006 C CG  . ASP A 403 ? 1.5673 1.0140 1.3187 0.2424  -0.1340 -0.0286 383 ASP A CG  
3007 O OD1 . ASP A 403 ? 1.4788 0.9488 1.2498 0.2180  -0.1409 -0.0355 383 ASP A OD1 
3008 O OD2 . ASP A 403 ? 1.6187 1.0606 1.3600 0.2693  -0.1194 -0.0247 383 ASP A OD2 
3009 N N   . ASP A 404 ? 1.7276 1.2037 1.5236 0.1781  -0.1759 -0.0168 384 ASP A N   
3010 C CA  . ASP A 404 ? 1.7230 1.2032 1.5266 0.1708  -0.1840 -0.0083 384 ASP A CA  
3011 C C   . ASP A 404 ? 1.6851 1.2270 1.5350 0.1781  -0.1740 0.0066  384 ASP A C   
3012 O O   . ASP A 404 ? 1.6632 1.2311 1.5357 0.1665  -0.1795 0.0154  384 ASP A O   
3013 C CB  . ASP A 404 ? 1.6872 1.1722 1.4987 0.1342  -0.2008 -0.0165 384 ASP A CB  
3014 C CG  . ASP A 404 ? 1.6962 1.1621 1.4916 0.1177  -0.2071 -0.0321 384 ASP A CG  
3015 O OD1 . ASP A 404 ? 1.7443 1.1720 1.5062 0.1334  -0.2026 -0.0380 384 ASP A OD1 
3016 O OD2 . ASP A 404 ? 1.6541 1.1439 1.4704 0.0887  -0.2163 -0.0382 384 ASP A OD2 
3017 N N   . GLU A 405 ? 1.3999 0.9656 1.2627 0.1955  -0.1594 0.0094  385 GLU A N   
3018 C CA  . GLU A 405 ? 1.3536 0.9789 1.2579 0.2033  -0.1484 0.0236  385 GLU A CA  
3019 C C   . GLU A 405 ? 1.4328 1.0496 1.3265 0.2396  -0.1361 0.0366  385 GLU A C   
3020 O O   . GLU A 405 ? 1.4414 1.1041 1.3640 0.2528  -0.1242 0.0491  385 GLU A O   
3021 C CB  . GLU A 405 ? 1.2686 0.9283 1.1948 0.1979  -0.1401 0.0189  385 GLU A CB  
3022 C CG  . GLU A 405 ? 1.2280 0.9100 1.1756 0.1628  -0.1499 0.0096  385 GLU A CG  
3023 C CD  . GLU A 405 ? 1.2225 0.9073 1.1703 0.1589  -0.1453 -0.0010 385 GLU A CD  
3024 O OE1 . GLU A 405 ? 1.2747 0.9440 1.2051 0.1825  -0.1349 -0.0012 385 GLU A OE1 
3025 O OE2 . GLU A 405 ? 1.1638 0.8661 1.1288 0.1327  -0.1518 -0.0088 385 GLU A OE2 
3026 N N   . LEU A 406 ? 1.5158 1.0732 1.3667 0.2556  -0.1387 0.0338  386 LEU A N   
3027 C CA  . LEU A 406 ? 1.4625 1.0049 1.2995 0.2915  -0.1274 0.0461  386 LEU A CA  
3028 C C   . LEU A 406 ? 1.4042 0.9572 1.2536 0.2914  -0.1337 0.0603  386 LEU A C   
3029 O O   . LEU A 406 ? 1.3642 0.8895 1.1988 0.2726  -0.1486 0.0557  386 LEU A O   
3030 C CB  . LEU A 406 ? 1.4993 0.9680 1.2803 0.3109  -0.1252 0.0362  386 LEU A CB  
3031 C CG  . LEU A 406 ? 1.4852 0.9401 1.2486 0.3281  -0.1122 0.0284  386 LEU A CG  
3032 C CD1 . LEU A 406 ? 1.4189 0.8747 1.1823 0.3007  -0.1197 0.0126  386 LEU A CD1 
3033 C CD2 . LEU A 406 ? 1.5188 0.9040 1.2281 0.3558  -0.1061 0.0248  386 LEU A CD2 
3034 N N   . ALA A 436 ? 0.9426 0.6767 0.9748 -0.0035 -0.2032 -0.1067 416 ALA A N   
3035 C CA  . ALA A 436 ? 0.9504 0.6817 0.9791 -0.0148 -0.2178 -0.1078 416 ALA A CA  
3036 C C   . ALA A 436 ? 0.9307 0.6803 0.9817 -0.0310 -0.2237 -0.1112 416 ALA A C   
3037 O O   . ALA A 436 ? 0.9364 0.6872 0.9859 -0.0416 -0.2362 -0.1117 416 ALA A O   
3038 C CB  . ALA A 436 ? 0.9478 0.6881 0.9867 -0.0121 -0.2187 -0.1036 416 ALA A CB  
3039 N N   . ARG A 437 ? 1.8156 1.5803 1.8862 -0.0337 -0.2150 -0.1130 417 ARG A N   
3040 C CA  . ARG A 437 ? 1.7934 1.5789 1.8889 -0.0492 -0.2177 -0.1164 417 ARG A CA  
3041 C C   . ARG A 437 ? 1.7668 1.5807 1.8982 -0.0535 -0.2119 -0.1158 417 ARG A C   
3042 O O   . ARG A 437 ? 1.7445 1.5791 1.9005 -0.0638 -0.2078 -0.1182 417 ARG A O   
3043 C CB  . ARG A 437 ? 1.6825 1.4589 1.7594 -0.0604 -0.2304 -0.1173 417 ARG A CB  
3044 C CG  . ARG A 437 ? 1.6648 1.4711 1.7617 -0.0722 -0.2286 -0.1141 417 ARG A CG  
3045 C CD  . ARG A 437 ? 1.6408 1.4723 1.7555 -0.0802 -0.2161 -0.1132 417 ARG A CD  
3046 N NE  . ARG A 437 ? 1.6206 1.4812 1.7607 -0.0876 -0.2106 -0.1117 417 ARG A NE  
3047 C CZ  . ARG A 437 ? 1.6241 1.4955 1.7606 -0.0964 -0.2138 -0.1095 417 ARG A CZ  
3048 N NH1 . ARG A 437 ? 1.6069 1.5038 1.7673 -0.1016 -0.2085 -0.1087 417 ARG A NH1 
3049 N NH2 . ARG A 437 ? 1.6464 1.5027 1.7551 -0.1002 -0.2220 -0.1082 417 ARG A NH2 
3050 N N   . TYR A 438 ? 1.7761 1.5898 1.9086 -0.0450 -0.2103 -0.1120 418 TYR A N   
3051 C CA  . TYR A 438 ? 1.7551 1.5905 1.9180 -0.0439 -0.2009 -0.1103 418 TYR A CA  
3052 C C   . TYR A 438 ? 1.7626 1.5905 1.9186 -0.0294 -0.1932 -0.1056 418 TYR A C   
3053 O O   . TYR A 438 ? 1.7856 1.5945 1.9161 -0.0218 -0.1993 -0.1029 418 TYR A O   
3054 C CB  . TYR A 438 ? 1.6231 1.4732 1.8032 -0.0520 -0.2092 -0.1100 418 TYR A CB  
3055 C CG  . TYR A 438 ? 1.5991 1.4726 1.8087 -0.0646 -0.2056 -0.1142 418 TYR A CG  
3056 C CD1 . TYR A 438 ? 1.5846 1.4641 1.8016 -0.0693 -0.1958 -0.1174 418 TYR A CD1 
3057 C CD2 . TYR A 438 ? 1.5918 1.4831 1.8215 -0.0716 -0.2109 -0.1140 418 TYR A CD2 
3058 C CE1 . TYR A 438 ? 1.5662 1.4701 1.7989 -0.0777 -0.1845 -0.1163 418 TYR A CE1 
3059 C CE2 . TYR A 438 ? 1.5731 1.4884 1.8210 -0.0793 -0.1997 -0.1140 418 TYR A CE2 
3060 C CZ  . TYR A 438 ? 1.5613 1.4816 1.8080 -0.0824 -0.1859 -0.1150 418 TYR A CZ  
3061 O OH  . TYR A 438 ? 1.5463 1.4878 1.8048 -0.0903 -0.1740 -0.1145 418 TYR A OH  
3062 N N   . LEU A 439 ? 0.8583 0.7004 1.0354 -0.0267 -0.1794 -0.1047 419 LEU A N   
3063 C CA  . LEU A 439 ? 0.8544 0.6930 1.0296 -0.0152 -0.1713 -0.1000 419 LEU A CA  
3064 C C   . LEU A 439 ? 0.9850 0.8236 1.1629 -0.0136 -0.1800 -0.0967 419 LEU A C   
3065 O O   . LEU A 439 ? 1.0418 0.8904 1.2322 -0.0222 -0.1882 -0.0981 419 LEU A O   
3066 C CB  . LEU A 439 ? 0.7268 0.5819 0.9263 -0.0169 -0.1559 -0.1002 419 LEU A CB  
3067 C CG  . LEU A 439 ? 0.6161 0.4709 0.8170 -0.0081 -0.1436 -0.0960 419 LEU A CG  
3068 C CD1 . LEU A 439 ? 0.5440 0.3819 0.7172 0.0033  -0.1441 -0.0927 419 LEU A CD1 
3069 C CD2 . LEU A 439 ? 0.6320 0.5003 0.8486 -0.0142 -0.1299 -0.0976 419 LEU A CD2 
3070 N N   . SER A 440 ? 0.9695 0.7979 1.1356 -0.0032 -0.1789 -0.0918 420 SER A N   
3071 C CA  . SER A 440 ? 0.9564 0.7865 1.1262 -0.0013 -0.1871 -0.0871 420 SER A CA  
3072 C C   . SER A 440 ? 1.0003 0.8261 1.1689 0.0094  -0.1796 -0.0816 420 SER A C   
3073 O O   . SER A 440 ? 0.9819 0.7945 1.1310 0.0168  -0.1744 -0.0806 420 SER A O   
3074 C CB  . SER A 440 ? 0.9123 0.7275 1.0559 -0.0034 -0.2033 -0.0861 420 SER A CB  
3075 O OG  . SER A 440 ? 0.9167 0.7415 1.0709 -0.0060 -0.2128 -0.0815 420 SER A OG  
3076 N N   . VAL A 441 ? 1.0931 0.9305 1.2827 0.0104  -0.1791 -0.0777 421 VAL A N   
3077 C CA  . VAL A 441 ? 1.0844 0.9173 1.2736 0.0199  -0.1739 -0.0715 421 VAL A CA  
3078 C C   . VAL A 441 ? 1.2295 1.0427 1.3862 0.0263  -0.1810 -0.0680 421 VAL A C   
3079 O O   . VAL A 441 ? 1.2528 1.0591 1.3941 0.0234  -0.1948 -0.0670 421 VAL A O   
3080 C CB  . VAL A 441 ? 0.9030 0.7478 1.1133 0.0209  -0.1784 -0.0662 421 VAL A CB  
3081 C CG1 . VAL A 441 ? 0.8279 0.6679 1.0405 0.0305  -0.1706 -0.0600 421 VAL A CG1 
3082 C CG2 . VAL A 441 ? 0.8086 0.6729 1.0491 0.0135  -0.1738 -0.0705 421 VAL A CG2 
3083 N N   . LEU A 442 ? 1.2877 1.0915 1.4328 0.0339  -0.1714 -0.0663 422 LEU A N   
3084 C CA  . LEU A 442 ? 1.3156 1.1000 1.4286 0.0404  -0.1756 -0.0635 422 LEU A CA  
3085 C C   . LEU A 442 ? 1.3757 1.1544 1.4802 0.0419  -0.1884 -0.0568 422 LEU A C   
3086 O O   . LEU A 442 ? 1.3996 1.1612 1.4759 0.0458  -0.1934 -0.0543 422 LEU A O   
3087 C CB  . LEU A 442 ? 1.2502 1.0303 1.3571 0.0478  -0.1619 -0.0618 422 LEU A CB  
3088 C CG  . LEU A 442 ? 1.1941 0.9578 1.2697 0.0537  -0.1599 -0.0628 422 LEU A CG  
3089 C CD1 . LEU A 442 ? 1.1655 0.9331 1.2414 0.0515  -0.1534 -0.0687 422 LEU A CD1 
3090 C CD2 . LEU A 442 ? 1.1432 0.9019 1.2096 0.0613  -0.1509 -0.0581 422 LEU A CD2 
3091 N N   . SER A 498 ? 1.0781 1.1578 1.3844 0.0222  -0.3878 0.1304  478 SER A N   
3092 C CA  . SER A 498 ? 1.1184 1.1708 1.4270 0.0369  -0.3669 0.1190  478 SER A CA  
3093 C C   . SER A 498 ? 1.2465 1.2704 1.5322 0.0450  -0.3651 0.1243  478 SER A C   
3094 O O   . SER A 498 ? 1.2517 1.2419 1.5108 0.0449  -0.3557 0.1120  478 SER A O   
3095 C CB  . SER A 498 ? 1.0442 1.1183 1.4000 0.0529  -0.3513 0.1188  478 SER A CB  
3096 O OG  . SER A 498 ? 1.0108 1.1099 1.3951 0.0655  -0.3553 0.1374  478 SER A OG  
3097 N N   . PHE A 499 ? 1.3188 1.3570 1.6147 0.0515  -0.3742 0.1428  479 PHE A N   
3098 C CA  . PHE A 499 ? 1.3329 1.3453 1.6073 0.0583  -0.3735 0.1490  479 PHE A CA  
3099 C C   . PHE A 499 ? 1.3705 1.3594 1.5956 0.0417  -0.3869 0.1479  479 PHE A C   
3100 O O   . PHE A 499 ? 1.3645 1.3190 1.5598 0.0425  -0.3793 0.1390  479 PHE A O   
3101 C CB  . PHE A 499 ? 1.3164 1.3502 1.6175 0.0714  -0.3785 0.1699  479 PHE A CB  
3102 C CG  . PHE A 499 ? 1.2690 1.2751 1.5538 0.0813  -0.3735 0.1748  479 PHE A CG  
3103 C CD1 . PHE A 499 ? 1.2795 1.2716 1.5294 0.0718  -0.3877 0.1832  479 PHE A CD1 
3104 C CD2 . PHE A 499 ? 1.1472 1.1402 1.4497 0.0989  -0.3544 0.1709  479 PHE A CD2 
3105 C CE1 . PHE A 499 ? 1.2478 1.2147 1.4818 0.0799  -0.3831 0.1876  479 PHE A CE1 
3106 C CE2 . PHE A 499 ? 1.1030 1.0702 1.3889 0.1067  -0.3501 0.1755  479 PHE A CE2 
3107 C CZ  . PHE A 499 ? 1.1560 1.1111 1.4084 0.0973  -0.3646 0.1839  479 PHE A CZ  
3108 N N   . GLU A 500 ? 1.4189 1.4263 1.6345 0.0263  -0.4064 0.1570  480 GLU A N   
3109 C CA  . GLU A 500 ? 1.4037 1.3878 1.5700 0.0088  -0.4195 0.1560  480 GLU A CA  
3110 C C   . GLU A 500 ? 1.3753 1.3310 1.5124 -0.0002 -0.4122 0.1350  480 GLU A C   
3111 O O   . GLU A 500 ? 1.3338 1.2556 1.4285 -0.0067 -0.4125 0.1284  480 GLU A O   
3112 C CB  . GLU A 500 ? 1.3770 1.3894 1.5405 -0.0073 -0.4423 0.1711  480 GLU A CB  
3113 C CG  . GLU A 500 ? 1.4140 1.4189 1.5506 -0.0140 -0.4570 0.1864  480 GLU A CG  
3114 C CD  . GLU A 500 ? 1.4604 1.4632 1.6148 0.0052  -0.4496 0.1967  480 GLU A CD  
3115 O OE1 . GLU A 500 ? 1.4614 1.4902 1.6611 0.0216  -0.4426 0.2038  480 GLU A OE1 
3116 O OE2 . GLU A 500 ? 1.4792 1.4529 1.6010 0.0038  -0.4503 0.1975  480 GLU A OE2 
3117 N N   . GLU A 501 ? 1.3542 1.3240 1.5146 0.0001  -0.4049 0.1251  481 GLU A N   
3118 C CA  . GLU A 501 ? 1.3750 1.3219 1.5129 -0.0078 -0.3980 0.1062  481 GLU A CA  
3119 C C   . GLU A 501 ? 1.3545 1.2701 1.4831 0.0044  -0.3785 0.0929  481 GLU A C   
3120 O O   . GLU A 501 ? 1.3330 1.2185 1.4265 -0.0017 -0.3752 0.0809  481 GLU A O   
3121 C CB  . GLU A 501 ? 1.3660 1.3401 1.5342 -0.0114 -0.3963 0.1007  481 GLU A CB  
3122 C CG  . GLU A 501 ? 1.3671 1.3248 1.5073 -0.0270 -0.3988 0.0862  481 GLU A CG  
3123 C CD  . GLU A 501 ? 1.3286 1.3135 1.5005 -0.0301 -0.3959 0.0806  481 GLU A CD  
3124 O OE1 . GLU A 501 ? 1.3071 1.2807 1.4599 -0.0426 -0.3976 0.0690  481 GLU A OE1 
3125 O OE2 . GLU A 501 ? 1.3140 1.3309 1.5295 -0.0198 -0.3916 0.0879  481 GLU A OE2 
3126 N N   . ALA A 502 ? 1.3306 1.2533 1.4902 0.0214  -0.3652 0.0956  482 ALA A N   
3127 C CA  . ALA A 502 ? 1.3177 1.2145 1.4711 0.0322  -0.3465 0.0843  482 ALA A CA  
3128 C C   . ALA A 502 ? 1.3523 1.2242 1.4776 0.0361  -0.3467 0.0896  482 ALA A C   
3129 O O   . ALA A 502 ? 1.3447 1.1930 1.4571 0.0426  -0.3328 0.0807  482 ALA A O   
3130 C CB  . ALA A 502 ? 1.2851 1.1974 1.4809 0.0468  -0.3310 0.0834  482 ALA A CB  
3131 N N   . LYS A 503 ? 1.3698 1.2488 1.4858 0.0314  -0.3626 0.1046  483 LYS A N   
3132 C CA  . LYS A 503 ? 1.3493 1.2069 1.4384 0.0335  -0.3649 0.1114  483 LYS A CA  
3133 C C   . LYS A 503 ? 1.3805 1.2090 1.4189 0.0199  -0.3709 0.1038  483 LYS A C   
3134 O O   . LYS A 503 ? 1.3503 1.1525 1.3607 0.0223  -0.3660 0.1018  483 LYS A O   
3135 C CB  . LYS A 503 ? 1.3301 1.2097 1.4332 0.0344  -0.3795 0.1322  483 LYS A CB  
3136 C CG  . LYS A 503 ? 1.3205 1.1813 1.3994 0.0366  -0.3830 0.1416  483 LYS A CG  
3137 C CD  . LYS A 503 ? 1.2795 1.1667 1.3800 0.0394  -0.3966 0.1635  483 LYS A CD  
3138 C CE  . LYS A 503 ? 1.2684 1.1394 1.3353 0.0331  -0.4078 0.1744  483 LYS A CE  
3139 N NZ  . LYS A 503 ? 1.2868 1.1864 1.3744 0.0342  -0.4232 0.1972  483 LYS A NZ  
3140 N N   . GLY A 504 ? 1.5097 1.3422 1.5356 0.0057  -0.3810 0.0996  484 GLY A N   
3141 C CA  . GLY A 504 ? 1.5059 1.3091 1.4827 -0.0077 -0.3865 0.0916  484 GLY A CA  
3142 C C   . GLY A 504 ? 1.5083 1.2883 1.4720 -0.0044 -0.3710 0.0729  484 GLY A C   
3143 O O   . GLY A 504 ? 1.5648 1.3141 1.4869 -0.0098 -0.3698 0.0650  484 GLY A O   
3144 N N   . LEU A 505 ? 1.3785 1.1735 1.3774 0.0043  -0.3589 0.0660  485 LEU A N   
3145 C CA  . LEU A 505 ? 1.3386 1.1159 1.3309 0.0087  -0.3432 0.0496  485 LEU A CA  
3146 C C   . LEU A 505 ? 1.3415 1.1047 1.3344 0.0226  -0.3270 0.0470  485 LEU A C   
3147 O O   . LEU A 505 ? 1.3135 1.0644 1.3032 0.0277  -0.3125 0.0349  485 LEU A O   
3148 C CB  . LEU A 505 ? 1.2474 1.0473 1.2759 0.0099  -0.3375 0.0434  485 LEU A CB  
3149 C CG  . LEU A 505 ? 1.1863 0.9964 1.2112 -0.0048 -0.3498 0.0409  485 LEU A CG  
3150 C CD1 . LEU A 505 ? 1.1306 0.9662 1.1965 -0.0018 -0.3424 0.0360  485 LEU A CD1 
3151 C CD2 . LEU A 505 ? 1.1766 0.9548 1.1567 -0.0141 -0.3511 0.0296  485 LEU A CD2 
3152 N N   . ASP A 506 ? 1.4024 1.1684 1.3989 0.0279  -0.3298 0.0590  486 ASP A N   
3153 C CA  . ASP A 506 ? 1.3882 1.1441 1.3888 0.0405  -0.3153 0.0585  486 ASP A CA  
3154 C C   . ASP A 506 ? 1.4126 1.1498 1.3818 0.0398  -0.3202 0.0660  486 ASP A C   
3155 O O   . ASP A 506 ? 1.4055 1.1347 1.3761 0.0489  -0.3100 0.0677  486 ASP A O   
3156 C CB  . ASP A 506 ? 1.3618 1.1415 1.4074 0.0511  -0.3095 0.0657  486 ASP A CB  
3157 C CG  . ASP A 506 ? 1.3457 1.1147 1.3980 0.0629  -0.2918 0.0621  486 ASP A CG  
3158 O OD1 . ASP A 506 ? 1.3153 1.0732 1.3606 0.0640  -0.2788 0.0492  486 ASP A OD1 
3159 O OD2 . ASP A 506 ? 1.3548 1.1265 1.4179 0.0704  -0.2912 0.0728  486 ASP A OD2 
3160 N N   . ARG A 507 ? 1.4924 1.2217 1.4316 0.0276  -0.3357 0.0705  487 ARG A N   
3161 C CA  . ARG A 507 ? 1.5475 1.2586 1.4543 0.0248  -0.3413 0.0778  487 ARG A CA  
3162 C C   . ARG A 507 ? 1.6217 1.3035 1.4976 0.0291  -0.3272 0.0667  487 ARG A C   
3163 O O   . ARG A 507 ? 1.6440 1.3146 1.5066 0.0330  -0.3242 0.0718  487 ARG A O   
3164 C CB  . ARG A 507 ? 1.5133 1.2213 1.3917 0.0086  -0.3610 0.0846  487 ARG A CB  
3165 C CG  . ARG A 507 ? 1.4966 1.2215 1.3846 0.0060  -0.3758 0.1039  487 ARG A CG  
3166 C CD  . ARG A 507 ? 1.5165 1.2333 1.3675 -0.0123 -0.3947 0.1107  487 ARG A CD  
3167 N NE  . ARG A 507 ? 1.5023 1.2256 1.3492 -0.0245 -0.4033 0.1056  487 ARG A NE  
3168 C CZ  . ARG A 507 ? 1.4796 1.2353 1.3562 -0.0294 -0.4149 0.1148  487 ARG A CZ  
3169 N NH1 . ARG A 507 ? 1.4637 1.2488 1.3780 -0.0213 -0.4189 0.1299  487 ARG A NH1 
3170 N NH2 . ARG A 507 ? 1.4771 1.2361 1.3457 -0.0420 -0.4222 0.1092  487 ARG A NH2 
3171 N N   . ILE A 508 ? 1.6180 1.2890 1.4839 0.0288  -0.3184 0.0523  488 ILE A N   
3172 C CA  . ILE A 508 ? 1.6000 1.2467 1.4397 0.0341  -0.3038 0.0415  488 ILE A CA  
3173 C C   . ILE A 508 ? 1.5449 1.1976 1.4076 0.0471  -0.2879 0.0415  488 ILE A C   
3174 O O   . ILE A 508 ? 1.5482 1.1843 1.3897 0.0515  -0.2778 0.0380  488 ILE A O   
3175 C CB  . ILE A 508 ? 1.0261 0.6625 0.8540 0.0319  -0.2981 0.0271  488 ILE A CB  
3176 C CG1 . ILE A 508 ? 1.0523 0.6610 0.8441 0.0360  -0.2861 0.0176  488 ILE A CG1 
3177 C CG2 . ILE A 508 ? 0.9900 0.6477 0.8591 0.0380  -0.2889 0.0216  488 ILE A CG2 
3178 C CD1 . ILE A 508 ? 1.0996 0.6826 0.8441 0.0284  -0.2943 0.0205  488 ILE A CD1 
3179 N N   . ASN A 509 ? 1.4254 1.1015 1.3300 0.0525  -0.2857 0.0458  489 ASN A N   
3180 C CA  . ASN A 509 ? 1.3260 1.0068 1.2525 0.0633  -0.2706 0.0456  489 ASN A CA  
3181 C C   . ASN A 509 ? 1.3174 1.0006 1.2505 0.0674  -0.2739 0.0592  489 ASN A C   
3182 O O   . ASN A 509 ? 1.3042 0.9861 1.2480 0.0752  -0.2616 0.0596  489 ASN A O   
3183 C CB  . ASN A 509 ? 1.2068 0.9073 1.1725 0.0674  -0.2628 0.0407  489 ASN A CB  
3184 C CG  . ASN A 509 ? 1.1139 0.8097 1.0734 0.0657  -0.2542 0.0264  489 ASN A CG  
3185 O OD1 . ASN A 509 ? 1.1338 0.8127 1.0679 0.0672  -0.2456 0.0193  489 ASN A OD1 
3186 N ND2 . ASN A 509 ? 1.0135 0.7251 0.9966 0.0628  -0.2563 0.0226  489 ASN A ND2 
3187 N N   . GLU A 510 ? 1.4412 1.1274 1.3668 0.0615  -0.2906 0.0707  490 GLU A N   
3188 C CA  . GLU A 510 ? 1.4523 1.1384 1.3795 0.0649  -0.2950 0.0845  490 GLU A CA  
3189 C C   . GLU A 510 ? 1.4708 1.1328 1.3547 0.0603  -0.2964 0.0851  490 GLU A C   
3190 O O   . GLU A 510 ? 1.4513 1.1105 1.3268 0.0590  -0.3046 0.0973  490 GLU A O   
3191 C CB  . GLU A 510 ? 1.4468 1.1529 1.3934 0.0620  -0.3122 0.0993  490 GLU A CB  
3192 C CG  . GLU A 510 ? 1.4569 1.1892 1.4490 0.0680  -0.3102 0.1004  490 GLU A CG  
3193 C CD  . GLU A 510 ? 1.4547 1.1910 1.4764 0.0814  -0.2956 0.1020  490 GLU A CD  
3194 O OE1 . GLU A 510 ? 1.4087 1.1563 1.4580 0.0861  -0.2857 0.0947  490 GLU A OE1 
3195 O OE2 . GLU A 510 ? 1.4240 1.1512 1.4404 0.0865  -0.2941 0.1107  490 GLU A OE2 
3196 N N   . ARG A 511 ? 1.4227 1.0678 1.2797 0.0582  -0.2877 0.0719  491 ARG A N   
3197 C CA  . ARG A 511 ? 1.4597 1.0808 1.2730 0.0539  -0.2871 0.0700  491 ARG A CA  
3198 C C   . ARG A 511 ? 1.4490 1.0598 1.2551 0.0618  -0.2688 0.0635  491 ARG A C   
3199 O O   . ARG A 511 ? 1.4342 1.0525 1.2609 0.0686  -0.2552 0.0554  491 ARG A O   
3200 C CB  . ARG A 511 ? 1.4555 1.0624 1.2375 0.0452  -0.2921 0.0609  491 ARG A CB  
3201 C CG  . ARG A 511 ? 1.4722 1.0520 1.2093 0.0436  -0.2849 0.0535  491 ARG A CG  
3202 C CD  . ARG A 511 ? 1.4790 1.0416 1.1840 0.0354  -0.2897 0.0448  491 ARG A CD  
3203 N NE  . ARG A 511 ? 1.5358 1.0866 1.2101 0.0225  -0.3063 0.0527  491 ARG A NE  
3204 C CZ  . ARG A 511 ? 1.5574 1.1199 1.2399 0.0126  -0.3234 0.0605  491 ARG A CZ  
3205 N NH1 . ARG A 511 ? 1.5544 1.1406 1.2756 0.0151  -0.3256 0.0610  491 ARG A NH1 
3206 N NH2 . ARG A 511 ? 1.5709 1.1223 1.2224 -0.0006 -0.3382 0.0681  491 ARG A NH2 
3207 N N   . MET A 512 ? 1.3733 0.9685 1.1500 0.0598  -0.2688 0.0675  492 MET A N   
3208 C CA  . MET A 512 ? 1.3403 0.9252 1.1032 0.0652  -0.2525 0.0617  492 MET A CA  
3209 C C   . MET A 512 ? 1.4334 1.0083 1.1766 0.0662  -0.2421 0.0471  492 MET A C   
3210 O O   . MET A 512 ? 1.4927 1.0517 1.2031 0.0602  -0.2479 0.0436  492 MET A O   
3211 C CB  . MET A 512 ? 1.3050 0.8751 1.0373 0.0608  -0.2569 0.0696  492 MET A CB  
3212 C CG  . MET A 512 ? 1.3431 0.9007 1.0518 0.0640  -0.2414 0.0632  492 MET A CG  
3213 S SD  . MET A 512 ? 1.5312 1.0974 1.2625 0.0716  -0.2275 0.0671  492 MET A SD  
3214 C CE  . MET A 512 ? 1.3210 0.8801 1.0407 0.0666  -0.2400 0.0836  492 MET A CE  
3215 N N   . PRO A 513 ? 1.4879 1.0715 1.2502 0.0736  -0.2267 0.0389  493 PRO A N   
3216 C CA  . PRO A 513 ? 1.5187 1.0953 1.2657 0.0765  -0.2154 0.0261  493 PRO A CA  
3217 C C   . PRO A 513 ? 1.6453 1.2022 1.3508 0.0763  -0.2098 0.0231  493 PRO A C   
3218 O O   . PRO A 513 ? 1.6945 1.2489 1.3921 0.0768  -0.2060 0.0287  493 PRO A O   
3219 C CB  . PRO A 513 ? 1.4351 1.0276 1.2117 0.0837  -0.2001 0.0221  493 PRO A CB  
3220 C CG  . PRO A 513 ? 1.3943 1.0020 1.2062 0.0836  -0.2060 0.0302  493 PRO A CG  
3221 C CD  . PRO A 513 ? 1.4224 1.0232 1.2224 0.0793  -0.2194 0.0420  493 PRO A CD  
3222 N N   . PRO A 514 ? 1.8056 1.3471 1.4835 0.0755  -0.2088 0.0145  494 PRO A N   
3223 C CA  . PRO A 514 ? 1.8530 1.3732 1.4880 0.0750  -0.2040 0.0116  494 PRO A CA  
3224 C C   . PRO A 514 ? 1.8430 1.3677 1.4762 0.0832  -0.1857 0.0086  494 PRO A C   
3225 O O   . PRO A 514 ? 1.8254 1.3683 1.4880 0.0891  -0.1757 0.0064  494 PRO A O   
3226 C CB  . PRO A 514 ? 1.8548 1.3586 1.4666 0.0745  -0.2045 0.0018  494 PRO A CB  
3227 C CG  . PRO A 514 ? 1.8158 1.3302 1.4528 0.0696  -0.2169 0.0031  494 PRO A CG  
3228 C CD  . PRO A 514 ? 1.7747 1.3158 1.4574 0.0741  -0.2130 0.0075  494 PRO A CD  
3229 N N   . ARG A 515 ? 1.7332 1.2424 1.3315 0.0823  -0.1818 0.0089  495 ARG A N   
3230 C CA  . ARG A 515 ? 1.6546 1.1686 1.2469 0.0887  -0.1649 0.0069  495 ARG A CA  
3231 C C   . ARG A 515 ? 1.6204 1.1549 1.2445 0.0895  -0.1609 0.0140  495 ARG A C   
3232 O O   . ARG A 515 ? 1.5973 1.1324 1.2280 0.0839  -0.1709 0.0236  495 ARG A O   
3233 C CB  . ARG A 515 ? 1.5691 1.0851 1.1585 0.0983  -0.1496 -0.0039 495 ARG A CB  
3234 C CG  . ARG A 515 ? 1.5726 1.0669 1.1182 0.1015  -0.1421 -0.0104 495 ARG A CG  
3235 C CD  . ARG A 515 ? 1.5616 1.0544 1.0875 0.1010  -0.1345 -0.0064 495 ARG A CD  
3236 N NE  . ARG A 515 ? 1.5730 1.0451 1.0565 0.1045  -0.1259 -0.0128 495 ARG A NE  
3237 C CZ  . ARG A 515 ? 1.5544 1.0312 1.0316 0.1157  -0.1084 -0.0196 495 ARG A CZ  
3238 N NH1 . ARG A 515 ? 1.5147 1.0171 1.0251 0.1231  -0.0984 -0.0205 495 ARG A NH1 
3239 N NH2 . ARG A 515 ? 1.5815 1.0376 1.0188 0.1195  -0.1004 -0.0251 495 ARG A NH2 
3240 N N   . ALA B 5   ? 1.0852 1.0867 1.0371 -0.0632 -0.0059 0.3104  4   ALA B N   
3241 C CA  . ALA B 5   ? 1.0671 1.0651 1.0047 -0.0539 -0.0080 0.2926  4   ALA B CA  
3242 C C   . ALA B 5   ? 1.0505 1.0645 0.9658 -0.0522 -0.0009 0.2808  4   ALA B C   
3243 O O   . ALA B 5   ? 1.1151 1.1430 1.0100 -0.0533 0.0033  0.2886  4   ALA B O   
3244 C CB  . ALA B 5   ? 1.0325 1.0269 0.9617 -0.0504 -0.0146 0.3021  4   ALA B CB  
3245 N N   . SER B 6   ? 0.8154 0.8267 0.7335 -0.0484 -0.0007 0.2617  5   SER B N   
3246 C CA  . SER B 6   ? 0.7164 0.7392 0.6151 -0.0460 0.0033  0.2486  5   SER B CA  
3247 C C   . SER B 6   ? 0.7119 0.7303 0.6022 -0.0403 -0.0046 0.2349  5   SER B C   
3248 O O   . SER B 6   ? 0.7264 0.7368 0.6287 -0.0372 -0.0107 0.2344  5   SER B O   
3249 C CB  . SER B 6   ? 0.6999 0.7283 0.6099 -0.0486 0.0106  0.2404  5   SER B CB  
3250 O OG  . SER B 6   ? 0.6975 0.7123 0.6297 -0.0488 0.0067  0.2313  5   SER B OG  
3251 N N   . TYR B 7   ? 0.6677 0.6929 0.5377 -0.0383 -0.0055 0.2249  6   TYR B N   
3252 C CA  . TYR B 7   ? 0.5838 0.6069 0.4470 -0.0351 -0.0155 0.2142  6   TYR B CA  
3253 C C   . TYR B 7   ? 0.5477 0.5688 0.4314 -0.0344 -0.0150 0.2012  6   TYR B C   
3254 O O   . TYR B 7   ? 0.5269 0.5478 0.4226 -0.0365 -0.0072 0.1960  6   TYR B O   
3255 C CB  . TYR B 7   ? 0.5997 0.6263 0.4360 -0.0331 -0.0194 0.2055  6   TYR B CB  
3256 C CG  . TYR B 7   ? 0.6943 0.7218 0.5036 -0.0316 -0.0215 0.2155  6   TYR B CG  
3257 C CD1 . TYR B 7   ? 0.6995 0.7228 0.5050 -0.0331 -0.0289 0.2298  6   TYR B CD1 
3258 C CD2 . TYR B 7   ? 0.7288 0.7625 0.5152 -0.0274 -0.0160 0.2108  6   TYR B CD2 
3259 C CE1 . TYR B 7   ? 0.7458 0.7691 0.5249 -0.0321 -0.0318 0.2390  6   TYR B CE1 
3260 C CE2 . TYR B 7   ? 0.7662 0.8012 0.5239 -0.0240 -0.0182 0.2190  6   TYR B CE2 
3261 C CZ  . TYR B 7   ? 0.7961 0.8248 0.5499 -0.0272 -0.0266 0.2332  6   TYR B CZ  
3262 O OH  . TYR B 7   ? 0.8423 0.8711 0.5660 -0.0243 -0.0299 0.2418  6   TYR B OH  
3263 N N   . PRO B 8   ? 0.5074 0.5292 0.3955 -0.0316 -0.0238 0.1975  7   PRO B N   
3264 C CA  . PRO B 8   ? 0.4890 0.5120 0.3937 -0.0296 -0.0244 0.1858  7   PRO B CA  
3265 C C   . PRO B 8   ? 0.4798 0.5055 0.3816 -0.0322 -0.0229 0.1711  7   PRO B C   
3266 O O   . PRO B 8   ? 0.4856 0.5134 0.3693 -0.0334 -0.0267 0.1679  7   PRO B O   
3267 C CB  . PRO B 8   ? 0.4815 0.5124 0.3860 -0.0264 -0.0351 0.1898  7   PRO B CB  
3268 C CG  . PRO B 8   ? 0.4959 0.5256 0.3928 -0.0259 -0.0383 0.2058  7   PRO B CG  
3269 C CD  . PRO B 8   ? 0.5122 0.5364 0.3915 -0.0302 -0.0341 0.2080  7   PRO B CD  
3270 N N   . LEU B 9   ? 0.4842 0.5076 0.4029 -0.0323 -0.0185 0.1617  8   LEU B N   
3271 C CA  . LEU B 9   ? 0.4563 0.4830 0.3771 -0.0347 -0.0184 0.1475  8   LEU B CA  
3272 C C   . LEU B 9   ? 0.4430 0.4771 0.3646 -0.0332 -0.0290 0.1434  8   LEU B C   
3273 O O   . LEU B 9   ? 0.5024 0.5404 0.4322 -0.0290 -0.0320 0.1488  8   LEU B O   
3274 C CB  . LEU B 9   ? 0.4718 0.4927 0.4114 -0.0360 -0.0121 0.1408  8   LEU B CB  
3275 C CG  . LEU B 9   ? 0.5098 0.5279 0.4538 -0.0405 -0.0030 0.1442  8   LEU B CG  
3276 C CD1 . LEU B 9   ? 0.4876 0.5021 0.4485 -0.0436 -0.0012 0.1337  8   LEU B CD1 
3277 C CD2 . LEU B 9   ? 0.5406 0.5683 0.4663 -0.0409 0.0003  0.1454  8   LEU B CD2 
3278 N N   . GLU B 10  ? 0.4583 0.4961 0.3723 -0.0359 -0.0353 0.1351  9   GLU B N   
3279 C CA  . GLU B 10  ? 0.4350 0.4819 0.3520 -0.0368 -0.0479 0.1343  9   GLU B CA  
3280 C C   . GLU B 10  ? 0.4108 0.4604 0.3382 -0.0395 -0.0480 0.1204  9   GLU B C   
3281 O O   . GLU B 10  ? 0.4743 0.5182 0.3977 -0.0414 -0.0435 0.1112  9   GLU B O   
3282 C CB  . GLU B 10  ? 0.4976 0.5434 0.3956 -0.0387 -0.0615 0.1395  9   GLU B CB  
3283 C CG  . GLU B 10  ? 0.6470 0.7002 0.5477 -0.0426 -0.0782 0.1381  9   GLU B CG  
3284 C CD  . GLU B 10  ? 0.7741 0.8204 0.6683 -0.0450 -0.0825 0.1230  9   GLU B CD  
3285 O OE1 . GLU B 10  ? 0.8167 0.8523 0.6939 -0.0420 -0.0773 0.1168  9   GLU B OE1 
3286 O OE2 . GLU B 10  ? 0.7566 0.8101 0.6629 -0.0489 -0.0906 0.1180  9   GLU B OE2 
3287 N N   . MET B 11  ? 0.3959 0.4564 0.3370 -0.0390 -0.0523 0.1197  10  MET B N   
3288 C CA  . MET B 11  ? 0.3819 0.4452 0.3340 -0.0421 -0.0522 0.1072  10  MET B CA  
3289 C C   . MET B 11  ? 0.3680 0.4493 0.3311 -0.0419 -0.0611 0.1101  10  MET B C   
3290 O O   . MET B 11  ? 0.3887 0.4827 0.3534 -0.0378 -0.0651 0.1227  10  MET B O   
3291 C CB  . MET B 11  ? 0.3824 0.4361 0.3442 -0.0402 -0.0393 0.1000  10  MET B CB  
3292 C CG  . MET B 11  ? 0.4151 0.4686 0.3838 -0.0326 -0.0353 0.1051  10  MET B CG  
3293 S SD  . MET B 11  ? 0.4573 0.4908 0.4344 -0.0316 -0.0251 0.0994  10  MET B SD  
3294 C CE  . MET B 11  ? 0.6238 0.6491 0.5919 -0.0358 -0.0191 0.1087  10  MET B CE  
3295 N N   . CYS B 12  ? 0.3549 0.4403 0.3267 -0.0461 -0.0637 0.1000  11  CYS B N   
3296 C CA  . CYS B 12  ? 0.3407 0.4469 0.3242 -0.0466 -0.0715 0.1032  11  CYS B CA  
3297 C C   . CYS B 12  ? 0.3328 0.4391 0.3268 -0.0443 -0.0636 0.0917  11  CYS B C   
3298 O O   . CYS B 12  ? 0.3527 0.4528 0.3509 -0.0507 -0.0643 0.0806  11  CYS B O   
3299 C CB  . CYS B 12  ? 0.3346 0.4472 0.3186 -0.0560 -0.0884 0.1042  11  CYS B CB  
3300 S SG  . CYS B 12  ? 0.3479 0.4932 0.3489 -0.0590 -0.1007 0.1146  11  CYS B SG  
3301 N N   . SER B 13  ? 0.3354 0.4482 0.3328 -0.0342 -0.0573 0.0940  12  SER B N   
3302 C CA  . SER B 13  ? 0.3327 0.4439 0.3368 -0.0302 -0.0524 0.0826  12  SER B CA  
3303 C C   . SER B 13  ? 0.3592 0.4949 0.3667 -0.0187 -0.0532 0.0880  12  SER B C   
3304 O O   . SER B 13  ? 0.3500 0.5062 0.3571 -0.0135 -0.0563 0.1027  12  SER B O   
3305 C CB  . SER B 13  ? 0.3476 0.4315 0.3491 -0.0263 -0.0428 0.0744  12  SER B CB  
3306 O OG  . SER B 13  ? 0.3613 0.4429 0.3580 -0.0146 -0.0391 0.0813  12  SER B OG  
3307 N N   . HIS B 14  ? 0.3577 0.4923 0.3679 -0.0140 -0.0506 0.0766  13  HIS B N   
3308 C CA  . HIS B 14  ? 0.3348 0.4912 0.3443 0.0013  -0.0493 0.0782  13  HIS B CA  
3309 C C   . HIS B 14  ? 0.4305 0.5690 0.4309 0.0189  -0.0422 0.0731  13  HIS B C   
3310 O O   . HIS B 14  ? 0.4772 0.6310 0.4732 0.0363  -0.0403 0.0726  13  HIS B O   
3311 C CB  . HIS B 14  ? 0.3285 0.4901 0.3418 -0.0006 -0.0514 0.0669  13  HIS B CB  
3312 C CG  . HIS B 14  ? 0.3922 0.5763 0.4161 -0.0155 -0.0605 0.0731  13  HIS B CG  
3313 N ND1 . HIS B 14  ? 0.3747 0.5967 0.4051 -0.0158 -0.0675 0.0910  13  HIS B ND1 
3314 C CD2 . HIS B 14  ? 0.3645 0.5386 0.3951 -0.0307 -0.0655 0.0652  13  HIS B CD2 
3315 C CE1 . HIS B 14  ? 0.3454 0.5770 0.3858 -0.0315 -0.0781 0.0935  13  HIS B CE1 
3316 N NE2 . HIS B 14  ? 0.3703 0.5729 0.4104 -0.0398 -0.0766 0.0769  13  HIS B NE2 
3317 N N   . PHE B 15  ? 0.3696 0.4765 0.3668 0.0153  -0.0391 0.0699  14  PHE B N   
3318 C CA  . PHE B 15  ? 0.3945 0.4763 0.3850 0.0292  -0.0360 0.0632  14  PHE B CA  
3319 C C   . PHE B 15  ? 0.4059 0.4947 0.3919 0.0423  -0.0337 0.0750  14  PHE B C   
3320 O O   . PHE B 15  ? 0.4476 0.5493 0.4359 0.0355  -0.0339 0.0891  14  PHE B O   
3321 C CB  . PHE B 15  ? 0.4032 0.4487 0.3958 0.0177  -0.0353 0.0565  14  PHE B CB  
3322 C CG  . PHE B 15  ? 0.3951 0.4317 0.3936 0.0061  -0.0374 0.0452  14  PHE B CG  
3323 C CD1 . PHE B 15  ? 0.3994 0.4372 0.3958 0.0134  -0.0406 0.0337  14  PHE B CD1 
3324 C CD2 . PHE B 15  ? 0.3846 0.4136 0.3900 -0.0109 -0.0362 0.0463  14  PHE B CD2 
3325 C CE1 . PHE B 15  ? 0.3919 0.4216 0.3949 0.0018  -0.0434 0.0242  14  PHE B CE1 
3326 C CE2 . PHE B 15  ? 0.3769 0.3998 0.3897 -0.0212 -0.0380 0.0370  14  PHE B CE2 
3327 C CZ  . PHE B 15  ? 0.3796 0.4022 0.3922 -0.0160 -0.0421 0.0263  14  PHE B CZ  
3328 N N   . ASP B 16  ? 0.4293 0.5072 0.4081 0.0619  -0.0330 0.0687  15  ASP B N   
3329 C CA  . ASP B 16  ? 0.4431 0.5255 0.4184 0.0766  -0.0311 0.0789  15  ASP B CA  
3330 C C   . ASP B 16  ? 0.5013 0.5447 0.4755 0.0737  -0.0321 0.0777  15  ASP B C   
3331 O O   . ASP B 16  ? 0.5384 0.5542 0.5153 0.0603  -0.0341 0.0703  15  ASP B O   
3332 C CB  . ASP B 16  ? 0.5199 0.6179 0.4870 0.1039  -0.0301 0.0744  15  ASP B CB  
3333 C CG  . ASP B 16  ? 0.6503 0.7127 0.6069 0.1165  -0.0342 0.0531  15  ASP B CG  
3334 O OD1 . ASP B 16  ? 0.6638 0.6851 0.6213 0.1067  -0.0387 0.0458  15  ASP B OD1 
3335 O OD2 . ASP B 16  ? 0.7167 0.7933 0.6635 0.1373  -0.0341 0.0447  15  ASP B OD2 
3336 N N   . ALA B 17  ? 0.5307 0.3784 0.5563 0.2320  -0.0724 0.0390  16  ALA B N   
3337 C CA  . ALA B 17  ? 0.5333 0.3603 0.5685 0.2304  -0.0746 0.0510  16  ALA B CA  
3338 C C   . ALA B 17  ? 0.5706 0.3565 0.6054 0.2250  -0.0808 0.0459  16  ALA B C   
3339 O O   . ALA B 17  ? 0.5736 0.3459 0.6145 0.2131  -0.0840 0.0568  16  ALA B O   
3340 C CB  . ALA B 17  ? 0.5643 0.3989 0.6069 0.2436  -0.0713 0.0544  16  ALA B CB  
3341 N N   . ASP B 18  ? 0.6480 0.4156 0.6752 0.2329  -0.0823 0.0297  17  ASP B N   
3342 C CA  . ASP B 18  ? 0.6849 0.4134 0.7100 0.2267  -0.0891 0.0232  17  ASP B CA  
3343 C C   . ASP B 18  ? 0.6282 0.3485 0.6540 0.2082  -0.0943 0.0248  17  ASP B C   
3344 O O   . ASP B 18  ? 0.6440 0.3445 0.6780 0.1964  -0.0985 0.0338  17  ASP B O   
3345 C CB  . ASP B 18  ? 0.8194 0.5343 0.8312 0.2378  -0.0897 0.0030  17  ASP B CB  
3346 C CG  . ASP B 18  ? 0.9456 0.6662 0.9584 0.2568  -0.0848 -0.0005 17  ASP B CG  
3347 O OD1 . ASP B 18  ? 0.9626 0.6789 0.9872 0.2590  -0.0851 0.0117  17  ASP B OD1 
3348 O OD2 . ASP B 18  ? 0.9781 0.7077 0.9800 0.2694  -0.0806 -0.0152 17  ASP B OD2 
3349 N N   . GLU B 19  ? 0.5884 0.3272 0.6069 0.2035  -0.0931 0.0165  18  GLU B N   
3350 C CA  . GLU B 19  ? 0.5692 0.3052 0.5900 0.1834  -0.0969 0.0160  18  GLU B CA  
3351 C C   . GLU B 19  ? 0.5603 0.3083 0.5949 0.1706  -0.0953 0.0339  18  GLU B C   
3352 O O   . GLU B 19  ? 0.5400 0.2730 0.5827 0.1563  -0.0998 0.0381  18  GLU B O   
3353 C CB  . GLU B 19  ? 0.5619 0.3235 0.5728 0.1784  -0.0942 0.0051  18  GLU B CB  
3354 C CG  . GLU B 19  ? 0.6551 0.4045 0.6497 0.1885  -0.0953 -0.0134 18  GLU B CG  
3355 C CD  . GLU B 19  ? 0.6536 0.4347 0.6377 0.1853  -0.0912 -0.0213 18  GLU B CD  
3356 O OE1 . GLU B 19  ? 0.5647 0.3814 0.5536 0.1842  -0.0858 -0.0123 18  GLU B OE1 
3357 O OE2 . GLU B 19  ? 0.7056 0.4750 0.6755 0.1835  -0.0944 -0.0361 18  GLU B OE2 
3358 N N   . ILE B 20  ? 0.5547 0.3301 0.5919 0.1758  -0.0889 0.0449  19  ILE B N   
3359 C CA  . ILE B 20  ? 0.5064 0.2935 0.5531 0.1650  -0.0866 0.0613  19  ILE B CA  
3360 C C   . ILE B 20  ? 0.5434 0.3005 0.5989 0.1634  -0.0905 0.0721  19  ILE B C   
3361 O O   . ILE B 20  ? 0.5281 0.2813 0.5927 0.1494  -0.0910 0.0819  19  ILE B O   
3362 C CB  . ILE B 20  ? 0.4860 0.3060 0.5307 0.1714  -0.0805 0.0706  19  ILE B CB  
3363 C CG1 . ILE B 20  ? 0.4565 0.3066 0.4951 0.1657  -0.0785 0.0636  19  ILE B CG1 
3364 C CG2 . ILE B 20  ? 0.4819 0.3058 0.5334 0.1645  -0.0782 0.0887  19  ILE B CG2 
3365 C CD1 . ILE B 20  ? 0.4390 0.3208 0.4743 0.1727  -0.0747 0.0705  19  ILE B CD1 
3366 N N   . LYS B 21  ? 0.5632 0.2991 0.6164 0.1776  -0.0936 0.0702  20  LYS B N   
3367 C CA  . LYS B 21  ? 0.6001 0.3101 0.6597 0.1740  -0.0960 0.0796  20  LYS B CA  
3368 C C   . LYS B 21  ? 0.6120 0.2961 0.6754 0.1595  -0.1024 0.0749  20  LYS B C   
3369 O O   . LYS B 21  ? 0.6076 0.2818 0.6801 0.1471  -0.1040 0.0876  20  LYS B O   
3370 C CB  . LYS B 21  ? 0.6134 0.3124 0.6692 0.1903  -0.0956 0.0750  20  LYS B CB  
3371 C CG  . LYS B 21  ? 0.6446 0.3177 0.7051 0.1888  -0.0991 0.0852  20  LYS B CG  
3372 C CD  . LYS B 21  ? 0.6390 0.3256 0.7037 0.1885  -0.0953 0.1050  20  LYS B CD  
3373 C CE  . LYS B 21  ? 0.6410 0.3425 0.7057 0.2055  -0.0916 0.1062  20  LYS B CE  
3374 N NZ  . LYS B 21  ? 0.6407 0.3510 0.7063 0.2040  -0.0893 0.1264  20  LYS B NZ  
3375 N N   . ARG B 22  ? 0.6040 0.2791 0.6598 0.1604  -0.1061 0.0573  21  ARG B N   
3376 C CA  . ARG B 22  ? 0.6177 0.2693 0.6758 0.1462  -0.1131 0.0514  21  ARG B CA  
3377 C C   . ARG B 22  ? 0.6468 0.3107 0.7168 0.1284  -0.1136 0.0587  21  ARG B C   
3378 O O   . ARG B 22  ? 0.7099 0.3597 0.7898 0.1139  -0.1177 0.0642  21  ARG B O   
3379 C CB  . ARG B 22  ? 0.6283 0.2680 0.6723 0.1516  -0.1171 0.0303  21  ARG B CB  
3380 C CG  . ARG B 22  ? 0.7300 0.3566 0.7629 0.1695  -0.1166 0.0210  21  ARG B CG  
3381 C CD  . ARG B 22  ? 0.7492 0.3523 0.7681 0.1703  -0.1227 0.0021  21  ARG B CD  
3382 N NE  . ARG B 22  ? 0.7886 0.4045 0.7970 0.1689  -0.1225 -0.0106 21  ARG B NE  
3383 C CZ  . ARG B 22  ? 0.8112 0.4417 0.8062 0.1843  -0.1176 -0.0221 21  ARG B CZ  
3384 N NH1 . ARG B 22  ? 0.8186 0.4552 0.8112 0.2026  -0.1118 -0.0226 21  ARG B NH1 
3385 N NH2 . ARG B 22  ? 0.7763 0.4167 0.7608 0.1813  -0.1186 -0.0328 21  ARG B NH2 
3386 N N   . LEU B 23  ? 0.6131 0.3048 0.6830 0.1296  -0.1098 0.0586  22  LEU B N   
3387 C CA  . LEU B 23  ? 0.5452 0.2569 0.6259 0.1131  -0.1070 0.0648  22  LEU B CA  
3388 C C   . LEU B 23  ? 0.5444 0.2605 0.6381 0.1069  -0.1029 0.0851  22  LEU B C   
3389 O O   . LEU B 23  ? 0.5510 0.2684 0.6587 0.0922  -0.1032 0.0926  22  LEU B O   
3390 C CB  . LEU B 23  ? 0.5019 0.2507 0.5748 0.1147  -0.1001 0.0596  22  LEU B CB  
3391 C CG  . LEU B 23  ? 0.4978 0.2453 0.5599 0.1144  -0.1046 0.0410  22  LEU B CG  
3392 C CD1 . LEU B 23  ? 0.4717 0.2535 0.5234 0.1194  -0.0990 0.0363  22  LEU B CD1 
3393 C CD2 . LEU B 23  ? 0.4987 0.2384 0.5708 0.0973  -0.1107 0.0381  22  LEU B CD2 
3394 N N   . GLY B 24  ? 0.5433 0.2625 0.6326 0.1182  -0.0990 0.0944  23  GLY B N   
3395 C CA  . GLY B 24  ? 0.5658 0.2881 0.6638 0.1134  -0.0951 0.1145  23  GLY B CA  
3396 C C   . GLY B 24  ? 0.6279 0.3222 0.7356 0.1030  -0.1006 0.1216  23  GLY B C   
3397 O O   . GLY B 24  ? 0.6223 0.3217 0.7419 0.0914  -0.0978 0.1375  23  GLY B O   
3398 N N   . LYS B 25  ? 0.6444 0.3121 0.7456 0.1065  -0.1075 0.1095  24  LYS B N   
3399 C CA  . LYS B 25  ? 0.6327 0.2748 0.7408 0.0956  -0.1139 0.1140  24  LYS B CA  
3400 C C   . LYS B 25  ? 0.6371 0.2818 0.7597 0.0774  -0.1165 0.1146  24  LYS B C   
3401 O O   . LYS B 25  ? 0.7085 0.3496 0.8447 0.0643  -0.1174 0.1285  24  LYS B O   
3402 C CB  . LYS B 25  ? 0.6947 0.3087 0.7909 0.1050  -0.1209 0.0998  24  LYS B CB  
3403 C CG  . LYS B 25  ? 0.7828 0.3926 0.8696 0.1221  -0.1188 0.1020  24  LYS B CG  
3404 C CD  . LYS B 25  ? 0.8485 0.4302 0.9256 0.1319  -0.1256 0.0884  24  LYS B CD  
3405 C CE  . LYS B 25  ? 0.8473 0.4285 0.9182 0.1500  -0.1229 0.0902  24  LYS B CE  
3406 N NZ  . LYS B 25  ? 0.8553 0.4364 0.9324 0.1460  -0.1222 0.1106  24  LYS B NZ  
3407 N N   . ARG B 26  ? 0.6001 0.2522 0.7205 0.0761  -0.1179 0.1001  25  ARG B N   
3408 C CA  . ARG B 26  ? 0.5881 0.2454 0.7234 0.0592  -0.1206 0.0999  25  ARG B CA  
3409 C C   . ARG B 26  ? 0.6058 0.2890 0.7585 0.0509  -0.1128 0.1170  25  ARG B C   
3410 O O   . ARG B 26  ? 0.6662 0.3516 0.8373 0.0359  -0.1135 0.1261  25  ARG B O   
3411 C CB  . ARG B 26  ? 0.5717 0.2334 0.6994 0.0599  -0.1240 0.0812  25  ARG B CB  
3412 C CG  . ARG B 26  ? 0.6163 0.2524 0.7290 0.0632  -0.1323 0.0640  25  ARG B CG  
3413 C CD  . ARG B 26  ? 0.6122 0.2526 0.7055 0.0780  -0.1310 0.0484  25  ARG B CD  
3414 N NE  . ARG B 26  ? 0.6356 0.2602 0.7165 0.0760  -0.1384 0.0307  25  ARG B NE  
3415 C CZ  . ARG B 26  ? 0.7000 0.3192 0.7611 0.0893  -0.1389 0.0158  25  ARG B CZ  
3416 N NH1 . ARG B 26  ? 0.6668 0.2970 0.7203 0.1060  -0.1323 0.0164  25  ARG B NH1 
3417 N NH2 . ARG B 26  ? 0.7891 0.3934 0.8378 0.0861  -0.1457 0.0008  25  ARG B NH2 
3418 N N   . PHE B 27  ? 0.5664 0.2708 0.7136 0.0609  -0.1051 0.1219  26  PHE B N   
3419 C CA  . PHE B 27  ? 0.5253 0.2616 0.6812 0.0544  -0.0937 0.1355  26  PHE B CA  
3420 C C   . PHE B 27  ? 0.5969 0.3252 0.7671 0.0456  -0.0921 0.1570  26  PHE B C   
3421 O O   . PHE B 27  ? 0.6266 0.3670 0.8147 0.0319  -0.0886 0.1660  26  PHE B O   
3422 C CB  . PHE B 27  ? 0.5075 0.2700 0.6465 0.0668  -0.0845 0.1350  26  PHE B CB  
3423 C CG  . PHE B 27  ? 0.4895 0.2857 0.6322 0.0613  -0.0731 0.1444  26  PHE B CG  
3424 C CD1 . PHE B 27  ? 0.4597 0.2791 0.6041 0.0572  -0.0707 0.1344  26  PHE B CD1 
3425 C CD2 . PHE B 27  ? 0.4996 0.3032 0.6427 0.0606  -0.0655 0.1631  26  PHE B CD2 
3426 C CE1 . PHE B 27  ? 0.4421 0.2909 0.5885 0.0538  -0.0608 0.1415  26  PHE B CE1 
3427 C CE2 . PHE B 27  ? 0.4784 0.3122 0.6221 0.0567  -0.0546 0.1706  26  PHE B CE2 
3428 C CZ  . PHE B 27  ? 0.4615 0.3176 0.6068 0.0541  -0.0523 0.1591  26  PHE B CZ  
3429 N N   . LYS B 28  ? 0.6258 0.3360 0.7871 0.0528  -0.0944 0.1640  27  LYS B N   
3430 C CA  . LYS B 28  ? 0.6181 0.3217 0.7878 0.0437  -0.0931 0.1830  27  LYS B CA  
3431 C C   . LYS B 28  ? 0.6655 0.3547 0.8521 0.0274  -0.1000 0.1848  27  LYS B C   
3432 O O   . LYS B 28  ? 0.7299 0.4279 0.9326 0.0146  -0.0960 0.2026  27  LYS B O   
3433 C CB  . LYS B 28  ? 0.6187 0.3041 0.7725 0.0546  -0.0962 0.1853  27  LYS B CB  
3434 C CG  . LYS B 28  ? 0.6051 0.3066 0.7437 0.0698  -0.0897 0.1858  27  LYS B CG  
3435 C CD  . LYS B 28  ? 0.6710 0.3562 0.7978 0.0782  -0.0924 0.1921  27  LYS B CD  
3436 C CE  . LYS B 28  ? 0.7260 0.4175 0.8363 0.0972  -0.0911 0.1823  27  LYS B CE  
3437 N NZ  . LYS B 28  ? 0.7325 0.4065 0.8364 0.1075  -0.0979 0.1614  27  LYS B NZ  
3438 N N   . LYS B 29  ? 0.6180 0.2869 0.8005 0.0277  -0.1101 0.1671  28  LYS B N   
3439 C CA  . LYS B 29  ? 0.6350 0.2906 0.8320 0.0127  -0.1183 0.1680  28  LYS B CA  
3440 C C   . LYS B 29  ? 0.6102 0.2891 0.8293 -0.0006 -0.1143 0.1716  28  LYS B C   
3441 O O   . LYS B 29  ? 0.6766 0.3575 0.9157 -0.0153 -0.1164 0.1822  28  LYS B O   
3442 C CB  . LYS B 29  ? 0.6536 0.2818 0.8374 0.0171  -0.1300 0.1478  28  LYS B CB  
3443 C CG  . LYS B 29  ? 0.6847 0.2916 0.8777 0.0050  -0.1409 0.1514  28  LYS B CG  
3444 C CD  . LYS B 29  ? 0.7039 0.2848 0.8816 0.0101  -0.1520 0.1311  28  LYS B CD  
3445 C CE  . LYS B 29  ? 0.7324 0.2952 0.9207 -0.0034 -0.1642 0.1343  28  LYS B CE  
3446 N NZ  . LYS B 29  ? 0.7534 0.2909 0.9252 0.0016  -0.1752 0.1148  28  LYS B NZ  
3447 N N   . LEU B 30  ? 0.6396 0.3369 0.8559 0.0051  -0.1092 0.1628  29  LEU B N   
3448 C CA  . LEU B 30  ? 0.5835 0.3043 0.8205 -0.0052 -0.1050 0.1648  29  LEU B CA  
3449 C C   . LEU B 30  ? 0.5853 0.3319 0.8375 -0.0095 -0.0917 0.1875  29  LEU B C   
3450 O O   . LEU B 30  ? 0.5865 0.3548 0.8599 -0.0208 -0.0862 0.1937  29  LEU B O   
3451 C CB  . LEU B 30  ? 0.5269 0.2576 0.7542 0.0030  -0.1052 0.1475  29  LEU B CB  
3452 C CG  . LEU B 30  ? 0.5314 0.2448 0.7492 0.0020  -0.1168 0.1256  29  LEU B CG  
3453 C CD1 . LEU B 30  ? 0.5074 0.2308 0.7113 0.0114  -0.1165 0.1104  29  LEU B CD1 
3454 C CD2 . LEU B 30  ? 0.5395 0.2562 0.7794 -0.0144 -0.1221 0.1258  29  LEU B CD2 
3455 N N   . ASP B 31  ? 0.6103 0.3612 0.8463 0.0001  -0.0845 0.1962  30  ASP B N   
3456 C CA  . ASP B 31  ? 0.6349 0.4153 0.8741 -0.0029 -0.0693 0.2136  30  ASP B CA  
3457 C C   . ASP B 31  ? 0.6916 0.4599 0.9490 -0.0161 -0.0710 0.2366  30  ASP B C   
3458 O O   . ASP B 31  ? 0.7597 0.5143 1.0058 -0.0129 -0.0722 0.2467  30  ASP B O   
3459 C CB  . ASP B 31  ? 0.6043 0.3925 0.8170 0.0122  -0.0626 0.2135  30  ASP B CB  
3460 C CG  . ASP B 31  ? 0.6298 0.4518 0.8390 0.0115  -0.0465 0.2262  30  ASP B CG  
3461 O OD1 . ASP B 31  ? 0.6070 0.4506 0.8341 0.0009  -0.0388 0.2319  30  ASP B OD1 
3462 O OD2 . ASP B 31  ? 0.5669 0.3938 0.7553 0.0219  -0.0418 0.2300  30  ASP B OD2 
3463 N N   . LEU B 32  ? 0.5915 0.3681 0.8760 -0.0312 -0.0711 0.2428  31  LEU B N   
3464 C CA  . LEU B 32  ? 0.6044 0.3778 0.9058 -0.0458 -0.0727 0.2596  31  LEU B CA  
3465 C C   . LEU B 32  ? 0.6814 0.4699 0.9795 -0.0477 -0.0599 0.2837  31  LEU B C   
3466 O O   . LEU B 32  ? 0.6784 0.4486 0.9656 -0.0477 -0.0653 0.2908  31  LEU B O   
3467 C CB  . LEU B 32  ? 0.5847 0.3754 0.9174 -0.0604 -0.0720 0.2617  31  LEU B CB  
3468 C CG  . LEU B 32  ? 0.5844 0.3598 0.9176 -0.0595 -0.0857 0.2376  31  LEU B CG  
3469 C CD1 . LEU B 32  ? 0.5622 0.3579 0.9268 -0.0724 -0.0852 0.2382  31  LEU B CD1 
3470 C CD2 . LEU B 32  ? 0.6131 0.3521 0.9316 -0.0583 -0.1025 0.2269  31  LEU B CD2 
3471 N N   . ASP B 33  ? 0.6778 0.5030 0.9804 -0.0481 -0.0425 0.2918  32  ASP B N   
3472 C CA  . ASP B 33  ? 0.6902 0.5354 0.9847 -0.0494 -0.0279 0.3124  32  ASP B CA  
3473 C C   . ASP B 33  ? 0.6825 0.5187 0.9435 -0.0339 -0.0272 0.3094  32  ASP B C   
3474 O O   . ASP B 33  ? 0.6866 0.5356 0.9352 -0.0333 -0.0166 0.3254  32  ASP B O   
3475 C CB  . ASP B 33  ? 0.7538 0.6447 1.0565 -0.0517 -0.0086 0.3146  32  ASP B CB  
3476 C CG  . ASP B 33  ? 0.8437 0.7505 1.1326 -0.0385 -0.0054 0.2904  32  ASP B CG  
3477 O OD1 . ASP B 33  ? 0.9111 0.7993 1.1772 -0.0261 -0.0137 0.2763  32  ASP B OD1 
3478 O OD2 . ASP B 33  ? 0.8376 0.7749 1.1391 -0.0404 0.0045  0.2854  32  ASP B OD2 
3479 N N   . ASN B 34  ? 0.7037 0.5199 0.9502 -0.0214 -0.0380 0.2890  33  ASN B N   
3480 C CA  . ASN B 34  ? 0.7054 0.5115 0.9234 -0.0057 -0.0397 0.2841  33  ASN B CA  
3481 C C   . ASN B 34  ? 0.6488 0.4865 0.8474 0.0019  -0.0243 0.2871  33  ASN B C   
3482 O O   . ASN B 34  ? 0.6416 0.4753 0.8238 0.0062  -0.0220 0.2997  33  ASN B O   
3483 C CB  . ASN B 34  ? 0.7916 0.5662 1.0041 -0.0067 -0.0500 0.2955  33  ASN B CB  
3484 C CG  . ASN B 34  ? 0.9026 0.6458 1.1226 -0.0101 -0.0666 0.2818  33  ASN B CG  
3485 O OD1 . ASN B 34  ? 0.9649 0.6981 1.1985 -0.0232 -0.0719 0.2909  33  ASN B OD1 
3486 N ND2 . ASN B 34  ? 0.8741 0.6029 1.0836 0.0020  -0.0747 0.2597  33  ASN B ND2 
3487 N N   . SER B 35  ? 0.6388 0.5055 0.8388 0.0035  -0.0153 0.2752  34  SER B N   
3488 C CA  . SER B 35  ? 0.5787 0.4764 0.7609 0.0102  -0.0012 0.2761  34  SER B CA  
3489 C C   . SER B 35  ? 0.5970 0.4955 0.7554 0.0260  -0.0049 0.2586  34  SER B C   
3490 O O   . SER B 35  ? 0.6251 0.5429 0.7640 0.0331  0.0035  0.2597  34  SER B O   
3491 C CB  . SER B 35  ? 0.6170 0.5464 0.8151 0.0036  0.0101  0.2730  34  SER B CB  
3492 O OG  . SER B 35  ? 0.6550 0.5939 0.8492 0.0113  0.0070  0.2504  34  SER B OG  
3493 N N   . GLY B 36  ? 0.5407 0.4188 0.7004 0.0311  -0.0177 0.2427  35  GLY B N   
3494 C CA  . GLY B 36  ? 0.5021 0.3814 0.6419 0.0452  -0.0220 0.2267  35  GLY B CA  
3495 C C   . GLY B 36  ? 0.5326 0.4307 0.6742 0.0466  -0.0217 0.2078  35  GLY B C   
3496 O O   . GLY B 36  ? 0.4815 0.3865 0.6066 0.0569  -0.0243 0.1956  35  GLY B O   
3497 N N   . SER B 37  ? 0.5138 0.4200 0.6765 0.0357  -0.0196 0.2062  36  SER B N   
3498 C CA  . SER B 37  ? 0.4398 0.3640 0.6073 0.0353  -0.0198 0.1900  36  SER B CA  
3499 C C   . SER B 37  ? 0.4412 0.3543 0.6354 0.0235  -0.0261 0.1868  36  SER B C   
3500 O O   . SER B 37  ? 0.5204 0.4159 0.7274 0.0160  -0.0287 0.1986  36  SER B O   
3501 C CB  . SER B 37  ? 0.4311 0.3869 0.5961 0.0351  -0.0065 0.1951  36  SER B CB  
3502 O OG  . SER B 37  ? 0.4112 0.3823 0.5581 0.0446  -0.0071 0.1817  36  SER B OG  
3503 N N   . LEU B 38  ? 0.4512 0.3726 0.6539 0.0212  -0.0305 0.1715  37  LEU B N   
3504 C CA  . LEU B 38  ? 0.4785 0.3864 0.7061 0.0097  -0.0390 0.1679  37  LEU B CA  
3505 C C   . LEU B 38  ? 0.4650 0.3992 0.7120 0.0030  -0.0338 0.1646  37  LEU B C   
3506 O O   . LEU B 38  ? 0.4286 0.3790 0.6678 0.0083  -0.0340 0.1512  37  LEU B O   
3507 C CB  . LEU B 38  ? 0.4328 0.3160 0.6528 0.0126  -0.0539 0.1506  37  LEU B CB  
3508 C CG  . LEU B 38  ? 0.4437 0.2941 0.6518 0.0178  -0.0622 0.1512  37  LEU B CG  
3509 C CD1 . LEU B 38  ? 0.5202 0.3518 0.7208 0.0206  -0.0750 0.1320  37  LEU B CD1 
3510 C CD2 . LEU B 38  ? 0.4704 0.2999 0.6956 0.0084  -0.0651 0.1668  37  LEU B CD2 
3511 N N   . SER B 39  ? 0.4203 0.3590 0.6936 -0.0085 -0.0297 0.1777  38  SER B N   
3512 C CA  . SER B 39  ? 0.4168 0.3836 0.7120 -0.0141 -0.0227 0.1771  38  SER B CA  
3513 C C   . SER B 39  ? 0.4054 0.3613 0.7216 -0.0224 -0.0364 0.1649  38  SER B C   
3514 O O   . SER B 39  ? 0.4507 0.3758 0.7663 -0.0260 -0.0500 0.1608  38  SER B O   
3515 C CB  . SER B 39  ? 0.4486 0.4294 0.7649 -0.0232 -0.0106 0.1989  38  SER B CB  
3516 O OG  . SER B 39  ? 0.4834 0.4403 0.8214 -0.0358 -0.0205 0.2078  38  SER B OG  
3517 N N   . VAL B 40  ? 0.4121 0.3890 0.8253 -0.0806 -0.0254 0.1943  39  VAL B N   
3518 C CA  . VAL B 40  ? 0.4160 0.3875 0.8294 -0.0845 -0.0327 0.1904  39  VAL B CA  
3519 C C   . VAL B 40  ? 0.5174 0.4826 0.9359 -0.0907 -0.0382 0.1935  39  VAL B C   
3520 O O   . VAL B 40  ? 0.5589 0.5115 0.9708 -0.0951 -0.0451 0.1884  39  VAL B O   
3521 C CB  . VAL B 40  ? 0.4068 0.3922 0.8321 -0.0830 -0.0317 0.1932  39  VAL B CB  
3522 C CG1 . VAL B 40  ? 0.4121 0.3943 0.8418 -0.0871 -0.0402 0.1923  39  VAL B CG1 
3523 C CG2 . VAL B 40  ? 0.3957 0.3833 0.8144 -0.0782 -0.0257 0.1880  39  VAL B CG2 
3524 N N   . GLU B 41  ? 0.5693 0.5422 0.9995 -0.0913 -0.0344 0.2019  40  GLU B N   
3525 C CA  . GLU B 41  ? 0.5234 0.4903 0.9607 -0.0980 -0.0377 0.2050  40  GLU B CA  
3526 C C   . GLU B 41  ? 0.5314 0.4771 0.9530 -0.1012 -0.0393 0.1992  40  GLU B C   
3527 O O   . GLU B 41  ? 0.4794 0.4138 0.9004 -0.1086 -0.0454 0.1961  40  GLU B O   
3528 C CB  . GLU B 41  ? 0.4634 0.4410 0.9150 -0.0968 -0.0306 0.2156  40  GLU B CB  
3529 C CG  . GLU B 41  ? 0.4569 0.4548 0.9233 -0.0929 -0.0272 0.2224  40  GLU B CG  
3530 C CD  . GLU B 41  ? 0.4476 0.4538 0.9079 -0.0850 -0.0201 0.2229  40  GLU B CD  
3531 O OE1 . GLU B 41  ? 0.4510 0.4589 0.9101 -0.0815 -0.0132 0.2282  40  GLU B OE1 
3532 O OE2 . GLU B 41  ? 0.4383 0.4494 0.8962 -0.0827 -0.0208 0.2186  40  GLU B OE2 
3533 N N   . GLU B 42  ? 0.4653 0.4056 0.8748 -0.0959 -0.0336 0.1980  41  GLU B N   
3534 C CA  . GLU B 42  ? 0.4768 0.3964 0.8702 -0.0973 -0.0331 0.1935  41  GLU B CA  
3535 C C   . GLU B 42  ? 0.4808 0.3860 0.8594 -0.0998 -0.0400 0.1832  41  GLU B C   
3536 O O   . GLU B 42  ? 0.4985 0.3843 0.8657 -0.1042 -0.0418 0.1789  41  GLU B O   
3537 C CB  . GLU B 42  ? 0.4720 0.3923 0.8585 -0.0900 -0.0255 0.1964  41  GLU B CB  
3538 C CG  . GLU B 42  ? 0.4860 0.4096 0.8808 -0.0881 -0.0178 0.2070  41  GLU B CG  
3539 C CD  . GLU B 42  ? 0.5900 0.5247 0.9854 -0.0797 -0.0111 0.2130  41  GLU B CD  
3540 O OE1 . GLU B 42  ? 0.6777 0.6234 1.0736 -0.0769 -0.0125 0.2099  41  GLU B OE1 
3541 O OE2 . GLU B 42  ? 0.4780 0.4104 0.8737 -0.0760 -0.0041 0.2213  41  GLU B OE2 
3542 N N   . PHE B 43  ? 0.4664 0.3796 0.8446 -0.0969 -0.0428 0.1794  42  PHE B N   
3543 C CA  . PHE B 43  ? 0.4822 0.3827 0.8478 -0.0986 -0.0489 0.1710  42  PHE B CA  
3544 C C   . PHE B 43  ? 0.5485 0.4473 0.9230 -0.1065 -0.0577 0.1714  42  PHE B C   
3545 O O   . PHE B 43  ? 0.5966 0.4781 0.9608 -0.1114 -0.0631 0.1661  42  PHE B O   
3546 C CB  . PHE B 43  ? 0.4588 0.3684 0.8233 -0.0930 -0.0478 0.1680  42  PHE B CB  
3547 C CG  . PHE B 43  ? 0.4762 0.3797 0.8265 -0.0872 -0.0420 0.1633  42  PHE B CG  
3548 C CD1 . PHE B 43  ? 0.4768 0.3611 0.8085 -0.0869 -0.0432 0.1561  42  PHE B CD1 
3549 C CD2 . PHE B 43  ? 0.4803 0.3976 0.8367 -0.0822 -0.0353 0.1663  42  PHE B CD2 
3550 C CE1 . PHE B 43  ? 0.4783 0.3579 0.7987 -0.0815 -0.0376 0.1522  42  PHE B CE1 
3551 C CE2 . PHE B 43  ? 0.4805 0.3938 0.8272 -0.0778 -0.0306 0.1623  42  PHE B CE2 
3552 C CZ  . PHE B 43  ? 0.4852 0.3800 0.8144 -0.0773 -0.0317 0.1554  42  PHE B CZ  
3553 N N   . MET B 44  ? 0.5532 0.4703 0.9477 -0.1077 -0.0591 0.1781  43  MET B N   
3554 C CA  . MET B 44  ? 0.5752 0.4962 0.9838 -0.1153 -0.0681 0.1804  43  MET B CA  
3555 C C   . MET B 44  ? 0.6343 0.5450 1.0466 -0.1245 -0.0704 0.1809  43  MET B C   
3556 O O   . MET B 44  ? 0.7016 0.6117 1.1236 -0.1329 -0.0794 0.1807  43  MET B O   
3557 C CB  . MET B 44  ? 0.5408 0.4851 0.9704 -0.1131 -0.0670 0.1886  43  MET B CB  
3558 C CG  . MET B 44  ? 0.4518 0.4044 0.8803 -0.1066 -0.0662 0.1876  43  MET B CG  
3559 S SD  . MET B 44  ? 0.5679 0.5080 0.9894 -0.1105 -0.0775 0.1820  43  MET B SD  
3560 C CE  . MET B 44  ? 0.5159 0.4722 0.9481 -0.1040 -0.0757 0.1864  43  MET B CE  
3561 N N   . SER B 45  ? 0.5813 0.4837 0.9868 -0.1232 -0.0622 0.1818  44  SER B N   
3562 C CA  . SER B 45  ? 0.5538 0.4434 0.9614 -0.1320 -0.0619 0.1820  44  SER B CA  
3563 C C   . SER B 45  ? 0.6093 0.4743 0.9993 -0.1381 -0.0671 0.1727  44  SER B C   
3564 O O   . SER B 45  ? 0.6857 0.5387 1.0784 -0.1481 -0.0693 0.1707  44  SER B O   
3565 C CB  . SER B 45  ? 0.5552 0.4423 0.9614 -0.1282 -0.0505 0.1873  44  SER B CB  
3566 O OG  . SER B 45  ? 0.6670 0.5340 1.0513 -0.1253 -0.0461 0.1824  44  SER B OG  
3567 N N   . LEU B 46  ? 0.6097 0.4661 0.9816 -0.1324 -0.0683 0.1667  45  LEU B N   
3568 C CA  . LEU B 46  ? 0.6435 0.4767 0.9985 -0.1376 -0.0740 0.1581  45  LEU B CA  
3569 C C   . LEU B 46  ? 0.7469 0.5868 1.1142 -0.1448 -0.0874 0.1570  45  LEU B C   
3570 O O   . LEU B 46  ? 0.7322 0.5863 1.1054 -0.1398 -0.0917 0.1590  45  LEU B O   
3571 C CB  . LEU B 46  ? 0.5844 0.4060 0.9163 -0.1288 -0.0705 0.1526  45  LEU B CB  
3572 C CG  . LEU B 46  ? 0.5856 0.4087 0.9078 -0.1189 -0.0593 0.1543  45  LEU B CG  
3573 C CD1 . LEU B 46  ? 0.5737 0.3751 0.8704 -0.1148 -0.0567 0.1470  45  LEU B CD1 
3574 C CD2 . LEU B 46  ? 0.5733 0.3964 0.9009 -0.1194 -0.0512 0.1605  45  LEU B CD2 
3575 N N   . PRO B 47  ? 0.7744 0.6038 1.1464 -0.1570 -0.0941 0.1540  46  PRO B N   
3576 C CA  . PRO B 47  ? 0.7433 0.5813 1.1309 -0.1659 -0.1089 0.1537  46  PRO B CA  
3577 C C   . PRO B 47  ? 0.7235 0.5582 1.1012 -0.1617 -0.1178 0.1505  46  PRO B C   
3578 O O   . PRO B 47  ? 0.7596 0.6117 1.1539 -0.1628 -0.1275 0.1551  46  PRO B O   
3579 C CB  . PRO B 47  ? 0.7781 0.5969 1.1632 -0.1799 -0.1129 0.1470  46  PRO B CB  
3580 C CG  . PRO B 47  ? 0.8147 0.6089 1.1760 -0.1761 -0.0998 0.1429  46  PRO B CG  
3581 C CD  . PRO B 47  ? 0.7876 0.5954 1.1500 -0.1637 -0.0879 0.1503  46  PRO B CD  
3582 N N   . GLU B 48  ? 0.7251 0.5376 1.0766 -0.1566 -0.1139 0.1437  47  GLU B N   
3583 C CA  . GLU B 48  ? 0.7201 0.5250 1.0595 -0.1521 -0.1210 0.1404  47  GLU B CA  
3584 C C   . GLU B 48  ? 0.6860 0.5105 1.0325 -0.1413 -0.1180 0.1462  47  GLU B C   
3585 O O   . GLU B 48  ? 0.6906 0.5134 1.0342 -0.1385 -0.1247 0.1461  47  GLU B O   
3586 C CB  . GLU B 48  ? 0.6934 0.4694 1.0019 -0.1477 -0.1145 0.1321  47  GLU B CB  
3587 C CG  . GLU B 48  ? 0.7196 0.4707 1.0172 -0.1586 -0.1180 0.1249  47  GLU B CG  
3588 C CD  . GLU B 48  ? 0.7215 0.4668 1.0181 -0.1609 -0.1053 0.1254  47  GLU B CD  
3589 O OE1 . GLU B 48  ? 0.6992 0.4581 0.9997 -0.1526 -0.0945 0.1312  47  GLU B OE1 
3590 O OE2 . GLU B 48  ? 0.7477 0.4739 1.0393 -0.1714 -0.1062 0.1201  47  GLU B OE2 
3591 N N   . LEU B 49  ? 0.6567 0.4984 1.0123 -0.1356 -0.1075 0.1514  48  LEU B N   
3592 C CA  . LEU B 49  ? 0.5908 0.4494 0.9518 -0.1258 -0.1022 0.1555  48  LEU B CA  
3593 C C   . LEU B 49  ? 0.6312 0.5142 1.0195 -0.1282 -0.1081 0.1644  48  LEU B C   
3594 O O   . LEU B 49  ? 0.5756 0.4707 0.9694 -0.1212 -0.1053 0.1680  48  LEU B O   
3595 C CB  . LEU B 49  ? 0.5118 0.3757 0.8674 -0.1183 -0.0883 0.1559  48  LEU B CB  
3596 C CG  . LEU B 49  ? 0.5074 0.3588 0.8401 -0.1097 -0.0798 0.1496  48  LEU B CG  
3597 C CD1 . LEU B 49  ? 0.5293 0.3538 0.8403 -0.1123 -0.0818 0.1424  48  LEU B CD1 
3598 C CD2 . LEU B 49  ? 0.4954 0.3548 0.8276 -0.1044 -0.0687 0.1514  48  LEU B CD2 
3599 N N   . GLN B 50  ? 0.6472 0.6234 1.0303 -0.1597 -0.1265 0.1739  49  GLN B N   
3600 C CA  . GLN B 50  ? 0.6476 0.6777 1.0818 -0.1628 -0.1249 0.1854  49  GLN B CA  
3601 C C   . GLN B 50  ? 0.7006 0.7624 1.1472 -0.1574 -0.1440 0.1801  49  GLN B C   
3602 O O   . GLN B 50  ? 0.6663 0.7711 1.1409 -0.1463 -0.1368 0.1901  49  GLN B O   
3603 C CB  . GLN B 50  ? 0.6256 0.6638 1.0958 -0.1864 -0.1241 0.1928  49  GLN B CB  
3604 C CG  . GLN B 50  ? 0.6389 0.6614 1.1017 -0.1825 -0.0968 0.2020  49  GLN B CG  
3605 C CD  . GLN B 50  ? 0.6823 0.6925 1.1559 -0.2027 -0.0959 0.2010  49  GLN B CD  
3606 O OE1 . GLN B 50  ? 0.7093 0.7172 1.1912 -0.2214 -0.1175 0.1918  49  GLN B OE1 
3607 N NE2 . GLN B 50  ? 0.6925 0.6934 1.1642 -0.1992 -0.0715 0.2103  49  GLN B NE2 
3608 N N   . GLN B 51  ? 0.7218 0.7601 1.1438 -0.1625 -0.1667 0.1653  50  GLN B N   
3609 C CA  . GLN B 51  ? 0.6689 0.7345 1.0978 -0.1553 -0.1853 0.1603  50  GLN B CA  
3610 C C   . GLN B 51  ? 0.6234 0.6673 1.0065 -0.1313 -0.1844 0.1508  50  GLN B C   
3611 O O   . GLN B 51  ? 0.6309 0.6798 1.0042 -0.1247 -0.2014 0.1432  50  GLN B O   
3612 C CB  . GLN B 51  ? 0.7496 0.8134 1.1894 -0.1784 -0.2149 0.1519  50  GLN B CB  
3613 C CG  . GLN B 51  ? 0.8055 0.8981 1.2966 -0.2033 -0.2173 0.1623  50  GLN B CG  
3614 C CD  . GLN B 51  ? 0.7946 0.9445 1.3322 -0.1925 -0.1979 0.1814  50  GLN B CD  
3615 O OE1 . GLN B 51  ? 0.7827 0.9674 1.3321 -0.1747 -0.1979 0.1865  50  GLN B OE1 
3616 N NE2 . GLN B 51  ? 0.8162 0.9730 1.3769 -0.2012 -0.1799 0.1926  50  GLN B NE2 
3617 N N   . ASN B 52  ? 0.5344 0.5556 0.8912 -0.1182 -0.1644 0.1527  51  ASN B N   
3618 C CA  . ASN B 52  ? 0.4580 0.4628 0.7785 -0.0967 -0.1606 0.1470  51  ASN B CA  
3619 C C   . ASN B 52  ? 0.4035 0.4413 0.7383 -0.0801 -0.1473 0.1550  51  ASN B C   
3620 O O   . ASN B 52  ? 0.4199 0.4659 0.7636 -0.0774 -0.1294 0.1639  51  ASN B O   
3621 C CB  . ASN B 52  ? 0.4489 0.4117 0.7335 -0.0928 -0.1483 0.1457  51  ASN B CB  
3622 C CG  . ASN B 52  ? 0.4511 0.3922 0.6984 -0.0744 -0.1482 0.1400  51  ASN B CG  
3623 O OD1 . ASN B 52  ? 0.4588 0.4185 0.7076 -0.0609 -0.1475 0.1401  51  ASN B OD1 
3624 N ND2 . ASN B 52  ? 0.4369 0.3373 0.6506 -0.0730 -0.1469 0.1366  51  ASN B ND2 
3625 N N   . PRO B 53  ? 0.3794 0.4326 0.7123 -0.0675 -0.1555 0.1518  52  PRO B N   
3626 C CA  . PRO B 53  ? 0.3245 0.4035 0.6660 -0.0503 -0.1431 0.1585  52  PRO B CA  
3627 C C   . PRO B 53  ? 0.3585 0.4143 0.6687 -0.0365 -0.1279 0.1575  52  PRO B C   
3628 O O   . PRO B 53  ? 0.3775 0.4463 0.6886 -0.0236 -0.1161 0.1622  52  PRO B O   
3629 C CB  . PRO B 53  ? 0.3272 0.4190 0.6672 -0.0406 -0.1577 0.1539  52  PRO B CB  
3630 C CG  . PRO B 53  ? 0.3453 0.4032 0.6566 -0.0458 -0.1733 0.1423  52  PRO B CG  
3631 C CD  . PRO B 53  ? 0.3599 0.4021 0.6768 -0.0668 -0.1763 0.1415  52  PRO B CD  
3632 N N   . LEU B 54  ? 0.3921 0.4137 0.6741 -0.0389 -0.1283 0.1520  53  LEU B N   
3633 C CA  . LEU B 54  ? 0.3618 0.3655 0.6180 -0.0279 -0.1172 0.1520  53  LEU B CA  
3634 C C   . LEU B 54  ? 0.3972 0.3921 0.6494 -0.0325 -0.1043 0.1579  53  LEU B C   
3635 O O   . LEU B 54  ? 0.3874 0.3720 0.6210 -0.0249 -0.0969 0.1590  53  LEU B O   
3636 C CB  . LEU B 54  ? 0.3487 0.3248 0.5761 -0.0217 -0.1245 0.1452  53  LEU B CB  
3637 C CG  . LEU B 54  ? 0.3402 0.3231 0.5633 -0.0094 -0.1310 0.1412  53  LEU B CG  
3638 C CD1 . LEU B 54  ? 0.3545 0.3109 0.5518 -0.0035 -0.1391 0.1356  53  LEU B CD1 
3639 C CD2 . LEU B 54  ? 0.3192 0.3074 0.5374 0.0020  -0.1196 0.1439  53  LEU B CD2 
3640 N N   . VAL B 55  ? 0.3571 0.3561 0.6269 -0.0452 -0.1021 0.1624  54  VAL B N   
3641 C CA  . VAL B 55  ? 0.3210 0.3099 0.5854 -0.0482 -0.0888 0.1693  54  VAL B CA  
3642 C C   . VAL B 55  ? 0.3656 0.3632 0.6222 -0.0367 -0.0760 0.1744  54  VAL B C   
3643 O O   . VAL B 55  ? 0.4470 0.4294 0.6820 -0.0323 -0.0711 0.1757  54  VAL B O   
3644 C CB  . VAL B 55  ? 0.3309 0.3281 0.6214 -0.0624 -0.0846 0.1759  54  VAL B CB  
3645 C CG1 . VAL B 55  ? 0.3338 0.3230 0.6173 -0.0610 -0.0677 0.1849  54  VAL B CG1 
3646 C CG2 . VAL B 55  ? 0.3499 0.3267 0.6385 -0.0763 -0.0977 0.1697  54  VAL B CG2 
3647 N N   . GLN B 56  ? 0.3399 0.3610 0.6120 -0.0308 -0.0712 0.1776  55  GLN B N   
3648 C CA  . GLN B 56  ? 0.3078 0.3315 0.5661 -0.0190 -0.0592 0.1815  55  GLN B CA  
3649 C C   . GLN B 56  ? 0.3062 0.3127 0.5344 -0.0105 -0.0635 0.1742  55  GLN B C   
3650 O O   . GLN B 56  ? 0.3112 0.3087 0.5196 -0.0063 -0.0578 0.1759  55  GLN B O   
3651 C CB  . GLN B 56  ? 0.3224 0.3709 0.5994 -0.0111 -0.0508 0.1877  55  GLN B CB  
3652 C CG  . GLN B 56  ? 0.3729 0.4168 0.6278 0.0027  -0.0372 0.1913  55  GLN B CG  
3653 C CD  . GLN B 56  ? 0.3979 0.4374 0.6482 0.0009  -0.0256 0.1993  55  GLN B CD  
3654 O OE1 . GLN B 56  ? 0.3988 0.4508 0.6754 -0.0068 -0.0192 0.2082  55  GLN B OE1 
3655 N NE2 . GLN B 56  ? 0.3537 0.3754 0.5708 0.0075  -0.0233 0.1969  55  GLN B NE2 
3656 N N   . ARG B 57  ? 0.3023 0.3045 0.5272 -0.0084 -0.0739 0.1670  56  ARG B N   
3657 C CA  . ARG B 57  ? 0.3028 0.2876 0.5030 -0.0027 -0.0776 0.1616  56  ARG B CA  
3658 C C   . ARG B 57  ? 0.3020 0.2716 0.4891 -0.0078 -0.0789 0.1635  56  ARG B C   
3659 O O   . ARG B 57  ? 0.3051 0.2672 0.4756 -0.0055 -0.0777 0.1641  56  ARG B O   
3660 C CB  . ARG B 57  ? 0.3007 0.2821 0.5003 0.0013  -0.0869 0.1554  56  ARG B CB  
3661 C CG  . ARG B 57  ? 0.3029 0.3005 0.5133 0.0098  -0.0856 0.1550  56  ARG B CG  
3662 C CD  . ARG B 57  ? 0.3127 0.3073 0.5086 0.0198  -0.0752 0.1559  56  ARG B CD  
3663 N NE  . ARG B 57  ? 0.3194 0.2896 0.4884 0.0218  -0.0770 0.1506  56  ARG B NE  
3664 C CZ  . ARG B 57  ? 0.3287 0.2863 0.4788 0.0202  -0.0736 0.1505  56  ARG B CZ  
3665 N NH1 . ARG B 57  ? 0.3439 0.3091 0.4952 0.0194  -0.0662 0.1554  56  ARG B NH1 
3666 N NH2 . ARG B 57  ? 0.3364 0.2741 0.4668 0.0190  -0.0779 0.1461  56  ARG B NH2 
3667 N N   . VAL B 58  ? 0.3016 0.2659 0.4953 -0.0145 -0.0815 0.1651  57  VAL B N   
3668 C CA  . VAL B 58  ? 0.3037 0.2538 0.4850 -0.0163 -0.0802 0.1696  57  VAL B CA  
3669 C C   . VAL B 58  ? 0.3063 0.2614 0.4831 -0.0161 -0.0712 0.1768  57  VAL B C   
3670 O O   . VAL B 58  ? 0.3111 0.2639 0.4736 -0.0137 -0.0707 0.1783  57  VAL B O   
3671 C CB  . VAL B 58  ? 0.3115 0.2491 0.4955 -0.0222 -0.0821 0.1702  57  VAL B CB  
3672 C CG1 . VAL B 58  ? 0.3172 0.2462 0.4838 -0.0211 -0.0733 0.1711  57  VAL B CG1 
3673 C CG2 . VAL B 58  ? 0.3145 0.2424 0.4942 -0.0200 -0.0925 0.1630  57  VAL B CG2 
3674 N N   . ILE B 59  ? 0.3098 0.2750 0.4988 -0.0185 -0.0635 0.1803  58  ILE B N   
3675 C CA  . ILE B 59  ? 0.3162 0.2858 0.4989 -0.0157 -0.0534 0.1879  58  ILE B CA  
3676 C C   . ILE B 59  ? 0.3201 0.2914 0.4846 -0.0085 -0.0549 0.1852  58  ILE B C   
3677 O O   . ILE B 59  ? 0.3266 0.2955 0.4756 -0.0063 -0.0539 0.1896  58  ILE B O   
3678 C CB  . ILE B 59  ? 0.3211 0.3024 0.5223 -0.0178 -0.0431 0.1931  58  ILE B CB  
3679 C CG1 . ILE B 59  ? 0.3249 0.2990 0.5407 -0.0281 -0.0421 0.1961  58  ILE B CG1 
3680 C CG2 . ILE B 59  ? 0.3313 0.3161 0.5215 -0.0109 -0.0314 0.2011  58  ILE B CG2 
3681 C CD1 . ILE B 59  ? 0.3303 0.3179 0.5720 -0.0338 -0.0334 0.2023  58  ILE B CD1 
3682 N N   . ASP B 60  ? 0.3203 0.2938 0.4844 -0.0047 -0.0579 0.1783  59  ASP B N   
3683 C CA  . ASP B 60  ? 0.3328 0.2999 0.4739 0.0016  -0.0592 0.1743  59  ASP B CA  
3684 C C   . ASP B 60  ? 0.3321 0.2889 0.4595 -0.0022 -0.0699 0.1717  59  ASP B C   
3685 O O   . ASP B 60  ? 0.3631 0.3141 0.4703 -0.0015 -0.0733 0.1709  59  ASP B O   
3686 C CB  . ASP B 60  ? 0.3643 0.3315 0.5050 0.0085  -0.0580 0.1684  59  ASP B CB  
3687 C CG  . ASP B 60  ? 0.5561 0.5368 0.7081 0.0152  -0.0451 0.1743  59  ASP B CG  
3688 O OD1 . ASP B 60  ? 0.6719 0.6563 0.8221 0.0163  -0.0363 0.1817  59  ASP B OD1 
3689 O OD2 . ASP B 60  ? 0.6079 0.5972 0.7720 0.0206  -0.0428 0.1734  59  ASP B OD2 
3690 N N   . ILE B 61  ? 0.3193 0.2735 0.4572 -0.0061 -0.0758 0.1710  60  ILE B N   
3691 C CA  . ILE B 61  ? 0.3182 0.2664 0.4488 -0.0092 -0.0837 0.1724  60  ILE B CA  
3692 C C   . ILE B 61  ? 0.3431 0.2981 0.4708 -0.0113 -0.0816 0.1808  60  ILE B C   
3693 O O   . ILE B 61  ? 0.3722 0.3290 0.4909 -0.0136 -0.0879 0.1834  60  ILE B O   
3694 C CB  . ILE B 61  ? 0.3082 0.2530 0.4454 -0.0096 -0.0859 0.1667  60  ILE B CB  
3695 C CG1 . ILE B 61  ? 0.3099 0.2481 0.4494 -0.0053 -0.0891 0.1617  60  ILE B CG1 
3696 C CG2 . ILE B 61  ? 0.3080 0.2530 0.4392 -0.0123 -0.0888 0.1659  60  ILE B CG2 
3697 C CD1 . ILE B 61  ? 0.3029 0.2398 0.4475 -0.0034 -0.0894 0.1553  60  ILE B CD1 
3698 N N   . PHE B 62  ? 0.3154 0.2747 0.4503 -0.0107 -0.0727 0.1842  61  PHE B N   
3699 C CA  . PHE B 62  ? 0.4008 0.3665 0.5305 -0.0098 -0.0668 0.1906  61  PHE B CA  
3700 C C   . PHE B 62  ? 0.3614 0.3317 0.4797 -0.0072 -0.0679 0.1991  61  PHE B C   
3701 O O   . PHE B 62  ? 0.3963 0.3744 0.5062 -0.0067 -0.0708 0.2041  61  PHE B O   
3702 C CB  . PHE B 62  ? 0.3194 0.2818 0.4558 -0.0095 -0.0561 0.1925  61  PHE B CB  
3703 C CG  . PHE B 62  ? 0.3164 0.2704 0.4526 -0.0099 -0.0550 0.1861  61  PHE B CG  
3704 C CD1 . PHE B 62  ? 0.3100 0.2607 0.4460 -0.0101 -0.0620 0.1784  61  PHE B CD1 
3705 C CD2 . PHE B 62  ? 0.3255 0.2708 0.4574 -0.0086 -0.0459 0.1883  61  PHE B CD2 
3706 C CE1 . PHE B 62  ? 0.3131 0.2528 0.4430 -0.0077 -0.0597 0.1737  61  PHE B CE1 
3707 C CE2 . PHE B 62  ? 0.3312 0.2620 0.4549 -0.0069 -0.0446 0.1830  61  PHE B CE2 
3708 C CZ  . PHE B 62  ? 0.3251 0.2536 0.4471 -0.0059 -0.0515 0.1760  61  PHE B CZ  
3709 N N   . ASP B 63  ? 0.2321 0.4110 0.4516 0.0404  -0.0371 0.1740  62  ASP B N   
3710 C CA  . ASP B 63  ? 0.2501 0.4435 0.4652 0.0500  -0.0268 0.1749  62  ASP B CA  
3711 C C   . ASP B 63  ? 0.2401 0.4313 0.4385 0.0519  -0.0201 0.1575  62  ASP B C   
3712 O O   . ASP B 63  ? 0.2813 0.4699 0.4815 0.0558  -0.0132 0.1572  62  ASP B O   
3713 C CB  . ASP B 63  ? 0.2322 0.4332 0.4660 0.0552  -0.0214 0.1922  62  ASP B CB  
3714 C CG  . ASP B 63  ? 0.2898 0.5058 0.5178 0.0668  -0.0088 0.1939  62  ASP B CG  
3715 O OD1 . ASP B 63  ? 0.3279 0.5512 0.5384 0.0717  -0.0061 0.1850  62  ASP B OD1 
3716 O OD2 . ASP B 63  ? 0.2677 0.4896 0.5084 0.0723  -0.0016 0.2038  62  ASP B OD2 
3717 N N   . THR B 64  ? 0.2499 0.4421 0.4342 0.0492  -0.0226 0.1426  63  THR B N   
3718 C CA  . THR B 64  ? 0.2457 0.4345 0.4176 0.0479  -0.0182 0.1242  63  THR B CA  
3719 C C   . THR B 64  ? 0.2565 0.4583 0.4185 0.0584  -0.0108 0.1170  63  THR B C   
3720 O O   . THR B 64  ? 0.3084 0.5043 0.4645 0.0586  -0.0060 0.1039  63  THR B O   
3721 C CB  . THR B 64  ? 0.2427 0.4299 0.4067 0.0397  -0.0236 0.1094  63  THR B CB  
3722 O OG1 . THR B 64  ? 0.2388 0.4381 0.4014 0.0427  -0.0292 0.1123  63  THR B OG1 
3723 C CG2 . THR B 64  ? 0.2397 0.4100 0.4075 0.0294  -0.0274 0.1107  63  THR B CG2 
3724 N N   . ASP B 65  ? 0.2604 0.4789 0.4196 0.0674  -0.0099 0.1250  64  ASP B N   
3725 C CA  . ASP B 65  ? 0.3171 0.5497 0.4633 0.0796  -0.0027 0.1190  64  ASP B CA  
3726 C C   . ASP B 65  ? 0.3765 0.6103 0.5288 0.0882  0.0073  0.1300  64  ASP B C   
3727 O O   . ASP B 65  ? 0.4686 0.7098 0.6090 0.0985  0.0147  0.1218  64  ASP B O   
3728 C CB  . ASP B 65  ? 0.2746 0.5257 0.4105 0.0880  -0.0049 0.1226  64  ASP B CB  
3729 C CG  . ASP B 65  ? 0.4199 0.6766 0.5671 0.0921  -0.0033 0.1474  64  ASP B CG  
3730 O OD1 . ASP B 65  ? 0.3275 0.5813 0.4888 0.0928  0.0025  0.1618  64  ASP B OD1 
3731 O OD2 . ASP B 65  ? 0.3995 0.6639 0.5431 0.0948  -0.0080 0.1530  64  ASP B OD2 
3732 N N   . GLY B 66  ? 0.3070 0.5350 0.4783 0.0845  0.0070  0.1478  65  GLY B N   
3733 C CA  . GLY B 66  ? 0.3007 0.5299 0.4830 0.0912  0.0157  0.1582  65  GLY B CA  
3734 C C   . GLY B 66  ? 0.3208 0.5686 0.5129 0.1006  0.0231  0.1791  65  GLY B C   
3735 O O   . GLY B 66  ? 0.3855 0.6385 0.5879 0.1078  0.0321  0.1877  65  GLY B O   
3736 N N   . ASN B 67  ? 0.3079 0.5656 0.4984 0.1010  0.0201  0.1884  66  ASN B N   
3737 C CA  . ASN B 67  ? 0.2961 0.5715 0.4951 0.1100  0.0290  0.2100  66  ASN B CA  
3738 C C   . ASN B 67  ? 0.3079 0.5834 0.5386 0.1032  0.0274  0.2329  66  ASN B C   
3739 O O   . ASN B 67  ? 0.3205 0.6100 0.5616 0.1080  0.0340  0.2527  66  ASN B O   
3740 C CB  . ASN B 67  ? 0.3086 0.5960 0.4899 0.1168  0.0290  0.2119  66  ASN B CB  
3741 C CG  . ASN B 67  ? 0.3728 0.6526 0.5629 0.1072  0.0175  0.2190  66  ASN B CG  
3742 O OD1 . ASN B 67  ? 0.4038 0.6708 0.6141 0.0957  0.0099  0.2241  66  ASN B OD1 
3743 N ND2 . ASN B 67  ? 0.3033 0.5910 0.4774 0.1133  0.0156  0.2191  66  ASN B ND2 
3744 N N   . GLY B 68  ? 0.2670 0.5270 0.5128 0.0919  0.0180  0.2305  67  GLY B N   
3745 C CA  . GLY B 68  ? 0.2506 0.5113 0.5279 0.0853  0.0145  0.2490  67  GLY B CA  
3746 C C   . GLY B 68  ? 0.2474 0.4976 0.5313 0.0727  0.0045  0.2541  67  GLY B C   
3747 O O   . GLY B 68  ? 0.2763 0.5204 0.5808 0.0623  0.0008  0.2622  67  GLY B O   
3748 N N   . GLU B 69  ? 0.2640 0.5123 0.5310 0.0739  0.0000  0.2479  68  GLU B N   
3749 C CA  . GLU B 69  ? 0.2478 0.4834 0.5188 0.0634  -0.0092 0.2498  68  GLU B CA  
3750 C C   . GLU B 69  ? 0.2932 0.5167 0.5479 0.0599  -0.0210 0.2321  68  GLU B C   
3751 O O   . GLU B 69  ? 0.2753 0.5029 0.5162 0.0650  -0.0208 0.2203  68  GLU B O   
3752 C CB  . GLU B 69  ? 0.2765 0.5227 0.5462 0.0693  -0.0018 0.2638  68  GLU B CB  
3753 C CG  . GLU B 69  ? 0.3846 0.6471 0.6733 0.0734  0.0122  0.2847  68  GLU B CG  
3754 C CD  . GLU B 69  ? 0.4361 0.7034 0.7351 0.0727  0.0172  0.3031  68  GLU B CD  
3755 O OE1 . GLU B 69  ? 0.5415 0.7978 0.8304 0.0704  0.0095  0.2984  68  GLU B OE1 
3756 O OE2 . GLU B 69  ? 0.4103 0.6929 0.7291 0.0749  0.0293  0.3231  68  GLU B OE2 
3757 N N   . VAL B 70  ? 0.2906 0.4996 0.5487 0.0508  -0.0312 0.2297  69  VAL B N   
3758 C CA  . VAL B 70  ? 0.2353 0.4355 0.4791 0.0487  -0.0412 0.2140  69  VAL B CA  
3759 C C   . VAL B 70  ? 0.2419 0.4428 0.4766 0.0527  -0.0434 0.2138  69  VAL B C   
3760 O O   . VAL B 70  ? 0.2491 0.4409 0.4938 0.0485  -0.0465 0.2216  69  VAL B O   
3761 C CB  . VAL B 70  ? 0.2427 0.4248 0.4940 0.0373  -0.0529 0.2078  69  VAL B CB  
3762 C CG1 . VAL B 70  ? 0.2272 0.4046 0.4637 0.0370  -0.0611 0.1928  69  VAL B CG1 
3763 C CG2 . VAL B 70  ? 0.2279 0.4082 0.4878 0.0339  -0.0518 0.2088  69  VAL B CG2 
3764 N N   . ASP B 71  ? 0.2409 0.4537 0.4582 0.0614  -0.0423 0.2050  70  ASP B N   
3765 C CA  . ASP B 71  ? 0.2606 0.4747 0.4679 0.0666  -0.0453 0.2036  70  ASP B CA  
3766 C C   . ASP B 71  ? 0.2976 0.5016 0.5019 0.0615  -0.0569 0.1894  70  ASP B C   
3767 O O   . ASP B 71  ? 0.2970 0.4938 0.5055 0.0540  -0.0618 0.1819  70  ASP B O   
3768 C CB  . ASP B 71  ? 0.2715 0.5073 0.4616 0.0802  -0.0390 0.2020  70  ASP B CB  
3769 C CG  . ASP B 71  ? 0.3216 0.5622 0.4958 0.0791  -0.0399 0.1786  70  ASP B CG  
3770 O OD1 . ASP B 71  ? 0.4112 0.6494 0.5798 0.0767  -0.0475 0.1653  70  ASP B OD1 
3771 O OD2 . ASP B 71  ? 0.3657 0.6122 0.5338 0.0808  -0.0323 0.1729  70  ASP B OD2 
3772 N N   . PHE B 72  ? 0.2497 0.4536 0.4463 0.0668  -0.0610 0.1866  71  PHE B N   
3773 C CA  . PHE B 72  ? 0.2473 0.4414 0.4434 0.0636  -0.0715 0.1752  71  PHE B CA  
3774 C C   . PHE B 72  ? 0.2368 0.4384 0.4237 0.0608  -0.0733 0.1563  71  PHE B C   
3775 O O   . PHE B 72  ? 0.2691 0.4592 0.4576 0.0538  -0.0791 0.1478  71  PHE B O   
3776 C CB  . PHE B 72  ? 0.2598 0.4525 0.4501 0.0717  -0.0747 0.1761  71  PHE B CB  
3777 C CG  . PHE B 72  ? 0.2600 0.4422 0.4517 0.0704  -0.0853 0.1656  71  PHE B CG  
3778 C CD1 . PHE B 72  ? 0.2605 0.4232 0.4635 0.0617  -0.0920 0.1658  71  PHE B CD1 
3779 C CD2 . PHE B 72  ? 0.2612 0.4550 0.4435 0.0788  -0.0890 0.1547  71  PHE B CD2 
3780 C CE1 . PHE B 72  ? 0.2631 0.4170 0.4665 0.0623  -0.1021 0.1556  71  PHE B CE1 
3781 C CE2 . PHE B 72  ? 0.2622 0.4487 0.4472 0.0793  -0.0981 0.1452  71  PHE B CE2 
3782 C CZ  . PHE B 72  ? 0.2637 0.4295 0.4586 0.0714  -0.1045 0.1458  71  PHE B CZ  
3783 N N   . LYS B 73  ? 0.2361 0.4536 0.4105 0.0650  -0.0669 0.1472  72  LYS B N   
3784 C CA  . LYS B 73  ? 0.2303 0.4516 0.3963 0.0593  -0.0658 0.1275  72  LYS B CA  
3785 C C   . LYS B 73  ? 0.2316 0.4394 0.4024 0.0486  -0.0637 0.1265  72  LYS B C   
3786 O O   . LYS B 73  ? 0.2219 0.4227 0.3907 0.0415  -0.0662 0.1161  72  LYS B O   
3787 C CB  . LYS B 73  ? 0.2336 0.4732 0.3882 0.0650  -0.0600 0.1182  72  LYS B CB  
3788 C CG  . LYS B 73  ? 0.2299 0.4725 0.3798 0.0571  -0.0577 0.0985  72  LYS B CG  
3789 C CD  . LYS B 73  ? 0.2363 0.4921 0.3774 0.0615  -0.0519 0.0904  72  LYS B CD  
3790 C CE  . LYS B 73  ? 0.2522 0.5020 0.3935 0.0511  -0.0474 0.0761  72  LYS B CE  
3791 N NZ  . LYS B 73  ? 0.3284 0.5921 0.4672 0.0481  -0.0498 0.0558  72  LYS B NZ  
3792 N N   . GLU B 74  ? 0.2251 0.4302 0.4021 0.0487  -0.0587 0.1385  73  GLU B N   
3793 C CA  . GLU B 74  ? 0.2220 0.4155 0.4038 0.0409  -0.0568 0.1392  73  GLU B CA  
3794 C C   . GLU B 74  ? 0.2208 0.3996 0.4124 0.0350  -0.0653 0.1456  73  GLU B C   
3795 O O   . GLU B 74  ? 0.2201 0.3885 0.4116 0.0283  -0.0667 0.1428  73  GLU B O   
3796 C CB  . GLU B 74  ? 0.2239 0.4209 0.4122 0.0446  -0.0492 0.1509  73  GLU B CB  
3797 C CG  . GLU B 74  ? 0.2295 0.4417 0.4070 0.0532  -0.0413 0.1461  73  GLU B CG  
3798 C CD  . GLU B 74  ? 0.3018 0.5190 0.4851 0.0590  -0.0328 0.1584  73  GLU B CD  
3799 O OE1 . GLU B 74  ? 0.2323 0.4470 0.4312 0.0585  -0.0338 0.1756  73  GLU B OE1 
3800 O OE2 . GLU B 74  ? 0.3007 0.5247 0.4742 0.0639  -0.0253 0.1503  73  GLU B OE2 
3801 N N   . PHE B 75  ? 0.2235 0.4006 0.4231 0.0380  -0.0714 0.1547  74  PHE B N   
3802 C CA  . PHE B 75  ? 0.2259 0.3884 0.4347 0.0331  -0.0818 0.1580  74  PHE B CA  
3803 C C   . PHE B 75  ? 0.2271 0.3844 0.4231 0.0305  -0.0868 0.1415  74  PHE B C   
3804 O O   . PHE B 75  ? 0.2350 0.3816 0.4286 0.0246  -0.0912 0.1371  74  PHE B O   
3805 C CB  . PHE B 75  ? 0.2333 0.3921 0.4525 0.0364  -0.0853 0.1691  74  PHE B CB  
3806 C CG  . PHE B 75  ? 0.2409 0.3810 0.4681 0.0305  -0.0958 0.1686  74  PHE B CG  
3807 C CD1 . PHE B 75  ? 0.2426 0.3737 0.4814 0.0228  -0.0986 0.1738  74  PHE B CD1 
3808 C CD2 . PHE B 75  ? 0.2478 0.3807 0.4720 0.0334  -0.1041 0.1620  74  PHE B CD2 
3809 C CE1 . PHE B 75  ? 0.2516 0.3669 0.4989 0.0174  -0.1106 0.1721  74  PHE B CE1 
3810 C CE2 . PHE B 75  ? 0.2574 0.3726 0.4897 0.0289  -0.1154 0.1604  74  PHE B CE2 
3811 C CZ  . PHE B 75  ? 0.2596 0.3661 0.5034 0.0205  -0.1193 0.1652  74  PHE B CZ  
3812 N N   . ILE B 76  ? 0.2278 0.3944 0.4153 0.0359  -0.0857 0.1327  75  ILE B N   
3813 C CA  . ILE B 76  ? 0.2290 0.3956 0.4057 0.0344  -0.0879 0.1166  75  ILE B CA  
3814 C C   . ILE B 76  ? 0.2260 0.3929 0.3944 0.0272  -0.0816 0.1079  75  ILE B C   
3815 O O   . ILE B 76  ? 0.2299 0.3880 0.3926 0.0225  -0.0842 0.1023  75  ILE B O   
3816 C CB  . ILE B 76  ? 0.2291 0.4113 0.4002 0.0418  -0.0863 0.1080  75  ILE B CB  
3817 C CG1 . ILE B 76  ? 0.2364 0.4151 0.4139 0.0502  -0.0933 0.1161  75  ILE B CG1 
3818 C CG2 . ILE B 76  ? 0.2291 0.4162 0.3916 0.0390  -0.0854 0.0910  75  ILE B CG2 
3819 C CD1 . ILE B 76  ? 0.2444 0.4048 0.4263 0.0487  -0.1030 0.1157  75  ILE B CD1 
3820 N N   . GLU B 77  ? 0.2221 0.3980 0.3888 0.0267  -0.0731 0.1070  76  GLU B N   
3821 C CA  . GLU B 77  ? 0.2531 0.4272 0.4134 0.0195  -0.0665 0.0987  76  GLU B CA  
3822 C C   . GLU B 77  ? 0.2607 0.4185 0.4220 0.0141  -0.0678 0.1064  76  GLU B C   
3823 O O   . GLU B 77  ? 0.3281 0.4795 0.4819 0.0082  -0.0648 0.1010  76  GLU B O   
3824 C CB  . GLU B 77  ? 0.2211 0.4060 0.3802 0.0206  -0.0582 0.0943  76  GLU B CB  
3825 C CG  . GLU B 77  ? 0.2204 0.4240 0.3763 0.0249  -0.0576 0.0823  76  GLU B CG  
3826 C CD  . GLU B 77  ? 0.2529 0.4663 0.4063 0.0249  -0.0508 0.0740  76  GLU B CD  
3827 O OE1 . GLU B 77  ? 0.2850 0.4895 0.4391 0.0233  -0.0459 0.0789  76  GLU B OE1 
3828 O OE2 . GLU B 77  ? 0.2364 0.4665 0.3878 0.0270  -0.0511 0.0614  76  GLU B OE2 
3829 N N   . GLY B 78  ? 0.2248 0.3769 0.3963 0.0162  -0.0722 0.1200  77  GLY B N   
3830 C CA  . GLY B 78  ? 0.2286 0.3678 0.4037 0.0124  -0.0759 0.1280  77  GLY B CA  
3831 C C   . GLY B 78  ? 0.2356 0.3646 0.4050 0.0099  -0.0856 0.1246  77  GLY B C   
3832 O O   . GLY B 78  ? 0.2425 0.3639 0.4015 0.0060  -0.0851 0.1212  77  GLY B O   
3833 N N   . VAL B 79  ? 0.2369 0.3649 0.4119 0.0128  -0.0942 0.1253  78  VAL B N   
3834 C CA  . VAL B 79  ? 0.2469 0.3649 0.4148 0.0121  -0.1041 0.1188  78  VAL B CA  
3835 C C   . VAL B 79  ? 0.2573 0.3774 0.4065 0.0109  -0.0989 0.1053  78  VAL B C   
3836 O O   . VAL B 79  ? 0.3604 0.4717 0.4981 0.0094  -0.1036 0.1013  78  VAL B O   
3837 C CB  . VAL B 79  ? 0.2499 0.3658 0.4263 0.0165  -0.1126 0.1188  78  VAL B CB  
3838 C CG1 . VAL B 79  ? 0.2639 0.3674 0.4323 0.0167  -0.1238 0.1102  78  VAL B CG1 
3839 C CG2 . VAL B 79  ? 0.2473 0.3617 0.4449 0.0165  -0.1165 0.1341  78  VAL B CG2 
3840 N N   . SER B 80  ? 0.2452 0.3783 0.3915 0.0116  -0.0892 0.0984  79  SER B N   
3841 C CA  . SER B 80  ? 0.2497 0.3884 0.3830 0.0096  -0.0827 0.0862  79  SER B CA  
3842 C C   . SER B 80  ? 0.2575 0.3882 0.3803 0.0031  -0.0768 0.0877  79  SER B C   
3843 O O   . SER B 80  ? 0.2674 0.3979 0.3773 0.0012  -0.0732 0.0809  79  SER B O   
3844 C CB  . SER B 80  ? 0.2413 0.3980 0.3782 0.0111  -0.0750 0.0783  79  SER B CB  
3845 O OG  . SER B 80  ? 0.2933 0.4580 0.4233 0.0063  -0.0661 0.0682  79  SER B OG  
3846 N N   . GLN B 81  ? 0.2556 0.3795 0.3836 0.0007  -0.0754 0.0976  80  GLN B N   
3847 C CA  . GLN B 81  ? 0.2694 0.3827 0.3879 -0.0039 -0.0711 0.1019  80  GLN B CA  
3848 C C   . GLN B 81  ? 0.3250 0.4280 0.4304 -0.0027 -0.0799 0.1028  80  GLN B C   
3849 O O   . GLN B 81  ? 0.3830 0.4789 0.4740 -0.0052 -0.0758 0.1042  80  GLN B O   
3850 C CB  . GLN B 81  ? 0.2632 0.3704 0.3919 -0.0038 -0.0710 0.1134  80  GLN B CB  
3851 C CG  . GLN B 81  ? 0.2525 0.3685 0.3917 -0.0033 -0.0627 0.1125  80  GLN B CG  
3852 C CD  . GLN B 81  ? 0.3411 0.4624 0.4747 -0.0081 -0.0515 0.1017  80  GLN B CD  
3853 O OE1 . GLN B 81  ? 0.4417 0.5536 0.5690 -0.0132 -0.0445 0.1023  80  GLN B OE1 
3854 N NE2 . GLN B 81  ? 0.3113 0.4479 0.4483 -0.0066 -0.0501 0.0921  80  GLN B NE2 
3855 N N   . PHE B 82  ? 0.3334 0.4348 0.4433 0.0015  -0.0923 0.1020  81  PHE B N   
3856 C CA  . PHE B 82  ? 0.3410 0.4320 0.4397 0.0037  -0.1041 0.1010  81  PHE B CA  
3857 C C   . PHE B 82  ? 0.3634 0.4571 0.4505 0.0076  -0.1064 0.0881  81  PHE B C   
3858 O O   . PHE B 82  ? 0.4056 0.4907 0.4831 0.0109  -0.1177 0.0840  81  PHE B O   
3859 C CB  . PHE B 82  ? 0.3416 0.4269 0.4571 0.0051  -0.1183 0.1087  81  PHE B CB  
3860 C CG  . PHE B 82  ? 0.3767 0.4597 0.5026 0.0029  -0.1178 0.1215  81  PHE B CG  
3861 C CD1 . PHE B 82  ? 0.3759 0.4663 0.5156 0.0020  -0.1078 0.1276  81  PHE B CD1 
3862 C CD2 . PHE B 82  ? 0.3794 0.4538 0.5002 0.0031  -0.1275 0.1268  81  PHE B CD2 
3863 C CE1 . PHE B 82  ? 0.3837 0.4724 0.5332 0.0017  -0.1065 0.1387  81  PHE B CE1 
3864 C CE2 . PHE B 82  ? 0.4401 0.5138 0.5720 0.0026  -0.1271 0.1388  81  PHE B CE2 
3865 C CZ  . PHE B 82  ? 0.4229 0.5036 0.5698 0.0020  -0.1160 0.1448  81  PHE B CZ  
3866 N N   . SER B 83  ? 0.3941 0.5004 0.4826 0.0079  -0.0963 0.0805  82  SER B N   
3867 C CA  . SER B 83  ? 0.3992 0.5108 0.4788 0.0130  -0.0970 0.0679  82  SER B CA  
3868 C C   . SER B 83  ? 0.4416 0.5498 0.4976 0.0133  -0.0935 0.0635  82  SER B C   
3869 O O   . SER B 83  ? 0.4042 0.5102 0.4515 0.0082  -0.0853 0.0700  82  SER B O   
3870 C CB  . SER B 83  ? 0.3855 0.5152 0.4732 0.0133  -0.0863 0.0611  82  SER B CB  
3871 O OG  . SER B 83  ? 0.4232 0.5591 0.5057 0.0203  -0.0882 0.0492  82  SER B OG  
3872 N N   . VAL B 84  ? 0.5648 0.6718 0.6096 0.0203  -0.0995 0.0528  83  VAL B N   
3873 C CA  . VAL B 84  ? 0.5869 0.6927 0.6059 0.0230  -0.0956 0.0476  83  VAL B CA  
3874 C C   . VAL B 84  ? 0.5360 0.6583 0.5512 0.0190  -0.0759 0.0458  83  VAL B C   
3875 O O   . VAL B 84  ? 0.5197 0.6424 0.5146 0.0187  -0.0675 0.0464  83  VAL B O   
3876 C CB  . VAL B 84  ? 0.6291 0.7309 0.6375 0.0331  -0.1059 0.0339  83  VAL B CB  
3877 C CG1 . VAL B 84  ? 0.6641 0.7500 0.6847 0.0353  -0.1256 0.0348  83  VAL B CG1 
3878 C CG2 . VAL B 84  ? 0.5955 0.7135 0.6119 0.0379  -0.0979 0.0233  83  VAL B CG2 
3879 N N   . LYS B 85  ? 0.4393 0.5755 0.4746 0.0158  -0.0687 0.0440  84  LYS B N   
3880 C CA  . LYS B 85  ? 0.3624 0.5171 0.4012 0.0107  -0.0515 0.0404  84  LYS B CA  
3881 C C   . LYS B 85  ? 0.4077 0.5607 0.4547 -0.0004 -0.0418 0.0504  84  LYS B C   
3882 O O   . LYS B 85  ? 0.4186 0.5854 0.4734 -0.0071 -0.0282 0.0479  84  LYS B O   
3883 C CB  . LYS B 85  ? 0.3283 0.5016 0.3847 0.0149  -0.0510 0.0302  84  LYS B CB  
3884 C CG  . LYS B 85  ? 0.3330 0.5086 0.3825 0.0269  -0.0581 0.0189  84  LYS B CG  
3885 C CD  . LYS B 85  ? 0.3227 0.5079 0.3913 0.0329  -0.0642 0.0136  84  LYS B CD  
3886 C CE  . LYS B 85  ? 0.3285 0.5242 0.3942 0.0446  -0.0649 0.0003  84  LYS B CE  
3887 N NZ  . LYS B 85  ? 0.3150 0.5184 0.3996 0.0511  -0.0716 -0.0022 84  LYS B NZ  
3888 N N   . GLY B 86  ? 0.4108 0.5468 0.4577 -0.0022 -0.0493 0.0611  85  GLY B N   
3889 C CA  . GLY B 86  ? 0.3699 0.5008 0.4241 -0.0107 -0.0415 0.0702  85  GLY B CA  
3890 C C   . GLY B 86  ? 0.4420 0.5655 0.4802 -0.0158 -0.0304 0.0773  85  GLY B C   
3891 O O   . GLY B 86  ? 0.4786 0.5927 0.4960 -0.0114 -0.0345 0.0812  85  GLY B O   
3892 N N   . ASP B 87  ? 0.5231 0.6502 0.5707 -0.0250 -0.0166 0.0790  86  ASP B N   
3893 C CA  . ASP B 87  ? 0.5473 0.6648 0.5825 -0.0311 -0.0043 0.0885  86  ASP B CA  
3894 C C   . ASP B 87  ? 0.5798 0.6747 0.6072 -0.0299 -0.0101 0.1027  86  ASP B C   
3895 O O   . ASP B 87  ? 0.5782 0.6675 0.6151 -0.0263 -0.0216 0.1046  86  ASP B O   
3896 C CB  . ASP B 87  ? 0.5882 0.7149 0.6396 -0.0429 0.0122  0.0854  86  ASP B CB  
3897 C CG  . ASP B 87  ? 0.6618 0.7902 0.7364 -0.0469 0.0098  0.0809  86  ASP B CG  
3898 O OD1 . ASP B 87  ? 0.7135 0.8464 0.7949 -0.0401 -0.0023 0.0763  86  ASP B OD1 
3899 O OD2 . ASP B 87  ? 0.6693 0.7941 0.7549 -0.0568 0.0204  0.0818  86  ASP B OD2 
3900 N N   . LYS B 88  ? 0.6728 0.7153 0.6677 0.0482  -0.0523 0.1668  87  LYS B N   
3901 C CA  . LYS B 88  ? 0.6408 0.6461 0.6123 0.0379  -0.0537 0.1653  87  LYS B CA  
3902 C C   . LYS B 88  ? 0.5893 0.5915 0.5676 0.0153  -0.0608 0.1689  87  LYS B C   
3903 O O   . LYS B 88  ? 0.6198 0.5902 0.5844 0.0109  -0.0700 0.1678  87  LYS B O   
3904 C CB  . LYS B 88  ? 0.6782 0.6854 0.6362 0.0367  -0.0367 0.1665  87  LYS B CB  
3905 C CG  . LYS B 88  ? 0.7051 0.6796 0.6393 0.0243  -0.0353 0.1662  87  LYS B CG  
3906 C CD  . LYS B 88  ? 0.7417 0.7293 0.6715 0.0179  -0.0152 0.1719  87  LYS B CD  
3907 C CE  . LYS B 88  ? 0.7946 0.7474 0.6957 0.0099  -0.0124 0.1717  87  LYS B CE  
3908 N NZ  . LYS B 88  ? 0.8073 0.7689 0.7006 0.0078  0.0093  0.1790  87  LYS B NZ  
3909 N N   . GLU B 89  ? 0.5152 0.5517 0.5161 0.0019  -0.0571 0.1727  88  GLU B N   
3910 C CA  . GLU B 89  ? 0.5090 0.5445 0.5151 -0.0182 -0.0640 0.1746  88  GLU B CA  
3911 C C   . GLU B 89  ? 0.5569 0.5800 0.5626 -0.0134 -0.0798 0.1751  88  GLU B C   
3912 O O   . GLU B 89  ? 0.6165 0.6210 0.6133 -0.0243 -0.0868 0.1763  88  GLU B O   
3913 C CB  . GLU B 89  ? 0.4908 0.5681 0.5255 -0.0313 -0.0594 0.1764  88  GLU B CB  
3914 C CG  . GLU B 89  ? 0.5301 0.6109 0.5728 -0.0484 -0.0703 0.1760  88  GLU B CG  
3915 C CD  . GLU B 89  ? 0.6658 0.7891 0.7411 -0.0609 -0.0682 0.1753  88  GLU B CD  
3916 O OE1 . GLU B 89  ? 0.7023 0.8497 0.7937 -0.0606 -0.0545 0.1772  88  GLU B OE1 
3917 O OE2 . GLU B 89  ? 0.7058 0.8393 0.7917 -0.0702 -0.0805 0.1727  88  GLU B OE2 
3918 N N   . GLN B 90  ? 0.5400 0.5726 0.5545 0.0043  -0.0845 0.1751  89  GLN B N   
3919 C CA  . GLN B 90  ? 0.5281 0.5490 0.5434 0.0113  -0.0972 0.1782  89  GLN B CA  
3920 C C   . GLN B 90  ? 0.5668 0.5434 0.5631 0.0146  -0.1020 0.1781  89  GLN B C   
3921 O O   . GLN B 90  ? 0.5931 0.5539 0.5862 0.0102  -0.1097 0.1826  89  GLN B O   
3922 C CB  . GLN B 90  ? 0.4973 0.5387 0.5269 0.0306  -0.0998 0.1788  89  GLN B CB  
3923 C CG  . GLN B 90  ? 0.5355 0.5680 0.5675 0.0397  -0.1108 0.1843  89  GLN B CG  
3924 C CD  . GLN B 90  ? 0.5992 0.6530 0.6443 0.0595  -0.1127 0.1851  89  GLN B CD  
3925 O OE1 . GLN B 90  ? 0.6297 0.6965 0.6786 0.0695  -0.1062 0.1807  89  GLN B OE1 
3926 N NE2 . GLN B 90  ? 0.5893 0.6474 0.6398 0.0673  -0.1209 0.1914  89  GLN B NE2 
3927 N N   . LYS B 91  ? 0.4862 0.4445 0.4707 0.0238  -0.0978 0.1730  90  LYS B N   
3928 C CA  . LYS B 91  ? 0.5021 0.4198 0.4717 0.0273  -0.1039 0.1704  90  LYS B CA  
3929 C C   . LYS B 91  ? 0.5334 0.4339 0.4890 0.0100  -0.1031 0.1708  90  LYS B C   
3930 O O   . LYS B 91  ? 0.5533 0.4272 0.5033 0.0073  -0.1105 0.1721  90  LYS B O   
3931 C CB  . LYS B 91  ? 0.4870 0.3904 0.4452 0.0434  -0.1011 0.1621  90  LYS B CB  
3932 C CG  . LYS B 91  ? 0.5495 0.4474 0.5161 0.0636  -0.1080 0.1601  90  LYS B CG  
3933 C CD  . LYS B 91  ? 0.5753 0.5104 0.5546 0.0738  -0.1017 0.1614  90  LYS B CD  
3934 C CE  . LYS B 91  ? 0.5511 0.4765 0.5305 0.0980  -0.1062 0.1561  90  LYS B CE  
3935 N NZ  . LYS B 91  ? 0.6195 0.5209 0.6076 0.1026  -0.1186 0.1597  90  LYS B NZ  
3936 N N   . LEU B 92  ? 0.5113 0.4272 0.4628 -0.0017 -0.0938 0.1704  91  LEU B N   
3937 C CA  . LEU B 92  ? 0.5555 0.4548 0.4923 -0.0176 -0.0925 0.1707  91  LEU B CA  
3938 C C   . LEU B 92  ? 0.5617 0.4655 0.5049 -0.0296 -0.0997 0.1761  91  LEU B C   
3939 O O   . LEU B 92  ? 0.5648 0.4489 0.4975 -0.0355 -0.1012 0.1724  91  LEU B O   
3940 C CB  . LEU B 92  ? 0.6130 0.5258 0.5451 -0.0267 -0.0793 0.1701  91  LEU B CB  
3941 C CG  . LEU B 92  ? 0.5650 0.4670 0.4807 -0.0150 -0.0698 0.1658  91  LEU B CG  
3942 C CD1 . LEU B 92  ? 0.5664 0.4809 0.4790 -0.0271 -0.0551 0.1690  91  LEU B CD1 
3943 C CD2 . LEU B 92  ? 0.4935 0.3560 0.3860 -0.0081 -0.0768 0.1603  91  LEU B CD2 
3944 N N   . ARG B 93  ? 0.4933 0.4278 0.4549 -0.0306 -0.1012 0.1789  92  ARG B N   
3945 C CA  . ARG B 93  ? 0.4591 0.3988 0.4241 -0.0377 -0.1093 0.1832  92  ARG B CA  
3946 C C   . ARG B 93  ? 0.4483 0.3696 0.4118 -0.0274 -0.1123 0.1805  92  ARG B C   
3947 O O   . ARG B 93  ? 0.4192 0.3360 0.3789 -0.0316 -0.1105 0.1741  92  ARG B O   
3948 C CB  . ARG B 93  ? 0.4502 0.4283 0.4356 -0.0376 -0.1116 0.1836  92  ARG B CB  
3949 C CG  . ARG B 93  ? 0.5241 0.5079 0.5084 -0.0455 -0.1204 0.1856  92  ARG B CG  
3950 C CD  . ARG B 93  ? 0.5539 0.5765 0.5581 -0.0474 -0.1246 0.1826  92  ARG B CD  
3951 N NE  . ARG B 93  ? 0.6039 0.6394 0.6156 -0.0651 -0.1203 0.1768  92  ARG B NE  
3952 C CZ  . ARG B 93  ? 0.5775 0.6382 0.6085 -0.0685 -0.1121 0.1740  92  ARG B CZ  
3953 N NH1 . ARG B 93  ? 0.5082 0.5844 0.5500 -0.0537 -0.1080 0.1753  92  ARG B NH1 
3954 N NH2 . ARG B 93  ? 0.5664 0.6365 0.6069 -0.0864 -0.1075 0.1705  92  ARG B NH2 
3955 N N   . PHE B 94  ? 0.4841 0.3973 0.4526 -0.0132 -0.1128 0.1802  93  PHE B N   
3956 C CA  . PHE B 94  ? 0.4315 0.3304 0.4027 -0.0052 -0.1104 0.1735  93  PHE B CA  
3957 C C   . PHE B 94  ? 0.4892 0.3672 0.4504 -0.0110 -0.1053 0.1630  93  PHE B C   
3958 O O   . PHE B 94  ? 0.5253 0.4014 0.4877 -0.0127 -0.1018 0.1588  93  PHE B O   
3959 C CB  . PHE B 94  ? 0.4215 0.3140 0.4014 0.0105  -0.1130 0.1753  93  PHE B CB  
3960 C CG  . PHE B 94  ? 0.4287 0.3098 0.4145 0.0167  -0.1099 0.1720  93  PHE B CG  
3961 C CD1 . PHE B 94  ? 0.4567 0.3172 0.4411 0.0147  -0.1071 0.1640  93  PHE B CD1 
3962 C CD2 . PHE B 94  ? 0.4828 0.3759 0.4763 0.0245  -0.1099 0.1780  93  PHE B CD2 
3963 C CE1 . PHE B 94  ? 0.4919 0.3450 0.4849 0.0184  -0.1039 0.1635  93  PHE B CE1 
3964 C CE2 . PHE B 94  ? 0.4924 0.3743 0.4900 0.0298  -0.1055 0.1774  93  PHE B CE2 
3965 C CZ  . PHE B 94  ? 0.5249 0.3874 0.5237 0.0257  -0.1023 0.1708  93  PHE B CZ  
3966 N N   . ALA B 95  ? 0.5356 0.3999 0.4865 -0.0120 -0.1049 0.1596  94  ALA B N   
3967 C CA  . ALA B 95  ? 0.4654 0.3130 0.4064 -0.0161 -0.1012 0.1494  94  ALA B CA  
3968 C C   . ALA B 95  ? 0.4555 0.3107 0.3904 -0.0278 -0.0971 0.1464  94  ALA B C   
3969 O O   . ALA B 95  ? 0.3913 0.2412 0.3251 -0.0293 -0.0942 0.1391  94  ALA B O   
3970 C CB  . ALA B 95  ? 0.4260 0.2582 0.3525 -0.0129 -0.1020 0.1474  94  ALA B CB  
3971 N N   . PHE B 96  ? 0.4015 0.2700 0.3340 -0.0359 -0.0978 0.1526  95  PHE B N   
3972 C CA  . PHE B 96  ? 0.4156 0.2899 0.3430 -0.0464 -0.0962 0.1495  95  PHE B CA  
3973 C C   . PHE B 96  ? 0.4353 0.3165 0.3704 -0.0424 -0.0968 0.1478  95  PHE B C   
3974 O O   . PHE B 96  ? 0.4677 0.3460 0.3976 -0.0449 -0.0939 0.1414  95  PHE B O   
3975 C CB  . PHE B 96  ? 0.4318 0.3207 0.3597 -0.0572 -0.0996 0.1584  95  PHE B CB  
3976 C CG  . PHE B 96  ? 0.3944 0.2870 0.3174 -0.0684 -0.1011 0.1553  95  PHE B CG  
3977 C CD1 . PHE B 96  ? 0.3973 0.2777 0.3073 -0.0761 -0.0959 0.1487  95  PHE B CD1 
3978 C CD2 . PHE B 96  ? 0.3912 0.2986 0.3211 -0.0692 -0.1085 0.1591  95  PHE B CD2 
3979 C CE1 . PHE B 96  ? 0.4159 0.2969 0.3205 -0.0855 -0.0987 0.1455  95  PHE B CE1 
3980 C CE2 . PHE B 96  ? 0.3922 0.3001 0.3152 -0.0786 -0.1124 0.1562  95  PHE B CE2 
3981 C CZ  . PHE B 96  ? 0.4006 0.2943 0.3113 -0.0874 -0.1079 0.1493  95  PHE B CZ  
3982 N N   . ARG B 97  ? 0.4201 0.3101 0.3662 -0.0344 -0.0996 0.1543  96  ARG B N   
3983 C CA  . ARG B 97  ? 0.4284 0.3248 0.3791 -0.0285 -0.0984 0.1551  96  ARG B CA  
3984 C C   . ARG B 97  ? 0.4243 0.3091 0.3767 -0.0234 -0.0920 0.1496  96  ARG B C   
3985 O O   . ARG B 97  ? 0.4757 0.3636 0.4273 -0.0202 -0.0884 0.1496  96  ARG B O   
3986 C CB  . ARG B 97  ? 0.3859 0.2942 0.3461 -0.0192 -0.1022 0.1639  96  ARG B CB  
3987 C CG  . ARG B 97  ? 0.3886 0.3165 0.3499 -0.0237 -0.1101 0.1703  96  ARG B CG  
3988 C CD  . ARG B 97  ? 0.4497 0.3921 0.4221 -0.0124 -0.1146 0.1785  96  ARG B CD  
3989 N NE  . ARG B 97  ? 0.5389 0.5071 0.5156 -0.0150 -0.1241 0.1843  96  ARG B NE  
3990 C CZ  . ARG B 97  ? 0.5676 0.5576 0.5562 -0.0051 -0.1300 0.1909  96  ARG B CZ  
3991 N NH1 . ARG B 97  ? 0.5776 0.5610 0.5720 0.0080  -0.1265 0.1929  96  ARG B NH1 
3992 N NH2 . ARG B 97  ? 0.5407 0.5603 0.5365 -0.0075 -0.1406 0.1942  96  ARG B NH2 
3993 N N   . ILE B 98  ? 0.3773 0.2493 0.3321 -0.0220 -0.0914 0.1460  97  ILE B N   
3994 C CA  . ILE B 98  ? 0.3850 0.2476 0.3438 -0.0198 -0.0877 0.1410  97  ILE B CA  
3995 C C   . ILE B 98  ? 0.3643 0.2282 0.3146 -0.0252 -0.0842 0.1349  97  ILE B C   
3996 O O   . ILE B 98  ? 0.3612 0.2260 0.3155 -0.0231 -0.0810 0.1351  97  ILE B O   
3997 C CB  . ILE B 98  ? 0.4185 0.2661 0.3798 -0.0181 -0.0910 0.1369  97  ILE B CB  
3998 C CG1 . ILE B 98  ? 0.3920 0.2359 0.3639 -0.0100 -0.0945 0.1424  97  ILE B CG1 
3999 C CG2 . ILE B 98  ? 0.3770 0.2169 0.3430 -0.0187 -0.0898 0.1313  97  ILE B CG2 
4000 C CD1 . ILE B 98  ? 0.3943 0.2371 0.3796 -0.0050 -0.0920 0.1459  97  ILE B CD1 
4001 N N   . TYR B 99  ? 0.3629 0.2263 0.3017 -0.0323 -0.0853 0.1309  98  TYR B N   
4002 C CA  . TYR B 99  ? 0.3559 0.2186 0.2859 -0.0365 -0.0824 0.1244  98  TYR B CA  
4003 C C   . TYR B 99  ? 0.3534 0.2261 0.2795 -0.0377 -0.0820 0.1265  98  TYR B C   
4004 O O   . TYR B 99  ? 0.3545 0.2268 0.2772 -0.0397 -0.0826 0.1247  98  TYR B O   
4005 C CB  . TYR B 99  ? 0.3598 0.2148 0.2773 -0.0428 -0.0832 0.1195  98  TYR B CB  
4006 C CG  . TYR B 99  ? 0.3832 0.2255 0.2991 -0.0398 -0.0844 0.1171  98  TYR B CG  
4007 C CD1 . TYR B 99  ? 0.4001 0.2386 0.3159 -0.0381 -0.0870 0.1219  98  TYR B CD1 
4008 C CD2 . TYR B 99  ? 0.3651 0.1988 0.2789 -0.0379 -0.0842 0.1106  98  TYR B CD2 
4009 C CE1 . TYR B 99  ? 0.3886 0.2128 0.3002 -0.0332 -0.0895 0.1196  98  TYR B CE1 
4010 C CE2 . TYR B 99  ? 0.3756 0.1956 0.2860 -0.0344 -0.0880 0.1080  98  TYR B CE2 
4011 C CZ  . TYR B 99  ? 0.3882 0.2022 0.2966 -0.0314 -0.0906 0.1121  98  TYR B CZ  
4012 O OH  . TYR B 99  ? 0.4032 0.2004 0.3051 -0.0254 -0.0959 0.1090  98  TYR B OH  
4013 N N   . ASP B 100 ? 0.3847 0.2824 0.3519 -0.0155 -0.0840 0.1674  99  ASP B N   
4014 C CA  . ASP B 100 ? 0.3780 0.2845 0.3510 -0.0161 -0.0815 0.1691  99  ASP B CA  
4015 C C   . ASP B 100 ? 0.4268 0.3446 0.4149 -0.0155 -0.0767 0.1757  99  ASP B C   
4016 O O   . ASP B 100 ? 0.4334 0.3593 0.4304 -0.0138 -0.0711 0.1810  99  ASP B O   
4017 C CB  . ASP B 100 ? 0.3783 0.2868 0.3495 -0.0149 -0.0787 0.1704  99  ASP B CB  
4018 C CG  . ASP B 100 ? 0.3842 0.2995 0.3595 -0.0163 -0.0779 0.1719  99  ASP B CG  
4019 O OD1 . ASP B 100 ? 0.4067 0.3206 0.3800 -0.0174 -0.0803 0.1699  99  ASP B OD1 
4020 O OD2 . ASP B 100 ? 0.3729 0.2940 0.3523 -0.0157 -0.0749 0.1754  99  ASP B OD2 
4021 N N   . MET B 101 ? 0.4005 0.3201 0.3928 -0.0166 -0.0787 0.1764  100 MET B N   
4022 C CA  . MET B 101 ? 0.3737 0.3062 0.3833 -0.0161 -0.0742 0.1846  100 MET B CA  
4023 C C   . MET B 101 ? 0.3752 0.3178 0.3917 -0.0135 -0.0679 0.1888  100 MET B C   
4024 O O   . MET B 101 ? 0.4279 0.3822 0.4599 -0.0124 -0.0624 0.1960  100 MET B O   
4025 C CB  . MET B 101 ? 0.3688 0.3030 0.3824 -0.0172 -0.0771 0.1860  100 MET B CB  
4026 C CG  . MET B 101 ? 0.3739 0.2983 0.3814 -0.0202 -0.0843 0.1819  100 MET B CG  
4027 S SD  . MET B 101 ? 0.6244 0.5567 0.6450 -0.0221 -0.0868 0.1880  100 MET B SD  
4028 C CE  . MET B 101 ? 0.5443 0.4890 0.5898 -0.0250 -0.0854 0.1992  100 MET B CE  
4029 N N   . ASP B 102 ? 0.3654 0.3027 0.3703 -0.0124 -0.0689 0.1847  101 ASP B N   
4030 C CA  . ASP B 102 ? 0.3639 0.3089 0.3737 -0.0096 -0.0636 0.1891  101 ASP B CA  
4031 C C   . ASP B 102 ? 0.3993 0.3460 0.4089 -0.0101 -0.0621 0.1890  101 ASP B C   
4032 O O   . ASP B 102 ? 0.4157 0.3671 0.4276 -0.0083 -0.0589 0.1919  101 ASP B O   
4033 C CB  . ASP B 102 ? 0.3716 0.3084 0.3681 -0.0067 -0.0646 0.1869  101 ASP B CB  
4034 C CG  . ASP B 102 ? 0.4577 0.3783 0.4340 -0.0081 -0.0713 0.1786  101 ASP B CG  
4035 O OD1 . ASP B 102 ? 0.5371 0.4567 0.5124 -0.0115 -0.0740 0.1762  101 ASP B OD1 
4036 O OD2 . ASP B 102 ? 0.4815 0.3912 0.4437 -0.0053 -0.0737 0.1757  101 ASP B OD2 
4037 N N   . LYS B 103 ? 0.3623 0.3047 0.3685 -0.0120 -0.0645 0.1862  102 LYS B N   
4038 C CA  . LYS B 103 ? 0.3614 0.3067 0.3689 -0.0120 -0.0627 0.1875  102 LYS B CA  
4039 C C   . LYS B 103 ? 0.3641 0.3064 0.3640 -0.0138 -0.0660 0.1855  102 LYS B C   
4040 O O   . LYS B 103 ? 0.3623 0.3119 0.3683 -0.0137 -0.0636 0.1893  102 LYS B O   
4041 C CB  . LYS B 103 ? 0.3565 0.3158 0.3810 -0.0092 -0.0548 0.1955  102 LYS B CB  
4042 C CG  . LYS B 103 ? 0.3553 0.3201 0.3920 -0.0080 -0.0515 0.2003  102 LYS B CG  
4043 C CD  . LYS B 103 ? 0.3525 0.3300 0.4057 -0.0049 -0.0437 0.2083  102 LYS B CD  
4044 C CE  . LYS B 103 ? 0.3560 0.3347 0.4192 -0.0045 -0.0421 0.2134  102 LYS B CE  
4045 N NZ  . LYS B 103 ? 0.3558 0.3455 0.4350 -0.0008 -0.0340 0.2219  102 LYS B NZ  
4046 N N   . ASP B 104 ? 0.4663 0.3977 0.4534 -0.0155 -0.0721 0.1802  103 ASP B N   
4047 C CA  . ASP B 104 ? 0.4642 0.3905 0.4435 -0.0180 -0.0768 0.1791  103 ASP B CA  
4048 C C   . ASP B 104 ? 0.4719 0.3960 0.4486 -0.0228 -0.0825 0.1775  103 ASP B C   
4049 O O   . ASP B 104 ? 0.5576 0.4788 0.5306 -0.0270 -0.0881 0.1778  103 ASP B O   
4050 C CB  . ASP B 104 ? 0.4413 0.3552 0.4067 -0.0169 -0.0805 0.1754  103 ASP B CB  
4051 C CG  . ASP B 104 ? 0.5084 0.4108 0.4626 -0.0195 -0.0878 0.1688  103 ASP B CG  
4052 O OD1 . ASP B 104 ? 0.4312 0.3346 0.3877 -0.0223 -0.0899 0.1669  103 ASP B OD1 
4053 O OD2 . ASP B 104 ? 0.4627 0.3540 0.4047 -0.0179 -0.0909 0.1657  103 ASP B OD2 
4054 N N   . GLY B 105 ? 0.3754 0.2998 0.3531 -0.0222 -0.0816 0.1764  104 GLY B N   
4055 C CA  . GLY B 105 ? 0.3912 0.3142 0.3664 -0.0249 -0.0854 0.1763  104 GLY B CA  
4056 C C   . GLY B 105 ? 0.4769 0.3883 0.4406 -0.0273 -0.0923 0.1703  104 GLY B C   
4057 O O   . GLY B 105 ? 0.4699 0.3799 0.4312 -0.0289 -0.0952 0.1709  104 GLY B O   
4058 N N   . TYR B 106 ? 0.5472 0.4508 0.5043 -0.0268 -0.0945 0.1654  105 TYR B N   
4059 C CA  . TYR B 106 ? 0.4657 0.3577 0.4117 -0.0288 -0.1012 0.1593  105 TYR B CA  
4060 C C   . TYR B 106 ? 0.4653 0.3549 0.4100 -0.0252 -0.0986 0.1567  105 TYR B C   
4061 O O   . TYR B 106 ? 0.5154 0.4115 0.4676 -0.0223 -0.0929 0.1598  105 TYR B O   
4062 C CB  . TYR B 106 ? 0.4282 0.3105 0.3652 -0.0323 -0.1083 0.1560  105 TYR B CB  
4063 C CG  . TYR B 106 ? 0.5068 0.3893 0.4446 -0.0380 -0.1138 0.1589  105 TYR B CG  
4064 C CD1 . TYR B 106 ? 0.5261 0.4068 0.4629 -0.0430 -0.1200 0.1596  105 TYR B CD1 
4065 C CD2 . TYR B 106 ? 0.5207 0.4054 0.4605 -0.0384 -0.1131 0.1620  105 TYR B CD2 
4066 C CE1 . TYR B 106 ? 0.4816 0.3639 0.4215 -0.0498 -0.1264 0.1639  105 TYR B CE1 
4067 C CE2 . TYR B 106 ? 0.5508 0.4353 0.4919 -0.0449 -0.1197 0.1652  105 TYR B CE2 
4068 C CZ  . TYR B 106 ? 0.5310 0.4149 0.4732 -0.0514 -0.1269 0.1664  105 TYR B CZ  
4069 O OH  . TYR B 106 ? 0.5647 0.4496 0.5102 -0.0595 -0.1350 0.1712  105 TYR B OH  
4070 N N   . ILE B 107 ? 0.3944 0.2748 0.3304 -0.0259 -0.1033 0.1517  106 ILE B N   
4071 C CA  . ILE B 107 ? 0.3936 0.2707 0.3280 -0.0238 -0.1031 0.1491  106 ILE B CA  
4072 C C   . ILE B 107 ? 0.4119 0.2793 0.3367 -0.0250 -0.1088 0.1440  106 ILE B C   
4073 O O   . ILE B 107 ? 0.4075 0.2657 0.3228 -0.0273 -0.1149 0.1399  106 ILE B O   
4074 C CB  . ILE B 107 ? 0.3967 0.2692 0.3270 -0.0223 -0.1037 0.1476  106 ILE B CB  
4075 C CG1 . ILE B 107 ? 0.3944 0.2734 0.3311 -0.0191 -0.0971 0.1530  106 ILE B CG1 
4076 C CG2 . ILE B 107 ? 0.3981 0.2655 0.3260 -0.0219 -0.1062 0.1445  106 ILE B CG2 
4077 C CD1 . ILE B 107 ? 0.4020 0.2734 0.3308 -0.0154 -0.0969 0.1522  106 ILE B CD1 
4078 N N   . SER B 108 ? 0.3985 0.2677 0.3253 -0.0226 -0.1066 0.1451  107 SER B N   
4079 C CA  . SER B 108 ? 0.4071 0.2663 0.3229 -0.0215 -0.1107 0.1412  107 SER B CA  
4080 C C   . SER B 108 ? 0.4152 0.2705 0.3286 -0.0205 -0.1129 0.1384  107 SER B C   
4081 O O   . SER B 108 ? 0.4237 0.2849 0.3454 -0.0209 -0.1110 0.1405  107 SER B O   
4082 C CB  . SER B 108 ? 0.4351 0.2973 0.3516 -0.0169 -0.1060 0.1453  107 SER B CB  
4083 O OG  . SER B 108 ? 0.4024 0.2749 0.3299 -0.0137 -0.0999 0.1507  107 SER B OG  
4084 N N   . ASN B 109 ? 0.4181 0.2620 0.3192 -0.0193 -0.1178 0.1336  108 ASN B N   
4085 C CA  . ASN B 109 ? 0.4210 0.2609 0.3190 -0.0176 -0.1200 0.1314  108 ASN B CA  
4086 C C   . ASN B 109 ? 0.4359 0.2874 0.3466 -0.0153 -0.1148 0.1380  108 ASN B C   
4087 O O   . ASN B 109 ? 0.4167 0.2708 0.3339 -0.0175 -0.1163 0.1387  108 ASN B O   
4088 C CB  . ASN B 109 ? 0.4341 0.2613 0.3172 -0.0143 -0.1241 0.1271  108 ASN B CB  
4089 C CG  . ASN B 109 ? 0.4590 0.2809 0.3373 -0.0122 -0.1272 0.1243  108 ASN B CG  
4090 O OD1 . ASN B 109 ? 0.5580 0.3882 0.4455 -0.0108 -0.1246 0.1285  108 ASN B OD1 
4091 N ND2 . ASN B 109 ? 0.4507 0.2580 0.3146 -0.0120 -0.1334 0.1175  108 ASN B ND2 
4092 N N   . GLY B 110 ? 0.4397 0.2974 0.3536 -0.0108 -0.1091 0.1436  109 GLY B N   
4093 C CA  . GLY B 110 ? 0.4095 0.2788 0.3363 -0.0086 -0.1040 0.1515  109 GLY B CA  
4094 C C   . GLY B 110 ? 0.3996 0.2789 0.3426 -0.0139 -0.1032 0.1551  109 GLY B C   
4095 O O   . GLY B 110 ? 0.3979 0.2830 0.3517 -0.0160 -0.1044 0.1593  109 GLY B O   
4096 N N   . GLU B 111 ? 0.3951 0.2759 0.3397 -0.0161 -0.1017 0.1542  110 GLU B N   
4097 C CA  . GLU B 111 ? 0.3887 0.2775 0.3464 -0.0191 -0.1000 0.1582  110 GLU B CA  
4098 C C   . GLU B 111 ? 0.3917 0.2737 0.3467 -0.0222 -0.1058 0.1546  110 GLU B C   
4099 O O   . GLU B 111 ? 0.3915 0.2774 0.3569 -0.0244 -0.1069 0.1589  110 GLU B O   
4100 C CB  . GLU B 111 ? 0.4413 0.3324 0.3990 -0.0190 -0.0965 0.1583  110 GLU B CB  
4101 C CG  . GLU B 111 ? 0.3813 0.2828 0.3485 -0.0166 -0.0899 0.1648  110 GLU B CG  
4102 C CD  . GLU B 111 ? 0.6473 0.5477 0.6095 -0.0162 -0.0883 0.1634  110 GLU B CD  
4103 O OE1 . GLU B 111 ? 0.3790 0.2867 0.3475 -0.0141 -0.0831 0.1683  110 GLU B OE1 
4104 O OE2 . GLU B 111 ? 0.7214 0.6142 0.6744 -0.0183 -0.0926 0.1582  110 GLU B OE2 
4105 N N   . LEU B 112 ? 0.3965 0.2674 0.3375 -0.0224 -0.1099 0.1472  111 LEU B N   
4106 C CA  . LEU B 112 ? 0.4025 0.2640 0.3369 -0.0239 -0.1154 0.1430  111 LEU B CA  
4107 C C   . LEU B 112 ? 0.4247 0.2852 0.3633 -0.0256 -0.1201 0.1441  111 LEU B C   
4108 O O   . LEU B 112 ? 0.4656 0.3240 0.4084 -0.0279 -0.1235 0.1458  111 LEU B O   
4109 C CB  . LEU B 112 ? 0.4085 0.2590 0.3277 -0.0232 -0.1191 0.1358  111 LEU B CB  
4110 C CG  . LEU B 112 ? 0.4163 0.2569 0.3268 -0.0226 -0.1227 0.1321  111 LEU B CG  
4111 C CD1 . LEU B 112 ? 0.4159 0.2600 0.3321 -0.0216 -0.1190 0.1369  111 LEU B CD1 
4112 C CD2 . LEU B 112 ? 0.4527 0.2866 0.3517 -0.0212 -0.1238 0.1281  111 LEU B CD2 
4113 N N   . PHE B 113 ? 0.4064 0.2677 0.3437 -0.0241 -0.1206 0.1441  112 PHE B N   
4114 C CA  . PHE B 113 ? 0.4098 0.2721 0.3527 -0.0254 -0.1247 0.1468  112 PHE B CA  
4115 C C   . PHE B 113 ? 0.4055 0.2801 0.3684 -0.0288 -0.1236 0.1562  112 PHE B C   
4116 O O   . PHE B 113 ? 0.4424 0.3151 0.4117 -0.0331 -0.1301 0.1582  112 PHE B O   
4117 C CB  . PHE B 113 ? 0.4125 0.2758 0.3511 -0.0207 -0.1227 0.1479  112 PHE B CB  
4118 C CG  . PHE B 113 ? 0.4169 0.2826 0.3618 -0.0211 -0.1265 0.1521  112 PHE B CG  
4119 C CD1 . PHE B 113 ? 0.4132 0.2936 0.3774 -0.0226 -0.1241 0.1630  112 PHE B CD1 
4120 C CD2 . PHE B 113 ? 0.4254 0.2798 0.3584 -0.0200 -0.1326 0.1462  112 PHE B CD2 
4121 C CE1 . PHE B 113 ? 0.4177 0.3024 0.3905 -0.0239 -0.1283 0.1685  112 PHE B CE1 
4122 C CE2 . PHE B 113 ? 0.4303 0.2877 0.3696 -0.0201 -0.1364 0.1508  112 PHE B CE2 
4123 C CZ  . PHE B 113 ? 0.4263 0.2993 0.3861 -0.0224 -0.1345 0.1624  112 PHE B CZ  
4124 N N   . GLN B 114 ? 0.4058 0.2922 0.3788 -0.0271 -0.1162 0.1625  113 GLN B N   
4125 C CA  . GLN B 114 ? 0.3950 0.2955 0.3901 -0.0301 -0.1146 0.1731  113 GLN B CA  
4126 C C   . GLN B 114 ? 0.4185 0.3154 0.4183 -0.0343 -0.1186 0.1739  113 GLN B C   
4127 O O   . GLN B 114 ? 0.4299 0.3301 0.4438 -0.0391 -0.1242 0.1800  113 GLN B O   
4128 C CB  . GLN B 114 ? 0.4128 0.3261 0.4165 -0.0264 -0.1053 0.1793  113 GLN B CB  
4129 C CG  . GLN B 114 ? 0.4993 0.4156 0.4993 -0.0211 -0.1015 0.1816  113 GLN B CG  
4130 C CD  . GLN B 114 ? 0.5421 0.4716 0.5525 -0.0171 -0.0927 0.1895  113 GLN B CD  
4131 O OE1 . GLN B 114 ? 0.5163 0.4580 0.5446 -0.0197 -0.0895 0.1962  113 GLN B OE1 
4132 N NE2 . GLN B 114 ? 0.5320 0.4577 0.5297 -0.0097 -0.0885 0.1892  113 GLN B NE2 
4133 N N   . VAL B 115 ? 0.3987 0.2877 0.3863 -0.0320 -0.1163 0.1683  114 VAL B N   
4134 C CA  . VAL B 115 ? 0.4058 0.2881 0.3930 -0.0333 -0.1186 0.1692  114 VAL B CA  
4135 C C   . VAL B 115 ? 0.4725 0.3398 0.4502 -0.0361 -0.1290 0.1642  114 VAL B C   
4136 O O   . VAL B 115 ? 0.5403 0.4027 0.5236 -0.0392 -0.1346 0.1680  114 VAL B O   
4137 C CB  . VAL B 115 ? 0.4050 0.2835 0.3814 -0.0286 -0.1120 0.1662  114 VAL B CB  
4138 C CG1 . VAL B 115 ? 0.4160 0.2855 0.3891 -0.0276 -0.1128 0.1681  114 VAL B CG1 
4139 C CG2 . VAL B 115 ? 0.3947 0.2874 0.3815 -0.0265 -0.1033 0.1712  114 VAL B CG2 
4140 N N   . LEU B 116 ? 0.4772 0.3357 0.4404 -0.0350 -0.1324 0.1560  115 LEU B N   
4141 C CA  . LEU B 116 ? 0.4333 0.2771 0.3873 -0.0374 -0.1428 0.1510  115 LEU B CA  
4142 C C   . LEU B 116 ? 0.4674 0.3163 0.4376 -0.0434 -0.1505 0.1572  115 LEU B C   
4143 O O   . LEU B 116 ? 0.4960 0.3353 0.4675 -0.0473 -0.1599 0.1580  115 LEU B O   
4144 C CB  . LEU B 116 ? 0.4346 0.2685 0.3708 -0.0344 -0.1444 0.1415  115 LEU B CB  
4145 C CG  . LEU B 116 ? 0.4816 0.3003 0.3991 -0.0305 -0.1456 0.1346  115 LEU B CG  
4146 C CD1 . LEU B 116 ? 0.4770 0.3014 0.3923 -0.0263 -0.1361 0.1357  115 LEU B CD1 
4147 C CD2 . LEU B 116 ? 0.6285 0.4364 0.5313 -0.0285 -0.1500 0.1265  115 LEU B CD2 
4148 N N   . LYS B 117 ? 0.4255 0.2887 0.4079 -0.0437 -0.1468 0.1624  116 LYS B N   
4149 C CA  . LYS B 117 ? 0.4332 0.3055 0.4347 -0.0490 -0.1527 0.1709  116 LYS B CA  
4150 C C   . LYS B 117 ? 0.4942 0.3726 0.5160 -0.0547 -0.1567 0.1806  116 LYS B C   
4151 O O   . LYS B 117 ? 0.5778 0.4550 0.6123 -0.0614 -0.1674 0.1856  116 LYS B O   
4152 C CB  . LYS B 117 ? 0.4169 0.3059 0.4282 -0.0457 -0.1443 0.1772  116 LYS B CB  
4153 C CG  . LYS B 117 ? 0.4182 0.3199 0.4504 -0.0498 -0.1486 0.1879  116 LYS B CG  
4154 C CD  . LYS B 117 ? 0.4463 0.3346 0.4681 -0.0517 -0.1588 0.1822  116 LYS B CD  
4155 C CE  . LYS B 117 ? 0.5349 0.4376 0.5778 -0.0550 -0.1622 0.1940  116 LYS B CE  
4156 N NZ  . LYS B 117 ? 0.5928 0.4824 0.6269 -0.0569 -0.1730 0.1893  116 LYS B NZ  
4157 N N   . MET B 118 ? 0.4915 0.3756 0.5165 -0.0520 -0.1483 0.1835  117 MET B N   
4158 C CA  . MET B 118 ? 0.4787 0.3673 0.5209 -0.0553 -0.1497 0.1929  117 MET B CA  
4159 C C   . MET B 118 ? 0.5444 0.4111 0.5752 -0.0580 -0.1611 0.1887  117 MET B C   
4160 O O   . MET B 118 ? 0.6303 0.4959 0.6768 -0.0637 -0.1696 0.1967  117 MET B O   
4161 C CB  . MET B 118 ? 0.4433 0.3383 0.4836 -0.0494 -0.1371 0.1939  117 MET B CB  
4162 C CG  . MET B 118 ? 0.4266 0.3273 0.4833 -0.0503 -0.1345 0.2040  117 MET B CG  
4163 S SD  . MET B 118 ? 0.5986 0.5031 0.6456 -0.0420 -0.1196 0.2017  117 MET B SD  
4164 C CE  . MET B 118 ? 0.3986 0.3254 0.4577 -0.0398 -0.1109 0.2047  117 MET B CE  
4165 N N   . MET B 119 ? 0.5155 0.3641 0.5190 -0.0535 -0.1618 0.1766  118 MET B N   
4166 C CA  . MET B 119 ? 0.5807 0.4058 0.5685 -0.0538 -0.1719 0.1715  118 MET B CA  
4167 C C   . MET B 119 ? 0.6054 0.4179 0.5870 -0.0582 -0.1862 0.1655  118 MET B C   
4168 O O   . MET B 119 ? 0.5930 0.3885 0.5711 -0.0615 -0.1992 0.1646  118 MET B O   
4169 C CB  . MET B 119 ? 0.5873 0.3998 0.5493 -0.0451 -0.1643 0.1629  118 MET B CB  
4170 C CG  . MET B 119 ? 0.5243 0.3480 0.4897 -0.0398 -0.1500 0.1675  118 MET B CG  
4171 S SD  . MET B 119 ? 0.5923 0.4021 0.5299 -0.0298 -0.1425 0.1593  118 MET B SD  
4172 C CE  . MET B 119 ? 0.4954 0.3164 0.4296 -0.0285 -0.1371 0.1529  118 MET B CE  
4173 N N   . VAL B 120 ? 0.6053 0.4240 0.5841 -0.0575 -0.1841 0.1611  119 VAL B N   
4174 C CA  . VAL B 120 ? 0.5869 0.3924 0.5573 -0.0600 -0.1962 0.1548  119 VAL B CA  
4175 C C   . VAL B 120 ? 0.5727 0.3887 0.5690 -0.0689 -0.2059 0.1646  119 VAL B C   
4176 O O   . VAL B 120 ? 0.5764 0.3788 0.5717 -0.0735 -0.2207 0.1623  119 VAL B O   
4177 C CB  . VAL B 120 ? 0.4806 0.2841 0.4337 -0.0539 -0.1900 0.1457  119 VAL B CB  
4178 C CG1 . VAL B 120 ? 0.4906 0.2842 0.4390 -0.0559 -0.2008 0.1414  119 VAL B CG1 
4179 C CG2 . VAL B 120 ? 0.4932 0.2829 0.4216 -0.0463 -0.1847 0.1364  119 VAL B CG2 
4180 N N   . GLY B 121 ? 0.5307 0.3711 0.5513 -0.0709 -0.1981 0.1762  120 GLY B N   
4181 C CA  . GLY B 121 ? 0.5358 0.3912 0.5851 -0.0788 -0.2052 0.1881  120 GLY B CA  
4182 C C   . GLY B 121 ? 0.5820 0.4361 0.6253 -0.0779 -0.2080 0.1845  120 GLY B C   
4183 O O   . GLY B 121 ? 0.5827 0.4396 0.6116 -0.0703 -0.1972 0.1793  120 GLY B O   
4184 N N   . ASN B 122 ? 0.7116 0.5598 0.7652 -0.0853 -0.2232 0.1874  121 ASN B N   
4185 C CA  . ASN B 122 ? 0.6984 0.5464 0.7483 -0.0840 -0.2257 0.1860  121 ASN B CA  
4186 C C   . ASN B 122 ? 0.6955 0.5151 0.7172 -0.0810 -0.2356 0.1711  121 ASN B C   
4187 O O   . ASN B 122 ? 0.7501 0.5664 0.7686 -0.0797 -0.2401 0.1700  121 ASN B O   
4188 C CB  . ASN B 122 ? 0.7042 0.5709 0.7894 -0.0932 -0.2336 0.2024  121 ASN B CB  
4189 C CG  . ASN B 122 ? 0.7455 0.6436 0.8557 -0.0922 -0.2198 0.2174  121 ASN B CG  
4190 O OD1 . ASN B 122 ? 0.7692 0.6834 0.9091 -0.0992 -0.2219 0.2303  121 ASN B OD1 
4191 N ND2 . ASN B 122 ? 0.7314 0.6373 0.8286 -0.0821 -0.2056 0.2159  121 ASN B ND2 
4192 N N   . ASN B 123 ? 0.6320 0.4317 0.6326 -0.0783 -0.2380 0.1603  122 ASN B N   
4193 C CA  . ASN B 123 ? 0.6943 0.4669 0.6652 -0.0727 -0.2448 0.1454  122 ASN B CA  
4194 C C   . ASN B 123 ? 0.7184 0.4913 0.6712 -0.0631 -0.2347 0.1385  122 ASN B C   
4195 O O   . ASN B 123 ? 0.8502 0.6123 0.7943 -0.0605 -0.2419 0.1338  122 ASN B O   
4196 C CB  . ASN B 123 ? 0.7438 0.4986 0.6939 -0.0687 -0.2446 0.1367  122 ASN B CB  
4197 C CG  . ASN B 123 ? 0.7668 0.5136 0.7288 -0.0762 -0.2580 0.1417  122 ASN B CG  
4198 O OD1 . ASN B 123 ? 0.7721 0.5277 0.7613 -0.0860 -0.2688 0.1522  122 ASN B OD1 
4199 N ND2 . ASN B 123 ? 0.6931 0.4233 0.6355 -0.0710 -0.2573 0.1355  122 ASN B ND2 
4200 N N   . LEU B 124 ? 0.6353 0.4197 0.5827 -0.0571 -0.2189 0.1381  123 LEU B N   
4201 C CA  . LEU B 124 ? 0.5565 0.3424 0.4892 -0.0479 -0.2097 0.1331  123 LEU B CA  
4202 C C   . LEU B 124 ? 0.5254 0.3328 0.4747 -0.0471 -0.2028 0.1440  123 LEU B C   
4203 O O   . LEU B 124 ? 0.5236 0.3489 0.4957 -0.0526 -0.1999 0.1553  123 LEU B O   
4204 C CB  . LEU B 124 ? 0.5006 0.2849 0.4176 -0.0416 -0.1983 0.1264  123 LEU B CB  
4205 C CG  . LEU B 124 ? 0.5663 0.3295 0.4601 -0.0372 -0.2014 0.1150  123 LEU B CG  
4206 C CD1 . LEU B 124 ? 0.5454 0.3117 0.4293 -0.0319 -0.1896 0.1117  123 LEU B CD1 
4207 C CD2 . LEU B 124 ? 0.6238 0.3721 0.5015 -0.0316 -0.2076 0.1072  123 LEU B CD2 
4208 N N   . LYS B 125 ? 0.5094 0.3155 0.4469 -0.0388 -0.1997 0.1412  124 LYS B N   
4209 C CA  . LYS B 125 ? 0.5278 0.3525 0.4737 -0.0335 -0.1903 0.1506  124 LYS B CA  
4210 C C   . LYS B 125 ? 0.5007 0.3310 0.4406 -0.0290 -0.1777 0.1487  124 LYS B C   
4211 O O   . LYS B 125 ? 0.5044 0.3229 0.4294 -0.0279 -0.1763 0.1389  124 LYS B O   
4212 C CB  . LYS B 125 ? 0.5441 0.3647 0.4750 -0.0229 -0.1901 0.1477  124 LYS B CB  
4213 C CG  . LYS B 125 ? 0.5104 0.3294 0.4492 -0.0256 -0.2020 0.1518  124 LYS B CG  
4214 C CD  . LYS B 125 ? 0.5242 0.3356 0.4424 -0.0129 -0.2023 0.1455  124 LYS B CD  
4215 C CE  . LYS B 125 ? 0.5414 0.3456 0.4636 -0.0155 -0.2168 0.1460  124 LYS B CE  
4216 N NZ  . LYS B 125 ? 0.5560 0.3486 0.4551 -0.0029 -0.2190 0.1363  124 LYS B NZ  
4217 N N   . ASP B 126 ? 0.4731 0.3210 0.4244 -0.0260 -0.1689 0.1587  125 ASP B N   
4218 C CA  . ASP B 126 ? 0.4571 0.3088 0.4013 -0.0203 -0.1576 0.1571  125 ASP B CA  
4219 C C   . ASP B 126 ? 0.5003 0.3379 0.4190 -0.0117 -0.1549 0.1458  125 ASP B C   
4220 O O   . ASP B 126 ? 0.5053 0.3375 0.4158 -0.0118 -0.1514 0.1396  125 ASP B O   
4221 C CB  . ASP B 126 ? 0.4539 0.3233 0.4090 -0.0149 -0.1489 0.1691  125 ASP B CB  
4222 C CG  . ASP B 126 ? 0.5174 0.4041 0.5020 -0.0245 -0.1498 0.1815  125 ASP B CG  
4223 O OD1 . ASP B 126 ? 0.5270 0.4114 0.5206 -0.0338 -0.1548 0.1795  125 ASP B OD1 
4224 O OD2 . ASP B 126 ? 0.5597 0.4631 0.5586 -0.0220 -0.1456 0.1938  125 ASP B OD2 
4225 N N   . THR B 127 ? 0.5184 0.3512 0.4262 -0.0044 -0.1571 0.1441  126 THR B N   
4226 C CA  . THR B 127 ? 0.5051 0.3254 0.3911 0.0035  -0.1559 0.1345  126 THR B CA  
4227 C C   . THR B 127 ? 0.4879 0.2921 0.3637 -0.0016 -0.1612 0.1232  126 THR B C   
4228 O O   . THR B 127 ? 0.5046 0.3007 0.3681 0.0005  -0.1587 0.1164  126 THR B O   
4229 C CB  . THR B 127 ? 0.5825 0.4020 0.4603 0.0126  -0.1586 0.1355  126 THR B CB  
4230 O OG1 . THR B 127 ? 0.5590 0.3933 0.4400 0.0222  -0.1511 0.1459  126 THR B OG1 
4231 C CG2 . THR B 127 ? 0.6381 0.4418 0.4945 0.0186  -0.1604 0.1242  126 THR B CG2 
4232 N N   . GLN B 128 ? 0.5248 0.3237 0.4053 -0.0079 -0.1690 0.1217  127 GLN B N   
4233 C CA  . GLN B 128 ? 0.5093 0.2926 0.3777 -0.0099 -0.1734 0.1119  127 GLN B CA  
4234 C C   . GLN B 128 ? 0.4907 0.2774 0.3626 -0.0141 -0.1682 0.1118  127 GLN B C   
4235 O O   . GLN B 128 ? 0.4810 0.2602 0.3408 -0.0117 -0.1659 0.1056  127 GLN B O   
4236 C CB  . GLN B 128 ? 0.5104 0.2856 0.3818 -0.0145 -0.1837 0.1110  127 GLN B CB  
4237 C CG  . GLN B 128 ? 0.5573 0.3270 0.4229 -0.0093 -0.1900 0.1098  127 GLN B CG  
4238 C CD  . GLN B 128 ? 0.6354 0.3980 0.5078 -0.0152 -0.2021 0.1106  127 GLN B CD  
4239 O OE1 . GLN B 128 ? 0.6134 0.3850 0.5053 -0.0239 -0.2056 0.1191  127 GLN B OE1 
4240 N NE2 . GLN B 128 ? 0.6653 0.4108 0.5219 -0.0102 -0.2095 0.1020  127 GLN B NE2 
4241 N N   . LEU B 129 ? 0.5337 0.3332 0.4235 -0.0198 -0.1664 0.1199  128 LEU B N   
4242 C CA  . LEU B 129 ? 0.5310 0.3363 0.4265 -0.0231 -0.1612 0.1215  128 LEU B CA  
4243 C C   . LEU B 129 ? 0.4842 0.2923 0.3731 -0.0187 -0.1534 0.1199  128 LEU B C   
4244 O O   . LEU B 129 ? 0.4530 0.2572 0.3356 -0.0190 -0.1513 0.1159  128 LEU B O   
4245 C CB  . LEU B 129 ? 0.5367 0.3571 0.4540 -0.0287 -0.1602 0.1319  128 LEU B CB  
4246 C CG  . LEU B 129 ? 0.5838 0.4111 0.5083 -0.0312 -0.1548 0.1345  128 LEU B CG  
4247 C CD1 . LEU B 129 ? 0.5982 0.4125 0.5115 -0.0318 -0.1582 0.1279  128 LEU B CD1 
4248 C CD2 . LEU B 129 ? 0.6193 0.4609 0.5665 -0.0364 -0.1548 0.1454  128 LEU B CD2 
4249 N N   . GLN B 130 ? 0.4625 0.2765 0.3519 -0.0141 -0.1497 0.1235  129 GLN B N   
4250 C CA  . GLN B 130 ? 0.4541 0.2672 0.3349 -0.0096 -0.1443 0.1216  129 GLN B CA  
4251 C C   . GLN B 130 ? 0.4626 0.2604 0.3261 -0.0081 -0.1477 0.1121  129 GLN B C   
4252 O O   . GLN B 130 ? 0.4697 0.2653 0.3289 -0.0089 -0.1457 0.1100  129 GLN B O   
4253 C CB  . GLN B 130 ? 0.4585 0.2767 0.3376 -0.0019 -0.1406 0.1266  129 GLN B CB  
4254 C CG  . GLN B 130 ? 0.4616 0.2762 0.3306 0.0026  -0.1366 0.1247  129 GLN B CG  
4255 C CD  . GLN B 130 ? 0.4683 0.2922 0.3473 -0.0005 -0.1310 0.1291  129 GLN B CD  
4256 O OE1 . GLN B 130 ? 0.5550 0.3915 0.4451 0.0019  -0.1253 0.1378  129 GLN B OE1 
4257 N NE2 . GLN B 130 ? 0.4487 0.2670 0.3240 -0.0051 -0.1324 0.1239  129 GLN B NE2 
4258 N N   . GLN B 131 ? 0.5037 0.2910 0.3576 -0.0059 -0.1533 0.1071  130 GLN B N   
4259 C CA  . GLN B 131 ? 0.4829 0.2561 0.3207 -0.0033 -0.1563 0.0992  130 GLN B CA  
4260 C C   . GLN B 131 ? 0.5183 0.2882 0.3547 -0.0067 -0.1565 0.0968  130 GLN B C   
4261 O O   . GLN B 131 ? 0.5078 0.2736 0.3376 -0.0064 -0.1556 0.0947  130 GLN B O   
4262 C CB  . GLN B 131 ? 0.4954 0.2593 0.3234 0.0019  -0.1613 0.0953  130 GLN B CB  
4263 C CG  . GLN B 131 ? 0.5002 0.2674 0.3264 0.0081  -0.1602 0.0982  130 GLN B CG  
4264 C CD  . GLN B 131 ? 0.5138 0.2724 0.3294 0.0147  -0.1651 0.0943  130 GLN B CD  
4265 O OE1 . GLN B 131 ? 0.5165 0.2726 0.3338 0.0135  -0.1697 0.0931  130 GLN B OE1 
4266 N NE2 . GLN B 131 ? 0.5250 0.2776 0.3281 0.0224  -0.1650 0.0918  130 GLN B NE2 
4267 N N   . ILE B 132 ? 0.4904 0.2617 0.3325 -0.0093 -0.1581 0.0979  131 ILE B N   
4268 C CA  . ILE B 132 ? 0.4791 0.2484 0.3188 -0.0100 -0.1569 0.0972  131 ILE B CA  
4269 C C   . ILE B 132 ? 0.4751 0.2560 0.3248 -0.0135 -0.1508 0.1021  131 ILE B C   
4270 O O   . ILE B 132 ? 0.4861 0.2673 0.3333 -0.0127 -0.1482 0.1028  131 ILE B O   
4271 C CB  . ILE B 132 ? 0.4840 0.2489 0.3242 -0.0107 -0.1607 0.0969  131 ILE B CB  
4272 C CG1 . ILE B 132 ? 0.4752 0.2502 0.3317 -0.0165 -0.1611 0.1028  131 ILE B CG1 
4273 C CG2 . ILE B 132 ? 0.4988 0.2503 0.3270 -0.0064 -0.1674 0.0913  131 ILE B CG2 
4274 C CD1 . ILE B 132 ? 0.4836 0.2514 0.3405 -0.0184 -0.1674 0.1027  131 ILE B CD1 
4275 N N   . VAL B 133 ? 0.4573 0.2488 0.3188 -0.0161 -0.1481 0.1067  132 VAL B N   
4276 C CA  . VAL B 133 ? 0.4560 0.2579 0.3261 -0.0182 -0.1424 0.1112  132 VAL B CA  
4277 C C   . VAL B 133 ? 0.4565 0.2536 0.3179 -0.0171 -0.1424 0.1086  132 VAL B C   
4278 O O   . VAL B 133 ? 0.4496 0.2489 0.3116 -0.0185 -0.1406 0.1099  132 VAL B O   
4279 C CB  . VAL B 133 ? 0.4380 0.2526 0.3223 -0.0196 -0.1389 0.1177  132 VAL B CB  
4280 C CG1 . VAL B 133 ? 0.4324 0.2537 0.3198 -0.0192 -0.1338 0.1205  132 VAL B CG1 
4281 C CG2 . VAL B 133 ? 0.4330 0.2542 0.3289 -0.0226 -0.1383 0.1222  132 VAL B CG2 
4282 N N   . ASP B 134 ? 0.5147 0.3046 0.3678 -0.0143 -0.1451 0.1056  133 ASP B N   
4283 C CA  . ASP B 134 ? 0.4954 0.2757 0.3371 -0.0134 -0.1477 0.1022  133 ASP B CA  
4284 C C   . ASP B 134 ? 0.5563 0.3303 0.3915 -0.0141 -0.1501 0.1002  133 ASP B C   
4285 O O   . ASP B 134 ? 0.5241 0.2992 0.3600 -0.0170 -0.1502 0.1022  133 ASP B O   
4286 C CB  . ASP B 134 ? 0.5393 0.3093 0.3694 -0.0082 -0.1510 0.0985  133 ASP B CB  
4287 C CG  . ASP B 134 ? 0.6494 0.4256 0.4832 -0.0050 -0.1475 0.1025  133 ASP B CG  
4288 O OD1 . ASP B 134 ? 0.6885 0.4745 0.5316 -0.0071 -0.1431 0.1073  133 ASP B OD1 
4289 O OD2 . ASP B 134 ? 0.7162 0.4881 0.5429 0.0010  -0.1486 0.1016  133 ASP B OD2 
4290 N N   . LYS B 135 ? 0.5630 0.3314 0.3924 -0.0110 -0.1521 0.0975  134 LYS B N   
4291 C CA  . LYS B 135 ? 0.5139 0.2772 0.3360 -0.0088 -0.1534 0.0971  134 LYS B CA  
4292 C C   . LYS B 135 ? 0.5345 0.3079 0.3649 -0.0104 -0.1488 0.1029  134 LYS B C   
4293 O O   . LYS B 135 ? 0.5393 0.3132 0.3671 -0.0092 -0.1485 0.1062  134 LYS B O   
4294 C CB  . LYS B 135 ? 0.4991 0.2541 0.3119 -0.0031 -0.1560 0.0933  134 LYS B CB  
4295 C CG  . LYS B 135 ? 0.5118 0.2552 0.3127 0.0010  -0.1606 0.0883  134 LYS B CG  
4296 C CD  . LYS B 135 ? 0.5237 0.2597 0.3158 0.0075  -0.1632 0.0847  134 LYS B CD  
4297 C CE  . LYS B 135 ? 0.5301 0.2646 0.3236 0.0084  -0.1656 0.0820  134 LYS B CE  
4298 N NZ  . LYS B 135 ? 0.6135 0.3473 0.4059 0.0091  -0.1661 0.0815  134 LYS B NZ  
4299 N N   . THR B 136 ? 0.5254 0.3078 0.3662 -0.0123 -0.1451 0.1055  135 THR B N   
4300 C CA  . THR B 136 ? 0.5239 0.3153 0.3713 -0.0119 -0.1399 0.1113  135 THR B CA  
4301 C C   . THR B 136 ? 0.5215 0.3204 0.3755 -0.0158 -0.1382 0.1155  135 THR B C   
4302 O O   . THR B 136 ? 0.5610 0.3641 0.4157 -0.0146 -0.1361 0.1206  135 THR B O   
4303 C CB  . THR B 136 ? 0.4916 0.2888 0.3473 -0.0125 -0.1369 0.1132  135 THR B CB  
4304 O OG1 . THR B 136 ? 0.5176 0.3060 0.3656 -0.0088 -0.1397 0.1102  135 THR B OG1 
4305 C CG2 . THR B 136 ? 0.4523 0.2595 0.3152 -0.0117 -0.1306 0.1198  135 THR B CG2 
4306 N N   . ILE B 137 ? 0.4702 0.2706 0.3284 -0.0198 -0.1393 0.1143  136 ILE B N   
4307 C CA  . ILE B 137 ? 0.4939 0.2987 0.3568 -0.0240 -0.1394 0.1174  136 ILE B CA  
4308 C C   . ILE B 137 ? 0.5843 0.3803 0.4386 -0.0257 -0.1453 0.1168  136 ILE B C   
4309 O O   . ILE B 137 ? 0.6010 0.4023 0.4597 -0.0285 -0.1455 0.1222  136 ILE B O   
4310 C CB  . ILE B 137 ? 0.4775 0.2824 0.3424 -0.0254 -0.1396 0.1158  136 ILE B CB  
4311 C CG1 . ILE B 137 ? 0.4505 0.2659 0.3261 -0.0239 -0.1340 0.1185  136 ILE B CG1 
4312 C CG2 . ILE B 137 ? 0.4799 0.2858 0.3463 -0.0293 -0.1412 0.1182  136 ILE B CG2 
4313 C CD1 . ILE B 137 ? 0.4273 0.2556 0.3151 -0.0251 -0.1283 0.1245  136 ILE B CD1 
4314 N N   . ILE B 138 ? 0.5683 0.3510 0.4107 -0.0241 -0.1505 0.1112  137 ILE B N   
4315 C CA  . ILE B 138 ? 0.5463 0.3179 0.3790 -0.0258 -0.1575 0.1105  137 ILE B CA  
4316 C C   . ILE B 138 ? 0.5807 0.3581 0.4158 -0.0250 -0.1566 0.1171  137 ILE B C   
4317 O O   . ILE B 138 ? 0.5792 0.3552 0.4142 -0.0293 -0.1615 0.1216  137 ILE B O   
4318 C CB  . ILE B 138 ? 0.5799 0.3366 0.3985 -0.0215 -0.1619 0.1038  137 ILE B CB  
4319 C CG1 . ILE B 138 ? 0.5910 0.3413 0.4052 -0.0207 -0.1630 0.0990  137 ILE B CG1 
4320 C CG2 . ILE B 138 ? 0.5650 0.3104 0.3736 -0.0223 -0.1690 0.1043  137 ILE B CG2 
4321 C CD1 . ILE B 138 ? 0.5831 0.3189 0.3828 -0.0152 -0.1670 0.0931  137 ILE B CD1 
4322 N N   . ASN B 139 ? 0.5852 0.3689 0.4220 -0.0189 -0.1507 0.1187  138 ASN B N   
4323 C CA  . ASN B 139 ? 0.6149 0.4048 0.4517 -0.0139 -0.1476 0.1261  138 ASN B CA  
4324 C C   . ASN B 139 ? 0.6871 0.4912 0.5354 -0.0155 -0.1428 0.1351  138 ASN B C   
4325 O O   . ASN B 139 ? 0.7494 0.5596 0.5988 -0.0131 -0.1418 0.1438  138 ASN B O   
4326 C CB  . ASN B 139 ? 0.6823 0.4716 0.5140 -0.0052 -0.1432 0.1244  138 ASN B CB  
4327 C CG  . ASN B 139 ? 0.8553 0.6348 0.6745 0.0004  -0.1469 0.1216  138 ASN B CG  
4328 O OD1 . ASN B 139 ? 0.8915 0.6745 0.7064 0.0088  -0.1436 0.1267  138 ASN B OD1 
4329 N ND2 . ASN B 139 ? 0.8604 0.6281 0.6730 -0.0026 -0.1532 0.1144  138 ASN B ND2 
4330 N N   . ALA B 140 ? 0.6329 0.4431 0.4899 -0.0186 -0.1395 0.1342  139 ALA B N   
4331 C CA  . ALA B 140 ? 0.5779 0.4016 0.4455 -0.0185 -0.1337 0.1424  139 ALA B CA  
4332 C C   . ALA B 140 ? 0.5846 0.4119 0.4603 -0.0279 -0.1384 0.1446  139 ALA B C   
4333 O O   . ALA B 140 ? 0.6736 0.5123 0.5588 -0.0293 -0.1353 0.1521  139 ALA B O   
4334 C CB  . ALA B 140 ? 0.5675 0.3962 0.4391 -0.0143 -0.1264 0.1414  139 ALA B CB  
4335 N N   . ASP B 141 ? 0.5647 0.4530 0.5802 -0.1381 -0.1055 0.1957  140 ASP B N   
4336 C CA  . ASP B 141 ? 0.5946 0.4815 0.6211 -0.1503 -0.1176 0.1955  140 ASP B CA  
4337 C C   . ASP B 141 ? 0.6976 0.5867 0.7420 -0.1652 -0.1210 0.1998  140 ASP B C   
4338 O O   . ASP B 141 ? 0.7650 0.6369 0.8133 -0.1698 -0.1252 0.1939  140 ASP B O   
4339 C CB  . ASP B 141 ? 0.5213 0.3871 0.5401 -0.1466 -0.1238 0.1850  140 ASP B CB  
4340 C CG  . ASP B 141 ? 0.5919 0.4500 0.6201 -0.1594 -0.1367 0.1815  140 ASP B CG  
4341 O OD1 . ASP B 141 ? 0.6358 0.5101 0.6740 -0.1690 -0.1414 0.1855  140 ASP B OD1 
4342 O OD2 . ASP B 141 ? 0.6258 0.4630 0.6517 -0.1592 -0.1416 0.1729  140 ASP B OD2 
4343 N N   . LYS B 142 ? 0.6799 0.5917 0.7354 -0.1719 -0.1190 0.2101  141 LYS B N   
4344 C CA  . LYS B 142 ? 0.6554 0.5740 0.7287 -0.1853 -0.1213 0.2153  141 LYS B CA  
4345 C C   . LYS B 142 ? 0.6309 0.5410 0.7163 -0.1995 -0.1343 0.2086  141 LYS B C   
4346 O O   . LYS B 142 ? 0.7583 0.6606 0.8529 -0.2074 -0.1372 0.2076  141 LYS B O   
4347 C CB  . LYS B 142 ? 0.6034 0.5524 0.6870 -0.1887 -0.1158 0.2288  141 LYS B CB  
4348 C CG  . LYS B 142 ? 0.5431 0.4991 0.6143 -0.1747 -0.1025 0.2342  141 LYS B CG  
4349 C CD  . LYS B 142 ? 0.5720 0.5080 0.6341 -0.1685 -0.0971 0.2289  141 LYS B CD  
4350 C CE  . LYS B 142 ? 0.6653 0.6089 0.7166 -0.1572 -0.0842 0.2338  141 LYS B CE  
4351 N NZ  . LYS B 142 ? 0.7102 0.6350 0.7512 -0.1511 -0.0785 0.2280  141 LYS B NZ  
4352 N N   . ASP B 143 ? 0.5011 0.4125 0.5858 -0.2027 -0.1424 0.2032  142 ASP B N   
4353 C CA  . ASP B 143 ? 0.5783 0.4828 0.6736 -0.2161 -0.1554 0.1937  142 ASP B CA  
4354 C C   . ASP B 143 ? 0.6459 0.5204 0.7300 -0.2124 -0.1627 0.1786  142 ASP B C   
4355 O O   . ASP B 143 ? 0.6839 0.5538 0.7719 -0.2190 -0.1730 0.1663  142 ASP B O   
4356 C CB  . ASP B 143 ? 0.6525 0.5892 0.7575 -0.2201 -0.1593 0.1917  142 ASP B CB  
4357 C CG  . ASP B 143 ? 0.7410 0.6910 0.8324 -0.2040 -0.1561 0.1847  142 ASP B CG  
4358 O OD1 . ASP B 143 ? 0.7980 0.7283 0.8733 -0.1929 -0.1555 0.1771  142 ASP B OD1 
4359 O OD2 . ASP B 143 ? 0.7467 0.7281 0.8444 -0.2025 -0.1545 0.1877  142 ASP B OD2 
4360 N N   . GLY B 144 ? 0.6595 0.5176 0.7276 -0.1980 -0.1560 0.1773  143 GLY B N   
4361 C CA  . GLY B 144 ? 0.6444 0.4744 0.7023 -0.1922 -0.1604 0.1654  143 GLY B CA  
4362 C C   . GLY B 144 ? 0.7024 0.5294 0.7525 -0.1879 -0.1682 0.1515  143 GLY B C   
4363 O O   . GLY B 144 ? 0.7428 0.5464 0.7891 -0.1878 -0.1746 0.1403  143 GLY B O   
4364 N N   . ASP B 145 ? 0.6803 0.5346 0.7267 -0.1803 -0.1659 0.1500  144 ASP B N   
4365 C CA  . ASP B 145 ? 0.6075 0.4680 0.6448 -0.1715 -0.1709 0.1356  144 ASP B CA  
4366 C C   . ASP B 145 ? 0.6696 0.5221 0.6900 -0.1552 -0.1658 0.1357  144 ASP B C   
4367 O O   . ASP B 145 ? 0.7056 0.5640 0.7170 -0.1458 -0.1686 0.1257  144 ASP B O   
4368 C CB  . ASP B 145 ? 0.5567 0.4519 0.5997 -0.1721 -0.1717 0.1350  144 ASP B CB  
4369 C CG  . ASP B 145 ? 0.6657 0.5811 0.7069 -0.1647 -0.1619 0.1483  144 ASP B CG  
4370 O OD1 . ASP B 145 ? 0.6062 0.5076 0.6391 -0.1586 -0.1548 0.1570  144 ASP B OD1 
4371 O OD2 . ASP B 145 ? 0.6786 0.6232 0.7260 -0.1648 -0.1614 0.1502  144 ASP B OD2 
4372 N N   . GLY B 146 ? 0.6426 0.4841 0.6591 -0.1526 -0.1584 0.1482  145 GLY B N   
4373 C CA  . GLY B 146 ? 0.5988 0.4306 0.5999 -0.1392 -0.1540 0.1512  145 GLY B CA  
4374 C C   . GLY B 146 ? 0.5635 0.4167 0.5560 -0.1291 -0.1487 0.1570  145 GLY B C   
4375 O O   . GLY B 146 ? 0.5399 0.3859 0.5194 -0.1188 -0.1459 0.1604  145 GLY B O   
4376 N N   . ARG B 147 ? 0.5093 0.3884 0.5092 -0.1318 -0.1477 0.1587  146 ARG B N   
4377 C CA  . ARG B 147 ? 0.4658 0.3643 0.4579 -0.1217 -0.1428 0.1643  146 ARG B CA  
4378 C C   . ARG B 147 ? 0.5159 0.4272 0.5144 -0.1258 -0.1359 0.1764  146 ARG B C   
4379 O O   . ARG B 147 ? 0.6407 0.5455 0.6489 -0.1360 -0.1348 0.1811  146 ARG B O   
4380 C CB  . ARG B 147 ? 0.4808 0.4020 0.4743 -0.1176 -0.1480 0.1544  146 ARG B CB  
4381 C CG  . ARG B 147 ? 0.4896 0.4177 0.4970 -0.1292 -0.1550 0.1451  146 ARG B CG  
4382 C CD  . ARG B 147 ? 0.4732 0.4223 0.4805 -0.1256 -0.1609 0.1345  146 ARG B CD  
4383 N NE  . ARG B 147 ? 0.5244 0.4885 0.5466 -0.1381 -0.1663 0.1302  146 ARG B NE  
4384 C CZ  . ARG B 147 ? 0.5113 0.4916 0.5357 -0.1394 -0.1736 0.1194  146 ARG B CZ  
4385 N NH1 . ARG B 147 ? 0.5146 0.4988 0.5274 -0.1281 -0.1756 0.1118  146 ARG B NH1 
4386 N NH2 . ARG B 147 ? 0.4671 0.4606 0.5052 -0.1523 -0.1792 0.1169  146 ARG B NH2 
4387 N N   . ILE B 148 ? 0.4166 0.3456 0.4094 -0.1172 -0.1311 0.1817  147 ILE B N   
4388 C CA  . ILE B 148 ? 0.4141 0.3544 0.4099 -0.1180 -0.1231 0.1936  147 ILE B CA  
4389 C C   . ILE B 148 ? 0.4356 0.4079 0.4392 -0.1152 -0.1221 0.1941  147 ILE B C   
4390 O O   . ILE B 148 ? 0.4463 0.4282 0.4408 -0.1043 -0.1210 0.1937  147 ILE B O   
4391 C CB  . ILE B 148 ? 0.4290 0.3624 0.4108 -0.1043 -0.1122 0.1917  147 ILE B CB  
4392 C CG1 . ILE B 148 ? 0.4425 0.3536 0.4195 -0.1026 -0.1094 0.1838  147 ILE B CG1 
4393 C CG2 . ILE B 148 ? 0.4107 0.3565 0.3948 -0.1022 -0.1022 0.1988  147 ILE B CG2 
4394 C CD1 . ILE B 148 ? 0.5314 0.4345 0.5188 -0.1136 -0.1091 0.1876  147 ILE B CD1 
4395 N N   . SER B 149 ? 0.5312 0.5206 0.5524 -0.1256 -0.1228 0.1958  148 SER B N   
4396 C CA  . SER B 149 ? 0.5523 0.5745 0.5834 -0.1240 -0.1213 0.1985  148 SER B CA  
4397 C C   . SER B 149 ? 0.5213 0.5513 0.5446 -0.1136 -0.1107 0.2102  148 SER B C   
4398 O O   . SER B 149 ? 0.4480 0.4578 0.4590 -0.1099 -0.1050 0.2162  148 SER B O   
4399 C CB  . SER B 149 ? 0.6091 0.6465 0.6613 -0.1390 -0.1242 0.2007  148 SER B CB  
4400 O OG  . SER B 149 ? 0.6484 0.6764 0.7043 -0.1452 -0.1184 0.2112  148 SER B OG  
4401 N N   . PHE B 150 ? 0.4925 0.5516 0.5226 -0.1087 -0.1082 0.2134  149 PHE B N   
4402 C CA  . PHE B 150 ? 0.4351 0.5025 0.4574 -0.0972 -0.0979 0.2238  149 PHE B CA  
4403 C C   . PHE B 150 ? 0.4719 0.5409 0.5003 -0.1023 -0.0900 0.2351  149 PHE B C   
4404 O O   . PHE B 150 ? 0.4487 0.5065 0.4630 -0.0940 -0.0815 0.2423  149 PHE B O   
4405 C CB  . PHE B 150 ? 0.3846 0.4847 0.4152 -0.0908 -0.0972 0.2252  149 PHE B CB  
4406 C CG  . PHE B 150 ? 0.4168 0.5254 0.4395 -0.0775 -0.0864 0.2354  149 PHE B CG  
4407 C CD1 . PHE B 150 ? 0.4171 0.5030 0.4174 -0.0650 -0.0821 0.2347  149 PHE B CD1 
4408 C CD2 . PHE B 150 ? 0.4599 0.5991 0.4974 -0.0770 -0.0805 0.2443  149 PHE B CD2 
4409 C CE1 . PHE B 150 ? 0.4539 0.5436 0.4467 -0.0511 -0.0707 0.2361  149 PHE B CE1 
4410 C CE2 . PHE B 150 ? 0.4705 0.6167 0.4993 -0.0628 -0.0699 0.2533  149 PHE B CE2 
4411 C CZ  . PHE B 150 ? 0.4627 0.5828 0.4681 -0.0499 -0.0655 0.2494  149 PHE B CZ  
4412 N N   . GLU B 151 ? 0.5528 0.6364 0.6016 -0.1162 -0.0930 0.2369  150 GLU B N   
4413 C CA  . GLU B 151 ? 0.5287 0.6171 0.5865 -0.1231 -0.0864 0.2487  150 GLU B CA  
4414 C C   . GLU B 151 ? 0.5635 0.6185 0.6081 -0.1249 -0.0843 0.2503  150 GLU B C   
4415 O O   . GLU B 151 ? 0.5450 0.5979 0.5839 -0.1209 -0.0748 0.2595  150 GLU B O   
4416 C CB  . GLU B 151 ? 0.4628 0.5698 0.5454 -0.1402 -0.0930 0.2499  150 GLU B CB  
4417 C CG  . GLU B 151 ? 0.4634 0.6094 0.5620 -0.1398 -0.0938 0.2526  150 GLU B CG  
4418 C CD  . GLU B 151 ? 0.4622 0.6130 0.5572 -0.1351 -0.1018 0.2399  150 GLU B CD  
4419 O OE1 . GLU B 151 ? 0.4665 0.5935 0.5531 -0.1378 -0.1100 0.2275  150 GLU B OE1 
4420 O OE2 . GLU B 151 ? 0.4565 0.6366 0.5576 -0.1283 -0.0999 0.2428  150 GLU B OE2 
4421 N N   . GLU B 152 ? 0.5439 0.5738 0.5834 -0.1296 -0.0925 0.2404  151 GLU B N   
4422 C CA  . GLU B 152 ? 0.4235 0.4230 0.4511 -0.1286 -0.0902 0.2373  151 GLU B CA  
4423 C C   . GLU B 152 ? 0.5573 0.5457 0.5635 -0.1100 -0.0811 0.2291  151 GLU B C   
4424 O O   . GLU B 152 ? 0.5713 0.5474 0.5693 -0.1051 -0.0732 0.2264  151 GLU B O   
4425 C CB  . GLU B 152 ? 0.5736 0.5507 0.6010 -0.1361 -0.1006 0.2280  151 GLU B CB  
4426 C CG  . GLU B 152 ? 0.4374 0.4152 0.4840 -0.1537 -0.1075 0.2296  151 GLU B CG  
4427 C CD  . GLU B 152 ? 0.5629 0.5280 0.6107 -0.1576 -0.1183 0.2154  151 GLU B CD  
4428 O OE1 . GLU B 152 ? 0.5642 0.5261 0.5995 -0.1470 -0.1202 0.2074  151 GLU B OE1 
4429 O OE2 . GLU B 152 ? 0.5610 0.5192 0.6217 -0.1710 -0.1250 0.2126  151 GLU B OE2 
4430 N N   . PHE B 153 ? 0.5545 0.5471 0.5518 -0.1003 -0.0828 0.2246  152 PHE B N   
4431 C CA  . PHE B 153 ? 0.4803 0.4628 0.4585 -0.0837 -0.0749 0.2160  152 PHE B CA  
4432 C C   . PHE B 153 ? 0.5042 0.4941 0.4779 -0.0768 -0.0635 0.2224  152 PHE B C   
4433 O O   . PHE B 153 ? 0.5384 0.5104 0.4970 -0.0691 -0.0560 0.2167  152 PHE B O   
4434 C CB  . PHE B 153 ? 0.4567 0.4485 0.4306 -0.0757 -0.0788 0.2119  152 PHE B CB  
4435 C CG  . PHE B 153 ? 0.3981 0.3783 0.3529 -0.0595 -0.0711 0.2025  152 PHE B CG  
4436 C CD1 . PHE B 153 ? 0.3923 0.3495 0.3343 -0.0543 -0.0698 0.1906  152 PHE B CD1 
4437 C CD2 . PHE B 153 ? 0.3942 0.3868 0.3444 -0.0495 -0.0653 0.2058  152 PHE B CD2 
4438 C CE1 . PHE B 153 ? 0.4047 0.3506 0.3294 -0.0409 -0.0632 0.1824  152 PHE B CE1 
4439 C CE2 . PHE B 153 ? 0.3959 0.3732 0.3269 -0.0356 -0.0594 0.1968  152 PHE B CE2 
4440 C CZ  . PHE B 153 ? 0.3950 0.3485 0.3130 -0.0319 -0.0586 0.1852  152 PHE B CZ  
4441 N N   . CYS B 154 ? 0.5667 0.5838 0.5531 -0.0793 -0.0621 0.2347  153 CYS B N   
4442 C CA  . CYS B 154 ? 0.5726 0.5992 0.5545 -0.0711 -0.0506 0.2417  153 CYS B CA  
4443 C C   . CYS B 154 ? 0.5713 0.5877 0.5528 -0.0760 -0.0449 0.2444  153 CYS B C   
4444 O O   . CYS B 154 ? 0.5689 0.5745 0.5342 -0.0662 -0.0357 0.2426  153 CYS B O   
4445 C CB  . CYS B 154 ? 0.5397 0.6028 0.5387 -0.0727 -0.0494 0.2557  153 CYS B CB  
4446 S SG  . CYS B 154 ? 0.6917 0.7693 0.6867 -0.0605 -0.0520 0.2525  153 CYS B SG  
4447 N N   . ALA B 155 ? 0.5450 0.5632 0.5431 -0.0915 -0.0511 0.2482  154 ALA B N   
4448 C CA  . ALA B 155 ? 0.5239 0.5334 0.5244 -0.0976 -0.0472 0.2505  154 ALA B CA  
4449 C C   . ALA B 155 ? 0.6087 0.5886 0.5868 -0.0883 -0.0421 0.2389  154 ALA B C   
4450 O O   . ALA B 155 ? 0.6561 0.6310 0.6285 -0.0869 -0.0348 0.2414  154 ALA B O   
4451 C CB  . ALA B 155 ? 0.4655 0.4740 0.4850 -0.1151 -0.0569 0.2521  154 ALA B CB  
4452 N N   . VAL B 156 ? 0.5985 0.5607 0.5645 -0.0823 -0.0460 0.2266  155 VAL B N   
4453 C CA  . VAL B 156 ? 0.5413 0.4779 0.4874 -0.0738 -0.0416 0.2154  155 VAL B CA  
4454 C C   . VAL B 156 ? 0.6242 0.5541 0.5484 -0.0590 -0.0331 0.2126  155 VAL B C   
4455 O O   . VAL B 156 ? 0.6989 0.6143 0.6081 -0.0539 -0.0259 0.2105  155 VAL B O   
4456 C CB  . VAL B 156 ? 0.5129 0.4359 0.4566 -0.0732 -0.0486 0.2039  155 VAL B CB  
4457 C CG1 . VAL B 156 ? 0.5007 0.4024 0.4260 -0.0637 -0.0428 0.1935  155 VAL B CG1 
4458 C CG2 . VAL B 156 ? 0.4309 0.3548 0.3925 -0.0869 -0.0575 0.2055  155 VAL B CG2 
4459 N N   . VAL B 157 ? 0.5512 0.4905 0.4727 -0.0522 -0.0343 0.2126  156 VAL B N   
4460 C CA  . VAL B 157 ? 0.5547 0.4816 0.4529 -0.0377 -0.0281 0.2072  156 VAL B CA  
4461 C C   . VAL B 157 ? 0.5590 0.5011 0.4544 -0.0318 -0.0219 0.2170  156 VAL B C   
4462 O O   . VAL B 157 ? 0.5787 0.5073 0.4522 -0.0202 -0.0173 0.2129  156 VAL B O   
4463 C CB  . VAL B 157 ? 0.5676 0.4895 0.4603 -0.0312 -0.0332 0.1976  156 VAL B CB  
4464 C CG1 . VAL B 157 ? 0.5291 0.4366 0.4222 -0.0339 -0.0370 0.1875  156 VAL B CG1 
4465 C CG2 . VAL B 157 ? 0.5998 0.5476 0.5111 -0.0356 -0.0396 0.2041  156 VAL B CG2 
4466 N N   . GLY B 158 ? 0.8342 0.7999 0.5417 -0.0442 0.0572  0.1878  157 GLY B N   
4467 C CA  . GLY B 158 ? 0.8825 0.8756 0.6014 -0.0428 0.0577  0.1846  157 GLY B CA  
4468 C C   . GLY B 158 ? 0.9551 0.9705 0.6721 -0.0327 0.0626  0.1803  157 GLY B C   
4469 O O   . GLY B 158 ? 0.9794 1.0106 0.7034 -0.0238 0.0642  0.1740  157 GLY B O   
4470 N N   . GLY B 159 ? 0.8470 0.8600 0.5505 -0.0326 0.0652  0.1841  158 GLY B N   
4471 C CA  . GLY B 159 ? 0.8460 0.8713 0.5362 -0.0226 0.0693  0.1804  158 GLY B CA  
4472 C C   . GLY B 159 ? 0.9441 0.9533 0.6220 -0.0125 0.0602  0.1688  158 GLY B C   
4473 O O   . GLY B 159 ? 0.9787 0.9879 0.6354 -0.0037 0.0607  0.1643  158 GLY B O   
4474 N N   . LEU B 160 ? 0.9758 0.9686 0.6645 -0.0136 0.0512  0.1652  159 LEU B N   
4475 C CA  . LEU B 160 ? 0.9206 0.8974 0.6034 -0.0074 0.0389  0.1576  159 LEU B CA  
4476 C C   . LEU B 160 ? 0.8992 0.8755 0.5795 0.0031  0.0358  0.1443  159 LEU B C   
4477 O O   . LEU B 160 ? 0.9358 0.8958 0.6045 0.0087  0.0237  0.1366  159 LEU B O   
4478 C CB  . LEU B 160 ? 0.8838 0.8453 0.5839 -0.0125 0.0322  0.1638  159 LEU B CB  
4479 C CG  . LEU B 160 ? 0.8983 0.8518 0.5981 -0.0169 0.0274  0.1750  159 LEU B CG  
4480 C CD1 . LEU B 160 ? 0.9444 0.9053 0.6340 -0.0223 0.0374  0.1835  159 LEU B CD1 
4481 C CD2 . LEU B 160 ? 0.8637 0.8057 0.5860 -0.0186 0.0267  0.1841  159 LEU B CD2 
4482 N N   . ASP B 161 ? 0.8570 0.8489 0.5487 0.0053  0.0447  0.1429  160 ASP B N   
4483 C CA  . ASP B 161 ? 1.0110 1.0041 0.7019 0.0174  0.0441  0.1318  160 ASP B CA  
4484 C C   . ASP B 161 ? 1.0178 0.9882 0.7129 0.0192  0.0296  0.1242  160 ASP B C   
4485 O O   . ASP B 161 ? 1.0132 0.9705 0.6936 0.0294  0.0229  0.1133  160 ASP B O   
4486 C CB  . ASP B 161 ? 1.1455 1.1409 0.8088 0.0310  0.0506  0.1258  160 ASP B CB  
4487 C CG  . ASP B 161 ? 1.1787 1.2036 0.8457 0.0323  0.0689  0.1358  160 ASP B CG  
4488 O OD1 . ASP B 161 ? 1.1474 1.1878 0.8363 0.0189  0.0723  0.1478  160 ASP B OD1 
4489 O OD2 . ASP B 161 ? 1.1871 1.2172 0.8336 0.0473  0.0800  0.1330  160 ASP B OD2 
4490 N N   . ILE B 162 ? 1.0219 0.9849 0.7350 0.0098  0.0254  0.1311  161 ILE B N   
4491 C CA  . ILE B 162 ? 0.9841 0.9293 0.7079 0.0105  0.0138  0.1285  161 ILE B CA  
4492 C C   . ILE B 162 ? 0.9268 0.8744 0.6605 0.0160  0.0152  0.1222  161 ILE B C   
4493 O O   . ILE B 162 ? 0.9352 0.8694 0.6721 0.0209  0.0056  0.1159  161 ILE B O   
4494 C CB  . ILE B 162 ? 0.9388 0.8760 0.6784 0.0019  0.0135  0.1415  161 ILE B CB  
4495 C CG1 . ILE B 162 ? 0.9469 0.8821 0.6809 -0.0025 0.0098  0.1494  161 ILE B CG1 
4496 C CG2 . ILE B 162 ? 0.8978 0.8211 0.6544 0.0031  0.0046  0.1428  161 ILE B CG2 
4497 C CD1 . ILE B 162 ? 0.9261 0.8488 0.6552 -0.0010 -0.0081 0.1460  161 ILE B CD1 
4498 N N   . HIS B 163 ? 0.7549 0.7191 0.4944 0.0142  0.0251  0.1253  162 HIS B N   
4499 C CA  . HIS B 163 ? 0.7838 0.7545 0.5343 0.0189  0.0258  0.1217  162 HIS B CA  
4500 C C   . HIS B 163 ? 0.8701 0.8412 0.6147 0.0335  0.0240  0.1102  162 HIS B C   
4501 O O   . HIS B 163 ? 0.9156 0.8861 0.6704 0.0391  0.0216  0.1066  162 HIS B O   
4502 C CB  . HIS B 163 ? 0.8294 0.8213 0.5880 0.0131  0.0338  0.1294  162 HIS B CB  
4503 C CG  . HIS B 163 ? 0.8987 0.9141 0.6535 0.0186  0.0432  0.1306  162 HIS B CG  
4504 N ND1 . HIS B 163 ? 0.9222 0.9389 0.6622 0.0164  0.0479  0.1335  162 HIS B ND1 
4505 C CD2 . HIS B 163 ? 0.9052 0.9441 0.6698 0.0280  0.0508  0.1314  162 HIS B CD2 
4506 C CE1 . HIS B 163 ? 0.9584 0.9972 0.6962 0.0242  0.0589  0.1356  162 HIS B CE1 
4507 N NE2 . HIS B 163 ? 0.9627 1.0166 0.7170 0.0320  0.0619  0.1352  162 HIS B NE2 
4508 N N   . LYS B 164 ? 0.9622 0.9303 0.6857 0.0410  0.0252  0.1045  163 LYS B N   
4509 C CA  . LYS B 164 ? 0.9172 0.8750 0.6240 0.0575  0.0239  0.0924  163 LYS B CA  
4510 C C   . LYS B 164 ? 0.9171 0.8437 0.6197 0.0573  0.0061  0.0850  163 LYS B C   
4511 O O   . LYS B 164 ? 0.9692 0.8803 0.6616 0.0694  0.0016  0.0748  163 LYS B O   
4512 C CB  . LYS B 164 ? 0.9699 0.9259 0.6452 0.0669  0.0309  0.0887  163 LYS B CB  
4513 C CG  . LYS B 164 ? 1.0179 1.0061 0.6993 0.0653  0.0488  0.0997  163 LYS B CG  
4514 C CD  . LYS B 164 ? 1.1079 1.0932 0.7541 0.0803  0.0600  0.0961  163 LYS B CD  
4515 C CE  . LYS B 164 ? 1.1332 1.0854 0.7433 0.0773  0.0459  0.0896  163 LYS B CE  
4516 N NZ  . LYS B 164 ? 1.1809 1.1197 0.7446 0.0941  0.0553  0.0840  163 LYS B NZ  
4517 N N   . LYS B 165 ? 0.9113 0.8285 0.6238 0.0438  -0.0036 0.0921  164 LYS B N   
4518 C CA  . LYS B 165 ? 0.8960 0.7874 0.6128 0.0407  -0.0215 0.0905  164 LYS B CA  
4519 C C   . LYS B 165 ? 0.8801 0.7716 0.6235 0.0380  -0.0221 0.0951  164 LYS B C   
4520 O O   . LYS B 165 ? 0.9361 0.8082 0.6840 0.0396  -0.0348 0.0919  164 LYS B O   
4521 C CB  . LYS B 165 ? 0.8116 0.6958 0.5314 0.0289  -0.0313 0.1002  164 LYS B CB  
4522 C CG  . LYS B 165 ? 0.8632 0.7224 0.5544 0.0305  -0.0490 0.0930  164 LYS B CG  
4523 C CD  . LYS B 165 ? 0.9089 0.7678 0.5606 0.0425  -0.0397 0.0821  164 LYS B CD  
4524 C CE  . LYS B 165 ? 0.9691 0.7902 0.5782 0.0469  -0.0595 0.0718  164 LYS B CE  
4525 N NZ  . LYS B 165 ? 1.0010 0.7876 0.5957 0.0540  -0.0761 0.0596  164 LYS B NZ  
4526 N N   . MET B 166 ? 0.8049 0.7145 0.5622 0.0337  -0.0097 0.1028  165 MET B N   
4527 C CA  . MET B 166 ? 0.7571 0.6633 0.5317 0.0317  -0.0092 0.1078  165 MET B CA  
4528 C C   . MET B 166 ? 0.7641 0.6748 0.5404 0.0415  -0.0085 0.0999  165 MET B C   
4529 O O   . MET B 166 ? 0.7399 0.6648 0.5228 0.0404  -0.0016 0.1036  165 MET B O   
4530 C CB  . MET B 166 ? 0.7629 0.6773 0.5422 0.0231  0.0013  0.1189  165 MET B CB  
4531 C CG  . MET B 166 ? 0.8210 0.7314 0.6004 0.0157  0.0036  0.1289  165 MET B CG  
4532 S SD  . MET B 166 ? 0.8293 0.7388 0.6037 0.0082  0.0167  0.1404  165 MET B SD  
4533 C CE  . MET B 166 ? 1.1495 1.0387 0.9296 0.0102  0.0180  0.1464  165 MET B CE  
4534 N N   . VAL B 167 ? 0.7684 0.6643 0.5379 0.0509  -0.0174 0.0900  166 VAL B N   
4535 C CA  . VAL B 167 ? 0.7630 0.6617 0.5341 0.0633  -0.0160 0.0829  166 VAL B CA  
4536 C C   . VAL B 167 ? 0.7888 0.6598 0.5602 0.0675  -0.0299 0.0775  166 VAL B C   
4537 O O   . VAL B 167 ? 0.8408 0.6895 0.6019 0.0651  -0.0421 0.0742  166 VAL B O   
4538 C CB  . VAL B 167 ? 0.7654 0.6754 0.5197 0.0772  -0.0069 0.0748  166 VAL B CB  
4539 C CG1 . VAL B 167 ? 0.7870 0.6931 0.5415 0.0942  -0.0060 0.0674  166 VAL B CG1 
4540 C CG2 . VAL B 167 ? 0.7577 0.7004 0.5208 0.0730  0.0072  0.0836  166 VAL B CG2 
4541 N N   . VAL B 168 ? 0.7177 0.5887 0.5015 0.0724  -0.0303 0.0781  167 VAL B N   
4542 C CA  . VAL B 168 ? 0.7768 0.6214 0.5622 0.0768  -0.0432 0.0739  167 VAL B CA  
4543 C C   . VAL B 168 ? 0.8112 0.6567 0.5952 0.0934  -0.0407 0.0663  167 VAL B C   
4544 O O   . VAL B 168 ? 0.8020 0.6742 0.5957 0.0981  -0.0296 0.0698  167 VAL B O   
4545 C CB  . VAL B 168 ? 0.7315 0.5697 0.5369 0.0660  -0.0471 0.0864  167 VAL B CB  
4546 C CG1 . VAL B 168 ? 0.7129 0.5508 0.5243 0.0525  -0.0468 0.0974  167 VAL B CG1 
4547 C CG2 . VAL B 168 ? 0.7119 0.5670 0.5264 0.0663  -0.0382 0.0925  167 VAL B CG2 
4548 N N   . ASP B 169 ? 0.8639 0.6792 0.6374 0.1020  -0.0523 0.0577  168 ASP B N   
4549 C CA  . ASP B 169 ? 0.9274 0.7384 0.7011 0.1193  -0.0505 0.0518  168 ASP B CA  
4550 C C   . ASP B 169 ? 0.9239 0.7328 0.7207 0.1129  -0.0567 0.0610  168 ASP B C   
4551 O O   . ASP B 169 ? 0.9472 0.7410 0.7512 0.0996  -0.0662 0.0677  168 ASP B O   
4552 C CB  . ASP B 169 ? 1.0103 0.7807 0.7547 0.1329  -0.0610 0.0373  168 ASP B CB  
4553 C CG  . ASP B 169 ? 1.1112 0.8760 0.8218 0.1441  -0.0535 0.0269  168 ASP B CG  
4554 O OD1 . ASP B 169 ? 1.1160 0.9159 0.8318 0.1473  -0.0356 0.0311  168 ASP B OD1 
4555 O OD2 . ASP B 169 ? 1.1569 0.8789 0.8334 0.1492  -0.0668 0.0151  168 ASP B OD2 
4556 N N   . VAL B 170 ? 0.9426 0.7672 0.7522 0.1228  -0.0511 0.0636  169 VAL B N   
4557 C CA  . VAL B 170 ? 0.9433 0.7615 0.7693 0.1186  -0.0580 0.0720  169 VAL B CA  
4558 C C   . VAL B 170 ? 1.0192 0.8217 0.8453 0.1364  -0.0628 0.0660  169 VAL B C   
4559 O O   . VAL B 170 ? 1.0415 0.8272 0.8758 0.1345  -0.0720 0.0707  169 VAL B O   
4560 C CB  . VAL B 170 ? 0.8507 0.6978 0.6923 0.1104  -0.0518 0.0844  169 VAL B CB  
4561 C CG1 . VAL B 170 ? 0.7394 0.5978 0.5767 0.0947  -0.0458 0.0898  169 VAL B CG1 
4562 C CG2 . VAL B 170 ? 0.8874 0.7629 0.7405 0.1235  -0.0446 0.0851  169 VAL B CG2 
4563 O OXT . VAL B 170 ? 1.0432 0.8479 0.8598 0.1547  -0.0561 0.0573  169 VAL B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  ALA 22  2   ?   ?   ?   A . n 
A 1 23  ALA 23  3   ?   ?   ?   A . n 
A 1 24  PRO 24  4   ?   ?   ?   A . n 
A 1 25  GLU 25  5   ?   ?   ?   A . n 
A 1 26  PRO 26  6   ?   ?   ?   A . n 
A 1 27  ALA 27  7   ?   ?   ?   A . n 
A 1 28  ARG 28  8   ?   ?   ?   A . n 
A 1 29  ALA 29  9   ?   ?   ?   A . n 
A 1 30  ALA 30  10  ?   ?   ?   A . n 
A 1 31  PRO 31  11  ?   ?   ?   A . n 
A 1 32  PRO 32  12  ?   ?   ?   A . n 
A 1 33  PRO 33  13  ?   ?   ?   A . n 
A 1 34  PRO 34  14  ?   ?   ?   A . n 
A 1 35  PRO 35  15  15  PRO PRO A . n 
A 1 36  PRO 36  16  16  PRO PRO A . n 
A 1 37  PRO 37  17  17  PRO PRO A . n 
A 1 38  PRO 38  18  18  PRO PRO A . n 
A 1 39  PRO 39  19  19  PRO PRO A . n 
A 1 40  PRO 40  20  20  PRO PRO A . n 
A 1 41  PRO 41  21  21  PRO PRO A . n 
A 1 42  GLY 42  22  22  GLY GLY A . n 
A 1 43  ALA 43  23  23  ALA ALA A . n 
A 1 44  ASP 44  24  24  ASP ASP A . n 
A 1 45  ARG 45  25  25  ARG ARG A . n 
A 1 46  VAL 46  26  26  VAL VAL A . n 
A 1 47  VAL 47  27  27  VAL VAL A . n 
A 1 48  LYS 48  28  28  LYS LYS A . n 
A 1 49  ALA 49  29  29  ALA ALA A . n 
A 1 50  VAL 50  30  30  VAL VAL A . n 
A 1 51  PRO 51  31  31  PRO PRO A . n 
A 1 52  PHE 52  32  32  PHE PHE A . n 
A 1 53  PRO 53  33  33  PRO PRO A . n 
A 1 54  PRO 54  34  34  PRO PRO A . n 
A 1 55  THR 55  35  35  THR THR A . n 
A 1 56  HIS 56  36  36  HIS HIS A . n 
A 1 57  ARG 57  37  37  ARG ARG A . n 
A 1 58  LEU 58  38  38  LEU LEU A . n 
A 1 59  THR 59  39  39  THR THR A . n 
A 1 60  SER 60  40  40  SER SER A . n 
A 1 61  GLU 61  41  41  GLU GLU A . n 
A 1 62  GLU 62  42  42  GLU GLU A . n 
A 1 63  VAL 63  43  43  VAL VAL A . n 
A 1 64  PHE 64  44  44  PHE PHE A . n 
A 1 65  ASP 65  45  45  ASP ASP A . n 
A 1 66  LEU 66  46  46  LEU LEU A . n 
A 1 67  ASP 67  47  47  ASP ASP A . n 
A 1 68  GLY 68  48  48  GLY GLY A . n 
A 1 69  ILE 69  49  49  ILE ILE A . n 
A 1 70  PRO 70  50  50  PRO PRO A . n 
A 1 71  ARG 71  51  51  ARG ARG A . n 
A 1 72  VAL 72  52  52  VAL VAL A . n 
A 1 73  ASP 73  53  53  ASP ASP A . n 
A 1 74  VAL 74  54  54  VAL VAL A . n 
A 1 75  LEU 75  55  55  LEU LEU A . n 
A 1 76  LYS 76  56  56  LYS LYS A . n 
A 1 77  ASN 77  57  57  ASN ASN A . n 
A 1 78  HIS 78  58  58  HIS HIS A . n 
A 1 79  LEU 79  59  59  LEU LEU A . n 
A 1 80  VAL 80  60  60  VAL VAL A . n 
A 1 81  LYS 81  61  61  LYS LYS A . n 
A 1 82  GLU 82  62  62  GLU GLU A . n 
A 1 83  GLY 83  63  63  GLY GLY A . n 
A 1 84  ARG 84  64  64  ARG ARG A . n 
A 1 85  VAL 85  65  65  VAL VAL A . n 
A 1 86  ASP 86  66  66  ASP ASP A . n 
A 1 87  GLU 87  67  67  GLU GLU A . n 
A 1 88  GLU 88  68  68  GLU GLU A . n 
A 1 89  ILE 89  69  69  ILE ILE A . n 
A 1 90  ALA 90  70  70  ALA ALA A . n 
A 1 91  LEU 91  71  71  LEU LEU A . n 
A 1 92  ARG 92  72  72  ARG ARG A . n 
A 1 93  ILE 93  73  73  ILE ILE A . n 
A 1 94  ILE 94  74  74  ILE ILE A . n 
A 1 95  ASN 95  75  75  ASN ASN A . n 
A 1 96  GLU 96  76  76  GLU GLU A . n 
A 1 97  GLY 97  77  77  GLY GLY A . n 
A 1 98  ALA 98  78  78  ALA ALA A . n 
A 1 99  ALA 99  79  79  ALA ALA A . n 
A 1 100 ILE 100 80  80  ILE ILE A . n 
A 1 101 LEU 101 81  81  LEU LEU A . n 
A 1 102 ARG 102 82  82  ARG ARG A . n 
A 1 103 ARG 103 83  83  ARG ARG A . n 
A 1 104 GLU 104 84  84  GLU GLU A . n 
A 1 105 LYS 105 85  85  LYS LYS A . n 
A 1 106 THR 106 86  86  THR THR A . n 
A 1 107 MET 107 87  87  MET MET A . n 
A 1 108 ILE 108 88  88  ILE ILE A . n 
A 1 109 GLU 109 89  89  GLU GLU A . n 
A 1 110 VAL 110 90  90  VAL VAL A . n 
A 1 111 GLU 111 91  91  GLU GLU A . n 
A 1 112 ALA 112 92  92  ALA ALA A . n 
A 1 113 PRO 113 93  93  PRO PRO A . n 
A 1 114 ILE 114 94  94  ILE ILE A . n 
A 1 115 THR 115 95  95  THR THR A . n 
A 1 116 VAL 116 96  96  VAL VAL A . n 
A 1 117 CYS 117 97  97  CYS CYS A . n 
A 1 118 GLY 118 98  98  GLY GLY A . n 
A 1 119 ASP 119 99  99  ASP ASP A . n 
A 1 120 ILE 120 100 100 ILE ILE A . n 
A 1 121 HIS 121 101 101 HIS HIS A . n 
A 1 122 GLY 122 102 102 GLY GLY A . n 
A 1 123 GLN 123 103 103 GLN GLN A . n 
A 1 124 PHE 124 104 104 PHE PHE A . n 
A 1 125 PHE 125 105 105 PHE PHE A . n 
A 1 126 ASP 126 106 106 ASP ASP A . n 
A 1 127 LEU 127 107 107 LEU LEU A . n 
A 1 128 MET 128 108 108 MET MET A . n 
A 1 129 LYS 129 109 109 LYS LYS A . n 
A 1 130 LEU 130 110 110 LEU LEU A . n 
A 1 131 PHE 131 111 111 PHE PHE A . n 
A 1 132 GLU 132 112 112 GLU GLU A . n 
A 1 133 VAL 133 113 113 VAL VAL A . n 
A 1 134 GLY 134 114 114 GLY GLY A . n 
A 1 135 GLY 135 115 115 GLY GLY A . n 
A 1 136 SER 136 116 116 SER SER A . n 
A 1 137 PRO 137 117 117 PRO PRO A . n 
A 1 138 ALA 138 118 118 ALA ALA A . n 
A 1 139 ASN 139 119 119 ASN ASN A . n 
A 1 140 THR 140 120 120 THR THR A . n 
A 1 141 ARG 141 121 121 ARG ARG A . n 
A 1 142 TYR 142 122 122 TYR TYR A . n 
A 1 143 LEU 143 123 123 LEU LEU A . n 
A 1 144 PHE 144 124 124 PHE PHE A . n 
A 1 145 LEU 145 125 125 LEU LEU A . n 
A 1 146 GLY 146 126 126 GLY GLY A . n 
A 1 147 ASP 147 127 127 ASP ASP A . n 
A 1 148 TYR 148 128 128 TYR TYR A . n 
A 1 149 VAL 149 129 129 VAL VAL A . n 
A 1 150 ASP 150 130 130 ASP ASP A . n 
A 1 151 ARG 151 131 131 ARG ARG A . n 
A 1 152 GLY 152 132 132 GLY GLY A . n 
A 1 153 TYR 153 133 133 TYR TYR A . n 
A 1 154 PHE 154 134 134 PHE PHE A . n 
A 1 155 SER 155 135 135 SER SER A . n 
A 1 156 ILE 156 136 136 ILE ILE A . n 
A 1 157 GLU 157 137 137 GLU GLU A . n 
A 1 158 CYS 158 138 138 CYS CYS A . n 
A 1 159 VAL 159 139 139 VAL VAL A . n 
A 1 160 LEU 160 140 140 LEU LEU A . n 
A 1 161 TYR 161 141 141 TYR TYR A . n 
A 1 162 LEU 162 142 142 LEU LEU A . n 
A 1 163 TRP 163 143 143 TRP TRP A . n 
A 1 164 VAL 164 144 144 VAL VAL A . n 
A 1 165 LEU 165 145 145 LEU LEU A . n 
A 1 166 LYS 166 146 146 LYS LYS A . n 
A 1 167 ILE 167 147 147 ILE ILE A . n 
A 1 168 LEU 168 148 148 LEU LEU A . n 
A 1 169 TYR 169 149 149 TYR TYR A . n 
A 1 170 PRO 170 150 150 PRO PRO A . n 
A 1 171 SER 171 151 151 SER SER A . n 
A 1 172 THR 172 152 152 THR THR A . n 
A 1 173 LEU 173 153 153 LEU LEU A . n 
A 1 174 PHE 174 154 154 PHE PHE A . n 
A 1 175 LEU 175 155 155 LEU LEU A . n 
A 1 176 LEU 176 156 156 LEU LEU A . n 
A 1 177 ARG 177 157 157 ARG ARG A . n 
A 1 178 GLY 178 158 158 GLY GLY A . n 
A 1 179 ASN 179 159 159 ASN ASN A . n 
A 1 180 HIS 180 160 160 HIS HIS A . n 
A 1 181 GLU 181 161 161 GLU GLU A . n 
A 1 182 CYS 182 162 162 CYS CYS A . n 
A 1 183 ARG 183 163 163 ARG ARG A . n 
A 1 184 HIS 184 164 164 HIS HIS A . n 
A 1 185 LEU 185 165 165 LEU LEU A . n 
A 1 186 THR 186 166 166 THR THR A . n 
A 1 187 GLU 187 167 167 GLU GLU A . n 
A 1 188 TYR 188 168 168 TYR TYR A . n 
A 1 189 PHE 189 169 169 PHE PHE A . n 
A 1 190 THR 190 170 170 THR THR A . n 
A 1 191 PHE 191 171 171 PHE PHE A . n 
A 1 192 LYS 192 172 172 LYS LYS A . n 
A 1 193 GLN 193 173 173 GLN GLN A . n 
A 1 194 GLU 194 174 174 GLU GLU A . n 
A 1 195 CYS 195 175 175 CYS CYS A . n 
A 1 196 LYS 196 176 176 LYS LYS A . n 
A 1 197 ILE 197 177 177 ILE ILE A . n 
A 1 198 LYS 198 178 178 LYS LYS A . n 
A 1 199 TYR 199 179 179 TYR TYR A . n 
A 1 200 SER 200 180 180 SER SER A . n 
A 1 201 GLU 201 181 181 GLU GLU A . n 
A 1 202 ARG 202 182 182 ARG ARG A . n 
A 1 203 VAL 203 183 183 VAL VAL A . n 
A 1 204 TYR 204 184 184 TYR TYR A . n 
A 1 205 GLU 205 185 185 GLU GLU A . n 
A 1 206 ALA 206 186 186 ALA ALA A . n 
A 1 207 CYS 207 187 187 CYS CYS A . n 
A 1 208 MET 208 188 188 MET MET A . n 
A 1 209 GLU 209 189 189 GLU GLU A . n 
A 1 210 ALA 210 190 190 ALA ALA A . n 
A 1 211 PHE 211 191 191 PHE PHE A . n 
A 1 212 ASP 212 192 192 ASP ASP A . n 
A 1 213 SER 213 193 193 SER SER A . n 
A 1 214 LEU 214 194 194 LEU LEU A . n 
A 1 215 PRO 215 195 195 PRO PRO A . n 
A 1 216 LEU 216 196 196 LEU LEU A . n 
A 1 217 ALA 217 197 197 ALA ALA A . n 
A 1 218 ALA 218 198 198 ALA ALA A . n 
A 1 219 LEU 219 199 199 LEU LEU A . n 
A 1 220 LEU 220 200 200 LEU LEU A . n 
A 1 221 ASN 221 201 201 ASN ASN A . n 
A 1 222 GLN 222 202 202 GLN GLN A . n 
A 1 223 GLN 223 203 203 GLN GLN A . n 
A 1 224 PHE 224 204 204 PHE PHE A . n 
A 1 225 LEU 225 205 205 LEU LEU A . n 
A 1 226 CYS 226 206 206 CYS CYS A . n 
A 1 227 VAL 227 207 207 VAL VAL A . n 
A 1 228 HIS 228 208 208 HIS HIS A . n 
A 1 229 GLY 229 209 209 GLY GLY A . n 
A 1 230 GLY 230 210 210 GLY GLY A . n 
A 1 231 LEU 231 211 211 LEU LEU A . n 
A 1 232 SER 232 212 212 SER SER A . n 
A 1 233 PRO 233 213 213 PRO PRO A . n 
A 1 234 GLU 234 214 214 GLU GLU A . n 
A 1 235 ILE 235 215 215 ILE ILE A . n 
A 1 236 HIS 236 216 216 HIS HIS A . n 
A 1 237 THR 237 217 217 THR THR A . n 
A 1 238 LEU 238 218 218 LEU LEU A . n 
A 1 239 ASP 239 219 219 ASP ASP A . n 
A 1 240 ASP 240 220 220 ASP ASP A . n 
A 1 241 ILE 241 221 221 ILE ILE A . n 
A 1 242 ARG 242 222 222 ARG ARG A . n 
A 1 243 ARG 243 223 223 ARG ARG A . n 
A 1 244 LEU 244 224 224 LEU LEU A . n 
A 1 245 ASP 245 225 225 ASP ASP A . n 
A 1 246 ARG 246 226 226 ARG ARG A . n 
A 1 247 PHE 247 227 227 PHE PHE A . n 
A 1 248 LYS 248 228 228 LYS LYS A . n 
A 1 249 GLU 249 229 229 GLU GLU A . n 
A 1 250 PRO 250 230 230 PRO PRO A . n 
A 1 251 PRO 251 231 231 PRO PRO A . n 
A 1 252 ALA 252 232 232 ALA ALA A . n 
A 1 253 PHE 253 233 233 PHE PHE A . n 
A 1 254 GLY 254 234 234 GLY GLY A . n 
A 1 255 PRO 255 235 235 PRO PRO A . n 
A 1 256 MET 256 236 236 MET MET A . n 
A 1 257 CYS 257 237 237 CYS CYS A . n 
A 1 258 ASP 258 238 238 ASP ASP A . n 
A 1 259 LEU 259 239 239 LEU LEU A . n 
A 1 260 LEU 260 240 240 LEU LEU A . n 
A 1 261 TRP 261 241 241 TRP TRP A . n 
A 1 262 SER 262 242 242 SER SER A . n 
A 1 263 ASP 263 243 243 ASP ASP A . n 
A 1 264 PRO 264 244 244 PRO PRO A . n 
A 1 265 SER 265 245 245 SER SER A . n 
A 1 266 GLU 266 246 246 GLU GLU A . n 
A 1 267 ASP 267 247 247 ASP ASP A . n 
A 1 268 PHE 268 248 248 PHE PHE A . n 
A 1 269 GLY 269 249 249 GLY GLY A . n 
A 1 270 ASN 270 250 250 ASN ASN A . n 
A 1 271 GLU 271 251 251 GLU GLU A . n 
A 1 272 LYS 272 252 252 LYS LYS A . n 
A 1 273 SER 273 253 253 SER SER A . n 
A 1 274 GLN 274 254 254 GLN GLN A . n 
A 1 275 GLU 275 255 255 GLU GLU A . n 
A 1 276 HIS 276 256 256 HIS HIS A . n 
A 1 277 PHE 277 257 257 PHE PHE A . n 
A 1 278 SER 278 258 258 SER SER A . n 
A 1 279 HIS 279 259 259 HIS HIS A . n 
A 1 280 ASN 280 260 260 ASN ASN A . n 
A 1 281 THR 281 261 261 THR THR A . n 
A 1 282 VAL 282 262 262 VAL VAL A . n 
A 1 283 ARG 283 263 263 ARG ARG A . n 
A 1 284 GLY 284 264 264 GLY GLY A . n 
A 1 285 CYS 285 265 265 CYS CYS A . n 
A 1 286 SER 286 266 266 SER SER A . n 
A 1 287 TYR 287 267 267 TYR TYR A . n 
A 1 288 PHE 288 268 268 PHE PHE A . n 
A 1 289 TYR 289 269 269 TYR TYR A . n 
A 1 290 ASN 290 270 270 ASN ASN A . n 
A 1 291 TYR 291 271 271 TYR TYR A . n 
A 1 292 PRO 292 272 272 PRO PRO A . n 
A 1 293 ALA 293 273 273 ALA ALA A . n 
A 1 294 VAL 294 274 274 VAL VAL A . n 
A 1 295 CYS 295 275 275 CYS CYS A . n 
A 1 296 GLU 296 276 276 GLU GLU A . n 
A 1 297 PHE 297 277 277 PHE PHE A . n 
A 1 298 LEU 298 278 278 LEU LEU A . n 
A 1 299 GLN 299 279 279 GLN GLN A . n 
A 1 300 ASN 300 280 280 ASN ASN A . n 
A 1 301 ASN 301 281 281 ASN ASN A . n 
A 1 302 ASN 302 282 282 ASN ASN A . n 
A 1 303 LEU 303 283 283 LEU LEU A . n 
A 1 304 LEU 304 284 284 LEU LEU A . n 
A 1 305 SER 305 285 285 SER SER A . n 
A 1 306 ILE 306 286 286 ILE ILE A . n 
A 1 307 ILE 307 287 287 ILE ILE A . n 
A 1 308 ARG 308 288 288 ARG ARG A . n 
A 1 309 ALA 309 289 289 ALA ALA A . n 
A 1 310 HIS 310 290 290 HIS HIS A . n 
A 1 311 GLU 311 291 291 GLU GLU A . n 
A 1 312 ALA 312 292 292 ALA ALA A . n 
A 1 313 GLN 313 293 293 GLN GLN A . n 
A 1 314 ASP 314 294 294 ASP ASP A . n 
A 1 315 ALA 315 295 295 ALA ALA A . n 
A 1 316 GLY 316 296 296 GLY GLY A . n 
A 1 317 TYR 317 297 297 TYR TYR A . n 
A 1 318 ARG 318 298 298 ARG ARG A . n 
A 1 319 MET 319 299 299 MET MET A . n 
A 1 320 TYR 320 300 300 TYR TYR A . n 
A 1 321 ARG 321 301 301 ARG ARG A . n 
A 1 322 LYS 322 302 302 LYS LYS A . n 
A 1 323 SER 323 303 303 SER SER A . n 
A 1 324 GLN 324 304 304 GLN GLN A . n 
A 1 325 THR 325 305 305 THR THR A . n 
A 1 326 THR 326 306 306 THR THR A . n 
A 1 327 GLY 327 307 307 GLY GLY A . n 
A 1 328 PHE 328 308 308 PHE PHE A . n 
A 1 329 PRO 329 309 309 PRO PRO A . n 
A 1 330 SER 330 310 310 SER SER A . n 
A 1 331 LEU 331 311 311 LEU LEU A . n 
A 1 332 ILE 332 312 312 ILE ILE A . n 
A 1 333 THR 333 313 313 THR THR A . n 
A 1 334 ILE 334 314 314 ILE ILE A . n 
A 1 335 PHE 335 315 315 PHE PHE A . n 
A 1 336 SER 336 316 316 SER SER A . n 
A 1 337 ALA 337 317 317 ALA ALA A . n 
A 1 338 PRO 338 318 318 PRO PRO A . n 
A 1 339 ASN 339 319 319 ASN ASN A . n 
A 1 340 TYR 340 320 320 TYR TYR A . n 
A 1 341 LEU 341 321 321 LEU LEU A . n 
A 1 342 ASP 342 322 322 ASP ASP A . n 
A 1 343 VAL 343 323 323 VAL VAL A . n 
A 1 344 TYR 344 324 324 TYR TYR A . n 
A 1 345 ASN 345 325 325 ASN ASN A . n 
A 1 346 ASN 346 326 326 ASN ASN A . n 
A 1 347 LYS 347 327 327 LYS LYS A . n 
A 1 348 ALA 348 328 328 ALA ALA A . n 
A 1 349 ALA 349 329 329 ALA ALA A . n 
A 1 350 VAL 350 330 330 VAL VAL A . n 
A 1 351 LEU 351 331 331 LEU LEU A . n 
A 1 352 LYS 352 332 332 LYS LYS A . n 
A 1 353 TYR 353 333 333 TYR TYR A . n 
A 1 354 GLU 354 334 334 GLU GLU A . n 
A 1 355 ASN 355 335 335 ASN ASN A . n 
A 1 356 ASN 356 336 336 ASN ASN A . n 
A 1 357 VAL 357 337 337 VAL VAL A . n 
A 1 358 MET 358 338 338 MET MET A . n 
A 1 359 ASN 359 339 339 ASN ASN A . n 
A 1 360 ILE 360 340 340 ILE ILE A . n 
A 1 361 ARG 361 341 341 ARG ARG A . n 
A 1 362 GLN 362 342 342 GLN GLN A . n 
A 1 363 PHE 363 343 343 PHE PHE A . n 
A 1 364 ASN 364 344 344 ASN ASN A . n 
A 1 365 CYS 365 345 345 CYS CYS A . n 
A 1 366 SER 366 346 346 SER SER A . n 
A 1 367 PRO 367 347 347 PRO PRO A . n 
A 1 368 HIS 368 348 348 HIS HIS A . n 
A 1 369 PRO 369 349 349 PRO PRO A . n 
A 1 370 TYR 370 350 350 TYR TYR A . n 
A 1 371 TRP 371 351 351 TRP TRP A . n 
A 1 372 LEU 372 352 352 LEU LEU A . n 
A 1 373 PRO 373 353 353 PRO PRO A . n 
A 1 374 ASN 374 354 354 ASN ASN A . n 
A 1 375 PHE 375 355 355 PHE PHE A . n 
A 1 376 MET 376 356 356 MET MET A . n 
A 1 377 ASP 377 357 357 ASP ASP A . n 
A 1 378 VAL 378 358 358 VAL VAL A . n 
A 1 379 PHE 379 359 359 PHE PHE A . n 
A 1 380 THR 380 360 360 THR THR A . n 
A 1 381 TRP 381 361 361 TRP TRP A . n 
A 1 382 SER 382 362 362 SER SER A . n 
A 1 383 LEU 383 363 363 LEU LEU A . n 
A 1 384 PRO 384 364 364 PRO PRO A . n 
A 1 385 PHE 385 365 365 PHE PHE A . n 
A 1 386 VAL 386 366 366 VAL VAL A . n 
A 1 387 GLY 387 367 367 GLY GLY A . n 
A 1 388 GLU 388 368 368 GLU GLU A . n 
A 1 389 LYS 389 369 369 LYS LYS A . n 
A 1 390 VAL 390 370 370 VAL VAL A . n 
A 1 391 THR 391 371 371 THR THR A . n 
A 1 392 GLU 392 372 372 GLU GLU A . n 
A 1 393 MET 393 373 373 MET MET A . n 
A 1 394 LEU 394 374 374 LEU LEU A . n 
A 1 395 VAL 395 375 375 VAL VAL A . n 
A 1 396 ASN 396 376 376 ASN ASN A . n 
A 1 397 VAL 397 377 377 VAL VAL A . n 
A 1 398 LEU 398 378 378 LEU LEU A . n 
A 1 399 SER 399 379 379 SER SER A . n 
A 1 400 ILE 400 380 380 ILE ILE A . n 
A 1 401 CYS 401 381 381 CYS CYS A . n 
A 1 402 SER 402 382 382 SER SER A . n 
A 1 403 ASP 403 383 383 ASP ASP A . n 
A 1 404 ASP 404 384 384 ASP ASP A . n 
A 1 405 GLU 405 385 385 GLU GLU A . n 
A 1 406 LEU 406 386 386 LEU LEU A . n 
A 1 407 MET 407 387 ?   ?   ?   A . n 
A 1 408 THR 408 388 ?   ?   ?   A . n 
A 1 409 GLU 409 389 ?   ?   ?   A . n 
A 1 410 GLY 410 390 ?   ?   ?   A . n 
A 1 411 GLU 411 391 ?   ?   ?   A . n 
A 1 412 ASP 412 392 ?   ?   ?   A . n 
A 1 413 GLN 413 393 ?   ?   ?   A . n 
A 1 414 PHE 414 394 ?   ?   ?   A . n 
A 1 415 ASP 415 395 ?   ?   ?   A . n 
A 1 416 GLY 416 396 ?   ?   ?   A . n 
A 1 417 SER 417 397 ?   ?   ?   A . n 
A 1 418 ALA 418 398 ?   ?   ?   A . n 
A 1 419 ALA 419 399 ?   ?   ?   A . n 
A 1 420 ALA 420 400 ?   ?   ?   A . n 
A 1 421 ARG 421 401 ?   ?   ?   A . n 
A 1 422 LYS 422 402 ?   ?   ?   A . n 
A 1 423 GLU 423 403 ?   ?   ?   A . n 
A 1 424 ILE 424 404 ?   ?   ?   A . n 
A 1 425 ILE 425 405 ?   ?   ?   A . n 
A 1 426 ARG 426 406 ?   ?   ?   A . n 
A 1 427 ASN 427 407 ?   ?   ?   A . n 
A 1 428 LYS 428 408 ?   ?   ?   A . n 
A 1 429 ILE 429 409 ?   ?   ?   A . n 
A 1 430 ARG 430 410 ?   ?   ?   A . n 
A 1 431 ALA 431 411 ?   ?   ?   A . n 
A 1 432 ILE 432 412 ?   ?   ?   A . n 
A 1 433 GLY 433 413 ?   ?   ?   A . n 
A 1 434 LYS 434 414 ?   ?   ?   A . n 
A 1 435 MET 435 415 ?   ?   ?   A . n 
A 1 436 ALA 436 416 416 ALA ALA A . n 
A 1 437 ARG 437 417 417 ARG ARG A . n 
A 1 438 TYR 438 418 418 TYR TYR A . n 
A 1 439 LEU 439 419 419 LEU LEU A . n 
A 1 440 SER 440 420 420 SER SER A . n 
A 1 441 VAL 441 421 421 VAL VAL A . n 
A 1 442 LEU 442 422 422 LEU LEU A . n 
A 1 443 ARG 443 423 ?   ?   ?   A . n 
A 1 444 GLU 444 424 ?   ?   ?   A . n 
A 1 445 GLU 445 425 ?   ?   ?   A . n 
A 1 446 SER 446 426 ?   ?   ?   A . n 
A 1 447 GLU 447 427 ?   ?   ?   A . n 
A 1 448 SER 448 428 ?   ?   ?   A . n 
A 1 449 VAL 449 429 ?   ?   ?   A . n 
A 1 450 LEU 450 430 ?   ?   ?   A . n 
A 1 451 THR 451 431 ?   ?   ?   A . n 
A 1 452 LEU 452 432 ?   ?   ?   A . n 
A 1 453 LYS 453 433 ?   ?   ?   A . n 
A 1 454 GLY 454 434 ?   ?   ?   A . n 
A 1 455 LEU 455 435 ?   ?   ?   A . n 
A 1 456 THR 456 436 ?   ?   ?   A . n 
A 1 457 PRO 457 437 ?   ?   ?   A . n 
A 1 458 THR 458 438 ?   ?   ?   A . n 
A 1 459 GLY 459 439 ?   ?   ?   A . n 
A 1 460 MET 460 440 ?   ?   ?   A . n 
A 1 461 LEU 461 441 ?   ?   ?   A . n 
A 1 462 PRO 462 442 ?   ?   ?   A . n 
A 1 463 SER 463 443 ?   ?   ?   A . n 
A 1 464 GLY 464 444 ?   ?   ?   A . n 
A 1 465 VAL 465 445 ?   ?   ?   A . n 
A 1 466 LEU 466 446 ?   ?   ?   A . n 
A 1 467 ALA 467 447 ?   ?   ?   A . n 
A 1 468 GLY 468 448 ?   ?   ?   A . n 
A 1 469 GLY 469 449 ?   ?   ?   A . n 
A 1 470 ARG 470 450 ?   ?   ?   A . n 
A 1 471 GLN 471 451 ?   ?   ?   A . n 
A 1 472 THR 472 452 ?   ?   ?   A . n 
A 1 473 LEU 473 453 ?   ?   ?   A . n 
A 1 474 GLN 474 454 ?   ?   ?   A . n 
A 1 475 SER 475 455 ?   ?   ?   A . n 
A 1 476 ALA 476 456 ?   ?   ?   A . n 
A 1 477 THR 477 457 ?   ?   ?   A . n 
A 1 478 VAL 478 458 ?   ?   ?   A . n 
A 1 479 GLU 479 459 ?   ?   ?   A . n 
A 1 480 ALA 480 460 ?   ?   ?   A . n 
A 1 481 ILE 481 461 ?   ?   ?   A . n 
A 1 482 GLU 482 462 ?   ?   ?   A . n 
A 1 483 ALA 483 463 ?   ?   ?   A . n 
A 1 484 GLU 484 464 ?   ?   ?   A . n 
A 1 485 LYS 485 465 ?   ?   ?   A . n 
A 1 486 ALA 486 466 ?   ?   ?   A . n 
A 1 487 ILE 487 467 ?   ?   ?   A . n 
A 1 488 ARG 488 468 ?   ?   ?   A . n 
A 1 489 GLY 489 469 ?   ?   ?   A . n 
A 1 490 PHE 490 470 ?   ?   ?   A . n 
A 1 491 SER 491 471 ?   ?   ?   A . n 
A 1 492 PRO 492 472 ?   ?   ?   A . n 
A 1 493 PRO 493 473 ?   ?   ?   A . n 
A 1 494 HIS 494 474 ?   ?   ?   A . n 
A 1 495 ARG 495 475 ?   ?   ?   A . n 
A 1 496 ILE 496 476 ?   ?   ?   A . n 
A 1 497 CYS 497 477 ?   ?   ?   A . n 
A 1 498 SER 498 478 478 SER SER A . n 
A 1 499 PHE 499 479 479 PHE PHE A . n 
A 1 500 GLU 500 480 480 GLU GLU A . n 
A 1 501 GLU 501 481 481 GLU GLU A . n 
A 1 502 ALA 502 482 482 ALA ALA A . n 
A 1 503 LYS 503 483 483 LYS LYS A . n 
A 1 504 GLY 504 484 484 GLY GLY A . n 
A 1 505 LEU 505 485 485 LEU LEU A . n 
A 1 506 ASP 506 486 486 ASP ASP A . n 
A 1 507 ARG 507 487 487 ARG ARG A . n 
A 1 508 ILE 508 488 488 ILE ILE A . n 
A 1 509 ASN 509 489 489 ASN ASN A . n 
A 1 510 GLU 510 490 490 GLU GLU A . n 
A 1 511 ARG 511 491 491 ARG ARG A . n 
A 1 512 MET 512 492 492 MET MET A . n 
A 1 513 PRO 513 493 493 PRO PRO A . n 
A 1 514 PRO 514 494 494 PRO PRO A . n 
A 1 515 ARG 515 495 495 ARG ARG A . n 
A 1 516 LYS 516 496 ?   ?   ?   A . n 
A 1 517 ASP 517 497 ?   ?   ?   A . n 
A 1 518 ALA 518 498 ?   ?   ?   A . n 
A 1 519 VAL 519 499 ?   ?   ?   A . n 
A 1 520 GLN 520 500 ?   ?   ?   A . n 
A 1 521 GLN 521 501 ?   ?   ?   A . n 
A 1 522 ASP 522 502 ?   ?   ?   A . n 
A 1 523 GLY 523 503 ?   ?   ?   A . n 
A 1 524 PHE 524 504 ?   ?   ?   A . n 
A 1 525 ASN 525 505 ?   ?   ?   A . n 
A 1 526 SER 526 506 ?   ?   ?   A . n 
A 1 527 LEU 527 507 ?   ?   ?   A . n 
A 1 528 ASN 528 508 ?   ?   ?   A . n 
A 1 529 THR 529 509 ?   ?   ?   A . n 
A 1 530 ALA 530 510 ?   ?   ?   A . n 
A 1 531 HIS 531 511 ?   ?   ?   A . n 
A 1 532 ALA 532 512 ?   ?   ?   A . n 
A 1 533 THR 533 513 ?   ?   ?   A . n 
A 1 534 GLU 534 514 ?   ?   ?   A . n 
A 1 535 ASN 535 515 ?   ?   ?   A . n 
A 1 536 HIS 536 516 ?   ?   ?   A . n 
A 1 537 GLY 537 517 ?   ?   ?   A . n 
A 1 538 THR 538 518 ?   ?   ?   A . n 
A 1 539 GLY 539 519 ?   ?   ?   A . n 
A 1 540 ASN 540 520 ?   ?   ?   A . n 
A 1 541 HIS 541 521 ?   ?   ?   A . n 
A 1 542 THR 542 522 ?   ?   ?   A . n 
A 1 543 ALA 543 523 ?   ?   ?   A . n 
A 1 544 GLN 544 524 ?   ?   ?   A . n 
B 2 1   MET 1   0   ?   ?   ?   B . n 
B 2 2   GLY 2   1   ?   ?   ?   B . n 
B 2 3   ASN 3   2   ?   ?   ?   B . n 
B 2 4   GLU 4   3   ?   ?   ?   B . n 
B 2 5   ALA 5   4   4   ALA ALA B . n 
B 2 6   SER 6   5   5   SER SER B . n 
B 2 7   TYR 7   6   6   TYR TYR B . n 
B 2 8   PRO 8   7   7   PRO PRO B . n 
B 2 9   LEU 9   8   8   LEU LEU B . n 
B 2 10  GLU 10  9   9   GLU GLU B . n 
B 2 11  MET 11  10  10  MET MET B . n 
B 2 12  CYS 12  11  11  CYS CYS B . n 
B 2 13  SER 13  12  12  SER SER B . n 
B 2 14  HIS 14  13  13  HIS HIS B . n 
B 2 15  PHE 15  14  14  PHE PHE B . n 
B 2 16  ASP 16  15  15  ASP ASP B . n 
B 2 17  ALA 17  16  16  ALA ALA B . n 
B 2 18  ASP 18  17  17  ASP ASP B . n 
B 2 19  GLU 19  18  18  GLU GLU B . n 
B 2 20  ILE 20  19  19  ILE ILE B . n 
B 2 21  LYS 21  20  20  LYS LYS B . n 
B 2 22  ARG 22  21  21  ARG ARG B . n 
B 2 23  LEU 23  22  22  LEU LEU B . n 
B 2 24  GLY 24  23  23  GLY GLY B . n 
B 2 25  LYS 25  24  24  LYS LYS B . n 
B 2 26  ARG 26  25  25  ARG ARG B . n 
B 2 27  PHE 27  26  26  PHE PHE B . n 
B 2 28  LYS 28  27  27  LYS LYS B . n 
B 2 29  LYS 29  28  28  LYS LYS B . n 
B 2 30  LEU 30  29  29  LEU LEU B . n 
B 2 31  ASP 31  30  30  ASP ASP B . n 
B 2 32  LEU 32  31  31  LEU LEU B . n 
B 2 33  ASP 33  32  32  ASP ASP B . n 
B 2 34  ASN 34  33  33  ASN ASN B . n 
B 2 35  SER 35  34  34  SER SER B . n 
B 2 36  GLY 36  35  35  GLY GLY B . n 
B 2 37  SER 37  36  36  SER SER B . n 
B 2 38  LEU 38  37  37  LEU LEU B . n 
B 2 39  SER 39  38  38  SER SER B . n 
B 2 40  VAL 40  39  39  VAL VAL B . n 
B 2 41  GLU 41  40  40  GLU GLU B . n 
B 2 42  GLU 42  41  41  GLU GLU B . n 
B 2 43  PHE 43  42  42  PHE PHE B . n 
B 2 44  MET 44  43  43  MET MET B . n 
B 2 45  SER 45  44  44  SER SER B . n 
B 2 46  LEU 46  45  45  LEU LEU B . n 
B 2 47  PRO 47  46  46  PRO PRO B . n 
B 2 48  GLU 48  47  47  GLU GLU B . n 
B 2 49  LEU 49  48  48  LEU LEU B . n 
B 2 50  GLN 50  49  49  GLN GLN B . n 
B 2 51  GLN 51  50  50  GLN GLN B . n 
B 2 52  ASN 52  51  51  ASN ASN B . n 
B 2 53  PRO 53  52  52  PRO PRO B . n 
B 2 54  LEU 54  53  53  LEU LEU B . n 
B 2 55  VAL 55  54  54  VAL VAL B . n 
B 2 56  GLN 56  55  55  GLN GLN B . n 
B 2 57  ARG 57  56  56  ARG ARG B . n 
B 2 58  VAL 58  57  57  VAL VAL B . n 
B 2 59  ILE 59  58  58  ILE ILE B . n 
B 2 60  ASP 60  59  59  ASP ASP B . n 
B 2 61  ILE 61  60  60  ILE ILE B . n 
B 2 62  PHE 62  61  61  PHE PHE B . n 
B 2 63  ASP 63  62  62  ASP ASP B . n 
B 2 64  THR 64  63  63  THR THR B . n 
B 2 65  ASP 65  64  64  ASP ASP B . n 
B 2 66  GLY 66  65  65  GLY GLY B . n 
B 2 67  ASN 67  66  66  ASN ASN B . n 
B 2 68  GLY 68  67  67  GLY GLY B . n 
B 2 69  GLU 69  68  68  GLU GLU B . n 
B 2 70  VAL 70  69  69  VAL VAL B . n 
B 2 71  ASP 71  70  70  ASP ASP B . n 
B 2 72  PHE 72  71  71  PHE PHE B . n 
B 2 73  LYS 73  72  72  LYS LYS B . n 
B 2 74  GLU 74  73  73  GLU GLU B . n 
B 2 75  PHE 75  74  74  PHE PHE B . n 
B 2 76  ILE 76  75  75  ILE ILE B . n 
B 2 77  GLU 77  76  76  GLU GLU B . n 
B 2 78  GLY 78  77  77  GLY GLY B . n 
B 2 79  VAL 79  78  78  VAL VAL B . n 
B 2 80  SER 80  79  79  SER SER B . n 
B 2 81  GLN 81  80  80  GLN GLN B . n 
B 2 82  PHE 82  81  81  PHE PHE B . n 
B 2 83  SER 83  82  82  SER SER B . n 
B 2 84  VAL 84  83  83  VAL VAL B . n 
B 2 85  LYS 85  84  84  LYS LYS B . n 
B 2 86  GLY 86  85  85  GLY GLY B . n 
B 2 87  ASP 87  86  86  ASP ASP B . n 
B 2 88  LYS 88  87  87  LYS LYS B . n 
B 2 89  GLU 89  88  88  GLU GLU B . n 
B 2 90  GLN 90  89  89  GLN GLN B . n 
B 2 91  LYS 91  90  90  LYS LYS B . n 
B 2 92  LEU 92  91  91  LEU LEU B . n 
B 2 93  ARG 93  92  92  ARG ARG B . n 
B 2 94  PHE 94  93  93  PHE PHE B . n 
B 2 95  ALA 95  94  94  ALA ALA B . n 
B 2 96  PHE 96  95  95  PHE PHE B . n 
B 2 97  ARG 97  96  96  ARG ARG B . n 
B 2 98  ILE 98  97  97  ILE ILE B . n 
B 2 99  TYR 99  98  98  TYR TYR B . n 
B 2 100 ASP 100 99  99  ASP ASP B . n 
B 2 101 MET 101 100 100 MET MET B . n 
B 2 102 ASP 102 101 101 ASP ASP B . n 
B 2 103 LYS 103 102 102 LYS LYS B . n 
B 2 104 ASP 104 103 103 ASP ASP B . n 
B 2 105 GLY 105 104 104 GLY GLY B . n 
B 2 106 TYR 106 105 105 TYR TYR B . n 
B 2 107 ILE 107 106 106 ILE ILE B . n 
B 2 108 SER 108 107 107 SER SER B . n 
B 2 109 ASN 109 108 108 ASN ASN B . n 
B 2 110 GLY 110 109 109 GLY GLY B . n 
B 2 111 GLU 111 110 110 GLU GLU B . n 
B 2 112 LEU 112 111 111 LEU LEU B . n 
B 2 113 PHE 113 112 112 PHE PHE B . n 
B 2 114 GLN 114 113 113 GLN GLN B . n 
B 2 115 VAL 115 114 114 VAL VAL B . n 
B 2 116 LEU 116 115 115 LEU LEU B . n 
B 2 117 LYS 117 116 116 LYS LYS B . n 
B 2 118 MET 118 117 117 MET MET B . n 
B 2 119 MET 119 118 118 MET MET B . n 
B 2 120 VAL 120 119 119 VAL VAL B . n 
B 2 121 GLY 121 120 120 GLY GLY B . n 
B 2 122 ASN 122 121 121 ASN ASN B . n 
B 2 123 ASN 123 122 122 ASN ASN B . n 
B 2 124 LEU 124 123 123 LEU LEU B . n 
B 2 125 LYS 125 124 124 LYS LYS B . n 
B 2 126 ASP 126 125 125 ASP ASP B . n 
B 2 127 THR 127 126 126 THR THR B . n 
B 2 128 GLN 128 127 127 GLN GLN B . n 
B 2 129 LEU 129 128 128 LEU LEU B . n 
B 2 130 GLN 130 129 129 GLN GLN B . n 
B 2 131 GLN 131 130 130 GLN GLN B . n 
B 2 132 ILE 132 131 131 ILE ILE B . n 
B 2 133 VAL 133 132 132 VAL VAL B . n 
B 2 134 ASP 134 133 133 ASP ASP B . n 
B 2 135 LYS 135 134 134 LYS LYS B . n 
B 2 136 THR 136 135 135 THR THR B . n 
B 2 137 ILE 137 136 136 ILE ILE B . n 
B 2 138 ILE 138 137 137 ILE ILE B . n 
B 2 139 ASN 139 138 138 ASN ASN B . n 
B 2 140 ALA 140 139 139 ALA ALA B . n 
B 2 141 ASP 141 140 140 ASP ASP B . n 
B 2 142 LYS 142 141 141 LYS LYS B . n 
B 2 143 ASP 143 142 142 ASP ASP B . n 
B 2 144 GLY 144 143 143 GLY GLY B . n 
B 2 145 ASP 145 144 144 ASP ASP B . n 
B 2 146 GLY 146 145 145 GLY GLY B . n 
B 2 147 ARG 147 146 146 ARG ARG B . n 
B 2 148 ILE 148 147 147 ILE ILE B . n 
B 2 149 SER 149 148 148 SER SER B . n 
B 2 150 PHE 150 149 149 PHE PHE B . n 
B 2 151 GLU 151 150 150 GLU GLU B . n 
B 2 152 GLU 152 151 151 GLU GLU B . n 
B 2 153 PHE 153 152 152 PHE PHE B . n 
B 2 154 CYS 154 153 153 CYS CYS B . n 
B 2 155 ALA 155 154 154 ALA ALA B . n 
B 2 156 VAL 156 155 155 VAL VAL B . n 
B 2 157 VAL 157 156 156 VAL VAL B . n 
B 2 158 GLY 158 157 157 GLY GLY B . n 
B 2 159 GLY 159 158 158 GLY GLY B . n 
B 2 160 LEU 160 159 159 LEU LEU B . n 
B 2 161 ASP 161 160 160 ASP ASP B . n 
B 2 162 ILE 162 161 161 ILE ILE B . n 
B 2 163 HIS 163 162 162 HIS HIS B . n 
B 2 164 LYS 164 163 163 LYS LYS B . n 
B 2 165 LYS 165 164 164 LYS LYS B . n 
B 2 166 MET 166 165 165 MET MET B . n 
B 2 167 VAL 167 166 166 VAL VAL B . n 
B 2 168 VAL 168 167 167 VAL VAL B . n 
B 2 169 ASP 169 168 168 ASP ASP B . n 
B 2 170 VAL 170 169 169 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5200  ? 
1 MORE         -50   ? 
1 'SSA (A^2)'  24940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OE1 ? B GLU 74  ? B GLU 73  ? 1_555 75.5  ? 
2  O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASN 67  ? B ASN 66  ? 1_555 78.5  ? 
3  OE1 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASN 67  ? B ASN 66  ? 1_555 152.3 ? 
4  O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 147.2 ? 
5  OE1 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 127.1 ? 
6  OD1 ? B ASN 67  ? B ASN 66  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 80.5  ? 
7  O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 117.9 ? 
8  OE1 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 45.4  ? 
9  OD1 ? B ASN 67  ? B ASN 66  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 162.3 ? 
10 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 81.9  ? 
11 O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 79.5  ? 
12 OE1 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 98.2  ? 
13 OD1 ? B ASN 67  ? B ASN 66  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 86.2  ? 
14 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 74.2  ? 
15 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 90.3  ? 
16 O   ? B GLU 69  ? B GLU 68  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 114.9 ? 
17 OE1 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 102.9 ? 
18 OD1 ? B ASN 67  ? B ASN 66  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 79.6  ? 
19 OD1 ? B ASP 65  ? B ASP 64  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 85.5  ? 
20 OE2 ? B GLU 74  ? B GLU 73  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 97.8  ? 
21 OD1 ? B ASP 63  ? B ASP 62  ? 1_555 CA ? F CA . ? B CA 202 ? 1_555 O   ? J HOH .   ? B HOH 309 ? 1_555 156.9 ? 
22 NE2 ? A HIS 121 ? A HIS 101 ? 1_555 FE ? D FE . ? A FE 602 ? 1_555 O   ? I HOH .   ? A HOH 712 ? 1_555 134.2 ? 
23 O   ? B SER 37  ? B SER 36  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OD1 ? B ASP 33  ? B ASP 32  ? 1_555 132.3 ? 
24 O   ? B SER 37  ? B SER 36  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE2 ? B GLU 42  ? B GLU 41  ? 1_555 102.5 ? 
25 OD1 ? B ASP 33  ? B ASP 32  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE2 ? B GLU 42  ? B GLU 41  ? 1_555 67.5  ? 
26 O   ? B SER 37  ? B SER 36  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OD1 ? B ASP 31  ? B ASP 30  ? 1_555 65.4  ? 
27 OD1 ? B ASP 33  ? B ASP 32  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OD1 ? B ASP 31  ? B ASP 30  ? 1_555 68.5  ? 
28 OE2 ? B GLU 42  ? B GLU 41  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OD1 ? B ASP 31  ? B ASP 30  ? 1_555 65.3  ? 
29 O   ? B SER 37  ? B SER 36  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE1 ? B GLU 42  ? B GLU 41  ? 1_555 84.3  ? 
30 OD1 ? B ASP 33  ? B ASP 32  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE1 ? B GLU 42  ? B GLU 41  ? 1_555 109.6 ? 
31 OE2 ? B GLU 42  ? B GLU 41  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE1 ? B GLU 42  ? B GLU 41  ? 1_555 44.2  ? 
32 OD1 ? B ASP 31  ? B ASP 30  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OE1 ? B GLU 42  ? B GLU 41  ? 1_555 92.6  ? 
33 O   ? B SER 37  ? B SER 36  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OG  ? B SER 35  ? B SER 34  ? 1_555 85.1  ? 
34 OD1 ? B ASP 33  ? B ASP 32  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OG  ? B SER 35  ? B SER 34  ? 1_555 85.2  ? 
35 OE2 ? B GLU 42  ? B GLU 41  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OG  ? B SER 35  ? B SER 34  ? 1_555 149.3 ? 
36 OD1 ? B ASP 31  ? B ASP 30  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OG  ? B SER 35  ? B SER 34  ? 1_555 92.4  ? 
37 OE1 ? B GLU 42  ? B GLU 41  ? 1_555 CA ? E CA . ? B CA 201 ? 1_555 OG  ? B SER 35  ? B SER 34  ? 1_555 165.2 ? 
38 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 152.7 ? 
39 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 46.7  ? 
40 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 156.1 ? 
41 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 130.3 ? 
42 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 76.9  ? 
43 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 85.7  ? 
44 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? B ARG 147 ? B ARG 146 ? 1_555 84.3  ? 
45 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? B ARG 147 ? B ARG 146 ? 1_555 69.5  ? 
46 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? B ARG 147 ? B ARG 146 ? 1_555 119.4 ? 
47 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? B ARG 147 ? B ARG 146 ? 1_555 141.5 ? 
48 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 112.5 ? 
49 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 67.8  ? 
50 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 92.6  ? 
51 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 77.0  ? 
52 O   ? B ARG 147 ? B ARG 146 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 73.5  ? 
53 OE1 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 88.5  ? 
54 OD1 ? B ASP 145 ? B ASP 144 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 98.7  ? 
55 OE2 ? B GLU 152 ? B GLU 151 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 94.5  ? 
56 OD1 ? B ASP 143 ? B ASP 142 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 81.1  ? 
57 O   ? B ARG 147 ? B ARG 146 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 121.4 ? 
58 OD1 ? B ASP 141 ? B ASP 140 ? 1_555 CA ? H CA . ? B CA 204 ? 1_555 O   ? J HOH .   ? B HOH 308 ? 1_555 156.3 ? 
59 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 80.2  ? 
60 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? B TYR 106 ? B TYR 105 ? 1_555 116.9 ? 
61 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? B TYR 106 ? B TYR 105 ? 1_555 135.0 ? 
62 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 92.8  ? 
63 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 85.8  ? 
64 O   ? B TYR 106 ? B TYR 105 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 54.0  ? 
65 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 158.8 ? 
66 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 78.7  ? 
67 O   ? B TYR 106 ? B TYR 105 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 78.4  ? 
68 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 84.6  ? 
69 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 45.2  ? 
70 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 124.9 ? 
71 O   ? B TYR 106 ? B TYR 105 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 78.7  ? 
72 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 89.4  ? 
73 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 155.3 ? 
74 OE1 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 83.0  ? 
75 OD1 ? B ASP 102 ? B ASP 101 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 92.0  ? 
76 O   ? B TYR 106 ? B TYR 105 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 129.4 ? 
77 OD1 ? B ASP 100 ? B ASP 99  ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 175.6 ? 
78 OD1 ? B ASP 104 ? B ASP 103 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 98.7  ? 
79 OE2 ? B GLU 111 ? B GLU 110 ? 1_555 CA ? G CA . ? B CA 203 ? 1_555 O   ? J HOH .   ? B HOH 301 ? 1_555 88.7  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-05-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -25.7598 28.6813 -6.6074  0.4002 0.1666 0.2029 -0.0842 -0.1176 0.0236  0.6101 0.6123 0.4439 0.0020 
-0.0947 -0.5128 -0.0768 0.1357  -0.1169 0.2093  0.1180  0.3059  -0.5644 0.2552  -0.1649 
'X-RAY DIFFRACTION' 2 ? refined -14.7324 32.7700 23.8786  0.0966 0.0390 0.0718 -0.0431 -0.0726 0.0488  1.2966 0.8705 1.6132 
-0.0522 0.2310  0.0116  -0.0620 -0.0584 0.0283  -0.0941 0.1011  -0.0121 -0.0113 -0.1388 -0.0070 
'X-RAY DIFFRACTION' 3 ? refined -21.0300 53.4445 0.4727   0.2763 0.1351 0.2277 -0.0463 -0.1174 0.0343  0.7498 0.8142 1.3221 
-0.5613 0.6688  -1.0288 -0.2446 0.1031  0.1382  -0.0916 0.3665  -0.2258 0.2339  -0.3106 -0.1556 
'X-RAY DIFFRACTION' 4 ? refined -17.8755 58.7688 -0.8799  0.3947 0.4387 0.2645 0.0596  -0.1411 0.0795  2.2905 4.4843 1.5594 
-0.0676 -1.5817 -0.4660 0.1295  0.2208  -0.1355 -1.1754 -0.8094 -0.2164 0.8747  0.8026  0.2989  
'X-RAY DIFFRACTION' 5 ? refined -12.3460 50.7577 21.8276  0.8002 0.4174 1.0420 -0.0560 -0.1822 -0.0440 0.1913 0.3495 0.8376 
-0.2431 0.3997  -0.4983 -0.1296 0.0048  0.1876  0.0071  0.4325  -0.2325 0.0847  -0.5315 0.2880  
'X-RAY DIFFRACTION' 6 ? refined -33.0709 60.5550 -14.5491 0.1733 0.1537 0.2119 -0.0214 -0.0645 0.1009  1.2354 1.2896 1.1753 
-1.0839 0.6040  -0.4870 -0.0445 0.0112  0.0046  -0.0409 0.2371  -0.1527 0.1082  -0.1059 -0.1153 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 15  A 51  
;chain 'A' and (resseq 15:51)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 52  A 334 
;chain 'A' and (resseq 52:334)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 335 A 386 
;chain 'A' and (resseq 335:386)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 416 A 422 
;chain 'A' and (resseq 416:422)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 478 A 495 
;chain 'A' and (resseq 478:495)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 B 4   B 169 
;chain 'B' and (resseq 4:169)
;
? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                             ? 1 
PHASER   phasing           .                             ? 2 
PHENIX   refinement        '(phenix.refine: 1.8.2_1309)' ? 3 
HKL-2000 'data reduction'  .                             ? 4 
HKL-2000 'data scaling'    .                             ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 130 ? ? 68.68   148.75  
2  1 ARG A 131 ? ? 87.26   -56.02  
3  1 TYR A 179 ? ? -130.40 -92.59  
4  1 PRO A 195 ? ? -49.37  153.57  
5  1 GLN A 203 ? ? -141.16 -19.49  
6  1 ASN A 250 ? ? -140.49 55.75   
7  1 LYS A 252 ? ? -73.01  -74.31  
8  1 SER A 266 ? ? 58.23   -155.02 
9  1 ALA A 289 ? ? -141.35 -122.11 
10 1 HIS A 290 ? ? 73.38   -27.15  
11 1 ASN A 354 ? ? 55.48   18.34   
12 1 ARG A 417 ? ? 79.84   -19.77  
13 1 ASP B 62  ? ? -69.95  80.11   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -19 ? A MET 1   
2   1 Y 1 A GLY -18 ? A GLY 2   
3   1 Y 1 A SER -17 ? A SER 3   
4   1 Y 1 A SER -16 ? A SER 4   
5   1 Y 1 A HIS -15 ? A HIS 5   
6   1 Y 1 A HIS -14 ? A HIS 6   
7   1 Y 1 A HIS -13 ? A HIS 7   
8   1 Y 1 A HIS -12 ? A HIS 8   
9   1 Y 1 A HIS -11 ? A HIS 9   
10  1 Y 1 A HIS -10 ? A HIS 10  
11  1 Y 1 A SER -9  ? A SER 11  
12  1 Y 1 A SER -8  ? A SER 12  
13  1 Y 1 A GLY -7  ? A GLY 13  
14  1 Y 1 A LEU -6  ? A LEU 14  
15  1 Y 1 A VAL -5  ? A VAL 15  
16  1 Y 1 A PRO -4  ? A PRO 16  
17  1 Y 1 A ARG -3  ? A ARG 17  
18  1 Y 1 A GLY -2  ? A GLY 18  
19  1 Y 1 A SER -1  ? A SER 19  
20  1 Y 1 A HIS 0   ? A HIS 20  
21  1 Y 1 A MET 1   ? A MET 21  
22  1 Y 1 A ALA 2   ? A ALA 22  
23  1 Y 1 A ALA 3   ? A ALA 23  
24  1 Y 1 A PRO 4   ? A PRO 24  
25  1 Y 1 A GLU 5   ? A GLU 25  
26  1 Y 1 A PRO 6   ? A PRO 26  
27  1 Y 1 A ALA 7   ? A ALA 27  
28  1 Y 1 A ARG 8   ? A ARG 28  
29  1 Y 1 A ALA 9   ? A ALA 29  
30  1 Y 1 A ALA 10  ? A ALA 30  
31  1 Y 1 A PRO 11  ? A PRO 31  
32  1 Y 1 A PRO 12  ? A PRO 32  
33  1 Y 1 A PRO 13  ? A PRO 33  
34  1 Y 1 A PRO 14  ? A PRO 34  
35  1 Y 1 A MET 387 ? A MET 407 
36  1 Y 1 A THR 388 ? A THR 408 
37  1 Y 1 A GLU 389 ? A GLU 409 
38  1 Y 1 A GLY 390 ? A GLY 410 
39  1 Y 1 A GLU 391 ? A GLU 411 
40  1 Y 1 A ASP 392 ? A ASP 412 
41  1 Y 1 A GLN 393 ? A GLN 413 
42  1 Y 1 A PHE 394 ? A PHE 414 
43  1 Y 1 A ASP 395 ? A ASP 415 
44  1 Y 1 A GLY 396 ? A GLY 416 
45  1 Y 1 A SER 397 ? A SER 417 
46  1 Y 1 A ALA 398 ? A ALA 418 
47  1 Y 1 A ALA 399 ? A ALA 419 
48  1 Y 1 A ALA 400 ? A ALA 420 
49  1 Y 1 A ARG 401 ? A ARG 421 
50  1 Y 1 A LYS 402 ? A LYS 422 
51  1 Y 1 A GLU 403 ? A GLU 423 
52  1 Y 1 A ILE 404 ? A ILE 424 
53  1 Y 1 A ILE 405 ? A ILE 425 
54  1 Y 1 A ARG 406 ? A ARG 426 
55  1 Y 1 A ASN 407 ? A ASN 427 
56  1 Y 1 A LYS 408 ? A LYS 428 
57  1 Y 1 A ILE 409 ? A ILE 429 
58  1 Y 1 A ARG 410 ? A ARG 430 
59  1 Y 1 A ALA 411 ? A ALA 431 
60  1 Y 1 A ILE 412 ? A ILE 432 
61  1 Y 1 A GLY 413 ? A GLY 433 
62  1 Y 1 A LYS 414 ? A LYS 434 
63  1 Y 1 A MET 415 ? A MET 435 
64  1 Y 1 A ARG 423 ? A ARG 443 
65  1 Y 1 A GLU 424 ? A GLU 444 
66  1 Y 1 A GLU 425 ? A GLU 445 
67  1 Y 1 A SER 426 ? A SER 446 
68  1 Y 1 A GLU 427 ? A GLU 447 
69  1 Y 1 A SER 428 ? A SER 448 
70  1 Y 1 A VAL 429 ? A VAL 449 
71  1 Y 1 A LEU 430 ? A LEU 450 
72  1 Y 1 A THR 431 ? A THR 451 
73  1 Y 1 A LEU 432 ? A LEU 452 
74  1 Y 1 A LYS 433 ? A LYS 453 
75  1 Y 1 A GLY 434 ? A GLY 454 
76  1 Y 1 A LEU 435 ? A LEU 455 
77  1 Y 1 A THR 436 ? A THR 456 
78  1 Y 1 A PRO 437 ? A PRO 457 
79  1 Y 1 A THR 438 ? A THR 458 
80  1 Y 1 A GLY 439 ? A GLY 459 
81  1 Y 1 A MET 440 ? A MET 460 
82  1 Y 1 A LEU 441 ? A LEU 461 
83  1 Y 1 A PRO 442 ? A PRO 462 
84  1 Y 1 A SER 443 ? A SER 463 
85  1 Y 1 A GLY 444 ? A GLY 464 
86  1 Y 1 A VAL 445 ? A VAL 465 
87  1 Y 1 A LEU 446 ? A LEU 466 
88  1 Y 1 A ALA 447 ? A ALA 467 
89  1 Y 1 A GLY 448 ? A GLY 468 
90  1 Y 1 A GLY 449 ? A GLY 469 
91  1 Y 1 A ARG 450 ? A ARG 470 
92  1 Y 1 A GLN 451 ? A GLN 471 
93  1 Y 1 A THR 452 ? A THR 472 
94  1 Y 1 A LEU 453 ? A LEU 473 
95  1 Y 1 A GLN 454 ? A GLN 474 
96  1 Y 1 A SER 455 ? A SER 475 
97  1 Y 1 A ALA 456 ? A ALA 476 
98  1 Y 1 A THR 457 ? A THR 477 
99  1 Y 1 A VAL 458 ? A VAL 478 
100 1 Y 1 A GLU 459 ? A GLU 479 
101 1 Y 1 A ALA 460 ? A ALA 480 
102 1 Y 1 A ILE 461 ? A ILE 481 
103 1 Y 1 A GLU 462 ? A GLU 482 
104 1 Y 1 A ALA 463 ? A ALA 483 
105 1 Y 1 A GLU 464 ? A GLU 484 
106 1 Y 1 A LYS 465 ? A LYS 485 
107 1 Y 1 A ALA 466 ? A ALA 486 
108 1 Y 1 A ILE 467 ? A ILE 487 
109 1 Y 1 A ARG 468 ? A ARG 488 
110 1 Y 1 A GLY 469 ? A GLY 489 
111 1 Y 1 A PHE 470 ? A PHE 490 
112 1 Y 1 A SER 471 ? A SER 491 
113 1 Y 1 A PRO 472 ? A PRO 492 
114 1 Y 1 A PRO 473 ? A PRO 493 
115 1 Y 1 A HIS 474 ? A HIS 494 
116 1 Y 1 A ARG 475 ? A ARG 495 
117 1 Y 1 A ILE 476 ? A ILE 496 
118 1 Y 1 A CYS 477 ? A CYS 497 
119 1 Y 1 A LYS 496 ? A LYS 516 
120 1 Y 1 A ASP 497 ? A ASP 517 
121 1 Y 1 A ALA 498 ? A ALA 518 
122 1 Y 1 A VAL 499 ? A VAL 519 
123 1 Y 1 A GLN 500 ? A GLN 520 
124 1 Y 1 A GLN 501 ? A GLN 521 
125 1 Y 1 A ASP 502 ? A ASP 522 
126 1 Y 1 A GLY 503 ? A GLY 523 
127 1 Y 1 A PHE 504 ? A PHE 524 
128 1 Y 1 A ASN 505 ? A ASN 525 
129 1 Y 1 A SER 506 ? A SER 526 
130 1 Y 1 A LEU 507 ? A LEU 527 
131 1 Y 1 A ASN 508 ? A ASN 528 
132 1 Y 1 A THR 509 ? A THR 529 
133 1 Y 1 A ALA 510 ? A ALA 530 
134 1 Y 1 A HIS 511 ? A HIS 531 
135 1 Y 1 A ALA 512 ? A ALA 532 
136 1 Y 1 A THR 513 ? A THR 533 
137 1 Y 1 A GLU 514 ? A GLU 534 
138 1 Y 1 A ASN 515 ? A ASN 535 
139 1 Y 1 A HIS 516 ? A HIS 536 
140 1 Y 1 A GLY 517 ? A GLY 537 
141 1 Y 1 A THR 518 ? A THR 538 
142 1 Y 1 A GLY 519 ? A GLY 539 
143 1 Y 1 A ASN 520 ? A ASN 540 
144 1 Y 1 A HIS 521 ? A HIS 541 
145 1 Y 1 A THR 522 ? A THR 542 
146 1 Y 1 A ALA 523 ? A ALA 543 
147 1 Y 1 A GLN 524 ? A GLN 544 
148 1 Y 1 B MET 0   ? B MET 1   
149 1 Y 1 B GLY 1   ? B GLY 2   
150 1 Y 1 B ASN 2   ? B ASN 3   
151 1 Y 1 B GLU 3   ? B GLU 4   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'     ZN  
4 'FE (III) ION' FE  
5 'CALCIUM ION'  CA  
6 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1  601 1   ZN  ZN  A . 
D 4 FE  1  602 1   FE  FE  A . 
E 5 CA  1  201 1   CA  CA  B . 
F 5 CA  1  202 1   CA  CA  B . 
G 5 CA  1  203 1   CA  CA  B . 
H 5 CA  1  204 1   CA  CA  B . 
I 6 HOH 1  701 1   HOH HOH A . 
I 6 HOH 2  702 4   HOH HOH A . 
I 6 HOH 3  703 6   HOH HOH A . 
I 6 HOH 4  704 7   HOH HOH A . 
I 6 HOH 5  705 8   HOH HOH A . 
I 6 HOH 6  706 9   HOH HOH A . 
I 6 HOH 7  707 12  HOH HOH A . 
I 6 HOH 8  708 28  HOH HOH A . 
I 6 HOH 9  709 35  HOH HOH A . 
I 6 HOH 10 710 44  HOH HOH A . 
I 6 HOH 11 711 82  HOH HOH A . 
I 6 HOH 12 712 84  HOH HOH A . 
I 6 HOH 13 713 85  HOH HOH A . 
I 6 HOH 14 714 86  HOH HOH A . 
I 6 HOH 15 715 89  HOH HOH A . 
I 6 HOH 16 716 90  HOH HOH A . 
I 6 HOH 17 717 91  HOH HOH A . 
I 6 HOH 18 718 92  HOH HOH A . 
I 6 HOH 19 719 93  HOH HOH A . 
I 6 HOH 20 720 94  HOH HOH A . 
I 6 HOH 21 721 95  HOH HOH A . 
I 6 HOH 22 722 96  HOH HOH A . 
I 6 HOH 23 723 97  HOH HOH A . 
I 6 HOH 24 724 98  HOH HOH A . 
I 6 HOH 25 725 99  HOH HOH A . 
I 6 HOH 26 726 100 HOH HOH A . 
I 6 HOH 27 727 101 HOH HOH A . 
I 6 HOH 28 728 102 HOH HOH A . 
I 6 HOH 29 729 103 HOH HOH A . 
I 6 HOH 30 730 104 HOH HOH A . 
I 6 HOH 31 731 105 HOH HOH A . 
I 6 HOH 32 732 106 HOH HOH A . 
I 6 HOH 33 733 109 HOH HOH A . 
I 6 HOH 34 734 110 HOH HOH A . 
J 6 HOH 1  301 2   HOH HOH B . 
J 6 HOH 2  302 3   HOH HOH B . 
J 6 HOH 3  303 5   HOH HOH B . 
J 6 HOH 4  304 33  HOH HOH B . 
J 6 HOH 5  305 37  HOH HOH B . 
J 6 HOH 6  306 62  HOH HOH B . 
J 6 HOH 7  307 63  HOH HOH B . 
J 6 HOH 8  308 87  HOH HOH B . 
J 6 HOH 9  309 88  HOH HOH B . 
J 6 HOH 10 310 107 HOH HOH B . 
J 6 HOH 11 311 108 HOH HOH B . 
#